data_6M6C
# 
_entry.id   6M6C 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.336 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6M6C         
WWPDB D_1300016162 
EMDB  EMD-30119    
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'CryoEM structure of Thermus thermophilus RNA polymerase elongation complex' 
_pdbx_database_related.db_id          EMD-30119 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6M6C 
_pdbx_database_status.recvd_initial_deposition_date   2020-03-14 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    PDBJ 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.status_code_nmr_data            ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Shi, J.'  1 ? 
'Wen, A.'  2 ? 
'Feng, Y.' 3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            48 
_citation.language                  ? 
_citation.page_first                11762 
_citation.page_last                 11772 
_citation.title                     'Structural basis of Mfd-dependent transcription termination.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gkaa904 
_citation.pdbx_database_id_PubMed   33068413 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Shi, J.'   1  ? 
primary 'Wen, A.'   2  ? 
primary 'Zhao, M.'  3  ? 
primary 'Jin, S.'   4  ? 
primary 'You, L.'   5  ? 
primary 'Shi, Y.'   6  ? 
primary 'Dong, S.'  7  ? 
primary 'Hua, X.'   8  ? 
primary 'Zhang, Y.' 9  ? 
primary 'Feng, Y.'  10 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6M6C 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.00 
_cell.length_a_esd                 ? 
_cell.length_b                     1.00 
_cell.length_b_esd                 ? 
_cell.length_c                     1.00 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        ? 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6M6C 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     nat 'DNA-directed RNA polymerase subunit alpha' 35056.164  2 2.7.7.6 ? ? ? 
2 polymer     nat 'DNA-directed RNA polymerase subunit beta'  125436.539 1 2.7.7.6 ? ? ? 
3 polymer     nat 
;DNA-directed RNA polymerase subunit beta'
;
170997.391 1 2.7.7.6 ? ? ? 
4 polymer     nat 'DNA-directed RNA polymerase subunit omega' 11533.316  1 2.7.7.6 ? ? ? 
5 polymer     syn RNA                                         6509.968   1 ?       ? ? ? 
6 polymer     syn 'nontemplate strand DNA'                    19366.436  1 ?       ? ? ? 
7 polymer     syn 'template strand DNA'                       19290.348  1 ?       ? ? ? 
8 non-polymer syn 'ZINC ION'                                  65.409     2 ?       ? ? ? 
9 non-polymer syn 'MAGNESIUM ION'                             24.305     1 ?       ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'RNAP subunit alpha,RNA polymerase subunit alpha,Transcriptase subunit alpha' 
2 'RNAP subunit beta,RNA polymerase subunit beta,Transcriptase subunit beta'    
3 
;RNAP subunit beta',RNA polymerase subunit beta',Transcriptase subunit beta'
;
4 'RNAP omega subunit,RNA polymerase omega subunit,Transcriptase subunit omega' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
A,B ? 
2 'polypeptide(L)'        no no 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
C   ? 
3 'polypeptide(L)'        no no 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
D   ? 
4 'polypeptide(L)'        no no 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
E   ? 
5 polyribonucleotide      no no GCAUUCAAAGCGGAGAGGUA GCAUUCAAAGCGGAGAGGUA R   ? 
6 polydeoxyribonucleotide no no 
;(DC)(DG)(DA)(DA)(DA)(DA)(DG)(DA)(DA)(DG)(DC)(DT)(DT)(DT)(DG)(DC)(DT)(DT)(DA)(DA)
(DT)(DA)(DA)(DT)(DC)(DC)(DA)(DT)(DA)(DT)(DG)(DG)(DT)(DT)(DG)(DG)(DG)(DC)(DT)(DA)
(DC)(DC)(DT)(DC)(DT)(DC)(DC)(DA)(DT)(DG)(DA)(DC)(DG)(DG)(DC)(DG)(DA)(DA)(DT)(DA)
(DC)(DC)(DC)
;
CGAAAAGAAGCTTTGCTTAATAATCCATATGGTTGGGCTACCTCTCCATGACGGCGAATACCC N   ? 
7 polydeoxyribonucleotide no no 
;(DG)(DG)(DG)(DT)(DA)(DT)(DT)(DC)(DG)(DC)(DC)(DG)(DT)(DG)(DT)(DA)(DC)(DC)(DT)(DC)
(DT)(DC)(DC)(DT)(DA)(DG)(DC)(DC)(DC)(DA)(DA)(DC)(DC)(DA)(DT)(DA)(DT)(DG)(DG)(DA)
(DT)(DT)(DA)(DT)(DT)(DA)(DA)(DG)(DC)(DA)(DA)(DA)(DG)(DC)(DT)(DT)(DC)(DT)(DT)(DT)
(DT)(DC)(DG)
;
GGGTATTCGCCGTGTACCTCTCCTAGCCCAACCATATGGATTATTAAGCAAAGCTTCTTTTCG T   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    MET n 
1 2    LEU n 
1 3    ASP n 
1 4    SER n 
1 5    LYS n 
1 6    LEU n 
1 7    LYS n 
1 8    ALA n 
1 9    PRO n 
1 10   VAL n 
1 11   PHE n 
1 12   THR n 
1 13   VAL n 
1 14   ARG n 
1 15   THR n 
1 16   GLN n 
1 17   GLY n 
1 18   ARG n 
1 19   GLU n 
1 20   TYR n 
1 21   GLY n 
1 22   GLU n 
1 23   PHE n 
1 24   VAL n 
1 25   LEU n 
1 26   GLU n 
1 27   PRO n 
1 28   LEU n 
1 29   GLU n 
1 30   ARG n 
1 31   GLY n 
1 32   PHE n 
1 33   GLY n 
1 34   VAL n 
1 35   THR n 
1 36   LEU n 
1 37   GLY n 
1 38   ASN n 
1 39   PRO n 
1 40   LEU n 
1 41   ARG n 
1 42   ARG n 
1 43   ILE n 
1 44   LEU n 
1 45   LEU n 
1 46   SER n 
1 47   SER n 
1 48   ILE n 
1 49   PRO n 
1 50   GLY n 
1 51   THR n 
1 52   ALA n 
1 53   VAL n 
1 54   THR n 
1 55   SER n 
1 56   VAL n 
1 57   TYR n 
1 58   ILE n 
1 59   GLU n 
1 60   ASP n 
1 61   VAL n 
1 62   LEU n 
1 63   HIS n 
1 64   GLU n 
1 65   PHE n 
1 66   SER n 
1 67   THR n 
1 68   ILE n 
1 69   PRO n 
1 70   GLY n 
1 71   VAL n 
1 72   LYS n 
1 73   GLU n 
1 74   ASP n 
1 75   VAL n 
1 76   VAL n 
1 77   GLU n 
1 78   ILE n 
1 79   ILE n 
1 80   LEU n 
1 81   ASN n 
1 82   LEU n 
1 83   LYS n 
1 84   GLU n 
1 85   LEU n 
1 86   VAL n 
1 87   VAL n 
1 88   ARG n 
1 89   PHE n 
1 90   LEU n 
1 91   ASN n 
1 92   PRO n 
1 93   SER n 
1 94   LEU n 
1 95   GLN n 
1 96   THR n 
1 97   VAL n 
1 98   THR n 
1 99   LEU n 
1 100  LEU n 
1 101  LEU n 
1 102  LYS n 
1 103  ALA n 
1 104  GLU n 
1 105  GLY n 
1 106  PRO n 
1 107  LYS n 
1 108  GLU n 
1 109  VAL n 
1 110  LYS n 
1 111  ALA n 
1 112  ARG n 
1 113  ASP n 
1 114  PHE n 
1 115  LEU n 
1 116  PRO n 
1 117  VAL n 
1 118  ALA n 
1 119  ASP n 
1 120  VAL n 
1 121  GLU n 
1 122  ILE n 
1 123  MET n 
1 124  ASN n 
1 125  PRO n 
1 126  ASP n 
1 127  LEU n 
1 128  HIS n 
1 129  ILE n 
1 130  ALA n 
1 131  THR n 
1 132  LEU n 
1 133  GLU n 
1 134  GLU n 
1 135  GLY n 
1 136  GLY n 
1 137  ARG n 
1 138  LEU n 
1 139  ASN n 
1 140  MET n 
1 141  GLU n 
1 142  VAL n 
1 143  ARG n 
1 144  VAL n 
1 145  ASP n 
1 146  ARG n 
1 147  GLY n 
1 148  VAL n 
1 149  GLY n 
1 150  TYR n 
1 151  VAL n 
1 152  PRO n 
1 153  ALA n 
1 154  GLU n 
1 155  LYS n 
1 156  HIS n 
1 157  GLY n 
1 158  ILE n 
1 159  LYS n 
1 160  ASP n 
1 161  ARG n 
1 162  ILE n 
1 163  ASN n 
1 164  ALA n 
1 165  ILE n 
1 166  PRO n 
1 167  VAL n 
1 168  ASP n 
1 169  ALA n 
1 170  VAL n 
1 171  PHE n 
1 172  SER n 
1 173  PRO n 
1 174  VAL n 
1 175  ARG n 
1 176  ARG n 
1 177  VAL n 
1 178  ALA n 
1 179  PHE n 
1 180  GLN n 
1 181  VAL n 
1 182  GLU n 
1 183  ASP n 
1 184  THR n 
1 185  ARG n 
1 186  LEU n 
1 187  GLY n 
1 188  GLN n 
1 189  ARG n 
1 190  THR n 
1 191  ASP n 
1 192  LEU n 
1 193  ASP n 
1 194  LYS n 
1 195  LEU n 
1 196  THR n 
1 197  LEU n 
1 198  ARG n 
1 199  ILE n 
1 200  TRP n 
1 201  THR n 
1 202  ASP n 
1 203  GLY n 
1 204  SER n 
1 205  VAL n 
1 206  THR n 
1 207  PRO n 
1 208  LEU n 
1 209  GLU n 
1 210  ALA n 
1 211  LEU n 
1 212  ASN n 
1 213  GLN n 
1 214  ALA n 
1 215  VAL n 
1 216  GLU n 
1 217  ILE n 
1 218  LEU n 
1 219  ARG n 
1 220  GLU n 
1 221  HIS n 
1 222  LEU n 
1 223  THR n 
1 224  TYR n 
1 225  PHE n 
1 226  SER n 
1 227  ASN n 
1 228  PRO n 
1 229  GLN n 
1 230  ALA n 
1 231  ALA n 
1 232  ALA n 
1 233  VAL n 
1 234  ALA n 
1 235  ALA n 
1 236  PRO n 
1 237  GLU n 
1 238  GLU n 
1 239  ALA n 
1 240  LYS n 
1 241  GLU n 
1 242  PRO n 
1 243  GLU n 
1 244  ALA n 
1 245  PRO n 
1 246  PRO n 
1 247  GLU n 
1 248  GLN n 
1 249  GLU n 
1 250  GLU n 
1 251  GLU n 
1 252  LEU n 
1 253  ASP n 
1 254  LEU n 
1 255  PRO n 
1 256  LEU n 
1 257  GLU n 
1 258  GLU n 
1 259  LEU n 
1 260  GLY n 
1 261  LEU n 
1 262  SER n 
1 263  THR n 
1 264  ARG n 
1 265  VAL n 
1 266  LEU n 
1 267  HIS n 
1 268  SER n 
1 269  LEU n 
1 270  LYS n 
1 271  GLU n 
1 272  GLU n 
1 273  GLY n 
1 274  ILE n 
1 275  GLU n 
1 276  SER n 
1 277  VAL n 
1 278  ARG n 
1 279  ALA n 
1 280  LEU n 
1 281  LEU n 
1 282  ALA n 
1 283  LEU n 
1 284  ASN n 
1 285  LEU n 
1 286  LYS n 
1 287  ASP n 
1 288  LEU n 
1 289  LYS n 
1 290  ASN n 
1 291  ILE n 
1 292  PRO n 
1 293  GLY n 
1 294  ILE n 
1 295  GLY n 
1 296  GLU n 
1 297  ARG n 
1 298  SER n 
1 299  LEU n 
1 300  GLU n 
1 301  GLU n 
1 302  ILE n 
1 303  LYS n 
1 304  GLU n 
1 305  ALA n 
1 306  LEU n 
1 307  GLU n 
1 308  LYS n 
1 309  LYS n 
1 310  GLY n 
1 311  PHE n 
1 312  THR n 
1 313  LEU n 
1 314  LYS n 
1 315  GLU n 
2 1    MET n 
2 2    GLU n 
2 3    ILE n 
2 4    LYS n 
2 5    ARG n 
2 6    PHE n 
2 7    GLY n 
2 8    ARG n 
2 9    ILE n 
2 10   ARG n 
2 11   GLU n 
2 12   VAL n 
2 13   ILE n 
2 14   PRO n 
2 15   LEU n 
2 16   PRO n 
2 17   PRO n 
2 18   LEU n 
2 19   THR n 
2 20   GLU n 
2 21   ILE n 
2 22   GLN n 
2 23   VAL n 
2 24   GLU n 
2 25   SER n 
2 26   TYR n 
2 27   ARG n 
2 28   ARG n 
2 29   ALA n 
2 30   LEU n 
2 31   GLN n 
2 32   ALA n 
2 33   ASP n 
2 34   VAL n 
2 35   PRO n 
2 36   PRO n 
2 37   GLU n 
2 38   LYS n 
2 39   ARG n 
2 40   GLU n 
2 41   ASN n 
2 42   VAL n 
2 43   GLY n 
2 44   ILE n 
2 45   GLN n 
2 46   ALA n 
2 47   ALA n 
2 48   PHE n 
2 49   ARG n 
2 50   GLU n 
2 51   THR n 
2 52   PHE n 
2 53   PRO n 
2 54   ILE n 
2 55   GLU n 
2 56   GLU n 
2 57   GLU n 
2 58   ASP n 
2 59   LYS n 
2 60   GLY n 
2 61   LYS n 
2 62   GLY n 
2 63   GLY n 
2 64   LEU n 
2 65   VAL n 
2 66   LEU n 
2 67   ASP n 
2 68   PHE n 
2 69   LEU n 
2 70   GLU n 
2 71   TYR n 
2 72   ARG n 
2 73   LEU n 
2 74   GLY n 
2 75   GLU n 
2 76   PRO n 
2 77   PRO n 
2 78   PHE n 
2 79   PRO n 
2 80   GLN n 
2 81   ASP n 
2 82   GLU n 
2 83   CYS n 
2 84   ARG n 
2 85   GLU n 
2 86   LYS n 
2 87   ASP n 
2 88   LEU n 
2 89   THR n 
2 90   TYR n 
2 91   GLN n 
2 92   ALA n 
2 93   PRO n 
2 94   LEU n 
2 95   TYR n 
2 96   ALA n 
2 97   ARG n 
2 98   LEU n 
2 99   GLN n 
2 100  LEU n 
2 101  ILE n 
2 102  HIS n 
2 103  LYS n 
2 104  ASP n 
2 105  THR n 
2 106  GLY n 
2 107  LEU n 
2 108  ILE n 
2 109  LYS n 
2 110  GLU n 
2 111  ASP n 
2 112  GLU n 
2 113  VAL n 
2 114  PHE n 
2 115  LEU n 
2 116  GLY n 
2 117  HIS n 
2 118  ILE n 
2 119  PRO n 
2 120  LEU n 
2 121  MET n 
2 122  THR n 
2 123  GLU n 
2 124  ASP n 
2 125  GLY n 
2 126  SER n 
2 127  PHE n 
2 128  ILE n 
2 129  ILE n 
2 130  ASN n 
2 131  GLY n 
2 132  ALA n 
2 133  ASP n 
2 134  ARG n 
2 135  VAL n 
2 136  ILE n 
2 137  VAL n 
2 138  SER n 
2 139  GLN n 
2 140  ILE n 
2 141  HIS n 
2 142  ARG n 
2 143  SER n 
2 144  PRO n 
2 145  GLY n 
2 146  VAL n 
2 147  TYR n 
2 148  PHE n 
2 149  THR n 
2 150  PRO n 
2 151  ASP n 
2 152  PRO n 
2 153  ALA n 
2 154  ARG n 
2 155  PRO n 
2 156  GLY n 
2 157  ARG n 
2 158  TYR n 
2 159  ILE n 
2 160  ALA n 
2 161  SER n 
2 162  ILE n 
2 163  ILE n 
2 164  PRO n 
2 165  LEU n 
2 166  PRO n 
2 167  LYS n 
2 168  ARG n 
2 169  GLY n 
2 170  PRO n 
2 171  TRP n 
2 172  ILE n 
2 173  ASP n 
2 174  LEU n 
2 175  GLU n 
2 176  VAL n 
2 177  GLU n 
2 178  PRO n 
2 179  ASN n 
2 180  GLY n 
2 181  VAL n 
2 182  VAL n 
2 183  SER n 
2 184  MET n 
2 185  LYS n 
2 186  VAL n 
2 187  ASN n 
2 188  LYS n 
2 189  ARG n 
2 190  LYS n 
2 191  PHE n 
2 192  PRO n 
2 193  LEU n 
2 194  VAL n 
2 195  LEU n 
2 196  LEU n 
2 197  LEU n 
2 198  ARG n 
2 199  VAL n 
2 200  LEU n 
2 201  GLY n 
2 202  TYR n 
2 203  ASP n 
2 204  GLN n 
2 205  GLU n 
2 206  THR n 
2 207  LEU n 
2 208  ALA n 
2 209  ARG n 
2 210  GLU n 
2 211  LEU n 
2 212  GLY n 
2 213  ALA n 
2 214  TYR n 
2 215  GLY n 
2 216  GLU n 
2 217  LEU n 
2 218  VAL n 
2 219  GLN n 
2 220  GLY n 
2 221  LEU n 
2 222  MET n 
2 223  ASP n 
2 224  GLU n 
2 225  SER n 
2 226  VAL n 
2 227  PHE n 
2 228  ALA n 
2 229  MET n 
2 230  ARG n 
2 231  PRO n 
2 232  GLU n 
2 233  GLU n 
2 234  ALA n 
2 235  LEU n 
2 236  ILE n 
2 237  ARG n 
2 238  LEU n 
2 239  PHE n 
2 240  THR n 
2 241  LEU n 
2 242  LEU n 
2 243  ARG n 
2 244  PRO n 
2 245  GLY n 
2 246  ASP n 
2 247  PRO n 
2 248  PRO n 
2 249  LYS n 
2 250  ARG n 
2 251  ASP n 
2 252  LYS n 
2 253  ALA n 
2 254  VAL n 
2 255  ALA n 
2 256  TYR n 
2 257  VAL n 
2 258  TYR n 
2 259  GLY n 
2 260  LEU n 
2 261  ILE n 
2 262  ALA n 
2 263  ASP n 
2 264  PRO n 
2 265  ARG n 
2 266  ARG n 
2 267  TYR n 
2 268  ASP n 
2 269  LEU n 
2 270  GLY n 
2 271  GLU n 
2 272  ALA n 
2 273  GLY n 
2 274  ARG n 
2 275  TYR n 
2 276  LYS n 
2 277  ALA n 
2 278  GLU n 
2 279  GLU n 
2 280  LYS n 
2 281  LEU n 
2 282  GLY n 
2 283  ILE n 
2 284  ARG n 
2 285  LEU n 
2 286  SER n 
2 287  GLY n 
2 288  ARG n 
2 289  THR n 
2 290  LEU n 
2 291  ALA n 
2 292  ARG n 
2 293  PHE n 
2 294  GLU n 
2 295  ASP n 
2 296  GLY n 
2 297  GLU n 
2 298  PHE n 
2 299  LYS n 
2 300  ASP n 
2 301  GLU n 
2 302  VAL n 
2 303  PHE n 
2 304  LEU n 
2 305  PRO n 
2 306  THR n 
2 307  LEU n 
2 308  ARG n 
2 309  TYR n 
2 310  LEU n 
2 311  PHE n 
2 312  ALA n 
2 313  LEU n 
2 314  THR n 
2 315  ALA n 
2 316  GLY n 
2 317  VAL n 
2 318  PRO n 
2 319  GLY n 
2 320  HIS n 
2 321  GLU n 
2 322  VAL n 
2 323  ASP n 
2 324  ASP n 
2 325  ILE n 
2 326  ASP n 
2 327  HIS n 
2 328  LEU n 
2 329  GLY n 
2 330  ASN n 
2 331  ARG n 
2 332  ARG n 
2 333  ILE n 
2 334  ARG n 
2 335  THR n 
2 336  VAL n 
2 337  GLY n 
2 338  GLU n 
2 339  LEU n 
2 340  MET n 
2 341  THR n 
2 342  ASP n 
2 343  GLN n 
2 344  PHE n 
2 345  ARG n 
2 346  VAL n 
2 347  GLY n 
2 348  LEU n 
2 349  ALA n 
2 350  ARG n 
2 351  LEU n 
2 352  ALA n 
2 353  ARG n 
2 354  GLY n 
2 355  VAL n 
2 356  ARG n 
2 357  GLU n 
2 358  ARG n 
2 359  MET n 
2 360  LEU n 
2 361  MET n 
2 362  GLY n 
2 363  SER n 
2 364  GLU n 
2 365  ASP n 
2 366  SER n 
2 367  LEU n 
2 368  THR n 
2 369  PRO n 
2 370  ALA n 
2 371  LYS n 
2 372  LEU n 
2 373  VAL n 
2 374  ASN n 
2 375  SER n 
2 376  ARG n 
2 377  PRO n 
2 378  LEU n 
2 379  GLU n 
2 380  ALA n 
2 381  ALA n 
2 382  ILE n 
2 383  ARG n 
2 384  GLU n 
2 385  PHE n 
2 386  PHE n 
2 387  SER n 
2 388  ARG n 
2 389  SER n 
2 390  GLN n 
2 391  LEU n 
2 392  SER n 
2 393  GLN n 
2 394  PHE n 
2 395  LYS n 
2 396  ASP n 
2 397  GLU n 
2 398  THR n 
2 399  ASN n 
2 400  PRO n 
2 401  LEU n 
2 402  SER n 
2 403  SER n 
2 404  LEU n 
2 405  ARG n 
2 406  HIS n 
2 407  LYS n 
2 408  ARG n 
2 409  ARG n 
2 410  ILE n 
2 411  SER n 
2 412  ALA n 
2 413  LEU n 
2 414  GLY n 
2 415  PRO n 
2 416  GLY n 
2 417  GLY n 
2 418  LEU n 
2 419  THR n 
2 420  ARG n 
2 421  GLU n 
2 422  ARG n 
2 423  ALA n 
2 424  GLY n 
2 425  PHE n 
2 426  ASP n 
2 427  VAL n 
2 428  ARG n 
2 429  ASP n 
2 430  VAL n 
2 431  HIS n 
2 432  ARG n 
2 433  THR n 
2 434  HIS n 
2 435  TYR n 
2 436  GLY n 
2 437  ARG n 
2 438  ILE n 
2 439  CYS n 
2 440  PRO n 
2 441  VAL n 
2 442  GLU n 
2 443  THR n 
2 444  PRO n 
2 445  GLU n 
2 446  GLY n 
2 447  ALA n 
2 448  ASN n 
2 449  ILE n 
2 450  GLY n 
2 451  LEU n 
2 452  ILE n 
2 453  THR n 
2 454  SER n 
2 455  LEU n 
2 456  ALA n 
2 457  ALA n 
2 458  TYR n 
2 459  ALA n 
2 460  ARG n 
2 461  VAL n 
2 462  ASP n 
2 463  GLU n 
2 464  LEU n 
2 465  GLY n 
2 466  PHE n 
2 467  ILE n 
2 468  ARG n 
2 469  THR n 
2 470  PRO n 
2 471  TYR n 
2 472  ARG n 
2 473  ARG n 
2 474  VAL n 
2 475  VAL n 
2 476  GLY n 
2 477  GLY n 
2 478  VAL n 
2 479  VAL n 
2 480  THR n 
2 481  ASP n 
2 482  GLU n 
2 483  VAL n 
2 484  VAL n 
2 485  TYR n 
2 486  MET n 
2 487  THR n 
2 488  ALA n 
2 489  THR n 
2 490  GLU n 
2 491  GLU n 
2 492  ASP n 
2 493  ARG n 
2 494  TYR n 
2 495  THR n 
2 496  ILE n 
2 497  ALA n 
2 498  GLN n 
2 499  ALA n 
2 500  ASN n 
2 501  THR n 
2 502  PRO n 
2 503  LEU n 
2 504  GLU n 
2 505  GLY n 
2 506  ASN n 
2 507  ARG n 
2 508  ILE n 
2 509  ALA n 
2 510  ALA n 
2 511  GLU n 
2 512  ARG n 
2 513  VAL n 
2 514  VAL n 
2 515  ALA n 
2 516  ARG n 
2 517  ARG n 
2 518  LYS n 
2 519  GLY n 
2 520  GLU n 
2 521  PRO n 
2 522  VAL n 
2 523  ILE n 
2 524  VAL n 
2 525  SER n 
2 526  PRO n 
2 527  GLU n 
2 528  GLU n 
2 529  VAL n 
2 530  GLU n 
2 531  PHE n 
2 532  MET n 
2 533  ASP n 
2 534  VAL n 
2 535  SER n 
2 536  PRO n 
2 537  LYS n 
2 538  GLN n 
2 539  VAL n 
2 540  PHE n 
2 541  SER n 
2 542  VAL n 
2 543  ASN n 
2 544  THR n 
2 545  ASN n 
2 546  LEU n 
2 547  ILE n 
2 548  PRO n 
2 549  PHE n 
2 550  LEU n 
2 551  GLU n 
2 552  HIS n 
2 553  ASP n 
2 554  ASP n 
2 555  ALA n 
2 556  ASN n 
2 557  ARG n 
2 558  ALA n 
2 559  LEU n 
2 560  MET n 
2 561  GLY n 
2 562  SER n 
2 563  ASN n 
2 564  MET n 
2 565  GLN n 
2 566  THR n 
2 567  GLN n 
2 568  ALA n 
2 569  VAL n 
2 570  PRO n 
2 571  LEU n 
2 572  ILE n 
2 573  ARG n 
2 574  ALA n 
2 575  GLN n 
2 576  ALA n 
2 577  PRO n 
2 578  VAL n 
2 579  VAL n 
2 580  MET n 
2 581  THR n 
2 582  GLY n 
2 583  LEU n 
2 584  GLU n 
2 585  GLU n 
2 586  ARG n 
2 587  VAL n 
2 588  VAL n 
2 589  ARG n 
2 590  ASP n 
2 591  SER n 
2 592  LEU n 
2 593  ALA n 
2 594  ALA n 
2 595  LEU n 
2 596  TYR n 
2 597  ALA n 
2 598  GLU n 
2 599  GLU n 
2 600  ASP n 
2 601  GLY n 
2 602  GLU n 
2 603  VAL n 
2 604  ALA n 
2 605  LYS n 
2 606  VAL n 
2 607  ASP n 
2 608  GLY n 
2 609  ASN n 
2 610  ARG n 
2 611  ILE n 
2 612  VAL n 
2 613  VAL n 
2 614  ARG n 
2 615  TYR n 
2 616  GLU n 
2 617  ASP n 
2 618  GLY n 
2 619  ARG n 
2 620  LEU n 
2 621  VAL n 
2 622  GLU n 
2 623  TYR n 
2 624  PRO n 
2 625  LEU n 
2 626  ARG n 
2 627  ARG n 
2 628  PHE n 
2 629  TYR n 
2 630  ARG n 
2 631  SER n 
2 632  ASN n 
2 633  GLN n 
2 634  GLY n 
2 635  THR n 
2 636  ALA n 
2 637  LEU n 
2 638  ASP n 
2 639  GLN n 
2 640  ARG n 
2 641  PRO n 
2 642  ARG n 
2 643  VAL n 
2 644  VAL n 
2 645  VAL n 
2 646  GLY n 
2 647  GLN n 
2 648  ARG n 
2 649  VAL n 
2 650  ARG n 
2 651  LYS n 
2 652  GLY n 
2 653  ASP n 
2 654  LEU n 
2 655  LEU n 
2 656  ALA n 
2 657  ASP n 
2 658  GLY n 
2 659  PRO n 
2 660  ALA n 
2 661  SER n 
2 662  GLU n 
2 663  ASN n 
2 664  GLY n 
2 665  PHE n 
2 666  LEU n 
2 667  ALA n 
2 668  LEU n 
2 669  GLY n 
2 670  GLN n 
2 671  ASN n 
2 672  VAL n 
2 673  LEU n 
2 674  VAL n 
2 675  ALA n 
2 676  ILE n 
2 677  MET n 
2 678  PRO n 
2 679  PHE n 
2 680  ASP n 
2 681  GLY n 
2 682  TYR n 
2 683  ASN n 
2 684  PHE n 
2 685  GLU n 
2 686  ASP n 
2 687  ALA n 
2 688  ILE n 
2 689  VAL n 
2 690  ILE n 
2 691  SER n 
2 692  GLU n 
2 693  GLU n 
2 694  LEU n 
2 695  LEU n 
2 696  LYS n 
2 697  ARG n 
2 698  ASP n 
2 699  PHE n 
2 700  TYR n 
2 701  THR n 
2 702  SER n 
2 703  ILE n 
2 704  HIS n 
2 705  ILE n 
2 706  GLU n 
2 707  ARG n 
2 708  TYR n 
2 709  GLU n 
2 710  ILE n 
2 711  GLU n 
2 712  ALA n 
2 713  ARG n 
2 714  ASP n 
2 715  THR n 
2 716  LYS n 
2 717  LEU n 
2 718  GLY n 
2 719  PRO n 
2 720  GLU n 
2 721  ARG n 
2 722  ILE n 
2 723  THR n 
2 724  ARG n 
2 725  ASP n 
2 726  ILE n 
2 727  PRO n 
2 728  HIS n 
2 729  LEU n 
2 730  SER n 
2 731  GLU n 
2 732  ALA n 
2 733  ALA n 
2 734  LEU n 
2 735  ARG n 
2 736  ASP n 
2 737  LEU n 
2 738  ASP n 
2 739  GLU n 
2 740  GLU n 
2 741  GLY n 
2 742  VAL n 
2 743  VAL n 
2 744  ARG n 
2 745  ILE n 
2 746  GLY n 
2 747  ALA n 
2 748  GLU n 
2 749  VAL n 
2 750  LYS n 
2 751  PRO n 
2 752  GLY n 
2 753  ASP n 
2 754  ILE n 
2 755  LEU n 
2 756  VAL n 
2 757  GLY n 
2 758  ARG n 
2 759  THR n 
2 760  SER n 
2 761  PHE n 
2 762  LYS n 
2 763  GLY n 
2 764  GLU n 
2 765  SER n 
2 766  GLU n 
2 767  PRO n 
2 768  THR n 
2 769  PRO n 
2 770  GLU n 
2 771  GLU n 
2 772  ARG n 
2 773  LEU n 
2 774  LEU n 
2 775  ARG n 
2 776  SER n 
2 777  ILE n 
2 778  PHE n 
2 779  GLY n 
2 780  GLU n 
2 781  LYS n 
2 782  ALA n 
2 783  ARG n 
2 784  ASP n 
2 785  VAL n 
2 786  LYS n 
2 787  ASP n 
2 788  THR n 
2 789  SER n 
2 790  LEU n 
2 791  ARG n 
2 792  VAL n 
2 793  PRO n 
2 794  PRO n 
2 795  GLY n 
2 796  GLU n 
2 797  GLY n 
2 798  GLY n 
2 799  ILE n 
2 800  VAL n 
2 801  VAL n 
2 802  ARG n 
2 803  THR n 
2 804  VAL n 
2 805  ARG n 
2 806  LEU n 
2 807  ARG n 
2 808  ARG n 
2 809  GLY n 
2 810  ASP n 
2 811  PRO n 
2 812  GLY n 
2 813  VAL n 
2 814  GLU n 
2 815  LEU n 
2 816  LYS n 
2 817  PRO n 
2 818  GLY n 
2 819  VAL n 
2 820  ARG n 
2 821  GLU n 
2 822  VAL n 
2 823  VAL n 
2 824  ARG n 
2 825  VAL n 
2 826  TYR n 
2 827  VAL n 
2 828  ALA n 
2 829  GLN n 
2 830  LYS n 
2 831  ARG n 
2 832  LYS n 
2 833  LEU n 
2 834  GLN n 
2 835  VAL n 
2 836  GLY n 
2 837  ASP n 
2 838  LYS n 
2 839  LEU n 
2 840  ALA n 
2 841  ASN n 
2 842  ARG n 
2 843  HIS n 
2 844  GLY n 
2 845  ASN n 
2 846  LYS n 
2 847  GLY n 
2 848  VAL n 
2 849  VAL n 
2 850  ALA n 
2 851  LYS n 
2 852  ILE n 
2 853  LEU n 
2 854  PRO n 
2 855  VAL n 
2 856  GLU n 
2 857  ASP n 
2 858  MET n 
2 859  PRO n 
2 860  HIS n 
2 861  LEU n 
2 862  PRO n 
2 863  ASP n 
2 864  GLY n 
2 865  THR n 
2 866  PRO n 
2 867  VAL n 
2 868  ASP n 
2 869  VAL n 
2 870  ILE n 
2 871  LEU n 
2 872  ASN n 
2 873  PRO n 
2 874  LEU n 
2 875  GLY n 
2 876  VAL n 
2 877  PRO n 
2 878  SER n 
2 879  ARG n 
2 880  MET n 
2 881  ASN n 
2 882  LEU n 
2 883  GLY n 
2 884  GLN n 
2 885  ILE n 
2 886  LEU n 
2 887  GLU n 
2 888  THR n 
2 889  HIS n 
2 890  LEU n 
2 891  GLY n 
2 892  LEU n 
2 893  ALA n 
2 894  GLY n 
2 895  TYR n 
2 896  PHE n 
2 897  LEU n 
2 898  GLY n 
2 899  GLN n 
2 900  ARG n 
2 901  TYR n 
2 902  ILE n 
2 903  SER n 
2 904  PRO n 
2 905  ILE n 
2 906  PHE n 
2 907  ASP n 
2 908  GLY n 
2 909  ALA n 
2 910  LYS n 
2 911  GLU n 
2 912  PRO n 
2 913  GLU n 
2 914  ILE n 
2 915  LYS n 
2 916  GLU n 
2 917  LEU n 
2 918  LEU n 
2 919  ALA n 
2 920  GLN n 
2 921  ALA n 
2 922  PHE n 
2 923  GLU n 
2 924  VAL n 
2 925  TYR n 
2 926  PHE n 
2 927  GLY n 
2 928  LYS n 
2 929  ARG n 
2 930  LYS n 
2 931  GLY n 
2 932  GLU n 
2 933  GLY n 
2 934  PHE n 
2 935  GLY n 
2 936  VAL n 
2 937  ASP n 
2 938  LYS n 
2 939  ARG n 
2 940  GLU n 
2 941  VAL n 
2 942  GLU n 
2 943  VAL n 
2 944  LEU n 
2 945  ARG n 
2 946  ARG n 
2 947  ALA n 
2 948  GLU n 
2 949  LYS n 
2 950  LEU n 
2 951  GLY n 
2 952  LEU n 
2 953  VAL n 
2 954  THR n 
2 955  PRO n 
2 956  GLY n 
2 957  LYS n 
2 958  THR n 
2 959  PRO n 
2 960  GLU n 
2 961  GLU n 
2 962  GLN n 
2 963  LEU n 
2 964  LYS n 
2 965  GLU n 
2 966  LEU n 
2 967  PHE n 
2 968  LEU n 
2 969  GLN n 
2 970  GLY n 
2 971  LYS n 
2 972  VAL n 
2 973  VAL n 
2 974  LEU n 
2 975  TYR n 
2 976  ASP n 
2 977  GLY n 
2 978  ARG n 
2 979  THR n 
2 980  GLY n 
2 981  GLU n 
2 982  PRO n 
2 983  ILE n 
2 984  GLU n 
2 985  GLY n 
2 986  PRO n 
2 987  ILE n 
2 988  VAL n 
2 989  VAL n 
2 990  GLY n 
2 991  GLN n 
2 992  MET n 
2 993  PHE n 
2 994  ILE n 
2 995  MET n 
2 996  LYS n 
2 997  LEU n 
2 998  TYR n 
2 999  HIS n 
2 1000 MET n 
2 1001 VAL n 
2 1002 GLU n 
2 1003 ASP n 
2 1004 LYS n 
2 1005 MET n 
2 1006 HIS n 
2 1007 ALA n 
2 1008 ARG n 
2 1009 SER n 
2 1010 THR n 
2 1011 GLY n 
2 1012 PRO n 
2 1013 TYR n 
2 1014 SER n 
2 1015 LEU n 
2 1016 ILE n 
2 1017 THR n 
2 1018 GLN n 
2 1019 GLN n 
2 1020 PRO n 
2 1021 LEU n 
2 1022 GLY n 
2 1023 GLY n 
2 1024 LYS n 
2 1025 ALA n 
2 1026 GLN n 
2 1027 PHE n 
2 1028 GLY n 
2 1029 GLY n 
2 1030 GLN n 
2 1031 ARG n 
2 1032 PHE n 
2 1033 GLY n 
2 1034 GLU n 
2 1035 MET n 
2 1036 GLU n 
2 1037 VAL n 
2 1038 TRP n 
2 1039 ALA n 
2 1040 LEU n 
2 1041 GLU n 
2 1042 ALA n 
2 1043 TYR n 
2 1044 GLY n 
2 1045 ALA n 
2 1046 ALA n 
2 1047 HIS n 
2 1048 THR n 
2 1049 LEU n 
2 1050 GLN n 
2 1051 GLU n 
2 1052 MET n 
2 1053 LEU n 
2 1054 THR n 
2 1055 LEU n 
2 1056 LYS n 
2 1057 SER n 
2 1058 ASP n 
2 1059 ASP n 
2 1060 ILE n 
2 1061 GLU n 
2 1062 GLY n 
2 1063 ARG n 
2 1064 ASN n 
2 1065 ALA n 
2 1066 ALA n 
2 1067 TYR n 
2 1068 GLU n 
2 1069 ALA n 
2 1070 ILE n 
2 1071 ILE n 
2 1072 LYS n 
2 1073 GLY n 
2 1074 GLU n 
2 1075 ASP n 
2 1076 VAL n 
2 1077 PRO n 
2 1078 GLU n 
2 1079 PRO n 
2 1080 SER n 
2 1081 VAL n 
2 1082 PRO n 
2 1083 GLU n 
2 1084 SER n 
2 1085 PHE n 
2 1086 ARG n 
2 1087 VAL n 
2 1088 LEU n 
2 1089 VAL n 
2 1090 LYS n 
2 1091 GLU n 
2 1092 LEU n 
2 1093 GLN n 
2 1094 ALA n 
2 1095 LEU n 
2 1096 ALA n 
2 1097 LEU n 
2 1098 ASP n 
2 1099 VAL n 
2 1100 GLN n 
2 1101 THR n 
2 1102 LEU n 
2 1103 ASP n 
2 1104 GLU n 
2 1105 LYS n 
2 1106 ASP n 
2 1107 ASN n 
2 1108 PRO n 
2 1109 VAL n 
2 1110 ASP n 
2 1111 ILE n 
2 1112 PHE n 
2 1113 GLU n 
2 1114 GLY n 
2 1115 LEU n 
2 1116 ALA n 
2 1117 SER n 
2 1118 LYS n 
2 1119 ARG n 
3 1    MET n 
3 2    LYS n 
3 3    LYS n 
3 4    GLU n 
3 5    VAL n 
3 6    ARG n 
3 7    LYS n 
3 8    VAL n 
3 9    ARG n 
3 10   ILE n 
3 11   ALA n 
3 12   LEU n 
3 13   ALA n 
3 14   SER n 
3 15   PRO n 
3 16   GLU n 
3 17   LYS n 
3 18   ILE n 
3 19   ARG n 
3 20   SER n 
3 21   TRP n 
3 22   SER n 
3 23   TYR n 
3 24   GLY n 
3 25   GLU n 
3 26   VAL n 
3 27   GLU n 
3 28   LYS n 
3 29   PRO n 
3 30   GLU n 
3 31   THR n 
3 32   ILE n 
3 33   ASN n 
3 34   TYR n 
3 35   ARG n 
3 36   THR n 
3 37   LEU n 
3 38   LYS n 
3 39   PRO n 
3 40   GLU n 
3 41   ARG n 
3 42   ASP n 
3 43   GLY n 
3 44   LEU n 
3 45   PHE n 
3 46   ASP n 
3 47   GLU n 
3 48   ARG n 
3 49   ILE n 
3 50   PHE n 
3 51   GLY n 
3 52   PRO n 
3 53   ILE n 
3 54   LYS n 
3 55   ASP n 
3 56   TYR n 
3 57   GLU n 
3 58   CYS n 
3 59   ALA n 
3 60   CYS n 
3 61   GLY n 
3 62   LYS n 
3 63   TYR n 
3 64   LYS n 
3 65   ARG n 
3 66   GLN n 
3 67   ARG n 
3 68   PHE n 
3 69   GLU n 
3 70   GLY n 
3 71   LYS n 
3 72   VAL n 
3 73   CYS n 
3 74   GLU n 
3 75   ARG n 
3 76   CYS n 
3 77   GLY n 
3 78   VAL n 
3 79   GLU n 
3 80   VAL n 
3 81   THR n 
3 82   LYS n 
3 83   SER n 
3 84   ILE n 
3 85   VAL n 
3 86   ARG n 
3 87   ARG n 
3 88   TYR n 
3 89   ARG n 
3 90   MET n 
3 91   GLY n 
3 92   HIS n 
3 93   ILE n 
3 94   GLU n 
3 95   LEU n 
3 96   ALA n 
3 97   THR n 
3 98   PRO n 
3 99   ALA n 
3 100  ALA n 
3 101  HIS n 
3 102  ILE n 
3 103  TRP n 
3 104  PHE n 
3 105  VAL n 
3 106  LYS n 
3 107  ASP n 
3 108  VAL n 
3 109  PRO n 
3 110  SER n 
3 111  LYS n 
3 112  ILE n 
3 113  GLY n 
3 114  THR n 
3 115  LEU n 
3 116  LEU n 
3 117  ASP n 
3 118  LEU n 
3 119  SER n 
3 120  ALA n 
3 121  THR n 
3 122  GLU n 
3 123  LEU n 
3 124  GLU n 
3 125  GLN n 
3 126  VAL n 
3 127  LEU n 
3 128  TYR n 
3 129  PHE n 
3 130  SER n 
3 131  LYS n 
3 132  TYR n 
3 133  ILE n 
3 134  VAL n 
3 135  LEU n 
3 136  ASP n 
3 137  PRO n 
3 138  LYS n 
3 139  GLY n 
3 140  ALA n 
3 141  ILE n 
3 142  LEU n 
3 143  ASN n 
3 144  GLY n 
3 145  VAL n 
3 146  PRO n 
3 147  VAL n 
3 148  GLU n 
3 149  LYS n 
3 150  ARG n 
3 151  GLN n 
3 152  LEU n 
3 153  LEU n 
3 154  THR n 
3 155  ASP n 
3 156  GLU n 
3 157  GLU n 
3 158  TYR n 
3 159  ARG n 
3 160  GLU n 
3 161  LEU n 
3 162  ARG n 
3 163  TYR n 
3 164  GLY n 
3 165  LYS n 
3 166  GLN n 
3 167  GLU n 
3 168  THR n 
3 169  TYR n 
3 170  PRO n 
3 171  LEU n 
3 172  PRO n 
3 173  PRO n 
3 174  GLY n 
3 175  VAL n 
3 176  ASP n 
3 177  ALA n 
3 178  LEU n 
3 179  VAL n 
3 180  LYS n 
3 181  ASP n 
3 182  GLY n 
3 183  GLU n 
3 184  GLU n 
3 185  VAL n 
3 186  VAL n 
3 187  LYS n 
3 188  GLY n 
3 189  GLN n 
3 190  GLU n 
3 191  LEU n 
3 192  ALA n 
3 193  PRO n 
3 194  GLY n 
3 195  VAL n 
3 196  VAL n 
3 197  SER n 
3 198  ARG n 
3 199  LEU n 
3 200  ASP n 
3 201  GLY n 
3 202  VAL n 
3 203  ALA n 
3 204  LEU n 
3 205  TYR n 
3 206  ARG n 
3 207  PHE n 
3 208  PRO n 
3 209  ARG n 
3 210  ARG n 
3 211  VAL n 
3 212  ARG n 
3 213  VAL n 
3 214  GLU n 
3 215  TYR n 
3 216  VAL n 
3 217  LYS n 
3 218  LYS n 
3 219  GLU n 
3 220  ARG n 
3 221  ALA n 
3 222  GLY n 
3 223  LEU n 
3 224  ARG n 
3 225  LEU n 
3 226  PRO n 
3 227  LEU n 
3 228  ALA n 
3 229  ALA n 
3 230  TRP n 
3 231  VAL n 
3 232  GLU n 
3 233  LYS n 
3 234  GLU n 
3 235  ALA n 
3 236  TYR n 
3 237  LYS n 
3 238  PRO n 
3 239  GLY n 
3 240  GLU n 
3 241  ILE n 
3 242  LEU n 
3 243  ALA n 
3 244  GLU n 
3 245  LEU n 
3 246  PRO n 
3 247  GLU n 
3 248  PRO n 
3 249  TYR n 
3 250  LEU n 
3 251  PHE n 
3 252  ARG n 
3 253  ALA n 
3 254  GLU n 
3 255  GLU n 
3 256  GLU n 
3 257  GLY n 
3 258  VAL n 
3 259  VAL n 
3 260  GLU n 
3 261  LEU n 
3 262  LYS n 
3 263  GLU n 
3 264  LEU n 
3 265  GLU n 
3 266  GLU n 
3 267  GLY n 
3 268  ALA n 
3 269  PHE n 
3 270  LEU n 
3 271  VAL n 
3 272  LEU n 
3 273  ARG n 
3 274  ARG n 
3 275  GLU n 
3 276  ASP n 
3 277  GLU n 
3 278  PRO n 
3 279  VAL n 
3 280  ALA n 
3 281  THR n 
3 282  TYR n 
3 283  PHE n 
3 284  LEU n 
3 285  PRO n 
3 286  VAL n 
3 287  GLY n 
3 288  MET n 
3 289  THR n 
3 290  PRO n 
3 291  LEU n 
3 292  VAL n 
3 293  VAL n 
3 294  HIS n 
3 295  GLY n 
3 296  GLU n 
3 297  ILE n 
3 298  VAL n 
3 299  GLU n 
3 300  LYS n 
3 301  GLY n 
3 302  GLN n 
3 303  PRO n 
3 304  LEU n 
3 305  ALA n 
3 306  GLU n 
3 307  ALA n 
3 308  LYS n 
3 309  GLY n 
3 310  LEU n 
3 311  LEU n 
3 312  ARG n 
3 313  MET n 
3 314  PRO n 
3 315  ARG n 
3 316  GLN n 
3 317  VAL n 
3 318  ARG n 
3 319  ALA n 
3 320  ALA n 
3 321  GLN n 
3 322  VAL n 
3 323  GLU n 
3 324  ALA n 
3 325  GLU n 
3 326  GLU n 
3 327  GLU n 
3 328  GLY n 
3 329  GLU n 
3 330  THR n 
3 331  VAL n 
3 332  TYR n 
3 333  LEU n 
3 334  THR n 
3 335  LEU n 
3 336  PHE n 
3 337  LEU n 
3 338  GLU n 
3 339  TRP n 
3 340  THR n 
3 341  GLU n 
3 342  PRO n 
3 343  LYS n 
3 344  ASP n 
3 345  TYR n 
3 346  ARG n 
3 347  VAL n 
3 348  GLN n 
3 349  PRO n 
3 350  HIS n 
3 351  MET n 
3 352  ASN n 
3 353  VAL n 
3 354  VAL n 
3 355  VAL n 
3 356  PRO n 
3 357  GLU n 
3 358  GLY n 
3 359  ALA n 
3 360  ARG n 
3 361  VAL n 
3 362  GLU n 
3 363  ALA n 
3 364  GLY n 
3 365  ASP n 
3 366  LYS n 
3 367  ILE n 
3 368  VAL n 
3 369  ALA n 
3 370  ALA n 
3 371  ILE n 
3 372  ASP n 
3 373  PRO n 
3 374  GLU n 
3 375  GLU n 
3 376  GLU n 
3 377  VAL n 
3 378  ILE n 
3 379  ALA n 
3 380  GLU n 
3 381  ALA n 
3 382  GLU n 
3 383  GLY n 
3 384  VAL n 
3 385  VAL n 
3 386  HIS n 
3 387  LEU n 
3 388  HIS n 
3 389  GLU n 
3 390  PRO n 
3 391  ALA n 
3 392  SER n 
3 393  ILE n 
3 394  LEU n 
3 395  VAL n 
3 396  VAL n 
3 397  LYS n 
3 398  ALA n 
3 399  ARG n 
3 400  VAL n 
3 401  TYR n 
3 402  PRO n 
3 403  PHE n 
3 404  GLU n 
3 405  ASP n 
3 406  ASP n 
3 407  VAL n 
3 408  GLU n 
3 409  VAL n 
3 410  SER n 
3 411  THR n 
3 412  GLY n 
3 413  ASP n 
3 414  ARG n 
3 415  VAL n 
3 416  ALA n 
3 417  PRO n 
3 418  GLY n 
3 419  ASP n 
3 420  VAL n 
3 421  LEU n 
3 422  ALA n 
3 423  ASP n 
3 424  GLY n 
3 425  GLY n 
3 426  LYS n 
3 427  VAL n 
3 428  LYS n 
3 429  SER n 
3 430  ASP n 
3 431  VAL n 
3 432  TYR n 
3 433  GLY n 
3 434  ARG n 
3 435  VAL n 
3 436  GLU n 
3 437  VAL n 
3 438  ASP n 
3 439  LEU n 
3 440  VAL n 
3 441  ARG n 
3 442  ASN n 
3 443  VAL n 
3 444  VAL n 
3 445  ARG n 
3 446  VAL n 
3 447  VAL n 
3 448  GLU n 
3 449  SER n 
3 450  TYR n 
3 451  ASP n 
3 452  ILE n 
3 453  ASP n 
3 454  ALA n 
3 455  ARG n 
3 456  MET n 
3 457  GLY n 
3 458  ALA n 
3 459  GLU n 
3 460  ALA n 
3 461  ILE n 
3 462  GLN n 
3 463  GLN n 
3 464  LEU n 
3 465  LEU n 
3 466  LYS n 
3 467  GLU n 
3 468  LEU n 
3 469  ASP n 
3 470  LEU n 
3 471  GLU n 
3 472  ALA n 
3 473  LEU n 
3 474  GLU n 
3 475  LYS n 
3 476  GLU n 
3 477  LEU n 
3 478  LEU n 
3 479  GLU n 
3 480  GLU n 
3 481  MET n 
3 482  LYS n 
3 483  HIS n 
3 484  PRO n 
3 485  SER n 
3 486  ARG n 
3 487  ALA n 
3 488  ARG n 
3 489  ARG n 
3 490  ALA n 
3 491  LYS n 
3 492  ALA n 
3 493  ARG n 
3 494  LYS n 
3 495  ARG n 
3 496  LEU n 
3 497  GLU n 
3 498  VAL n 
3 499  VAL n 
3 500  ARG n 
3 501  ALA n 
3 502  PHE n 
3 503  LEU n 
3 504  ASP n 
3 505  SER n 
3 506  GLY n 
3 507  ASN n 
3 508  ARG n 
3 509  PRO n 
3 510  GLU n 
3 511  TRP n 
3 512  MET n 
3 513  ILE n 
3 514  LEU n 
3 515  GLU n 
3 516  ALA n 
3 517  VAL n 
3 518  PRO n 
3 519  VAL n 
3 520  LEU n 
3 521  PRO n 
3 522  PRO n 
3 523  ASP n 
3 524  LEU n 
3 525  ARG n 
3 526  PRO n 
3 527  MET n 
3 528  VAL n 
3 529  GLN n 
3 530  VAL n 
3 531  ASP n 
3 532  GLY n 
3 533  GLY n 
3 534  ARG n 
3 535  PHE n 
3 536  ALA n 
3 537  THR n 
3 538  SER n 
3 539  ASP n 
3 540  LEU n 
3 541  ASN n 
3 542  ASP n 
3 543  LEU n 
3 544  TYR n 
3 545  ARG n 
3 546  ARG n 
3 547  LEU n 
3 548  ILE n 
3 549  ASN n 
3 550  ARG n 
3 551  ASN n 
3 552  ASN n 
3 553  ARG n 
3 554  LEU n 
3 555  LYS n 
3 556  LYS n 
3 557  LEU n 
3 558  LEU n 
3 559  ALA n 
3 560  GLN n 
3 561  GLY n 
3 562  ALA n 
3 563  PRO n 
3 564  GLU n 
3 565  ILE n 
3 566  ILE n 
3 567  ILE n 
3 568  ARG n 
3 569  ASN n 
3 570  GLU n 
3 571  LYS n 
3 572  ARG n 
3 573  MET n 
3 574  LEU n 
3 575  GLN n 
3 576  GLU n 
3 577  ALA n 
3 578  VAL n 
3 579  ASP n 
3 580  ALA n 
3 581  LEU n 
3 582  LEU n 
3 583  ASP n 
3 584  ASN n 
3 585  GLY n 
3 586  ARG n 
3 587  ARG n 
3 588  GLY n 
3 589  ALA n 
3 590  PRO n 
3 591  VAL n 
3 592  THR n 
3 593  ASN n 
3 594  PRO n 
3 595  GLY n 
3 596  SER n 
3 597  ASP n 
3 598  ARG n 
3 599  PRO n 
3 600  LEU n 
3 601  ARG n 
3 602  SER n 
3 603  LEU n 
3 604  THR n 
3 605  ASP n 
3 606  ILE n 
3 607  LEU n 
3 608  SER n 
3 609  GLY n 
3 610  LYS n 
3 611  GLN n 
3 612  GLY n 
3 613  ARG n 
3 614  PHE n 
3 615  ARG n 
3 616  GLN n 
3 617  ASN n 
3 618  LEU n 
3 619  LEU n 
3 620  GLY n 
3 621  LYS n 
3 622  ARG n 
3 623  VAL n 
3 624  ASP n 
3 625  TYR n 
3 626  SER n 
3 627  GLY n 
3 628  ARG n 
3 629  SER n 
3 630  VAL n 
3 631  ILE n 
3 632  VAL n 
3 633  VAL n 
3 634  GLY n 
3 635  PRO n 
3 636  GLN n 
3 637  LEU n 
3 638  LYS n 
3 639  LEU n 
3 640  HIS n 
3 641  GLN n 
3 642  CYS n 
3 643  GLY n 
3 644  LEU n 
3 645  PRO n 
3 646  LYS n 
3 647  ARG n 
3 648  MET n 
3 649  ALA n 
3 650  LEU n 
3 651  GLU n 
3 652  LEU n 
3 653  PHE n 
3 654  LYS n 
3 655  PRO n 
3 656  PHE n 
3 657  LEU n 
3 658  LEU n 
3 659  LYS n 
3 660  LYS n 
3 661  MET n 
3 662  GLU n 
3 663  GLU n 
3 664  LYS n 
3 665  GLY n 
3 666  ILE n 
3 667  ALA n 
3 668  PRO n 
3 669  ASN n 
3 670  VAL n 
3 671  LYS n 
3 672  ALA n 
3 673  ALA n 
3 674  ARG n 
3 675  ARG n 
3 676  MET n 
3 677  LEU n 
3 678  GLU n 
3 679  ARG n 
3 680  GLN n 
3 681  ARG n 
3 682  ASP n 
3 683  ILE n 
3 684  LYS n 
3 685  ASP n 
3 686  GLU n 
3 687  VAL n 
3 688  TRP n 
3 689  ASP n 
3 690  ALA n 
3 691  LEU n 
3 692  GLU n 
3 693  GLU n 
3 694  VAL n 
3 695  ILE n 
3 696  HIS n 
3 697  GLY n 
3 698  LYS n 
3 699  VAL n 
3 700  VAL n 
3 701  LEU n 
3 702  LEU n 
3 703  ASN n 
3 704  ARG n 
3 705  ALA n 
3 706  PRO n 
3 707  THR n 
3 708  LEU n 
3 709  HIS n 
3 710  ARG n 
3 711  LEU n 
3 712  GLY n 
3 713  ILE n 
3 714  GLN n 
3 715  ALA n 
3 716  PHE n 
3 717  GLN n 
3 718  PRO n 
3 719  VAL n 
3 720  LEU n 
3 721  VAL n 
3 722  GLU n 
3 723  GLY n 
3 724  GLN n 
3 725  SER n 
3 726  ILE n 
3 727  GLN n 
3 728  LEU n 
3 729  HIS n 
3 730  PRO n 
3 731  LEU n 
3 732  VAL n 
3 733  CYS n 
3 734  GLU n 
3 735  ALA n 
3 736  PHE n 
3 737  ASN n 
3 738  ALA n 
3 739  ASP n 
3 740  PHE n 
3 741  ASP n 
3 742  GLY n 
3 743  ASP n 
3 744  GLN n 
3 745  MET n 
3 746  ALA n 
3 747  VAL n 
3 748  HIS n 
3 749  VAL n 
3 750  PRO n 
3 751  LEU n 
3 752  SER n 
3 753  SER n 
3 754  PHE n 
3 755  ALA n 
3 756  GLN n 
3 757  ALA n 
3 758  GLU n 
3 759  ALA n 
3 760  ARG n 
3 761  ILE n 
3 762  GLN n 
3 763  MET n 
3 764  LEU n 
3 765  SER n 
3 766  ALA n 
3 767  HIS n 
3 768  ASN n 
3 769  LEU n 
3 770  LEU n 
3 771  SER n 
3 772  PRO n 
3 773  ALA n 
3 774  SER n 
3 775  GLY n 
3 776  GLU n 
3 777  PRO n 
3 778  LEU n 
3 779  ALA n 
3 780  LYS n 
3 781  PRO n 
3 782  SER n 
3 783  ARG n 
3 784  ASP n 
3 785  ILE n 
3 786  ILE n 
3 787  LEU n 
3 788  GLY n 
3 789  LEU n 
3 790  TYR n 
3 791  TYR n 
3 792  ILE n 
3 793  THR n 
3 794  GLN n 
3 795  VAL n 
3 796  ARG n 
3 797  LYS n 
3 798  GLU n 
3 799  LYS n 
3 800  LYS n 
3 801  GLY n 
3 802  ALA n 
3 803  GLY n 
3 804  LEU n 
3 805  GLU n 
3 806  PHE n 
3 807  ALA n 
3 808  THR n 
3 809  PRO n 
3 810  GLU n 
3 811  GLU n 
3 812  ALA n 
3 813  LEU n 
3 814  ALA n 
3 815  ALA n 
3 816  HIS n 
3 817  GLU n 
3 818  ARG n 
3 819  GLY n 
3 820  GLU n 
3 821  VAL n 
3 822  ALA n 
3 823  LEU n 
3 824  ASN n 
3 825  ALA n 
3 826  PRO n 
3 827  ILE n 
3 828  LYS n 
3 829  VAL n 
3 830  ALA n 
3 831  GLY n 
3 832  ARG n 
3 833  GLU n 
3 834  THR n 
3 835  SER n 
3 836  VAL n 
3 837  GLY n 
3 838  ARG n 
3 839  LEU n 
3 840  LYS n 
3 841  TYR n 
3 842  VAL n 
3 843  PHE n 
3 844  ALA n 
3 845  ASN n 
3 846  PRO n 
3 847  ASP n 
3 848  GLU n 
3 849  ALA n 
3 850  LEU n 
3 851  LEU n 
3 852  ALA n 
3 853  VAL n 
3 854  ALA n 
3 855  HIS n 
3 856  GLY n 
3 857  ILE n 
3 858  VAL n 
3 859  ASP n 
3 860  LEU n 
3 861  GLN n 
3 862  ASP n 
3 863  VAL n 
3 864  VAL n 
3 865  THR n 
3 866  VAL n 
3 867  ARG n 
3 868  TYR n 
3 869  MET n 
3 870  GLY n 
3 871  LYS n 
3 872  ARG n 
3 873  LEU n 
3 874  GLU n 
3 875  THR n 
3 876  SER n 
3 877  PRO n 
3 878  GLY n 
3 879  ARG n 
3 880  ILE n 
3 881  LEU n 
3 882  PHE n 
3 883  ALA n 
3 884  ARG n 
3 885  ILE n 
3 886  VAL n 
3 887  ALA n 
3 888  GLU n 
3 889  ALA n 
3 890  VAL n 
3 891  GLU n 
3 892  ASP n 
3 893  GLU n 
3 894  LYS n 
3 895  VAL n 
3 896  ALA n 
3 897  TRP n 
3 898  GLU n 
3 899  LEU n 
3 900  ILE n 
3 901  GLN n 
3 902  LEU n 
3 903  ASP n 
3 904  VAL n 
3 905  PRO n 
3 906  GLN n 
3 907  GLU n 
3 908  LYS n 
3 909  ASN n 
3 910  SER n 
3 911  LEU n 
3 912  LYS n 
3 913  ASP n 
3 914  LEU n 
3 915  VAL n 
3 916  TYR n 
3 917  GLN n 
3 918  ALA n 
3 919  PHE n 
3 920  LEU n 
3 921  ARG n 
3 922  LEU n 
3 923  GLY n 
3 924  MET n 
3 925  GLU n 
3 926  LYS n 
3 927  THR n 
3 928  ALA n 
3 929  ARG n 
3 930  LEU n 
3 931  LEU n 
3 932  ASP n 
3 933  ALA n 
3 934  LEU n 
3 935  LYS n 
3 936  TYR n 
3 937  TYR n 
3 938  GLY n 
3 939  PHE n 
3 940  THR n 
3 941  PHE n 
3 942  SER n 
3 943  THR n 
3 944  THR n 
3 945  SER n 
3 946  GLY n 
3 947  ILE n 
3 948  THR n 
3 949  ILE n 
3 950  GLY n 
3 951  ILE n 
3 952  ASP n 
3 953  ASP n 
3 954  ALA n 
3 955  VAL n 
3 956  ILE n 
3 957  PRO n 
3 958  GLU n 
3 959  GLU n 
3 960  LYS n 
3 961  LYS n 
3 962  GLN n 
3 963  TYR n 
3 964  LEU n 
3 965  GLU n 
3 966  GLU n 
3 967  ALA n 
3 968  ASP n 
3 969  ARG n 
3 970  LYS n 
3 971  LEU n 
3 972  LEU n 
3 973  GLN n 
3 974  ILE n 
3 975  GLU n 
3 976  GLN n 
3 977  ALA n 
3 978  TYR n 
3 979  GLU n 
3 980  MET n 
3 981  GLY n 
3 982  PHE n 
3 983  LEU n 
3 984  THR n 
3 985  ASP n 
3 986  ARG n 
3 987  GLU n 
3 988  ARG n 
3 989  TYR n 
3 990  ASP n 
3 991  GLN n 
3 992  ILE n 
3 993  LEU n 
3 994  GLN n 
3 995  LEU n 
3 996  TRP n 
3 997  THR n 
3 998  GLU n 
3 999  THR n 
3 1000 THR n 
3 1001 GLU n 
3 1002 LYS n 
3 1003 VAL n 
3 1004 THR n 
3 1005 GLN n 
3 1006 ALA n 
3 1007 VAL n 
3 1008 PHE n 
3 1009 LYS n 
3 1010 ASN n 
3 1011 PHE n 
3 1012 GLU n 
3 1013 GLU n 
3 1014 ASN n 
3 1015 TYR n 
3 1016 PRO n 
3 1017 PHE n 
3 1018 ASN n 
3 1019 PRO n 
3 1020 LEU n 
3 1021 TYR n 
3 1022 VAL n 
3 1023 MET n 
3 1024 ALA n 
3 1025 GLN n 
3 1026 SER n 
3 1027 GLY n 
3 1028 ALA n 
3 1029 ARG n 
3 1030 GLY n 
3 1031 ASN n 
3 1032 PRO n 
3 1033 GLN n 
3 1034 GLN n 
3 1035 ILE n 
3 1036 ARG n 
3 1037 GLN n 
3 1038 LEU n 
3 1039 CYS n 
3 1040 GLY n 
3 1041 LEU n 
3 1042 ARG n 
3 1043 GLY n 
3 1044 LEU n 
3 1045 MET n 
3 1046 GLN n 
3 1047 LYS n 
3 1048 PRO n 
3 1049 SER n 
3 1050 GLY n 
3 1051 GLU n 
3 1052 THR n 
3 1053 PHE n 
3 1054 GLU n 
3 1055 VAL n 
3 1056 PRO n 
3 1057 VAL n 
3 1058 ARG n 
3 1059 SER n 
3 1060 SER n 
3 1061 PHE n 
3 1062 ARG n 
3 1063 GLU n 
3 1064 GLY n 
3 1065 LEU n 
3 1066 THR n 
3 1067 VAL n 
3 1068 LEU n 
3 1069 GLU n 
3 1070 TYR n 
3 1071 PHE n 
3 1072 ILE n 
3 1073 SER n 
3 1074 SER n 
3 1075 HIS n 
3 1076 GLY n 
3 1077 ALA n 
3 1078 ARG n 
3 1079 LYS n 
3 1080 GLY n 
3 1081 GLY n 
3 1082 ALA n 
3 1083 ASP n 
3 1084 THR n 
3 1085 ALA n 
3 1086 LEU n 
3 1087 ARG n 
3 1088 THR n 
3 1089 ALA n 
3 1090 ASP n 
3 1091 SER n 
3 1092 GLY n 
3 1093 TYR n 
3 1094 LEU n 
3 1095 THR n 
3 1096 ARG n 
3 1097 LYS n 
3 1098 LEU n 
3 1099 VAL n 
3 1100 ASP n 
3 1101 VAL n 
3 1102 THR n 
3 1103 HIS n 
3 1104 GLU n 
3 1105 ILE n 
3 1106 VAL n 
3 1107 VAL n 
3 1108 ARG n 
3 1109 GLU n 
3 1110 ALA n 
3 1111 ASP n 
3 1112 CYS n 
3 1113 GLY n 
3 1114 THR n 
3 1115 THR n 
3 1116 ASN n 
3 1117 TYR n 
3 1118 ILE n 
3 1119 SER n 
3 1120 VAL n 
3 1121 PRO n 
3 1122 LEU n 
3 1123 PHE n 
3 1124 GLN n 
3 1125 PRO n 
3 1126 ASP n 
3 1127 GLU n 
3 1128 VAL n 
3 1129 THR n 
3 1130 ARG n 
3 1131 SER n 
3 1132 LEU n 
3 1133 ARG n 
3 1134 LEU n 
3 1135 ARG n 
3 1136 LYS n 
3 1137 ARG n 
3 1138 ALA n 
3 1139 ASP n 
3 1140 ILE n 
3 1141 GLU n 
3 1142 ALA n 
3 1143 GLY n 
3 1144 LEU n 
3 1145 TYR n 
3 1146 GLY n 
3 1147 ARG n 
3 1148 VAL n 
3 1149 LEU n 
3 1150 ALA n 
3 1151 ARG n 
3 1152 GLU n 
3 1153 VAL n 
3 1154 GLU n 
3 1155 VAL n 
3 1156 LEU n 
3 1157 GLY n 
3 1158 VAL n 
3 1159 ARG n 
3 1160 LEU n 
3 1161 GLU n 
3 1162 GLU n 
3 1163 GLY n 
3 1164 ARG n 
3 1165 TYR n 
3 1166 LEU n 
3 1167 SER n 
3 1168 MET n 
3 1169 ASP n 
3 1170 ASP n 
3 1171 VAL n 
3 1172 HIS n 
3 1173 LEU n 
3 1174 LEU n 
3 1175 ILE n 
3 1176 LYS n 
3 1177 ALA n 
3 1178 ALA n 
3 1179 GLU n 
3 1180 ALA n 
3 1181 GLY n 
3 1182 GLU n 
3 1183 ILE n 
3 1184 GLN n 
3 1185 GLU n 
3 1186 VAL n 
3 1187 PRO n 
3 1188 VAL n 
3 1189 ARG n 
3 1190 SER n 
3 1191 PRO n 
3 1192 LEU n 
3 1193 THR n 
3 1194 CYS n 
3 1195 GLN n 
3 1196 THR n 
3 1197 ARG n 
3 1198 TYR n 
3 1199 GLY n 
3 1200 VAL n 
3 1201 CYS n 
3 1202 GLN n 
3 1203 LYS n 
3 1204 CYS n 
3 1205 TYR n 
3 1206 GLY n 
3 1207 TYR n 
3 1208 ASP n 
3 1209 LEU n 
3 1210 SER n 
3 1211 MET n 
3 1212 ALA n 
3 1213 ARG n 
3 1214 PRO n 
3 1215 VAL n 
3 1216 SER n 
3 1217 ILE n 
3 1218 GLY n 
3 1219 GLU n 
3 1220 ALA n 
3 1221 VAL n 
3 1222 GLY n 
3 1223 ILE n 
3 1224 VAL n 
3 1225 ALA n 
3 1226 ALA n 
3 1227 GLN n 
3 1228 SER n 
3 1229 ILE n 
3 1230 GLY n 
3 1231 GLU n 
3 1232 PRO n 
3 1233 GLY n 
3 1234 THR n 
3 1235 GLN n 
3 1236 LEU n 
3 1237 THR n 
3 1238 MET n 
3 1239 ARG n 
3 1240 THR n 
3 1241 PHE n 
3 1242 HIS n 
3 1243 THR n 
3 1244 GLY n 
3 1245 GLY n 
3 1246 VAL n 
3 1247 ALA n 
3 1248 GLY n 
3 1249 ALA n 
3 1250 ALA n 
3 1251 ASP n 
3 1252 ILE n 
3 1253 THR n 
3 1254 GLN n 
3 1255 GLY n 
3 1256 LEU n 
3 1257 PRO n 
3 1258 ARG n 
3 1259 VAL n 
3 1260 ILE n 
3 1261 GLU n 
3 1262 LEU n 
3 1263 PHE n 
3 1264 GLU n 
3 1265 ALA n 
3 1266 ARG n 
3 1267 ARG n 
3 1268 PRO n 
3 1269 LYS n 
3 1270 ALA n 
3 1271 LYS n 
3 1272 ALA n 
3 1273 VAL n 
3 1274 ILE n 
3 1275 SER n 
3 1276 GLU n 
3 1277 ILE n 
3 1278 ASP n 
3 1279 GLY n 
3 1280 VAL n 
3 1281 VAL n 
3 1282 ARG n 
3 1283 ILE n 
3 1284 GLU n 
3 1285 GLU n 
3 1286 THR n 
3 1287 GLU n 
3 1288 GLU n 
3 1289 LYS n 
3 1290 LEU n 
3 1291 SER n 
3 1292 VAL n 
3 1293 PHE n 
3 1294 VAL n 
3 1295 GLU n 
3 1296 SER n 
3 1297 GLU n 
3 1298 GLY n 
3 1299 PHE n 
3 1300 SER n 
3 1301 LYS n 
3 1302 GLU n 
3 1303 TYR n 
3 1304 LYS n 
3 1305 LEU n 
3 1306 PRO n 
3 1307 LYS n 
3 1308 GLU n 
3 1309 ALA n 
3 1310 ARG n 
3 1311 LEU n 
3 1312 LEU n 
3 1313 VAL n 
3 1314 LYS n 
3 1315 ASP n 
3 1316 GLY n 
3 1317 ASP n 
3 1318 TYR n 
3 1319 VAL n 
3 1320 GLU n 
3 1321 ALA n 
3 1322 GLY n 
3 1323 GLN n 
3 1324 PRO n 
3 1325 LEU n 
3 1326 THR n 
3 1327 ARG n 
3 1328 GLY n 
3 1329 ALA n 
3 1330 ILE n 
3 1331 ASP n 
3 1332 PRO n 
3 1333 HIS n 
3 1334 GLN n 
3 1335 LEU n 
3 1336 LEU n 
3 1337 GLU n 
3 1338 ALA n 
3 1339 LYS n 
3 1340 GLY n 
3 1341 PRO n 
3 1342 GLU n 
3 1343 ALA n 
3 1344 VAL n 
3 1345 GLU n 
3 1346 ARG n 
3 1347 TYR n 
3 1348 LEU n 
3 1349 VAL n 
3 1350 GLU n 
3 1351 GLU n 
3 1352 ILE n 
3 1353 GLN n 
3 1354 LYS n 
3 1355 VAL n 
3 1356 TYR n 
3 1357 ARG n 
3 1358 ALA n 
3 1359 GLN n 
3 1360 GLY n 
3 1361 VAL n 
3 1362 LYS n 
3 1363 LEU n 
3 1364 HIS n 
3 1365 ASP n 
3 1366 LYS n 
3 1367 HIS n 
3 1368 ILE n 
3 1369 GLU n 
3 1370 ILE n 
3 1371 VAL n 
3 1372 VAL n 
3 1373 ARG n 
3 1374 GLN n 
3 1375 MET n 
3 1376 MET n 
3 1377 LYS n 
3 1378 TYR n 
3 1379 VAL n 
3 1380 GLU n 
3 1381 VAL n 
3 1382 THR n 
3 1383 ASP n 
3 1384 PRO n 
3 1385 GLY n 
3 1386 ASP n 
3 1387 SER n 
3 1388 ARG n 
3 1389 LEU n 
3 1390 LEU n 
3 1391 GLU n 
3 1392 GLY n 
3 1393 GLN n 
3 1394 VAL n 
3 1395 LEU n 
3 1396 GLU n 
3 1397 LYS n 
3 1398 TRP n 
3 1399 ASP n 
3 1400 VAL n 
3 1401 GLU n 
3 1402 ALA n 
3 1403 LEU n 
3 1404 ASN n 
3 1405 GLU n 
3 1406 ARG n 
3 1407 LEU n 
3 1408 ILE n 
3 1409 ALA n 
3 1410 GLU n 
3 1411 GLY n 
3 1412 LYS n 
3 1413 THR n 
3 1414 PRO n 
3 1415 VAL n 
3 1416 ALA n 
3 1417 TRP n 
3 1418 LYS n 
3 1419 PRO n 
3 1420 LEU n 
3 1421 LEU n 
3 1422 MET n 
3 1423 GLY n 
3 1424 VAL n 
3 1425 THR n 
3 1426 LYS n 
3 1427 SER n 
3 1428 ALA n 
3 1429 LEU n 
3 1430 SER n 
3 1431 THR n 
3 1432 LYS n 
3 1433 SER n 
3 1434 TRP n 
3 1435 LEU n 
3 1436 SER n 
3 1437 ALA n 
3 1438 ALA n 
3 1439 SER n 
3 1440 PHE n 
3 1441 GLN n 
3 1442 ASN n 
3 1443 THR n 
3 1444 THR n 
3 1445 HIS n 
3 1446 VAL n 
3 1447 LEU n 
3 1448 THR n 
3 1449 GLU n 
3 1450 ALA n 
3 1451 ALA n 
3 1452 ILE n 
3 1453 ALA n 
3 1454 GLY n 
3 1455 LYS n 
3 1456 LYS n 
3 1457 ASP n 
3 1458 GLU n 
3 1459 LEU n 
3 1460 ILE n 
3 1461 GLY n 
3 1462 LEU n 
3 1463 LYS n 
3 1464 GLU n 
3 1465 ASN n 
3 1466 VAL n 
3 1467 ILE n 
3 1468 LEU n 
3 1469 GLY n 
3 1470 ARG n 
3 1471 LEU n 
3 1472 ILE n 
3 1473 PRO n 
3 1474 ALA n 
3 1475 GLY n 
3 1476 THR n 
3 1477 GLY n 
3 1478 SER n 
3 1479 ASP n 
3 1480 PHE n 
3 1481 VAL n 
3 1482 ARG n 
3 1483 PHE n 
3 1484 THR n 
3 1485 GLN n 
3 1486 VAL n 
3 1487 VAL n 
3 1488 ASP n 
3 1489 GLN n 
3 1490 LYS n 
3 1491 THR n 
3 1492 LEU n 
3 1493 LYS n 
3 1494 ALA n 
3 1495 ILE n 
3 1496 GLU n 
3 1497 GLU n 
3 1498 ALA n 
3 1499 ARG n 
3 1500 LYS n 
3 1501 GLU n 
3 1502 ALA n 
3 1503 VAL n 
3 1504 GLU n 
3 1505 ALA n 
3 1506 LYS n 
3 1507 GLU n 
3 1508 ARG n 
3 1509 PRO n 
3 1510 ALA n 
3 1511 ALA n 
3 1512 ARG n 
3 1513 ARG n 
3 1514 GLY n 
3 1515 VAL n 
3 1516 LYS n 
3 1517 ARG n 
3 1518 GLU n 
3 1519 GLN n 
3 1520 PRO n 
3 1521 GLY n 
3 1522 LYS n 
3 1523 GLN n 
3 1524 ALA n 
4 1    MET n 
4 2    ALA n 
4 3    GLU n 
4 4    PRO n 
4 5    GLY n 
4 6    ILE n 
4 7    ASP n 
4 8    LYS n 
4 9    LEU n 
4 10   PHE n 
4 11   GLY n 
4 12   MET n 
4 13   VAL n 
4 14   ASP n 
4 15   SER n 
4 16   LYS n 
4 17   TYR n 
4 18   ARG n 
4 19   LEU n 
4 20   THR n 
4 21   VAL n 
4 22   VAL n 
4 23   VAL n 
4 24   ALA n 
4 25   LYS n 
4 26   ARG n 
4 27   ALA n 
4 28   GLN n 
4 29   GLN n 
4 30   LEU n 
4 31   LEU n 
4 32   ARG n 
4 33   HIS n 
4 34   GLY n 
4 35   PHE n 
4 36   LYS n 
4 37   ASN n 
4 38   THR n 
4 39   VAL n 
4 40   LEU n 
4 41   GLU n 
4 42   PRO n 
4 43   GLU n 
4 44   GLU n 
4 45   ARG n 
4 46   PRO n 
4 47   LYS n 
4 48   MET n 
4 49   GLN n 
4 50   THR n 
4 51   LEU n 
4 52   GLU n 
4 53   GLY n 
4 54   LEU n 
4 55   PHE n 
4 56   ASP n 
4 57   ASP n 
4 58   PRO n 
4 59   ASN n 
4 60   ALA n 
4 61   VAL n 
4 62   THR n 
4 63   TRP n 
4 64   ALA n 
4 65   MET n 
4 66   LYS n 
4 67   GLU n 
4 68   LEU n 
4 69   LEU n 
4 70   THR n 
4 71   GLY n 
4 72   ARG n 
4 73   LEU n 
4 74   VAL n 
4 75   PHE n 
4 76   GLY n 
4 77   GLU n 
4 78   ASN n 
4 79   LEU n 
4 80   VAL n 
4 81   PRO n 
4 82   GLU n 
4 83   ASP n 
4 84   ARG n 
4 85   LEU n 
4 86   GLN n 
4 87   LYS n 
4 88   GLU n 
4 89   MET n 
4 90   GLU n 
4 91   ARG n 
4 92   LEU n 
4 93   TYR n 
4 94   PRO n 
4 95   VAL n 
4 96   GLU n 
4 97   ARG n 
4 98   GLU n 
4 99   GLU n 
5 1    G   n 
5 2    C   n 
5 3    A   n 
5 4    U   n 
5 5    U   n 
5 6    C   n 
5 7    A   n 
5 8    A   n 
5 9    A   n 
5 10   G   n 
5 11   C   n 
5 12   G   n 
5 13   G   n 
5 14   A   n 
5 15   G   n 
5 16   A   n 
5 17   G   n 
5 18   G   n 
5 19   U   n 
5 20   A   n 
6 1    DC  n 
6 2    DG  n 
6 3    DA  n 
6 4    DA  n 
6 5    DA  n 
6 6    DA  n 
6 7    DG  n 
6 8    DA  n 
6 9    DA  n 
6 10   DG  n 
6 11   DC  n 
6 12   DT  n 
6 13   DT  n 
6 14   DT  n 
6 15   DG  n 
6 16   DC  n 
6 17   DT  n 
6 18   DT  n 
6 19   DA  n 
6 20   DA  n 
6 21   DT  n 
6 22   DA  n 
6 23   DA  n 
6 24   DT  n 
6 25   DC  n 
6 26   DC  n 
6 27   DA  n 
6 28   DT  n 
6 29   DA  n 
6 30   DT  n 
6 31   DG  n 
6 32   DG  n 
6 33   DT  n 
6 34   DT  n 
6 35   DG  n 
6 36   DG  n 
6 37   DG  n 
6 38   DC  n 
6 39   DT  n 
6 40   DA  n 
6 41   DC  n 
6 42   DC  n 
6 43   DT  n 
6 44   DC  n 
6 45   DT  n 
6 46   DC  n 
6 47   DC  n 
6 48   DA  n 
6 49   DT  n 
6 50   DG  n 
6 51   DA  n 
6 52   DC  n 
6 53   DG  n 
6 54   DG  n 
6 55   DC  n 
6 56   DG  n 
6 57   DA  n 
6 58   DA  n 
6 59   DT  n 
6 60   DA  n 
6 61   DC  n 
6 62   DC  n 
6 63   DC  n 
7 1    DG  n 
7 2    DG  n 
7 3    DG  n 
7 4    DT  n 
7 5    DA  n 
7 6    DT  n 
7 7    DT  n 
7 8    DC  n 
7 9    DG  n 
7 10   DC  n 
7 11   DC  n 
7 12   DG  n 
7 13   DT  n 
7 14   DG  n 
7 15   DT  n 
7 16   DA  n 
7 17   DC  n 
7 18   DC  n 
7 19   DT  n 
7 20   DC  n 
7 21   DT  n 
7 22   DC  n 
7 23   DC  n 
7 24   DT  n 
7 25   DA  n 
7 26   DG  n 
7 27   DC  n 
7 28   DC  n 
7 29   DC  n 
7 30   DA  n 
7 31   DA  n 
7 32   DC  n 
7 33   DC  n 
7 34   DA  n 
7 35   DT  n 
7 36   DA  n 
7 37   DT  n 
7 38   DG  n 
7 39   DG  n 
7 40   DA  n 
7 41   DT  n 
7 42   DT  n 
7 43   DA  n 
7 44   DT  n 
7 45   DT  n 
7 46   DA  n 
7 47   DA  n 
7 48   DG  n 
7 49   DC  n 
7 50   DA  n 
7 51   DA  n 
7 52   DA  n 
7 53   DG  n 
7 54   DC  n 
7 55   DT  n 
7 56   DT  n 
7 57   DC  n 
7 58   DT  n 
7 59   DT  n 
7 60   DT  n 
7 61   DT  n 
7 62   DC  n 
7 63   DG  n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample 1 315  ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
2 1 sample 1 1119 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
3 1 sample 1 1524 ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
4 1 sample 1 99   ? 'Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)' 300852 ? ? 'HB8 / ATCC 27634 / DSM 579' ? ? ? ? ? ? 
? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
5 1 sample 1 20 'Thermus thermophilus' ? 274 ? 
6 1 sample 1 63 'Thermus thermophilus' ? 274 ? 
7 1 sample 1 63 'Thermus thermophilus' ? 274 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP RPOA_THET8 Q5SHR6 ? 1 
;MLDSKLKAPVFTVRTQGREYGEFVLEPLERGFGVTLGNPLRRILLSSIPGTAVTSVYIEDVLHEFSTIPGVKEDVVEIIL
NLKELVVRFLNPSLQTVTLLLKAEGPKEVKARDFLPVADVEIMNPDLHIATLEEGGRLNMEVRVDRGVGYVPAEKHGIKD
RINAIPVDAVFSPVRRVAFQVEDTRLGQRTDLDKLTLRIWTDGSVTPLEALNQAVEILREHLTYFSNPQAAAVAAPEEAK
EPEAPPEQEEELDLPLEELGLSTRVLHSLKEEGIESVRALLALNLKDLKNIPGIGERSLEEIKEALEKKGFTLKE
;
1 
2 UNP RPOB_THET8 Q8RQE9 ? 2 
;MEIKRFGRIREVIPLPPLTEIQVESYRRALQADVPPEKRENVGIQAAFRETFPIEEEDKGKGGLVLDFLEYRLGEPPFPQ
DECREKDLTYQAPLYARLQLIHKDTGLIKEDEVFLGHIPLMTEDGSFIINGADRVIVSQIHRSPGVYFTPDPARPGRYIA
SIIPLPKRGPWIDLEVEPNGVVSMKVNKRKFPLVLLLRVLGYDQETLARELGAYGELVQGLMDESVFAMRPEEALIRLFT
LLRPGDPPKRDKAVAYVYGLIADPRRYDLGEAGRYKAEEKLGIRLSGRTLARFEDGEFKDEVFLPTLRYLFALTAGVPGH
EVDDIDHLGNRRIRTVGELMTDQFRVGLARLARGVRERMLMGSEDSLTPAKLVNSRPLEAAIREFFSRSQLSQFKDETNP
LSSLRHKRRISALGPGGLTRERAGFDVRDVHRTHYGRICPVETPEGANIGLITSLAAYARVDELGFIRTPYRRVVGGVVT
DEVVYMTATEEDRYTIAQANTPLEGNRIAAERVVARRKGEPVIVSPEEVEFMDVSPKQVFSVNTNLIPFLEHDDANRALM
GSNMQTQAVPLIRAQAPVVMTGLEERVVRDSLAALYAEEDGEVAKVDGNRIVVRYEDGRLVEYPLRRFYRSNQGTALDQR
PRVVVGQRVRKGDLLADGPASENGFLALGQNVLVAIMPFDGYNFEDAIVISEELLKRDFYTSIHIERYEIEARDTKLGPE
RITRDIPHLSEAALRDLDEEGVVRIGAEVKPGDILVGRTSFKGESEPTPEERLLRSIFGEKARDVKDTSLRVPPGEGGIV
VRTVRLRRGDPGVELKPGVREVVRVYVAQKRKLQVGDKLANRHGNKGVVAKILPVEDMPHLPDGTPVDVILNPLGVPSRM
NLGQILETHLGLAGYFLGQRYISPIFDGAKEPEIKELLAQAFEVYFGKRKGEGFGVDKREVEVLRRAEKLGLVTPGKTPE
EQLKELFLQGKVVLYDGRTGEPIEGPIVVGQMFIMKLYHMVEDKMHARSTGPYSLITQQPLGGKAQFGGQRFGEMEVWAL
EAYGAAHTLQEMLTLKSDDIEGRNAAYEAIIKGEDVPEPSVPESFRVLVKELQALALDVQTLDEKDNPVDIFEGLASKR
;
1 
3 UNP RPOC_THET8 Q8RQE8 ? 3 
;MKKEVRKVRIALASPEKIRSWSYGEVEKPETINYRTLKPERDGLFDERIFGPIKDYECACGKYKRQRFEGKVCERCGVEV
TKSIVRRYRMGHIELATPAAHIWFVKDVPSKIGTLLDLSATELEQVLYFSKYIVLDPKGAILNGVPVEKRQLLTDEEYRE
LRYGKQETYPLPPGVDALVKDGEEVVKGQELAPGVVSRLDGVALYRFPRRVRVEYVKKERAGLRLPLAAWVEKEAYKPGE
ILAELPEPYLFRAEEEGVVELKELEEGAFLVLRREDEPVATYFLPVGMTPLVVHGEIVEKGQPLAEAKGLLRMPRQVRAA
QVEAEEEGETVYLTLFLEWTEPKDYRVQPHMNVVVPEGARVEAGDKIVAAIDPEEEVIAEAEGVVHLHEPASILVVKARV
YPFEDDVEVSTGDRVAPGDVLADGGKVKSDVYGRVEVDLVRNVVRVVESYDIDARMGAEAIQQLLKELDLEALEKELLEE
MKHPSRARRAKARKRLEVVRAFLDSGNRPEWMILEAVPVLPPDLRPMVQVDGGRFATSDLNDLYRRLINRNNRLKKLLAQ
GAPEIIIRNEKRMLQEAVDALLDNGRRGAPVTNPGSDRPLRSLTDILSGKQGRFRQNLLGKRVDYSGRSVIVVGPQLKLH
QCGLPKRMALELFKPFLLKKMEEKGIAPNVKAARRMLERQRDIKDEVWDALEEVIHGKVVLLNRAPTLHRLGIQAFQPVL
VEGQSIQLHPLVCEAFNADFDGDQMAVHVPLSSFAQAEARIQMLSAHNLLSPASGEPLAKPSRDIILGLYYITQVRKEKK
GAGLEFATPEEALAAHERGEVALNAPIKVAGRETSVGRLKYVFANPDEALLAVAHGIVDLQDVVTVRYMGKRLETSPGRI
LFARIVAEAVEDEKVAWELIQLDVPQEKNSLKDLVYQAFLRLGMEKTARLLDALKYYGFTFSTTSGITIGIDDAVIPEEK
KQYLEEADRKLLQIEQAYEMGFLTDRERYDQILQLWTETTEKVTQAVFKNFEENYPFNPLYVMAQSGARGNPQQIRQLCG
LRGLMQKPSGETFEVPVRSSFREGLTVLEYFISSHGARKGGADTALRTADSGYLTRKLVDVTHEIVVREADCGTTNYISV
PLFQPDEVTRSLRLRKRADIEAGLYGRVLAREVEVLGVRLEEGRYLSMDDVHLLIKAAEAGEIQEVPVRSPLTCQTRYGV
CQKCYGYDLSMARPVSIGEAVGIVAAQSIGEPGTQLTMRTFHTGGVAGAADITQGLPRVIELFEARRPKAKAVISEIDGV
VRIEETEEKLSVFVESEGFSKEYKLPKEARLLVKDGDYVEAGQPLTRGAIDPHQLLEAKGPEAVERYLVEEIQKVYRAQG
VKLHDKHIEIVVRQMMKYVEVTDPGDSRLLEGQVLEKWDVEALNERLIAEGKTPVAWKPLLMGVTKSALSTKSWLSAASF
QNTTHVLTEAAIAGKKDELIGLKENVILGRLIPAGTGSDFVRFTQVVDQKTLKAIEEARKEAVEAKERPAARRGVKREQP
GKQA
;
1 
4 UNP RPOZ_THET8 Q8RQE7 ? 4 
;MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHGFKNTVLEPEERPKMQTLEGLFDDPNAVTWAMKELLTGRLVFGENLV
PEDRLQKEMERLYPVEREE
;
1 
5 PDB 6M6C       6M6C   ? 5 ? 1 
6 PDB 6M6C       6M6C   ? 6 ? 1 
7 PDB 6M6C       6M6C   ? 7 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6M6C A 1 ? 315  ? Q5SHR6 1   ? 315  ? 1   315  
2 1 6M6C B 1 ? 315  ? Q5SHR6 1   ? 315  ? 1   315  
3 2 6M6C C 1 ? 1119 ? Q8RQE9 1   ? 1119 ? 1   1119 
4 3 6M6C D 1 ? 1524 ? Q8RQE8 1   ? 1524 ? 1   1524 
5 4 6M6C E 1 ? 99   ? Q8RQE7 1   ? 99   ? 1   99   
6 5 6M6C R 1 ? 20   ? 6M6C   1   ? 20   ? 1   20   
7 6 6M6C N 1 ? 63   ? 6M6C   -33 ? 29   ? -33 29   
8 7 6M6C T 1 ? 63   ? 6M6C   1   ? 63   ? 1   63   
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"          ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE"         ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"           ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ? 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6M6C 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6M6C 
_struct.title                        'CryoEM structure of Thermus thermophilus RNA polymerase elongation complex' 
_struct.pdbx_descriptor              
;DNA-directed RNA polymerase subunit alpha, DNA-directed RNA polymerase subunit beta, DNA-directed RNA polymerase subunit beta', DNA-directed RNA polymerase subunit omega/RNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6M6C 
_struct_keywords.text            'Transcription, RNA polymerase' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
G N N 6 ? 
H N N 7 ? 
I N N 8 ? 
J N N 8 ? 
K N N 9 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   AA1 GLY A 31   ? SER A 47   ? GLY A 31   SER A 47   1 ? 17 
HELX_P HELX_P2   AA2 ASP A 74   ? LYS A 83   ? ASP A 74   LYS A 83   1 ? 10 
HELX_P HELX_P3   AA3 ARG A 112  ? PHE A 114  ? ARG A 112  PHE A 114  5 ? 3  
HELX_P HELX_P4   AA4 PRO A 152  ? GLY A 157  ? PRO A 152  GLY A 157  1 ? 6  
HELX_P HELX_P5   AA5 THR A 206  ? TYR A 224  ? THR A 206  TYR A 224  1 ? 19 
HELX_P HELX_P6   AA6 GLY B 31   ? ILE B 48   ? GLY B 31   ILE B 48   1 ? 18 
HELX_P HELX_P7   AA7 ASP B 74   ? GLU B 84   ? ASP B 74   GLU B 84   1 ? 11 
HELX_P HELX_P8   AA8 ARG B 112  ? PHE B 114  ? ARG B 112  PHE B 114  5 ? 3  
HELX_P HELX_P9   AA9 PRO B 152  ? GLY B 157  ? PRO B 152  GLY B 157  1 ? 6  
HELX_P HELX_P10  AB1 THR B 206  ? THR B 223  ? THR B 206  THR B 223  1 ? 18 
HELX_P HELX_P11  AB2 TYR B 224  ? SER B 226  ? TYR B 224  SER B 226  5 ? 3  
HELX_P HELX_P12  AB3 THR C 19   ? GLN C 31   ? THR C 19   GLN C 31   1 ? 13 
HELX_P HELX_P13  AB4 PRO C 35   ? ARG C 39   ? PRO C 35   ARG C 39   5 ? 5  
HELX_P HELX_P14  AB5 GLY C 43   ? PHE C 52   ? GLY C 43   PHE C 52   1 ? 10 
HELX_P HELX_P15  AB6 PRO C 79   ? ASP C 87   ? PRO C 79   ASP C 87   1 ? 9  
HELX_P HELX_P16  AB7 LEU C 193  ? LEU C 200  ? LEU C 193  LEU C 200  1 ? 8  
HELX_P HELX_P17  AB8 ASP C 203  ? GLY C 212  ? ASP C 203  GLY C 212  1 ? 10 
HELX_P HELX_P18  AB9 TYR C 214  ? MET C 222  ? TYR C 214  MET C 222  1 ? 9  
HELX_P HELX_P19  AC1 ASP C 223  ? MET C 229  ? ASP C 223  MET C 229  1 ? 7  
HELX_P HELX_P20  AC2 ARG C 230  ? ARG C 243  ? ARG C 230  ARG C 243  1 ? 14 
HELX_P HELX_P21  AC3 LYS C 249  ? ILE C 261  ? LYS C 249  ILE C 261  1 ? 13 
HELX_P HELX_P22  AC4 GLY C 270  ? GLY C 282  ? GLY C 270  GLY C 282  1 ? 13 
HELX_P HELX_P23  AC5 VAL C 302  ? GLY C 316  ? VAL C 302  GLY C 316  1 ? 15 
HELX_P HELX_P24  AC6 THR C 335  ? MET C 359  ? THR C 335  MET C 359  1 ? 25 
HELX_P HELX_P25  AC7 THR C 368  ? VAL C 373  ? THR C 368  VAL C 373  1 ? 6  
HELX_P HELX_P26  AC8 SER C 375  ? SER C 389  ? SER C 375  SER C 389  1 ? 15 
HELX_P HELX_P27  AC9 ASN C 399  ? LYS C 407  ? ASN C 399  LYS C 407  1 ? 9  
HELX_P HELX_P28  AD1 GLY C 424  ? ASP C 429  ? GLY C 424  ASP C 429  1 ? 6  
HELX_P HELX_P29  AD2 HIS C 431  ? TYR C 435  ? HIS C 431  TYR C 435  5 ? 5  
HELX_P HELX_P30  AD3 THR C 487  ? ASP C 492  ? THR C 487  ASP C 492  1 ? 6  
HELX_P HELX_P31  AD4 SER C 525  ? VAL C 529  ? SER C 525  VAL C 529  5 ? 5  
HELX_P HELX_P32  AD5 SER C 535  ? PHE C 540  ? SER C 535  PHE C 540  5 ? 6  
HELX_P HELX_P33  AD6 ASN C 543  ? ILE C 547  ? ASN C 543  ILE C 547  5 ? 5  
HELX_P HELX_P34  AD7 PHE C 549  ? ASP C 553  ? PHE C 549  ASP C 553  5 ? 5  
HELX_P HELX_P35  AD8 ASP C 554  ? GLN C 565  ? ASP C 554  GLN C 565  1 ? 12 
HELX_P HELX_P36  AD9 THR C 566  ? ALA C 568  ? THR C 566  ALA C 568  5 ? 3  
HELX_P HELX_P37  AE1 LEU C 583  ? SER C 591  ? LEU C 583  SER C 591  1 ? 9  
HELX_P HELX_P38  AE2 GLU C 692  ? ARG C 697  ? GLU C 692  ARG C 697  1 ? 6  
HELX_P HELX_P39  AE3 SER C 730  ? ARG C 735  ? SER C 730  ARG C 735  5 ? 6  
HELX_P HELX_P40  AE4 THR C 768  ? GLY C 779  ? THR C 768  GLY C 779  1 ? 12 
HELX_P HELX_P41  AE5 PRO C 854  ? MET C 858  ? PRO C 854  MET C 858  5 ? 5  
HELX_P HELX_P42  AE6 ASN C 872  ? LEU C 874  ? ASN C 872  LEU C 874  5 ? 3  
HELX_P HELX_P43  AE7 GLY C 875  ? MET C 880  ? GLY C 875  MET C 880  1 ? 6  
HELX_P HELX_P44  AE8 LEU C 882  ? GLY C 898  ? LEU C 882  GLY C 898  1 ? 17 
HELX_P HELX_P45  AE9 LYS C 910  ? GLU C 932  ? LYS C 910  GLU C 932  1 ? 23 
HELX_P HELX_P46  AF1 ASP C 937  ? LYS C 949  ? ASP C 937  LYS C 949  1 ? 13 
HELX_P HELX_P47  AF2 THR C 958  ? LEU C 968  ? THR C 958  LEU C 968  1 ? 11 
HELX_P HELX_P48  AF3 MET C 1000 ? LYS C 1004 ? MET C 1000 LYS C 1004 5 ? 5  
HELX_P HELX_P49  AF4 GLY C 1033 ? TYR C 1043 ? GLY C 1033 TYR C 1043 1 ? 11 
HELX_P HELX_P50  AF5 ALA C 1045 ? THR C 1054 ? ALA C 1045 THR C 1054 1 ? 10 
HELX_P HELX_P51  AF6 ASP C 1059 ? GLY C 1073 ? ASP C 1059 GLY C 1073 1 ? 15 
HELX_P HELX_P52  AF7 PRO C 1082 ? ALA C 1094 ? PRO C 1082 ALA C 1094 1 ? 13 
HELX_P HELX_P53  AF8 SER D 14   ? TRP D 21   ? SER D 14   TRP D 21   1 ? 8  
HELX_P HELX_P54  AF9 ASP D 46   ? GLY D 51   ? ASP D 46   GLY D 51   1 ? 6  
HELX_P HELX_P55  AG1 LYS D 82   ? TYR D 88   ? LYS D 82   TYR D 88   5 ? 7  
HELX_P HELX_P56  AG2 ILE D 102  ? ASP D 107  ? ILE D 102  ASP D 107  1 ? 6  
HELX_P HELX_P57  AG3 SER D 110  ? ASP D 117  ? SER D 110  ASP D 117  1 ? 8  
HELX_P HELX_P58  AG4 SER D 119  ? TYR D 128  ? SER D 119  TYR D 128  1 ? 10 
HELX_P HELX_P59  AG5 THR D 154  ? TYR D 163  ? THR D 154  TYR D 163  1 ? 10 
HELX_P HELX_P60  AG6 ASP D 423  ? LYS D 426  ? ASP D 423  LYS D 426  5 ? 4  
HELX_P HELX_P61  AG7 GLY D 457  ? GLU D 467  ? GLY D 457  GLU D 467  1 ? 11 
HELX_P HELX_P62  AG8 ASP D 469  ? MET D 481  ? ASP D 469  MET D 481  1 ? 13 
HELX_P HELX_P63  AG9 SER D 485  ? GLY D 506  ? SER D 485  GLY D 506  1 ? 22 
HELX_P HELX_P64  AH1 ARG D 508  ? TRP D 511  ? ARG D 508  TRP D 511  5 ? 4  
HELX_P HELX_P65  AH2 PRO D 521  ? ARG D 525  ? PRO D 521  ARG D 525  5 ? 5  
HELX_P HELX_P66  AH3 SER D 538  ? GLY D 561  ? SER D 538  GLY D 561  1 ? 24 
HELX_P HELX_P67  AH4 PRO D 563  ? ASP D 583  ? PRO D 563  ASP D 583  1 ? 21 
HELX_P HELX_P68  AH5 SER D 602  ? SER D 608  ? SER D 602  SER D 608  1 ? 7  
HELX_P HELX_P69  AH6 GLY D 612  ? LEU D 618  ? GLY D 612  LEU D 618  1 ? 7  
HELX_P HELX_P70  AH7 LYS D 646  ? PHE D 653  ? LYS D 646  PHE D 653  1 ? 8  
HELX_P HELX_P71  AH8 PHE D 653  ? LYS D 664  ? PHE D 653  LYS D 664  1 ? 12 
HELX_P HELX_P72  AH9 ASN D 669  ? GLU D 678  ? ASN D 669  GLU D 678  1 ? 10 
HELX_P HELX_P73  AI1 ARG D 679  ? ILE D 683  ? ARG D 679  ILE D 683  5 ? 5  
HELX_P HELX_P74  AI2 ASP D 685  ? ILE D 695  ? ASP D 685  ILE D 695  1 ? 11 
HELX_P HELX_P75  AI3 HIS D 709  ? LEU D 711  ? HIS D 709  LEU D 711  5 ? 3  
HELX_P HELX_P76  AI4 VAL D 732  ? ASN D 737  ? VAL D 732  ASN D 737  1 ? 6  
HELX_P HELX_P77  AI5 SER D 752  ? GLN D 762  ? SER D 752  GLN D 762  1 ? 11 
HELX_P HELX_P78  AI6 LEU D 764  ? ASN D 768  ? LEU D 764  ASN D 768  5 ? 5  
HELX_P HELX_P79  AI7 SER D 782  ? THR D 793  ? SER D 782  THR D 793  1 ? 12 
HELX_P HELX_P80  AI8 THR D 808  ? GLY D 819  ? THR D 808  GLY D 819  1 ? 12 
HELX_P HELX_P81  AI9 VAL D 836  ? TYR D 841  ? VAL D 836  TYR D 841  1 ? 6  
HELX_P HELX_P82  AJ1 ASN D 845  ? HIS D 855  ? ASN D 845  HIS D 855  1 ? 11 
HELX_P HELX_P83  AJ2 SER D 876  ? GLU D 891  ? SER D 876  GLU D 891  1 ? 16 
HELX_P HELX_P84  AJ3 ASP D 892  ? ILE D 900  ? ASP D 892  ILE D 900  1 ? 9  
HELX_P HELX_P85  AJ4 GLU D 907  ? GLY D 923  ? GLU D 907  GLY D 923  1 ? 17 
HELX_P HELX_P86  AJ5 GLY D 923  ? THR D 944  ? GLY D 923  THR D 944  1 ? 22 
HELX_P HELX_P87  AJ6 GLY D 950  ? ALA D 954  ? GLY D 950  ALA D 954  5 ? 5  
HELX_P HELX_P88  AJ7 GLU D 958  ? MET D 980  ? GLU D 958  MET D 980  1 ? 23 
HELX_P HELX_P89  AJ8 THR D 984  ? TYR D 1015 ? THR D 984  TYR D 1015 1 ? 32 
HELX_P HELX_P90  AJ9 ASN D 1018 ? SER D 1026 ? ASN D 1018 SER D 1026 1 ? 9  
HELX_P HELX_P91  AK1 ASN D 1031 ? GLY D 1040 ? ASN D 1031 GLY D 1040 1 ? 10 
HELX_P HELX_P92  AK2 THR D 1066 ? THR D 1102 ? THR D 1066 THR D 1102 1 ? 37 
HELX_P HELX_P93  AK3 LYS D 1136 ? TYR D 1145 ? LYS D 1136 TYR D 1145 1 ? 10 
HELX_P HELX_P94  AK4 SER D 1167 ? GLU D 1179 ? SER D 1167 GLU D 1179 1 ? 13 
HELX_P HELX_P95  AK5 GLN D 1202 ? GLY D 1206 ? GLN D 1202 GLY D 1206 1 ? 5  
HELX_P HELX_P96  AK6 ALA D 1220 ? GLU D 1231 ? ALA D 1220 GLU D 1231 1 ? 12 
HELX_P HELX_P97  AK7 PRO D 1232 ? LEU D 1236 ? PRO D 1232 LEU D 1236 5 ? 5  
HELX_P HELX_P98  AK8 GLY D 1255 ? GLU D 1264 ? GLY D 1255 GLU D 1264 1 ? 10 
HELX_P HELX_P99  AK9 ASP D 1331 ? GLY D 1340 ? ASP D 1331 GLY D 1340 1 ? 10 
HELX_P HELX_P100 AL1 GLY D 1340 ? GLN D 1359 ? GLY D 1340 GLN D 1359 1 ? 20 
HELX_P HELX_P101 AL2 HIS D 1364 ? MET D 1376 ? HIS D 1364 MET D 1376 1 ? 13 
HELX_P HELX_P102 AL3 LYS D 1397 ? ILE D 1408 ? LYS D 1397 ILE D 1408 1 ? 12 
HELX_P HELX_P103 AL4 GLY D 1423 ? SER D 1430 ? GLY D 1423 SER D 1430 1 ? 8  
HELX_P HELX_P104 AL5 SER D 1433 ? GLN D 1441 ? SER D 1433 GLN D 1441 1 ? 9  
HELX_P HELX_P105 AL6 ASN D 1442 ? GLY D 1454 ? ASN D 1442 GLY D 1454 1 ? 13 
HELX_P HELX_P106 AL7 LEU D 1462 ? LEU D 1468 ? LEU D 1462 LEU D 1468 1 ? 7  
HELX_P HELX_P107 AL8 ALA D 1474 ? SER D 1478 ? ALA D 1474 SER D 1478 5 ? 5  
HELX_P HELX_P108 AL9 GLN D 1489 ? GLU D 1501 ? GLN D 1489 GLU D 1501 1 ? 13 
HELX_P HELX_P109 AM1 GLY E 5    ? VAL E 13   ? GLY E 5    VAL E 13   1 ? 9  
HELX_P HELX_P110 AM2 SER E 15   ? HIS E 33   ? SER E 15   HIS E 33   1 ? 19 
HELX_P HELX_P111 AM3 GLU E 41   ? ARG E 45   ? GLU E 41   ARG E 45   5 ? 5  
HELX_P HELX_P112 AM4 ASN E 59   ? GLY E 71   ? ASN E 59   GLY E 71   1 ? 13 
HELX_P HELX_P113 AM5 PRO E 81   ? TYR E 93   ? PRO E 81   TYR E 93   1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? D CYS 58   SG  ? ? ? 1_555 J ZN .  ZN    ? ? D CYS 58   D ZN 2002 1_555 ? ? ? ? ? ? ?            2.374 ? ? 
metalc2  metalc ? ? D CYS 60   SG  ? ? ? 1_555 J ZN .  ZN    ? ? D CYS 60   D ZN 2002 1_555 ? ? ? ? ? ? ?            2.412 ? ? 
metalc3  metalc ? ? D CYS 73   SG  ? ? ? 1_555 J ZN .  ZN    ? ? D CYS 73   D ZN 2002 1_555 ? ? ? ? ? ? ?            2.412 ? ? 
metalc4  metalc ? ? D CYS 76   SG  ? ? ? 1_555 J ZN .  ZN    ? ? D CYS 76   D ZN 2002 1_555 ? ? ? ? ? ? ?            2.385 ? ? 
metalc5  metalc ? ? D ASP 739  OD1 ? ? ? 1_555 K MG .  MG    ? ? D ASP 739  D MG 2003 1_555 ? ? ? ? ? ? ?            2.016 ? ? 
metalc6  metalc ? ? D ASP 739  OD2 ? ? ? 1_555 K MG .  MG    ? ? D ASP 739  D MG 2003 1_555 ? ? ? ? ? ? ?            2.568 ? ? 
metalc7  metalc ? ? D ASP 741  OD1 ? ? ? 1_555 K MG .  MG    ? ? D ASP 741  D MG 2003 1_555 ? ? ? ? ? ? ?            2.080 ? ? 
metalc8  metalc ? ? D ASP 741  OD2 ? ? ? 1_555 K MG .  MG    ? ? D ASP 741  D MG 2003 1_555 ? ? ? ? ? ? ?            2.478 ? ? 
metalc9  metalc ? ? D ASP 743  OD1 ? ? ? 1_555 K MG .  MG    ? ? D ASP 743  D MG 2003 1_555 ? ? ? ? ? ? ?            2.828 ? ? 
metalc10 metalc ? ? D CYS 1112 SG  ? ? ? 1_555 I ZN .  ZN    ? ? D CYS 1112 D ZN 2001 1_555 ? ? ? ? ? ? ?            2.331 ? ? 
metalc11 metalc ? ? D CYS 1194 SG  ? ? ? 1_555 I ZN .  ZN    ? ? D CYS 1194 D ZN 2001 1_555 ? ? ? ? ? ? ?            2.337 ? ? 
metalc12 metalc ? ? D CYS 1201 SG  ? ? ? 1_555 I ZN .  ZN    ? ? D CYS 1201 D ZN 2001 1_555 ? ? ? ? ? ? ?            2.351 ? ? 
metalc13 metalc ? ? D CYS 1204 SG  ? ? ? 1_555 I ZN .  ZN    ? ? D CYS 1204 D ZN 2001 1_555 ? ? ? ? ? ? ?            2.354 ? ? 
metalc14 metalc ? ? K MG  .    MG  ? ? ? 1_555 F A  20 "O3'" ? ? D MG  2003 R A  20   1_555 ? ? ? ? ? ? ?            2.035 ? ? 
hydrog1  hydrog ? ? G DG  35   N1  ? ? ? 1_555 H DC 29 N3    ? ? N DG  1    T DC 29   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog2  hydrog ? ? G DG  35   N2  ? ? ? 1_555 H DC 29 O2    ? ? N DG  1    T DC 29   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog3  hydrog ? ? G DG  35   O6  ? ? ? 1_555 H DC 29 N4    ? ? N DG  1    T DC 29   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog4  hydrog ? ? G DG  36   N1  ? ? ? 1_555 H DC 28 N3    ? ? N DG  2    T DC 28   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog5  hydrog ? ? G DG  36   N2  ? ? ? 1_555 H DC 28 O2    ? ? N DG  2    T DC 28   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog6  hydrog ? ? G DG  36   O6  ? ? ? 1_555 H DC 28 N4    ? ? N DG  2    T DC 28   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog7  hydrog ? ? G DG  37   N1  ? ? ? 1_555 H DC 27 N3    ? ? N DG  3    T DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog8  hydrog ? ? G DG  37   N2  ? ? ? 1_555 H DC 27 O2    ? ? N DG  3    T DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog9  hydrog ? ? G DG  37   O6  ? ? ? 1_555 H DC 27 N4    ? ? N DG  3    T DC 27   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog10 hydrog ? ? G DC  38   N3  ? ? ? 1_555 H DG 26 N1    ? ? N DC  4    T DG 26   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog11 hydrog ? ? G DC  38   N4  ? ? ? 1_555 H DG 26 O6    ? ? N DC  4    T DG 26   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog12 hydrog ? ? G DC  38   O2  ? ? ? 1_555 H DG 26 N2    ? ? N DC  4    T DG 26   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog13 hydrog ? ? G DT  39   N3  ? ? ? 1_555 H DA 25 N1    ? ? N DT  5    T DA 25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog14 hydrog ? ? G DT  39   O4  ? ? ? 1_555 H DA 25 N6    ? ? N DT  5    T DA 25   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog15 hydrog ? ? G DA  40   N1  ? ? ? 1_555 H DT 24 N3    ? ? N DA  6    T DT 24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog16 hydrog ? ? G DA  40   N6  ? ? ? 1_555 H DT 24 O4    ? ? N DA  6    T DT 24   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog17 hydrog ? ? G DA  51   N1  ? ? ? 1_555 H DT 13 N3    ? ? N DA  17   T DT 13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog18 hydrog ? ? G DA  51   N6  ? ? ? 1_555 H DT 13 O4    ? ? N DA  17   T DT 13   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog19 hydrog ? ? G DC  52   N3  ? ? ? 1_555 H DG 12 N1    ? ? N DC  18   T DG 12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog20 hydrog ? ? G DC  52   N4  ? ? ? 1_555 H DG 12 O6    ? ? N DC  18   T DG 12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog21 hydrog ? ? G DC  52   O2  ? ? ? 1_555 H DG 12 N2    ? ? N DC  18   T DG 12   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog22 hydrog ? ? G DG  53   N1  ? ? ? 1_555 H DC 11 N3    ? ? N DG  19   T DC 11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog23 hydrog ? ? G DG  53   N2  ? ? ? 1_555 H DC 11 O2    ? ? N DG  19   T DC 11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog24 hydrog ? ? G DG  53   O6  ? ? ? 1_555 H DC 11 N4    ? ? N DG  19   T DC 11   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog25 hydrog ? ? G DG  54   N1  ? ? ? 1_555 H DC 10 N3    ? ? N DG  20   T DC 10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog26 hydrog ? ? G DG  54   N2  ? ? ? 1_555 H DC 10 O2    ? ? N DG  20   T DC 10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog27 hydrog ? ? G DG  54   O6  ? ? ? 1_555 H DC 10 N4    ? ? N DG  20   T DC 10   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog28 hydrog ? ? G DC  55   N3  ? ? ? 1_555 H DG 9  N1    ? ? N DC  21   T DG 9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog29 hydrog ? ? G DC  55   N4  ? ? ? 1_555 H DG 9  O6    ? ? N DC  21   T DG 9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog30 hydrog ? ? G DC  55   O2  ? ? ? 1_555 H DG 9  N2    ? ? N DC  21   T DG 9    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog31 hydrog ? ? G DG  56   N1  ? ? ? 1_555 H DC 8  N3    ? ? N DG  22   T DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog32 hydrog ? ? G DG  56   N2  ? ? ? 1_555 H DC 8  O2    ? ? N DG  22   T DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog33 hydrog ? ? G DG  56   O6  ? ? ? 1_555 H DC 8  N4    ? ? N DG  22   T DC 8    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog34 hydrog ? ? G DA  57   N1  ? ? ? 1_555 H DT 7  N3    ? ? N DA  23   T DT 7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog35 hydrog ? ? G DA  57   N6  ? ? ? 1_555 H DT 7  O4    ? ? N DA  23   T DT 7    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog36 hydrog ? ? G DA  58   N1  ? ? ? 1_555 H DT 6  N3    ? ? N DA  24   T DT 6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog37 hydrog ? ? G DA  58   N6  ? ? ? 1_555 H DT 6  O4    ? ? N DA  24   T DT 6    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog38 hydrog ? ? G DT  59   N3  ? ? ? 1_555 H DA 5  N1    ? ? N DT  25   T DA 5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog39 hydrog ? ? G DT  59   O4  ? ? ? 1_555 H DA 5  N6    ? ? N DT  25   T DA 5    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog40 hydrog ? ? G DA  60   N1  ? ? ? 1_555 H DT 4  N3    ? ? N DA  26   T DT 4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog41 hydrog ? ? G DA  60   N6  ? ? ? 1_555 H DT 4  O4    ? ? N DA  26   T DT 4    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog42 hydrog ? ? G DC  61   N3  ? ? ? 1_555 H DG 3  N1    ? ? N DC  27   T DG 3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog43 hydrog ? ? G DC  61   N4  ? ? ? 1_555 H DG 3  O6    ? ? N DC  27   T DG 3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog44 hydrog ? ? G DC  61   O2  ? ? ? 1_555 H DG 3  N2    ? ? N DC  27   T DG 3    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog45 hydrog ? ? G DC  62   N3  ? ? ? 1_555 H DG 2  N1    ? ? N DC  28   T DG 2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog46 hydrog ? ? G DC  62   N4  ? ? ? 1_555 H DG 2  O6    ? ? N DC  28   T DG 2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog47 hydrog ? ? G DC  62   O2  ? ? ? 1_555 H DG 2  N2    ? ? N DC  28   T DG 2    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog48 hydrog ? ? G DC  63   N3  ? ? ? 1_555 H DG 1  N1    ? ? N DC  29   T DG 1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog49 hydrog ? ? G DC  63   N4  ? ? ? 1_555 H DG 1  O6    ? ? N DC  29   T DG 1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog50 hydrog ? ? G DC  63   O2  ? ? ? 1_555 H DG 1  N2    ? ? N DC  29   T DG 1    1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog51 hydrog ? ? F G   12   N1  ? ? ? 1_555 H DC 23 N3    ? ? R G   12   T DC 23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog52 hydrog ? ? F G   12   N2  ? ? ? 1_555 H DC 23 O2    ? ? R G   12   T DC 23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog53 hydrog ? ? F G   12   O6  ? ? ? 1_555 H DC 23 N4    ? ? R G   12   T DC 23   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog54 hydrog ? ? F G   13   N1  ? ? ? 1_555 H DC 22 N3    ? ? R G   13   T DC 22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog55 hydrog ? ? F G   13   N2  ? ? ? 1_555 H DC 22 O2    ? ? R G   13   T DC 22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog56 hydrog ? ? F G   13   O6  ? ? ? 1_555 H DC 22 N4    ? ? R G   13   T DC 22   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog57 hydrog ? ? F A   14   N1  ? ? ? 1_555 H DT 21 N3    ? ? R A   14   T DT 21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog58 hydrog ? ? F A   14   N6  ? ? ? 1_555 H DT 21 O4    ? ? R A   14   T DT 21   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog59 hydrog ? ? F G   15   N1  ? ? ? 1_555 H DC 20 N3    ? ? R G   15   T DC 20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog60 hydrog ? ? F G   15   N2  ? ? ? 1_555 H DC 20 O2    ? ? R G   15   T DC 20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog61 hydrog ? ? F G   15   O6  ? ? ? 1_555 H DC 20 N4    ? ? R G   15   T DC 20   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog62 hydrog ? ? F A   16   N1  ? ? ? 1_555 H DT 19 N3    ? ? R A   16   T DT 19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog63 hydrog ? ? F A   16   N6  ? ? ? 1_555 H DT 19 O4    ? ? R A   16   T DT 19   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog64 hydrog ? ? F G   17   N1  ? ? ? 1_555 H DC 18 N3    ? ? R G   17   T DC 18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog65 hydrog ? ? F G   17   N2  ? ? ? 1_555 H DC 18 O2    ? ? R G   17   T DC 18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog66 hydrog ? ? F G   17   O6  ? ? ? 1_555 H DC 18 N4    ? ? R G   17   T DC 18   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog67 hydrog ? ? F G   18   N1  ? ? ? 1_555 H DC 17 N3    ? ? R G   18   T DC 17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog68 hydrog ? ? F G   18   N2  ? ? ? 1_555 H DC 17 O2    ? ? R G   18   T DC 17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog69 hydrog ? ? F G   18   O6  ? ? ? 1_555 H DC 17 N4    ? ? R G   18   T DC 17   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog70 hydrog ? ? F U   19   N3  ? ? ? 1_555 H DA 16 N1    ? ? R U   19   T DA 16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog71 hydrog ? ? F U   19   O4  ? ? ? 1_555 H DA 16 N6    ? ? R U   19   T DA 16   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog72 hydrog ? ? F A   20   N1  ? ? ? 1_555 H DT 15 N3    ? ? R A   20   T DT 15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
hydrog73 hydrog ? ? F A   20   N6  ? ? ? 1_555 H DT 15 O4    ? ? R A   20   T DT 15   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 26  A . ? GLU 26  A PRO 27  A ? PRO 27  A 1 -3.47 
2 GLU 26  B . ? GLU 26  B PRO 27  B ? PRO 27  B 1 -3.96 
3 PHE 52  C . ? PHE 52  C PRO 53  C ? PRO 53  C 1 -2.19 
4 VAL 108 D . ? VAL 108 D PRO 109 D ? PRO 109 D 1 -4.00 
5 ALA 705 D . ? ALA 705 D PRO 706 D ? PRO 706 D 1 0.12  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 4 ? 
AA7 ? 4 ? 
AA8 ? 2 ? 
AA9 ? 2 ? 
AB1 ? 2 ? 
AB2 ? 3 ? 
AB3 ? 3 ? 
AB4 ? 3 ? 
AB5 ? 4 ? 
AB6 ? 5 ? 
AB7 ? 2 ? 
AB8 ? 3 ? 
AB9 ? 6 ? 
AC1 ? 2 ? 
AC2 ? 3 ? 
AC3 ? 4 ? 
AC4 ? 2 ? 
AC5 ? 2 ? 
AC6 ? 8 ? 
AC7 ? 5 ? 
AC8 ? 3 ? 
AC9 ? 2 ? 
AD1 ? 8 ? 
AD2 ? 2 ? 
AD3 ? 3 ? 
AD4 ? 3 ? 
AD5 ? 3 ? 
AD6 ? 2 ? 
AD7 ? 4 ? 
AD8 ? 2 ? 
AD9 ? 4 ? 
AE1 ? 2 ? 
AE2 ? 2 ? 
AE3 ? 3 ? 
AE4 ? 3 ? 
AE5 ? 2 ? 
AE6 ? 2 ? 
AE7 ? 2 ? 
AE8 ? 2 ? 
AE9 ? 4 ? 
AF1 ? 3 ? 
AF2 ? 2 ? 
AF3 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? parallel      
AB2 2 3 ? parallel      
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? parallel      
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB6 4 5 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB8 1 2 ? anti-parallel 
AB8 2 3 ? anti-parallel 
AB9 1 2 ? anti-parallel 
AB9 2 3 ? anti-parallel 
AB9 3 4 ? parallel      
AB9 4 5 ? anti-parallel 
AB9 5 6 ? anti-parallel 
AC1 1 2 ? anti-parallel 
AC2 1 2 ? anti-parallel 
AC2 2 3 ? anti-parallel 
AC3 1 2 ? anti-parallel 
AC3 2 3 ? anti-parallel 
AC3 3 4 ? anti-parallel 
AC4 1 2 ? anti-parallel 
AC5 1 2 ? anti-parallel 
AC6 1 2 ? anti-parallel 
AC6 2 3 ? anti-parallel 
AC6 3 4 ? anti-parallel 
AC6 4 5 ? parallel      
AC6 5 6 ? anti-parallel 
AC6 6 7 ? parallel      
AC6 7 8 ? anti-parallel 
AC7 1 2 ? anti-parallel 
AC7 2 3 ? anti-parallel 
AC7 3 4 ? anti-parallel 
AC7 4 5 ? anti-parallel 
AC8 1 2 ? anti-parallel 
AC8 2 3 ? anti-parallel 
AC9 1 2 ? anti-parallel 
AD1 1 2 ? anti-parallel 
AD1 2 3 ? anti-parallel 
AD1 3 4 ? anti-parallel 
AD1 4 5 ? anti-parallel 
AD1 5 6 ? parallel      
AD1 6 7 ? anti-parallel 
AD1 7 8 ? parallel      
AD2 1 2 ? anti-parallel 
AD3 1 2 ? anti-parallel 
AD3 2 3 ? anti-parallel 
AD4 1 2 ? parallel      
AD4 2 3 ? anti-parallel 
AD5 1 2 ? anti-parallel 
AD5 2 3 ? anti-parallel 
AD6 1 2 ? anti-parallel 
AD7 1 2 ? anti-parallel 
AD7 2 3 ? anti-parallel 
AD7 3 4 ? anti-parallel 
AD8 1 2 ? anti-parallel 
AD9 1 2 ? anti-parallel 
AD9 2 3 ? anti-parallel 
AD9 3 4 ? anti-parallel 
AE1 1 2 ? anti-parallel 
AE2 1 2 ? anti-parallel 
AE3 1 2 ? parallel      
AE3 2 3 ? anti-parallel 
AE4 1 2 ? parallel      
AE4 2 3 ? anti-parallel 
AE5 1 2 ? parallel      
AE6 1 2 ? anti-parallel 
AE7 1 2 ? anti-parallel 
AE8 1 2 ? anti-parallel 
AE9 1 2 ? anti-parallel 
AE9 2 3 ? anti-parallel 
AE9 3 4 ? anti-parallel 
AF1 1 2 ? anti-parallel 
AF1 2 3 ? anti-parallel 
AF2 1 2 ? anti-parallel 
AF3 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 10   ? GLN A 16   ? VAL A 10   GLN A 16   
AA1 2 TYR A 20   ? LEU A 28   ? TYR A 20   LEU A 28   
AA1 3 LEU A 192  ? THR A 201  ? LEU A 192  THR A 201  
AA1 4 VAL A 174  ? THR A 184  ? VAL A 174  THR A 184  
AA2 1 THR A 96   ? GLU A 104  ? THR A 96   GLU A 104  
AA2 2 ARG A 137  ? GLY A 147  ? ARG A 137  GLY A 147  
AA2 3 GLY A 50   ? ILE A 58   ? GLY A 50   ILE A 58   
AA2 4 ILE A 165  ? PRO A 166  ? ILE A 165  PRO A 166  
AA3 1 VAL A 87   ? PHE A 89   ? VAL A 87   PHE A 89   
AA3 2 VAL A 120  ? ILE A 122  ? VAL A 120  ILE A 122  
AA4 1 GLU A 108  ? LYS A 110  ? GLU A 108  LYS A 110  
AA4 2 HIS A 128  ? THR A 131  ? HIS A 128  THR A 131  
AA5 1 TYR A 150  ? VAL A 151  ? TYR A 150  VAL A 151  
AA5 2 ALA A 169  ? VAL A 170  ? ALA A 169  VAL A 170  
AA6 1 VAL B 10   ? GLN B 16   ? VAL B 10   GLN B 16   
AA6 2 TYR B 20   ? LEU B 28   ? TYR B 20   LEU B 28   
AA6 3 ARG B 189  ? THR B 201  ? ARG B 189  THR B 201  
AA6 4 VAL B 174  ? LEU B 186  ? VAL B 174  LEU B 186  
AA7 1 THR B 96   ? GLU B 104  ? THR B 96   GLU B 104  
AA7 2 ARG B 137  ? GLY B 147  ? ARG B 137  GLY B 147  
AA7 3 GLY B 50   ? ILE B 58   ? GLY B 50   ILE B 58   
AA7 4 ILE B 165  ? PRO B 166  ? ILE B 165  PRO B 166  
AA8 1 VAL B 87   ? PHE B 89   ? VAL B 87   PHE B 89   
AA8 2 VAL B 120  ? ILE B 122  ? VAL B 120  ILE B 122  
AA9 1 LYS B 107  ? LYS B 110  ? LYS B 107  LYS B 110  
AA9 2 HIS B 128  ? LEU B 132  ? HIS B 128  LEU B 132  
AB1 1 TYR B 150  ? VAL B 151  ? TYR B 150  VAL B 151  
AB1 2 ALA B 169  ? VAL B 170  ? ALA B 169  VAL B 170  
AB2 1 GLU C 2    ? ARG C 5    ? GLU C 2    ARG C 5    
AB2 2 GLN C 899  ? ILE C 902  ? GLN C 899  ILE C 902  
AB2 3 VAL C 579  ? MET C 580  ? VAL C 579  MET C 580  
AB3 1 VAL C 65   ? LEU C 73   ? VAL C 65   LEU C 73   
AB3 2 GLN C 91   ? ILE C 101  ? GLN C 91   ILE C 101  
AB3 3 ILE C 108  ? PRO C 119  ? ILE C 108  PRO C 119  
AB4 1 PHE C 127  ? ILE C 129  ? PHE C 127  ILE C 129  
AB4 2 ALA C 132  ? ILE C 136  ? ALA C 132  ILE C 136  
AB4 3 SER C 392  ? PHE C 394  ? SER C 392  PHE C 394  
AB5 1 ARG C 331  ? ARG C 334  ? ARG C 331  ARG C 334  
AB5 2 SER C 138  ? ARG C 142  ? SER C 138  ARG C 142  
AB5 3 ARG C 409  ? SER C 411  ? ARG C 409  SER C 411  
AB5 4 ILE C 452  ? SER C 454  ? ILE C 452  SER C 454  
AB6 1 GLY C 145  ? PRO C 150  ? GLY C 145  PRO C 150  
AB6 2 TYR C 158  ? ILE C 163  ? TYR C 158  ILE C 163  
AB6 3 ILE C 172  ? VAL C 176  ? ILE C 172  VAL C 176  
AB6 4 VAL C 182  ? VAL C 186  ? VAL C 182  VAL C 186  
AB6 5 ARG C 189  ? PRO C 192  ? ARG C 189  PRO C 192  
AB7 1 ALA C 291  ? GLU C 294  ? ALA C 291  GLU C 294  
AB7 2 GLU C 297  ? ASP C 300  ? GLU C 297  ASP C 300  
AB8 1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
AB8 2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
AB8 3 VAL C 478  ? MET C 486  ? VAL C 478  MET C 486  
AB9 1 ARG C 460  ? VAL C 461  ? ARG C 460  VAL C 461  
AB9 2 ILE C 467  ? VAL C 475  ? ILE C 467  VAL C 475  
AB9 3 PHE C 531  ? MET C 532  ? PHE C 531  MET C 532  
AB9 4 ILE C 496  ? ALA C 497  ? ILE C 496  ALA C 497  
AB9 5 VAL C 513  ? ARG C 517  ? VAL C 513  ARG C 517  
AB9 6 GLU C 520  ? VAL C 524  ? GLU C 520  VAL C 524  
AC1 1 LEU C 503  ? GLU C 504  ? LEU C 503  GLU C 504  
AC1 2 ARG C 507  ? ILE C 508  ? ARG C 507  ILE C 508  
AC2 1 LEU C 595  ? TYR C 596  ? LEU C 595  TYR C 596  
AC2 2 LEU C 654  ? ASP C 657  ? LEU C 654  ASP C 657  
AC2 3 ARG C 640  ? PRO C 641  ? ARG C 640  PRO C 641  
AC3 1 LEU C 620  ? PRO C 624  ? LEU C 620  PRO C 624  
AC3 2 ARG C 610  ? TYR C 615  ? ARG C 610  TYR C 615  
AC3 3 GLY C 601  ? VAL C 606  ? GLY C 601  VAL C 606  
AC3 4 ARG C 648  ? VAL C 649  ? ARG C 648  VAL C 649  
AC4 1 TYR C 629  ? ARG C 630  ? TYR C 629  ARG C 630  
AC4 2 ALA C 636  ? LEU C 637  ? ALA C 636  LEU C 637  
AC5 1 SER C 661  ? GLU C 662  ? SER C 661  GLU C 662  
AC5 2 PHE C 665  ? LEU C 666  ? PHE C 665  LEU C 666  
AC6 1 LYS C 971  ? VAL C 972  ? LYS C 971  VAL C 972  
AC6 2 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
AC6 3 LYS C 838  ? ASN C 841  ? LYS C 838  ASN C 841  
AC6 4 LYS C 846  ? LEU C 853  ? LYS C 846  LEU C 853  
AC6 5 ILE C 688  ? SER C 691  ? ILE C 688  SER C 691  
AC6 6 VAL C 869  ? LEU C 871  ? VAL C 869  LEU C 871  
AC6 7 GLY C 669  ? ILE C 676  ? GLY C 669  ILE C 676  
AC6 8 ILE C 987  ? LYS C 996  ? ILE C 987  LYS C 996  
AC7 1 GLY C 718  ? PRO C 719  ? GLY C 718  PRO C 719  
AC7 2 SER C 702  ? THR C 715  ? SER C 702  THR C 715  
AC7 3 VAL C 819  ? ARG C 831  ? VAL C 819  ARG C 831  
AC7 4 GLY C 798  ? LEU C 806  ? GLY C 798  LEU C 806  
AC7 5 GLU C 748  ? VAL C 749  ? GLU C 748  VAL C 749  
AC8 1 ARG C 721  ? ILE C 722  ? ARG C 721  ILE C 722  
AC8 2 ARG C 758  ? PHE C 761  ? ARG C 758  PHE C 761  
AC8 3 VAL C 785  ? ASP C 787  ? VAL C 785  ASP C 787  
AC9 1 ILE C 754  ? VAL C 756  ? ILE C 754  VAL C 756  
AC9 2 LEU C 790  ? ARG C 791  ? LEU C 790  ARG C 791  
AD1 1 HIS C 1006 ? ARG C 1008 ? HIS C 1006 ARG C 1008 
AD1 2 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AD1 3 GLN D 744  ? HIS D 748  ? GLN D 744  HIS D 748  
AD1 4 VAL D 700  ? ASN D 703  ? VAL D 700  ASN D 703  
AD1 5 ILE D 713  ? VAL D 721  ? ILE D 713  VAL D 721  
AD1 6 GLN D 641  ? PRO D 645  ? GLN D 641  PRO D 645  
AD1 7 ILE D 726  ? LEU D 728  ? ILE D 726  LEU D 728  
AD1 8 SER D 626  ? VAL D 633  ? SER D 626  VAL D 633  
AD2 1 ARG C 1031 ? PHE C 1032 ? ARG C 1031 PHE C 1032 
AD2 2 LYS D 621  ? ARG D 622  ? LYS D 621  ARG D 622  
AD3 1 LEU C 1097 ? LEU C 1102 ? LEU C 1097 LEU C 1102 
AD3 2 LYS D 7    ? LEU D 12   ? LYS D 7    LEU D 12   
AD3 3 LYS D 1456 ? ASP D 1457 ? LYS D 1456 ASP D 1457 
AD4 1 SER D 22   ? GLU D 25   ? SER D 22   GLU D 25   
AD4 2 MET D 90   ? ALA D 100  ? MET D 90   ALA D 100  
AD4 3 ILE D 513  ? VAL D 519  ? ILE D 513  VAL D 519  
AD5 1 LEU D 152  ? LEU D 153  ? LEU D 152  LEU D 153  
AD5 2 TYR D 132  ? ASP D 136  ? TYR D 132  ASP D 136  
AD5 3 ASP D 453  ? ARG D 455  ? ASP D 453  ARG D 455  
AD6 1 ILE D 141  ? LEU D 142  ? ILE D 141  LEU D 142  
AD6 2 VAL D 145  ? PRO D 146  ? VAL D 145  PRO D 146  
AD7 1 GLN D 166  ? PRO D 170  ? GLN D 166  PRO D 170  
AD7 2 SER D 392  ? VAL D 396  ? SER D 392  VAL D 396  
AD7 3 GLY D 201  ? TYR D 205  ? GLY D 201  TYR D 205  
AD7 4 GLU D 184  ? VAL D 185  ? GLU D 184  VAL D 185  
AD8 1 GLU D 190  ? ALA D 192  ? GLU D 190  ALA D 192  
AD8 2 VAL D 195  ? VAL D 196  ? VAL D 195  VAL D 196  
AD9 1 ALA D 398  ? PRO D 402  ? ALA D 398  PRO D 402  
AD9 2 VAL D 443  ? VAL D 447  ? VAL D 443  VAL D 447  
AD9 3 GLY D 433  ? ASP D 438  ? GLY D 433  ASP D 438  
AD9 4 ARG D 414  ? VAL D 415  ? ARG D 414  VAL D 415  
AE1 1 VAL D 420  ? ALA D 422  ? VAL D 420  ALA D 422  
AE1 2 VAL D 427  ? LYS D 428  ? VAL D 427  LYS D 428  
AE2 1 MET D 527  ? GLN D 529  ? MET D 527  GLN D 529  
AE2 2 PHE D 535  ? THR D 537  ? PHE D 535  THR D 537  
AE3 1 GLU D 805  ? PHE D 806  ? GLU D 805  PHE D 806  
AE3 2 ILE D 827  ? VAL D 829  ? ILE D 827  VAL D 829  
AE3 3 GLU D 833  ? THR D 834  ? GLU D 833  THR D 834  
AE4 1 VAL D 842  ? PHE D 843  ? VAL D 842  PHE D 843  
AE4 2 VAL D 864  ? TYR D 868  ? VAL D 864  TYR D 868  
AE4 3 LYS D 871  ? THR D 875  ? LYS D 871  THR D 875  
AE5 1 VAL D 1106 ? GLU D 1109 ? VAL D 1106 GLU D 1109 
AE5 2 GLY D 1199 ? CYS D 1201 ? GLY D 1199 CYS D 1201 
AE6 1 ILE D 1118 ? PRO D 1121 ? ILE D 1118 PRO D 1121 
AE6 2 GLU D 1185 ? VAL D 1188 ? GLU D 1185 VAL D 1188 
AE7 1 PHE D 1123 ? ASP D 1126 ? PHE D 1123 ASP D 1126 
AE7 2 SER D 1131 ? LEU D 1134 ? SER D 1131 LEU D 1134 
AE8 1 VAL D 1153 ? VAL D 1155 ? VAL D 1153 VAL D 1155 
AE8 2 VAL D 1158 ? LEU D 1160 ? VAL D 1158 LEU D 1160 
AE9 1 SER D 1300 ? LEU D 1305 ? SER D 1300 LEU D 1305 
AE9 2 LEU D 1290 ? GLU D 1295 ? LEU D 1290 GLU D 1295 
AE9 3 GLY D 1279 ? GLU D 1285 ? GLY D 1279 GLU D 1285 
AE9 4 TYR D 1318 ? VAL D 1319 ? TYR D 1318 VAL D 1319 
AF1 1 VAL D 1394 ? GLU D 1396 ? VAL D 1394 GLU D 1396 
AF1 2 TYR D 1378 ? ASP D 1383 ? TYR D 1378 ASP D 1383 
AF1 3 ALA D 1416 ? PRO D 1419 ? ALA D 1416 PRO D 1419 
AF2 1 GLN D 1485 ? ASP D 1488 ? GLN D 1485 ASP D 1488 
AF2 2 LEU E 73   ? GLY E 76   ? LEU E 73   GLY E 76   
AF3 1 LYS E 47   ? GLN E 49   ? LYS E 47   GLN E 49   
AF3 2 LEU E 54   ? ASP E 56   ? LEU E 54   ASP E 56   
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLN A 16   ? N GLN A 16   O TYR A 20   ? O TYR A 20   
AA1 2 3 N PHE A 23   ? N PHE A 23   O LEU A 197  ? O LEU A 197  
AA1 3 4 O ARG A 198  ? O ARG A 198  N ALA A 178  ? N ALA A 178  
AA2 1 2 N LEU A 99   ? N LEU A 99   O VAL A 142  ? O VAL A 142  
AA2 2 3 O GLY A 147  ? O GLY A 147  N GLY A 50   ? N GLY A 50   
AA2 3 4 N VAL A 56   ? N VAL A 56   O ILE A 165  ? O ILE A 165  
AA3 1 2 N ARG A 88   ? N ARG A 88   O GLU A 121  ? O GLU A 121  
AA4 1 2 N VAL A 109  ? N VAL A 109  O ALA A 130  ? O ALA A 130  
AA5 1 2 N VAL A 151  ? N VAL A 151  O ALA A 169  ? O ALA A 169  
AA6 1 2 N THR B 12   ? N THR B 12   O VAL B 24   ? O VAL B 24   
AA6 2 3 N LEU B 28   ? N LEU B 28   O ASP B 193  ? O ASP B 193  
AA6 3 4 O ARG B 198  ? O ARG B 198  N ALA B 178  ? N ALA B 178  
AA7 1 2 N LEU B 99   ? N LEU B 99   O VAL B 142  ? O VAL B 142  
AA7 2 3 O ARG B 143  ? O ARG B 143  N THR B 54   ? N THR B 54   
AA7 3 4 N VAL B 56   ? N VAL B 56   O ILE B 165  ? O ILE B 165  
AA8 1 2 N ARG B 88   ? N ARG B 88   O GLU B 121  ? O GLU B 121  
AA9 1 2 N LYS B 107  ? N LYS B 107  O LEU B 132  ? O LEU B 132  
AB1 1 2 N VAL B 151  ? N VAL B 151  O ALA B 169  ? O ALA B 169  
AB2 1 2 N LYS C 4    ? N LYS C 4    O ARG C 900  ? O ARG C 900  
AB2 2 3 O TYR C 901  ? O TYR C 901  N MET C 580  ? N MET C 580  
AB3 1 2 N VAL C 65   ? N VAL C 65   O ILE C 101  ? O ILE C 101  
AB3 2 3 N ALA C 96   ? N ALA C 96   O VAL C 113  ? O VAL C 113  
AB4 1 2 N PHE C 127  ? N PHE C 127  O ARG C 134  ? O ARG C 134  
AB4 2 3 N VAL C 135  ? N VAL C 135  O GLN C 393  ? O GLN C 393  
AB5 1 2 O ARG C 334  ? O ARG C 334  N GLN C 139  ? N GLN C 139  
AB5 2 3 N ILE C 140  ? N ILE C 140  O SER C 411  ? O SER C 411  
AB5 3 4 N ILE C 410  ? N ILE C 410  O THR C 453  ? O THR C 453  
AB6 1 2 N THR C 149  ? N THR C 149  O ILE C 159  ? O ILE C 159  
AB6 2 3 N ILE C 162  ? N ILE C 162  O ILE C 172  ? O ILE C 172  
AB6 3 4 N ASP C 173  ? N ASP C 173  O LYS C 185  ? O LYS C 185  
AB6 4 5 N MET C 184  ? N MET C 184  O PHE C 191  ? O PHE C 191  
AB7 1 2 N ARG C 292  ? N ARG C 292  O LYS C 299  ? O LYS C 299  
AB8 1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
AB8 2 3 N THR C 469  ? N THR C 469  O MET C 486  ? O MET C 486  
AB9 1 2 N ARG C 460  ? N ARG C 460  O ARG C 468  ? O ARG C 468  
AB9 2 3 N ARG C 472  ? N ARG C 472  O MET C 532  ? O MET C 532  
AB9 3 4 O PHE C 531  ? O PHE C 531  N ALA C 497  ? N ALA C 497  
AB9 4 5 N ILE C 496  ? N ILE C 496  O ARG C 516  ? O ARG C 516  
AB9 5 6 N ALA C 515  ? N ALA C 515  O VAL C 522  ? O VAL C 522  
AC1 1 2 N GLU C 504  ? N GLU C 504  O ARG C 507  ? O ARG C 507  
AC2 1 2 N LEU C 595  ? N LEU C 595  O LEU C 655  ? O LEU C 655  
AC2 2 3 O ASP C 657  ? O ASP C 657  N ARG C 640  ? N ARG C 640  
AC3 1 2 O TYR C 623  ? O TYR C 623  N ILE C 611  ? N ILE C 611  
AC3 2 3 O ARG C 614  ? O ARG C 614  N GLU C 602  ? N GLU C 602  
AC3 3 4 N GLY C 601  ? N GLY C 601  O VAL C 649  ? O VAL C 649  
AC4 1 2 N TYR C 629  ? N TYR C 629  O LEU C 637  ? O LEU C 637  
AC5 1 2 N GLU C 662  ? N GLU C 662  O PHE C 665  ? O PHE C 665  
AC6 1 2 N VAL C 972  ? N VAL C 972  O ILE C 987  ? O ILE C 987  
AC6 2 3 O MET C 995  ? O MET C 995  N ALA C 840  ? N ALA C 840  
AC6 3 4 N LEU C 839  ? N LEU C 839  O GLY C 847  ? O GLY C 847  
AC6 4 5 O ALA C 850  ? O ALA C 850  N ILE C 688  ? N ILE C 688  
AC6 5 6 N VAL C 689  ? N VAL C 689  O ILE C 870  ? O ILE C 870  
AC6 6 7 O VAL C 869  ? O VAL C 869  N ALA C 675  ? N ALA C 675  
AC6 7 8 N VAL C 672  ? N VAL C 672  O MET C 992  ? O MET C 992  
AC7 1 2 O GLY C 718  ? O GLY C 718  N THR C 715  ? N THR C 715  
AC7 2 3 N GLU C 706  ? N GLU C 706  O VAL C 827  ? O VAL C 827  
AC7 3 4 O VAL C 822  ? O VAL C 822  N LEU C 806  ? N LEU C 806  
AC7 4 5 O GLY C 798  ? O GLY C 798  N VAL C 749  ? N VAL C 749  
AC8 1 2 N ARG C 721  ? N ARG C 721  O THR C 759  ? O THR C 759  
AC8 2 3 N SER C 760  ? N SER C 760  O LYS C 786  ? O LYS C 786  
AC9 1 2 N LEU C 755  ? N LEU C 755  O LEU C 790  ? O LEU C 790  
AD1 1 2 N HIS C 1006 ? N HIS C 1006 O ARG D 628  ? O ARG D 628  
AD1 2 3 N SER D 629  ? N SER D 629  O MET D 745  ? O MET D 745  
AD1 3 4 O ALA D 746  ? O ALA D 746  N ASN D 703  ? N ASN D 703  
AD1 4 5 N LEU D 702  ? N LEU D 702  O GLN D 714  ? O GLN D 714  
AD1 5 6 O VAL D 719  ? O VAL D 719  N LEU D 644  ? N LEU D 644  
AD1 6 7 N GLY D 643  ? N GLY D 643  O GLN D 727  ? O GLN D 727  
AD1 7 8 O ILE D 726  ? O ILE D 726  N VAL D 630  ? N VAL D 630  
AD2 1 2 N PHE C 1032 ? N PHE C 1032 O LYS D 621  ? O LYS D 621  
AD3 1 2 N GLN C 1100 ? N GLN C 1100 O ARG D 9    ? O ARG D 9    
AD3 2 3 N VAL D 8    ? N VAL D 8    O ASP D 1457 ? O ASP D 1457 
AD4 1 2 N TYR D 23   ? N TYR D 23   O MET D 90   ? O MET D 90   
AD4 2 3 N ALA D 99   ? N ALA D 99   O LEU D 514  ? O LEU D 514  
AD5 1 2 O LEU D 153  ? O LEU D 153  N TYR D 132  ? N TYR D 132  
AD5 2 3 N LEU D 135  ? N LEU D 135  O ASP D 453  ? O ASP D 453  
AD6 1 2 N LEU D 142  ? N LEU D 142  O VAL D 145  ? O VAL D 145  
AD7 1 2 N GLU D 167  ? N GLU D 167  O VAL D 395  ? O VAL D 395  
AD7 2 3 O LEU D 394  ? O LEU D 394  N LEU D 204  ? N LEU D 204  
AD7 3 4 O GLY D 201  ? O GLY D 201  N VAL D 185  ? N VAL D 185  
AD8 1 2 N ALA D 192  ? N ALA D 192  O VAL D 195  ? O VAL D 195  
AD9 1 2 N TYR D 401  ? N TYR D 401  O VAL D 444  ? O VAL D 444  
AD9 2 3 O VAL D 443  ? O VAL D 443  N ASP D 438  ? N ASP D 438  
AD9 3 4 O GLY D 433  ? O GLY D 433  N VAL D 415  ? N VAL D 415  
AE1 1 2 N LEU D 421  ? N LEU D 421  O VAL D 427  ? O VAL D 427  
AE2 1 2 N VAL D 528  ? N VAL D 528  O ALA D 536  ? O ALA D 536  
AE3 1 2 N PHE D 806  ? N PHE D 806  O LYS D 828  ? O LYS D 828  
AE3 2 3 N ILE D 827  ? N ILE D 827  O THR D 834  ? O THR D 834  
AE4 1 2 N PHE D 843  ? N PHE D 843  O THR D 865  ? O THR D 865  
AE4 2 3 N VAL D 866  ? N VAL D 866  O LEU D 873  ? O LEU D 873  
AE5 1 2 N ARG D 1108 ? N ARG D 1108 O VAL D 1200 ? O VAL D 1200 
AE6 1 2 N ILE D 1118 ? N ILE D 1118 O VAL D 1188 ? O VAL D 1188 
AE7 1 2 N ASP D 1126 ? N ASP D 1126 O SER D 1131 ? O SER D 1131 
AE8 1 2 N VAL D 1153 ? N VAL D 1153 O LEU D 1160 ? O LEU D 1160 
AE9 1 2 O TYR D 1303 ? O TYR D 1303 N VAL D 1292 ? N VAL D 1292 
AE9 2 3 O SER D 1291 ? O SER D 1291 N GLU D 1284 ? N GLU D 1284 
AE9 3 4 N GLY D 1279 ? N GLY D 1279 O VAL D 1319 ? O VAL D 1319 
AF1 1 2 O LEU D 1395 ? O LEU D 1395 N VAL D 1379 ? N VAL D 1379 
AF1 2 3 N GLU D 1380 ? N GLU D 1380 O LYS D 1418 ? O LYS D 1418 
AF2 1 2 N GLN D 1485 ? N GLN D 1485 O GLY E 76   ? O GLY E 76   
AF3 1 2 N MET E 48   ? N MET E 48   O PHE E 55   ? O PHE E 55   
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software D ZN 2001 ? 4 'binding site for residue ZN D 2001' 
AC2 Software D ZN 2002 ? 4 'binding site for residue ZN D 2002' 
AC3 Software D MG 2003 ? 4 'binding site for residue MG D 2003' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS D 1112 ? CYS D 1112 . ? 1_555 ? 
2  AC1 4 CYS D 1194 ? CYS D 1194 . ? 1_555 ? 
3  AC1 4 CYS D 1201 ? CYS D 1201 . ? 1_555 ? 
4  AC1 4 CYS D 1204 ? CYS D 1204 . ? 1_555 ? 
5  AC2 4 CYS D 58   ? CYS D 58   . ? 1_555 ? 
6  AC2 4 CYS D 60   ? CYS D 60   . ? 1_555 ? 
7  AC2 4 CYS D 73   ? CYS D 73   . ? 1_555 ? 
8  AC2 4 CYS D 76   ? CYS D 76   . ? 1_555 ? 
9  AC3 4 ASP D 739  ? ASP D 739  . ? 1_555 ? 
10 AC3 4 ASP D 741  ? ASP D 741  . ? 1_555 ? 
11 AC3 4 ASP D 743  ? ASP D 743  . ? 1_555 ? 
12 AC3 4 A   F 20   ? A   R 20   . ? 1_555 ? 
# 
_atom_sites.entry_id                    6M6C 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N  N     . SER A 1 4    ? 77.460  81.916  154.996 1.00 174.52 ? 4    SER A N     1 
ATOM   2     C  CA    . SER A 1 4    ? 77.780  83.226  154.442 1.00 174.52 ? 4    SER A CA    1 
ATOM   3     C  C     . SER A 1 4    ? 78.812  83.108  153.327 1.00 174.52 ? 4    SER A C     1 
ATOM   4     O  O     . SER A 1 4    ? 79.704  83.946  153.202 1.00 174.52 ? 4    SER A O     1 
ATOM   5     C  CB    . SER A 1 4    ? 78.292  84.163  155.538 1.00 174.52 ? 4    SER A CB    1 
ATOM   6     O  OG    . SER A 1 4    ? 77.219  84.723  156.275 1.00 174.52 ? 4    SER A OG    1 
ATOM   7     N  N     . LYS A 1 5    ? 78.686  82.060  152.519 1.00 170.72 ? 5    LYS A N     1 
ATOM   8     C  CA    . LYS A 1 5    ? 79.613  81.809  151.424 1.00 170.72 ? 5    LYS A CA    1 
ATOM   9     C  C     . LYS A 1 5    ? 78.828  81.714  150.120 1.00 170.72 ? 5    LYS A C     1 
ATOM   10    O  O     . LYS A 1 5    ? 77.923  80.883  149.992 1.00 170.72 ? 5    LYS A O     1 
ATOM   11    C  CB    . LYS A 1 5    ? 80.418  80.535  151.706 1.00 170.72 ? 5    LYS A CB    1 
ATOM   12    C  CG    . LYS A 1 5    ? 81.429  80.107  150.645 1.00 170.72 ? 5    LYS A CG    1 
ATOM   13    C  CD    . LYS A 1 5    ? 80.827  79.197  149.588 1.00 170.72 ? 5    LYS A CD    1 
ATOM   14    C  CE    . LYS A 1 5    ? 81.809  78.952  148.454 1.00 170.72 ? 5    LYS A CE    1 
ATOM   15    N  NZ    . LYS A 1 5    ? 81.426  77.775  147.627 1.00 170.72 ? 5    LYS A NZ    1 
ATOM   16    N  N     . LEU A 1 6    ? 79.177  82.569  149.161 1.00 167.54 ? 6    LEU A N     1 
ATOM   17    C  CA    . LEU A 1 6    ? 78.391  82.714  147.943 1.00 167.54 ? 6    LEU A CA    1 
ATOM   18    C  C     . LEU A 1 6    ? 78.461  81.460  147.080 1.00 167.54 ? 6    LEU A C     1 
ATOM   19    O  O     . LEU A 1 6    ? 79.264  80.556  147.317 1.00 167.54 ? 6    LEU A O     1 
ATOM   20    C  CB    . LEU A 1 6    ? 78.876  83.919  147.135 1.00 167.54 ? 6    LEU A CB    1 
ATOM   21    C  CG    . LEU A 1 6    ? 78.243  85.285  147.414 1.00 167.54 ? 6    LEU A CG    1 
ATOM   22    C  CD1   . LEU A 1 6    ? 76.751  85.244  147.129 1.00 167.54 ? 6    LEU A CD1   1 
ATOM   23    C  CD2   . LEU A 1 6    ? 78.512  85.748  148.837 1.00 167.54 ? 6    LEU A CD2   1 
ATOM   24    N  N     . LYS A 1 7    ? 77.616  81.421  146.056 1.00 159.35 ? 7    LYS A N     1 
ATOM   25    C  CA    . LYS A 1 7    ? 77.577  80.311  145.119 1.00 159.35 ? 7    LYS A CA    1 
ATOM   26    C  C     . LYS A 1 7    ? 78.338  80.683  143.854 1.00 159.35 ? 7    LYS A C     1 
ATOM   27    O  O     . LYS A 1 7    ? 78.777  81.824  143.682 1.00 159.35 ? 7    LYS A O     1 
ATOM   28    C  CB    . LYS A 1 7    ? 76.134  79.921  144.774 1.00 159.35 ? 7    LYS A CB    1 
ATOM   29    C  CG    . LYS A 1 7    ? 75.358  79.347  145.948 1.00 159.35 ? 7    LYS A CG    1 
ATOM   30    C  CD    . LYS A 1 7    ? 76.222  78.395  146.762 1.00 159.35 ? 7    LYS A CD    1 
ATOM   31    C  CE    . LYS A 1 7    ? 75.589  78.075  148.106 1.00 159.35 ? 7    LYS A CE    1 
ATOM   32    N  NZ    . LYS A 1 7    ? 76.507  77.292  148.981 1.00 159.35 ? 7    LYS A NZ    1 
ATOM   33    N  N     . ALA A 1 8    ? 78.499  79.699  142.977 1.00 146.44 ? 8    ALA A N     1 
ATOM   34    C  CA    . ALA A 1 8    ? 79.237  79.911  141.743 1.00 146.44 ? 8    ALA A CA    1 
ATOM   35    C  C     . ALA A 1 8    ? 78.567  81.010  140.921 1.00 146.44 ? 8    ALA A C     1 
ATOM   36    O  O     . ALA A 1 8    ? 77.397  80.865  140.539 1.00 146.44 ? 8    ALA A O     1 
ATOM   37    C  CB    . ALA A 1 8    ? 79.311  78.616  140.934 1.00 146.44 ? 8    ALA A CB    1 
ATOM   38    N  N     . PRO A 1 9    ? 79.257  82.108  140.637 1.00 136.03 ? 9    PRO A N     1 
ATOM   39    C  CA    . PRO A 1 9    ? 78.633  83.208  139.901 1.00 136.03 ? 9    PRO A CA    1 
ATOM   40    C  C     . PRO A 1 9    ? 78.389  82.847  138.444 1.00 136.03 ? 9    PRO A C     1 
ATOM   41    O  O     . PRO A 1 9    ? 79.043  81.979  137.864 1.00 136.03 ? 9    PRO A O     1 
ATOM   42    C  CB    . PRO A 1 9    ? 79.658  84.340  140.022 1.00 136.03 ? 9    PRO A CB    1 
ATOM   43    C  CG    . PRO A 1 9    ? 80.958  83.645  140.224 1.00 136.03 ? 9    PRO A CG    1 
ATOM   44    C  CD    . PRO A 1 9    ? 80.647  82.410  141.017 1.00 136.03 ? 9    PRO A CD    1 
ATOM   45    N  N     . VAL A 1 10   ? 77.417  83.542  137.855 1.00 133.34 ? 10   VAL A N     1 
ATOM   46    C  CA    . VAL A 1 10   ? 77.106  83.342  136.447 1.00 133.34 ? 10   VAL A CA    1 
ATOM   47    C  C     . VAL A 1 10   ? 78.022  84.220  135.606 1.00 133.34 ? 10   VAL A C     1 
ATOM   48    O  O     . VAL A 1 10   ? 78.382  85.341  136.002 1.00 133.34 ? 10   VAL A O     1 
ATOM   49    C  CB    . VAL A 1 10   ? 75.622  83.631  136.171 1.00 133.34 ? 10   VAL A CB    1 
ATOM   50    C  CG1   . VAL A 1 10   ? 75.262  85.058  136.546 1.00 133.34 ? 10   VAL A CG1   1 
ATOM   51    C  CG2   . VAL A 1 10   ? 75.271  83.343  134.717 1.00 133.34 ? 10   VAL A CG2   1 
ATOM   52    N  N     . PHE A 1 11   ? 78.413  83.701  134.442 1.00 130.01 ? 11   PHE A N     1 
ATOM   53    C  CA    . PHE A 1 11   ? 79.367  84.331  133.538 1.00 130.01 ? 11   PHE A CA    1 
ATOM   54    C  C     . PHE A 1 11   ? 78.755  84.339  132.142 1.00 130.01 ? 11   PHE A C     1 
ATOM   55    O  O     . PHE A 1 11   ? 78.619  83.286  131.512 1.00 130.01 ? 11   PHE A O     1 
ATOM   56    C  CB    . PHE A 1 11   ? 80.697  83.581  133.568 1.00 130.01 ? 11   PHE A CB    1 
ATOM   57    C  CG    . PHE A 1 11   ? 81.569  83.821  132.371 1.00 130.01 ? 11   PHE A CG    1 
ATOM   58    C  CD1   . PHE A 1 11   ? 81.967  82.764  131.572 1.00 130.01 ? 11   PHE A CD1   1 
ATOM   59    C  CD2   . PHE A 1 11   ? 82.008  85.094  132.055 1.00 130.01 ? 11   PHE A CD2   1 
ATOM   60    C  CE1   . PHE A 1 11   ? 82.775  82.973  130.474 1.00 130.01 ? 11   PHE A CE1   1 
ATOM   61    C  CE2   . PHE A 1 11   ? 82.817  85.309  130.957 1.00 130.01 ? 11   PHE A CE2   1 
ATOM   62    C  CZ    . PHE A 1 11   ? 83.201  84.246  130.166 1.00 130.01 ? 11   PHE A CZ    1 
ATOM   63    N  N     . THR A 1 12   ? 78.382  85.522  131.668 1.00 128.44 ? 12   THR A N     1 
ATOM   64    C  CA    . THR A 1 12   ? 77.739  85.694  130.374 1.00 128.44 ? 12   THR A CA    1 
ATOM   65    C  C     . THR A 1 12   ? 78.658  86.437  129.413 1.00 128.44 ? 12   THR A C     1 
ATOM   66    O  O     . THR A 1 12   ? 79.533  87.203  129.826 1.00 128.44 ? 12   THR A O     1 
ATOM   67    C  CB    . THR A 1 12   ? 76.420  86.455  130.516 1.00 128.44 ? 12   THR A CB    1 
ATOM   68    O  OG1   . THR A 1 12   ? 76.689  87.854  130.662 1.00 128.44 ? 12   THR A OG1   1 
ATOM   69    C  CG2   . THR A 1 12   ? 75.653  85.964  131.732 1.00 128.44 ? 12   THR A CG2   1 
ATOM   70    N  N     . VAL A 1 13   ? 78.439  86.212  128.118 1.00 126.87 ? 13   VAL A N     1 
ATOM   71    C  CA    . VAL A 1 13   ? 79.302  86.727  127.061 1.00 126.87 ? 13   VAL A CA    1 
ATOM   72    C  C     . VAL A 1 13   ? 78.432  87.409  126.014 1.00 126.87 ? 13   VAL A C     1 
ATOM   73    O  O     . VAL A 1 13   ? 77.389  86.870  125.624 1.00 126.87 ? 13   VAL A O     1 
ATOM   74    C  CB    . VAL A 1 13   ? 80.141  85.611  126.416 1.00 126.87 ? 13   VAL A CB    1 
ATOM   75    C  CG1   . VAL A 1 13   ? 81.004  86.169  125.302 1.00 126.87 ? 13   VAL A CG1   1 
ATOM   76    C  CG2   . VAL A 1 13   ? 80.995  84.913  127.459 1.00 126.87 ? 13   VAL A CG2   1 
ATOM   77    N  N     . ARG A 1 14   ? 78.857  88.589  125.561 1.00 132.61 ? 14   ARG A N     1 
ATOM   78    C  CA    . ARG A 1 14   ? 78.203  89.318  124.477 1.00 132.61 ? 14   ARG A CA    1 
ATOM   79    C  C     . ARG A 1 14   ? 79.280  89.788  123.508 1.00 132.61 ? 14   ARG A C     1 
ATOM   80    O  O     . ARG A 1 14   ? 80.121  90.620  123.864 1.00 132.61 ? 14   ARG A O     1 
ATOM   81    C  CB    . ARG A 1 14   ? 77.395  90.499  125.012 1.00 132.61 ? 14   ARG A CB    1 
ATOM   82    C  CG    . ARG A 1 14   ? 76.449  90.152  126.148 1.00 132.61 ? 14   ARG A CG    1 
ATOM   83    C  CD    . ARG A 1 14   ? 75.574  91.337  126.516 1.00 132.61 ? 14   ARG A CD    1 
ATOM   84    N  NE    . ARG A 1 14   ? 76.351  92.440  127.072 1.00 132.61 ? 14   ARG A NE    1 
ATOM   85    C  CZ    . ARG A 1 14   ? 76.357  92.775  128.357 1.00 132.61 ? 14   ARG A CZ    1 
ATOM   86    N  NH1   . ARG A 1 14   ? 75.624  92.092  129.225 1.00 132.61 ? 14   ARG A NH1   1 
ATOM   87    N  NH2   . ARG A 1 14   ? 77.095  93.794  128.775 1.00 132.61 ? 14   ARG A NH2   1 
ATOM   88    N  N     . THR A 1 15   ? 79.256  89.267  122.286 1.00 138.57 ? 15   THR A N     1 
ATOM   89    C  CA    . THR A 1 15   ? 80.290  89.548  121.301 1.00 138.57 ? 15   THR A CA    1 
ATOM   90    C  C     . THR A 1 15   ? 79.706  90.275  120.099 1.00 138.57 ? 15   THR A C     1 
ATOM   91    O  O     . THR A 1 15   ? 78.597  89.966  119.652 1.00 138.57 ? 15   THR A O     1 
ATOM   92    C  CB    . THR A 1 15   ? 80.973  88.261  120.831 1.00 138.57 ? 15   THR A CB    1 
ATOM   93    O  OG1   . THR A 1 15   ? 80.000  87.393  120.237 1.00 138.57 ? 15   THR A OG1   1 
ATOM   94    C  CG2   . THR A 1 15   ? 81.633  87.553  121.999 1.00 138.57 ? 15   THR A CG2   1 
ATOM   95    N  N     . GLN A 1 16   ? 80.461  91.241  119.583 1.00 139.61 ? 16   GLN A N     1 
ATOM   96    C  CA    . GLN A 1 16   ? 80.169  91.899  118.315 1.00 139.61 ? 16   GLN A CA    1 
ATOM   97    C  C     . GLN A 1 16   ? 81.317  91.583  117.367 1.00 139.61 ? 16   GLN A C     1 
ATOM   98    O  O     . GLN A 1 16   ? 82.448  92.046  117.572 1.00 139.61 ? 16   GLN A O     1 
ATOM   99    C  CB    . GLN A 1 16   ? 79.995  93.405  118.490 1.00 139.61 ? 16   GLN A CB    1 
ATOM   100   C  CG    . GLN A 1 16   ? 79.016  93.801  119.577 1.00 139.61 ? 16   GLN A CG    1 
ATOM   101   C  CD    . GLN A 1 16   ? 79.057  95.286  119.876 1.00 139.61 ? 16   GLN A CD    1 
ATOM   102   O  OE1   . GLN A 1 16   ? 79.706  96.055  119.167 1.00 139.61 ? 16   GLN A OE1   1 
ATOM   103   N  NE2   . GLN A 1 16   ? 78.364  95.697  120.932 1.00 139.61 ? 16   GLN A NE2   1 
ATOM   104   N  N     . GLY A 1 17   ? 81.021  90.787  116.341 1.00 135.07 ? 17   GLY A N     1 
ATOM   105   C  CA    . GLY A 1 17   ? 81.970  90.326  115.352 1.00 135.07 ? 17   GLY A CA    1 
ATOM   106   C  C     . GLY A 1 17   ? 83.179  89.676  115.995 1.00 135.07 ? 17   GLY A C     1 
ATOM   107   O  O     . GLY A 1 17   ? 83.119  89.121  117.097 1.00 135.07 ? 17   GLY A O     1 
ATOM   108   N  N     . ARG A 1 18   ? 84.299  89.743  115.286 1.00 129.63 ? 18   ARG A N     1 
ATOM   109   C  CA    . ARG A 1 18   ? 85.587  89.355  115.836 1.00 129.63 ? 18   ARG A CA    1 
ATOM   110   C  C     . ARG A 1 18   ? 86.340  90.540  116.415 1.00 129.63 ? 18   ARG A C     1 
ATOM   111   O  O     . ARG A 1 18   ? 87.568  90.486  116.529 1.00 129.63 ? 18   ARG A O     1 
ATOM   112   C  CB    . ARG A 1 18   ? 86.439  88.674  114.762 1.00 129.63 ? 18   ARG A CB    1 
ATOM   113   C  CG    . ARG A 1 18   ? 85.802  87.438  114.159 1.00 129.63 ? 18   ARG A CG    1 
ATOM   114   C  CD    . ARG A 1 18   ? 86.671  86.870  113.058 1.00 129.63 ? 18   ARG A CD    1 
ATOM   115   N  NE    . ARG A 1 18   ? 88.064  86.776  113.480 1.00 129.63 ? 18   ARG A NE    1 
ATOM   116   C  CZ    . ARG A 1 18   ? 88.577  85.738  114.131 1.00 129.63 ? 18   ARG A CZ    1 
ATOM   117   N  NH1   . ARG A 1 18   ? 87.811  84.700  114.435 1.00 129.63 ? 18   ARG A NH1   1 
ATOM   118   N  NH2   . ARG A 1 18   ? 89.857  85.737  114.476 1.00 129.63 ? 18   ARG A NH2   1 
ATOM   119   N  N     . GLU A 1 19   ? 85.633  91.609  116.780 1.00 127.96 ? 19   GLU A N     1 
ATOM   120   C  CA    . GLU A 1 19   ? 86.295  92.834  117.205 1.00 127.96 ? 19   GLU A CA    1 
ATOM   121   C  C     . GLU A 1 19   ? 86.029  93.149  118.671 1.00 127.96 ? 19   GLU A C     1 
ATOM   122   O  O     . GLU A 1 19   ? 86.969  93.417  119.427 1.00 127.96 ? 19   GLU A O     1 
ATOM   123   C  CB    . GLU A 1 19   ? 85.842  94.000  116.327 1.00 127.96 ? 19   GLU A CB    1 
ATOM   124   C  CG    . GLU A 1 19   ? 86.253  93.879  114.874 1.00 127.96 ? 19   GLU A CG    1 
ATOM   125   C  CD    . GLU A 1 19   ? 87.730  94.136  114.668 1.00 127.96 ? 19   GLU A CD    1 
ATOM   126   O  OE1   . GLU A 1 19   ? 88.285  94.999  115.378 1.00 127.96 ? 19   GLU A OE1   1 
ATOM   127   O  OE2   . GLU A 1 19   ? 88.335  93.479  113.796 1.00 127.96 ? 19   GLU A OE2   1 
ATOM   128   N  N     . TYR A 1 20   ? 84.767  93.123  119.094 1.00 126.11 ? 20   TYR A N     1 
ATOM   129   C  CA    . TYR A 1 20   ? 84.397  93.644  120.401 1.00 126.11 ? 20   TYR A CA    1 
ATOM   130   C  C     . TYR A 1 20   ? 83.817  92.538  121.269 1.00 126.11 ? 20   TYR A C     1 
ATOM   131   O  O     . TYR A 1 20   ? 83.032  91.709  120.803 1.00 126.11 ? 20   TYR A O     1 
ATOM   132   C  CB    . TYR A 1 20   ? 83.388  94.785  120.264 1.00 126.11 ? 20   TYR A CB    1 
ATOM   133   C  CG    . TYR A 1 20   ? 82.934  95.376  121.575 1.00 126.11 ? 20   TYR A CG    1 
ATOM   134   C  CD1   . TYR A 1 20   ? 81.630  95.215  122.014 1.00 126.11 ? 20   TYR A CD1   1 
ATOM   135   C  CD2   . TYR A 1 20   ? 83.807  96.103  122.368 1.00 126.11 ? 20   TYR A CD2   1 
ATOM   136   C  CE1   . TYR A 1 20   ? 81.208  95.758  123.207 1.00 126.11 ? 20   TYR A CE1   1 
ATOM   137   C  CE2   . TYR A 1 20   ? 83.395  96.651  123.562 1.00 126.11 ? 20   TYR A CE2   1 
ATOM   138   C  CZ    . TYR A 1 20   ? 82.095  96.475  123.977 1.00 126.11 ? 20   TYR A CZ    1 
ATOM   139   O  OH    . TYR A 1 20   ? 81.678  97.019  125.168 1.00 126.11 ? 20   TYR A OH    1 
ATOM   140   N  N     . GLY A 1 21   ? 84.200  92.536  122.538 1.00 124.98 ? 21   GLY A N     1 
ATOM   141   C  CA    . GLY A 1 21   ? 83.716  91.521  123.458 1.00 124.98 ? 21   GLY A CA    1 
ATOM   142   C  C     . GLY A 1 21   ? 83.401  92.105  124.814 1.00 124.98 ? 21   GLY A C     1 
ATOM   143   O  O     . GLY A 1 21   ? 84.093  93.005  125.301 1.00 124.98 ? 21   GLY A O     1 
ATOM   144   N  N     . GLU A 1 22   ? 82.343  91.583  125.432 1.00 126.49 ? 22   GLU A N     1 
ATOM   145   C  CA    . GLU A 1 22   ? 81.945  91.949  126.782 1.00 126.49 ? 22   GLU A CA    1 
ATOM   146   C  C     . GLU A 1 22   ? 81.690  90.676  127.571 1.00 126.49 ? 22   GLU A C     1 
ATOM   147   O  O     . GLU A 1 22   ? 81.046  89.748  127.070 1.00 126.49 ? 22   GLU A O     1 
ATOM   148   C  CB    . GLU A 1 22   ? 80.693  92.827  126.774 1.00 126.49 ? 22   GLU A CB    1 
ATOM   149   C  CG    . GLU A 1 22   ? 80.980  94.312  126.738 1.00 126.49 ? 22   GLU A CG    1 
ATOM   150   C  CD    . GLU A 1 22   ? 79.718  95.147  126.781 1.00 126.49 ? 22   GLU A CD    1 
ATOM   151   O  OE1   . GLU A 1 22   ? 78.636  94.577  127.036 1.00 126.49 ? 22   GLU A OE1   1 
ATOM   152   O  OE2   . GLU A 1 22   ? 79.806  96.372  126.561 1.00 126.49 ? 22   GLU A OE2   1 
ATOM   153   N  N     . PHE A 1 23   ? 82.193  90.635  128.800 1.00 122.73 ? 23   PHE A N     1 
ATOM   154   C  CA    . PHE A 1 23   ? 82.097  89.451  129.646 1.00 122.73 ? 23   PHE A CA    1 
ATOM   155   C  C     . PHE A 1 23   ? 81.640  89.886  131.030 1.00 122.73 ? 23   PHE A C     1 
ATOM   156   O  O     . PHE A 1 23   ? 82.364  90.600  131.729 1.00 122.73 ? 23   PHE A O     1 
ATOM   157   C  CB    . PHE A 1 23   ? 83.435  88.719  129.712 1.00 122.73 ? 23   PHE A CB    1 
ATOM   158   C  CG    . PHE A 1 23   ? 84.028  88.430  128.364 1.00 122.73 ? 23   PHE A CG    1 
ATOM   159   C  CD1   . PHE A 1 23   ? 83.707  87.267  127.688 1.00 122.73 ? 23   PHE A CD1   1 
ATOM   160   C  CD2   . PHE A 1 23   ? 84.901  89.324  127.770 1.00 122.73 ? 23   PHE A CD2   1 
ATOM   161   C  CE1   . PHE A 1 23   ? 84.249  87.000  126.447 1.00 122.73 ? 23   PHE A CE1   1 
ATOM   162   C  CE2   . PHE A 1 23   ? 85.445  89.062  126.529 1.00 122.73 ? 23   PHE A CE2   1 
ATOM   163   C  CZ    . PHE A 1 23   ? 85.118  87.898  125.867 1.00 122.73 ? 23   PHE A CZ    1 
ATOM   164   N  N     . VAL A 1 24   ? 80.443  89.463  131.419 1.00 123.00 ? 24   VAL A N     1 
ATOM   165   C  CA    . VAL A 1 24   ? 79.861  89.822  132.706 1.00 123.00 ? 24   VAL A CA    1 
ATOM   166   C  C     . VAL A 1 24   ? 79.989  88.637  133.648 1.00 123.00 ? 24   VAL A C     1 
ATOM   167   O  O     . VAL A 1 24   ? 79.719  87.493  133.266 1.00 123.00 ? 24   VAL A O     1 
ATOM   168   C  CB    . VAL A 1 24   ? 78.390  90.248  132.552 1.00 123.00 ? 24   VAL A CB    1 
ATOM   169   C  CG1   . VAL A 1 24   ? 77.844  90.756  133.874 1.00 123.00 ? 24   VAL A CG1   1 
ATOM   170   C  CG2   . VAL A 1 24   ? 78.260  91.310  131.474 1.00 123.00 ? 24   VAL A CG2   1 
ATOM   171   N  N     . LEU A 1 25   ? 80.407  88.906  134.881 1.00 126.13 ? 25   LEU A N     1 
ATOM   172   C  CA    . LEU A 1 25   ? 80.558  87.879  135.907 1.00 126.13 ? 25   LEU A CA    1 
ATOM   173   C  C     . LEU A 1 25   ? 79.954  88.419  137.194 1.00 126.13 ? 25   LEU A C     1 
ATOM   174   O  O     . LEU A 1 25   ? 80.386  89.463  137.696 1.00 126.13 ? 25   LEU A O     1 
ATOM   175   C  CB    . LEU A 1 25   ? 82.027  87.506  136.101 1.00 126.13 ? 25   LEU A CB    1 
ATOM   176   C  CG    . LEU A 1 25   ? 82.337  86.501  137.207 1.00 126.13 ? 25   LEU A CG    1 
ATOM   177   C  CD1   . LEU A 1 25   ? 81.579  85.209  136.968 1.00 126.13 ? 25   LEU A CD1   1 
ATOM   178   C  CD2   . LEU A 1 25   ? 83.830  86.241  137.284 1.00 126.13 ? 25   LEU A CD2   1 
ATOM   179   N  N     . GLU A 1 26   ? 78.955  87.718  137.727 1.00 135.00 ? 26   GLU A N     1 
ATOM   180   C  CA    . GLU A 1 26   ? 78.276  88.218  138.916 1.00 135.00 ? 26   GLU A CA    1 
ATOM   181   C  C     . GLU A 1 26   ? 77.469  87.102  139.554 1.00 135.00 ? 26   GLU A C     1 
ATOM   182   O  O     . GLU A 1 26   ? 77.009  86.197  138.852 1.00 135.00 ? 26   GLU A O     1 
ATOM   183   C  CB    . GLU A 1 26   ? 77.357  89.402  138.575 1.00 135.00 ? 26   GLU A CB    1 
ATOM   184   C  CG    . GLU A 1 26   ? 76.145  89.038  137.739 1.00 135.00 ? 26   GLU A CG    1 
ATOM   185   C  CD    . GLU A 1 26   ? 75.193  90.203  137.566 1.00 135.00 ? 26   GLU A CD    1 
ATOM   186   O  OE1   . GLU A 1 26   ? 75.076  91.019  138.504 1.00 135.00 ? 26   GLU A OE1   1 
ATOM   187   O  OE2   . GLU A 1 26   ? 74.561  90.303  136.493 1.00 135.00 ? 26   GLU A OE2   1 
ATOM   188   N  N     . PRO A 1 27   ? 77.271  87.136  140.882 1.00 134.55 ? 27   PRO A N     1 
ATOM   189   C  CA    . PRO A 1 27   ? 77.824  88.124  141.812 1.00 134.55 ? 27   PRO A CA    1 
ATOM   190   C  C     . PRO A 1 27   ? 79.143  87.678  142.430 1.00 134.55 ? 27   PRO A C     1 
ATOM   191   O  O     . PRO A 1 27   ? 79.429  86.483  142.476 1.00 134.55 ? 27   PRO A O     1 
ATOM   192   C  CB    . PRO A 1 27   ? 76.738  88.224  142.877 1.00 134.55 ? 27   PRO A CB    1 
ATOM   193   C  CG    . PRO A 1 27   ? 76.200  86.836  142.949 1.00 134.55 ? 27   PRO A CG    1 
ATOM   194   C  CD    . PRO A 1 27   ? 76.294  86.258  141.551 1.00 134.55 ? 27   PRO A CD    1 
ATOM   195   N  N     . LEU A 1 28   ? 79.934  88.635  142.903 1.00 136.96 ? 28   LEU A N     1 
ATOM   196   C  CA    . LEU A 1 28   ? 81.210  88.355  143.539 1.00 136.96 ? 28   LEU A CA    1 
ATOM   197   C  C     . LEU A 1 28   ? 81.237  88.961  144.934 1.00 136.96 ? 28   LEU A C     1 
ATOM   198   O  O     . LEU A 1 28   ? 80.421  89.824  145.270 1.00 136.96 ? 28   LEU A O     1 
ATOM   199   C  CB    . LEU A 1 28   ? 82.377  88.908  142.717 1.00 136.96 ? 28   LEU A CB    1 
ATOM   200   C  CG    . LEU A 1 28   ? 82.516  88.395  141.285 1.00 136.96 ? 28   LEU A CG    1 
ATOM   201   C  CD1   . LEU A 1 28   ? 83.807  88.901  140.667 1.00 136.96 ? 28   LEU A CD1   1 
ATOM   202   C  CD2   . LEU A 1 28   ? 82.468  86.879  141.257 1.00 136.96 ? 28   LEU A CD2   1 
ATOM   203   N  N     . GLU A 1 29   ? 82.185  88.500  145.744 1.00 143.22 ? 29   GLU A N     1 
ATOM   204   C  CA    . GLU A 1 29   ? 82.361  89.066  147.072 1.00 143.22 ? 29   GLU A CA    1 
ATOM   205   C  C     . GLU A 1 29   ? 82.964  90.461  146.973 1.00 143.22 ? 29   GLU A C     1 
ATOM   206   O  O     . GLU A 1 29   ? 83.637  90.803  145.997 1.00 143.22 ? 29   GLU A O     1 
ATOM   207   C  CB    . GLU A 1 29   ? 83.252  88.163  147.924 1.00 143.22 ? 29   GLU A CB    1 
ATOM   208   C  CG    . GLU A 1 29   ? 82.486  87.246  148.863 1.00 143.22 ? 29   GLU A CG    1 
ATOM   209   C  CD    . GLU A 1 29   ? 81.741  88.003  149.946 1.00 143.22 ? 29   GLU A CD    1 
ATOM   210   O  OE1   . GLU A 1 29   ? 82.093  89.172  150.214 1.00 143.22 ? 29   GLU A OE1   1 
ATOM   211   O  OE2   . GLU A 1 29   ? 80.801  87.427  150.533 1.00 143.22 ? 29   GLU A OE2   1 
ATOM   212   N  N     . ARG A 1 30   ? 82.706  91.274  147.995 1.00 140.42 ? 30   ARG A N     1 
ATOM   213   C  CA    . ARG A 1 30   ? 83.156  92.660  147.994 1.00 140.42 ? 30   ARG A CA    1 
ATOM   214   C  C     . ARG A 1 30   ? 84.668  92.744  147.847 1.00 140.42 ? 30   ARG A C     1 
ATOM   215   O  O     . ARG A 1 30   ? 85.412  92.017  148.510 1.00 140.42 ? 30   ARG A O     1 
ATOM   216   C  CB    . ARG A 1 30   ? 82.717  93.356  149.281 1.00 140.42 ? 30   ARG A CB    1 
ATOM   217   C  CG    . ARG A 1 30   ? 83.132  94.813  149.353 1.00 140.42 ? 30   ARG A CG    1 
ATOM   218   C  CD    . ARG A 1 30   ? 82.694  95.452  150.655 1.00 140.42 ? 30   ARG A CD    1 
ATOM   219   N  NE    . ARG A 1 30   ? 83.707  95.323  151.697 1.00 140.42 ? 30   ARG A NE    1 
ATOM   220   C  CZ    . ARG A 1 30   ? 84.610  96.258  151.974 1.00 140.42 ? 30   ARG A CZ    1 
ATOM   221   N  NH1   . ARG A 1 30   ? 84.626  97.390  151.284 1.00 140.42 ? 30   ARG A NH1   1 
ATOM   222   N  NH2   . ARG A 1 30   ? 85.496  96.062  152.940 1.00 140.42 ? 30   ARG A NH2   1 
ATOM   223   N  N     . GLY A 1 31   ? 85.118  93.638  146.969 1.00 129.94 ? 31   GLY A N     1 
ATOM   224   C  CA    . GLY A 1 31   ? 86.527  93.844  146.731 1.00 129.94 ? 31   GLY A CA    1 
ATOM   225   C  C     . GLY A 1 31   ? 87.140  92.952  145.674 1.00 129.94 ? 31   GLY A C     1 
ATOM   226   O  O     . GLY A 1 31   ? 88.240  93.255  145.195 1.00 129.94 ? 31   GLY A O     1 
ATOM   227   N  N     . PHE A 1 32   ? 86.469  91.867  145.292 1.00 129.29 ? 32   PHE A N     1 
ATOM   228   C  CA    . PHE A 1 32   ? 86.996  90.976  144.267 1.00 129.29 ? 32   PHE A CA    1 
ATOM   229   C  C     . PHE A 1 32   ? 86.894  91.555  142.865 1.00 129.29 ? 32   PHE A C     1 
ATOM   230   O  O     . PHE A 1 32   ? 87.554  91.038  141.956 1.00 129.29 ? 32   PHE A O     1 
ATOM   231   C  CB    . PHE A 1 32   ? 86.273  89.631  144.323 1.00 129.29 ? 32   PHE A CB    1 
ATOM   232   C  CG    . PHE A 1 32   ? 86.854  88.678  145.322 1.00 129.29 ? 32   PHE A CG    1 
ATOM   233   C  CD1   . PHE A 1 32   ? 88.159  88.825  145.757 1.00 129.29 ? 32   PHE A CD1   1 
ATOM   234   C  CD2   . PHE A 1 32   ? 86.093  87.646  145.839 1.00 129.29 ? 32   PHE A CD2   1 
ATOM   235   C  CE1   . PHE A 1 32   ? 88.698  87.953  146.678 1.00 129.29 ? 32   PHE A CE1   1 
ATOM   236   C  CE2   . PHE A 1 32   ? 86.626  86.774  146.765 1.00 129.29 ? 32   PHE A CE2   1 
ATOM   237   C  CZ    . PHE A 1 32   ? 87.930  86.927  147.184 1.00 129.29 ? 32   PHE A CZ    1 
ATOM   238   N  N     . GLY A 1 33   ? 86.093  92.605  142.673 1.00 123.39 ? 33   GLY A N     1 
ATOM   239   C  CA    . GLY A 1 33   ? 85.983  93.211  141.356 1.00 123.39 ? 33   GLY A CA    1 
ATOM   240   C  C     . GLY A 1 33   ? 87.329  93.598  140.779 1.00 123.39 ? 33   GLY A C     1 
ATOM   241   O  O     . GLY A 1 33   ? 87.784  93.019  139.790 1.00 123.39 ? 33   GLY A O     1 
ATOM   242   N  N     . VAL A 1 34   ? 87.995  94.571  141.401 1.00 116.63 ? 34   VAL A N     1 
ATOM   243   C  CA    . VAL A 1 34   ? 89.301  94.989  140.907 1.00 116.63 ? 34   VAL A CA    1 
ATOM   244   C  C     . VAL A 1 34   ? 90.336  93.888  141.099 1.00 116.63 ? 34   VAL A C     1 
ATOM   245   O  O     . VAL A 1 34   ? 91.253  93.752  140.280 1.00 116.63 ? 34   VAL A O     1 
ATOM   246   C  CB    . VAL A 1 34   ? 89.742  96.298  141.584 1.00 116.63 ? 34   VAL A CB    1 
ATOM   247   C  CG1   . VAL A 1 34   ? 88.797  97.425  141.213 1.00 116.63 ? 34   VAL A CG1   1 
ATOM   248   C  CG2   . VAL A 1 34   ? 89.796  96.128  143.089 1.00 116.63 ? 34   VAL A CG2   1 
ATOM   249   N  N     . THR A 1 35   ? 90.189  93.075  142.150 1.00 115.90 ? 35   THR A N     1 
ATOM   250   C  CA    . THR A 1 35   ? 91.129  91.986  142.401 1.00 115.90 ? 35   THR A CA    1 
ATOM   251   C  C     . THR A 1 35   ? 91.215  91.043  141.208 1.00 115.90 ? 35   THR A C     1 
ATOM   252   O  O     . THR A 1 35   ? 92.295  90.536  140.884 1.00 115.90 ? 35   THR A O     1 
ATOM   253   C  CB    . THR A 1 35   ? 90.715  91.226  143.663 1.00 115.90 ? 35   THR A CB    1 
ATOM   254   O  OG1   . THR A 1 35   ? 90.917  92.060  144.810 1.00 115.90 ? 35   THR A OG1   1 
ATOM   255   C  CG2   . THR A 1 35   ? 91.531  89.955  143.824 1.00 115.90 ? 35   THR A CG2   1 
ATOM   256   N  N     . LEU A 1 36   ? 90.090  90.804  140.535 1.00 113.35 ? 36   LEU A N     1 
ATOM   257   C  CA    . LEU A 1 36   ? 90.117  89.953  139.351 1.00 113.35 ? 36   LEU A CA    1 
ATOM   258   C  C     . LEU A 1 36   ? 90.336  90.762  138.078 1.00 113.35 ? 36   LEU A C     1 
ATOM   259   O  O     . LEU A 1 36   ? 90.925  90.258  137.116 1.00 113.35 ? 36   LEU A O     1 
ATOM   260   C  CB    . LEU A 1 36   ? 88.823  89.147  139.255 1.00 113.35 ? 36   LEU A CB    1 
ATOM   261   C  CG    . LEU A 1 36   ? 88.775  87.889  140.119 1.00 113.35 ? 36   LEU A CG    1 
ATOM   262   C  CD1   . LEU A 1 36   ? 87.508  87.100  139.845 1.00 113.35 ? 36   LEU A CD1   1 
ATOM   263   C  CD2   . LEU A 1 36   ? 90.005  87.035  139.877 1.00 113.35 ? 36   LEU A CD2   1 
ATOM   264   N  N     . GLY A 1 37   ? 89.874  92.013  138.050 1.00 114.65 ? 37   GLY A N     1 
ATOM   265   C  CA    . GLY A 1 37   ? 89.977  92.798  136.831 1.00 114.65 ? 37   GLY A CA    1 
ATOM   266   C  C     . GLY A 1 37   ? 91.397  93.218  136.506 1.00 114.65 ? 37   GLY A C     1 
ATOM   267   O  O     . GLY A 1 37   ? 91.852  93.066  135.370 1.00 114.65 ? 37   GLY A O     1 
ATOM   268   N  N     . ASN A 1 38   ? 92.116  93.758  137.497 1.00 111.81 ? 38   ASN A N     1 
ATOM   269   C  CA    . ASN A 1 38   ? 93.432  94.334  137.220 1.00 111.81 ? 38   ASN A CA    1 
ATOM   270   C  C     . ASN A 1 38   ? 94.422  93.320  136.658 1.00 111.81 ? 38   ASN A C     1 
ATOM   271   O  O     . ASN A 1 38   ? 95.097  93.640  135.661 1.00 111.81 ? 38   ASN A O     1 
ATOM   272   C  CB    . ASN A 1 38   ? 93.975  95.011  138.481 1.00 111.81 ? 38   ASN A CB    1 
ATOM   273   C  CG    . ASN A 1 38   ? 95.027  96.048  138.171 1.00 111.81 ? 38   ASN A CG    1 
ATOM   274   O  OD1   . ASN A 1 38   ? 94.904  96.801  137.207 1.00 111.81 ? 38   ASN A OD1   1 
ATOM   275   N  ND2   . ASN A 1 38   ? 96.074  96.089  138.984 1.00 111.81 ? 38   ASN A ND2   1 
ATOM   276   N  N     . PRO A 1 39   ? 94.581  92.118  137.225 1.00 108.27 ? 39   PRO A N     1 
ATOM   277   C  CA    . PRO A 1 39   ? 95.538  91.169  136.631 1.00 108.27 ? 39   PRO A CA    1 
ATOM   278   C  C     . PRO A 1 39   ? 95.194  90.786  135.209 1.00 108.27 ? 39   PRO A C     1 
ATOM   279   O  O     . PRO A 1 39   ? 96.089  90.741  134.356 1.00 108.27 ? 39   PRO A O     1 
ATOM   280   C  CB    . PRO A 1 39   ? 95.463  89.954  137.566 1.00 108.27 ? 39   PRO A CB    1 
ATOM   281   C  CG    . PRO A 1 39   ? 94.856  90.449  138.803 1.00 108.27 ? 39   PRO A CG    1 
ATOM   282   C  CD    . PRO A 1 39   ? 93.944  91.556  138.426 1.00 108.27 ? 39   PRO A CD    1 
ATOM   283   N  N     . LEU A 1 40   ? 93.922  90.491  134.931 1.00 104.60 ? 40   LEU A N     1 
ATOM   284   C  CA    . LEU A 1 40   ? 93.529  90.146  133.572 1.00 104.60 ? 40   LEU A CA    1 
ATOM   285   C  C     . LEU A 1 40   ? 93.794  91.299  132.616 1.00 104.60 ? 40   LEU A C     1 
ATOM   286   O  O     . LEU A 1 40   ? 94.252  91.082  131.491 1.00 104.60 ? 40   LEU A O     1 
ATOM   287   C  CB    . LEU A 1 40   ? 92.056  89.743  133.537 1.00 104.60 ? 40   LEU A CB    1 
ATOM   288   C  CG    . LEU A 1 40   ? 91.675  88.548  134.410 1.00 104.60 ? 40   LEU A CG    1 
ATOM   289   C  CD1   . LEU A 1 40   ? 90.284  88.055  134.063 1.00 104.60 ? 40   LEU A CD1   1 
ATOM   290   C  CD2   . LEU A 1 40   ? 92.692  87.430  134.259 1.00 104.60 ? 40   LEU A CD2   1 
ATOM   291   N  N     . ARG A 1 41   ? 93.529  92.533  133.051 1.00 104.89 ? 41   ARG A N     1 
ATOM   292   C  CA    . ARG A 1 41   ? 93.801  93.684  132.197 1.00 104.89 ? 41   ARG A CA    1 
ATOM   293   C  C     . ARG A 1 41   ? 95.286  93.801  131.887 1.00 104.89 ? 41   ARG A C     1 
ATOM   294   O  O     . ARG A 1 41   ? 95.674  93.980  130.725 1.00 104.89 ? 41   ARG A O     1 
ATOM   295   C  CB    . ARG A 1 41   ? 93.295  94.964  132.858 1.00 104.89 ? 41   ARG A CB    1 
ATOM   296   C  CG    . ARG A 1 41   ? 93.649  96.220  132.087 1.00 104.89 ? 41   ARG A CG    1 
ATOM   297   C  CD    . ARG A 1 41   ? 93.003  97.450  132.691 1.00 104.89 ? 41   ARG A CD    1 
ATOM   298   N  NE    . ARG A 1 41   ? 93.099  98.599  131.797 1.00 104.89 ? 41   ARG A NE    1 
ATOM   299   C  CZ    . ARG A 1 41   ? 94.179  99.364  131.678 1.00 104.89 ? 41   ARG A CZ    1 
ATOM   300   N  NH1   . ARG A 1 41   ? 95.261  99.105  132.398 1.00 104.89 ? 41   ARG A NH1   1 
ATOM   301   N  NH2   . ARG A 1 41   ? 94.177  100.388 130.838 1.00 104.89 ? 41   ARG A NH2   1 
ATOM   302   N  N     . ARG A 1 42   ? 96.133  93.698  132.912 1.00 106.59 ? 42   ARG A N     1 
ATOM   303   C  CA    . ARG A 1 42   ? 97.570  93.833  132.694 1.00 106.59 ? 42   ARG A CA    1 
ATOM   304   C  C     . ARG A 1 42   ? 98.095  92.719  131.796 1.00 106.59 ? 42   ARG A C     1 
ATOM   305   O  O     . ARG A 1 42   ? 98.928  92.957  130.913 1.00 106.59 ? 42   ARG A O     1 
ATOM   306   C  CB    . ARG A 1 42   ? 98.303  93.843  134.034 1.00 106.59 ? 42   ARG A CB    1 
ATOM   307   C  CG    . ARG A 1 42   ? 98.006  95.063  134.883 1.00 106.59 ? 42   ARG A CG    1 
ATOM   308   C  CD    . ARG A 1 42   ? 98.702  94.983  136.224 1.00 106.59 ? 42   ARG A CD    1 
ATOM   309   N  NE    . ARG A 1 42   ? 100.133 94.743  136.077 1.00 106.59 ? 42   ARG A NE    1 
ATOM   310   C  CZ    . ARG A 1 42   ? 101.038 95.704  135.932 1.00 106.59 ? 42   ARG A CZ    1 
ATOM   311   N  NH1   . ARG A 1 42   ? 100.660 96.973  135.920 1.00 106.59 ? 42   ARG A NH1   1 
ATOM   312   N  NH2   . ARG A 1 42   ? 102.320 95.398  135.803 1.00 106.59 ? 42   ARG A NH2   1 
ATOM   313   N  N     . ILE A 1 43   ? 97.604  91.495  131.993 1.00 105.52 ? 43   ILE A N     1 
ATOM   314   C  CA    . ILE A 1 43   ? 98.071  90.376  131.182 1.00 105.52 ? 43   ILE A CA    1 
ATOM   315   C  C     . ILE A 1 43   ? 97.616  90.532  129.737 1.00 105.52 ? 43   ILE A C     1 
ATOM   316   O  O     . ILE A 1 43   ? 98.394  90.311  128.802 1.00 105.52 ? 43   ILE A O     1 
ATOM   317   C  CB    . ILE A 1 43   ? 97.598  89.044  131.789 1.00 105.52 ? 43   ILE A CB    1 
ATOM   318   C  CG1   . ILE A 1 43   ? 98.308  88.794  133.118 1.00 105.52 ? 43   ILE A CG1   1 
ATOM   319   C  CG2   . ILE A 1 43   ? 97.856  87.898  130.829 1.00 105.52 ? 43   ILE A CG2   1 
ATOM   320   C  CD1   . ILE A 1 43   ? 97.995  87.454  133.735 1.00 105.52 ? 43   ILE A CD1   1 
ATOM   321   N  N     . LEU A 1 44   ? 96.355  90.919  129.526 1.00 103.35 ? 44   LEU A N     1 
ATOM   322   C  CA    . LEU A 1 44   ? 95.855  91.112  128.170 1.00 103.35 ? 44   LEU A CA    1 
ATOM   323   C  C     . LEU A 1 44   ? 96.605  92.227  127.457 1.00 103.35 ? 44   LEU A C     1 
ATOM   324   O  O     . LEU A 1 44   ? 96.858  92.139  126.251 1.00 103.35 ? 44   LEU A O     1 
ATOM   325   C  CB    . LEU A 1 44   ? 94.359  91.412  128.203 1.00 103.35 ? 44   LEU A CB    1 
ATOM   326   C  CG    . LEU A 1 44   ? 93.446  90.217  128.469 1.00 103.35 ? 44   LEU A CG    1 
ATOM   327   C  CD1   . LEU A 1 44   ? 92.031  90.683  128.745 1.00 103.35 ? 44   LEU A CD1   1 
ATOM   328   C  CD2   . LEU A 1 44   ? 93.477  89.260  127.296 1.00 103.35 ? 44   LEU A CD2   1 
ATOM   329   N  N     . LEU A 1 45   ? 96.967  93.285  128.181 1.00 103.79 ? 45   LEU A N     1 
ATOM   330   C  CA    . LEU A 1 45   ? 97.685  94.385  127.557 1.00 103.79 ? 45   LEU A CA    1 
ATOM   331   C  C     . LEU A 1 45   ? 99.173  94.109  127.396 1.00 103.79 ? 45   LEU A C     1 
ATOM   332   O  O     . LEU A 1 45   ? 99.833  94.804  126.617 1.00 103.79 ? 45   LEU A O     1 
ATOM   333   C  CB    . LEU A 1 45   ? 97.490  95.667  128.366 1.00 103.79 ? 45   LEU A CB    1 
ATOM   334   C  CG    . LEU A 1 45   ? 96.207  96.446  128.086 1.00 103.79 ? 45   LEU A CG    1 
ATOM   335   C  CD1   . LEU A 1 45   ? 96.165  97.719  128.910 1.00 103.79 ? 45   LEU A CD1   1 
ATOM   336   C  CD2   . LEU A 1 45   ? 96.096  96.761  126.608 1.00 103.79 ? 45   LEU A CD2   1 
ATOM   337   N  N     . SER A 1 46   ? 99.719  93.119  128.103 1.00 111.08 ? 46   SER A N     1 
ATOM   338   C  CA    . SER A 1 46   ? 101.160 92.903  128.128 1.00 111.08 ? 46   SER A CA    1 
ATOM   339   C  C     . SER A 1 46   ? 101.602 91.683  127.329 1.00 111.08 ? 46   SER A C     1 
ATOM   340   O  O     . SER A 1 46   ? 102.497 91.794  126.487 1.00 111.08 ? 46   SER A O     1 
ATOM   341   C  CB    . SER A 1 46   ? 101.637 92.783  129.581 1.00 111.08 ? 46   SER A CB    1 
ATOM   342   O  OG    . SER A 1 46   ? 101.110 91.620  130.195 1.00 111.08 ? 46   SER A OG    1 
ATOM   343   N  N     . SER A 1 47   ? 101.006 90.516  127.563 1.00 112.90 ? 47   SER A N     1 
ATOM   344   C  CA    . SER A 1 47   ? 101.604 89.269  127.105 1.00 112.90 ? 47   SER A CA    1 
ATOM   345   C  C     . SER A 1 47   ? 100.646 88.353  126.353 1.00 112.90 ? 47   SER A C     1 
ATOM   346   O  O     . SER A 1 47   ? 100.520 87.182  126.726 1.00 112.90 ? 47   SER A O     1 
ATOM   347   C  CB    . SER A 1 47   ? 102.193 88.508  128.296 1.00 112.90 ? 47   SER A CB    1 
ATOM   348   O  OG    . SER A 1 47   ? 102.479 87.166  127.948 1.00 112.90 ? 47   SER A OG    1 
ATOM   349   N  N     . ILE A 1 48   ? 99.975  88.837  125.313 1.00 110.12 ? 48   ILE A N     1 
ATOM   350   C  CA    . ILE A 1 48   ? 99.183  87.958  124.456 1.00 110.12 ? 48   ILE A CA    1 
ATOM   351   C  C     . ILE A 1 48   ? 99.928  87.763  123.140 1.00 110.12 ? 48   ILE A C     1 
ATOM   352   O  O     . ILE A 1 48   ? 100.361 88.748  122.524 1.00 110.12 ? 48   ILE A O     1 
ATOM   353   C  CB    . ILE A 1 48   ? 97.773  88.521  124.224 1.00 110.12 ? 48   ILE A CB    1 
ATOM   354   C  CG1   . ILE A 1 48   ? 96.995  88.546  125.537 1.00 110.12 ? 48   ILE A CG1   1 
ATOM   355   C  CG2   . ILE A 1 48   ? 97.029  87.681  123.205 1.00 110.12 ? 48   ILE A CG2   1 
ATOM   356   C  CD1   . ILE A 1 48   ? 96.876  87.193  126.194 1.00 110.12 ? 48   ILE A CD1   1 
ATOM   357   N  N     . PRO A 1 49   ? 100.106 86.528  122.673 1.00 108.15 ? 49   PRO A N     1 
ATOM   358   C  CA    . PRO A 1 49   ? 100.849 86.311  121.427 1.00 108.15 ? 49   PRO A CA    1 
ATOM   359   C  C     . PRO A 1 49   ? 100.045 86.741  120.209 1.00 108.15 ? 49   PRO A C     1 
ATOM   360   O  O     . PRO A 1 49   ? 98.822  86.602  120.153 1.00 108.15 ? 49   PRO A O     1 
ATOM   361   C  CB    . PRO A 1 49   ? 101.102 84.797  121.419 1.00 108.15 ? 49   PRO A CB    1 
ATOM   362   C  CG    . PRO A 1 49   ? 100.784 84.328  122.809 1.00 108.15 ? 49   PRO A CG    1 
ATOM   363   C  CD    . PRO A 1 49   ? 99.740  85.260  123.319 1.00 108.15 ? 49   PRO A CD    1 
ATOM   364   N  N     . GLY A 1 50   ? 100.758 87.265  119.220 1.00 112.81 ? 50   GLY A N     1 
ATOM   365   C  CA    . GLY A 1 50   ? 100.133 87.706  117.995 1.00 112.81 ? 50   GLY A CA    1 
ATOM   366   C  C     . GLY A 1 50   ? 101.123 87.730  116.852 1.00 112.81 ? 50   GLY A C     1 
ATOM   367   O  O     . GLY A 1 50   ? 102.225 87.186  116.947 1.00 112.81 ? 50   GLY A O     1 
ATOM   368   N  N     . THR A 1 51   ? 100.714 88.375  115.762 1.00 113.08 ? 51   THR A N     1 
ATOM   369   C  CA    . THR A 1 51   ? 101.522 88.467  114.555 1.00 113.08 ? 51   THR A CA    1 
ATOM   370   C  C     . THR A 1 51   ? 101.757 89.927  114.199 1.00 113.08 ? 51   THR A C     1 
ATOM   371   O  O     . THR A 1 51   ? 100.944 90.799  114.515 1.00 113.08 ? 51   THR A O     1 
ATOM   372   C  CB    . THR A 1 51   ? 100.855 87.759  113.370 1.00 113.08 ? 51   THR A CB    1 
ATOM   373   O  OG1   . THR A 1 51   ? 99.717  88.515  112.941 1.00 113.08 ? 51   THR A OG1   1 
ATOM   374   C  CG2   . THR A 1 51   ? 100.408 86.362  113.762 1.00 113.08 ? 51   THR A CG2   1 
ATOM   375   N  N     . ALA A 1 52   ? 102.882 90.185  113.534 1.00 111.29 ? 52   ALA A N     1 
ATOM   376   C  CA    . ALA A 1 52   ? 103.223 91.529  113.095 1.00 111.29 ? 52   ALA A CA    1 
ATOM   377   C  C     . ALA A 1 52   ? 104.237 91.446  111.965 1.00 111.29 ? 52   ALA A C     1 
ATOM   378   O  O     . ALA A 1 52   ? 104.989 90.475  111.857 1.00 111.29 ? 52   ALA A O     1 
ATOM   379   C  CB    . ALA A 1 52   ? 103.782 92.374  114.244 1.00 111.29 ? 52   ALA A CB    1 
ATOM   380   N  N     . VAL A 1 53   ? 104.252 92.482  111.127 1.00 110.20 ? 53   VAL A N     1 
ATOM   381   C  CA    . VAL A 1 53   ? 105.181 92.520  110.003 1.00 110.20 ? 53   VAL A CA    1 
ATOM   382   C  C     . VAL A 1 53   ? 106.579 92.807  110.528 1.00 110.20 ? 53   VAL A C     1 
ATOM   383   O  O     . VAL A 1 53   ? 106.803 93.799  111.232 1.00 110.20 ? 53   VAL A O     1 
ATOM   384   C  CB    . VAL A 1 53   ? 104.743 93.567  108.977 1.00 110.20 ? 53   VAL A CB    1 
ATOM   385   C  CG1   . VAL A 1 53   ? 105.845 93.802  107.962 1.00 110.20 ? 53   VAL A CG1   1 
ATOM   386   C  CG2   . VAL A 1 53   ? 103.465 93.123  108.287 1.00 110.20 ? 53   VAL A CG2   1 
ATOM   387   N  N     . THR A 1 54   ? 107.531 91.940  110.184 1.00 117.14 ? 54   THR A N     1 
ATOM   388   C  CA    . THR A 1 54   ? 108.893 92.076  110.680 1.00 117.14 ? 54   THR A CA    1 
ATOM   389   C  C     . THR A 1 54   ? 109.884 92.555  109.631 1.00 117.14 ? 54   THR A C     1 
ATOM   390   O  O     . THR A 1 54   ? 110.787 93.327  109.970 1.00 117.14 ? 54   THR A O     1 
ATOM   391   C  CB    . THR A 1 54   ? 109.391 90.745  111.252 1.00 117.14 ? 54   THR A CB    1 
ATOM   392   O  OG1   . THR A 1 54   ? 109.741 89.865  110.178 1.00 117.14 ? 54   THR A OG1   1 
ATOM   393   C  CG2   . THR A 1 54   ? 108.317 90.099  112.106 1.00 117.14 ? 54   THR A CG2   1 
ATOM   394   N  N     . SER A 1 55   ? 109.754 92.127  108.377 1.00 120.66 ? 55   SER A N     1 
ATOM   395   C  CA    . SER A 1 55   ? 110.744 92.530  107.387 1.00 120.66 ? 55   SER A CA    1 
ATOM   396   C  C     . SER A 1 55   ? 110.044 92.985  106.117 1.00 120.66 ? 55   SER A C     1 
ATOM   397   O  O     . SER A 1 55   ? 108.929 92.555  105.823 1.00 120.66 ? 55   SER A O     1 
ATOM   398   C  CB    . SER A 1 55   ? 111.718 91.392  107.074 1.00 120.66 ? 55   SER A CB    1 
ATOM   399   O  OG    . SER A 1 55   ? 112.334 91.587  105.815 1.00 120.66 ? 55   SER A OG    1 
ATOM   400   N  N     . VAL A 1 56   ? 110.722 93.845  105.361 1.00 117.62 ? 56   VAL A N     1 
ATOM   401   C  CA    . VAL A 1 56   ? 110.209 94.369  104.099 1.00 117.62 ? 56   VAL A CA    1 
ATOM   402   C  C     . VAL A 1 56   ? 111.363 94.456  103.111 1.00 117.62 ? 56   VAL A C     1 
ATOM   403   O  O     . VAL A 1 56   ? 112.448 94.932  103.460 1.00 117.62 ? 56   VAL A O     1 
ATOM   404   C  CB    . VAL A 1 56   ? 109.549 95.753  104.268 1.00 117.62 ? 56   VAL A CB    1 
ATOM   405   C  CG1   . VAL A 1 56   ? 109.172 96.330  102.917 1.00 117.62 ? 56   VAL A CG1   1 
ATOM   406   C  CG2   . VAL A 1 56   ? 108.321 95.663  105.157 1.00 117.62 ? 56   VAL A CG2   1 
ATOM   407   N  N     . TYR A 1 57   ? 111.134 94.000  101.882 1.00 124.19 ? 57   TYR A N     1 
ATOM   408   C  CA    . TYR A 1 57   ? 112.115 94.105  100.809 1.00 124.19 ? 57   TYR A CA    1 
ATOM   409   C  C     . TYR A 1 57   ? 111.423 94.623  99.559  1.00 124.19 ? 57   TYR A C     1 
ATOM   410   O  O     . TYR A 1 57   ? 110.551 93.947  99.005  1.00 124.19 ? 57   TYR A O     1 
ATOM   411   C  CB    . TYR A 1 57   ? 112.776 92.756  100.528 1.00 124.19 ? 57   TYR A CB    1 
ATOM   412   C  CG    . TYR A 1 57   ? 113.463 92.704  99.185  1.00 124.19 ? 57   TYR A CG    1 
ATOM   413   C  CD1   . TYR A 1 57   ? 114.631 93.415  98.954  1.00 124.19 ? 57   TYR A CD1   1 
ATOM   414   C  CD2   . TYR A 1 57   ? 112.937 91.952  98.145  1.00 124.19 ? 57   TYR A CD2   1 
ATOM   415   C  CE1   . TYR A 1 57   ? 115.259 93.373  97.727  1.00 124.19 ? 57   TYR A CE1   1 
ATOM   416   C  CE2   . TYR A 1 57   ? 113.558 91.906  96.915  1.00 124.19 ? 57   TYR A CE2   1 
ATOM   417   C  CZ    . TYR A 1 57   ? 114.719 92.617  96.711  1.00 124.19 ? 57   TYR A CZ    1 
ATOM   418   O  OH    . TYR A 1 57   ? 115.342 92.573  95.486  1.00 124.19 ? 57   TYR A OH    1 
ATOM   419   N  N     . ILE A 1 58   ? 111.813 95.814  99.116  1.00 127.79 ? 58   ILE A N     1 
ATOM   420   C  CA    . ILE A 1 58   ? 111.266 96.433  97.915  1.00 127.79 ? 58   ILE A CA    1 
ATOM   421   C  C     . ILE A 1 58   ? 112.326 96.377  96.827  1.00 127.79 ? 58   ILE A C     1 
ATOM   422   O  O     . ILE A 1 58   ? 113.503 96.661  97.083  1.00 127.79 ? 58   ILE A O     1 
ATOM   423   C  CB    . ILE A 1 58   ? 110.822 97.881  98.177  1.00 127.79 ? 58   ILE A CB    1 
ATOM   424   C  CG1   . ILE A 1 58   ? 109.899 97.941  99.392  1.00 127.79 ? 58   ILE A CG1   1 
ATOM   425   C  CG2   . ILE A 1 58   ? 110.116 98.444  96.959  1.00 127.79 ? 58   ILE A CG2   1 
ATOM   426   C  CD1   . ILE A 1 58   ? 109.481 99.340  99.764  1.00 127.79 ? 58   ILE A CD1   1 
ATOM   427   N  N     . GLU A 1 59   ? 111.912 96.010  95.618  1.00 136.28 ? 59   GLU A N     1 
ATOM   428   C  CA    . GLU A 1 59   ? 112.848 95.892  94.510  1.00 136.28 ? 59   GLU A CA    1 
ATOM   429   C  C     . GLU A 1 59   ? 113.403 97.259  94.128  1.00 136.28 ? 59   GLU A C     1 
ATOM   430   O  O     . GLU A 1 59   ? 112.674 98.254  94.086  1.00 136.28 ? 59   GLU A O     1 
ATOM   431   C  CB    . GLU A 1 59   ? 112.163 95.245  93.309  1.00 136.28 ? 59   GLU A CB    1 
ATOM   432   C  CG    . GLU A 1 59   ? 113.117 94.765  92.234  1.00 136.28 ? 59   GLU A CG    1 
ATOM   433   C  CD    . GLU A 1 59   ? 112.399 94.114  91.071  1.00 136.28 ? 59   GLU A CD    1 
ATOM   434   O  OE1   . GLU A 1 59   ? 111.151 94.064  91.096  1.00 136.28 ? 59   GLU A OE1   1 
ATOM   435   O  OE2   . GLU A 1 59   ? 113.080 93.654  90.131  1.00 136.28 ? 59   GLU A OE2   1 
ATOM   436   N  N     . ASP A 1 60   ? 114.710 97.300  93.859  1.00 135.63 ? 60   ASP A N     1 
ATOM   437   C  CA    . ASP A 1 60   ? 115.421 98.530  93.502  1.00 135.63 ? 60   ASP A CA    1 
ATOM   438   C  C     . ASP A 1 60   ? 115.324 99.585  94.599  1.00 135.63 ? 60   ASP A C     1 
ATOM   439   O  O     . ASP A 1 60   ? 115.167 100.775 94.319  1.00 135.63 ? 60   ASP A O     1 
ATOM   440   C  CB    . ASP A 1 60   ? 114.925 99.102  92.170  1.00 135.63 ? 60   ASP A CB    1 
ATOM   441   C  CG    . ASP A 1 60   ? 114.834 98.053  91.083  1.00 135.63 ? 60   ASP A CG    1 
ATOM   442   O  OD1   . ASP A 1 60   ? 113.719 97.553  90.831  1.00 135.63 ? 60   ASP A OD1   1 
ATOM   443   O  OD2   . ASP A 1 60   ? 115.879 97.728  90.481  1.00 135.63 ? 60   ASP A OD2   1 
ATOM   444   N  N     . VAL A 1 61   ? 115.415 99.159  95.855  1.00 126.52 ? 61   VAL A N     1 
ATOM   445   C  CA    . VAL A 1 61   ? 115.434 100.059 97.002  1.00 126.52 ? 61   VAL A CA    1 
ATOM   446   C  C     . VAL A 1 61   ? 116.566 99.613  97.914  1.00 126.52 ? 61   VAL A C     1 
ATOM   447   O  O     . VAL A 1 61   ? 116.648 98.433  98.274  1.00 126.52 ? 61   VAL A O     1 
ATOM   448   C  CB    . VAL A 1 61   ? 114.096 100.068 97.757  1.00 126.52 ? 61   VAL A CB    1 
ATOM   449   C  CG1   . VAL A 1 61   ? 114.226 100.846 99.053  1.00 126.52 ? 61   VAL A CG1   1 
ATOM   450   C  CG2   . VAL A 1 61   ? 113.006 100.669 96.888  1.00 126.52 ? 61   VAL A CG2   1 
ATOM   451   N  N     . LEU A 1 62   ? 117.436 100.548 98.285  1.00 120.14 ? 62   LEU A N     1 
ATOM   452   C  CA    . LEU A 1 62   ? 118.629 100.203 99.044  1.00 120.14 ? 62   LEU A CA    1 
ATOM   453   C  C     . LEU A 1 62   ? 118.506 100.480 100.535 1.00 120.14 ? 62   LEU A C     1 
ATOM   454   O  O     . LEU A 1 62   ? 119.209 99.840  101.324 1.00 120.14 ? 62   LEU A O     1 
ATOM   455   C  CB    . LEU A 1 62   ? 119.840 100.956 98.488  1.00 120.14 ? 62   LEU A CB    1 
ATOM   456   C  CG    . LEU A 1 62   ? 120.159 100.704 97.014  1.00 120.14 ? 62   LEU A CG    1 
ATOM   457   C  CD1   . LEU A 1 62   ? 121.466 101.374 96.625  1.00 120.14 ? 62   LEU A CD1   1 
ATOM   458   C  CD2   . LEU A 1 62   ? 120.214 99.214  96.730  1.00 120.14 ? 62   LEU A CD2   1 
ATOM   459   N  N     . HIS A 1 63   ? 117.639 101.399 100.944 1.00 118.78 ? 63   HIS A N     1 
ATOM   460   C  CA    . HIS A 1 63   ? 117.538 101.764 102.353 1.00 118.78 ? 63   HIS A CA    1 
ATOM   461   C  C     . HIS A 1 63   ? 116.187 102.427 102.590 1.00 118.78 ? 63   HIS A C     1 
ATOM   462   O  O     . HIS A 1 63   ? 115.421 102.681 101.656 1.00 118.78 ? 63   HIS A O     1 
ATOM   463   C  CB    . HIS A 1 63   ? 118.691 102.676 102.772 1.00 118.78 ? 63   HIS A CB    1 
ATOM   464   C  CG    . HIS A 1 63   ? 119.010 103.743 101.774 1.00 118.78 ? 63   HIS A CG    1 
ATOM   465   N  ND1   . HIS A 1 63   ? 118.431 104.992 101.809 1.00 118.78 ? 63   HIS A ND1   1 
ATOM   466   C  CD2   . HIS A 1 63   ? 119.849 103.746 100.711 1.00 118.78 ? 63   HIS A CD2   1 
ATOM   467   C  CE1   . HIS A 1 63   ? 118.899 105.720 100.812 1.00 118.78 ? 63   HIS A CE1   1 
ATOM   468   N  NE2   . HIS A 1 63   ? 119.762 104.988 100.131 1.00 118.78 ? 63   HIS A NE2   1 
ATOM   469   N  N     . GLU A 1 64   ? 115.902 102.703 103.866 1.00 125.16 ? 64   GLU A N     1 
ATOM   470   C  CA    . GLU A 1 64   ? 114.625 103.296 104.247 1.00 125.16 ? 64   GLU A CA    1 
ATOM   471   C  C     . GLU A 1 64   ? 114.442 104.689 103.663 1.00 125.16 ? 64   GLU A C     1 
ATOM   472   O  O     . GLU A 1 64   ? 113.322 105.065 103.302 1.00 125.16 ? 64   GLU A O     1 
ATOM   473   C  CB    . GLU A 1 64   ? 114.514 103.361 105.769 1.00 125.16 ? 64   GLU A CB    1 
ATOM   474   C  CG    . GLU A 1 64   ? 114.449 102.011 106.446 1.00 125.16 ? 64   GLU A CG    1 
ATOM   475   C  CD    . GLU A 1 64   ? 114.394 102.118 107.956 1.00 125.16 ? 64   GLU A CD    1 
ATOM   476   O  OE1   . GLU A 1 64   ? 114.544 103.242 108.475 1.00 125.16 ? 64   GLU A OE1   1 
ATOM   477   O  OE2   . GLU A 1 64   ? 114.200 101.080 108.623 1.00 125.16 ? 64   GLU A OE2   1 
ATOM   478   N  N     . PHE A 1 65   ? 115.515 105.465 103.569 1.00 117.86 ? 65   PHE A N     1 
ATOM   479   C  CA    . PHE A 1 65   ? 115.433 106.860 103.163 1.00 117.86 ? 65   PHE A CA    1 
ATOM   480   C  C     . PHE A 1 65   ? 115.500 107.039 101.654 1.00 117.86 ? 65   PHE A C     1 
ATOM   481   O  O     . PHE A 1 65   ? 115.851 108.126 101.185 1.00 117.86 ? 65   PHE A O     1 
ATOM   482   C  CB    . PHE A 1 65   ? 116.547 107.663 103.838 1.00 117.86 ? 65   PHE A CB    1 
ATOM   483   C  CG    . PHE A 1 65   ? 116.811 107.249 105.256 1.00 117.86 ? 65   PHE A CG    1 
ATOM   484   C  CD1   . PHE A 1 65   ? 117.774 106.298 105.546 1.00 117.86 ? 65   PHE A CD1   1 
ATOM   485   C  CD2   . PHE A 1 65   ? 116.088 107.801 106.297 1.00 117.86 ? 65   PHE A CD2   1 
ATOM   486   C  CE1   . PHE A 1 65   ? 118.015 105.913 106.848 1.00 117.86 ? 65   PHE A CE1   1 
ATOM   487   C  CE2   . PHE A 1 65   ? 116.324 107.419 107.600 1.00 117.86 ? 65   PHE A CE2   1 
ATOM   488   C  CZ    . PHE A 1 65   ? 117.289 106.474 107.876 1.00 117.86 ? 65   PHE A CZ    1 
ATOM   489   N  N     . SER A 1 66   ? 115.176 106.003 100.887 1.00 121.41 ? 66   SER A N     1 
ATOM   490   C  CA    . SER A 1 66   ? 115.185 106.105 99.438  1.00 121.41 ? 66   SER A CA    1 
ATOM   491   C  C     . SER A 1 66   ? 113.849 106.653 98.941  1.00 121.41 ? 66   SER A C     1 
ATOM   492   O  O     . SER A 1 66   ? 113.007 107.124 99.710  1.00 121.41 ? 66   SER A O     1 
ATOM   493   C  CB    . SER A 1 66   ? 115.483 104.744 98.815  1.00 121.41 ? 66   SER A CB    1 
ATOM   494   O  OG    . SER A 1 66   ? 115.146 104.732 97.440  1.00 121.41 ? 66   SER A OG    1 
ATOM   495   N  N     . THR A 1 67   ? 113.662 106.593 97.626  1.00 122.91 ? 67   THR A N     1 
ATOM   496   C  CA    . THR A 1 67   ? 112.422 107.015 96.992  1.00 122.91 ? 67   THR A CA    1 
ATOM   497   C  C     . THR A 1 67   ? 112.262 106.231 95.699  1.00 122.91 ? 67   THR A C     1 
ATOM   498   O  O     . THR A 1 67   ? 113.237 106.012 94.976  1.00 122.91 ? 67   THR A O     1 
ATOM   499   C  CB    . THR A 1 67   ? 112.411 108.521 96.707  1.00 122.91 ? 67   THR A CB    1 
ATOM   500   O  OG1   . THR A 1 67   ? 112.777 109.238 97.892  1.00 122.91 ? 67   THR A OG1   1 
ATOM   501   C  CG2   . THR A 1 67   ? 111.029 108.968 96.265  1.00 122.91 ? 67   THR A CG2   1 
ATOM   502   N  N     . ILE A 1 68   ? 111.038 105.815 95.415  1.00 126.19 ? 68   ILE A N     1 
ATOM   503   C  CA    . ILE A 1 68   ? 110.727 104.970 94.266  1.00 126.19 ? 68   ILE A CA    1 
ATOM   504   C  C     . ILE A 1 68   ? 110.130 105.849 93.176  1.00 126.19 ? 68   ILE A C     1 
ATOM   505   O  O     . ILE A 1 68   ? 109.197 106.611 93.455  1.00 126.19 ? 68   ILE A O     1 
ATOM   506   C  CB    . ILE A 1 68   ? 109.754 103.835 94.638  1.00 126.19 ? 68   ILE A CB    1 
ATOM   507   C  CG1   . ILE A 1 68   ? 110.068 103.307 96.037  1.00 126.19 ? 68   ILE A CG1   1 
ATOM   508   C  CG2   . ILE A 1 68   ? 109.827 102.716 93.615  1.00 126.19 ? 68   ILE A CG2   1 
ATOM   509   C  CD1   . ILE A 1 68   ? 109.034 102.344 96.569  1.00 126.19 ? 68   ILE A CD1   1 
ATOM   510   N  N     . PRO A 1 69   ? 110.628 105.783 91.944  1.00 127.67 ? 69   PRO A N     1 
ATOM   511   C  CA    . PRO A 1 69   ? 110.031 106.579 90.865  1.00 127.67 ? 69   PRO A CA    1 
ATOM   512   C  C     . PRO A 1 69   ? 108.644 106.063 90.513  1.00 127.67 ? 69   PRO A C     1 
ATOM   513   O  O     . PRO A 1 69   ? 108.441 104.865 90.309  1.00 127.67 ? 69   PRO A O     1 
ATOM   514   C  CB    . PRO A 1 69   ? 111.016 106.400 89.702  1.00 127.67 ? 69   PRO A CB    1 
ATOM   515   C  CG    . PRO A 1 69   ? 112.264 105.831 90.316  1.00 127.67 ? 69   PRO A CG    1 
ATOM   516   C  CD    . PRO A 1 69   ? 111.808 105.033 91.489  1.00 127.67 ? 69   PRO A CD    1 
ATOM   517   N  N     . GLY A 1 70   ? 107.686 106.984 90.443  1.00 129.71 ? 70   GLY A N     1 
ATOM   518   C  CA    . GLY A 1 70   ? 106.311 106.647 90.167  1.00 129.71 ? 70   GLY A CA    1 
ATOM   519   C  C     . GLY A 1 70   ? 105.458 106.397 91.392  1.00 129.71 ? 70   GLY A C     1 
ATOM   520   O  O     . GLY A 1 70   ? 104.253 106.168 91.253  1.00 129.71 ? 70   GLY A O     1 
ATOM   521   N  N     . VAL A 1 71   ? 106.044 106.430 92.584  1.00 125.71 ? 71   VAL A N     1 
ATOM   522   C  CA    . VAL A 1 71   ? 105.308 106.262 93.830  1.00 125.71 ? 71   VAL A CA    1 
ATOM   523   C  C     . VAL A 1 71   ? 105.250 107.604 94.539  1.00 125.71 ? 71   VAL A C     1 
ATOM   524   O  O     . VAL A 1 71   ? 106.272 108.287 94.683  1.00 125.71 ? 71   VAL A O     1 
ATOM   525   C  CB    . VAL A 1 71   ? 105.963 105.194 94.725  1.00 125.71 ? 71   VAL A CB    1 
ATOM   526   C  CG1   . VAL A 1 71   ? 105.203 105.059 96.033  1.00 125.71 ? 71   VAL A CG1   1 
ATOM   527   C  CG2   . VAL A 1 71   ? 106.034 103.863 94.002  1.00 125.71 ? 71   VAL A CG2   1 
ATOM   528   N  N     . LYS A 1 72   ? 104.056 107.987 94.989  1.00 126.35 ? 72   LYS A N     1 
ATOM   529   C  CA    . LYS A 1 72   ? 103.902 109.277 95.652  1.00 126.35 ? 72   LYS A CA    1 
ATOM   530   C  C     . LYS A 1 72   ? 104.577 109.284 97.017  1.00 126.35 ? 72   LYS A C     1 
ATOM   531   O  O     . LYS A 1 72   ? 105.201 110.277 97.405  1.00 126.35 ? 72   LYS A O     1 
ATOM   532   C  CB    . LYS A 1 72   ? 102.421 109.630 95.784  1.00 126.35 ? 72   LYS A CB    1 
ATOM   533   C  CG    . LYS A 1 72   ? 102.163 110.914 96.552  1.00 126.35 ? 72   LYS A CG    1 
ATOM   534   C  CD    . LYS A 1 72   ? 100.679 111.154 96.752  1.00 126.35 ? 72   LYS A CD    1 
ATOM   535   C  CE    . LYS A 1 72   ? 100.429 112.109 97.905  1.00 126.35 ? 72   LYS A CE    1 
ATOM   536   N  NZ    . LYS A 1 72   ? 98.983  112.196 98.244  1.00 126.35 ? 72   LYS A NZ    1 
ATOM   537   N  N     . GLU A 1 73   ? 104.466 108.186 97.757  1.00 130.76 ? 73   GLU A N     1 
ATOM   538   C  CA    . GLU A 1 73   ? 105.065 108.106 99.081  1.00 130.76 ? 73   GLU A CA    1 
ATOM   539   C  C     . GLU A 1 73   ? 106.505 107.625 98.986  1.00 130.76 ? 73   GLU A C     1 
ATOM   540   O  O     . GLU A 1 73   ? 106.905 107.002 97.999  1.00 130.76 ? 73   GLU A O     1 
ATOM   541   C  CB    . GLU A 1 73   ? 104.265 107.158 99.974  1.00 130.76 ? 73   GLU A CB    1 
ATOM   542   C  CG    . GLU A 1 73   ? 102.841 107.600 100.244 1.00 130.76 ? 73   GLU A CG    1 
ATOM   543   C  CD    . GLU A 1 73   ? 101.866 107.058 99.220  1.00 130.76 ? 73   GLU A CD    1 
ATOM   544   O  OE1   . GLU A 1 73   ? 102.309 106.336 98.304  1.00 130.76 ? 73   GLU A OE1   1 
ATOM   545   O  OE2   . GLU A 1 73   ? 100.657 107.349 99.333  1.00 130.76 ? 73   GLU A OE2   1 
ATOM   546   N  N     . ASP A 1 74   ? 107.286 107.926 100.016 1.00 127.84 ? 74   ASP A N     1 
ATOM   547   C  CA    . ASP A 1 74   ? 108.615 107.351 100.127 1.00 127.84 ? 74   ASP A CA    1 
ATOM   548   C  C     . ASP A 1 74   ? 108.558 106.053 100.928 1.00 127.84 ? 74   ASP A C     1 
ATOM   549   O  O     . ASP A 1 74   ? 107.498 105.622 101.389 1.00 127.84 ? 74   ASP A O     1 
ATOM   550   C  CB    . ASP A 1 74   ? 109.579 108.345 100.771 1.00 127.84 ? 74   ASP A CB    1 
ATOM   551   C  CG    . ASP A 1 74   ? 109.020 108.967 102.031 1.00 127.84 ? 74   ASP A CG    1 
ATOM   552   O  OD1   . ASP A 1 74   ? 107.858 108.670 102.376 1.00 127.84 ? 74   ASP A OD1   1 
ATOM   553   O  OD2   . ASP A 1 74   ? 109.740 109.760 102.673 1.00 127.84 ? 74   ASP A OD2   1 
ATOM   554   N  N     . VAL A 1 75   ? 109.722 105.421 101.086 1.00 120.52 ? 75   VAL A N     1 
ATOM   555   C  CA    . VAL A 1 75   ? 109.768 104.108 101.723 1.00 120.52 ? 75   VAL A CA    1 
ATOM   556   C  C     . VAL A 1 75   ? 109.374 104.209 103.191 1.00 120.52 ? 75   VAL A C     1 
ATOM   557   O  O     . VAL A 1 75   ? 108.766 103.288 103.751 1.00 120.52 ? 75   VAL A O     1 
ATOM   558   C  CB    . VAL A 1 75   ? 111.163 103.481 101.544 1.00 120.52 ? 75   VAL A CB    1 
ATOM   559   C  CG1   . VAL A 1 75   ? 111.266 102.169 102.302 1.00 120.52 ? 75   VAL A CG1   1 
ATOM   560   C  CG2   . VAL A 1 75   ? 111.457 103.270 100.071 1.00 120.52 ? 75   VAL A CG2   1 
ATOM   561   N  N     . VAL A 1 76   ? 109.703 105.331 103.836 1.00 117.76 ? 76   VAL A N     1 
ATOM   562   C  CA    . VAL A 1 76   ? 109.344 105.516 105.241 1.00 117.76 ? 76   VAL A CA    1 
ATOM   563   C  C     . VAL A 1 76   ? 107.830 105.464 105.415 1.00 117.76 ? 76   VAL A C     1 
ATOM   564   O  O     . VAL A 1 76   ? 107.311 104.787 106.312 1.00 117.76 ? 76   VAL A O     1 
ATOM   565   C  CB    . VAL A 1 76   ? 109.929 106.834 105.774 1.00 117.76 ? 76   VAL A CB    1 
ATOM   566   C  CG1   . VAL A 1 76   ? 109.407 107.117 107.170 1.00 117.76 ? 76   VAL A CG1   1 
ATOM   567   C  CG2   . VAL A 1 76   ? 111.444 106.776 105.771 1.00 117.76 ? 76   VAL A CG2   1 
ATOM   568   N  N     . GLU A 1 77   ? 107.098 106.172 104.554 1.00 123.30 ? 77   GLU A N     1 
ATOM   569   C  CA    . GLU A 1 77   ? 105.643 106.172 104.655 1.00 123.30 ? 77   GLU A CA    1 
ATOM   570   C  C     . GLU A 1 77   ? 105.065 104.809 104.304 1.00 123.30 ? 77   GLU A C     1 
ATOM   571   O  O     . GLU A 1 77   ? 104.072 104.379 104.901 1.00 123.30 ? 77   GLU A O     1 
ATOM   572   C  CB    . GLU A 1 77   ? 105.052 107.255 103.755 1.00 123.30 ? 77   GLU A CB    1 
ATOM   573   C  CG    . GLU A 1 77   ? 104.694 108.535 104.489 1.00 123.30 ? 77   GLU A CG    1 
ATOM   574   C  CD    . GLU A 1 77   ? 104.584 109.729 103.561 1.00 123.30 ? 77   GLU A CD    1 
ATOM   575   O  OE1   . GLU A 1 77   ? 104.498 110.868 104.064 1.00 123.30 ? 77   GLU A OE1   1 
ATOM   576   O  OE2   . GLU A 1 77   ? 104.585 109.528 102.329 1.00 123.30 ? 77   GLU A OE2   1 
ATOM   577   N  N     . ILE A 1 78   ? 105.675 104.111 103.345 1.00 116.77 ? 78   ILE A N     1 
ATOM   578   C  CA    . ILE A 1 78   ? 105.213 102.770 102.997 1.00 116.77 ? 78   ILE A CA    1 
ATOM   579   C  C     . ILE A 1 78   ? 105.350 101.840 104.195 1.00 116.77 ? 78   ILE A C     1 
ATOM   580   O  O     . ILE A 1 78   ? 104.453 101.044 104.493 1.00 116.77 ? 78   ILE A O     1 
ATOM   581   C  CB    . ILE A 1 78   ? 105.981 102.236 101.776 1.00 116.77 ? 78   ILE A CB    1 
ATOM   582   C  CG1   . ILE A 1 78   ? 105.630 103.048 100.531 1.00 116.77 ? 78   ILE A CG1   1 
ATOM   583   C  CG2   . ILE A 1 78   ? 105.674 100.769 101.551 1.00 116.77 ? 78   ILE A CG2   1 
ATOM   584   C  CD1   . ILE A 1 78   ? 106.424 102.658 99.309  1.00 116.77 ? 78   ILE A CD1   1 
ATOM   585   N  N     . ILE A 1 79   ? 106.467 101.946 104.915 1.00 114.28 ? 79   ILE A N     1 
ATOM   586   C  CA    . ILE A 1 79   ? 106.681 101.099 106.085 1.00 114.28 ? 79   ILE A CA    1 
ATOM   587   C  C     . ILE A 1 79   ? 105.719 101.477 107.204 1.00 114.28 ? 79   ILE A C     1 
ATOM   588   O  O     . ILE A 1 79   ? 105.180 100.607 107.901 1.00 114.28 ? 79   ILE A O     1 
ATOM   589   C  CB    . ILE A 1 79   ? 108.149 101.191 106.537 1.00 114.28 ? 79   ILE A CB    1 
ATOM   590   C  CG1   . ILE A 1 79   ? 109.054 100.467 105.541 1.00 114.28 ? 79   ILE A CG1   1 
ATOM   591   C  CG2   . ILE A 1 79   ? 108.322 100.616 107.930 1.00 114.28 ? 79   ILE A CG2   1 
ATOM   592   C  CD1   . ILE A 1 79   ? 110.508 100.461 105.939 1.00 114.28 ? 79   ILE A CD1   1 
ATOM   593   N  N     . LEU A 1 80   ? 105.489 102.777 107.398 1.00 111.79 ? 80   LEU A N     1 
ATOM   594   C  CA    . LEU A 1 80   ? 104.562 103.212 108.438 1.00 111.79 ? 80   LEU A CA    1 
ATOM   595   C  C     . LEU A 1 80   ? 103.142 102.754 108.137 1.00 111.79 ? 80   LEU A C     1 
ATOM   596   O  O     . LEU A 1 80   ? 102.362 102.479 109.055 1.00 111.79 ? 80   LEU A O     1 
ATOM   597   C  CB    . LEU A 1 80   ? 104.619 104.731 108.588 1.00 111.79 ? 80   LEU A CB    1 
ATOM   598   C  CG    . LEU A 1 80   ? 105.403 105.248 109.792 1.00 111.79 ? 80   LEU A CG    1 
ATOM   599   C  CD1   . LEU A 1 80   ? 106.822 104.709 109.780 1.00 111.79 ? 80   LEU A CD1   1 
ATOM   600   C  CD2   . LEU A 1 80   ? 105.410 106.764 109.797 1.00 111.79 ? 80   LEU A CD2   1 
ATOM   601   N  N     . ASN A 1 81   ? 102.787 102.666 106.854 1.00 113.79 ? 81   ASN A N     1 
ATOM   602   C  CA    . ASN A 1 81   ? 101.478 102.136 106.491 1.00 113.79 ? 81   ASN A CA    1 
ATOM   603   C  C     . ASN A 1 81   ? 101.426 100.627 106.679 1.00 113.79 ? 81   ASN A C     1 
ATOM   604   O  O     . ASN A 1 81   ? 100.423 100.089 107.162 1.00 113.79 ? 81   ASN A O     1 
ATOM   605   C  CB    . ASN A 1 81   ? 101.145 102.509 105.048 1.00 113.79 ? 81   ASN A CB    1 
ATOM   606   C  CG    . ASN A 1 81   ? 100.635 103.925 104.918 1.00 113.79 ? 81   ASN A CG    1 
ATOM   607   O  OD1   . ASN A 1 81   ? 100.464 104.628 105.913 1.00 113.79 ? 81   ASN A OD1   1 
ATOM   608   N  ND2   . ASN A 1 81   ? 100.389 104.356 103.687 1.00 113.79 ? 81   ASN A ND2   1 
ATOM   609   N  N     . LEU A 1 82   ? 102.498 99.927  106.303 1.00 111.57 ? 82   LEU A N     1 
ATOM   610   C  CA    . LEU A 1 82   ? 102.550 98.479  106.449 1.00 111.57 ? 82   LEU A CA    1 
ATOM   611   C  C     . LEU A 1 82   ? 102.498 98.039  107.904 1.00 111.57 ? 82   LEU A C     1 
ATOM   612   O  O     . LEU A 1 82   ? 101.980 96.955  108.189 1.00 111.57 ? 82   LEU A O     1 
ATOM   613   C  CB    . LEU A 1 82   ? 103.816 97.934  105.792 1.00 111.57 ? 82   LEU A CB    1 
ATOM   614   C  CG    . LEU A 1 82   ? 103.712 97.641  104.298 1.00 111.57 ? 82   LEU A CG    1 
ATOM   615   C  CD1   . LEU A 1 82   ? 105.066 97.249  103.738 1.00 111.57 ? 82   LEU A CD1   1 
ATOM   616   C  CD2   . LEU A 1 82   ? 102.688 96.550  104.046 1.00 111.57 ? 82   LEU A CD2   1 
ATOM   617   N  N     . LYS A 1 83   ? 103.024 98.848  108.825 1.00 111.27 ? 83   LYS A N     1 
ATOM   618   C  CA    . LYS A 1 83   ? 103.015 98.476  110.236 1.00 111.27 ? 83   LYS A CA    1 
ATOM   619   C  C     . LYS A 1 83   ? 101.612 98.284  110.798 1.00 111.27 ? 83   LYS A C     1 
ATOM   620   O  O     . LYS A 1 83   ? 101.476 97.712  111.884 1.00 111.27 ? 83   LYS A O     1 
ATOM   621   C  CB    . LYS A 1 83   ? 103.754 99.526  111.065 1.00 111.27 ? 83   LYS A CB    1 
ATOM   622   C  CG    . LYS A 1 83   ? 105.261 99.364  111.067 1.00 111.27 ? 83   LYS A CG    1 
ATOM   623   C  CD    . LYS A 1 83   ? 105.930 100.490 111.833 1.00 111.27 ? 83   LYS A CD    1 
ATOM   624   C  CE    . LYS A 1 83   ? 105.481 100.506 113.282 1.00 111.27 ? 83   LYS A CE    1 
ATOM   625   N  NZ    . LYS A 1 83   ? 106.269 101.470 114.096 1.00 111.27 ? 83   LYS A NZ    1 
ATOM   626   N  N     . GLU A 1 84   ? 100.576 98.739  110.098 1.00 118.52 ? 84   GLU A N     1 
ATOM   627   C  CA    . GLU A 1 84   ? 99.199  98.563  110.539 1.00 118.52 ? 84   GLU A CA    1 
ATOM   628   C  C     . GLU A 1 84   ? 98.514  97.371  109.884 1.00 118.52 ? 84   GLU A C     1 
ATOM   629   O  O     . GLU A 1 84   ? 97.291  97.243  109.992 1.00 118.52 ? 84   GLU A O     1 
ATOM   630   C  CB    . GLU A 1 84   ? 98.387  99.834  110.262 1.00 118.52 ? 84   GLU A CB    1 
ATOM   631   C  CG    . GLU A 1 84   ? 99.031  101.141 110.730 1.00 118.52 ? 84   GLU A CG    1 
ATOM   632   C  CD    . GLU A 1 84   ? 99.214  101.248 112.241 1.00 118.52 ? 84   GLU A CD    1 
ATOM   633   O  OE1   . GLU A 1 84   ? 98.953  100.271 112.973 1.00 118.52 ? 84   GLU A OE1   1 
ATOM   634   O  OE2   . GLU A 1 84   ? 99.627  102.333 112.701 1.00 118.52 ? 84   GLU A OE2   1 
ATOM   635   N  N     . LEU A 1 85   ? 99.264  96.505  109.209 1.00 115.75 ? 85   LEU A N     1 
ATOM   636   C  CA    . LEU A 1 85   ? 98.665  95.346  108.563 1.00 115.75 ? 85   LEU A CA    1 
ATOM   637   C  C     . LEU A 1 85   ? 98.264  94.313  109.607 1.00 115.75 ? 85   LEU A C     1 
ATOM   638   O  O     . LEU A 1 85   ? 99.078  93.910  110.443 1.00 115.75 ? 85   LEU A O     1 
ATOM   639   C  CB    . LEU A 1 85   ? 99.641  94.738  107.559 1.00 115.75 ? 85   LEU A CB    1 
ATOM   640   C  CG    . LEU A 1 85   ? 99.094  93.645  106.643 1.00 115.75 ? 85   LEU A CG    1 
ATOM   641   C  CD1   . LEU A 1 85   ? 97.896  94.155  105.866 1.00 115.75 ? 85   LEU A CD1   1 
ATOM   642   C  CD2   . LEU A 1 85   ? 100.176 93.156  105.700 1.00 115.75 ? 85   LEU A CD2   1 
ATOM   643   N  N     . VAL A 1 86   ? 97.006  93.889  109.560 1.00 121.00 ? 86   VAL A N     1 
ATOM   644   C  CA    . VAL A 1 86   ? 96.468  92.898  110.484 1.00 121.00 ? 86   VAL A CA    1 
ATOM   645   C  C     . VAL A 1 86   ? 96.277  91.596  109.722 1.00 121.00 ? 86   VAL A C     1 
ATOM   646   O  O     . VAL A 1 86   ? 95.422  91.506  108.833 1.00 121.00 ? 86   VAL A O     1 
ATOM   647   C  CB    . VAL A 1 86   ? 95.147  93.371  111.108 1.00 121.00 ? 86   VAL A CB    1 
ATOM   648   C  CG1   . VAL A 1 86   ? 94.535  92.265  111.948 1.00 121.00 ? 86   VAL A CG1   1 
ATOM   649   C  CG2   . VAL A 1 86   ? 95.378  94.620  111.943 1.00 121.00 ? 86   VAL A CG2   1 
ATOM   650   N  N     . VAL A 1 87   ? 97.069  90.586  110.069 1.00 119.85 ? 87   VAL A N     1 
ATOM   651   C  CA    . VAL A 1 87   ? 97.073  89.305  109.375 1.00 119.85 ? 87   VAL A CA    1 
ATOM   652   C  C     . VAL A 1 87   ? 96.844  88.202  110.400 1.00 119.85 ? 87   VAL A C     1 
ATOM   653   O  O     . VAL A 1 87   ? 97.398  88.249  111.505 1.00 119.85 ? 87   VAL A O     1 
ATOM   654   C  CB    . VAL A 1 87   ? 98.386  89.086  108.606 1.00 119.85 ? 87   VAL A CB    1 
ATOM   655   C  CG1   . VAL A 1 87   ? 99.579  89.276  109.524 1.00 119.85 ? 87   VAL A CG1   1 
ATOM   656   C  CG2   . VAL A 1 87   ? 98.412  87.709  107.976 1.00 119.85 ? 87   VAL A CG2   1 
ATOM   657   N  N     . ARG A 1 88   ? 96.020  87.222  110.039 1.00 126.28 ? 88   ARG A N     1 
ATOM   658   C  CA    . ARG A 1 88   ? 95.736  86.086  110.901 1.00 126.28 ? 88   ARG A CA    1 
ATOM   659   C  C     . ARG A 1 88   ? 96.257  84.810  110.253 1.00 126.28 ? 88   ARG A C     1 
ATOM   660   O  O     . ARG A 1 88   ? 96.118  84.612  109.037 1.00 126.28 ? 88   ARG A O     1 
ATOM   661   C  CB    . ARG A 1 88   ? 94.236  85.959  111.172 1.00 126.28 ? 88   ARG A CB    1 
ATOM   662   C  CG    . ARG A 1 88   ? 93.432  85.595  109.945 1.00 126.28 ? 88   ARG A CG    1 
ATOM   663   C  CD    . ARG A 1 88   ? 91.961  85.419  110.245 1.00 126.28 ? 88   ARG A CD    1 
ATOM   664   N  NE    . ARG A 1 88   ? 91.708  84.283  111.116 1.00 126.28 ? 88   ARG A NE    1 
ATOM   665   C  CZ    . ARG A 1 88   ? 90.525  84.030  111.665 1.00 126.28 ? 88   ARG A CZ    1 
ATOM   666   N  NH1   . ARG A 1 88   ? 89.493  84.826  111.405 1.00 126.28 ? 88   ARG A NH1   1 
ATOM   667   N  NH2   . ARG A 1 88   ? 90.360  82.977  112.456 1.00 126.28 ? 88   ARG A NH2   1 
ATOM   668   N  N     . PHE A 1 89   ? 96.884  83.965  111.066 1.00 127.67 ? 89   PHE A N     1 
ATOM   669   C  CA    . PHE A 1 89   ? 97.321  82.640  110.652 1.00 127.67 ? 89   PHE A CA    1 
ATOM   670   C  C     . PHE A 1 89   ? 96.220  81.648  110.997 1.00 127.67 ? 89   PHE A C     1 
ATOM   671   O  O     . PHE A 1 89   ? 95.665  81.693  112.100 1.00 127.67 ? 89   PHE A O     1 
ATOM   672   C  CB    . PHE A 1 89   ? 98.626  82.249  111.345 1.00 127.67 ? 89   PHE A CB    1 
ATOM   673   C  CG    . PHE A 1 89   ? 99.806  83.083  110.941 1.00 127.67 ? 89   PHE A CG    1 
ATOM   674   C  CD1   . PHE A 1 89   ? 99.750  83.904  109.830 1.00 127.67 ? 89   PHE A CD1   1 
ATOM   675   C  CD2   . PHE A 1 89   ? 100.976 83.043  111.678 1.00 127.67 ? 89   PHE A CD2   1 
ATOM   676   C  CE1   . PHE A 1 89   ? 100.838 84.671  109.467 1.00 127.67 ? 89   PHE A CE1   1 
ATOM   677   C  CE2   . PHE A 1 89   ? 102.066 83.805  111.318 1.00 127.67 ? 89   PHE A CE2   1 
ATOM   678   C  CZ    . PHE A 1 89   ? 101.997 84.620  110.211 1.00 127.67 ? 89   PHE A CZ    1 
ATOM   679   N  N     . LEU A 1 90   ? 95.906  80.754  110.060 1.00 135.54 ? 90   LEU A N     1 
ATOM   680   C  CA    . LEU A 1 90   ? 94.892  79.741  110.334 1.00 135.54 ? 90   LEU A CA    1 
ATOM   681   C  C     . LEU A 1 90   ? 95.518  78.481  110.915 1.00 135.54 ? 90   LEU A C     1 
ATOM   682   O  O     . LEU A 1 90   ? 94.900  77.795  111.737 1.00 135.54 ? 90   LEU A O     1 
ATOM   683   C  CB    . LEU A 1 90   ? 94.110  79.424  109.061 1.00 135.54 ? 90   LEU A CB    1 
ATOM   684   C  CG    . LEU A 1 90   ? 93.243  80.558  108.511 1.00 135.54 ? 90   LEU A CG    1 
ATOM   685   C  CD1   . LEU A 1 90   ? 92.173  80.009  107.583 1.00 135.54 ? 90   LEU A CD1   1 
ATOM   686   C  CD2   . LEU A 1 90   ? 92.613  81.356  109.641 1.00 135.54 ? 90   LEU A CD2   1 
ATOM   687   N  N     . ASN A 1 91   ? 96.741  78.161  110.501 1.00 141.36 ? 91   ASN A N     1 
ATOM   688   C  CA    . ASN A 1 91   ? 97.452  77.008  111.032 1.00 141.36 ? 91   ASN A CA    1 
ATOM   689   C  C     . ASN A 1 91   ? 98.177  77.410  112.308 1.00 141.36 ? 91   ASN A C     1 
ATOM   690   O  O     . ASN A 1 91   ? 98.992  78.342  112.274 1.00 141.36 ? 91   ASN A O     1 
ATOM   691   C  CB    . ASN A 1 91   ? 98.444  76.476  110.010 1.00 141.36 ? 91   ASN A CB    1 
ATOM   692   C  CG    . ASN A 1 91   ? 99.053  75.147  110.415 1.00 141.36 ? 91   ASN A CG    1 
ATOM   693   O  OD1   . ASN A 1 91   ? 98.772  74.618  111.489 1.00 141.36 ? 91   ASN A OD1   1 
ATOM   694   N  ND2   . ASN A 1 91   ? 99.893  74.598  109.547 1.00 141.36 ? 91   ASN A ND2   1 
ATOM   695   N  N     . PRO A 1 92   ? 97.916  76.759  113.443 1.00 138.74 ? 92   PRO A N     1 
ATOM   696   C  CA    . PRO A 1 92   ? 98.629  77.124  114.677 1.00 138.74 ? 92   PRO A CA    1 
ATOM   697   C  C     . PRO A 1 92   ? 100.124 76.869  114.618 1.00 138.74 ? 92   PRO A C     1 
ATOM   698   O  O     . PRO A 1 92   ? 100.879 77.549  115.324 1.00 138.74 ? 92   PRO A O     1 
ATOM   699   C  CB    . PRO A 1 92   ? 97.957  76.250  115.746 1.00 138.74 ? 92   PRO A CB    1 
ATOM   700   C  CG    . PRO A 1 92   ? 96.631  75.880  115.166 1.00 138.74 ? 92   PRO A CG    1 
ATOM   701   C  CD    . PRO A 1 92   ? 96.842  75.782  113.689 1.00 138.74 ? 92   PRO A CD    1 
ATOM   702   N  N     . SER A 1 93   ? 100.579 75.917  113.804 1.00 139.83 ? 93   SER A N     1 
ATOM   703   C  CA    . SER A 1 93   ? 101.994 75.573  113.756 1.00 139.83 ? 93   SER A CA    1 
ATOM   704   C  C     . SER A 1 93   ? 102.793 76.436  112.789 1.00 139.83 ? 93   SER A C     1 
ATOM   705   O  O     . SER A 1 93   ? 104.018 76.288  112.725 1.00 139.83 ? 93   SER A O     1 
ATOM   706   C  CB    . SER A 1 93   ? 102.158 74.099  113.379 1.00 139.83 ? 93   SER A CB    1 
ATOM   707   O  OG    . SER A 1 93   ? 101.292 73.749  112.315 1.00 139.83 ? 93   SER A OG    1 
ATOM   708   N  N     . LEU A 1 94   ? 102.144 77.324  112.042 1.00 135.96 ? 94   LEU A N     1 
ATOM   709   C  CA    . LEU A 1 94   ? 102.828 78.201  111.097 1.00 135.96 ? 94   LEU A CA    1 
ATOM   710   C  C     . LEU A 1 94   ? 103.362 79.406  111.863 1.00 135.96 ? 94   LEU A C     1 
ATOM   711   O  O     . LEU A 1 94   ? 102.661 79.970  112.709 1.00 135.96 ? 94   LEU A O     1 
ATOM   712   C  CB    . LEU A 1 94   ? 101.877 78.623  109.979 1.00 135.96 ? 94   LEU A CB    1 
ATOM   713   C  CG    . LEU A 1 94   ? 102.349 79.692  108.995 1.00 135.96 ? 94   LEU A CG    1 
ATOM   714   C  CD1   . LEU A 1 94   ? 103.702 79.325  108.409 1.00 135.96 ? 94   LEU A CD1   1 
ATOM   715   C  CD2   . LEU A 1 94   ? 101.320 79.877  107.893 1.00 135.96 ? 94   LEU A CD2   1 
ATOM   716   N  N     . GLN A 1 95   ? 104.601 79.802  111.571 1.00 135.48 ? 95   GLN A N     1 
ATOM   717   C  CA    . GLN A 1 95   ? 105.252 80.874  112.313 1.00 135.48 ? 95   GLN A CA    1 
ATOM   718   C  C     . GLN A 1 95   ? 105.883 81.942  111.429 1.00 135.48 ? 95   GLN A C     1 
ATOM   719   O  O     . GLN A 1 95   ? 106.228 83.013  111.938 1.00 135.48 ? 95   GLN A O     1 
ATOM   720   C  CB    . GLN A 1 95   ? 106.328 80.294  113.239 1.00 135.48 ? 95   GLN A CB    1 
ATOM   721   C  CG    . GLN A 1 95   ? 105.774 79.544  114.433 1.00 135.48 ? 95   GLN A CG    1 
ATOM   722   C  CD    . GLN A 1 95   ? 106.862 79.051  115.362 1.00 135.48 ? 95   GLN A CD    1 
ATOM   723   O  OE1   . GLN A 1 95   ? 108.050 79.220  115.088 1.00 135.48 ? 95   GLN A OE1   1 
ATOM   724   N  NE2   . GLN A 1 95   ? 106.462 78.437  116.469 1.00 135.48 ? 95   GLN A NE2   1 
ATOM   725   N  N     . THR A 1 96   ? 106.046 81.688  110.133 1.00 130.33 ? 96   THR A N     1 
ATOM   726   C  CA    . THR A 1 96   ? 106.708 82.639  109.253 1.00 130.33 ? 96   THR A CA    1 
ATOM   727   C  C     . THR A 1 96   ? 106.080 82.572  107.871 1.00 130.33 ? 96   THR A C     1 
ATOM   728   O  O     . THR A 1 96   ? 105.977 81.493  107.283 1.00 130.33 ? 96   THR A O     1 
ATOM   729   C  CB    . THR A 1 96   ? 108.212 82.358  109.155 1.00 130.33 ? 96   THR A CB    1 
ATOM   730   O  OG1   . THR A 1 96   ? 108.796 82.398  110.463 1.00 130.33 ? 96   THR A OG1   1 
ATOM   731   C  CG2   . THR A 1 96   ? 108.894 83.380  108.258 1.00 130.33 ? 96   THR A CG2   1 
ATOM   732   N  N     . VAL A 1 97   ? 105.663 83.727  107.358 1.00 124.70 ? 97   VAL A N     1 
ATOM   733   C  CA    . VAL A 1 97   ? 105.068 83.816  106.029 1.00 124.70 ? 97   VAL A CA    1 
ATOM   734   C  C     . VAL A 1 97   ? 105.745 84.948  105.271 1.00 124.70 ? 97   VAL A C     1 
ATOM   735   O  O     . VAL A 1 97   ? 106.241 85.905  105.875 1.00 124.70 ? 97   VAL A O     1 
ATOM   736   C  CB    . VAL A 1 97   ? 103.540 84.036  106.094 1.00 124.70 ? 97   VAL A CB    1 
ATOM   737   C  CG1   . VAL A 1 97   ? 102.905 83.796  104.735 1.00 124.70 ? 97   VAL A CG1   1 
ATOM   738   C  CG2   . VAL A 1 97   ? 102.913 83.123  107.128 1.00 124.70 ? 97   VAL A CG2   1 
ATOM   739   N  N     . THR A 1 98   ? 105.778 84.832  103.946 1.00 124.76 ? 98   THR A N     1 
ATOM   740   C  CA    . THR A 1 98   ? 106.327 85.859  103.069 1.00 124.76 ? 98   THR A CA    1 
ATOM   741   C  C     . THR A 1 98   ? 105.269 86.203  102.028 1.00 124.76 ? 98   THR A C     1 
ATOM   742   O  O     . THR A 1 98   ? 104.996 85.406  101.124 1.00 124.76 ? 98   THR A O     1 
ATOM   743   C  CB    . THR A 1 98   ? 107.619 85.386  102.408 1.00 124.76 ? 98   THR A CB    1 
ATOM   744   O  OG1   . THR A 1 98   ? 108.628 85.201  103.408 1.00 124.76 ? 98   THR A OG1   1 
ATOM   745   C  CG2   . THR A 1 98   ? 108.103 86.411  101.397 1.00 124.76 ? 98   THR A CG2   1 
ATOM   746   N  N     . LEU A 1 99   ? 104.674 87.383  102.160 1.00 123.73 ? 99   LEU A N     1 
ATOM   747   C  CA    . LEU A 1 99   ? 103.644 87.829  101.236 1.00 123.73 ? 99   LEU A CA    1 
ATOM   748   C  C     . LEU A 1 99   ? 104.265 88.636  100.105 1.00 123.73 ? 99   LEU A C     1 
ATOM   749   O  O     . LEU A 1 99   ? 105.155 89.464  100.326 1.00 123.73 ? 99   LEU A O     1 
ATOM   750   C  CB    . LEU A 1 99   ? 102.597 88.673  101.963 1.00 123.73 ? 99   LEU A CB    1 
ATOM   751   C  CG    . LEU A 1 99   ? 101.508 87.957  102.767 1.00 123.73 ? 99   LEU A CG    1 
ATOM   752   C  CD1   . LEU A 1 99   ? 102.068 87.336  104.034 1.00 123.73 ? 99   LEU A CD1   1 
ATOM   753   C  CD2   . LEU A 1 99   ? 100.381 88.919  103.099 1.00 123.73 ? 99   LEU A CD2   1 
ATOM   754   N  N     . LEU A 1 100  ? 103.782 88.393  98.891  1.00 127.45 ? 100  LEU A N     1 
ATOM   755   C  CA    . LEU A 1 100  ? 104.280 89.038  97.686  1.00 127.45 ? 100  LEU A CA    1 
ATOM   756   C  C     . LEU A 1 100  ? 103.301 90.113  97.238  1.00 127.45 ? 100  LEU A C     1 
ATOM   757   O  O     . LEU A 1 100  ? 102.091 89.988  97.449  1.00 127.45 ? 100  LEU A O     1 
ATOM   758   C  CB    . LEU A 1 100  ? 104.469 88.017  96.563  1.00 127.45 ? 100  LEU A CB    1 
ATOM   759   C  CG    . LEU A 1 100  ? 105.430 86.857  96.819  1.00 127.45 ? 100  LEU A CG    1 
ATOM   760   C  CD1   . LEU A 1 100  ? 105.175 85.734  95.830  1.00 127.45 ? 100  LEU A CD1   1 
ATOM   761   C  CD2   . LEU A 1 100  ? 106.865 87.325  96.727  1.00 127.45 ? 100  LEU A CD2   1 
ATOM   762   N  N     . LEU A 1 101  ? 103.824 91.168  96.617  1.00 128.41 ? 101  LEU A N     1 
ATOM   763   C  CA    . LEU A 1 101  ? 102.980 92.203  96.039  1.00 128.41 ? 101  LEU A CA    1 
ATOM   764   C  C     . LEU A 1 101  ? 103.615 92.686  94.746  1.00 128.41 ? 101  LEU A C     1 
ATOM   765   O  O     . LEU A 1 101  ? 104.788 93.070  94.734  1.00 128.41 ? 101  LEU A O     1 
ATOM   766   C  CB    . LEU A 1 101  ? 102.783 93.371  97.012  1.00 128.41 ? 101  LEU A CB    1 
ATOM   767   C  CG    . LEU A 1 101  ? 101.627 94.327  96.706  1.00 128.41 ? 101  LEU A CG    1 
ATOM   768   C  CD1   . LEU A 1 101  ? 101.048 94.885  97.992  1.00 128.41 ? 101  LEU A CD1   1 
ATOM   769   C  CD2   . LEU A 1 101  ? 102.073 95.461  95.797  1.00 128.41 ? 101  LEU A CD2   1 
ATOM   770   N  N     . LYS A 1 102  ? 102.836 92.661  93.666  1.00 131.74 ? 102  LYS A N     1 
ATOM   771   C  CA    . LYS A 1 102  ? 103.284 93.097  92.350  1.00 131.74 ? 102  LYS A CA    1 
ATOM   772   C  C     . LYS A 1 102  ? 102.189 93.948  91.730  1.00 131.74 ? 102  LYS A C     1 
ATOM   773   O  O     . LYS A 1 102  ? 101.068 93.468  91.534  1.00 131.74 ? 102  LYS A O     1 
ATOM   774   C  CB    . LYS A 1 102  ? 103.603 91.902  91.448  1.00 131.74 ? 102  LYS A CB    1 
ATOM   775   C  CG    . LYS A 1 102  ? 104.904 91.195  91.774  1.00 131.74 ? 102  LYS A CG    1 
ATOM   776   C  CD    . LYS A 1 102  ? 105.312 90.268  90.643  1.00 131.74 ? 102  LYS A CD    1 
ATOM   777   C  CE    . LYS A 1 102  ? 106.689 89.674  90.884  1.00 131.74 ? 102  LYS A CE    1 
ATOM   778   N  NZ    . LYS A 1 102  ? 106.740 88.902  92.156  1.00 131.74 ? 102  LYS A NZ    1 
ATOM   779   N  N     . ALA A 1 103  ? 102.506 95.203  91.421  1.00 135.67 ? 103  ALA A N     1 
ATOM   780   C  CA    . ALA A 1 103  ? 101.526 96.105  90.837  1.00 135.67 ? 103  ALA A CA    1 
ATOM   781   C  C     . ALA A 1 103  ? 102.227 97.183  90.026  1.00 135.67 ? 103  ALA A C     1 
ATOM   782   O  O     . ALA A 1 103  ? 103.413 97.463  90.223  1.00 135.67 ? 103  ALA A O     1 
ATOM   783   C  CB    . ALA A 1 103  ? 100.647 96.752  91.912  1.00 135.67 ? 103  ALA A CB    1 
ATOM   784   N  N     . GLU A 1 104  ? 101.475 97.784  89.110  1.00 142.47 ? 104  GLU A N     1 
ATOM   785   C  CA    . GLU A 1 104  ? 101.954 98.906  88.315  1.00 142.47 ? 104  GLU A CA    1 
ATOM   786   C  C     . GLU A 1 104  ? 100.742 99.660  87.779  1.00 142.47 ? 104  GLU A C     1 
ATOM   787   O  O     . GLU A 1 104  ? 99.593  99.291  88.041  1.00 142.47 ? 104  GLU A O     1 
ATOM   788   C  CB    . GLU A 1 104  ? 102.885 98.426  87.195  1.00 142.47 ? 104  GLU A CB    1 
ATOM   789   C  CG    . GLU A 1 104  ? 102.323 97.299  86.352  1.00 142.47 ? 104  GLU A CG    1 
ATOM   790   C  CD    . GLU A 1 104  ? 103.366 96.689  85.438  1.00 142.47 ? 104  GLU A CD    1 
ATOM   791   O  OE1   . GLU A 1 104  ? 103.240 96.839  84.205  1.00 142.47 ? 104  GLU A OE1   1 
ATOM   792   O  OE2   . GLU A 1 104  ? 104.315 96.061  85.954  1.00 142.47 ? 104  GLU A OE2   1 
ATOM   793   N  N     . GLY A 1 105  ? 101.001 100.722 87.022  1.00 142.51 ? 105  GLY A N     1 
ATOM   794   C  CA    . GLY A 1 105  ? 99.946  101.517 86.443  1.00 142.51 ? 105  GLY A CA    1 
ATOM   795   C  C     . GLY A 1 105  ? 99.341  102.496 87.429  1.00 142.51 ? 105  GLY A C     1 
ATOM   796   O  O     . GLY A 1 105  ? 99.692  102.524 88.612  1.00 142.51 ? 105  GLY A O     1 
ATOM   797   N  N     . PRO A 1 106  ? 98.413  103.323 86.950  1.00 140.56 ? 106  PRO A N     1 
ATOM   798   C  CA    . PRO A 1 106  ? 97.798  104.335 87.821  1.00 140.56 ? 106  PRO A CA    1 
ATOM   799   C  C     . PRO A 1 106  ? 96.729  103.757 88.733  1.00 140.56 ? 106  PRO A C     1 
ATOM   800   O  O     . PRO A 1 106  ? 95.539  103.804 88.406  1.00 140.56 ? 106  PRO A O     1 
ATOM   801   C  CB    . PRO A 1 106  ? 97.196  105.339 86.825  1.00 140.56 ? 106  PRO A CB    1 
ATOM   802   C  CG    . PRO A 1 106  ? 97.716  104.932 85.462  1.00 140.56 ? 106  PRO A CG    1 
ATOM   803   C  CD    . PRO A 1 106  ? 97.983  103.471 85.554  1.00 140.56 ? 106  PRO A CD    1 
ATOM   804   N  N     . LYS A 1 107  ? 97.135  103.211 89.877  1.00 137.87 ? 107  LYS A N     1 
ATOM   805   C  CA    . LYS A 1 107  ? 96.206  102.630 90.833  1.00 137.87 ? 107  LYS A CA    1 
ATOM   806   C  C     . LYS A 1 107  ? 96.678  102.909 92.251  1.00 137.87 ? 107  LYS A C     1 
ATOM   807   O  O     . LYS A 1 107  ? 97.807  103.351 92.472  1.00 137.87 ? 107  LYS A O     1 
ATOM   808   C  CB    . LYS A 1 107  ? 96.061  101.118 90.626  1.00 137.87 ? 107  LYS A CB    1 
ATOM   809   C  CG    . LYS A 1 107  ? 97.246  100.313 91.126  1.00 137.87 ? 107  LYS A CG    1 
ATOM   810   C  CD    . LYS A 1 107  ? 97.016  98.823  90.945  1.00 137.87 ? 107  LYS A CD    1 
ATOM   811   C  CE    . LYS A 1 107  ? 95.742  98.375  91.638  1.00 137.87 ? 107  LYS A CE    1 
ATOM   812   N  NZ    . LYS A 1 107  ? 95.552  96.903  91.541  1.00 137.87 ? 107  LYS A NZ    1 
ATOM   813   N  N     . GLU A 1 108  ? 95.794  102.656 93.212  1.00 134.85 ? 108  GLU A N     1 
ATOM   814   C  CA    . GLU A 1 108  ? 96.103  102.791 94.631  1.00 134.85 ? 108  GLU A CA    1 
ATOM   815   C  C     . GLU A 1 108  ? 96.128  101.395 95.239  1.00 134.85 ? 108  GLU A C     1 
ATOM   816   O  O     . GLU A 1 108  ? 95.076  100.768 95.406  1.00 134.85 ? 108  GLU A O     1 
ATOM   817   C  CB    . GLU A 1 108  ? 95.074  103.675 95.331  1.00 134.85 ? 108  GLU A CB    1 
ATOM   818   C  CG    . GLU A 1 108  ? 94.952  105.070 94.751  1.00 134.85 ? 108  GLU A CG    1 
ATOM   819   C  CD    . GLU A 1 108  ? 94.325  106.048 95.725  1.00 134.85 ? 108  GLU A CD    1 
ATOM   820   O  OE1   . GLU A 1 108  ? 93.945  105.620 96.835  1.00 134.85 ? 108  GLU A OE1   1 
ATOM   821   O  OE2   . GLU A 1 108  ? 94.209  107.243 95.381  1.00 134.85 ? 108  GLU A OE2   1 
ATOM   822   N  N     . VAL A 1 109  ? 97.322  100.903 95.567  1.00 128.19 ? 109  VAL A N     1 
ATOM   823   C  CA    . VAL A 1 109  ? 97.443  99.530  96.037  1.00 128.19 ? 109  VAL A CA    1 
ATOM   824   C  C     . VAL A 1 109  ? 96.879  99.417  97.448  1.00 128.19 ? 109  VAL A C     1 
ATOM   825   O  O     . VAL A 1 109  ? 97.303  100.124 98.371  1.00 128.19 ? 109  VAL A O     1 
ATOM   826   C  CB    . VAL A 1 109  ? 98.900  99.045  95.953  1.00 128.19 ? 109  VAL A CB    1 
ATOM   827   C  CG1   . VAL A 1 109  ? 99.364  99.050  94.508  1.00 128.19 ? 109  VAL A CG1   1 
ATOM   828   C  CG2   . VAL A 1 109  ? 99.828  99.896  96.799  1.00 128.19 ? 109  VAL A CG2   1 
ATOM   829   N  N     . LYS A 1 110  ? 95.886  98.554  97.608  1.00 130.64 ? 110  LYS A N     1 
ATOM   830   C  CA    . LYS A 1 110  ? 95.280  98.254  98.894  1.00 130.64 ? 110  LYS A CA    1 
ATOM   831   C  C     . LYS A 1 110  ? 95.879  96.966  99.447  1.00 130.64 ? 110  LYS A C     1 
ATOM   832   O  O     . LYS A 1 110  ? 96.779  96.365  98.857  1.00 130.64 ? 110  LYS A O     1 
ATOM   833   C  CB    . LYS A 1 110  ? 93.760  98.145  98.761  1.00 130.64 ? 110  LYS A CB    1 
ATOM   834   C  CG    . LYS A 1 110  ? 93.100  99.372  98.160  1.00 130.64 ? 110  LYS A CG    1 
ATOM   835   C  CD    . LYS A 1 110  ? 93.202  100.562 99.096  1.00 130.64 ? 110  LYS A CD    1 
ATOM   836   C  CE    . LYS A 1 110  ? 92.501  101.778 98.519  1.00 130.64 ? 110  LYS A CE    1 
ATOM   837   N  NZ    . LYS A 1 110  ? 92.778  103.003 99.317  1.00 130.64 ? 110  LYS A NZ    1 
ATOM   838   N  N     . ALA A 1 111  ? 95.366  96.542  100.602 1.00 130.27 ? 111  ALA A N     1 
ATOM   839   C  CA    . ALA A 1 111  ? 95.815  95.288  101.190 1.00 130.27 ? 111  ALA A CA    1 
ATOM   840   C  C     . ALA A 1 111  ? 95.347  94.076  100.395 1.00 130.27 ? 111  ALA A C     1 
ATOM   841   O  O     . ALA A 1 111  ? 95.922  92.994  100.547 1.00 130.27 ? 111  ALA A O     1 
ATOM   842   C  CB    . ALA A 1 111  ? 95.333  95.181  102.635 1.00 130.27 ? 111  ALA A CB    1 
ATOM   843   N  N     . ARG A 1 112  ? 94.318  94.232  99.558  1.00 132.87 ? 112  ARG A N     1 
ATOM   844   C  CA    . ARG A 1 112  ? 93.822  93.108  98.770  1.00 132.87 ? 112  ARG A CA    1 
ATOM   845   C  C     . ARG A 1 112  ? 94.883  92.587  97.810  1.00 132.87 ? 112  ARG A C     1 
ATOM   846   O  O     . ARG A 1 112  ? 94.955  91.381  97.548  1.00 132.87 ? 112  ARG A O     1 
ATOM   847   C  CB    . ARG A 1 112  ? 92.575  93.520  97.989  1.00 132.87 ? 112  ARG A CB    1 
ATOM   848   C  CG    . ARG A 1 112  ? 91.484  94.159  98.818  1.00 132.87 ? 112  ARG A CG    1 
ATOM   849   C  CD    . ARG A 1 112  ? 90.453  94.824  97.920  1.00 132.87 ? 112  ARG A CD    1 
ATOM   850   N  NE    . ARG A 1 112  ? 89.532  95.676  98.667  1.00 132.87 ? 112  ARG A NE    1 
ATOM   851   C  CZ    . ARG A 1 112  ? 88.518  95.221  99.395  1.00 132.87 ? 112  ARG A CZ    1 
ATOM   852   N  NH1   . ARG A 1 112  ? 87.730  96.069  100.040 1.00 132.87 ? 112  ARG A NH1   1 
ATOM   853   N  NH2   . ARG A 1 112  ? 88.287  93.918  99.476  1.00 132.87 ? 112  ARG A NH2   1 
ATOM   854   N  N     . ASP A 1 113  ? 95.716  93.481  97.275  1.00 135.16 ? 113  ASP A N     1 
ATOM   855   C  CA    . ASP A 1 113  ? 96.627  93.124  96.194  1.00 135.16 ? 113  ASP A CA    1 
ATOM   856   C  C     . ASP A 1 113  ? 97.719  92.151  96.615  1.00 135.16 ? 113  ASP A C     1 
ATOM   857   O  O     . ASP A 1 113  ? 98.481  91.702  95.753  1.00 135.16 ? 113  ASP A O     1 
ATOM   858   C  CB    . ASP A 1 113  ? 97.255  94.387  95.609  1.00 135.16 ? 113  ASP A CB    1 
ATOM   859   C  CG    . ASP A 1 113  ? 96.218  95.409  95.198  1.00 135.16 ? 113  ASP A CG    1 
ATOM   860   O  OD1   . ASP A 1 113  ? 95.146  95.002  94.704  1.00 135.16 ? 113  ASP A OD1   1 
ATOM   861   O  OD2   . ASP A 1 113  ? 96.470  96.617  95.371  1.00 135.16 ? 113  ASP A OD2   1 
ATOM   862   N  N     . PHE A 1 114  ? 97.823  91.818  97.898  1.00 127.67 ? 114  PHE A N     1 
ATOM   863   C  CA    . PHE A 1 114  ? 98.741  90.765  98.305  1.00 127.67 ? 114  PHE A CA    1 
ATOM   864   C  C     . PHE A 1 114  ? 98.253  89.423  97.776  1.00 127.67 ? 114  PHE A C     1 
ATOM   865   O  O     . PHE A 1 114  ? 97.067  89.096  97.868  1.00 127.67 ? 114  PHE A O     1 
ATOM   866   C  CB    . PHE A 1 114  ? 98.868  90.724  99.826  1.00 127.67 ? 114  PHE A CB    1 
ATOM   867   C  CG    . PHE A 1 114  ? 99.750  91.799  100.387 1.00 127.67 ? 114  PHE A CG    1 
ATOM   868   C  CD1   . PHE A 1 114  ? 99.212  92.843  101.117 1.00 127.67 ? 114  PHE A CD1   1 
ATOM   869   C  CD2   . PHE A 1 114  ? 101.117 91.767  100.182 1.00 127.67 ? 114  PHE A CD2   1 
ATOM   870   C  CE1   . PHE A 1 114  ? 100.022 93.834  101.633 1.00 127.67 ? 114  PHE A CE1   1 
ATOM   871   C  CE2   . PHE A 1 114  ? 101.932 92.755  100.696 1.00 127.67 ? 114  PHE A CE2   1 
ATOM   872   C  CZ    . PHE A 1 114  ? 101.383 93.789  101.422 1.00 127.67 ? 114  PHE A CZ    1 
ATOM   873   N  N     . LEU A 1 115  ? 99.172  88.653  97.209  1.00 132.97 ? 115  LEU A N     1 
ATOM   874   C  CA    . LEU A 1 115  ? 98.822  87.371  96.616  1.00 132.97 ? 115  LEU A CA    1 
ATOM   875   C  C     . LEU A 1 115  ? 98.253  86.437  97.677  1.00 132.97 ? 115  LEU A C     1 
ATOM   876   O  O     . LEU A 1 115  ? 98.717  86.463  98.827  1.00 132.97 ? 115  LEU A O     1 
ATOM   877   C  CB    . LEU A 1 115  ? 100.045 86.740  95.958  1.00 132.97 ? 115  LEU A CB    1 
ATOM   878   C  CG    . LEU A 1 115  ? 100.537 87.411  94.676  1.00 132.97 ? 115  LEU A CG    1 
ATOM   879   C  CD1   . LEU A 1 115  ? 101.541 86.523  93.961  1.00 132.97 ? 115  LEU A CD1   1 
ATOM   880   C  CD2   . LEU A 1 115  ? 99.369  87.746  93.763  1.00 132.97 ? 115  LEU A CD2   1 
ATOM   881   N  N     . PRO A 1 116  ? 97.261  85.613  97.348  1.00 134.09 ? 116  PRO A N     1 
ATOM   882   C  CA    . PRO A 1 116  ? 96.675  84.730  98.363  1.00 134.09 ? 116  PRO A CA    1 
ATOM   883   C  C     . PRO A 1 116  ? 97.651  83.640  98.776  1.00 134.09 ? 116  PRO A C     1 
ATOM   884   O  O     . PRO A 1 116  ? 98.288  82.998  97.938  1.00 134.09 ? 116  PRO A O     1 
ATOM   885   C  CB    . PRO A 1 116  ? 95.440  84.146  97.663  1.00 134.09 ? 116  PRO A CB    1 
ATOM   886   C  CG    . PRO A 1 116  ? 95.244  84.974  96.423  1.00 134.09 ? 116  PRO A CG    1 
ATOM   887   C  CD    . PRO A 1 116  ? 96.595  85.476  96.045  1.00 134.09 ? 116  PRO A CD    1 
ATOM   888   N  N     . VAL A 1 117  ? 97.762  83.436  100.085 1.00 134.10 ? 117  VAL A N     1 
ATOM   889   C  CA    . VAL A 1 117  ? 98.622  82.411  100.660 1.00 134.10 ? 117  VAL A CA    1 
ATOM   890   C  C     . VAL A 1 117  ? 97.755  81.475  101.489 1.00 134.10 ? 117  VAL A C     1 
ATOM   891   O  O     . VAL A 1 117  ? 96.745  81.897  102.063 1.00 134.10 ? 117  VAL A O     1 
ATOM   892   C  CB    . VAL A 1 117  ? 99.746  83.025  101.523 1.00 134.10 ? 117  VAL A CB    1 
ATOM   893   C  CG1   . VAL A 1 117  ? 100.830 81.996  101.800 1.00 134.10 ? 117  VAL A CG1   1 
ATOM   894   C  CG2   . VAL A 1 117  ? 100.332 84.251  100.842 1.00 134.10 ? 117  VAL A CG2   1 
ATOM   895   N  N     . ALA A 1 118  ? 98.146  80.204  101.545 1.00 136.95 ? 118  ALA A N     1 
ATOM   896   C  CA    . ALA A 1 118  ? 97.362  79.216  102.271 1.00 136.95 ? 118  ALA A CA    1 
ATOM   897   C  C     . ALA A 1 118  ? 97.400  79.485  103.770 1.00 136.95 ? 118  ALA A C     1 
ATOM   898   O  O     . ALA A 1 118  ? 98.454  79.782  104.339 1.00 136.95 ? 118  ALA A O     1 
ATOM   899   C  CB    . ALA A 1 118  ? 97.881  77.809  101.976 1.00 136.95 ? 118  ALA A CB    1 
ATOM   900   N  N     . ASP A 1 119  ? 96.230  79.382  104.404 1.00 140.10 ? 119  ASP A N     1 
ATOM   901   C  CA    . ASP A 1 119  ? 96.085  79.519  105.854 1.00 140.10 ? 119  ASP A CA    1 
ATOM   902   C  C     . ASP A 1 119  ? 96.574  80.876  106.354 1.00 140.10 ? 119  ASP A C     1 
ATOM   903   O  O     . ASP A 1 119  ? 97.111  80.986  107.459 1.00 140.10 ? 119  ASP A O     1 
ATOM   904   C  CB    . ASP A 1 119  ? 96.804  78.386  106.591 1.00 140.10 ? 119  ASP A CB    1 
ATOM   905   C  CG    . ASP A 1 119  ? 95.934  77.156  106.754 1.00 140.10 ? 119  ASP A CG    1 
ATOM   906   O  OD1   . ASP A 1 119  ? 95.067  76.922  105.885 1.00 140.10 ? 119  ASP A OD1   1 
ATOM   907   O  OD2   . ASP A 1 119  ? 96.113  76.426  107.750 1.00 140.10 ? 119  ASP A OD2   1 
ATOM   908   N  N     . VAL A 1 120  ? 96.390  81.917  105.546 1.00 131.47 ? 120  VAL A N     1 
ATOM   909   C  CA    . VAL A 1 120  ? 96.758  83.282  105.906 1.00 131.47 ? 120  VAL A CA    1 
ATOM   910   C  C     . VAL A 1 120  ? 95.654  84.197  105.397 1.00 131.47 ? 120  VAL A C     1 
ATOM   911   O  O     . VAL A 1 120  ? 95.267  84.107  104.226 1.00 131.47 ? 120  VAL A O     1 
ATOM   912   C  CB    . VAL A 1 120  ? 98.115  83.697  105.311 1.00 131.47 ? 120  VAL A CB    1 
ATOM   913   C  CG1   . VAL A 1 120  ? 98.318  85.191  105.441 1.00 131.47 ? 120  VAL A CG1   1 
ATOM   914   C  CG2   . VAL A 1 120  ? 99.248  82.947  105.989 1.00 131.47 ? 120  VAL A CG2   1 
ATOM   915   N  N     . GLU A 1 121  ? 95.140  85.070  106.261 1.00 129.43 ? 121  GLU A N     1 
ATOM   916   C  CA    . GLU A 1 121  ? 94.042  85.951  105.882 1.00 129.43 ? 121  GLU A CA    1 
ATOM   917   C  C     . GLU A 1 121  ? 94.296  87.367  106.378 1.00 129.43 ? 121  GLU A C     1 
ATOM   918   O  O     . GLU A 1 121  ? 94.677  87.567  107.533 1.00 129.43 ? 121  GLU A O     1 
ATOM   919   C  CB    . GLU A 1 121  ? 92.711  85.432  106.429 1.00 129.43 ? 121  GLU A CB    1 
ATOM   920   C  CG    . GLU A 1 121  ? 91.541  86.374  106.199 1.00 129.43 ? 121  GLU A CG    1 
ATOM   921   C  CD    . GLU A 1 121  ? 90.304  85.970  106.974 1.00 129.43 ? 121  GLU A CD    1 
ATOM   922   O  OE1   . GLU A 1 121  ? 90.289  84.853  107.533 1.00 129.43 ? 121  GLU A OE1   1 
ATOM   923   O  OE2   . GLU A 1 121  ? 89.347  86.769  107.027 1.00 129.43 ? 121  GLU A OE2   1 
ATOM   924   N  N     . ILE A 1 122  ? 94.066  88.346  105.509 1.00 123.48 ? 122  ILE A N     1 
ATOM   925   C  CA    . ILE A 1 122  ? 94.195  89.753  105.868 1.00 123.48 ? 122  ILE A CA    1 
ATOM   926   C  C     . ILE A 1 122  ? 92.848  90.226  106.406 1.00 123.48 ? 122  ILE A C     1 
ATOM   927   O  O     . ILE A 1 122  ? 91.827  90.127  105.721 1.00 123.48 ? 122  ILE A O     1 
ATOM   928   C  CB    . ILE A 1 122  ? 94.650  90.603  104.676 1.00 123.48 ? 122  ILE A CB    1 
ATOM   929   C  CG1   . ILE A 1 122  ? 96.054  90.194  104.223 1.00 123.48 ? 122  ILE A CG1   1 
ATOM   930   C  CG2   . ILE A 1 122  ? 94.623  92.076  105.035 1.00 123.48 ? 122  ILE A CG2   1 
ATOM   931   C  CD1   . ILE A 1 122  ? 96.074  89.148  103.128 1.00 123.48 ? 122  ILE A CD1   1 
ATOM   932   N  N     . MET A 1 123  ? 92.845  90.748  107.636 1.00 126.40 ? 123  MET A N     1 
ATOM   933   C  CA    . MET A 1 123  ? 91.599  91.174  108.265 1.00 126.40 ? 123  MET A CA    1 
ATOM   934   C  C     . MET A 1 123  ? 91.190  92.587  107.884 1.00 126.40 ? 123  MET A C     1 
ATOM   935   O  O     . MET A 1 123  ? 90.011  92.931  108.019 1.00 126.40 ? 123  MET A O     1 
ATOM   936   C  CB    . MET A 1 123  ? 91.709  91.067  109.785 1.00 126.40 ? 123  MET A CB    1 
ATOM   937   C  CG    . MET A 1 123  ? 91.935  89.653  110.263 1.00 126.40 ? 123  MET A CG    1 
ATOM   938   S  SD    . MET A 1 123  ? 90.619  88.569  109.675 1.00 126.40 ? 123  MET A SD    1 
ATOM   939   C  CE    . MET A 1 123  ? 89.173  89.405  110.327 1.00 126.40 ? 123  MET A CE    1 
ATOM   940   N  N     . ASN A 1 124  ? 92.121  93.415  107.422 1.00 124.78 ? 124  ASN A N     1 
ATOM   941   C  CA    . ASN A 1 124  ? 91.819  94.778  106.989 1.00 124.78 ? 124  ASN A CA    1 
ATOM   942   C  C     . ASN A 1 124  ? 92.201  94.921  105.522 1.00 124.78 ? 124  ASN A C     1 
ATOM   943   O  O     . ASN A 1 124  ? 93.225  95.525  105.185 1.00 124.78 ? 124  ASN A O     1 
ATOM   944   C  CB    . ASN A 1 124  ? 92.537  95.808  107.861 1.00 124.78 ? 124  ASN A CB    1 
ATOM   945   C  CG    . ASN A 1 124  ? 94.008  95.498  108.044 1.00 124.78 ? 124  ASN A CG    1 
ATOM   946   O  OD1   . ASN A 1 124  ? 94.511  94.491  107.548 1.00 124.78 ? 124  ASN A OD1   1 
ATOM   947   N  ND2   . ASN A 1 124  ? 94.709  96.371  108.755 1.00 124.78 ? 124  ASN A ND2   1 
ATOM   948   N  N     . PRO A 1 125  ? 91.386  94.374  104.615 1.00 127.72 ? 125  PRO A N     1 
ATOM   949   C  CA    . PRO A 1 125  ? 91.730  94.416  103.187 1.00 127.72 ? 125  PRO A CA    1 
ATOM   950   C  C     . PRO A 1 125  ? 91.649  95.800  102.570 1.00 127.72 ? 125  PRO A C     1 
ATOM   951   O  O     . PRO A 1 125  ? 92.066  95.966  101.419 1.00 127.72 ? 125  PRO A O     1 
ATOM   952   C  CB    . PRO A 1 125  ? 90.695  93.474  102.561 1.00 127.72 ? 125  PRO A CB    1 
ATOM   953   C  CG    . PRO A 1 125  ? 89.515  93.592  103.457 1.00 127.72 ? 125  PRO A CG    1 
ATOM   954   C  CD    . PRO A 1 125  ? 90.069  93.759  104.848 1.00 127.72 ? 125  PRO A CD    1 
ATOM   955   N  N     . ASP A 1 126  ? 91.135  96.796  103.285 1.00 131.13 ? 126  ASP A N     1 
ATOM   956   C  CA    . ASP A 1 126  ? 91.022  98.142  102.745 1.00 131.13 ? 126  ASP A CA    1 
ATOM   957   C  C     . ASP A 1 126  ? 92.104  99.081  103.254 1.00 131.13 ? 126  ASP A C     1 
ATOM   958   O  O     . ASP A 1 126  ? 92.006  100.292 103.029 1.00 131.13 ? 126  ASP A O     1 
ATOM   959   C  CB    . ASP A 1 126  ? 89.646  98.729  103.071 1.00 131.13 ? 126  ASP A CB    1 
ATOM   960   C  CG    . ASP A 1 126  ? 88.592  98.337  102.057 1.00 131.13 ? 126  ASP A CG    1 
ATOM   961   O  OD1   . ASP A 1 126  ? 88.914  98.293  100.851 1.00 131.13 ? 126  ASP A OD1   1 
ATOM   962   O  OD2   . ASP A 1 126  ? 87.442  98.072  102.465 1.00 131.13 ? 126  ASP A OD2   1 
ATOM   963   N  N     . LEU A 1 127  ? 93.121  98.560  103.935 1.00 124.68 ? 127  LEU A N     1 
ATOM   964   C  CA    . LEU A 1 127  ? 94.228  99.394  104.379 1.00 124.68 ? 127  LEU A CA    1 
ATOM   965   C  C     . LEU A 1 127  ? 94.972  99.961  103.178 1.00 124.68 ? 127  LEU A C     1 
ATOM   966   O  O     . LEU A 1 127  ? 95.479  99.214  102.337 1.00 124.68 ? 127  LEU A O     1 
ATOM   967   C  CB    . LEU A 1 127  ? 95.178  98.583  105.258 1.00 124.68 ? 127  LEU A CB    1 
ATOM   968   C  CG    . LEU A 1 127  ? 96.481  99.272  105.660 1.00 124.68 ? 127  LEU A CG    1 
ATOM   969   C  CD1   . LEU A 1 127  ? 96.198  100.522 106.474 1.00 124.68 ? 127  LEU A CD1   1 
ATOM   970   C  CD2   . LEU A 1 127  ? 97.372  98.314  106.431 1.00 124.68 ? 127  LEU A CD2   1 
ATOM   971   N  N     . HIS A 1 128  ? 95.036  101.286 103.100 1.00 124.43 ? 128  HIS A N     1 
ATOM   972   C  CA    . HIS A 1 128  ? 95.725  101.931 101.993 1.00 124.43 ? 128  HIS A CA    1 
ATOM   973   C  C     . HIS A 1 128  ? 97.231  101.870 102.208 1.00 124.43 ? 128  HIS A C     1 
ATOM   974   O  O     . HIS A 1 128  ? 97.726  102.101 103.314 1.00 124.43 ? 128  HIS A O     1 
ATOM   975   C  CB    . HIS A 1 128  ? 95.264  103.380 101.854 1.00 124.43 ? 128  HIS A CB    1 
ATOM   976   C  CG    . HIS A 1 128  ? 96.012  104.155 100.816 1.00 124.43 ? 128  HIS A CG    1 
ATOM   977   N  ND1   . HIS A 1 128  ? 97.190  104.817 101.086 1.00 124.43 ? 128  HIS A ND1   1 
ATOM   978   C  CD2   . HIS A 1 128  ? 95.749  104.377 99.506  1.00 124.43 ? 128  HIS A CD2   1 
ATOM   979   C  CE1   . HIS A 1 128  ? 97.621  105.412 99.989  1.00 124.43 ? 128  HIS A CE1   1 
ATOM   980   N  NE2   . HIS A 1 128  ? 96.764  105.161 99.015  1.00 124.43 ? 128  HIS A NE2   1 
ATOM   981   N  N     . ILE A 1 129  ? 97.963  101.557 101.141 1.00 122.81 ? 129  ILE A N     1 
ATOM   982   C  CA    . ILE A 1 129  ? 99.403  101.357 101.244 1.00 122.81 ? 129  ILE A CA    1 
ATOM   983   C  C     . ILE A 1 129  ? 100.137 102.452 100.482 1.00 122.81 ? 129  ILE A C     1 
ATOM   984   O  O     . ILE A 1 129  ? 100.929 103.200 101.064 1.00 122.81 ? 129  ILE A O     1 
ATOM   985   C  CB    . ILE A 1 129  ? 99.807  99.964  100.732 1.00 122.81 ? 129  ILE A CB    1 
ATOM   986   C  CG1   . ILE A 1 129  ? 99.347  98.889  101.715 1.00 122.81 ? 129  ILE A CG1   1 
ATOM   987   C  CG2   . ILE A 1 129  ? 101.309 99.884  100.545 1.00 122.81 ? 129  ILE A CG2   1 
ATOM   988   C  CD1   . ILE A 1 129  ? 99.348  97.496  101.136 1.00 122.81 ? 129  ILE A CD1   1 
ATOM   989   N  N     . ALA A 1 130  ? 99.881  102.556 99.180  1.00 125.53 ? 130  ALA A N     1 
ATOM   990   C  CA    . ALA A 1 130  ? 100.565 103.542 98.358  1.00 125.53 ? 130  ALA A CA    1 
ATOM   991   C  C     . ALA A 1 130  ? 99.753  103.815 97.102  1.00 125.53 ? 130  ALA A C     1 
ATOM   992   O  O     . ALA A 1 130  ? 99.237  102.894 96.465  1.00 125.53 ? 130  ALA A O     1 
ATOM   993   C  CB    . ALA A 1 130  ? 101.976 103.079 97.982  1.00 125.53 ? 130  ALA A CB    1 
ATOM   994   N  N     . THR A 1 131  ? 99.648  105.091 96.749  1.00 129.94 ? 131  THR A N     1 
ATOM   995   C  CA    . THR A 1 131  ? 99.019  105.490 95.498  1.00 129.94 ? 131  THR A CA    1 
ATOM   996   C  C     . THR A 1 131  ? 100.073 105.501 94.394  1.00 129.94 ? 131  THR A C     1 
ATOM   997   O  O     . THR A 1 131  ? 101.086 106.202 94.492  1.00 129.94 ? 131  THR A O     1 
ATOM   998   C  CB    . THR A 1 131  ? 98.324  106.845 95.641  1.00 129.94 ? 131  THR A CB    1 
ATOM   999   O  OG1   . THR A 1 131  ? 97.735  107.225 94.391  1.00 129.94 ? 131  THR A OG1   1 
ATOM   1000  C  CG2   . THR A 1 131  ? 99.276  107.924 96.132  1.00 129.94 ? 131  THR A CG2   1 
ATOM   1001  N  N     . LEU A 1 132  ? 99.851  104.691 93.365  1.00 135.72 ? 132  LEU A N     1 
ATOM   1002  C  CA    . LEU A 1 132  ? 100.821 104.474 92.306  1.00 135.72 ? 132  LEU A CA    1 
ATOM   1003  C  C     . LEU A 1 132  ? 100.465 105.305 91.080  1.00 135.72 ? 132  LEU A C     1 
ATOM   1004  O  O     . LEU A 1 132  ? 99.294  105.430 90.710  1.00 135.72 ? 132  LEU A O     1 
ATOM   1005  C  CB    . LEU A 1 132  ? 100.892 102.990 91.939  1.00 135.72 ? 132  LEU A CB    1 
ATOM   1006  C  CG    . LEU A 1 132  ? 102.104 102.518 91.145  1.00 135.72 ? 132  LEU A CG    1 
ATOM   1007  C  CD1   . LEU A 1 132  ? 103.365 103.114 91.721  1.00 135.72 ? 132  LEU A CD1   1 
ATOM   1008  C  CD2   . LEU A 1 132  ? 102.177 101.008 91.188  1.00 135.72 ? 132  LEU A CD2   1 
ATOM   1009  N  N     . GLU A 1 133  ? 101.491 105.871 90.455  1.00 141.65 ? 133  GLU A N     1 
ATOM   1010  C  CA    . GLU A 1 133  ? 101.346 106.744 89.302  1.00 141.65 ? 133  GLU A CA    1 
ATOM   1011  C  C     . GLU A 1 133  ? 101.546 105.927 88.030  1.00 141.65 ? 133  GLU A C     1 
ATOM   1012  O  O     . GLU A 1 133  ? 101.937 104.758 88.070  1.00 141.65 ? 133  GLU A O     1 
ATOM   1013  C  CB    . GLU A 1 133  ? 102.358 107.899 89.372  1.00 141.65 ? 133  GLU A CB    1 
ATOM   1014  C  CG    . GLU A 1 133  ? 102.148 109.032 88.378  1.00 141.65 ? 133  GLU A CG    1 
ATOM   1015  C  CD    . GLU A 1 133  ? 103.253 110.063 88.439  1.00 141.65 ? 133  GLU A CD    1 
ATOM   1016  O  OE1   . GLU A 1 133  ? 104.215 109.858 89.206  1.00 141.65 ? 133  GLU A OE1   1 
ATOM   1017  O  OE2   . GLU A 1 133  ? 103.156 111.082 87.724  1.00 141.65 ? 133  GLU A OE2   1 
ATOM   1018  N  N     . GLU A 1 134  ? 101.266 106.554 86.891  1.00 145.37 ? 134  GLU A N     1 
ATOM   1019  C  CA    . GLU A 1 134  ? 101.570 105.955 85.599  1.00 145.37 ? 134  GLU A CA    1 
ATOM   1020  C  C     . GLU A 1 134  ? 103.068 105.728 85.463  1.00 145.37 ? 134  GLU A C     1 
ATOM   1021  O  O     . GLU A 1 134  ? 103.870 106.623 85.742  1.00 145.37 ? 134  GLU A O     1 
ATOM   1022  C  CB    . GLU A 1 134  ? 101.064 106.861 84.477  1.00 145.37 ? 134  GLU A CB    1 
ATOM   1023  C  CG    . GLU A 1 134  ? 101.340 106.341 83.078  1.00 145.37 ? 134  GLU A CG    1 
ATOM   1024  C  CD    . GLU A 1 134  ? 101.145 104.844 82.963  1.00 145.37 ? 134  GLU A CD    1 
ATOM   1025  O  OE1   . GLU A 1 134  ? 99.980  104.394 82.954  1.00 145.37 ? 134  GLU A OE1   1 
ATOM   1026  O  OE2   . GLU A 1 134  ? 102.158 104.117 82.884  1.00 145.37 ? 134  GLU A OE2   1 
ATOM   1027  N  N     . GLY A 1 135  ? 103.442 104.524 85.036  1.00 145.02 ? 135  GLY A N     1 
ATOM   1028  C  CA    . GLY A 1 135  ? 104.833 104.152 84.908  1.00 145.02 ? 135  GLY A CA    1 
ATOM   1029  C  C     . GLY A 1 135  ? 105.491 103.683 86.187  1.00 145.02 ? 135  GLY A C     1 
ATOM   1030  O  O     . GLY A 1 135  ? 106.605 103.149 86.130  1.00 145.02 ? 135  GLY A O     1 
ATOM   1031  N  N     . GLY A 1 136  ? 104.845 103.866 87.336  1.00 142.00 ? 136  GLY A N     1 
ATOM   1032  C  CA    . GLY A 1 136  ? 105.414 103.387 88.585  1.00 142.00 ? 136  GLY A CA    1 
ATOM   1033  C  C     . GLY A 1 136  ? 105.154 101.902 88.761  1.00 142.00 ? 136  GLY A C     1 
ATOM   1034  O  O     . GLY A 1 136  ? 104.068 101.404 88.441  1.00 142.00 ? 136  GLY A O     1 
ATOM   1035  N  N     . ARG A 1 137  ? 106.153 101.186 89.270  1.00 141.50 ? 137  ARG A N     1 
ATOM   1036  C  CA    . ARG A 1 137  ? 106.067 99.745  89.474  1.00 141.50 ? 137  ARG A CA    1 
ATOM   1037  C  C     . ARG A 1 137  ? 106.473 99.429  90.904  1.00 141.50 ? 137  ARG A C     1 
ATOM   1038  O  O     . ARG A 1 137  ? 107.571 99.797  91.333  1.00 141.50 ? 137  ARG A O     1 
ATOM   1039  C  CB    . ARG A 1 137  ? 106.961 98.993  88.486  1.00 141.50 ? 137  ARG A CB    1 
ATOM   1040  C  CG    . ARG A 1 137  ? 106.626 99.241  87.026  1.00 141.50 ? 137  ARG A CG    1 
ATOM   1041  C  CD    . ARG A 1 137  ? 107.722 98.719  86.110  1.00 141.50 ? 137  ARG A CD    1 
ATOM   1042  N  NE    . ARG A 1 137  ? 108.440 97.586  86.689  1.00 141.50 ? 137  ARG A NE    1 
ATOM   1043  C  CZ    . ARG A 1 137  ? 107.996 96.333  86.676  1.00 141.50 ? 137  ARG A CZ    1 
ATOM   1044  N  NH1   . ARG A 1 137  ? 106.832 96.045  86.112  1.00 141.50 ? 137  ARG A NH1   1 
ATOM   1045  N  NH2   . ARG A 1 137  ? 108.718 95.367  87.228  1.00 141.50 ? 137  ARG A NH2   1 
ATOM   1046  N  N     . LEU A 1 138  ? 105.593 98.751  91.637  1.00 132.19 ? 138  LEU A N     1 
ATOM   1047  C  CA    . LEU A 1 138  ? 105.854 98.357  93.017  1.00 132.19 ? 138  LEU A CA    1 
ATOM   1048  C  C     . LEU A 1 138  ? 105.863 96.836  93.086  1.00 132.19 ? 138  LEU A C     1 
ATOM   1049  O  O     . LEU A 1 138  ? 104.833 96.192  92.858  1.00 132.19 ? 138  LEU A O     1 
ATOM   1050  C  CB    . LEU A 1 138  ? 104.809 98.944  93.963  1.00 132.19 ? 138  LEU A CB    1 
ATOM   1051  C  CG    . LEU A 1 138  ? 105.225 99.026  95.431  1.00 132.19 ? 138  LEU A CG    1 
ATOM   1052  C  CD1   . LEU A 1 138  ? 106.545 99.761  95.565  1.00 132.19 ? 138  LEU A CD1   1 
ATOM   1053  C  CD2   . LEU A 1 138  ? 104.145 99.703  96.256  1.00 132.19 ? 138  LEU A CD2   1 
ATOM   1054  N  N     . ASN A 1 139  ? 107.022 96.268  93.406  1.00 130.53 ? 139  ASN A N     1 
ATOM   1055  C  CA    . ASN A 1 139  ? 107.188 94.825  93.546  1.00 130.53 ? 139  ASN A CA    1 
ATOM   1056  C  C     . ASN A 1 139  ? 107.958 94.580  94.834  1.00 130.53 ? 139  ASN A C     1 
ATOM   1057  O  O     . ASN A 1 139  ? 109.165 94.836  94.896  1.00 130.53 ? 139  ASN A O     1 
ATOM   1058  C  CB    . ASN A 1 139  ? 107.919 94.234  92.340  1.00 130.53 ? 139  ASN A CB    1 
ATOM   1059  C  CG    . ASN A 1 139  ? 108.393 92.815  92.579  1.00 130.53 ? 139  ASN A CG    1 
ATOM   1060  O  OD1   . ASN A 1 139  ? 107.765 92.051  93.312  1.00 130.53 ? 139  ASN A OD1   1 
ATOM   1061  N  ND2   . ASN A 1 139  ? 109.508 92.453  91.958  1.00 130.53 ? 139  ASN A ND2   1 
ATOM   1062  N  N     . MET A 1 140  ? 107.267 94.086  95.858  1.00 129.21 ? 140  MET A N     1 
ATOM   1063  C  CA    . MET A 1 140  ? 107.869 93.958  97.177  1.00 129.21 ? 140  MET A CA    1 
ATOM   1064  C  C     . MET A 1 140  ? 107.447 92.655  97.841  1.00 129.21 ? 140  MET A C     1 
ATOM   1065  O  O     . MET A 1 140  ? 106.518 91.971  97.402  1.00 129.21 ? 140  MET A O     1 
ATOM   1066  C  CB    . MET A 1 140  ? 107.507 95.146  98.076  1.00 129.21 ? 140  MET A CB    1 
ATOM   1067  C  CG    . MET A 1 140  ? 106.028 95.283  98.367  1.00 129.21 ? 140  MET A CG    1 
ATOM   1068  S  SD    . MET A 1 140  ? 105.691 96.711  99.414  1.00 129.21 ? 140  MET A SD    1 
ATOM   1069  C  CE    . MET A 1 140  ? 103.905 96.770  99.335  1.00 129.21 ? 140  MET A CE    1 
ATOM   1070  N  N     . GLU A 1 141  ? 108.164 92.324  98.914  1.00 126.83 ? 141  GLU A N     1 
ATOM   1071  C  CA    . GLU A 1 141  ? 107.953 91.103  99.686  1.00 126.83 ? 141  GLU A CA    1 
ATOM   1072  C  C     . GLU A 1 141  ? 108.012 91.469  101.162 1.00 126.83 ? 141  GLU A C     1 
ATOM   1073  O  O     . GLU A 1 141  ? 109.009 92.031  101.625 1.00 126.83 ? 141  GLU A O     1 
ATOM   1074  C  CB    . GLU A 1 141  ? 109.006 90.047  99.354  1.00 126.83 ? 141  GLU A CB    1 
ATOM   1075  C  CG    . GLU A 1 141  ? 109.176 89.767  97.875  1.00 126.83 ? 141  GLU A CG    1 
ATOM   1076  C  CD    . GLU A 1 141  ? 110.339 88.839  97.591  1.00 126.83 ? 141  GLU A CD    1 
ATOM   1077  O  OE1   . GLU A 1 141  ? 111.114 88.553  98.527  1.00 126.83 ? 141  GLU A OE1   1 
ATOM   1078  O  OE2   . GLU A 1 141  ? 110.477 88.394  96.432  1.00 126.83 ? 141  GLU A OE2   1 
ATOM   1079  N  N     . VAL A 1 142  ? 106.956 91.145  101.902 1.00 118.57 ? 142  VAL A N     1 
ATOM   1080  C  CA    . VAL A 1 142  ? 106.886 91.433  103.330 1.00 118.57 ? 142  VAL A CA    1 
ATOM   1081  C  C     . VAL A 1 142  ? 106.934 90.116  104.091 1.00 118.57 ? 142  VAL A C     1 
ATOM   1082  O  O     . VAL A 1 142  ? 106.168 89.191  103.800 1.00 118.57 ? 142  VAL A O     1 
ATOM   1083  C  CB    . VAL A 1 142  ? 105.630 92.240  103.689 1.00 118.57 ? 142  VAL A CB    1 
ATOM   1084  C  CG1   . VAL A 1 142  ? 105.788 93.676  103.237 1.00 118.57 ? 142  VAL A CG1   1 
ATOM   1085  C  CG2   . VAL A 1 142  ? 104.400 91.626  103.051 1.00 118.57 ? 142  VAL A CG2   1 
ATOM   1086  N  N     . ARG A 1 143  ? 107.830 90.031  105.068 1.00 120.19 ? 143  ARG A N     1 
ATOM   1087  C  CA    . ARG A 1 143  ? 107.968 88.841  105.894 1.00 120.19 ? 143  ARG A CA    1 
ATOM   1088  C  C     . ARG A 1 143  ? 107.305 89.092  107.242 1.00 120.19 ? 143  ARG A C     1 
ATOM   1089  O  O     . ARG A 1 143  ? 107.680 90.030  107.960 1.00 120.19 ? 143  ARG A O     1 
ATOM   1090  C  CB    . ARG A 1 143  ? 109.436 88.470  106.084 1.00 120.19 ? 143  ARG A CB    1 
ATOM   1091  C  CG    . ARG A 1 143  ? 109.681 87.624  107.320 1.00 120.19 ? 143  ARG A CG    1 
ATOM   1092  C  CD    . ARG A 1 143  ? 111.064 87.005  107.325 1.00 120.19 ? 143  ARG A CD    1 
ATOM   1093  N  NE    . ARG A 1 143  ? 111.275 86.195  108.520 1.00 120.19 ? 143  ARG A NE    1 
ATOM   1094  C  CZ    . ARG A 1 143  ? 112.389 85.521  108.780 1.00 120.19 ? 143  ARG A CZ    1 
ATOM   1095  N  NH1   . ARG A 1 143  ? 113.402 85.555  107.926 1.00 120.19 ? 143  ARG A NH1   1 
ATOM   1096  N  NH2   . ARG A 1 143  ? 112.489 84.811  109.895 1.00 120.19 ? 143  ARG A NH2   1 
ATOM   1097  N  N     . VAL A 1 144  ? 106.334 88.244  107.579 1.00 118.91 ? 144  VAL A N     1 
ATOM   1098  C  CA    . VAL A 1 144  ? 105.541 88.355  108.797 1.00 118.91 ? 144  VAL A CA    1 
ATOM   1099  C  C     . VAL A 1 144  ? 105.838 87.150  109.678 1.00 118.91 ? 144  VAL A C     1 
ATOM   1100  O  O     . VAL A 1 144  ? 105.974 86.023  109.179 1.00 118.91 ? 144  VAL A O     1 
ATOM   1101  C  CB    . VAL A 1 144  ? 104.038 88.440  108.479 1.00 118.91 ? 144  VAL A CB    1 
ATOM   1102  C  CG1   . VAL A 1 144  ? 103.253 88.826  109.717 1.00 118.91 ? 144  VAL A CG1   1 
ATOM   1103  C  CG2   . VAL A 1 144  ? 103.792 89.431  107.357 1.00 118.91 ? 144  VAL A CG2   1 
ATOM   1104  N  N     . ASP A 1 145  ? 105.926 87.387  110.984 1.00 125.07 ? 145  ASP A N     1 
ATOM   1105  C  CA    . ASP A 1 145  ? 106.239 86.361  111.965 1.00 125.07 ? 145  ASP A CA    1 
ATOM   1106  C  C     . ASP A 1 145  ? 105.224 86.392  113.098 1.00 125.07 ? 145  ASP A C     1 
ATOM   1107  O  O     . ASP A 1 145  ? 104.354 87.264  113.160 1.00 125.07 ? 145  ASP A O     1 
ATOM   1108  C  CB    . ASP A 1 145  ? 107.647 86.551  112.541 1.00 125.07 ? 145  ASP A CB    1 
ATOM   1109  C  CG    . ASP A 1 145  ? 108.729 86.056  111.611 1.00 125.07 ? 145  ASP A CG    1 
ATOM   1110  O  OD1   . ASP A 1 145  ? 108.389 85.520  110.539 1.00 125.07 ? 145  ASP A OD1   1 
ATOM   1111  O  OD2   . ASP A 1 145  ? 109.922 86.202  111.952 1.00 125.07 ? 145  ASP A OD2   1 
ATOM   1112  N  N     . ARG A 1 146  ? 105.346 85.422  113.997 1.00 123.20 ? 146  ARG A N     1 
ATOM   1113  C  CA    . ARG A 1 146  ? 104.544 85.370  115.210 1.00 123.20 ? 146  ARG A CA    1 
ATOM   1114  C  C     . ARG A 1 146  ? 105.437 85.599  116.421 1.00 123.20 ? 146  ARG A C     1 
ATOM   1115  O  O     . ARG A 1 146  ? 106.474 84.948  116.572 1.00 123.20 ? 146  ARG A O     1 
ATOM   1116  C  CB    . ARG A 1 146  ? 103.823 84.027  115.337 1.00 123.20 ? 146  ARG A CB    1 
ATOM   1117  C  CG    . ARG A 1 146  ? 102.824 83.978  116.478 1.00 123.20 ? 146  ARG A CG    1 
ATOM   1118  C  CD    . ARG A 1 146  ? 102.390 82.557  116.790 1.00 123.20 ? 146  ARG A CD    1 
ATOM   1119  N  NE    . ARG A 1 146  ? 101.106 82.223  116.182 1.00 123.20 ? 146  ARG A NE    1 
ATOM   1120  C  CZ    . ARG A 1 146  ? 100.942 81.293  115.248 1.00 123.20 ? 146  ARG A CZ    1 
ATOM   1121  N  NH1   . ARG A 1 146  ? 101.983 80.599  114.816 1.00 123.20 ? 146  ARG A NH1   1 
ATOM   1122  N  NH2   . ARG A 1 146  ? 99.737  81.053  114.751 1.00 123.20 ? 146  ARG A NH2   1 
ATOM   1123  N  N     . GLY A 1 147  ? 105.032 86.527  117.280 1.00 113.59 ? 147  GLY A N     1 
ATOM   1124  C  CA    . GLY A 1 147  ? 105.842 86.860  118.436 1.00 113.59 ? 147  GLY A CA    1 
ATOM   1125  C  C     . GLY A 1 147  ? 104.987 87.425  119.547 1.00 113.59 ? 147  GLY A C     1 
ATOM   1126  O  O     . GLY A 1 147  ? 103.756 87.450  119.465 1.00 113.59 ? 147  GLY A O     1 
ATOM   1127  N  N     . VAL A 1 148  ? 105.664 87.875  120.601 1.00 109.78 ? 148  VAL A N     1 
ATOM   1128  C  CA    . VAL A 1 148  ? 105.016 88.438  121.778 1.00 109.78 ? 148  VAL A CA    1 
ATOM   1129  C  C     . VAL A 1 148  ? 105.730 89.725  122.165 1.00 109.78 ? 148  VAL A C     1 
ATOM   1130  O  O     . VAL A 1 148  ? 106.961 89.810  122.131 1.00 109.78 ? 148  VAL A O     1 
ATOM   1131  C  CB    . VAL A 1 148  ? 105.012 87.448  122.965 1.00 109.78 ? 148  VAL A CB    1 
ATOM   1132  C  CG1   . VAL A 1 148  ? 104.270 88.038  124.151 1.00 109.78 ? 148  VAL A CG1   1 
ATOM   1133  C  CG2   . VAL A 1 148  ? 104.397 86.119  122.559 1.00 109.78 ? 148  VAL A CG2   1 
ATOM   1134  N  N     . GLY A 1 149  ? 104.943 90.733  122.540 1.00 113.05 ? 149  GLY A N     1 
ATOM   1135  C  CA    . GLY A 1 149  ? 105.520 91.968  123.033 1.00 113.05 ? 149  GLY A CA    1 
ATOM   1136  C  C     . GLY A 1 149  ? 105.867 92.942  121.920 1.00 113.05 ? 149  GLY A C     1 
ATOM   1137  O  O     . GLY A 1 149  ? 105.356 92.866  120.799 1.00 113.05 ? 149  GLY A O     1 
ATOM   1138  N  N     . TYR A 1 150  ? 106.757 93.876  122.244 1.00 109.38 ? 150  TYR A N     1 
ATOM   1139  C  CA    . TYR A 1 150  ? 107.193 94.921  121.324 1.00 109.38 ? 150  TYR A CA    1 
ATOM   1140  C  C     . TYR A 1 150  ? 108.706 94.821  121.177 1.00 109.38 ? 150  TYR A C     1 
ATOM   1141  O  O     . TYR A 1 150  ? 109.447 95.076  122.132 1.00 109.38 ? 150  TYR A O     1 
ATOM   1142  C  CB    . TYR A 1 150  ? 106.773 96.297  121.833 1.00 109.38 ? 150  TYR A CB    1 
ATOM   1143  C  CG    . TYR A 1 150  ? 107.581 97.442  121.271 1.00 109.38 ? 150  TYR A CG    1 
ATOM   1144  C  CD1   . TYR A 1 150  ? 107.444 97.830  119.947 1.00 109.38 ? 150  TYR A CD1   1 
ATOM   1145  C  CD2   . TYR A 1 150  ? 108.477 98.140  122.067 1.00 109.38 ? 150  TYR A CD2   1 
ATOM   1146  C  CE1   . TYR A 1 150  ? 108.179 98.877  119.431 1.00 109.38 ? 150  TYR A CE1   1 
ATOM   1147  C  CE2   . TYR A 1 150  ? 109.215 99.188  121.560 1.00 109.38 ? 150  TYR A CE2   1 
ATOM   1148  C  CZ    . TYR A 1 150  ? 109.063 99.552  120.242 1.00 109.38 ? 150  TYR A CZ    1 
ATOM   1149  O  OH    . TYR A 1 150  ? 109.798 100.597 119.733 1.00 109.38 ? 150  TYR A OH    1 
ATOM   1150  N  N     . VAL A 1 151  ? 109.160 94.453  119.984 1.00 112.10 ? 151  VAL A N     1 
ATOM   1151  C  CA    . VAL A 1 151  ? 110.570 94.213  119.702 1.00 112.10 ? 151  VAL A CA    1 
ATOM   1152  C  C     . VAL A 1 151  ? 111.021 95.232  118.657 1.00 112.10 ? 151  VAL A C     1 
ATOM   1153  O  O     . VAL A 1 151  ? 110.556 95.185  117.509 1.00 112.10 ? 151  VAL A O     1 
ATOM   1154  C  CB    . VAL A 1 151  ? 110.811 92.779  119.216 1.00 112.10 ? 151  VAL A CB    1 
ATOM   1155  C  CG1   . VAL A 1 151  ? 112.286 92.560  118.935 1.00 112.10 ? 151  VAL A CG1   1 
ATOM   1156  C  CG2   . VAL A 1 151  ? 110.305 91.782  120.243 1.00 112.10 ? 151  VAL A CG2   1 
ATOM   1157  N  N     . PRO A 1 152  ? 111.908 96.162  118.998 1.00 115.61 ? 152  PRO A N     1 
ATOM   1158  C  CA    . PRO A 1 152  ? 112.401 97.111  117.996 1.00 115.61 ? 152  PRO A CA    1 
ATOM   1159  C  C     . PRO A 1 152  ? 113.233 96.416  116.931 1.00 115.61 ? 152  PRO A C     1 
ATOM   1160  O  O     . PRO A 1 152  ? 113.640 95.262  117.080 1.00 115.61 ? 152  PRO A O     1 
ATOM   1161  C  CB    . PRO A 1 152  ? 113.253 98.088  118.816 1.00 115.61 ? 152  PRO A CB    1 
ATOM   1162  C  CG    . PRO A 1 152  ? 112.812 97.900  120.231 1.00 115.61 ? 152  PRO A CG    1 
ATOM   1163  C  CD    . PRO A 1 152  ? 112.416 96.465  120.344 1.00 115.61 ? 152  PRO A CD    1 
ATOM   1164  N  N     . ALA A 1 153  ? 113.485 97.144  115.841 1.00 119.81 ? 153  ALA A N     1 
ATOM   1165  C  CA    . ALA A 1 153  ? 114.250 96.579  114.734 1.00 119.81 ? 153  ALA A CA    1 
ATOM   1166  C  C     . ALA A 1 153  ? 115.696 96.321  115.132 1.00 119.81 ? 153  ALA A C     1 
ATOM   1167  O  O     . ALA A 1 153  ? 116.312 95.353  114.673 1.00 119.81 ? 153  ALA A O     1 
ATOM   1168  C  CB    . ALA A 1 153  ? 114.189 97.508  113.522 1.00 119.81 ? 153  ALA A CB    1 
ATOM   1169  N  N     . GLU A 1 154  ? 116.257 97.184  115.982 1.00 126.95 ? 154  GLU A N     1 
ATOM   1170  C  CA    . GLU A 1 154  ? 117.639 97.006  116.416 1.00 126.95 ? 154  GLU A CA    1 
ATOM   1171  C  C     . GLU A 1 154  ? 117.823 95.708  117.188 1.00 126.95 ? 154  GLU A C     1 
ATOM   1172  O  O     . GLU A 1 154  ? 118.910 95.120  117.162 1.00 126.95 ? 154  GLU A O     1 
ATOM   1173  C  CB    . GLU A 1 154  ? 118.090 98.192  117.274 1.00 126.95 ? 154  GLU A CB    1 
ATOM   1174  C  CG    . GLU A 1 154  ? 118.075 99.552  116.577 1.00 126.95 ? 154  GLU A CG    1 
ATOM   1175  C  CD    . GLU A 1 154  ? 116.677 100.071 116.301 1.00 126.95 ? 154  GLU A CD    1 
ATOM   1176  O  OE1   . GLU A 1 154  ? 115.977 100.437 117.268 1.00 126.95 ? 154  GLU A OE1   1 
ATOM   1177  O  OE2   . GLU A 1 154  ? 116.278 100.111 115.119 1.00 126.95 ? 154  GLU A OE2   1 
ATOM   1178  N  N     . LYS A 1 155  ? 116.780 95.245  117.878 1.00 125.70 ? 155  LYS A N     1 
ATOM   1179  C  CA    . LYS A 1 155  ? 116.901 94.038  118.687 1.00 125.70 ? 155  LYS A CA    1 
ATOM   1180  C  C     . LYS A 1 155  ? 117.039 92.798  117.812 1.00 125.70 ? 155  LYS A C     1 
ATOM   1181  O  O     . LYS A 1 155  ? 118.014 92.046  117.930 1.00 125.70 ? 155  LYS A O     1 
ATOM   1182  C  CB    . LYS A 1 155  ? 115.696 93.913  119.620 1.00 125.70 ? 155  LYS A CB    1 
ATOM   1183  C  CG    . LYS A 1 155  ? 115.831 94.701  120.911 1.00 125.70 ? 155  LYS A CG    1 
ATOM   1184  C  CD    . LYS A 1 155  ? 116.726 93.980  121.903 1.00 125.70 ? 155  LYS A CD    1 
ATOM   1185  C  CE    . LYS A 1 155  ? 116.196 92.592  122.219 1.00 125.70 ? 155  LYS A CE    1 
ATOM   1186  N  NZ    . LYS A 1 155  ? 114.804 92.632  122.744 1.00 125.70 ? 155  LYS A NZ    1 
ATOM   1187  N  N     . HIS A 1 156  ? 116.073 92.566  116.922 1.00 122.96 ? 156  HIS A N     1 
ATOM   1188  C  CA    . HIS A 1 156  ? 116.090 91.336  116.138 1.00 122.96 ? 156  HIS A CA    1 
ATOM   1189  C  C     . HIS A 1 156  ? 116.893 91.493  114.851 1.00 122.96 ? 156  HIS A C     1 
ATOM   1190  O  O     . HIS A 1 156  ? 117.700 90.619  114.516 1.00 122.96 ? 156  HIS A O     1 
ATOM   1191  C  CB    . HIS A 1 156  ? 114.658 90.878  115.844 1.00 122.96 ? 156  HIS A CB    1 
ATOM   1192  C  CG    . HIS A 1 156  ? 113.861 91.844  115.022 1.00 122.96 ? 156  HIS A CG    1 
ATOM   1193  N  ND1   . HIS A 1 156  ? 113.939 91.894  113.647 1.00 122.96 ? 156  HIS A ND1   1 
ATOM   1194  C  CD2   . HIS A 1 156  ? 112.961 92.789  115.383 1.00 122.96 ? 156  HIS A CD2   1 
ATOM   1195  C  CE1   . HIS A 1 156  ? 113.126 92.832  113.196 1.00 122.96 ? 156  HIS A CE1   1 
ATOM   1196  N  NE2   . HIS A 1 156  ? 112.521 93.390  114.229 1.00 122.96 ? 156  HIS A NE2   1 
ATOM   1197  N  N     . GLY A 1 157  ? 116.705 92.596  114.133 1.00 122.92 ? 157  GLY A N     1 
ATOM   1198  C  CA    . GLY A 1 157  ? 117.455 92.813  112.900 1.00 122.92 ? 157  GLY A CA    1 
ATOM   1199  C  C     . GLY A 1 157  ? 117.282 91.713  111.877 1.00 122.92 ? 157  GLY A C     1 
ATOM   1200  O  O     . GLY A 1 157  ? 118.271 91.223  111.317 1.00 122.92 ? 157  GLY A O     1 
ATOM   1201  N  N     . ILE A 1 158  ? 116.042 91.310  111.619 1.00 127.23 ? 158  ILE A N     1 
ATOM   1202  C  CA    . ILE A 1 158  ? 115.767 90.215  110.695 1.00 127.23 ? 158  ILE A CA    1 
ATOM   1203  C  C     . ILE A 1 158  ? 115.865 90.733  109.266 1.00 127.23 ? 158  ILE A C     1 
ATOM   1204  O  O     . ILE A 1 158  ? 115.152 91.667  108.883 1.00 127.23 ? 158  ILE A O     1 
ATOM   1205  C  CB    . ILE A 1 158  ? 114.388 89.598  110.964 1.00 127.23 ? 158  ILE A CB    1 
ATOM   1206  C  CG1   . ILE A 1 158  ? 114.388 88.861  112.303 1.00 127.23 ? 158  ILE A CG1   1 
ATOM   1207  C  CG2   . ILE A 1 158  ? 113.996 88.659  109.837 1.00 127.23 ? 158  ILE A CG2   1 
ATOM   1208  C  CD1   . ILE A 1 158  ? 113.008 88.489  112.790 1.00 127.23 ? 158  ILE A CD1   1 
ATOM   1209  N  N     . LYS A 1 159  ? 116.749 90.128  108.476 1.00 131.50 ? 159  LYS A N     1 
ATOM   1210  C  CA    . LYS A 1 159  ? 116.897 90.458  107.063 1.00 131.50 ? 159  LYS A CA    1 
ATOM   1211  C  C     . LYS A 1 159  ? 116.941 89.160  106.274 1.00 131.50 ? 159  LYS A C     1 
ATOM   1212  O  O     . LYS A 1 159  ? 117.953 88.454  106.297 1.00 131.50 ? 159  LYS A O     1 
ATOM   1213  C  CB    . LYS A 1 159  ? 118.161 91.284  106.807 1.00 131.50 ? 159  LYS A CB    1 
ATOM   1214  C  CG    . LYS A 1 159  ? 118.277 92.534  107.659 1.00 131.50 ? 159  LYS A CG    1 
ATOM   1215  C  CD    . LYS A 1 159  ? 119.641 93.181  107.503 1.00 131.50 ? 159  LYS A CD    1 
ATOM   1216  C  CE    . LYS A 1 159  ? 119.869 93.648  106.076 1.00 131.50 ? 159  LYS A CE    1 
ATOM   1217  N  NZ    . LYS A 1 159  ? 121.155 94.382  105.933 1.00 131.50 ? 159  LYS A NZ    1 
ATOM   1218  N  N     . ASP A 1 160  ? 115.846 88.848  105.578 1.00 136.35 ? 160  ASP A N     1 
ATOM   1219  C  CA    . ASP A 1 160  ? 115.780 87.593  104.838 1.00 136.35 ? 160  ASP A CA    1 
ATOM   1220  C  C     . ASP A 1 160  ? 116.736 87.579  103.653 1.00 136.35 ? 160  ASP A C     1 
ATOM   1221  O  O     . ASP A 1 160  ? 117.178 86.505  103.230 1.00 136.35 ? 160  ASP A O     1 
ATOM   1222  C  CB    . ASP A 1 160  ? 114.347 87.334  104.373 1.00 136.35 ? 160  ASP A CB    1 
ATOM   1223  C  CG    . ASP A 1 160  ? 113.754 88.510  103.624 1.00 136.35 ? 160  ASP A CG    1 
ATOM   1224  O  OD1   . ASP A 1 160  ? 114.205 88.787  102.493 1.00 136.35 ? 160  ASP A OD1   1 
ATOM   1225  O  OD2   . ASP A 1 160  ? 112.836 89.159  104.167 1.00 136.35 ? 160  ASP A OD2   1 
ATOM   1226  N  N     . ARG A 1 161  ? 117.067 88.747  103.104 1.00 130.09 ? 161  ARG A N     1 
ATOM   1227  C  CA    . ARG A 1 161  ? 118.008 88.844  101.999 1.00 130.09 ? 161  ARG A CA    1 
ATOM   1228  C  C     . ARG A 1 161  ? 118.883 90.074  102.204 1.00 130.09 ? 161  ARG A C     1 
ATOM   1229  O  O     . ARG A 1 161  ? 118.925 90.657  103.292 1.00 130.09 ? 161  ARG A O     1 
ATOM   1230  C  CB    . ARG A 1 161  ? 117.283 88.871  100.648 1.00 130.09 ? 161  ARG A CB    1 
ATOM   1231  C  CG    . ARG A 1 161  ? 116.387 90.070  100.421 1.00 130.09 ? 161  ARG A CG    1 
ATOM   1232  C  CD    . ARG A 1 161  ? 115.951 90.124  98.968  1.00 130.09 ? 161  ARG A CD    1 
ATOM   1233  N  NE    . ARG A 1 161  ? 115.290 88.888  98.558  1.00 130.09 ? 161  ARG A NE    1 
ATOM   1234  C  CZ    . ARG A 1 161  ? 115.028 88.562  97.297  1.00 130.09 ? 161  ARG A CZ    1 
ATOM   1235  N  NH1   . ARG A 1 161  ? 115.375 89.377  96.312  1.00 130.09 ? 161  ARG A NH1   1 
ATOM   1236  N  NH2   . ARG A 1 161  ? 114.422 87.416  97.020  1.00 130.09 ? 161  ARG A NH2   1 
ATOM   1237  N  N     . ILE A 1 162  ? 119.593 90.467  101.145 1.00 128.18 ? 162  ILE A N     1 
ATOM   1238  C  CA    . ILE A 1 162  ? 120.625 91.493  101.278 1.00 128.18 ? 162  ILE A CA    1 
ATOM   1239  C  C     . ILE A 1 162  ? 120.002 92.854  101.562 1.00 128.18 ? 162  ILE A C     1 
ATOM   1240  O  O     . ILE A 1 162  ? 120.250 93.464  102.609 1.00 128.18 ? 162  ILE A O     1 
ATOM   1241  C  CB    . ILE A 1 162  ? 121.505 91.532  100.017 1.00 128.18 ? 162  ILE A CB    1 
ATOM   1242  C  CG1   . ILE A 1 162  ? 122.170 90.174  99.790  1.00 128.18 ? 162  ILE A CG1   1 
ATOM   1243  C  CG2   . ILE A 1 162  ? 122.553 92.627  100.137 1.00 128.18 ? 162  ILE A CG2   1 
ATOM   1244  C  CD1   . ILE A 1 162  ? 122.992 89.695  100.964 1.00 128.18 ? 162  ILE A CD1   1 
ATOM   1245  N  N     . ASN A 1 163  ? 119.183 93.350  100.639 1.00 128.93 ? 163  ASN A N     1 
ATOM   1246  C  CA    . ASN A 1 163  ? 118.639 94.698  100.732 1.00 128.93 ? 163  ASN A CA    1 
ATOM   1247  C  C     . ASN A 1 163  ? 117.327 94.764  101.501 1.00 128.93 ? 163  ASN A C     1 
ATOM   1248  O  O     . ASN A 1 163  ? 116.597 95.751  101.368 1.00 128.93 ? 163  ASN A O     1 
ATOM   1249  C  CB    . ASN A 1 163  ? 118.449 95.285  99.332  1.00 128.93 ? 163  ASN A CB    1 
ATOM   1250  C  CG    . ASN A 1 163  ? 119.752 95.407  98.574  1.00 128.93 ? 163  ASN A CG    1 
ATOM   1251  O  OD1   . ASN A 1 163  ? 120.828 95.443  99.170  1.00 128.93 ? 163  ASN A OD1   1 
ATOM   1252  N  ND2   . ASN A 1 163  ? 119.664 95.470  97.251  1.00 128.93 ? 163  ASN A ND2   1 
ATOM   1253  N  N     . ALA A 1 164  ? 117.010 93.744  102.294 1.00 125.37 ? 164  ALA A N     1 
ATOM   1254  C  CA    . ALA A 1 164  ? 115.799 93.781  103.101 1.00 125.37 ? 164  ALA A CA    1 
ATOM   1255  C  C     . ALA A 1 164  ? 115.885 94.890  104.142 1.00 125.37 ? 164  ALA A C     1 
ATOM   1256  O  O     . ALA A 1 164  ? 116.965 95.406  104.438 1.00 125.37 ? 164  ALA A O     1 
ATOM   1257  C  CB    . ALA A 1 164  ? 115.574 92.432  103.784 1.00 125.37 ? 164  ALA A CB    1 
ATOM   1258  N  N     . ILE A 1 165  ? 114.735 95.256  104.697 1.00 116.82 ? 165  ILE A N     1 
ATOM   1259  C  CA    . ILE A 1 165  ? 114.633 96.326  105.681 1.00 116.82 ? 165  ILE A CA    1 
ATOM   1260  C  C     . ILE A 1 165  ? 114.013 95.745  106.949 1.00 116.82 ? 165  ILE A C     1 
ATOM   1261  O  O     . ILE A 1 165  ? 112.933 95.139  106.889 1.00 116.82 ? 165  ILE A O     1 
ATOM   1262  C  CB    . ILE A 1 165  ? 113.805 97.504  105.154 1.00 116.82 ? 165  ILE A CB    1 
ATOM   1263  C  CG1   . ILE A 1 165  ? 114.381 98.017  103.833 1.00 116.82 ? 165  ILE A CG1   1 
ATOM   1264  C  CG2   . ILE A 1 165  ? 113.740 98.599  106.191 1.00 116.82 ? 165  ILE A CG2   1 
ATOM   1265  C  CD1   . ILE A 1 165  ? 113.703 99.264  103.319 1.00 116.82 ? 165  ILE A CD1   1 
ATOM   1266  N  N     . PRO A 1 166  ? 114.648 95.897  108.108 1.00 114.19 ? 166  PRO A N     1 
ATOM   1267  C  CA    . PRO A 1 166  ? 114.001 95.483  109.356 1.00 114.19 ? 166  PRO A CA    1 
ATOM   1268  C  C     . PRO A 1 166  ? 112.966 96.509  109.788 1.00 114.19 ? 166  PRO A C     1 
ATOM   1269  O  O     . PRO A 1 166  ? 113.183 97.718  109.688 1.00 114.19 ? 166  PRO A O     1 
ATOM   1270  C  CB    . PRO A 1 166  ? 115.165 95.400  110.352 1.00 114.19 ? 166  PRO A CB    1 
ATOM   1271  C  CG    . PRO A 1 166  ? 116.417 95.477  109.516 1.00 114.19 ? 166  PRO A CG    1 
ATOM   1272  C  CD    . PRO A 1 166  ? 116.045 96.295  108.329 1.00 114.19 ? 166  PRO A CD    1 
ATOM   1273  N  N     . VAL A 1 167  ? 111.831 96.016  110.274 1.00 113.46 ? 167  VAL A N     1 
ATOM   1274  C  CA    . VAL A 1 167  ? 110.723 96.856  110.707 1.00 113.46 ? 167  VAL A CA    1 
ATOM   1275  C  C     . VAL A 1 167  ? 110.420 96.554  112.167 1.00 113.46 ? 167  VAL A C     1 
ATOM   1276  O  O     . VAL A 1 167  ? 110.460 95.393  112.589 1.00 113.46 ? 167  VAL A O     1 
ATOM   1277  C  CB    . VAL A 1 167  ? 109.470 96.635  109.835 1.00 113.46 ? 167  VAL A CB    1 
ATOM   1278  C  CG1   . VAL A 1 167  ? 108.396 97.649  110.179 1.00 113.46 ? 167  VAL A CG1   1 
ATOM   1279  C  CG2   . VAL A 1 167  ? 109.830 96.718  108.364 1.00 113.46 ? 167  VAL A CG2   1 
ATOM   1280  N  N     . ASP A 1 168  ? 110.129 97.601  112.936 1.00 116.96 ? 168  ASP A N     1 
ATOM   1281  C  CA    . ASP A 1 168  ? 109.722 97.419  114.322 1.00 116.96 ? 168  ASP A CA    1 
ATOM   1282  C  C     . ASP A 1 168  ? 108.436 96.609  114.383 1.00 116.96 ? 168  ASP A C     1 
ATOM   1283  O  O     . ASP A 1 168  ? 107.512 96.826  113.594 1.00 116.96 ? 168  ASP A O     1 
ATOM   1284  C  CB    . ASP A 1 168  ? 109.525 98.776  114.995 1.00 116.96 ? 168  ASP A CB    1 
ATOM   1285  C  CG    . ASP A 1 168  ? 110.785 99.610  114.997 1.00 116.96 ? 168  ASP A CG    1 
ATOM   1286  O  OD1   . ASP A 1 168  ? 111.881 99.030  115.139 1.00 116.96 ? 168  ASP A OD1   1 
ATOM   1287  O  OD2   . ASP A 1 168  ? 110.681 100.844 114.846 1.00 116.96 ? 168  ASP A OD2   1 
ATOM   1288  N  N     . ALA A 1 169  ? 108.376 95.672  115.323 1.00 111.81 ? 169  ALA A N     1 
ATOM   1289  C  CA    . ALA A 1 169  ? 107.259 94.741  115.433 1.00 111.81 ? 169  ALA A CA    1 
ATOM   1290  C  C     . ALA A 1 169  ? 106.448 95.078  116.677 1.00 111.81 ? 169  ALA A C     1 
ATOM   1291  O  O     . ALA A 1 169  ? 107.013 95.333  117.745 1.00 111.81 ? 169  ALA A O     1 
ATOM   1292  C  CB    . ALA A 1 169  ? 107.760 93.300  115.481 1.00 111.81 ? 169  ALA A CB    1 
ATOM   1293  N  N     . VAL A 1 170  ? 105.128 95.083  116.532 1.00 107.63 ? 170  VAL A N     1 
ATOM   1294  C  CA    . VAL A 1 170  ? 104.203 95.203  117.652 1.00 107.63 ? 170  VAL A CA    1 
ATOM   1295  C  C     . VAL A 1 170  ? 103.302 93.977  117.590 1.00 107.63 ? 170  VAL A C     1 
ATOM   1296  O  O     . VAL A 1 170  ? 102.359 93.920  116.797 1.00 107.63 ? 170  VAL A O     1 
ATOM   1297  C  CB    . VAL A 1 170  ? 103.404 96.506  117.598 1.00 107.63 ? 170  VAL A CB    1 
ATOM   1298  C  CG1   . VAL A 1 170  ? 102.538 96.643  118.837 1.00 107.63 ? 170  VAL A CG1   1 
ATOM   1299  C  CG2   . VAL A 1 170  ? 104.340 97.694  117.467 1.00 107.63 ? 170  VAL A CG2   1 
ATOM   1300  N  N     . PHE A 1 171  ? 103.590 92.987  118.435 1.00 110.19 ? 171  PHE A N     1 
ATOM   1301  C  CA    . PHE A 1 171  ? 102.949 91.685  118.297 1.00 110.19 ? 171  PHE A CA    1 
ATOM   1302  C  C     . PHE A 1 171  ? 101.608 91.624  119.017 1.00 110.19 ? 171  PHE A C     1 
ATOM   1303  O  O     . PHE A 1 171  ? 100.785 90.753  118.717 1.00 110.19 ? 171  PHE A O     1 
ATOM   1304  C  CB    . PHE A 1 171  ? 103.876 90.591  118.822 1.00 110.19 ? 171  PHE A CB    1 
ATOM   1305  C  CG    . PHE A 1 171  ? 105.061 90.328  117.943 1.00 110.19 ? 171  PHE A CG    1 
ATOM   1306  C  CD1   . PHE A 1 171  ? 104.892 89.880  116.646 1.00 110.19 ? 171  PHE A CD1   1 
ATOM   1307  C  CD2   . PHE A 1 171  ? 106.346 90.524  118.415 1.00 110.19 ? 171  PHE A CD2   1 
ATOM   1308  C  CE1   . PHE A 1 171  ? 105.982 89.637  115.837 1.00 110.19 ? 171  PHE A CE1   1 
ATOM   1309  C  CE2   . PHE A 1 171  ? 107.439 90.283  117.611 1.00 110.19 ? 171  PHE A CE2   1 
ATOM   1310  C  CZ    . PHE A 1 171  ? 107.257 89.839  116.320 1.00 110.19 ? 171  PHE A CZ    1 
ATOM   1311  N  N     . SER A 1 172  ? 101.374 92.523  119.965 1.00 112.10 ? 172  SER A N     1 
ATOM   1312  C  CA    . SER A 1 172  ? 100.176 92.470  120.786 1.00 112.10 ? 172  SER A CA    1 
ATOM   1313  C  C     . SER A 1 172  ? 98.926  92.623  119.922 1.00 112.10 ? 172  SER A C     1 
ATOM   1314  O  O     . SER A 1 172  ? 98.779  93.641  119.231 1.00 112.10 ? 172  SER A O     1 
ATOM   1315  C  CB    . SER A 1 172  ? 100.216 93.564  121.849 1.00 112.10 ? 172  SER A CB    1 
ATOM   1316  O  OG    . SER A 1 172  ? 99.317  93.276  122.905 1.00 112.10 ? 172  SER A OG    1 
ATOM   1317  N  N     . PRO A 1 173  ? 98.014  91.647  119.928 1.00 111.01 ? 173  PRO A N     1 
ATOM   1318  C  CA    . PRO A 1 173  ? 96.791  91.786  119.127 1.00 111.01 ? 173  PRO A CA    1 
ATOM   1319  C  C     . PRO A 1 173  ? 95.680  92.526  119.844 1.00 111.01 ? 173  PRO A C     1 
ATOM   1320  O  O     . PRO A 1 173  ? 94.689  92.889  119.201 1.00 111.01 ? 173  PRO A O     1 
ATOM   1321  C  CB    . PRO A 1 173  ? 96.399  90.332  118.853 1.00 111.01 ? 173  PRO A CB    1 
ATOM   1322  C  CG    . PRO A 1 173  ? 96.835  89.627  120.091 1.00 111.01 ? 173  PRO A CG    1 
ATOM   1323  C  CD    . PRO A 1 173  ? 98.116  90.309  120.535 1.00 111.01 ? 173  PRO A CD    1 
ATOM   1324  N  N     . VAL A 1 174  ? 95.810  92.765  121.145 1.00 109.62 ? 174  VAL A N     1 
ATOM   1325  C  CA    . VAL A 1 174  ? 94.757  93.418  121.914 1.00 109.62 ? 174  VAL A CA    1 
ATOM   1326  C  C     . VAL A 1 174  ? 94.901  94.926  121.761 1.00 109.62 ? 174  VAL A C     1 
ATOM   1327  O  O     . VAL A 1 174  ? 95.978  95.486  121.988 1.00 109.62 ? 174  VAL A O     1 
ATOM   1328  C  CB    . VAL A 1 174  ? 94.816  93.004  123.390 1.00 109.62 ? 174  VAL A CB    1 
ATOM   1329  C  CG1   . VAL A 1 174  ? 93.922  93.899  124.221 1.00 109.62 ? 174  VAL A CG1   1 
ATOM   1330  C  CG2   . VAL A 1 174  ? 94.406  91.550  123.543 1.00 109.62 ? 174  VAL A CG2   1 
ATOM   1331  N  N     . ARG A 1 175  ? 93.809  95.589  121.376 1.00 115.40 ? 175  ARG A N     1 
ATOM   1332  C  CA    . ARG A 1 175  ? 93.851  97.031  121.172 1.00 115.40 ? 175  ARG A CA    1 
ATOM   1333  C  C     . ARG A 1 175  ? 93.552  97.789  122.458 1.00 115.40 ? 175  ARG A C     1 
ATOM   1334  O  O     . ARG A 1 175  ? 94.256  98.748  122.792 1.00 115.40 ? 175  ARG A O     1 
ATOM   1335  C  CB    . ARG A 1 175  ? 92.862  97.437  120.080 1.00 115.40 ? 175  ARG A CB    1 
ATOM   1336  C  CG    . ARG A 1 175  ? 93.239  96.971  118.687 1.00 115.40 ? 175  ARG A CG    1 
ATOM   1337  C  CD    . ARG A 1 175  ? 92.896  98.027  117.651 1.00 115.40 ? 175  ARG A CD    1 
ATOM   1338  N  NE    . ARG A 1 175  ? 93.561  97.786  116.374 1.00 115.40 ? 175  ARG A NE    1 
ATOM   1339  C  CZ    . ARG A 1 175  ? 94.851  98.010  116.146 1.00 115.40 ? 175  ARG A CZ    1 
ATOM   1340  N  NH1   . ARG A 1 175  ? 95.626  98.489  117.110 1.00 115.40 ? 175  ARG A NH1   1 
ATOM   1341  N  NH2   . ARG A 1 175  ? 95.366  97.760  114.951 1.00 115.40 ? 175  ARG A NH2   1 
ATOM   1342  N  N     . ARG A 1 176  ? 92.517  97.381  123.189 1.00 113.22 ? 176  ARG A N     1 
ATOM   1343  C  CA    . ARG A 1 176  ? 92.106  98.125  124.372 1.00 113.22 ? 176  ARG A CA    1 
ATOM   1344  C  C     . ARG A 1 176  ? 91.358  97.205  125.324 1.00 113.22 ? 176  ARG A C     1 
ATOM   1345  O  O     . ARG A 1 176  ? 90.679  96.268  124.900 1.00 113.22 ? 176  ARG A O     1 
ATOM   1346  C  CB    . ARG A 1 176  ? 91.232  99.323  123.989 1.00 113.22 ? 176  ARG A CB    1 
ATOM   1347  C  CG    . ARG A 1 176  ? 91.265  100.466 124.980 1.00 113.22 ? 176  ARG A CG    1 
ATOM   1348  C  CD    . ARG A 1 176  ? 90.931  101.780 124.294 1.00 113.22 ? 176  ARG A CD    1 
ATOM   1349  N  NE    . ARG A 1 176  ? 89.666  101.711 123.573 1.00 113.22 ? 176  ARG A NE    1 
ATOM   1350  C  CZ    . ARG A 1 176  ? 88.495  102.076 124.082 1.00 113.22 ? 176  ARG A CZ    1 
ATOM   1351  N  NH1   . ARG A 1 176  ? 88.425  102.541 125.321 1.00 113.22 ? 176  ARG A NH1   1 
ATOM   1352  N  NH2   . ARG A 1 176  ? 87.393  101.978 123.352 1.00 113.22 ? 176  ARG A NH2   1 
ATOM   1353  N  N     . VAL A 1 177  ? 91.482  97.488  126.620 1.00 110.29 ? 177  VAL A N     1 
ATOM   1354  C  CA    . VAL A 1 177  ? 90.849  96.682  127.659 1.00 110.29 ? 177  VAL A CA    1 
ATOM   1355  C  C     . VAL A 1 177  ? 90.362  97.615  128.759 1.00 110.29 ? 177  VAL A C     1 
ATOM   1356  O  O     . VAL A 1 177  ? 91.118  98.472  129.229 1.00 110.29 ? 177  VAL A O     1 
ATOM   1357  C  CB    . VAL A 1 177  ? 91.805  95.627  128.243 1.00 110.29 ? 177  VAL A CB    1 
ATOM   1358  C  CG1   . VAL A 1 177  ? 91.285  95.117  129.575 1.00 110.29 ? 177  VAL A CG1   1 
ATOM   1359  C  CG2   . VAL A 1 177  ? 91.983  94.475  127.274 1.00 110.29 ? 177  VAL A CG2   1 
ATOM   1360  N  N     . ALA A 1 178  ? 89.107  97.452  129.168 1.00 112.43 ? 178  ALA A N     1 
ATOM   1361  C  CA    . ALA A 1 178  ? 88.549  98.176  130.299 1.00 112.43 ? 178  ALA A CA    1 
ATOM   1362  C  C     . ALA A 1 178  ? 87.679  97.227  131.109 1.00 112.43 ? 178  ALA A C     1 
ATOM   1363  O  O     . ALA A 1 178  ? 87.377  96.114  130.676 1.00 112.43 ? 178  ALA A O     1 
ATOM   1364  C  CB    . ALA A 1 178  ? 87.730  99.390  129.846 1.00 112.43 ? 178  ALA A CB    1 
ATOM   1365  N  N     . PHE A 1 179  ? 87.278  97.666  132.299 1.00 113.21 ? 179  PHE A N     1 
ATOM   1366  C  CA    . PHE A 1 179  ? 86.371  96.864  133.109 1.00 113.21 ? 179  PHE A CA    1 
ATOM   1367  C  C     . PHE A 1 179  ? 85.624  97.744  134.097 1.00 113.21 ? 179  PHE A C     1 
ATOM   1368  O  O     . PHE A 1 179  ? 86.201  98.663  134.685 1.00 113.21 ? 179  PHE A O     1 
ATOM   1369  C  CB    . PHE A 1 179  ? 87.117  95.744  133.848 1.00 113.21 ? 179  PHE A CB    1 
ATOM   1370  C  CG    . PHE A 1 179  ? 88.066  96.228  134.903 1.00 113.21 ? 179  PHE A CG    1 
ATOM   1371  C  CD1   . PHE A 1 179  ? 87.708  96.200  136.238 1.00 113.21 ? 179  PHE A CD1   1 
ATOM   1372  C  CD2   . PHE A 1 179  ? 89.324  96.691  134.563 1.00 113.21 ? 179  PHE A CD2   1 
ATOM   1373  C  CE1   . PHE A 1 179  ? 88.581  96.636  137.213 1.00 113.21 ? 179  PHE A CE1   1 
ATOM   1374  C  CE2   . PHE A 1 179  ? 90.201  97.128  135.533 1.00 113.21 ? 179  PHE A CE2   1 
ATOM   1375  C  CZ    . PHE A 1 179  ? 89.829  97.100  136.859 1.00 113.21 ? 179  PHE A CZ    1 
ATOM   1376  N  N     . GLN A 1 180  ? 84.340  97.453  134.260 1.00 123.39 ? 180  GLN A N     1 
ATOM   1377  C  CA    . GLN A 1 180  ? 83.487  98.136  135.218 1.00 123.39 ? 180  GLN A CA    1 
ATOM   1378  C  C     . GLN A 1 180  ? 83.185  97.219  136.395 1.00 123.39 ? 180  GLN A C     1 
ATOM   1379  O  O     . GLN A 1 180  ? 83.070  96.000  136.236 1.00 123.39 ? 180  GLN A O     1 
ATOM   1380  C  CB    . GLN A 1 180  ? 82.179  98.576  134.559 1.00 123.39 ? 180  GLN A CB    1 
ATOM   1381  C  CG    . GLN A 1 180  ? 82.353  99.483  133.356 1.00 123.39 ? 180  GLN A CG    1 
ATOM   1382  C  CD    . GLN A 1 180  ? 82.821  100.871 133.736 1.00 123.39 ? 180  GLN A CD    1 
ATOM   1383  O  OE1   . GLN A 1 180  ? 83.945  101.265 133.429 1.00 123.39 ? 180  GLN A OE1   1 
ATOM   1384  N  NE2   . GLN A 1 180  ? 81.957  101.622 134.408 1.00 123.39 ? 180  GLN A NE2   1 
ATOM   1385  N  N     . VAL A 1 181  ? 83.057  97.815  137.576 1.00 125.40 ? 181  VAL A N     1 
ATOM   1386  C  CA    . VAL A 1 181  ? 82.685  97.102  138.792 1.00 125.40 ? 181  VAL A CA    1 
ATOM   1387  C  C     . VAL A 1 181  ? 81.424  97.764  139.324 1.00 125.40 ? 181  VAL A C     1 
ATOM   1388  O  O     . VAL A 1 181  ? 81.495  98.807  139.985 1.00 125.40 ? 181  VAL A O     1 
ATOM   1389  C  CB    . VAL A 1 181  ? 83.802  97.122  139.842 1.00 125.40 ? 181  VAL A CB    1 
ATOM   1390  C  CG1   . VAL A 1 181  ? 83.431  96.242  141.022 1.00 125.40 ? 181  VAL A CG1   1 
ATOM   1391  C  CG2   . VAL A 1 181  ? 85.116  96.672  139.228 1.00 125.40 ? 181  VAL A CG2   1 
ATOM   1392  N  N     . GLU A 1 182  ? 80.273  97.163  139.045 1.00 140.31 ? 182  GLU A N     1 
ATOM   1393  C  CA    . GLU A 1 182  ? 78.994  97.746  139.409 1.00 140.31 ? 182  GLU A CA    1 
ATOM   1394  C  C     . GLU A 1 182  ? 78.473  97.114  140.691 1.00 140.31 ? 182  GLU A C     1 
ATOM   1395  O  O     . GLU A 1 182  ? 78.856  96.002  141.067 1.00 140.31 ? 182  GLU A O     1 
ATOM   1396  C  CB    . GLU A 1 182  ? 77.966  97.578  138.286 1.00 140.31 ? 182  GLU A CB    1 
ATOM   1397  C  CG    . GLU A 1 182  ? 78.415  98.150  136.954 1.00 140.31 ? 182  GLU A CG    1 
ATOM   1398  C  CD    . GLU A 1 182  ? 77.333  98.078  135.898 1.00 140.31 ? 182  GLU A CD    1 
ATOM   1399  O  OE1   . GLU A 1 182  ? 76.149  98.276  136.244 1.00 140.31 ? 182  GLU A OE1   1 
ATOM   1400  O  OE2   . GLU A 1 182  ? 77.666  97.825  134.721 1.00 140.31 ? 182  GLU A OE2   1 
ATOM   1401  N  N     . ASP A 1 183  ? 77.595  97.847  141.366 1.00 146.45 ? 183  ASP A N     1 
ATOM   1402  C  CA    . ASP A 1 183  ? 77.014  97.362  142.606 1.00 146.45 ? 183  ASP A CA    1 
ATOM   1403  C  C     . ASP A 1 183  ? 75.863  96.408  142.311 1.00 146.45 ? 183  ASP A C     1 
ATOM   1404  O  O     . ASP A 1 183  ? 75.158  96.537  141.307 1.00 146.45 ? 183  ASP A O     1 
ATOM   1405  C  CB    . ASP A 1 183  ? 76.529  98.538  143.456 1.00 146.45 ? 183  ASP A CB    1 
ATOM   1406  C  CG    . ASP A 1 183  ? 76.075  98.120  144.845 1.00 146.45 ? 183  ASP A CG    1 
ATOM   1407  O  OD1   . ASP A 1 183  ? 76.584  98.699  145.827 1.00 146.45 ? 183  ASP A OD1   1 
ATOM   1408  O  OD2   . ASP A 1 183  ? 75.205  97.232  144.965 1.00 146.45 ? 183  ASP A OD2   1 
ATOM   1409  N  N     . THR A 1 184  ? 75.677  95.441  143.205 1.00 152.07 ? 184  THR A N     1 
ATOM   1410  C  CA    . THR A 1 184  ? 74.576  94.495  143.099 1.00 152.07 ? 184  THR A CA    1 
ATOM   1411  C  C     . THR A 1 184  ? 74.347  93.873  144.466 1.00 152.07 ? 184  THR A C     1 
ATOM   1412  O  O     . THR A 1 184  ? 75.198  93.953  145.356 1.00 152.07 ? 184  THR A O     1 
ATOM   1413  C  CB    . THR A 1 184  ? 74.857  93.410  142.053 1.00 152.07 ? 184  THR A CB    1 
ATOM   1414  O  OG1   . THR A 1 184  ? 73.694  92.588  141.892 1.00 152.07 ? 184  THR A OG1   1 
ATOM   1415  C  CG2   . THR A 1 184  ? 76.027  92.545  142.486 1.00 152.07 ? 184  THR A CG2   1 
ATOM   1416  N  N     . ARG A 1 185  ? 73.183  93.246  144.621 1.00 164.99 ? 185  ARG A N     1 
ATOM   1417  C  CA    . ARG A 1 185  ? 72.803  92.627  145.880 1.00 164.99 ? 185  ARG A CA    1 
ATOM   1418  C  C     . ARG A 1 185  ? 72.025  91.350  145.604 1.00 164.99 ? 185  ARG A C     1 
ATOM   1419  O  O     . ARG A 1 185  ? 71.369  91.214  144.568 1.00 164.99 ? 185  ARG A O     1 
ATOM   1420  C  CB    . ARG A 1 185  ? 71.965  93.577  146.744 1.00 164.99 ? 185  ARG A CB    1 
ATOM   1421  C  CG    . ARG A 1 185  ? 70.721  94.106  146.052 1.00 164.99 ? 185  ARG A CG    1 
ATOM   1422  C  CD    . ARG A 1 185  ? 69.843  94.876  147.020 1.00 164.99 ? 185  ARG A CD    1 
ATOM   1423  N  NE    . ARG A 1 185  ? 69.724  94.192  148.304 1.00 164.99 ? 185  ARG A NE    1 
ATOM   1424  C  CZ    . ARG A 1 185  ? 69.292  94.770  149.420 1.00 164.99 ? 185  ARG A CZ    1 
ATOM   1425  N  NH1   . ARG A 1 185  ? 68.937  96.047  149.413 1.00 164.99 ? 185  ARG A NH1   1 
ATOM   1426  N  NH2   . ARG A 1 185  ? 69.216  94.071  150.544 1.00 164.99 ? 185  ARG A NH2   1 
ATOM   1427  N  N     . LEU A 1 186  ? 72.108  90.412  146.546 1.00 169.59 ? 186  LEU A N     1 
ATOM   1428  C  CA    . LEU A 1 186  ? 71.418  89.134  146.445 1.00 169.59 ? 186  LEU A CA    1 
ATOM   1429  C  C     . LEU A 1 186  ? 70.066  89.143  147.147 1.00 169.59 ? 186  LEU A C     1 
ATOM   1430  O  O     . LEU A 1 186  ? 69.422  88.094  147.248 1.00 169.59 ? 186  LEU A O     1 
ATOM   1431  C  CB    . LEU A 1 186  ? 72.297  88.018  147.013 1.00 169.59 ? 186  LEU A CB    1 
ATOM   1432  C  CG    . LEU A 1 186  ? 72.112  86.626  146.406 1.00 169.59 ? 186  LEU A CG    1 
ATOM   1433  C  CD1   . LEU A 1 186  ? 72.286  86.674  144.897 1.00 169.59 ? 186  LEU A CD1   1 
ATOM   1434  C  CD2   . LEU A 1 186  ? 73.078  85.634  147.031 1.00 169.59 ? 186  LEU A CD2   1 
ATOM   1435  N  N     . GLY A 1 187  ? 69.620  90.302  147.630 1.00 173.07 ? 187  GLY A N     1 
ATOM   1436  C  CA    . GLY A 1 187  ? 68.350  90.414  148.311 1.00 173.07 ? 187  GLY A CA    1 
ATOM   1437  C  C     . GLY A 1 187  ? 68.430  90.450  149.822 1.00 173.07 ? 187  GLY A C     1 
ATOM   1438  O  O     . GLY A 1 187  ? 67.601  91.119  150.453 1.00 173.07 ? 187  GLY A O     1 
ATOM   1439  N  N     . GLN A 1 188  ? 69.395  89.758  150.424 1.00 172.98 ? 188  GLN A N     1 
ATOM   1440  C  CA    . GLN A 1 188  ? 69.575  89.771  151.870 1.00 172.98 ? 188  GLN A CA    1 
ATOM   1441  C  C     . GLN A 1 188  ? 70.859  90.471  152.296 1.00 172.98 ? 188  GLN A C     1 
ATOM   1442  O  O     . GLN A 1 188  ? 70.879  91.135  153.336 1.00 172.98 ? 188  GLN A O     1 
ATOM   1443  C  CB    . GLN A 1 188  ? 69.552  88.341  152.428 1.00 172.98 ? 188  GLN A CB    1 
ATOM   1444  C  CG    . GLN A 1 188  ? 70.744  87.469  152.050 1.00 172.98 ? 188  GLN A CG    1 
ATOM   1445  C  CD    . GLN A 1 188  ? 70.739  87.058  150.591 1.00 172.98 ? 188  GLN A CD    1 
ATOM   1446  O  OE1   . GLN A 1 188  ? 69.695  87.057  149.938 1.00 172.98 ? 188  GLN A OE1   1 
ATOM   1447  N  NE2   . GLN A 1 188  ? 71.909  86.707  150.071 1.00 172.98 ? 188  GLN A NE2   1 
ATOM   1448  N  N     . ARG A 1 189  ? 71.930  90.339  151.517 1.00 166.32 ? 189  ARG A N     1 
ATOM   1449  C  CA    . ARG A 1 189  ? 73.165  91.067  151.753 1.00 166.32 ? 189  ARG A CA    1 
ATOM   1450  C  C     . ARG A 1 189  ? 73.426  91.989  150.573 1.00 166.32 ? 189  ARG A C     1 
ATOM   1451  O  O     . ARG A 1 189  ? 73.073  91.679  149.433 1.00 166.32 ? 189  ARG A O     1 
ATOM   1452  C  CB    . ARG A 1 189  ? 74.354  90.122  151.961 1.00 166.32 ? 189  ARG A CB    1 
ATOM   1453  C  CG    . ARG A 1 189  ? 74.299  88.855  151.130 1.00 166.32 ? 189  ARG A CG    1 
ATOM   1454  C  CD    . ARG A 1 189  ? 75.265  87.815  151.668 1.00 166.32 ? 189  ARG A CD    1 
ATOM   1455  N  NE    . ARG A 1 189  ? 76.637  88.312  151.696 1.00 166.32 ? 189  ARG A NE    1 
ATOM   1456  C  CZ    . ARG A 1 189  ? 77.706  87.543  151.864 1.00 166.32 ? 189  ARG A CZ    1 
ATOM   1457  N  NH1   . ARG A 1 189  ? 77.565  86.235  152.024 1.00 166.32 ? 189  ARG A NH1   1 
ATOM   1458  N  NH2   . ARG A 1 189  ? 78.918  88.081  151.875 1.00 166.32 ? 189  ARG A NH2   1 
ATOM   1459  N  N     . THR A 1 190  ? 74.051  93.127  150.856 1.00 161.83 ? 190  THR A N     1 
ATOM   1460  C  CA    . THR A 1 190  ? 74.266  94.159  149.857 1.00 161.83 ? 190  THR A CA    1 
ATOM   1461  C  C     . THR A 1 190  ? 75.756  94.377  149.643 1.00 161.83 ? 190  THR A C     1 
ATOM   1462  O  O     . THR A 1 190  ? 76.598  93.691  150.228 1.00 161.83 ? 190  THR A O     1 
ATOM   1463  C  CB    . THR A 1 190  ? 73.600  95.481  150.261 1.00 161.83 ? 190  THR A CB    1 
ATOM   1464  O  OG1   . THR A 1 190  ? 73.664  96.404  149.168 1.00 161.83 ? 190  THR A OG1   1 
ATOM   1465  C  CG2   . THR A 1 190  ? 74.300  96.081  151.471 1.00 161.83 ? 190  THR A CG2   1 
ATOM   1466  N  N     . ASP A 1 191  ? 76.061  95.339  148.770 1.00 154.44 ? 191  ASP A N     1 
ATOM   1467  C  CA    . ASP A 1 191  ? 77.425  95.770  148.477 1.00 154.44 ? 191  ASP A CA    1 
ATOM   1468  C  C     . ASP A 1 191  ? 78.235  94.677  147.782 1.00 154.44 ? 191  ASP A C     1 
ATOM   1469  O  O     . ASP A 1 191  ? 79.459  94.619  147.913 1.00 154.44 ? 191  ASP A O     1 
ATOM   1470  C  CB    . ASP A 1 191  ? 78.139  96.256  149.744 1.00 154.44 ? 191  ASP A CB    1 
ATOM   1471  C  CG    . ASP A 1 191  ? 79.347  97.118  149.442 1.00 154.44 ? 191  ASP A CG    1 
ATOM   1472  O  OD1   . ASP A 1 191  ? 80.176  97.322  150.352 1.00 154.44 ? 191  ASP A OD1   1 
ATOM   1473  O  OD2   . ASP A 1 191  ? 79.468  97.591  148.292 1.00 154.44 ? 191  ASP A OD2   1 
ATOM   1474  N  N     . LEU A 1 192  ? 77.564  93.800  147.041 1.00 148.48 ? 192  LEU A N     1 
ATOM   1475  C  CA    . LEU A 1 192  ? 78.263  92.822  146.225 1.00 148.48 ? 192  LEU A CA    1 
ATOM   1476  C  C     . LEU A 1 192  ? 78.688  93.448  144.901 1.00 148.48 ? 192  LEU A C     1 
ATOM   1477  O  O     . LEU A 1 192  ? 78.101  94.423  144.426 1.00 148.48 ? 192  LEU A O     1 
ATOM   1478  C  CB    . LEU A 1 192  ? 77.384  91.598  145.975 1.00 148.48 ? 192  LEU A CB    1 
ATOM   1479  C  CG    . LEU A 1 192  ? 76.951  90.821  147.218 1.00 148.48 ? 192  LEU A CG    1 
ATOM   1480  C  CD1   . LEU A 1 192  ? 76.248  89.533  146.826 1.00 148.48 ? 192  LEU A CD1   1 
ATOM   1481  C  CD2   . LEU A 1 192  ? 78.150  90.533  148.103 1.00 148.48 ? 192  LEU A CD2   1 
ATOM   1482  N  N     . ASP A 1 193  ? 79.720  92.866  144.298 1.00 141.57 ? 193  ASP A N     1 
ATOM   1483  C  CA    . ASP A 1 193  ? 80.324  93.401  143.087 1.00 141.57 ? 193  ASP A CA    1 
ATOM   1484  C  C     . ASP A 1 193  ? 79.897  92.579  141.880 1.00 141.57 ? 193  ASP A C     1 
ATOM   1485  O  O     . ASP A 1 193  ? 79.729  91.359  141.980 1.00 141.57 ? 193  ASP A O     1 
ATOM   1486  C  CB    . ASP A 1 193  ? 81.849  93.414  143.198 1.00 141.57 ? 193  ASP A CB    1 
ATOM   1487  C  CG    . ASP A 1 193  ? 82.346  94.350  144.279 1.00 141.57 ? 193  ASP A CG    1 
ATOM   1488  O  OD1   . ASP A 1 193  ? 81.612  95.297  144.631 1.00 141.57 ? 193  ASP A OD1   1 
ATOM   1489  O  OD2   . ASP A 1 193  ? 83.471  94.139  144.778 1.00 141.57 ? 193  ASP A OD2   1 
ATOM   1490  N  N     . LYS A 1 194  ? 79.720  93.252  140.747 1.00 131.33 ? 194  LYS A N     1 
ATOM   1491  C  CA    . LYS A 1 194  ? 79.469  92.614  139.462 1.00 131.33 ? 194  LYS A CA    1 
ATOM   1492  C  C     . LYS A 1 194  ? 80.497  93.150  138.476 1.00 131.33 ? 194  LYS A C     1 
ATOM   1493  O  O     . LYS A 1 194  ? 80.589  94.367  138.274 1.00 131.33 ? 194  LYS A O     1 
ATOM   1494  C  CB    . LYS A 1 194  ? 78.044  92.893  138.985 1.00 131.33 ? 194  LYS A CB    1 
ATOM   1495  C  CG    . LYS A 1 194  ? 77.872  92.942  137.479 1.00 131.33 ? 194  LYS A CG    1 
ATOM   1496  C  CD    . LYS A 1 194  ? 76.546  93.587  137.110 1.00 131.33 ? 194  LYS A CD    1 
ATOM   1497  C  CE    . LYS A 1 194  ? 76.383  93.704  135.605 1.00 131.33 ? 194  LYS A CE    1 
ATOM   1498  N  NZ    . LYS A 1 194  ? 75.040  94.230  135.240 1.00 131.33 ? 194  LYS A NZ    1 
ATOM   1499  N  N     . LEU A 1 195  ? 81.277  92.252  137.882 1.00 121.61 ? 195  LEU A N     1 
ATOM   1500  C  CA    . LEU A 1 195  ? 82.413  92.627  137.052 1.00 121.61 ? 195  LEU A CA    1 
ATOM   1501  C  C     . LEU A 1 195  ? 82.016  92.554  135.586 1.00 121.61 ? 195  LEU A C     1 
ATOM   1502  O  O     . LEU A 1 195  ? 81.304  91.632  135.178 1.00 121.61 ? 195  LEU A O     1 
ATOM   1503  C  CB    . LEU A 1 195  ? 83.605  91.709  137.329 1.00 121.61 ? 195  LEU A CB    1 
ATOM   1504  C  CG    . LEU A 1 195  ? 84.830  91.840  136.427 1.00 121.61 ? 195  LEU A CG    1 
ATOM   1505  C  CD1   . LEU A 1 195  ? 85.435  93.226  136.552 1.00 121.61 ? 195  LEU A CD1   1 
ATOM   1506  C  CD2   . LEU A 1 195  ? 85.853  90.774  136.773 1.00 121.61 ? 195  LEU A CD2   1 
ATOM   1507  N  N     . THR A 1 196  ? 82.468  93.528  134.798 1.00 121.14 ? 196  THR A N     1 
ATOM   1508  C  CA    . THR A 1 196  ? 82.195  93.559  133.364 1.00 121.14 ? 196  THR A CA    1 
ATOM   1509  C  C     . THR A 1 196  ? 83.481  93.912  132.632 1.00 121.14 ? 196  THR A C     1 
ATOM   1510  O  O     . THR A 1 196  ? 83.969  95.040  132.742 1.00 121.14 ? 196  THR A O     1 
ATOM   1511  C  CB    . THR A 1 196  ? 81.093  94.565  133.032 1.00 121.14 ? 196  THR A CB    1 
ATOM   1512  O  OG1   . THR A 1 196  ? 79.882  94.185  133.696 1.00 121.14 ? 196  THR A OG1   1 
ATOM   1513  C  CG2   . THR A 1 196  ? 80.851  94.608  131.535 1.00 121.14 ? 196  THR A CG2   1 
ATOM   1514  N  N     . LEU A 1 197  ? 84.022  92.954  131.884 1.00 116.14 ? 197  LEU A N     1 
ATOM   1515  C  CA    . LEU A 1 197  ? 85.241  93.155  131.109 1.00 116.14 ? 197  LEU A CA    1 
ATOM   1516  C  C     . LEU A 1 197  ? 84.859  93.532  129.682 1.00 116.14 ? 197  LEU A C     1 
ATOM   1517  O  O     . LEU A 1 197  ? 84.023  92.868  129.062 1.00 116.14 ? 197  LEU A O     1 
ATOM   1518  C  CB    . LEU A 1 197  ? 86.101  91.894  131.126 1.00 116.14 ? 197  LEU A CB    1 
ATOM   1519  C  CG    . LEU A 1 197  ? 87.164  91.779  132.216 1.00 116.14 ? 197  LEU A CG    1 
ATOM   1520  C  CD1   . LEU A 1 197  ? 87.760  90.384  132.222 1.00 116.14 ? 197  LEU A CD1   1 
ATOM   1521  C  CD2   . LEU A 1 197  ? 88.248  92.817  132.006 1.00 116.14 ? 197  LEU A CD2   1 
ATOM   1522  N  N     . ARG A 1 198  ? 85.471  94.592  129.162 1.00 117.06 ? 198  ARG A N     1 
ATOM   1523  C  CA    . ARG A 1 198  ? 85.264  95.041  127.794 1.00 117.06 ? 198  ARG A CA    1 
ATOM   1524  C  C     . ARG A 1 198  ? 86.594  94.991  127.056 1.00 117.06 ? 198  ARG A C     1 
ATOM   1525  O  O     . ARG A 1 198  ? 87.584  95.575  127.513 1.00 117.06 ? 198  ARG A O     1 
ATOM   1526  C  CB    . ARG A 1 198  ? 84.696  96.459  127.768 1.00 117.06 ? 198  ARG A CB    1 
ATOM   1527  C  CG    . ARG A 1 198  ? 83.444  96.637  128.602 1.00 117.06 ? 198  ARG A CG    1 
ATOM   1528  C  CD    . ARG A 1 198  ? 82.619  97.809  128.109 1.00 117.06 ? 198  ARG A CD    1 
ATOM   1529  N  NE    . ARG A 1 198  ? 83.318  99.078  128.274 1.00 117.06 ? 198  ARG A NE    1 
ATOM   1530  C  CZ    . ARG A 1 198  ? 82.978  100.201 127.652 1.00 117.06 ? 198  ARG A CZ    1 
ATOM   1531  N  NH1   . ARG A 1 198  ? 83.669  101.312 127.861 1.00 117.06 ? 198  ARG A NH1   1 
ATOM   1532  N  NH2   . ARG A 1 198  ? 81.948  100.212 126.819 1.00 117.06 ? 198  ARG A NH2   1 
ATOM   1533  N  N     . ILE A 1 199  ? 86.615  94.298  125.920 1.00 115.79 ? 199  ILE A N     1 
ATOM   1534  C  CA    . ILE A 1 199  ? 87.845  94.043  125.180 1.00 115.79 ? 199  ILE A CA    1 
ATOM   1535  C  C     . ILE A 1 199  ? 87.643  94.458  123.730 1.00 115.79 ? 199  ILE A C     1 
ATOM   1536  O  O     . ILE A 1 199  ? 86.683  94.020  123.081 1.00 115.79 ? 199  ILE A O     1 
ATOM   1537  C  CB    . ILE A 1 199  ? 88.265  92.567  125.259 1.00 115.79 ? 199  ILE A CB    1 
ATOM   1538  C  CG1   . ILE A 1 199  ? 88.382  92.120  126.715 1.00 115.79 ? 199  ILE A CG1   1 
ATOM   1539  C  CG2   . ILE A 1 199  ? 89.579  92.353  124.534 1.00 115.79 ? 199  ILE A CG2   1 
ATOM   1540  C  CD1   . ILE A 1 199  ? 88.864  90.701  126.875 1.00 115.79 ? 199  ILE A CD1   1 
ATOM   1541  N  N     . TRP A 1 200  ? 88.545  95.298  123.225 1.00 114.79 ? 200  TRP A N     1 
ATOM   1542  C  CA    . TRP A 1 200  ? 88.629  95.630  121.812 1.00 114.79 ? 200  TRP A CA    1 
ATOM   1543  C  C     . TRP A 1 200  ? 89.898  95.020  121.237 1.00 114.79 ? 200  TRP A C     1 
ATOM   1544  O  O     . TRP A 1 200  ? 91.008  95.380  121.643 1.00 114.79 ? 200  TRP A O     1 
ATOM   1545  C  CB    . TRP A 1 200  ? 88.654  97.143  121.593 1.00 114.79 ? 200  TRP A CB    1 
ATOM   1546  C  CG    . TRP A 1 200  ? 87.389  97.847  121.940 1.00 114.79 ? 200  TRP A CG    1 
ATOM   1547  C  CD1   . TRP A 1 200  ? 86.337  98.093  121.112 1.00 114.79 ? 200  TRP A CD1   1 
ATOM   1548  C  CD2   . TRP A 1 200  ? 87.048  98.419  123.205 1.00 114.79 ? 200  TRP A CD2   1 
ATOM   1549  N  NE1   . TRP A 1 200  ? 85.356  98.777  121.785 1.00 114.79 ? 200  TRP A NE1   1 
ATOM   1550  C  CE2   . TRP A 1 200  ? 85.769  98.989  123.073 1.00 114.79 ? 200  TRP A CE2   1 
ATOM   1551  C  CE3   . TRP A 1 200  ? 87.699  98.501  124.437 1.00 114.79 ? 200  TRP A CE3   1 
ATOM   1552  C  CZ2   . TRP A 1 200  ? 85.127  99.630  124.128 1.00 114.79 ? 200  TRP A CZ2   1 
ATOM   1553  C  CZ3   . TRP A 1 200  ? 87.061  99.138  125.482 1.00 114.79 ? 200  TRP A CZ3   1 
ATOM   1554  C  CH2   . TRP A 1 200  ? 85.789  99.694  125.322 1.00 114.79 ? 200  TRP A CH2   1 
ATOM   1555  N  N     . THR A 1 201  ? 89.725  94.098  120.294 1.00 119.00 ? 201  THR A N     1 
ATOM   1556  C  CA    . THR A 1 201  ? 90.833  93.430  119.632 1.00 119.00 ? 201  THR A CA    1 
ATOM   1557  C  C     . THR A 1 201  ? 90.835  93.854  118.169 1.00 119.00 ? 201  THR A C     1 
ATOM   1558  O  O     . THR A 1 201  ? 89.818  94.301  117.636 1.00 119.00 ? 201  THR A O     1 
ATOM   1559  C  CB    . THR A 1 201  ? 90.715  91.902  119.770 1.00 119.00 ? 201  THR A CB    1 
ATOM   1560  O  OG1   . THR A 1 201  ? 90.563  91.564  121.153 1.00 119.00 ? 201  THR A OG1   1 
ATOM   1561  C  CG2   . THR A 1 201  ? 91.958  91.201  119.248 1.00 119.00 ? 201  THR A CG2   1 
ATOM   1562  N  N     . ASP A 1 202  ? 91.990  93.712  117.518 1.00 123.56 ? 202  ASP A N     1 
ATOM   1563  C  CA    . ASP A 1 202  ? 92.124  94.115  116.124 1.00 123.56 ? 202  ASP A CA    1 
ATOM   1564  C  C     . ASP A 1 202  ? 91.501  93.127  115.147 1.00 123.56 ? 202  ASP A C     1 
ATOM   1565  O  O     . ASP A 1 202  ? 91.580  93.352  113.935 1.00 123.56 ? 202  ASP A O     1 
ATOM   1566  C  CB    . ASP A 1 202  ? 93.601  94.318  115.774 1.00 123.56 ? 202  ASP A CB    1 
ATOM   1567  C  CG    . ASP A 1 202  ? 94.413  93.040  115.884 1.00 123.56 ? 202  ASP A CG    1 
ATOM   1568  O  OD1   . ASP A 1 202  ? 93.874  92.020  116.364 1.00 123.56 ? 202  ASP A OD1   1 
ATOM   1569  O  OD2   . ASP A 1 202  ? 95.595  93.054  115.485 1.00 123.56 ? 202  ASP A OD2   1 
ATOM   1570  N  N     . GLY A 1 203  ? 90.892  92.047  115.632 1.00 122.45 ? 203  GLY A N     1 
ATOM   1571  C  CA    . GLY A 1 203  ? 90.249  91.069  114.789 1.00 122.45 ? 203  GLY A CA    1 
ATOM   1572  C  C     . GLY A 1 203  ? 91.090  89.848  114.479 1.00 122.45 ? 203  GLY A C     1 
ATOM   1573  O  O     . GLY A 1 203  ? 90.569  88.885  113.905 1.00 122.45 ? 203  GLY A O     1 
ATOM   1574  N  N     . SER A 1 204  ? 92.374  89.863  114.839 1.00 122.60 ? 204  SER A N     1 
ATOM   1575  C  CA    . SER A 1 204  ? 93.215  88.697  114.598 1.00 122.60 ? 204  SER A CA    1 
ATOM   1576  C  C     . SER A 1 204  ? 92.806  87.531  115.487 1.00 122.60 ? 204  SER A C     1 
ATOM   1577  O  O     . SER A 1 204  ? 92.799  86.377  115.044 1.00 122.60 ? 204  SER A O     1 
ATOM   1578  C  CB    . SER A 1 204  ? 94.683  89.054  114.822 1.00 122.60 ? 204  SER A CB    1 
ATOM   1579  O  OG    . SER A 1 204  ? 95.461  87.887  115.018 1.00 122.60 ? 204  SER A OG    1 
ATOM   1580  N  N     . VAL A 1 205  ? 92.465  87.811  116.743 1.00 122.83 ? 205  VAL A N     1 
ATOM   1581  C  CA    . VAL A 1 205  ? 92.025  86.793  117.684 1.00 122.83 ? 205  VAL A CA    1 
ATOM   1582  C  C     . VAL A 1 205  ? 90.730  87.254  118.339 1.00 122.83 ? 205  VAL A C     1 
ATOM   1583  O  O     . VAL A 1 205  ? 90.569  88.420  118.708 1.00 122.83 ? 205  VAL A O     1 
ATOM   1584  C  CB    . VAL A 1 205  ? 93.096  86.483  118.749 1.00 122.83 ? 205  VAL A CB    1 
ATOM   1585  C  CG1   . VAL A 1 205  ? 94.240  85.701  118.133 1.00 122.83 ? 205  VAL A CG1   1 
ATOM   1586  C  CG2   . VAL A 1 205  ? 93.609  87.767  119.373 1.00 122.83 ? 205  VAL A CG2   1 
ATOM   1587  N  N     . THR A 1 206  ? 89.794  86.320  118.467 1.00 123.33 ? 206  THR A N     1 
ATOM   1588  C  CA    . THR A 1 206  ? 88.535  86.637  119.129 1.00 123.33 ? 206  THR A CA    1 
ATOM   1589  C  C     . THR A 1 206  ? 88.789  86.982  120.594 1.00 123.33 ? 206  THR A C     1 
ATOM   1590  O  O     . THR A 1 206  ? 89.600  86.322  121.250 1.00 123.33 ? 206  THR A O     1 
ATOM   1591  C  CB    . THR A 1 206  ? 87.570  85.458  119.038 1.00 123.33 ? 206  THR A CB    1 
ATOM   1592  O  OG1   . THR A 1 206  ? 87.431  85.058  117.669 1.00 123.33 ? 206  THR A OG1   1 
ATOM   1593  C  CG2   . THR A 1 206  ? 86.201  85.828  119.588 1.00 123.33 ? 206  THR A CG2   1 
ATOM   1594  N  N     . PRO A 1 207  ? 88.133  88.027  121.110 1.00 120.87 ? 207  PRO A N     1 
ATOM   1595  C  CA    . PRO A 1 207  ? 88.312  88.385  122.529 1.00 120.87 ? 207  PRO A CA    1 
ATOM   1596  C  C     . PRO A 1 207  ? 88.174  87.216  123.491 1.00 120.87 ? 207  PRO A C     1 
ATOM   1597  O  O     . PRO A 1 207  ? 88.870  87.180  124.513 1.00 120.87 ? 207  PRO A O     1 
ATOM   1598  C  CB    . PRO A 1 207  ? 87.217  89.434  122.748 1.00 120.87 ? 207  PRO A CB    1 
ATOM   1599  C  CG    . PRO A 1 207  ? 87.081  90.097  121.425 1.00 120.87 ? 207  PRO A CG    1 
ATOM   1600  C  CD    . PRO A 1 207  ? 87.361  89.047  120.378 1.00 120.87 ? 207  PRO A CD    1 
ATOM   1601  N  N     . LEU A 1 208  ? 87.289  86.262  123.197 1.00 119.40 ? 208  LEU A N     1 
ATOM   1602  C  CA    . LEU A 1 208  ? 87.154  85.086  124.050 1.00 119.40 ? 208  LEU A CA    1 
ATOM   1603  C  C     . LEU A 1 208  ? 88.460  84.304  124.116 1.00 119.40 ? 208  LEU A C     1 
ATOM   1604  O  O     . LEU A 1 208  ? 88.860  83.825  125.185 1.00 119.40 ? 208  LEU A O     1 
ATOM   1605  C  CB    . LEU A 1 208  ? 86.019  84.201  123.540 1.00 119.40 ? 208  LEU A CB    1 
ATOM   1606  C  CG    . LEU A 1 208  ? 85.630  83.025  124.433 1.00 119.40 ? 208  LEU A CG    1 
ATOM   1607  C  CD1   . LEU A 1 208  ? 84.952  83.520  125.697 1.00 119.40 ? 208  LEU A CD1   1 
ATOM   1608  C  CD2   . LEU A 1 208  ? 84.730  82.061  123.680 1.00 119.40 ? 208  LEU A CD2   1 
ATOM   1609  N  N     . GLU A 1 209  ? 89.144  84.168  122.977 1.00 123.15 ? 209  GLU A N     1 
ATOM   1610  C  CA    . GLU A 1 209  ? 90.423  83.468  122.964 1.00 123.15 ? 209  GLU A CA    1 
ATOM   1611  C  C     . GLU A 1 209  ? 91.463  84.206  123.796 1.00 123.15 ? 209  GLU A C     1 
ATOM   1612  O  O     . GLU A 1 209  ? 92.241  83.582  124.528 1.00 123.15 ? 209  GLU A O     1 
ATOM   1613  C  CB    . GLU A 1 209  ? 90.916  83.293  121.529 1.00 123.15 ? 209  GLU A CB    1 
ATOM   1614  C  CG    . GLU A 1 209  ? 90.031  82.418  120.663 1.00 123.15 ? 209  GLU A CG    1 
ATOM   1615  C  CD    . GLU A 1 209  ? 90.350  82.554  119.187 1.00 123.15 ? 209  GLU A CD    1 
ATOM   1616  O  OE1   . GLU A 1 209  ? 89.447  82.928  118.411 1.00 123.15 ? 209  GLU A OE1   1 
ATOM   1617  O  OE2   . GLU A 1 209  ? 91.509  82.290  118.802 1.00 123.15 ? 209  GLU A OE2   1 
ATOM   1618  N  N     . ALA A 1 210  ? 91.494  85.536  123.695 1.00 120.11 ? 210  ALA A N     1 
ATOM   1619  C  CA    . ALA A 1 210  ? 92.438  86.320  124.482 1.00 120.11 ? 210  ALA A CA    1 
ATOM   1620  C  C     . ALA A 1 210  ? 92.163  86.161  125.972 1.00 120.11 ? 210  ALA A C     1 
ATOM   1621  O  O     . ALA A 1 210  ? 93.088  86.019  126.779 1.00 120.11 ? 210  ALA A O     1 
ATOM   1622  C  CB    . ALA A 1 210  ? 92.369  87.790  124.069 1.00 120.11 ? 210  ALA A CB    1 
ATOM   1623  N  N     . LEU A 1 211  ? 90.884  86.178  126.354 1.00 119.83 ? 211  LEU A N     1 
ATOM   1624  C  CA    . LEU A 1 211  ? 90.527  85.990  127.756 1.00 119.83 ? 211  LEU A CA    1 
ATOM   1625  C  C     . LEU A 1 211  ? 90.947  84.614  128.253 1.00 119.83 ? 211  LEU A C     1 
ATOM   1626  O  O     . LEU A 1 211  ? 91.499  84.482  129.354 1.00 119.83 ? 211  LEU A O     1 
ATOM   1627  C  CB    . LEU A 1 211  ? 89.024  86.189  127.945 1.00 119.83 ? 211  LEU A CB    1 
ATOM   1628  C  CG    . LEU A 1 211  ? 88.534  86.272  129.389 1.00 119.83 ? 211  LEU A CG    1 
ATOM   1629  C  CD1   . LEU A 1 211  ? 89.094  87.510  130.065 1.00 119.83 ? 211  LEU A CD1   1 
ATOM   1630  C  CD2   . LEU A 1 211  ? 87.017  86.272  129.434 1.00 119.83 ? 211  LEU A CD2   1 
ATOM   1631  N  N     . ASN A 1 212  ? 90.689  83.574  127.457 1.00 119.70 ? 212  ASN A N     1 
ATOM   1632  C  CA    . ASN A 1 212  ? 91.090  82.227  127.849 1.00 119.70 ? 212  ASN A CA    1 
ATOM   1633  C  C     . ASN A 1 212  ? 92.602  82.125  128.004 1.00 119.70 ? 212  ASN A C     1 
ATOM   1634  O  O     . ASN A 1 212  ? 93.095  81.522  128.966 1.00 119.70 ? 212  ASN A O     1 
ATOM   1635  C  CB    . ASN A 1 212  ? 90.585  81.212  126.827 1.00 119.70 ? 212  ASN A CB    1 
ATOM   1636  C  CG    . ASN A 1 212  ? 89.081  81.050  126.866 1.00 119.70 ? 212  ASN A CG    1 
ATOM   1637  O  OD1   . ASN A 1 212  ? 88.441  81.346  127.874 1.00 119.70 ? 212  ASN A OD1   1 
ATOM   1638  N  ND2   . ASN A 1 212  ? 88.507  80.580  125.766 1.00 119.70 ? 212  ASN A ND2   1 
ATOM   1639  N  N     . GLN A 1 213  ? 93.353  82.716  127.072 1.00 117.70 ? 213  GLN A N     1 
ATOM   1640  C  CA    . GLN A 1 213  ? 94.808  82.663  127.157 1.00 117.70 ? 213  GLN A CA    1 
ATOM   1641  C  C     . GLN A 1 213  ? 95.319  83.412  128.381 1.00 117.70 ? 213  GLN A C     1 
ATOM   1642  O  O     . GLN A 1 213  ? 96.255  82.958  129.048 1.00 117.70 ? 213  GLN A O     1 
ATOM   1643  C  CB    . GLN A 1 213  ? 95.428  83.230  125.882 1.00 117.70 ? 213  GLN A CB    1 
ATOM   1644  C  CG    . GLN A 1 213  ? 95.233  82.350  124.662 1.00 117.70 ? 213  GLN A CG    1 
ATOM   1645  C  CD    . GLN A 1 213  ? 95.865  82.935  123.418 1.00 117.70 ? 213  GLN A CD    1 
ATOM   1646  O  OE1   . GLN A 1 213  ? 96.805  83.724  123.498 1.00 117.70 ? 213  GLN A OE1   1 
ATOM   1647  N  NE2   . GLN A 1 213  ? 95.352  82.549  122.257 1.00 117.70 ? 213  GLN A NE2   1 
ATOM   1648  N  N     . ALA A 1 214  ? 94.713  84.558  128.698 1.00 118.26 ? 214  ALA A N     1 
ATOM   1649  C  CA    . ALA A 1 214  ? 95.133  85.313  129.874 1.00 118.26 ? 214  ALA A CA    1 
ATOM   1650  C  C     . ALA A 1 214  ? 94.852  84.534  131.152 1.00 118.26 ? 214  ALA A C     1 
ATOM   1651  O  O     . ALA A 1 214  ? 95.680  84.504  132.072 1.00 118.26 ? 214  ALA A O     1 
ATOM   1652  C  CB    . ALA A 1 214  ? 94.433  86.671  129.903 1.00 118.26 ? 214  ALA A CB    1 
ATOM   1653  N  N     . VAL A 1 215  ? 93.680  83.898  131.228 1.00 116.56 ? 215  VAL A N     1 
ATOM   1654  C  CA    . VAL A 1 215  ? 93.359  83.072  132.388 1.00 116.56 ? 215  VAL A CA    1 
ATOM   1655  C  C     . VAL A 1 215  ? 94.361  81.935  132.523 1.00 116.56 ? 215  VAL A C     1 
ATOM   1656  O  O     . VAL A 1 215  ? 94.839  81.633  133.625 1.00 116.56 ? 215  VAL A O     1 
ATOM   1657  C  CB    . VAL A 1 215  ? 91.916  82.547  132.286 1.00 116.56 ? 215  VAL A CB    1 
ATOM   1658  C  CG1   . VAL A 1 215  ? 91.676  81.451  133.310 1.00 116.56 ? 215  VAL A CG1   1 
ATOM   1659  C  CG2   . VAL A 1 215  ? 90.929  83.682  132.478 1.00 116.56 ? 215  VAL A CG2   1 
ATOM   1660  N  N     . GLU A 1 216  ? 94.700  81.290  131.405 1.00 124.01 ? 216  GLU A N     1 
ATOM   1661  C  CA    . GLU A 1 216  ? 95.673  80.204  131.445 1.00 124.01 ? 216  GLU A CA    1 
ATOM   1662  C  C     . GLU A 1 216  ? 97.033  80.694  131.926 1.00 124.01 ? 216  GLU A C     1 
ATOM   1663  O  O     . GLU A 1 216  ? 97.692  80.028  132.733 1.00 124.01 ? 216  GLU A O     1 
ATOM   1664  C  CB    . GLU A 1 216  ? 95.792  79.564  130.064 1.00 124.01 ? 216  GLU A CB    1 
ATOM   1665  C  CG    . GLU A 1 216  ? 96.760  78.402  130.006 1.00 124.01 ? 216  GLU A CG    1 
ATOM   1666  C  CD    . GLU A 1 216  ? 96.435  77.331  131.024 1.00 124.01 ? 216  GLU A CD    1 
ATOM   1667  O  OE1   . GLU A 1 216  ? 95.241  77.005  131.187 1.00 124.01 ? 216  GLU A OE1   1 
ATOM   1668  O  OE2   . GLU A 1 216  ? 97.375  76.812  131.662 1.00 124.01 ? 216  GLU A OE2   1 
ATOM   1669  N  N     . ILE A 1 217  ? 97.470  81.855  131.440 1.00 118.28 ? 217  ILE A N     1 
ATOM   1670  C  CA    . ILE A 1 217  ? 98.764  82.399  131.843 1.00 118.28 ? 217  ILE A CA    1 
ATOM   1671  C  C     . ILE A 1 217  ? 98.775  82.697  133.338 1.00 118.28 ? 217  ILE A C     1 
ATOM   1672  O  O     . ILE A 1 217  ? 99.739  82.381  134.050 1.00 118.28 ? 217  ILE A O     1 
ATOM   1673  C  CB    . ILE A 1 217  ? 99.096  83.652  131.013 1.00 118.28 ? 217  ILE A CB    1 
ATOM   1674  C  CG1   . ILE A 1 217  ? 99.367  83.271  129.555 1.00 118.28 ? 217  ILE A CG1   1 
ATOM   1675  C  CG2   . ILE A 1 217  ? 100.274 84.394  131.616 1.00 118.28 ? 217  ILE A CG2   1 
ATOM   1676  C  CD1   . ILE A 1 217  ? 100.044 84.361  128.750 1.00 118.28 ? 217  ILE A CD1   1 
ATOM   1677  N  N     . LEU A 1 218  ? 97.702  83.314  133.838 1.00 119.04 ? 218  LEU A N     1 
ATOM   1678  C  CA    . LEU A 1 218  ? 97.653  83.646  135.257 1.00 119.04 ? 218  LEU A CA    1 
ATOM   1679  C  C     . LEU A 1 218  ? 97.635  82.389  136.116 1.00 119.04 ? 218  LEU A C     1 
ATOM   1680  O  O     . LEU A 1 218  ? 98.283  82.339  137.168 1.00 119.04 ? 218  LEU A O     1 
ATOM   1681  C  CB    . LEU A 1 218  ? 96.439  84.523  135.557 1.00 119.04 ? 218  LEU A CB    1 
ATOM   1682  C  CG    . LEU A 1 218  ? 96.446  85.174  136.940 1.00 119.04 ? 218  LEU A CG    1 
ATOM   1683  C  CD1   . LEU A 1 218  ? 97.757  85.901  137.173 1.00 119.04 ? 218  LEU A CD1   1 
ATOM   1684  C  CD2   . LEU A 1 218  ? 95.272  86.125  137.093 1.00 119.04 ? 218  LEU A CD2   1 
ATOM   1685  N  N     . ARG A 1 219  ? 96.905  81.359  135.684 1.00 124.77 ? 219  ARG A N     1 
ATOM   1686  C  CA    . ARG A 1 219  ? 96.889  80.100  136.424 1.00 124.77 ? 219  ARG A CA    1 
ATOM   1687  C  C     . ARG A 1 219  ? 98.275  79.462  136.447 1.00 124.77 ? 219  ARG A C     1 
ATOM   1688  O  O     . ARG A 1 219  ? 98.741  78.979  137.488 1.00 124.77 ? 219  ARG A O     1 
ATOM   1689  C  CB    . ARG A 1 219  ? 95.860  79.150  135.808 1.00 124.77 ? 219  ARG A CB    1 
ATOM   1690  C  CG    . ARG A 1 219  ? 95.386  78.054  136.741 1.00 124.77 ? 219  ARG A CG    1 
ATOM   1691  C  CD    . ARG A 1 219  ? 94.678  76.945  135.976 1.00 124.77 ? 219  ARG A CD    1 
ATOM   1692  N  NE    . ARG A 1 219  ? 95.417  76.525  134.787 1.00 124.77 ? 219  ARG A NE    1 
ATOM   1693  C  CZ    . ARG A 1 219  ? 96.584  75.888  134.808 1.00 124.77 ? 219  ARG A CZ    1 
ATOM   1694  N  NH1   . ARG A 1 219  ? 97.174  75.553  133.669 1.00 124.77 ? 219  ARG A NH1   1 
ATOM   1695  N  NH2   . ARG A 1 219  ? 97.160  75.573  135.960 1.00 124.77 ? 219  ARG A NH2   1 
ATOM   1696  N  N     . GLU A 1 220  ? 98.952  79.453  135.296 1.00 129.75 ? 220  GLU A N     1 
ATOM   1697  C  CA    . GLU A 1 220  ? 100.288 78.871  135.232 1.00 129.75 ? 220  GLU A CA    1 
ATOM   1698  C  C     . GLU A 1 220  ? 101.270 79.619  136.125 1.00 129.75 ? 220  GLU A C     1 
ATOM   1699  O  O     . GLU A 1 220  ? 102.125 78.994  136.763 1.00 129.75 ? 220  GLU A O     1 
ATOM   1700  C  CB    . GLU A 1 220  ? 100.781 78.853  133.786 1.00 129.75 ? 220  GLU A CB    1 
ATOM   1701  C  CG    . GLU A 1 220  ? 102.232 78.441  133.628 1.00 129.75 ? 220  GLU A CG    1 
ATOM   1702  C  CD    . GLU A 1 220  ? 102.671 78.411  132.179 1.00 129.75 ? 220  GLU A CD    1 
ATOM   1703  O  OE1   . GLU A 1 220  ? 101.811 78.184  131.303 1.00 129.75 ? 220  GLU A OE1   1 
ATOM   1704  O  OE2   . GLU A 1 220  ? 103.875 78.613  131.916 1.00 129.75 ? 220  GLU A OE2   1 
ATOM   1705  N  N     . HIS A 1 221  ? 101.169 80.949  136.186 1.00 125.72 ? 221  HIS A N     1 
ATOM   1706  C  CA    . HIS A 1 221  ? 102.032 81.699  137.096 1.00 125.72 ? 221  HIS A CA    1 
ATOM   1707  C  C     . HIS A 1 221  ? 101.686 81.428  138.554 1.00 125.72 ? 221  HIS A C     1 
ATOM   1708  O  O     . HIS A 1 221  ? 102.584 81.323  139.397 1.00 125.72 ? 221  HIS A O     1 
ATOM   1709  C  CB    . HIS A 1 221  ? 101.963 83.193  136.791 1.00 125.72 ? 221  HIS A CB    1 
ATOM   1710  C  CG    . HIS A 1 221  ? 102.754 83.595  135.588 1.00 125.72 ? 221  HIS A CG    1 
ATOM   1711  N  ND1   . HIS A 1 221  ? 102.246 83.547  134.310 1.00 125.72 ? 221  HIS A ND1   1 
ATOM   1712  C  CD2   . HIS A 1 221  ? 104.025 84.044  135.470 1.00 125.72 ? 221  HIS A CD2   1 
ATOM   1713  C  CE1   . HIS A 1 221  ? 103.171 83.951  133.458 1.00 125.72 ? 221  HIS A CE1   1 
ATOM   1714  N  NE2   . HIS A 1 221  ? 104.260 84.261  134.136 1.00 125.72 ? 221  HIS A NE2   1 
ATOM   1715  N  N     . LEU A 1 222  ? 100.395 81.322  138.877 1.00 123.16 ? 222  LEU A N     1 
ATOM   1716  C  CA    . LEU A 1 222  ? 100.009 80.969  140.239 1.00 123.16 ? 222  LEU A CA    1 
ATOM   1717  C  C     . LEU A 1 222  ? 100.540 79.600  140.635 1.00 123.16 ? 222  LEU A C     1 
ATOM   1718  O  O     . LEU A 1 222  ? 100.762 79.339  141.822 1.00 123.16 ? 222  LEU A O     1 
ATOM   1719  C  CB    . LEU A 1 222  ? 98.489  80.998  140.382 1.00 123.16 ? 222  LEU A CB    1 
ATOM   1720  C  CG    . LEU A 1 222  ? 97.823  82.366  140.510 1.00 123.16 ? 222  LEU A CG    1 
ATOM   1721  C  CD1   . LEU A 1 222  ? 96.432  82.197  141.083 1.00 123.16 ? 222  LEU A CD1   1 
ATOM   1722  C  CD2   . LEU A 1 222  ? 98.655  83.293  141.378 1.00 123.16 ? 222  LEU A CD2   1 
ATOM   1723  N  N     . THR A 1 223  ? 100.732 78.711  139.659 1.00 128.96 ? 223  THR A N     1 
ATOM   1724  C  CA    . THR A 1 223  ? 101.266 77.384  139.956 1.00 128.96 ? 223  THR A CA    1 
ATOM   1725  C  C     . THR A 1 223  ? 102.649 77.461  140.604 1.00 128.96 ? 223  THR A C     1 
ATOM   1726  O  O     . THR A 1 223  ? 103.017 76.593  141.403 1.00 128.96 ? 223  THR A O     1 
ATOM   1727  C  CB    . THR A 1 223  ? 101.315 76.548  138.673 1.00 128.96 ? 223  THR A CB    1 
ATOM   1728  O  OG1   . THR A 1 223  ? 99.987  76.378  138.164 1.00 128.96 ? 223  THR A OG1   1 
ATOM   1729  C  CG2   . THR A 1 223  ? 101.918 75.176  138.934 1.00 128.96 ? 223  THR A CG2   1 
ATOM   1730  N  N     . TYR A 1 224  ? 103.416 78.513  140.297 1.00 129.80 ? 224  TYR A N     1 
ATOM   1731  C  CA    . TYR A 1 224  ? 104.818 78.577  140.706 1.00 129.80 ? 224  TYR A CA    1 
ATOM   1732  C  C     . TYR A 1 224  ? 105.013 78.624  142.217 1.00 129.80 ? 224  TYR A C     1 
ATOM   1733  O  O     . TYR A 1 224  ? 106.134 78.403  142.687 1.00 129.80 ? 224  TYR A O     1 
ATOM   1734  C  CB    . TYR A 1 224  ? 105.494 79.796  140.078 1.00 129.80 ? 224  TYR A CB    1 
ATOM   1735  C  CG    . TYR A 1 224  ? 105.637 79.715  138.578 1.00 129.80 ? 224  TYR A CG    1 
ATOM   1736  C  CD1   . TYR A 1 224  ? 105.743 78.490  137.938 1.00 129.80 ? 224  TYR A CD1   1 
ATOM   1737  C  CD2   . TYR A 1 224  ? 105.668 80.865  137.802 1.00 129.80 ? 224  TYR A CD2   1 
ATOM   1738  C  CE1   . TYR A 1 224  ? 105.874 78.410  136.567 1.00 129.80 ? 224  TYR A CE1   1 
ATOM   1739  C  CE2   . TYR A 1 224  ? 105.798 80.796  136.431 1.00 129.80 ? 224  TYR A CE2   1 
ATOM   1740  C  CZ    . TYR A 1 224  ? 105.901 79.567  135.819 1.00 129.80 ? 224  TYR A CZ    1 
ATOM   1741  O  OH    . TYR A 1 224  ? 106.031 79.494  134.451 1.00 129.80 ? 224  TYR A OH    1 
ATOM   1742  N  N     . PHE A 1 225  ? 103.967 78.904  142.990 1.00 129.60 ? 225  PHE A N     1 
ATOM   1743  C  CA    . PHE A 1 225  ? 104.107 79.012  144.438 1.00 129.60 ? 225  PHE A CA    1 
ATOM   1744  C  C     . PHE A 1 225  ? 104.079 77.665  145.149 1.00 129.60 ? 225  PHE A C     1 
ATOM   1745  O  O     . PHE A 1 225  ? 103.821 77.629  146.356 1.00 129.60 ? 225  PHE A O     1 
ATOM   1746  C  CB    . PHE A 1 225  ? 103.007 79.909  145.011 1.00 129.60 ? 225  PHE A CB    1 
ATOM   1747  C  CG    . PHE A 1 225  ? 103.218 81.371  144.748 1.00 129.60 ? 225  PHE A CG    1 
ATOM   1748  C  CD1   . PHE A 1 225  ? 102.451 82.037  143.810 1.00 129.60 ? 225  PHE A CD1   1 
ATOM   1749  C  CD2   . PHE A 1 225  ? 104.184 82.079  145.441 1.00 129.60 ? 225  PHE A CD2   1 
ATOM   1750  C  CE1   . PHE A 1 225  ? 102.643 83.381  143.567 1.00 129.60 ? 225  PHE A CE1   1 
ATOM   1751  C  CE2   . PHE A 1 225  ? 104.380 83.424  145.201 1.00 129.60 ? 225  PHE A CE2   1 
ATOM   1752  C  CZ    . PHE A 1 225  ? 103.608 84.075  144.263 1.00 129.60 ? 225  PHE A CZ    1 
ATOM   1753  N  N     . SER A 1 226  ? 104.335 76.564  144.442 1.00 141.33 ? 226  SER A N     1 
ATOM   1754  C  CA    . SER A 1 226  ? 104.176 75.243  145.042 1.00 141.33 ? 226  SER A CA    1 
ATOM   1755  C  C     . SER A 1 226  ? 105.398 74.848  145.864 1.00 141.33 ? 226  SER A C     1 
ATOM   1756  O  O     . SER A 1 226  ? 105.304 74.645  147.080 1.00 141.33 ? 226  SER A O     1 
ATOM   1757  C  CB    . SER A 1 226  ? 103.904 74.207  143.951 1.00 141.33 ? 226  SER A CB    1 
ATOM   1758  O  OG    . SER A 1 226  ? 104.975 74.154  143.026 1.00 141.33 ? 226  SER A OG    1 
ATOM   1759  N  N     . ASN A 1 227  ? 106.558 74.733  145.216 1.00 149.78 ? 227  ASN A N     1 
ATOM   1760  C  CA    . ASN A 1 227  ? 107.739 74.171  145.854 1.00 149.78 ? 227  ASN A CA    1 
ATOM   1761  C  C     . ASN A 1 227  ? 108.486 75.243  146.631 1.00 149.78 ? 227  ASN A C     1 
ATOM   1762  O  O     . ASN A 1 227  ? 108.974 76.207  146.022 1.00 149.78 ? 227  ASN A O     1 
ATOM   1763  C  CB    . ASN A 1 227  ? 108.658 73.536  144.814 1.00 149.78 ? 227  ASN A CB    1 
ATOM   1764  C  CG    . ASN A 1 227  ? 108.265 72.112  144.484 1.00 149.78 ? 227  ASN A CG    1 
ATOM   1765  O  OD1   . ASN A 1 227  ? 107.599 71.442  145.273 1.00 149.78 ? 227  ASN A OD1   1 
ATOM   1766  N  ND2   . ASN A 1 227  ? 108.678 71.639  143.314 1.00 149.78 ? 227  ASN A ND2   1 
ATOM   1767  N  N     . PRO A 1 228  ? 108.605 75.128  147.948 1.00 151.49 ? 228  PRO A N     1 
ATOM   1768  C  CA    . PRO A 1 228  ? 109.399 76.090  148.715 1.00 151.49 ? 228  PRO A CA    1 
ATOM   1769  C  C     . PRO A 1 228  ? 110.883 75.749  148.652 1.00 151.49 ? 228  PRO A C     1 
ATOM   1770  O  O     . PRO A 1 228  ? 111.301 74.750  148.066 1.00 151.49 ? 228  PRO A O     1 
ATOM   1771  C  CB    . PRO A 1 228  ? 108.861 75.941  150.147 1.00 151.49 ? 228  PRO A CB    1 
ATOM   1772  C  CG    . PRO A 1 228  ? 107.667 75.007  150.044 1.00 151.49 ? 228  PRO A CG    1 
ATOM   1773  C  CD    . PRO A 1 228  ? 107.911 74.179  148.829 1.00 151.49 ? 228  PRO A CD    1 
ATOM   1774  N  N     . GLN A 1 229  ? 111.680 76.608  149.281 1.00 152.47 ? 229  GLN A N     1 
ATOM   1775  C  CA    . GLN A 1 229  ? 113.119 76.390  149.384 1.00 152.47 ? 229  GLN A CA    1 
ATOM   1776  C  C     . GLN A 1 229  ? 113.644 76.855  150.739 1.00 152.47 ? 229  GLN A C     1 
ATOM   1777  O  O     . GLN A 1 229  ? 114.750 77.385  150.838 1.00 152.47 ? 229  GLN A O     1 
ATOM   1778  C  CB    . GLN A 1 229  ? 113.865 77.113  148.258 1.00 152.47 ? 229  GLN A CB    1 
ATOM   1779  C  CG    . GLN A 1 229  ? 113.687 76.512  146.864 1.00 152.47 ? 229  GLN A CG    1 
ATOM   1780  C  CD    . GLN A 1 229  ? 114.403 75.183  146.677 1.00 152.47 ? 229  GLN A CD    1 
ATOM   1781  O  OE1   . GLN A 1 229  ? 114.271 74.265  147.488 1.00 152.47 ? 229  GLN A OE1   1 
ATOM   1782  N  NE2   . GLN A 1 229  ? 115.170 75.077  145.599 1.00 152.47 ? 229  GLN A NE2   1 
ATOM   1783  N  N     . LYS B 1 7    ? 111.348 80.777  131.714 1.00 139.93 ? 7    LYS B N     1 
ATOM   1784  C  CA    . LYS B 1 7    ? 111.893 79.804  132.653 1.00 139.93 ? 7    LYS B CA    1 
ATOM   1785  C  C     . LYS B 1 7    ? 110.969 79.593  133.844 1.00 139.93 ? 7    LYS B C     1 
ATOM   1786  O  O     . LYS B 1 7    ? 109.981 80.306  134.012 1.00 139.93 ? 7    LYS B O     1 
ATOM   1787  C  CB    . LYS B 1 7    ? 113.270 80.247  133.147 1.00 139.93 ? 7    LYS B CB    1 
ATOM   1788  C  CG    . LYS B 1 7    ? 114.411 79.905  132.211 1.00 139.93 ? 7    LYS B CG    1 
ATOM   1789  C  CD    . LYS B 1 7    ? 115.731 80.407  132.767 1.00 139.93 ? 7    LYS B CD    1 
ATOM   1790  C  CE    . LYS B 1 7    ? 115.970 79.874  134.171 1.00 139.93 ? 7    LYS B CE    1 
ATOM   1791  N  NZ    . LYS B 1 7    ? 116.053 78.388  134.196 1.00 139.93 ? 7    LYS B NZ    1 
ATOM   1792  N  N     . ALA B 1 8    ? 111.300 78.607  134.669 1.00 135.17 ? 8    ALA B N     1 
ATOM   1793  C  CA    . ALA B 1 8    ? 110.556 78.368  135.897 1.00 135.17 ? 8    ALA B CA    1 
ATOM   1794  C  C     . ALA B 1 8    ? 111.218 79.123  137.042 1.00 135.17 ? 8    ALA B C     1 
ATOM   1795  O  O     . ALA B 1 8    ? 112.332 78.766  137.442 1.00 135.17 ? 8    ALA B O     1 
ATOM   1796  C  CB    . ALA B 1 8    ? 110.498 76.880  136.210 1.00 135.17 ? 8    ALA B CB    1 
ATOM   1797  N  N     . PRO B 1 9    ? 110.585 80.159  137.588 1.00 130.07 ? 9    PRO B N     1 
ATOM   1798  C  CA    . PRO B 1 9    ? 111.233 80.947  138.641 1.00 130.07 ? 9    PRO B CA    1 
ATOM   1799  C  C     . PRO B 1 9    ? 111.415 80.131  139.913 1.00 130.07 ? 9    PRO B C     1 
ATOM   1800  O  O     . PRO B 1 9    ? 110.718 79.142  140.148 1.00 130.07 ? 9    PRO B O     1 
ATOM   1801  C  CB    . PRO B 1 9    ? 110.264 82.116  138.860 1.00 130.07 ? 9    PRO B CB    1 
ATOM   1802  C  CG    . PRO B 1 9    ? 109.347 82.105  137.672 1.00 130.07 ? 9    PRO B CG    1 
ATOM   1803  C  CD    . PRO B 1 9    ? 109.255 80.681  137.246 1.00 130.07 ? 9    PRO B CD    1 
ATOM   1804  N  N     . VAL B 1 10   ? 112.365 80.557  140.731 1.00 129.83 ? 10   VAL B N     1 
ATOM   1805  C  CA    . VAL B 1 10   ? 112.638 79.910  142.007 1.00 129.83 ? 10   VAL B CA    1 
ATOM   1806  C  C     . VAL B 1 10   ? 111.916 80.671  143.111 1.00 129.83 ? 10   VAL B C     1 
ATOM   1807  O  O     . VAL B 1 10   ? 111.745 81.901  143.050 1.00 129.83 ? 10   VAL B O     1 
ATOM   1808  C  CB    . VAL B 1 10   ? 114.154 79.820  142.273 1.00 129.83 ? 10   VAL B CB    1 
ATOM   1809  C  CG1   . VAL B 1 10   ? 114.744 81.186  142.576 1.00 129.83 ? 10   VAL B CG1   1 
ATOM   1810  C  CG2   . VAL B 1 10   ? 114.445 78.840  143.400 1.00 129.83 ? 10   VAL B CG2   1 
ATOM   1811  N  N     . PHE B 1 11   ? 111.482 79.920  144.122 1.00 132.35 ? 11   PHE B N     1 
ATOM   1812  C  CA    . PHE B 1 11   ? 110.672 80.417  145.225 1.00 132.35 ? 11   PHE B CA    1 
ATOM   1813  C  C     . PHE B 1 11   ? 111.335 80.015  146.535 1.00 132.35 ? 11   PHE B C     1 
ATOM   1814  O  O     . PHE B 1 11   ? 111.438 78.822  146.841 1.00 132.35 ? 11   PHE B O     1 
ATOM   1815  C  CB    . PHE B 1 11   ? 109.254 79.854  145.136 1.00 132.35 ? 11   PHE B CB    1 
ATOM   1816  C  CG    . PHE B 1 11   ? 108.409 80.129  146.342 1.00 132.35 ? 11   PHE B CG    1 
ATOM   1817  C  CD1   . PHE B 1 11   ? 108.170 81.425  146.758 1.00 132.35 ? 11   PHE B CD1   1 
ATOM   1818  C  CD2   . PHE B 1 11   ? 107.844 79.086  147.055 1.00 132.35 ? 11   PHE B CD2   1 
ATOM   1819  C  CE1   . PHE B 1 11   ? 107.388 81.676  147.866 1.00 132.35 ? 11   PHE B CE1   1 
ATOM   1820  C  CE2   . PHE B 1 11   ? 107.063 79.331  148.163 1.00 132.35 ? 11   PHE B CE2   1 
ATOM   1821  C  CZ    . PHE B 1 11   ? 106.834 80.627  148.569 1.00 132.35 ? 11   PHE B CZ    1 
ATOM   1822  N  N     . THR B 1 12   ? 111.776 81.006  147.306 1.00 133.42 ? 12   THR B N     1 
ATOM   1823  C  CA    . THR B 1 12   ? 112.508 80.782  148.544 1.00 133.42 ? 12   THR B CA    1 
ATOM   1824  C  C     . THR B 1 12   ? 111.697 81.309  149.717 1.00 133.42 ? 12   THR B C     1 
ATOM   1825  O  O     . THR B 1 12   ? 110.984 82.310  149.587 1.00 133.42 ? 12   THR B O     1 
ATOM   1826  C  CB    . THR B 1 12   ? 113.879 81.464  148.514 1.00 133.42 ? 12   THR B CB    1 
ATOM   1827  O  OG1   . THR B 1 12   ? 113.725 82.858  148.801 1.00 133.42 ? 12   THR B OG1   1 
ATOM   1828  C  CG2   . THR B 1 12   ? 114.522 81.303  147.148 1.00 133.42 ? 12   THR B CG2   1 
ATOM   1829  N  N     . VAL B 1 13   ? 111.823 80.638  150.859 1.00 134.27 ? 13   VAL B N     1 
ATOM   1830  C  CA    . VAL B 1 13   ? 111.059 80.937  152.062 1.00 134.27 ? 13   VAL B CA    1 
ATOM   1831  C  C     . VAL B 1 13   ? 112.032 81.287  153.179 1.00 134.27 ? 13   VAL B C     1 
ATOM   1832  O  O     . VAL B 1 13   ? 113.134 80.733  153.249 1.00 134.27 ? 13   VAL B O     1 
ATOM   1833  C  CB    . VAL B 1 13   ? 110.169 79.741  152.458 1.00 134.27 ? 13   VAL B CB    1 
ATOM   1834  C  CG1   . VAL B 1 13   ? 109.377 80.038  153.717 1.00 134.27 ? 13   VAL B CG1   1 
ATOM   1835  C  CG2   . VAL B 1 13   ? 109.238 79.379  151.315 1.00 134.27 ? 13   VAL B CG2   1 
ATOM   1836  N  N     . ARG B 1 14   ? 111.625 82.208  154.052 1.00 138.82 ? 14   ARG B N     1 
ATOM   1837  C  CA    . ARG B 1 14   ? 112.428 82.597  155.205 1.00 138.82 ? 14   ARG B CA    1 
ATOM   1838  C  C     . ARG B 1 14   ? 111.477 83.014  156.316 1.00 138.82 ? 14   ARG B C     1 
ATOM   1839  O  O     . ARG B 1 14   ? 110.908 84.108  156.270 1.00 138.82 ? 14   ARG B O     1 
ATOM   1840  C  CB    . ARG B 1 14   ? 113.388 83.732  154.839 1.00 138.82 ? 14   ARG B CB    1 
ATOM   1841  C  CG    . ARG B 1 14   ? 114.089 84.390  156.010 1.00 138.82 ? 14   ARG B CG    1 
ATOM   1842  C  CD    . ARG B 1 14   ? 115.327 85.156  155.553 1.00 138.82 ? 14   ARG B CD    1 
ATOM   1843  N  NE    . ARG B 1 14   ? 115.008 86.268  154.659 1.00 138.82 ? 14   ARG B NE    1 
ATOM   1844  C  CZ    . ARG B 1 14   ? 115.091 86.214  153.332 1.00 138.82 ? 14   ARG B CZ    1 
ATOM   1845  N  NH1   . ARG B 1 14   ? 115.486 85.100  152.733 1.00 138.82 ? 14   ARG B NH1   1 
ATOM   1846  N  NH2   . ARG B 1 14   ? 114.781 87.278  152.604 1.00 138.82 ? 14   ARG B NH2   1 
ATOM   1847  N  N     . THR B 1 15   ? 111.296 82.145  157.305 1.00 139.68 ? 15   THR B N     1 
ATOM   1848  C  CA    . THR B 1 15   ? 110.264 82.325  158.313 1.00 139.68 ? 15   THR B CA    1 
ATOM   1849  C  C     . THR B 1 15   ? 110.880 82.544  159.687 1.00 139.68 ? 15   THR B C     1 
ATOM   1850  O  O     . THR B 1 15   ? 111.886 81.923  160.044 1.00 139.68 ? 15   THR B O     1 
ATOM   1851  C  CB    . THR B 1 15   ? 109.322 81.116  158.367 1.00 139.68 ? 15   THR B CB    1 
ATOM   1852  O  OG1   . THR B 1 15   ? 110.093 79.914  158.479 1.00 139.68 ? 15   THR B OG1   1 
ATOM   1853  C  CG2   . THR B 1 15   ? 108.470 81.051  157.113 1.00 139.68 ? 15   THR B CG2   1 
ATOM   1854  N  N     . GLN B 1 16   ? 110.259 83.436  160.455 1.00 141.89 ? 16   GLN B N     1 
ATOM   1855  C  CA    . GLN B 1 16   ? 110.619 83.693  161.844 1.00 141.89 ? 16   GLN B CA    1 
ATOM   1856  C  C     . GLN B 1 16   ? 109.408 83.345  162.700 1.00 141.89 ? 16   GLN B C     1 
ATOM   1857  O  O     . GLN B 1 16   ? 108.380 84.036  162.646 1.00 141.89 ? 16   GLN B O     1 
ATOM   1858  C  CB    . GLN B 1 16   ? 111.047 85.144  162.049 1.00 141.89 ? 16   GLN B CB    1 
ATOM   1859  C  CG    . GLN B 1 16   ? 112.393 85.482  161.434 1.00 141.89 ? 16   GLN B CG    1 
ATOM   1860  C  CD    . GLN B 1 16   ? 112.926 86.820  161.902 1.00 141.89 ? 16   GLN B CD    1 
ATOM   1861  O  OE1   . GLN B 1 16   ? 112.418 87.403  162.860 1.00 141.89 ? 16   GLN B OE1   1 
ATOM   1862  N  NE2   . GLN B 1 16   ? 113.955 87.316  161.226 1.00 141.89 ? 16   GLN B NE2   1 
ATOM   1863  N  N     . GLY B 1 17   ? 109.533 82.266  163.469 1.00 139.02 ? 17   GLY B N     1 
ATOM   1864  C  CA    . GLY B 1 17   ? 108.497 81.744  164.331 1.00 139.02 ? 17   GLY B CA    1 
ATOM   1865  C  C     . GLY B 1 17   ? 107.218 81.458  163.570 1.00 139.02 ? 17   GLY B C     1 
ATOM   1866  O  O     . GLY B 1 17   ? 107.217 81.168  162.369 1.00 139.02 ? 17   GLY B O     1 
ATOM   1867  N  N     . ARG B 1 18   ? 106.105 81.538  164.290 1.00 136.52 ? 18   ARG B N     1 
ATOM   1868  C  CA    . ARG B 1 18   ? 104.782 81.418  163.702 1.00 136.52 ? 18   ARG B CA    1 
ATOM   1869  C  C     . ARG B 1 18   ? 104.143 82.770  163.434 1.00 136.52 ? 18   ARG B C     1 
ATOM   1870  O  O     . ARG B 1 18   ? 102.920 82.844  163.287 1.00 136.52 ? 18   ARG B O     1 
ATOM   1871  C  CB    . ARG B 1 18   ? 103.871 80.594  164.617 1.00 136.52 ? 18   ARG B CB    1 
ATOM   1872  C  CG    . ARG B 1 18   ? 104.391 79.203  164.928 1.00 136.52 ? 18   ARG B CG    1 
ATOM   1873  C  CD    . ARG B 1 18   ? 103.507 78.507  165.950 1.00 136.52 ? 18   ARG B CD    1 
ATOM   1874  N  NE    . ARG B 1 18   ? 102.093 78.572  165.590 1.00 136.52 ? 18   ARG B NE    1 
ATOM   1875  C  CZ    . ARG B 1 18   ? 101.509 77.774  164.702 1.00 136.52 ? 18   ARG B CZ    1 
ATOM   1876  N  NH1   . ARG B 1 18   ? 100.217 77.908  164.439 1.00 136.52 ? 18   ARG B NH1   1 
ATOM   1877  N  NH2   . ARG B 1 18   ? 102.213 76.839  164.081 1.00 136.52 ? 18   ARG B NH2   1 
ATOM   1878  N  N     . GLU B 1 19   ? 104.934 83.841  163.372 1.00 131.08 ? 19   GLU B N     1 
ATOM   1879  C  CA    . GLU B 1 19   ? 104.381 85.184  163.308 1.00 131.08 ? 19   GLU B CA    1 
ATOM   1880  C  C     . GLU B 1 19   ? 105.037 86.080  162.265 1.00 131.08 ? 19   GLU B C     1 
ATOM   1881  O  O     . GLU B 1 19   ? 104.563 87.202  162.064 1.00 131.08 ? 19   GLU B O     1 
ATOM   1882  C  CB    . GLU B 1 19   ? 104.481 85.856  164.682 1.00 131.08 ? 19   GLU B CB    1 
ATOM   1883  C  CG    . GLU B 1 19   ? 103.449 85.362  165.681 1.00 131.08 ? 19   GLU B CG    1 
ATOM   1884  C  CD    . GLU B 1 19   ? 103.534 86.077  167.014 1.00 131.08 ? 19   GLU B CD    1 
ATOM   1885  O  OE1   . GLU B 1 19   ? 103.814 85.409  168.031 1.00 131.08 ? 19   GLU B OE1   1 
ATOM   1886  O  OE2   . GLU B 1 19   ? 103.319 87.307  167.046 1.00 131.08 ? 19   GLU B OE2   1 
ATOM   1887  N  N     . TYR B 1 20   ? 106.101 85.636  161.597 1.00 122.69 ? 20   TYR B N     1 
ATOM   1888  C  CA    . TYR B 1 20   ? 106.683 86.474  160.557 1.00 122.69 ? 20   TYR B CA    1 
ATOM   1889  C  C     . TYR B 1 20   ? 107.167 85.608  159.405 1.00 122.69 ? 20   TYR B C     1 
ATOM   1890  O  O     . TYR B 1 20   ? 107.719 84.528  159.623 1.00 122.69 ? 20   TYR B O     1 
ATOM   1891  C  CB    . TYR B 1 20   ? 107.838 87.320  161.100 1.00 122.69 ? 20   TYR B CB    1 
ATOM   1892  C  CG    . TYR B 1 20   ? 108.462 88.225  160.066 1.00 122.69 ? 20   TYR B CG    1 
ATOM   1893  C  CD1   . TYR B 1 20   ? 109.712 87.948  159.535 1.00 122.69 ? 20   TYR B CD1   1 
ATOM   1894  C  CD2   . TYR B 1 20   ? 107.799 89.357  159.619 1.00 122.69 ? 20   TYR B CD2   1 
ATOM   1895  C  CE1   . TYR B 1 20   ? 110.285 88.775  158.591 1.00 122.69 ? 20   TYR B CE1   1 
ATOM   1896  C  CE2   . TYR B 1 20   ? 108.363 90.188  158.675 1.00 122.69 ? 20   TYR B CE2   1 
ATOM   1897  C  CZ    . TYR B 1 20   ? 109.605 89.893  158.165 1.00 122.69 ? 20   TYR B CZ    1 
ATOM   1898  O  OH    . TYR B 1 20   ? 110.171 90.719  157.224 1.00 122.69 ? 20   TYR B OH    1 
ATOM   1899  N  N     . GLY B 1 21   ? 106.976 86.094  158.187 1.00 124.35 ? 21   GLY B N     1 
ATOM   1900  C  CA    . GLY B 1 21   ? 107.406 85.348  157.016 1.00 124.35 ? 21   GLY B CA    1 
ATOM   1901  C  C     . GLY B 1 21   ? 107.869 86.261  155.906 1.00 124.35 ? 21   GLY B C     1 
ATOM   1902  O  O     . GLY B 1 21   ? 107.354 87.369  155.731 1.00 124.35 ? 21   GLY B O     1 
ATOM   1903  N  N     . GLU B 1 22   ? 108.852 85.784  155.146 1.00 128.46 ? 22   GLU B N     1 
ATOM   1904  C  CA    . GLU B 1 22   ? 109.324 86.446  153.939 1.00 128.46 ? 22   GLU B CA    1 
ATOM   1905  C  C     . GLU B 1 22   ? 109.388 85.415  152.823 1.00 128.46 ? 22   GLU B C     1 
ATOM   1906  O  O     . GLU B 1 22   ? 109.878 84.299  153.028 1.00 128.46 ? 22   GLU B O     1 
ATOM   1907  C  CB    . GLU B 1 22   ? 110.697 87.086  154.153 1.00 128.46 ? 22   GLU B CB    1 
ATOM   1908  C  CG    . GLU B 1 22   ? 110.676 88.305  155.053 1.00 128.46 ? 22   GLU B CG    1 
ATOM   1909  C  CD    . GLU B 1 22   ? 111.749 89.312  154.694 1.00 128.46 ? 22   GLU B CD    1 
ATOM   1910  O  OE1   . GLU B 1 22   ? 112.498 89.065  153.726 1.00 128.46 ? 22   GLU B OE1   1 
ATOM   1911  O  OE2   . GLU B 1 22   ? 111.841 90.353  155.377 1.00 128.46 ? 22   GLU B OE2   1 
ATOM   1912  N  N     . PHE B 1 23   ? 108.884 85.783  151.650 1.00 121.27 ? 23   PHE B N     1 
ATOM   1913  C  CA    . PHE B 1 23   ? 108.808 84.863  150.522 1.00 121.27 ? 23   PHE B CA    1 
ATOM   1914  C  C     . PHE B 1 23   ? 109.313 85.573  149.277 1.00 121.27 ? 23   PHE B C     1 
ATOM   1915  O  O     . PHE B 1 23   ? 108.788 86.627  148.910 1.00 121.27 ? 23   PHE B O     1 
ATOM   1916  C  CB    . PHE B 1 23   ? 107.376 84.364  150.326 1.00 121.27 ? 23   PHE B CB    1 
ATOM   1917  C  CG    . PHE B 1 23   ? 106.797 83.711  151.547 1.00 121.27 ? 23   PHE B CG    1 
ATOM   1918  C  CD1   . PHE B 1 23   ? 106.947 82.353  151.759 1.00 121.27 ? 23   PHE B CD1   1 
ATOM   1919  C  CD2   . PHE B 1 23   ? 106.112 84.458  152.489 1.00 121.27 ? 23   PHE B CD2   1 
ATOM   1920  C  CE1   . PHE B 1 23   ? 106.417 81.751  152.883 1.00 121.27 ? 23   PHE B CE1   1 
ATOM   1921  C  CE2   . PHE B 1 23   ? 105.583 83.861  153.615 1.00 121.27 ? 23   PHE B CE2   1 
ATOM   1922  C  CZ    . PHE B 1 23   ? 105.735 82.506  153.812 1.00 121.27 ? 23   PHE B CZ    1 
ATOM   1923  N  N     . VAL B 1 24   ? 110.327 85.003  148.632 1.00 121.58 ? 24   VAL B N     1 
ATOM   1924  C  CA    . VAL B 1 24   ? 110.986 85.634  147.494 1.00 121.58 ? 24   VAL B CA    1 
ATOM   1925  C  C     . VAL B 1 24   ? 110.756 84.772  146.262 1.00 121.58 ? 24   VAL B C     1 
ATOM   1926  O  O     . VAL B 1 24   ? 111.055 83.573  146.268 1.00 121.58 ? 24   VAL B O     1 
ATOM   1927  C  CB    . VAL B 1 24   ? 112.487 85.836  147.748 1.00 121.58 ? 24   VAL B CB    1 
ATOM   1928  C  CG1   . VAL B 1 24   ? 113.177 86.308  146.480 1.00 121.58 ? 24   VAL B CG1   1 
ATOM   1929  C  CG2   . VAL B 1 24   ? 112.701 86.827  148.878 1.00 121.58 ? 24   VAL B CG2   1 
ATOM   1930  N  N     . LEU B 1 25   ? 110.236 85.383  145.203 1.00 122.47 ? 25   LEU B N     1 
ATOM   1931  C  CA    . LEU B 1 25   ? 110.007 84.710  143.929 1.00 122.47 ? 25   LEU B CA    1 
ATOM   1932  C  C     . LEU B 1 25   ? 110.780 85.466  142.858 1.00 122.47 ? 25   LEU B C     1 
ATOM   1933  O  O     . LEU B 1 25   ? 110.574 86.673  142.671 1.00 122.47 ? 25   LEU B O     1 
ATOM   1934  C  CB    . LEU B 1 25   ? 108.517 84.653  143.601 1.00 122.47 ? 25   LEU B CB    1 
ATOM   1935  C  CG    . LEU B 1 25   ? 108.119 83.878  142.346 1.00 122.47 ? 25   LEU B CG    1 
ATOM   1936  C  CD1   . LEU B 1 25   ? 108.591 82.441  142.442 1.00 122.47 ? 25   LEU B CD1   1 
ATOM   1937  C  CD2   . LEU B 1 25   ? 106.617 83.936  142.138 1.00 122.47 ? 25   LEU B CD2   1 
ATOM   1938  N  N     . GLU B 1 26   ? 111.671 84.768  142.160 1.00 131.68 ? 26   GLU B N     1 
ATOM   1939  C  CA    . GLU B 1 26   ? 112.493 85.421  141.151 1.00 131.68 ? 26   GLU B CA    1 
ATOM   1940  C  C     . GLU B 1 26   ? 113.098 84.363  140.246 1.00 131.68 ? 26   GLU B C     1 
ATOM   1941  O  O     . GLU B 1 26   ? 113.369 83.243  140.690 1.00 131.68 ? 26   GLU B O     1 
ATOM   1942  C  CB    . GLU B 1 26   ? 113.599 86.269  141.794 1.00 131.68 ? 26   GLU B CB    1 
ATOM   1943  C  CG    . GLU B 1 26   ? 114.688 85.462  142.480 1.00 131.68 ? 26   GLU B CG    1 
ATOM   1944  C  CD    . GLU B 1 26   ? 115.847 86.322  142.940 1.00 131.68 ? 26   GLU B CD    1 
ATOM   1945  O  OE1   . GLU B 1 26   ? 116.047 87.411  142.362 1.00 131.68 ? 26   GLU B OE1   1 
ATOM   1946  O  OE2   . GLU B 1 26   ? 116.558 85.910  143.880 1.00 131.68 ? 26   GLU B OE2   1 
ATOM   1947  N  N     . PRO B 1 27   ? 113.329 84.685  138.963 1.00 127.18 ? 27   PRO B N     1 
ATOM   1948  C  CA    . PRO B 1 27   ? 112.979 85.948  138.312 1.00 127.18 ? 27   PRO B CA    1 
ATOM   1949  C  C     . PRO B 1 27   ? 111.640 85.879  137.587 1.00 127.18 ? 27   PRO B C     1 
ATOM   1950  O  O     . PRO B 1 27   ? 111.163 84.788  137.280 1.00 127.18 ? 27   PRO B O     1 
ATOM   1951  C  CB    . PRO B 1 27   ? 114.120 86.141  137.321 1.00 127.18 ? 27   PRO B CB    1 
ATOM   1952  C  CG    . PRO B 1 27   ? 114.445 84.746  136.897 1.00 127.18 ? 27   PRO B CG    1 
ATOM   1953  C  CD    . PRO B 1 27   ? 114.149 83.839  138.079 1.00 127.18 ? 27   PRO B CD    1 
ATOM   1954  N  N     . LEU B 1 28   ? 111.046 87.034  137.310 1.00 126.46 ? 28   LEU B N     1 
ATOM   1955  C  CA    . LEU B 1 28   ? 109.752 87.111  136.654 1.00 126.46 ? 28   LEU B CA    1 
ATOM   1956  C  C     . LEU B 1 28   ? 109.829 88.046  135.457 1.00 126.46 ? 28   LEU B C     1 
ATOM   1957  O  O     . LEU B 1 28   ? 110.656 88.962  135.415 1.00 126.46 ? 28   LEU B O     1 
ATOM   1958  C  CB    . LEU B 1 28   ? 108.668 87.599  137.619 1.00 126.46 ? 28   LEU B CB    1 
ATOM   1959  C  CG    . LEU B 1 28   ? 108.243 86.622  138.713 1.00 126.46 ? 28   LEU B CG    1 
ATOM   1960  C  CD1   . LEU B 1 28   ? 107.221 87.266  139.631 1.00 126.46 ? 28   LEU B CD1   1 
ATOM   1961  C  CD2   . LEU B 1 28   ? 107.687 85.354  138.097 1.00 126.46 ? 28   LEU B CD2   1 
ATOM   1962  N  N     . GLU B 1 29   ? 108.963 87.797  134.478 1.00 132.44 ? 29   GLU B N     1 
ATOM   1963  C  CA    . GLU B 1 29   ? 108.873 88.669  133.318 1.00 132.44 ? 29   GLU B CA    1 
ATOM   1964  C  C     . GLU B 1 29   ? 108.492 90.083  133.753 1.00 132.44 ? 29   GLU B C     1 
ATOM   1965  O  O     . GLU B 1 29   ? 107.807 90.288  134.758 1.00 132.44 ? 29   GLU B O     1 
ATOM   1966  C  CB    . GLU B 1 29   ? 107.855 88.119  132.319 1.00 132.44 ? 29   GLU B CB    1 
ATOM   1967  C  CG    . GLU B 1 29   ? 107.772 88.890  131.014 1.00 132.44 ? 29   GLU B CG    1 
ATOM   1968  C  CD    . GLU B 1 29   ? 109.073 88.864  130.236 1.00 132.44 ? 29   GLU B CD    1 
ATOM   1969  O  OE1   . GLU B 1 29   ? 109.804 87.856  130.328 1.00 132.44 ? 29   GLU B OE1   1 
ATOM   1970  O  OE2   . GLU B 1 29   ? 109.368 89.855  129.535 1.00 132.44 ? 29   GLU B OE2   1 
ATOM   1971  N  N     . ARG B 1 30   ? 108.962 91.065  132.985 1.00 127.95 ? 30   ARG B N     1 
ATOM   1972  C  CA    . ARG B 1 30   ? 108.761 92.464  133.341 1.00 127.95 ? 30   ARG B CA    1 
ATOM   1973  C  C     . ARG B 1 30   ? 107.280 92.784  133.487 1.00 127.95 ? 30   ARG B C     1 
ATOM   1974  O  O     . ARG B 1 30   ? 106.487 92.557  132.570 1.00 127.95 ? 30   ARG B O     1 
ATOM   1975  C  CB    . ARG B 1 30   ? 109.388 93.371  132.285 1.00 127.95 ? 30   ARG B CB    1 
ATOM   1976  C  CG    . ARG B 1 30   ? 109.140 94.848  132.527 1.00 127.95 ? 30   ARG B CG    1 
ATOM   1977  C  CD    . ARG B 1 30   ? 109.540 95.681  131.325 1.00 127.95 ? 30   ARG B CD    1 
ATOM   1978  N  NE    . ARG B 1 30   ? 108.499 95.691  130.303 1.00 127.95 ? 30   ARG B NE    1 
ATOM   1979  C  CZ    . ARG B 1 30   ? 108.483 96.517  129.263 1.00 127.95 ? 30   ARG B CZ    1 
ATOM   1980  N  NH1   . ARG B 1 30   ? 109.455 97.404  129.106 1.00 127.95 ? 30   ARG B NH1   1 
ATOM   1981  N  NH2   . ARG B 1 30   ? 107.496 96.457  128.381 1.00 127.95 ? 30   ARG B NH2   1 
ATOM   1982  N  N     . GLY B 1 31   ? 106.911 93.315  134.651 1.00 122.69 ? 31   GLY B N     1 
ATOM   1983  C  CA    . GLY B 1 31   ? 105.557 93.726  134.930 1.00 122.69 ? 31   GLY B CA    1 
ATOM   1984  C  C     . GLY B 1 31   ? 104.746 92.739  135.743 1.00 122.69 ? 31   GLY B C     1 
ATOM   1985  O  O     . GLY B 1 31   ? 103.668 93.099  136.227 1.00 122.69 ? 31   GLY B O     1 
ATOM   1986  N  N     . PHE B 1 32   ? 105.230 91.506  135.906 1.00 118.80 ? 32   PHE B N     1 
ATOM   1987  C  CA    . PHE B 1 32   ? 104.468 90.513  136.652 1.00 118.80 ? 32   PHE B CA    1 
ATOM   1988  C  C     . PHE B 1 32   ? 104.621 90.670  138.157 1.00 118.80 ? 32   PHE B C     1 
ATOM   1989  O  O     . PHE B 1 32   ? 103.829 90.089  138.909 1.00 118.80 ? 32   PHE B O     1 
ATOM   1990  C  CB    . PHE B 1 32   ? 104.883 89.106  136.231 1.00 118.80 ? 32   PHE B CB    1 
ATOM   1991  C  CG    . PHE B 1 32   ? 103.997 88.509  135.183 1.00 118.80 ? 32   PHE B CG    1 
ATOM   1992  C  CD1   . PHE B 1 32   ? 104.063 88.946  133.872 1.00 118.80 ? 32   PHE B CD1   1 
ATOM   1993  C  CD2   . PHE B 1 32   ? 103.088 87.519  135.509 1.00 118.80 ? 32   PHE B CD2   1 
ATOM   1994  C  CE1   . PHE B 1 32   ? 103.246 88.402  132.905 1.00 118.80 ? 32   PHE B CE1   1 
ATOM   1995  C  CE2   . PHE B 1 32   ? 102.267 86.972  134.546 1.00 118.80 ? 32   PHE B CE2   1 
ATOM   1996  C  CZ    . PHE B 1 32   ? 102.346 87.414  133.242 1.00 118.80 ? 32   PHE B CZ    1 
ATOM   1997  N  N     . GLY B 1 33   ? 105.617 91.436  138.608 1.00 118.61 ? 33   GLY B N     1 
ATOM   1998  C  CA    . GLY B 1 33   ? 105.800 91.634  140.037 1.00 118.61 ? 33   GLY B CA    1 
ATOM   1999  C  C     . GLY B 1 33   ? 104.549 92.150  140.719 1.00 118.61 ? 33   GLY B C     1 
ATOM   2000  O  O     . GLY B 1 33   ? 103.953 91.465  141.552 1.00 118.61 ? 33   GLY B O     1 
ATOM   2001  N  N     . VAL B 1 34   ? 104.120 93.362  140.359 1.00 116.81 ? 34   VAL B N     1 
ATOM   2002  C  CA    . VAL B 1 34   ? 102.912 93.916  140.958 1.00 116.81 ? 34   VAL B CA    1 
ATOM   2003  C  C     . VAL B 1 34   ? 101.666 93.147  140.540 1.00 116.81 ? 34   VAL B C     1 
ATOM   2004  O  O     . VAL B 1 34   ? 100.705 93.077  141.318 1.00 116.81 ? 34   VAL B O     1 
ATOM   2005  C  CB    . VAL B 1 34   ? 102.771 95.408  140.615 1.00 116.81 ? 34   VAL B CB    1 
ATOM   2006  C  CG1   . VAL B 1 34   ? 104.060 96.142  140.928 1.00 116.81 ? 34   VAL B CG1   1 
ATOM   2007  C  CG2   . VAL B 1 34   ? 102.403 95.596  139.156 1.00 116.81 ? 34   VAL B CG2   1 
ATOM   2008  N  N     . THR B 1 35   ? 101.675 92.536  139.351 1.00 112.83 ? 35   THR B N     1 
ATOM   2009  C  CA    . THR B 1 35   ? 100.525 91.765  138.891 1.00 112.83 ? 35   THR B CA    1 
ATOM   2010  C  C     . THR B 1 35   ? 100.255 90.580  139.810 1.00 112.83 ? 35   THR B C     1 
ATOM   2011  O  O     . THR B 1 35   ? 99.098  90.195  140.013 1.00 112.83 ? 35   THR B O     1 
ATOM   2012  C  CB    . THR B 1 35   ? 100.758 91.296  137.453 1.00 112.83 ? 35   THR B CB    1 
ATOM   2013  O  OG1   . THR B 1 35   ? 100.734 92.426  136.574 1.00 112.83 ? 35   THR B OG1   1 
ATOM   2014  C  CG2   . THR B 1 35   ? 99.686  90.311  137.017 1.00 112.83 ? 35   THR B CG2   1 
ATOM   2015  N  N     . LEU B 1 36   ? 101.306 89.996  140.384 1.00 113.20 ? 36   LEU B N     1 
ATOM   2016  C  CA    . LEU B 1 36   ? 101.102 88.912  141.338 1.00 113.20 ? 36   LEU B CA    1 
ATOM   2017  C  C     . LEU B 1 36   ? 101.066 89.425  142.773 1.00 113.20 ? 36   LEU B C     1 
ATOM   2018  O  O     . LEU B 1 36   ? 100.560 88.738  143.667 1.00 113.20 ? 36   LEU B O     1 
ATOM   2019  C  CB    . LEU B 1 36   ? 102.193 87.856  141.172 1.00 113.20 ? 36   LEU B CB    1 
ATOM   2020  C  CG    . LEU B 1 36   ? 102.051 86.971  139.934 1.00 113.20 ? 36   LEU B CG    1 
ATOM   2021  C  CD1   . LEU B 1 36   ? 103.187 85.967  139.858 1.00 113.20 ? 36   LEU B CD1   1 
ATOM   2022  C  CD2   . LEU B 1 36   ? 100.707 86.266  139.940 1.00 113.20 ? 36   LEU B CD2   1 
ATOM   2023  N  N     . GLY B 1 37   ? 101.594 90.626  143.013 1.00 112.62 ? 37   GLY B N     1 
ATOM   2024  C  CA    . GLY B 1 37   ? 101.621 91.150  144.369 1.00 112.62 ? 37   GLY B CA    1 
ATOM   2025  C  C     . GLY B 1 37   ? 100.282 91.697  144.828 1.00 112.62 ? 37   GLY B C     1 
ATOM   2026  O  O     . GLY B 1 37   ? 99.813  91.374  145.921 1.00 112.62 ? 37   GLY B O     1 
ATOM   2027  N  N     . ASN B 1 38   ? 99.651  92.540  144.001 1.00 111.08 ? 38   ASN B N     1 
ATOM   2028  C  CA    . ASN B 1 38   ? 98.434  93.222  144.443 1.00 111.08 ? 38   ASN B CA    1 
ATOM   2029  C  C     . ASN B 1 38   ? 97.288  92.261  144.740 1.00 111.08 ? 38   ASN B C     1 
ATOM   2030  O  O     . ASN B 1 38   ? 96.679  92.378  145.819 1.00 111.08 ? 38   ASN B O     1 
ATOM   2031  C  CB    . ASN B 1 38   ? 98.030  94.281  143.413 1.00 111.08 ? 38   ASN B CB    1 
ATOM   2032  C  CG    . ASN B 1 38   ? 98.842  95.550  143.537 1.00 111.08 ? 38   ASN B CG    1 
ATOM   2033  O  OD1   . ASN B 1 38   ? 99.020  96.081  144.632 1.00 111.08 ? 38   ASN B OD1   1 
ATOM   2034  N  ND2   . ASN B 1 38   ? 99.342  96.045  142.412 1.00 111.08 ? 38   ASN B ND2   1 
ATOM   2035  N  N     . PRO B 1 39   ? 96.929  91.317  143.859 1.00 109.34 ? 39   PRO B N     1 
ATOM   2036  C  CA    . PRO B 1 39   ? 95.812  90.416  144.195 1.00 109.34 ? 39   PRO B CA    1 
ATOM   2037  C  C     . PRO B 1 39   ? 96.079  89.579  145.431 1.00 109.34 ? 39   PRO B C     1 
ATOM   2038  O  O     . PRO B 1 39   ? 95.176  89.389  146.255 1.00 109.34 ? 39   PRO B O     1 
ATOM   2039  C  CB    . PRO B 1 39   ? 95.671  89.546  142.938 1.00 109.34 ? 39   PRO B CB    1 
ATOM   2040  C  CG    . PRO B 1 39   ? 96.381  90.274  141.876 1.00 109.34 ? 39   PRO B CG    1 
ATOM   2041  C  CD    . PRO B 1 39   ? 97.482  91.016  142.530 1.00 109.34 ? 39   PRO B CD    1 
ATOM   2042  N  N     . LEU B 1 40   ? 97.298  89.057  145.573 1.00 111.92 ? 40   LEU B N     1 
ATOM   2043  C  CA    . LEU B 1 40   ? 97.627  88.270  146.754 1.00 111.92 ? 40   LEU B CA    1 
ATOM   2044  C  C     . LEU B 1 40   ? 97.503  89.105  148.019 1.00 111.92 ? 40   LEU B C     1 
ATOM   2045  O  O     . LEU B 1 40   ? 96.963  88.639  149.027 1.00 111.92 ? 40   LEU B O     1 
ATOM   2046  C  CB    . LEU B 1 40   ? 99.035  87.692  146.623 1.00 111.92 ? 40   LEU B CB    1 
ATOM   2047  C  CG    . LEU B 1 40   ? 99.131  86.400  145.815 1.00 111.92 ? 40   LEU B CG    1 
ATOM   2048  C  CD1   . LEU B 1 40   ? 100.517 85.795  145.938 1.00 111.92 ? 40   LEU B CD1   1 
ATOM   2049  C  CD2   . LEU B 1 40   ? 98.070  85.413  146.265 1.00 111.92 ? 40   LEU B CD2   1 
ATOM   2050  N  N     . ARG B 1 41   ? 97.987  90.348  147.980 1.00 114.40 ? 41   ARG B N     1 
ATOM   2051  C  CA    . ARG B 1 41   ? 97.868  91.230  149.136 1.00 114.40 ? 41   ARG B CA    1 
ATOM   2052  C  C     . ARG B 1 41   ? 96.408  91.483  149.494 1.00 114.40 ? 41   ARG B C     1 
ATOM   2053  O  O     . ARG B 1 41   ? 96.023  91.387  150.668 1.00 114.40 ? 41   ARG B O     1 
ATOM   2054  C  CB    . ARG B 1 41   ? 98.592  92.546  148.858 1.00 114.40 ? 41   ARG B CB    1 
ATOM   2055  C  CG    . ARG B 1 41   ? 98.359  93.625  149.895 1.00 114.40 ? 41   ARG B CG    1 
ATOM   2056  C  CD    . ARG B 1 41   ? 98.946  94.947  149.436 1.00 114.40 ? 41   ARG B CD    1 
ATOM   2057  N  NE    . ARG B 1 41   ? 98.987  95.930  150.513 1.00 114.40 ? 41   ARG B NE    1 
ATOM   2058  C  CZ    . ARG B 1 41   ? 97.965  96.705  150.855 1.00 114.40 ? 41   ARG B CZ    1 
ATOM   2059  N  NH1   . ARG B 1 41   ? 96.816  96.617  150.199 1.00 114.40 ? 41   ARG B NH1   1 
ATOM   2060  N  NH2   . ARG B 1 41   ? 98.090  97.571  151.851 1.00 114.40 ? 41   ARG B NH2   1 
ATOM   2061  N  N     . ARG B 1 42   ? 95.582  91.807  148.496 1.00 115.44 ? 42   ARG B N     1 
ATOM   2062  C  CA    . ARG B 1 42   ? 94.177  92.088  148.775 1.00 115.44 ? 42   ARG B CA    1 
ATOM   2063  C  C     . ARG B 1 42   ? 93.461  90.858  149.320 1.00 115.44 ? 42   ARG B C     1 
ATOM   2064  O  O     . ARG B 1 42   ? 92.676  90.959  150.269 1.00 115.44 ? 42   ARG B O     1 
ATOM   2065  C  CB    . ARG B 1 42   ? 93.481  92.603  147.518 1.00 115.44 ? 42   ARG B CB    1 
ATOM   2066  C  CG    . ARG B 1 42   ? 93.999  93.943  147.032 1.00 115.44 ? 42   ARG B CG    1 
ATOM   2067  C  CD    . ARG B 1 42   ? 93.324  94.353  145.737 1.00 115.44 ? 42   ARG B CD    1 
ATOM   2068  N  NE    . ARG B 1 42   ? 91.872  94.391  145.876 1.00 115.44 ? 42   ARG B NE    1 
ATOM   2069  C  CZ    . ARG B 1 42   ? 91.190  95.455  146.284 1.00 115.44 ? 42   ARG B CZ    1 
ATOM   2070  N  NH1   . ARG B 1 42   ? 91.828  96.576  146.590 1.00 115.44 ? 42   ARG B NH1   1 
ATOM   2071  N  NH2   . ARG B 1 42   ? 89.869  95.401  146.383 1.00 115.44 ? 42   ARG B NH2   1 
ATOM   2072  N  N     . ILE B 1 43   ? 93.723  89.685  148.741 1.00 115.28 ? 43   ILE B N     1 
ATOM   2073  C  CA    . ILE B 1 43   ? 93.065  88.467  149.203 1.00 115.28 ? 43   ILE B CA    1 
ATOM   2074  C  C     . ILE B 1 43   ? 93.506  88.130  150.621 1.00 115.28 ? 43   ILE B C     1 
ATOM   2075  O  O     . ILE B 1 43   ? 92.692  87.737  151.464 1.00 115.28 ? 43   ILE B O     1 
ATOM   2076  C  CB    . ILE B 1 43   ? 93.341  87.305  148.233 1.00 115.28 ? 43   ILE B CB    1 
ATOM   2077  C  CG1   . ILE B 1 43   ? 92.653  87.560  146.893 1.00 115.28 ? 43   ILE B CG1   1 
ATOM   2078  C  CG2   . ILE B 1 43   ? 92.862  85.991  148.823 1.00 115.28 ? 43   ILE B CG2   1 
ATOM   2079  C  CD1   . ILE B 1 43   ? 92.743  86.398  145.936 1.00 115.28 ? 43   ILE B CD1   1 
ATOM   2080  N  N     . LEU B 1 44   ? 94.803  88.280  150.907 1.00 113.20 ? 44   LEU B N     1 
ATOM   2081  C  CA    . LEU B 1 44   ? 95.303  88.037  152.254 1.00 113.20 ? 44   LEU B CA    1 
ATOM   2082  C  C     . LEU B 1 44   ? 94.635  88.948  153.268 1.00 113.20 ? 44   LEU B C     1 
ATOM   2083  O  O     . LEU B 1 44   ? 94.189  88.484  154.324 1.00 113.20 ? 44   LEU B O     1 
ATOM   2084  C  CB    . LEU B 1 44   ? 96.818  88.235  152.291 1.00 113.20 ? 44   LEU B CB    1 
ATOM   2085  C  CG    . LEU B 1 44   ? 97.674  87.064  151.817 1.00 113.20 ? 44   LEU B CG    1 
ATOM   2086  C  CD1   . LEU B 1 44   ? 99.107  87.513  151.611 1.00 113.20 ? 44   LEU B CD1   1 
ATOM   2087  C  CD2   . LEU B 1 44   ? 97.607  85.926  152.816 1.00 113.20 ? 44   LEU B CD2   1 
ATOM   2088  N  N     . LEU B 1 45   ? 94.552  90.245  152.971 1.00 115.63 ? 45   LEU B N     1 
ATOM   2089  C  CA    . LEU B 1 45   ? 93.926  91.165  153.913 1.00 115.63 ? 45   LEU B CA    1 
ATOM   2090  C  C     . LEU B 1 45   ? 92.414  90.983  153.969 1.00 115.63 ? 45   LEU B C     1 
ATOM   2091  O  O     . LEU B 1 45   ? 91.768  91.448  154.914 1.00 115.63 ? 45   LEU B O     1 
ATOM   2092  C  CB    . LEU B 1 45   ? 94.271  92.607  153.545 1.00 115.63 ? 45   LEU B CB    1 
ATOM   2093  C  CG    . LEU B 1 45   ? 95.682  93.067  153.907 1.00 115.63 ? 45   LEU B CG    1 
ATOM   2094  C  CD1   . LEU B 1 45   ? 95.921  94.487  153.426 1.00 115.63 ? 45   LEU B CD1   1 
ATOM   2095  C  CD2   . LEU B 1 45   ? 95.899  92.964  155.404 1.00 115.63 ? 45   LEU B CD2   1 
ATOM   2096  N  N     . SER B 1 46   ? 91.829  90.316  152.973 1.00 119.11 ? 46   SER B N     1 
ATOM   2097  C  CA    . SER B 1 46   ? 90.376  90.302  152.850 1.00 119.11 ? 46   SER B CA    1 
ATOM   2098  C  C     . SER B 1 46   ? 89.728  89.000  153.316 1.00 119.11 ? 46   SER B C     1 
ATOM   2099  O  O     . SER B 1 46   ? 88.893  89.017  154.225 1.00 119.11 ? 46   SER B O     1 
ATOM   2100  C  CB    . SER B 1 46   ? 89.981  90.581  151.398 1.00 119.11 ? 46   SER B CB    1 
ATOM   2101  O  OG    . SER B 1 46   ? 88.575  90.526  151.237 1.00 119.11 ? 46   SER B OG    1 
ATOM   2102  N  N     . SER B 1 47   ? 90.091  87.870  152.713 1.00 118.85 ? 47   SER B N     1 
ATOM   2103  C  CA    . SER B 1 47   ? 89.241  86.687  152.753 1.00 118.85 ? 47   SER B CA    1 
ATOM   2104  C  C     . SER B 1 47   ? 89.865  85.482  153.444 1.00 118.85 ? 47   SER B C     1 
ATOM   2105  O  O     . SER B 1 47   ? 89.421  84.356  153.201 1.00 118.85 ? 47   SER B O     1 
ATOM   2106  C  CB    . SER B 1 47   ? 88.832  86.296  151.331 1.00 118.85 ? 47   SER B CB    1 
ATOM   2107  O  OG    . SER B 1 47   ? 88.039  87.307  150.737 1.00 118.85 ? 47   SER B OG    1 
ATOM   2108  N  N     . ILE B 1 48   ? 90.870  85.671  154.291 1.00 118.48 ? 48   ILE B N     1 
ATOM   2109  C  CA    . ILE B 1 48   ? 91.416  84.546  155.047 1.00 118.48 ? 48   ILE B CA    1 
ATOM   2110  C  C     . ILE B 1 48   ? 90.473  84.231  156.202 1.00 118.48 ? 48   ILE B C     1 
ATOM   2111  O  O     . ILE B 1 48   ? 90.174  85.117  157.014 1.00 118.48 ? 48   ILE B O     1 
ATOM   2112  C  CB    . ILE B 1 48   ? 92.837  84.840  155.547 1.00 118.48 ? 48   ILE B CB    1 
ATOM   2113  C  CG1   . ILE B 1 48   ? 93.733  85.243  154.378 1.00 118.48 ? 48   ILE B CG1   1 
ATOM   2114  C  CG2   . ILE B 1 48   ? 93.408  83.621  156.243 1.00 118.48 ? 48   ILE B CG2   1 
ATOM   2115  C  CD1   . ILE B 1 48   ? 93.874  84.169  153.327 1.00 118.48 ? 48   ILE B CD1   1 
ATOM   2116  N  N     . PRO B 1 49   ? 89.980  82.999  156.314 1.00 122.01 ? 49   PRO B N     1 
ATOM   2117  C  CA    . PRO B 1 49   ? 89.027  82.679  157.386 1.00 122.01 ? 49   PRO B CA    1 
ATOM   2118  C  C     . PRO B 1 49   ? 89.699  82.692  158.752 1.00 122.01 ? 49   PRO B C     1 
ATOM   2119  O  O     . PRO B 1 49   ? 90.784  82.138  158.936 1.00 122.01 ? 49   PRO B O     1 
ATOM   2120  C  CB    . PRO B 1 49   ? 88.531  81.276  157.014 1.00 122.01 ? 49   PRO B CB    1 
ATOM   2121  C  CG    . PRO B 1 49   ? 88.929  81.079  155.582 1.00 122.01 ? 49   PRO B CG    1 
ATOM   2122  C  CD    . PRO B 1 49   ? 90.185  81.863  155.405 1.00 122.01 ? 49   PRO B CD    1 
ATOM   2123  N  N     . GLY B 1 50   ? 89.040  83.329  159.712 1.00 132.02 ? 50   GLY B N     1 
ATOM   2124  C  CA    . GLY B 1 50   ? 89.560  83.404  161.057 1.00 132.02 ? 50   GLY B CA    1 
ATOM   2125  C  C     . GLY B 1 50   ? 88.445  83.536  162.069 1.00 132.02 ? 50   GLY B C     1 
ATOM   2126  O  O     . GLY B 1 50   ? 87.265  83.594  161.720 1.00 132.02 ? 50   GLY B O     1 
ATOM   2127  N  N     . THR B 1 51   ? 88.837  83.576  163.340 1.00 137.08 ? 51   THR B N     1 
ATOM   2128  C  CA    . THR B 1 51   ? 87.903  83.713  164.446 1.00 137.08 ? 51   THR B CA    1 
ATOM   2129  C  C     . THR B 1 51   ? 88.270  84.928  165.285 1.00 137.08 ? 51   THR B C     1 
ATOM   2130  O  O     . THR B 1 51   ? 89.423  85.368  165.299 1.00 137.08 ? 51   THR B O     1 
ATOM   2131  C  CB    . THR B 1 51   ? 87.891  82.464  165.336 1.00 137.08 ? 51   THR B CB    1 
ATOM   2132  O  OG1   . THR B 1 51   ? 89.067  82.449  166.155 1.00 137.08 ? 51   THR B OG1   1 
ATOM   2133  C  CG2   . THR B 1 51   ? 87.853  81.201  164.492 1.00 137.08 ? 51   THR B CG2   1 
ATOM   2134  N  N     . ALA B 1 52   ? 87.275  85.463  165.990 1.00 136.80 ? 52   ALA B N     1 
ATOM   2135  C  CA    . ALA B 1 52   ? 87.475  86.624  166.844 1.00 136.80 ? 52   ALA B CA    1 
ATOM   2136  C  C     . ALA B 1 52   ? 86.284  86.769  167.777 1.00 136.80 ? 52   ALA B C     1 
ATOM   2137  O  O     . ALA B 1 52   ? 85.233  86.161  167.565 1.00 136.80 ? 52   ALA B O     1 
ATOM   2138  C  CB    . ALA B 1 52   ? 87.655  87.907  166.027 1.00 136.80 ? 52   ALA B CB    1 
ATOM   2139  N  N     . VAL B 1 53   ? 86.461  87.585  168.812 1.00 137.44 ? 53   VAL B N     1 
ATOM   2140  C  CA    . VAL B 1 53   ? 85.383  87.889  169.747 1.00 137.44 ? 53   VAL B CA    1 
ATOM   2141  C  C     . VAL B 1 53   ? 84.494  88.947  169.101 1.00 137.44 ? 53   VAL B C     1 
ATOM   2142  O  O     . VAL B 1 53   ? 84.984  89.862  168.435 1.00 137.44 ? 53   VAL B O     1 
ATOM   2143  C  CB    . VAL B 1 53   ? 85.928  88.360  171.101 1.00 137.44 ? 53   VAL B CB    1 
ATOM   2144  C  CG1   . VAL B 1 53   ? 86.835  89.566  170.928 1.00 137.44 ? 53   VAL B CG1   1 
ATOM   2145  C  CG2   . VAL B 1 53   ? 84.789  88.674  172.059 1.00 137.44 ? 53   VAL B CG2   1 
ATOM   2146  N  N     . THR B 1 54   ? 83.180  88.813  169.278 1.00 143.23 ? 54   THR B N     1 
ATOM   2147  C  CA    . THR B 1 54   ? 82.231  89.710  168.636 1.00 143.23 ? 54   THR B CA    1 
ATOM   2148  C  C     . THR B 1 54   ? 81.336  90.454  169.617 1.00 143.23 ? 54   THR B C     1 
ATOM   2149  O  O     . THR B 1 54   ? 80.887  91.560  169.300 1.00 143.23 ? 54   THR B O     1 
ATOM   2150  C  CB    . THR B 1 54   ? 81.354  88.933  167.647 1.00 143.23 ? 54   THR B CB    1 
ATOM   2151  O  OG1   . THR B 1 54   ? 80.387  89.815  167.067 1.00 143.23 ? 54   THR B OG1   1 
ATOM   2152  C  CG2   . THR B 1 54   ? 80.645  87.785  168.346 1.00 143.23 ? 54   THR B CG2   1 
ATOM   2153  N  N     . SER B 1 55   ? 81.067  89.885  170.788 1.00 149.89 ? 55   SER B N     1 
ATOM   2154  C  CA    . SER B 1 55   ? 80.207  90.535  171.764 1.00 149.89 ? 55   SER B CA    1 
ATOM   2155  C  C     . SER B 1 55   ? 80.678  90.162  173.160 1.00 149.89 ? 55   SER B C     1 
ATOM   2156  O  O     . SER B 1 55   ? 81.227  89.079  173.375 1.00 149.89 ? 55   SER B O     1 
ATOM   2157  C  CB    . SER B 1 55   ? 78.739  90.143  171.572 1.00 149.89 ? 55   SER B CB    1 
ATOM   2158  O  OG    . SER B 1 55   ? 77.918  90.754  172.550 1.00 149.89 ? 55   SER B OG    1 
ATOM   2159  N  N     . VAL B 1 56   ? 80.462  91.074  174.104 1.00 151.03 ? 56   VAL B N     1 
ATOM   2160  C  CA    . VAL B 1 56   ? 80.836  90.861  175.497 1.00 151.03 ? 56   VAL B CA    1 
ATOM   2161  C  C     . VAL B 1 56   ? 79.711  91.371  176.385 1.00 151.03 ? 56   VAL B C     1 
ATOM   2162  O  O     . VAL B 1 56   ? 79.130  92.429  176.121 1.00 151.03 ? 56   VAL B O     1 
ATOM   2163  C  CB    . VAL B 1 56   ? 82.172  91.548  175.847 1.00 151.03 ? 56   VAL B CB    1 
ATOM   2164  C  CG1   . VAL B 1 56   ? 82.081  93.054  175.657 1.00 151.03 ? 56   VAL B CG1   1 
ATOM   2165  C  CG2   . VAL B 1 56   ? 82.581  91.215  177.271 1.00 151.03 ? 56   VAL B CG2   1 
ATOM   2166  N  N     . TYR B 1 57   ? 79.379  90.601  177.417 1.00 163.14 ? 57   TYR B N     1 
ATOM   2167  C  CA    . TYR B 1 57   ? 78.388  90.989  178.410 1.00 163.14 ? 57   TYR B CA    1 
ATOM   2168  C  C     . TYR B 1 57   ? 79.027  90.907  179.787 1.00 163.14 ? 57   TYR B C     1 
ATOM   2169  O  O     . TYR B 1 57   ? 79.436  89.825  180.221 1.00 163.14 ? 57   TYR B O     1 
ATOM   2170  C  CB    . TYR B 1 57   ? 77.151  90.093  178.341 1.00 163.14 ? 57   TYR B CB    1 
ATOM   2171  C  CG    . TYR B 1 57   ? 76.283  90.176  179.574 1.00 163.14 ? 57   TYR B CG    1 
ATOM   2172  C  CD1   . TYR B 1 57   ? 75.445  91.262  179.784 1.00 163.14 ? 57   TYR B CD1   1 
ATOM   2173  C  CD2   . TYR B 1 57   ? 76.308  89.173  180.534 1.00 163.14 ? 57   TYR B CD2   1 
ATOM   2174  C  CE1   . TYR B 1 57   ? 74.653  91.344  180.911 1.00 163.14 ? 57   TYR B CE1   1 
ATOM   2175  C  CE2   . TYR B 1 57   ? 75.522  89.248  181.665 1.00 163.14 ? 57   TYR B CE2   1 
ATOM   2176  C  CZ    . TYR B 1 57   ? 74.695  90.334  181.848 1.00 163.14 ? 57   TYR B CZ    1 
ATOM   2177  O  OH    . TYR B 1 57   ? 73.908  90.411  182.974 1.00 163.14 ? 57   TYR B OH    1 
ATOM   2178  N  N     . ILE B 1 58   ? 79.117  92.047  180.464 1.00 167.40 ? 58   ILE B N     1 
ATOM   2179  C  CA    . ILE B 1 58   ? 79.594  92.121  181.838 1.00 167.40 ? 58   ILE B CA    1 
ATOM   2180  C  C     . ILE B 1 58   ? 78.376  92.287  182.735 1.00 167.40 ? 58   ILE B C     1 
ATOM   2181  O  O     . ILE B 1 58   ? 77.362  92.850  182.309 1.00 167.40 ? 58   ILE B O     1 
ATOM   2182  C  CB    . ILE B 1 58   ? 80.594  93.274  182.031 1.00 167.40 ? 58   ILE B CB    1 
ATOM   2183  C  CG1   . ILE B 1 58   ? 81.586  93.312  180.869 1.00 167.40 ? 58   ILE B CG1   1 
ATOM   2184  C  CG2   . ILE B 1 58   ? 81.346  93.116  183.341 1.00 167.40 ? 58   ILE B CG2   1 
ATOM   2185  C  CD1   . ILE B 1 58   ? 82.586  94.442  180.956 1.00 167.40 ? 58   ILE B CD1   1 
ATOM   2186  N  N     . GLU B 1 59   ? 78.474  91.788  183.967 1.00 175.19 ? 59   GLU B N     1 
ATOM   2187  C  CA    . GLU B 1 59   ? 77.317  91.681  184.849 1.00 175.19 ? 59   GLU B CA    1 
ATOM   2188  C  C     . GLU B 1 59   ? 76.663  93.025  185.151 1.00 175.19 ? 59   GLU B C     1 
ATOM   2189  O  O     . GLU B 1 59   ? 75.496  93.239  184.808 1.00 175.19 ? 59   GLU B O     1 
ATOM   2190  C  CB    . GLU B 1 59   ? 77.717  90.995  186.157 1.00 175.19 ? 59   GLU B CB    1 
ATOM   2191  C  CG    . GLU B 1 59   ? 76.552  90.759  187.102 1.00 175.19 ? 59   GLU B CG    1 
ATOM   2192  C  CD    . GLU B 1 59   ? 76.664  89.445  187.848 1.00 175.19 ? 59   GLU B CD    1 
ATOM   2193  O  OE1   . GLU B 1 59   ? 77.704  88.769  187.713 1.00 175.19 ? 59   GLU B OE1   1 
ATOM   2194  O  OE2   . GLU B 1 59   ? 75.709  89.087  188.569 1.00 175.19 ? 59   GLU B OE2   1 
ATOM   2195  N  N     . ASP B 1 60   ? 77.396  93.936  185.786 1.00 174.53 ? 60   ASP B N     1 
ATOM   2196  C  CA    . ASP B 1 60   ? 76.809  95.170  186.292 1.00 174.53 ? 60   ASP B CA    1 
ATOM   2197  C  C     . ASP B 1 60   ? 77.144  96.397  185.453 1.00 174.53 ? 60   ASP B C     1 
ATOM   2198  O  O     . ASP B 1 60   ? 77.136  97.511  185.986 1.00 174.53 ? 60   ASP B O     1 
ATOM   2199  C  CB    . ASP B 1 60   ? 77.255  95.406  187.739 1.00 174.53 ? 60   ASP B CB    1 
ATOM   2200  C  CG    . ASP B 1 60   ? 76.666  94.393  188.701 1.00 174.53 ? 60   ASP B CG    1 
ATOM   2201  O  OD1   . ASP B 1 60   ? 75.739  93.660  188.298 1.00 174.53 ? 60   ASP B OD1   1 
ATOM   2202  O  OD2   . ASP B 1 60   ? 77.129  94.329  189.859 1.00 174.53 ? 60   ASP B OD2   1 
ATOM   2203  N  N     . VAL B 1 61   ? 77.436  96.231  184.169 1.00 169.20 ? 61   VAL B N     1 
ATOM   2204  C  CA    . VAL B 1 61   ? 77.743  97.356  183.293 1.00 169.20 ? 61   VAL B CA    1 
ATOM   2205  C  C     . VAL B 1 61   ? 76.524  97.657  182.430 1.00 169.20 ? 61   VAL B C     1 
ATOM   2206  O  O     . VAL B 1 61   ? 75.878  96.741  181.909 1.00 169.20 ? 61   VAL B O     1 
ATOM   2207  C  CB    . VAL B 1 61   ? 78.976  97.066  182.427 1.00 169.20 ? 61   VAL B CB    1 
ATOM   2208  C  CG1   . VAL B 1 61   ? 79.392  98.311  181.672 1.00 169.20 ? 61   VAL B CG1   1 
ATOM   2209  C  CG2   . VAL B 1 61   ? 80.114  96.580  183.299 1.00 169.20 ? 61   VAL B CG2   1 
ATOM   2210  N  N     . LEU B 1 62   ? 76.208  98.944  182.280 1.00 167.71 ? 62   LEU B N     1 
ATOM   2211  C  CA    . LEU B 1 62   ? 75.057  99.346  181.480 1.00 167.71 ? 62   LEU B CA    1 
ATOM   2212  C  C     . LEU B 1 62   ? 75.462  99.677  180.048 1.00 167.71 ? 62   LEU B C     1 
ATOM   2213  O  O     . LEU B 1 62   ? 74.814  99.233  179.094 1.00 167.71 ? 62   LEU B O     1 
ATOM   2214  C  CB    . LEU B 1 62   ? 74.360  100.541 182.131 1.00 167.71 ? 62   LEU B CB    1 
ATOM   2215  C  CG    . LEU B 1 62   ? 73.868  100.316 183.562 1.00 167.71 ? 62   LEU B CG    1 
ATOM   2216  C  CD1   . LEU B 1 62   ? 73.136  101.544 184.080 1.00 167.71 ? 62   LEU B CD1   1 
ATOM   2217  C  CD2   . LEU B 1 62   ? 72.979  99.085  183.634 1.00 167.71 ? 62   LEU B CD2   1 
ATOM   2218  N  N     . HIS B 1 63   ? 76.528  100.455 179.877 1.00 164.56 ? 63   HIS B N     1 
ATOM   2219  C  CA    . HIS B 1 63   ? 77.002  100.839 178.554 1.00 164.56 ? 63   HIS B CA    1 
ATOM   2220  C  C     . HIS B 1 63   ? 78.527  100.840 178.572 1.00 164.56 ? 63   HIS B C     1 
ATOM   2221  O  O     . HIS B 1 63   ? 79.157  100.747 179.629 1.00 164.56 ? 63   HIS B O     1 
ATOM   2222  C  CB    . HIS B 1 63   ? 76.417  102.195 178.139 1.00 164.56 ? 63   HIS B CB    1 
ATOM   2223  C  CG    . HIS B 1 63   ? 76.610  103.273 179.157 1.00 164.56 ? 63   HIS B CG    1 
ATOM   2224  N  ND1   . HIS B 1 63   ? 77.733  104.072 179.191 1.00 164.56 ? 63   HIS B ND1   1 
ATOM   2225  C  CD2   . HIS B 1 63   ? 75.823  103.686 180.179 1.00 164.56 ? 63   HIS B CD2   1 
ATOM   2226  C  CE1   . HIS B 1 63   ? 77.629  104.931 180.190 1.00 164.56 ? 63   HIS B CE1   1 
ATOM   2227  N  NE2   . HIS B 1 63   ? 76.480  104.718 180.805 1.00 164.56 ? 63   HIS B NE2   1 
ATOM   2228  N  N     . GLU B 1 64   ? 79.122  100.961 177.384 1.00 164.94 ? 64   GLU B N     1 
ATOM   2229  C  CA    . GLU B 1 64   ? 80.563  100.766 177.250 1.00 164.94 ? 64   GLU B CA    1 
ATOM   2230  C  C     . GLU B 1 64   ? 81.352  101.920 177.857 1.00 164.94 ? 64   GLU B C     1 
ATOM   2231  O  O     . GLU B 1 64   ? 82.509  101.743 178.253 1.00 164.94 ? 64   GLU B O     1 
ATOM   2232  C  CB    . GLU B 1 64   ? 80.934  100.583 175.778 1.00 164.94 ? 64   GLU B CB    1 
ATOM   2233  C  CG    . GLU B 1 64   ? 80.646  101.789 174.895 1.00 164.94 ? 64   GLU B CG    1 
ATOM   2234  C  CD    . GLU B 1 64   ? 79.183  101.903 174.513 1.00 164.94 ? 64   GLU B CD    1 
ATOM   2235  O  OE1   . GLU B 1 64   ? 78.758  103.002 174.100 1.00 164.94 ? 64   GLU B OE1   1 
ATOM   2236  O  OE2   . GLU B 1 64   ? 78.458  100.893 174.628 1.00 164.94 ? 64   GLU B OE2   1 
ATOM   2237  N  N     . PHE B 1 65   ? 80.755  103.106 177.935 1.00 162.89 ? 65   PHE B N     1 
ATOM   2238  C  CA    . PHE B 1 65   ? 81.467  104.288 178.398 1.00 162.89 ? 65   PHE B CA    1 
ATOM   2239  C  C     . PHE B 1 65   ? 81.396  104.480 179.908 1.00 162.89 ? 65   PHE B C     1 
ATOM   2240  O  O     . PHE B 1 65   ? 81.829  105.524 180.407 1.00 162.89 ? 65   PHE B O     1 
ATOM   2241  C  CB    . PHE B 1 65   ? 80.937  105.531 177.682 1.00 162.89 ? 65   PHE B CB    1 
ATOM   2242  C  CG    . PHE B 1 65   ? 81.357  105.618 176.245 1.00 162.89 ? 65   PHE B CG    1 
ATOM   2243  C  CD1   . PHE B 1 65   ? 82.674  105.882 175.912 1.00 162.89 ? 65   PHE B CD1   1 
ATOM   2244  C  CD2   . PHE B 1 65   ? 80.439  105.426 175.227 1.00 162.89 ? 65   PHE B CD2   1 
ATOM   2245  C  CE1   . PHE B 1 65   ? 83.068  105.959 174.592 1.00 162.89 ? 65   PHE B CE1   1 
ATOM   2246  C  CE2   . PHE B 1 65   ? 80.827  105.503 173.903 1.00 162.89 ? 65   PHE B CE2   1 
ATOM   2247  C  CZ    . PHE B 1 65   ? 82.143  105.770 173.586 1.00 162.89 ? 65   PHE B CZ    1 
ATOM   2248  N  N     . SER B 1 66   ? 80.865  103.507 180.642 1.00 165.02 ? 66   SER B N     1 
ATOM   2249  C  CA    . SER B 1 66   ? 80.862  103.591 182.093 1.00 165.02 ? 66   SER B CA    1 
ATOM   2250  C  C     . SER B 1 66   ? 82.170  103.048 182.663 1.00 165.02 ? 66   SER B C     1 
ATOM   2251  O  O     . SER B 1 66   ? 83.082  102.648 181.935 1.00 165.02 ? 66   SER B O     1 
ATOM   2252  C  CB    . SER B 1 66   ? 79.677  102.822 182.674 1.00 165.02 ? 66   SER B CB    1 
ATOM   2253  O  OG    . SER B 1 66   ? 79.908  102.482 184.030 1.00 165.02 ? 66   SER B OG    1 
ATOM   2254  N  N     . THR B 1 67   ? 82.254  103.043 183.990 1.00 162.88 ? 67   THR B N     1 
ATOM   2255  C  CA    . THR B 1 67   ? 83.399  102.505 184.709 1.00 162.88 ? 67   THR B CA    1 
ATOM   2256  C  C     . THR B 1 67   ? 82.919  101.489 185.737 1.00 162.88 ? 67   THR B C     1 
ATOM   2257  O  O     . THR B 1 67   ? 81.920  101.716 186.427 1.00 162.88 ? 67   THR B O     1 
ATOM   2258  C  CB    . THR B 1 67   ? 84.190  103.622 185.397 1.00 162.88 ? 67   THR B CB    1 
ATOM   2259  O  OG1   . THR B 1 67   ? 84.729  104.506 184.406 1.00 162.88 ? 67   THR B OG1   1 
ATOM   2260  C  CG2   . THR B 1 67   ? 85.333  103.049 186.221 1.00 162.88 ? 67   THR B CG2   1 
ATOM   2261  N  N     . ILE B 1 68   ? 83.630  100.374 185.837 1.00 164.99 ? 68   ILE B N     1 
ATOM   2262  C  CA    . ILE B 1 68   ? 83.266  99.278  186.731 1.00 164.99 ? 68   ILE B CA    1 
ATOM   2263  C  C     . ILE B 1 68   ? 83.948  99.519  188.073 1.00 164.99 ? 68   ILE B C     1 
ATOM   2264  O  O     . ILE B 1 68   ? 85.160  99.781  188.098 1.00 164.99 ? 68   ILE B O     1 
ATOM   2265  C  CB    . ILE B 1 68   ? 83.671  97.916  186.151 1.00 164.99 ? 68   ILE B CB    1 
ATOM   2266  C  CG1   . ILE B 1 68   ? 83.186  97.780  184.709 1.00 164.99 ? 68   ILE B CG1   1 
ATOM   2267  C  CG2   . ILE B 1 68   ? 83.121  96.787  187.008 1.00 164.99 ? 68   ILE B CG2   1 
ATOM   2268  C  CD1   . ILE B 1 68   ? 84.132  96.997  183.828 1.00 164.99 ? 68   ILE B CD1   1 
ATOM   2269  N  N     . PRO B 1 69   ? 83.230  99.444  189.192 1.00 166.95 ? 69   PRO B N     1 
ATOM   2270  C  CA    . PRO B 1 69   ? 83.880  99.628  190.494 1.00 166.95 ? 69   PRO B CA    1 
ATOM   2271  C  C     . PRO B 1 69   ? 84.698  98.406  190.879 1.00 166.95 ? 69   PRO B C     1 
ATOM   2272  O  O     . PRO B 1 69   ? 84.354  97.271  190.542 1.00 166.95 ? 69   PRO B O     1 
ATOM   2273  C  CB    . PRO B 1 69   ? 82.705  99.840  191.458 1.00 166.95 ? 69   PRO B CB    1 
ATOM   2274  C  CG    . PRO B 1 69   ? 81.486  100.020 190.589 1.00 166.95 ? 69   PRO B CG    1 
ATOM   2275  C  CD    . PRO B 1 69   ? 81.773  99.297  189.318 1.00 166.95 ? 69   PRO B CD    1 
ATOM   2276  N  N     . GLY B 1 70   ? 85.795  98.651  191.595 1.00 167.96 ? 70   GLY B N     1 
ATOM   2277  C  CA    . GLY B 1 70   ? 86.654  97.592  192.074 1.00 167.96 ? 70   GLY B CA    1 
ATOM   2278  C  C     . GLY B 1 70   ? 87.771  97.189  191.137 1.00 167.96 ? 70   GLY B C     1 
ATOM   2279  O  O     . GLY B 1 70   ? 88.688  96.478  191.567 1.00 167.96 ? 70   GLY B O     1 
ATOM   2280  N  N     . VAL B 1 71   ? 87.731  97.616  189.878 1.00 166.70 ? 71   VAL B N     1 
ATOM   2281  C  CA    . VAL B 1 71   ? 88.758  97.290  188.897 1.00 166.70 ? 71   VAL B CA    1 
ATOM   2282  C  C     . VAL B 1 71   ? 89.403  98.586  188.433 1.00 166.70 ? 71   VAL B C     1 
ATOM   2283  O  O     . VAL B 1 71   ? 88.734  99.624  188.351 1.00 166.70 ? 71   VAL B O     1 
ATOM   2284  C  CB    . VAL B 1 71   ? 88.183  96.507  187.703 1.00 166.70 ? 71   VAL B CB    1 
ATOM   2285  C  CG1   . VAL B 1 71   ? 87.707  95.139  188.150 1.00 166.70 ? 71   VAL B CG1   1 
ATOM   2286  C  CG2   . VAL B 1 71   ? 87.055  97.280  187.053 1.00 166.70 ? 71   VAL B CG2   1 
ATOM   2287  N  N     . LYS B 1 72   ? 90.702  98.529  188.142 1.00 164.36 ? 72   LYS B N     1 
ATOM   2288  C  CA    . LYS B 1 72   ? 91.414  99.718  187.690 1.00 164.36 ? 72   LYS B CA    1 
ATOM   2289  C  C     . LYS B 1 72   ? 90.963  100.129 186.293 1.00 164.36 ? 72   LYS B C     1 
ATOM   2290  O  O     . LYS B 1 72   ? 90.480  101.247 186.083 1.00 164.36 ? 72   LYS B O     1 
ATOM   2291  C  CB    . LYS B 1 72   ? 92.922  99.466  187.724 1.00 164.36 ? 72   LYS B CB    1 
ATOM   2292  C  CG    . LYS B 1 72   ? 93.497  99.386  189.126 1.00 164.36 ? 72   LYS B CG    1 
ATOM   2293  C  CD    . LYS B 1 72   ? 95.011  99.277  189.099 1.00 164.36 ? 72   LYS B CD    1 
ATOM   2294  C  CE    . LYS B 1 72   ? 95.589  99.329  190.502 1.00 164.36 ? 72   LYS B CE    1 
ATOM   2295  N  NZ    . LYS B 1 72   ? 95.175  98.151  191.313 1.00 164.36 ? 72   LYS B NZ    1 
ATOM   2296  N  N     . GLU B 1 73   ? 91.117  99.232  185.322 1.00 162.30 ? 73   GLU B N     1 
ATOM   2297  C  CA    . GLU B 1 73   ? 90.747  99.543  183.948 1.00 162.30 ? 73   GLU B CA    1 
ATOM   2298  C  C     . GLU B 1 73   ? 89.240  99.736  183.822 1.00 162.30 ? 73   GLU B C     1 
ATOM   2299  O  O     . GLU B 1 73   ? 88.450  99.162  184.577 1.00 162.30 ? 73   GLU B O     1 
ATOM   2300  C  CB    . GLU B 1 73   ? 91.210  98.432  183.006 1.00 162.30 ? 73   GLU B CB    1 
ATOM   2301  C  CG    . GLU B 1 73   ? 92.707  98.167  183.036 1.00 162.30 ? 73   GLU B CG    1 
ATOM   2302  C  CD    . GLU B 1 73   ? 93.092  97.097  184.038 1.00 162.30 ? 73   GLU B CD    1 
ATOM   2303  O  OE1   . GLU B 1 73   ? 92.353  96.911  185.028 1.00 162.30 ? 73   GLU B OE1   1 
ATOM   2304  O  OE2   . GLU B 1 73   ? 94.135  96.441  183.836 1.00 162.30 ? 73   GLU B OE2   1 
ATOM   2305  N  N     . ASP B 1 74   ? 88.845  100.559 182.855 1.00 154.34 ? 74   ASP B N     1 
ATOM   2306  C  CA    . ASP B 1 74   ? 87.438  100.781 182.568 1.00 154.34 ? 74   ASP B CA    1 
ATOM   2307  C  C     . ASP B 1 74   ? 86.930  99.733  181.579 1.00 154.34 ? 74   ASP B C     1 
ATOM   2308  O  O     . ASP B 1 74   ? 87.634  98.787  181.214 1.00 154.34 ? 74   ASP B O     1 
ATOM   2309  C  CB    . ASP B 1 74   ? 87.221  102.196 182.038 1.00 154.34 ? 74   ASP B CB    1 
ATOM   2310  C  CG    . ASP B 1 74   ? 88.137  102.532 180.878 1.00 154.34 ? 74   ASP B CG    1 
ATOM   2311  O  OD1   . ASP B 1 74   ? 88.016  101.893 179.813 1.00 154.34 ? 74   ASP B OD1   1 
ATOM   2312  O  OD2   . ASP B 1 74   ? 88.981  103.440 181.033 1.00 154.34 ? 74   ASP B OD2   1 
ATOM   2313  N  N     . VAL B 1 75   ? 85.683  99.905  181.137 1.00 149.73 ? 75   VAL B N     1 
ATOM   2314  C  CA    . VAL B 1 75   ? 85.085  98.953  180.205 1.00 149.73 ? 75   VAL B CA    1 
ATOM   2315  C  C     . VAL B 1 75   ? 85.812  98.982  178.868 1.00 149.73 ? 75   VAL B C     1 
ATOM   2316  O  O     . VAL B 1 75   ? 86.067  97.935  178.258 1.00 149.73 ? 75   VAL B O     1 
ATOM   2317  C  CB    . VAL B 1 75   ? 83.584  99.247  180.033 1.00 149.73 ? 75   VAL B CB    1 
ATOM   2318  C  CG1   . VAL B 1 75   ? 82.924  98.164  179.195 1.00 149.73 ? 75   VAL B CG1   1 
ATOM   2319  C  CG2   . VAL B 1 75   ? 82.909  99.376  181.385 1.00 149.73 ? 75   VAL B CG2   1 
ATOM   2320  N  N     . VAL B 1 76   ? 86.150  100.181 178.388 1.00 144.70 ? 76   VAL B N     1 
ATOM   2321  C  CA    . VAL B 1 76   ? 86.792  100.312 177.082 1.00 144.70 ? 76   VAL B CA    1 
ATOM   2322  C  C     . VAL B 1 76   ? 88.139  99.602  177.078 1.00 144.70 ? 76   VAL B C     1 
ATOM   2323  O  O     . VAL B 1 76   ? 88.513  98.946  176.099 1.00 144.70 ? 76   VAL B O     1 
ATOM   2324  C  CB    . VAL B 1 76   ? 86.933  101.797 176.703 1.00 144.70 ? 76   VAL B CB    1 
ATOM   2325  C  CG1   . VAL B 1 76   ? 87.617  101.939 175.354 1.00 144.70 ? 76   VAL B CG1   1 
ATOM   2326  C  CG2   . VAL B 1 76   ? 85.571  102.467 176.687 1.00 144.70 ? 76   VAL B CG2   1 
ATOM   2327  N  N     . GLU B 1 77   ? 88.885  99.713  178.179 1.00 146.56 ? 77   GLU B N     1 
ATOM   2328  C  CA    . GLU B 1 77   ? 90.186  99.058  178.251 1.00 146.56 ? 77   GLU B CA    1 
ATOM   2329  C  C     . GLU B 1 77   ? 90.043  97.542  178.242 1.00 146.56 ? 77   GLU B C     1 
ATOM   2330  O  O     . GLU B 1 77   ? 90.827  96.840  177.593 1.00 146.56 ? 77   GLU B O     1 
ATOM   2331  C  CB    . GLU B 1 77   ? 90.937  99.520  179.498 1.00 146.56 ? 77   GLU B CB    1 
ATOM   2332  C  CG    . GLU B 1 77   ? 92.436  99.302  179.430 1.00 146.56 ? 77   GLU B CG    1 
ATOM   2333  C  CD    . GLU B 1 77   ? 93.063  99.964  178.220 1.00 146.56 ? 77   GLU B CD    1 
ATOM   2334  O  OE1   . GLU B 1 77   ? 93.796  99.276  177.480 1.00 146.56 ? 77   GLU B OE1   1 
ATOM   2335  O  OE2   . GLU B 1 77   ? 92.821  101.171 178.008 1.00 146.56 ? 77   GLU B OE2   1 
ATOM   2336  N  N     . ILE B 1 78   ? 89.044  97.017  178.954 1.00 143.94 ? 78   ILE B N     1 
ATOM   2337  C  CA    . ILE B 1 78   ? 88.812  95.576  178.956 1.00 143.94 ? 78   ILE B CA    1 
ATOM   2338  C  C     . ILE B 1 78   ? 88.436  95.099  177.559 1.00 143.94 ? 78   ILE B C     1 
ATOM   2339  O  O     . ILE B 1 78   ? 88.904  94.056  177.091 1.00 143.94 ? 78   ILE B O     1 
ATOM   2340  C  CB    . ILE B 1 78   ? 87.734  95.205  179.989 1.00 143.94 ? 78   ILE B CB    1 
ATOM   2341  C  CG1   . ILE B 1 78   ? 88.183  95.608  181.393 1.00 143.94 ? 78   ILE B CG1   1 
ATOM   2342  C  CG2   . ILE B 1 78   ? 87.437  93.718  179.935 1.00 143.94 ? 78   ILE B CG2   1 
ATOM   2343  C  CD1   . ILE B 1 78   ? 87.168  95.301  182.467 1.00 143.94 ? 78   ILE B CD1   1 
ATOM   2344  N  N     . ILE B 1 79   ? 87.583  95.861  176.872 1.00 138.22 ? 79   ILE B N     1 
ATOM   2345  C  CA    . ILE B 1 79   ? 87.195  95.495  175.512 1.00 138.22 ? 79   ILE B CA    1 
ATOM   2346  C  C     . ILE B 1 79   ? 88.408  95.498  174.590 1.00 138.22 ? 79   ILE B C     1 
ATOM   2347  O  O     . ILE B 1 79   ? 88.589  94.587  173.771 1.00 138.22 ? 79   ILE B O     1 
ATOM   2348  C  CB    . ILE B 1 79   ? 86.088  96.438  175.005 1.00 138.22 ? 79   ILE B CB    1 
ATOM   2349  C  CG1   . ILE B 1 79   ? 84.719  95.940  175.467 1.00 138.22 ? 79   ILE B CG1   1 
ATOM   2350  C  CG2   . ILE B 1 79   ? 86.128  96.561  173.491 1.00 138.22 ? 79   ILE B CG2   1 
ATOM   2351  C  CD1   . ILE B 1 79   ? 83.584  96.871  175.115 1.00 138.22 ? 79   ILE B CD1   1 
ATOM   2352  N  N     . LEU B 1 80   ? 89.259  96.520  174.708 1.00 136.49 ? 80   LEU B N     1 
ATOM   2353  C  CA    . LEU B 1 80   ? 90.460  96.589  173.881 1.00 136.49 ? 80   LEU B CA    1 
ATOM   2354  C  C     . LEU B 1 80   ? 91.379  95.406  174.151 1.00 136.49 ? 80   LEU B C     1 
ATOM   2355  O  O     . LEU B 1 80   ? 91.959  94.830  173.224 1.00 136.49 ? 80   LEU B O     1 
ATOM   2356  C  CB    . LEU B 1 80   ? 91.188  97.908  174.128 1.00 136.49 ? 80   LEU B CB    1 
ATOM   2357  C  CG    . LEU B 1 80   ? 90.940  99.009  173.098 1.00 136.49 ? 80   LEU B CG    1 
ATOM   2358  C  CD1   . LEU B 1 80   ? 89.459  99.322  172.999 1.00 136.49 ? 80   LEU B CD1   1 
ATOM   2359  C  CD2   . LEU B 1 80   ? 91.727  100.256 173.459 1.00 136.49 ? 80   LEU B CD2   1 
ATOM   2360  N  N     . ASN B 1 81   ? 91.530  95.032  175.424 1.00 139.94 ? 81   ASN B N     1 
ATOM   2361  C  CA    . ASN B 1 81   ? 92.318  93.850  175.755 1.00 139.94 ? 81   ASN B CA    1 
ATOM   2362  C  C     . ASN B 1 81   ? 91.696  92.594  175.161 1.00 139.94 ? 81   ASN B C     1 
ATOM   2363  O  O     . ASN B 1 81   ? 92.407  91.668  174.755 1.00 139.94 ? 81   ASN B O     1 
ATOM   2364  C  CB    . ASN B 1 81   ? 92.450  93.715  177.272 1.00 139.94 ? 81   ASN B CB    1 
ATOM   2365  C  CG    . ASN B 1 81   ? 93.456  94.682  177.856 1.00 139.94 ? 81   ASN B CG    1 
ATOM   2366  O  OD1   . ASN B 1 81   ? 93.173  95.375  178.832 1.00 139.94 ? 81   ASN B OD1   1 
ATOM   2367  N  ND2   . ASN B 1 81   ? 94.640  94.734  177.259 1.00 139.94 ? 81   ASN B ND2   1 
ATOM   2368  N  N     . LEU B 1 82   ? 90.365  92.548  175.103 1.00 134.92 ? 82   LEU B N     1 
ATOM   2369  C  CA    . LEU B 1 82   ? 89.685  91.387  174.542 1.00 134.92 ? 82   LEU B CA    1 
ATOM   2370  C  C     . LEU B 1 82   ? 89.875  91.307  173.034 1.00 134.92 ? 82   LEU B C     1 
ATOM   2371  O  O     . LEU B 1 82   ? 89.892  90.210  172.463 1.00 134.92 ? 82   LEU B O     1 
ATOM   2372  C  CB    . LEU B 1 82   ? 88.200  91.435  174.894 1.00 134.92 ? 82   LEU B CB    1 
ATOM   2373  C  CG    . LEU B 1 82   ? 87.842  90.976  176.306 1.00 134.92 ? 82   LEU B CG    1 
ATOM   2374  C  CD1   . LEU B 1 82   ? 86.339  90.994  176.501 1.00 134.92 ? 82   LEU B CD1   1 
ATOM   2375  C  CD2   . LEU B 1 82   ? 88.403  89.591  176.568 1.00 134.92 ? 82   LEU B CD2   1 
ATOM   2376  N  N     . LYS B 1 83   ? 90.011  92.458  172.370 1.00 131.72 ? 83   LYS B N     1 
ATOM   2377  C  CA    . LYS B 1 83   ? 90.180  92.458  170.920 1.00 131.72 ? 83   LYS B CA    1 
ATOM   2378  C  C     . LYS B 1 83   ? 91.456  91.742  170.494 1.00 131.72 ? 83   LYS B C     1 
ATOM   2379  O  O     . LYS B 1 83   ? 91.557  91.286  169.350 1.00 131.72 ? 83   LYS B O     1 
ATOM   2380  C  CB    . LYS B 1 83   ? 90.183  93.890  170.388 1.00 131.72 ? 83   LYS B CB    1 
ATOM   2381  C  CG    . LYS B 1 83   ? 88.820  94.398  169.957 1.00 131.72 ? 83   LYS B CG    1 
ATOM   2382  C  CD    . LYS B 1 83   ? 88.935  95.750  169.273 1.00 131.72 ? 83   LYS B CD    1 
ATOM   2383  C  CE    . LYS B 1 83   ? 87.587  96.440  169.180 1.00 131.72 ? 83   LYS B CE    1 
ATOM   2384  N  NZ    . LYS B 1 83   ? 87.713  97.821  168.637 1.00 131.72 ? 83   LYS B NZ    1 
ATOM   2385  N  N     . GLU B 1 84   ? 92.437  91.635  171.389 1.00 134.68 ? 84   GLU B N     1 
ATOM   2386  C  CA    . GLU B 1 84   ? 93.697  90.982  171.061 1.00 134.68 ? 84   GLU B CA    1 
ATOM   2387  C  C     . GLU B 1 84   ? 93.691  89.488  171.348 1.00 134.68 ? 84   GLU B C     1 
ATOM   2388  O  O     . GLU B 1 84   ? 94.674  88.812  171.027 1.00 134.68 ? 84   GLU B O     1 
ATOM   2389  C  CB    . GLU B 1 84   ? 94.845  91.642  171.826 1.00 134.68 ? 84   GLU B CB    1 
ATOM   2390  C  CG    . GLU B 1 84   ? 95.387  92.889  171.158 1.00 134.68 ? 84   GLU B CG    1 
ATOM   2391  C  CD    . GLU B 1 84   ? 95.447  92.754  169.650 1.00 134.68 ? 84   GLU B CD    1 
ATOM   2392  O  OE1   . GLU B 1 84   ? 96.401  92.125  169.146 1.00 134.68 ? 84   GLU B OE1   1 
ATOM   2393  O  OE2   . GLU B 1 84   ? 94.545  93.282  168.966 1.00 134.68 ? 84   GLU B OE2   1 
ATOM   2394  N  N     . LEU B 1 85   ? 92.625  88.962  171.942 1.00 136.65 ? 85   LEU B N     1 
ATOM   2395  C  CA    . LEU B 1 85   ? 92.571  87.543  172.265 1.00 136.65 ? 85   LEU B CA    1 
ATOM   2396  C  C     . LEU B 1 85   ? 92.538  86.713  170.988 1.00 136.65 ? 85   LEU B C     1 
ATOM   2397  O  O     . LEU B 1 85   ? 91.729  86.965  170.091 1.00 136.65 ? 85   LEU B O     1 
ATOM   2398  C  CB    . LEU B 1 85   ? 91.347  87.247  173.127 1.00 136.65 ? 85   LEU B CB    1 
ATOM   2399  C  CG    . LEU B 1 85   ? 91.016  85.773  173.355 1.00 136.65 ? 85   LEU B CG    1 
ATOM   2400  C  CD1   . LEU B 1 85   ? 92.138  85.092  174.115 1.00 136.65 ? 85   LEU B CD1   1 
ATOM   2401  C  CD2   . LEU B 1 85   ? 89.700  85.634  174.096 1.00 136.65 ? 85   LEU B CD2   1 
ATOM   2402  N  N     . VAL B 1 86   ? 93.421  85.722  170.907 1.00 141.16 ? 86   VAL B N     1 
ATOM   2403  C  CA    . VAL B 1 86   ? 93.546  84.862  169.735 1.00 141.16 ? 86   VAL B CA    1 
ATOM   2404  C  C     . VAL B 1 86   ? 93.003  83.490  170.107 1.00 141.16 ? 86   VAL B C     1 
ATOM   2405  O  O     . VAL B 1 86   ? 93.596  82.777  170.926 1.00 141.16 ? 86   VAL B O     1 
ATOM   2406  C  CB    . VAL B 1 86   ? 94.996  84.771  169.246 1.00 141.16 ? 86   VAL B CB    1 
ATOM   2407  C  CG1   . VAL B 1 86   ? 95.115  83.736  168.140 1.00 141.16 ? 86   VAL B CG1   1 
ATOM   2408  C  CG2   . VAL B 1 86   ? 95.476  86.128  168.764 1.00 141.16 ? 86   VAL B CG2   1 
ATOM   2409  N  N     . VAL B 1 87   ? 91.879  83.116  169.504 1.00 144.38 ? 87   VAL B N     1 
ATOM   2410  C  CA    . VAL B 1 87   ? 91.215  81.845  169.765 1.00 144.38 ? 87   VAL B CA    1 
ATOM   2411  C  C     . VAL B 1 87   ? 91.361  80.976  168.524 1.00 144.38 ? 87   VAL B C     1 
ATOM   2412  O  O     . VAL B 1 87   ? 91.379  81.491  167.400 1.00 144.38 ? 87   VAL B O     1 
ATOM   2413  C  CB    . VAL B 1 87   ? 89.733  82.053  170.131 1.00 144.38 ? 87   VAL B CB    1 
ATOM   2414  C  CG1   . VAL B 1 87   ? 89.014  80.724  170.309 1.00 144.38 ? 87   VAL B CG1   1 
ATOM   2415  C  CG2   . VAL B 1 87   ? 89.614  82.898  171.387 1.00 144.38 ? 87   VAL B CG2   1 
ATOM   2416  N  N     . ARG B 1 88   ? 91.469  79.664  168.726 1.00 154.60 ? 88   ARG B N     1 
ATOM   2417  C  CA    . ARG B 1 88   ? 91.644  78.700  167.646 1.00 154.60 ? 88   ARG B CA    1 
ATOM   2418  C  C     . ARG B 1 88   ? 90.584  77.618  167.801 1.00 154.60 ? 88   ARG B C     1 
ATOM   2419  O  O     . ARG B 1 88   ? 90.507  76.964  168.848 1.00 154.60 ? 88   ARG B O     1 
ATOM   2420  C  CB    . ARG B 1 88   ? 93.047  78.099  167.684 1.00 154.60 ? 88   ARG B CB    1 
ATOM   2421  C  CG    . ARG B 1 88   ? 93.494  77.432  166.399 1.00 154.60 ? 88   ARG B CG    1 
ATOM   2422  C  CD    . ARG B 1 88   ? 94.942  76.993  166.520 1.00 154.60 ? 88   ARG B CD    1 
ATOM   2423  N  NE    . ARG B 1 88   ? 95.529  76.633  165.234 1.00 154.60 ? 88   ARG B NE    1 
ATOM   2424  C  CZ    . ARG B 1 88   ? 96.815  76.348  165.060 1.00 154.60 ? 88   ARG B CZ    1 
ATOM   2425  N  NH1   . ARG B 1 88   ? 97.646  76.380  166.092 1.00 154.60 ? 88   ARG B NH1   1 
ATOM   2426  N  NH2   . ARG B 1 88   ? 97.269  76.029  163.856 1.00 154.60 ? 88   ARG B NH2   1 
ATOM   2427  N  N     . PHE B 1 89   ? 89.767  77.436  166.767 1.00 156.61 ? 89   PHE B N     1 
ATOM   2428  C  CA    . PHE B 1 89   ? 88.748  76.395  166.770 1.00 156.61 ? 89   PHE B CA    1 
ATOM   2429  C  C     . PHE B 1 89   ? 89.364  75.090  166.281 1.00 156.61 ? 89   PHE B C     1 
ATOM   2430  O  O     . PHE B 1 89   ? 90.090  75.076  165.282 1.00 156.61 ? 89   PHE B O     1 
ATOM   2431  C  CB    . PHE B 1 89   ? 87.568  76.795  165.889 1.00 156.61 ? 89   PHE B CB    1 
ATOM   2432  C  CG    . PHE B 1 89   ? 86.671  77.830  166.506 1.00 156.61 ? 89   PHE B CG    1 
ATOM   2433  C  CD1   . PHE B 1 89   ? 86.823  78.200  167.830 1.00 156.61 ? 89   PHE B CD1   1 
ATOM   2434  C  CD2   . PHE B 1 89   ? 85.673  78.431  165.759 1.00 156.61 ? 89   PHE B CD2   1 
ATOM   2435  C  CE1   . PHE B 1 89   ? 86.000  79.151  168.396 1.00 156.61 ? 89   PHE B CE1   1 
ATOM   2436  C  CE2   . PHE B 1 89   ? 84.845  79.382  166.320 1.00 156.61 ? 89   PHE B CE2   1 
ATOM   2437  C  CZ    . PHE B 1 89   ? 85.009  79.743  167.640 1.00 156.61 ? 89   PHE B CZ    1 
ATOM   2438  N  N     . LEU B 1 90   ? 89.078  73.995  166.985 1.00 161.54 ? 90   LEU B N     1 
ATOM   2439  C  CA    . LEU B 1 90   ? 89.614  72.701  166.583 1.00 161.54 ? 90   LEU B CA    1 
ATOM   2440  C  C     . LEU B 1 90   ? 88.628  71.915  165.730 1.00 161.54 ? 90   LEU B C     1 
ATOM   2441  O  O     . LEU B 1 90   ? 89.047  71.136  164.866 1.00 161.54 ? 90   LEU B O     1 
ATOM   2442  C  CB    . LEU B 1 90   ? 90.010  71.890  167.817 1.00 161.54 ? 90   LEU B CB    1 
ATOM   2443  C  CG    . LEU B 1 90   ? 91.206  72.424  168.608 1.00 161.54 ? 90   LEU B CG    1 
ATOM   2444  C  CD1   . LEU B 1 90   ? 91.747  71.362  169.552 1.00 161.54 ? 90   LEU B CD1   1 
ATOM   2445  C  CD2   . LEU B 1 90   ? 92.299  72.920  167.672 1.00 161.54 ? 90   LEU B CD2   1 
ATOM   2446  N  N     . ASN B 1 91   ? 87.330  72.100  165.952 1.00 163.30 ? 91   ASN B N     1 
ATOM   2447  C  CA    . ASN B 1 91   ? 86.313  71.421  165.162 1.00 163.30 ? 91   ASN B CA    1 
ATOM   2448  C  C     . ASN B 1 91   ? 85.948  72.285  163.961 1.00 163.30 ? 91   ASN B C     1 
ATOM   2449  O  O     . ASN B 1 91   ? 85.647  73.475  164.119 1.00 163.30 ? 91   ASN B O     1 
ATOM   2450  C  CB    . ASN B 1 91   ? 85.078  71.123  166.015 1.00 163.30 ? 91   ASN B CB    1 
ATOM   2451  C  CG    . ASN B 1 91   ? 84.107  70.173  165.336 1.00 163.30 ? 91   ASN B CG    1 
ATOM   2452  O  OD1   . ASN B 1 91   ? 83.789  70.322  164.156 1.00 163.30 ? 91   ASN B OD1   1 
ATOM   2453  N  ND2   . ASN B 1 91   ? 83.635  69.183  166.083 1.00 163.30 ? 91   ASN B ND2   1 
ATOM   2454  N  N     . PRO B 1 92   ? 85.966  71.729  162.751 1.00 163.00 ? 92   PRO B N     1 
ATOM   2455  C  CA    . PRO B 1 92   ? 85.607  72.532  161.572 1.00 163.00 ? 92   PRO B CA    1 
ATOM   2456  C  C     . PRO B 1 92   ? 84.137  72.907  161.512 1.00 163.00 ? 92   PRO B C     1 
ATOM   2457  O  O     . PRO B 1 92   ? 83.759  73.760  160.699 1.00 163.00 ? 92   PRO B O     1 
ATOM   2458  C  CB    . PRO B 1 92   ? 86.002  71.624  160.398 1.00 163.00 ? 92   PRO B CB    1 
ATOM   2459  C  CG    . PRO B 1 92   ? 86.942  70.611  160.980 1.00 163.00 ? 92   PRO B CG    1 
ATOM   2460  C  CD    . PRO B 1 92   ? 86.474  70.400  162.381 1.00 163.00 ? 92   PRO B CD    1 
ATOM   2461  N  N     . SER B 1 93   ? 83.293  72.300  162.343 1.00 160.85 ? 93   SER B N     1 
ATOM   2462  C  CA    . SER B 1 93   ? 81.860  72.560  162.320 1.00 160.85 ? 93   SER B CA    1 
ATOM   2463  C  C     . SER B 1 93   ? 81.417  73.578  163.362 1.00 160.85 ? 93   SER B C     1 
ATOM   2464  O  O     . SER B 1 93   ? 80.224  73.890  163.432 1.00 160.85 ? 93   SER B O     1 
ATOM   2465  C  CB    . SER B 1 93   ? 81.083  71.255  162.518 1.00 160.85 ? 93   SER B CB    1 
ATOM   2466  O  OG    . SER B 1 93   ? 81.576  70.530  163.630 1.00 160.85 ? 93   SER B OG    1 
ATOM   2467  N  N     . LEU B 1 94   ? 82.335  74.101  164.171 1.00 157.54 ? 94   LEU B N     1 
ATOM   2468  C  CA    . LEU B 1 94   ? 81.983  75.092  165.181 1.00 157.54 ? 94   LEU B CA    1 
ATOM   2469  C  C     . LEU B 1 94   ? 81.739  76.440  164.514 1.00 157.54 ? 94   LEU B C     1 
ATOM   2470  O  O     . LEU B 1 94   ? 82.501  76.850  163.633 1.00 157.54 ? 94   LEU B O     1 
ATOM   2471  C  CB    . LEU B 1 94   ? 83.085  75.203  166.230 1.00 157.54 ? 94   LEU B CB    1 
ATOM   2472  C  CG    . LEU B 1 94   ? 83.032  74.183  167.367 1.00 157.54 ? 94   LEU B CG    1 
ATOM   2473  C  CD1   . LEU B 1 94   ? 84.214  74.369  168.302 1.00 157.54 ? 94   LEU B CD1   1 
ATOM   2474  C  CD2   . LEU B 1 94   ? 81.720  74.302  168.124 1.00 157.54 ? 94   LEU B CD2   1 
ATOM   2475  N  N     . GLN B 1 95   ? 80.678  77.127  164.934 1.00 159.05 ? 95   GLN B N     1 
ATOM   2476  C  CA    . GLN B 1 95   ? 80.340  78.434  164.392 1.00 159.05 ? 95   GLN B CA    1 
ATOM   2477  C  C     . GLN B 1 95   ? 80.348  79.541  165.437 1.00 159.05 ? 95   GLN B C     1 
ATOM   2478  O  O     . GLN B 1 95   ? 80.584  80.701  165.082 1.00 159.05 ? 95   GLN B O     1 
ATOM   2479  C  CB    . GLN B 1 95   ? 78.965  78.387  163.715 1.00 159.05 ? 95   GLN B CB    1 
ATOM   2480  C  CG    . GLN B 1 95   ? 78.967  77.693  162.364 1.00 159.05 ? 95   GLN B CG    1 
ATOM   2481  C  CD    . GLN B 1 95   ? 79.872  78.379  161.359 1.00 159.05 ? 95   GLN B CD    1 
ATOM   2482  O  OE1   . GLN B 1 95   ? 80.036  79.598  161.384 1.00 159.05 ? 95   GLN B OE1   1 
ATOM   2483  N  NE2   . GLN B 1 95   ? 80.467  77.595  160.468 1.00 159.05 ? 95   GLN B NE2   1 
ATOM   2484  N  N     . THR B 1 96   ? 80.104  79.218  166.704 1.00 155.29 ? 96   THR B N     1 
ATOM   2485  C  CA    . THR B 1 96   ? 80.089  80.220  167.762 1.00 155.29 ? 96   THR B CA    1 
ATOM   2486  C  C     . THR B 1 96   ? 80.294  79.517  169.096 1.00 155.29 ? 96   THR B C     1 
ATOM   2487  O  O     . THR B 1 96   ? 79.775  78.422  169.329 1.00 155.29 ? 96   THR B O     1 
ATOM   2488  C  CB    . THR B 1 96   ? 78.782  81.022  167.774 1.00 155.29 ? 96   THR B CB    1 
ATOM   2489  O  OG1   . THR B 1 96   ? 78.755  81.878  168.923 1.00 155.29 ? 96   THR B OG1   1 
ATOM   2490  C  CG2   . THR B 1 96   ? 77.578  80.094  167.802 1.00 155.29 ? 96   THR B CG2   1 
ATOM   2491  N  N     . VAL B 1 97   ? 81.072  80.161  169.965 1.00 153.75 ? 97   VAL B N     1 
ATOM   2492  C  CA    . VAL B 1 97   ? 81.359  79.642  171.297 1.00 153.75 ? 97   VAL B CA    1 
ATOM   2493  C  C     . VAL B 1 97   ? 81.186  80.784  172.287 1.00 153.75 ? 97   VAL B C     1 
ATOM   2494  O  O     . VAL B 1 97   ? 81.294  81.959  171.929 1.00 153.75 ? 97   VAL B O     1 
ATOM   2495  C  CB    . VAL B 1 97   ? 82.782  79.033  171.387 1.00 153.75 ? 97   VAL B CB    1 
ATOM   2496  C  CG1   . VAL B 1 97   ? 82.962  78.253  172.682 1.00 153.75 ? 97   VAL B CG1   1 
ATOM   2497  C  CG2   . VAL B 1 97   ? 83.067  78.137  170.193 1.00 153.75 ? 97   VAL B CG2   1 
ATOM   2498  N  N     . THR B 1 98   ? 80.905  80.436  173.539 1.00 156.23 ? 98   THR B N     1 
ATOM   2499  C  CA    . THR B 1 98   ? 80.752  81.409  174.612 1.00 156.23 ? 98   THR B CA    1 
ATOM   2500  C  C     . THR B 1 98   ? 81.728  81.069  175.729 1.00 156.23 ? 98   THR B C     1 
ATOM   2501  O  O     . THR B 1 98   ? 81.694  79.959  176.272 1.00 156.23 ? 98   THR B O     1 
ATOM   2502  C  CB    . THR B 1 98   ? 79.317  81.429  175.138 1.00 156.23 ? 98   THR B CB    1 
ATOM   2503  O  OG1   . THR B 1 98   ? 78.429  81.830  174.088 1.00 156.23 ? 98   THR B OG1   1 
ATOM   2504  C  CG2   . THR B 1 98   ? 79.192  82.404  176.296 1.00 156.23 ? 98   THR B CG2   1 
ATOM   2505  N  N     . LEU B 1 99   ? 82.591  82.021  176.067 1.00 156.02 ? 99   LEU B N     1 
ATOM   2506  C  CA    . LEU B 1 99   ? 83.588  81.844  177.112 1.00 156.02 ? 99   LEU B CA    1 
ATOM   2507  C  C     . LEU B 1 99   ? 83.216  82.682  178.328 1.00 156.02 ? 99   LEU B C     1 
ATOM   2508  O  O     . LEU B 1 99   ? 82.984  83.889  178.216 1.00 156.02 ? 99   LEU B O     1 
ATOM   2509  C  CB    . LEU B 1 99   ? 84.981  82.238  176.616 1.00 156.02 ? 99   LEU B CB    1 
ATOM   2510  C  CG    . LEU B 1 99   ? 85.856  81.167  175.960 1.00 156.02 ? 99   LEU B CG    1 
ATOM   2511  C  CD1   . LEU B 1 99   ? 85.126  80.465  174.827 1.00 156.02 ? 99   LEU B CD1   1 
ATOM   2512  C  CD2   . LEU B 1 99   ? 87.152  81.783  175.460 1.00 156.02 ? 99   LEU B CD2   1 
ATOM   2513  N  N     . LEU B 1 100  ? 83.169  82.038  179.489 1.00 161.31 ? 100  LEU B N     1 
ATOM   2514  C  CA    . LEU B 1 100  ? 82.756  82.679  180.729 1.00 161.31 ? 100  LEU B CA    1 
ATOM   2515  C  C     . LEU B 1 100  ? 83.967  82.918  181.619 1.00 161.31 ? 100  LEU B C     1 
ATOM   2516  O  O     . LEU B 1 100  ? 84.931  82.146  181.592 1.00 161.31 ? 100  LEU B O     1 
ATOM   2517  C  CB    . LEU B 1 100  ? 81.725  81.827  181.475 1.00 161.31 ? 100  LEU B CB    1 
ATOM   2518  C  CG    . LEU B 1 100  ? 80.276  81.860  180.983 1.00 161.31 ? 100  LEU B CG    1 
ATOM   2519  C  CD1   . LEU B 1 100  ? 80.107  81.092  179.680 1.00 161.31 ? 100  LEU B CD1   1 
ATOM   2520  C  CD2   . LEU B 1 100  ? 79.343  81.313  182.050 1.00 161.31 ? 100  LEU B CD2   1 
ATOM   2521  N  N     . LEU B 1 101  ? 83.914  83.990  182.407 1.00 165.05 ? 101  LEU B N     1 
ATOM   2522  C  CA    . LEU B 1 101  ? 84.996  84.322  183.323 1.00 165.05 ? 101  LEU B CA    1 
ATOM   2523  C  C     . LEU B 1 101  ? 84.411  84.917  184.593 1.00 165.05 ? 101  LEU B C     1 
ATOM   2524  O  O     . LEU B 1 101  ? 83.642  85.881  184.534 1.00 165.05 ? 101  LEU B O     1 
ATOM   2525  C  CB    . LEU B 1 101  ? 85.987  85.300  182.681 1.00 165.05 ? 101  LEU B CB    1 
ATOM   2526  C  CG    . LEU B 1 101  ? 87.290  85.556  183.440 1.00 165.05 ? 101  LEU B CG    1 
ATOM   2527  C  CD1   . LEU B 1 101  ? 88.460  85.636  182.476 1.00 165.05 ? 101  LEU B CD1   1 
ATOM   2528  C  CD2   . LEU B 1 101  ? 87.194  86.830  184.264 1.00 165.05 ? 101  LEU B CD2   1 
ATOM   2529  N  N     . LYS B 1 102  ? 84.778  84.340  185.735 1.00 167.55 ? 102  LYS B N     1 
ATOM   2530  C  CA    . LYS B 1 102  ? 84.320  84.813  187.036 1.00 167.55 ? 102  LYS B CA    1 
ATOM   2531  C  C     . LYS B 1 102  ? 85.511  84.863  187.977 1.00 167.55 ? 102  LYS B C     1 
ATOM   2532  O  O     . LYS B 1 102  ? 86.140  83.832  188.236 1.00 167.55 ? 102  LYS B O     1 
ATOM   2533  C  CB    . LYS B 1 102  ? 83.226  83.905  187.606 1.00 167.55 ? 102  LYS B CB    1 
ATOM   2534  C  CG    . LYS B 1 102  ? 81.879  84.063  186.929 1.00 167.55 ? 102  LYS B CG    1 
ATOM   2535  C  CD    . LYS B 1 102  ? 80.933  82.935  187.300 1.00 167.55 ? 102  LYS B CD    1 
ATOM   2536  C  CE    . LYS B 1 102  ? 79.647  83.010  186.493 1.00 167.55 ? 102  LYS B CE    1 
ATOM   2537  N  NZ    . LYS B 1 102  ? 78.711  81.904  186.835 1.00 167.55 ? 102  LYS B NZ    1 
ATOM   2538  N  N     . ALA B 1 103  ? 85.822  86.053  188.484 1.00 174.98 ? 103  ALA B N     1 
ATOM   2539  C  CA    . ALA B 1 103  ? 86.949  86.207  189.392 1.00 174.98 ? 103  ALA B CA    1 
ATOM   2540  C  C     . ALA B 1 103  ? 86.704  87.404  190.295 1.00 174.98 ? 103  ALA B C     1 
ATOM   2541  O  O     . ALA B 1 103  ? 85.832  88.236  190.033 1.00 174.98 ? 103  ALA B O     1 
ATOM   2542  C  CB    . ALA B 1 103  ? 88.268  86.368  188.628 1.00 174.98 ? 103  ALA B CB    1 
ATOM   2543  N  N     . GLU B 1 104  ? 87.490  87.478  191.366 1.00 182.28 ? 104  GLU B N     1 
ATOM   2544  C  CA    . GLU B 1 104  ? 87.433  88.596  192.299 1.00 182.28 ? 104  GLU B CA    1 
ATOM   2545  C  C     . GLU B 1 104  ? 88.675  88.548  193.181 1.00 182.28 ? 104  GLU B C     1 
ATOM   2546  O  O     . GLU B 1 104  ? 89.509  87.646  193.067 1.00 182.28 ? 104  GLU B O     1 
ATOM   2547  C  CB    . GLU B 1 104  ? 86.145  88.569  193.127 1.00 182.28 ? 104  GLU B CB    1 
ATOM   2548  C  CG    . GLU B 1 104  ? 85.954  87.319  193.963 1.00 182.28 ? 104  GLU B CG    1 
ATOM   2549  C  CD    . GLU B 1 104  ? 84.539  87.193  194.489 1.00 182.28 ? 104  GLU B CD    1 
ATOM   2550  O  OE1   . GLU B 1 104  ? 83.897  86.154  194.229 1.00 182.28 ? 104  GLU B OE1   1 
ATOM   2551  O  OE2   . GLU B 1 104  ? 84.066  88.136  195.158 1.00 182.28 ? 104  GLU B OE2   1 
ATOM   2552  N  N     . GLY B 1 105  ? 88.791  89.533  194.068 1.00 179.14 ? 105  GLY B N     1 
ATOM   2553  C  CA    . GLY B 1 105  ? 89.951  89.660  194.916 1.00 179.14 ? 105  GLY B CA    1 
ATOM   2554  C  C     . GLY B 1 105  ? 91.077  90.400  194.225 1.00 179.14 ? 105  GLY B C     1 
ATOM   2555  O  O     . GLY B 1 105  ? 91.040  90.641  193.015 1.00 179.14 ? 105  GLY B O     1 
ATOM   2556  N  N     . PRO B 1 106  ? 92.112  90.767  194.982 1.00 176.63 ? 106  PRO B N     1 
ATOM   2557  C  CA    . PRO B 1 106  ? 93.224  91.527  194.393 1.00 176.63 ? 106  PRO B CA    1 
ATOM   2558  C  C     . PRO B 1 106  ? 94.102  90.658  193.508 1.00 176.63 ? 106  PRO B C     1 
ATOM   2559  O  O     . PRO B 1 106  ? 95.143  90.160  193.946 1.00 176.63 ? 106  PRO B O     1 
ATOM   2560  C  CB    . PRO B 1 106  ? 93.985  92.036  195.621 1.00 176.63 ? 106  PRO B CB    1 
ATOM   2561  C  CG    . PRO B 1 106  ? 93.707  91.013  196.672 1.00 176.63 ? 106  PRO B CG    1 
ATOM   2562  C  CD    . PRO B 1 106  ? 92.305  90.521  196.421 1.00 176.63 ? 106  PRO B CD    1 
ATOM   2563  N  N     . LYS B 1 107  ? 93.689  90.474  192.256 1.00 169.43 ? 107  LYS B N     1 
ATOM   2564  C  CA    . LYS B 1 107  ? 94.334  89.514  191.373 1.00 169.43 ? 107  LYS B CA    1 
ATOM   2565  C  C     . LYS B 1 107  ? 94.353  90.063  189.953 1.00 169.43 ? 107  LYS B C     1 
ATOM   2566  O  O     . LYS B 1 107  ? 93.429  90.766  189.541 1.00 169.43 ? 107  LYS B O     1 
ATOM   2567  C  CB    . LYS B 1 107  ? 93.604  88.166  191.427 1.00 169.43 ? 107  LYS B CB    1 
ATOM   2568  C  CG    . LYS B 1 107  ? 94.002  87.161  190.363 1.00 169.43 ? 107  LYS B CG    1 
ATOM   2569  C  CD    . LYS B 1 107  ? 92.957  86.064  190.246 1.00 169.43 ? 107  LYS B CD    1 
ATOM   2570  C  CE    . LYS B 1 107  ? 93.193  85.198  189.022 1.00 169.43 ? 107  LYS B CE    1 
ATOM   2571  N  NZ    . LYS B 1 107  ? 92.065  84.255  188.793 1.00 169.43 ? 107  LYS B NZ    1 
ATOM   2572  N  N     . GLU B 1 108  ? 95.416  89.751  189.217 1.00 165.80 ? 108  GLU B N     1 
ATOM   2573  C  CA    . GLU B 1 108  ? 95.545  90.139  187.817 1.00 165.80 ? 108  GLU B CA    1 
ATOM   2574  C  C     . GLU B 1 108  ? 95.064  88.974  186.960 1.00 165.80 ? 108  GLU B C     1 
ATOM   2575  O  O     . GLU B 1 108  ? 95.712  87.924  186.912 1.00 165.80 ? 108  GLU B O     1 
ATOM   2576  C  CB    . GLU B 1 108  ? 96.989  90.504  187.485 1.00 165.80 ? 108  GLU B CB    1 
ATOM   2577  C  CG    . GLU B 1 108  ? 97.524  91.684  188.271 1.00 165.80 ? 108  GLU B CG    1 
ATOM   2578  C  CD    . GLU B 1 108  ? 98.638  92.406  187.544 1.00 165.80 ? 108  GLU B CD    1 
ATOM   2579  O  OE1   . GLU B 1 108  ? 98.979  91.991  186.416 1.00 165.80 ? 108  GLU B OE1   1 
ATOM   2580  O  OE2   . GLU B 1 108  ? 99.175  93.386  188.101 1.00 165.80 ? 108  GLU B OE2   1 
ATOM   2581  N  N     . VAL B 1 109  ? 93.933  89.155  186.285 1.00 162.24 ? 109  VAL B N     1 
ATOM   2582  C  CA    . VAL B 1 109  ? 93.330  88.065  185.525 1.00 162.24 ? 109  VAL B CA    1 
ATOM   2583  C  C     . VAL B 1 109  ? 94.043  87.939  184.183 1.00 162.24 ? 109  VAL B C     1 
ATOM   2584  O  O     . VAL B 1 109  ? 94.287  88.935  183.494 1.00 162.24 ? 109  VAL B O     1 
ATOM   2585  C  CB    . VAL B 1 109  ? 91.818  88.273  185.348 1.00 162.24 ? 109  VAL B CB    1 
ATOM   2586  C  CG1   . VAL B 1 109  ? 91.146  88.398  186.705 1.00 162.24 ? 109  VAL B CG1   1 
ATOM   2587  C  CG2   . VAL B 1 109  ? 91.516  89.499  184.503 1.00 162.24 ? 109  VAL B CG2   1 
ATOM   2588  N  N     . LYS B 1 110  ? 94.420  86.714  183.831 1.00 159.25 ? 110  LYS B N     1 
ATOM   2589  C  CA    . LYS B 1 110  ? 95.077  86.426  182.569 1.00 159.25 ? 110  LYS B CA    1 
ATOM   2590  C  C     . LYS B 1 110  ? 94.099  85.738  181.622 1.00 159.25 ? 110  LYS B C     1 
ATOM   2591  O  O     . LYS B 1 110  ? 92.957  85.433  181.974 1.00 159.25 ? 110  LYS B O     1 
ATOM   2592  C  CB    . LYS B 1 110  ? 96.322  85.567  182.797 1.00 159.25 ? 110  LYS B CB    1 
ATOM   2593  C  CG    . LYS B 1 110  ? 97.313  86.162  183.780 1.00 159.25 ? 110  LYS B CG    1 
ATOM   2594  C  CD    . LYS B 1 110  ? 97.650  87.598  183.420 1.00 159.25 ? 110  LYS B CD    1 
ATOM   2595  C  CE    . LYS B 1 110  ? 98.261  88.330  184.602 1.00 159.25 ? 110  LYS B CE    1 
ATOM   2596  N  NZ    . LYS B 1 110  ? 98.517  89.765  184.298 1.00 159.25 ? 110  LYS B NZ    1 
ATOM   2597  N  N     . ALA B 1 111  ? 94.559  85.493  180.394 1.00 156.80 ? 111  ALA B N     1 
ATOM   2598  C  CA    . ALA B 1 111  ? 93.708  84.841  179.405 1.00 156.80 ? 111  ALA B CA    1 
ATOM   2599  C  C     . ALA B 1 111  ? 93.432  83.391  179.782 1.00 156.80 ? 111  ALA B C     1 
ATOM   2600  O  O     . ALA B 1 111  ? 92.358  82.859  179.479 1.00 156.80 ? 111  ALA B O     1 
ATOM   2601  C  CB    . ALA B 1 111  ? 94.348  84.926  178.021 1.00 156.80 ? 111  ALA B CB    1 
ATOM   2602  N  N     . ARG B 1 112  ? 94.389  82.736  180.444 1.00 157.65 ? 112  ARG B N     1 
ATOM   2603  C  CA    . ARG B 1 112  ? 94.216  81.333  180.804 1.00 157.65 ? 112  ARG B CA    1 
ATOM   2604  C  C     . ARG B 1 112  ? 93.112  81.141  181.836 1.00 157.65 ? 112  ARG B C     1 
ATOM   2605  O  O     . ARG B 1 112  ? 92.644  80.015  182.038 1.00 157.65 ? 112  ARG B O     1 
ATOM   2606  C  CB    . ARG B 1 112  ? 95.532  80.760  181.332 1.00 157.65 ? 112  ARG B CB    1 
ATOM   2607  C  CG    . ARG B 1 112  ? 95.772  81.026  182.809 1.00 157.65 ? 112  ARG B CG    1 
ATOM   2608  C  CD    . ARG B 1 112  ? 97.169  80.608  183.233 1.00 157.65 ? 112  ARG B CD    1 
ATOM   2609  N  NE    . ARG B 1 112  ? 98.184  81.570  182.816 1.00 157.65 ? 112  ARG B NE    1 
ATOM   2610  C  CZ    . ARG B 1 112  ? 98.957  81.425  181.745 1.00 157.65 ? 112  ARG B CZ    1 
ATOM   2611  N  NH1   . ARG B 1 112  ? 99.855  82.352  181.441 1.00 157.65 ? 112  ARG B NH1   1 
ATOM   2612  N  NH2   . ARG B 1 112  ? 98.834  80.351  180.977 1.00 157.65 ? 112  ARG B NH2   1 
ATOM   2613  N  N     . ASP B 1 113  ? 92.682  82.218  182.496 1.00 160.13 ? 113  ASP B N     1 
ATOM   2614  C  CA    . ASP B 1 113  ? 91.671  82.095  183.540 1.00 160.13 ? 113  ASP B CA    1 
ATOM   2615  C  C     . ASP B 1 113  ? 90.288  81.790  182.982 1.00 160.13 ? 113  ASP B C     1 
ATOM   2616  O  O     . ASP B 1 113  ? 89.356  81.565  183.761 1.00 160.13 ? 113  ASP B O     1 
ATOM   2617  C  CB    . ASP B 1 113  ? 91.630  83.371  184.378 1.00 160.13 ? 113  ASP B CB    1 
ATOM   2618  C  CG    . ASP B 1 113  ? 92.979  83.715  184.974 1.00 160.13 ? 113  ASP B CG    1 
ATOM   2619  O  OD1   . ASP B 1 113  ? 93.730  82.780  185.322 1.00 160.13 ? 113  ASP B OD1   1 
ATOM   2620  O  OD2   . ASP B 1 113  ? 93.291  84.917  185.089 1.00 160.13 ? 113  ASP B OD2   1 
ATOM   2621  N  N     . PHE B 1 114  ? 90.130  81.782  181.661 1.00 158.05 ? 114  PHE B N     1 
ATOM   2622  C  CA    . PHE B 1 114  ? 88.861  81.383  181.070 1.00 158.05 ? 114  PHE B CA    1 
ATOM   2623  C  C     . PHE B 1 114  ? 88.593  79.911  181.351 1.00 158.05 ? 114  PHE B C     1 
ATOM   2624  O  O     . PHE B 1 114  ? 89.509  79.085  181.352 1.00 158.05 ? 114  PHE B O     1 
ATOM   2625  C  CB    . PHE B 1 114  ? 88.872  81.640  179.564 1.00 158.05 ? 114  PHE B CB    1 
ATOM   2626  C  CG    . PHE B 1 114  ? 88.555  83.057  179.188 1.00 158.05 ? 114  PHE B CG    1 
ATOM   2627  C  CD1   . PHE B 1 114  ? 87.372  83.648  179.598 1.00 158.05 ? 114  PHE B CD1   1 
ATOM   2628  C  CD2   . PHE B 1 114  ? 89.440  83.800  178.426 1.00 158.05 ? 114  PHE B CD2   1 
ATOM   2629  C  CE1   . PHE B 1 114  ? 87.078  84.952  179.253 1.00 158.05 ? 114  PHE B CE1   1 
ATOM   2630  C  CE2   . PHE B 1 114  ? 89.151  85.104  178.079 1.00 158.05 ? 114  PHE B CE2   1 
ATOM   2631  C  CZ    . PHE B 1 114  ? 87.968  85.681  178.493 1.00 158.05 ? 114  PHE B CZ    1 
ATOM   2632  N  N     . LEU B 1 115  ? 87.331  79.585  181.594 1.00 158.70 ? 115  LEU B N     1 
ATOM   2633  C  CA    . LEU B 1 115  ? 86.953  78.208  181.872 1.00 158.70 ? 115  LEU B CA    1 
ATOM   2634  C  C     . LEU B 1 115  ? 87.170  77.352  180.629 1.00 158.70 ? 115  LEU B C     1 
ATOM   2635  O  O     . LEU B 1 115  ? 86.865  77.805  179.515 1.00 158.70 ? 115  LEU B O     1 
ATOM   2636  C  CB    . LEU B 1 115  ? 85.498  78.130  182.322 1.00 158.70 ? 115  LEU B CB    1 
ATOM   2637  C  CG    . LEU B 1 115  ? 85.192  78.782  183.671 1.00 158.70 ? 115  LEU B CG    1 
ATOM   2638  C  CD1   . LEU B 1 115  ? 83.731  78.586  184.044 1.00 158.70 ? 115  LEU B CD1   1 
ATOM   2639  C  CD2   . LEU B 1 115  ? 86.106  78.229  184.753 1.00 158.70 ? 115  LEU B CD2   1 
ATOM   2640  N  N     . PRO B 1 116  ? 87.691  76.135  180.764 1.00 164.07 ? 116  PRO B N     1 
ATOM   2641  C  CA    . PRO B 1 116  ? 87.978  75.320  179.578 1.00 164.07 ? 116  PRO B CA    1 
ATOM   2642  C  C     . PRO B 1 116  ? 86.701  74.905  178.862 1.00 164.07 ? 116  PRO B C     1 
ATOM   2643  O  O     . PRO B 1 116  ? 85.705  74.532  179.485 1.00 164.07 ? 116  PRO B O     1 
ATOM   2644  C  CB    . PRO B 1 116  ? 88.723  74.108  180.152 1.00 164.07 ? 116  PRO B CB    1 
ATOM   2645  C  CG    . PRO B 1 116  ? 89.174  74.529  181.517 1.00 164.07 ? 116  PRO B CG    1 
ATOM   2646  C  CD    . PRO B 1 116  ? 88.134  75.482  182.005 1.00 164.07 ? 116  PRO B CD    1 
ATOM   2647  N  N     . VAL B 1 117  ? 86.742  74.974  177.534 1.00 167.03 ? 117  VAL B N     1 
ATOM   2648  C  CA    . VAL B 1 117  ? 85.642  74.560  176.672 1.00 167.03 ? 117  VAL B CA    1 
ATOM   2649  C  C     . VAL B 1 117  ? 86.219  73.649  175.598 1.00 167.03 ? 117  VAL B C     1 
ATOM   2650  O  O     . VAL B 1 117  ? 87.385  73.793  175.214 1.00 167.03 ? 117  VAL B O     1 
ATOM   2651  C  CB    . VAL B 1 117  ? 84.917  75.774  176.050 1.00 167.03 ? 117  VAL B CB    1 
ATOM   2652  C  CG1   . VAL B 1 117  ? 83.746  75.333  175.181 1.00 167.03 ? 117  VAL B CG1   1 
ATOM   2653  C  CG2   . VAL B 1 117  ? 84.443  76.730  177.135 1.00 167.03 ? 117  VAL B CG2   1 
ATOM   2654  N  N     . ALA B 1 118  ? 85.412  72.701  175.128 1.00 167.26 ? 118  ALA B N     1 
ATOM   2655  C  CA    . ALA B 1 118  ? 85.903  71.697  174.195 1.00 167.26 ? 118  ALA B CA    1 
ATOM   2656  C  C     . ALA B 1 118  ? 86.262  72.318  172.851 1.00 167.26 ? 118  ALA B C     1 
ATOM   2657  O  O     . ALA B 1 118  ? 85.546  73.181  172.336 1.00 167.26 ? 118  ALA B O     1 
ATOM   2658  C  CB    . ALA B 1 118  ? 84.854  70.602  174.005 1.00 167.26 ? 118  ALA B CB    1 
ATOM   2659  N  N     . ASP B 1 119  ? 87.387  71.871  172.291 1.00 165.57 ? 119  ASP B N     1 
ATOM   2660  C  CA    . ASP B 1 119  ? 87.816  72.189  170.930 1.00 165.57 ? 119  ASP B CA    1 
ATOM   2661  C  C     . ASP B 1 119  ? 88.027  73.682  170.697 1.00 165.57 ? 119  ASP B C     1 
ATOM   2662  O  O     . ASP B 1 119  ? 87.845  74.167  169.576 1.00 165.57 ? 119  ASP B O     1 
ATOM   2663  C  CB    . ASP B 1 119  ? 86.831  71.631  169.898 1.00 165.57 ? 119  ASP B CB    1 
ATOM   2664  C  CG    . ASP B 1 119  ? 87.271  70.290  169.345 1.00 165.57 ? 119  ASP B CG    1 
ATOM   2665  O  OD1   . ASP B 1 119  ? 88.257  69.728  169.868 1.00 165.57 ? 119  ASP B OD1   1 
ATOM   2666  O  OD2   . ASP B 1 119  ? 86.637  69.796  168.391 1.00 165.57 ? 119  ASP B OD2   1 
ATOM   2667  N  N     . VAL B 1 120  ? 88.408  74.430  171.727 1.00 159.04 ? 120  VAL B N     1 
ATOM   2668  C  CA    . VAL B 1 120  ? 88.815  75.824  171.581 1.00 159.04 ? 120  VAL B CA    1 
ATOM   2669  C  C     . VAL B 1 120  ? 90.124  75.997  172.339 1.00 159.04 ? 120  VAL B C     1 
ATOM   2670  O  O     . VAL B 1 120  ? 90.228  75.621  173.514 1.00 159.04 ? 120  VAL B O     1 
ATOM   2671  C  CB    . VAL B 1 120  ? 87.741  76.805  172.075 1.00 159.04 ? 120  VAL B CB    1 
ATOM   2672  C  CG1   . VAL B 1 120  ? 86.543  76.788  171.141 1.00 159.04 ? 120  VAL B CG1   1 
ATOM   2673  C  CG2   . VAL B 1 120  ? 87.305  76.469  173.484 1.00 159.04 ? 120  VAL B CG2   1 
ATOM   2674  N  N     . GLU B 1 121  ? 91.133  76.534  171.662 1.00 157.18 ? 121  GLU B N     1 
ATOM   2675  C  CA    . GLU B 1 121  ? 92.460  76.696  172.240 1.00 157.18 ? 121  GLU B CA    1 
ATOM   2676  C  C     . GLU B 1 121  ? 92.863  78.164  172.209 1.00 157.18 ? 121  GLU B C     1 
ATOM   2677  O  O     . GLU B 1 121  ? 92.735  78.828  171.176 1.00 157.18 ? 121  GLU B O     1 
ATOM   2678  C  CB    . GLU B 1 121  ? 93.482  75.844  171.486 1.00 157.18 ? 121  GLU B CB    1 
ATOM   2679  C  CG    . GLU B 1 121  ? 94.928  76.236  171.729 1.00 157.18 ? 121  GLU B CG    1 
ATOM   2680  C  CD    . GLU B 1 121  ? 95.871  75.633  170.707 1.00 157.18 ? 121  GLU B CD    1 
ATOM   2681  O  OE1   . GLU B 1 121  ? 97.076  75.508  171.009 1.00 157.18 ? 121  GLU B OE1   1 
ATOM   2682  O  OE2   . GLU B 1 121  ? 95.406  75.284  169.601 1.00 157.18 ? 121  GLU B OE2   1 
ATOM   2683  N  N     . ILE B 1 122  ? 93.347  78.667  173.340 1.00 151.96 ? 122  ILE B N     1 
ATOM   2684  C  CA    . ILE B 1 122  ? 93.824  80.040  173.436 1.00 151.96 ? 122  ILE B CA    1 
ATOM   2685  C  C     . ILE B 1 122  ? 95.316  80.033  173.125 1.00 151.96 ? 122  ILE B C     1 
ATOM   2686  O  O     . ILE B 1 122  ? 96.099  79.365  173.804 1.00 151.96 ? 122  ILE B O     1 
ATOM   2687  C  CB    . ILE B 1 122  ? 93.542  80.639  174.818 1.00 151.96 ? 122  ILE B CB    1 
ATOM   2688  C  CG1   . ILE B 1 122  ? 92.035  80.685  175.074 1.00 151.96 ? 122  ILE B CG1   1 
ATOM   2689  C  CG2   . ILE B 1 122  ? 94.147  82.027  174.927 1.00 151.96 ? 122  ILE B CG2   1 
ATOM   2690  C  CD1   . ILE B 1 122  ? 91.668  81.018  176.499 1.00 151.96 ? 122  ILE B CD1   1 
ATOM   2691  N  N     . MET B 1 123  ? 95.711  80.780  172.092 1.00 156.09 ? 123  MET B N     1 
ATOM   2692  C  CA    . MET B 1 123  ? 97.098  80.732  171.642 1.00 156.09 ? 123  MET B CA    1 
ATOM   2693  C  C     . MET B 1 123  ? 98.013  81.528  172.563 1.00 156.09 ? 123  MET B C     1 
ATOM   2694  O  O     . MET B 1 123  ? 99.188  81.181  172.730 1.00 156.09 ? 123  MET B O     1 
ATOM   2695  C  CB    . MET B 1 123  ? 97.199  81.245  170.206 1.00 156.09 ? 123  MET B CB    1 
ATOM   2696  C  CG    . MET B 1 123  ? 96.373  80.451  169.210 1.00 156.09 ? 123  MET B CG    1 
ATOM   2697  S  SD    . MET B 1 123  ? 96.749  78.689  169.237 1.00 156.09 ? 123  MET B SD    1 
ATOM   2698  C  CE    . MET B 1 123  ? 98.421  78.691  168.600 1.00 156.09 ? 123  MET B CE    1 
ATOM   2699  N  N     . ASN B 1 124  ? 97.499  82.598  173.169 1.00 154.13 ? 124  ASN B N     1 
ATOM   2700  C  CA    . ASN B 1 124  ? 98.252  83.419  174.114 1.00 154.13 ? 124  ASN B CA    1 
ATOM   2701  C  C     . ASN B 1 124  ? 97.517  83.435  175.450 1.00 154.13 ? 124  ASN B C     1 
ATOM   2702  O  O     . ASN B 1 124  ? 96.772  84.376  175.755 1.00 154.13 ? 124  ASN B O     1 
ATOM   2703  C  CB    . ASN B 1 124  ? 98.453  84.836  173.581 1.00 154.13 ? 124  ASN B CB    1 
ATOM   2704  C  CG    . ASN B 1 124  ? 97.203  85.401  172.946 1.00 154.13 ? 124  ASN B CG    1 
ATOM   2705  O  OD1   . ASN B 1 124  ? 96.175  84.730  172.870 1.00 154.13 ? 124  ASN B OD1   1 
ATOM   2706  N  ND2   . ASN B 1 124  ? 97.282  86.644  172.487 1.00 154.13 ? 124  ASN B ND2   1 
ATOM   2707  N  N     . PRO B 1 125  ? 97.705  82.402  176.273 1.00 156.72 ? 125  PRO B N     1 
ATOM   2708  C  CA    . PRO B 1 125  ? 96.999  82.358  177.562 1.00 156.72 ? 125  PRO B CA    1 
ATOM   2709  C  C     . PRO B 1 125  ? 97.542  83.338  178.584 1.00 156.72 ? 125  PRO B C     1 
ATOM   2710  O  O     . PRO B 1 125  ? 96.890  83.560  179.612 1.00 156.72 ? 125  PRO B O     1 
ATOM   2711  C  CB    . PRO B 1 125  ? 97.198  80.907  178.014 1.00 156.72 ? 125  PRO B CB    1 
ATOM   2712  C  CG    . PRO B 1 125  ? 98.496  80.514  177.398 1.00 156.72 ? 125  PRO B CG    1 
ATOM   2713  C  CD    . PRO B 1 125  ? 98.557  81.219  176.067 1.00 156.72 ? 125  PRO B CD    1 
ATOM   2714  N  N     . ASP B 1 126  ? 98.708  83.928  178.342 1.00 157.67 ? 126  ASP B N     1 
ATOM   2715  C  CA    . ASP B 1 126  ? 99.301  84.889  179.260 1.00 157.67 ? 126  ASP B CA    1 
ATOM   2716  C  C     . ASP B 1 126  ? 98.841  86.318  179.005 1.00 157.67 ? 126  ASP B C     1 
ATOM   2717  O  O     . ASP B 1 126  ? 99.385  87.245  179.613 1.00 157.67 ? 126  ASP B O     1 
ATOM   2718  C  CB    . ASP B 1 126  ? 100.828 84.822  179.176 1.00 157.67 ? 126  ASP B CB    1 
ATOM   2719  C  CG    . ASP B 1 126  ? 101.336 84.958  177.757 1.00 157.67 ? 126  ASP B CG    1 
ATOM   2720  O  OD1   . ASP B 1 126  ? 100.560 84.679  176.820 1.00 157.67 ? 126  ASP B OD1   1 
ATOM   2721  O  OD2   . ASP B 1 126  ? 102.509 85.347  177.578 1.00 157.67 ? 126  ASP B OD2   1 
ATOM   2722  N  N     . LEU B 1 127  ? 97.866  86.518  178.121 1.00 154.75 ? 127  LEU B N     1 
ATOM   2723  C  CA    . LEU B 1 127  ? 97.386  87.861  177.825 1.00 154.75 ? 127  LEU B CA    1 
ATOM   2724  C  C     . LEU B 1 127  ? 96.721  88.476  179.049 1.00 154.75 ? 127  LEU B C     1 
ATOM   2725  O  O     . LEU B 1 127  ? 95.879  87.849  179.696 1.00 154.75 ? 127  LEU B O     1 
ATOM   2726  C  CB    . LEU B 1 127  ? 96.406  87.822  176.654 1.00 154.75 ? 127  LEU B CB    1 
ATOM   2727  C  CG    . LEU B 1 127  ? 95.920  89.182  176.155 1.00 154.75 ? 127  LEU B CG    1 
ATOM   2728  C  CD1   . LEU B 1 127  ? 97.100  90.090  175.854 1.00 154.75 ? 127  LEU B CD1   1 
ATOM   2729  C  CD2   . LEU B 1 127  ? 95.040  89.017  174.928 1.00 154.75 ? 127  LEU B CD2   1 
ATOM   2730  N  N     . HIS B 1 128  ? 97.106  89.709  179.365 1.00 156.21 ? 128  HIS B N     1 
ATOM   2731  C  CA    . HIS B 1 128  ? 96.529  90.403  180.506 1.00 156.21 ? 128  HIS B CA    1 
ATOM   2732  C  C     . HIS B 1 128  ? 95.206  91.055  180.125 1.00 156.21 ? 128  HIS B C     1 
ATOM   2733  O  O     . HIS B 1 128  ? 95.055  91.597  179.027 1.00 156.21 ? 128  HIS B O     1 
ATOM   2734  C  CB    . HIS B 1 128  ? 97.499  91.459  181.032 1.00 156.21 ? 128  HIS B CB    1 
ATOM   2735  C  CG    . HIS B 1 128  ? 96.930  92.311  182.122 1.00 156.21 ? 128  HIS B CG    1 
ATOM   2736  N  ND1   . HIS B 1 128  ? 96.500  91.793  183.325 1.00 156.21 ? 128  HIS B ND1   1 
ATOM   2737  C  CD2   . HIS B 1 128  ? 96.718  93.647  182.190 1.00 156.21 ? 128  HIS B CD2   1 
ATOM   2738  C  CE1   . HIS B 1 128  ? 96.048  92.773  184.087 1.00 156.21 ? 128  HIS B CE1   1 
ATOM   2739  N  NE2   . HIS B 1 128  ? 96.169  93.908  183.422 1.00 156.21 ? 128  HIS B NE2   1 
ATOM   2740  N  N     . ILE B 1 129  ? 94.244  91.002  181.042 1.00 155.90 ? 129  ILE B N     1 
ATOM   2741  C  CA    . ILE B 1 129  ? 92.935  91.623  180.854 1.00 155.90 ? 129  ILE B CA    1 
ATOM   2742  C  C     . ILE B 1 129  ? 92.722  92.773  181.834 1.00 155.90 ? 129  ILE B C     1 
ATOM   2743  O  O     . ILE B 1 129  ? 92.528  93.919  181.424 1.00 155.90 ? 129  ILE B O     1 
ATOM   2744  C  CB    . ILE B 1 129  ? 91.797  90.583  180.955 1.00 155.90 ? 129  ILE B CB    1 
ATOM   2745  C  CG1   . ILE B 1 129  ? 91.850  89.609  179.777 1.00 155.90 ? 129  ILE B CG1   1 
ATOM   2746  C  CG2   . ILE B 1 129  ? 90.448  91.275  181.008 1.00 155.90 ? 129  ILE B CG2   1 
ATOM   2747  C  CD1   . ILE B 1 129  ? 92.677  88.380  180.030 1.00 155.90 ? 129  ILE B CD1   1 
ATOM   2748  N  N     . ALA B 1 130  ? 92.761  92.490  183.135 1.00 161.10 ? 130  ALA B N     1 
ATOM   2749  C  CA    . ALA B 1 130  ? 92.483  93.518  184.126 1.00 161.10 ? 130  ALA B CA    1 
ATOM   2750  C  C     . ALA B 1 130  ? 93.019  93.102  185.487 1.00 161.10 ? 130  ALA B C     1 
ATOM   2751  O  O     . ALA B 1 130  ? 93.095  91.914  185.812 1.00 161.10 ? 130  ALA B O     1 
ATOM   2752  C  CB    . ALA B 1 130  ? 90.980  93.806  184.228 1.00 161.10 ? 130  ALA B CB    1 
ATOM   2753  N  N     . THR B 1 131  ? 93.375  94.104  186.285 1.00 166.44 ? 131  THR B N     1 
ATOM   2754  C  CA    . THR B 1 131  ? 93.761  93.912  187.675 1.00 166.44 ? 131  THR B CA    1 
ATOM   2755  C  C     . THR B 1 131  ? 92.576  94.262  188.565 1.00 166.44 ? 131  THR B C     1 
ATOM   2756  O  O     . THR B 1 131  ? 91.936  95.301  188.371 1.00 166.44 ? 131  THR B O     1 
ATOM   2757  C  CB    . THR B 1 131  ? 94.965  94.780  188.038 1.00 166.44 ? 131  THR B CB    1 
ATOM   2758  O  OG1   . THR B 1 131  ? 94.527  96.121  188.290 1.00 166.44 ? 131  THR B OG1   1 
ATOM   2759  C  CG2   . THR B 1 131  ? 95.973  94.792  186.902 1.00 166.44 ? 131  THR B CG2   1 
ATOM   2760  N  N     . LEU B 1 132  ? 92.289  93.400  189.534 1.00 172.24 ? 132  LEU B N     1 
ATOM   2761  C  CA    . LEU B 1 132  ? 91.144  93.556  190.418 1.00 172.24 ? 132  LEU B CA    1 
ATOM   2762  C  C     . LEU B 1 132  ? 91.634  93.866  191.824 1.00 172.24 ? 132  LEU B C     1 
ATOM   2763  O  O     . LEU B 1 132  ? 92.437  93.112  192.387 1.00 172.24 ? 132  LEU B O     1 
ATOM   2764  C  CB    . LEU B 1 132  ? 90.287  92.289  190.424 1.00 172.24 ? 132  LEU B CB    1 
ATOM   2765  C  CG    . LEU B 1 132  ? 89.260  92.118  189.305 1.00 172.24 ? 132  LEU B CG    1 
ATOM   2766  C  CD1   . LEU B 1 132  ? 89.940  91.790  187.985 1.00 172.24 ? 132  LEU B CD1   1 
ATOM   2767  C  CD2   . LEU B 1 132  ? 88.249  91.045  189.666 1.00 172.24 ? 132  LEU B CD2   1 
ATOM   2768  N  N     . GLU B 1 133  ? 91.150  94.969  192.384 1.00 177.44 ? 133  GLU B N     1 
ATOM   2769  C  CA    . GLU B 1 133  ? 91.485  95.367  193.741 1.00 177.44 ? 133  GLU B CA    1 
ATOM   2770  C  C     . GLU B 1 133  ? 90.611  94.593  194.727 1.00 177.44 ? 133  GLU B C     1 
ATOM   2771  O  O     . GLU B 1 133  ? 89.932  93.628  194.366 1.00 177.44 ? 133  GLU B O     1 
ATOM   2772  C  CB    . GLU B 1 133  ? 91.328  96.877  193.901 1.00 177.44 ? 133  GLU B CB    1 
ATOM   2773  C  CG    . GLU B 1 133  ? 92.245  97.693  193.008 1.00 177.44 ? 133  GLU B CG    1 
ATOM   2774  C  CD    . GLU B 1 133  ? 91.997  99.183  193.128 1.00 177.44 ? 133  GLU B CD    1 
ATOM   2775  O  OE1   . GLU B 1 133  ? 91.018  99.571  193.798 1.00 177.44 ? 133  GLU B OE1   1 
ATOM   2776  O  OE2   . GLU B 1 133  ? 92.782  99.966  192.553 1.00 177.44 ? 133  GLU B OE2   1 
ATOM   2777  N  N     . GLU B 1 134  ? 90.625  95.008  195.991 1.00 180.87 ? 134  GLU B N     1 
ATOM   2778  C  CA    . GLU B 1 134  ? 89.783  94.367  196.991 1.00 180.87 ? 134  GLU B CA    1 
ATOM   2779  C  C     . GLU B 1 134  ? 88.314  94.634  196.695 1.00 180.87 ? 134  GLU B C     1 
ATOM   2780  O  O     . GLU B 1 134  ? 87.938  95.740  196.295 1.00 180.87 ? 134  GLU B O     1 
ATOM   2781  C  CB    . GLU B 1 134  ? 90.143  94.874  198.388 1.00 180.87 ? 134  GLU B CB    1 
ATOM   2782  C  CG    . GLU B 1 134  ? 91.542  94.498  198.855 1.00 180.87 ? 134  GLU B CG    1 
ATOM   2783  C  CD    . GLU B 1 134  ? 91.694  93.016  199.148 1.00 180.87 ? 134  GLU B CD    1 
ATOM   2784  O  OE1   . GLU B 1 134  ? 92.841  92.569  199.360 1.00 180.87 ? 134  GLU B OE1   1 
ATOM   2785  O  OE2   . GLU B 1 134  ? 90.672  92.298  199.180 1.00 180.87 ? 134  GLU B OE2   1 
ATOM   2786  N  N     . GLY B 1 135  ? 87.483  93.613  196.888 1.00 182.32 ? 135  GLY B N     1 
ATOM   2787  C  CA    . GLY B 1 135  ? 86.062  93.728  196.634 1.00 182.32 ? 135  GLY B CA    1 
ATOM   2788  C  C     . GLY B 1 135  ? 85.665  93.832  195.179 1.00 182.32 ? 135  GLY B C     1 
ATOM   2789  O  O     . GLY B 1 135  ? 84.468  93.769  194.876 1.00 182.32 ? 135  GLY B O     1 
ATOM   2790  N  N     . GLY B 1 136  ? 86.623  93.989  194.267 1.00 179.41 ? 136  GLY B N     1 
ATOM   2791  C  CA    . GLY B 1 136  ? 86.298  94.048  192.853 1.00 179.41 ? 136  GLY B CA    1 
ATOM   2792  C  C     . GLY B 1 136  ? 85.993  92.664  192.300 1.00 179.41 ? 136  GLY B C     1 
ATOM   2793  O  O     . GLY B 1 136  ? 86.727  91.704  192.528 1.00 179.41 ? 136  GLY B O     1 
ATOM   2794  N  N     . ARG B 1 137  ? 84.889  92.573  191.562 1.00 180.37 ? 137  ARG B N     1 
ATOM   2795  C  CA    . ARG B 1 137  ? 84.428  91.306  191.011 1.00 180.37 ? 137  ARG B CA    1 
ATOM   2796  C  C     . ARG B 1 137  ? 84.187  91.462  189.519 1.00 180.37 ? 137  ARG B C     1 
ATOM   2797  O  O     . ARG B 1 137  ? 83.434  92.345  189.099 1.00 180.37 ? 137  ARG B O     1 
ATOM   2798  C  CB    . ARG B 1 137  ? 83.144  90.835  191.704 1.00 180.37 ? 137  ARG B CB    1 
ATOM   2799  C  CG    . ARG B 1 137  ? 83.223  90.825  193.220 1.00 180.37 ? 137  ARG B CG    1 
ATOM   2800  C  CD    . ARG B 1 137  ? 81.893  91.213  193.845 1.00 180.37 ? 137  ARG B CD    1 
ATOM   2801  N  NE    . ARG B 1 137  ? 80.756  90.653  193.119 1.00 180.37 ? 137  ARG B NE    1 
ATOM   2802  C  CZ    . ARG B 1 137  ? 80.361  89.387  193.207 1.00 180.37 ? 137  ARG B CZ    1 
ATOM   2803  N  NH1   . ARG B 1 137  ? 81.009  88.540  193.995 1.00 180.37 ? 137  ARG B NH1   1 
ATOM   2804  N  NH2   . ARG B 1 137  ? 79.314  88.968  192.509 1.00 180.37 ? 137  ARG B NH2   1 
ATOM   2805  N  N     . LEU B 1 138  ? 84.823  90.603  188.726 1.00 174.90 ? 138  LEU B N     1 
ATOM   2806  C  CA    . LEU B 1 138  ? 84.658  90.589  187.277 1.00 174.90 ? 138  LEU B CA    1 
ATOM   2807  C  C     . LEU B 1 138  ? 83.929  89.308  186.893 1.00 174.90 ? 138  LEU B C     1 
ATOM   2808  O  O     . LEU B 1 138  ? 84.469  88.207  187.053 1.00 174.90 ? 138  LEU B O     1 
ATOM   2809  C  CB    . LEU B 1 138  ? 86.006  90.689  186.567 1.00 174.90 ? 138  LEU B CB    1 
ATOM   2810  C  CG    . LEU B 1 138  ? 85.943  91.019  185.075 1.00 174.90 ? 138  LEU B CG    1 
ATOM   2811  C  CD1   . LEU B 1 138  ? 85.046  92.221  184.832 1.00 174.90 ? 138  LEU B CD1   1 
ATOM   2812  C  CD2   . LEU B 1 138  ? 87.336  91.267  184.523 1.00 174.90 ? 138  LEU B CD2   1 
ATOM   2813  N  N     . ASN B 1 139  ? 82.704  89.457  186.395 1.00 172.29 ? 139  ASN B N     1 
ATOM   2814  C  CA    . ASN B 1 139  ? 81.889  88.344  185.919 1.00 172.29 ? 139  ASN B CA    1 
ATOM   2815  C  C     . ASN B 1 139  ? 81.416  88.703  184.519 1.00 172.29 ? 139  ASN B C     1 
ATOM   2816  O  O     . ASN B 1 139  ? 80.619  89.631  184.350 1.00 172.29 ? 139  ASN B O     1 
ATOM   2817  C  CB    . ASN B 1 139  ? 80.709  88.085  186.857 1.00 172.29 ? 139  ASN B CB    1 
ATOM   2818  C  CG    . ASN B 1 139  ? 79.932  86.831  186.496 1.00 172.29 ? 139  ASN B CG    1 
ATOM   2819  O  OD1   . ASN B 1 139  ? 80.059  86.295  185.396 1.00 172.29 ? 139  ASN B OD1   1 
ATOM   2820  N  ND2   . ASN B 1 139  ? 79.118  86.356  187.432 1.00 172.29 ? 139  ASN B ND2   1 
ATOM   2821  N  N     . MET B 1 140  ? 81.900  87.972  183.517 1.00 166.59 ? 140  MET B N     1 
ATOM   2822  C  CA    . MET B 1 140  ? 81.638  88.347  182.136 1.00 166.59 ? 140  MET B CA    1 
ATOM   2823  C  C     . MET B 1 140  ? 81.513  87.109  181.262 1.00 166.59 ? 140  MET B C     1 
ATOM   2824  O  O     . MET B 1 140  ? 81.972  86.020  181.620 1.00 166.59 ? 140  MET B O     1 
ATOM   2825  C  CB    . MET B 1 140  ? 82.742  89.261  181.593 1.00 166.59 ? 140  MET B CB    1 
ATOM   2826  C  CG    . MET B 1 140  ? 84.099  88.589  181.490 1.00 166.59 ? 140  MET B CG    1 
ATOM   2827  S  SD    . MET B 1 140  ? 85.187  89.422  180.323 1.00 166.59 ? 140  MET B SD    1 
ATOM   2828  C  CE    . MET B 1 140  ? 84.977  91.124  180.835 1.00 166.59 ? 140  MET B CE    1 
ATOM   2829  N  N     . GLU B 1 141  ? 80.873  87.297  180.110 1.00 162.21 ? 141  GLU B N     1 
ATOM   2830  C  CA    . GLU B 1 141  ? 80.738  86.270  179.085 1.00 162.21 ? 141  GLU B CA    1 
ATOM   2831  C  C     . GLU B 1 141  ? 81.029  86.891  177.728 1.00 162.21 ? 141  GLU B C     1 
ATOM   2832  O  O     . GLU B 1 141  ? 80.431  87.910  177.367 1.00 162.21 ? 141  GLU B O     1 
ATOM   2833  C  CB    . GLU B 1 141  ? 79.336  85.655  179.086 1.00 162.21 ? 141  GLU B CB    1 
ATOM   2834  C  CG    . GLU B 1 141  ? 78.805  85.277  180.456 1.00 162.21 ? 141  GLU B CG    1 
ATOM   2835  C  CD    . GLU B 1 141  ? 77.336  84.909  180.422 1.00 162.21 ? 141  GLU B CD    1 
ATOM   2836  O  OE1   . GLU B 1 141  ? 76.750  84.905  179.320 1.00 162.21 ? 141  GLU B OE1   1 
ATOM   2837  O  OE2   . GLU B 1 141  ? 76.767  84.627  181.497 1.00 162.21 ? 141  GLU B OE2   1 
ATOM   2838  N  N     . VAL B 1 142  ? 81.930  86.273  176.973 1.00 153.67 ? 142  VAL B N     1 
ATOM   2839  C  CA    . VAL B 1 142  ? 82.312  86.749  175.650 1.00 153.67 ? 142  VAL B CA    1 
ATOM   2840  C  C     . VAL B 1 142  ? 81.854  85.732  174.617 1.00 153.67 ? 142  VAL B C     1 
ATOM   2841  O  O     . VAL B 1 142  ? 81.732  84.539  174.917 1.00 153.67 ? 142  VAL B O     1 
ATOM   2842  C  CB    . VAL B 1 142  ? 83.830  86.990  175.548 1.00 153.67 ? 142  VAL B CB    1 
ATOM   2843  C  CG1   . VAL B 1 142  ? 84.263  88.038  176.553 1.00 153.67 ? 142  VAL B CG1   1 
ATOM   2844  C  CG2   . VAL B 1 142  ? 84.591  85.698  175.766 1.00 153.67 ? 142  VAL B CG2   1 
ATOM   2845  N  N     . ARG B 1 143  ? 81.595  86.208  173.404 1.00 148.81 ? 143  ARG B N     1 
ATOM   2846  C  CA    . ARG B 1 143  ? 81.151  85.361  172.306 1.00 148.81 ? 143  ARG B CA    1 
ATOM   2847  C  C     . ARG B 1 143  ? 82.196  85.402  171.199 1.00 148.81 ? 143  ARG B C     1 
ATOM   2848  O  O     . ARG B 1 143  ? 82.585  86.484  170.747 1.00 148.81 ? 143  ARG B O     1 
ATOM   2849  C  CB    . ARG B 1 143  ? 79.791  85.819  171.783 1.00 148.81 ? 143  ARG B CB    1 
ATOM   2850  C  CG    . ARG B 1 143  ? 79.226  84.943  170.684 1.00 148.81 ? 143  ARG B CG    1 
ATOM   2851  C  CD    . ARG B 1 143  ? 77.878  85.453  170.207 1.00 148.81 ? 143  ARG B CD    1 
ATOM   2852  N  NE    . ARG B 1 143  ? 77.382  84.689  169.066 1.00 148.81 ? 143  ARG B NE    1 
ATOM   2853  C  CZ    . ARG B 1 143  ? 76.236  84.935  168.442 1.00 148.81 ? 143  ARG B CZ    1 
ATOM   2854  N  NH1   . ARG B 1 143  ? 75.458  85.930  168.847 1.00 148.81 ? 143  ARG B NH1   1 
ATOM   2855  N  NH2   . ARG B 1 143  ? 75.865  84.187  167.413 1.00 148.81 ? 143  ARG B NH2   1 
ATOM   2856  N  N     . VAL B 1 144  ? 82.645  84.228  170.765 1.00 146.54 ? 144  VAL B N     1 
ATOM   2857  C  CA    . VAL B 1 144  ? 83.662  84.094  169.730 1.00 146.54 ? 144  VAL B CA    1 
ATOM   2858  C  C     . VAL B 1 144  ? 83.001  83.443  168.525 1.00 146.54 ? 144  VAL B C     1 
ATOM   2859  O  O     . VAL B 1 144  ? 82.479  82.324  168.624 1.00 146.54 ? 144  VAL B O     1 
ATOM   2860  C  CB    . VAL B 1 144  ? 84.866  83.275  170.208 1.00 146.54 ? 144  VAL B CB    1 
ATOM   2861  C  CG1   . VAL B 1 144  ? 86.032  83.444  169.251 1.00 146.54 ? 144  VAL B CG1   1 
ATOM   2862  C  CG2   . VAL B 1 144  ? 85.259  83.685  171.616 1.00 146.54 ? 144  VAL B CG2   1 
ATOM   2863  N  N     . ASP B 1 145  ? 83.024  84.135  167.391 1.00 149.29 ? 145  ASP B N     1 
ATOM   2864  C  CA    . ASP B 1 145  ? 82.394  83.670  166.166 1.00 149.29 ? 145  ASP B CA    1 
ATOM   2865  C  C     . ASP B 1 145  ? 83.440  83.447  165.082 1.00 149.29 ? 145  ASP B C     1 
ATOM   2866  O  O     . ASP B 1 145  ? 84.613  83.797  165.242 1.00 149.29 ? 145  ASP B O     1 
ATOM   2867  C  CB    . ASP B 1 145  ? 81.349  84.672  165.669 1.00 149.29 ? 145  ASP B CB    1 
ATOM   2868  C  CG    . ASP B 1 145  ? 80.089  84.662  166.506 1.00 149.29 ? 145  ASP B CG    1 
ATOM   2869  O  OD1   . ASP B 1 145  ? 80.158  84.244  167.680 1.00 149.29 ? 145  ASP B OD1   1 
ATOM   2870  O  OD2   . ASP B 1 145  ? 79.028  85.074  165.992 1.00 149.29 ? 145  ASP B OD2   1 
ATOM   2871  N  N     . ARG B 1 146  ? 82.999  82.857  163.976 1.00 148.13 ? 146  ARG B N     1 
ATOM   2872  C  CA    . ARG B 1 146  ? 83.859  82.619  162.827 1.00 148.13 ? 146  ARG B CA    1 
ATOM   2873  C  C     . ARG B 1 146  ? 83.444  83.520  161.673 1.00 148.13 ? 146  ARG B C     1 
ATOM   2874  O  O     . ARG B 1 146  ? 82.253  83.674  161.387 1.00 148.13 ? 146  ARG B O     1 
ATOM   2875  C  CB    . ARG B 1 146  ? 83.792  81.152  162.402 1.00 148.13 ? 146  ARG B CB    1 
ATOM   2876  C  CG    . ARG B 1 146  ? 84.682  80.804  161.224 1.00 148.13 ? 146  ARG B CG    1 
ATOM   2877  C  CD    . ARG B 1 146  ? 84.649  79.315  160.929 1.00 148.13 ? 146  ARG B CD    1 
ATOM   2878  N  NE    . ARG B 1 146  ? 85.163  78.521  162.040 1.00 148.13 ? 146  ARG B NE    1 
ATOM   2879  C  CZ    . ARG B 1 146  ? 85.167  77.193  162.066 1.00 148.13 ? 146  ARG B CZ    1 
ATOM   2880  N  NH1   . ARG B 1 146  ? 84.683  76.507  161.040 1.00 148.13 ? 146  ARG B NH1   1 
ATOM   2881  N  NH2   . ARG B 1 146  ? 85.655  76.548  163.116 1.00 148.13 ? 146  ARG B NH2   1 
ATOM   2882  N  N     . GLY B 1 147  ? 84.429  84.114  161.013 1.00 132.10 ? 147  GLY B N     1 
ATOM   2883  C  CA    . GLY B 1 147  ? 84.136  85.013  159.917 1.00 132.10 ? 147  GLY B CA    1 
ATOM   2884  C  C     . GLY B 1 147  ? 85.391  85.376  159.157 1.00 132.10 ? 147  GLY B C     1 
ATOM   2885  O  O     . GLY B 1 147  ? 86.449  84.774  159.342 1.00 132.10 ? 147  GLY B O     1 
ATOM   2886  N  N     . VAL B 1 148  ? 85.256  86.376  158.288 1.00 127.70 ? 148  VAL B N     1 
ATOM   2887  C  CA    . VAL B 1 148  ? 86.360  86.852  157.467 1.00 127.70 ? 148  VAL B CA    1 
ATOM   2888  C  C     . VAL B 1 148  ? 86.386  88.373  157.495 1.00 127.70 ? 148  VAL B C     1 
ATOM   2889  O  O     . VAL B 1 148  ? 85.389  89.026  157.818 1.00 127.70 ? 148  VAL B O     1 
ATOM   2890  C  CB    . VAL B 1 148  ? 86.262  86.349  156.010 1.00 127.70 ? 148  VAL B CB    1 
ATOM   2891  C  CG1   . VAL B 1 148  ? 86.279  84.829  155.960 1.00 127.70 ? 148  VAL B CG1   1 
ATOM   2892  C  CG2   . VAL B 1 148  ? 85.010  86.894  155.348 1.00 127.70 ? 148  VAL B CG2   1 
ATOM   2893  N  N     . GLY B 1 149  ? 87.542  88.934  157.152 1.00 126.31 ? 149  GLY B N     1 
ATOM   2894  C  CA    . GLY B 1 149  ? 87.688  90.369  157.005 1.00 126.31 ? 149  GLY B CA    1 
ATOM   2895  C  C     . GLY B 1 149  ? 87.569  91.156  158.292 1.00 126.31 ? 149  GLY B C     1 
ATOM   2896  O  O     . GLY B 1 149  ? 87.931  90.670  159.367 1.00 126.31 ? 149  GLY B O     1 
ATOM   2897  N  N     . TYR B 1 150  ? 87.058  92.381  158.188 1.00 127.51 ? 150  TYR B N     1 
ATOM   2898  C  CA    . TYR B 1 150  ? 86.898  93.273  159.330 1.00 127.51 ? 150  TYR B CA    1 
ATOM   2899  C  C     . TYR B 1 150  ? 85.470  93.792  159.328 1.00 127.51 ? 150  TYR B C     1 
ATOM   2900  O  O     . TYR B 1 150  ? 85.008  94.328  158.317 1.00 127.51 ? 150  TYR B O     1 
ATOM   2901  C  CB    . TYR B 1 150  ? 87.898  94.433  159.268 1.00 127.51 ? 150  TYR B CB    1 
ATOM   2902  C  CG    . TYR B 1 150  ? 87.825  95.389  160.437 1.00 127.51 ? 150  TYR B CG    1 
ATOM   2903  C  CD1   . TYR B 1 150  ? 88.599  95.189  161.570 1.00 127.51 ? 150  TYR B CD1   1 
ATOM   2904  C  CD2   . TYR B 1 150  ? 86.992  96.498  160.402 1.00 127.51 ? 150  TYR B CD2   1 
ATOM   2905  C  CE1   . TYR B 1 150  ? 88.539  96.061  162.639 1.00 127.51 ? 150  TYR B CE1   1 
ATOM   2906  C  CE2   . TYR B 1 150  ? 86.925  97.374  161.465 1.00 127.51 ? 150  TYR B CE2   1 
ATOM   2907  C  CZ    . TYR B 1 150  ? 87.701  97.151  162.581 1.00 127.51 ? 150  TYR B CZ    1 
ATOM   2908  O  OH    . TYR B 1 150  ? 87.637  98.024  163.642 1.00 127.51 ? 150  TYR B OH    1 
ATOM   2909  N  N     . VAL B 1 151  ? 84.776  93.634  160.449 1.00 130.34 ? 151  VAL B N     1 
ATOM   2910  C  CA    . VAL B 1 151  ? 83.373  94.004  160.571 1.00 130.34 ? 151  VAL B CA    1 
ATOM   2911  C  C     . VAL B 1 151  ? 83.219  94.915  161.782 1.00 130.34 ? 151  VAL B C     1 
ATOM   2912  O  O     . VAL B 1 151  ? 83.436  94.477  162.915 1.00 130.34 ? 151  VAL B O     1 
ATOM   2913  C  CB    . VAL B 1 151  ? 82.462  92.773  160.703 1.00 130.34 ? 151  VAL B CB    1 
ATOM   2914  C  CG1   . VAL B 1 151  ? 81.031  93.203  160.969 1.00 130.34 ? 151  VAL B CG1   1 
ATOM   2915  C  CG2   . VAL B 1 151  ? 82.541  91.918  159.451 1.00 130.34 ? 151  VAL B CG2   1 
ATOM   2916  N  N     . PRO B 1 152  ? 82.855  96.183  161.600 1.00 134.42 ? 152  PRO B N     1 
ATOM   2917  C  CA    . PRO B 1 152  ? 82.599  97.050  162.755 1.00 134.42 ? 152  PRO B CA    1 
ATOM   2918  C  C     . PRO B 1 152  ? 81.400  96.567  163.557 1.00 134.42 ? 152  PRO B C     1 
ATOM   2919  O  O     . PRO B 1 152  ? 80.617  95.724  163.115 1.00 134.42 ? 152  PRO B O     1 
ATOM   2920  C  CB    . PRO B 1 152  ? 82.331  98.421  162.121 1.00 134.42 ? 152  PRO B CB    1 
ATOM   2921  C  CG    . PRO B 1 152  ? 82.947  98.344  160.763 1.00 134.42 ? 152  PRO B CG    1 
ATOM   2922  C  CD    . PRO B 1 152  ? 82.795  96.920  160.329 1.00 134.42 ? 152  PRO B CD    1 
ATOM   2923  N  N     . ALA B 1 153  ? 81.268  97.120  164.765 1.00 140.13 ? 153  ALA B N     1 
ATOM   2924  C  CA    . ALA B 1 153  ? 80.202  96.692  165.666 1.00 140.13 ? 153  ALA B CA    1 
ATOM   2925  C  C     . ALA B 1 153  ? 78.828  97.012  165.090 1.00 140.13 ? 153  ALA B C     1 
ATOM   2926  O  O     . ALA B 1 153  ? 77.938  96.155  165.066 1.00 140.13 ? 153  ALA B O     1 
ATOM   2927  C  CB    . ALA B 1 153  ? 80.378  97.349  167.035 1.00 140.13 ? 153  ALA B CB    1 
ATOM   2928  N  N     . GLU B 1 154  ? 78.638  98.246  164.619 1.00 145.31 ? 154  GLU B N     1 
ATOM   2929  C  CA    . GLU B 1 154  ? 77.337  98.663  164.109 1.00 145.31 ? 154  GLU B CA    1 
ATOM   2930  C  C     . GLU B 1 154  ? 76.902  97.867  162.886 1.00 145.31 ? 154  GLU B C     1 
ATOM   2931  O  O     . GLU B 1 154  ? 75.701  97.791  162.608 1.00 145.31 ? 154  GLU B O     1 
ATOM   2932  C  CB    . GLU B 1 154  ? 77.357  100.156 163.772 1.00 145.31 ? 154  GLU B CB    1 
ATOM   2933  C  CG    . GLU B 1 154  ? 78.081  101.026 164.790 1.00 145.31 ? 154  GLU B CG    1 
ATOM   2934  C  CD    . GLU B 1 154  ? 79.573  101.127 164.529 1.00 145.31 ? 154  GLU B CD    1 
ATOM   2935  O  OE1   . GLU B 1 154  ? 80.147  100.179 163.952 1.00 145.31 ? 154  GLU B OE1   1 
ATOM   2936  O  OE2   . GLU B 1 154  ? 80.172  102.158 164.899 1.00 145.31 ? 154  GLU B OE2   1 
ATOM   2937  N  N     . LYS B 1 155  ? 77.844  97.276  162.149 1.00 140.58 ? 155  LYS B N     1 
ATOM   2938  C  CA    . LYS B 1 155  ? 77.478  96.511  160.962 1.00 140.58 ? 155  LYS B CA    1 
ATOM   2939  C  C     . LYS B 1 155  ? 76.706  95.248  161.324 1.00 140.58 ? 155  LYS B C     1 
ATOM   2940  O  O     . LYS B 1 155  ? 75.622  95.006  160.783 1.00 140.58 ? 155  LYS B O     1 
ATOM   2941  C  CB    . LYS B 1 155  ? 78.727  96.159  160.156 1.00 140.58 ? 155  LYS B CB    1 
ATOM   2942  C  CG    . LYS B 1 155  ? 79.346  97.342  159.437 1.00 140.58 ? 155  LYS B CG    1 
ATOM   2943  C  CD    . LYS B 1 155  ? 78.454  97.837  158.314 1.00 140.58 ? 155  LYS B CD    1 
ATOM   2944  C  CE    . LYS B 1 155  ? 79.079  99.026  157.606 1.00 140.58 ? 155  LYS B CE    1 
ATOM   2945  N  NZ    . LYS B 1 155  ? 79.307  100.166 158.536 1.00 140.58 ? 155  LYS B NZ    1 
ATOM   2946  N  N     . HIS B 1 156  ? 77.244  94.433  162.233 1.00 141.42 ? 156  HIS B N     1 
ATOM   2947  C  CA    . HIS B 1 156  ? 76.533  93.228  162.641 1.00 141.42 ? 156  HIS B CA    1 
ATOM   2948  C  C     . HIS B 1 156  ? 75.623  93.494  163.834 1.00 141.42 ? 156  HIS B C     1 
ATOM   2949  O  O     . HIS B 1 156  ? 74.459  93.076  163.830 1.00 141.42 ? 156  HIS B O     1 
ATOM   2950  C  CB    . HIS B 1 156  ? 77.530  92.108  162.948 1.00 141.42 ? 156  HIS B CB    1 
ATOM   2951  C  CG    . HIS B 1 156  ? 78.430  92.395  164.109 1.00 141.42 ? 156  HIS B CG    1 
ATOM   2952  N  ND1   . HIS B 1 156  ? 78.081  92.109  165.411 1.00 141.42 ? 156  HIS B ND1   1 
ATOM   2953  C  CD2   . HIS B 1 156  ? 79.669  92.939  164.162 1.00 141.42 ? 156  HIS B CD2   1 
ATOM   2954  C  CE1   . HIS B 1 156  ? 79.064  92.468  166.217 1.00 141.42 ? 156  HIS B CE1   1 
ATOM   2955  N  NE2   . HIS B 1 156  ? 80.039  92.973  165.485 1.00 141.42 ? 156  HIS B NE2   1 
ATOM   2956  N  N     . GLY B 1 157  ? 76.127  94.198  164.846 1.00 148.24 ? 157  GLY B N     1 
ATOM   2957  C  CA    . GLY B 1 157  ? 75.358  94.555  166.024 1.00 148.24 ? 157  GLY B CA    1 
ATOM   2958  C  C     . GLY B 1 157  ? 74.575  93.421  166.651 1.00 148.24 ? 157  GLY B C     1 
ATOM   2959  O  O     . GLY B 1 157  ? 73.383  93.569  166.932 1.00 148.24 ? 157  GLY B O     1 
ATOM   2960  N  N     . ILE B 1 158  ? 75.228  92.285  166.879 1.00 149.84 ? 158  ILE B N     1 
ATOM   2961  C  CA    . ILE B 1 158  ? 74.582  91.116  167.464 1.00 149.84 ? 158  ILE B CA    1 
ATOM   2962  C  C     . ILE B 1 158  ? 74.679  91.211  168.980 1.00 149.84 ? 158  ILE B C     1 
ATOM   2963  O  O     . ILE B 1 158  ? 75.740  91.537  169.528 1.00 149.84 ? 158  ILE B O     1 
ATOM   2964  C  CB    . ILE B 1 158  ? 75.204  89.809  166.941 1.00 149.84 ? 158  ILE B CB    1 
ATOM   2965  C  CG1   . ILE B 1 158  ? 76.698  89.739  167.259 1.00 149.84 ? 158  ILE B CG1   1 
ATOM   2966  C  CG2   . ILE B 1 158  ? 74.978  89.677  165.444 1.00 149.84 ? 158  ILE B CG2   1 
ATOM   2967  C  CD1   . ILE B 1 158  ? 77.306  88.382  167.001 1.00 149.84 ? 158  ILE B CD1   1 
ATOM   2968  N  N     . LYS B 1 159  ? 73.562  90.954  169.657 1.00 161.47 ? 159  LYS B N     1 
ATOM   2969  C  CA    . LYS B 1 159  ? 73.489  91.012  171.111 1.00 161.47 ? 159  LYS B CA    1 
ATOM   2970  C  C     . LYS B 1 159  ? 72.983  89.674  171.623 1.00 161.47 ? 159  LYS B C     1 
ATOM   2971  O  O     . LYS B 1 159  ? 71.863  89.266  171.296 1.00 161.47 ? 159  LYS B O     1 
ATOM   2972  C  CB    . LYS B 1 159  ? 72.571  92.146  171.575 1.00 161.47 ? 159  LYS B CB    1 
ATOM   2973  C  CG    . LYS B 1 159  ? 73.173  93.533  171.442 1.00 161.47 ? 159  LYS B CG    1 
ATOM   2974  C  CD    . LYS B 1 159  ? 72.192  94.599  171.905 1.00 161.47 ? 159  LYS B CD    1 
ATOM   2975  C  CE    . LYS B 1 159  ? 72.876  95.944  172.076 1.00 161.47 ? 159  LYS B CE    1 
ATOM   2976  N  NZ    . LYS B 1 159  ? 73.271  96.537  170.769 1.00 161.47 ? 159  LYS B NZ    1 
ATOM   2977  N  N     . ASP B 1 160  ? 73.807  88.991  172.419 1.00 167.96 ? 160  ASP B N     1 
ATOM   2978  C  CA    . ASP B 1 160  ? 73.372  87.737  173.023 1.00 167.96 ? 160  ASP B CA    1 
ATOM   2979  C  C     . ASP B 1 160  ? 72.240  87.972  174.015 1.00 167.96 ? 160  ASP B C     1 
ATOM   2980  O  O     . ASP B 1 160  ? 71.345  87.129  174.146 1.00 167.96 ? 160  ASP B O     1 
ATOM   2981  C  CB    . ASP B 1 160  ? 74.563  87.048  173.698 1.00 167.96 ? 160  ASP B CB    1 
ATOM   2982  C  CG    . ASP B 1 160  ? 74.240  85.645  174.193 1.00 167.96 ? 160  ASP B CG    1 
ATOM   2983  O  OD1   . ASP B 1 160  ? 74.947  84.702  173.780 1.00 167.96 ? 160  ASP B OD1   1 
ATOM   2984  O  OD2   . ASP B 1 160  ? 73.312  85.478  175.011 1.00 167.96 ? 160  ASP B OD2   1 
ATOM   2985  N  N     . ARG B 1 161  ? 72.247  89.114  174.696 1.00 167.39 ? 161  ARG B N     1 
ATOM   2986  C  CA    . ARG B 1 161  ? 71.202  89.462  175.645 1.00 167.39 ? 161  ARG B CA    1 
ATOM   2987  C  C     . ARG B 1 161  ? 71.159  90.978  175.778 1.00 167.39 ? 161  ARG B C     1 
ATOM   2988  O  O     . ARG B 1 161  ? 71.854  91.705  175.064 1.00 167.39 ? 161  ARG B O     1 
ATOM   2989  C  CB    . ARG B 1 161  ? 71.438  88.778  176.995 1.00 167.39 ? 161  ARG B CB    1 
ATOM   2990  C  CG    . ARG B 1 161  ? 72.562  89.385  177.818 1.00 167.39 ? 161  ARG B CG    1 
ATOM   2991  C  CD    . ARG B 1 161  ? 72.706  88.671  179.150 1.00 167.39 ? 161  ARG B CD    1 
ATOM   2992  N  NE    . ARG B 1 161  ? 73.299  87.346  178.994 1.00 167.39 ? 161  ARG B NE    1 
ATOM   2993  C  CZ    . ARG B 1 161  ? 73.612  86.543  180.005 1.00 167.39 ? 161  ARG B CZ    1 
ATOM   2994  N  NH1   . ARG B 1 161  ? 73.384  86.924  181.254 1.00 167.39 ? 161  ARG B NH1   1 
ATOM   2995  N  NH2   . ARG B 1 161  ? 74.149  85.354  179.768 1.00 167.39 ? 161  ARG B NH2   1 
ATOM   2996  N  N     . ILE B 1 162  ? 70.320  91.456  176.694 1.00 166.36 ? 162  ILE B N     1 
ATOM   2997  C  CA    . ILE B 1 162  ? 70.225  92.888  176.937 1.00 166.36 ? 162  ILE B CA    1 
ATOM   2998  C  C     . ILE B 1 162  ? 71.467  93.354  177.693 1.00 166.36 ? 162  ILE B C     1 
ATOM   2999  O  O     . ILE B 1 162  ? 72.092  92.597  178.442 1.00 166.36 ? 162  ILE B O     1 
ATOM   3000  C  CB    . ILE B 1 162  ? 68.928  93.237  177.695 1.00 166.36 ? 162  ILE B CB    1 
ATOM   3001  C  CG1   . ILE B 1 162  ? 67.703  92.701  176.949 1.00 166.36 ? 162  ILE B CG1   1 
ATOM   3002  C  CG2   . ILE B 1 162  ? 68.755  94.742  177.813 1.00 166.36 ? 162  ILE B CG2   1 
ATOM   3003  C  CD1   . ILE B 1 162  ? 67.242  91.323  177.400 1.00 166.36 ? 162  ILE B CD1   1 
ATOM   3004  N  N     . ASN B 1 163  ? 71.844  94.615  177.461 1.00 166.90 ? 163  ASN B N     1 
ATOM   3005  C  CA    . ASN B 1 163  ? 73.048  95.239  178.009 1.00 166.90 ? 163  ASN B CA    1 
ATOM   3006  C  C     . ASN B 1 163  ? 74.324  94.623  177.446 1.00 166.90 ? 163  ASN B C     1 
ATOM   3007  O  O     . ASN B 1 163  ? 75.426  94.979  177.877 1.00 166.90 ? 163  ASN B O     1 
ATOM   3008  C  CB    . ASN B 1 163  ? 73.080  95.169  179.541 1.00 166.90 ? 163  ASN B CB    1 
ATOM   3009  C  CG    . ASN B 1 163  ? 71.822  95.715  180.180 1.00 166.90 ? 163  ASN B CG    1 
ATOM   3010  O  OD1   . ASN B 1 163  ? 70.775  95.072  180.169 1.00 166.90 ? 163  ASN B OD1   1 
ATOM   3011  N  ND2   . ASN B 1 163  ? 71.919  96.916  180.741 1.00 166.90 ? 163  ASN B ND2   1 
ATOM   3012  N  N     . ALA B 1 164  ? 74.199  93.706  176.492 1.00 161.01 ? 164  ALA B N     1 
ATOM   3013  C  CA    . ALA B 1 164  ? 75.381  93.147  175.849 1.00 161.01 ? 164  ALA B CA    1 
ATOM   3014  C  C     . ALA B 1 164  ? 76.005  94.185  174.926 1.00 161.01 ? 164  ALA B C     1 
ATOM   3015  O  O     . ALA B 1 164  ? 75.304  94.849  174.156 1.00 161.01 ? 164  ALA B O     1 
ATOM   3016  C  CB    . ALA B 1 164  ? 75.021  91.886  175.068 1.00 161.01 ? 164  ALA B CB    1 
ATOM   3017  N  N     . ILE B 1 165  ? 77.322  94.325  175.004 1.00 152.36 ? 165  ILE B N     1 
ATOM   3018  C  CA    . ILE B 1 165  ? 78.057  95.335  174.249 1.00 152.36 ? 165  ILE B CA    1 
ATOM   3019  C  C     . ILE B 1 165  ? 78.625  94.676  172.998 1.00 152.36 ? 165  ILE B C     1 
ATOM   3020  O  O     . ILE B 1 165  ? 79.443  93.751  173.118 1.00 152.36 ? 165  ILE B O     1 
ATOM   3021  C  CB    . ILE B 1 165  ? 79.176  95.963  175.091 1.00 152.36 ? 165  ILE B CB    1 
ATOM   3022  C  CG1   . ILE B 1 165  ? 78.647  96.342  176.474 1.00 152.36 ? 165  ILE B CG1   1 
ATOM   3023  C  CG2   . ILE B 1 165  ? 79.749  97.179  174.387 1.00 152.36 ? 165  ILE B CG2   1 
ATOM   3024  C  CD1   . ILE B 1 165  ? 79.727  96.753  177.445 1.00 152.36 ? 165  ILE B CD1   1 
ATOM   3025  N  N     . PRO B 1 166  ? 78.232  95.104  171.801 1.00 147.01 ? 166  PRO B N     1 
ATOM   3026  C  CA    . PRO B 1 166  ? 78.858  94.564  170.590 1.00 147.01 ? 166  PRO B CA    1 
ATOM   3027  C  C     . PRO B 1 166  ? 80.269  95.104  170.423 1.00 147.01 ? 166  PRO B C     1 
ATOM   3028  O  O     . PRO B 1 166  ? 80.546  96.271  170.708 1.00 147.01 ? 166  PRO B O     1 
ATOM   3029  C  CB    . PRO B 1 166  ? 77.934  95.046  169.467 1.00 147.01 ? 166  PRO B CB    1 
ATOM   3030  C  CG    . PRO B 1 166  ? 77.300  96.278  170.015 1.00 147.01 ? 166  PRO B CG    1 
ATOM   3031  C  CD    . PRO B 1 166  ? 77.143  96.046  171.492 1.00 147.01 ? 166  PRO B CD    1 
ATOM   3032  N  N     . VAL B 1 167  ? 81.164  94.240  169.955 1.00 139.09 ? 167  VAL B N     1 
ATOM   3033  C  CA    . VAL B 1 167  ? 82.574  94.568  169.799 1.00 139.09 ? 167  VAL B CA    1 
ATOM   3034  C  C     . VAL B 1 167  ? 82.936  94.484  168.325 1.00 139.09 ? 167  VAL B C     1 
ATOM   3035  O  O     . VAL B 1 167  ? 82.444  93.608  167.605 1.00 139.09 ? 167  VAL B O     1 
ATOM   3036  C  CB    . VAL B 1 167  ? 83.468  93.627  170.634 1.00 139.09 ? 167  VAL B CB    1 
ATOM   3037  C  CG1   . VAL B 1 167  ? 84.903  94.123  170.647 1.00 139.09 ? 167  VAL B CG1   1 
ATOM   3038  C  CG2   . VAL B 1 167  ? 82.928  93.501  172.047 1.00 139.09 ? 167  VAL B CG2   1 
ATOM   3039  N  N     . ASP B 1 168  ? 83.789  95.403  167.875 1.00 139.02 ? 168  ASP B N     1 
ATOM   3040  C  CA    . ASP B 1 168  ? 84.311  95.340  166.517 1.00 139.02 ? 168  ASP B CA    1 
ATOM   3041  C  C     . ASP B 1 168  ? 85.069  94.036  166.316 1.00 139.02 ? 168  ASP B C     1 
ATOM   3042  O  O     . ASP B 1 168  ? 86.006  93.731  167.059 1.00 139.02 ? 168  ASP B O     1 
ATOM   3043  C  CB    . ASP B 1 168  ? 85.221  96.535  166.247 1.00 139.02 ? 168  ASP B CB    1 
ATOM   3044  C  CG    . ASP B 1 168  ? 84.523  97.859  166.469 1.00 139.02 ? 168  ASP B CG    1 
ATOM   3045  O  OD1   . ASP B 1 168  ? 83.379  98.015  165.993 1.00 139.02 ? 168  ASP B OD1   1 
ATOM   3046  O  OD2   . ASP B 1 168  ? 85.115  98.744  167.121 1.00 139.02 ? 168  ASP B OD2   1 
ATOM   3047  N  N     . ALA B 1 169  ? 84.662  93.266  165.312 1.00 132.80 ? 169  ALA B N     1 
ATOM   3048  C  CA    . ALA B 1 169  ? 85.214  91.940  165.069 1.00 132.80 ? 169  ALA B CA    1 
ATOM   3049  C  C     . ALA B 1 169  ? 86.284  92.038  163.990 1.00 132.80 ? 169  ALA B C     1 
ATOM   3050  O  O     . ALA B 1 169  ? 86.024  92.531  162.888 1.00 132.80 ? 169  ALA B O     1 
ATOM   3051  C  CB    . ALA B 1 169  ? 84.114  90.962  164.664 1.00 132.80 ? 169  ALA B CB    1 
ATOM   3052  N  N     . VAL B 1 170  ? 87.485  91.570  164.311 1.00 132.00 ? 170  VAL B N     1 
ATOM   3053  C  CA    . VAL B 1 170  ? 88.589  91.497  163.362 1.00 132.00 ? 170  VAL B CA    1 
ATOM   3054  C  C     . VAL B 1 170  ? 88.909  90.018  163.161 1.00 132.00 ? 170  VAL B C     1 
ATOM   3055  O  O     . VAL B 1 170  ? 89.598  89.386  163.968 1.00 132.00 ? 170  VAL B O     1 
ATOM   3056  C  CB    . VAL B 1 170  ? 89.796  92.321  163.828 1.00 132.00 ? 170  VAL B CB    1 
ATOM   3057  C  CG1   . VAL B 1 170  ? 90.238  91.939  165.243 1.00 132.00 ? 170  VAL B CG1   1 
ATOM   3058  C  CG2   . VAL B 1 170  ? 90.944  92.174  162.844 1.00 132.00 ? 170  VAL B CG2   1 
ATOM   3059  N  N     . PHE B 1 171  ? 88.391  89.453  162.070 1.00 130.38 ? 171  PHE B N     1 
ATOM   3060  C  CA    . PHE B 1 171  ? 88.456  88.010  161.876 1.00 130.38 ? 171  PHE B CA    1 
ATOM   3061  C  C     . PHE B 1 171  ? 89.769  87.576  161.239 1.00 130.38 ? 171  PHE B C     1 
ATOM   3062  O  O     . PHE B 1 171  ? 90.287  86.501  161.558 1.00 130.38 ? 171  PHE B O     1 
ATOM   3063  C  CB    . PHE B 1 171  ? 87.280  87.548  161.018 1.00 130.38 ? 171  PHE B CB    1 
ATOM   3064  C  CG    . PHE B 1 171  ? 85.963  87.568  161.734 1.00 130.38 ? 171  PHE B CG    1 
ATOM   3065  C  CD1   . PHE B 1 171  ? 85.684  86.642  162.723 1.00 130.38 ? 171  PHE B CD1   1 
ATOM   3066  C  CD2   . PHE B 1 171  ? 85.002  88.510  161.414 1.00 130.38 ? 171  PHE B CD2   1 
ATOM   3067  C  CE1   . PHE B 1 171  ? 84.472  86.657  163.381 1.00 130.38 ? 171  PHE B CE1   1 
ATOM   3068  C  CE2   . PHE B 1 171  ? 83.789  88.530  162.067 1.00 130.38 ? 171  PHE B CE2   1 
ATOM   3069  C  CZ    . PHE B 1 171  ? 83.523  87.602  163.053 1.00 130.38 ? 171  PHE B CZ    1 
ATOM   3070  N  N     . SER B 1 172  ? 90.309  88.387  160.337 1.00 124.92 ? 172  SER B N     1 
ATOM   3071  C  CA    . SER B 1 172  ? 91.472  88.010  159.551 1.00 124.92 ? 172  SER B CA    1 
ATOM   3072  C  C     . SER B 1 172  ? 92.661  87.701  160.458 1.00 124.92 ? 172  SER B C     1 
ATOM   3073  O  O     . SER B 1 172  ? 93.091  88.575  161.225 1.00 124.92 ? 172  SER B O     1 
ATOM   3074  C  CB    . SER B 1 172  ? 91.838  89.128  158.580 1.00 124.92 ? 172  SER B CB    1 
ATOM   3075  O  OG    . SER B 1 172  ? 92.284  90.276  159.279 1.00 124.92 ? 172  SER B OG    1 
ATOM   3076  N  N     . PRO B 1 173  ? 93.215  86.488  160.403 1.00 120.55 ? 173  PRO B N     1 
ATOM   3077  C  CA    . PRO B 1 173  ? 94.419  86.199  161.193 1.00 120.55 ? 173  PRO B CA    1 
ATOM   3078  C  C     . PRO B 1 173  ? 95.661  86.885  160.661 1.00 120.55 ? 173  PRO B C     1 
ATOM   3079  O  O     . PRO B 1 173  ? 96.691  86.882  161.346 1.00 120.55 ? 173  PRO B O     1 
ATOM   3080  C  CB    . PRO B 1 173  ? 94.539  84.674  161.100 1.00 120.55 ? 173  PRO B CB    1 
ATOM   3081  C  CG    . PRO B 1 173  ? 93.905  84.343  159.797 1.00 120.55 ? 173  PRO B CG    1 
ATOM   3082  C  CD    . PRO B 1 173  ? 92.770  85.319  159.626 1.00 120.55 ? 173  PRO B CD    1 
ATOM   3083  N  N     . VAL B 1 174  ? 95.603  87.465  159.467 1.00 116.33 ? 174  VAL B N     1 
ATOM   3084  C  CA    . VAL B 1 174  ? 96.730  88.209  158.918 1.00 116.33 ? 174  VAL B CA    1 
ATOM   3085  C  C     . VAL B 1 174  ? 96.658  89.637  159.440 1.00 116.33 ? 174  VAL B C     1 
ATOM   3086  O  O     . VAL B 1 174  ? 95.602  90.276  159.387 1.00 116.33 ? 174  VAL B O     1 
ATOM   3087  C  CB    . VAL B 1 174  ? 96.717  88.179  157.385 1.00 116.33 ? 174  VAL B CB    1 
ATOM   3088  C  CG1   . VAL B 1 174  ? 97.744  89.145  156.831 1.00 116.33 ? 174  VAL B CG1   1 
ATOM   3089  C  CG2   . VAL B 1 174  ? 96.981  86.771  156.884 1.00 116.33 ? 174  VAL B CG2   1 
ATOM   3090  N  N     . ARG B 1 175  ? 97.783  90.143  159.947 1.00 122.83 ? 175  ARG B N     1 
ATOM   3091  C  CA    . ARG B 1 175  ? 97.780  91.478  160.532 1.00 122.83 ? 175  ARG B CA    1 
ATOM   3092  C  C     . ARG B 1 175  ? 98.425  92.502  159.608 1.00 122.83 ? 175  ARG B C     1 
ATOM   3093  O  O     . ARG B 1 175  ? 98.052  93.680  159.632 1.00 122.83 ? 175  ARG B O     1 
ATOM   3094  C  CB    . ARG B 1 175  ? 98.487  91.460  161.886 1.00 122.83 ? 175  ARG B CB    1 
ATOM   3095  C  CG    . ARG B 1 175  ? 97.758  90.648  162.940 1.00 122.83 ? 175  ARG B CG    1 
ATOM   3096  C  CD    . ARG B 1 175  ? 98.032  91.173  164.339 1.00 122.83 ? 175  ARG B CD    1 
ATOM   3097  N  NE    . ARG B 1 175  ? 97.416  90.338  165.367 1.00 122.83 ? 175  ARG B NE    1 
ATOM   3098  C  CZ    . ARG B 1 175  ? 96.115  90.323  165.640 1.00 122.83 ? 175  ARG B CZ    1 
ATOM   3099  N  NH1   . ARG B 1 175  ? 95.282  91.103  164.966 1.00 122.83 ? 175  ARG B NH1   1 
ATOM   3100  N  NH2   . ARG B 1 175  ? 95.646  89.529  166.593 1.00 122.83 ? 175  ARG B NH2   1 
ATOM   3101  N  N     . ARG B 1 176  ? 99.387  92.084  158.787 1.00 113.80 ? 176  ARG B N     1 
ATOM   3102  C  CA    . ARG B 1 176  ? 100.045 93.027  157.896 1.00 113.80 ? 176  ARG B CA    1 
ATOM   3103  C  C     . ARG B 1 176  ? 100.664 92.284  156.722 1.00 113.80 ? 176  ARG B C     1 
ATOM   3104  O  O     . ARG B 1 176  ? 101.172 91.170  156.870 1.00 113.80 ? 176  ARG B O     1 
ATOM   3105  C  CB    . ARG B 1 176  ? 101.119 93.833  158.637 1.00 113.80 ? 176  ARG B CB    1 
ATOM   3106  C  CG    . ARG B 1 176  ? 101.779 94.914  157.802 1.00 113.80 ? 176  ARG B CG    1 
ATOM   3107  C  CD    . ARG B 1 176  ? 102.810 95.680  158.608 1.00 113.80 ? 176  ARG B CD    1 
ATOM   3108  N  NE    . ARG B 1 176  ? 103.509 96.670  157.797 1.00 113.80 ? 176  ARG B NE    1 
ATOM   3109  C  CZ    . ARG B 1 176  ? 104.471 97.464  158.252 1.00 113.80 ? 176  ARG B CZ    1 
ATOM   3110  N  NH1   . ARG B 1 176  ? 104.858 97.379  159.515 1.00 113.80 ? 176  ARG B NH1   1 
ATOM   3111  N  NH2   . ARG B 1 176  ? 105.051 98.337  157.441 1.00 113.80 ? 176  ARG B NH2   1 
ATOM   3112  N  N     . VAL B 1 177  ? 100.627 92.921  155.554 1.00 110.51 ? 177  VAL B N     1 
ATOM   3113  C  CA    . VAL B 1 177  ? 101.208 92.383  154.329 1.00 110.51 ? 177  VAL B CA    1 
ATOM   3114  C  C     . VAL B 1 177  ? 101.886 93.530  153.597 1.00 110.51 ? 177  VAL B C     1 
ATOM   3115  O  O     . VAL B 1 177  ? 101.297 94.607  153.448 1.00 110.51 ? 177  VAL B O     1 
ATOM   3116  C  CB    . VAL B 1 177  ? 100.153 91.719  153.430 1.00 110.51 ? 177  VAL B CB    1 
ATOM   3117  C  CG1   . VAL B 1 177  ? 100.713 91.477  152.040 1.00 110.51 ? 177  VAL B CG1   1 
ATOM   3118  C  CG2   . VAL B 1 177  ? 99.676  90.416  154.038 1.00 110.51 ? 177  VAL B CG2   1 
ATOM   3119  N  N     . ALA B 1 178  ? 103.118 93.308  153.144 1.00 113.81 ? 178  ALA B N     1 
ATOM   3120  C  CA    . ALA B 1 178  ? 103.849 94.308  152.379 1.00 113.81 ? 178  ALA B CA    1 
ATOM   3121  C  C     . ALA B 1 178  ? 104.679 93.615  151.313 1.00 113.81 ? 178  ALA B C     1 
ATOM   3122  O  O     . ALA B 1 178  ? 105.510 92.761  151.627 1.00 113.81 ? 178  ALA B O     1 
ATOM   3123  C  CB    . ALA B 1 178  ? 104.748 95.152  153.286 1.00 113.81 ? 178  ALA B CB    1 
ATOM   3124  N  N     . PHE B 1 179  ? 104.466 93.990  150.057 1.00 114.59 ? 179  PHE B N     1 
ATOM   3125  C  CA    . PHE B 1 179  ? 105.197 93.390  148.953 1.00 114.59 ? 179  PHE B CA    1 
ATOM   3126  C  C     . PHE B 1 179  ? 106.099 94.434  148.320 1.00 114.59 ? 179  PHE B C     1 
ATOM   3127  O  O     . PHE B 1 179  ? 105.789 95.629  148.331 1.00 114.59 ? 179  PHE B O     1 
ATOM   3128  C  CB    . PHE B 1 179  ? 104.249 92.794  147.904 1.00 114.59 ? 179  PHE B CB    1 
ATOM   3129  C  CG    . PHE B 1 179  ? 103.664 93.807  146.965 1.00 114.59 ? 179  PHE B CG    1 
ATOM   3130  C  CD1   . PHE B 1 179  ? 104.220 94.014  145.714 1.00 114.59 ? 179  PHE B CD1   1 
ATOM   3131  C  CD2   . PHE B 1 179  ? 102.557 94.548  147.331 1.00 114.59 ? 179  PHE B CD2   1 
ATOM   3132  C  CE1   . PHE B 1 179  ? 103.684 94.944  144.849 1.00 114.59 ? 179  PHE B CE1   1 
ATOM   3133  C  CE2   . PHE B 1 179  ? 102.015 95.479  146.469 1.00 114.59 ? 179  PHE B CE2   1 
ATOM   3134  C  CZ    . PHE B 1 179  ? 102.580 95.677  145.227 1.00 114.59 ? 179  PHE B CZ    1 
ATOM   3135  N  N     . GLN B 1 180  ? 107.220 93.974  147.775 1.00 121.24 ? 180  GLN B N     1 
ATOM   3136  C  CA    . GLN B 1 180  ? 108.192 94.842  147.132 1.00 121.24 ? 180  GLN B CA    1 
ATOM   3137  C  C     . GLN B 1 180  ? 108.711 94.152  145.883 1.00 121.24 ? 180  GLN B C     1 
ATOM   3138  O  O     . GLN B 1 180  ? 109.179 93.012  145.947 1.00 121.24 ? 180  GLN B O     1 
ATOM   3139  C  CB    . GLN B 1 180  ? 109.349 95.176  148.077 1.00 121.24 ? 180  GLN B CB    1 
ATOM   3140  C  CG    . GLN B 1 180  ? 110.362 96.143  147.497 1.00 121.24 ? 180  GLN B CG    1 
ATOM   3141  C  CD    . GLN B 1 180  ? 111.666 96.149  148.266 1.00 121.24 ? 180  GLN B CD    1 
ATOM   3142  O  OE1   . GLN B 1 180  ? 111.912 95.276  149.099 1.00 121.24 ? 180  GLN B OE1   1 
ATOM   3143  N  NE2   . GLN B 1 180  ? 112.511 97.134  147.990 1.00 121.24 ? 180  GLN B NE2   1 
ATOM   3144  N  N     . VAL B 1 181  ? 108.615 94.838  144.751 1.00 124.81 ? 181  VAL B N     1 
ATOM   3145  C  CA    . VAL B 1 181  ? 109.148 94.352  143.487 1.00 124.81 ? 181  VAL B CA    1 
ATOM   3146  C  C     . VAL B 1 181  ? 110.376 95.178  143.139 1.00 124.81 ? 181  VAL B C     1 
ATOM   3147  O  O     . VAL B 1 181  ? 110.364 96.410  143.254 1.00 124.81 ? 181  VAL B O     1 
ATOM   3148  C  CB    . VAL B 1 181  ? 108.089 94.407  142.367 1.00 124.81 ? 181  VAL B CB    1 
ATOM   3149  C  CG1   . VAL B 1 181  ? 107.603 95.829  142.140 1.00 124.81 ? 181  VAL B CG1   1 
ATOM   3150  C  CG2   . VAL B 1 181  ? 108.647 93.822  141.082 1.00 124.81 ? 181  VAL B CG2   1 
ATOM   3151  N  N     . GLU B 1 182  ? 111.452 94.498  142.751 1.00 133.98 ? 182  GLU B N     1 
ATOM   3152  C  CA    . GLU B 1 182  ? 112.689 95.188  142.418 1.00 133.98 ? 182  GLU B CA    1 
ATOM   3153  C  C     . GLU B 1 182  ? 113.292 94.596  141.154 1.00 133.98 ? 182  GLU B C     1 
ATOM   3154  O  O     . GLU B 1 182  ? 113.073 93.428  140.826 1.00 133.98 ? 182  GLU B O     1 
ATOM   3155  C  CB    . GLU B 1 182  ? 113.701 95.131  143.569 1.00 133.98 ? 182  GLU B CB    1 
ATOM   3156  C  CG    . GLU B 1 182  ? 113.887 93.759  144.183 1.00 133.98 ? 182  GLU B CG    1 
ATOM   3157  C  CD    . GLU B 1 182  ? 114.678 93.813  145.474 1.00 133.98 ? 182  GLU B CD    1 
ATOM   3158  O  OE1   . GLU B 1 182  ? 114.837 94.922  146.026 1.00 133.98 ? 182  GLU B OE1   1 
ATOM   3159  O  OE2   . GLU B 1 182  ? 115.140 92.751  145.938 1.00 133.98 ? 182  GLU B OE2   1 
ATOM   3160  N  N     . ASP B 1 183  ? 114.054 95.422  140.446 1.00 143.37 ? 183  ASP B N     1 
ATOM   3161  C  CA    . ASP B 1 183  ? 114.630 95.005  139.179 1.00 143.37 ? 183  ASP B CA    1 
ATOM   3162  C  C     . ASP B 1 183  ? 115.761 94.006  139.395 1.00 143.37 ? 183  ASP B C     1 
ATOM   3163  O  O     . ASP B 1 183  ? 116.447 94.016  140.421 1.00 143.37 ? 183  ASP B O     1 
ATOM   3164  C  CB    . ASP B 1 183  ? 115.144 96.216  138.403 1.00 143.37 ? 183  ASP B CB    1 
ATOM   3165  C  CG    . ASP B 1 183  ? 114.052 96.906  137.611 1.00 143.37 ? 183  ASP B CG    1 
ATOM   3166  O  OD1   . ASP B 1 183  ? 114.216 98.099  137.283 1.00 143.37 ? 183  ASP B OD1   1 
ATOM   3167  O  OD2   . ASP B 1 183  ? 113.027 96.254  137.317 1.00 143.37 ? 183  ASP B OD2   1 
ATOM   3168  N  N     . THR B 1 184  ? 115.945 93.136  138.407 1.00 143.16 ? 184  THR B N     1 
ATOM   3169  C  CA    . THR B 1 184  ? 117.017 92.154  138.416 1.00 143.16 ? 184  THR B CA    1 
ATOM   3170  C  C     . THR B 1 184  ? 117.284 91.730  136.980 1.00 143.16 ? 184  THR B C     1 
ATOM   3171  O  O     . THR B 1 184  ? 116.447 91.917  136.089 1.00 143.16 ? 184  THR B O     1 
ATOM   3172  C  CB    . THR B 1 184  ? 116.673 90.936  139.283 1.00 143.16 ? 184  THR B CB    1 
ATOM   3173  O  OG1   . THR B 1 184  ? 117.850 90.145  139.486 1.00 143.16 ? 184  THR B OG1   1 
ATOM   3174  C  CG2   . THR B 1 184  ? 115.609 90.085  138.611 1.00 143.16 ? 184  THR B CG2   1 
ATOM   3175  N  N     . ARG B 1 185  ? 118.462 91.151  136.764 1.00 146.19 ? 185  ARG B N     1 
ATOM   3176  C  CA    . ARG B 1 185  ? 118.919 90.801  135.428 1.00 146.19 ? 185  ARG B CA    1 
ATOM   3177  C  C     . ARG B 1 185  ? 119.286 89.327  135.370 1.00 146.19 ? 185  ARG B C     1 
ATOM   3178  O  O     . ARG B 1 185  ? 119.757 88.758  136.360 1.00 146.19 ? 185  ARG B O     1 
ATOM   3179  C  CB    . ARG B 1 185  ? 120.117 91.661  135.011 1.00 146.19 ? 185  ARG B CB    1 
ATOM   3180  C  CG    . ARG B 1 185  ? 121.353 91.477  135.869 1.00 146.19 ? 185  ARG B CG    1 
ATOM   3181  C  CD    . ARG B 1 185  ? 122.529 92.250  135.300 1.00 146.19 ? 185  ARG B CD    1 
ATOM   3182  N  NE    . ARG B 1 185  ? 123.807 91.666  135.694 1.00 146.19 ? 185  ARG B NE    1 
ATOM   3183  C  CZ    . ARG B 1 185  ? 124.422 90.699  135.023 1.00 146.19 ? 185  ARG B CZ    1 
ATOM   3184  N  NH1   . ARG B 1 185  ? 123.878 90.204  133.920 1.00 146.19 ? 185  ARG B NH1   1 
ATOM   3185  N  NH2   . ARG B 1 185  ? 125.583 90.226  135.454 1.00 146.19 ? 185  ARG B NH2   1 
ATOM   3186  N  N     . LEU B 1 186  ? 119.057 88.715  134.211 1.00 148.62 ? 186  LEU B N     1 
ATOM   3187  C  CA    . LEU B 1 186  ? 119.466 87.343  133.929 1.00 148.62 ? 186  LEU B CA    1 
ATOM   3188  C  C     . LEU B 1 186  ? 120.206 87.347  132.599 1.00 148.62 ? 186  LEU B C     1 
ATOM   3189  O  O     . LEU B 1 186  ? 119.589 87.512  131.541 1.00 148.62 ? 186  LEU B O     1 
ATOM   3190  C  CB    . LEU B 1 186  ? 118.262 86.404  133.886 1.00 148.62 ? 186  LEU B CB    1 
ATOM   3191  C  CG    . LEU B 1 186  ? 118.524 84.992  133.361 1.00 148.62 ? 186  LEU B CG    1 
ATOM   3192  C  CD1   . LEU B 1 186  ? 119.205 84.146  134.423 1.00 148.62 ? 186  LEU B CD1   1 
ATOM   3193  C  CD2   . LEU B 1 186  ? 117.229 84.344  132.900 1.00 148.62 ? 186  LEU B CD2   1 
ATOM   3194  N  N     . GLY B 1 187  ? 121.518 87.170  132.650 1.00 152.84 ? 187  GLY B N     1 
ATOM   3195  C  CA    . GLY B 1 187  ? 122.304 87.230  131.430 1.00 152.84 ? 187  GLY B CA    1 
ATOM   3196  C  C     . GLY B 1 187  ? 122.434 88.664  130.958 1.00 152.84 ? 187  GLY B C     1 
ATOM   3197  O  O     . GLY B 1 187  ? 123.132 89.483  131.568 1.00 152.84 ? 187  GLY B O     1 
ATOM   3198  N  N     . GLN B 1 188  ? 121.754 88.987  129.857 1.00 160.04 ? 188  GLN B N     1 
ATOM   3199  C  CA    . GLN B 1 188  ? 121.822 90.340  129.317 1.00 160.04 ? 188  GLN B CA    1 
ATOM   3200  C  C     . GLN B 1 188  ? 120.537 91.123  129.558 1.00 160.04 ? 188  GLN B C     1 
ATOM   3201  O  O     . GLN B 1 188  ? 120.582 92.353  129.668 1.00 160.04 ? 188  GLN B O     1 
ATOM   3202  C  CB    . GLN B 1 188  ? 122.145 90.301  127.820 1.00 160.04 ? 188  GLN B CB    1 
ATOM   3203  C  CG    . GLN B 1 188  ? 121.072 89.670  126.939 1.00 160.04 ? 188  GLN B CG    1 
ATOM   3204  C  CD    . GLN B 1 188  ? 120.979 88.165  127.104 1.00 160.04 ? 188  GLN B CD    1 
ATOM   3205  O  OE1   . GLN B 1 188  ? 121.875 87.533  127.663 1.00 160.04 ? 188  GLN B OE1   1 
ATOM   3206  N  NE2   . GLN B 1 188  ? 119.889 87.583  126.618 1.00 160.04 ? 188  GLN B NE2   1 
ATOM   3207  N  N     . ARG B 1 189  ? 119.393 90.445  129.638 1.00 153.23 ? 189  ARG B N     1 
ATOM   3208  C  CA    . ARG B 1 189  ? 118.131 91.110  129.940 1.00 153.23 ? 189  ARG B CA    1 
ATOM   3209  C  C     . ARG B 1 189  ? 118.191 91.677  131.353 1.00 153.23 ? 189  ARG B C     1 
ATOM   3210  O  O     . ARG B 1 189  ? 118.434 90.938  132.312 1.00 153.23 ? 189  ARG B O     1 
ATOM   3211  C  CB    . ARG B 1 189  ? 116.961 90.141  129.799 1.00 153.23 ? 189  ARG B CB    1 
ATOM   3212  C  CG    . ARG B 1 189  ? 117.020 89.261  128.567 1.00 153.23 ? 189  ARG B CG    1 
ATOM   3213  C  CD    . ARG B 1 189  ? 116.275 87.958  128.797 1.00 153.23 ? 189  ARG B CD    1 
ATOM   3214  N  NE    . ARG B 1 189  ? 114.829 88.159  128.822 1.00 153.23 ? 189  ARG B NE    1 
ATOM   3215  C  CZ    . ARG B 1 189  ? 113.939 87.232  128.486 1.00 153.23 ? 189  ARG B CZ    1 
ATOM   3216  N  NH1   . ARG B 1 189  ? 112.643 87.505  128.540 1.00 153.23 ? 189  ARG B NH1   1 
ATOM   3217  N  NH2   . ARG B 1 189  ? 114.343 86.031  128.096 1.00 153.23 ? 189  ARG B NH2   1 
ATOM   3218  N  N     . THR B 1 190  ? 117.968 92.982  131.481 1.00 149.73 ? 190  THR B N     1 
ATOM   3219  C  CA    . THR B 1 190  ? 118.114 93.677  132.752 1.00 149.73 ? 190  THR B CA    1 
ATOM   3220  C  C     . THR B 1 190  ? 116.779 94.124  133.340 1.00 149.73 ? 190  THR B C     1 
ATOM   3221  O  O     . THR B 1 190  ? 116.761 94.760  134.398 1.00 149.73 ? 190  THR B O     1 
ATOM   3222  C  CB    . THR B 1 190  ? 119.043 94.886  132.576 1.00 149.73 ? 190  THR B CB    1 
ATOM   3223  O  OG1   . THR B 1 190  ? 120.086 94.549  131.653 1.00 149.73 ? 190  THR B OG1   1 
ATOM   3224  C  CG2   . THR B 1 190  ? 119.691 95.275  133.901 1.00 149.73 ? 190  THR B CG2   1 
ATOM   3225  N  N     . ASP B 1 191  ? 115.665 93.796  132.694 1.00 147.28 ? 191  ASP B N     1 
ATOM   3226  C  CA    . ASP B 1 191  ? 114.360 94.291  133.106 1.00 147.28 ? 191  ASP B CA    1 
ATOM   3227  C  C     . ASP B 1 191  ? 113.521 93.251  133.839 1.00 147.28 ? 191  ASP B C     1 
ATOM   3228  O  O     . ASP B 1 191  ? 112.310 93.444  133.977 1.00 147.28 ? 191  ASP B O     1 
ATOM   3229  C  CB    . ASP B 1 191  ? 113.587 94.806  131.890 1.00 147.28 ? 191  ASP B CB    1 
ATOM   3230  C  CG    . ASP B 1 191  ? 113.486 93.772  130.788 1.00 147.28 ? 191  ASP B CG    1 
ATOM   3231  O  OD1   . ASP B 1 191  ? 114.319 92.841  130.768 1.00 147.28 ? 191  ASP B OD1   1 
ATOM   3232  O  OD2   . ASP B 1 191  ? 112.574 93.888  129.943 1.00 147.28 ? 191  ASP B OD2   1 
ATOM   3233  N  N     . LEU B 1 192  ? 114.122 92.161  134.308 1.00 140.02 ? 192  LEU B N     1 
ATOM   3234  C  CA    . LEU B 1 192  ? 113.330 91.154  134.995 1.00 140.02 ? 192  LEU B CA    1 
ATOM   3235  C  C     . LEU B 1 192  ? 112.929 91.648  136.382 1.00 140.02 ? 192  LEU B C     1 
ATOM   3236  O  O     . LEU B 1 192  ? 113.539 92.557  136.947 1.00 140.02 ? 192  LEU B O     1 
ATOM   3237  C  CB    . LEU B 1 192  ? 114.099 89.839  135.098 1.00 140.02 ? 192  LEU B CB    1 
ATOM   3238  C  CG    . LEU B 1 192  ? 114.528 89.212  133.772 1.00 140.02 ? 192  LEU B CG    1 
ATOM   3239  C  CD1   . LEU B 1 192  ? 114.922 87.763  133.977 1.00 140.02 ? 192  LEU B CD1   1 
ATOM   3240  C  CD2   . LEU B 1 192  ? 113.419 89.321  132.741 1.00 140.02 ? 192  LEU B CD2   1 
ATOM   3241  N  N     . ASP B 1 193  ? 111.890 91.031  136.932 1.00 134.88 ? 193  ASP B N     1 
ATOM   3242  C  CA    . ASP B 1 193  ? 111.348 91.428  138.223 1.00 134.88 ? 193  ASP B CA    1 
ATOM   3243  C  C     . ASP B 1 193  ? 111.663 90.382  139.283 1.00 134.88 ? 193  ASP B C     1 
ATOM   3244  O  O     . ASP B 1 193  ? 111.767 89.189  138.985 1.00 134.88 ? 193  ASP B O     1 
ATOM   3245  C  CB    . ASP B 1 193  ? 109.836 91.637  138.138 1.00 134.88 ? 193  ASP B CB    1 
ATOM   3246  C  CG    . ASP B 1 193  ? 109.461 92.836  137.293 1.00 134.88 ? 193  ASP B CG    1 
ATOM   3247  O  OD1   . ASP B 1 193  ? 110.313 93.734  137.126 1.00 134.88 ? 193  ASP B OD1   1 
ATOM   3248  O  OD2   . ASP B 1 193  ? 108.315 92.883  136.798 1.00 134.88 ? 193  ASP B OD2   1 
ATOM   3249  N  N     . LYS B 1 194  ? 111.811 90.842  140.523 1.00 126.80 ? 194  LYS B N     1 
ATOM   3250  C  CA    . LYS B 1 194  ? 111.991 89.976  141.680 1.00 126.80 ? 194  LYS B CA    1 
ATOM   3251  C  C     . LYS B 1 194  ? 111.025 90.444  142.753 1.00 126.80 ? 194  LYS B C     1 
ATOM   3252  O  O     . LYS B 1 194  ? 111.070 91.611  143.160 1.00 126.80 ? 194  LYS B O     1 
ATOM   3253  C  CB    . LYS B 1 194  ? 113.433 90.023  142.190 1.00 126.80 ? 194  LYS B CB    1 
ATOM   3254  C  CG    . LYS B 1 194  ? 113.599 89.540  143.617 1.00 126.80 ? 194  LYS B CG    1 
ATOM   3255  C  CD    . LYS B 1 194  ? 114.959 89.922  144.172 1.00 126.80 ? 194  LYS B CD    1 
ATOM   3256  C  CE    . LYS B 1 194  ? 115.077 89.551  145.640 1.00 126.80 ? 194  LYS B CE    1 
ATOM   3257  N  NZ    . LYS B 1 194  ? 116.334 90.072  146.242 1.00 126.80 ? 194  LYS B NZ    1 
ATOM   3258  N  N     . LEU B 1 195  ? 110.146 89.549  143.195 1.00 118.74 ? 195  LEU B N     1 
ATOM   3259  C  CA    . LEU B 1 195  ? 109.098 89.886  144.146 1.00 118.74 ? 195  LEU B CA    1 
ATOM   3260  C  C     . LEU B 1 195  ? 109.468 89.352  145.522 1.00 118.74 ? 195  LEU B C     1 
ATOM   3261  O  O     . LEU B 1 195  ? 109.940 88.218  145.642 1.00 118.74 ? 195  LEU B O     1 
ATOM   3262  C  CB    . LEU B 1 195  ? 107.759 89.304  143.693 1.00 118.74 ? 195  LEU B CB    1 
ATOM   3263  C  CG    . LEU B 1 195  ? 106.633 89.199  144.720 1.00 118.74 ? 195  LEU B CG    1 
ATOM   3264  C  CD1   . LEU B 1 195  ? 106.168 90.578  145.149 1.00 118.74 ? 195  LEU B CD1   1 
ATOM   3265  C  CD2   . LEU B 1 195  ? 105.479 88.388  144.159 1.00 118.74 ? 195  LEU B CD2   1 
ATOM   3266  N  N     . THR B 1 196  ? 109.262 90.166  146.554 1.00 115.70 ? 196  THR B N     1 
ATOM   3267  C  CA    . THR B 1 196  ? 109.441 89.730  147.932 1.00 115.70 ? 196  THR B CA    1 
ATOM   3268  C  C     . THR B 1 196  ? 108.208 90.131  148.727 1.00 115.70 ? 196  THR B C     1 
ATOM   3269  O  O     . THR B 1 196  ? 107.690 91.240  148.567 1.00 115.70 ? 196  THR B O     1 
ATOM   3270  C  CB    . THR B 1 196  ? 110.713 90.317  148.551 1.00 115.70 ? 196  THR B CB    1 
ATOM   3271  O  OG1   . THR B 1 196  ? 110.774 89.968  149.940 1.00 115.70 ? 196  THR B OG1   1 
ATOM   3272  C  CG2   . THR B 1 196  ? 110.750 91.826  148.409 1.00 115.70 ? 196  THR B CG2   1 
ATOM   3273  N  N     . LEU B 1 197  ? 107.726 89.217  149.560 1.00 114.01 ? 197  LEU B N     1 
ATOM   3274  C  CA    . LEU B 1 197  ? 106.485 89.393  150.298 1.00 114.01 ? 197  LEU B CA    1 
ATOM   3275  C  C     . LEU B 1 197  ? 106.759 89.196  151.781 1.00 114.01 ? 197  LEU B C     1 
ATOM   3276  O  O     . LEU B 1 197  ? 107.188 88.114  152.195 1.00 114.01 ? 197  LEU B O     1 
ATOM   3277  C  CB    . LEU B 1 197  ? 105.428 88.402  149.806 1.00 114.01 ? 197  LEU B CB    1 
ATOM   3278  C  CG    . LEU B 1 197  ? 104.008 88.515  150.351 1.00 114.01 ? 197  LEU B CG    1 
ATOM   3279  C  CD1   . LEU B 1 197  ? 103.390 89.839  149.943 1.00 114.01 ? 197  LEU B CD1   1 
ATOM   3280  C  CD2   . LEU B 1 197  ? 103.168 87.354  149.854 1.00 114.01 ? 197  LEU B CD2   1 
ATOM   3281  N  N     . ARG B 1 198  ? 106.537 90.249  152.567 1.00 113.22 ? 198  ARG B N     1 
ATOM   3282  C  CA    . ARG B 1 198  ? 106.689 90.232  154.015 1.00 113.22 ? 198  ARG B CA    1 
ATOM   3283  C  C     . ARG B 1 198  ? 105.298 90.141  154.625 1.00 113.22 ? 198  ARG B C     1 
ATOM   3284  O  O     . ARG B 1 198  ? 104.414 90.935  154.282 1.00 113.22 ? 198  ARG B O     1 
ATOM   3285  C  CB    . ARG B 1 198  ? 107.417 91.490  154.498 1.00 113.22 ? 198  ARG B CB    1 
ATOM   3286  C  CG    . ARG B 1 198  ? 108.926 91.482  154.265 1.00 113.22 ? 198  ARG B CG    1 
ATOM   3287  C  CD    . ARG B 1 198  ? 109.494 92.898  154.155 1.00 113.22 ? 198  ARG B CD    1 
ATOM   3288  N  NE    . ARG B 1 198  ? 109.925 93.442  155.443 1.00 113.22 ? 198  ARG B NE    1 
ATOM   3289  C  CZ    . ARG B 1 198  ? 110.487 94.639  155.606 1.00 113.22 ? 198  ARG B CZ    1 
ATOM   3290  N  NH1   . ARG B 1 198  ? 110.845 95.049  156.816 1.00 113.22 ? 198  ARG B NH1   1 
ATOM   3291  N  NH2   . ARG B 1 198  ? 110.692 95.430  154.561 1.00 113.22 ? 198  ARG B NH2   1 
ATOM   3292  N  N     . ILE B 1 199  ? 105.101 89.175  155.519 1.00 112.80 ? 199  ILE B N     1 
ATOM   3293  C  CA    . ILE B 1 199  ? 103.792 88.881  156.089 1.00 112.80 ? 199  ILE B CA    1 
ATOM   3294  C  C     . ILE B 1 199  ? 103.918 88.789  157.603 1.00 112.80 ? 199  ILE B C     1 
ATOM   3295  O  O     . ILE B 1 199  ? 104.770 88.053  158.119 1.00 112.80 ? 199  ILE B O     1 
ATOM   3296  C  CB    . ILE B 1 199  ? 103.209 87.576  155.519 1.00 112.80 ? 199  ILE B CB    1 
ATOM   3297  C  CG1   . ILE B 1 199  ? 102.942 87.720  154.022 1.00 112.80 ? 199  ILE B CG1   1 
ATOM   3298  C  CG2   . ILE B 1 199  ? 101.932 87.206  156.245 1.00 112.80 ? 199  ILE B CG2   1 
ATOM   3299  C  CD1   . ILE B 1 199  ? 102.185 86.556  153.427 1.00 112.80 ? 199  ILE B CD1   1 
ATOM   3300  N  N     . TRP B 1 200  ? 103.068 89.536  158.309 1.00 114.67 ? 200  TRP B N     1 
ATOM   3301  C  CA    . TRP B 1 200  ? 102.916 89.447  159.756 1.00 114.67 ? 200  TRP B CA    1 
ATOM   3302  C  C     . TRP B 1 200  ? 101.533 88.893  160.055 1.00 114.67 ? 200  TRP B C     1 
ATOM   3303  O  O     . TRP B 1 200  ? 100.525 89.524  159.711 1.00 114.67 ? 200  TRP B O     1 
ATOM   3304  C  CB    . TRP B 1 200  ? 103.073 90.813  160.427 1.00 114.67 ? 200  TRP B CB    1 
ATOM   3305  C  CG    . TRP B 1 200  ? 104.412 91.448  160.292 1.00 114.67 ? 200  TRP B CG    1 
ATOM   3306  C  CD1   . TRP B 1 200  ? 105.408 91.459  161.221 1.00 114.67 ? 200  TRP B CD1   1 
ATOM   3307  C  CD2   . TRP B 1 200  ? 104.894 92.201  159.177 1.00 114.67 ? 200  TRP B CD2   1 
ATOM   3308  N  NE1   . TRP B 1 200  ? 106.488 92.160  160.747 1.00 114.67 ? 200  TRP B NE1   1 
ATOM   3309  C  CE2   . TRP B 1 200  ? 106.196 92.626  159.493 1.00 114.67 ? 200  TRP B CE2   1 
ATOM   3310  C  CE3   . TRP B 1 200  ? 104.354 92.548  157.938 1.00 114.67 ? 200  TRP B CE3   1 
ATOM   3311  C  CZ2   . TRP B 1 200  ? 106.967 93.381  158.615 1.00 114.67 ? 200  TRP B CZ2   1 
ATOM   3312  C  CZ3   . TRP B 1 200  ? 105.119 93.299  157.069 1.00 114.67 ? 200  TRP B CZ3   1 
ATOM   3313  C  CH2   . TRP B 1 200  ? 106.411 93.707  157.411 1.00 114.67 ? 200  TRP B CH2   1 
ATOM   3314  N  N     . THR B 1 201  ? 101.486 87.732  160.699 1.00 123.63 ? 201  THR B N     1 
ATOM   3315  C  CA    . THR B 1 201  ? 100.252 87.102  161.148 1.00 123.63 ? 201  THR B CA    1 
ATOM   3316  C  C     . THR B 1 201  ? 100.170 87.179  162.669 1.00 123.63 ? 201  THR B C     1 
ATOM   3317  O  O     . THR B 1 201  ? 101.008 87.796  163.329 1.00 123.63 ? 201  THR B O     1 
ATOM   3318  C  CB    . THR B 1 201  ? 100.167 85.649  160.676 1.00 123.63 ? 201  THR B CB    1 
ATOM   3319  O  OG1   . THR B 1 201  ? 100.949 84.818  161.542 1.00 123.63 ? 201  THR B OG1   1 
ATOM   3320  C  CG2   . THR B 1 201  ? 100.685 85.519  159.258 1.00 123.63 ? 201  THR B CG2   1 
ATOM   3321  N  N     . ASP B 1 202  ? 99.147  86.539  163.227 1.00 131.62 ? 202  ASP B N     1 
ATOM   3322  C  CA    . ASP B 1 202  ? 98.901  86.590  164.662 1.00 131.62 ? 202  ASP B CA    1 
ATOM   3323  C  C     . ASP B 1 202  ? 99.322  85.322  165.394 1.00 131.62 ? 202  ASP B C     1 
ATOM   3324  O  O     . ASP B 1 202  ? 99.296  85.303  166.628 1.00 131.62 ? 202  ASP B O     1 
ATOM   3325  C  CB    . ASP B 1 202  ? 97.420  86.874  164.932 1.00 131.62 ? 202  ASP B CB    1 
ATOM   3326  C  CG    . ASP B 1 202  ? 96.525  85.693  164.606 1.00 131.62 ? 202  ASP B CG    1 
ATOM   3327  O  OD1   . ASP B 1 202  ? 96.951  84.803  163.840 1.00 131.62 ? 202  ASP B OD1   1 
ATOM   3328  O  OD2   . ASP B 1 202  ? 95.388  85.653  165.120 1.00 131.62 ? 202  ASP B OD2   1 
ATOM   3329  N  N     . GLY B 1 203  ? 99.703  84.270  164.674 1.00 134.71 ? 203  GLY B N     1 
ATOM   3330  C  CA    . GLY B 1 203  ? 100.165 83.042  165.275 1.00 134.71 ? 203  GLY B CA    1 
ATOM   3331  C  C     . GLY B 1 203  ? 99.218  81.868  165.134 1.00 134.71 ? 203  GLY B C     1 
ATOM   3332  O  O     . GLY B 1 203  ? 99.676  80.719  165.148 1.00 134.71 ? 203  GLY B O     1 
ATOM   3333  N  N     . SER B 1 204  ? 97.915  82.120  165.007 1.00 137.14 ? 204  SER B N     1 
ATOM   3334  C  CA    . SER B 1 204  ? 96.973  81.025  164.799 1.00 137.14 ? 204  SER B CA    1 
ATOM   3335  C  C     . SER B 1 204  ? 97.209  80.358  163.451 1.00 137.14 ? 204  SER B C     1 
ATOM   3336  O  O     . SER B 1 204  ? 97.057  79.139  163.313 1.00 137.14 ? 204  SER B O     1 
ATOM   3337  C  CB    . SER B 1 204  ? 95.537  81.539  164.903 1.00 137.14 ? 204  SER B CB    1 
ATOM   3338  O  OG    . SER B 1 204  ? 95.239  82.429  163.842 1.00 137.14 ? 204  SER B OG    1 
ATOM   3339  N  N     . VAL B 1 205  ? 97.576  81.145  162.445 1.00 132.25 ? 205  VAL B N     1 
ATOM   3340  C  CA    . VAL B 1 205  ? 97.899  80.643  161.115 1.00 132.25 ? 205  VAL B CA    1 
ATOM   3341  C  C     . VAL B 1 205  ? 99.289  81.129  160.738 1.00 132.25 ? 205  VAL B C     1 
ATOM   3342  O  O     . VAL B 1 205  ? 99.557  82.337  160.736 1.00 132.25 ? 205  VAL B O     1 
ATOM   3343  C  CB    . VAL B 1 205  ? 96.857  81.100  160.076 1.00 132.25 ? 205  VAL B CB    1 
ATOM   3344  C  CG1   . VAL B 1 205  ? 97.008  80.305  158.793 1.00 132.25 ? 205  VAL B CG1   1 
ATOM   3345  C  CG2   . VAL B 1 205  ? 95.449  80.961  160.630 1.00 132.25 ? 205  VAL B CG2   1 
ATOM   3346  N  N     . THR B 1 206  ? 100.179 80.193  160.426 1.00 129.29 ? 206  THR B N     1 
ATOM   3347  C  CA    . THR B 1 206  ? 101.511 80.574  159.991 1.00 129.29 ? 206  THR B CA    1 
ATOM   3348  C  C     . THR B 1 206  ? 101.440 81.280  158.637 1.00 129.29 ? 206  THR B C     1 
ATOM   3349  O  O     . THR B 1 206  ? 100.488 81.080  157.878 1.00 129.29 ? 206  THR B O     1 
ATOM   3350  C  CB    . THR B 1 206  ? 102.412 79.349  159.888 1.00 129.29 ? 206  THR B CB    1 
ATOM   3351  O  OG1   . THR B 1 206  ? 101.910 78.467  158.879 1.00 129.29 ? 206  THR B OG1   1 
ATOM   3352  C  CG2   . THR B 1 206  ? 102.455 78.613  161.216 1.00 129.29 ? 206  THR B CG2   1 
ATOM   3353  N  N     . PRO B 1 207  ? 102.427 82.124  158.319 1.00 125.68 ? 207  PRO B N     1 
ATOM   3354  C  CA    . PRO B 1 207  ? 102.369 82.854  157.039 1.00 125.68 ? 207  PRO B CA    1 
ATOM   3355  C  C     . PRO B 1 207  ? 102.295 81.947  155.822 1.00 125.68 ? 207  PRO B C     1 
ATOM   3356  O  O     . PRO B 1 207  ? 101.625 82.287  154.837 1.00 125.68 ? 207  PRO B O     1 
ATOM   3357  C  CB    . PRO B 1 207  ? 103.657 83.688  157.060 1.00 125.68 ? 207  PRO B CB    1 
ATOM   3358  C  CG    . PRO B 1 207  ? 104.003 83.816  158.501 1.00 125.68 ? 207  PRO B CG    1 
ATOM   3359  C  CD    . PRO B 1 207  ? 103.586 82.528  159.132 1.00 125.68 ? 207  PRO B CD    1 
ATOM   3360  N  N     . LEU B 1 208  ? 102.975 80.799  155.857 1.00 127.00 ? 208  LEU B N     1 
ATOM   3361  C  CA    . LEU B 1 208  ? 102.952 79.893  154.714 1.00 127.00 ? 208  LEU B CA    1 
ATOM   3362  C  C     . LEU B 1 208  ? 101.544 79.376  154.445 1.00 127.00 ? 208  LEU B C     1 
ATOM   3363  O  O     . LEU B 1 208  ? 101.107 79.317  153.289 1.00 127.00 ? 208  LEU B O     1 
ATOM   3364  C  CB    . LEU B 1 208  ? 103.918 78.734  154.948 1.00 127.00 ? 208  LEU B CB    1 
ATOM   3365  C  CG    . LEU B 1 208  ? 104.199 77.848  153.735 1.00 127.00 ? 208  LEU B CG    1 
ATOM   3366  C  CD1   . LEU B 1 208  ? 104.565 78.695  152.529 1.00 127.00 ? 208  LEU B CD1   1 
ATOM   3367  C  CD2   . LEU B 1 208  ? 105.301 76.852  154.048 1.00 127.00 ? 208  LEU B CD2   1 
ATOM   3368  N  N     . GLU B 1 209  ? 100.819 78.996  155.500 1.00 130.40 ? 209  GLU B N     1 
ATOM   3369  C  CA    . GLU B 1 209  ? 99.447  78.531  155.323 1.00 130.40 ? 209  GLU B CA    1 
ATOM   3370  C  C     . GLU B 1 209  ? 98.563  79.639  154.767 1.00 130.40 ? 209  GLU B C     1 
ATOM   3371  O  O     . GLU B 1 209  ? 97.694  79.392  153.924 1.00 130.40 ? 209  GLU B O     1 
ATOM   3372  C  CB    . GLU B 1 209  ? 98.889  78.012  156.647 1.00 130.40 ? 209  GLU B CB    1 
ATOM   3373  C  CG    . GLU B 1 209  ? 99.663  76.854  157.247 1.00 130.40 ? 209  GLU B CG    1 
ATOM   3374  C  CD    . GLU B 1 209  ? 99.458  76.739  158.744 1.00 130.40 ? 209  GLU B CD    1 
ATOM   3375  O  OE1   . GLU B 1 209  ? 99.454  75.602  159.262 1.00 130.40 ? 209  GLU B OE1   1 
ATOM   3376  O  OE2   . GLU B 1 209  ? 99.302  77.788  159.404 1.00 130.40 ? 209  GLU B OE2   1 
ATOM   3377  N  N     . ALA B 1 210  ? 98.765  80.871  155.237 1.00 124.99 ? 210  ALA B N     1 
ATOM   3378  C  CA    . ALA B 1 210  ? 97.986  81.995  154.730 1.00 124.99 ? 210  ALA B CA    1 
ATOM   3379  C  C     . ALA B 1 210  ? 98.242  82.211  153.244 1.00 124.99 ? 210  ALA B C     1 
ATOM   3380  O  O     . ALA B 1 210  ? 97.306  82.411  152.462 1.00 124.99 ? 210  ALA B O     1 
ATOM   3381  C  CB    . ALA B 1 210  ? 98.312  83.260  155.524 1.00 124.99 ? 210  ALA B CB    1 
ATOM   3382  N  N     . LEU B 1 211  ? 99.511  82.170  152.837 1.00 120.45 ? 211  LEU B N     1 
ATOM   3383  C  CA    . LEU B 1 211  ? 99.848  82.334  151.426 1.00 120.45 ? 211  LEU B CA    1 
ATOM   3384  C  C     . LEU B 1 211  ? 99.244  81.215  150.585 1.00 120.45 ? 211  LEU B C     1 
ATOM   3385  O  O     . LEU B 1 211  ? 98.736  81.452  149.481 1.00 120.45 ? 211  LEU B O     1 
ATOM   3386  C  CB    . LEU B 1 211  ? 101.366 82.379  151.259 1.00 120.45 ? 211  LEU B CB    1 
ATOM   3387  C  CG    . LEU B 1 211  ? 101.901 82.619  149.850 1.00 120.45 ? 211  LEU B CG    1 
ATOM   3388  C  CD1   . LEU B 1 211  ? 101.344 83.911  149.283 1.00 120.45 ? 211  LEU B CD1   1 
ATOM   3389  C  CD2   . LEU B 1 211  ? 103.418 82.647  149.859 1.00 120.45 ? 211  LEU B CD2   1 
ATOM   3390  N  N     . ASN B 1 212  ? 99.297  79.982  151.094 1.00 122.72 ? 212  ASN B N     1 
ATOM   3391  C  CA    . ASN B 1 212  ? 98.723  78.857  150.365 1.00 122.72 ? 212  ASN B CA    1 
ATOM   3392  C  C     . ASN B 1 212  ? 97.217  79.014  150.204 1.00 122.72 ? 212  ASN B C     1 
ATOM   3393  O  O     . ASN B 1 212  ? 96.674  78.788  149.117 1.00 122.72 ? 212  ASN B O     1 
ATOM   3394  C  CB    . ASN B 1 212  ? 99.055  77.547  151.078 1.00 122.72 ? 212  ASN B CB    1 
ATOM   3395  C  CG    . ASN B 1 212  ? 100.488 77.116  150.861 1.00 122.72 ? 212  ASN B CG    1 
ATOM   3396  O  OD1   . ASN B 1 212  ? 101.194 77.671  150.020 1.00 122.72 ? 212  ASN B OD1   1 
ATOM   3397  N  ND2   . ASN B 1 212  ? 100.928 76.120  151.619 1.00 122.72 ? 212  ASN B ND2   1 
ATOM   3398  N  N     . GLN B 1 213  ? 96.524  79.409  151.273 1.00 124.48 ? 213  GLN B N     1 
ATOM   3399  C  CA    . GLN B 1 213  ? 95.084  79.613  151.177 1.00 124.48 ? 213  GLN B CA    1 
ATOM   3400  C  C     . GLN B 1 213  ? 94.755  80.757  150.227 1.00 124.48 ? 213  GLN B C     1 
ATOM   3401  O  O     . GLN B 1 213  ? 93.763  80.697  149.491 1.00 124.48 ? 213  GLN B O     1 
ATOM   3402  C  CB    . GLN B 1 213  ? 94.496  79.874  152.562 1.00 124.48 ? 213  GLN B CB    1 
ATOM   3403  C  CG    . GLN B 1 213  ? 94.579  78.682  153.496 1.00 124.48 ? 213  GLN B CG    1 
ATOM   3404  C  CD    . GLN B 1 213  ? 93.890  78.932  154.820 1.00 124.48 ? 213  GLN B CD    1 
ATOM   3405  O  OE1   . GLN B 1 213  ? 93.140  79.895  154.969 1.00 124.48 ? 213  GLN B OE1   1 
ATOM   3406  N  NE2   . GLN B 1 213  ? 94.142  78.063  155.791 1.00 124.48 ? 213  GLN B NE2   1 
ATOM   3407  N  N     . ALA B 1 214  ? 95.590  81.797  150.210 1.00 122.39 ? 214  ALA B N     1 
ATOM   3408  C  CA    . ALA B 1 214  ? 95.356  82.920  149.308 1.00 122.39 ? 214  ALA B CA    1 
ATOM   3409  C  C     . ALA B 1 214  ? 95.471  82.488  147.852 1.00 122.39 ? 214  ALA B C     1 
ATOM   3410  O  O     . ALA B 1 214  ? 94.593  82.787  147.032 1.00 122.39 ? 214  ALA B O     1 
ATOM   3411  C  CB    . ALA B 1 214  ? 96.336  84.051  149.615 1.00 122.39 ? 214  ALA B CB    1 
ATOM   3412  N  N     . VAL B 1 215  ? 96.555  81.788  147.507 1.00 121.54 ? 215  VAL B N     1 
ATOM   3413  C  CA    . VAL B 1 215  ? 96.725  81.366  146.118 1.00 121.54 ? 215  VAL B CA    1 
ATOM   3414  C  C     . VAL B 1 215  ? 95.657  80.348  145.738 1.00 121.54 ? 215  VAL B C     1 
ATOM   3415  O  O     . VAL B 1 215  ? 95.196  80.311  144.591 1.00 121.54 ? 215  VAL B O     1 
ATOM   3416  C  CB    . VAL B 1 215  ? 98.148  80.829  145.873 1.00 121.54 ? 215  VAL B CB    1 
ATOM   3417  C  CG1   . VAL B 1 215  ? 99.176  81.907  146.161 1.00 121.54 ? 215  VAL B CG1   1 
ATOM   3418  C  CG2   . VAL B 1 215  ? 98.422  79.591  146.699 1.00 121.54 ? 215  VAL B CG2   1 
ATOM   3419  N  N     . GLU B 1 216  ? 95.218  79.530  146.699 1.00 127.10 ? 216  GLU B N     1 
ATOM   3420  C  CA    . GLU B 1 216  ? 94.140  78.585  146.429 1.00 127.10 ? 216  GLU B CA    1 
ATOM   3421  C  C     . GLU B 1 216  ? 92.842  79.315  146.104 1.00 127.10 ? 216  GLU B C     1 
ATOM   3422  O  O     . GLU B 1 216  ? 92.137  78.960  145.152 1.00 127.10 ? 216  GLU B O     1 
ATOM   3423  C  CB    . GLU B 1 216  ? 93.952  77.657  147.628 1.00 127.10 ? 216  GLU B CB    1 
ATOM   3424  C  CG    . GLU B 1 216  ? 92.746  76.744  147.527 1.00 127.10 ? 216  GLU B CG    1 
ATOM   3425  C  CD    . GLU B 1 216  ? 92.710  75.973  146.225 1.00 127.10 ? 216  GLU B CD    1 
ATOM   3426  O  OE1   . GLU B 1 216  ? 91.645  75.958  145.573 1.00 127.10 ? 216  GLU B OE1   1 
ATOM   3427  O  OE2   . GLU B 1 216  ? 93.744  75.381  145.853 1.00 127.10 ? 216  GLU B OE2   1 
ATOM   3428  N  N     . ILE B 1 217  ? 92.510  80.339  146.894 1.00 123.16 ? 217  ILE B N     1 
ATOM   3429  C  CA    . ILE B 1 217  ? 91.300  81.119  146.644 1.00 123.16 ? 217  ILE B CA    1 
ATOM   3430  C  C     . ILE B 1 217  ? 91.382  81.799  145.284 1.00 123.16 ? 217  ILE B C     1 
ATOM   3431  O  O     . ILE B 1 217  ? 90.404  81.840  144.526 1.00 123.16 ? 217  ILE B O     1 
ATOM   3432  C  CB    . ILE B 1 217  ? 91.077  82.139  147.774 1.00 123.16 ? 217  ILE B CB    1 
ATOM   3433  C  CG1   . ILE B 1 217  ? 90.644  81.428  149.055 1.00 123.16 ? 217  ILE B CG1   1 
ATOM   3434  C  CG2   . ILE B 1 217  ? 90.045  83.177  147.370 1.00 123.16 ? 217  ILE B CG2   1 
ATOM   3435  C  CD1   . ILE B 1 217  ? 90.692  82.307  150.281 1.00 123.16 ? 217  ILE B CD1   1 
ATOM   3436  N  N     . LEU B 1 218  ? 92.557  82.338  144.951 1.00 119.89 ? 218  LEU B N     1 
ATOM   3437  C  CA    . LEU B 1 218  ? 92.705  83.020  143.670 1.00 119.89 ? 218  LEU B CA    1 
ATOM   3438  C  C     . LEU B 1 218  ? 92.538  82.051  142.505 1.00 119.89 ? 218  LEU B C     1 
ATOM   3439  O  O     . LEU B 1 218  ? 91.889  82.378  141.505 1.00 119.89 ? 218  LEU B O     1 
ATOM   3440  C  CB    . LEU B 1 218  ? 94.058  83.725  143.595 1.00 119.89 ? 218  LEU B CB    1 
ATOM   3441  C  CG    . LEU B 1 218  ? 94.201  84.717  142.441 1.00 119.89 ? 218  LEU B CG    1 
ATOM   3442  C  CD1   . LEU B 1 218  ? 92.981  85.616  142.352 1.00 119.89 ? 218  LEU B CD1   1 
ATOM   3443  C  CD2   . LEU B 1 218  ? 95.466  85.543  142.593 1.00 119.89 ? 218  LEU B CD2   1 
ATOM   3444  N  N     . ARG B 1 219  ? 93.110  80.851  142.618 1.00 124.69 ? 219  ARG B N     1 
ATOM   3445  C  CA    . ARG B 1 219  ? 92.946  79.853  141.565 1.00 124.69 ? 219  ARG B CA    1 
ATOM   3446  C  C     . ARG B 1 219  ? 91.487  79.432  141.432 1.00 124.69 ? 219  ARG B C     1 
ATOM   3447  O  O     . ARG B 1 219  ? 90.963  79.289  140.318 1.00 124.69 ? 219  ARG B O     1 
ATOM   3448  C  CB    . ARG B 1 219  ? 93.834  78.643  141.853 1.00 124.69 ? 219  ARG B CB    1 
ATOM   3449  C  CG    . ARG B 1 219  ? 93.809  77.586  140.768 1.00 124.69 ? 219  ARG B CG    1 
ATOM   3450  C  CD    . ARG B 1 219  ? 94.321  76.257  141.291 1.00 124.69 ? 219  ARG B CD    1 
ATOM   3451  N  NE    . ARG B 1 219  ? 93.537  75.783  142.428 1.00 124.69 ? 219  ARG B NE    1 
ATOM   3452  C  CZ    . ARG B 1 219  ? 92.340  75.216  142.328 1.00 124.69 ? 219  ARG B CZ    1 
ATOM   3453  N  NH1   . ARG B 1 219  ? 91.781  75.045  141.138 1.00 124.69 ? 219  ARG B NH1   1 
ATOM   3454  N  NH2   . ARG B 1 219  ? 91.701  74.817  143.418 1.00 124.69 ? 219  ARG B NH2   1 
ATOM   3455  N  N     . GLU B 1 220  ? 90.809  79.231  142.564 1.00 129.88 ? 220  GLU B N     1 
ATOM   3456  C  CA    . GLU B 1 220  ? 89.407  78.830  142.523 1.00 129.88 ? 220  GLU B CA    1 
ATOM   3457  C  C     . GLU B 1 220  ? 88.549  79.905  141.870 1.00 129.88 ? 220  GLU B C     1 
ATOM   3458  O  O     . GLU B 1 220  ? 87.609  79.602  141.126 1.00 129.88 ? 220  GLU B O     1 
ATOM   3459  C  CB    . GLU B 1 220  ? 88.907  78.520  143.933 1.00 129.88 ? 220  GLU B CB    1 
ATOM   3460  C  CG    . GLU B 1 220  ? 87.445  78.122  143.989 1.00 129.88 ? 220  GLU B CG    1 
ATOM   3461  C  CD    . GLU B 1 220  ? 86.939  77.959  145.406 1.00 129.88 ? 220  GLU B CD    1 
ATOM   3462  O  OE1   . GLU B 1 220  ? 87.775  77.887  146.331 1.00 129.88 ? 220  GLU B OE1   1 
ATOM   3463  O  OE2   . GLU B 1 220  ? 85.706  77.903  145.595 1.00 129.88 ? 220  GLU B OE2   1 
ATOM   3464  N  N     . HIS B 1 221  ? 88.857  81.176  142.139 1.00 128.08 ? 221  HIS B N     1 
ATOM   3465  C  CA    . HIS B 1 221  ? 88.111  82.253  141.496 1.00 128.08 ? 221  HIS B CA    1 
ATOM   3466  C  C     . HIS B 1 221  ? 88.426  82.350  140.010 1.00 128.08 ? 221  HIS B C     1 
ATOM   3467  O  O     . HIS B 1 221  ? 87.533  82.641  139.207 1.00 128.08 ? 221  HIS B O     1 
ATOM   3468  C  CB    . HIS B 1 221  ? 88.388  83.581  142.195 1.00 128.08 ? 221  HIS B CB    1 
ATOM   3469  C  CG    . HIS B 1 221  ? 87.400  83.906  143.269 1.00 128.08 ? 221  HIS B CG    1 
ATOM   3470  N  ND1   . HIS B 1 221  ? 87.487  83.388  144.543 1.00 128.08 ? 221  HIS B ND1   1 
ATOM   3471  C  CD2   . HIS B 1 221  ? 86.296  84.691  143.257 1.00 128.08 ? 221  HIS B CD2   1 
ATOM   3472  C  CE1   . HIS B 1 221  ? 86.481  83.840  145.270 1.00 128.08 ? 221  HIS B CE1   1 
ATOM   3473  N  NE2   . HIS B 1 221  ? 85.745  84.634  144.514 1.00 128.08 ? 221  HIS B NE2   1 
ATOM   3474  N  N     . LEU B 1 222  ? 89.683  82.119  139.623 1.00 125.29 ? 222  LEU B N     1 
ATOM   3475  C  CA    . LEU B 1 222  ? 90.012  82.075  138.202 1.00 125.29 ? 222  LEU B CA    1 
ATOM   3476  C  C     . LEU B 1 222  ? 89.275  80.949  137.491 1.00 125.29 ? 222  LEU B C     1 
ATOM   3477  O  O     . LEU B 1 222  ? 88.984  81.057  136.296 1.00 125.29 ? 222  LEU B O     1 
ATOM   3478  C  CB    . LEU B 1 222  ? 91.518  81.914  138.010 1.00 125.29 ? 222  LEU B CB    1 
ATOM   3479  C  CG    . LEU B 1 222  ? 92.376  83.164  138.175 1.00 125.29 ? 222  LEU B CG    1 
ATOM   3480  C  CD1   . LEU B 1 222  ? 93.824  82.831  137.879 1.00 125.29 ? 222  LEU B CD1   1 
ATOM   3481  C  CD2   . LEU B 1 222  ? 91.881  84.269  137.260 1.00 125.29 ? 222  LEU B CD2   1 
ATOM   3482  N  N     . THR B 1 223  ? 88.976  79.864  138.207 1.00 128.32 ? 223  THR B N     1 
ATOM   3483  C  CA    . THR B 1 223  ? 88.263  78.741  137.606 1.00 128.32 ? 223  THR B CA    1 
ATOM   3484  C  C     . THR B 1 223  ? 86.874  79.130  137.098 1.00 128.32 ? 223  THR B C     1 
ATOM   3485  O  O     . THR B 1 223  ? 86.355  78.477  136.187 1.00 128.32 ? 223  THR B O     1 
ATOM   3486  C  CB    . THR B 1 223  ? 88.159  77.600  138.624 1.00 128.32 ? 223  THR B CB    1 
ATOM   3487  O  OG1   . THR B 1 223  ? 89.474  77.218  139.043 1.00 128.32 ? 223  THR B OG1   1 
ATOM   3488  C  CG2   . THR B 1 223  ? 87.473  76.382  138.023 1.00 128.32 ? 223  THR B CG2   1 
ATOM   3489  N  N     . TYR B 1 224  ? 86.283  80.203  137.628 1.00 132.00 ? 224  TYR B N     1 
ATOM   3490  C  CA    . TYR B 1 224  ? 84.899  80.565  137.330 1.00 132.00 ? 224  TYR B CA    1 
ATOM   3491  C  C     . TYR B 1 224  ? 84.666  80.992  135.884 1.00 132.00 ? 224  TYR B C     1 
ATOM   3492  O  O     . TYR B 1 224  ? 83.504  81.163  135.500 1.00 132.00 ? 224  TYR B O     1 
ATOM   3493  C  CB    . TYR B 1 224  ? 84.440  81.689  138.261 1.00 132.00 ? 224  TYR B CB    1 
ATOM   3494  C  CG    . TYR B 1 224  ? 84.203  81.252  139.686 1.00 132.00 ? 224  TYR B CG    1 
ATOM   3495  C  CD1   . TYR B 1 224  ? 83.845  79.945  139.981 1.00 132.00 ? 224  TYR B CD1   1 
ATOM   3496  C  CD2   . TYR B 1 224  ? 84.333  82.149  140.736 1.00 132.00 ? 224  TYR B CD2   1 
ATOM   3497  C  CE1   . TYR B 1 224  ? 83.628  79.543  141.283 1.00 132.00 ? 224  TYR B CE1   1 
ATOM   3498  C  CE2   . TYR B 1 224  ? 84.117  81.757  142.040 1.00 132.00 ? 224  TYR B CE2   1 
ATOM   3499  C  CZ    . TYR B 1 224  ? 83.764  80.453  142.308 1.00 132.00 ? 224  TYR B CZ    1 
ATOM   3500  O  OH    . TYR B 1 224  ? 83.548  80.058  143.607 1.00 132.00 ? 224  TYR B OH    1 
ATOM   3501  N  N     . PHE B 1 225  ? 85.708  81.167  135.078 1.00 126.87 ? 225  PHE B N     1 
ATOM   3502  C  CA    . PHE B 1 225  ? 85.568  81.686  133.723 1.00 126.87 ? 225  PHE B CA    1 
ATOM   3503  C  C     . PHE B 1 225  ? 85.308  80.601  132.684 1.00 126.87 ? 225  PHE B C     1 
ATOM   3504  O  O     . PHE B 1 225  ? 85.609  80.810  131.505 1.00 126.87 ? 225  PHE B O     1 
ATOM   3505  C  CB    . PHE B 1 225  ? 86.818  82.475  133.331 1.00 126.87 ? 225  PHE B CB    1 
ATOM   3506  C  CG    . PHE B 1 225  ? 86.865  83.860  133.903 1.00 126.87 ? 225  PHE B CG    1 
ATOM   3507  C  CD1   . PHE B 1 225  ? 87.521  84.109  135.094 1.00 126.87 ? 225  PHE B CD1   1 
ATOM   3508  C  CD2   . PHE B 1 225  ? 86.254  84.913  133.246 1.00 126.87 ? 225  PHE B CD2   1 
ATOM   3509  C  CE1   . PHE B 1 225  ? 87.567  85.383  135.621 1.00 126.87 ? 225  PHE B CE1   1 
ATOM   3510  C  CE2   . PHE B 1 225  ? 86.296  86.189  133.769 1.00 126.87 ? 225  PHE B CE2   1 
ATOM   3511  C  CZ    . PHE B 1 225  ? 86.953  86.425  134.958 1.00 126.87 ? 225  PHE B CZ    1 
ATOM   3512  N  N     . SER B 1 226  ? 84.762  79.452  133.085 1.00 140.10 ? 226  SER B N     1 
ATOM   3513  C  CA    . SER B 1 226  ? 84.679  78.319  132.167 1.00 140.10 ? 226  SER B CA    1 
ATOM   3514  C  C     . SER B 1 226  ? 83.372  78.320  131.381 1.00 140.10 ? 226  SER B C     1 
ATOM   3515  O  O     . SER B 1 226  ? 83.377  78.372  130.146 1.00 140.10 ? 226  SER B O     1 
ATOM   3516  C  CB    . SER B 1 226  ? 84.839  77.010  132.941 1.00 140.10 ? 226  SER B CB    1 
ATOM   3517  O  OG    . SER B 1 226  ? 84.719  75.893  132.077 1.00 140.10 ? 226  SER B OG    1 
ATOM   3518  N  N     . ASN B 1 227  ? 82.240  78.262  132.076 1.00 146.17 ? 227  ASN B N     1 
ATOM   3519  C  CA    . ASN B 1 227  ? 80.962  78.000  131.422 1.00 146.17 ? 227  ASN B CA    1 
ATOM   3520  C  C     . ASN B 1 227  ? 80.184  79.288  131.199 1.00 146.17 ? 227  ASN B C     1 
ATOM   3521  O  O     . ASN B 1 227  ? 79.882  80.000  132.170 1.00 146.17 ? 227  ASN B O     1 
ATOM   3522  C  CB    . ASN B 1 227  ? 80.132  77.019  132.251 1.00 146.17 ? 227  ASN B CB    1 
ATOM   3523  C  CG    . ASN B 1 227  ? 80.618  75.592  132.119 1.00 146.17 ? 227  ASN B CG    1 
ATOM   3524  O  OD1   . ASN B 1 227  ? 80.944  75.134  131.024 1.00 146.17 ? 227  ASN B OD1   1 
ATOM   3525  N  ND2   . ASN B 1 227  ? 80.672  74.880  133.238 1.00 146.17 ? 227  ASN B ND2   1 
ATOM   3526  N  N     . PRO B 1 228  ? 79.836  79.631  129.950 1.00 145.39 ? 228  PRO B N     1 
ATOM   3527  C  CA    . PRO B 1 228  ? 78.992  80.787  129.629 1.00 145.39 ? 228  PRO B CA    1 
ATOM   3528  C  C     . PRO B 1 228  ? 77.558  80.614  130.123 1.00 145.39 ? 228  PRO B C     1 
ATOM   3529  O  O     . PRO B 1 228  ? 76.632  81.028  129.426 1.00 145.39 ? 228  PRO B O     1 
ATOM   3530  C  CB    . PRO B 1 228  ? 79.036  80.841  128.098 1.00 145.39 ? 228  PRO B CB    1 
ATOM   3531  C  CG    . PRO B 1 228  ? 80.268  80.083  127.723 1.00 145.39 ? 228  PRO B CG    1 
ATOM   3532  C  CD    . PRO B 1 228  ? 80.362  78.989  128.735 1.00 145.39 ? 228  PRO B CD    1 
ATOM   3533  N  N     . MET C 2 1    ? 89.325  117.773 110.565 1.00 137.33 ? 1    MET C N     1 
ATOM   3534  C  CA    . MET C 2 1    ? 88.506  118.137 111.714 1.00 137.33 ? 1    MET C CA    1 
ATOM   3535  C  C     . MET C 2 1    ? 88.097  119.604 111.648 1.00 137.33 ? 1    MET C C     1 
ATOM   3536  O  O     . MET C 2 1    ? 88.698  120.394 110.921 1.00 137.33 ? 1    MET C O     1 
ATOM   3537  C  CB    . MET C 2 1    ? 89.255  117.856 113.017 1.00 137.33 ? 1    MET C CB    1 
ATOM   3538  C  CG    . MET C 2 1    ? 90.356  118.853 113.325 1.00 137.33 ? 1    MET C CG    1 
ATOM   3539  S  SD    . MET C 2 1    ? 91.514  119.066 111.960 1.00 137.33 ? 1    MET C SD    1 
ATOM   3540  C  CE    . MET C 2 1    ? 92.435  117.534 112.055 1.00 137.33 ? 1    MET C CE    1 
ATOM   3541  N  N     . GLU C 2 2    ? 87.068  119.961 112.410 1.00 129.81 ? 2    GLU C N     1 
ATOM   3542  C  CA    . GLU C 2 2    ? 86.577  121.330 112.412 1.00 129.81 ? 2    GLU C CA    1 
ATOM   3543  C  C     . GLU C 2 2    ? 87.572  122.261 113.097 1.00 129.81 ? 2    GLU C C     1 
ATOM   3544  O  O     . GLU C 2 2    ? 88.335  121.856 113.979 1.00 129.81 ? 2    GLU C O     1 
ATOM   3545  C  CB    . GLU C 2 2    ? 85.218  121.405 113.107 1.00 129.81 ? 2    GLU C CB    1 
ATOM   3546  C  CG    . GLU C 2 2    ? 84.291  122.474 112.553 1.00 129.81 ? 2    GLU C CG    1 
ATOM   3547  C  CD    . GLU C 2 2    ? 84.467  123.813 113.238 1.00 129.81 ? 2    GLU C CD    1 
ATOM   3548  O  OE1   . GLU C 2 2    ? 83.953  124.824 112.713 1.00 129.81 ? 2    GLU C OE1   1 
ATOM   3549  O  OE2   . GLU C 2 2    ? 85.117  123.856 114.303 1.00 129.81 ? 2    GLU C OE2   1 
ATOM   3550  N  N     . ILE C 2 3    ? 87.568  123.520 112.664 1.00 119.85 ? 3    ILE C N     1 
ATOM   3551  C  CA    . ILE C 2 3    ? 88.427  124.561 113.217 1.00 119.85 ? 3    ILE C CA    1 
ATOM   3552  C  C     . ILE C 2 3    ? 87.522  125.669 113.735 1.00 119.85 ? 3    ILE C C     1 
ATOM   3553  O  O     . ILE C 2 3    ? 86.841  126.337 112.947 1.00 119.85 ? 3    ILE C O     1 
ATOM   3554  C  CB    . ILE C 2 3    ? 89.416  125.112 112.182 1.00 119.85 ? 3    ILE C CB    1 
ATOM   3555  C  CG1   . ILE C 2 3    ? 90.384  124.018 111.727 1.00 119.85 ? 3    ILE C CG1   1 
ATOM   3556  C  CG2   . ILE C 2 3    ? 90.167  126.307 112.751 1.00 119.85 ? 3    ILE C CG2   1 
ATOM   3557  C  CD1   . ILE C 2 3    ? 91.599  123.865 112.611 1.00 119.85 ? 3    ILE C CD1   1 
ATOM   3558  N  N     . LYS C 2 4    ? 87.510  125.866 115.048 1.00 118.58 ? 4    LYS C N     1 
ATOM   3559  C  CA    . LYS C 2 4    ? 86.737  126.930 115.674 1.00 118.58 ? 4    LYS C CA    1 
ATOM   3560  C  C     . LYS C 2 4    ? 87.706  127.995 116.171 1.00 118.58 ? 4    LYS C C     1 
ATOM   3561  O  O     . LYS C 2 4    ? 88.781  127.667 116.682 1.00 118.58 ? 4    LYS C O     1 
ATOM   3562  C  CB    . LYS C 2 4    ? 85.891  126.384 116.822 1.00 118.58 ? 4    LYS C CB    1 
ATOM   3563  C  CG    . LYS C 2 4    ? 84.917  127.387 117.410 1.00 118.58 ? 4    LYS C CG    1 
ATOM   3564  C  CD    . LYS C 2 4    ? 84.128  126.775 118.554 1.00 118.58 ? 4    LYS C CD    1 
ATOM   3565  C  CE    . LYS C 2 4    ? 82.999  127.688 118.996 1.00 118.58 ? 4    LYS C CE    1 
ATOM   3566  N  NZ    . LYS C 2 4    ? 83.464  129.087 119.191 1.00 118.58 ? 4    LYS C NZ    1 
ATOM   3567  N  N     . ARG C 2 5    ? 87.336  129.261 116.019 1.00 122.69 ? 5    ARG C N     1 
ATOM   3568  C  CA    . ARG C 2 5    ? 88.211  130.361 116.390 1.00 122.69 ? 5    ARG C CA    1 
ATOM   3569  C  C     . ARG C 2 5    ? 87.440  131.436 117.142 1.00 122.69 ? 5    ARG C C     1 
ATOM   3570  O  O     . ARG C 2 5    ? 86.328  131.808 116.756 1.00 122.69 ? 5    ARG C O     1 
ATOM   3571  C  CB    . ARG C 2 5    ? 88.890  130.964 115.160 1.00 122.69 ? 5    ARG C CB    1 
ATOM   3572  C  CG    . ARG C 2 5    ? 87.947  131.439 114.077 1.00 122.69 ? 5    ARG C CG    1 
ATOM   3573  C  CD    . ARG C 2 5    ? 88.741  131.992 112.911 1.00 122.69 ? 5    ARG C CD    1 
ATOM   3574  N  NE    . ARG C 2 5    ? 89.641  133.057 113.342 1.00 122.69 ? 5    ARG C NE    1 
ATOM   3575  C  CZ    . ARG C 2 5    ? 90.808  133.325 112.768 1.00 122.69 ? 5    ARG C CZ    1 
ATOM   3576  N  NH1   . ARG C 2 5    ? 91.223  132.602 111.737 1.00 122.69 ? 5    ARG C NH1   1 
ATOM   3577  N  NH2   . ARG C 2 5    ? 91.563  134.314 113.227 1.00 122.69 ? 5    ARG C NH2   1 
ATOM   3578  N  N     . PHE C 2 6    ? 88.040  131.923 118.222 1.00 121.46 ? 6    PHE C N     1 
ATOM   3579  C  CA    . PHE C 2 6    ? 87.469  132.971 119.046 1.00 121.46 ? 6    PHE C CA    1 
ATOM   3580  C  C     . PHE C 2 6    ? 88.097  134.314 118.682 1.00 121.46 ? 6    PHE C C     1 
ATOM   3581  O  O     . PHE C 2 6    ? 88.884  134.428 117.740 1.00 121.46 ? 6    PHE C O     1 
ATOM   3582  C  CB    . PHE C 2 6    ? 87.674  132.645 120.525 1.00 121.46 ? 6    PHE C CB    1 
ATOM   3583  C  CG    . PHE C 2 6    ? 86.961  131.404 120.973 1.00 121.46 ? 6    PHE C CG    1 
ATOM   3584  C  CD1   . PHE C 2 6    ? 85.615  131.438 121.286 1.00 121.46 ? 6    PHE C CD1   1 
ATOM   3585  C  CD2   . PHE C 2 6    ? 87.637  130.200 121.073 1.00 121.46 ? 6    PHE C CD2   1 
ATOM   3586  C  CE1   . PHE C 2 6    ? 84.958  130.298 121.700 1.00 121.46 ? 6    PHE C CE1   1 
ATOM   3587  C  CE2   . PHE C 2 6    ? 86.985  129.057 121.486 1.00 121.46 ? 6    PHE C CE2   1 
ATOM   3588  C  CZ    . PHE C 2 6    ? 85.643  129.106 121.797 1.00 121.46 ? 6    PHE C CZ    1 
ATOM   3589  N  N     . GLY C 2 7    ? 87.740  135.345 119.441 1.00 127.85 ? 7    GLY C N     1 
ATOM   3590  C  CA    . GLY C 2 7    ? 88.301  136.664 119.220 1.00 127.85 ? 7    GLY C CA    1 
ATOM   3591  C  C     . GLY C 2 7    ? 87.368  137.599 118.481 1.00 127.85 ? 7    GLY C C     1 
ATOM   3592  O  O     . GLY C 2 7    ? 86.651  137.177 117.568 1.00 127.85 ? 7    GLY C O     1 
ATOM   3593  N  N     . ARG C 2 8    ? 87.369  138.873 118.864 1.00 131.35 ? 8    ARG C N     1 
ATOM   3594  C  CA    . ARG C 2 8    ? 86.507  139.873 118.252 1.00 131.35 ? 8    ARG C CA    1 
ATOM   3595  C  C     . ARG C 2 8    ? 87.279  141.013 117.603 1.00 131.35 ? 8    ARG C C     1 
ATOM   3596  O  O     . ARG C 2 8    ? 86.696  141.771 116.823 1.00 131.35 ? 8    ARG C O     1 
ATOM   3597  C  CB    . ARG C 2 8    ? 85.536  140.437 119.292 1.00 131.35 ? 8    ARG C CB    1 
ATOM   3598  C  CG    . ARG C 2 8    ? 86.212  141.184 120.427 1.00 131.35 ? 8    ARG C CG    1 
ATOM   3599  C  CD    . ARG C 2 8    ? 85.314  141.248 121.652 1.00 131.35 ? 8    ARG C CD    1 
ATOM   3600  N  NE    . ARG C 2 8    ? 84.583  140.002 121.862 1.00 131.35 ? 8    ARG C NE    1 
ATOM   3601  C  CZ    . ARG C 2 8    ? 85.112  138.901 122.388 1.00 131.35 ? 8    ARG C CZ    1 
ATOM   3602  N  NH1   . ARG C 2 8    ? 86.384  138.887 122.764 1.00 131.35 ? 8    ARG C NH1   1 
ATOM   3603  N  NH2   . ARG C 2 8    ? 84.369  137.814 122.540 1.00 131.35 ? 8    ARG C NH2   1 
ATOM   3604  N  N     . ILE C 2 9    ? 88.566  141.155 117.902 1.00 129.77 ? 9    ILE C N     1 
ATOM   3605  C  CA    . ILE C 2 9    ? 89.377  142.213 117.309 1.00 129.77 ? 9    ILE C CA    1 
ATOM   3606  C  C     . ILE C 2 9    ? 89.597  141.892 115.837 1.00 129.77 ? 9    ILE C C     1 
ATOM   3607  O  O     . ILE C 2 9    ? 90.154  140.844 115.495 1.00 129.77 ? 9    ILE C O     1 
ATOM   3608  C  CB    . ILE C 2 9    ? 90.714  142.366 118.045 1.00 129.77 ? 9    ILE C CB    1 
ATOM   3609  C  CG1   . ILE C 2 9    ? 90.477  142.750 119.506 1.00 129.77 ? 9    ILE C CG1   1 
ATOM   3610  C  CG2   . ILE C 2 9    ? 91.582  143.403 117.353 1.00 129.77 ? 9    ILE C CG2   1 
ATOM   3611  C  CD1   . ILE C 2 9    ? 91.749  142.972 120.289 1.00 129.77 ? 9    ILE C CD1   1 
ATOM   3612  N  N     . ARG C 2 10   ? 89.161  142.795 114.965 1.00 135.64 ? 10   ARG C N     1 
ATOM   3613  C  CA    . ARG C 2 10   ? 89.283  142.623 113.523 1.00 135.64 ? 10   ARG C CA    1 
ATOM   3614  C  C     . ARG C 2 10   ? 90.453  143.460 113.023 1.00 135.64 ? 10   ARG C C     1 
ATOM   3615  O  O     . ARG C 2 10   ? 90.433  144.691 113.130 1.00 135.64 ? 10   ARG C O     1 
ATOM   3616  C  CB    . ARG C 2 10   ? 87.987  143.025 112.821 1.00 135.64 ? 10   ARG C CB    1 
ATOM   3617  C  CG    . ARG C 2 10   ? 87.951  142.698 111.340 1.00 135.64 ? 10   ARG C CG    1 
ATOM   3618  C  CD    . ARG C 2 10   ? 87.965  143.966 110.506 1.00 135.64 ? 10   ARG C CD    1 
ATOM   3619  N  NE    . ARG C 2 10   ? 87.041  144.966 111.031 1.00 135.64 ? 10   ARG C NE    1 
ATOM   3620  C  CZ    . ARG C 2 10   ? 86.886  146.182 110.518 1.00 135.64 ? 10   ARG C CZ    1 
ATOM   3621  N  NH1   . ARG C 2 10   ? 86.022  147.028 111.061 1.00 135.64 ? 10   ARG C NH1   1 
ATOM   3622  N  NH2   . ARG C 2 10   ? 87.595  146.553 109.461 1.00 135.64 ? 10   ARG C NH2   1 
ATOM   3623  N  N     . GLU C 2 11   ? 91.467  142.793 112.479 1.00 130.49 ? 11   GLU C N     1 
ATOM   3624  C  CA    . GLU C 2 11   ? 92.681  143.457 112.022 1.00 130.49 ? 11   GLU C CA    1 
ATOM   3625  C  C     . GLU C 2 11   ? 92.457  144.013 110.622 1.00 130.49 ? 11   GLU C C     1 
ATOM   3626  O  O     . GLU C 2 11   ? 91.934  143.316 109.747 1.00 130.49 ? 11   GLU C O     1 
ATOM   3627  C  CB    . GLU C 2 11   ? 93.861  142.488 112.038 1.00 130.49 ? 11   GLU C CB    1 
ATOM   3628  C  CG    . GLU C 2 11   ? 94.107  141.845 113.391 1.00 130.49 ? 11   GLU C CG    1 
ATOM   3629  C  CD    . GLU C 2 11   ? 94.805  140.505 113.282 1.00 130.49 ? 11   GLU C CD    1 
ATOM   3630  O  OE1   . GLU C 2 11   ? 94.450  139.720 112.378 1.00 130.49 ? 11   GLU C OE1   1 
ATOM   3631  O  OE2   . GLU C 2 11   ? 95.708  140.237 114.102 1.00 130.49 ? 11   GLU C OE2   1 
ATOM   3632  N  N     . VAL C 2 12   ? 92.856  145.270 110.413 1.00 123.77 ? 12   VAL C N     1 
ATOM   3633  C  CA    . VAL C 2 12   ? 92.620  145.921 109.131 1.00 123.77 ? 12   VAL C CA    1 
ATOM   3634  C  C     . VAL C 2 12   ? 93.717  145.621 108.120 1.00 123.77 ? 12   VAL C C     1 
ATOM   3635  O  O     . VAL C 2 12   ? 93.501  145.789 106.915 1.00 123.77 ? 12   VAL C O     1 
ATOM   3636  C  CB    . VAL C 2 12   ? 92.475  147.441 109.323 1.00 123.77 ? 12   VAL C CB    1 
ATOM   3637  C  CG1   . VAL C 2 12   ? 91.243  147.752 110.153 1.00 123.77 ? 12   VAL C CG1   1 
ATOM   3638  C  CG2   . VAL C 2 12   ? 93.721  148.010 109.976 1.00 123.77 ? 12   VAL C CG2   1 
ATOM   3639  N  N     . ILE C 2 13   ? 94.891  145.186 108.568 1.00 116.32 ? 13   ILE C N     1 
ATOM   3640  C  CA    . ILE C 2 13   ? 96.006  144.942 107.657 1.00 116.32 ? 13   ILE C CA    1 
ATOM   3641  C  C     . ILE C 2 13   ? 96.635  143.586 107.952 1.00 116.32 ? 13   ILE C C     1 
ATOM   3642  O  O     . ILE C 2 13   ? 96.710  143.175 109.119 1.00 116.32 ? 13   ILE C O     1 
ATOM   3643  C  CB    . ILE C 2 13   ? 97.058  146.059 107.750 1.00 116.32 ? 13   ILE C CB    1 
ATOM   3644  C  CG1   . ILE C 2 13   ? 97.482  146.272 109.204 1.00 116.32 ? 13   ILE C CG1   1 
ATOM   3645  C  CG2   . ILE C 2 13   ? 96.525  147.347 107.150 1.00 116.32 ? 13   ILE C CG2   1 
ATOM   3646  C  CD1   . ILE C 2 13   ? 98.721  147.118 109.356 1.00 116.32 ? 13   ILE C CD1   1 
ATOM   3647  N  N     . PRO C 2 14   ? 97.089  142.859 106.938 1.00 111.52 ? 14   PRO C N     1 
ATOM   3648  C  CA    . PRO C 2 14   ? 97.828  141.621 107.184 1.00 111.52 ? 14   PRO C CA    1 
ATOM   3649  C  C     . PRO C 2 14   ? 99.286  141.905 107.509 1.00 111.52 ? 14   PRO C C     1 
ATOM   3650  O  O     . PRO C 2 14   ? 99.805  142.996 107.271 1.00 111.52 ? 14   PRO C O     1 
ATOM   3651  C  CB    . PRO C 2 14   ? 97.696  140.871 105.857 1.00 111.52 ? 14   PRO C CB    1 
ATOM   3652  C  CG    . PRO C 2 14   ? 97.639  141.964 104.847 1.00 111.52 ? 14   PRO C CG    1 
ATOM   3653  C  CD    . PRO C 2 14   ? 96.877  143.096 105.500 1.00 111.52 ? 14   PRO C CD    1 
ATOM   3654  N  N     . LEU C 2 15   ? 99.940  140.895 108.070 1.00 109.22 ? 15   LEU C N     1 
ATOM   3655  C  CA    . LEU C 2 15   ? 101.346 141.030 108.413 1.00 109.22 ? 15   LEU C CA    1 
ATOM   3656  C  C     . LEU C 2 15   ? 102.169 141.295 107.155 1.00 109.22 ? 15   LEU C C     1 
ATOM   3657  O  O     . LEU C 2 15   ? 101.874 140.740 106.090 1.00 109.22 ? 15   LEU C O     1 
ATOM   3658  C  CB    . LEU C 2 15   ? 101.858 139.771 109.112 1.00 109.22 ? 15   LEU C CB    1 
ATOM   3659  C  CG    . LEU C 2 15   ? 101.793 139.731 110.639 1.00 109.22 ? 15   LEU C CG    1 
ATOM   3660  C  CD1   . LEU C 2 15   ? 100.361 139.842 111.131 1.00 109.22 ? 15   LEU C CD1   1 
ATOM   3661  C  CD2   . LEU C 2 15   ? 102.447 138.467 111.163 1.00 109.22 ? 15   LEU C CD2   1 
ATOM   3662  N  N     . PRO C 2 16   ? 103.199 142.130 107.236 1.00 106.94 ? 16   PRO C N     1 
ATOM   3663  C  CA    . PRO C 2 16   ? 104.070 142.356 106.083 1.00 106.94 ? 16   PRO C CA    1 
ATOM   3664  C  C     . PRO C 2 16   ? 104.897 141.119 105.788 1.00 106.94 ? 16   PRO C C     1 
ATOM   3665  O  O     . PRO C 2 16   ? 104.917 140.176 106.593 1.00 106.94 ? 16   PRO C O     1 
ATOM   3666  C  CB    . PRO C 2 16   ? 104.959 143.527 106.535 1.00 106.94 ? 16   PRO C CB    1 
ATOM   3667  C  CG    . PRO C 2 16   ? 104.281 144.102 107.741 1.00 106.94 ? 16   PRO C CG    1 
ATOM   3668  C  CD    . PRO C 2 16   ? 103.594 142.951 108.390 1.00 106.94 ? 16   PRO C CD    1 
ATOM   3669  N  N     . PRO C 2 17   ? 105.572 141.069 104.640 1.00 109.33 ? 17   PRO C N     1 
ATOM   3670  C  CA    . PRO C 2 17   ? 106.507 139.965 104.390 1.00 109.33 ? 17   PRO C CA    1 
ATOM   3671  C  C     . PRO C 2 17   ? 107.545 139.881 105.499 1.00 109.33 ? 17   PRO C C     1 
ATOM   3672  O  O     . PRO C 2 17   ? 108.288 140.831 105.752 1.00 109.33 ? 17   PRO C O     1 
ATOM   3673  C  CB    . PRO C 2 17   ? 107.137 140.334 103.044 1.00 109.33 ? 17   PRO C CB    1 
ATOM   3674  C  CG    . PRO C 2 17   ? 106.100 141.164 102.373 1.00 109.33 ? 17   PRO C CG    1 
ATOM   3675  C  CD    . PRO C 2 17   ? 105.433 141.948 103.466 1.00 109.33 ? 17   PRO C CD    1 
ATOM   3676  N  N     . LEU C 2 18   ? 107.584 138.726 106.167 1.00 105.59 ? 18   LEU C N     1 
ATOM   3677  C  CA    . LEU C 2 18   ? 108.363 138.602 107.394 1.00 105.59 ? 18   LEU C CA    1 
ATOM   3678  C  C     . LEU C 2 18   ? 109.858 138.754 107.148 1.00 105.59 ? 18   LEU C C     1 
ATOM   3679  O  O     . LEU C 2 18   ? 110.605 139.071 108.080 1.00 105.59 ? 18   LEU C O     1 
ATOM   3680  C  CB    . LEU C 2 18   ? 108.066 137.263 108.063 1.00 105.59 ? 18   LEU C CB    1 
ATOM   3681  C  CG    . LEU C 2 18   ? 106.633 137.107 108.574 1.00 105.59 ? 18   LEU C CG    1 
ATOM   3682  C  CD1   . LEU C 2 18   ? 106.459 135.786 109.299 1.00 105.59 ? 18   LEU C CD1   1 
ATOM   3683  C  CD2   . LEU C 2 18   ? 106.256 138.269 109.475 1.00 105.59 ? 18   LEU C CD2   1 
ATOM   3684  N  N     . THR C 2 19   ? 110.316 138.536 105.919 1.00 108.45 ? 19   THR C N     1 
ATOM   3685  C  CA    . THR C 2 19   ? 111.728 138.658 105.591 1.00 108.45 ? 19   THR C CA    1 
ATOM   3686  C  C     . THR C 2 19   ? 112.037 139.870 104.722 1.00 108.45 ? 19   THR C C     1 
ATOM   3687  O  O     . THR C 2 19   ? 113.092 139.899 104.082 1.00 108.45 ? 19   THR C O     1 
ATOM   3688  C  CB    . THR C 2 19   ? 112.220 137.391 104.889 1.00 108.45 ? 19   THR C CB    1 
ATOM   3689  O  OG1   . THR C 2 19   ? 111.365 137.097 103.779 1.00 108.45 ? 19   THR C OG1   1 
ATOM   3690  C  CG2   . THR C 2 19   ? 112.216 136.220 105.851 1.00 108.45 ? 19   THR C CG2   1 
ATOM   3691  N  N     . GLU C 2 20   ? 111.147 140.864 104.678 1.00 115.65 ? 20   GLU C N     1 
ATOM   3692  C  CA    . GLU C 2 20   ? 111.403 142.028 103.835 1.00 115.65 ? 20   GLU C CA    1 
ATOM   3693  C  C     . GLU C 2 20   ? 112.599 142.829 104.329 1.00 115.65 ? 20   GLU C C     1 
ATOM   3694  O  O     . GLU C 2 20   ? 113.260 143.502 103.531 1.00 115.65 ? 20   GLU C O     1 
ATOM   3695  C  CB    . GLU C 2 20   ? 110.166 142.922 103.764 1.00 115.65 ? 20   GLU C CB    1 
ATOM   3696  C  CG    . GLU C 2 20   ? 109.818 143.619 105.065 1.00 115.65 ? 20   GLU C CG    1 
ATOM   3697  C  CD    . GLU C 2 20   ? 108.576 144.478 104.947 1.00 115.65 ? 20   GLU C CD    1 
ATOM   3698  O  OE1   . GLU C 2 20   ? 107.975 144.506 103.853 1.00 115.65 ? 20   GLU C OE1   1 
ATOM   3699  O  OE2   . GLU C 2 20   ? 108.201 145.127 105.946 1.00 115.65 ? 20   GLU C OE2   1 
ATOM   3700  N  N     . ILE C 2 21   ? 112.904 142.753 105.628 1.00 108.39 ? 21   ILE C N     1 
ATOM   3701  C  CA    . ILE C 2 21   ? 113.993 143.543 106.198 1.00 108.39 ? 21   ILE C CA    1 
ATOM   3702  C  C     . ILE C 2 21   ? 115.319 143.226 105.518 1.00 108.39 ? 21   ILE C C     1 
ATOM   3703  O  O     . ILE C 2 21   ? 116.171 144.109 105.363 1.00 108.39 ? 21   ILE C O     1 
ATOM   3704  C  CB    . ILE C 2 21   ? 114.067 143.324 107.723 1.00 108.39 ? 21   ILE C CB    1 
ATOM   3705  C  CG1   . ILE C 2 21   ? 115.087 144.272 108.353 1.00 108.39 ? 21   ILE C CG1   1 
ATOM   3706  C  CG2   . ILE C 2 21   ? 114.390 141.877 108.056 1.00 108.39 ? 21   ILE C CG2   1 
ATOM   3707  C  CD1   . ILE C 2 21   ? 115.021 144.319 109.857 1.00 108.39 ? 21   ILE C CD1   1 
ATOM   3708  N  N     . GLN C 2 22   ? 115.517 141.978 105.100 1.00 107.36 ? 22   GLN C N     1 
ATOM   3709  C  CA    . GLN C 2 22   ? 116.746 141.604 104.410 1.00 107.36 ? 22   GLN C CA    1 
ATOM   3710  C  C     . GLN C 2 22   ? 116.608 141.794 102.903 1.00 107.36 ? 22   GLN C C     1 
ATOM   3711  O  O     . GLN C 2 22   ? 117.462 142.415 102.259 1.00 107.36 ? 22   GLN C O     1 
ATOM   3712  C  CB    . GLN C 2 22   ? 117.102 140.151 104.735 1.00 107.36 ? 22   GLN C CB    1 
ATOM   3713  C  CG    . GLN C 2 22   ? 117.276 139.865 106.214 1.00 107.36 ? 22   GLN C CG    1 
ATOM   3714  C  CD    . GLN C 2 22   ? 118.723 139.894 106.649 1.00 107.36 ? 22   GLN C CD    1 
ATOM   3715  O  OE1   . GLN C 2 22   ? 119.603 139.404 105.945 1.00 107.36 ? 22   GLN C OE1   1 
ATOM   3716  N  NE2   . GLN C 2 22   ? 118.979 140.464 107.820 1.00 107.36 ? 22   GLN C NE2   1 
ATOM   3717  N  N     . VAL C 2 23   ? 115.529 141.254 102.330 1.00 110.34 ? 23   VAL C N     1 
ATOM   3718  C  CA    . VAL C 2 23   ? 115.384 141.206 100.877 1.00 110.34 ? 23   VAL C CA    1 
ATOM   3719  C  C     . VAL C 2 23   ? 115.272 142.609 100.299 1.00 110.34 ? 23   VAL C C     1 
ATOM   3720  O  O     . VAL C 2 23   ? 115.985 142.968 99.354  1.00 110.34 ? 23   VAL C O     1 
ATOM   3721  C  CB    . VAL C 2 23   ? 114.172 140.341 100.490 1.00 110.34 ? 23   VAL C CB    1 
ATOM   3722  C  CG1   . VAL C 2 23   ? 113.813 140.555 99.030  1.00 110.34 ? 23   VAL C CG1   1 
ATOM   3723  C  CG2   . VAL C 2 23   ? 114.462 138.877 100.764 1.00 110.34 ? 23   VAL C CG2   1 
ATOM   3724  N  N     . GLU C 2 24   ? 114.359 143.418 100.843 1.00 118.80 ? 24   GLU C N     1 
ATOM   3725  C  CA    . GLU C 2 24   ? 114.168 144.766 100.320 1.00 118.80 ? 24   GLU C CA    1 
ATOM   3726  C  C     . GLU C 2 24   ? 115.426 145.605 100.490 1.00 118.80 ? 24   GLU C C     1 
ATOM   3727  O  O     . GLU C 2 24   ? 115.802 146.363 99.587  1.00 118.80 ? 24   GLU C O     1 
ATOM   3728  C  CB    . GLU C 2 24   ? 112.981 145.432 101.013 1.00 118.80 ? 24   GLU C CB    1 
ATOM   3729  C  CG    . GLU C 2 24   ? 112.732 146.867 100.585 1.00 118.80 ? 24   GLU C CG    1 
ATOM   3730  C  CD    . GLU C 2 24   ? 112.374 146.989 99.117  1.00 118.80 ? 24   GLU C CD    1 
ATOM   3731  O  OE1   . GLU C 2 24   ? 111.792 146.033 98.562  1.00 118.80 ? 24   GLU C OE1   1 
ATOM   3732  O  OE2   . GLU C 2 24   ? 112.675 148.042 98.516  1.00 118.80 ? 24   GLU C OE2   1 
ATOM   3733  N  N     . SER C 2 25   ? 116.097 145.470 101.634 1.00 114.22 ? 25   SER C N     1 
ATOM   3734  C  CA    . SER C 2 25   ? 117.329 146.214 101.868 1.00 114.22 ? 25   SER C CA    1 
ATOM   3735  C  C     . SER C 2 25   ? 118.390 145.863 100.835 1.00 114.22 ? 25   SER C C     1 
ATOM   3736  O  O     . SER C 2 25   ? 119.001 146.751 100.230 1.00 114.22 ? 25   SER C O     1 
ATOM   3737  C  CB    . SER C 2 25   ? 117.845 145.940 103.277 1.00 114.22 ? 25   SER C CB    1 
ATOM   3738  O  OG    . SER C 2 25   ? 119.144 146.477 103.440 1.00 114.22 ? 25   SER C OG    1 
ATOM   3739  N  N     . TYR C 2 26   ? 118.630 144.568 100.622 1.00 113.70 ? 26   TYR C N     1 
ATOM   3740  C  CA    . TYR C 2 26   ? 119.661 144.168 99.669  1.00 113.70 ? 26   TYR C CA    1 
ATOM   3741  C  C     . TYR C 2 26   ? 119.286 144.568 98.248  1.00 113.70 ? 26   TYR C C     1 
ATOM   3742  O  O     . TYR C 2 26   ? 120.152 144.976 97.463  1.00 113.70 ? 26   TYR C O     1 
ATOM   3743  C  CB    . TYR C 2 26   ? 119.902 142.664 99.759  1.00 113.70 ? 26   TYR C CB    1 
ATOM   3744  C  CG    . TYR C 2 26   ? 121.298 142.252 99.364  1.00 113.70 ? 26   TYR C CG    1 
ATOM   3745  C  CD1   . TYR C 2 26   ? 122.387 142.595 100.149 1.00 113.70 ? 26   TYR C CD1   1 
ATOM   3746  C  CD2   . TYR C 2 26   ? 121.528 141.514 98.214  1.00 113.70 ? 26   TYR C CD2   1 
ATOM   3747  C  CE1   . TYR C 2 26   ? 123.664 142.221 99.798  1.00 113.70 ? 26   TYR C CE1   1 
ATOM   3748  C  CE2   . TYR C 2 26   ? 122.804 141.133 97.858  1.00 113.70 ? 26   TYR C CE2   1 
ATOM   3749  C  CZ    . TYR C 2 26   ? 123.867 141.491 98.652  1.00 113.70 ? 26   TYR C CZ    1 
ATOM   3750  O  OH    . TYR C 2 26   ? 125.142 141.116 98.300  1.00 113.70 ? 26   TYR C OH    1 
ATOM   3751  N  N     . ARG C 2 27   ? 118.002 144.464 97.899  1.00 119.60 ? 27   ARG C N     1 
ATOM   3752  C  CA    . ARG C 2 27   ? 117.567 144.828 96.556  1.00 119.60 ? 27   ARG C CA    1 
ATOM   3753  C  C     . ARG C 2 27   ? 117.737 146.321 96.315  1.00 119.60 ? 27   ARG C C     1 
ATOM   3754  O  O     . ARG C 2 27   ? 118.075 146.748 95.206  1.00 119.60 ? 27   ARG C O     1 
ATOM   3755  C  CB    . ARG C 2 27   ? 116.114 144.405 96.350  1.00 119.60 ? 27   ARG C CB    1 
ATOM   3756  C  CG    . ARG C 2 27   ? 115.719 144.226 94.898  1.00 119.60 ? 27   ARG C CG    1 
ATOM   3757  C  CD    . ARG C 2 27   ? 114.239 143.907 94.771  1.00 119.60 ? 27   ARG C CD    1 
ATOM   3758  N  NE    . ARG C 2 27   ? 113.410 144.834 95.536  1.00 119.60 ? 27   ARG C NE    1 
ATOM   3759  C  CZ    . ARG C 2 27   ? 113.154 146.087 95.173  1.00 119.60 ? 27   ARG C CZ    1 
ATOM   3760  N  NH1   . ARG C 2 27   ? 113.656 146.572 94.045  1.00 119.60 ? 27   ARG C NH1   1 
ATOM   3761  N  NH2   . ARG C 2 27   ? 112.389 146.855 95.935  1.00 119.60 ? 27   ARG C NH2   1 
ATOM   3762  N  N     . ARG C 2 28   ? 117.506 147.134 97.347  1.00 124.54 ? 28   ARG C N     1 
ATOM   3763  C  CA    . ARG C 2 28   ? 117.764 148.563 97.223  1.00 124.54 ? 28   ARG C CA    1 
ATOM   3764  C  C     . ARG C 2 28   ? 119.259 148.842 97.139  1.00 124.54 ? 28   ARG C C     1 
ATOM   3765  O  O     . ARG C 2 28   ? 119.692 149.741 96.410  1.00 124.54 ? 28   ARG C O     1 
ATOM   3766  C  CB    . ARG C 2 28   ? 117.141 149.312 98.401  1.00 124.54 ? 28   ARG C CB    1 
ATOM   3767  C  CG    . ARG C 2 28   ? 117.586 150.758 98.527  1.00 124.54 ? 28   ARG C CG    1 
ATOM   3768  C  CD    . ARG C 2 28   ? 116.753 151.503 99.555  1.00 124.54 ? 28   ARG C CD    1 
ATOM   3769  N  NE    . ARG C 2 28   ? 115.345 151.555 99.176  1.00 124.54 ? 28   ARG C NE    1 
ATOM   3770  C  CZ    . ARG C 2 28   ? 114.847 152.385 98.265  1.00 124.54 ? 28   ARG C CZ    1 
ATOM   3771  N  NH1   . ARG C 2 28   ? 115.641 153.241 97.637  1.00 124.54 ? 28   ARG C NH1   1 
ATOM   3772  N  NH2   . ARG C 2 28   ? 113.551 152.361 97.983  1.00 124.54 ? 28   ARG C NH2   1 
ATOM   3773  N  N     . ALA C 2 29   ? 120.063 148.075 97.877  1.00 120.58 ? 29   ALA C N     1 
ATOM   3774  C  CA    . ALA C 2 29   ? 121.504 148.306 97.881  1.00 120.58 ? 29   ALA C CA    1 
ATOM   3775  C  C     . ALA C 2 29   ? 122.125 148.000 96.523  1.00 120.58 ? 29   ALA C C     1 
ATOM   3776  O  O     . ALA C 2 29   ? 122.975 148.758 96.043  1.00 120.58 ? 29   ALA C O     1 
ATOM   3777  C  CB    . ALA C 2 29   ? 122.166 147.470 98.974  1.00 120.58 ? 29   ALA C CB    1 
ATOM   3778  N  N     . LEU C 2 30   ? 121.718 146.899 95.887  1.00 122.60 ? 30   LEU C N     1 
ATOM   3779  C  CA    . LEU C 2 30   ? 122.350 146.517 94.626  1.00 122.60 ? 30   LEU C CA    1 
ATOM   3780  C  C     . LEU C 2 30   ? 121.864 147.346 93.444  1.00 122.60 ? 30   LEU C C     1 
ATOM   3781  O  O     . LEU C 2 30   ? 122.683 147.762 92.618  1.00 122.60 ? 30   LEU C O     1 
ATOM   3782  C  CB    . LEU C 2 30   ? 122.114 145.038 94.327  1.00 122.60 ? 30   LEU C CB    1 
ATOM   3783  C  CG    . LEU C 2 30   ? 122.812 144.007 95.210  1.00 122.60 ? 30   LEU C CG    1 
ATOM   3784  C  CD1   . LEU C 2 30   ? 122.394 142.612 94.786  1.00 122.60 ? 30   LEU C CD1   1 
ATOM   3785  C  CD2   . LEU C 2 30   ? 124.316 144.169 95.127  1.00 122.60 ? 30   LEU C CD2   1 
ATOM   3786  N  N     . GLN C 2 31   ? 120.555 147.583 93.340  1.00 131.45 ? 31   GLN C N     1 
ATOM   3787  C  CA    . GLN C 2 31   ? 119.969 148.250 92.176  1.00 131.45 ? 31   GLN C CA    1 
ATOM   3788  C  C     . GLN C 2 31   ? 120.327 147.511 90.889  1.00 131.45 ? 31   GLN C C     1 
ATOM   3789  O  O     . GLN C 2 31   ? 120.759 148.108 89.901  1.00 131.45 ? 31   GLN C O     1 
ATOM   3790  C  CB    . GLN C 2 31   ? 120.398 149.716 92.102  1.00 131.45 ? 31   GLN C CB    1 
ATOM   3791  C  CG    . GLN C 2 31   ? 120.011 150.541 93.311  1.00 131.45 ? 31   GLN C CG    1 
ATOM   3792  C  CD    . GLN C 2 31   ? 119.723 151.983 92.957  1.00 131.45 ? 31   GLN C CD    1 
ATOM   3793  O  OE1   . GLN C 2 31   ? 120.635 152.801 92.843  1.00 131.45 ? 31   GLN C OE1   1 
ATOM   3794  N  NE2   . GLN C 2 31   ? 118.448 152.304 92.780  1.00 131.45 ? 31   GLN C NE2   1 
ATOM   3795  N  N     . ALA C 2 32   ? 120.148 146.189 90.908  1.00 133.97 ? 32   ALA C N     1 
ATOM   3796  C  CA    . ALA C 2 32   ? 120.628 145.357 89.808  1.00 133.97 ? 32   ALA C CA    1 
ATOM   3797  C  C     . ALA C 2 32   ? 119.816 145.569 88.535  1.00 133.97 ? 32   ALA C C     1 
ATOM   3798  O  O     . ALA C 2 32   ? 120.387 145.800 87.464  1.00 133.97 ? 32   ALA C O     1 
ATOM   3799  C  CB    . ALA C 2 32   ? 120.601 143.886 90.218  1.00 133.97 ? 32   ALA C CB    1 
ATOM   3800  N  N     . ASP C 2 33   ? 118.492 145.494 88.627  1.00 145.84 ? 33   ASP C N     1 
ATOM   3801  C  CA    . ASP C 2 33   ? 117.640 145.473 87.444  1.00 145.84 ? 33   ASP C CA    1 
ATOM   3802  C  C     . ASP C 2 33   ? 117.346 146.856 86.876  1.00 145.84 ? 33   ASP C C     1 
ATOM   3803  O  O     . ASP C 2 33   ? 117.094 146.970 85.672  1.00 145.84 ? 33   ASP C O     1 
ATOM   3804  C  CB    . ASP C 2 33   ? 116.324 144.754 87.760  1.00 145.84 ? 33   ASP C CB    1 
ATOM   3805  C  CG    . ASP C 2 33   ? 115.555 145.405 88.897  1.00 145.84 ? 33   ASP C CG    1 
ATOM   3806  O  OD1   . ASP C 2 33   ? 115.970 146.481 89.376  1.00 145.84 ? 33   ASP C OD1   1 
ATOM   3807  O  OD2   . ASP C 2 33   ? 114.525 144.835 89.312  1.00 145.84 ? 33   ASP C OD2   1 
ATOM   3808  N  N     . VAL C 2 34   ? 117.366 147.898 87.701  1.00 144.76 ? 34   VAL C N     1 
ATOM   3809  C  CA    . VAL C 2 34   ? 117.045 149.252 87.256  1.00 144.76 ? 34   VAL C CA    1 
ATOM   3810  C  C     . VAL C 2 34   ? 118.081 149.701 86.230  1.00 144.76 ? 34   VAL C C     1 
ATOM   3811  O  O     . VAL C 2 34   ? 119.282 149.451 86.414  1.00 144.76 ? 34   VAL C O     1 
ATOM   3812  C  CB    . VAL C 2 34   ? 116.967 150.218 88.450  1.00 144.76 ? 34   VAL C CB    1 
ATOM   3813  C  CG1   . VAL C 2 34   ? 118.231 150.141 89.284  1.00 144.76 ? 34   VAL C CG1   1 
ATOM   3814  C  CG2   . VAL C 2 34   ? 116.722 151.645 87.983  1.00 144.76 ? 34   VAL C CG2   1 
ATOM   3815  N  N     . PRO C 2 35   ? 117.667 150.322 85.128  1.00 147.92 ? 35   PRO C N     1 
ATOM   3816  C  CA    . PRO C 2 35   ? 118.631 150.815 84.137  1.00 147.92 ? 35   PRO C CA    1 
ATOM   3817  C  C     . PRO C 2 35   ? 119.610 151.791 84.762  1.00 147.92 ? 35   PRO C C     1 
ATOM   3818  O  O     . PRO C 2 35   ? 119.228 152.608 85.614  1.00 147.92 ? 35   PRO C O     1 
ATOM   3819  C  CB    . PRO C 2 35   ? 117.742 151.506 83.089  1.00 147.92 ? 35   PRO C CB    1 
ATOM   3820  C  CG    . PRO C 2 35   ? 116.411 151.690 83.759  1.00 147.92 ? 35   PRO C CG    1 
ATOM   3821  C  CD    . PRO C 2 35   ? 116.280 150.529 84.686  1.00 147.92 ? 35   PRO C CD    1 
ATOM   3822  N  N     . PRO C 2 36   ? 120.888 151.727 84.371  1.00 147.64 ? 36   PRO C N     1 
ATOM   3823  C  CA    . PRO C 2 36   ? 121.922 152.537 85.034  1.00 147.64 ? 36   PRO C CA    1 
ATOM   3824  C  C     . PRO C 2 36   ? 121.663 154.036 85.001  1.00 147.64 ? 36   PRO C C     1 
ATOM   3825  O  O     . PRO C 2 36   ? 122.147 154.768 85.869  1.00 147.64 ? 36   PRO C O     1 
ATOM   3826  C  CB    . PRO C 2 36   ? 123.192 152.185 84.250  1.00 147.64 ? 36   PRO C CB    1 
ATOM   3827  C  CG    . PRO C 2 36   ? 122.920 150.839 83.671  1.00 147.64 ? 36   PRO C CG    1 
ATOM   3828  C  CD    . PRO C 2 36   ? 121.454 150.817 83.362  1.00 147.64 ? 36   PRO C CD    1 
ATOM   3829  N  N     . GLU C 2 37   ? 120.906 154.506 84.009  1.00 152.06 ? 37   GLU C N     1 
ATOM   3830  C  CA    . GLU C 2 37   ? 120.670 155.939 83.879  1.00 152.06 ? 37   GLU C CA    1 
ATOM   3831  C  C     . GLU C 2 37   ? 119.754 156.486 84.967  1.00 152.06 ? 37   GLU C C     1 
ATOM   3832  O  O     . GLU C 2 37   ? 119.732 157.702 85.182  1.00 152.06 ? 37   GLU C O     1 
ATOM   3833  C  CB    . GLU C 2 37   ? 120.081 156.260 82.503  1.00 152.06 ? 37   GLU C CB    1 
ATOM   3834  C  CG    . GLU C 2 37   ? 118.880 155.412 82.109  1.00 152.06 ? 37   GLU C CG    1 
ATOM   3835  C  CD    . GLU C 2 37   ? 119.269 154.099 81.457  1.00 152.06 ? 37   GLU C CD    1 
ATOM   3836  O  OE1   . GLU C 2 37   ? 120.259 153.478 81.899  1.00 152.06 ? 37   GLU C OE1   1 
ATOM   3837  O  OE2   . GLU C 2 37   ? 118.583 153.685 80.499  1.00 152.06 ? 37   GLU C OE2   1 
ATOM   3838  N  N     . LYS C 2 38   ? 119.003 155.628 85.654  1.00 147.96 ? 38   LYS C N     1 
ATOM   3839  C  CA    . LYS C 2 38   ? 118.033 156.072 86.645  1.00 147.96 ? 38   LYS C CA    1 
ATOM   3840  C  C     . LYS C 2 38   ? 118.312 155.531 88.042  1.00 147.96 ? 38   LYS C C     1 
ATOM   3841  O  O     . LYS C 2 38   ? 117.409 155.533 88.885  1.00 147.96 ? 38   LYS C O     1 
ATOM   3842  C  CB    . LYS C 2 38   ? 116.621 155.681 86.206  1.00 147.96 ? 38   LYS C CB    1 
ATOM   3843  C  CG    . LYS C 2 38   ? 116.159 156.380 84.939  1.00 147.96 ? 38   LYS C CG    1 
ATOM   3844  C  CD    . LYS C 2 38   ? 115.178 155.526 84.153  1.00 147.96 ? 38   LYS C CD    1 
ATOM   3845  C  CE    . LYS C 2 38   ? 114.155 154.870 85.065  1.00 147.96 ? 38   LYS C CE    1 
ATOM   3846  N  NZ    . LYS C 2 38   ? 113.319 153.879 84.333  1.00 147.96 ? 38   LYS C NZ    1 
ATOM   3847  N  N     . ARG C 2 39   ? 119.529 155.070 88.308  1.00 139.00 ? 39   ARG C N     1 
ATOM   3848  C  CA    . ARG C 2 39   ? 119.866 154.597 89.644  1.00 139.00 ? 39   ARG C CA    1 
ATOM   3849  C  C     . ARG C 2 39   ? 120.018 155.771 90.602  1.00 139.00 ? 39   ARG C C     1 
ATOM   3850  O  O     . ARG C 2 39   ? 120.643 156.784 90.277  1.00 139.00 ? 39   ARG C O     1 
ATOM   3851  C  CB    . ARG C 2 39   ? 121.153 153.776 89.610  1.00 139.00 ? 39   ARG C CB    1 
ATOM   3852  C  CG    . ARG C 2 39   ? 121.030 152.474 88.840  1.00 139.00 ? 39   ARG C CG    1 
ATOM   3853  C  CD    . ARG C 2 39   ? 122.362 151.752 88.746  1.00 139.00 ? 39   ARG C CD    1 
ATOM   3854  N  NE    . ARG C 2 39   ? 122.197 150.373 88.298  1.00 139.00 ? 39   ARG C NE    1 
ATOM   3855  C  CZ    . ARG C 2 39   ? 123.089 149.713 87.568  1.00 139.00 ? 39   ARG C CZ    1 
ATOM   3856  N  NH1   . ARG C 2 39   ? 124.214 150.306 87.199  1.00 139.00 ? 39   ARG C NH1   1 
ATOM   3857  N  NH2   . ARG C 2 39   ? 122.854 148.461 87.206  1.00 139.00 ? 39   ARG C NH2   1 
ATOM   3858  N  N     . GLU C 2 40   ? 119.439 155.632 91.790  1.00 143.22 ? 40   GLU C N     1 
ATOM   3859  C  CA    . GLU C 2 40   ? 119.536 156.681 92.791  1.00 143.22 ? 40   GLU C CA    1 
ATOM   3860  C  C     . GLU C 2 40   ? 120.897 156.641 93.479  1.00 143.22 ? 40   GLU C C     1 
ATOM   3861  O  O     . GLU C 2 40   ? 121.640 155.660 93.396  1.00 143.22 ? 40   GLU C O     1 
ATOM   3862  C  CB    . GLU C 2 40   ? 118.419 156.551 93.826  1.00 143.22 ? 40   GLU C CB    1 
ATOM   3863  C  CG    . GLU C 2 40   ? 117.020 156.657 93.243  1.00 143.22 ? 40   GLU C CG    1 
ATOM   3864  C  CD    . GLU C 2 40   ? 115.969 156.014 94.126  1.00 143.22 ? 40   GLU C CD    1 
ATOM   3865  O  OE1   . GLU C 2 40   ? 115.284 156.748 94.868  1.00 143.22 ? 40   GLU C OE1   1 
ATOM   3866  O  OE2   . GLU C 2 40   ? 115.828 154.774 94.079  1.00 143.22 ? 40   GLU C OE2   1 
ATOM   3867  N  N     . ASN C 2 41   ? 121.216 157.731 94.172  1.00 136.94 ? 41   ASN C N     1 
ATOM   3868  C  CA    . ASN C 2 41   ? 122.514 157.898 94.821  1.00 136.94 ? 41   ASN C CA    1 
ATOM   3869  C  C     . ASN C 2 41   ? 122.492 157.174 96.162  1.00 136.94 ? 41   ASN C C     1 
ATOM   3870  O  O     . ASN C 2 41   ? 122.565 157.802 97.220  1.00 136.94 ? 41   ASN C O     1 
ATOM   3871  C  CB    . ASN C 2 41   ? 122.834 159.378 94.991  1.00 136.94 ? 41   ASN C CB    1 
ATOM   3872  C  CG    . ASN C 2 41   ? 124.318 159.643 95.134  1.00 136.94 ? 41   ASN C CG    1 
ATOM   3873  O  OD1   . ASN C 2 41   ? 125.035 158.884 95.783  1.00 136.94 ? 41   ASN C OD1   1 
ATOM   3874  N  ND2   . ASN C 2 41   ? 124.786 160.727 94.527  1.00 136.94 ? 41   ASN C ND2   1 
ATOM   3875  N  N     . VAL C 2 42   ? 122.406 155.844 96.121  1.00 132.50 ? 42   VAL C N     1 
ATOM   3876  C  CA    . VAL C 2 42   ? 122.387 155.031 97.332  1.00 132.50 ? 42   VAL C CA    1 
ATOM   3877  C  C     . VAL C 2 42   ? 123.165 153.753 97.063  1.00 132.50 ? 42   VAL C C     1 
ATOM   3878  O  O     . VAL C 2 42   ? 123.148 153.218 95.954  1.00 132.50 ? 42   VAL C O     1 
ATOM   3879  C  CB    . VAL C 2 42   ? 120.939 154.716 97.786  1.00 132.50 ? 42   VAL C CB    1 
ATOM   3880  C  CG1   . VAL C 2 42   ? 120.303 155.928 98.444  1.00 132.50 ? 42   VAL C CG1   1 
ATOM   3881  C  CG2   . VAL C 2 42   ? 120.107 154.250 96.604  1.00 132.50 ? 42   VAL C CG2   1 
ATOM   3882  N  N     . GLY C 2 43   ? 123.852 153.258 98.089  1.00 131.40 ? 43   GLY C N     1 
ATOM   3883  C  CA    . GLY C 2 43   ? 124.498 151.962 97.993  1.00 131.40 ? 43   GLY C CA    1 
ATOM   3884  C  C     . GLY C 2 43   ? 125.730 151.975 97.117  1.00 131.40 ? 43   GLY C C     1 
ATOM   3885  O  O     . GLY C 2 43   ? 126.637 152.800 97.283  1.00 131.40 ? 43   GLY C O     1 
ATOM   3886  N  N     . ILE C 2 44   ? 125.775 151.026 96.179  1.00 128.94 ? 44   ILE C N     1 
ATOM   3887  C  CA    . ILE C 2 44   ? 126.941 150.871 95.312  1.00 128.94 ? 44   ILE C CA    1 
ATOM   3888  C  C     . ILE C 2 44   ? 127.150 152.127 94.477  1.00 128.94 ? 44   ILE C C     1 
ATOM   3889  O  O     . ILE C 2 44   ? 128.276 152.622 94.330  1.00 128.94 ? 44   ILE C O     1 
ATOM   3890  C  CB    . ILE C 2 44   ? 126.783 149.625 94.424  1.00 128.94 ? 44   ILE C CB    1 
ATOM   3891  C  CG1   . ILE C 2 44   ? 126.818 148.359 95.278  1.00 128.94 ? 44   ILE C CG1   1 
ATOM   3892  C  CG2   . ILE C 2 44   ? 127.875 149.577 93.373  1.00 128.94 ? 44   ILE C CG2   1 
ATOM   3893  C  CD1   . ILE C 2 44   ? 128.030 148.265 96.172  1.00 128.94 ? 44   ILE C CD1   1 
ATOM   3894  N  N     . GLN C 2 45   ? 126.065 152.652 93.907  1.00 131.30 ? 45   GLN C N     1 
ATOM   3895  C  CA    . GLN C 2 45   ? 126.156 153.881 93.127  1.00 131.30 ? 45   GLN C CA    1 
ATOM   3896  C  C     . GLN C 2 45   ? 126.663 155.032 93.985  1.00 131.30 ? 45   GLN C C     1 
ATOM   3897  O  O     . GLN C 2 45   ? 127.453 155.864 93.527  1.00 131.30 ? 45   GLN C O     1 
ATOM   3898  C  CB    . GLN C 2 45   ? 124.795 154.217 92.520  1.00 131.30 ? 45   GLN C CB    1 
ATOM   3899  C  CG    . GLN C 2 45   ? 124.777 155.501 91.717  1.00 131.30 ? 45   GLN C CG    1 
ATOM   3900  C  CD    . GLN C 2 45   ? 125.122 155.277 90.261  1.00 131.30 ? 45   GLN C CD    1 
ATOM   3901  O  OE1   . GLN C 2 45   ? 125.468 154.167 89.859  1.00 131.30 ? 45   GLN C OE1   1 
ATOM   3902  N  NE2   . GLN C 2 45   ? 125.027 156.331 89.461  1.00 131.30 ? 45   GLN C NE2   1 
ATOM   3903  N  N     . ALA C 2 46   ? 126.226 155.086 95.244  1.00 134.05 ? 46   ALA C N     1 
ATOM   3904  C  CA    . ALA C 2 46   ? 126.675 156.152 96.132  1.00 134.05 ? 46   ALA C CA    1 
ATOM   3905  C  C     . ALA C 2 46   ? 128.167 156.042 96.414  1.00 134.05 ? 46   ALA C C     1 
ATOM   3906  O  O     . ALA C 2 46   ? 128.885 157.047 96.394  1.00 134.05 ? 46   ALA C O     1 
ATOM   3907  C  CB    . ALA C 2 46   ? 125.880 156.124 97.435  1.00 134.05 ? 46   ALA C CB    1 
ATOM   3908  N  N     . ALA C 2 47   ? 128.652 154.827 96.674  1.00 136.55 ? 47   ALA C N     1 
ATOM   3909  C  CA    . ALA C 2 47   ? 130.081 154.637 96.899  1.00 136.55 ? 47   ALA C CA    1 
ATOM   3910  C  C     . ALA C 2 47   ? 130.883 155.018 95.661  1.00 136.55 ? 47   ALA C C     1 
ATOM   3911  O  O     . ALA C 2 47   ? 131.946 155.644 95.760  1.00 136.55 ? 47   ALA C O     1 
ATOM   3912  C  CB    . ALA C 2 47   ? 130.362 153.189 97.302  1.00 136.55 ? 47   ALA C CB    1 
ATOM   3913  N  N     . PHE C 2 48   ? 130.383 154.646 94.481  1.00 138.74 ? 48   PHE C N     1 
ATOM   3914  C  CA    . PHE C 2 48   ? 131.069 154.993 93.240  1.00 138.74 ? 48   PHE C CA    1 
ATOM   3915  C  C     . PHE C 2 48   ? 131.138 156.504 93.050  1.00 138.74 ? 48   PHE C C     1 
ATOM   3916  O  O     . PHE C 2 48   ? 132.193 157.050 92.708  1.00 138.74 ? 48   PHE C O     1 
ATOM   3917  C  CB    . PHE C 2 48   ? 130.373 154.327 92.055  1.00 138.74 ? 48   PHE C CB    1 
ATOM   3918  C  CG    . PHE C 2 48   ? 130.814 152.914 91.812  1.00 138.74 ? 48   PHE C CG    1 
ATOM   3919  C  CD1   . PHE C 2 48   ? 132.056 152.483 92.240  1.00 138.74 ? 48   PHE C CD1   1 
ATOM   3920  C  CD2   . PHE C 2 48   ? 129.986 152.014 91.165  1.00 138.74 ? 48   PHE C CD2   1 
ATOM   3921  C  CE1   . PHE C 2 48   ? 132.469 151.186 92.023  1.00 138.74 ? 48   PHE C CE1   1 
ATOM   3922  C  CE2   . PHE C 2 48   ? 130.393 150.714 90.945  1.00 138.74 ? 48   PHE C CE2   1 
ATOM   3923  C  CZ    . PHE C 2 48   ? 131.636 150.300 91.375  1.00 138.74 ? 48   PHE C CZ    1 
ATOM   3924  N  N     . ARG C 2 49   ? 130.019 157.199 93.268  1.00 142.56 ? 49   ARG C N     1 
ATOM   3925  C  CA    . ARG C 2 49   ? 130.021 158.650 93.111  1.00 142.56 ? 49   ARG C CA    1 
ATOM   3926  C  C     . ARG C 2 49   ? 130.871 159.330 94.176  1.00 142.56 ? 49   ARG C C     1 
ATOM   3927  O  O     . ARG C 2 49   ? 131.392 160.426 93.944  1.00 142.56 ? 49   ARG C O     1 
ATOM   3928  C  CB    . ARG C 2 49   ? 128.592 159.194 93.149  1.00 142.56 ? 49   ARG C CB    1 
ATOM   3929  C  CG    . ARG C 2 49   ? 127.667 158.604 92.099  1.00 142.56 ? 49   ARG C CG    1 
ATOM   3930  C  CD    . ARG C 2 49   ? 128.162 158.878 90.692  1.00 142.56 ? 49   ARG C CD    1 
ATOM   3931  N  NE    . ARG C 2 49   ? 128.151 160.302 90.373  1.00 142.56 ? 49   ARG C NE    1 
ATOM   3932  C  CZ    . ARG C 2 49   ? 128.822 160.845 89.364  1.00 142.56 ? 49   ARG C CZ    1 
ATOM   3933  N  NH1   . ARG C 2 49   ? 129.560 160.082 88.570  1.00 142.56 ? 49   ARG C NH1   1 
ATOM   3934  N  NH2   . ARG C 2 49   ? 128.755 162.151 89.145  1.00 142.56 ? 49   ARG C NH2   1 
ATOM   3935  N  N     . GLU C 2 50   ? 131.020 158.705 95.345  1.00 145.69 ? 50   GLU C N     1 
ATOM   3936  C  CA    . GLU C 2 50   ? 131.854 159.289 96.390  1.00 145.69 ? 50   GLU C CA    1 
ATOM   3937  C  C     . GLU C 2 50   ? 133.337 159.142 96.077  1.00 145.69 ? 50   GLU C C     1 
ATOM   3938  O  O     . GLU C 2 50   ? 134.093 160.114 96.180  1.00 145.69 ? 50   GLU C O     1 
ATOM   3939  C  CB    . GLU C 2 50   ? 131.536 158.645 97.740  1.00 145.69 ? 50   GLU C CB    1 
ATOM   3940  C  CG    . GLU C 2 50   ? 130.538 159.418 98.581  1.00 145.69 ? 50   GLU C CG    1 
ATOM   3941  C  CD    . GLU C 2 50   ? 130.495 158.937 100.018 1.00 145.69 ? 50   GLU C CD    1 
ATOM   3942  O  OE1   . GLU C 2 50   ? 130.621 159.778 100.933 1.00 145.69 ? 50   GLU C OE1   1 
ATOM   3943  O  OE2   . GLU C 2 50   ? 130.338 157.717 100.233 1.00 145.69 ? 50   GLU C OE2   1 
ATOM   3944  N  N     . THR C 2 51   ? 133.773 157.938 95.700  1.00 148.45 ? 51   THR C N     1 
ATOM   3945  C  CA    . THR C 2 51   ? 135.198 157.715 95.477  1.00 148.45 ? 51   THR C CA    1 
ATOM   3946  C  C     . THR C 2 51   ? 135.689 158.395 94.206  1.00 148.45 ? 51   THR C C     1 
ATOM   3947  O  O     . THR C 2 51   ? 136.793 158.950 94.188  1.00 148.45 ? 51   THR C O     1 
ATOM   3948  C  CB    . THR C 2 51   ? 135.489 156.216 95.423  1.00 148.45 ? 51   THR C CB    1 
ATOM   3949  O  OG1   . THR C 2 51   ? 135.153 155.619 96.681  1.00 148.45 ? 51   THR C OG1   1 
ATOM   3950  C  CG2   . THR C 2 51   ? 136.957 155.964 95.131  1.00 148.45 ? 51   THR C CG2   1 
ATOM   3951  N  N     . PHE C 2 52   ? 134.888 158.384 93.149  1.00 154.38 ? 52   PHE C N     1 
ATOM   3952  C  CA    . PHE C 2 52   ? 135.289 158.946 91.872  1.00 154.38 ? 52   PHE C CA    1 
ATOM   3953  C  C     . PHE C 2 52   ? 134.734 160.359 91.710  1.00 154.38 ? 52   PHE C C     1 
ATOM   3954  O  O     . PHE C 2 52   ? 133.699 160.693 92.295  1.00 154.38 ? 52   PHE C O     1 
ATOM   3955  C  CB    . PHE C 2 52   ? 134.795 158.068 90.716  1.00 154.38 ? 52   PHE C CB    1 
ATOM   3956  C  CG    . PHE C 2 52   ? 135.562 156.786 90.557  1.00 154.38 ? 52   PHE C CG    1 
ATOM   3957  C  CD1   . PHE C 2 52   ? 136.408 156.599 89.478  1.00 154.38 ? 52   PHE C CD1   1 
ATOM   3958  C  CD2   . PHE C 2 52   ? 135.433 155.766 91.484  1.00 154.38 ? 52   PHE C CD2   1 
ATOM   3959  C  CE1   . PHE C 2 52   ? 137.113 155.421 89.330  1.00 154.38 ? 52   PHE C CE1   1 
ATOM   3960  C  CE2   . PHE C 2 52   ? 136.135 154.587 91.341  1.00 154.38 ? 52   PHE C CE2   1 
ATOM   3961  C  CZ    . PHE C 2 52   ? 136.976 154.414 90.262  1.00 154.38 ? 52   PHE C CZ    1 
ATOM   3962  N  N     . PRO C 2 53   ? 135.396 161.222 90.922  1.00 163.28 ? 53   PRO C N     1 
ATOM   3963  C  CA    . PRO C 2 53   ? 136.653 160.982 90.206  1.00 163.28 ? 53   PRO C CA    1 
ATOM   3964  C  C     . PRO C 2 53   ? 137.893 161.265 91.050  1.00 163.28 ? 53   PRO C C     1 
ATOM   3965  O  O     . PRO C 2 53   ? 137.878 162.170 91.884  1.00 163.28 ? 53   PRO C O     1 
ATOM   3966  C  CB    . PRO C 2 53   ? 136.567 161.959 89.036  1.00 163.28 ? 53   PRO C CB    1 
ATOM   3967  C  CG    . PRO C 2 53   ? 135.809 163.108 89.592  1.00 163.28 ? 53   PRO C CG    1 
ATOM   3968  C  CD    . PRO C 2 53   ? 134.817 162.532 90.575  1.00 163.28 ? 53   PRO C CD    1 
ATOM   3969  N  N     . ILE C 2 54   ? 138.953 160.492 90.834  1.00 170.94 ? 54   ILE C N     1 
ATOM   3970  C  CA    . ILE C 2 54   ? 140.225 160.701 91.515  1.00 170.94 ? 54   ILE C CA    1 
ATOM   3971  C  C     . ILE C 2 54   ? 141.149 161.453 90.564  1.00 170.94 ? 54   ILE C C     1 
ATOM   3972  O  O     . ILE C 2 54   ? 141.315 161.064 89.405  1.00 170.94 ? 54   ILE C O     1 
ATOM   3973  C  CB    . ILE C 2 54   ? 140.844 159.375 91.971  1.00 170.94 ? 54   ILE C CB    1 
ATOM   3974  C  CG1   . ILE C 2 54   ? 140.771 158.336 90.851  1.00 170.94 ? 54   ILE C CG1   1 
ATOM   3975  C  CG2   . ILE C 2 54   ? 140.144 158.863 93.219  1.00 170.94 ? 54   ILE C CG2   1 
ATOM   3976  C  CD1   . ILE C 2 54   ? 141.312 156.984 91.245  1.00 170.94 ? 54   ILE C CD1   1 
ATOM   3977  N  N     . GLU C 2 55   ? 141.745 162.543 91.050  1.00 184.90 ? 55   GLU C N     1 
ATOM   3978  C  CA    . GLU C 2 55   ? 142.596 163.356 90.189  1.00 184.90 ? 55   GLU C CA    1 
ATOM   3979  C  C     . GLU C 2 55   ? 144.005 162.785 90.083  1.00 184.90 ? 55   GLU C C     1 
ATOM   3980  O  O     . GLU C 2 55   ? 144.421 162.362 88.999  1.00 184.90 ? 55   GLU C O     1 
ATOM   3981  C  CB    . GLU C 2 55   ? 142.647 164.792 90.713  1.00 184.90 ? 55   GLU C CB    1 
ATOM   3982  C  CG    . GLU C 2 55   ? 141.281 165.406 90.981  1.00 184.90 ? 55   GLU C CG    1 
ATOM   3983  C  CD    . GLU C 2 55   ? 140.563 165.832 89.714  1.00 184.90 ? 55   GLU C CD    1 
ATOM   3984  O  OE1   . GLU C 2 55   ? 139.411 166.302 89.816  1.00 184.90 ? 55   GLU C OE1   1 
ATOM   3985  O  OE2   . GLU C 2 55   ? 141.150 165.707 88.618  1.00 184.90 ? 55   GLU C OE2   1 
ATOM   3986  N  N     . GLU C 2 56   ? 144.731 162.732 91.197  1.00 187.83 ? 56   GLU C N     1 
ATOM   3987  C  CA    . GLU C 2 56   ? 146.110 162.249 91.213  1.00 187.83 ? 56   GLU C CA    1 
ATOM   3988  C  C     . GLU C 2 56   ? 146.646 162.203 92.640  1.00 187.83 ? 56   GLU C C     1 
ATOM   3989  O  O     . GLU C 2 56   ? 147.683 161.595 92.905  1.00 187.83 ? 56   GLU C O     1 
ATOM   3990  C  CB    . GLU C 2 56   ? 147.011 163.131 90.340  1.00 187.83 ? 56   GLU C CB    1 
ATOM   3991  C  CG    . GLU C 2 56   ? 147.077 164.589 90.766  1.00 187.83 ? 56   GLU C CG    1 
ATOM   3992  C  CD    . GLU C 2 56   ? 148.267 164.883 91.658  1.00 187.83 ? 56   GLU C CD    1 
ATOM   3993  O  OE1   . GLU C 2 56   ? 149.170 164.025 91.748  1.00 187.83 ? 56   GLU C OE1   1 
ATOM   3994  O  OE2   . GLU C 2 56   ? 148.302 165.974 92.265  1.00 187.83 ? 56   GLU C OE2   1 
ATOM   3995  N  N     . LEU C 2 64   ? 145.730 163.265 83.503  1.00 185.63 ? 64   LEU C N     1 
ATOM   3996  C  CA    . LEU C 2 64   ? 145.354 162.081 84.266  1.00 185.63 ? 64   LEU C CA    1 
ATOM   3997  C  C     . LEU C 2 64   ? 144.237 162.376 85.260  1.00 185.63 ? 64   LEU C C     1 
ATOM   3998  O  O     . LEU C 2 64   ? 144.479 162.931 86.329  1.00 185.63 ? 64   LEU C O     1 
ATOM   3999  C  CB    . LEU C 2 64   ? 146.563 161.510 85.014  1.00 185.63 ? 64   LEU C CB    1 
ATOM   4000  C  CG    . LEU C 2 64   ? 147.550 160.627 84.246  1.00 185.63 ? 64   LEU C CG    1 
ATOM   4001  C  CD1   . LEU C 2 64   ? 148.412 161.444 83.299  1.00 185.63 ? 64   LEU C CD1   1 
ATOM   4002  C  CD2   . LEU C 2 64   ? 148.417 159.835 85.215  1.00 185.63 ? 64   LEU C CD2   1 
ATOM   4003  N  N     . VAL C 2 65   ? 143.011 162.016 84.891  1.00 179.83 ? 65   VAL C N     1 
ATOM   4004  C  CA    . VAL C 2 65   ? 141.869 162.056 85.797  1.00 179.83 ? 65   VAL C CA    1 
ATOM   4005  C  C     . VAL C 2 65   ? 140.937 160.907 85.431  1.00 179.83 ? 65   VAL C C     1 
ATOM   4006  O  O     . VAL C 2 65   ? 140.451 160.826 84.298  1.00 179.83 ? 65   VAL C O     1 
ATOM   4007  C  CB    . VAL C 2 65   ? 141.135 163.414 85.764  1.00 179.83 ? 65   VAL C CB    1 
ATOM   4008  C  CG1   . VAL C 2 65   ? 140.804 163.841 84.342  1.00 179.83 ? 65   VAL C CG1   1 
ATOM   4009  C  CG2   . VAL C 2 65   ? 139.871 163.352 86.603  1.00 179.83 ? 65   VAL C CG2   1 
ATOM   4010  N  N     . LEU C 2 66   ? 140.717 160.002 86.379  1.00 169.43 ? 66   LEU C N     1 
ATOM   4011  C  CA    . LEU C 2 66   ? 139.919 158.802 86.163  1.00 169.43 ? 66   LEU C CA    1 
ATOM   4012  C  C     . LEU C 2 66   ? 138.487 159.085 86.593  1.00 169.43 ? 66   LEU C C     1 
ATOM   4013  O  O     . LEU C 2 66   ? 138.253 159.542 87.717  1.00 169.43 ? 66   LEU C O     1 
ATOM   4014  C  CB    . LEU C 2 66   ? 140.493 157.616 86.936  1.00 169.43 ? 66   LEU C CB    1 
ATOM   4015  C  CG    . LEU C 2 66   ? 139.903 156.244 86.610  1.00 169.43 ? 66   LEU C CG    1 
ATOM   4016  C  CD1   . LEU C 2 66   ? 139.750 156.079 85.109  1.00 169.43 ? 66   LEU C CD1   1 
ATOM   4017  C  CD2   . LEU C 2 66   ? 140.771 155.138 87.188  1.00 169.43 ? 66   LEU C CD2   1 
ATOM   4018  N  N     . ASP C 2 67   ? 137.538 158.804 85.706  1.00 166.24 ? 67   ASP C N     1 
ATOM   4019  C  CA    . ASP C 2 67   ? 136.139 159.130 85.925  1.00 166.24 ? 67   ASP C CA    1 
ATOM   4020  C  C     . ASP C 2 67   ? 135.294 157.871 85.789  1.00 166.24 ? 67   ASP C C     1 
ATOM   4021  O  O     . ASP C 2 67   ? 135.602 156.978 84.994  1.00 166.24 ? 67   ASP C O     1 
ATOM   4022  C  CB    . ASP C 2 67   ? 135.673 160.207 84.930  1.00 166.24 ? 67   ASP C CB    1 
ATOM   4023  C  CG    . ASP C 2 67   ? 134.276 160.724 85.226  1.00 166.24 ? 67   ASP C CG    1 
ATOM   4024  O  OD1   . ASP C 2 67   ? 134.122 161.955 85.369  1.00 166.24 ? 67   ASP C OD1   1 
ATOM   4025  O  OD2   . ASP C 2 67   ? 133.329 159.916 85.295  1.00 166.24 ? 67   ASP C OD2   1 
ATOM   4026  N  N     . PHE C 2 68   ? 134.223 157.809 86.576  1.00 151.78 ? 68   PHE C N     1 
ATOM   4027  C  CA    . PHE C 2 68   ? 133.336 156.655 86.594  1.00 151.78 ? 68   PHE C CA    1 
ATOM   4028  C  C     . PHE C 2 68   ? 132.020 157.000 85.910  1.00 151.78 ? 68   PHE C C     1 
ATOM   4029  O  O     . PHE C 2 68   ? 131.475 158.089 86.113  1.00 151.78 ? 68   PHE C O     1 
ATOM   4030  C  CB    . PHE C 2 68   ? 133.084 156.200 88.032  1.00 151.78 ? 68   PHE C CB    1 
ATOM   4031  C  CG    . PHE C 2 68   ? 131.772 155.501 88.226  1.00 151.78 ? 68   PHE C CG    1 
ATOM   4032  C  CD1   . PHE C 2 68   ? 131.628 154.167 87.890  1.00 151.78 ? 68   PHE C CD1   1 
ATOM   4033  C  CD2   . PHE C 2 68   ? 130.681 156.179 88.743  1.00 151.78 ? 68   PHE C CD2   1 
ATOM   4034  C  CE1   . PHE C 2 68   ? 130.422 153.522 88.068  1.00 151.78 ? 68   PHE C CE1   1 
ATOM   4035  C  CE2   . PHE C 2 68   ? 129.471 155.540 88.918  1.00 151.78 ? 68   PHE C CE2   1 
ATOM   4036  C  CZ    . PHE C 2 68   ? 129.342 154.209 88.582  1.00 151.78 ? 68   PHE C CZ    1 
ATOM   4037  N  N     . LEU C 2 69   ? 131.501 156.065 85.116  1.00 152.90 ? 69   LEU C N     1 
ATOM   4038  C  CA    . LEU C 2 69   ? 130.274 156.313 84.367  1.00 152.90 ? 69   LEU C CA    1 
ATOM   4039  C  C     . LEU C 2 69   ? 129.106 155.485 84.895  1.00 152.90 ? 69   LEU C C     1 
ATOM   4040  O  O     . LEU C 2 69   ? 128.067 156.037 85.271  1.00 152.90 ? 69   LEU C O     1 
ATOM   4041  C  CB    . LEU C 2 69   ? 130.505 156.030 82.880  1.00 152.90 ? 69   LEU C CB    1 
ATOM   4042  C  CG    . LEU C 2 69   ? 131.392 157.035 82.146  1.00 152.90 ? 69   LEU C CG    1 
ATOM   4043  C  CD1   . LEU C 2 69   ? 131.723 156.538 80.750  1.00 152.90 ? 69   LEU C CD1   1 
ATOM   4044  C  CD2   . LEU C 2 69   ? 130.716 158.395 82.089  1.00 152.90 ? 69   LEU C CD2   1 
ATOM   4045  N  N     . GLU C 2 70   ? 129.265 154.165 84.939  1.00 146.82 ? 70   GLU C N     1 
ATOM   4046  C  CA    . GLU C 2 70   ? 128.185 153.279 85.353  1.00 146.82 ? 70   GLU C CA    1 
ATOM   4047  C  C     . GLU C 2 70   ? 128.756 151.892 85.605  1.00 146.82 ? 70   GLU C C     1 
ATOM   4048  O  O     . GLU C 2 70   ? 129.925 151.620 85.315  1.00 146.82 ? 70   GLU C O     1 
ATOM   4049  C  CB    . GLU C 2 70   ? 127.065 153.230 84.306  1.00 146.82 ? 70   GLU C CB    1 
ATOM   4050  C  CG    . GLU C 2 70   ? 127.512 152.791 82.922  1.00 146.82 ? 70   GLU C CG    1 
ATOM   4051  C  CD    . GLU C 2 70   ? 127.465 151.290 82.740  1.00 146.82 ? 70   GLU C CD    1 
ATOM   4052  O  OE1   . GLU C 2 70   ? 126.753 150.620 83.516  1.00 146.82 ? 70   GLU C OE1   1 
ATOM   4053  O  OE2   . GLU C 2 70   ? 128.141 150.779 81.823  1.00 146.82 ? 70   GLU C OE2   1 
ATOM   4054  N  N     . TYR C 2 71   ? 127.919 151.025 86.167  1.00 133.47 ? 71   TYR C N     1 
ATOM   4055  C  CA    . TYR C 2 71   ? 128.297 149.659 86.482  1.00 133.47 ? 71   TYR C CA    1 
ATOM   4056  C  C     . TYR C 2 71   ? 127.179 148.705 86.088  1.00 133.47 ? 71   TYR C C     1 
ATOM   4057  O  O     . TYR C 2 71   ? 126.058 149.119 85.780  1.00 133.47 ? 71   TYR C O     1 
ATOM   4058  C  CB    . TYR C 2 71   ? 128.615 149.500 87.975  1.00 133.47 ? 71   TYR C CB    1 
ATOM   4059  C  CG    . TYR C 2 71   ? 127.394 149.438 88.865  1.00 133.47 ? 71   TYR C CG    1 
ATOM   4060  C  CD1   . TYR C 2 71   ? 126.885 148.221 89.293  1.00 133.47 ? 71   TYR C CD1   1 
ATOM   4061  C  CD2   . TYR C 2 71   ? 126.752 150.596 89.277  1.00 133.47 ? 71   TYR C CD2   1 
ATOM   4062  C  CE1   . TYR C 2 71   ? 125.772 148.158 90.105  1.00 133.47 ? 71   TYR C CE1   1 
ATOM   4063  C  CE2   . TYR C 2 71   ? 125.636 150.541 90.092  1.00 133.47 ? 71   TYR C CE2   1 
ATOM   4064  C  CZ    . TYR C 2 71   ? 125.152 149.320 90.501  1.00 133.47 ? 71   TYR C CZ    1 
ATOM   4065  O  OH    . TYR C 2 71   ? 124.042 149.257 91.310  1.00 133.47 ? 71   TYR C OH    1 
ATOM   4066  N  N     . ARG C 2 72   ? 127.496 147.413 86.114  1.00 131.41 ? 72   ARG C N     1 
ATOM   4067  C  CA    . ARG C 2 72   ? 126.522 146.377 85.813  1.00 131.41 ? 72   ARG C CA    1 
ATOM   4068  C  C     . ARG C 2 72   ? 126.954 145.068 86.456  1.00 131.41 ? 72   ARG C C     1 
ATOM   4069  O  O     . ARG C 2 72   ? 128.121 144.884 86.816  1.00 131.41 ? 72   ARG C O     1 
ATOM   4070  C  CB    . ARG C 2 72   ? 126.341 146.191 84.302  1.00 131.41 ? 72   ARG C CB    1 
ATOM   4071  C  CG    . ARG C 2 72   ? 127.578 145.713 83.570  1.00 131.41 ? 72   ARG C CG    1 
ATOM   4072  C  CD    . ARG C 2 72   ? 127.218 145.217 82.181  1.00 131.41 ? 72   ARG C CD    1 
ATOM   4073  N  NE    . ARG C 2 72   ? 128.353 144.605 81.499  1.00 131.41 ? 72   ARG C NE    1 
ATOM   4074  C  CZ    . ARG C 2 72   ? 128.657 143.314 81.568  1.00 131.41 ? 72   ARG C CZ    1 
ATOM   4075  N  NH1   . ARG C 2 72   ? 127.907 142.493 82.290  1.00 131.41 ? 72   ARG C NH1   1 
ATOM   4076  N  NH2   . ARG C 2 72   ? 129.710 142.843 80.915  1.00 131.41 ? 72   ARG C NH2   1 
ATOM   4077  N  N     . LEU C 2 73   ? 125.991 144.164 86.606  1.00 123.83 ? 73   LEU C N     1 
ATOM   4078  C  CA    . LEU C 2 73   ? 126.202 142.871 87.240  1.00 123.83 ? 73   LEU C CA    1 
ATOM   4079  C  C     . LEU C 2 73   ? 125.988 141.768 86.215  1.00 123.83 ? 73   LEU C C     1 
ATOM   4080  O  O     . LEU C 2 73   ? 125.004 141.792 85.469  1.00 123.83 ? 73   LEU C O     1 
ATOM   4081  C  CB    . LEU C 2 73   ? 125.253 142.685 88.424  1.00 123.83 ? 73   LEU C CB    1 
ATOM   4082  C  CG    . LEU C 2 73   ? 125.572 143.499 89.677  1.00 123.83 ? 73   LEU C CG    1 
ATOM   4083  C  CD1   . LEU C 2 73   ? 124.405 143.465 90.644  1.00 123.83 ? 73   LEU C CD1   1 
ATOM   4084  C  CD2   . LEU C 2 73   ? 126.833 142.980 90.339  1.00 123.83 ? 73   LEU C CD2   1 
ATOM   4085  N  N     . GLY C 2 74   ? 126.906 140.809 86.180  1.00 132.18 ? 74   GLY C N     1 
ATOM   4086  C  CA    . GLY C 2 74   ? 126.827 139.712 85.243  1.00 132.18 ? 74   GLY C CA    1 
ATOM   4087  C  C     . GLY C 2 74   ? 125.919 138.601 85.734  1.00 132.18 ? 74   GLY C C     1 
ATOM   4088  O  O     . GLY C 2 74   ? 125.078 138.774 86.617  1.00 132.18 ? 74   GLY C O     1 
ATOM   4089  N  N     . GLU C 2 75   ? 126.104 137.430 85.137  1.00 136.78 ? 75   GLU C N     1 
ATOM   4090  C  CA    . GLU C 2 75   ? 125.335 136.249 85.491  1.00 136.78 ? 75   GLU C CA    1 
ATOM   4091  C  C     . GLU C 2 75   ? 126.132 135.351 86.431  1.00 136.78 ? 75   GLU C C     1 
ATOM   4092  O  O     . GLU C 2 75   ? 127.358 135.257 86.319  1.00 136.78 ? 75   GLU C O     1 
ATOM   4093  C  CB    . GLU C 2 75   ? 124.957 135.466 84.238  1.00 136.78 ? 75   GLU C CB    1 
ATOM   4094  C  CG    . GLU C 2 75   ? 123.656 135.915 83.598  1.00 136.78 ? 75   GLU C CG    1 
ATOM   4095  C  CD    . GLU C 2 75   ? 122.501 135.927 84.578  1.00 136.78 ? 75   GLU C CD    1 
ATOM   4096  O  OE1   . GLU C 2 75   ? 122.029 137.028 84.930  1.00 136.78 ? 75   GLU C OE1   1 
ATOM   4097  O  OE2   . GLU C 2 75   ? 122.065 134.834 84.996  1.00 136.78 ? 75   GLU C OE2   1 
ATOM   4098  N  N     . PRO C 2 76   ? 125.461 134.688 87.367  1.00 132.08 ? 76   PRO C N     1 
ATOM   4099  C  CA    . PRO C 2 76   ? 126.159 133.781 88.281  1.00 132.08 ? 76   PRO C CA    1 
ATOM   4100  C  C     . PRO C 2 76   ? 126.756 132.609 87.526  1.00 132.08 ? 76   PRO C C     1 
ATOM   4101  O  O     . PRO C 2 76   ? 126.079 131.982 86.698  1.00 132.08 ? 76   PRO C O     1 
ATOM   4102  C  CB    . PRO C 2 76   ? 125.052 133.320 89.242  1.00 132.08 ? 76   PRO C CB    1 
ATOM   4103  C  CG    . PRO C 2 76   ? 123.943 134.308 89.070  1.00 132.08 ? 76   PRO C CG    1 
ATOM   4104  C  CD    . PRO C 2 76   ? 124.020 134.763 87.653  1.00 132.08 ? 76   PRO C CD    1 
ATOM   4105  N  N     . PRO C 2 77   ? 128.027 132.290 87.776  1.00 131.73 ? 77   PRO C N     1 
ATOM   4106  C  CA    . PRO C 2 77   ? 128.661 131.186 87.037  1.00 131.73 ? 77   PRO C CA    1 
ATOM   4107  C  C     . PRO C 2 77   ? 128.022 129.833 87.291  1.00 131.73 ? 77   PRO C C     1 
ATOM   4108  O  O     . PRO C 2 77   ? 128.032 128.979 86.396  1.00 131.73 ? 77   PRO C O     1 
ATOM   4109  C  CB    . PRO C 2 77   ? 130.112 131.224 87.534  1.00 131.73 ? 77   PRO C CB    1 
ATOM   4110  C  CG    . PRO C 2 77   ? 130.309 132.615 88.039  1.00 131.73 ? 77   PRO C CG    1 
ATOM   4111  C  CD    . PRO C 2 77   ? 128.989 133.021 88.615  1.00 131.73 ? 77   PRO C CD    1 
ATOM   4112  N  N     . PHE C 2 78   ? 127.465 129.605 88.481  1.00 134.14 ? 78   PHE C N     1 
ATOM   4113  C  CA    . PHE C 2 78   ? 126.898 128.313 88.829  1.00 134.14 ? 78   PHE C CA    1 
ATOM   4114  C  C     . PHE C 2 78   ? 125.616 128.496 89.630  1.00 134.14 ? 78   PHE C C     1 
ATOM   4115  O  O     . PHE C 2 78   ? 125.502 129.456 90.406  1.00 134.14 ? 78   PHE C O     1 
ATOM   4116  C  CB    . PHE C 2 78   ? 127.891 127.469 89.639  1.00 134.14 ? 78   PHE C CB    1 
ATOM   4117  C  CG    . PHE C 2 78   ? 129.228 127.309 88.979  1.00 134.14 ? 78   PHE C CG    1 
ATOM   4118  C  CD1   . PHE C 2 78   ? 130.281 128.143 89.308  1.00 134.14 ? 78   PHE C CD1   1 
ATOM   4119  C  CD2   . PHE C 2 78   ? 129.431 126.325 88.028  1.00 134.14 ? 78   PHE C CD2   1 
ATOM   4120  C  CE1   . PHE C 2 78   ? 131.513 127.999 88.701  1.00 134.14 ? 78   PHE C CE1   1 
ATOM   4121  C  CE2   . PHE C 2 78   ? 130.659 126.175 87.418  1.00 134.14 ? 78   PHE C CE2   1 
ATOM   4122  C  CZ    . PHE C 2 78   ? 131.702 127.013 87.755  1.00 134.14 ? 78   PHE C CZ    1 
ATOM   4123  N  N     . PRO C 2 79   ? 124.641 127.599 89.467  1.00 131.52 ? 79   PRO C N     1 
ATOM   4124  C  CA    . PRO C 2 79   ? 123.413 127.690 90.268  1.00 131.52 ? 79   PRO C CA    1 
ATOM   4125  C  C     . PRO C 2 79   ? 123.662 127.389 91.737  1.00 131.52 ? 79   PRO C C     1 
ATOM   4126  O  O     . PRO C 2 79   ? 124.740 126.914 92.104  1.00 131.52 ? 79   PRO C O     1 
ATOM   4127  C  CB    . PRO C 2 79   ? 122.494 126.646 89.623  1.00 131.52 ? 79   PRO C CB    1 
ATOM   4128  C  CG    . PRO C 2 79   ? 123.421 125.677 88.976  1.00 131.52 ? 79   PRO C CG    1 
ATOM   4129  C  CD    . PRO C 2 79   ? 124.606 126.474 88.518  1.00 131.52 ? 79   PRO C CD    1 
ATOM   4130  N  N     . GLN C 2 80   ? 122.659 127.646 92.579  1.00 131.82 ? 80   GLN C N     1 
ATOM   4131  C  CA    . GLN C 2 80   ? 122.856 127.594 94.026  1.00 131.82 ? 80   GLN C CA    1 
ATOM   4132  C  C     . GLN C 2 80   ? 123.253 126.198 94.493  1.00 131.82 ? 80   GLN C C     1 
ATOM   4133  O  O     . GLN C 2 80   ? 124.248 126.032 95.211  1.00 131.82 ? 80   GLN C O     1 
ATOM   4134  C  CB    . GLN C 2 80   ? 121.585 128.059 94.736  1.00 131.82 ? 80   GLN C CB    1 
ATOM   4135  C  CG    . GLN C 2 80   ? 120.985 129.326 94.155  1.00 131.82 ? 80   GLN C CG    1 
ATOM   4136  C  CD    . GLN C 2 80   ? 119.655 129.680 94.784  1.00 131.82 ? 80   GLN C CD    1 
ATOM   4137  O  OE1   . GLN C 2 80   ? 119.236 129.066 95.764  1.00 131.82 ? 80   GLN C OE1   1 
ATOM   4138  N  NE2   . GLN C 2 80   ? 118.980 130.675 94.221  1.00 131.82 ? 80   GLN C NE2   1 
ATOM   4139  N  N     . ASP C 2 81   ? 122.474 125.183 94.112  1.00 138.24 ? 81   ASP C N     1 
ATOM   4140  C  CA    . ASP C 2 81   ? 122.752 123.822 94.560  1.00 138.24 ? 81   ASP C CA    1 
ATOM   4141  C  C     . ASP C 2 81   ? 124.142 123.371 94.129  1.00 138.24 ? 81   ASP C C     1 
ATOM   4142  O  O     . ASP C 2 81   ? 124.811 122.614 94.840  1.00 138.24 ? 81   ASP C O     1 
ATOM   4143  C  CB    . ASP C 2 81   ? 121.681 122.866 94.031  1.00 138.24 ? 81   ASP C CB    1 
ATOM   4144  C  CG    . ASP C 2 81   ? 121.420 123.042 92.550  1.00 138.24 ? 81   ASP C CG    1 
ATOM   4145  O  OD1   . ASP C 2 81   ? 120.255 123.294 92.179  1.00 138.24 ? 81   ASP C OD1   1 
ATOM   4146  O  OD2   . ASP C 2 81   ? 122.375 122.924 91.755  1.00 138.24 ? 81   ASP C OD2   1 
ATOM   4147  N  N     . GLU C 2 82   ? 124.604 123.847 92.973  1.00 138.72 ? 82   GLU C N     1 
ATOM   4148  C  CA    . GLU C 2 82   ? 125.943 123.489 92.517  1.00 138.72 ? 82   GLU C CA    1 
ATOM   4149  C  C     . GLU C 2 82   ? 127.012 124.082 93.428  1.00 138.72 ? 82   GLU C C     1 
ATOM   4150  O  O     . GLU C 2 82   ? 128.009 123.419 93.743  1.00 138.72 ? 82   GLU C O     1 
ATOM   4151  C  CB    . GLU C 2 82   ? 126.138 123.952 91.074  1.00 138.72 ? 82   GLU C CB    1 
ATOM   4152  C  CG    . GLU C 2 82   ? 126.972 123.013 90.225  1.00 138.72 ? 82   GLU C CG    1 
ATOM   4153  C  CD    . GLU C 2 82   ? 128.456 123.275 90.354  1.00 138.72 ? 82   GLU C CD    1 
ATOM   4154  O  OE1   . GLU C 2 82   ? 128.829 124.365 90.835  1.00 138.72 ? 82   GLU C OE1   1 
ATOM   4155  O  OE2   . GLU C 2 82   ? 129.249 122.394 89.966  1.00 138.72 ? 82   GLU C OE2   1 
ATOM   4156  N  N     . CYS C 2 83   ? 126.820 125.330 93.865  1.00 135.64 ? 83   CYS C N     1 
ATOM   4157  C  CA    . CYS C 2 83   ? 127.752 125.933 94.813  1.00 135.64 ? 83   CYS C CA    1 
ATOM   4158  C  C     . CYS C 2 83   ? 127.725 125.200 96.146  1.00 135.64 ? 83   CYS C C     1 
ATOM   4159  O  O     . CYS C 2 83   ? 128.773 124.966 96.760  1.00 135.64 ? 83   CYS C O     1 
ATOM   4160  C  CB    . CYS C 2 83   ? 127.433 127.416 95.007  1.00 135.64 ? 83   CYS C CB    1 
ATOM   4161  S  SG    . CYS C 2 83   ? 127.087 128.325 93.489  1.00 135.64 ? 83   CYS C SG    1 
ATOM   4162  N  N     . ARG C 2 84   ? 126.529 124.843 96.621  1.00 130.10 ? 84   ARG C N     1 
ATOM   4163  C  CA    . ARG C 2 84   ? 126.435 124.043 97.838  1.00 130.10 ? 84   ARG C CA    1 
ATOM   4164  C  C     . ARG C 2 84   ? 127.167 122.717 97.678  1.00 130.10 ? 84   ARG C C     1 
ATOM   4165  O  O     . ARG C 2 84   ? 127.761 122.204 98.633  1.00 130.10 ? 84   ARG C O     1 
ATOM   4166  C  CB    . ARG C 2 84   ? 124.971 123.798 98.201  1.00 130.10 ? 84   ARG C CB    1 
ATOM   4167  C  CG    . ARG C 2 84   ? 124.250 125.003 98.771  1.00 130.10 ? 84   ARG C CG    1 
ATOM   4168  C  CD    . ARG C 2 84   ? 122.940 124.586 99.413  1.00 130.10 ? 84   ARG C CD    1 
ATOM   4169  N  NE    . ARG C 2 84   ? 122.159 125.729 99.871  1.00 130.10 ? 84   ARG C NE    1 
ATOM   4170  C  CZ    . ARG C 2 84   ? 121.151 126.262 99.190  1.00 130.10 ? 84   ARG C CZ    1 
ATOM   4171  N  NH1   . ARG C 2 84   ? 120.798 125.751 98.019  1.00 130.10 ? 84   ARG C NH1   1 
ATOM   4172  N  NH2   . ARG C 2 84   ? 120.494 127.302 99.680  1.00 130.10 ? 84   ARG C NH2   1 
ATOM   4173  N  N     . GLU C 2 85   ? 127.131 122.148 96.472  1.00 140.24 ? 85   GLU C N     1 
ATOM   4174  C  CA    . GLU C 2 85   ? 127.782 120.868 96.226  1.00 140.24 ? 85   GLU C CA    1 
ATOM   4175  C  C     . GLU C 2 85   ? 129.299 121.002 96.257  1.00 140.24 ? 85   GLU C C     1 
ATOM   4176  O  O     . GLU C 2 85   ? 129.987 120.238 96.943  1.00 140.24 ? 85   GLU C O     1 
ATOM   4177  C  CB    . GLU C 2 85   ? 127.319 120.306 94.882  1.00 140.24 ? 85   GLU C CB    1 
ATOM   4178  C  CG    . GLU C 2 85   ? 128.014 119.024 94.466  1.00 140.24 ? 85   GLU C CG    1 
ATOM   4179  C  CD    . GLU C 2 85   ? 127.569 117.831 95.284  1.00 140.24 ? 85   GLU C CD    1 
ATOM   4180  O  OE1   . GLU C 2 85   ? 126.466 117.884 95.866  1.00 140.24 ? 85   GLU C OE1   1 
ATOM   4181  O  OE2   . GLU C 2 85   ? 128.322 116.837 95.341  1.00 140.24 ? 85   GLU C OE2   1 
ATOM   4182  N  N     . LYS C 2 86   ? 129.841 121.970 95.520  1.00 139.60 ? 86   LYS C N     1 
ATOM   4183  C  CA    . LYS C 2 86   ? 131.283 122.085 95.349  1.00 139.60 ? 86   LYS C CA    1 
ATOM   4184  C  C     . LYS C 2 86   ? 131.909 123.182 96.201  1.00 139.60 ? 86   LYS C C     1 
ATOM   4185  O  O     . LYS C 2 86   ? 133.006 123.647 95.878  1.00 139.60 ? 86   LYS C O     1 
ATOM   4186  C  CB    . LYS C 2 86   ? 131.620 122.310 93.875  1.00 139.60 ? 86   LYS C CB    1 
ATOM   4187  C  CG    . LYS C 2 86   ? 131.118 121.202 92.968  1.00 139.60 ? 86   LYS C CG    1 
ATOM   4188  C  CD    . LYS C 2 86   ? 131.764 121.267 91.598  1.00 139.60 ? 86   LYS C CD    1 
ATOM   4189  C  CE    . LYS C 2 86   ? 131.356 120.076 90.747  1.00 139.60 ? 86   LYS C CE    1 
ATOM   4190  N  NZ    . LYS C 2 86   ? 131.857 120.193 89.351  1.00 139.60 ? 86   LYS C NZ    1 
ATOM   4191  N  N     . ASP C 2 87   ? 131.240 123.602 97.276  1.00 136.58 ? 87   ASP C N     1 
ATOM   4192  C  CA    . ASP C 2 87   ? 131.805 124.543 98.248  1.00 136.58 ? 87   ASP C CA    1 
ATOM   4193  C  C     . ASP C 2 87   ? 132.235 125.851 97.590  1.00 136.58 ? 87   ASP C C     1 
ATOM   4194  O  O     . ASP C 2 87   ? 133.312 126.383 97.868  1.00 136.58 ? 87   ASP C O     1 
ATOM   4195  C  CB    . ASP C 2 87   ? 132.975 123.913 99.007  1.00 136.58 ? 87   ASP C CB    1 
ATOM   4196  C  CG    . ASP C 2 87   ? 132.517 123.004 100.129 1.00 136.58 ? 87   ASP C CG    1 
ATOM   4197  O  OD1   . ASP C 2 87   ? 131.336 122.599 100.123 1.00 136.58 ? 87   ASP C OD1   1 
ATOM   4198  O  OD2   . ASP C 2 87   ? 133.339 122.697 101.018 1.00 136.58 ? 87   ASP C OD2   1 
ATOM   4199  N  N     . LEU C 2 88   ? 131.390 126.376 96.712  1.00 129.34 ? 88   LEU C N     1 
ATOM   4200  C  CA    . LEU C 2 88   ? 131.648 127.635 96.036  1.00 129.34 ? 88   LEU C CA    1 
ATOM   4201  C  C     . LEU C 2 88   ? 130.843 128.751 96.684  1.00 129.34 ? 88   LEU C C     1 
ATOM   4202  O  O     . LEU C 2 88   ? 129.988 128.508 97.540  1.00 129.34 ? 88   LEU C O     1 
ATOM   4203  C  CB    . LEU C 2 88   ? 131.300 127.546 94.548  1.00 129.34 ? 88   LEU C CB    1 
ATOM   4204  C  CG    . LEU C 2 88   ? 132.181 126.640 93.690  1.00 129.34 ? 88   LEU C CG    1 
ATOM   4205  C  CD1   . LEU C 2 88   ? 132.057 127.016 92.226  1.00 129.34 ? 88   LEU C CD1   1 
ATOM   4206  C  CD2   . LEU C 2 88   ? 133.628 126.721 94.143  1.00 129.34 ? 88   LEU C CD2   1 
ATOM   4207  N  N     . THR C 2 89   ? 131.131 129.980 96.272  1.00 120.74 ? 89   THR C N     1 
ATOM   4208  C  CA    . THR C 2 89   ? 130.369 131.130 96.733  1.00 120.74 ? 89   THR C CA    1 
ATOM   4209  C  C     . THR C 2 89   ? 129.422 131.587 95.632  1.00 120.74 ? 89   THR C C     1 
ATOM   4210  O  O     . THR C 2 89   ? 129.855 131.889 94.516  1.00 120.74 ? 89   THR C O     1 
ATOM   4211  C  CB    . THR C 2 89   ? 131.305 132.268 97.136  1.00 120.74 ? 89   THR C CB    1 
ATOM   4212  O  OG1   . THR C 2 89   ? 131.987 131.918 98.347  1.00 120.74 ? 89   THR C OG1   1 
ATOM   4213  C  CG2   . THR C 2 89   ? 130.521 133.549 97.357  1.00 120.74 ? 89   THR C CG2   1 
ATOM   4214  N  N     . TYR C 2 90   ? 128.132 131.631 95.945  1.00 117.51 ? 90   TYR C N     1 
ATOM   4215  C  CA    . TYR C 2 90   ? 127.129 132.048 94.975  1.00 117.51 ? 90   TYR C CA    1 
ATOM   4216  C  C     . TYR C 2 90   ? 127.246 133.552 94.763  1.00 117.51 ? 90   TYR C C     1 
ATOM   4217  O  O     . TYR C 2 90   ? 126.769 134.340 95.586  1.00 117.51 ? 90   TYR C O     1 
ATOM   4218  C  CB    . TYR C 2 90   ? 125.734 131.667 95.461  1.00 117.51 ? 90   TYR C CB    1 
ATOM   4219  C  CG    . TYR C 2 90   ? 124.626 132.023 94.502  1.00 117.51 ? 90   TYR C CG    1 
ATOM   4220  C  CD1   . TYR C 2 90   ? 124.712 131.692 93.160  1.00 117.51 ? 90   TYR C CD1   1 
ATOM   4221  C  CD2   . TYR C 2 90   ? 123.486 132.678 94.942  1.00 117.51 ? 90   TYR C CD2   1 
ATOM   4222  C  CE1   . TYR C 2 90   ? 123.699 132.009 92.281  1.00 117.51 ? 90   TYR C CE1   1 
ATOM   4223  C  CE2   . TYR C 2 90   ? 122.468 133.001 94.070  1.00 117.51 ? 90   TYR C CE2   1 
ATOM   4224  C  CZ    . TYR C 2 90   ? 122.580 132.664 92.741  1.00 117.51 ? 90   TYR C CZ    1 
ATOM   4225  O  OH    . TYR C 2 90   ? 121.568 132.983 91.866  1.00 117.51 ? 90   TYR C OH    1 
ATOM   4226  N  N     . GLN C 2 91   ? 127.878 133.949 93.662  1.00 120.38 ? 91   GLN C N     1 
ATOM   4227  C  CA    . GLN C 2 91   ? 128.215 135.348 93.451  1.00 120.38 ? 91   GLN C CA    1 
ATOM   4228  C  C     . GLN C 2 91   ? 128.050 135.693 91.980  1.00 120.38 ? 91   GLN C C     1 
ATOM   4229  O  O     . GLN C 2 91   ? 127.925 134.813 91.125  1.00 120.38 ? 91   GLN C O     1 
ATOM   4230  C  CB    . GLN C 2 91   ? 129.644 135.646 93.908  1.00 120.38 ? 91   GLN C CB    1 
ATOM   4231  C  CG    . GLN C 2 91   ? 130.677 134.724 93.289  1.00 120.38 ? 91   GLN C CG    1 
ATOM   4232  C  CD    . GLN C 2 91   ? 132.018 134.798 93.985  1.00 120.38 ? 91   GLN C CD    1 
ATOM   4233  O  OE1   . GLN C 2 91   ? 132.139 135.374 95.065  1.00 120.38 ? 91   GLN C OE1   1 
ATOM   4234  N  NE2   . GLN C 2 91   ? 133.037 134.213 93.368  1.00 120.38 ? 91   GLN C NE2   1 
ATOM   4235  N  N     . ALA C 2 92   ? 128.054 136.994 91.701  1.00 121.21 ? 92   ALA C N     1 
ATOM   4236  C  CA    . ALA C 2 92   ? 127.940 137.521 90.356  1.00 121.21 ? 92   ALA C CA    1 
ATOM   4237  C  C     . ALA C 2 92   ? 129.107 138.451 90.047  1.00 121.21 ? 92   ALA C C     1 
ATOM   4238  O  O     . ALA C 2 92   ? 129.587 139.157 90.939  1.00 121.21 ? 92   ALA C O     1 
ATOM   4239  C  CB    . ALA C 2 92   ? 126.622 138.284 90.173  1.00 121.21 ? 92   ALA C CB    1 
ATOM   4240  N  N     . PRO C 2 93   ? 129.581 138.480 88.802  1.00 127.11 ? 93   PRO C N     1 
ATOM   4241  C  CA    . PRO C 2 93   ? 130.693 139.374 88.459  1.00 127.11 ? 93   PRO C CA    1 
ATOM   4242  C  C     . PRO C 2 93   ? 130.202 140.800 88.264  1.00 127.11 ? 93   PRO C C     1 
ATOM   4243  O  O     . PRO C 2 93   ? 129.149 141.034 87.667  1.00 127.11 ? 93   PRO C O     1 
ATOM   4244  C  CB    . PRO C 2 93   ? 131.232 138.777 87.157  1.00 127.11 ? 93   PRO C CB    1 
ATOM   4245  C  CG    . PRO C 2 93   ? 130.031 138.166 86.525  1.00 127.11 ? 93   PRO C CG    1 
ATOM   4246  C  CD    . PRO C 2 93   ? 129.172 137.648 87.657  1.00 127.11 ? 93   PRO C CD    1 
ATOM   4247  N  N     . LEU C 2 94   ? 130.974 141.753 88.774  1.00 127.28 ? 94   LEU C N     1 
ATOM   4248  C  CA    . LEU C 2 94   ? 130.629 143.167 88.725  1.00 127.28 ? 94   LEU C CA    1 
ATOM   4249  C  C     . LEU C 2 94   ? 131.575 143.893 87.779  1.00 127.28 ? 94   LEU C C     1 
ATOM   4250  O  O     . LEU C 2 94   ? 132.788 143.914 88.007  1.00 127.28 ? 94   LEU C O     1 
ATOM   4251  C  CB    . LEU C 2 94   ? 130.697 143.788 90.120  1.00 127.28 ? 94   LEU C CB    1 
ATOM   4252  C  CG    . LEU C 2 94   ? 130.819 145.309 90.184  1.00 127.28 ? 94   LEU C CG    1 
ATOM   4253  C  CD1   . LEU C 2 94   ? 129.485 145.956 89.882  1.00 127.28 ? 94   LEU C CD1   1 
ATOM   4254  C  CD2   . LEU C 2 94   ? 131.336 145.747 91.543  1.00 127.28 ? 94   LEU C CD2   1 
ATOM   4255  N  N     . TYR C 2 95   ? 131.022 144.482 86.721  1.00 135.39 ? 95   TYR C N     1 
ATOM   4256  C  CA    . TYR C 2 95   ? 131.802 145.254 85.767  1.00 135.39 ? 95   TYR C CA    1 
ATOM   4257  C  C     . TYR C 2 95   ? 131.489 146.734 85.929  1.00 135.39 ? 95   TYR C C     1 
ATOM   4258  O  O     . TYR C 2 95   ? 130.366 147.111 86.274  1.00 135.39 ? 95   TYR C O     1 
ATOM   4259  C  CB    . TYR C 2 95   ? 131.516 144.822 84.326  1.00 135.39 ? 95   TYR C CB    1 
ATOM   4260  C  CG    . TYR C 2 95   ? 131.863 143.382 84.037  1.00 135.39 ? 95   TYR C CG    1 
ATOM   4261  C  CD1   . TYR C 2 95   ? 130.873 142.418 83.934  1.00 135.39 ? 95   TYR C CD1   1 
ATOM   4262  C  CD2   . TYR C 2 95   ? 133.182 142.988 83.867  1.00 135.39 ? 95   TYR C CD2   1 
ATOM   4263  C  CE1   . TYR C 2 95   ? 131.185 141.102 83.668  1.00 135.39 ? 95   TYR C CE1   1 
ATOM   4264  C  CE2   . TYR C 2 95   ? 133.504 141.674 83.603  1.00 135.39 ? 95   TYR C CE2   1 
ATOM   4265  C  CZ    . TYR C 2 95   ? 132.502 140.735 83.505  1.00 135.39 ? 95   TYR C CZ    1 
ATOM   4266  O  OH    . TYR C 2 95   ? 132.817 139.423 83.241  1.00 135.39 ? 95   TYR C OH    1 
ATOM   4267  N  N     . ALA C 2 96   ? 132.493 147.571 85.681  1.00 146.27 ? 96   ALA C N     1 
ATOM   4268  C  CA    . ALA C 2 96   ? 132.338 149.017 85.780  1.00 146.27 ? 96   ALA C CA    1 
ATOM   4269  C  C     . ALA C 2 96   ? 132.970 149.668 84.562  1.00 146.27 ? 96   ALA C C     1 
ATOM   4270  O  O     . ALA C 2 96   ? 134.126 149.387 84.238  1.00 146.27 ? 96   ALA C O     1 
ATOM   4271  C  CB    . ALA C 2 96   ? 132.976 149.558 87.062  1.00 146.27 ? 96   ALA C CB    1 
ATOM   4272  N  N     . ARG C 2 97   ? 132.217 150.531 83.886  1.00 154.82 ? 97   ARG C N     1 
ATOM   4273  C  CA    . ARG C 2 97   ? 132.731 151.202 82.700  1.00 154.82 ? 97   ARG C CA    1 
ATOM   4274  C  C     . ARG C 2 97   ? 133.407 152.504 83.109  1.00 154.82 ? 97   ARG C C     1 
ATOM   4275  O  O     . ARG C 2 97   ? 132.733 153.478 83.459  1.00 154.82 ? 97   ARG C O     1 
ATOM   4276  C  CB    . ARG C 2 97   ? 131.606 151.463 81.703  1.00 154.82 ? 97   ARG C CB    1 
ATOM   4277  C  CG    . ARG C 2 97   ? 132.063 152.137 80.425  1.00 154.82 ? 97   ARG C CG    1 
ATOM   4278  C  CD    . ARG C 2 97   ? 130.969 153.019 79.852  1.00 154.82 ? 97   ARG C CD    1 
ATOM   4279  N  NE    . ARG C 2 97   ? 129.738 152.272 79.610  1.00 154.82 ? 97   ARG C NE    1 
ATOM   4280  C  CZ    . ARG C 2 97   ? 129.567 151.408 78.615  1.00 154.82 ? 97   ARG C CZ    1 
ATOM   4281  N  NH1   . ARG C 2 97   ? 130.548 151.178 77.752  1.00 154.82 ? 97   ARG C NH1   1 
ATOM   4282  N  NH2   . ARG C 2 97   ? 128.411 150.775 78.477  1.00 154.82 ? 97   ARG C NH2   1 
ATOM   4283  N  N     . LEU C 2 98   ? 134.736 152.521 83.062  1.00 160.75 ? 98   LEU C N     1 
ATOM   4284  C  CA    . LEU C 2 98   ? 135.525 153.668 83.481  1.00 160.75 ? 98   LEU C CA    1 
ATOM   4285  C  C     . LEU C 2 98   ? 136.226 154.278 82.277  1.00 160.75 ? 98   LEU C C     1 
ATOM   4286  O  O     . LEU C 2 98   ? 136.586 153.571 81.329  1.00 160.75 ? 98   LEU C O     1 
ATOM   4287  C  CB    . LEU C 2 98   ? 136.565 153.271 84.532  1.00 160.75 ? 98   LEU C CB    1 
ATOM   4288  C  CG    . LEU C 2 98   ? 136.057 152.538 85.772  1.00 160.75 ? 98   LEU C CG    1 
ATOM   4289  C  CD1   . LEU C 2 98   ? 137.225 151.996 86.578  1.00 160.75 ? 98   LEU C CD1   1 
ATOM   4290  C  CD2   . LEU C 2 98   ? 135.201 153.460 86.619  1.00 160.75 ? 98   LEU C CD2   1 
ATOM   4291  N  N     . GLN C 2 99   ? 136.436 155.591 82.329  1.00 169.58 ? 99   GLN C N     1 
ATOM   4292  C  CA    . GLN C 2 99   ? 137.163 156.310 81.292  1.00 169.58 ? 99   GLN C CA    1 
ATOM   4293  C  C     . GLN C 2 99   ? 138.269 157.130 81.942  1.00 169.58 ? 99   GLN C C     1 
ATOM   4294  O  O     . GLN C 2 99   ? 138.021 157.883 82.890  1.00 169.58 ? 99   GLN C O     1 
ATOM   4295  C  CB    . GLN C 2 99   ? 136.226 157.199 80.468  1.00 169.58 ? 99   GLN C CB    1 
ATOM   4296  C  CG    . GLN C 2 99   ? 135.511 158.286 81.249  1.00 169.58 ? 99   GLN C CG    1 
ATOM   4297  C  CD    . GLN C 2 99   ? 134.543 159.071 80.391  1.00 169.58 ? 99   GLN C CD    1 
ATOM   4298  O  OE1   . GLN C 2 99   ? 134.347 158.764 79.216  1.00 169.58 ? 99   GLN C OE1   1 
ATOM   4299  N  NE2   . GLN C 2 99   ? 133.933 160.096 80.974  1.00 169.58 ? 99   GLN C NE2   1 
ATOM   4300  N  N     . LEU C 2 100  ? 139.491 156.952 81.452  1.00 179.11 ? 100  LEU C N     1 
ATOM   4301  C  CA    . LEU C 2 100  ? 140.617 157.767 81.877  1.00 179.11 ? 100  LEU C CA    1 
ATOM   4302  C  C     . LEU C 2 100  ? 140.748 158.970 80.954  1.00 179.11 ? 100  LEU C C     1 
ATOM   4303  O  O     . LEU C 2 100  ? 140.801 158.821 79.727  1.00 179.11 ? 100  LEU C O     1 
ATOM   4304  C  CB    . LEU C 2 100  ? 141.905 156.944 81.867  1.00 179.11 ? 100  LEU C CB    1 
ATOM   4305  C  CG    . LEU C 2 100  ? 143.195 157.692 82.206  1.00 179.11 ? 100  LEU C CG    1 
ATOM   4306  C  CD1   . LEU C 2 100  ? 143.032 158.503 83.482  1.00 179.11 ? 100  LEU C CD1   1 
ATOM   4307  C  CD2   . LEU C 2 100  ? 144.354 156.718 82.332  1.00 179.11 ? 100  LEU C CD2   1 
ATOM   4308  N  N     . ILE C 2 101  ? 140.788 160.160 81.547  1.00 183.61 ? 101  ILE C N     1 
ATOM   4309  C  CA    . ILE C 2 101  ? 140.893 161.414 80.815  1.00 183.61 ? 101  ILE C CA    1 
ATOM   4310  C  C     . ILE C 2 101  ? 142.218 162.072 81.165  1.00 183.61 ? 101  ILE C C     1 
ATOM   4311  O  O     . ILE C 2 101  ? 142.587 162.160 82.341  1.00 183.61 ? 101  ILE C O     1 
ATOM   4312  C  CB    . ILE C 2 101  ? 139.714 162.359 81.128  1.00 183.61 ? 101  ILE C CB    1 
ATOM   4313  C  CG1   . ILE C 2 101  ? 138.384 161.623 80.969  1.00 183.61 ? 101  ILE C CG1   1 
ATOM   4314  C  CG2   . ILE C 2 101  ? 139.763 163.588 80.232  1.00 183.61 ? 101  ILE C CG2   1 
ATOM   4315  C  CD1   . ILE C 2 101  ? 137.190 162.416 81.450  1.00 183.61 ? 101  ILE C CD1   1 
ATOM   4316  N  N     . HIS C 2 102  ? 142.939 162.521 80.142  1.00 190.12 ? 102  HIS C N     1 
ATOM   4317  C  CA    . HIS C 2 102  ? 144.202 163.227 80.321  1.00 190.12 ? 102  HIS C CA    1 
ATOM   4318  C  C     . HIS C 2 102  ? 143.898 164.718 80.407  1.00 190.12 ? 102  HIS C C     1 
ATOM   4319  O  O     . HIS C 2 102  ? 143.548 165.344 79.402  1.00 190.12 ? 102  HIS C O     1 
ATOM   4320  C  CB    . HIS C 2 102  ? 145.167 162.923 79.179  1.00 190.12 ? 102  HIS C CB    1 
ATOM   4321  C  CG    . HIS C 2 102  ? 146.609 163.049 79.559  1.00 190.12 ? 102  HIS C CG    1 
ATOM   4322  N  ND1   . HIS C 2 102  ? 147.292 164.245 79.505  1.00 190.12 ? 102  HIS C ND1   1 
ATOM   4323  C  CD2   . HIS C 2 102  ? 147.498 162.127 79.997  1.00 190.12 ? 102  HIS C CD2   1 
ATOM   4324  C  CE1   . HIS C 2 102  ? 148.539 164.055 79.895  1.00 190.12 ? 102  HIS C CE1   1 
ATOM   4325  N  NE2   . HIS C 2 102  ? 148.691 162.778 80.199  1.00 190.12 ? 102  HIS C NE2   1 
ATOM   4326  N  N     . LYS C 2 103  ? 144.020 165.277 81.614  1.00 189.61 ? 103  LYS C N     1 
ATOM   4327  C  CA    . LYS C 2 103  ? 143.677 166.680 81.833  1.00 189.61 ? 103  LYS C CA    1 
ATOM   4328  C  C     . LYS C 2 103  ? 144.444 167.611 80.903  1.00 189.61 ? 103  LYS C C     1 
ATOM   4329  O  O     . LYS C 2 103  ? 143.895 168.623 80.453  1.00 189.61 ? 103  LYS C O     1 
ATOM   4330  C  CB    . LYS C 2 103  ? 143.939 167.063 83.290  1.00 189.61 ? 103  LYS C CB    1 
ATOM   4331  C  CG    . LYS C 2 103  ? 145.296 166.620 83.818  1.00 189.61 ? 103  LYS C CG    1 
ATOM   4332  C  CD    . LYS C 2 103  ? 145.415 166.865 85.313  1.00 189.61 ? 103  LYS C CD    1 
ATOM   4333  C  CE    . LYS C 2 103  ? 146.721 166.315 85.865  1.00 189.61 ? 103  LYS C CE    1 
ATOM   4334  N  NZ    . LYS C 2 103  ? 146.771 164.828 85.819  1.00 189.61 ? 103  LYS C NZ    1 
ATOM   4335  N  N     . ASP C 2 104  ? 145.702 167.290 80.602  1.00 193.36 ? 104  ASP C N     1 
ATOM   4336  C  CA    . ASP C 2 104  ? 146.533 168.194 79.815  1.00 193.36 ? 104  ASP C CA    1 
ATOM   4337  C  C     . ASP C 2 104  ? 146.135 168.176 78.343  1.00 193.36 ? 104  ASP C C     1 
ATOM   4338  O  O     . ASP C 2 104  ? 145.844 169.222 77.752  1.00 193.36 ? 104  ASP C O     1 
ATOM   4339  C  CB    . ASP C 2 104  ? 148.007 167.821 79.985  1.00 193.36 ? 104  ASP C CB    1 
ATOM   4340  C  CG    . ASP C 2 104  ? 148.473 167.935 81.423  1.00 193.36 ? 104  ASP C CG    1 
ATOM   4341  O  OD1   . ASP C 2 104  ? 147.910 168.766 82.166  1.00 193.36 ? 104  ASP C OD1   1 
ATOM   4342  O  OD2   . ASP C 2 104  ? 149.397 167.191 81.813  1.00 193.36 ? 104  ASP C OD2   1 
ATOM   4343  N  N     . THR C 2 105  ? 146.114 166.990 77.732  1.00 192.24 ? 105  THR C N     1 
ATOM   4344  C  CA    . THR C 2 105  ? 145.887 166.912 76.292  1.00 192.24 ? 105  THR C CA    1 
ATOM   4345  C  C     . THR C 2 105  ? 144.430 166.606 75.968  1.00 192.24 ? 105  THR C C     1 
ATOM   4346  O  O     . THR C 2 105  ? 143.850 167.216 75.063  1.00 192.24 ? 105  THR C O     1 
ATOM   4347  C  CB    . THR C 2 105  ? 146.803 165.856 75.674  1.00 192.24 ? 105  THR C CB    1 
ATOM   4348  O  OG1   . THR C 2 105  ? 148.119 165.979 76.228  1.00 192.24 ? 105  THR C OG1   1 
ATOM   4349  C  CG2   . THR C 2 105  ? 146.874 166.031 74.165  1.00 192.24 ? 105  THR C CG2   1 
ATOM   4350  N  N     . GLY C 2 106  ? 143.822 165.669 76.691  1.00 189.33 ? 106  GLY C N     1 
ATOM   4351  C  CA    . GLY C 2 106  ? 142.465 165.247 76.424  1.00 189.33 ? 106  GLY C CA    1 
ATOM   4352  C  C     . GLY C 2 106  ? 142.321 163.800 76.006  1.00 189.33 ? 106  GLY C C     1 
ATOM   4353  O  O     . GLY C 2 106  ? 141.274 163.436 75.456  1.00 189.33 ? 106  GLY C O     1 
ATOM   4354  N  N     . LEU C 2 107  ? 143.342 162.974 76.234  1.00 189.49 ? 107  LEU C N     1 
ATOM   4355  C  CA    . LEU C 2 107  ? 143.251 161.554 75.923  1.00 189.49 ? 107  LEU C CA    1 
ATOM   4356  C  C     . LEU C 2 107  ? 142.092 160.917 76.678  1.00 189.49 ? 107  LEU C C     1 
ATOM   4357  O  O     . LEU C 2 107  ? 141.998 161.018 77.903  1.00 189.49 ? 107  LEU C O     1 
ATOM   4358  C  CB    . LEU C 2 107  ? 144.567 160.854 76.278  1.00 189.49 ? 107  LEU C CB    1 
ATOM   4359  C  CG    . LEU C 2 107  ? 144.747 159.385 75.883  1.00 189.49 ? 107  LEU C CG    1 
ATOM   4360  C  CD1   . LEU C 2 107  ? 146.183 159.128 75.462  1.00 189.49 ? 107  LEU C CD1   1 
ATOM   4361  C  CD2   . LEU C 2 107  ? 144.362 158.459 77.029  1.00 189.49 ? 107  LEU C CD2   1 
ATOM   4362  N  N     . ILE C 2 108  ? 141.210 160.252 75.936  1.00 185.20 ? 108  ILE C N     1 
ATOM   4363  C  CA    . ILE C 2 108  ? 140.028 159.611 76.501  1.00 185.20 ? 108  ILE C CA    1 
ATOM   4364  C  C     . ILE C 2 108  ? 140.116 158.121 76.208  1.00 185.20 ? 108  ILE C C     1 
ATOM   4365  O  O     . ILE C 2 108  ? 139.978 157.703 75.052  1.00 185.20 ? 108  ILE C O     1 
ATOM   4366  C  CB    . ILE C 2 108  ? 138.725 160.199 75.935  1.00 185.20 ? 108  ILE C CB    1 
ATOM   4367  C  CG1   . ILE C 2 108  ? 138.519 161.623 76.454  1.00 185.20 ? 108  ILE C CG1   1 
ATOM   4368  C  CG2   . ILE C 2 108  ? 137.538 159.326 76.310  1.00 185.20 ? 108  ILE C CG2   1 
ATOM   4369  C  CD1   . ILE C 2 108  ? 137.245 162.272 75.962  1.00 185.20 ? 108  ILE C CD1   1 
ATOM   4370  N  N     . LYS C 2 109  ? 140.356 157.326 77.245  1.00 180.44 ? 109  LYS C N     1 
ATOM   4371  C  CA    . LYS C 2 109  ? 140.429 155.876 77.125  1.00 180.44 ? 109  LYS C CA    1 
ATOM   4372  C  C     . LYS C 2 109  ? 139.324 155.250 77.964  1.00 180.44 ? 109  LYS C C     1 
ATOM   4373  O  O     . LYS C 2 109  ? 139.429 155.199 79.191  1.00 180.44 ? 109  LYS C O     1 
ATOM   4374  C  CB    . LYS C 2 109  ? 141.798 155.359 77.573  1.00 180.44 ? 109  LYS C CB    1 
ATOM   4375  C  CG    . LYS C 2 109  ? 142.004 153.870 77.354  1.00 180.44 ? 109  LYS C CG    1 
ATOM   4376  C  CD    . LYS C 2 109  ? 141.753 153.487 75.905  1.00 180.44 ? 109  LYS C CD    1 
ATOM   4377  C  CE    . LYS C 2 109  ? 141.917 151.991 75.691  1.00 180.44 ? 109  LYS C CE    1 
ATOM   4378  N  NZ    . LYS C 2 109  ? 141.110 151.199 76.658  1.00 180.44 ? 109  LYS C NZ    1 
ATOM   4379  N  N     . GLU C 2 110  ? 138.269 154.781 77.303  1.00 171.55 ? 110  GLU C N     1 
ATOM   4380  C  CA    . GLU C 2 110  ? 137.093 154.252 77.979  1.00 171.55 ? 110  GLU C CA    1 
ATOM   4381  C  C     . GLU C 2 110  ? 137.017 152.746 77.776  1.00 171.55 ? 110  GLU C C     1 
ATOM   4382  O  O     . GLU C 2 110  ? 137.213 152.253 76.662  1.00 171.55 ? 110  GLU C O     1 
ATOM   4383  C  CB    . GLU C 2 110  ? 135.814 154.919 77.460  1.00 171.55 ? 110  GLU C CB    1 
ATOM   4384  C  CG    . GLU C 2 110  ? 134.532 154.181 77.808  1.00 171.55 ? 110  GLU C CG    1 
ATOM   4385  C  CD    . GLU C 2 110  ? 133.312 154.799 77.158  1.00 171.55 ? 110  GLU C CD    1 
ATOM   4386  O  OE1   . GLU C 2 110  ? 132.391 154.045 76.781  1.00 171.55 ? 110  GLU C OE1   1 
ATOM   4387  O  OE2   . GLU C 2 110  ? 133.274 156.040 77.022  1.00 171.55 ? 110  GLU C OE2   1 
ATOM   4388  N  N     . ASP C 2 111  ? 136.726 152.021 78.855  1.00 166.87 ? 111  ASP C N     1 
ATOM   4389  C  CA    . ASP C 2 111  ? 136.636 150.570 78.792  1.00 166.87 ? 111  ASP C CA    1 
ATOM   4390  C  C     . ASP C 2 111  ? 135.915 150.051 80.027  1.00 166.87 ? 111  ASP C C     1 
ATOM   4391  O  O     . ASP C 2 111  ? 135.823 150.732 81.051  1.00 166.87 ? 111  ASP C O     1 
ATOM   4392  C  CB    . ASP C 2 111  ? 138.021 149.925 78.676  1.00 166.87 ? 111  ASP C CB    1 
ATOM   4393  C  CG    . ASP C 2 111  ? 139.033 150.555 79.609  1.00 166.87 ? 111  ASP C CG    1 
ATOM   4394  O  OD1   . ASP C 2 111  ? 138.704 151.587 80.229  1.00 166.87 ? 111  ASP C OD1   1 
ATOM   4395  O  OD2   . ASP C 2 111  ? 140.156 150.020 79.722  1.00 166.87 ? 111  ASP C OD2   1 
ATOM   4396  N  N     . GLU C 2 112  ? 135.414 148.823 79.918  1.00 151.76 ? 112  GLU C N     1 
ATOM   4397  C  CA    . GLU C 2 112  ? 134.696 148.159 81.000  1.00 151.76 ? 112  GLU C CA    1 
ATOM   4398  C  C     . GLU C 2 112  ? 135.666 147.235 81.725  1.00 151.76 ? 112  GLU C C     1 
ATOM   4399  O  O     . GLU C 2 112  ? 136.166 146.268 81.142  1.00 151.76 ? 112  GLU C O     1 
ATOM   4400  C  CB    . GLU C 2 112  ? 133.496 147.384 80.461  1.00 151.76 ? 112  GLU C CB    1 
ATOM   4401  C  CG    . GLU C 2 112  ? 132.419 147.109 81.495  1.00 151.76 ? 112  GLU C CG    1 
ATOM   4402  C  CD    . GLU C 2 112  ? 131.421 146.066 81.033  1.00 151.76 ? 112  GLU C CD    1 
ATOM   4403  O  OE1   . GLU C 2 112  ? 131.851 144.952 80.668  1.00 151.76 ? 112  GLU C OE1   1 
ATOM   4404  O  OE2   . GLU C 2 112  ? 130.207 146.359 81.034  1.00 151.76 ? 112  GLU C OE2   1 
ATOM   4405  N  N     . VAL C 2 113  ? 135.928 147.531 82.993  1.00 144.38 ? 113  VAL C N     1 
ATOM   4406  C  CA    . VAL C 2 113  ? 136.882 146.785 83.801  1.00 144.38 ? 113  VAL C CA    1 
ATOM   4407  C  C     . VAL C 2 113  ? 136.127 145.857 84.741  1.00 144.38 ? 113  VAL C C     1 
ATOM   4408  O  O     . VAL C 2 113  ? 135.047 146.199 85.246  1.00 144.38 ? 113  VAL C O     1 
ATOM   4409  C  CB    . VAL C 2 113  ? 137.802 147.741 84.583  1.00 144.38 ? 113  VAL C CB    1 
ATOM   4410  C  CG1   . VAL C 2 113  ? 138.818 146.960 85.394  1.00 144.38 ? 113  VAL C CG1   1 
ATOM   4411  C  CG2   . VAL C 2 113  ? 138.494 148.701 83.632  1.00 144.38 ? 113  VAL C CG2   1 
ATOM   4412  N  N     . PHE C 2 114  ? 136.699 144.680 84.978  1.00 135.95 ? 114  PHE C N     1 
ATOM   4413  C  CA    . PHE C 2 114  ? 136.145 143.695 85.896  1.00 135.95 ? 114  PHE C CA    1 
ATOM   4414  C  C     . PHE C 2 114  ? 136.688 143.965 87.295  1.00 135.95 ? 114  PHE C C     1 
ATOM   4415  O  O     . PHE C 2 114  ? 137.907 143.986 87.498  1.00 135.95 ? 114  PHE C O     1 
ATOM   4416  C  CB    . PHE C 2 114  ? 136.502 142.287 85.423  1.00 135.95 ? 114  PHE C CB    1 
ATOM   4417  C  CG    . PHE C 2 114  ? 136.305 141.221 86.458  1.00 135.95 ? 114  PHE C CG    1 
ATOM   4418  C  CD1   . PHE C 2 114  ? 135.063 140.643 86.646  1.00 135.95 ? 114  PHE C CD1   1 
ATOM   4419  C  CD2   . PHE C 2 114  ? 137.369 140.776 87.225  1.00 135.95 ? 114  PHE C CD2   1 
ATOM   4420  C  CE1   . PHE C 2 114  ? 134.880 139.656 87.591  1.00 135.95 ? 114  PHE C CE1   1 
ATOM   4421  C  CE2   . PHE C 2 114  ? 137.192 139.789 88.171  1.00 135.95 ? 114  PHE C CE2   1 
ATOM   4422  C  CZ    . PHE C 2 114  ? 135.946 139.227 88.353  1.00 135.95 ? 114  PHE C CZ    1 
ATOM   4423  N  N     . LEU C 2 115  ? 135.788 144.171 88.255  1.00 135.64 ? 115  LEU C N     1 
ATOM   4424  C  CA    . LEU C 2 115  ? 136.160 144.571 89.605  1.00 135.64 ? 115  LEU C CA    1 
ATOM   4425  C  C     . LEU C 2 115  ? 135.873 143.501 90.649  1.00 135.64 ? 115  LEU C C     1 
ATOM   4426  O  O     . LEU C 2 115  ? 135.622 143.838 91.809  1.00 135.64 ? 115  LEU C O     1 
ATOM   4427  C  CB    . LEU C 2 115  ? 135.440 145.865 89.986  1.00 135.64 ? 115  LEU C CB    1 
ATOM   4428  C  CG    . LEU C 2 115  ? 135.836 147.118 89.206  1.00 135.64 ? 115  LEU C CG    1 
ATOM   4429  C  CD1   . LEU C 2 115  ? 135.343 148.364 89.919  1.00 135.64 ? 115  LEU C CD1   1 
ATOM   4430  C  CD2   . LEU C 2 115  ? 137.341 147.169 89.011  1.00 135.64 ? 115  LEU C CD2   1 
ATOM   4431  N  N     . GLY C 2 116  ? 135.903 142.231 90.273  1.00 132.51 ? 116  GLY C N     1 
ATOM   4432  C  CA    . GLY C 2 116  ? 135.653 141.158 91.211  1.00 132.51 ? 116  GLY C CA    1 
ATOM   4433  C  C     . GLY C 2 116  ? 134.203 140.720 91.231  1.00 132.51 ? 116  GLY C C     1 
ATOM   4434  O  O     . GLY C 2 116  ? 133.390 141.087 90.379  1.00 132.51 ? 116  GLY C O     1 
ATOM   4435  N  N     . HIS C 2 117  ? 133.880 139.914 92.237  1.00 126.41 ? 117  HIS C N     1 
ATOM   4436  C  CA    . HIS C 2 117  ? 132.556 139.329 92.377  1.00 126.41 ? 117  HIS C CA    1 
ATOM   4437  C  C     . HIS C 2 117  ? 131.859 139.862 93.622  1.00 126.41 ? 117  HIS C C     1 
ATOM   4438  O  O     . HIS C 2 117  ? 132.502 140.319 94.571  1.00 126.41 ? 117  HIS C O     1 
ATOM   4439  C  CB    . HIS C 2 117  ? 132.633 137.803 92.452  1.00 126.41 ? 117  HIS C CB    1 
ATOM   4440  C  CG    . HIS C 2 117  ? 133.328 137.173 91.286  1.00 126.41 ? 117  HIS C CG    1 
ATOM   4441  N  ND1   . HIS C 2 117  ? 132.648 136.546 90.265  1.00 126.41 ? 117  HIS C ND1   1 
ATOM   4442  C  CD2   . HIS C 2 117  ? 134.643 137.066 90.984  1.00 126.41 ? 117  HIS C CD2   1 
ATOM   4443  C  CE1   . HIS C 2 117  ? 133.514 136.083 89.381  1.00 126.41 ? 117  HIS C CE1   1 
ATOM   4444  N  NE2   . HIS C 2 117  ? 134.731 136.385 89.794  1.00 126.41 ? 117  HIS C NE2   1 
ATOM   4445  N  N     . ILE C 2 118  ? 130.532 139.794 93.602  1.00 116.39 ? 118  ILE C N     1 
ATOM   4446  C  CA    . ILE C 2 118  ? 129.699 140.197 94.731  1.00 116.39 ? 118  ILE C CA    1 
ATOM   4447  C  C     . ILE C 2 118  ? 128.750 139.052 95.060  1.00 116.39 ? 118  ILE C C     1 
ATOM   4448  O  O     . ILE C 2 118  ? 128.085 138.527 94.157  1.00 116.39 ? 118  ILE C O     1 
ATOM   4449  C  CB    . ILE C 2 118  ? 128.922 141.485 94.424  1.00 116.39 ? 118  ILE C CB    1 
ATOM   4450  C  CG1   . ILE C 2 118  ? 129.884 142.651 94.207  1.00 116.39 ? 118  ILE C CG1   1 
ATOM   4451  C  CG2   . ILE C 2 118  ? 127.945 141.796 95.541  1.00 116.39 ? 118  ILE C CG2   1 
ATOM   4452  C  CD1   . ILE C 2 118  ? 129.188 143.965 93.957  1.00 116.39 ? 118  ILE C CD1   1 
ATOM   4453  N  N     . PRO C 2 119  ? 128.663 138.623 96.318  1.00 111.49 ? 119  PRO C N     1 
ATOM   4454  C  CA    . PRO C 2 119  ? 127.742 137.533 96.656  1.00 111.49 ? 119  PRO C CA    1 
ATOM   4455  C  C     . PRO C 2 119  ? 126.296 137.963 96.478  1.00 111.49 ? 119  PRO C C     1 
ATOM   4456  O  O     . PRO C 2 119  ? 125.925 139.103 96.769  1.00 111.49 ? 119  PRO C O     1 
ATOM   4457  C  CB    . PRO C 2 119  ? 128.062 137.238 98.127  1.00 111.49 ? 119  PRO C CB    1 
ATOM   4458  C  CG    . PRO C 2 119  ? 129.411 137.837 98.358  1.00 111.49 ? 119  PRO C CG    1 
ATOM   4459  C  CD    . PRO C 2 119  ? 129.470 139.039 97.474  1.00 111.49 ? 119  PRO C CD    1 
ATOM   4460  N  N     . LEU C 2 120  ? 125.478 137.037 95.991  1.00 112.02 ? 120  LEU C N     1 
ATOM   4461  C  CA    . LEU C 2 120  ? 124.070 137.296 95.735  1.00 112.02 ? 120  LEU C CA    1 
ATOM   4462  C  C     . LEU C 2 120  ? 123.217 136.711 96.850  1.00 112.02 ? 120  LEU C C     1 
ATOM   4463  O  O     . LEU C 2 120  ? 123.588 135.713 97.475  1.00 112.02 ? 120  LEU C O     1 
ATOM   4464  C  CB    . LEU C 2 120  ? 123.642 136.708 94.391  1.00 112.02 ? 120  LEU C CB    1 
ATOM   4465  C  CG    . LEU C 2 120  ? 124.155 137.439 93.153  1.00 112.02 ? 120  LEU C CG    1 
ATOM   4466  C  CD1   . LEU C 2 120  ? 123.737 136.706 91.893  1.00 112.02 ? 120  LEU C CD1   1 
ATOM   4467  C  CD2   . LEU C 2 120  ? 123.648 138.868 93.135  1.00 112.02 ? 120  LEU C CD2   1 
ATOM   4468  N  N     . MET C 2 121  ? 122.073 137.341 97.095  1.00 114.05 ? 121  MET C N     1 
ATOM   4469  C  CA    . MET C 2 121  ? 121.154 136.879 98.124  1.00 114.05 ? 121  MET C CA    1 
ATOM   4470  C  C     . MET C 2 121  ? 120.130 135.924 97.526  1.00 114.05 ? 121  MET C C     1 
ATOM   4471  O  O     . MET C 2 121  ? 119.579 136.176 96.451  1.00 114.05 ? 121  MET C O     1 
ATOM   4472  C  CB    . MET C 2 121  ? 120.451 138.068 98.780  1.00 114.05 ? 121  MET C CB    1 
ATOM   4473  C  CG    . MET C 2 121  ? 119.230 137.700 99.603  1.00 114.05 ? 121  MET C CG    1 
ATOM   4474  S  SD    . MET C 2 121  ? 118.632 139.053 100.631 1.00 114.05 ? 121  MET C SD    1 
ATOM   4475  C  CE    . MET C 2 121  ? 120.098 139.435 101.580 1.00 114.05 ? 121  MET C CE    1 
ATOM   4476  N  N     . THR C 2 122  ? 119.879 134.823 98.229  1.00 116.17 ? 122  THR C N     1 
ATOM   4477  C  CA    . THR C 2 122  ? 118.903 133.846 97.775  1.00 116.17 ? 122  THR C CA    1 
ATOM   4478  C  C     . THR C 2 122  ? 117.491 134.420 97.888  1.00 116.17 ? 122  THR C C     1 
ATOM   4479  O  O     . THR C 2 122  ? 117.279 135.558 98.312  1.00 116.17 ? 122  THR C O     1 
ATOM   4480  C  CB    . THR C 2 122  ? 119.031 132.554 98.576  1.00 116.17 ? 122  THR C CB    1 
ATOM   4481  O  OG1   . THR C 2 122  ? 119.124 132.863 99.971  1.00 116.17 ? 122  THR C OG1   1 
ATOM   4482  C  CG2   . THR C 2 122  ? 120.271 131.788 98.149  1.00 116.17 ? 122  THR C CG2   1 
ATOM   4483  N  N     . GLU C 2 123  ? 116.504 133.611 97.501  1.00 124.42 ? 123  GLU C N     1 
ATOM   4484  C  CA    . GLU C 2 123  ? 115.127 134.091 97.496  1.00 124.42 ? 123  GLU C CA    1 
ATOM   4485  C  C     . GLU C 2 123  ? 114.569 134.227 98.906  1.00 124.42 ? 123  GLU C C     1 
ATOM   4486  O  O     . GLU C 2 123  ? 113.617 134.985 99.121  1.00 124.42 ? 123  GLU C O     1 
ATOM   4487  C  CB    . GLU C 2 123  ? 114.239 133.165 96.661  1.00 124.42 ? 123  GLU C CB    1 
ATOM   4488  C  CG    . GLU C 2 123  ? 114.093 131.739 97.190  1.00 124.42 ? 123  GLU C CG    1 
ATOM   4489  C  CD    . GLU C 2 123  ? 115.371 130.928 97.099  1.00 124.42 ? 123  GLU C CD    1 
ATOM   4490  O  OE1   . GLU C 2 123  ? 116.255 131.295 96.298  1.00 124.42 ? 123  GLU C OE1   1 
ATOM   4491  O  OE2   . GLU C 2 123  ? 115.492 129.922 97.831  1.00 124.42 ? 123  GLU C OE2   1 
ATOM   4492  N  N     . ASP C 2 124  ? 115.137 133.514 99.873  1.00 119.63 ? 124  ASP C N     1 
ATOM   4493  C  CA    . ASP C 2 124  ? 114.674 133.584 101.252 1.00 119.63 ? 124  ASP C CA    1 
ATOM   4494  C  C     . ASP C 2 124  ? 115.377 134.660 102.067 1.00 119.63 ? 124  ASP C C     1 
ATOM   4495  O  O     . ASP C 2 124  ? 114.851 135.072 103.105 1.00 119.63 ? 124  ASP C O     1 
ATOM   4496  C  CB    . ASP C 2 124  ? 114.841 132.222 101.937 1.00 119.63 ? 124  ASP C CB    1 
ATOM   4497  C  CG    . ASP C 2 124  ? 116.252 131.674 101.823 1.00 119.63 ? 124  ASP C CG    1 
ATOM   4498  O  OD1   . ASP C 2 124  ? 116.403 130.434 101.816 1.00 119.63 ? 124  ASP C OD1   1 
ATOM   4499  O  OD2   . ASP C 2 124  ? 117.210 132.469 101.737 1.00 119.63 ? 124  ASP C OD2   1 
ATOM   4500  N  N     . GLY C 2 125  ? 116.543 135.125 101.628 1.00 113.66 ? 125  GLY C N     1 
ATOM   4501  C  CA    . GLY C 2 125  ? 117.260 136.156 102.347 1.00 113.66 ? 125  GLY C CA    1 
ATOM   4502  C  C     . GLY C 2 125  ? 118.539 135.714 103.016 1.00 113.66 ? 125  GLY C C     1 
ATOM   4503  O  O     . GLY C 2 125  ? 118.971 136.361 103.976 1.00 113.66 ? 125  GLY C O     1 
ATOM   4504  N  N     . SER C 2 126  ? 119.158 134.639 102.548 1.00 110.24 ? 126  SER C N     1 
ATOM   4505  C  CA    . SER C 2 126  ? 120.413 134.143 103.094 1.00 110.24 ? 126  SER C CA    1 
ATOM   4506  C  C     . SER C 2 126  ? 121.447 134.038 101.979 1.00 110.24 ? 126  SER C C     1 
ATOM   4507  O  O     . SER C 2 126  ? 121.116 134.022 100.792 1.00 110.24 ? 126  SER C O     1 
ATOM   4508  C  CB    . SER C 2 126  ? 120.211 132.791 103.781 1.00 110.24 ? 126  SER C CB    1 
ATOM   4509  O  OG    . SER C 2 126  ? 120.236 131.737 102.837 1.00 110.24 ? 126  SER C OG    1 
ATOM   4510  N  N     . PHE C 2 127  ? 122.714 133.961 102.374 1.00 108.46 ? 127  PHE C N     1 
ATOM   4511  C  CA    . PHE C 2 127  ? 123.818 133.871 101.434 1.00 108.46 ? 127  PHE C CA    1 
ATOM   4512  C  C     . PHE C 2 127  ? 124.426 132.478 101.469 1.00 108.46 ? 127  PHE C C     1 
ATOM   4513  O  O     . PHE C 2 127  ? 124.262 131.729 102.436 1.00 108.46 ? 127  PHE C O     1 
ATOM   4514  C  CB    . PHE C 2 127  ? 124.903 134.908 101.744 1.00 108.46 ? 127  PHE C CB    1 
ATOM   4515  C  CG    . PHE C 2 127  ? 124.434 136.326 101.648 1.00 108.46 ? 127  PHE C CG    1 
ATOM   4516  C  CD1   . PHE C 2 127  ? 124.117 137.042 102.786 1.00 108.46 ? 127  PHE C CD1   1 
ATOM   4517  C  CD2   . PHE C 2 127  ? 124.317 136.946 100.418 1.00 108.46 ? 127  PHE C CD2   1 
ATOM   4518  C  CE1   . PHE C 2 127  ? 123.688 138.347 102.699 1.00 108.46 ? 127  PHE C CE1   1 
ATOM   4519  C  CE2   . PHE C 2 127  ? 123.890 138.251 100.326 1.00 108.46 ? 127  PHE C CE2   1 
ATOM   4520  C  CZ    . PHE C 2 127  ? 123.576 138.952 101.468 1.00 108.46 ? 127  PHE C CZ    1 
ATOM   4521  N  N     . ILE C 2 128  ? 125.152 132.148 100.407 1.00 111.64 ? 128  ILE C N     1 
ATOM   4522  C  CA    . ILE C 2 128  ? 125.893 130.897 100.305 1.00 111.64 ? 128  ILE C CA    1 
ATOM   4523  C  C     . ILE C 2 128  ? 127.362 131.261 100.159 1.00 111.64 ? 128  ILE C C     1 
ATOM   4524  O  O     . ILE C 2 128  ? 127.796 131.704 99.088  1.00 111.64 ? 128  ILE C O     1 
ATOM   4525  C  CB    . ILE C 2 128  ? 125.420 130.035 99.130  1.00 111.64 ? 128  ILE C CB    1 
ATOM   4526  C  CG1   . ILE C 2 128  ? 123.945 129.676 99.295  1.00 111.64 ? 128  ILE C CG1   1 
ATOM   4527  C  CG2   . ILE C 2 128  ? 126.260 128.778 99.028  1.00 111.64 ? 128  ILE C CG2   1 
ATOM   4528  C  CD1   . ILE C 2 128  ? 123.328 129.077 98.055  1.00 111.64 ? 128  ILE C CD1   1 
ATOM   4529  N  N     . ILE C 2 129  ? 128.128 131.076 101.228 1.00 115.27 ? 129  ILE C N     1 
ATOM   4530  C  CA    . ILE C 2 129  ? 129.542 131.420 101.263 1.00 115.27 ? 129  ILE C CA    1 
ATOM   4531  C  C     . ILE C 2 129  ? 130.318 130.133 101.495 1.00 115.27 ? 129  ILE C C     1 
ATOM   4532  O  O     . ILE C 2 129  ? 130.130 129.465 102.520 1.00 115.27 ? 129  ILE C O     1 
ATOM   4533  C  CB    . ILE C 2 129  ? 129.856 132.456 102.348 1.00 115.27 ? 129  ILE C CB    1 
ATOM   4534  C  CG1   . ILE C 2 129  ? 129.014 133.713 102.139 1.00 115.27 ? 129  ILE C CG1   1 
ATOM   4535  C  CG2   . ILE C 2 129  ? 131.332 132.801 102.337 1.00 115.27 ? 129  ILE C CG2   1 
ATOM   4536  C  CD1   . ILE C 2 129  ? 129.219 134.358 100.794 1.00 115.27 ? 129  ILE C CD1   1 
ATOM   4537  N  N     . ASN C 2 130  ? 131.184 129.784 100.543 1.00 121.53 ? 130  ASN C N     1 
ATOM   4538  C  CA    . ASN C 2 130  ? 132.006 128.577 100.620 1.00 121.53 ? 130  ASN C CA    1 
ATOM   4539  C  C     . ASN C 2 130  ? 131.153 127.339 100.884 1.00 121.53 ? 130  ASN C C     1 
ATOM   4540  O  O     . ASN C 2 130  ? 131.550 126.424 101.608 1.00 121.53 ? 130  ASN C O     1 
ATOM   4541  C  CB    . ASN C 2 130  ? 133.098 128.726 101.679 1.00 121.53 ? 130  ASN C CB    1 
ATOM   4542  C  CG    . ASN C 2 130  ? 134.152 129.740 101.284 1.00 121.53 ? 130  ASN C CG    1 
ATOM   4543  O  OD1   . ASN C 2 130  ? 134.597 130.542 102.103 1.00 121.53 ? 130  ASN C OD1   1 
ATOM   4544  N  ND2   . ASN C 2 130  ? 134.557 129.709 100.021 1.00 121.53 ? 130  ASN C ND2   1 
ATOM   4545  N  N     . GLY C 2 131  ? 129.962 127.313 100.289 1.00 121.09 ? 131  GLY C N     1 
ATOM   4546  C  CA    . GLY C 2 131  ? 129.060 126.193 100.410 1.00 121.09 ? 131  GLY C CA    1 
ATOM   4547  C  C     . GLY C 2 131  ? 128.195 126.192 101.652 1.00 121.09 ? 131  GLY C C     1 
ATOM   4548  O  O     . GLY C 2 131  ? 127.290 125.357 101.755 1.00 121.09 ? 131  GLY C O     1 
ATOM   4549  N  N     . ALA C 2 132  ? 128.440 127.094 102.596 1.00 115.13 ? 132  ALA C N     1 
ATOM   4550  C  CA    . ALA C 2 132  ? 127.675 127.152 103.832 1.00 115.13 ? 132  ALA C CA    1 
ATOM   4551  C  C     . ALA C 2 132  ? 126.657 128.281 103.771 1.00 115.13 ? 132  ALA C C     1 
ATOM   4552  O  O     . ALA C 2 132  ? 126.914 129.332 103.180 1.00 115.13 ? 132  ALA C O     1 
ATOM   4553  C  CB    . ALA C 2 132  ? 128.598 127.349 105.035 1.00 115.13 ? 132  ALA C CB    1 
ATOM   4554  N  N     . ASP C 2 133  ? 125.500 128.061 104.389 1.00 113.84 ? 133  ASP C N     1 
ATOM   4555  C  CA    . ASP C 2 133  ? 124.471 129.088 104.448 1.00 113.84 ? 133  ASP C CA    1 
ATOM   4556  C  C     . ASP C 2 133  ? 124.780 130.062 105.576 1.00 113.84 ? 133  ASP C C     1 
ATOM   4557  O  O     . ASP C 2 133  ? 125.014 129.651 106.716 1.00 113.84 ? 133  ASP C O     1 
ATOM   4558  C  CB    . ASP C 2 133  ? 123.095 128.457 104.649 1.00 113.84 ? 133  ASP C CB    1 
ATOM   4559  C  CG    . ASP C 2 133  ? 122.610 127.717 103.420 1.00 113.84 ? 133  ASP C CG    1 
ATOM   4560  O  OD1   . ASP C 2 133  ? 123.068 126.578 103.191 1.00 113.84 ? 133  ASP C OD1   1 
ATOM   4561  O  OD2   . ASP C 2 133  ? 121.768 128.272 102.683 1.00 113.84 ? 133  ASP C OD2   1 
ATOM   4562  N  N     . ARG C 2 134  ? 124.775 131.353 105.258 1.00 105.30 ? 134  ARG C N     1 
ATOM   4563  C  CA    . ARG C 2 134  ? 125.127 132.391 106.213 1.00 105.30 ? 134  ARG C CA    1 
ATOM   4564  C  C     . ARG C 2 134  ? 124.079 133.494 106.190 1.00 105.30 ? 134  ARG C C     1 
ATOM   4565  O  O     . ARG C 2 134  ? 123.365 133.684 105.202 1.00 105.30 ? 134  ARG C O     1 
ATOM   4566  C  CB    . ARG C 2 134  ? 126.512 132.976 105.915 1.00 105.30 ? 134  ARG C CB    1 
ATOM   4567  C  CG    . ARG C 2 134  ? 127.642 131.994 106.141 1.00 105.30 ? 134  ARG C CG    1 
ATOM   4568  C  CD    . ARG C 2 134  ? 128.996 132.653 105.990 1.00 105.30 ? 134  ARG C CD    1 
ATOM   4569  N  NE    . ARG C 2 134  ? 129.982 132.063 106.888 1.00 105.30 ? 134  ARG C NE    1 
ATOM   4570  C  CZ    . ARG C 2 134  ? 130.260 132.534 108.098 1.00 105.30 ? 134  ARG C CZ    1 
ATOM   4571  N  NH1   . ARG C 2 134  ? 129.626 133.603 108.555 1.00 105.30 ? 134  ARG C NH1   1 
ATOM   4572  N  NH2   . ARG C 2 134  ? 131.171 131.936 108.851 1.00 105.30 ? 134  ARG C NH2   1 
ATOM   4573  N  N     . VAL C 2 135  ? 124.000 134.226 107.299 1.00 101.74 ? 135  VAL C N     1 
ATOM   4574  C  CA    . VAL C 2 135  ? 123.024 135.293 107.480 1.00 101.74 ? 135  VAL C CA    1 
ATOM   4575  C  C     . VAL C 2 135  ? 123.732 136.517 108.040 1.00 101.74 ? 135  VAL C C     1 
ATOM   4576  O  O     . VAL C 2 135  ? 124.576 136.403 108.936 1.00 101.74 ? 135  VAL C O     1 
ATOM   4577  C  CB    . VAL C 2 135  ? 121.874 134.858 108.412 1.00 101.74 ? 135  VAL C CB    1 
ATOM   4578  C  CG1   . VAL C 2 135  ? 120.958 136.027 108.710 1.00 101.74 ? 135  VAL C CG1   1 
ATOM   4579  C  CG2   . VAL C 2 135  ? 121.085 133.735 107.780 1.00 101.74 ? 135  VAL C CG2   1 
ATOM   4580  N  N     . ILE C 2 136  ? 123.391 137.686 107.509 1.00 100.31 ? 136  ILE C N     1 
ATOM   4581  C  CA    . ILE C 2 136  ? 123.909 138.957 107.997 1.00 100.31 ? 136  ILE C CA    1 
ATOM   4582  C  C     . ILE C 2 136  ? 122.877 139.530 108.957 1.00 100.31 ? 136  ILE C C     1 
ATOM   4583  O  O     . ILE C 2 136  ? 121.728 139.775 108.577 1.00 100.31 ? 136  ILE C O     1 
ATOM   4584  C  CB    . ILE C 2 136  ? 124.202 139.929 106.849 1.00 100.31 ? 136  ILE C CB    1 
ATOM   4585  C  CG1   . ILE C 2 136  ? 125.111 139.274 105.812 1.00 100.31 ? 136  ILE C CG1   1 
ATOM   4586  C  CG2   . ILE C 2 136  ? 124.839 141.197 107.383 1.00 100.31 ? 136  ILE C CG2   1 
ATOM   4587  C  CD1   . ILE C 2 136  ? 126.399 138.749 106.381 1.00 100.31 ? 136  ILE C CD1   1 
ATOM   4588  N  N     . VAL C 2 137  ? 123.283 139.750 110.201 1.00 97.98  ? 137  VAL C N     1 
ATOM   4589  C  CA    . VAL C 2 137  ? 122.368 140.218 111.234 1.00 97.98  ? 137  VAL C CA    1 
ATOM   4590  C  C     . VAL C 2 137  ? 122.385 141.739 111.270 1.00 97.98  ? 137  VAL C C     1 
ATOM   4591  O  O     . VAL C 2 137  ? 123.453 142.358 111.340 1.00 97.98  ? 137  VAL C O     1 
ATOM   4592  C  CB    . VAL C 2 137  ? 122.746 139.626 112.599 1.00 97.98  ? 137  VAL C CB    1 
ATOM   4593  C  CG1   . VAL C 2 137  ? 121.756 140.065 113.658 1.00 97.98  ? 137  VAL C CG1   1 
ATOM   4594  C  CG2   . VAL C 2 137  ? 122.808 138.113 112.517 1.00 97.98  ? 137  VAL C CG2   1 
ATOM   4595  N  N     . SER C 2 138  ? 121.201 142.345 111.214 1.00 101.57 ? 138  SER C N     1 
ATOM   4596  C  CA    . SER C 2 138  ? 121.095 143.792 111.333 1.00 101.57 ? 138  SER C CA    1 
ATOM   4597  C  C     . SER C 2 138  ? 121.636 144.250 112.682 1.00 101.57 ? 138  SER C C     1 
ATOM   4598  O  O     . SER C 2 138  ? 121.554 143.535 113.684 1.00 101.57 ? 138  SER C O     1 
ATOM   4599  C  CB    . SER C 2 138  ? 119.641 144.232 111.172 1.00 101.57 ? 138  SER C CB    1 
ATOM   4600  O  OG    . SER C 2 138  ? 119.106 143.775 109.943 1.00 101.57 ? 138  SER C OG    1 
ATOM   4601  N  N     . GLN C 2 139  ? 122.196 145.458 112.707 1.00 106.65 ? 139  GLN C N     1 
ATOM   4602  C  CA    . GLN C 2 139  ? 122.883 145.970 113.888 1.00 106.65 ? 139  GLN C CA    1 
ATOM   4603  C  C     . GLN C 2 139  ? 122.233 147.270 114.336 1.00 106.65 ? 139  GLN C C     1 
ATOM   4604  O  O     . GLN C 2 139  ? 121.966 148.148 113.513 1.00 106.65 ? 139  GLN C O     1 
ATOM   4605  C  CB    . GLN C 2 139  ? 124.368 146.188 113.600 1.00 106.65 ? 139  GLN C CB    1 
ATOM   4606  C  CG    . GLN C 2 139  ? 125.116 146.897 114.710 1.00 106.65 ? 139  GLN C CG    1 
ATOM   4607  C  CD    . GLN C 2 139  ? 126.572 147.123 114.371 1.00 106.65 ? 139  GLN C CD    1 
ATOM   4608  O  OE1   . GLN C 2 139  ? 126.901 147.942 113.514 1.00 106.65 ? 139  GLN C OE1   1 
ATOM   4609  N  NE2   . GLN C 2 139  ? 127.455 146.395 115.041 1.00 106.65 ? 139  GLN C NE2   1 
ATOM   4610  N  N     . ILE C 2 140  ? 122.000 147.402 115.633 1.00 106.55 ? 140  ILE C N     1 
ATOM   4611  C  CA    . ILE C 2 140  ? 121.430 148.629 116.175 1.00 106.55 ? 140  ILE C CA    1 
ATOM   4612  C  C     . ILE C 2 140  ? 122.541 149.476 116.781 1.00 106.55 ? 140  ILE C C     1 
ATOM   4613  O  O     . ILE C 2 140  ? 123.476 148.960 117.404 1.00 106.55 ? 140  ILE C O     1 
ATOM   4614  C  CB    . ILE C 2 140  ? 120.332 148.304 117.208 1.00 106.55 ? 140  ILE C CB    1 
ATOM   4615  C  CG1   . ILE C 2 140  ? 119.678 149.585 117.723 1.00 106.55 ? 140  ILE C CG1   1 
ATOM   4616  C  CG2   . ILE C 2 140  ? 120.891 147.483 118.354 1.00 106.55 ? 140  ILE C CG2   1 
ATOM   4617  C  CD1   . ILE C 2 140  ? 118.437 149.340 118.542 1.00 106.55 ? 140  ILE C CD1   1 
ATOM   4618  N  N     . HIS C 2 141  ? 122.451 150.789 116.592 1.00 110.86 ? 141  HIS C N     1 
ATOM   4619  C  CA    . HIS C 2 141  ? 123.468 151.685 117.131 1.00 110.86 ? 141  HIS C CA    1 
ATOM   4620  C  C     . HIS C 2 141  ? 122.880 153.084 117.252 1.00 110.86 ? 141  HIS C C     1 
ATOM   4621  O  O     . HIS C 2 141  ? 121.690 153.302 117.013 1.00 110.86 ? 141  HIS C O     1 
ATOM   4622  C  CB    . HIS C 2 141  ? 124.726 151.682 116.260 1.00 110.86 ? 141  HIS C CB    1 
ATOM   4623  C  CG    . HIS C 2 141  ? 124.577 152.446 114.984 1.00 110.86 ? 141  HIS C CG    1 
ATOM   4624  N  ND1   . HIS C 2 141  ? 125.000 153.750 114.842 1.00 110.86 ? 141  HIS C ND1   1 
ATOM   4625  C  CD2   . HIS C 2 141  ? 124.040 152.094 113.794 1.00 110.86 ? 141  HIS C CD2   1 
ATOM   4626  C  CE1   . HIS C 2 141  ? 124.739 154.164 113.615 1.00 110.86 ? 141  HIS C CE1   1 
ATOM   4627  N  NE2   . HIS C 2 141  ? 124.156 153.178 112.959 1.00 110.86 ? 141  HIS C NE2   1 
ATOM   4628  N  N     . ARG C 2 142  ? 123.730 154.034 117.631 1.00 117.59 ? 142  ARG C N     1 
ATOM   4629  C  CA    . ARG C 2 142  ? 123.280 155.398 117.874 1.00 117.59 ? 142  ARG C CA    1 
ATOM   4630  C  C     . ARG C 2 142  ? 123.228 156.185 116.573 1.00 117.59 ? 142  ARG C C     1 
ATOM   4631  O  O     . ARG C 2 142  ? 124.182 156.178 115.791 1.00 117.59 ? 142  ARG C O     1 
ATOM   4632  C  CB    . ARG C 2 142  ? 124.211 156.088 118.867 1.00 117.59 ? 142  ARG C CB    1 
ATOM   4633  C  CG    . ARG C 2 142  ? 124.238 155.443 120.237 1.00 117.59 ? 142  ARG C CG    1 
ATOM   4634  C  CD    . ARG C 2 142  ? 124.925 156.340 121.247 1.00 117.59 ? 142  ARG C CD    1 
ATOM   4635  N  NE    . ARG C 2 142  ? 124.418 157.706 121.195 1.00 117.59 ? 142  ARG C NE    1 
ATOM   4636  C  CZ    . ARG C 2 142  ? 124.876 158.699 121.949 1.00 117.59 ? 142  ARG C CZ    1 
ATOM   4637  N  NH1   . ARG C 2 142  ? 125.855 158.477 122.814 1.00 117.59 ? 142  ARG C NH1   1 
ATOM   4638  N  NH2   . ARG C 2 142  ? 124.357 159.912 121.839 1.00 117.59 ? 142  ARG C NH2   1 
ATOM   4639  N  N     . SER C 2 143  ? 122.116 156.874 116.350 1.00 120.52 ? 143  SER C N     1 
ATOM   4640  C  CA    . SER C 2 143  ? 121.963 157.648 115.130 1.00 120.52 ? 143  SER C CA    1 
ATOM   4641  C  C     . SER C 2 143  ? 122.899 158.854 115.150 1.00 120.52 ? 143  SER C C     1 
ATOM   4642  O  O     . SER C 2 143  ? 123.092 159.474 116.200 1.00 120.52 ? 143  SER C O     1 
ATOM   4643  C  CB    . SER C 2 143  ? 120.521 158.117 114.969 1.00 120.52 ? 143  SER C CB    1 
ATOM   4644  O  OG    . SER C 2 143  ? 120.452 159.242 114.112 1.00 120.52 ? 143  SER C OG    1 
ATOM   4645  N  N     . PRO C 2 144  ? 123.494 159.207 114.014 1.00 123.81 ? 144  PRO C N     1 
ATOM   4646  C  CA    . PRO C 2 144  ? 124.341 160.401 113.966 1.00 123.81 ? 144  PRO C CA    1 
ATOM   4647  C  C     . PRO C 2 144  ? 123.517 161.667 114.136 1.00 123.81 ? 144  PRO C C     1 
ATOM   4648  O  O     . PRO C 2 144  ? 122.307 161.691 113.903 1.00 123.81 ? 144  PRO C O     1 
ATOM   4649  C  CB    . PRO C 2 144  ? 124.979 160.336 112.572 1.00 123.81 ? 144  PRO C CB    1 
ATOM   4650  C  CG    . PRO C 2 144  ? 124.740 158.940 112.087 1.00 123.81 ? 144  PRO C CG    1 
ATOM   4651  C  CD    . PRO C 2 144  ? 123.479 158.485 112.735 1.00 123.81 ? 144  PRO C CD    1 
ATOM   4652  N  N     . GLY C 2 145  ? 124.188 162.728 114.554 1.00 129.68 ? 145  GLY C N     1 
ATOM   4653  C  CA    . GLY C 2 145  ? 123.548 164.019 114.677 1.00 129.68 ? 145  GLY C CA    1 
ATOM   4654  C  C     . GLY C 2 145  ? 124.092 164.783 115.868 1.00 129.68 ? 145  GLY C C     1 
ATOM   4655  O  O     . GLY C 2 145  ? 125.247 164.622 116.257 1.00 129.68 ? 145  GLY C O     1 
ATOM   4656  N  N     . VAL C 2 146  ? 123.222 165.617 116.431 1.00 131.46 ? 146  VAL C N     1 
ATOM   4657  C  CA    . VAL C 2 146  ? 123.559 166.508 117.534 1.00 131.46 ? 146  VAL C CA    1 
ATOM   4658  C  C     . VAL C 2 146  ? 122.725 166.101 118.739 1.00 131.46 ? 146  VAL C C     1 
ATOM   4659  O  O     . VAL C 2 146  ? 121.502 165.951 118.631 1.00 131.46 ? 146  VAL C O     1 
ATOM   4660  C  CB    . VAL C 2 146  ? 123.312 167.980 117.173 1.00 131.46 ? 146  VAL C CB    1 
ATOM   4661  C  CG1   . VAL C 2 146  ? 123.717 168.882 118.323 1.00 131.46 ? 146  VAL C CG1   1 
ATOM   4662  C  CG2   . VAL C 2 146  ? 124.065 168.347 115.906 1.00 131.46 ? 146  VAL C CG2   1 
ATOM   4663  N  N     . TYR C 2 147  ? 123.381 165.929 119.882 1.00 131.90 ? 147  TYR C N     1 
ATOM   4664  C  CA    . TYR C 2 147  ? 122.717 165.544 121.116 1.00 131.90 ? 147  TYR C CA    1 
ATOM   4665  C  C     . TYR C 2 147  ? 123.145 166.461 122.251 1.00 131.90 ? 147  TYR C C     1 
ATOM   4666  O  O     . TYR C 2 147  ? 124.248 167.015 122.244 1.00 131.90 ? 147  TYR C O     1 
ATOM   4667  C  CB    . TYR C 2 147  ? 123.024 164.090 121.481 1.00 131.90 ? 147  TYR C CB    1 
ATOM   4668  C  CG    . TYR C 2 147  ? 122.616 163.101 120.419 1.00 131.90 ? 147  TYR C CG    1 
ATOM   4669  C  CD1   . TYR C 2 147  ? 123.539 162.227 119.867 1.00 131.90 ? 147  TYR C CD1   1 
ATOM   4670  C  CD2   . TYR C 2 147  ? 121.307 163.041 119.968 1.00 131.90 ? 147  TYR C CD2   1 
ATOM   4671  C  CE1   . TYR C 2 147  ? 123.169 161.321 118.898 1.00 131.90 ? 147  TYR C CE1   1 
ATOM   4672  C  CE2   . TYR C 2 147  ? 120.928 162.139 118.998 1.00 131.90 ? 147  TYR C CE2   1 
ATOM   4673  C  CZ    . TYR C 2 147  ? 121.863 161.282 118.467 1.00 131.90 ? 147  TYR C CZ    1 
ATOM   4674  O  OH    . TYR C 2 147  ? 121.489 160.381 117.499 1.00 131.90 ? 147  TYR C OH    1 
ATOM   4675  N  N     . PHE C 2 148  ? 122.259 166.612 123.232 1.00 142.08 ? 148  PHE C N     1 
ATOM   4676  C  CA    . PHE C 2 148  ? 122.509 167.445 124.401 1.00 142.08 ? 148  PHE C CA    1 
ATOM   4677  C  C     . PHE C 2 148  ? 122.218 166.626 125.647 1.00 142.08 ? 148  PHE C C     1 
ATOM   4678  O  O     . PHE C 2 148  ? 121.084 166.180 125.847 1.00 142.08 ? 148  PHE C O     1 
ATOM   4679  C  CB    . PHE C 2 148  ? 121.649 168.709 124.371 1.00 142.08 ? 148  PHE C CB    1 
ATOM   4680  C  CG    . PHE C 2 148  ? 121.884 169.567 123.166 1.00 142.08 ? 148  PHE C CG    1 
ATOM   4681  C  CD1   . PHE C 2 148  ? 121.039 169.495 122.074 1.00 142.08 ? 148  PHE C CD1   1 
ATOM   4682  C  CD2   . PHE C 2 148  ? 122.954 170.442 123.124 1.00 142.08 ? 148  PHE C CD2   1 
ATOM   4683  C  CE1   . PHE C 2 148  ? 121.255 170.282 120.963 1.00 142.08 ? 148  PHE C CE1   1 
ATOM   4684  C  CE2   . PHE C 2 148  ? 123.175 171.232 122.016 1.00 142.08 ? 148  PHE C CE2   1 
ATOM   4685  C  CZ    . PHE C 2 148  ? 122.324 171.153 120.934 1.00 142.08 ? 148  PHE C CZ    1 
ATOM   4686  N  N     . THR C 2 149  ? 123.235 166.431 126.480 1.00 153.71 ? 149  THR C N     1 
ATOM   4687  C  CA    . THR C 2 149  ? 123.088 165.607 127.667 1.00 153.71 ? 149  THR C CA    1 
ATOM   4688  C  C     . THR C 2 149  ? 123.381 166.419 128.922 1.00 153.71 ? 149  THR C C     1 
ATOM   4689  O  O     . THR C 2 149  ? 124.086 167.428 128.861 1.00 153.71 ? 149  THR C O     1 
ATOM   4690  C  CB    . THR C 2 149  ? 124.028 164.396 127.620 1.00 153.71 ? 149  THR C CB    1 
ATOM   4691  O  OG1   . THR C 2 149  ? 125.387 164.846 127.580 1.00 153.71 ? 149  THR C OG1   1 
ATOM   4692  C  CG2   . THR C 2 149  ? 123.743 163.549 126.391 1.00 153.71 ? 149  THR C CG2   1 
ATOM   4693  N  N     . PRO C 2 150  ? 122.842 166.017 130.071 1.00 159.68 ? 150  PRO C N     1 
ATOM   4694  C  CA    . PRO C 2 150  ? 123.184 166.709 131.317 1.00 159.68 ? 150  PRO C CA    1 
ATOM   4695  C  C     . PRO C 2 150  ? 124.597 166.368 131.763 1.00 159.68 ? 150  PRO C C     1 
ATOM   4696  O  O     . PRO C 2 150  ? 125.030 165.216 131.692 1.00 159.68 ? 150  PRO C O     1 
ATOM   4697  C  CB    . PRO C 2 150  ? 122.142 166.188 132.315 1.00 159.68 ? 150  PRO C CB    1 
ATOM   4698  C  CG    . PRO C 2 150  ? 121.050 165.604 131.470 1.00 159.68 ? 150  PRO C CG    1 
ATOM   4699  C  CD    . PRO C 2 150  ? 121.742 165.059 130.265 1.00 159.68 ? 150  PRO C CD    1 
ATOM   4700  N  N     . ASP C 2 151  ? 125.312 167.384 132.220 1.00 175.03 ? 151  ASP C N     1 
ATOM   4701  C  CA    . ASP C 2 151  ? 126.665 167.201 132.730 1.00 175.03 ? 151  ASP C CA    1 
ATOM   4702  C  C     . ASP C 2 151  ? 126.610 166.393 134.019 1.00 175.03 ? 151  ASP C C     1 
ATOM   4703  O  O     . ASP C 2 151  ? 125.961 166.831 134.979 1.00 175.03 ? 151  ASP C O     1 
ATOM   4704  C  CB    . ASP C 2 151  ? 127.323 168.561 132.965 1.00 175.03 ? 151  ASP C CB    1 
ATOM   4705  C  CG    . ASP C 2 151  ? 128.798 168.452 133.307 1.00 175.03 ? 151  ASP C CG    1 
ATOM   4706  O  OD1   . ASP C 2 151  ? 129.353 167.337 133.252 1.00 175.03 ? 151  ASP C OD1   1 
ATOM   4707  O  OD2   . ASP C 2 151  ? 129.408 169.493 133.628 1.00 175.03 ? 151  ASP C OD2   1 
ATOM   4708  N  N     . PRO C 2 152  ? 127.249 165.221 134.091 1.00 177.03 ? 152  PRO C N     1 
ATOM   4709  C  CA    . PRO C 2 152  ? 127.114 164.391 135.301 1.00 177.03 ? 152  PRO C CA    1 
ATOM   4710  C  C     . PRO C 2 152  ? 127.630 165.055 136.566 1.00 177.03 ? 152  PRO C C     1 
ATOM   4711  O  O     . PRO C 2 152  ? 126.942 165.029 137.595 1.00 177.03 ? 152  PRO C O     1 
ATOM   4712  C  CB    . PRO C 2 152  ? 127.921 163.131 134.950 1.00 177.03 ? 152  PRO C CB    1 
ATOM   4713  C  CG    . PRO C 2 152  ? 128.807 163.537 133.811 1.00 177.03 ? 152  PRO C CG    1 
ATOM   4714  C  CD    . PRO C 2 152  ? 128.016 164.538 133.038 1.00 177.03 ? 152  PRO C CD    1 
ATOM   4715  N  N     . ALA C 2 153  ? 128.821 165.652 136.525 1.00 178.65 ? 153  ALA C N     1 
ATOM   4716  C  CA    . ALA C 2 153  ? 129.400 166.225 137.737 1.00 178.65 ? 153  ALA C CA    1 
ATOM   4717  C  C     . ALA C 2 153  ? 128.773 167.576 138.061 1.00 178.65 ? 153  ALA C C     1 
ATOM   4718  O  O     . ALA C 2 153  ? 128.158 167.753 139.119 1.00 178.65 ? 153  ALA C O     1 
ATOM   4719  C  CB    . ALA C 2 153  ? 130.916 166.354 137.582 1.00 178.65 ? 153  ALA C CB    1 
ATOM   4720  N  N     . ARG C 2 154  ? 128.915 168.540 137.158 1.00 182.71 ? 154  ARG C N     1 
ATOM   4721  C  CA    . ARG C 2 154  ? 128.403 169.889 137.373 1.00 182.71 ? 154  ARG C CA    1 
ATOM   4722  C  C     . ARG C 2 154  ? 126.921 169.930 137.030 1.00 182.71 ? 154  ARG C C     1 
ATOM   4723  O  O     . ARG C 2 154  ? 126.556 169.754 135.857 1.00 182.71 ? 154  ARG C O     1 
ATOM   4724  C  CB    . ARG C 2 154  ? 129.192 170.895 136.533 1.00 182.71 ? 154  ARG C CB    1 
ATOM   4725  C  CG    . ARG C 2 154  ? 130.654 170.975 136.963 1.00 182.71 ? 154  ARG C CG    1 
ATOM   4726  C  CD    . ARG C 2 154  ? 131.506 171.884 136.090 1.00 182.71 ? 154  ARG C CD    1 
ATOM   4727  N  NE    . ARG C 2 154  ? 131.069 173.274 136.134 1.00 182.71 ? 154  ARG C NE    1 
ATOM   4728  C  CZ    . ARG C 2 154  ? 130.725 173.981 135.064 1.00 182.71 ? 154  ARG C CZ    1 
ATOM   4729  N  NH1   . ARG C 2 154  ? 130.789 173.433 133.858 1.00 182.71 ? 154  ARG C NH1   1 
ATOM   4730  N  NH2   . ARG C 2 154  ? 130.334 175.240 135.196 1.00 182.71 ? 154  ARG C NH2   1 
ATOM   4731  N  N     . PRO C 2 155  ? 126.038 170.149 138.010 1.00 181.38 ? 155  PRO C N     1 
ATOM   4732  C  CA    . PRO C 2 155  ? 124.600 169.923 137.765 1.00 181.38 ? 155  PRO C CA    1 
ATOM   4733  C  C     . PRO C 2 155  ? 123.996 170.820 136.697 1.00 181.38 ? 155  PRO C C     1 
ATOM   4734  O  O     . PRO C 2 155  ? 123.411 170.317 135.729 1.00 181.38 ? 155  PRO C O     1 
ATOM   4735  C  CB    . PRO C 2 155  ? 123.974 170.180 139.145 1.00 181.38 ? 155  PRO C CB    1 
ATOM   4736  C  CG    . PRO C 2 155  ? 125.098 170.020 140.120 1.00 181.38 ? 155  PRO C CG    1 
ATOM   4737  C  CD    . PRO C 2 155  ? 126.312 170.517 139.408 1.00 181.38 ? 155  PRO C CD    1 
ATOM   4738  N  N     . GLY C 2 156  ? 124.117 172.136 136.842 1.00 177.07 ? 156  GLY C N     1 
ATOM   4739  C  CA    . GLY C 2 156  ? 123.442 173.055 135.951 1.00 177.07 ? 156  GLY C CA    1 
ATOM   4740  C  C     . GLY C 2 156  ? 124.051 173.230 134.581 1.00 177.07 ? 156  GLY C C     1 
ATOM   4741  O  O     . GLY C 2 156  ? 123.750 174.219 133.908 1.00 177.07 ? 156  GLY C O     1 
ATOM   4742  N  N     . ARG C 2 157  ? 124.890 172.300 134.134 1.00 174.61 ? 157  ARG C N     1 
ATOM   4743  C  CA    . ARG C 2 157  ? 125.591 172.422 132.866 1.00 174.61 ? 157  ARG C CA    1 
ATOM   4744  C  C     . ARG C 2 157  ? 125.212 171.272 131.942 1.00 174.61 ? 157  ARG C C     1 
ATOM   4745  O  O     . ARG C 2 157  ? 124.592 170.290 132.357 1.00 174.61 ? 157  ARG C O     1 
ATOM   4746  C  CB    . ARG C 2 157  ? 127.108 172.456 133.078 1.00 174.61 ? 157  ARG C CB    1 
ATOM   4747  C  CG    . ARG C 2 157  ? 127.582 173.660 133.873 1.00 174.61 ? 157  ARG C CG    1 
ATOM   4748  C  CD    . ARG C 2 157  ? 126.846 174.927 133.467 1.00 174.61 ? 157  ARG C CD    1 
ATOM   4749  N  NE    . ARG C 2 157  ? 126.964 175.976 134.475 1.00 174.61 ? 157  ARG C NE    1 
ATOM   4750  C  CZ    . ARG C 2 157  ? 127.837 176.975 134.415 1.00 174.61 ? 157  ARG C CZ    1 
ATOM   4751  N  NH1   . ARG C 2 157  ? 128.674 177.064 133.391 1.00 174.61 ? 157  ARG C NH1   1 
ATOM   4752  N  NH2   . ARG C 2 157  ? 127.874 177.885 135.378 1.00 174.61 ? 157  ARG C NH2   1 
ATOM   4753  N  N     . TYR C 2 158  ? 125.593 171.408 130.673 1.00 166.08 ? 158  TYR C N     1 
ATOM   4754  C  CA    . TYR C 2 158  ? 125.215 170.446 129.651 1.00 166.08 ? 158  TYR C CA    1 
ATOM   4755  C  C     . TYR C 2 158  ? 126.393 170.181 128.724 1.00 166.08 ? 158  TYR C C     1 
ATOM   4756  O  O     . TYR C 2 158  ? 127.302 171.002 128.583 1.00 166.08 ? 158  TYR C O     1 
ATOM   4757  C  CB    . TYR C 2 158  ? 124.008 170.939 128.842 1.00 166.08 ? 158  TYR C CB    1 
ATOM   4758  C  CG    . TYR C 2 158  ? 122.764 171.143 129.675 1.00 166.08 ? 158  TYR C CG    1 
ATOM   4759  C  CD1   . TYR C 2 158  ? 121.973 170.066 130.049 1.00 166.08 ? 158  TYR C CD1   1 
ATOM   4760  C  CD2   . TYR C 2 158  ? 122.385 172.410 130.092 1.00 166.08 ? 158  TYR C CD2   1 
ATOM   4761  C  CE1   . TYR C 2 158  ? 120.837 170.247 130.812 1.00 166.08 ? 158  TYR C CE1   1 
ATOM   4762  C  CE2   . TYR C 2 158  ? 121.251 172.601 130.855 1.00 166.08 ? 158  TYR C CE2   1 
ATOM   4763  C  CZ    . TYR C 2 158  ? 120.481 171.516 131.212 1.00 166.08 ? 158  TYR C CZ    1 
ATOM   4764  O  OH    . TYR C 2 158  ? 119.350 171.700 131.973 1.00 166.08 ? 158  TYR C OH    1 
ATOM   4765  N  N     . ILE C 2 159  ? 126.359 169.012 128.092 1.00 153.74 ? 159  ILE C N     1 
ATOM   4766  C  CA    . ILE C 2 159  ? 127.352 168.589 127.114 1.00 153.74 ? 159  ILE C CA    1 
ATOM   4767  C  C     . ILE C 2 159  ? 126.669 168.530 125.757 1.00 153.74 ? 159  ILE C C     1 
ATOM   4768  O  O     . ILE C 2 159  ? 125.568 167.977 125.638 1.00 153.74 ? 159  ILE C O     1 
ATOM   4769  C  CB    . ILE C 2 159  ? 127.951 167.219 127.476 1.00 153.74 ? 159  ILE C CB    1 
ATOM   4770  C  CG1   . ILE C 2 159  ? 128.592 167.254 128.863 1.00 153.74 ? 159  ILE C CG1   1 
ATOM   4771  C  CG2   . ILE C 2 159  ? 128.967 166.788 126.432 1.00 153.74 ? 159  ILE C CG2   1 
ATOM   4772  C  CD1   . ILE C 2 159  ? 129.768 168.180 128.960 1.00 153.74 ? 159  ILE C CD1   1 
ATOM   4773  N  N     . ALA C 2 160  ? 127.314 169.091 124.737 1.00 149.79 ? 160  ALA C N     1 
ATOM   4774  C  CA    . ALA C 2 160  ? 126.784 169.073 123.380 1.00 149.79 ? 160  ALA C CA    1 
ATOM   4775  C  C     . ALA C 2 160  ? 127.675 168.194 122.512 1.00 149.79 ? 160  ALA C C     1 
ATOM   4776  O  O     . ALA C 2 160  ? 128.830 168.543 122.250 1.00 149.79 ? 160  ALA C O     1 
ATOM   4777  C  CB    . ALA C 2 160  ? 126.697 170.487 122.807 1.00 149.79 ? 160  ALA C CB    1 
ATOM   4778  N  N     . SER C 2 161  ? 127.143 167.063 122.064 1.00 137.43 ? 161  SER C N     1 
ATOM   4779  C  CA    . SER C 2 161  ? 127.907 166.096 121.288 1.00 137.43 ? 161  SER C CA    1 
ATOM   4780  C  C     . SER C 2 161  ? 127.455 166.145 119.836 1.00 137.43 ? 161  SER C C     1 
ATOM   4781  O  O     . SER C 2 161  ? 126.253 166.217 119.557 1.00 137.43 ? 161  SER C O     1 
ATOM   4782  C  CB    . SER C 2 161  ? 127.740 164.686 121.853 1.00 137.43 ? 161  SER C CB    1 
ATOM   4783  O  OG    . SER C 2 161  ? 128.055 164.652 123.233 1.00 137.43 ? 161  SER C OG    1 
ATOM   4784  N  N     . ILE C 2 162  ? 128.416 166.113 118.921 1.00 137.54 ? 162  ILE C N     1 
ATOM   4785  C  CA    . ILE C 2 162  ? 128.152 165.974 117.496 1.00 137.54 ? 162  ILE C CA    1 
ATOM   4786  C  C     . ILE C 2 162  ? 128.830 164.688 117.049 1.00 137.54 ? 162  ILE C C     1 
ATOM   4787  O  O     . ILE C 2 162  ? 130.050 164.531 117.198 1.00 137.54 ? 162  ILE C O     1 
ATOM   4788  C  CB    . ILE C 2 162  ? 128.654 167.183 116.699 1.00 137.54 ? 162  ILE C CB    1 
ATOM   4789  C  CG1   . ILE C 2 162  ? 127.913 168.447 117.134 1.00 137.54 ? 162  ILE C CG1   1 
ATOM   4790  C  CG2   . ILE C 2 162  ? 128.469 166.949 115.213 1.00 137.54 ? 162  ILE C CG2   1 
ATOM   4791  C  CD1   . ILE C 2 162  ? 128.416 169.704 116.467 1.00 137.54 ? 162  ILE C CD1   1 
ATOM   4792  N  N     . ILE C 2 163  ? 128.041 163.768 116.510 1.00 134.91 ? 163  ILE C N     1 
ATOM   4793  C  CA    . ILE C 2 163  ? 128.485 162.415 116.195 1.00 134.91 ? 163  ILE C CA    1 
ATOM   4794  C  C     . ILE C 2 163  ? 128.193 162.146 114.723 1.00 134.91 ? 163  ILE C C     1 
ATOM   4795  O  O     . ILE C 2 163  ? 127.024 162.168 114.317 1.00 134.91 ? 163  ILE C O     1 
ATOM   4796  C  CB    . ILE C 2 163  ? 127.797 161.372 117.088 1.00 134.91 ? 163  ILE C CB    1 
ATOM   4797  C  CG1   . ILE C 2 163  ? 128.101 161.647 118.559 1.00 134.91 ? 163  ILE C CG1   1 
ATOM   4798  C  CG2   . ILE C 2 163  ? 128.240 159.972 116.704 1.00 134.91 ? 163  ILE C CG2   1 
ATOM   4799  C  CD1   . ILE C 2 163  ? 127.564 160.594 119.497 1.00 134.91 ? 163  ILE C CD1   1 
ATOM   4800  N  N     . PRO C 2 164  ? 129.204 161.894 113.896 1.00 138.87 ? 164  PRO C N     1 
ATOM   4801  C  CA    . PRO C 2 164  ? 128.945 161.491 112.511 1.00 138.87 ? 164  PRO C CA    1 
ATOM   4802  C  C     . PRO C 2 164  ? 128.751 159.989 112.390 1.00 138.87 ? 164  PRO C C     1 
ATOM   4803  O  O     . PRO C 2 164  ? 128.703 159.285 113.403 1.00 138.87 ? 164  PRO C O     1 
ATOM   4804  C  CB    . PRO C 2 164  ? 130.207 161.957 111.783 1.00 138.87 ? 164  PRO C CB    1 
ATOM   4805  C  CG    . PRO C 2 164  ? 131.279 161.766 112.809 1.00 138.87 ? 164  PRO C CG    1 
ATOM   4806  C  CD    . PRO C 2 164  ? 130.644 162.066 114.154 1.00 138.87 ? 164  PRO C CD    1 
ATOM   4807  N  N     . LEU C 2 165  ? 128.627 159.493 111.160 1.00 136.55 ? 165  LEU C N     1 
ATOM   4808  C  CA    . LEU C 2 165  ? 128.500 158.062 110.938 1.00 136.55 ? 165  LEU C CA    1 
ATOM   4809  C  C     . LEU C 2 165  ? 129.711 157.326 111.513 1.00 136.55 ? 165  LEU C C     1 
ATOM   4810  O  O     . LEU C 2 165  ? 130.797 157.901 111.633 1.00 136.55 ? 165  LEU C O     1 
ATOM   4811  C  CB    . LEU C 2 165  ? 128.371 157.764 109.446 1.00 136.55 ? 165  LEU C CB    1 
ATOM   4812  C  CG    . LEU C 2 165  ? 126.979 157.901 108.834 1.00 136.55 ? 165  LEU C CG    1 
ATOM   4813  C  CD1   . LEU C 2 165  ? 127.068 157.906 107.319 1.00 136.55 ? 165  LEU C CD1   1 
ATOM   4814  C  CD2   . LEU C 2 165  ? 126.077 156.781 109.317 1.00 136.55 ? 165  LEU C CD2   1 
ATOM   4815  N  N     . PRO C 2 166  ? 129.551 156.056 111.885 1.00 136.29 ? 166  PRO C N     1 
ATOM   4816  C  CA    . PRO C 2 166  ? 130.681 155.304 112.441 1.00 136.29 ? 166  PRO C CA    1 
ATOM   4817  C  C     . PRO C 2 166  ? 131.820 155.190 111.438 1.00 136.29 ? 166  PRO C C     1 
ATOM   4818  O  O     . PRO C 2 166  ? 131.604 154.958 110.247 1.00 136.29 ? 166  PRO C O     1 
ATOM   4819  C  CB    . PRO C 2 166  ? 130.072 153.935 112.762 1.00 136.29 ? 166  PRO C CB    1 
ATOM   4820  C  CG    . PRO C 2 166  ? 128.608 154.187 112.881 1.00 136.29 ? 166  PRO C CG    1 
ATOM   4821  C  CD    . PRO C 2 166  ? 128.308 155.267 111.893 1.00 136.29 ? 166  PRO C CD    1 
ATOM   4822  N  N     . LYS C 2 167  ? 133.044 155.368 111.933 1.00 139.93 ? 167  LYS C N     1 
ATOM   4823  C  CA    . LYS C 2 167  ? 134.285 155.351 111.164 1.00 139.93 ? 167  LYS C CA    1 
ATOM   4824  C  C     . LYS C 2 167  ? 134.325 156.427 110.088 1.00 139.93 ? 167  LYS C C     1 
ATOM   4825  O  O     . LYS C 2 167  ? 135.210 156.385 109.225 1.00 139.93 ? 167  LYS C O     1 
ATOM   4826  C  CB    . LYS C 2 167  ? 134.549 153.986 110.511 1.00 139.93 ? 167  LYS C CB    1 
ATOM   4827  C  CG    . LYS C 2 167  ? 134.787 152.864 111.505 1.00 139.93 ? 167  LYS C CG    1 
ATOM   4828  C  CD    . LYS C 2 167  ? 136.139 153.011 112.181 1.00 139.93 ? 167  LYS C CD    1 
ATOM   4829  C  CE    . LYS C 2 167  ? 136.477 151.784 113.011 1.00 139.93 ? 167  LYS C CE    1 
ATOM   4830  N  NZ    . LYS C 2 167  ? 137.864 151.845 113.546 1.00 139.93 ? 167  LYS C NZ    1 
ATOM   4831  N  N     . ARG C 2 168  ? 133.401 157.387 110.104 1.00 147.22 ? 168  ARG C N     1 
ATOM   4832  C  CA    . ARG C 2 168  ? 133.355 158.453 109.112 1.00 147.22 ? 168  ARG C CA    1 
ATOM   4833  C  C     . ARG C 2 168  ? 133.677 159.815 109.714 1.00 147.22 ? 168  ARG C C     1 
ATOM   4834  O  O     . ARG C 2 168  ? 133.187 160.836 109.223 1.00 147.22 ? 168  ARG C O     1 
ATOM   4835  C  CB    . ARG C 2 168  ? 131.985 158.483 108.435 1.00 147.22 ? 168  ARG C CB    1 
ATOM   4836  C  CG    . ARG C 2 168  ? 131.574 157.161 107.815 1.00 147.22 ? 168  ARG C CG    1 
ATOM   4837  C  CD    . ARG C 2 168  ? 132.440 156.822 106.619 1.00 147.22 ? 168  ARG C CD    1 
ATOM   4838  N  NE    . ARG C 2 168  ? 132.278 157.791 105.540 1.00 147.22 ? 168  ARG C NE    1 
ATOM   4839  C  CZ    . ARG C 2 168  ? 133.129 157.932 104.530 1.00 147.22 ? 168  ARG C CZ    1 
ATOM   4840  N  NH1   . ARG C 2 168  ? 134.207 157.164 104.459 1.00 147.22 ? 168  ARG C NH1   1 
ATOM   4841  N  NH2   . ARG C 2 168  ? 132.903 158.840 103.590 1.00 147.22 ? 168  ARG C NH2   1 
ATOM   4842  N  N     . GLY C 2 169  ? 134.479 159.852 110.773 1.00 151.06 ? 169  GLY C N     1 
ATOM   4843  C  CA    . GLY C 2 169  ? 134.852 161.099 111.395 1.00 151.06 ? 169  GLY C CA    1 
ATOM   4844  C  C     . GLY C 2 169  ? 135.005 160.978 112.896 1.00 151.06 ? 169  GLY C C     1 
ATOM   4845  O  O     . GLY C 2 169  ? 134.660 159.959 113.501 1.00 151.06 ? 169  GLY C O     1 
ATOM   4846  N  N     . PRO C 2 170  ? 135.532 162.022 113.526 1.00 149.52 ? 170  PRO C N     1 
ATOM   4847  C  CA    . PRO C 2 170  ? 135.698 162.006 114.980 1.00 149.52 ? 170  PRO C CA    1 
ATOM   4848  C  C     . PRO C 2 170  ? 134.477 162.563 115.695 1.00 149.52 ? 170  PRO C C     1 
ATOM   4849  O  O     . PRO C 2 170  ? 133.676 163.313 115.136 1.00 149.52 ? 170  PRO C O     1 
ATOM   4850  C  CB    . PRO C 2 170  ? 136.915 162.908 115.189 1.00 149.52 ? 170  PRO C CB    1 
ATOM   4851  C  CG    . PRO C 2 170  ? 136.767 163.933 114.106 1.00 149.52 ? 170  PRO C CG    1 
ATOM   4852  C  CD    . PRO C 2 170  ? 136.129 163.226 112.922 1.00 149.52 ? 170  PRO C CD    1 
ATOM   4853  N  N     . TRP C 2 171  ? 134.342 162.167 116.956 1.00 143.68 ? 171  TRP C N     1 
ATOM   4854  C  CA    . TRP C 2 171  ? 133.280 162.671 117.813 1.00 143.68 ? 171  TRP C CA    1 
ATOM   4855  C  C     . TRP C 2 171  ? 133.667 164.028 118.384 1.00 143.68 ? 171  TRP C C     1 
ATOM   4856  O  O     . TRP C 2 171  ? 134.692 164.168 119.056 1.00 143.68 ? 171  TRP C O     1 
ATOM   4857  C  CB    . TRP C 2 171  ? 132.995 161.694 118.955 1.00 143.68 ? 171  TRP C CB    1 
ATOM   4858  C  CG    . TRP C 2 171  ? 132.320 160.431 118.525 1.00 143.68 ? 171  TRP C CG    1 
ATOM   4859  C  CD1   . TRP C 2 171  ? 132.393 159.838 117.300 1.00 143.68 ? 171  TRP C CD1   1 
ATOM   4860  C  CD2   . TRP C 2 171  ? 131.472 159.599 119.324 1.00 143.68 ? 171  TRP C CD2   1 
ATOM   4861  N  NE1   . TRP C 2 171  ? 131.641 158.690 117.284 1.00 143.68 ? 171  TRP C NE1   1 
ATOM   4862  C  CE2   . TRP C 2 171  ? 131.065 158.521 118.516 1.00 143.68 ? 171  TRP C CE2   1 
ATOM   4863  C  CE3   . TRP C 2 171  ? 131.016 159.662 120.644 1.00 143.68 ? 171  TRP C CE3   1 
ATOM   4864  C  CZ2   . TRP C 2 171  ? 130.224 157.514 118.983 1.00 143.68 ? 171  TRP C CZ2   1 
ATOM   4865  C  CZ3   . TRP C 2 171  ? 130.182 158.662 121.105 1.00 143.68 ? 171  TRP C CZ3   1 
ATOM   4866  C  CH2   . TRP C 2 171  ? 129.795 157.602 120.277 1.00 143.68 ? 171  TRP C CH2   1 
ATOM   4867  N  N     . ILE C 2 172  ? 132.838 165.034 118.114 1.00 149.26 ? 172  ILE C N     1 
ATOM   4868  C  CA    . ILE C 2 172  ? 133.090 166.396 118.574 1.00 149.26 ? 172  ILE C CA    1 
ATOM   4869  C  C     . ILE C 2 172  ? 132.319 166.615 119.867 1.00 149.26 ? 172  ILE C C     1 
ATOM   4870  O  O     . ILE C 2 172  ? 131.124 166.302 119.942 1.00 149.26 ? 172  ILE C O     1 
ATOM   4871  C  CB    . ILE C 2 172  ? 132.699 167.439 117.513 1.00 149.26 ? 172  ILE C CB    1 
ATOM   4872  C  CG1   . ILE C 2 172  ? 133.626 167.348 116.298 1.00 149.26 ? 172  ILE C CG1   1 
ATOM   4873  C  CG2   . ILE C 2 172  ? 132.730 168.839 118.098 1.00 149.26 ? 172  ILE C CG2   1 
ATOM   4874  C  CD1   . ILE C 2 172  ? 133.135 166.428 115.211 1.00 149.26 ? 172  ILE C CD1   1 
ATOM   4875  N  N     . ASP C 2 173  ? 132.993 167.150 120.884 1.00 163.91 ? 173  ASP C N     1 
ATOM   4876  C  CA    . ASP C 2 173  ? 132.363 167.420 122.170 1.00 163.91 ? 173  ASP C CA    1 
ATOM   4877  C  C     . ASP C 2 173  ? 132.478 168.904 122.484 1.00 163.91 ? 173  ASP C C     1 
ATOM   4878  O  O     . ASP C 2 173  ? 133.516 169.516 122.220 1.00 163.91 ? 173  ASP C O     1 
ATOM   4879  C  CB    . ASP C 2 173  ? 133.010 166.581 123.277 1.00 163.91 ? 173  ASP C CB    1 
ATOM   4880  C  CG    . ASP C 2 173  ? 132.219 166.604 124.572 1.00 163.91 ? 173  ASP C CG    1 
ATOM   4881  O  OD1   . ASP C 2 173  ? 132.014 165.520 125.155 1.00 163.91 ? 173  ASP C OD1   1 
ATOM   4882  O  OD2   . ASP C 2 173  ? 131.809 167.697 125.016 1.00 163.91 ? 173  ASP C OD2   1 
ATOM   4883  N  N     . LEU C 2 174  ? 131.420 169.474 123.056 1.00 164.23 ? 174  LEU C N     1 
ATOM   4884  C  CA    . LEU C 2 174  ? 131.397 170.870 123.475 1.00 164.23 ? 174  LEU C CA    1 
ATOM   4885  C  C     . LEU C 2 174  ? 130.941 170.934 124.927 1.00 164.23 ? 174  LEU C C     1 
ATOM   4886  O  O     . LEU C 2 174  ? 129.930 170.318 125.290 1.00 164.23 ? 174  LEU C O     1 
ATOM   4887  C  CB    . LEU C 2 174  ? 130.463 171.693 122.588 1.00 164.23 ? 174  LEU C CB    1 
ATOM   4888  C  CG    . LEU C 2 174  ? 131.055 172.487 121.422 1.00 164.23 ? 174  LEU C CG    1 
ATOM   4889  C  CD1   . LEU C 2 174  ? 131.770 171.577 120.439 1.00 164.23 ? 174  LEU C CD1   1 
ATOM   4890  C  CD2   . LEU C 2 174  ? 129.964 173.280 120.722 1.00 164.23 ? 174  LEU C CD2   1 
ATOM   4891  N  N     . GLU C 2 175  ? 131.673 171.687 125.748 1.00 177.56 ? 175  GLU C N     1 
ATOM   4892  C  CA    . GLU C 2 175  ? 131.372 171.802 127.167 1.00 177.56 ? 175  GLU C CA    1 
ATOM   4893  C  C     . GLU C 2 175  ? 131.601 173.238 127.614 1.00 177.56 ? 175  GLU C C     1 
ATOM   4894  O  O     . GLU C 2 175  ? 132.449 173.946 127.066 1.00 177.56 ? 175  GLU C O     1 
ATOM   4895  C  CB    . GLU C 2 175  ? 132.231 170.815 127.985 1.00 177.56 ? 175  GLU C CB    1 
ATOM   4896  C  CG    . GLU C 2 175  ? 132.532 171.174 129.448 1.00 177.56 ? 175  GLU C CG    1 
ATOM   4897  C  CD    . GLU C 2 175  ? 131.302 171.294 130.343 1.00 177.56 ? 175  GLU C CD    1 
ATOM   4898  O  OE1   . GLU C 2 175  ? 130.163 171.143 129.858 1.00 177.56 ? 175  GLU C OE1   1 
ATOM   4899  O  OE2   . GLU C 2 175  ? 131.485 171.535 131.554 1.00 177.56 ? 175  GLU C OE2   1 
ATOM   4900  N  N     . VAL C 2 176  ? 130.821 173.673 128.598 1.00 179.41 ? 176  VAL C N     1 
ATOM   4901  C  CA    . VAL C 2 176  ? 130.977 174.989 129.204 1.00 179.41 ? 176  VAL C CA    1 
ATOM   4902  C  C     . VAL C 2 176  ? 131.771 174.806 130.491 1.00 179.41 ? 176  VAL C C     1 
ATOM   4903  O  O     . VAL C 2 176  ? 131.235 174.341 131.503 1.00 179.41 ? 176  VAL C O     1 
ATOM   4904  C  CB    . VAL C 2 176  ? 129.622 175.657 129.470 1.00 179.41 ? 176  VAL C CB    1 
ATOM   4905  C  CG1   . VAL C 2 176  ? 129.816 176.969 130.213 1.00 179.41 ? 176  VAL C CG1   1 
ATOM   4906  C  CG2   . VAL C 2 176  ? 128.882 175.886 128.162 1.00 179.41 ? 176  VAL C CG2   1 
ATOM   4907  N  N     . GLU C 2 177  ? 133.052 175.169 130.452 1.00 187.13 ? 177  GLU C N     1 
ATOM   4908  C  CA    . GLU C 2 177  ? 133.929 174.993 131.596 1.00 187.13 ? 177  GLU C CA    1 
ATOM   4909  C  C     . GLU C 2 177  ? 133.475 175.869 132.763 1.00 187.13 ? 177  GLU C C     1 
ATOM   4910  O  O     . GLU C 2 177  ? 132.785 176.872 132.567 1.00 187.13 ? 177  GLU C O     1 
ATOM   4911  C  CB    . GLU C 2 177  ? 135.368 175.329 131.212 1.00 187.13 ? 177  GLU C CB    1 
ATOM   4912  C  CG    . GLU C 2 177  ? 136.037 174.296 130.322 1.00 187.13 ? 177  GLU C CG    1 
ATOM   4913  C  CD    . GLU C 2 177  ? 136.377 173.018 131.062 1.00 187.13 ? 177  GLU C CD    1 
ATOM   4914  O  OE1   . GLU C 2 177  ? 136.695 173.094 132.267 1.00 187.13 ? 177  GLU C OE1   1 
ATOM   4915  O  OE2   . GLU C 2 177  ? 136.329 171.937 130.439 1.00 187.13 ? 177  GLU C OE2   1 
ATOM   4916  N  N     . PRO C 2 178  ? 133.842 175.498 133.994 1.00 186.72 ? 178  PRO C N     1 
ATOM   4917  C  CA    . PRO C 2 178  ? 133.446 176.320 135.150 1.00 186.72 ? 178  PRO C CA    1 
ATOM   4918  C  C     . PRO C 2 178  ? 133.963 177.745 135.089 1.00 186.72 ? 178  PRO C C     1 
ATOM   4919  O  O     . PRO C 2 178  ? 133.237 178.672 135.469 1.00 186.72 ? 178  PRO C O     1 
ATOM   4920  C  CB    . PRO C 2 178  ? 134.036 175.554 136.344 1.00 186.72 ? 178  PRO C CB    1 
ATOM   4921  C  CG    . PRO C 2 178  ? 135.062 174.633 135.757 1.00 186.72 ? 178  PRO C CG    1 
ATOM   4922  C  CD    . PRO C 2 178  ? 134.541 174.271 134.408 1.00 186.72 ? 178  PRO C CD    1 
ATOM   4923  N  N     . ASN C 2 179  ? 135.195 177.954 134.624 1.00 187.38 ? 179  ASN C N     1 
ATOM   4924  C  CA    . ASN C 2 179  ? 135.747 179.301 134.551 1.00 187.38 ? 179  ASN C CA    1 
ATOM   4925  C  C     . ASN C 2 179  ? 135.128 180.141 133.439 1.00 187.38 ? 179  ASN C C     1 
ATOM   4926  O  O     . ASN C 2 179  ? 135.465 181.324 133.325 1.00 187.38 ? 179  ASN C O     1 
ATOM   4927  C  CB    . ASN C 2 179  ? 137.265 179.236 134.375 1.00 187.38 ? 179  ASN C CB    1 
ATOM   4928  C  CG    . ASN C 2 179  ? 137.680 178.361 133.214 1.00 187.38 ? 179  ASN C CG    1 
ATOM   4929  O  OD1   . ASN C 2 179  ? 136.840 177.852 132.476 1.00 187.38 ? 179  ASN C OD1   1 
ATOM   4930  N  ND2   . ASN C 2 179  ? 138.985 178.178 133.047 1.00 187.38 ? 179  ASN C ND2   1 
ATOM   4931  N  N     . GLY C 2 180  ? 134.244 179.570 132.623 1.00 187.30 ? 180  GLY C N     1 
ATOM   4932  C  CA    . GLY C 2 180  ? 133.491 180.325 131.641 1.00 187.30 ? 180  GLY C CA    1 
ATOM   4933  C  C     . GLY C 2 180  ? 133.808 180.011 130.195 1.00 187.30 ? 180  GLY C C     1 
ATOM   4934  O  O     . GLY C 2 180  ? 132.925 180.173 129.342 1.00 187.30 ? 180  GLY C O     1 
ATOM   4935  N  N     . VAL C 2 181  ? 135.020 179.571 129.883 1.00 185.65 ? 181  VAL C N     1 
ATOM   4936  C  CA    . VAL C 2 181  ? 135.423 179.334 128.502 1.00 185.65 ? 181  VAL C CA    1 
ATOM   4937  C  C     . VAL C 2 181  ? 134.753 178.066 127.993 1.00 185.65 ? 181  VAL C C     1 
ATOM   4938  O  O     . VAL C 2 181  ? 134.586 177.091 128.734 1.00 185.65 ? 181  VAL C O     1 
ATOM   4939  C  CB    . VAL C 2 181  ? 136.956 179.240 128.382 1.00 185.65 ? 181  VAL C CB    1 
ATOM   4940  C  CG1   . VAL C 2 181  ? 137.585 180.613 128.559 1.00 185.65 ? 181  VAL C CG1   1 
ATOM   4941  C  CG2   . VAL C 2 181  ? 137.514 178.255 129.393 1.00 185.65 ? 181  VAL C CG2   1 
ATOM   4942  N  N     . VAL C 2 182  ? 134.357 178.083 126.726 1.00 182.64 ? 182  VAL C N     1 
ATOM   4943  C  CA    . VAL C 2 182  ? 133.741 176.926 126.088 1.00 182.64 ? 182  VAL C CA    1 
ATOM   4944  C  C     . VAL C 2 182  ? 134.841 176.051 125.499 1.00 182.64 ? 182  VAL C C     1 
ATOM   4945  O  O     . VAL C 2 182  ? 135.564 176.467 124.588 1.00 182.64 ? 182  VAL C O     1 
ATOM   4946  C  CB    . VAL C 2 182  ? 132.726 177.352 125.017 1.00 182.64 ? 182  VAL C CB    1 
ATOM   4947  C  CG1   . VAL C 2 182  ? 131.440 177.805 125.678 1.00 182.64 ? 182  VAL C CG1   1 
ATOM   4948  C  CG2   . VAL C 2 182  ? 133.288 178.476 124.159 1.00 182.64 ? 182  VAL C CG2   1 
ATOM   4949  N  N     . SER C 2 183  ? 134.972 174.840 126.027 1.00 182.09 ? 183  SER C N     1 
ATOM   4950  C  CA    . SER C 2 183  ? 136.008 173.912 125.606 1.00 182.09 ? 183  SER C CA    1 
ATOM   4951  C  C     . SER C 2 183  ? 135.448 172.892 124.624 1.00 182.09 ? 183  SER C C     1 
ATOM   4952  O  O     . SER C 2 183  ? 134.423 172.249 124.874 1.00 182.09 ? 183  SER C O     1 
ATOM   4953  C  CB    . SER C 2 183  ? 136.617 173.192 126.810 1.00 182.09 ? 183  SER C CB    1 
ATOM   4954  O  OG    . SER C 2 183  ? 135.876 172.029 127.134 1.00 182.09 ? 183  SER C OG    1 
ATOM   4955  N  N     . MET C 2 184  ? 136.134 172.760 123.493 1.00 181.34 ? 184  MET C N     1 
ATOM   4956  C  CA    . MET C 2 184  ? 135.829 171.768 122.476 1.00 181.34 ? 184  MET C CA    1 
ATOM   4957  C  C     . MET C 2 184  ? 136.848 170.644 122.582 1.00 181.34 ? 184  MET C C     1 
ATOM   4958  O  O     . MET C 2 184  ? 138.052 170.900 122.717 1.00 181.34 ? 184  MET C O     1 
ATOM   4959  C  CB    . MET C 2 184  ? 135.853 172.392 121.080 1.00 181.34 ? 184  MET C CB    1 
ATOM   4960  C  CG    . MET C 2 184  ? 135.860 171.395 119.938 1.00 181.34 ? 184  MET C CG    1 
ATOM   4961  S  SD    . MET C 2 184  ? 135.624 172.220 118.353 1.00 181.34 ? 184  MET C SD    1 
ATOM   4962  C  CE    . MET C 2 184  ? 135.770 170.846 117.219 1.00 181.34 ? 184  MET C CE    1 
ATOM   4963  N  N     . LYS C 2 185  ? 136.361 169.409 122.534 1.00 175.66 ? 185  LYS C N     1 
ATOM   4964  C  CA    . LYS C 2 185  ? 137.189 168.217 122.649 1.00 175.66 ? 185  LYS C CA    1 
ATOM   4965  C  C     . LYS C 2 185  ? 137.084 167.404 121.366 1.00 175.66 ? 185  LYS C C     1 
ATOM   4966  O  O     . LYS C 2 185  ? 135.975 167.112 120.895 1.00 175.66 ? 185  LYS C O     1 
ATOM   4967  C  CB    . LYS C 2 185  ? 136.777 167.371 123.852 1.00 175.66 ? 185  LYS C CB    1 
ATOM   4968  C  CG    . LYS C 2 185  ? 137.365 165.970 123.837 1.00 175.66 ? 185  LYS C CG    1 
ATOM   4969  C  CD    . LYS C 2 185  ? 136.816 165.115 124.964 1.00 175.66 ? 185  LYS C CD    1 
ATOM   4970  C  CE    . LYS C 2 185  ? 137.231 165.657 126.320 1.00 175.66 ? 185  LYS C CE    1 
ATOM   4971  N  NZ    . LYS C 2 185  ? 136.720 164.812 127.434 1.00 175.66 ? 185  LYS C NZ    1 
ATOM   4972  N  N     . VAL C 2 186  ? 138.243 167.049 120.811 1.00 176.27 ? 186  VAL C N     1 
ATOM   4973  C  CA    . VAL C 2 186  ? 138.366 166.180 119.645 1.00 176.27 ? 186  VAL C CA    1 
ATOM   4974  C  C     . VAL C 2 186  ? 139.564 165.271 119.874 1.00 176.27 ? 186  VAL C C     1 
ATOM   4975  O  O     . VAL C 2 186  ? 140.672 165.756 120.133 1.00 176.27 ? 186  VAL C O     1 
ATOM   4976  C  CB    . VAL C 2 186  ? 138.544 166.969 118.336 1.00 176.27 ? 186  VAL C CB    1 
ATOM   4977  C  CG1   . VAL C 2 186  ? 138.904 166.027 117.201 1.00 176.27 ? 186  VAL C CG1   1 
ATOM   4978  C  CG2   . VAL C 2 186  ? 137.283 167.734 118.000 1.00 176.27 ? 186  VAL C CG2   1 
ATOM   4979  N  N     . ASN C 2 187  ? 139.344 163.958 119.788 1.00 181.79 ? 187  ASN C N     1 
ATOM   4980  C  CA    . ASN C 2 187  ? 140.411 162.963 119.918 1.00 181.79 ? 187  ASN C CA    1 
ATOM   4981  C  C     . ASN C 2 187  ? 141.221 163.172 121.195 1.00 181.79 ? 187  ASN C C     1 
ATOM   4982  O  O     . ASN C 2 187  ? 142.448 163.285 121.166 1.00 181.79 ? 187  ASN C O     1 
ATOM   4983  C  CB    . ASN C 2 187  ? 141.323 162.976 118.690 1.00 181.79 ? 187  ASN C CB    1 
ATOM   4984  C  CG    . ASN C 2 187  ? 140.652 162.396 117.464 1.00 181.79 ? 187  ASN C CG    1 
ATOM   4985  O  OD1   . ASN C 2 187  ? 140.757 162.944 116.367 1.00 181.79 ? 187  ASN C OD1   1 
ATOM   4986  N  ND2   . ASN C 2 187  ? 139.956 161.279 117.643 1.00 181.79 ? 187  ASN C ND2   1 
ATOM   4987  N  N     . LYS C 2 188  ? 140.515 163.248 122.326 1.00 185.88 ? 188  LYS C N     1 
ATOM   4988  C  CA    . LYS C 2 188  ? 141.122 163.380 123.647 1.00 185.88 ? 188  LYS C CA    1 
ATOM   4989  C  C     . LYS C 2 188  ? 141.904 164.680 123.795 1.00 185.88 ? 188  LYS C C     1 
ATOM   4990  O  O     . LYS C 2 188  ? 142.614 164.870 124.788 1.00 185.88 ? 188  LYS C O     1 
ATOM   4991  C  CB    . LYS C 2 188  ? 142.025 162.179 123.946 1.00 185.88 ? 188  LYS C CB    1 
ATOM   4992  C  CG    . LYS C 2 188  ? 141.319 160.839 123.838 1.00 185.88 ? 188  LYS C CG    1 
ATOM   4993  C  CD    . LYS C 2 188  ? 142.273 159.686 124.092 1.00 185.88 ? 188  LYS C CD    1 
ATOM   4994  C  CE    . LYS C 2 188  ? 141.552 158.350 124.012 1.00 185.88 ? 188  LYS C CE    1 
ATOM   4995  N  NZ    . LYS C 2 188  ? 140.982 158.108 122.658 1.00 185.88 ? 188  LYS C NZ    1 
ATOM   4996  N  N     . ARG C 2 189  ? 141.785 165.579 122.823 1.00 190.14 ? 189  ARG C N     1 
ATOM   4997  C  CA    . ARG C 2 189  ? 142.428 166.883 122.887 1.00 190.14 ? 189  ARG C CA    1 
ATOM   4998  C  C     . ARG C 2 189  ? 141.384 167.965 123.119 1.00 190.14 ? 189  ARG C C     1 
ATOM   4999  O  O     . ARG C 2 189  ? 140.466 168.139 122.313 1.00 190.14 ? 189  ARG C O     1 
ATOM   5000  C  CB    . ARG C 2 189  ? 143.206 167.178 121.605 1.00 190.14 ? 189  ARG C CB    1 
ATOM   5001  C  CG    . ARG C 2 189  ? 144.460 166.342 121.433 1.00 190.14 ? 189  ARG C CG    1 
ATOM   5002  C  CD    . ARG C 2 189  ? 145.362 166.929 120.361 1.00 190.14 ? 189  ARG C CD    1 
ATOM   5003  N  NE    . ARG C 2 189  ? 146.358 165.970 119.894 1.00 190.14 ? 189  ARG C NE    1 
ATOM   5004  C  CZ    . ARG C 2 189  ? 147.515 165.738 120.504 1.00 190.14 ? 189  ARG C CZ    1 
ATOM   5005  N  NH1   . ARG C 2 189  ? 147.828 166.397 121.612 1.00 190.14 ? 189  ARG C NH1   1 
ATOM   5006  N  NH2   . ARG C 2 189  ? 148.362 164.846 120.007 1.00 190.14 ? 189  ARG C NH2   1 
ATOM   5007  N  N     . LYS C 2 190  ? 141.527 168.684 124.227 1.00 185.06 ? 190  LYS C N     1 
ATOM   5008  C  CA    . LYS C 2 190  ? 140.638 169.780 124.575 1.00 185.06 ? 190  LYS C CA    1 
ATOM   5009  C  C     . LYS C 2 190  ? 141.315 171.108 124.273 1.00 185.06 ? 190  LYS C C     1 
ATOM   5010  O  O     . LYS C 2 190  ? 142.529 171.256 124.439 1.00 185.06 ? 190  LYS C O     1 
ATOM   5011  C  CB    . LYS C 2 190  ? 140.248 169.727 126.055 1.00 185.06 ? 190  LYS C CB    1 
ATOM   5012  C  CG    . LYS C 2 190  ? 140.025 168.324 126.592 1.00 185.06 ? 190  LYS C CG    1 
ATOM   5013  C  CD    . LYS C 2 190  ? 139.744 168.344 128.087 1.00 185.06 ? 190  LYS C CD    1 
ATOM   5014  C  CE    . LYS C 2 190  ? 138.665 169.356 128.435 1.00 185.06 ? 190  LYS C CE    1 
ATOM   5015  N  NZ    . LYS C 2 190  ? 138.594 169.609 129.901 1.00 185.06 ? 190  LYS C NZ    1 
ATOM   5016  N  N     . PHE C 2 191  ? 140.521 172.075 123.833 1.00 186.02 ? 191  PHE C N     1 
ATOM   5017  C  CA    . PHE C 2 191  ? 141.037 173.409 123.560 1.00 186.02 ? 191  PHE C CA    1 
ATOM   5018  C  C     . PHE C 2 191  ? 139.863 174.368 123.489 1.00 186.02 ? 191  PHE C C     1 
ATOM   5019  O  O     . PHE C 2 191  ? 138.726 173.953 123.237 1.00 186.02 ? 191  PHE C O     1 
ATOM   5020  C  CB    . PHE C 2 191  ? 141.852 173.444 122.260 1.00 186.02 ? 191  PHE C CB    1 
ATOM   5021  C  CG    . PHE C 2 191  ? 141.117 172.915 121.066 1.00 186.02 ? 191  PHE C CG    1 
ATOM   5022  C  CD1   . PHE C 2 191  ? 140.419 173.771 120.231 1.00 186.02 ? 191  PHE C CD1   1 
ATOM   5023  C  CD2   . PHE C 2 191  ? 141.132 171.563 120.770 1.00 186.02 ? 191  PHE C CD2   1 
ATOM   5024  C  CE1   . PHE C 2 191  ? 139.745 173.289 119.129 1.00 186.02 ? 191  PHE C CE1   1 
ATOM   5025  C  CE2   . PHE C 2 191  ? 140.459 171.074 119.670 1.00 186.02 ? 191  PHE C CE2   1 
ATOM   5026  C  CZ    . PHE C 2 191  ? 139.765 171.938 118.847 1.00 186.02 ? 191  PHE C CZ    1 
ATOM   5027  N  N     . PRO C 2 192  ? 140.102 175.661 123.705 1.00 187.40 ? 192  PRO C N     1 
ATOM   5028  C  CA    . PRO C 2 192  ? 138.996 176.627 123.649 1.00 187.40 ? 192  PRO C CA    1 
ATOM   5029  C  C     . PRO C 2 192  ? 138.371 176.673 122.262 1.00 187.40 ? 192  PRO C C     1 
ATOM   5030  O  O     . PRO C 2 192  ? 139.071 176.751 121.249 1.00 187.40 ? 192  PRO C O     1 
ATOM   5031  C  CB    . PRO C 2 192  ? 139.666 177.958 124.014 1.00 187.40 ? 192  PRO C CB    1 
ATOM   5032  C  CG    . PRO C 2 192  ? 141.123 177.738 123.758 1.00 187.40 ? 192  PRO C CG    1 
ATOM   5033  C  CD    . PRO C 2 192  ? 141.362 176.305 124.109 1.00 187.40 ? 192  PRO C CD    1 
ATOM   5034  N  N     . LEU C 2 193  ? 137.037 176.619 122.229 1.00 188.47 ? 193  LEU C N     1 
ATOM   5035  C  CA    . LEU C 2 193  ? 136.311 176.659 120.963 1.00 188.47 ? 193  LEU C CA    1 
ATOM   5036  C  C     . LEU C 2 193  ? 136.496 177.993 120.250 1.00 188.47 ? 193  LEU C C     1 
ATOM   5037  O  O     . LEU C 2 193  ? 136.240 178.094 119.043 1.00 188.47 ? 193  LEU C O     1 
ATOM   5038  C  CB    . LEU C 2 193  ? 134.828 176.379 121.217 1.00 188.47 ? 193  LEU C CB    1 
ATOM   5039  C  CG    . LEU C 2 193  ? 133.828 176.449 120.062 1.00 188.47 ? 193  LEU C CG    1 
ATOM   5040  C  CD1   . LEU C 2 193  ? 134.105 175.362 119.043 1.00 188.47 ? 193  LEU C CD1   1 
ATOM   5041  C  CD2   . LEU C 2 193  ? 132.408 176.341 120.585 1.00 188.47 ? 193  LEU C CD2   1 
ATOM   5042  N  N     . VAL C 2 194  ? 136.948 179.019 120.973 1.00 195.33 ? 194  VAL C N     1 
ATOM   5043  C  CA    . VAL C 2 194  ? 137.079 180.352 120.391 1.00 195.33 ? 194  VAL C CA    1 
ATOM   5044  C  C     . VAL C 2 194  ? 138.073 180.339 119.237 1.00 195.33 ? 194  VAL C C     1 
ATOM   5045  O  O     . VAL C 2 194  ? 137.902 181.056 118.243 1.00 195.33 ? 194  VAL C O     1 
ATOM   5046  C  CB    . VAL C 2 194  ? 137.489 181.360 121.478 1.00 195.33 ? 194  VAL C CB    1 
ATOM   5047  C  CG1   . VAL C 2 194  ? 136.369 181.512 122.471 1.00 195.33 ? 194  VAL C CG1   1 
ATOM   5048  C  CG2   . VAL C 2 194  ? 138.770 180.918 122.172 1.00 195.33 ? 194  VAL C CG2   1 
ATOM   5049  N  N     . LEU C 2 195  ? 139.125 179.527 119.351 1.00 198.36 ? 195  LEU C N     1 
ATOM   5050  C  CA    . LEU C 2 195  ? 140.121 179.442 118.289 1.00 198.36 ? 195  LEU C CA    1 
ATOM   5051  C  C     . LEU C 2 195  ? 139.494 178.945 116.992 1.00 198.36 ? 195  LEU C C     1 
ATOM   5052  O  O     . LEU C 2 195  ? 139.674 179.550 115.928 1.00 198.36 ? 195  LEU C O     1 
ATOM   5053  C  CB    . LEU C 2 195  ? 141.267 178.531 118.728 1.00 198.36 ? 195  LEU C CB    1 
ATOM   5054  C  CG    . LEU C 2 195  ? 142.381 178.266 117.718 1.00 198.36 ? 195  LEU C CG    1 
ATOM   5055  C  CD1   . LEU C 2 195  ? 143.094 179.557 117.370 1.00 198.36 ? 195  LEU C CD1   1 
ATOM   5056  C  CD2   . LEU C 2 195  ? 143.356 177.258 118.287 1.00 198.36 ? 195  LEU C CD2   1 
ATOM   5057  N  N     . LEU C 2 196  ? 138.740 177.846 117.065 1.00 194.99 ? 196  LEU C N     1 
ATOM   5058  C  CA    . LEU C 2 196  ? 138.096 177.313 115.869 1.00 194.99 ? 196  LEU C CA    1 
ATOM   5059  C  C     . LEU C 2 196  ? 137.029 178.268 115.348 1.00 194.99 ? 196  LEU C C     1 
ATOM   5060  O  O     . LEU C 2 196  ? 136.848 178.402 114.132 1.00 194.99 ? 196  LEU C O     1 
ATOM   5061  C  CB    . LEU C 2 196  ? 137.498 175.937 116.163 1.00 194.99 ? 196  LEU C CB    1 
ATOM   5062  C  CG    . LEU C 2 196  ? 137.258 175.011 114.968 1.00 194.99 ? 196  LEU C CG    1 
ATOM   5063  C  CD1   . LEU C 2 196  ? 137.360 173.562 115.406 1.00 194.99 ? 196  LEU C CD1   1 
ATOM   5064  C  CD2   . LEU C 2 196  ? 135.904 175.272 114.323 1.00 194.99 ? 196  LEU C CD2   1 
ATOM   5065  N  N     . LEU C 2 197  ? 136.303 178.931 116.253 1.00 194.78 ? 197  LEU C N     1 
ATOM   5066  C  CA    . LEU C 2 197  ? 135.328 179.929 115.824 1.00 194.78 ? 197  LEU C CA    1 
ATOM   5067  C  C     . LEU C 2 197  ? 135.997 181.037 115.021 1.00 194.78 ? 197  LEU C C     1 
ATOM   5068  O  O     . LEU C 2 197  ? 135.465 181.480 113.996 1.00 194.78 ? 197  LEU C O     1 
ATOM   5069  C  CB    . LEU C 2 197  ? 134.598 180.507 117.035 1.00 194.78 ? 197  LEU C CB    1 
ATOM   5070  C  CG    . LEU C 2 197  ? 133.350 179.747 117.485 1.00 194.78 ? 197  LEU C CG    1 
ATOM   5071  C  CD1   . LEU C 2 197  ? 132.844 180.289 118.811 1.00 194.78 ? 197  LEU C CD1   1 
ATOM   5072  C  CD2   . LEU C 2 197  ? 132.267 179.826 116.421 1.00 194.78 ? 197  LEU C CD2   1 
ATOM   5073  N  N     . ARG C 2 198  ? 137.165 181.497 115.472 1.00 201.35 ? 198  ARG C N     1 
ATOM   5074  C  CA    . ARG C 2 198  ? 137.921 182.476 114.699 1.00 201.35 ? 198  ARG C CA    1 
ATOM   5075  C  C     . ARG C 2 198  ? 138.371 181.891 113.366 1.00 201.35 ? 198  ARG C C     1 
ATOM   5076  O  O     . ARG C 2 198  ? 138.325 182.573 112.336 1.00 201.35 ? 198  ARG C O     1 
ATOM   5077  C  CB    . ARG C 2 198  ? 139.122 182.969 115.507 1.00 201.35 ? 198  ARG C CB    1 
ATOM   5078  C  CG    . ARG C 2 198  ? 140.012 183.959 114.768 1.00 201.35 ? 198  ARG C CG    1 
ATOM   5079  C  CD    . ARG C 2 198  ? 139.207 185.113 114.188 1.00 201.35 ? 198  ARG C CD    1 
ATOM   5080  N  NE    . ARG C 2 198  ? 140.029 185.989 113.358 1.00 201.35 ? 198  ARG C NE    1 
ATOM   5081  C  CZ    . ARG C 2 198  ? 139.550 186.985 112.620 1.00 201.35 ? 198  ARG C CZ    1 
ATOM   5082  N  NH1   . ARG C 2 198  ? 140.373 187.732 111.896 1.00 201.35 ? 198  ARG C NH1   1 
ATOM   5083  N  NH2   . ARG C 2 198  ? 138.248 187.235 112.603 1.00 201.35 ? 198  ARG C NH2   1 
ATOM   5084  N  N     . VAL C 2 199  ? 138.815 180.630 113.369 1.00 198.59 ? 199  VAL C N     1 
ATOM   5085  C  CA    . VAL C 2 199  ? 139.225 179.974 112.130 1.00 198.59 ? 199  VAL C CA    1 
ATOM   5086  C  C     . VAL C 2 199  ? 138.082 179.943 111.126 1.00 198.59 ? 199  VAL C C     1 
ATOM   5087  O  O     . VAL C 2 199  ? 138.291 180.156 109.925 1.00 198.59 ? 199  VAL C O     1 
ATOM   5088  C  CB    . VAL C 2 199  ? 139.751 178.555 112.427 1.00 198.59 ? 199  VAL C CB    1 
ATOM   5089  C  CG1   . VAL C 2 199  ? 139.945 177.775 111.137 1.00 198.59 ? 199  VAL C CG1   1 
ATOM   5090  C  CG2   . VAL C 2 199  ? 141.055 178.624 113.200 1.00 198.59 ? 199  VAL C CG2   1 
ATOM   5091  N  N     . LEU C 2 200  ? 136.857 179.703 111.594 1.00 194.41 ? 200  LEU C N     1 
ATOM   5092  C  CA    . LEU C 2 200  ? 135.708 179.582 110.706 1.00 194.41 ? 200  LEU C CA    1 
ATOM   5093  C  C     . LEU C 2 200  ? 135.236 180.917 110.145 1.00 194.41 ? 200  LEU C C     1 
ATOM   5094  O  O     . LEU C 2 200  ? 134.177 180.960 109.510 1.00 194.41 ? 200  LEU C O     1 
ATOM   5095  C  CB    . LEU C 2 200  ? 134.555 178.894 111.440 1.00 194.41 ? 200  LEU C CB    1 
ATOM   5096  C  CG    . LEU C 2 200  ? 134.407 177.397 111.167 1.00 194.41 ? 200  LEU C CG    1 
ATOM   5097  C  CD1   . LEU C 2 200  ? 133.259 176.812 111.969 1.00 194.41 ? 200  LEU C CD1   1 
ATOM   5098  C  CD2   . LEU C 2 200  ? 134.203 177.147 109.683 1.00 194.41 ? 200  LEU C CD2   1 
ATOM   5099  N  N     . GLY C 2 201  ? 135.979 181.995 110.360 1.00 194.16 ? 201  GLY C N     1 
ATOM   5100  C  CA    . GLY C 2 201  ? 135.623 183.288 109.821 1.00 194.16 ? 201  GLY C CA    1 
ATOM   5101  C  C     . GLY C 2 201  ? 134.718 184.134 110.688 1.00 194.16 ? 201  GLY C C     1 
ATOM   5102  O  O     . GLY C 2 201  ? 134.096 185.067 110.168 1.00 194.16 ? 201  GLY C O     1 
ATOM   5103  N  N     . TYR C 2 202  ? 134.620 183.842 111.981 1.00 196.68 ? 202  TYR C N     1 
ATOM   5104  C  CA    . TYR C 2 202  ? 133.758 184.611 112.865 1.00 196.68 ? 202  TYR C CA    1 
ATOM   5105  C  C     . TYR C 2 202  ? 134.531 185.754 113.509 1.00 196.68 ? 202  TYR C C     1 
ATOM   5106  O  O     . TYR C 2 202  ? 135.742 185.662 113.726 1.00 196.68 ? 202  TYR C O     1 
ATOM   5107  C  CB    . TYR C 2 202  ? 133.159 183.711 113.944 1.00 196.68 ? 202  TYR C CB    1 
ATOM   5108  C  CG    . TYR C 2 202  ? 132.002 182.879 113.450 1.00 196.68 ? 202  TYR C CG    1 
ATOM   5109  C  CD1   . TYR C 2 202  ? 130.757 183.449 113.232 1.00 196.68 ? 202  TYR C CD1   1 
ATOM   5110  C  CD2   . TYR C 2 202  ? 132.157 181.524 113.193 1.00 196.68 ? 202  TYR C CD2   1 
ATOM   5111  C  CE1   . TYR C 2 202  ? 129.696 182.695 112.776 1.00 196.68 ? 202  TYR C CE1   1 
ATOM   5112  C  CE2   . TYR C 2 202  ? 131.102 180.760 112.738 1.00 196.68 ? 202  TYR C CE2   1 
ATOM   5113  C  CZ    . TYR C 2 202  ? 129.874 181.351 112.531 1.00 196.68 ? 202  TYR C CZ    1 
ATOM   5114  O  OH    . TYR C 2 202  ? 128.818 180.597 112.077 1.00 196.68 ? 202  TYR C OH    1 
ATOM   5115  N  N     . ASP C 2 203  ? 133.818 186.834 113.811 1.00 204.84 ? 203  ASP C N     1 
ATOM   5116  C  CA    . ASP C 2 203  ? 134.397 188.014 114.429 1.00 204.84 ? 203  ASP C CA    1 
ATOM   5117  C  C     . ASP C 2 203  ? 133.779 188.229 115.804 1.00 204.84 ? 203  ASP C C     1 
ATOM   5118  O  O     . ASP C 2 203  ? 132.741 187.652 116.140 1.00 204.84 ? 203  ASP C O     1 
ATOM   5119  C  CB    . ASP C 2 203  ? 134.189 189.257 113.553 1.00 204.84 ? 203  ASP C CB    1 
ATOM   5120  C  CG    . ASP C 2 203  ? 135.070 190.419 113.968 1.00 204.84 ? 203  ASP C CG    1 
ATOM   5121  O  OD1   . ASP C 2 203  ? 136.215 190.504 113.476 1.00 204.84 ? 203  ASP C OD1   1 
ATOM   5122  O  OD2   . ASP C 2 203  ? 134.619 191.244 114.790 1.00 204.84 ? 203  ASP C OD2   1 
ATOM   5123  N  N     . GLN C 2 204  ? 134.445 189.066 116.604 1.00 206.97 ? 204  GLN C N     1 
ATOM   5124  C  CA    . GLN C 2 204  ? 133.945 189.390 117.937 1.00 206.97 ? 204  GLN C CA    1 
ATOM   5125  C  C     . GLN C 2 204  ? 132.546 189.988 117.877 1.00 206.97 ? 204  GLN C C     1 
ATOM   5126  O  O     . GLN C 2 204  ? 131.663 189.609 118.658 1.00 206.97 ? 204  GLN C O     1 
ATOM   5127  C  CB    . GLN C 2 204  ? 134.907 190.358 118.625 1.00 206.97 ? 204  GLN C CB    1 
ATOM   5128  C  CG    . GLN C 2 204  ? 134.608 190.609 120.089 1.00 206.97 ? 204  GLN C CG    1 
ATOM   5129  C  CD    . GLN C 2 204  ? 135.756 191.295 120.800 1.00 206.97 ? 204  GLN C CD    1 
ATOM   5130  O  OE1   . GLN C 2 204  ? 136.786 191.590 120.193 1.00 206.97 ? 204  GLN C OE1   1 
ATOM   5131  N  NE2   . GLN C 2 204  ? 135.588 191.551 122.092 1.00 206.97 ? 204  GLN C NE2   1 
ATOM   5132  N  N     . GLU C 2 205  ? 132.324 190.919 116.948 1.00 206.63 ? 205  GLU C N     1 
ATOM   5133  C  CA    . GLU C 2 205  ? 131.024 191.572 116.842 1.00 206.63 ? 205  GLU C CA    1 
ATOM   5134  C  C     . GLU C 2 205  ? 129.939 190.577 116.454 1.00 206.63 ? 205  GLU C C     1 
ATOM   5135  O  O     . GLU C 2 205  ? 128.810 190.652 116.950 1.00 206.63 ? 205  GLU C O     1 
ATOM   5136  C  CB    . GLU C 2 205  ? 131.094 192.715 115.830 1.00 206.63 ? 205  GLU C CB    1 
ATOM   5137  C  CG    . GLU C 2 205  ? 129.829 193.554 115.755 1.00 206.63 ? 205  GLU C CG    1 
ATOM   5138  C  CD    . GLU C 2 205  ? 129.701 194.535 116.905 1.00 206.63 ? 205  GLU C CD    1 
ATOM   5139  O  OE1   . GLU C 2 205  ? 130.598 194.565 117.774 1.00 206.63 ? 205  GLU C OE1   1 
ATOM   5140  O  OE2   . GLU C 2 205  ? 128.698 195.278 116.941 1.00 206.63 ? 205  GLU C OE2   1 
ATOM   5141  N  N     . THR C 2 206  ? 130.263 189.641 115.559 1.00 206.83 ? 206  THR C N     1 
ATOM   5142  C  CA    . THR C 2 206  ? 129.280 188.653 115.124 1.00 206.83 ? 206  THR C CA    1 
ATOM   5143  C  C     . THR C 2 206  ? 128.815 187.788 116.289 1.00 206.83 ? 206  THR C C     1 
ATOM   5144  O  O     . THR C 2 206  ? 127.610 187.597 116.496 1.00 206.83 ? 206  THR C O     1 
ATOM   5145  C  CB    . THR C 2 206  ? 129.867 187.785 114.011 1.00 206.83 ? 206  THR C CB    1 
ATOM   5146  O  OG1   . THR C 2 206  ? 131.017 187.085 114.504 1.00 206.83 ? 206  THR C OG1   1 
ATOM   5147  C  CG2   . THR C 2 206  ? 130.275 188.645 112.825 1.00 206.83 ? 206  THR C CG2   1 
ATOM   5148  N  N     . LEU C 2 207  ? 129.763 187.246 117.058 1.00 207.21 ? 207  LEU C N     1 
ATOM   5149  C  CA    . LEU C 2 207  ? 129.399 186.458 118.230 1.00 207.21 ? 207  LEU C CA    1 
ATOM   5150  C  C     . LEU C 2 207  ? 128.629 187.299 119.238 1.00 207.21 ? 207  LEU C C     1 
ATOM   5151  O  O     . LEU C 2 207  ? 127.659 186.822 119.841 1.00 207.21 ? 207  LEU C O     1 
ATOM   5152  C  CB    . LEU C 2 207  ? 130.651 185.861 118.874 1.00 207.21 ? 207  LEU C CB    1 
ATOM   5153  C  CG    . LEU C 2 207  ? 131.588 185.056 117.972 1.00 207.21 ? 207  LEU C CG    1 
ATOM   5154  C  CD1   . LEU C 2 207  ? 132.619 184.312 118.805 1.00 207.21 ? 207  LEU C CD1   1 
ATOM   5155  C  CD2   . LEU C 2 207  ? 130.802 184.087 117.102 1.00 207.21 ? 207  LEU C CD2   1 
ATOM   5156  N  N     . ALA C 2 208  ? 129.039 188.556 119.425 1.00 207.99 ? 208  ALA C N     1 
ATOM   5157  C  CA    . ALA C 2 208  ? 128.366 189.423 120.387 1.00 207.99 ? 208  ALA C CA    1 
ATOM   5158  C  C     . ALA C 2 208  ? 126.908 189.651 120.004 1.00 207.99 ? 208  ALA C C     1 
ATOM   5159  O  O     . ALA C 2 208  ? 126.018 189.616 120.859 1.00 207.99 ? 208  ALA C O     1 
ATOM   5160  C  CB    . ALA C 2 208  ? 129.108 190.754 120.500 1.00 207.99 ? 208  ALA C CB    1 
ATOM   5161  N  N     . ARG C 2 209  ? 126.643 189.887 118.717 1.00 203.45 ? 209  ARG C N     1 
ATOM   5162  C  CA    . ARG C 2 209  ? 125.273 190.176 118.303 1.00 203.45 ? 209  ARG C CA    1 
ATOM   5163  C  C     . ARG C 2 209  ? 124.435 188.907 118.230 1.00 203.45 ? 209  ARG C C     1 
ATOM   5164  O  O     . ARG C 2 209  ? 123.222 188.946 118.470 1.00 203.45 ? 209  ARG C O     1 
ATOM   5165  C  CB    . ARG C 2 209  ? 125.256 190.903 116.957 1.00 203.45 ? 209  ARG C CB    1 
ATOM   5166  C  CG    . ARG C 2 209  ? 126.014 190.200 115.850 1.00 203.45 ? 209  ARG C CG    1 
ATOM   5167  C  CD    . ARG C 2 209  ? 125.722 190.809 114.492 1.00 203.45 ? 209  ARG C CD    1 
ATOM   5168  N  NE    . ARG C 2 209  ? 124.679 190.074 113.784 1.00 203.45 ? 209  ARG C NE    1 
ATOM   5169  C  CZ    . ARG C 2 209  ? 124.901 188.987 113.052 1.00 203.45 ? 209  ARG C CZ    1 
ATOM   5170  N  NH1   . ARG C 2 209  ? 126.132 188.509 112.932 1.00 203.45 ? 209  ARG C NH1   1 
ATOM   5171  N  NH2   . ARG C 2 209  ? 123.895 188.378 112.441 1.00 203.45 ? 209  ARG C NH2   1 
ATOM   5172  N  N     . GLU C 2 210  ? 125.054 187.771 117.903 1.00 201.60 ? 210  GLU C N     1 
ATOM   5173  C  CA    . GLU C 2 210  ? 124.294 186.530 117.805 1.00 201.60 ? 210  GLU C CA    1 
ATOM   5174  C  C     . GLU C 2 210  ? 123.946 185.988 119.185 1.00 201.60 ? 210  GLU C C     1 
ATOM   5175  O  O     . GLU C 2 210  ? 122.768 185.796 119.510 1.00 201.60 ? 210  GLU C O     1 
ATOM   5176  C  CB    . GLU C 2 210  ? 125.081 185.494 117.002 1.00 201.60 ? 210  GLU C CB    1 
ATOM   5177  C  CG    . GLU C 2 210  ? 124.403 184.132 116.869 1.00 201.60 ? 210  GLU C CG    1 
ATOM   5178  C  CD    . GLU C 2 210  ? 122.984 184.214 116.329 1.00 201.60 ? 210  GLU C CD    1 
ATOM   5179  O  OE1   . GLU C 2 210  ? 122.051 184.483 117.115 1.00 201.60 ? 210  GLU C OE1   1 
ATOM   5180  O  OE2   . GLU C 2 210  ? 122.803 184.004 115.112 1.00 201.60 ? 210  GLU C OE2   1 
ATOM   5181  N  N     . LEU C 2 211  ? 124.957 185.739 120.012 1.00 195.97 ? 211  LEU C N     1 
ATOM   5182  C  CA    . LEU C 2 211  ? 124.770 185.106 121.309 1.00 195.97 ? 211  LEU C CA    1 
ATOM   5183  C  C     . LEU C 2 211  ? 124.505 186.103 122.429 1.00 195.97 ? 211  LEU C C     1 
ATOM   5184  O  O     . LEU C 2 211  ? 124.464 185.704 123.596 1.00 195.97 ? 211  LEU C O     1 
ATOM   5185  C  CB    . LEU C 2 211  ? 125.998 184.254 121.642 1.00 195.97 ? 211  LEU C CB    1 
ATOM   5186  C  CG    . LEU C 2 211  ? 126.352 183.231 120.558 1.00 195.97 ? 211  LEU C CG    1 
ATOM   5187  C  CD1   . LEU C 2 211  ? 127.369 182.231 121.060 1.00 195.97 ? 211  LEU C CD1   1 
ATOM   5188  C  CD2   . LEU C 2 211  ? 125.105 182.505 120.075 1.00 195.97 ? 211  LEU C CD2   1 
ATOM   5189  N  N     . GLY C 2 212  ? 124.301 187.382 122.100 1.00 194.84 ? 212  GLY C N     1 
ATOM   5190  C  CA    . GLY C 2 212  ? 124.177 188.404 123.126 1.00 194.84 ? 212  GLY C CA    1 
ATOM   5191  C  C     . GLY C 2 212  ? 123.000 188.208 124.060 1.00 194.84 ? 212  GLY C C     1 
ATOM   5192  O  O     . GLY C 2 212  ? 122.984 188.758 125.164 1.00 194.84 ? 212  GLY C O     1 
ATOM   5193  N  N     . ALA C 2 213  ? 121.996 187.438 123.632 1.00 188.48 ? 213  ALA C N     1 
ATOM   5194  C  CA    . ALA C 2 213  ? 120.820 187.226 124.468 1.00 188.48 ? 213  ALA C CA    1 
ATOM   5195  C  C     . ALA C 2 213  ? 121.179 186.563 125.791 1.00 188.48 ? 213  ALA C C     1 
ATOM   5196  O  O     . ALA C 2 213  ? 120.492 186.774 126.797 1.00 188.48 ? 213  ALA C O     1 
ATOM   5197  C  CB    . ALA C 2 213  ? 119.787 186.388 123.715 1.00 188.48 ? 213  ALA C CB    1 
ATOM   5198  N  N     . TYR C 2 214  ? 122.245 185.769 125.815 1.00 186.34 ? 214  TYR C N     1 
ATOM   5199  C  CA    . TYR C 2 214  ? 122.689 185.077 127.018 1.00 186.34 ? 214  TYR C CA    1 
ATOM   5200  C  C     . TYR C 2 214  ? 124.079 185.594 127.376 1.00 186.34 ? 214  TYR C C     1 
ATOM   5201  O  O     . TYR C 2 214  ? 125.090 185.010 126.975 1.00 186.34 ? 214  TYR C O     1 
ATOM   5202  C  CB    . TYR C 2 214  ? 122.686 183.568 126.788 1.00 186.34 ? 214  TYR C CB    1 
ATOM   5203  C  CG    . TYR C 2 214  ? 121.327 183.044 126.395 1.00 186.34 ? 214  TYR C CG    1 
ATOM   5204  C  CD1   . TYR C 2 214  ? 120.333 182.867 127.335 1.00 186.34 ? 214  TYR C CD1   1 
ATOM   5205  C  CD2   . TYR C 2 214  ? 121.036 182.739 125.075 1.00 186.34 ? 214  TYR C CD2   1 
ATOM   5206  C  CE1   . TYR C 2 214  ? 119.085 182.393 126.977 1.00 186.34 ? 214  TYR C CE1   1 
ATOM   5207  C  CE2   . TYR C 2 214  ? 119.793 182.267 124.709 1.00 186.34 ? 214  TYR C CE2   1 
ATOM   5208  C  CZ    . TYR C 2 214  ? 118.820 182.096 125.663 1.00 186.34 ? 214  TYR C CZ    1 
ATOM   5209  O  OH    . TYR C 2 214  ? 117.582 181.623 125.296 1.00 186.34 ? 214  TYR C OH    1 
ATOM   5210  N  N     . GLY C 2 215  ? 124.122 186.686 128.136 1.00 193.62 ? 215  GLY C N     1 
ATOM   5211  C  CA    . GLY C 2 215  ? 125.355 187.405 128.396 1.00 193.62 ? 215  GLY C CA    1 
ATOM   5212  C  C     . GLY C 2 215  ? 126.434 186.644 129.139 1.00 193.62 ? 215  GLY C C     1 
ATOM   5213  O  O     . GLY C 2 215  ? 127.578 186.571 128.678 1.00 193.62 ? 215  GLY C O     1 
ATOM   5214  N  N     . GLU C 2 216  ? 126.080 186.072 130.290 1.00 196.21 ? 216  GLU C N     1 
ATOM   5215  C  CA    . GLU C 2 216  ? 127.033 185.479 131.223 1.00 196.21 ? 216  GLU C CA    1 
ATOM   5216  C  C     . GLU C 2 216  ? 127.934 184.417 130.601 1.00 196.21 ? 216  GLU C C     1 
ATOM   5217  O  O     . GLU C 2 216  ? 128.974 184.095 131.186 1.00 196.21 ? 216  GLU C O     1 
ATOM   5218  C  CB    . GLU C 2 216  ? 126.292 184.868 132.419 1.00 196.21 ? 216  GLU C CB    1 
ATOM   5219  C  CG    . GLU C 2 216  ? 125.172 185.735 132.979 1.00 196.21 ? 216  GLU C CG    1 
ATOM   5220  C  CD    . GLU C 2 216  ? 123.864 185.569 132.229 1.00 196.21 ? 216  GLU C CD    1 
ATOM   5221  O  OE1   . GLU C 2 216  ? 122.927 186.354 132.484 1.00 196.21 ? 216  GLU C OE1   1 
ATOM   5222  O  OE2   . GLU C 2 216  ? 123.775 184.655 131.383 1.00 196.21 ? 216  GLU C OE2   1 
ATOM   5223  N  N     . LEU C 2 217  ? 127.571 183.867 129.442 1.00 191.56 ? 217  LEU C N     1 
ATOM   5224  C  CA    . LEU C 2 217  ? 128.436 182.887 128.796 1.00 191.56 ? 217  LEU C CA    1 
ATOM   5225  C  C     . LEU C 2 217  ? 129.237 183.512 127.660 1.00 191.56 ? 217  LEU C C     1 
ATOM   5226  O  O     . LEU C 2 217  ? 130.332 183.039 127.335 1.00 191.56 ? 217  LEU C O     1 
ATOM   5227  C  CB    . LEU C 2 217  ? 127.608 181.705 128.291 1.00 191.56 ? 217  LEU C CB    1 
ATOM   5228  C  CG    . LEU C 2 217  ? 126.758 180.990 129.346 1.00 191.56 ? 217  LEU C CG    1 
ATOM   5229  C  CD1   . LEU C 2 217  ? 125.312 181.468 129.308 1.00 191.56 ? 217  LEU C CD1   1 
ATOM   5230  C  CD2   . LEU C 2 217  ? 126.836 179.481 129.166 1.00 191.56 ? 217  LEU C CD2   1 
ATOM   5231  N  N     . VAL C 2 218  ? 128.707 184.571 127.044 1.00 195.27 ? 218  VAL C N     1 
ATOM   5232  C  CA    . VAL C 2 218  ? 129.454 185.284 126.012 1.00 195.27 ? 218  VAL C CA    1 
ATOM   5233  C  C     . VAL C 2 218  ? 130.754 185.840 126.575 1.00 195.27 ? 218  VAL C C     1 
ATOM   5234  O  O     . VAL C 2 218  ? 131.771 185.898 125.871 1.00 195.27 ? 218  VAL C O     1 
ATOM   5235  C  CB    . VAL C 2 218  ? 128.583 186.394 125.395 1.00 195.27 ? 218  VAL C CB    1 
ATOM   5236  C  CG1   . VAL C 2 218  ? 129.353 187.148 124.323 1.00 195.27 ? 218  VAL C CG1   1 
ATOM   5237  C  CG2   . VAL C 2 218  ? 127.321 185.800 124.818 1.00 195.27 ? 218  VAL C CG2   1 
ATOM   5238  N  N     . GLN C 2 219  ? 130.753 186.250 127.845 1.00 199.05 ? 219  GLN C N     1 
ATOM   5239  C  CA    . GLN C 2 219  ? 131.979 186.760 128.447 1.00 199.05 ? 219  GLN C CA    1 
ATOM   5240  C  C     . GLN C 2 219  ? 133.026 185.665 128.593 1.00 199.05 ? 219  GLN C C     1 
ATOM   5241  O  O     . GLN C 2 219  ? 134.222 185.927 128.422 1.00 199.05 ? 219  GLN C O     1 
ATOM   5242  C  CB    . GLN C 2 219  ? 131.676 187.400 129.800 1.00 199.05 ? 219  GLN C CB    1 
ATOM   5243  C  CG    . GLN C 2 219  ? 130.799 188.634 129.699 1.00 199.05 ? 219  GLN C CG    1 
ATOM   5244  C  CD    . GLN C 2 219  ? 131.430 189.723 128.852 1.00 199.05 ? 219  GLN C CD    1 
ATOM   5245  O  OE1   . GLN C 2 219  ? 130.971 190.007 127.746 1.00 199.05 ? 219  GLN C OE1   1 
ATOM   5246  N  NE2   . GLN C 2 219  ? 132.490 190.334 129.367 1.00 199.05 ? 219  GLN C NE2   1 
ATOM   5247  N  N     . GLY C 2 220  ? 132.605 184.439 128.907 1.00 196.60 ? 220  GLY C N     1 
ATOM   5248  C  CA    . GLY C 2 220  ? 133.510 183.309 128.809 1.00 196.60 ? 220  GLY C CA    1 
ATOM   5249  C  C     . GLY C 2 220  ? 133.875 182.958 127.383 1.00 196.60 ? 220  GLY C C     1 
ATOM   5250  O  O     . GLY C 2 220  ? 134.883 182.281 127.158 1.00 196.60 ? 220  GLY C O     1 
ATOM   5251  N  N     . LEU C 2 221  ? 133.071 183.405 126.417 1.00 202.67 ? 221  LEU C N     1 
ATOM   5252  C  CA    . LEU C 2 221  ? 133.367 183.197 125.006 1.00 202.67 ? 221  LEU C CA    1 
ATOM   5253  C  C     . LEU C 2 221  ? 134.311 184.254 124.443 1.00 202.67 ? 221  LEU C C     1 
ATOM   5254  O  O     . LEU C 2 221  ? 135.003 183.986 123.457 1.00 202.67 ? 221  LEU C O     1 
ATOM   5255  C  CB    . LEU C 2 221  ? 132.065 183.185 124.200 1.00 202.67 ? 221  LEU C CB    1 
ATOM   5256  C  CG    . LEU C 2 221  ? 132.125 183.023 122.678 1.00 202.67 ? 221  LEU C CG    1 
ATOM   5257  C  CD1   . LEU C 2 221  ? 132.811 181.722 122.289 1.00 202.67 ? 221  LEU C CD1   1 
ATOM   5258  C  CD2   . LEU C 2 221  ? 130.734 183.109 122.073 1.00 202.67 ? 221  LEU C CD2   1 
ATOM   5259  N  N     . MET C 2 222  ? 134.356 185.444 125.031 1.00 206.97 ? 222  MET C N     1 
ATOM   5260  C  CA    . MET C 2 222  ? 135.189 186.516 124.498 1.00 206.97 ? 222  MET C CA    1 
ATOM   5261  C  C     . MET C 2 222  ? 136.649 186.283 124.874 1.00 206.97 ? 222  MET C C     1 
ATOM   5262  O  O     . MET C 2 222  ? 136.971 186.084 126.050 1.00 206.97 ? 222  MET C O     1 
ATOM   5263  C  CB    . MET C 2 222  ? 134.707 187.870 125.009 1.00 206.97 ? 222  MET C CB    1 
ATOM   5264  C  CG    . MET C 2 222  ? 133.410 188.326 124.368 1.00 206.97 ? 222  MET C CG    1 
ATOM   5265  S  SD    . MET C 2 222  ? 133.498 188.270 122.570 1.00 206.97 ? 222  MET C SD    1 
ATOM   5266  C  CE    . MET C 2 222  ? 131.896 188.935 122.130 1.00 206.97 ? 222  MET C CE    1 
ATOM   5267  N  N     . ASP C 2 223  ? 137.528 186.306 123.872 1.00 214.38 ? 223  ASP C N     1 
ATOM   5268  C  CA    . ASP C 2 223  ? 138.969 186.182 124.071 1.00 214.38 ? 223  ASP C CA    1 
ATOM   5269  C  C     . ASP C 2 223  ? 139.671 187.011 123.007 1.00 214.38 ? 223  ASP C C     1 
ATOM   5270  O  O     . ASP C 2 223  ? 139.551 186.721 121.813 1.00 214.38 ? 223  ASP C O     1 
ATOM   5271  C  CB    . ASP C 2 223  ? 139.418 184.719 124.000 1.00 214.38 ? 223  ASP C CB    1 
ATOM   5272  C  CG    . ASP C 2 223  ? 140.901 184.554 124.257 1.00 214.38 ? 223  ASP C CG    1 
ATOM   5273  O  OD1   . ASP C 2 223  ? 141.662 184.401 123.279 1.00 214.38 ? 223  ASP C OD1   1 
ATOM   5274  O  OD2   . ASP C 2 223  ? 141.308 184.580 125.437 1.00 214.38 ? 223  ASP C OD2   1 
ATOM   5275  N  N     . GLU C 2 224  ? 140.416 188.029 123.442 1.00 215.46 ? 224  GLU C N     1 
ATOM   5276  C  CA    . GLU C 2 224  ? 140.963 189.005 122.503 1.00 215.46 ? 224  GLU C CA    1 
ATOM   5277  C  C     . GLU C 2 224  ? 142.216 188.477 121.814 1.00 215.46 ? 224  GLU C C     1 
ATOM   5278  O  O     . GLU C 2 224  ? 142.541 188.888 120.693 1.00 215.46 ? 224  GLU C O     1 
ATOM   5279  C  CB    . GLU C 2 224  ? 141.259 190.316 123.231 1.00 215.46 ? 224  GLU C CB    1 
ATOM   5280  C  CG    . GLU C 2 224  ? 140.107 190.833 124.080 1.00 215.46 ? 224  GLU C CG    1 
ATOM   5281  C  CD    . GLU C 2 224  ? 138.757 190.631 123.419 1.00 215.46 ? 224  GLU C CD    1 
ATOM   5282  O  OE1   . GLU C 2 224  ? 138.512 191.255 122.366 1.00 215.46 ? 224  GLU C OE1   1 
ATOM   5283  O  OE2   . GLU C 2 224  ? 137.943 189.847 123.951 1.00 215.46 ? 224  GLU C OE2   1 
ATOM   5284  N  N     . SER C 2 225  ? 142.940 187.571 122.477 1.00 214.61 ? 225  SER C N     1 
ATOM   5285  C  CA    . SER C 2 225  ? 144.183 187.057 121.910 1.00 214.61 ? 225  SER C CA    1 
ATOM   5286  C  C     . SER C 2 225  ? 143.941 186.361 120.577 1.00 214.61 ? 225  SER C C     1 
ATOM   5287  O  O     . SER C 2 225  ? 144.728 186.515 119.636 1.00 214.61 ? 225  SER C O     1 
ATOM   5288  C  CB    . SER C 2 225  ? 144.856 186.105 122.898 1.00 214.61 ? 225  SER C CB    1 
ATOM   5289  O  OG    . SER C 2 225  ? 144.078 184.938 123.090 1.00 214.61 ? 225  SER C OG    1 
ATOM   5290  N  N     . VAL C 2 226  ? 142.858 185.590 120.474 1.00 212.97 ? 226  VAL C N     1 
ATOM   5291  C  CA    . VAL C 2 226  ? 142.559 184.909 119.219 1.00 212.97 ? 226  VAL C CA    1 
ATOM   5292  C  C     . VAL C 2 226  ? 141.886 185.862 118.237 1.00 212.97 ? 226  VAL C C     1 
ATOM   5293  O  O     . VAL C 2 226  ? 142.029 185.717 117.017 1.00 212.97 ? 226  VAL C O     1 
ATOM   5294  C  CB    . VAL C 2 226  ? 141.711 183.650 119.478 1.00 212.97 ? 226  VAL C CB    1 
ATOM   5295  C  CG1   . VAL C 2 226  ? 142.364 182.787 120.544 1.00 212.97 ? 226  VAL C CG1   1 
ATOM   5296  C  CG2   . VAL C 2 226  ? 140.294 184.022 119.890 1.00 212.97 ? 226  VAL C CG2   1 
ATOM   5297  N  N     . PHE C 2 227  ? 141.143 186.849 118.746 1.00 211.62 ? 227  PHE C N     1 
ATOM   5298  C  CA    . PHE C 2 227  ? 140.512 187.821 117.860 1.00 211.62 ? 227  PHE C CA    1 
ATOM   5299  C  C     . PHE C 2 227  ? 141.541 188.726 117.198 1.00 211.62 ? 227  PHE C C     1 
ATOM   5300  O  O     . PHE C 2 227  ? 141.255 189.333 116.160 1.00 211.62 ? 227  PHE C O     1 
ATOM   5301  C  CB    . PHE C 2 227  ? 139.490 188.658 118.629 1.00 211.62 ? 227  PHE C CB    1 
ATOM   5302  C  CG    . PHE C 2 227  ? 138.180 187.961 118.846 1.00 211.62 ? 227  PHE C CG    1 
ATOM   5303  C  CD1   . PHE C 2 227  ? 137.631 187.168 117.853 1.00 211.62 ? 227  PHE C CD1   1 
ATOM   5304  C  CD2   . PHE C 2 227  ? 137.493 188.103 120.040 1.00 211.62 ? 227  PHE C CD2   1 
ATOM   5305  C  CE1   . PHE C 2 227  ? 136.425 186.524 118.050 1.00 211.62 ? 227  PHE C CE1   1 
ATOM   5306  C  CE2   . PHE C 2 227  ? 136.288 187.461 120.243 1.00 211.62 ? 227  PHE C CE2   1 
ATOM   5307  C  CZ    . PHE C 2 227  ? 135.753 186.671 119.246 1.00 211.62 ? 227  PHE C CZ    1 
ATOM   5308  N  N     . ALA C 2 228  ? 142.736 188.833 117.783 1.00 213.17 ? 228  ALA C N     1 
ATOM   5309  C  CA    . ALA C 2 228  ? 143.772 189.675 117.195 1.00 213.17 ? 228  ALA C CA    1 
ATOM   5310  C  C     . ALA C 2 228  ? 144.313 189.071 115.904 1.00 213.17 ? 228  ALA C C     1 
ATOM   5311  O  O     . ALA C 2 228  ? 144.439 189.768 114.890 1.00 213.17 ? 228  ALA C O     1 
ATOM   5312  C  CB    . ALA C 2 228  ? 144.902 189.895 118.199 1.00 213.17 ? 228  ALA C CB    1 
ATOM   5313  N  N     . MET C 2 229  ? 144.637 187.782 115.920 1.00 211.32 ? 229  MET C N     1 
ATOM   5314  C  CA    . MET C 2 229  ? 145.265 187.130 114.780 1.00 211.32 ? 229  MET C CA    1 
ATOM   5315  C  C     . MET C 2 229  ? 144.237 186.786 113.711 1.00 211.32 ? 229  MET C C     1 
ATOM   5316  O  O     . MET C 2 229  ? 143.065 186.537 114.010 1.00 211.32 ? 229  MET C O     1 
ATOM   5317  C  CB    . MET C 2 229  ? 146.003 185.864 115.217 1.00 211.32 ? 229  MET C CB    1 
ATOM   5318  C  CG    . MET C 2 229  ? 145.161 184.887 116.019 1.00 211.32 ? 229  MET C CG    1 
ATOM   5319  S  SD    . MET C 2 229  ? 146.070 183.376 116.395 1.00 211.32 ? 229  MET C SD    1 
ATOM   5320  C  CE    . MET C 2 229  ? 145.086 182.704 117.731 1.00 211.32 ? 229  MET C CE    1 
ATOM   5321  N  N     . ARG C 2 230  ? 144.689 186.781 112.459 1.00 209.54 ? 230  ARG C N     1 
ATOM   5322  C  CA    . ARG C 2 230  ? 143.842 186.409 111.341 1.00 209.54 ? 230  ARG C CA    1 
ATOM   5323  C  C     . ARG C 2 230  ? 143.568 184.905 111.362 1.00 209.54 ? 230  ARG C C     1 
ATOM   5324  O  O     . ARG C 2 230  ? 144.274 184.147 112.030 1.00 209.54 ? 230  ARG C O     1 
ATOM   5325  C  CB    . ARG C 2 230  ? 144.507 186.815 110.027 1.00 209.54 ? 230  ARG C CB    1 
ATOM   5326  C  CG    . ARG C 2 230  ? 145.791 186.067 109.728 1.00 209.54 ? 230  ARG C CG    1 
ATOM   5327  C  CD    . ARG C 2 230  ? 146.461 186.612 108.479 1.00 209.54 ? 230  ARG C CD    1 
ATOM   5328  N  NE    . ARG C 2 230  ? 147.670 185.868 108.142 1.00 209.54 ? 230  ARG C NE    1 
ATOM   5329  C  CZ    . ARG C 2 230  ? 148.862 186.100 108.681 1.00 209.54 ? 230  ARG C CZ    1 
ATOM   5330  N  NH1   . ARG C 2 230  ? 149.910 185.375 108.317 1.00 209.54 ? 230  ARG C NH1   1 
ATOM   5331  N  NH2   . ARG C 2 230  ? 149.006 187.059 109.586 1.00 209.54 ? 230  ARG C NH2   1 
ATOM   5332  N  N     . PRO C 2 231  ? 142.527 184.448 110.641 1.00 206.09 ? 231  PRO C N     1 
ATOM   5333  C  CA    . PRO C 2 231  ? 142.199 183.014 110.639 1.00 206.09 ? 231  PRO C CA    1 
ATOM   5334  C  C     . PRO C 2 231  ? 143.348 182.106 110.223 1.00 206.09 ? 231  PRO C C     1 
ATOM   5335  O  O     . PRO C 2 231  ? 143.353 180.924 110.572 1.00 206.09 ? 231  PRO C O     1 
ATOM   5336  C  CB    . PRO C 2 231  ? 141.040 182.927 109.639 1.00 206.09 ? 231  PRO C CB    1 
ATOM   5337  C  CG    . PRO C 2 231  ? 140.389 184.256 109.718 1.00 206.09 ? 231  PRO C CG    1 
ATOM   5338  C  CD    . PRO C 2 231  ? 141.496 185.245 109.949 1.00 206.09 ? 231  PRO C CD    1 
ATOM   5339  N  N     . GLU C 2 232  ? 144.327 182.636 109.489 1.00 207.38 ? 232  GLU C N     1 
ATOM   5340  C  CA    . GLU C 2 232  ? 145.457 181.813 109.065 1.00 207.38 ? 232  GLU C CA    1 
ATOM   5341  C  C     . GLU C 2 232  ? 146.363 181.471 110.243 1.00 207.38 ? 232  GLU C C     1 
ATOM   5342  O  O     . GLU C 2 232  ? 146.718 180.303 110.452 1.00 207.38 ? 232  GLU C O     1 
ATOM   5343  C  CB    . GLU C 2 232  ? 146.241 182.530 107.964 1.00 207.38 ? 232  GLU C CB    1 
ATOM   5344  C  CG    . GLU C 2 232  ? 145.527 182.592 106.616 1.00 207.38 ? 232  GLU C CG    1 
ATOM   5345  C  CD    . GLU C 2 232  ? 144.415 183.628 106.567 1.00 207.38 ? 232  GLU C CD    1 
ATOM   5346  O  OE1   . GLU C 2 232  ? 144.121 184.251 107.609 1.00 207.38 ? 232  GLU C OE1   1 
ATOM   5347  O  OE2   . GLU C 2 232  ? 143.832 183.818 105.479 1.00 207.38 ? 232  GLU C OE2   1 
ATOM   5348  N  N     . GLU C 2 233  ? 146.751 182.480 111.026 1.00 209.57 ? 233  GLU C N     1 
ATOM   5349  C  CA    . GLU C 2 233  ? 147.557 182.220 112.214 1.00 209.57 ? 233  GLU C CA    1 
ATOM   5350  C  C     . GLU C 2 233  ? 146.777 181.399 113.232 1.00 209.57 ? 233  GLU C C     1 
ATOM   5351  O  O     . GLU C 2 233  ? 147.347 180.548 113.926 1.00 209.57 ? 233  GLU C O     1 
ATOM   5352  C  CB    . GLU C 2 233  ? 148.025 183.538 112.829 1.00 209.57 ? 233  GLU C CB    1 
ATOM   5353  C  CG    . GLU C 2 233  ? 148.995 184.315 111.956 1.00 209.57 ? 233  GLU C CG    1 
ATOM   5354  C  CD    . GLU C 2 233  ? 149.417 185.629 112.582 1.00 209.57 ? 233  GLU C CD    1 
ATOM   5355  O  OE1   . GLU C 2 233  ? 148.861 185.990 113.641 1.00 209.57 ? 233  GLU C OE1   1 
ATOM   5356  O  OE2   . GLU C 2 233  ? 150.303 186.301 112.015 1.00 209.57 ? 233  GLU C OE2   1 
ATOM   5357  N  N     . ALA C 2 234  ? 145.469 181.645 113.336 1.00 205.24 ? 234  ALA C N     1 
ATOM   5358  C  CA    . ALA C 2 234  ? 144.629 180.829 114.202 1.00 205.24 ? 234  ALA C CA    1 
ATOM   5359  C  C     . ALA C 2 234  ? 144.623 179.372 113.761 1.00 205.24 ? 234  ALA C C     1 
ATOM   5360  O  O     . ALA C 2 234  ? 144.694 178.471 114.603 1.00 205.24 ? 234  ALA C O     1 
ATOM   5361  C  CB    . ALA C 2 234  ? 143.206 181.386 114.227 1.00 205.24 ? 234  ALA C CB    1 
ATOM   5362  N  N     . LEU C 2 235  ? 144.555 179.123 112.452 1.00 202.22 ? 235  LEU C N     1 
ATOM   5363  C  CA    . LEU C 2 235  ? 144.615 177.758 111.941 1.00 202.22 ? 235  LEU C CA    1 
ATOM   5364  C  C     . LEU C 2 235  ? 145.967 177.120 112.232 1.00 202.22 ? 235  LEU C C     1 
ATOM   5365  O  O     . LEU C 2 235  ? 146.039 175.935 112.579 1.00 202.22 ? 235  LEU C O     1 
ATOM   5366  C  CB    . LEU C 2 235  ? 144.326 177.758 110.440 1.00 202.22 ? 235  LEU C CB    1 
ATOM   5367  C  CG    . LEU C 2 235  ? 144.721 176.535 109.610 1.00 202.22 ? 235  LEU C CG    1 
ATOM   5368  C  CD1   . LEU C 2 235  ? 144.090 175.269 110.162 1.00 202.22 ? 235  LEU C CD1   1 
ATOM   5369  C  CD2   . LEU C 2 235  ? 144.321 176.743 108.161 1.00 202.22 ? 235  LEU C CD2   1 
ATOM   5370  N  N     . ILE C 2 236  ? 147.049 177.884 112.079 1.00 203.52 ? 236  ILE C N     1 
ATOM   5371  C  CA    . ILE C 2 236  ? 148.376 177.353 112.386 1.00 203.52 ? 236  ILE C CA    1 
ATOM   5372  C  C     . ILE C 2 236  ? 148.461 176.951 113.854 1.00 203.52 ? 236  ILE C C     1 
ATOM   5373  O  O     . ILE C 2 236  ? 148.924 175.852 114.190 1.00 203.52 ? 236  ILE C O     1 
ATOM   5374  C  CB    . ILE C 2 236  ? 149.462 178.377 112.012 1.00 203.52 ? 236  ILE C CB    1 
ATOM   5375  C  CG1   . ILE C 2 236  ? 149.460 178.628 110.503 1.00 203.52 ? 236  ILE C CG1   1 
ATOM   5376  C  CG2   . ILE C 2 236  ? 150.830 177.898 112.471 1.00 203.52 ? 236  ILE C CG2   1 
ATOM   5377  C  CD1   . ILE C 2 236  ? 150.255 179.844 110.083 1.00 203.52 ? 236  ILE C CD1   1 
ATOM   5378  N  N     . ARG C 2 237  ? 148.015 177.835 114.749 1.00 202.22 ? 237  ARG C N     1 
ATOM   5379  C  CA    . ARG C 2 237  ? 148.020 177.527 116.176 1.00 202.22 ? 237  ARG C CA    1 
ATOM   5380  C  C     . ARG C 2 237  ? 147.147 176.314 116.477 1.00 202.22 ? 237  ARG C C     1 
ATOM   5381  O  O     . ARG C 2 237  ? 147.505 175.460 117.298 1.00 202.22 ? 237  ARG C O     1 
ATOM   5382  C  CB    . ARG C 2 237  ? 147.553 178.748 116.969 1.00 202.22 ? 237  ARG C CB    1 
ATOM   5383  C  CG    . ARG C 2 237  ? 146.975 178.431 118.336 1.00 202.22 ? 237  ARG C CG    1 
ATOM   5384  C  CD    . ARG C 2 237  ? 148.072 178.191 119.357 1.00 202.22 ? 237  ARG C CD    1 
ATOM   5385  N  NE    . ARG C 2 237  ? 147.612 178.451 120.718 1.00 202.22 ? 237  ARG C NE    1 
ATOM   5386  C  CZ    . ARG C 2 237  ? 148.401 178.449 121.787 1.00 202.22 ? 237  ARG C CZ    1 
ATOM   5387  N  NH1   . ARG C 2 237  ? 147.895 178.697 122.987 1.00 202.22 ? 237  ARG C NH1   1 
ATOM   5388  N  NH2   . ARG C 2 237  ? 149.697 178.199 121.656 1.00 202.22 ? 237  ARG C NH2   1 
ATOM   5389  N  N     . LEU C 2 238  ? 145.995 176.217 115.810 1.00 199.52 ? 238  LEU C N     1 
ATOM   5390  C  CA    . LEU C 2 238  ? 145.116 175.070 116.006 1.00 199.52 ? 238  LEU C CA    1 
ATOM   5391  C  C     . LEU C 2 238  ? 145.803 173.774 115.600 1.00 199.52 ? 238  LEU C C     1 
ATOM   5392  O  O     . LEU C 2 238  ? 145.727 172.772 116.319 1.00 199.52 ? 238  LEU C O     1 
ATOM   5393  C  CB    . LEU C 2 238  ? 143.822 175.264 115.217 1.00 199.52 ? 238  LEU C CB    1 
ATOM   5394  C  CG    . LEU C 2 238  ? 142.870 174.070 115.143 1.00 199.52 ? 238  LEU C CG    1 
ATOM   5395  C  CD1   . LEU C 2 238  ? 142.468 173.620 116.536 1.00 199.52 ? 238  LEU C CD1   1 
ATOM   5396  C  CD2   . LEU C 2 238  ? 141.645 174.421 114.318 1.00 199.52 ? 238  LEU C CD2   1 
ATOM   5397  N  N     . PHE C 2 239  ? 146.482 173.775 114.451 1.00 200.01 ? 239  PHE C N     1 
ATOM   5398  C  CA    . PHE C 2 239  ? 147.174 172.569 114.009 1.00 200.01 ? 239  PHE C CA    1 
ATOM   5399  C  C     . PHE C 2 239  ? 148.305 172.206 114.961 1.00 200.01 ? 239  PHE C C     1 
ATOM   5400  O  O     . PHE C 2 239  ? 148.570 171.022 115.197 1.00 200.01 ? 239  PHE C O     1 
ATOM   5401  C  CB    . PHE C 2 239  ? 147.709 172.747 112.591 1.00 200.01 ? 239  PHE C CB    1 
ATOM   5402  C  CG    . PHE C 2 239  ? 148.561 171.603 112.123 1.00 200.01 ? 239  PHE C CG    1 
ATOM   5403  C  CD1   . PHE C 2 239  ? 149.940 171.719 112.078 1.00 200.01 ? 239  PHE C CD1   1 
ATOM   5404  C  CD2   . PHE C 2 239  ? 147.982 170.404 111.743 1.00 200.01 ? 239  PHE C CD2   1 
ATOM   5405  C  CE1   . PHE C 2 239  ? 150.725 170.664 111.654 1.00 200.01 ? 239  PHE C CE1   1 
ATOM   5406  C  CE2   . PHE C 2 239  ? 148.762 169.346 111.318 1.00 200.01 ? 239  PHE C CE2   1 
ATOM   5407  C  CZ    . PHE C 2 239  ? 150.135 169.476 111.274 1.00 200.01 ? 239  PHE C CZ    1 
ATOM   5408  N  N     . THR C 2 240  ? 148.992 173.212 115.508 1.00 200.50 ? 240  THR C N     1 
ATOM   5409  C  CA    . THR C 2 240  ? 149.974 172.927 116.550 1.00 200.50 ? 240  THR C CA    1 
ATOM   5410  C  C     . THR C 2 240  ? 149.320 172.300 117.773 1.00 200.50 ? 240  THR C C     1 
ATOM   5411  O  O     . THR C 2 240  ? 149.918 171.434 118.422 1.00 200.50 ? 240  THR C O     1 
ATOM   5412  C  CB    . THR C 2 240  ? 150.722 174.198 116.954 1.00 200.50 ? 240  THR C CB    1 
ATOM   5413  O  OG1   . THR C 2 240  ? 149.802 175.137 117.523 1.00 200.50 ? 240  THR C OG1   1 
ATOM   5414  C  CG2   . THR C 2 240  ? 151.417 174.819 115.755 1.00 200.50 ? 240  THR C CG2   1 
ATOM   5415  N  N     . LEU C 2 241  ? 148.098 172.723 118.102 1.00 197.60 ? 241  LEU C N     1 
ATOM   5416  C  CA    . LEU C 2 241  ? 147.414 172.171 119.267 1.00 197.60 ? 241  LEU C CA    1 
ATOM   5417  C  C     . LEU C 2 241  ? 146.946 170.741 119.020 1.00 197.60 ? 241  LEU C C     1 
ATOM   5418  O  O     . LEU C 2 241  ? 146.923 169.923 119.946 1.00 197.60 ? 241  LEU C O     1 
ATOM   5419  C  CB    . LEU C 2 241  ? 146.234 173.062 119.653 1.00 197.60 ? 241  LEU C CB    1 
ATOM   5420  C  CG    . LEU C 2 241  ? 146.594 174.418 120.260 1.00 197.60 ? 241  LEU C CG    1 
ATOM   5421  C  CD1   . LEU C 2 241  ? 145.341 175.213 120.582 1.00 197.60 ? 241  LEU C CD1   1 
ATOM   5422  C  CD2   . LEU C 2 241  ? 147.450 174.234 121.503 1.00 197.60 ? 241  LEU C CD2   1 
ATOM   5423  N  N     . LEU C 2 242  ? 146.568 170.418 117.780 1.00 199.12 ? 242  LEU C N     1 
ATOM   5424  C  CA    . LEU C 2 242  ? 146.083 169.072 117.488 1.00 199.12 ? 242  LEU C CA    1 
ATOM   5425  C  C     . LEU C 2 242  ? 147.212 168.097 117.188 1.00 199.12 ? 242  LEU C C     1 
ATOM   5426  O  O     . LEU C 2 242  ? 147.183 166.959 117.669 1.00 199.12 ? 242  LEU C O     1 
ATOM   5427  C  CB    . LEU C 2 242  ? 145.099 169.091 116.316 1.00 199.12 ? 242  LEU C CB    1 
ATOM   5428  C  CG    . LEU C 2 242  ? 144.030 170.180 116.289 1.00 199.12 ? 242  LEU C CG    1 
ATOM   5429  C  CD1   . LEU C 2 242  ? 143.116 169.996 115.089 1.00 199.12 ? 242  LEU C CD1   1 
ATOM   5430  C  CD2   . LEU C 2 242  ? 143.232 170.168 117.582 1.00 199.12 ? 242  LEU C CD2   1 
ATOM   5431  N  N     . ARG C 2 243  ? 148.202 168.508 116.399 1.00 203.02 ? 243  ARG C N     1 
ATOM   5432  C  CA    . ARG C 2 243  ? 149.324 167.649 116.023 1.00 203.02 ? 243  ARG C CA    1 
ATOM   5433  C  C     . ARG C 2 243  ? 150.625 168.280 116.503 1.00 203.02 ? 243  ARG C C     1 
ATOM   5434  O  O     . ARG C 2 243  ? 151.333 168.941 115.735 1.00 203.02 ? 243  ARG C O     1 
ATOM   5435  C  CB    . ARG C 2 243  ? 149.354 167.413 114.513 1.00 203.02 ? 243  ARG C CB    1 
ATOM   5436  C  CG    . ARG C 2 243  ? 148.318 166.419 114.019 1.00 203.02 ? 243  ARG C CG    1 
ATOM   5437  C  CD    . ARG C 2 243  ? 148.656 165.918 112.625 1.00 203.02 ? 243  ARG C CD    1 
ATOM   5438  N  NE    . ARG C 2 243  ? 149.713 164.911 112.645 1.00 203.02 ? 243  ARG C NE    1 
ATOM   5439  C  CZ    . ARG C 2 243  ? 149.498 163.607 112.778 1.00 203.02 ? 243  ARG C CZ    1 
ATOM   5440  N  NH1   . ARG C 2 243  ? 148.261 163.147 112.902 1.00 203.02 ? 243  ARG C NH1   1 
ATOM   5441  N  NH2   . ARG C 2 243  ? 150.519 162.761 112.786 1.00 203.02 ? 243  ARG C NH2   1 
ATOM   5442  N  N     . PRO C 2 244  ? 150.965 168.101 117.779 1.00 204.10 ? 244  PRO C N     1 
ATOM   5443  C  CA    . PRO C 2 244  ? 152.255 168.599 118.268 1.00 204.10 ? 244  PRO C CA    1 
ATOM   5444  C  C     . PRO C 2 244  ? 153.408 167.836 117.633 1.00 204.10 ? 244  PRO C C     1 
ATOM   5445  O  O     . PRO C 2 244  ? 153.298 166.646 117.330 1.00 204.10 ? 244  PRO C O     1 
ATOM   5446  C  CB    . PRO C 2 244  ? 152.181 168.356 119.781 1.00 204.10 ? 244  PRO C CB    1 
ATOM   5447  C  CG    . PRO C 2 244  ? 150.721 168.181 120.077 1.00 204.10 ? 244  PRO C CG    1 
ATOM   5448  C  CD    . PRO C 2 244  ? 150.157 167.519 118.862 1.00 204.10 ? 244  PRO C CD    1 
ATOM   5449  N  N     . GLY C 2 245  ? 154.522 168.537 117.432 1.00 210.98 ? 245  GLY C N     1 
ATOM   5450  C  CA    . GLY C 2 245  ? 155.699 167.959 116.827 1.00 210.98 ? 245  GLY C CA    1 
ATOM   5451  C  C     . GLY C 2 245  ? 155.753 168.051 115.317 1.00 210.98 ? 245  GLY C C     1 
ATOM   5452  O  O     . GLY C 2 245  ? 156.831 167.874 114.738 1.00 210.98 ? 245  GLY C O     1 
ATOM   5453  N  N     . ASP C 2 246  ? 154.627 168.322 114.662 1.00 213.71 ? 246  ASP C N     1 
ATOM   5454  C  CA    . ASP C 2 246  ? 154.602 168.457 113.213 1.00 213.71 ? 246  ASP C CA    1 
ATOM   5455  C  C     . ASP C 2 246  ? 154.951 169.889 112.831 1.00 213.71 ? 246  ASP C C     1 
ATOM   5456  O  O     . ASP C 2 246  ? 154.482 170.824 113.493 1.00 213.71 ? 246  ASP C O     1 
ATOM   5457  C  CB    . ASP C 2 246  ? 153.235 168.089 112.661 1.00 213.71 ? 246  ASP C CB    1 
ATOM   5458  C  CG    . ASP C 2 246  ? 153.091 166.602 112.405 1.00 213.71 ? 246  ASP C CG    1 
ATOM   5459  O  OD1   . ASP C 2 246  ? 151.952 166.143 112.176 1.00 213.71 ? 246  ASP C OD1   1 
ATOM   5460  O  OD2   . ASP C 2 246  ? 154.117 165.890 112.433 1.00 213.71 ? 246  ASP C OD2   1 
ATOM   5461  N  N     . PRO C 2 247  ? 155.766 170.107 111.802 1.00 210.01 ? 247  PRO C N     1 
ATOM   5462  C  CA    . PRO C 2 247  ? 156.101 171.475 111.390 1.00 210.01 ? 247  PRO C CA    1 
ATOM   5463  C  C     . PRO C 2 247  ? 154.857 172.232 110.961 1.00 210.01 ? 247  PRO C C     1 
ATOM   5464  O  O     . PRO C 2 247  ? 154.131 171.793 110.056 1.00 210.01 ? 247  PRO C O     1 
ATOM   5465  C  CB    . PRO C 2 247  ? 157.063 171.267 110.210 1.00 210.01 ? 247  PRO C CB    1 
ATOM   5466  C  CG    . PRO C 2 247  ? 156.816 169.865 109.749 1.00 210.01 ? 247  PRO C CG    1 
ATOM   5467  C  CD    . PRO C 2 247  ? 156.444 169.096 110.976 1.00 210.01 ? 247  PRO C CD    1 
ATOM   5468  N  N     . PRO C 2 248  ? 154.577 173.375 111.586 1.00 207.17 ? 248  PRO C N     1 
ATOM   5469  C  CA    . PRO C 2 248  ? 153.329 174.115 111.316 1.00 207.17 ? 248  PRO C CA    1 
ATOM   5470  C  C     . PRO C 2 248  ? 153.349 174.850 109.979 1.00 207.17 ? 248  PRO C C     1 
ATOM   5471  O  O     . PRO C 2 248  ? 153.069 176.050 109.892 1.00 207.17 ? 248  PRO C O     1 
ATOM   5472  C  CB    . PRO C 2 248  ? 153.250 175.077 112.513 1.00 207.17 ? 248  PRO C CB    1 
ATOM   5473  C  CG    . PRO C 2 248  ? 154.281 174.600 113.504 1.00 207.17 ? 248  PRO C CG    1 
ATOM   5474  C  CD    . PRO C 2 248  ? 155.346 173.981 112.682 1.00 207.17 ? 248  PRO C CD    1 
ATOM   5475  N  N     . LYS C 2 249  ? 153.685 174.126 108.915 1.00 205.25 ? 249  LYS C N     1 
ATOM   5476  C  CA    . LYS C 2 249  ? 153.571 174.690 107.578 1.00 205.25 ? 249  LYS C CA    1 
ATOM   5477  C  C     . LYS C 2 249  ? 152.102 174.831 107.195 1.00 205.25 ? 249  LYS C C     1 
ATOM   5478  O  O     . LYS C 2 249  ? 151.264 174.005 107.567 1.00 205.25 ? 249  LYS C O     1 
ATOM   5479  C  CB    . LYS C 2 249  ? 154.324 173.825 106.565 1.00 205.25 ? 249  LYS C CB    1 
ATOM   5480  C  CG    . LYS C 2 249  ? 153.839 172.393 106.461 1.00 205.25 ? 249  LYS C CG    1 
ATOM   5481  C  CD    . LYS C 2 249  ? 154.991 171.460 106.115 1.00 205.25 ? 249  LYS C CD    1 
ATOM   5482  C  CE    . LYS C 2 249  ? 154.530 170.018 105.992 1.00 205.25 ? 249  LYS C CE    1 
ATOM   5483  N  NZ    . LYS C 2 249  ? 154.118 169.449 107.304 1.00 205.25 ? 249  LYS C NZ    1 
ATOM   5484  N  N     . ARG C 2 250  ? 151.795 175.898 106.453 1.00 201.98 ? 250  ARG C N     1 
ATOM   5485  C  CA    . ARG C 2 250  ? 150.403 176.278 106.224 1.00 201.98 ? 250  ARG C CA    1 
ATOM   5486  C  C     . ARG C 2 250  ? 149.634 175.194 105.477 1.00 201.98 ? 250  ARG C C     1 
ATOM   5487  O  O     . ARG C 2 250  ? 148.483 174.893 105.820 1.00 201.98 ? 250  ARG C O     1 
ATOM   5488  C  CB    . ARG C 2 250  ? 150.347 177.601 105.461 1.00 201.98 ? 250  ARG C CB    1 
ATOM   5489  C  CG    . ARG C 2 250  ? 149.009 178.315 105.542 1.00 201.98 ? 250  ARG C CG    1 
ATOM   5490  C  CD    . ARG C 2 250  ? 148.216 178.159 104.258 1.00 201.98 ? 250  ARG C CD    1 
ATOM   5491  N  NE    . ARG C 2 250  ? 147.053 179.041 104.231 1.00 201.98 ? 250  ARG C NE    1 
ATOM   5492  C  CZ    . ARG C 2 250  ? 146.293 179.243 103.160 1.00 201.98 ? 250  ARG C CZ    1 
ATOM   5493  N  NH1   . ARG C 2 250  ? 146.570 178.626 102.020 1.00 201.98 ? 250  ARG C NH1   1 
ATOM   5494  N  NH2   . ARG C 2 250  ? 145.254 180.064 103.229 1.00 201.98 ? 250  ARG C NH2   1 
ATOM   5495  N  N     . ASP C 2 251  ? 150.249 174.597 104.453 1.00 204.95 ? 251  ASP C N     1 
ATOM   5496  C  CA    . ASP C 2 251  ? 149.544 173.605 103.646 1.00 204.95 ? 251  ASP C CA    1 
ATOM   5497  C  C     . ASP C 2 251  ? 149.156 172.386 104.475 1.00 204.95 ? 251  ASP C C     1 
ATOM   5498  O  O     . ASP C 2 251  ? 148.049 171.854 104.327 1.00 204.95 ? 251  ASP C O     1 
ATOM   5499  C  CB    . ASP C 2 251  ? 150.402 173.198 102.446 1.00 204.95 ? 251  ASP C CB    1 
ATOM   5500  C  CG    . ASP C 2 251  ? 151.727 172.577 102.853 1.00 204.95 ? 251  ASP C CG    1 
ATOM   5501  O  OD1   . ASP C 2 251  ? 151.725 171.449 103.391 1.00 204.95 ? 251  ASP C OD1   1 
ATOM   5502  O  OD2   . ASP C 2 251  ? 152.774 173.219 102.631 1.00 204.95 ? 251  ASP C OD2   1 
ATOM   5503  N  N     . LYS C 2 252  ? 150.055 171.930 105.352 1.00 203.26 ? 252  LYS C N     1 
ATOM   5504  C  CA    . LYS C 2 252  ? 149.745 170.786 106.202 1.00 203.26 ? 252  LYS C CA    1 
ATOM   5505  C  C     . LYS C 2 252  ? 148.571 171.087 107.123 1.00 203.26 ? 252  LYS C C     1 
ATOM   5506  O  O     . LYS C 2 252  ? 147.670 170.257 107.283 1.00 203.26 ? 252  LYS C O     1 
ATOM   5507  C  CB    . LYS C 2 252  ? 150.975 170.390 107.017 1.00 203.26 ? 252  LYS C CB    1 
ATOM   5508  C  CG    . LYS C 2 252  ? 150.822 169.110 107.824 1.00 203.26 ? 252  LYS C CG    1 
ATOM   5509  C  CD    . LYS C 2 252  ? 150.115 168.020 107.036 1.00 203.26 ? 252  LYS C CD    1 
ATOM   5510  C  CE    . LYS C 2 252  ? 150.147 166.699 107.787 1.00 203.26 ? 252  LYS C CE    1 
ATOM   5511  N  NZ    . LYS C 2 252  ? 149.791 166.869 109.222 1.00 203.26 ? 252  LYS C NZ    1 
ATOM   5512  N  N     . ALA C 2 253  ? 148.568 172.270 107.741 1.00 199.89 ? 253  ALA C N     1 
ATOM   5513  C  CA    . ALA C 2 253  ? 147.464 172.652 108.615 1.00 199.89 ? 253  ALA C CA    1 
ATOM   5514  C  C     . ALA C 2 253  ? 146.150 172.700 107.847 1.00 199.89 ? 253  ALA C C     1 
ATOM   5515  O  O     . ALA C 2 253  ? 145.125 172.182 108.312 1.00 199.89 ? 253  ALA C O     1 
ATOM   5516  C  CB    . ALA C 2 253  ? 147.756 174.004 109.264 1.00 199.89 ? 253  ALA C CB    1 
ATOM   5517  N  N     . VAL C 2 254  ? 146.162 173.328 106.667 1.00 197.02 ? 254  VAL C N     1 
ATOM   5518  C  CA    . VAL C 2 254  ? 144.948 173.424 105.859 1.00 197.02 ? 254  VAL C CA    1 
ATOM   5519  C  C     . VAL C 2 254  ? 144.427 172.035 105.521 1.00 197.02 ? 254  VAL C C     1 
ATOM   5520  O  O     . VAL C 2 254  ? 143.242 171.734 105.703 1.00 197.02 ? 254  VAL C O     1 
ATOM   5521  C  CB    . VAL C 2 254  ? 145.208 174.249 104.586 1.00 197.02 ? 254  VAL C CB    1 
ATOM   5522  C  CG1   . VAL C 2 254  ? 143.999 174.192 103.665 1.00 197.02 ? 254  VAL C CG1   1 
ATOM   5523  C  CG2   . VAL C 2 254  ? 145.533 175.688 104.939 1.00 197.02 ? 254  VAL C CG2   1 
ATOM   5524  N  N     . ALA C 2 255  ? 145.311 171.164 105.030 1.00 195.24 ? 255  ALA C N     1 
ATOM   5525  C  CA    . ALA C 2 255  ? 144.891 169.827 104.625 1.00 195.24 ? 255  ALA C CA    1 
ATOM   5526  C  C     . ALA C 2 255  ? 144.358 169.034 105.811 1.00 195.24 ? 255  ALA C C     1 
ATOM   5527  O  O     . ALA C 2 255  ? 143.340 168.340 105.700 1.00 195.24 ? 255  ALA C O     1 
ATOM   5528  C  CB    . ALA C 2 255  ? 146.055 169.091 103.961 1.00 195.24 ? 255  ALA C CB    1 
ATOM   5529  N  N     . TYR C 2 256  ? 145.030 169.129 106.960 1.00 192.50 ? 256  TYR C N     1 
ATOM   5530  C  CA    . TYR C 2 256  ? 144.603 168.373 108.131 1.00 192.50 ? 256  TYR C CA    1 
ATOM   5531  C  C     . TYR C 2 256  ? 143.233 168.831 108.611 1.00 192.50 ? 256  TYR C C     1 
ATOM   5532  O  O     . TYR C 2 256  ? 142.338 168.009 108.842 1.00 192.50 ? 256  TYR C O     1 
ATOM   5533  C  CB    . TYR C 2 256  ? 145.638 168.503 109.247 1.00 192.50 ? 256  TYR C CB    1 
ATOM   5534  C  CG    . TYR C 2 256  ? 145.319 167.668 110.464 1.00 192.50 ? 256  TYR C CG    1 
ATOM   5535  C  CD1   . TYR C 2 256  ? 145.604 166.310 110.491 1.00 192.50 ? 256  TYR C CD1   1 
ATOM   5536  C  CD2   . TYR C 2 256  ? 144.733 168.236 111.587 1.00 192.50 ? 256  TYR C CD2   1 
ATOM   5537  C  CE1   . TYR C 2 256  ? 145.313 165.541 111.600 1.00 192.50 ? 256  TYR C CE1   1 
ATOM   5538  C  CE2   . TYR C 2 256  ? 144.440 167.475 112.702 1.00 192.50 ? 256  TYR C CE2   1 
ATOM   5539  C  CZ    . TYR C 2 256  ? 144.733 166.128 112.703 1.00 192.50 ? 256  TYR C CZ    1 
ATOM   5540  O  OH    . TYR C 2 256  ? 144.443 165.363 113.809 1.00 192.50 ? 256  TYR C OH    1 
ATOM   5541  N  N     . VAL C 2 257  ? 143.045 170.144 108.766 1.00 189.71 ? 257  VAL C N     1 
ATOM   5542  C  CA    . VAL C 2 257  ? 141.764 170.640 109.262 1.00 189.71 ? 257  VAL C CA    1 
ATOM   5543  C  C     . VAL C 2 257  ? 140.656 170.375 108.247 1.00 189.71 ? 257  VAL C C     1 
ATOM   5544  O  O     . VAL C 2 257  ? 139.502 170.123 108.619 1.00 189.71 ? 257  VAL C O     1 
ATOM   5545  C  CB    . VAL C 2 257  ? 141.871 172.132 109.631 1.00 189.71 ? 257  VAL C CB    1 
ATOM   5546  C  CG1   . VAL C 2 257  ? 142.029 172.985 108.391 1.00 189.71 ? 257  VAL C CG1   1 
ATOM   5547  C  CG2   . VAL C 2 257  ? 140.655 172.568 110.432 1.00 189.71 ? 257  VAL C CG2   1 
ATOM   5548  N  N     . TYR C 2 258  ? 140.988 170.399 106.953 1.00 183.71 ? 258  TYR C N     1 
ATOM   5549  C  CA    . TYR C 2 258  ? 139.995 170.093 105.929 1.00 183.71 ? 258  TYR C CA    1 
ATOM   5550  C  C     . TYR C 2 258  ? 139.559 168.638 106.014 1.00 183.71 ? 258  TYR C C     1 
ATOM   5551  O  O     . TYR C 2 258  ? 138.360 168.335 106.020 1.00 183.71 ? 258  TYR C O     1 
ATOM   5552  C  CB    . TYR C 2 258  ? 140.560 170.415 104.546 1.00 183.71 ? 258  TYR C CB    1 
ATOM   5553  C  CG    . TYR C 2 258  ? 139.741 169.873 103.399 1.00 183.71 ? 258  TYR C CG    1 
ATOM   5554  C  CD1   . TYR C 2 258  ? 140.091 168.688 102.767 1.00 183.71 ? 258  TYR C CD1   1 
ATOM   5555  C  CD2   . TYR C 2 258  ? 138.616 170.548 102.948 1.00 183.71 ? 258  TYR C CD2   1 
ATOM   5556  C  CE1   . TYR C 2 258  ? 139.344 168.191 101.718 1.00 183.71 ? 258  TYR C CE1   1 
ATOM   5557  C  CE2   . TYR C 2 258  ? 137.863 170.060 101.900 1.00 183.71 ? 258  TYR C CE2   1 
ATOM   5558  C  CZ    . TYR C 2 258  ? 138.231 168.881 101.288 1.00 183.71 ? 258  TYR C CZ    1 
ATOM   5559  O  OH    . TYR C 2 258  ? 137.482 168.391 100.243 1.00 183.71 ? 258  TYR C OH    1 
ATOM   5560  N  N     . GLY C 2 259  ? 140.524 167.719 106.076 1.00 183.23 ? 259  GLY C N     1 
ATOM   5561  C  CA    . GLY C 2 259  ? 140.188 166.315 106.228 1.00 183.23 ? 259  GLY C CA    1 
ATOM   5562  C  C     . GLY C 2 259  ? 139.494 166.010 107.539 1.00 183.23 ? 259  GLY C C     1 
ATOM   5563  O  O     . GLY C 2 259  ? 138.783 165.008 107.651 1.00 183.23 ? 259  GLY C O     1 
ATOM   5564  N  N     . LEU C 2 260  ? 139.686 166.863 108.546 1.00 181.74 ? 260  LEU C N     1 
ATOM   5565  C  CA    . LEU C 2 260  ? 139.045 166.631 109.834 1.00 181.74 ? 260  LEU C CA    1 
ATOM   5566  C  C     . LEU C 2 260  ? 137.625 167.181 109.887 1.00 181.74 ? 260  LEU C C     1 
ATOM   5567  O  O     . LEU C 2 260  ? 136.793 166.646 110.627 1.00 181.74 ? 260  LEU C O     1 
ATOM   5568  C  CB    . LEU C 2 260  ? 139.885 167.247 110.954 1.00 181.74 ? 260  LEU C CB    1 
ATOM   5569  C  CG    . LEU C 2 260  ? 139.614 166.735 112.370 1.00 181.74 ? 260  LEU C CG    1 
ATOM   5570  C  CD1   . LEU C 2 260  ? 140.357 165.432 112.620 1.00 181.74 ? 260  LEU C CD1   1 
ATOM   5571  C  CD2   . LEU C 2 260  ? 139.997 167.781 113.405 1.00 181.74 ? 260  LEU C CD2   1 
ATOM   5572  N  N     . ILE C 2 261  ? 137.322 168.234 109.128 1.00 178.12 ? 261  ILE C N     1 
ATOM   5573  C  CA    . ILE C 2 261  ? 135.994 168.835 109.209 1.00 178.12 ? 261  ILE C CA    1 
ATOM   5574  C  C     . ILE C 2 261  ? 135.317 168.904 107.846 1.00 178.12 ? 261  ILE C C     1 
ATOM   5575  O  O     . ILE C 2 261  ? 134.222 168.362 107.659 1.00 178.12 ? 261  ILE C O     1 
ATOM   5576  C  CB    . ILE C 2 261  ? 136.053 170.236 109.846 1.00 178.12 ? 261  ILE C CB    1 
ATOM   5577  C  CG1   . ILE C 2 261  ? 136.475 170.151 111.315 1.00 178.12 ? 261  ILE C CG1   1 
ATOM   5578  C  CG2   . ILE C 2 261  ? 134.711 170.932 109.722 1.00 178.12 ? 261  ILE C CG2   1 
ATOM   5579  C  CD1   . ILE C 2 261  ? 137.962 170.280 111.544 1.00 178.12 ? 261  ILE C CD1   1 
ATOM   5580  N  N     . ALA C 2 262  ? 135.955 169.569 106.885 1.00 180.44 ? 262  ALA C N     1 
ATOM   5581  C  CA    . ALA C 2 262  ? 135.281 169.956 105.652 1.00 180.44 ? 262  ALA C CA    1 
ATOM   5582  C  C     . ALA C 2 262  ? 135.348 168.907 104.550 1.00 180.44 ? 262  ALA C C     1 
ATOM   5583  O  O     . ALA C 2 262  ? 134.738 169.108 103.495 1.00 180.44 ? 262  ALA C O     1 
ATOM   5584  C  CB    . ALA C 2 262  ? 135.863 171.272 105.126 1.00 180.44 ? 262  ALA C CB    1 
ATOM   5585  N  N     . ASP C 2 263  ? 136.059 167.804 104.757 1.00 174.56 ? 263  ASP C N     1 
ATOM   5586  C  CA    . ASP C 2 263  ? 136.200 166.794 103.715 1.00 174.56 ? 263  ASP C CA    1 
ATOM   5587  C  C     . ASP C 2 263  ? 134.942 165.938 103.623 1.00 174.56 ? 263  ASP C C     1 
ATOM   5588  O  O     . ASP C 2 263  ? 134.630 165.193 104.561 1.00 174.56 ? 263  ASP C O     1 
ATOM   5589  C  CB    . ASP C 2 263  ? 137.421 165.913 103.982 1.00 174.56 ? 263  ASP C CB    1 
ATOM   5590  C  CG    . ASP C 2 263  ? 137.782 165.033 102.798 1.00 174.56 ? 263  ASP C CG    1 
ATOM   5591  O  OD1   . ASP C 2 263  ? 137.050 165.049 101.786 1.00 174.56 ? 263  ASP C OD1   1 
ATOM   5592  O  OD2   . ASP C 2 263  ? 138.805 164.322 102.879 1.00 174.56 ? 263  ASP C OD2   1 
ATOM   5593  N  N     . PRO C 2 264  ? 134.198 166.009 102.515 1.00 166.35 ? 264  PRO C N     1 
ATOM   5594  C  CA    . PRO C 2 264  ? 133.029 165.129 102.367 1.00 166.35 ? 264  PRO C CA    1 
ATOM   5595  C  C     . PRO C 2 264  ? 133.394 163.668 102.185 1.00 166.35 ? 264  PRO C C     1 
ATOM   5596  O  O     . PRO C 2 264  ? 132.492 162.822 102.157 1.00 166.35 ? 264  PRO C O     1 
ATOM   5597  C  CB    . PRO C 2 264  ? 132.325 165.687 101.124 1.00 166.35 ? 264  PRO C CB    1 
ATOM   5598  C  CG    . PRO C 2 264  ? 133.420 166.307 100.333 1.00 166.35 ? 264  PRO C CG    1 
ATOM   5599  C  CD    . PRO C 2 264  ? 134.404 166.859 101.331 1.00 166.35 ? 264  PRO C CD    1 
ATOM   5600  N  N     . ARG C 2 265  ? 134.681 163.343 102.058 1.00 164.54 ? 265  ARG C N     1 
ATOM   5601  C  CA    . ARG C 2 265  ? 135.089 161.950 101.921 1.00 164.54 ? 265  ARG C CA    1 
ATOM   5602  C  C     . ARG C 2 265  ? 135.552 161.371 103.251 1.00 164.54 ? 265  ARG C C     1 
ATOM   5603  O  O     . ARG C 2 265  ? 135.218 160.229 103.584 1.00 164.54 ? 265  ARG C O     1 
ATOM   5604  C  CB    . ARG C 2 265  ? 136.195 161.828 100.873 1.00 164.54 ? 265  ARG C CB    1 
ATOM   5605  C  CG    . ARG C 2 265  ? 135.768 162.230 99.473  1.00 164.54 ? 265  ARG C CG    1 
ATOM   5606  C  CD    . ARG C 2 265  ? 136.913 162.087 98.487  1.00 164.54 ? 265  ARG C CD    1 
ATOM   5607  N  NE    . ARG C 2 265  ? 136.544 162.546 97.151  1.00 164.54 ? 265  ARG C NE    1 
ATOM   5608  C  CZ    . ARG C 2 265  ? 137.372 162.560 96.112  1.00 164.54 ? 265  ARG C CZ    1 
ATOM   5609  N  NH1   . ARG C 2 265  ? 138.620 162.138 96.253  1.00 164.54 ? 265  ARG C NH1   1 
ATOM   5610  N  NH2   . ARG C 2 265  ? 136.952 162.995 94.933  1.00 164.54 ? 265  ARG C NH2   1 
ATOM   5611  N  N     . ARG C 2 266  ? 136.320 162.141 104.022 1.00 166.77 ? 266  ARG C N     1 
ATOM   5612  C  CA    . ARG C 2 266  ? 136.805 161.680 105.316 1.00 166.77 ? 266  ARG C CA    1 
ATOM   5613  C  C     . ARG C 2 266  ? 135.803 161.896 106.440 1.00 166.77 ? 266  ARG C C     1 
ATOM   5614  O  O     . ARG C 2 266  ? 135.715 161.054 107.341 1.00 166.77 ? 266  ARG C O     1 
ATOM   5615  C  CB    . ARG C 2 266  ? 138.120 162.380 105.671 1.00 166.77 ? 266  ARG C CB    1 
ATOM   5616  C  CG    . ARG C 2 266  ? 139.325 161.852 104.915 1.00 166.77 ? 266  ARG C CG    1 
ATOM   5617  C  CD    . ARG C 2 266  ? 140.548 161.778 105.811 1.00 166.77 ? 266  ARG C CD    1 
ATOM   5618  N  NE    . ARG C 2 266  ? 140.460 160.671 106.758 1.00 166.77 ? 266  ARG C NE    1 
ATOM   5619  C  CZ    . ARG C 2 266  ? 141.416 160.349 107.623 1.00 166.77 ? 266  ARG C CZ    1 
ATOM   5620  N  NH1   . ARG C 2 266  ? 141.248 159.325 108.449 1.00 166.77 ? 266  ARG C NH1   1 
ATOM   5621  N  NH2   . ARG C 2 266  ? 142.541 161.049 107.661 1.00 166.77 ? 266  ARG C NH2   1 
ATOM   5622  N  N     . TYR C 2 267  ? 135.050 162.994 106.412 1.00 160.28 ? 267  TYR C N     1 
ATOM   5623  C  CA    . TYR C 2 267  ? 134.023 163.266 107.413 1.00 160.28 ? 267  TYR C CA    1 
ATOM   5624  C  C     . TYR C 2 267  ? 132.670 163.223 106.720 1.00 160.28 ? 267  TYR C C     1 
ATOM   5625  O  O     . TYR C 2 267  ? 132.382 164.062 105.860 1.00 160.28 ? 267  TYR C O     1 
ATOM   5626  C  CB    . TYR C 2 267  ? 134.244 164.616 108.094 1.00 160.28 ? 267  TYR C CB    1 
ATOM   5627  C  CG    . TYR C 2 267  ? 133.310 164.859 109.256 1.00 160.28 ? 267  TYR C CG    1 
ATOM   5628  C  CD1   . TYR C 2 267  ? 133.679 164.520 110.550 1.00 160.28 ? 267  TYR C CD1   1 
ATOM   5629  C  CD2   . TYR C 2 267  ? 132.055 165.419 109.059 1.00 160.28 ? 267  TYR C CD2   1 
ATOM   5630  C  CE1   . TYR C 2 267  ? 132.828 164.736 111.613 1.00 160.28 ? 267  TYR C CE1   1 
ATOM   5631  C  CE2   . TYR C 2 267  ? 131.198 165.636 110.115 1.00 160.28 ? 267  TYR C CE2   1 
ATOM   5632  C  CZ    . TYR C 2 267  ? 131.589 165.294 111.391 1.00 160.28 ? 267  TYR C CZ    1 
ATOM   5633  O  OH    . TYR C 2 267  ? 130.737 165.511 112.448 1.00 160.28 ? 267  TYR C OH    1 
ATOM   5634  N  N     . ASP C 2 268  ? 131.839 162.255 107.096 1.00 156.27 ? 268  ASP C N     1 
ATOM   5635  C  CA    . ASP C 2 268  ? 130.551 162.034 106.447 1.00 156.27 ? 268  ASP C CA    1 
ATOM   5636  C  C     . ASP C 2 268  ? 129.463 161.956 107.507 1.00 156.27 ? 268  ASP C C     1 
ATOM   5637  O  O     . ASP C 2 268  ? 129.280 160.910 108.138 1.00 156.27 ? 268  ASP C O     1 
ATOM   5638  C  CB    . ASP C 2 268  ? 130.574 160.761 105.602 1.00 156.27 ? 268  ASP C CB    1 
ATOM   5639  C  CG    . ASP C 2 268  ? 129.365 160.641 104.695 1.00 156.27 ? 268  ASP C CG    1 
ATOM   5640  O  OD1   . ASP C 2 268  ? 128.549 161.586 104.655 1.00 156.27 ? 268  ASP C OD1   1 
ATOM   5641  O  OD2   . ASP C 2 268  ? 129.229 159.598 104.020 1.00 156.27 ? 268  ASP C OD2   1 
ATOM   5642  N  N     . LEU C 2 269  ? 128.747 163.058 107.706 1.00 150.34 ? 269  LEU C N     1 
ATOM   5643  C  CA    . LEU C 2 269  ? 127.521 163.002 108.482 1.00 150.34 ? 269  LEU C CA    1 
ATOM   5644  C  C     . LEU C 2 269  ? 126.474 162.194 107.723 1.00 150.34 ? 269  LEU C C     1 
ATOM   5645  O  O     . LEU C 2 269  ? 126.394 162.232 106.493 1.00 150.34 ? 269  LEU C O     1 
ATOM   5646  C  CB    . LEU C 2 269  ? 126.999 164.408 108.771 1.00 150.34 ? 269  LEU C CB    1 
ATOM   5647  C  CG    . LEU C 2 269  ? 126.043 164.567 109.952 1.00 150.34 ? 269  LEU C CG    1 
ATOM   5648  C  CD1   . LEU C 2 269  ? 126.762 164.276 111.257 1.00 150.34 ? 269  LEU C CD1   1 
ATOM   5649  C  CD2   . LEU C 2 269  ? 125.445 165.963 109.966 1.00 150.34 ? 269  LEU C CD2   1 
ATOM   5650  N  N     . GLY C 2 270  ? 125.673 161.447 108.466 1.00 147.87 ? 270  GLY C N     1 
ATOM   5651  C  CA    . GLY C 2 270  ? 124.694 160.587 107.841 1.00 147.87 ? 270  GLY C CA    1 
ATOM   5652  C  C     . GLY C 2 270  ? 123.517 161.358 107.280 1.00 147.87 ? 270  GLY C C     1 
ATOM   5653  O  O     . GLY C 2 270  ? 123.193 162.470 107.698 1.00 147.87 ? 270  GLY C O     1 
ATOM   5654  N  N     . GLU C 2 271  ? 122.869 160.744 106.287 1.00 144.38 ? 271  GLU C N     1 
ATOM   5655  C  CA    . GLU C 2 271  ? 121.596 161.271 105.810 1.00 144.38 ? 271  GLU C CA    1 
ATOM   5656  C  C     . GLU C 2 271  ? 120.575 161.308 106.938 1.00 144.38 ? 271  GLU C C     1 
ATOM   5657  O  O     . GLU C 2 271  ? 119.893 162.321 107.138 1.00 144.38 ? 271  GLU C O     1 
ATOM   5658  C  CB    . GLU C 2 271  ? 121.083 160.430 104.643 1.00 144.38 ? 271  GLU C CB    1 
ATOM   5659  C  CG    . GLU C 2 271  ? 119.677 160.783 104.194 1.00 144.38 ? 271  GLU C CG    1 
ATOM   5660  C  CD    . GLU C 2 271  ? 119.596 162.151 103.548 1.00 144.38 ? 271  GLU C CD    1 
ATOM   5661  O  OE1   . GLU C 2 271  ? 120.626 162.628 103.028 1.00 144.38 ? 271  GLU C OE1   1 
ATOM   5662  O  OE2   . GLU C 2 271  ? 118.501 162.751 103.562 1.00 144.38 ? 271  GLU C OE2   1 
ATOM   5663  N  N     . ALA C 2 272  ? 120.465 160.211 107.689 1.00 138.60 ? 272  ALA C N     1 
ATOM   5664  C  CA    . ALA C 2 272  ? 119.688 160.230 108.922 1.00 138.60 ? 272  ALA C CA    1 
ATOM   5665  C  C     . ALA C 2 272  ? 120.223 161.279 109.885 1.00 138.60 ? 272  ALA C C     1 
ATOM   5666  O  O     . ALA C 2 272  ? 119.447 161.946 110.578 1.00 138.60 ? 272  ALA C O     1 
ATOM   5667  C  CB    . ALA C 2 272  ? 119.698 158.849 109.572 1.00 138.60 ? 272  ALA C CB    1 
ATOM   5668  N  N     . GLY C 2 273  ? 121.545 161.440 109.944 1.00 142.15 ? 273  GLY C N     1 
ATOM   5669  C  CA    . GLY C 2 273  ? 122.116 162.467 110.799 1.00 142.15 ? 273  GLY C CA    1 
ATOM   5670  C  C     . GLY C 2 273  ? 121.723 163.865 110.367 1.00 142.15 ? 273  GLY C C     1 
ATOM   5671  O  O     . GLY C 2 273  ? 121.383 164.713 111.196 1.00 142.15 ? 273  GLY C O     1 
ATOM   5672  N  N     . ARG C 2 274  ? 121.763 164.125 109.059 1.00 144.60 ? 274  ARG C N     1 
ATOM   5673  C  CA    . ARG C 2 274  ? 121.368 165.437 108.556 1.00 144.60 ? 274  ARG C CA    1 
ATOM   5674  C  C     . ARG C 2 274  ? 119.893 165.698 108.826 1.00 144.60 ? 274  ARG C C     1 
ATOM   5675  O  O     . ARG C 2 274  ? 119.502 166.815 109.184 1.00 144.60 ? 274  ARG C O     1 
ATOM   5676  C  CB    . ARG C 2 274  ? 121.670 165.539 107.062 1.00 144.60 ? 274  ARG C CB    1 
ATOM   5677  C  CG    . ARG C 2 274  ? 121.341 166.891 106.461 1.00 144.60 ? 274  ARG C CG    1 
ATOM   5678  C  CD    . ARG C 2 274  ? 121.306 166.830 104.946 1.00 144.60 ? 274  ARG C CD    1 
ATOM   5679  N  NE    . ARG C 2 274  ? 120.198 166.016 104.459 1.00 144.60 ? 274  ARG C NE    1 
ATOM   5680  C  CZ    . ARG C 2 274  ? 119.813 165.965 103.188 1.00 144.60 ? 274  ARG C CZ    1 
ATOM   5681  N  NH1   . ARG C 2 274  ? 120.449 166.685 102.274 1.00 144.60 ? 274  ARG C NH1   1 
ATOM   5682  N  NH2   . ARG C 2 274  ? 118.794 165.197 102.831 1.00 144.60 ? 274  ARG C NH2   1 
ATOM   5683  N  N     . TYR C 2 275  ? 119.059 164.670 108.666 1.00 143.78 ? 275  TYR C N     1 
ATOM   5684  C  CA    . TYR C 2 275  ? 117.639 164.815 108.966 1.00 143.78 ? 275  TYR C CA    1 
ATOM   5685  C  C     . TYR C 2 275  ? 117.415 165.114 110.444 1.00 143.78 ? 275  TYR C C     1 
ATOM   5686  O  O     . TYR C 2 275  ? 116.638 166.011 110.794 1.00 143.78 ? 275  TYR C O     1 
ATOM   5687  C  CB    . TYR C 2 275  ? 116.895 163.548 108.548 1.00 143.78 ? 275  TYR C CB    1 
ATOM   5688  C  CG    . TYR C 2 275  ? 115.462 163.482 109.015 1.00 143.78 ? 275  TYR C CG    1 
ATOM   5689  C  CD1   . TYR C 2 275  ? 114.472 164.221 108.384 1.00 143.78 ? 275  TYR C CD1   1 
ATOM   5690  C  CD2   . TYR C 2 275  ? 115.098 162.673 110.081 1.00 143.78 ? 275  TYR C CD2   1 
ATOM   5691  C  CE1   . TYR C 2 275  ? 113.160 164.160 108.805 1.00 143.78 ? 275  TYR C CE1   1 
ATOM   5692  C  CE2   . TYR C 2 275  ? 113.789 162.605 110.509 1.00 143.78 ? 275  TYR C CE2   1 
ATOM   5693  C  CZ    . TYR C 2 275  ? 112.824 163.351 109.868 1.00 143.78 ? 275  TYR C CZ    1 
ATOM   5694  O  OH    . TYR C 2 275  ? 111.518 163.286 110.293 1.00 143.78 ? 275  TYR C OH    1 
ATOM   5695  N  N     . LYS C 2 276  ? 118.087 164.369 111.325 1.00 140.80 ? 276  LYS C N     1 
ATOM   5696  C  CA    . LYS C 2 276  ? 117.982 164.615 112.759 1.00 140.80 ? 276  LYS C CA    1 
ATOM   5697  C  C     . LYS C 2 276  ? 118.425 166.028 113.112 1.00 140.80 ? 276  LYS C C     1 
ATOM   5698  O  O     . LYS C 2 276  ? 117.803 166.687 113.952 1.00 140.80 ? 276  LYS C O     1 
ATOM   5699  C  CB    . LYS C 2 276  ? 118.814 163.590 113.527 1.00 140.80 ? 276  LYS C CB    1 
ATOM   5700  C  CG    . LYS C 2 276  ? 118.159 162.228 113.664 1.00 140.80 ? 276  LYS C CG    1 
ATOM   5701  C  CD    . LYS C 2 276  ? 116.989 162.273 114.627 1.00 140.80 ? 276  LYS C CD    1 
ATOM   5702  C  CE    . LYS C 2 276  ? 117.424 162.776 115.991 1.00 140.80 ? 276  LYS C CE    1 
ATOM   5703  N  NZ    . LYS C 2 276  ? 118.512 161.939 116.566 1.00 140.80 ? 276  LYS C NZ    1 
ATOM   5704  N  N     . ALA C 2 277  ? 119.501 166.508 112.486 1.00 146.82 ? 277  ALA C N     1 
ATOM   5705  C  CA    . ALA C 2 277  ? 119.979 167.857 112.766 1.00 146.82 ? 277  ALA C CA    1 
ATOM   5706  C  C     . ALA C 2 277  ? 118.969 168.900 112.307 1.00 146.82 ? 277  ALA C C     1 
ATOM   5707  O  O     . ALA C 2 277  ? 118.660 169.847 113.040 1.00 146.82 ? 277  ALA C O     1 
ATOM   5708  C  CB    . ALA C 2 277  ? 121.334 168.084 112.097 1.00 146.82 ? 277  ALA C CB    1 
ATOM   5709  N  N     . GLU C 2 278  ? 118.444 168.744 111.089 1.00 152.80 ? 278  GLU C N     1 
ATOM   5710  C  CA    . GLU C 2 278  ? 117.445 169.682 110.588 1.00 152.80 ? 278  GLU C CA    1 
ATOM   5711  C  C     . GLU C 2 278  ? 116.207 169.699 111.474 1.00 152.80 ? 278  GLU C C     1 
ATOM   5712  O  O     . GLU C 2 278  ? 115.584 170.750 111.663 1.00 152.80 ? 278  GLU C O     1 
ATOM   5713  C  CB    . GLU C 2 278  ? 117.068 169.333 109.149 1.00 152.80 ? 278  GLU C CB    1 
ATOM   5714  C  CG    . GLU C 2 278  ? 118.161 169.612 108.134 1.00 152.80 ? 278  GLU C CG    1 
ATOM   5715  C  CD    . GLU C 2 278  ? 118.074 168.704 106.923 1.00 152.80 ? 278  GLU C CD    1 
ATOM   5716  O  OE1   . GLU C 2 278  ? 117.628 167.548 107.076 1.00 152.80 ? 278  GLU C OE1   1 
ATOM   5717  O  OE2   . GLU C 2 278  ? 118.452 169.146 105.818 1.00 152.80 ? 278  GLU C OE2   1 
ATOM   5718  N  N     . GLU C 2 279  ? 115.834 168.545 112.029 1.00 151.87 ? 279  GLU C N     1 
ATOM   5719  C  CA    . GLU C 2 279  ? 114.655 168.500 112.888 1.00 151.87 ? 279  GLU C CA    1 
ATOM   5720  C  C     . GLU C 2 279  ? 114.925 169.126 114.251 1.00 151.87 ? 279  GLU C C     1 
ATOM   5721  O  O     . GLU C 2 279  ? 114.110 169.911 114.747 1.00 151.87 ? 279  GLU C O     1 
ATOM   5722  C  CB    . GLU C 2 279  ? 114.175 167.058 113.053 1.00 151.87 ? 279  GLU C CB    1 
ATOM   5723  C  CG    . GLU C 2 279  ? 113.662 166.424 111.770 1.00 151.87 ? 279  GLU C CG    1 
ATOM   5724  C  CD    . GLU C 2 279  ? 112.487 167.174 111.175 1.00 151.87 ? 279  GLU C CD    1 
ATOM   5725  O  OE1   . GLU C 2 279  ? 111.674 167.725 111.947 1.00 151.87 ? 279  GLU C OE1   1 
ATOM   5726  O  OE2   . GLU C 2 279  ? 112.376 167.215 109.931 1.00 151.87 ? 279  GLU C OE2   1 
ATOM   5727  N  N     . LYS C 2 280  ? 116.058 168.793 114.870 1.00 148.85 ? 280  LYS C N     1 
ATOM   5728  C  CA    . LYS C 2 280  ? 116.352 169.295 116.208 1.00 148.85 ? 280  LYS C CA    1 
ATOM   5729  C  C     . LYS C 2 280  ? 116.672 170.784 116.185 1.00 148.85 ? 280  LYS C C     1 
ATOM   5730  O  O     . LYS C 2 280  ? 115.985 171.588 116.826 1.00 148.85 ? 280  LYS C O     1 
ATOM   5731  C  CB    . LYS C 2 280  ? 117.510 168.506 116.818 1.00 148.85 ? 280  LYS C CB    1 
ATOM   5732  C  CG    . LYS C 2 280  ? 117.891 168.946 118.218 1.00 148.85 ? 280  LYS C CG    1 
ATOM   5733  C  CD    . LYS C 2 280  ? 117.004 168.292 119.259 1.00 148.85 ? 280  LYS C CD    1 
ATOM   5734  C  CE    . LYS C 2 280  ? 117.475 168.616 120.664 1.00 148.85 ? 280  LYS C CE    1 
ATOM   5735  N  NZ    . LYS C 2 280  ? 116.701 167.868 121.690 1.00 148.85 ? 280  LYS C NZ    1 
ATOM   5736  N  N     . LEU C 2 281  ? 117.710 171.173 115.448 1.00 152.59 ? 281  LEU C N     1 
ATOM   5737  C  CA    . LEU C 2 281  ? 118.184 172.549 115.459 1.00 152.59 ? 281  LEU C CA    1 
ATOM   5738  C  C     . LEU C 2 281  ? 117.302 173.497 114.659 1.00 152.59 ? 281  LEU C C     1 
ATOM   5739  O  O     . LEU C 2 281  ? 117.416 174.715 114.832 1.00 152.59 ? 281  LEU C O     1 
ATOM   5740  C  CB    . LEU C 2 281  ? 119.618 172.613 114.923 1.00 152.59 ? 281  LEU C CB    1 
ATOM   5741  C  CG    . LEU C 2 281  ? 120.733 172.433 115.953 1.00 152.59 ? 281  LEU C CG    1 
ATOM   5742  C  CD1   . LEU C 2 281  ? 120.837 170.983 116.393 1.00 152.59 ? 281  LEU C CD1   1 
ATOM   5743  C  CD2   . LEU C 2 281  ? 122.057 172.910 115.388 1.00 152.59 ? 281  LEU C CD2   1 
ATOM   5744  N  N     . GLY C 2 282  ? 116.432 172.976 113.799 1.00 158.00 ? 282  GLY C N     1 
ATOM   5745  C  CA    . GLY C 2 282  ? 115.546 173.815 113.017 1.00 158.00 ? 282  GLY C CA    1 
ATOM   5746  C  C     . GLY C 2 282  ? 116.267 174.682 112.005 1.00 158.00 ? 282  GLY C C     1 
ATOM   5747  O  O     . GLY C 2 282  ? 115.948 175.865 111.852 1.00 158.00 ? 282  GLY C O     1 
ATOM   5748  N  N     . ILE C 2 283  ? 117.242 174.105 111.308 1.00 162.39 ? 283  ILE C N     1 
ATOM   5749  C  CA    . ILE C 2 283  ? 117.998 174.786 110.268 1.00 162.39 ? 283  ILE C CA    1 
ATOM   5750  C  C     . ILE C 2 283  ? 118.028 173.890 109.035 1.00 162.39 ? 283  ILE C C     1 
ATOM   5751  O  O     . ILE C 2 283  ? 117.474 172.788 109.029 1.00 162.39 ? 283  ILE C O     1 
ATOM   5752  C  CB    . ILE C 2 283  ? 119.428 175.145 110.721 1.00 162.39 ? 283  ILE C CB    1 
ATOM   5753  C  CG1   . ILE C 2 283  ? 120.252 173.878 110.953 1.00 162.39 ? 283  ILE C CG1   1 
ATOM   5754  C  CG2   . ILE C 2 283  ? 119.397 176.004 111.976 1.00 162.39 ? 283  ILE C CG2   1 
ATOM   5755  C  CD1   . ILE C 2 283  ? 121.710 174.148 111.245 1.00 162.39 ? 283  ILE C CD1   1 
ATOM   5756  N  N     . ARG C 2 284  ? 118.681 174.371 107.980 1.00 165.61 ? 284  ARG C N     1 
ATOM   5757  C  CA    . ARG C 2 284  ? 118.746 173.657 106.712 1.00 165.61 ? 284  ARG C CA    1 
ATOM   5758  C  C     . ARG C 2 284  ? 120.201 173.398 106.356 1.00 165.61 ? 284  ARG C C     1 
ATOM   5759  O  O     . ARG C 2 284  ? 120.995 174.338 106.253 1.00 165.61 ? 284  ARG C O     1 
ATOM   5760  C  CB    . ARG C 2 284  ? 118.056 174.443 105.591 1.00 165.61 ? 284  ARG C CB    1 
ATOM   5761  C  CG    . ARG C 2 284  ? 116.609 174.039 105.352 1.00 165.61 ? 284  ARG C CG    1 
ATOM   5762  C  CD    . ARG C 2 284  ? 115.745 174.357 106.559 1.00 165.61 ? 284  ARG C CD    1 
ATOM   5763  N  NE    . ARG C 2 284  ? 114.367 173.906 106.395 1.00 165.61 ? 284  ARG C NE    1 
ATOM   5764  C  CZ    . ARG C 2 284  ? 113.479 173.858 107.382 1.00 165.61 ? 284  ARG C CZ    1 
ATOM   5765  N  NH1   . ARG C 2 284  ? 112.244 173.435 107.147 1.00 165.61 ? 284  ARG C NH1   1 
ATOM   5766  N  NH2   . ARG C 2 284  ? 113.826 174.232 108.606 1.00 165.61 ? 284  ARG C NH2   1 
ATOM   5767  N  N     . LEU C 2 285  ? 120.543 172.127 106.168 1.00 165.66 ? 285  LEU C N     1 
ATOM   5768  C  CA    . LEU C 2 285  ? 121.905 171.729 105.845 1.00 165.66 ? 285  LEU C CA    1 
ATOM   5769  C  C     . LEU C 2 285  ? 122.046 171.533 104.342 1.00 165.66 ? 285  LEU C C     1 
ATOM   5770  O  O     . LEU C 2 285  ? 121.288 170.770 103.734 1.00 165.66 ? 285  LEU C O     1 
ATOM   5771  C  CB    . LEU C 2 285  ? 122.283 170.443 106.580 1.00 165.66 ? 285  LEU C CB    1 
ATOM   5772  C  CG    . LEU C 2 285  ? 122.916 170.569 107.968 1.00 165.66 ? 285  LEU C CG    1 
ATOM   5773  C  CD1   . LEU C 2 285  ? 124.254 171.286 107.882 1.00 165.66 ? 285  LEU C CD1   1 
ATOM   5774  C  CD2   . LEU C 2 285  ? 121.985 171.270 108.945 1.00 165.66 ? 285  LEU C CD2   1 
ATOM   5775  N  N     . SER C 2 286  ? 123.020 172.224 103.746 1.00 168.21 ? 286  SER C N     1 
ATOM   5776  C  CA    . SER C 2 286  ? 123.293 172.049 102.326 1.00 168.21 ? 286  SER C CA    1 
ATOM   5777  C  C     . SER C 2 286  ? 124.033 170.751 102.040 1.00 168.21 ? 286  SER C C     1 
ATOM   5778  O  O     . SER C 2 286  ? 123.907 170.209 100.937 1.00 168.21 ? 286  SER C O     1 
ATOM   5779  C  CB    . SER C 2 286  ? 124.098 173.235 101.794 1.00 168.21 ? 286  SER C CB    1 
ATOM   5780  O  OG    . SER C 2 286  ? 125.488 173.028 101.976 1.00 168.21 ? 286  SER C OG    1 
ATOM   5781  N  N     . GLY C 2 287  ? 124.794 170.244 103.000 1.00 162.81 ? 287  GLY C N     1 
ATOM   5782  C  CA    . GLY C 2 287  ? 125.533 169.019 102.787 1.00 162.81 ? 287  GLY C CA    1 
ATOM   5783  C  C     . GLY C 2 287  ? 125.650 168.230 104.070 1.00 162.81 ? 287  GLY C C     1 
ATOM   5784  O  O     . GLY C 2 287  ? 125.033 168.558 105.084 1.00 162.81 ? 287  GLY C O     1 
ATOM   5785  N  N     . ARG C 2 288  ? 126.458 167.177 104.009 1.00 158.53 ? 288  ARG C N     1 
ATOM   5786  C  CA    . ARG C 2 288  ? 126.638 166.268 105.130 1.00 158.53 ? 288  ARG C CA    1 
ATOM   5787  C  C     . ARG C 2 288  ? 127.970 166.461 105.845 1.00 158.53 ? 288  ARG C C     1 
ATOM   5788  O  O     . ARG C 2 288  ? 128.588 165.474 106.255 1.00 158.53 ? 288  ARG C O     1 
ATOM   5789  C  CB    . ARG C 2 288  ? 126.495 164.821 104.655 1.00 158.53 ? 288  ARG C CB    1 
ATOM   5790  C  CG    . ARG C 2 288  ? 125.247 164.579 103.819 1.00 158.53 ? 288  ARG C CG    1 
ATOM   5791  C  CD    . ARG C 2 288  ? 124.797 163.130 103.885 1.00 158.53 ? 288  ARG C CD    1 
ATOM   5792  N  NE    . ARG C 2 288  ? 125.810 162.216 103.370 1.00 158.53 ? 288  ARG C NE    1 
ATOM   5793  C  CZ    . ARG C 2 288  ? 125.954 161.910 102.086 1.00 158.53 ? 288  ARG C CZ    1 
ATOM   5794  N  NH1   . ARG C 2 288  ? 125.144 162.443 101.182 1.00 158.53 ? 288  ARG C NH1   1 
ATOM   5795  N  NH2   . ARG C 2 288  ? 126.904 161.068 101.705 1.00 158.53 ? 288  ARG C NH2   1 
ATOM   5796  N  N     . THR C 2 289  ? 128.431 167.700 105.987 1.00 168.95 ? 289  THR C N     1 
ATOM   5797  C  CA    . THR C 2 289  ? 129.640 168.019 106.730 1.00 168.95 ? 289  THR C CA    1 
ATOM   5798  C  C     . THR C 2 289  ? 129.383 169.191 107.669 1.00 168.95 ? 289  THR C C     1 
ATOM   5799  O  O     . THR C 2 289  ? 128.445 169.971 107.486 1.00 168.95 ? 289  THR C O     1 
ATOM   5800  C  CB    . THR C 2 289  ? 130.802 168.357 105.788 1.00 168.95 ? 289  THR C CB    1 
ATOM   5801  O  OG1   . THR C 2 289  ? 130.451 169.484 104.976 1.00 168.95 ? 289  THR C OG1   1 
ATOM   5802  C  CG2   . THR C 2 289  ? 131.137 167.171 104.895 1.00 168.95 ? 289  THR C CG2   1 
ATOM   5803  N  N     . LEU C 2 290  ? 130.239 169.304 108.689 1.00 173.81 ? 290  LEU C N     1 
ATOM   5804  C  CA    . LEU C 2 290  ? 130.075 170.366 109.677 1.00 173.81 ? 290  LEU C CA    1 
ATOM   5805  C  C     . LEU C 2 290  ? 130.395 171.738 109.098 1.00 173.81 ? 290  LEU C C     1 
ATOM   5806  O  O     . LEU C 2 290  ? 129.703 172.714 109.406 1.00 173.81 ? 290  LEU C O     1 
ATOM   5807  C  CB    . LEU C 2 290  ? 130.954 170.093 110.895 1.00 173.81 ? 290  LEU C CB    1 
ATOM   5808  C  CG    . LEU C 2 290  ? 130.738 168.756 111.600 1.00 173.81 ? 290  LEU C CG    1 
ATOM   5809  C  CD1   . LEU C 2 290  ? 131.515 168.715 112.902 1.00 173.81 ? 290  LEU C CD1   1 
ATOM   5810  C  CD2   . LEU C 2 290  ? 129.260 168.514 111.847 1.00 173.81 ? 290  LEU C CD2   1 
ATOM   5811  N  N     . ALA C 2 291  ? 131.435 171.837 108.275 1.00 182.49 ? 291  ALA C N     1 
ATOM   5812  C  CA    . ALA C 2 291  ? 131.816 173.098 107.658 1.00 182.49 ? 291  ALA C CA    1 
ATOM   5813  C  C     . ALA C 2 291  ? 132.298 172.813 106.243 1.00 182.49 ? 291  ALA C C     1 
ATOM   5814  O  O     . ALA C 2 291  ? 132.512 171.660 105.859 1.00 182.49 ? 291  ALA C O     1 
ATOM   5815  C  CB    . ALA C 2 291  ? 132.885 173.819 108.484 1.00 182.49 ? 291  ALA C CB    1 
ATOM   5816  N  N     . ARG C 2 292  ? 132.468 173.876 105.461 1.00 191.63 ? 292  ARG C N     1 
ATOM   5817  C  CA    . ARG C 2 292  ? 132.864 173.742 104.068 1.00 191.63 ? 292  ARG C CA    1 
ATOM   5818  C  C     . ARG C 2 292  ? 134.141 174.526 103.804 1.00 191.63 ? 292  ARG C C     1 
ATOM   5819  O  O     . ARG C 2 292  ? 134.369 175.594 104.374 1.00 191.63 ? 292  ARG C O     1 
ATOM   5820  C  CB    . ARG C 2 292  ? 131.759 174.222 103.118 1.00 191.63 ? 292  ARG C CB    1 
ATOM   5821  C  CG    . ARG C 2 292  ? 130.392 173.630 103.403 1.00 191.63 ? 292  ARG C CG    1 
ATOM   5822  C  CD    . ARG C 2 292  ? 129.296 174.506 102.830 1.00 191.63 ? 292  ARG C CD    1 
ATOM   5823  N  NE    . ARG C 2 292  ? 129.514 175.916 103.134 1.00 191.63 ? 292  ARG C NE    1 
ATOM   5824  C  CZ    . ARG C 2 292  ? 128.755 176.904 102.673 1.00 191.63 ? 292  ARG C CZ    1 
ATOM   5825  N  NH1   . ARG C 2 292  ? 127.725 176.637 101.884 1.00 191.63 ? 292  ARG C NH1   1 
ATOM   5826  N  NH2   . ARG C 2 292  ? 129.026 178.159 103.002 1.00 191.63 ? 292  ARG C NH2   1 
ATOM   5827  N  N     . PHE C 2 293  ? 134.977 173.979 102.925 1.00 197.10 ? 293  PHE C N     1 
ATOM   5828  C  CA    . PHE C 2 293  ? 136.180 174.655 102.451 1.00 197.10 ? 293  PHE C CA    1 
ATOM   5829  C  C     . PHE C 2 293  ? 135.840 175.335 101.132 1.00 197.10 ? 293  PHE C C     1 
ATOM   5830  O  O     . PHE C 2 293  ? 135.828 174.690 100.078 1.00 197.10 ? 293  PHE C O     1 
ATOM   5831  C  CB    . PHE C 2 293  ? 137.341 173.678 102.284 1.00 197.10 ? 293  PHE C CB    1 
ATOM   5832  C  CG    . PHE C 2 293  ? 138.647 174.342 101.945 1.00 197.10 ? 293  PHE C CG    1 
ATOM   5833  C  CD1   . PHE C 2 293  ? 139.469 174.836 102.945 1.00 197.10 ? 293  PHE C CD1   1 
ATOM   5834  C  CD2   . PHE C 2 293  ? 139.053 174.474 100.628 1.00 197.10 ? 293  PHE C CD2   1 
ATOM   5835  C  CE1   . PHE C 2 293  ? 140.670 175.447 102.638 1.00 197.10 ? 293  PHE C CE1   1 
ATOM   5836  C  CE2   . PHE C 2 293  ? 140.253 175.085 100.314 1.00 197.10 ? 293  PHE C CE2   1 
ATOM   5837  C  CZ    . PHE C 2 293  ? 141.062 175.571 101.321 1.00 197.10 ? 293  PHE C CZ    1 
ATOM   5838  N  N     . GLU C 2 294  ? 135.569 176.635 101.193 1.00 201.07 ? 294  GLU C N     1 
ATOM   5839  C  CA    . GLU C 2 294  ? 135.146 177.392 100.025 1.00 201.07 ? 294  GLU C CA    1 
ATOM   5840  C  C     . GLU C 2 294  ? 136.031 178.618 99.876  1.00 201.07 ? 294  GLU C C     1 
ATOM   5841  O  O     . GLU C 2 294  ? 136.322 179.298 100.864 1.00 201.07 ? 294  GLU C O     1 
ATOM   5842  C  CB    . GLU C 2 294  ? 133.676 177.808 100.144 1.00 201.07 ? 294  GLU C CB    1 
ATOM   5843  C  CG    . GLU C 2 294  ? 132.959 177.955 98.816  1.00 201.07 ? 294  GLU C CG    1 
ATOM   5844  C  CD    . GLU C 2 294  ? 131.551 178.491 98.976  1.00 201.07 ? 294  GLU C CD    1 
ATOM   5845  O  OE1   . GLU C 2 294  ? 131.399 179.714 99.177  1.00 201.07 ? 294  GLU C OE1   1 
ATOM   5846  O  OE2   . GLU C 2 294  ? 130.596 177.689 98.905  1.00 201.07 ? 294  GLU C OE2   1 
ATOM   5847  N  N     . ASP C 2 295  ? 136.464 178.885 98.642  1.00 204.88 ? 295  ASP C N     1 
ATOM   5848  C  CA    . ASP C 2 295  ? 137.254 180.073 98.315  1.00 204.88 ? 295  ASP C CA    1 
ATOM   5849  C  C     . ASP C 2 295  ? 138.523 180.153 99.161  1.00 204.88 ? 295  ASP C C     1 
ATOM   5850  O  O     . ASP C 2 295  ? 138.974 181.237 99.537  1.00 204.88 ? 295  ASP C O     1 
ATOM   5851  C  CB    . ASP C 2 295  ? 136.419 181.347 98.468  1.00 204.88 ? 295  ASP C CB    1 
ATOM   5852  C  CG    . ASP C 2 295  ? 135.045 181.219 97.844  1.00 204.88 ? 295  ASP C CG    1 
ATOM   5853  O  OD1   . ASP C 2 295  ? 134.914 180.495 96.835  1.00 204.88 ? 295  ASP C OD1   1 
ATOM   5854  O  OD2   . ASP C 2 295  ? 134.095 181.840 98.365  1.00 204.88 ? 295  ASP C OD2   1 
ATOM   5855  N  N     . GLY C 2 296  ? 139.102 178.994 99.469  1.00 203.62 ? 296  GLY C N     1 
ATOM   5856  C  CA    . GLY C 2 296  ? 140.297 178.917 100.275 1.00 203.62 ? 296  GLY C CA    1 
ATOM   5857  C  C     . GLY C 2 296  ? 140.081 179.093 101.764 1.00 203.62 ? 296  GLY C C     1 
ATOM   5858  O  O     . GLY C 2 296  ? 140.996 178.809 102.544 1.00 203.62 ? 296  GLY C O     1 
ATOM   5859  N  N     . GLU C 2 297  ? 138.906 179.549 102.180 1.00 201.92 ? 297  GLU C N     1 
ATOM   5860  C  CA    . GLU C 2 297  ? 138.585 179.750 103.586 1.00 201.92 ? 297  GLU C CA    1 
ATOM   5861  C  C     . GLU C 2 297  ? 137.595 178.681 104.039 1.00 201.92 ? 297  GLU C C     1 
ATOM   5862  O  O     . GLU C 2 297  ? 137.206 177.796 103.274 1.00 201.92 ? 297  GLU C O     1 
ATOM   5863  C  CB    . GLU C 2 297  ? 138.019 181.152 103.826 1.00 201.92 ? 297  GLU C CB    1 
ATOM   5864  C  CG    . GLU C 2 297  ? 136.613 181.349 103.284 1.00 201.92 ? 297  GLU C CG    1 
ATOM   5865  C  CD    . GLU C 2 297  ? 136.084 182.746 103.530 1.00 201.92 ? 297  GLU C CD    1 
ATOM   5866  O  OE1   . GLU C 2 297  ? 134.860 182.952 103.386 1.00 201.92 ? 297  GLU C OE1   1 
ATOM   5867  O  OE2   . GLU C 2 297  ? 136.890 183.638 103.868 1.00 201.92 ? 297  GLU C OE2   1 
ATOM   5868  N  N     . PHE C 2 298  ? 137.190 178.769 105.300 1.00 193.05 ? 298  PHE C N     1 
ATOM   5869  C  CA    . PHE C 2 298  ? 136.226 177.846 105.876 1.00 193.05 ? 298  PHE C CA    1 
ATOM   5870  C  C     . PHE C 2 298  ? 134.939 178.580 106.222 1.00 193.05 ? 298  PHE C C     1 
ATOM   5871  O  O     . PHE C 2 298  ? 134.967 179.715 106.707 1.00 193.05 ? 298  PHE C O     1 
ATOM   5872  C  CB    . PHE C 2 298  ? 136.799 177.168 107.121 1.00 193.05 ? 298  PHE C CB    1 
ATOM   5873  C  CG    . PHE C 2 298  ? 137.759 176.060 106.812 1.00 193.05 ? 298  PHE C CG    1 
ATOM   5874  C  CD1   . PHE C 2 298  ? 139.117 176.227 107.013 1.00 193.05 ? 298  PHE C CD1   1 
ATOM   5875  C  CD2   . PHE C 2 298  ? 137.302 174.851 106.320 1.00 193.05 ? 298  PHE C CD2   1 
ATOM   5876  C  CE1   . PHE C 2 298  ? 140.000 175.209 106.725 1.00 193.05 ? 298  PHE C CE1   1 
ATOM   5877  C  CE2   . PHE C 2 298  ? 138.182 173.828 106.034 1.00 193.05 ? 298  PHE C CE2   1 
ATOM   5878  C  CZ    . PHE C 2 298  ? 139.531 174.007 106.237 1.00 193.05 ? 298  PHE C CZ    1 
ATOM   5879  N  N     . LYS C 2 299  ? 133.811 177.924 105.967 1.00 193.62 ? 299  LYS C N     1 
ATOM   5880  C  CA    . LYS C 2 299  ? 132.491 178.502 106.181 1.00 193.62 ? 299  LYS C CA    1 
ATOM   5881  C  C     . LYS C 2 299  ? 131.679 177.567 107.064 1.00 193.62 ? 299  LYS C C     1 
ATOM   5882  O  O     . LYS C 2 299  ? 131.666 176.350 106.842 1.00 193.62 ? 299  LYS C O     1 
ATOM   5883  C  CB    . LYS C 2 299  ? 131.782 178.757 104.850 1.00 193.62 ? 299  LYS C CB    1 
ATOM   5884  C  CG    . LYS C 2 299  ? 132.440 179.844 104.018 1.00 193.62 ? 299  LYS C CG    1 
ATOM   5885  C  CD    . LYS C 2 299  ? 131.831 179.938 102.632 1.00 193.62 ? 299  LYS C CD    1 
ATOM   5886  C  CE    . LYS C 2 299  ? 132.208 181.247 101.960 1.00 193.62 ? 299  LYS C CE    1 
ATOM   5887  N  NZ    . LYS C 2 299  ? 131.775 182.427 102.759 1.00 193.62 ? 299  LYS C NZ    1 
ATOM   5888  N  N     . ASP C 2 300  ? 131.000 178.145 108.052 1.00 191.69 ? 300  ASP C N     1 
ATOM   5889  C  CA    . ASP C 2 300  ? 130.311 177.379 109.080 1.00 191.69 ? 300  ASP C CA    1 
ATOM   5890  C  C     . ASP C 2 300  ? 128.944 176.915 108.590 1.00 191.69 ? 300  ASP C C     1 
ATOM   5891  O  O     . ASP C 2 300  ? 128.283 177.582 107.791 1.00 191.69 ? 300  ASP C O     1 
ATOM   5892  C  CB    . ASP C 2 300  ? 130.156 178.232 110.342 1.00 191.69 ? 300  ASP C CB    1 
ATOM   5893  C  CG    . ASP C 2 300  ? 129.596 177.455 111.525 1.00 191.69 ? 300  ASP C CG    1 
ATOM   5894  O  OD1   . ASP C 2 300  ? 128.544 176.796 111.394 1.00 191.69 ? 300  ASP C OD1   1 
ATOM   5895  O  OD2   . ASP C 2 300  ? 130.213 177.522 112.607 1.00 191.69 ? 300  ASP C OD2   1 
ATOM   5896  N  N     . GLU C 2 301  ? 128.526 175.750 109.084 1.00 185.78 ? 301  GLU C N     1 
ATOM   5897  C  CA    . GLU C 2 301  ? 127.196 175.231 108.796 1.00 185.78 ? 301  GLU C CA    1 
ATOM   5898  C  C     . GLU C 2 301  ? 126.458 174.835 110.070 1.00 185.78 ? 301  GLU C C     1 
ATOM   5899  O  O     . GLU C 2 301  ? 125.242 175.026 110.171 1.00 185.78 ? 301  GLU C O     1 
ATOM   5900  C  CB    . GLU C 2 301  ? 127.283 174.034 107.846 1.00 185.78 ? 301  GLU C CB    1 
ATOM   5901  C  CG    . GLU C 2 301  ? 127.635 174.398 106.415 1.00 185.78 ? 301  GLU C CG    1 
ATOM   5902  C  CD    . GLU C 2 301  ? 126.491 175.075 105.688 1.00 185.78 ? 301  GLU C CD    1 
ATOM   5903  O  OE1   . GLU C 2 301  ? 125.344 175.001 106.177 1.00 185.78 ? 301  GLU C OE1   1 
ATOM   5904  O  OE2   . GLU C 2 301  ? 126.737 175.683 104.625 1.00 185.78 ? 301  GLU C OE2   1 
ATOM   5905  N  N     . VAL C 2 302  ? 127.181 174.284 111.046 1.00 180.18 ? 302  VAL C N     1 
ATOM   5906  C  CA    . VAL C 2 302  ? 126.547 173.614 112.177 1.00 180.18 ? 302  VAL C CA    1 
ATOM   5907  C  C     . VAL C 2 302  ? 126.901 174.271 113.507 1.00 180.18 ? 302  VAL C C     1 
ATOM   5908  O  O     . VAL C 2 302  ? 126.048 174.386 114.393 1.00 180.18 ? 302  VAL C O     1 
ATOM   5909  C  CB    . VAL C 2 302  ? 126.923 172.121 112.201 1.00 180.18 ? 302  VAL C CB    1 
ATOM   5910  C  CG1   . VAL C 2 302  ? 126.115 171.383 113.256 1.00 180.18 ? 302  VAL C CG1   1 
ATOM   5911  C  CG2   . VAL C 2 302  ? 126.713 171.496 110.832 1.00 180.18 ? 302  VAL C CG2   1 
ATOM   5912  N  N     . PHE C 2 303  ? 128.159 174.694 113.662 1.00 176.07 ? 303  PHE C N     1 
ATOM   5913  C  CA    . PHE C 2 303  ? 128.672 175.056 114.983 1.00 176.07 ? 303  PHE C CA    1 
ATOM   5914  C  C     . PHE C 2 303  ? 127.896 176.210 115.610 1.00 176.07 ? 303  PHE C C     1 
ATOM   5915  O  O     . PHE C 2 303  ? 127.600 176.196 116.810 1.00 176.07 ? 303  PHE C O     1 
ATOM   5916  C  CB    . PHE C 2 303  ? 130.158 175.398 114.890 1.00 176.07 ? 303  PHE C CB    1 
ATOM   5917  C  CG    . PHE C 2 303  ? 131.053 174.197 114.863 1.00 176.07 ? 303  PHE C CG    1 
ATOM   5918  C  CD1   . PHE C 2 303  ? 131.605 173.755 113.674 1.00 176.07 ? 303  PHE C CD1   1 
ATOM   5919  C  CD2   . PHE C 2 303  ? 131.340 173.507 116.027 1.00 176.07 ? 303  PHE C CD2   1 
ATOM   5920  C  CE1   . PHE C 2 303  ? 132.428 172.647 113.647 1.00 176.07 ? 303  PHE C CE1   1 
ATOM   5921  C  CE2   . PHE C 2 303  ? 132.163 172.399 116.007 1.00 176.07 ? 303  PHE C CE2   1 
ATOM   5922  C  CZ    . PHE C 2 303  ? 132.708 171.968 114.816 1.00 176.07 ? 303  PHE C CZ    1 
ATOM   5923  N  N     . LEU C 2 304  ? 127.559 177.227 114.813 1.00 177.09 ? 304  LEU C N     1 
ATOM   5924  C  CA    . LEU C 2 304  ? 126.873 178.387 115.384 1.00 177.09 ? 304  LEU C CA    1 
ATOM   5925  C  C     . LEU C 2 304  ? 125.472 178.044 115.876 1.00 177.09 ? 304  LEU C C     1 
ATOM   5926  O  O     . LEU C 2 304  ? 125.133 178.420 117.013 1.00 177.09 ? 304  LEU C O     1 
ATOM   5927  C  CB    . LEU C 2 304  ? 126.863 179.538 114.373 1.00 177.09 ? 304  LEU C CB    1 
ATOM   5928  C  CG    . LEU C 2 304  ? 126.114 180.803 114.793 1.00 177.09 ? 304  LEU C CG    1 
ATOM   5929  C  CD1   . LEU C 2 304  ? 126.837 181.493 115.938 1.00 177.09 ? 304  LEU C CD1   1 
ATOM   5930  C  CD2   . LEU C 2 304  ? 125.948 181.746 113.613 1.00 177.09 ? 304  LEU C CD2   1 
ATOM   5931  N  N     . PRO C 2 305  ? 124.613 177.362 115.106 1.00 171.07 ? 305  PRO C N     1 
ATOM   5932  C  CA    . PRO C 2 305  ? 123.289 177.018 115.652 1.00 171.07 ? 305  PRO C CA    1 
ATOM   5933  C  C     . PRO C 2 305  ? 123.341 176.103 116.865 1.00 171.07 ? 305  PRO C C     1 
ATOM   5934  O  O     . PRO C 2 305  ? 122.552 176.290 117.799 1.00 171.07 ? 305  PRO C O     1 
ATOM   5935  C  CB    . PRO C 2 305  ? 122.588 176.349 114.462 1.00 171.07 ? 305  PRO C CB    1 
ATOM   5936  C  CG    . PRO C 2 305  ? 123.246 176.933 113.273 1.00 171.07 ? 305  PRO C CG    1 
ATOM   5937  C  CD    . PRO C 2 305  ? 124.684 177.072 113.661 1.00 171.07 ? 305  PRO C CD    1 
ATOM   5938  N  N     . THR C 2 306  ? 124.240 175.115 116.888 1.00 168.71 ? 306  THR C N     1 
ATOM   5939  C  CA    . THR C 2 306  ? 124.293 174.229 118.048 1.00 168.71 ? 306  THR C CA    1 
ATOM   5940  C  C     . THR C 2 306  ? 124.832 174.958 119.274 1.00 168.71 ? 306  THR C C     1 
ATOM   5941  O  O     . THR C 2 306  ? 124.384 174.701 120.397 1.00 168.71 ? 306  THR C O     1 
ATOM   5942  C  CB    . THR C 2 306  ? 125.123 172.977 117.750 1.00 168.71 ? 306  THR C CB    1 
ATOM   5943  O  OG1   . THR C 2 306  ? 125.204 172.170 118.931 1.00 168.71 ? 306  THR C OG1   1 
ATOM   5944  C  CG2   . THR C 2 306  ? 126.522 173.332 117.314 1.00 168.71 ? 306  THR C CG2   1 
ATOM   5945  N  N     . LEU C 2 307  ? 125.784 175.876 119.085 1.00 172.19 ? 307  LEU C N     1 
ATOM   5946  C  CA    . LEU C 2 307  ? 126.234 176.694 120.206 1.00 172.19 ? 307  LEU C CA    1 
ATOM   5947  C  C     . LEU C 2 307  ? 125.106 177.576 120.723 1.00 172.19 ? 307  LEU C C     1 
ATOM   5948  O  O     . LEU C 2 307  ? 124.945 177.749 121.939 1.00 172.19 ? 307  LEU C O     1 
ATOM   5949  C  CB    . LEU C 2 307  ? 127.433 177.544 119.789 1.00 172.19 ? 307  LEU C CB    1 
ATOM   5950  C  CG    . LEU C 2 307  ? 128.295 178.095 120.925 1.00 172.19 ? 307  LEU C CG    1 
ATOM   5951  C  CD1   . LEU C 2 307  ? 128.586 177.013 121.953 1.00 172.19 ? 307  LEU C CD1   1 
ATOM   5952  C  CD2   . LEU C 2 307  ? 129.585 178.683 120.378 1.00 172.19 ? 307  LEU C CD2   1 
ATOM   5953  N  N     . ARG C 2 308  ? 124.314 178.145 119.810 1.00 168.24 ? 308  ARG C N     1 
ATOM   5954  C  CA    . ARG C 2 308  ? 123.142 178.915 120.212 1.00 168.24 ? 308  ARG C CA    1 
ATOM   5955  C  C     . ARG C 2 308  ? 122.191 178.061 121.039 1.00 168.24 ? 308  ARG C C     1 
ATOM   5956  O  O     . ARG C 2 308  ? 121.706 178.488 122.093 1.00 168.24 ? 308  ARG C O     1 
ATOM   5957  C  CB    . ARG C 2 308  ? 122.438 179.469 118.971 1.00 168.24 ? 308  ARG C CB    1 
ATOM   5958  C  CG    . ARG C 2 308  ? 121.304 180.448 119.248 1.00 168.24 ? 308  ARG C CG    1 
ATOM   5959  C  CD    . ARG C 2 308  ? 119.962 179.739 119.351 1.00 168.24 ? 308  ARG C CD    1 
ATOM   5960  N  NE    . ARG C 2 308  ? 119.639 179.004 118.132 1.00 168.24 ? 308  ARG C NE    1 
ATOM   5961  C  CZ    . ARG C 2 308  ? 118.721 178.045 118.060 1.00 168.24 ? 308  ARG C CZ    1 
ATOM   5962  N  NH1   . ARG C 2 308  ? 118.033 177.701 119.140 1.00 168.24 ? 308  ARG C NH1   1 
ATOM   5963  N  NH2   . ARG C 2 308  ? 118.494 177.428 116.909 1.00 168.24 ? 308  ARG C NH2   1 
ATOM   5964  N  N     . TYR C 2 309  ? 121.911 176.845 120.568 1.00 161.91 ? 309  TYR C N     1 
ATOM   5965  C  CA    . TYR C 2 309  ? 121.000 175.955 121.279 1.00 161.91 ? 309  TYR C CA    1 
ATOM   5966  C  C     . TYR C 2 309  ? 121.538 175.596 122.658 1.00 161.91 ? 309  TYR C C     1 
ATOM   5967  O  O     . TYR C 2 309  ? 120.779 175.546 123.631 1.00 161.91 ? 309  TYR C O     1 
ATOM   5968  C  CB    . TYR C 2 309  ? 120.756 174.693 120.454 1.00 161.91 ? 309  TYR C CB    1 
ATOM   5969  C  CG    . TYR C 2 309  ? 119.519 173.917 120.845 1.00 161.91 ? 309  TYR C CG    1 
ATOM   5970  C  CD1   . TYR C 2 309  ? 118.335 174.063 120.137 1.00 161.91 ? 309  TYR C CD1   1 
ATOM   5971  C  CD2   . TYR C 2 309  ? 119.538 173.031 121.912 1.00 161.91 ? 309  TYR C CD2   1 
ATOM   5972  C  CE1   . TYR C 2 309  ? 117.203 173.353 120.485 1.00 161.91 ? 309  TYR C CE1   1 
ATOM   5973  C  CE2   . TYR C 2 309  ? 118.411 172.316 122.267 1.00 161.91 ? 309  TYR C CE2   1 
ATOM   5974  C  CZ    . TYR C 2 309  ? 117.247 172.482 121.550 1.00 161.91 ? 309  TYR C CZ    1 
ATOM   5975  O  OH    . TYR C 2 309  ? 116.120 171.774 121.899 1.00 161.91 ? 309  TYR C OH    1 
ATOM   5976  N  N     . LEU C 2 310  ? 122.844 175.343 122.763 1.00 163.62 ? 310  LEU C N     1 
ATOM   5977  C  CA    . LEU C 2 310  ? 123.429 175.000 124.055 1.00 163.62 ? 310  LEU C CA    1 
ATOM   5978  C  C     . LEU C 2 310  ? 123.331 176.166 125.029 1.00 163.62 ? 310  LEU C C     1 
ATOM   5979  O  O     . LEU C 2 310  ? 122.929 175.990 126.186 1.00 163.62 ? 310  LEU C O     1 
ATOM   5980  C  CB    . LEU C 2 310  ? 124.884 174.567 123.877 1.00 163.62 ? 310  LEU C CB    1 
ATOM   5981  C  CG    . LEU C 2 310  ? 125.660 174.323 125.171 1.00 163.62 ? 310  LEU C CG    1 
ATOM   5982  C  CD1   . LEU C 2 310  ? 125.077 173.143 125.928 1.00 163.62 ? 310  LEU C CD1   1 
ATOM   5983  C  CD2   . LEU C 2 310  ? 127.132 174.093 124.876 1.00 163.62 ? 310  LEU C CD2   1 
ATOM   5984  N  N     . PHE C 2 311  ? 123.702 177.369 124.581 1.00 173.00 ? 311  PHE C N     1 
ATOM   5985  C  CA    . PHE C 2 311  ? 123.626 178.533 125.460 1.00 173.00 ? 311  PHE C CA    1 
ATOM   5986  C  C     . PHE C 2 311  ? 122.187 178.847 125.844 1.00 173.00 ? 311  PHE C C     1 
ATOM   5987  O  O     . PHE C 2 311  ? 121.927 179.346 126.945 1.00 173.00 ? 311  PHE C O     1 
ATOM   5988  C  CB    . PHE C 2 311  ? 124.290 179.742 124.804 1.00 173.00 ? 311  PHE C CB    1 
ATOM   5989  C  CG    . PHE C 2 311  ? 125.787 179.679 124.809 1.00 173.00 ? 311  PHE C CG    1 
ATOM   5990  C  CD1   . PHE C 2 311  ? 126.450 178.775 125.620 1.00 173.00 ? 311  PHE C CD1   1 
ATOM   5991  C  CD2   . PHE C 2 311  ? 126.532 180.528 124.014 1.00 173.00 ? 311  PHE C CD2   1 
ATOM   5992  C  CE1   . PHE C 2 311  ? 127.826 178.715 125.630 1.00 173.00 ? 311  PHE C CE1   1 
ATOM   5993  C  CE2   . PHE C 2 311  ? 127.911 180.471 124.022 1.00 173.00 ? 311  PHE C CE2   1 
ATOM   5994  C  CZ    . PHE C 2 311  ? 128.557 179.564 124.831 1.00 173.00 ? 311  PHE C CZ    1 
ATOM   5995  N  N     . ALA C 2 312  ? 121.238 178.572 124.950 1.00 169.63 ? 312  ALA C N     1 
ATOM   5996  C  CA    . ALA C 2 312  ? 119.835 178.744 125.306 1.00 169.63 ? 312  ALA C CA    1 
ATOM   5997  C  C     . ALA C 2 312  ? 119.401 177.731 126.357 1.00 169.63 ? 312  ALA C C     1 
ATOM   5998  O  O     . ALA C 2 312  ? 118.763 178.100 127.350 1.00 169.63 ? 312  ALA C O     1 
ATOM   5999  C  CB    . ALA C 2 312  ? 118.965 178.632 124.056 1.00 169.63 ? 312  ALA C CB    1 
ATOM   6000  N  N     . LEU C 2 313  ? 119.758 176.459 126.169 1.00 165.29 ? 313  LEU C N     1 
ATOM   6001  C  CA    . LEU C 2 313  ? 119.336 175.412 127.094 1.00 165.29 ? 313  LEU C CA    1 
ATOM   6002  C  C     . LEU C 2 313  ? 119.926 175.625 128.481 1.00 165.29 ? 313  LEU C C     1 
ATOM   6003  O  O     . LEU C 2 313  ? 119.223 175.503 129.491 1.00 165.29 ? 313  LEU C O     1 
ATOM   6004  C  CB    . LEU C 2 313  ? 119.734 174.041 126.548 1.00 165.29 ? 313  LEU C CB    1 
ATOM   6005  C  CG    . LEU C 2 313  ? 119.757 172.905 127.572 1.00 165.29 ? 313  LEU C CG    1 
ATOM   6006  C  CD1   . LEU C 2 313  ? 118.348 172.575 128.041 1.00 165.29 ? 313  LEU C CD1   1 
ATOM   6007  C  CD2   . LEU C 2 313  ? 120.439 171.677 126.995 1.00 165.29 ? 313  LEU C CD2   1 
ATOM   6008  N  N     . THR C 2 314  ? 121.220 175.946 128.553 1.00 169.32 ? 314  THR C N     1 
ATOM   6009  C  CA    . THR C 2 314  ? 121.870 176.076 129.855 1.00 169.32 ? 314  THR C CA    1 
ATOM   6010  C  C     . THR C 2 314  ? 121.286 177.230 130.662 1.00 169.32 ? 314  THR C C     1 
ATOM   6011  O  O     . THR C 2 314  ? 121.433 177.274 131.891 1.00 169.32 ? 314  THR C O     1 
ATOM   6012  C  CB    . THR C 2 314  ? 123.377 176.268 129.693 1.00 169.32 ? 314  THR C CB    1 
ATOM   6013  O  OG1   . THR C 2 314  ? 123.984 176.303 130.986 1.00 169.32 ? 314  THR C OG1   1 
ATOM   6014  C  CG2   . THR C 2 314  ? 123.672 177.574 128.985 1.00 169.32 ? 314  THR C CG2   1 
ATOM   6015  N  N     . ALA C 2 315  ? 120.621 178.177 129.993 1.00 170.25 ? 315  ALA C N     1 
ATOM   6016  C  CA    . ALA C 2 315  ? 119.991 179.275 130.717 1.00 170.25 ? 315  ALA C CA    1 
ATOM   6017  C  C     . ALA C 2 315  ? 118.551 178.973 131.124 1.00 170.25 ? 315  ALA C C     1 
ATOM   6018  O  O     . ALA C 2 315  ? 117.981 179.717 131.929 1.00 170.25 ? 315  ALA C O     1 
ATOM   6019  C  CB    . ALA C 2 315  ? 120.032 180.558 129.878 1.00 170.25 ? 315  ALA C CB    1 
ATOM   6020  N  N     . GLY C 2 316  ? 117.952 177.911 130.596 1.00 169.69 ? 316  GLY C N     1 
ATOM   6021  C  CA    . GLY C 2 316  ? 116.602 177.551 130.977 1.00 169.69 ? 316  GLY C CA    1 
ATOM   6022  C  C     . GLY C 2 316  ? 115.502 178.176 130.150 1.00 169.69 ? 316  GLY C C     1 
ATOM   6023  O  O     . GLY C 2 316  ? 114.423 178.458 130.680 1.00 169.69 ? 316  GLY C O     1 
ATOM   6024  N  N     . VAL C 2 317  ? 115.746 178.423 128.871 1.00 171.90 ? 317  VAL C N     1 
ATOM   6025  C  CA    . VAL C 2 317  ? 114.671 178.913 128.000 1.00 171.90 ? 317  VAL C CA    1 
ATOM   6026  C  C     . VAL C 2 317  ? 113.675 177.780 127.764 1.00 171.90 ? 317  VAL C C     1 
ATOM   6027  O  O     . VAL C 2 317  ? 114.083 176.607 127.688 1.00 171.90 ? 317  VAL C O     1 
ATOM   6028  C  CB    . VAL C 2 317  ? 115.252 179.427 126.677 1.00 171.90 ? 317  VAL C CB    1 
ATOM   6029  C  CG1   . VAL C 2 317  ? 115.982 178.313 125.944 1.00 171.90 ? 317  VAL C CG1   1 
ATOM   6030  C  CG2   . VAL C 2 317  ? 114.169 180.031 125.792 1.00 171.90 ? 317  VAL C CG2   1 
ATOM   6031  N  N     . PRO C 2 318  ? 112.376 178.058 127.680 1.00 171.07 ? 318  PRO C N     1 
ATOM   6032  C  CA    . PRO C 2 318  ? 111.425 176.991 127.352 1.00 171.07 ? 318  PRO C CA    1 
ATOM   6033  C  C     . PRO C 2 318  ? 111.623 176.492 125.929 1.00 171.07 ? 318  PRO C C     1 
ATOM   6034  O  O     . PRO C 2 318  ? 112.070 177.228 125.047 1.00 171.07 ? 318  PRO C O     1 
ATOM   6035  C  CB    . PRO C 2 318  ? 110.059 177.665 127.528 1.00 171.07 ? 318  PRO C CB    1 
ATOM   6036  C  CG    . PRO C 2 318  ? 110.314 178.818 128.435 1.00 171.07 ? 318  PRO C CG    1 
ATOM   6037  C  CD    . PRO C 2 318  ? 111.698 179.288 128.121 1.00 171.07 ? 318  PRO C CD    1 
ATOM   6038  N  N     . GLY C 2 319  ? 111.281 175.223 125.712 1.00 165.88 ? 319  GLY C N     1 
ATOM   6039  C  CA    . GLY C 2 319  ? 111.368 174.608 124.404 1.00 165.88 ? 319  GLY C CA    1 
ATOM   6040  C  C     . GLY C 2 319  ? 112.673 173.909 124.098 1.00 165.88 ? 319  GLY C C     1 
ATOM   6041  O  O     . GLY C 2 319  ? 112.861 173.462 122.960 1.00 165.88 ? 319  GLY C O     1 
ATOM   6042  N  N     . HIS C 2 320  ? 113.578 173.798 125.067 1.00 164.10 ? 320  HIS C N     1 
ATOM   6043  C  CA    . HIS C 2 320  ? 114.865 173.142 124.877 1.00 164.10 ? 320  HIS C CA    1 
ATOM   6044  C  C     . HIS C 2 320  ? 114.992 172.004 125.878 1.00 164.10 ? 320  HIS C C     1 
ATOM   6045  O  O     . HIS C 2 320  ? 114.986 172.236 127.091 1.00 164.10 ? 320  HIS C O     1 
ATOM   6046  C  CB    . HIS C 2 320  ? 116.020 174.134 125.042 1.00 164.10 ? 320  HIS C CB    1 
ATOM   6047  C  CG    . HIS C 2 320  ? 116.047 175.210 124.000 1.00 164.10 ? 320  HIS C CG    1 
ATOM   6048  N  ND1   . HIS C 2 320  ? 114.960 176.012 123.729 1.00 164.10 ? 320  HIS C ND1   1 
ATOM   6049  C  CD2   . HIS C 2 320  ? 117.030 175.613 123.162 1.00 164.10 ? 320  HIS C CD2   1 
ATOM   6050  C  CE1   . HIS C 2 320  ? 115.272 176.864 122.769 1.00 164.10 ? 320  HIS C CE1   1 
ATOM   6051  N  NE2   . HIS C 2 320  ? 116.523 176.643 122.407 1.00 164.10 ? 320  HIS C NE2   1 
ATOM   6052  N  N     . GLU C 2 321  ? 115.105 170.780 125.369 1.00 156.96 ? 321  GLU C N     1 
ATOM   6053  C  CA    . GLU C 2 321  ? 115.100 169.585 126.198 1.00 156.96 ? 321  GLU C CA    1 
ATOM   6054  C  C     . GLU C 2 321  ? 116.299 168.713 125.856 1.00 156.96 ? 321  GLU C C     1 
ATOM   6055  O  O     . GLU C 2 321  ? 116.750 168.659 124.710 1.00 156.96 ? 321  GLU C O     1 
ATOM   6056  C  CB    . GLU C 2 321  ? 113.808 168.769 126.021 1.00 156.96 ? 321  GLU C CB    1 
ATOM   6057  C  CG    . GLU C 2 321  ? 112.514 169.515 126.335 1.00 156.96 ? 321  GLU C CG    1 
ATOM   6058  C  CD    . GLU C 2 321  ? 112.154 170.553 125.287 1.00 156.96 ? 321  GLU C CD    1 
ATOM   6059  O  OE1   . GLU C 2 321  ? 112.690 170.474 124.161 1.00 156.96 ? 321  GLU C OE1   1 
ATOM   6060  O  OE2   . GLU C 2 321  ? 111.338 171.448 125.591 1.00 156.96 ? 321  GLU C OE2   1 
ATOM   6061  N  N     . VAL C 2 322  ? 116.811 168.023 126.873 1.00 145.84 ? 322  VAL C N     1 
ATOM   6062  C  CA    . VAL C 2 322  ? 117.875 167.054 126.655 1.00 145.84 ? 322  VAL C CA    1 
ATOM   6063  C  C     . VAL C 2 322  ? 117.320 165.842 125.913 1.00 145.84 ? 322  VAL C C     1 
ATOM   6064  O  O     . VAL C 2 322  ? 116.109 165.624 125.836 1.00 145.84 ? 322  VAL C O     1 
ATOM   6065  C  CB    . VAL C 2 322  ? 118.532 166.642 127.983 1.00 145.84 ? 322  VAL C CB    1 
ATOM   6066  C  CG1   . VAL C 2 322  ? 118.965 167.871 128.762 1.00 145.84 ? 322  VAL C CG1   1 
ATOM   6067  C  CG2   . VAL C 2 322  ? 117.577 165.794 128.803 1.00 145.84 ? 322  VAL C CG2   1 
ATOM   6068  N  N     . ASP C 2 323  ? 118.225 165.044 125.357 1.00 140.87 ? 323  ASP C N     1 
ATOM   6069  C  CA    . ASP C 2 323  ? 117.855 163.880 124.566 1.00 140.87 ? 323  ASP C CA    1 
ATOM   6070  C  C     . ASP C 2 323  ? 118.248 162.605 125.298 1.00 140.87 ? 323  ASP C C     1 
ATOM   6071  O  O     . ASP C 2 323  ? 119.360 162.502 125.825 1.00 140.87 ? 323  ASP C O     1 
ATOM   6072  C  CB    . ASP C 2 323  ? 118.521 163.923 123.191 1.00 140.87 ? 323  ASP C CB    1 
ATOM   6073  C  CG    . ASP C 2 323  ? 118.004 165.057 122.331 1.00 140.87 ? 323  ASP C CG    1 
ATOM   6074  O  OD1   . ASP C 2 323  ? 116.832 165.451 122.508 1.00 140.87 ? 323  ASP C OD1   1 
ATOM   6075  O  OD2   . ASP C 2 323  ? 118.767 165.556 121.478 1.00 140.87 ? 323  ASP C OD2   1 
ATOM   6076  N  N     . ASP C 2 324  ? 117.333 161.641 125.329 1.00 129.99 ? 324  ASP C N     1 
ATOM   6077  C  CA    . ASP C 2 324  ? 117.615 160.334 125.906 1.00 129.99 ? 324  ASP C CA    1 
ATOM   6078  C  C     . ASP C 2 324  ? 118.343 159.482 124.874 1.00 129.99 ? 324  ASP C C     1 
ATOM   6079  O  O     . ASP C 2 324  ? 117.877 159.343 123.738 1.00 129.99 ? 324  ASP C O     1 
ATOM   6080  C  CB    . ASP C 2 324  ? 116.322 159.659 126.355 1.00 129.99 ? 324  ASP C CB    1 
ATOM   6081  C  CG    . ASP C 2 324  ? 116.554 158.602 127.414 1.00 129.99 ? 324  ASP C CG    1 
ATOM   6082  O  OD1   . ASP C 2 324  ? 117.724 158.224 127.631 1.00 129.99 ? 324  ASP C OD1   1 
ATOM   6083  O  OD2   . ASP C 2 324  ? 115.567 158.149 128.030 1.00 129.99 ? 324  ASP C OD2   1 
ATOM   6084  N  N     . ILE C 2 325  ? 119.486 158.912 125.265 1.00 126.92 ? 325  ILE C N     1 
ATOM   6085  C  CA    . ILE C 2 325  ? 120.294 158.139 124.325 1.00 126.92 ? 325  ILE C CA    1 
ATOM   6086  C  C     . ILE C 2 325  ? 119.749 156.744 124.076 1.00 126.92 ? 325  ILE C C     1 
ATOM   6087  O  O     . ILE C 2 325  ? 120.341 155.991 123.293 1.00 126.92 ? 325  ILE C O     1 
ATOM   6088  C  CB    . ILE C 2 325  ? 121.749 158.032 124.815 1.00 126.92 ? 325  ILE C CB    1 
ATOM   6089  C  CG1   . ILE C 2 325  ? 121.853 157.030 125.965 1.00 126.92 ? 325  ILE C CG1   1 
ATOM   6090  C  CG2   . ILE C 2 325  ? 122.263 159.394 125.245 1.00 126.92 ? 325  ILE C CG2   1 
ATOM   6091  C  CD1   . ILE C 2 325  ? 123.266 156.805 126.451 1.00 126.92 ? 325  ILE C CD1   1 
ATOM   6092  N  N     . ASP C 2 326  ? 118.641 156.374 124.713 1.00 125.44 ? 326  ASP C N     1 
ATOM   6093  C  CA    . ASP C 2 326  ? 117.996 155.091 124.476 1.00 125.44 ? 326  ASP C CA    1 
ATOM   6094  C  C     . ASP C 2 326  ? 116.638 155.233 123.808 1.00 125.44 ? 326  ASP C C     1 
ATOM   6095  O  O     . ASP C 2 326  ? 116.035 154.221 123.441 1.00 125.44 ? 326  ASP C O     1 
ATOM   6096  C  CB    . ASP C 2 326  ? 117.850 154.323 125.791 1.00 125.44 ? 326  ASP C CB    1 
ATOM   6097  C  CG    . ASP C 2 326  ? 119.157 154.217 126.546 1.00 125.44 ? 326  ASP C CG    1 
ATOM   6098  O  OD1   . ASP C 2 326  ? 120.218 154.185 125.890 1.00 125.44 ? 326  ASP C OD1   1 
ATOM   6099  O  OD2   . ASP C 2 326  ? 119.123 154.166 127.793 1.00 125.44 ? 326  ASP C OD2   1 
ATOM   6100  N  N     . HIS C 2 327  ? 116.141 156.458 123.659 1.00 114.11 ? 327  HIS C N     1 
ATOM   6101  C  CA    . HIS C 2 327  ? 114.928 156.694 122.891 1.00 114.11 ? 327  HIS C CA    1 
ATOM   6102  C  C     . HIS C 2 327  ? 115.097 156.158 121.476 1.00 114.11 ? 327  HIS C C     1 
ATOM   6103  O  O     . HIS C 2 327  ? 116.089 156.446 120.801 1.00 114.11 ? 327  HIS C O     1 
ATOM   6104  C  CB    . HIS C 2 327  ? 114.620 158.190 122.863 1.00 114.11 ? 327  HIS C CB    1 
ATOM   6105  C  CG    . HIS C 2 327  ? 113.211 158.515 122.483 1.00 114.11 ? 327  HIS C CG    1 
ATOM   6106  N  ND1   . HIS C 2 327  ? 112.767 158.488 121.179 1.00 114.11 ? 327  HIS C ND1   1 
ATOM   6107  C  CD2   . HIS C 2 327  ? 112.149 158.890 123.235 1.00 114.11 ? 327  HIS C CD2   1 
ATOM   6108  C  CE1   . HIS C 2 327  ? 111.490 158.826 121.145 1.00 114.11 ? 327  HIS C CE1   1 
ATOM   6109  N  NE2   . HIS C 2 327  ? 111.092 159.075 122.379 1.00 114.11 ? 327  HIS C NE2   1 
ATOM   6110  N  N     . LEU C 2 328  ? 114.121 155.375 121.021 1.00 106.04 ? 328  LEU C N     1 
ATOM   6111  C  CA    . LEU C 2 328  ? 114.235 154.727 119.720 1.00 106.04 ? 328  LEU C CA    1 
ATOM   6112  C  C     . LEU C 2 328  ? 114.085 155.693 118.554 1.00 106.04 ? 328  LEU C C     1 
ATOM   6113  O  O     . LEU C 2 328  ? 114.045 155.246 117.404 1.00 106.04 ? 328  LEU C O     1 
ATOM   6114  C  CB    . LEU C 2 328  ? 113.205 153.604 119.595 1.00 106.04 ? 328  LEU C CB    1 
ATOM   6115  C  CG    . LEU C 2 328  ? 113.702 152.237 120.065 1.00 106.04 ? 328  LEU C CG    1 
ATOM   6116  C  CD1   . LEU C 2 328  ? 112.606 151.197 119.948 1.00 106.04 ? 328  LEU C CD1   1 
ATOM   6117  C  CD2   . LEU C 2 328  ? 114.924 151.820 119.270 1.00 106.04 ? 328  LEU C CD2   1 
ATOM   6118  N  N     . GLY C 2 329  ? 113.995 156.997 118.820 1.00 111.80 ? 329  GLY C N     1 
ATOM   6119  C  CA    . GLY C 2 329  ? 114.174 157.974 117.764 1.00 111.80 ? 329  GLY C CA    1 
ATOM   6120  C  C     . GLY C 2 329  ? 115.611 158.427 117.640 1.00 111.80 ? 329  GLY C C     1 
ATOM   6121  O  O     . GLY C 2 329  ? 115.951 159.174 116.718 1.00 111.80 ? 329  GLY C O     1 
ATOM   6122  N  N     . ASN C 2 330  ? 116.468 157.989 118.560 1.00 114.23 ? 330  ASN C N     1 
ATOM   6123  C  CA    . ASN C 2 330  ? 117.884 158.321 118.551 1.00 114.23 ? 330  ASN C CA    1 
ATOM   6124  C  C     . ASN C 2 330  ? 118.768 157.124 118.235 1.00 114.23 ? 330  ASN C C     1 
ATOM   6125  O  O     . ASN C 2 330  ? 119.986 157.283 118.121 1.00 114.23 ? 330  ASN C O     1 
ATOM   6126  C  CB    . ASN C 2 330  ? 118.292 158.916 119.900 1.00 114.23 ? 330  ASN C CB    1 
ATOM   6127  C  CG    . ASN C 2 330  ? 117.553 160.196 120.216 1.00 114.23 ? 330  ASN C CG    1 
ATOM   6128  O  OD1   . ASN C 2 330  ? 117.241 160.982 119.322 1.00 114.23 ? 330  ASN C OD1   1 
ATOM   6129  N  ND2   . ASN C 2 330  ? 117.265 160.414 121.493 1.00 114.23 ? 330  ASN C ND2   1 
ATOM   6130  N  N     . ARG C 2 331  ? 118.188 155.936 118.095 1.00 108.92 ? 331  ARG C N     1 
ATOM   6131  C  CA    . ARG C 2 331  ? 118.917 154.733 117.723 1.00 108.92 ? 331  ARG C CA    1 
ATOM   6132  C  C     . ARG C 2 331  ? 118.357 154.216 116.408 1.00 108.92 ? 331  ARG C C     1 
ATOM   6133  O  O     . ARG C 2 331  ? 117.145 154.280 116.179 1.00 108.92 ? 331  ARG C O     1 
ATOM   6134  C  CB    . ARG C 2 331  ? 118.808 153.660 118.809 1.00 108.92 ? 331  ARG C CB    1 
ATOM   6135  C  CG    . ARG C 2 331  ? 119.915 153.707 119.842 1.00 108.92 ? 331  ARG C CG    1 
ATOM   6136  C  CD    . ARG C 2 331  ? 119.415 153.272 121.206 1.00 108.92 ? 331  ARG C CD    1 
ATOM   6137  N  NE    . ARG C 2 331  ? 119.225 151.827 121.286 1.00 108.92 ? 331  ARG C NE    1 
ATOM   6138  C  CZ    . ARG C 2 331  ? 120.198 150.960 121.540 1.00 108.92 ? 331  ARG C CZ    1 
ATOM   6139  N  NH1   . ARG C 2 331  ? 119.936 149.662 121.595 1.00 108.92 ? 331  ARG C NH1   1 
ATOM   6140  N  NH2   . ARG C 2 331  ? 121.436 151.389 121.736 1.00 108.92 ? 331  ARG C NH2   1 
ATOM   6141  N  N     . ARG C 2 332  ? 119.233 153.706 115.550 1.00 107.03 ? 332  ARG C N     1 
ATOM   6142  C  CA    . ARG C 2 332  ? 118.832 153.247 114.232 1.00 107.03 ? 332  ARG C CA    1 
ATOM   6143  C  C     . ARG C 2 332  ? 119.426 151.877 113.939 1.00 107.03 ? 332  ARG C C     1 
ATOM   6144  O  O     . ARG C 2 332  ? 120.299 151.377 114.658 1.00 107.03 ? 332  ARG C O     1 
ATOM   6145  C  CB    . ARG C 2 332  ? 119.245 154.239 113.139 1.00 107.03 ? 332  ARG C CB    1 
ATOM   6146  C  CG    . ARG C 2 332  ? 120.736 154.461 113.023 1.00 107.03 ? 332  ARG C CG    1 
ATOM   6147  C  CD    . ARG C 2 332  ? 121.031 155.620 112.091 1.00 107.03 ? 332  ARG C CD    1 
ATOM   6148  N  NE    . ARG C 2 332  ? 120.804 155.269 110.693 1.00 107.03 ? 332  ARG C NE    1 
ATOM   6149  C  CZ    . ARG C 2 332  ? 121.668 154.592 109.945 1.00 107.03 ? 332  ARG C CZ    1 
ATOM   6150  N  NH1   . ARG C 2 332  ? 122.823 154.195 110.458 1.00 107.03 ? 332  ARG C NH1   1 
ATOM   6151  N  NH2   . ARG C 2 332  ? 121.379 154.314 108.682 1.00 107.03 ? 332  ARG C NH2   1 
ATOM   6152  N  N     . ILE C 2 333  ? 118.927 151.276 112.859 1.00 106.79 ? 333  ILE C N     1 
ATOM   6153  C  CA    . ILE C 2 333  ? 119.281 149.921 112.457 1.00 106.79 ? 333  ILE C CA    1 
ATOM   6154  C  C     . ILE C 2 333  ? 120.010 149.975 111.124 1.00 106.79 ? 333  ILE C C     1 
ATOM   6155  O  O     . ILE C 2 333  ? 119.523 150.585 110.164 1.00 106.79 ? 333  ILE C O     1 
ATOM   6156  C  CB    . ILE C 2 333  ? 118.032 149.030 112.349 1.00 106.79 ? 333  ILE C CB    1 
ATOM   6157  C  CG1   . ILE C 2 333  ? 117.072 149.297 113.507 1.00 106.79 ? 333  ILE C CG1   1 
ATOM   6158  C  CG2   . ILE C 2 333  ? 118.426 147.566 112.319 1.00 106.79 ? 333  ILE C CG2   1 
ATOM   6159  C  CD1   . ILE C 2 333  ? 117.619 148.906 114.847 1.00 106.79 ? 333  ILE C CD1   1 
ATOM   6160  N  N     . ARG C 2 334  ? 121.173 149.337 111.062 1.00 111.88 ? 334  ARG C N     1 
ATOM   6161  C  CA    . ARG C 2 334  ? 121.882 149.096 109.814 1.00 111.88 ? 334  ARG C CA    1 
ATOM   6162  C  C     . ARG C 2 334  ? 121.546 147.682 109.364 1.00 111.88 ? 334  ARG C C     1 
ATOM   6163  O  O     . ARG C 2 334  ? 121.840 146.710 110.070 1.00 111.88 ? 334  ARG C O     1 
ATOM   6164  C  CB    . ARG C 2 334  ? 123.388 149.265 109.984 1.00 111.88 ? 334  ARG C CB    1 
ATOM   6165  C  CG    . ARG C 2 334  ? 123.792 150.327 110.974 1.00 111.88 ? 334  ARG C CG    1 
ATOM   6166  C  CD    . ARG C 2 334  ? 125.277 150.243 111.274 1.00 111.88 ? 334  ARG C CD    1 
ATOM   6167  N  NE    . ARG C 2 334  ? 126.090 150.693 110.150 1.00 111.88 ? 334  ARG C NE    1 
ATOM   6168  C  CZ    . ARG C 2 334  ? 127.403 150.514 110.064 1.00 111.88 ? 334  ARG C CZ    1 
ATOM   6169  N  NH1   . ARG C 2 334  ? 128.052 149.892 111.038 1.00 111.88 ? 334  ARG C NH1   1 
ATOM   6170  N  NH2   . ARG C 2 334  ? 128.067 150.956 109.006 1.00 111.88 ? 334  ARG C NH2   1 
ATOM   6171  N  N     . THR C 2 335  ? 120.899 147.632 108.196 1.00 113.42 ? 335  THR C N     1 
ATOM   6172  C  CA    . THR C 2 335  ? 120.525 146.396 107.457 1.00 113.42 ? 335  THR C CA    1 
ATOM   6173  C  C     . THR C 2 335  ? 121.730 145.896 106.641 1.00 113.42 ? 335  THR C C     1 
ATOM   6174  O  O     . THR C 2 335  ? 122.739 146.627 106.526 1.00 113.42 ? 335  THR C O     1 
ATOM   6175  C  CB    . THR C 2 335  ? 119.261 146.611 106.615 1.00 113.42 ? 335  THR C CB    1 
ATOM   6176  O  OG1   . THR C 2 335  ? 119.356 147.893 105.996 1.00 113.42 ? 335  THR C OG1   1 
ATOM   6177  C  CG2   . THR C 2 335  ? 117.993 146.545 107.437 1.00 113.42 ? 335  THR C CG2   1 
ATOM   6178  N  N     . VAL C 2 336  ? 121.631 144.686 106.092 1.00 111.62 ? 336  VAL C N     1 
ATOM   6179  C  CA    . VAL C 2 336  ? 122.739 144.086 105.352 1.00 111.62 ? 336  VAL C CA    1 
ATOM   6180  C  C     . VAL C 2 336  ? 123.244 145.043 104.277 1.00 111.62 ? 336  VAL C C     1 
ATOM   6181  O  O     . VAL C 2 336  ? 124.447 145.113 103.994 1.00 111.62 ? 336  VAL C O     1 
ATOM   6182  C  CB    . VAL C 2 336  ? 122.316 142.729 104.759 1.00 111.62 ? 336  VAL C CB    1 
ATOM   6183  C  CG1   . VAL C 2 336  ? 121.140 142.892 103.811 1.00 111.62 ? 336  VAL C CG1   1 
ATOM   6184  C  CG2   . VAL C 2 336  ? 123.484 142.082 104.041 1.00 111.62 ? 336  VAL C CG2   1 
ATOM   6185  N  N     . GLY C 2 337  ? 122.327 145.798 103.668 1.00 114.04 ? 337  GLY C N     1 
ATOM   6186  C  CA    . GLY C 2 337  ? 122.717 146.698 102.595 1.00 114.04 ? 337  GLY C CA    1 
ATOM   6187  C  C     . GLY C 2 337  ? 123.731 147.734 103.037 1.00 114.04 ? 337  GLY C C     1 
ATOM   6188  O  O     . GLY C 2 337  ? 124.746 147.950 102.373 1.00 114.04 ? 337  GLY C O     1 
ATOM   6189  N  N     . GLU C 2 338  ? 123.475 148.381 104.176 1.00 118.27 ? 338  GLU C N     1 
ATOM   6190  C  CA    . GLU C 2 338  ? 124.367 149.438 104.639 1.00 118.27 ? 338  GLU C CA    1 
ATOM   6191  C  C     . GLU C 2 338  ? 125.732 148.883 105.028 1.00 118.27 ? 338  GLU C C     1 
ATOM   6192  O  O     . GLU C 2 338  ? 126.764 149.500 104.742 1.00 118.27 ? 338  GLU C O     1 
ATOM   6193  C  CB    . GLU C 2 338  ? 123.735 150.182 105.814 1.00 118.27 ? 338  GLU C CB    1 
ATOM   6194  C  CG    . GLU C 2 338  ? 124.559 151.356 106.311 1.00 118.27 ? 338  GLU C CG    1 
ATOM   6195  C  CD    . GLU C 2 338  ? 124.067 151.896 107.638 1.00 118.27 ? 338  GLU C CD    1 
ATOM   6196  O  OE1   . GLU C 2 338  ? 122.846 152.120 107.775 1.00 118.27 ? 338  GLU C OE1   1 
ATOM   6197  O  OE2   . GLU C 2 338  ? 124.903 152.100 108.542 1.00 118.27 ? 338  GLU C OE2   1 
ATOM   6198  N  N     . LEU C 2 339  ? 125.759 147.720 105.680 1.00 116.34 ? 339  LEU C N     1 
ATOM   6199  C  CA    . LEU C 2 339  ? 127.031 147.117 106.068 1.00 116.34 ? 339  LEU C CA    1 
ATOM   6200  C  C     . LEU C 2 339  ? 127.854 146.739 104.842 1.00 116.34 ? 339  LEU C C     1 
ATOM   6201  O  O     . LEU C 2 339  ? 129.061 147.024 104.771 1.00 116.34 ? 339  LEU C O     1 
ATOM   6202  C  CB    . LEU C 2 339  ? 126.776 145.893 106.945 1.00 116.34 ? 339  LEU C CB    1 
ATOM   6203  C  CG    . LEU C 2 339  ? 126.006 146.154 108.239 1.00 116.34 ? 339  LEU C CG    1 
ATOM   6204  C  CD1   . LEU C 2 339  ? 125.419 144.863 108.771 1.00 116.34 ? 339  LEU C CD1   1 
ATOM   6205  C  CD2   . LEU C 2 339  ? 126.906 146.801 109.272 1.00 116.34 ? 339  LEU C CD2   1 
ATOM   6206  N  N     . MET C 2 340  ? 127.219 146.078 103.871 1.00 124.97 ? 340  MET C N     1 
ATOM   6207  C  CA    . MET C 2 340  ? 127.922 145.733 102.641 1.00 124.97 ? 340  MET C CA    1 
ATOM   6208  C  C     . MET C 2 340  ? 128.418 146.984 101.931 1.00 124.97 ? 340  MET C C     1 
ATOM   6209  O  O     . MET C 2 340  ? 129.533 147.007 101.403 1.00 124.97 ? 340  MET C O     1 
ATOM   6210  C  CB    . MET C 2 340  ? 127.019 144.919 101.717 1.00 124.97 ? 340  MET C CB    1 
ATOM   6211  C  CG    . MET C 2 340  ? 127.541 144.854 100.291 1.00 124.97 ? 340  MET C CG    1 
ATOM   6212  S  SD    . MET C 2 340  ? 126.368 144.174 99.111  1.00 124.97 ? 340  MET C SD    1 
ATOM   6213  C  CE    . MET C 2 340  ? 127.092 144.732 97.572  1.00 124.97 ? 340  MET C CE    1 
ATOM   6214  N  N     . THR C 2 341  ? 127.603 148.041 101.914 1.00 123.50 ? 341  THR C N     1 
ATOM   6215  C  CA    . THR C 2 341  ? 128.011 149.276 101.256 1.00 123.50 ? 341  THR C CA    1 
ATOM   6216  C  C     . THR C 2 341  ? 129.205 149.906 101.958 1.00 123.50 ? 341  THR C C     1 
ATOM   6217  O  O     . THR C 2 341  ? 130.105 150.441 101.304 1.00 123.50 ? 341  THR C O     1 
ATOM   6218  C  CB    . THR C 2 341  ? 126.840 150.254 101.207 1.00 123.50 ? 341  THR C CB    1 
ATOM   6219  O  OG1   . THR C 2 341  ? 125.712 149.617 100.596 1.00 123.50 ? 341  THR C OG1   1 
ATOM   6220  C  CG2   . THR C 2 341  ? 127.211 151.488 100.404 1.00 123.50 ? 341  THR C CG2   1 
ATOM   6221  N  N     . ASP C 2 342  ? 129.238 149.846 103.289 1.00 128.58 ? 342  ASP C N     1 
ATOM   6222  C  CA    . ASP C 2 342  ? 130.374 150.390 104.026 1.00 128.58 ? 342  ASP C CA    1 
ATOM   6223  C  C     . ASP C 2 342  ? 131.651 149.623 103.706 1.00 128.58 ? 342  ASP C C     1 
ATOM   6224  O  O     . ASP C 2 342  ? 132.704 150.221 103.441 1.00 128.58 ? 342  ASP C O     1 
ATOM   6225  C  CB    . ASP C 2 342  ? 130.088 150.361 105.526 1.00 128.58 ? 342  ASP C CB    1 
ATOM   6226  C  CG    . ASP C 2 342  ? 129.423 151.630 106.016 1.00 128.58 ? 342  ASP C CG    1 
ATOM   6227  O  OD1   . ASP C 2 342  ? 128.900 152.390 105.174 1.00 128.58 ? 342  ASP C OD1   1 
ATOM   6228  O  OD2   . ASP C 2 342  ? 129.422 151.869 107.241 1.00 128.58 ? 342  ASP C OD2   1 
ATOM   6229  N  N     . GLN C 2 343  ? 131.579 148.290 103.733 1.00 124.52 ? 343  GLN C N     1 
ATOM   6230  C  CA    . GLN C 2 343  ? 132.762 147.496 103.408 1.00 124.52 ? 343  GLN C CA    1 
ATOM   6231  C  C     . GLN C 2 343  ? 133.200 147.727 101.966 1.00 124.52 ? 343  GLN C C     1 
ATOM   6232  O  O     . GLN C 2 343  ? 134.401 147.795 101.671 1.00 124.52 ? 343  GLN C O     1 
ATOM   6233  C  CB    . GLN C 2 343  ? 132.485 146.016 103.661 1.00 124.52 ? 343  GLN C CB    1 
ATOM   6234  C  CG    . GLN C 2 343  ? 132.431 145.653 105.132 1.00 124.52 ? 343  GLN C CG    1 
ATOM   6235  C  CD    . GLN C 2 343  ? 133.597 146.220 105.912 1.00 124.52 ? 343  GLN C CD    1 
ATOM   6236  O  OE1   . GLN C 2 343  ? 134.757 145.995 105.569 1.00 124.52 ? 343  GLN C OE1   1 
ATOM   6237  N  NE2   . GLN C 2 343  ? 133.296 146.963 106.969 1.00 124.52 ? 343  GLN C NE2   1 
ATOM   6238  N  N     . PHE C 2 344  ? 132.234 147.870 101.058 1.00 129.64 ? 344  PHE C N     1 
ATOM   6239  C  CA    . PHE C 2 344  ? 132.544 148.139 99.660  1.00 129.64 ? 344  PHE C CA    1 
ATOM   6240  C  C     . PHE C 2 344  ? 133.219 149.494 99.506  1.00 129.64 ? 344  PHE C C     1 
ATOM   6241  O  O     . PHE C 2 344  ? 134.144 149.651 98.706  1.00 129.64 ? 344  PHE C O     1 
ATOM   6242  C  CB    . PHE C 2 344  ? 131.262 148.073 98.832  1.00 129.64 ? 344  PHE C CB    1 
ATOM   6243  C  CG    . PHE C 2 344  ? 131.490 148.104 97.353  1.00 129.64 ? 344  PHE C CG    1 
ATOM   6244  C  CD1   . PHE C 2 344  ? 131.419 149.296 96.654  1.00 129.64 ? 344  PHE C CD1   1 
ATOM   6245  C  CD2   . PHE C 2 344  ? 131.762 146.941 96.657  1.00 129.64 ? 344  PHE C CD2   1 
ATOM   6246  C  CE1   . PHE C 2 344  ? 131.624 149.328 95.291  1.00 129.64 ? 344  PHE C CE1   1 
ATOM   6247  C  CE2   . PHE C 2 344  ? 131.967 146.965 95.294  1.00 129.64 ? 344  PHE C CE2   1 
ATOM   6248  C  CZ    . PHE C 2 344  ? 131.899 148.161 94.609  1.00 129.64 ? 344  PHE C CZ    1 
ATOM   6249  N  N     . ARG C 2 345  ? 132.766 150.488 100.271 1.00 135.77 ? 345  ARG C N     1 
ATOM   6250  C  CA    . ARG C 2 345  ? 133.381 151.808 100.216 1.00 135.77 ? 345  ARG C CA    1 
ATOM   6251  C  C     . ARG C 2 345  ? 134.810 151.771 100.740 1.00 135.77 ? 345  ARG C C     1 
ATOM   6252  O  O     . ARG C 2 345  ? 135.699 152.426 100.186 1.00 135.77 ? 345  ARG C O     1 
ATOM   6253  C  CB    . ARG C 2 345  ? 132.537 152.809 101.005 1.00 135.77 ? 345  ARG C CB    1 
ATOM   6254  C  CG    . ARG C 2 345  ? 133.326 153.936 101.645 1.00 135.77 ? 345  ARG C CG    1 
ATOM   6255  C  CD    . ARG C 2 345  ? 132.452 154.747 102.583 1.00 135.77 ? 345  ARG C CD    1 
ATOM   6256  N  NE    . ARG C 2 345  ? 131.385 155.441 101.866 1.00 135.77 ? 345  ARG C NE    1 
ATOM   6257  C  CZ    . ARG C 2 345  ? 130.094 155.154 101.988 1.00 135.77 ? 345  ARG C CZ    1 
ATOM   6258  N  NH1   . ARG C 2 345  ? 129.702 154.185 102.803 1.00 135.77 ? 345  ARG C NH1   1 
ATOM   6259  N  NH2   . ARG C 2 345  ? 129.193 155.838 101.296 1.00 135.77 ? 345  ARG C NH2   1 
ATOM   6260  N  N     . VAL C 2 346  ? 135.051 151.007 101.807 1.00 132.78 ? 346  VAL C N     1 
ATOM   6261  C  CA    . VAL C 2 346  ? 136.414 150.864 102.317 1.00 132.78 ? 346  VAL C CA    1 
ATOM   6262  C  C     . VAL C 2 346  ? 137.313 150.229 101.260 1.00 132.78 ? 346  VAL C C     1 
ATOM   6263  O  O     . VAL C 2 346  ? 138.416 150.721 100.970 1.00 132.78 ? 346  VAL C O     1 
ATOM   6264  C  CB    . VAL C 2 346  ? 136.419 150.049 103.622 1.00 132.78 ? 346  VAL C CB    1 
ATOM   6265  C  CG1   . VAL C 2 346  ? 137.843 149.773 104.065 1.00 132.78 ? 346  VAL C CG1   1 
ATOM   6266  C  CG2   . VAL C 2 346  ? 135.662 150.792 104.707 1.00 132.78 ? 346  VAL C CG2   1 
ATOM   6267  N  N     . GLY C 2 347  ? 136.858 149.116 100.678 1.00 137.89 ? 347  GLY C N     1 
ATOM   6268  C  CA    . GLY C 2 347  ? 137.622 148.486 99.614  1.00 137.89 ? 347  GLY C CA    1 
ATOM   6269  C  C     . GLY C 2 347  ? 137.865 149.406 98.435  1.00 137.89 ? 347  GLY C C     1 
ATOM   6270  O  O     . GLY C 2 347  ? 138.952 149.401 97.849  1.00 137.89 ? 347  GLY C O     1 
ATOM   6271  N  N     . LEU C 2 348  ? 136.871 150.220 98.081  1.00 138.97 ? 348  LEU C N     1 
ATOM   6272  C  CA    . LEU C 2 348  ? 137.018 151.125 96.950  1.00 138.97 ? 348  LEU C CA    1 
ATOM   6273  C  C     . LEU C 2 348  ? 137.998 152.246 97.265  1.00 138.97 ? 348  LEU C C     1 
ATOM   6274  O  O     . LEU C 2 348  ? 138.728 152.701 96.381  1.00 138.97 ? 348  LEU C O     1 
ATOM   6275  C  CB    . LEU C 2 348  ? 135.656 151.691 96.561  1.00 138.97 ? 348  LEU C CB    1 
ATOM   6276  C  CG    . LEU C 2 348  ? 135.546 152.273 95.155  1.00 138.97 ? 348  LEU C CG    1 
ATOM   6277  C  CD1   . LEU C 2 348  ? 135.841 151.207 94.115  1.00 138.97 ? 348  LEU C CD1   1 
ATOM   6278  C  CD2   . LEU C 2 348  ? 134.163 152.853 94.952  1.00 138.97 ? 348  LEU C CD2   1 
ATOM   6279  N  N     . ALA C 2 349  ? 138.034 152.702 98.517  1.00 141.60 ? 349  ALA C N     1 
ATOM   6280  C  CA    . ALA C 2 349  ? 139.025 153.701 98.903  1.00 141.60 ? 349  ALA C CA    1 
ATOM   6281  C  C     . ALA C 2 349  ? 140.434 153.126 98.830  1.00 141.60 ? 349  ALA C C     1 
ATOM   6282  O  O     . ALA C 2 349  ? 141.373 153.805 98.389  1.00 141.60 ? 349  ALA C O     1 
ATOM   6283  C  CB    . ALA C 2 349  ? 138.728 154.223 100.307 1.00 141.60 ? 349  ALA C CB    1 
ATOM   6284  N  N     . ARG C 2 350  ? 140.602 151.875 99.264  1.00 144.88 ? 350  ARG C N     1 
ATOM   6285  C  CA    . ARG C 2 350  ? 141.901 151.224 99.116  1.00 144.88 ? 350  ARG C CA    1 
ATOM   6286  C  C     . ARG C 2 350  ? 142.286 151.105 97.645  1.00 144.88 ? 350  ARG C C     1 
ATOM   6287  O  O     . ARG C 2 350  ? 143.434 151.372 97.263  1.00 144.88 ? 350  ARG C O     1 
ATOM   6288  C  CB    . ARG C 2 350  ? 141.888 149.850 99.785  1.00 144.88 ? 350  ARG C CB    1 
ATOM   6289  C  CG    . ARG C 2 350  ? 141.849 149.901 101.301 1.00 144.88 ? 350  ARG C CG    1 
ATOM   6290  C  CD    . ARG C 2 350  ? 141.824 148.504 101.893 1.00 144.88 ? 350  ARG C CD    1 
ATOM   6291  N  NE    . ARG C 2 350  ? 141.419 148.511 103.295 1.00 144.88 ? 350  ARG C NE    1 
ATOM   6292  C  CZ    . ARG C 2 350  ? 141.120 147.420 103.990 1.00 144.88 ? 350  ARG C CZ    1 
ATOM   6293  N  NH1   . ARG C 2 350  ? 141.180 146.228 103.412 1.00 144.88 ? 350  ARG C NH1   1 
ATOM   6294  N  NH2   . ARG C 2 350  ? 140.761 147.518 105.262 1.00 144.88 ? 350  ARG C NH2   1 
ATOM   6295  N  N     . LEU C 2 351  ? 141.332 150.710 96.800  1.00 147.33 ? 351  LEU C N     1 
ATOM   6296  C  CA    . LEU C 2 351  ? 141.595 150.634 95.366  1.00 147.33 ? 351  LEU C CA    1 
ATOM   6297  C  C     . LEU C 2 351  ? 141.968 151.998 94.800  1.00 147.33 ? 351  LEU C C     1 
ATOM   6298  O  O     . LEU C 2 351  ? 142.830 152.102 93.922  1.00 147.33 ? 351  LEU C O     1 
ATOM   6299  C  CB    . LEU C 2 351  ? 140.376 150.061 94.641  1.00 147.33 ? 351  LEU C CB    1 
ATOM   6300  C  CG    . LEU C 2 351  ? 140.448 149.938 93.118  1.00 147.33 ? 351  LEU C CG    1 
ATOM   6301  C  CD1   . LEU C 2 351  ? 139.835 148.625 92.670  1.00 147.33 ? 351  LEU C CD1   1 
ATOM   6302  C  CD2   . LEU C 2 351  ? 139.744 151.104 92.443  1.00 147.33 ? 351  LEU C CD2   1 
ATOM   6303  N  N     . ALA C 2 352  ? 141.330 153.058 95.298  1.00 154.54 ? 352  ALA C N     1 
ATOM   6304  C  CA    . ALA C 2 352  ? 141.609 154.399 94.797  1.00 154.54 ? 352  ALA C CA    1 
ATOM   6305  C  C     . ALA C 2 352  ? 143.015 154.849 95.167  1.00 154.54 ? 352  ALA C C     1 
ATOM   6306  O  O     . ALA C 2 352  ? 143.731 155.410 94.329  1.00 154.54 ? 352  ALA C O     1 
ATOM   6307  C  CB    . ALA C 2 352  ? 140.574 155.385 95.332  1.00 154.54 ? 352  ALA C CB    1 
ATOM   6308  N  N     . ARG C 2 353  ? 143.427 154.630 96.417  1.00 158.92 ? 353  ARG C N     1 
ATOM   6309  C  CA    . ARG C 2 353  ? 144.783 155.016 96.799  1.00 158.92 ? 353  ARG C CA    1 
ATOM   6310  C  C     . ARG C 2 353  ? 145.812 154.169 96.057  1.00 158.92 ? 353  ARG C C     1 
ATOM   6311  O  O     . ARG C 2 353  ? 146.883 154.660 95.676  1.00 158.92 ? 353  ARG C O     1 
ATOM   6312  C  CB    . ARG C 2 353  ? 144.972 154.921 98.316  1.00 158.92 ? 353  ARG C CB    1 
ATOM   6313  C  CG    . ARG C 2 353  ? 144.876 153.529 98.902  1.00 158.92 ? 353  ARG C CG    1 
ATOM   6314  C  CD    . ARG C 2 353  ? 145.334 153.515 100.351 1.00 158.92 ? 353  ARG C CD    1 
ATOM   6315  N  NE    . ARG C 2 353  ? 146.787 153.441 100.462 1.00 158.92 ? 353  ARG C NE    1 
ATOM   6316  C  CZ    . ARG C 2 353  ? 147.481 152.308 100.444 1.00 158.92 ? 353  ARG C CZ    1 
ATOM   6317  N  NH1   . ARG C 2 353  ? 146.855 151.146 100.318 1.00 158.92 ? 353  ARG C NH1   1 
ATOM   6318  N  NH2   . ARG C 2 353  ? 148.803 152.335 100.551 1.00 158.92 ? 353  ARG C NH2   1 
ATOM   6319  N  N     . GLY C 2 354  ? 145.488 152.899 95.801  1.00 162.63 ? 354  GLY C N     1 
ATOM   6320  C  CA    . GLY C 2 354  ? 146.361 152.088 94.968  1.00 162.63 ? 354  GLY C CA    1 
ATOM   6321  C  C     . GLY C 2 354  ? 146.498 152.643 93.563  1.00 162.63 ? 354  GLY C C     1 
ATOM   6322  O  O     . GLY C 2 354  ? 147.604 152.732 93.025  1.00 162.63 ? 354  GLY C O     1 
ATOM   6323  N  N     . VAL C 2 355  ? 145.377 153.035 92.956  1.00 166.22 ? 355  VAL C N     1 
ATOM   6324  C  CA    . VAL C 2 355  ? 145.410 153.607 91.611  1.00 166.22 ? 355  VAL C CA    1 
ATOM   6325  C  C     . VAL C 2 355  ? 146.242 154.881 91.601  1.00 166.22 ? 355  VAL C C     1 
ATOM   6326  O  O     . VAL C 2 355  ? 147.039 155.119 90.686  1.00 166.22 ? 355  VAL C O     1 
ATOM   6327  C  CB    . VAL C 2 355  ? 143.980 153.861 91.104  1.00 166.22 ? 355  VAL C CB    1 
ATOM   6328  C  CG1   . VAL C 2 355  ? 143.987 154.859 89.955  1.00 166.22 ? 355  VAL C CG1   1 
ATOM   6329  C  CG2   . VAL C 2 355  ? 143.335 152.557 90.681  1.00 166.22 ? 355  VAL C CG2   1 
ATOM   6330  N  N     . ARG C 2 356  ? 146.061 155.725 92.620  1.00 170.58 ? 356  ARG C N     1 
ATOM   6331  C  CA    . ARG C 2 356  ? 146.903 156.909 92.759  1.00 170.58 ? 356  ARG C CA    1 
ATOM   6332  C  C     . ARG C 2 356  ? 148.377 156.531 92.806  1.00 170.58 ? 356  ARG C C     1 
ATOM   6333  O  O     . ARG C 2 356  ? 149.221 157.221 92.222  1.00 170.58 ? 356  ARG C O     1 
ATOM   6334  C  CB    . ARG C 2 356  ? 146.513 157.691 94.012  1.00 170.58 ? 356  ARG C CB    1 
ATOM   6335  C  CG    . ARG C 2 356  ? 145.385 158.682 93.800  1.00 170.58 ? 356  ARG C CG    1 
ATOM   6336  C  CD    . ARG C 2 356  ? 145.421 159.776 94.849  1.00 170.58 ? 356  ARG C CD    1 
ATOM   6337  N  NE    . ARG C 2 356  ? 144.273 160.670 94.742  1.00 170.58 ? 356  ARG C NE    1 
ATOM   6338  C  CZ    . ARG C 2 356  ? 143.143 160.517 95.421  1.00 170.58 ? 356  ARG C CZ    1 
ATOM   6339  N  NH1   . ARG C 2 356  ? 143.006 159.501 96.262  1.00 170.58 ? 356  ARG C NH1   1 
ATOM   6340  N  NH2   . ARG C 2 356  ? 142.148 161.379 95.261  1.00 170.58 ? 356  ARG C NH2   1 
ATOM   6341  N  N     . GLU C 2 357  ? 148.705 155.441 93.503  1.00 173.54 ? 357  GLU C N     1 
ATOM   6342  C  CA    . GLU C 2 357  ? 150.083 154.959 93.497  1.00 173.54 ? 357  GLU C CA    1 
ATOM   6343  C  C     . GLU C 2 357  ? 150.542 154.573 92.095  1.00 173.54 ? 357  GLU C C     1 
ATOM   6344  O  O     . GLU C 2 357  ? 151.647 154.946 91.685  1.00 173.54 ? 357  GLU C O     1 
ATOM   6345  C  CB    . GLU C 2 357  ? 150.237 153.774 94.448  1.00 173.54 ? 357  GLU C CB    1 
ATOM   6346  C  CG    . GLU C 2 357  ? 151.622 153.149 94.430  1.00 173.54 ? 357  GLU C CG    1 
ATOM   6347  C  CD    . GLU C 2 357  ? 151.761 152.001 95.411  1.00 173.54 ? 357  GLU C CD    1 
ATOM   6348  O  OE1   . GLU C 2 357  ? 150.742 151.604 96.014  1.00 173.54 ? 357  GLU C OE1   1 
ATOM   6349  O  OE2   . GLU C 2 357  ? 152.891 151.496 95.578  1.00 173.54 ? 357  GLU C OE2   1 
ATOM   6350  N  N     . ARG C 2 358  ? 149.719 153.835 91.346  1.00 176.76 ? 358  ARG C N     1 
ATOM   6351  C  CA    . ARG C 2 358  ? 150.099 153.437 89.994  1.00 176.76 ? 358  ARG C CA    1 
ATOM   6352  C  C     . ARG C 2 358  ? 150.157 154.605 89.018  1.00 176.76 ? 358  ARG C C     1 
ATOM   6353  O  O     . ARG C 2 358  ? 150.758 154.462 87.948  1.00 176.76 ? 358  ARG C O     1 
ATOM   6354  C  CB    . ARG C 2 358  ? 149.140 152.380 89.433  1.00 176.76 ? 358  ARG C CB    1 
ATOM   6355  C  CG    . ARG C 2 358  ? 149.411 150.950 89.884  1.00 176.76 ? 358  ARG C CG    1 
ATOM   6356  C  CD    . ARG C 2 358  ? 148.632 150.598 91.136  1.00 176.76 ? 358  ARG C CD    1 
ATOM   6357  N  NE    . ARG C 2 358  ? 148.716 149.180 91.468  1.00 176.76 ? 358  ARG C NE    1 
ATOM   6358  C  CZ    . ARG C 2 358  ? 149.585 148.669 92.334  1.00 176.76 ? 358  ARG C CZ    1 
ATOM   6359  N  NH1   . ARG C 2 358  ? 150.445 149.463 92.958  1.00 176.76 ? 358  ARG C NH1   1 
ATOM   6360  N  NH2   . ARG C 2 358  ? 149.592 147.366 92.582  1.00 176.76 ? 358  ARG C NH2   1 
ATOM   6361  N  N     . MET C 2 359  ? 149.553 155.744 89.348  1.00 183.15 ? 359  MET C N     1 
ATOM   6362  C  CA    . MET C 2 359  ? 149.558 156.889 88.446  1.00 183.15 ? 359  MET C CA    1 
ATOM   6363  C  C     . MET C 2 359  ? 150.850 157.690 88.507  1.00 183.15 ? 359  MET C C     1 
ATOM   6364  O  O     . MET C 2 359  ? 150.955 158.715 87.826  1.00 183.15 ? 359  MET C O     1 
ATOM   6365  C  CB    . MET C 2 359  ? 148.371 157.807 88.746  1.00 183.15 ? 359  MET C CB    1 
ATOM   6366  C  CG    . MET C 2 359  ? 147.110 157.458 87.974  1.00 183.15 ? 359  MET C CG    1 
ATOM   6367  S  SD    . MET C 2 359  ? 145.895 158.790 87.970  1.00 183.15 ? 359  MET C SD    1 
ATOM   6368  C  CE    . MET C 2 359  ? 145.320 158.722 89.663  1.00 183.15 ? 359  MET C CE    1 
ATOM   6369  N  N     . LEU C 2 360  ? 151.828 157.256 89.301  1.00 185.90 ? 360  LEU C N     1 
ATOM   6370  C  CA    . LEU C 2 360  ? 153.132 157.901 89.374  1.00 185.90 ? 360  LEU C CA    1 
ATOM   6371  C  C     . LEU C 2 360  ? 154.242 156.972 88.899  1.00 185.90 ? 360  LEU C C     1 
ATOM   6372  O  O     . LEU C 2 360  ? 155.128 157.393 88.150  1.00 185.90 ? 360  LEU C O     1 
ATOM   6373  C  CB    . LEU C 2 360  ? 153.404 158.381 90.806  1.00 185.90 ? 360  LEU C CB    1 
ATOM   6374  C  CG    . LEU C 2 360  ? 153.161 159.864 91.093  1.00 185.90 ? 360  LEU C CG    1 
ATOM   6375  C  CD1   . LEU C 2 360  ? 151.761 160.290 90.673  1.00 185.90 ? 360  LEU C CD1   1 
ATOM   6376  C  CD2   . LEU C 2 360  ? 153.394 160.164 92.565  1.00 185.90 ? 360  LEU C CD2   1 
ATOM   6377  N  N     . MET C 2 361  ? 154.221 155.713 89.328  1.00 192.17 ? 361  MET C N     1 
ATOM   6378  C  CA    . MET C 2 361  ? 155.161 154.722 88.830  1.00 192.17 ? 361  MET C CA    1 
ATOM   6379  C  C     . MET C 2 361  ? 154.758 154.277 87.425  1.00 192.17 ? 361  MET C C     1 
ATOM   6380  O  O     . MET C 2 361  ? 153.730 154.688 86.879  1.00 192.17 ? 361  MET C O     1 
ATOM   6381  C  CB    . MET C 2 361  ? 155.229 153.528 89.780  1.00 192.17 ? 361  MET C CB    1 
ATOM   6382  C  CG    . MET C 2 361  ? 155.568 153.841 91.240  1.00 192.17 ? 361  MET C CG    1 
ATOM   6383  S  SD    . MET C 2 361  ? 157.044 154.856 91.507  1.00 192.17 ? 361  MET C SD    1 
ATOM   6384  C  CE    . MET C 2 361  ? 156.359 156.507 91.643  1.00 192.17 ? 361  MET C CE    1 
ATOM   6385  N  N     . GLY C 2 362  ? 155.583 153.414 86.835  1.00 196.32 ? 362  GLY C N     1 
ATOM   6386  C  CA    . GLY C 2 362  ? 155.313 152.900 85.507  1.00 196.32 ? 362  GLY C CA    1 
ATOM   6387  C  C     . GLY C 2 362  ? 155.350 153.976 84.427  1.00 196.32 ? 362  GLY C C     1 
ATOM   6388  O  O     . GLY C 2 362  ? 155.645 155.145 84.662  1.00 196.32 ? 362  GLY C O     1 
ATOM   6389  N  N     . SER C 2 363  ? 155.042 153.532 83.211  1.00 197.57 ? 363  SER C N     1 
ATOM   6390  C  CA    . SER C 2 363  ? 154.989 154.426 82.063  1.00 197.57 ? 363  SER C CA    1 
ATOM   6391  C  C     . SER C 2 363  ? 153.882 155.454 82.256  1.00 197.57 ? 363  SER C C     1 
ATOM   6392  O  O     . SER C 2 363  ? 152.710 155.096 82.406  1.00 197.57 ? 363  SER C O     1 
ATOM   6393  C  CB    . SER C 2 363  ? 154.759 153.633 80.778  1.00 197.57 ? 363  SER C CB    1 
ATOM   6394  O  OG    . SER C 2 363  ? 153.376 153.440 80.540  1.00 197.57 ? 363  SER C OG    1 
ATOM   6395  N  N     . GLU C 2 364  ? 154.256 156.734 82.253  1.00 195.59 ? 364  GLU C N     1 
ATOM   6396  C  CA    . GLU C 2 364  ? 153.295 157.798 82.509  1.00 195.59 ? 364  GLU C CA    1 
ATOM   6397  C  C     . GLU C 2 364  ? 152.411 158.107 81.308  1.00 195.59 ? 364  GLU C C     1 
ATOM   6398  O  O     . GLU C 2 364  ? 151.421 158.829 81.463  1.00 195.59 ? 364  GLU C O     1 
ATOM   6399  C  CB    . GLU C 2 364  ? 154.029 159.067 82.948  1.00 195.59 ? 364  GLU C CB    1 
ATOM   6400  C  CG    . GLU C 2 364  ? 154.900 158.893 84.186  1.00 195.59 ? 364  GLU C CG    1 
ATOM   6401  C  CD    . GLU C 2 364  ? 154.109 158.482 85.414  1.00 195.59 ? 364  GLU C CD    1 
ATOM   6402  O  OE1   . GLU C 2 364  ? 153.885 157.268 85.606  1.00 195.59 ? 364  GLU C OE1   1 
ATOM   6403  O  OE2   . GLU C 2 364  ? 153.709 159.376 86.190  1.00 195.59 ? 364  GLU C OE2   1 
ATOM   6404  N  N     . ASP C 2 365  ? 152.737 157.589 80.123  1.00 196.83 ? 365  ASP C N     1 
ATOM   6405  C  CA    . ASP C 2 365  ? 151.935 157.826 78.927  1.00 196.83 ? 365  ASP C CA    1 
ATOM   6406  C  C     . ASP C 2 365  ? 151.038 156.637 78.597  1.00 196.83 ? 365  ASP C C     1 
ATOM   6407  O  O     . ASP C 2 365  ? 149.818 156.787 78.485  1.00 196.83 ? 365  ASP C O     1 
ATOM   6408  C  CB    . ASP C 2 365  ? 152.844 158.151 77.735  1.00 196.83 ? 365  ASP C CB    1 
ATOM   6409  C  CG    . ASP C 2 365  ? 152.102 158.119 76.412  1.00 196.83 ? 365  ASP C CG    1 
ATOM   6410  O  OD1   . ASP C 2 365  ? 150.948 158.593 76.361  1.00 196.83 ? 365  ASP C OD1   1 
ATOM   6411  O  OD2   . ASP C 2 365  ? 152.672 157.615 75.421  1.00 196.83 ? 365  ASP C OD2   1 
ATOM   6412  N  N     . SER C 2 366  ? 151.624 155.454 78.438  1.00 198.12 ? 366  SER C N     1 
ATOM   6413  C  CA    . SER C 2 366  ? 150.873 154.255 78.071  1.00 198.12 ? 366  SER C CA    1 
ATOM   6414  C  C     . SER C 2 366  ? 150.115 153.780 79.303  1.00 198.12 ? 366  SER C C     1 
ATOM   6415  O  O     . SER C 2 366  ? 150.602 152.939 80.062  1.00 198.12 ? 366  SER C O     1 
ATOM   6416  C  CB    . SER C 2 366  ? 151.806 153.176 77.534  1.00 198.12 ? 366  SER C CB    1 
ATOM   6417  O  OG    . SER C 2 366  ? 152.572 152.599 78.576  1.00 198.12 ? 366  SER C OG    1 
ATOM   6418  N  N     . LEU C 2 367  ? 148.917 154.323 79.503  1.00 188.93 ? 367  LEU C N     1 
ATOM   6419  C  CA    . LEU C 2 367  ? 148.110 153.982 80.666  1.00 188.93 ? 367  LEU C CA    1 
ATOM   6420  C  C     . LEU C 2 367  ? 146.681 153.710 80.226  1.00 188.93 ? 367  LEU C C     1 
ATOM   6421  O  O     . LEU C 2 367  ? 146.016 154.593 79.677  1.00 188.93 ? 367  LEU C O     1 
ATOM   6422  C  CB    . LEU C 2 367  ? 148.140 155.101 81.711  1.00 188.93 ? 367  LEU C CB    1 
ATOM   6423  C  CG    . LEU C 2 367  ? 149.475 155.324 82.421  1.00 188.93 ? 367  LEU C CG    1 
ATOM   6424  C  CD1   . LEU C 2 367  ? 149.517 156.699 83.065  1.00 188.93 ? 367  LEU C CD1   1 
ATOM   6425  C  CD2   . LEU C 2 367  ? 149.724 154.234 83.452  1.00 188.93 ? 367  LEU C CD2   1 
ATOM   6426  N  N     . THR C 2 368  ? 146.221 152.490 80.472  1.00 177.97 ? 368  THR C N     1 
ATOM   6427  C  CA    . THR C 2 368  ? 144.849 152.080 80.210  1.00 177.97 ? 368  THR C CA    1 
ATOM   6428  C  C     . THR C 2 368  ? 144.219 151.686 81.540  1.00 177.97 ? 368  THR C C     1 
ATOM   6429  O  O     . THR C 2 368  ? 144.891 151.067 82.374  1.00 177.97 ? 368  THR C O     1 
ATOM   6430  C  CB    . THR C 2 368  ? 144.819 150.922 79.205  1.00 177.97 ? 368  THR C CB    1 
ATOM   6431  O  OG1   . THR C 2 368  ? 145.087 151.424 77.889  1.00 177.97 ? 368  THR C OG1   1 
ATOM   6432  C  CG2   . THR C 2 368  ? 143.470 150.216 79.207  1.00 177.97 ? 368  THR C CG2   1 
ATOM   6433  N  N     . PRO C 2 369  ? 142.954 152.047 81.789  1.00 170.28 ? 369  PRO C N     1 
ATOM   6434  C  CA    . PRO C 2 369  ? 142.328 151.681 83.072  1.00 170.28 ? 369  PRO C CA    1 
ATOM   6435  C  C     . PRO C 2 369  ? 142.488 150.217 83.442  1.00 170.28 ? 369  PRO C C     1 
ATOM   6436  O  O     . PRO C 2 369  ? 142.506 149.895 84.637  1.00 170.28 ? 369  PRO C O     1 
ATOM   6437  C  CB    . PRO C 2 369  ? 140.857 152.054 82.852  1.00 170.28 ? 369  PRO C CB    1 
ATOM   6438  C  CG    . PRO C 2 369  ? 140.922 153.199 81.900  1.00 170.28 ? 369  PRO C CG    1 
ATOM   6439  C  CD    . PRO C 2 369  ? 142.078 152.910 80.976  1.00 170.28 ? 369  PRO C CD    1 
ATOM   6440  N  N     . ALA C 2 370  ? 142.604 149.319 82.461  1.00 169.25 ? 370  ALA C N     1 
ATOM   6441  C  CA    . ALA C 2 370  ? 142.916 147.929 82.771  1.00 169.25 ? 370  ALA C CA    1 
ATOM   6442  C  C     . ALA C 2 370  ? 144.283 147.794 83.432  1.00 169.25 ? 370  ALA C C     1 
ATOM   6443  O  O     . ALA C 2 370  ? 144.499 146.868 84.221  1.00 169.25 ? 370  ALA C O     1 
ATOM   6444  C  CB    . ALA C 2 370  ? 142.853 147.080 81.502  1.00 169.25 ? 370  ALA C CB    1 
ATOM   6445  N  N     . LYS C 2 371  ? 145.212 148.701 83.124  1.00 168.97 ? 371  LYS C N     1 
ATOM   6446  C  CA    . LYS C 2 371  ? 146.534 148.659 83.737  1.00 168.97 ? 371  LYS C CA    1 
ATOM   6447  C  C     . LYS C 2 371  ? 146.572 149.387 85.074  1.00 168.97 ? 371  LYS C C     1 
ATOM   6448  O  O     . LYS C 2 371  ? 147.442 149.103 85.904  1.00 168.97 ? 371  LYS C O     1 
ATOM   6449  C  CB    . LYS C 2 371  ? 147.573 149.270 82.795  1.00 168.97 ? 371  LYS C CB    1 
ATOM   6450  C  CG    . LYS C 2 371  ? 147.934 148.409 81.599  1.00 168.97 ? 371  LYS C CG    1 
ATOM   6451  C  CD    . LYS C 2 371  ? 149.038 149.063 80.782  1.00 168.97 ? 371  LYS C CD    1 
ATOM   6452  C  CE    . LYS C 2 371  ? 149.794 148.044 79.948  1.00 168.97 ? 371  LYS C CE    1 
ATOM   6453  N  NZ    . LYS C 2 371  ? 150.461 147.021 80.799  1.00 168.97 ? 371  LYS C NZ    1 
ATOM   6454  N  N     . LEU C 2 372  ? 145.648 150.321 85.300  1.00 168.35 ? 372  LEU C N     1 
ATOM   6455  C  CA    . LEU C 2 372  ? 145.717 151.159 86.491  1.00 168.35 ? 372  LEU C CA    1 
ATOM   6456  C  C     . LEU C 2 372  ? 145.118 150.485 87.717  1.00 168.35 ? 372  LEU C C     1 
ATOM   6457  O  O     . LEU C 2 372  ? 145.751 150.468 88.778  1.00 168.35 ? 372  LEU C O     1 
ATOM   6458  C  CB    . LEU C 2 372  ? 145.006 152.490 86.242  1.00 168.35 ? 372  LEU C CB    1 
ATOM   6459  C  CG    . LEU C 2 372  ? 145.835 153.636 85.662  1.00 168.35 ? 372  LEU C CG    1 
ATOM   6460  C  CD1   . LEU C 2 372  ? 146.186 153.369 84.210  1.00 168.35 ? 372  LEU C CD1   1 
ATOM   6461  C  CD2   . LEU C 2 372  ? 145.091 154.954 85.800  1.00 168.35 ? 372  LEU C CD2   1 
ATOM   6462  N  N     . VAL C 2 373  ? 143.918 149.928 87.597  1.00 161.46 ? 373  VAL C N     1 
ATOM   6463  C  CA    . VAL C 2 373  ? 143.168 149.421 88.740  1.00 161.46 ? 373  VAL C CA    1 
ATOM   6464  C  C     . VAL C 2 373  ? 143.577 147.980 89.011  1.00 161.46 ? 373  VAL C C     1 
ATOM   6465  O  O     . VAL C 2 373  ? 143.833 147.208 88.078  1.00 161.46 ? 373  VAL C O     1 
ATOM   6466  C  CB    . VAL C 2 373  ? 141.651 149.534 88.508  1.00 161.46 ? 373  VAL C CB    1 
ATOM   6467  C  CG1   . VAL C 2 373  ? 141.275 150.964 88.170  1.00 161.46 ? 373  VAL C CG1   1 
ATOM   6468  C  CG2   . VAL C 2 373  ? 141.208 148.605 87.400  1.00 161.46 ? 373  VAL C CG2   1 
ATOM   6469  N  N     . ASN C 2 374  ? 143.676 147.631 90.289  1.00 157.89 ? 374  ASN C N     1 
ATOM   6470  C  CA    . ASN C 2 374  ? 143.908 146.263 90.728  1.00 157.89 ? 374  ASN C CA    1 
ATOM   6471  C  C     . ASN C 2 374  ? 142.705 145.822 91.550  1.00 157.89 ? 374  ASN C C     1 
ATOM   6472  O  O     . ASN C 2 374  ? 142.378 146.451 92.562  1.00 157.89 ? 374  ASN C O     1 
ATOM   6473  C  CB    . ASN C 2 374  ? 145.196 146.158 91.543  1.00 157.89 ? 374  ASN C CB    1 
ATOM   6474  C  CG    . ASN C 2 374  ? 145.640 144.724 91.746  1.00 157.89 ? 374  ASN C CG    1 
ATOM   6475  O  OD1   . ASN C 2 374  ? 145.265 143.833 90.985  1.00 157.89 ? 374  ASN C OD1   1 
ATOM   6476  N  ND2   . ASN C 2 374  ? 146.446 144.494 92.775  1.00 157.89 ? 374  ASN C ND2   1 
ATOM   6477  N  N     . SER C 2 375  ? 142.042 144.756 91.109  1.00 151.68 ? 375  SER C N     1 
ATOM   6478  C  CA    . SER C 2 375  ? 140.821 144.286 91.749  1.00 151.68 ? 375  SER C CA    1 
ATOM   6479  C  C     . SER C 2 375  ? 141.059 143.599 93.087  1.00 151.68 ? 375  SER C C     1 
ATOM   6480  O  O     . SER C 2 375  ? 140.087 143.211 93.743  1.00 151.68 ? 375  SER C O     1 
ATOM   6481  C  CB    . SER C 2 375  ? 140.077 143.326 90.817  1.00 151.68 ? 375  SER C CB    1 
ATOM   6482  O  OG    . SER C 2 375  ? 140.536 141.998 90.988  1.00 151.68 ? 375  SER C OG    1 
ATOM   6483  N  N     . ARG C 2 376  ? 142.313 143.430 93.501  1.00 154.46 ? 376  ARG C N     1 
ATOM   6484  C  CA    . ARG C 2 376  ? 142.616 142.691 94.726  1.00 154.46 ? 376  ARG C CA    1 
ATOM   6485  C  C     . ARG C 2 376  ? 142.003 143.295 95.986  1.00 154.46 ? 376  ARG C C     1 
ATOM   6486  O  O     . ARG C 2 376  ? 141.379 142.545 96.754  1.00 154.46 ? 376  ARG C O     1 
ATOM   6487  C  CB    . ARG C 2 376  ? 144.138 142.553 94.869  1.00 154.46 ? 376  ARG C CB    1 
ATOM   6488  C  CG    . ARG C 2 376  ? 144.785 141.694 93.799  1.00 154.46 ? 376  ARG C CG    1 
ATOM   6489  C  CD    . ARG C 2 376  ? 144.196 140.296 93.781  1.00 154.46 ? 376  ARG C CD    1 
ATOM   6490  N  NE    . ARG C 2 376  ? 144.839 139.451 92.778  1.00 154.46 ? 376  ARG C NE    1 
ATOM   6491  C  CZ    . ARG C 2 376  ? 144.537 138.174 92.573  1.00 154.46 ? 376  ARG C CZ    1 
ATOM   6492  N  NH1   . ARG C 2 376  ? 143.598 137.588 93.303  1.00 154.46 ? 376  ARG C NH1   1 
ATOM   6493  N  NH2   . ARG C 2 376  ? 145.173 137.482 91.638  1.00 154.46 ? 376  ARG C NH2   1 
ATOM   6494  N  N     . PRO C 2 377  ? 142.139 144.598 96.273  1.00 144.84 ? 377  PRO C N     1 
ATOM   6495  C  CA    . PRO C 2 377  ? 141.611 145.105 97.554  1.00 144.84 ? 377  PRO C CA    1 
ATOM   6496  C  C     . PRO C 2 377  ? 140.103 144.991 97.687  1.00 144.84 ? 377  PRO C C     1 
ATOM   6497  O  O     . PRO C 2 377  ? 139.607 144.704 98.782  1.00 144.84 ? 377  PRO C O     1 
ATOM   6498  C  CB    . PRO C 2 377  ? 142.071 146.570 97.564  1.00 144.84 ? 377  PRO C CB    1 
ATOM   6499  C  CG    . PRO C 2 377  ? 143.224 146.614 96.633  1.00 144.84 ? 377  PRO C CG    1 
ATOM   6500  C  CD    . PRO C 2 377  ? 142.874 145.649 95.549  1.00 144.84 ? 377  PRO C CD    1 
ATOM   6501  N  N     . LEU C 2 378  ? 139.356 145.208 96.603  1.00 138.29 ? 378  LEU C N     1 
ATOM   6502  C  CA    . LEU C 2 378  ? 137.900 145.123 96.679  1.00 138.29 ? 378  LEU C CA    1 
ATOM   6503  C  C     . LEU C 2 378  ? 137.448 143.704 97.001  1.00 138.29 ? 378  LEU C C     1 
ATOM   6504  O  O     . LEU C 2 378  ? 136.630 143.489 97.907  1.00 138.29 ? 378  LEU C O     1 
ATOM   6505  C  CB    . LEU C 2 378  ? 137.283 145.600 95.366  1.00 138.29 ? 378  LEU C CB    1 
ATOM   6506  C  CG    . LEU C 2 378  ? 135.766 145.769 95.355  1.00 138.29 ? 378  LEU C CG    1 
ATOM   6507  C  CD1   . LEU C 2 378  ? 135.303 146.480 96.613  1.00 138.29 ? 378  LEU C CD1   1 
ATOM   6508  C  CD2   . LEU C 2 378  ? 135.328 146.524 94.114  1.00 138.29 ? 378  LEU C CD2   1 
ATOM   6509  N  N     . GLU C 2 379  ? 137.958 142.724 96.251  1.00 140.10 ? 379  GLU C N     1 
ATOM   6510  C  CA    . GLU C 2 379  ? 137.656 141.327 96.541  1.00 140.10 ? 379  GLU C CA    1 
ATOM   6511  C  C     . GLU C 2 379  ? 138.074 140.959 97.956  1.00 140.10 ? 379  GLU C C     1 
ATOM   6512  O  O     . GLU C 2 379  ? 137.342 140.258 98.664  1.00 140.10 ? 379  GLU C O     1 
ATOM   6513  C  CB    . GLU C 2 379  ? 138.349 140.419 95.527  1.00 140.10 ? 379  GLU C CB    1 
ATOM   6514  C  CG    . GLU C 2 379  ? 137.624 140.298 94.202  1.00 140.10 ? 379  GLU C CG    1 
ATOM   6515  C  CD    . GLU C 2 379  ? 136.467 139.323 94.265  1.00 140.10 ? 379  GLU C CD    1 
ATOM   6516  O  OE1   . GLU C 2 379  ? 135.306 139.762 94.125  1.00 140.10 ? 379  GLU C OE1   1 
ATOM   6517  O  OE2   . GLU C 2 379  ? 136.718 138.115 94.456  1.00 140.10 ? 379  GLU C OE2   1 
ATOM   6518  N  N     . ALA C 2 380  ? 139.253 141.419 98.382  1.00 136.32 ? 380  ALA C N     1 
ATOM   6519  C  CA    . ALA C 2 380  ? 139.722 141.113 99.728  1.00 136.32 ? 380  ALA C CA    1 
ATOM   6520  C  C     . ALA C 2 380  ? 138.763 141.646 100.782 1.00 136.32 ? 380  ALA C C     1 
ATOM   6521  O  O     . ALA C 2 380  ? 138.392 140.922 101.709 1.00 136.32 ? 380  ALA C O     1 
ATOM   6522  C  CB    . ALA C 2 380  ? 141.123 141.684 99.937  1.00 136.32 ? 380  ALA C CB    1 
ATOM   6523  N  N     . ALA C 2 381  ? 138.340 142.905 100.648 1.00 133.36 ? 381  ALA C N     1 
ATOM   6524  C  CA    . ALA C 2 381  ? 137.441 143.496 101.634 1.00 133.36 ? 381  ALA C CA    1 
ATOM   6525  C  C     . ALA C 2 381  ? 136.090 142.793 101.649 1.00 133.36 ? 381  ALA C C     1 
ATOM   6526  O  O     . ALA C 2 381  ? 135.537 142.514 102.721 1.00 133.36 ? 381  ALA C O     1 
ATOM   6527  C  CB    . ALA C 2 381  ? 137.265 144.988 101.356 1.00 133.36 ? 381  ALA C CB    1 
ATOM   6528  N  N     . ILE C 2 382  ? 135.540 142.495 100.469 1.00 126.61 ? 382  ILE C N     1 
ATOM   6529  C  CA    . ILE C 2 382  ? 134.223 141.867 100.418 1.00 126.61 ? 382  ILE C CA    1 
ATOM   6530  C  C     . ILE C 2 382  ? 134.273 140.462 101.007 1.00 126.61 ? 382  ILE C C     1 
ATOM   6531  O  O     . ILE C 2 382  ? 133.401 140.074 101.797 1.00 126.61 ? 382  ILE C O     1 
ATOM   6532  C  CB    . ILE C 2 382  ? 133.691 141.861 98.975  1.00 126.61 ? 382  ILE C CB    1 
ATOM   6533  C  CG1   . ILE C 2 382  ? 133.244 143.265 98.573  1.00 126.61 ? 382  ILE C CG1   1 
ATOM   6534  C  CG2   . ILE C 2 382  ? 132.542 140.883 98.834  1.00 126.61 ? 382  ILE C CG2   1 
ATOM   6535  C  CD1   . ILE C 2 382  ? 132.832 143.380 97.126  1.00 126.61 ? 382  ILE C CD1   1 
ATOM   6536  N  N     . ARG C 2 383  ? 135.287 139.676 100.637 1.00 132.09 ? 383  ARG C N     1 
ATOM   6537  C  CA    . ARG C 2 383  ? 135.427 138.343 101.208 1.00 132.09 ? 383  ARG C CA    1 
ATOM   6538  C  C     . ARG C 2 383  ? 135.675 138.406 102.708 1.00 132.09 ? 383  ARG C C     1 
ATOM   6539  O  O     . ARG C 2 383  ? 135.154 137.573 103.456 1.00 132.09 ? 383  ARG C O     1 
ATOM   6540  C  CB    . ARG C 2 383  ? 136.554 137.587 100.505 1.00 132.09 ? 383  ARG C CB    1 
ATOM   6541  C  CG    . ARG C 2 383  ? 136.871 136.233 101.114 1.00 132.09 ? 383  ARG C CG    1 
ATOM   6542  C  CD    . ARG C 2 383  ? 137.825 135.438 100.239 1.00 132.09 ? 383  ARG C CD    1 
ATOM   6543  N  NE    . ARG C 2 383  ? 139.122 136.094 100.101 1.00 132.09 ? 383  ARG C NE    1 
ATOM   6544  C  CZ    . ARG C 2 383  ? 139.527 136.723 99.003  1.00 132.09 ? 383  ARG C CZ    1 
ATOM   6545  N  NH1   . ARG C 2 383  ? 138.736 136.784 97.942  1.00 132.09 ? 383  ARG C NH1   1 
ATOM   6546  N  NH2   . ARG C 2 383  ? 140.724 137.292 98.967  1.00 132.09 ? 383  ARG C NH2   1 
ATOM   6547  N  N     . GLU C 2 384  ? 136.452 139.390 103.166 1.00 133.42 ? 384  GLU C N     1 
ATOM   6548  C  CA    . GLU C 2 384  ? 136.668 139.573 104.596 1.00 133.42 ? 384  GLU C CA    1 
ATOM   6549  C  C     . GLU C 2 384  ? 135.351 139.809 105.318 1.00 133.42 ? 384  GLU C C     1 
ATOM   6550  O  O     . GLU C 2 384  ? 135.079 139.192 106.354 1.00 133.42 ? 384  GLU C O     1 
ATOM   6551  C  CB    . GLU C 2 384  ? 137.623 140.744 104.830 1.00 133.42 ? 384  GLU C CB    1 
ATOM   6552  C  CG    . GLU C 2 384  ? 138.495 140.630 106.069 1.00 133.42 ? 384  GLU C CG    1 
ATOM   6553  C  CD    . GLU C 2 384  ? 139.523 139.519 105.975 1.00 133.42 ? 384  GLU C CD    1 
ATOM   6554  O  OE1   . GLU C 2 384  ? 139.724 138.973 104.870 1.00 133.42 ? 384  GLU C OE1   1 
ATOM   6555  O  OE2   . GLU C 2 384  ? 140.140 139.194 107.012 1.00 133.42 ? 384  GLU C OE2   1 
ATOM   6556  N  N     . PHE C 2 385  ? 134.516 140.696 104.776 1.00 121.23 ? 385  PHE C N     1 
ATOM   6557  C  CA    . PHE C 2 385  ? 133.225 140.967 105.397 1.00 121.23 ? 385  PHE C CA    1 
ATOM   6558  C  C     . PHE C 2 385  ? 132.356 139.717 105.425 1.00 121.23 ? 385  PHE C C     1 
ATOM   6559  O  O     . PHE C 2 385  ? 131.757 139.385 106.452 1.00 121.23 ? 385  PHE C O     1 
ATOM   6560  C  CB    . PHE C 2 385  ? 132.507 142.094 104.658 1.00 121.23 ? 385  PHE C CB    1 
ATOM   6561  C  CG    . PHE C 2 385  ? 131.089 142.298 105.105 1.00 121.23 ? 385  PHE C CG    1 
ATOM   6562  C  CD1   . PHE C 2 385  ? 130.783 142.421 106.449 1.00 121.23 ? 385  PHE C CD1   1 
ATOM   6563  C  CD2   . PHE C 2 385  ? 130.060 142.352 104.183 1.00 121.23 ? 385  PHE C CD2   1 
ATOM   6564  C  CE1   . PHE C 2 385  ? 129.481 142.602 106.863 1.00 121.23 ? 385  PHE C CE1   1 
ATOM   6565  C  CE2   . PHE C 2 385  ? 128.756 142.534 104.591 1.00 121.23 ? 385  PHE C CE2   1 
ATOM   6566  C  CZ    . PHE C 2 385  ? 128.466 142.659 105.932 1.00 121.23 ? 385  PHE C CZ    1 
ATOM   6567  N  N     . PHE C 2 386  ? 132.268 139.008 104.301 1.00 119.70 ? 386  PHE C N     1 
ATOM   6568  C  CA    . PHE C 2 386  ? 131.318 137.904 104.230 1.00 119.70 ? 386  PHE C CA    1 
ATOM   6569  C  C     . PHE C 2 386  ? 131.807 136.678 104.993 1.00 119.70 ? 386  PHE C C     1 
ATOM   6570  O  O     . PHE C 2 386  ? 131.003 135.814 105.360 1.00 119.70 ? 386  PHE C O     1 
ATOM   6571  C  CB    . PHE C 2 386  ? 131.016 137.561 102.774 1.00 119.70 ? 386  PHE C CB    1 
ATOM   6572  C  CG    . PHE C 2 386  ? 129.920 138.395 102.183 1.00 119.70 ? 386  PHE C CG    1 
ATOM   6573  C  CD1   . PHE C 2 386  ? 130.213 139.527 101.447 1.00 119.70 ? 386  PHE C CD1   1 
ATOM   6574  C  CD2   . PHE C 2 386  ? 128.595 138.057 102.386 1.00 119.70 ? 386  PHE C CD2   1 
ATOM   6575  C  CE1   . PHE C 2 386  ? 129.204 140.299 100.911 1.00 119.70 ? 386  PHE C CE1   1 
ATOM   6576  C  CE2   . PHE C 2 386  ? 127.583 138.825 101.854 1.00 119.70 ? 386  PHE C CE2   1 
ATOM   6577  C  CZ    . PHE C 2 386  ? 127.888 139.947 101.115 1.00 119.70 ? 386  PHE C CZ    1 
ATOM   6578  N  N     . SER C 2 387  ? 133.113 136.576 105.247 1.00 126.15 ? 387  SER C N     1 
ATOM   6579  C  CA    . SER C 2 387  ? 133.623 135.384 105.916 1.00 126.15 ? 387  SER C CA    1 
ATOM   6580  C  C     . SER C 2 387  ? 133.922 135.632 107.391 1.00 126.15 ? 387  SER C C     1 
ATOM   6581  O  O     . SER C 2 387  ? 133.430 134.905 108.259 1.00 126.15 ? 387  SER C O     1 
ATOM   6582  C  CB    . SER C 2 387  ? 134.875 134.878 105.199 1.00 126.15 ? 387  SER C CB    1 
ATOM   6583  O  OG    . SER C 2 387  ? 134.625 134.682 103.819 1.00 126.15 ? 387  SER C OG    1 
ATOM   6584  N  N     . ARG C 2 388  ? 134.724 136.650 107.696 1.00 136.56 ? 388  ARG C N     1 
ATOM   6585  C  CA    . ARG C 2 388  ? 135.293 136.812 109.027 1.00 136.56 ? 388  ARG C CA    1 
ATOM   6586  C  C     . ARG C 2 388  ? 134.551 137.815 109.899 1.00 136.56 ? 388  ARG C C     1 
ATOM   6587  O  O     . ARG C 2 388  ? 134.858 137.914 111.090 1.00 136.56 ? 388  ARG C O     1 
ATOM   6588  C  CB    . ARG C 2 388  ? 136.758 137.242 108.924 1.00 136.56 ? 388  ARG C CB    1 
ATOM   6589  C  CG    . ARG C 2 388  ? 137.723 136.155 108.501 1.00 136.56 ? 388  ARG C CG    1 
ATOM   6590  C  CD    . ARG C 2 388  ? 139.149 136.644 108.673 1.00 136.56 ? 388  ARG C CD    1 
ATOM   6591  N  NE    . ARG C 2 388  ? 140.137 135.709 108.150 1.00 136.56 ? 388  ARG C NE    1 
ATOM   6592  C  CZ    . ARG C 2 388  ? 140.509 135.657 106.875 1.00 136.56 ? 388  ARG C CZ    1 
ATOM   6593  N  NH1   . ARG C 2 388  ? 139.967 136.480 105.991 1.00 136.56 ? 388  ARG C NH1   1 
ATOM   6594  N  NH2   . ARG C 2 388  ? 141.419 134.780 106.483 1.00 136.56 ? 388  ARG C NH2   1 
ATOM   6595  N  N     . SER C 2 389  ? 133.600 138.564 109.349 1.00 121.67 ? 389  SER C N     1 
ATOM   6596  C  CA    . SER C 2 389  ? 132.957 139.613 110.126 1.00 121.67 ? 389  SER C CA    1 
ATOM   6597  C  C     . SER C 2 389  ? 132.198 139.028 111.312 1.00 121.67 ? 389  SER C C     1 
ATOM   6598  O  O     . SER C 2 389  ? 131.822 137.854 111.335 1.00 121.67 ? 389  SER C O     1 
ATOM   6599  C  CB    . SER C 2 389  ? 132.004 140.431 109.260 1.00 121.67 ? 389  SER C CB    1 
ATOM   6600  O  OG    . SER C 2 389  ? 131.348 141.424 110.027 1.00 121.67 ? 389  SER C OG    1 
ATOM   6601  N  N     . GLN C 2 390  ? 131.975 139.880 112.310 1.00 120.79 ? 390  GLN C N     1 
ATOM   6602  C  CA    . GLN C 2 390  ? 131.313 139.451 113.533 1.00 120.79 ? 390  GLN C CA    1 
ATOM   6603  C  C     . GLN C 2 390  ? 129.810 139.297 113.337 1.00 120.79 ? 390  GLN C C     1 
ATOM   6604  O  O     . GLN C 2 390  ? 129.158 138.581 114.105 1.00 120.79 ? 390  GLN C O     1 
ATOM   6605  C  CB    . GLN C 2 390  ? 131.628 140.450 114.649 1.00 120.79 ? 390  GLN C CB    1 
ATOM   6606  C  CG    . GLN C 2 390  ? 130.946 140.192 115.976 1.00 120.79 ? 390  GLN C CG    1 
ATOM   6607  C  CD    . GLN C 2 390  ? 131.663 140.868 117.126 1.00 120.79 ? 390  GLN C CD    1 
ATOM   6608  O  OE1   . GLN C 2 390  ? 132.665 141.556 116.928 1.00 120.79 ? 390  GLN C OE1   1 
ATOM   6609  N  NE2   . GLN C 2 390  ? 131.156 140.673 118.337 1.00 120.79 ? 390  GLN C NE2   1 
ATOM   6610  N  N     . LEU C 2 391  ? 129.250 139.929 112.306 1.00 111.59 ? 391  LEU C N     1 
ATOM   6611  C  CA    . LEU C 2 391  ? 127.818 139.859 112.054 1.00 111.59 ? 391  LEU C CA    1 
ATOM   6612  C  C     . LEU C 2 391  ? 127.431 138.758 111.076 1.00 111.59 ? 391  LEU C C     1 
ATOM   6613  O  O     . LEU C 2 391  ? 126.276 138.322 111.091 1.00 111.59 ? 391  LEU C O     1 
ATOM   6614  C  CB    . LEU C 2 391  ? 127.314 141.205 111.532 1.00 111.59 ? 391  LEU C CB    1 
ATOM   6615  C  CG    . LEU C 2 391  ? 127.418 142.367 112.517 1.00 111.59 ? 391  LEU C CG    1 
ATOM   6616  C  CD1   . LEU C 2 391  ? 126.780 143.615 111.940 1.00 111.59 ? 391  LEU C CD1   1 
ATOM   6617  C  CD2   . LEU C 2 391  ? 126.779 142.001 113.842 1.00 111.59 ? 391  LEU C CD2   1 
ATOM   6618  N  N     . SER C 2 392  ? 128.351 138.303 110.231 1.00 108.56 ? 392  SER C N     1 
ATOM   6619  C  CA    . SER C 2 392  ? 128.083 137.213 109.298 1.00 108.56 ? 392  SER C CA    1 
ATOM   6620  C  C     . SER C 2 392  ? 128.083 135.907 110.081 1.00 108.56 ? 392  SER C C     1 
ATOM   6621  O  O     . SER C 2 392  ? 129.147 135.392 110.438 1.00 108.56 ? 392  SER C O     1 
ATOM   6622  C  CB    . SER C 2 392  ? 129.122 137.187 108.182 1.00 108.56 ? 392  SER C CB    1 
ATOM   6623  O  OG    . SER C 2 392  ? 129.184 135.907 107.579 1.00 108.56 ? 392  SER C OG    1 
ATOM   6624  N  N     . GLN C 2 393  ? 126.897 135.368 110.344 1.00 104.90 ? 393  GLN C N     1 
ATOM   6625  C  CA    . GLN C 2 393  ? 126.742 134.238 111.244 1.00 104.90 ? 393  GLN C CA    1 
ATOM   6626  C  C     . GLN C 2 393  ? 126.276 132.999 110.495 1.00 104.90 ? 393  GLN C C     1 
ATOM   6627  O  O     . GLN C 2 393  ? 125.525 133.082 109.516 1.00 104.90 ? 393  GLN C O     1 
ATOM   6628  C  CB    . GLN C 2 393  ? 125.751 134.564 112.364 1.00 104.90 ? 393  GLN C CB    1 
ATOM   6629  C  CG    . GLN C 2 393  ? 126.150 135.762 113.202 1.00 104.90 ? 393  GLN C CG    1 
ATOM   6630  C  CD    . GLN C 2 393  ? 125.181 136.028 114.331 1.00 104.90 ? 393  GLN C CD    1 
ATOM   6631  O  OE1   . GLN C 2 393  ? 124.189 135.318 114.491 1.00 104.90 ? 393  GLN C OE1   1 
ATOM   6632  N  NE2   . GLN C 2 393  ? 125.463 137.053 115.124 1.00 104.90 ? 393  GLN C NE2   1 
ATOM   6633  N  N     . PHE C 2 394  ? 126.744 131.846 110.970 1.00 105.24 ? 394  PHE C N     1 
ATOM   6634  C  CA    . PHE C 2 394  ? 126.262 130.562 110.482 1.00 105.24 ? 394  PHE C CA    1 
ATOM   6635  C  C     . PHE C 2 394  ? 124.757 130.461 110.680 1.00 105.24 ? 394  PHE C C     1 
ATOM   6636  O  O     . PHE C 2 394  ? 124.249 130.695 111.780 1.00 105.24 ? 394  PHE C O     1 
ATOM   6637  C  CB    . PHE C 2 394  ? 126.973 129.431 111.225 1.00 105.24 ? 394  PHE C CB    1 
ATOM   6638  C  CG    . PHE C 2 394  ? 127.057 128.148 110.455 1.00 105.24 ? 394  PHE C CG    1 
ATOM   6639  C  CD1   . PHE C 2 394  ? 127.596 128.120 109.181 1.00 105.24 ? 394  PHE C CD1   1 
ATOM   6640  C  CD2   . PHE C 2 394  ? 126.609 126.964 111.013 1.00 105.24 ? 394  PHE C CD2   1 
ATOM   6641  C  CE1   . PHE C 2 394  ? 127.677 126.935 108.477 1.00 105.24 ? 394  PHE C CE1   1 
ATOM   6642  C  CE2   . PHE C 2 394  ? 126.687 125.779 110.314 1.00 105.24 ? 394  PHE C CE2   1 
ATOM   6643  C  CZ    . PHE C 2 394  ? 127.220 125.764 109.044 1.00 105.24 ? 394  PHE C CZ    1 
ATOM   6644  N  N     . LYS C 2 395  ? 124.041 130.116 109.613 1.00 103.17 ? 395  LYS C N     1 
ATOM   6645  C  CA    . LYS C 2 395  ? 122.588 130.080 109.685 1.00 103.17 ? 395  LYS C CA    1 
ATOM   6646  C  C     . LYS C 2 395  ? 122.117 128.958 110.599 1.00 103.17 ? 395  LYS C C     1 
ATOM   6647  O  O     . LYS C 2 395  ? 122.705 127.875 110.640 1.00 103.17 ? 395  LYS C O     1 
ATOM   6648  C  CB    . LYS C 2 395  ? 121.984 129.905 108.293 1.00 103.17 ? 395  LYS C CB    1 
ATOM   6649  C  CG    . LYS C 2 395  ? 120.509 130.261 108.227 1.00 103.17 ? 395  LYS C CG    1 
ATOM   6650  C  CD    . LYS C 2 395  ? 119.749 129.338 107.297 1.00 103.17 ? 395  LYS C CD    1 
ATOM   6651  C  CE    . LYS C 2 395  ? 119.836 129.815 105.861 1.00 103.17 ? 395  LYS C CE    1 
ATOM   6652  N  NZ    . LYS C 2 395  ? 118.792 129.186 105.008 1.00 103.17 ? 395  LYS C NZ    1 
ATOM   6653  N  N     . ASP C 2 396  ? 121.045 129.229 111.337 1.00 110.39 ? 396  ASP C N     1 
ATOM   6654  C  CA    . ASP C 2 396  ? 120.446 128.255 112.240 1.00 110.39 ? 396  ASP C CA    1 
ATOM   6655  C  C     . ASP C 2 396  ? 119.149 127.778 111.595 1.00 110.39 ? 396  ASP C C     1 
ATOM   6656  O  O     . ASP C 2 396  ? 118.162 128.519 111.550 1.00 110.39 ? 396  ASP C O     1 
ATOM   6657  C  CB    . ASP C 2 396  ? 120.203 128.885 113.610 1.00 110.39 ? 396  ASP C CB    1 
ATOM   6658  C  CG    . ASP C 2 396  ? 119.603 127.917 114.618 1.00 110.39 ? 396  ASP C CG    1 
ATOM   6659  O  OD1   . ASP C 2 396  ? 119.535 128.282 115.810 1.00 110.39 ? 396  ASP C OD1   1 
ATOM   6660  O  OD2   . ASP C 2 396  ? 119.218 126.791 114.241 1.00 110.39 ? 396  ASP C OD2   1 
ATOM   6661  N  N     . GLU C 2 397  ? 119.150 126.545 111.097 1.00 110.63 ? 397  GLU C N     1 
ATOM   6662  C  CA    . GLU C 2 397  ? 118.029 126.016 110.331 1.00 110.63 ? 397  GLU C CA    1 
ATOM   6663  C  C     . GLU C 2 397  ? 117.629 124.635 110.824 1.00 110.63 ? 397  GLU C C     1 
ATOM   6664  O  O     . GLU C 2 397  ? 117.455 123.701 110.037 1.00 110.63 ? 397  GLU C O     1 
ATOM   6665  C  CB    . GLU C 2 397  ? 118.355 125.978 108.841 1.00 110.63 ? 397  GLU C CB    1 
ATOM   6666  C  CG    . GLU C 2 397  ? 119.743 125.465 108.520 1.00 110.63 ? 397  GLU C CG    1 
ATOM   6667  C  CD    . GLU C 2 397  ? 119.949 125.246 107.036 1.00 110.63 ? 397  GLU C CD    1 
ATOM   6668  O  OE1   . GLU C 2 397  ? 118.995 125.480 106.264 1.00 110.63 ? 397  GLU C OE1   1 
ATOM   6669  O  OE2   . GLU C 2 397  ? 121.060 124.839 106.639 1.00 110.63 ? 397  GLU C OE2   1 
ATOM   6670  N  N     . THR C 2 398  ? 117.486 124.481 112.142 1.00 102.54 ? 398  THR C N     1 
ATOM   6671  C  CA    . THR C 2 398  ? 116.925 123.246 112.678 1.00 102.54 ? 398  THR C CA    1 
ATOM   6672  C  C     . THR C 2 398  ? 115.508 123.025 112.163 1.00 102.54 ? 398  THR C C     1 
ATOM   6673  O  O     . THR C 2 398  ? 115.114 121.892 111.868 1.00 102.54 ? 398  THR C O     1 
ATOM   6674  C  CB    . THR C 2 398  ? 116.943 123.281 114.205 1.00 102.54 ? 398  THR C CB    1 
ATOM   6675  O  OG1   . THR C 2 398  ? 118.255 123.632 114.657 1.00 102.54 ? 398  THR C OG1   1 
ATOM   6676  C  CG2   . THR C 2 398  ? 116.578 121.924 114.767 1.00 102.54 ? 398  THR C CG2   1 
ATOM   6677  N  N     . ASN C 2 399  ? 114.735 124.098 112.044 1.00 100.89 ? 399  ASN C N     1 
ATOM   6678  C  CA    . ASN C 2 399  ? 113.402 124.064 111.461 1.00 100.89 ? 399  ASN C CA    1 
ATOM   6679  C  C     . ASN C 2 399  ? 113.140 125.420 110.826 1.00 100.89 ? 399  ASN C C     1 
ATOM   6680  O  O     . ASN C 2 399  ? 113.844 126.391 111.126 1.00 100.89 ? 399  ASN C O     1 
ATOM   6681  C  CB    . ASN C 2 399  ? 112.338 123.725 112.515 1.00 100.89 ? 399  ASN C CB    1 
ATOM   6682  C  CG    . ASN C 2 399  ? 112.447 124.580 113.758 1.00 100.89 ? 399  ASN C CG    1 
ATOM   6683  O  OD1   . ASN C 2 399  ? 112.552 125.802 113.683 1.00 100.89 ? 399  ASN C OD1   1 
ATOM   6684  N  ND2   . ASN C 2 399  ? 112.415 123.937 114.917 1.00 100.89 ? 399  ASN C ND2   1 
ATOM   6685  N  N     . PRO C 2 400  ? 112.153 125.518 109.926 1.00 99.61  ? 400  PRO C N     1 
ATOM   6686  C  CA    . PRO C 2 400  ? 111.925 126.804 109.237 1.00 99.61  ? 400  PRO C CA    1 
ATOM   6687  C  C     . PRO C 2 400  ? 111.747 127.988 110.172 1.00 99.61  ? 400  PRO C C     1 
ATOM   6688  O  O     . PRO C 2 400  ? 112.252 129.082 109.882 1.00 99.61  ? 400  PRO C O     1 
ATOM   6689  C  CB    . PRO C 2 400  ? 110.658 126.531 108.417 1.00 99.61  ? 400  PRO C CB    1 
ATOM   6690  C  CG    . PRO C 2 400  ? 110.689 125.072 108.169 1.00 99.61  ? 400  PRO C CG    1 
ATOM   6691  C  CD    . PRO C 2 400  ? 111.281 124.454 109.398 1.00 99.61  ? 400  PRO C CD    1 
ATOM   6692  N  N     . LEU C 2 401  ? 111.030 127.803 111.283 1.00 96.63  ? 401  LEU C N     1 
ATOM   6693  C  CA    . LEU C 2 401  ? 110.858 128.889 112.242 1.00 96.63  ? 401  LEU C CA    1 
ATOM   6694  C  C     . LEU C 2 401  ? 112.194 129.399 112.760 1.00 96.63  ? 401  LEU C C     1 
ATOM   6695  O  O     . LEU C 2 401  ? 112.348 130.603 112.995 1.00 96.63  ? 401  LEU C O     1 
ATOM   6696  C  CB    . LEU C 2 401  ? 109.981 128.428 113.404 1.00 96.63  ? 401  LEU C CB    1 
ATOM   6697  C  CG    . LEU C 2 401  ? 109.745 129.458 114.507 1.00 96.63  ? 401  LEU C CG    1 
ATOM   6698  C  CD1   . LEU C 2 401  ? 109.128 130.717 113.929 1.00 96.63  ? 401  LEU C CD1   1 
ATOM   6699  C  CD2   . LEU C 2 401  ? 108.866 128.877 115.595 1.00 96.63  ? 401  LEU C CD2   1 
ATOM   6700  N  N     . SER C 2 402  ? 113.173 128.509 112.930 1.00 100.33 ? 402  SER C N     1 
ATOM   6701  C  CA    . SER C 2 402  ? 114.476 128.925 113.436 1.00 100.33 ? 402  SER C CA    1 
ATOM   6702  C  C     . SER C 2 402  ? 115.152 129.903 112.483 1.00 100.33 ? 402  SER C C     1 
ATOM   6703  O  O     . SER C 2 402  ? 115.644 130.958 112.899 1.00 100.33 ? 402  SER C O     1 
ATOM   6704  C  CB    . SER C 2 402  ? 115.360 127.701 113.666 1.00 100.33 ? 402  SER C CB    1 
ATOM   6705  O  OG    . SER C 2 402  ? 116.725 128.070 113.702 1.00 100.33 ? 402  SER C OG    1 
ATOM   6706  N  N     . SER C 2 403  ? 115.183 129.568 111.192 1.00 97.12  ? 403  SER C N     1 
ATOM   6707  C  CA    . SER C 2 403  ? 115.805 130.460 110.220 1.00 97.12  ? 403  SER C CA    1 
ATOM   6708  C  C     . SER C 2 403  ? 115.003 131.744 110.058 1.00 97.12  ? 403  SER C C     1 
ATOM   6709  O  O     . SER C 2 403  ? 115.579 132.827 109.890 1.00 97.12  ? 403  SER C O     1 
ATOM   6710  C  CB    . SER C 2 403  ? 115.958 129.748 108.878 1.00 97.12  ? 403  SER C CB    1 
ATOM   6711  O  OG    . SER C 2 403  ? 114.694 129.416 108.336 1.00 97.12  ? 403  SER C OG    1 
ATOM   6712  N  N     . LEU C 2 404  ? 113.672 131.646 110.108 1.00 95.92  ? 404  LEU C N     1 
ATOM   6713  C  CA    . LEU C 2 404  ? 112.846 132.844 110.013 1.00 95.92  ? 404  LEU C CA    1 
ATOM   6714  C  C     . LEU C 2 404  ? 113.113 133.791 111.175 1.00 95.92  ? 404  LEU C C     1 
ATOM   6715  O  O     . LEU C 2 404  ? 113.095 135.015 111.006 1.00 95.92  ? 404  LEU C O     1 
ATOM   6716  C  CB    . LEU C 2 404  ? 111.368 132.462 109.958 1.00 95.92  ? 404  LEU C CB    1 
ATOM   6717  C  CG    . LEU C 2 404  ? 110.376 133.623 109.934 1.00 95.92  ? 404  LEU C CG    1 
ATOM   6718  C  CD1   . LEU C 2 404  ? 110.678 134.557 108.779 1.00 95.92  ? 404  LEU C CD1   1 
ATOM   6719  C  CD2   . LEU C 2 404  ? 108.959 133.100 109.839 1.00 95.92  ? 404  LEU C CD2   1 
ATOM   6720  N  N     . ARG C 2 405  ? 113.364 133.244 112.366 1.00 97.00  ? 405  ARG C N     1 
ATOM   6721  C  CA    . ARG C 2 405  ? 113.711 134.094 113.499 1.00 97.00  ? 405  ARG C CA    1 
ATOM   6722  C  C     . ARG C 2 405  ? 115.115 134.661 113.352 1.00 97.00  ? 405  ARG C C     1 
ATOM   6723  O  O     . ARG C 2 405  ? 115.351 135.835 113.657 1.00 97.00  ? 405  ARG C O     1 
ATOM   6724  C  CB    . ARG C 2 405  ? 113.597 133.317 114.806 1.00 97.00  ? 405  ARG C CB    1 
ATOM   6725  C  CG    . ARG C 2 405  ? 114.105 134.093 116.005 1.00 97.00  ? 405  ARG C CG    1 
ATOM   6726  C  CD    . ARG C 2 405  ? 114.267 133.210 117.222 1.00 97.00  ? 405  ARG C CD    1 
ATOM   6727  N  NE    . ARG C 2 405  ? 115.617 132.670 117.323 1.00 97.00  ? 405  ARG C NE    1 
ATOM   6728  C  CZ    . ARG C 2 405  ? 116.243 132.446 118.472 1.00 97.00  ? 405  ARG C CZ    1 
ATOM   6729  N  NH1   . ARG C 2 405  ? 115.640 132.719 119.620 1.00 97.00  ? 405  ARG C NH1   1 
ATOM   6730  N  NH2   . ARG C 2 405  ? 117.473 131.953 118.474 1.00 97.00  ? 405  ARG C NH2   1 
ATOM   6731  N  N     . HIS C 2 406  ? 116.061 133.840 112.892 1.00 97.78  ? 406  HIS C N     1 
ATOM   6732  C  CA    . HIS C 2 406  ? 117.435 134.306 112.743 1.00 97.78  ? 406  HIS C CA    1 
ATOM   6733  C  C     . HIS C 2 406  ? 117.524 135.452 111.745 1.00 97.78  ? 406  HIS C C     1 
ATOM   6734  O  O     . HIS C 2 406  ? 118.344 136.362 111.906 1.00 97.78  ? 406  HIS C O     1 
ATOM   6735  C  CB    . HIS C 2 406  ? 118.337 133.150 112.317 1.00 97.78  ? 406  HIS C CB    1 
ATOM   6736  C  CG    . HIS C 2 406  ? 119.793 133.405 112.544 1.00 97.78  ? 406  HIS C CG    1 
ATOM   6737  N  ND1   . HIS C 2 406  ? 120.764 132.462 112.283 1.00 97.78  ? 406  HIS C ND1   1 
ATOM   6738  C  CD2   . HIS C 2 406  ? 120.444 134.495 113.014 1.00 97.78  ? 406  HIS C CD2   1 
ATOM   6739  C  CE1   . HIS C 2 406  ? 121.950 132.962 112.579 1.00 97.78  ? 406  HIS C CE1   1 
ATOM   6740  N  NE2   . HIS C 2 406  ? 121.784 134.194 113.025 1.00 97.78  ? 406  HIS C NE2   1 
ATOM   6741  N  N     . LYS C 2 407  ? 116.685 135.428 110.709 1.00 95.72  ? 407  LYS C N     1 
ATOM   6742  C  CA    . LYS C 2 407  ? 116.704 136.509 109.731 1.00 95.72  ? 407  LYS C CA    1 
ATOM   6743  C  C     . LYS C 2 407  ? 116.173 137.823 110.295 1.00 95.72  ? 407  LYS C C     1 
ATOM   6744  O  O     . LYS C 2 407  ? 116.416 138.876 109.699 1.00 95.72  ? 407  LYS C O     1 
ATOM   6745  C  CB    . LYS C 2 407  ? 115.899 136.117 108.493 1.00 95.72  ? 407  LYS C CB    1 
ATOM   6746  C  CG    . LYS C 2 407  ? 116.510 134.985 107.692 1.00 95.72  ? 407  LYS C CG    1 
ATOM   6747  C  CD    . LYS C 2 407  ? 115.675 134.669 106.467 1.00 95.72  ? 407  LYS C CD    1 
ATOM   6748  C  CE    . LYS C 2 407  ? 116.332 133.601 105.614 1.00 95.72  ? 407  LYS C CE    1 
ATOM   6749  N  NZ    . LYS C 2 407  ? 116.311 132.271 106.277 1.00 95.72  ? 407  LYS C NZ    1 
ATOM   6750  N  N     . ARG C 2 408  ? 115.461 137.791 111.420 1.00 91.07  ? 408  ARG C N     1 
ATOM   6751  C  CA    . ARG C 2 408  ? 114.867 138.985 112.007 1.00 91.07  ? 408  ARG C CA    1 
ATOM   6752  C  C     . ARG C 2 408  ? 115.555 139.419 113.294 1.00 91.07  ? 408  ARG C C     1 
ATOM   6753  O  O     . ARG C 2 408  ? 114.999 140.234 114.036 1.00 91.07  ? 408  ARG C O     1 
ATOM   6754  C  CB    . ARG C 2 408  ? 113.380 138.754 112.274 1.00 91.07  ? 408  ARG C CB    1 
ATOM   6755  C  CG    . ARG C 2 408  ? 112.563 138.510 111.028 1.00 91.07  ? 408  ARG C CG    1 
ATOM   6756  C  CD    . ARG C 2 408  ? 111.092 138.400 111.359 1.00 91.07  ? 408  ARG C CD    1 
ATOM   6757  N  NE    . ARG C 2 408  ? 110.339 139.545 110.861 1.00 91.07  ? 408  ARG C NE    1 
ATOM   6758  C  CZ    . ARG C 2 408  ? 109.653 140.376 111.634 1.00 91.07  ? 408  ARG C CZ    1 
ATOM   6759  N  NH1   . ARG C 2 408  ? 109.624 140.189 112.944 1.00 91.07  ? 408  ARG C NH1   1 
ATOM   6760  N  NH2   . ARG C 2 408  ? 108.996 141.394 111.097 1.00 91.07  ? 408  ARG C NH2   1 
ATOM   6761  N  N     . ARG C 2 409  ? 116.742 138.899 113.574 1.00 96.09  ? 409  ARG C N     1 
ATOM   6762  C  CA    . ARG C 2 409  ? 117.428 139.185 114.823 1.00 96.09  ? 409  ARG C CA    1 
ATOM   6763  C  C     . ARG C 2 409  ? 118.151 140.526 114.741 1.00 96.09  ? 409  ARG C C     1 
ATOM   6764  O  O     . ARG C 2 409  ? 118.594 140.950 113.671 1.00 96.09  ? 409  ARG C O     1 
ATOM   6765  C  CB    . ARG C 2 409  ? 118.404 138.051 115.135 1.00 96.09  ? 409  ARG C CB    1 
ATOM   6766  C  CG    . ARG C 2 409  ? 119.339 138.283 116.291 1.00 96.09  ? 409  ARG C CG    1 
ATOM   6767  C  CD    . ARG C 2 409  ? 119.808 136.955 116.846 1.00 96.09  ? 409  ARG C CD    1 
ATOM   6768  N  NE    . ARG C 2 409  ? 118.834 136.399 117.778 1.00 96.09  ? 409  ARG C NE    1 
ATOM   6769  C  CZ    . ARG C 2 409  ? 119.051 135.335 118.540 1.00 96.09  ? 409  ARG C CZ    1 
ATOM   6770  N  NH1   . ARG C 2 409  ? 118.104 134.902 119.360 1.00 96.09  ? 409  ARG C NH1   1 
ATOM   6771  N  NH2   . ARG C 2 409  ? 120.215 134.704 118.486 1.00 96.09  ? 409  ARG C NH2   1 
ATOM   6772  N  N     . ILE C 2 410  ? 118.257 141.203 115.884 1.00 96.48  ? 410  ILE C N     1 
ATOM   6773  C  CA    . ILE C 2 410  ? 118.882 142.518 115.978 1.00 96.48  ? 410  ILE C CA    1 
ATOM   6774  C  C     . ILE C 2 410  ? 119.941 142.463 117.068 1.00 96.48  ? 410  ILE C C     1 
ATOM   6775  O  O     . ILE C 2 410  ? 119.631 142.174 118.231 1.00 96.48  ? 410  ILE C O     1 
ATOM   6776  C  CB    . ILE C 2 410  ? 117.853 143.619 116.273 1.00 96.48  ? 410  ILE C CB    1 
ATOM   6777  C  CG1   . ILE C 2 410  ? 116.935 143.825 115.070 1.00 96.48  ? 410  ILE C CG1   1 
ATOM   6778  C  CG2   . ILE C 2 410  ? 118.555 144.912 116.638 1.00 96.48  ? 410  ILE C CG2   1 
ATOM   6779  C  CD1   . ILE C 2 410  ? 116.104 145.080 115.151 1.00 96.48  ? 410  ILE C CD1   1 
ATOM   6780  N  N     . SER C 2 411  ? 121.185 142.750 116.698 1.00 105.09 ? 411  SER C N     1 
ATOM   6781  C  CA    . SER C 2 411  ? 122.311 142.696 117.617 1.00 105.09 ? 411  SER C CA    1 
ATOM   6782  C  C     . SER C 2 411  ? 122.838 144.098 117.889 1.00 105.09 ? 411  SER C C     1 
ATOM   6783  O  O     . SER C 2 411  ? 122.849 144.952 116.999 1.00 105.09 ? 411  SER C O     1 
ATOM   6784  C  CB    . SER C 2 411  ? 123.434 141.825 117.052 1.00 105.09 ? 411  SER C CB    1 
ATOM   6785  O  OG    . SER C 2 411  ? 124.675 142.148 117.653 1.00 105.09 ? 411  SER C OG    1 
ATOM   6786  N  N     . ALA C 2 412  ? 123.274 144.328 119.124 1.00 113.27 ? 412  ALA C N     1 
ATOM   6787  C  CA    . ALA C 2 412  ? 123.884 145.592 119.510 1.00 113.27 ? 412  ALA C CA    1 
ATOM   6788  C  C     . ALA C 2 412  ? 125.401 145.512 119.595 1.00 113.27 ? 412  ALA C C     1 
ATOM   6789  O  O     . ALA C 2 412  ? 126.047 146.528 119.867 1.00 113.27 ? 412  ALA C O     1 
ATOM   6790  C  CB    . ALA C 2 412  ? 123.320 146.065 120.852 1.00 113.27 ? 412  ALA C CB    1 
ATOM   6791  N  N     . LEU C 2 413  ? 125.978 144.336 119.372 1.00 120.85 ? 413  LEU C N     1 
ATOM   6792  C  CA    . LEU C 2 413  ? 127.419 144.151 119.382 1.00 120.85 ? 413  LEU C CA    1 
ATOM   6793  C  C     . LEU C 2 413  ? 127.963 144.317 117.964 1.00 120.85 ? 413  LEU C C     1 
ATOM   6794  O  O     . LEU C 2 413  ? 127.272 144.796 117.061 1.00 120.85 ? 413  LEU C O     1 
ATOM   6795  C  CB    . LEU C 2 413  ? 127.770 142.788 119.970 1.00 120.85 ? 413  LEU C CB    1 
ATOM   6796  C  CG    . LEU C 2 413  ? 127.035 142.416 121.257 1.00 120.85 ? 413  LEU C CG    1 
ATOM   6797  C  CD1   . LEU C 2 413  ? 127.208 140.939 121.563 1.00 120.85 ? 413  LEU C CD1   1 
ATOM   6798  C  CD2   . LEU C 2 413  ? 127.529 143.268 122.411 1.00 120.85 ? 413  LEU C CD2   1 
ATOM   6799  N  N     . GLY C 2 414  ? 129.217 143.928 117.756 1.00 126.94 ? 414  GLY C N     1 
ATOM   6800  C  CA    . GLY C 2 414  ? 129.822 143.990 116.449 1.00 126.94 ? 414  GLY C CA    1 
ATOM   6801  C  C     . GLY C 2 414  ? 130.692 145.215 116.270 1.00 126.94 ? 414  GLY C C     1 
ATOM   6802  O  O     . GLY C 2 414  ? 130.945 145.971 117.213 1.00 126.94 ? 414  GLY C O     1 
ATOM   6803  N  N     . PRO C 2 415  ? 131.178 145.427 115.047 1.00 130.24 ? 415  PRO C N     1 
ATOM   6804  C  CA    . PRO C 2 415  ? 132.031 146.592 114.784 1.00 130.24 ? 415  PRO C CA    1 
ATOM   6805  C  C     . PRO C 2 415  ? 131.293 147.893 115.060 1.00 130.24 ? 415  PRO C C     1 
ATOM   6806  O  O     . PRO C 2 415  ? 130.164 148.098 114.610 1.00 130.24 ? 415  PRO C O     1 
ATOM   6807  C  CB    . PRO C 2 415  ? 132.382 146.448 113.298 1.00 130.24 ? 415  PRO C CB    1 
ATOM   6808  C  CG    . PRO C 2 415  ? 132.127 145.010 112.976 1.00 130.24 ? 415  PRO C CG    1 
ATOM   6809  C  CD    . PRO C 2 415  ? 130.989 144.595 113.849 1.00 130.24 ? 415  PRO C CD    1 
ATOM   6810  N  N     . GLY C 2 416  ? 131.946 148.776 115.812 1.00 130.01 ? 416  GLY C N     1 
ATOM   6811  C  CA    . GLY C 2 416  ? 131.324 150.024 116.198 1.00 130.01 ? 416  GLY C CA    1 
ATOM   6812  C  C     . GLY C 2 416  ? 130.194 149.880 117.187 1.00 130.01 ? 416  GLY C C     1 
ATOM   6813  O  O     . GLY C 2 416  ? 129.294 150.724 117.210 1.00 130.01 ? 416  GLY C O     1 
ATOM   6814  N  N     . GLY C 2 417  ? 130.211 148.833 118.009 1.00 133.74 ? 417  GLY C N     1 
ATOM   6815  C  CA    . GLY C 2 417  ? 129.147 148.587 118.956 1.00 133.74 ? 417  GLY C CA    1 
ATOM   6816  C  C     . GLY C 2 417  ? 129.705 148.260 120.324 1.00 133.74 ? 417  GLY C C     1 
ATOM   6817  O  O     . GLY C 2 417  ? 130.917 148.272 120.545 1.00 133.74 ? 417  GLY C O     1 
ATOM   6818  N  N     . LEU C 2 418  ? 128.795 147.968 121.248 1.00 140.21 ? 418  LEU C N     1 
ATOM   6819  C  CA    . LEU C 2 418  ? 129.183 147.678 122.621 1.00 140.21 ? 418  LEU C CA    1 
ATOM   6820  C  C     . LEU C 2 418  ? 129.942 146.361 122.703 1.00 140.21 ? 418  LEU C C     1 
ATOM   6821  O  O     . LEU C 2 418  ? 129.873 145.524 121.799 1.00 140.21 ? 418  LEU C O     1 
ATOM   6822  C  CB    . LEU C 2 418  ? 127.946 147.616 123.519 1.00 140.21 ? 418  LEU C CB    1 
ATOM   6823  C  CG    . LEU C 2 418  ? 127.357 148.917 124.072 1.00 140.21 ? 418  LEU C CG    1 
ATOM   6824  C  CD1   . LEU C 2 418  ? 128.371 149.631 124.950 1.00 140.21 ? 418  LEU C CD1   1 
ATOM   6825  C  CD2   . LEU C 2 418  ? 126.853 149.827 122.963 1.00 140.21 ? 418  LEU C CD2   1 
ATOM   6826  N  N     . THR C 2 419  ? 130.676 146.183 123.798 1.00 145.67 ? 419  THR C N     1 
ATOM   6827  C  CA    . THR C 2 419  ? 131.275 144.903 124.132 1.00 145.67 ? 419  THR C CA    1 
ATOM   6828  C  C     . THR C 2 419  ? 130.614 144.343 125.390 1.00 145.67 ? 419  THR C C     1 
ATOM   6829  O  O     . THR C 2 419  ? 129.827 145.015 126.060 1.00 145.67 ? 419  THR C O     1 
ATOM   6830  C  CB    . THR C 2 419  ? 132.785 145.043 124.315 1.00 145.67 ? 419  THR C CB    1 
ATOM   6831  O  OG1   . THR C 2 419  ? 133.057 145.776 125.516 1.00 145.67 ? 419  THR C OG1   1 
ATOM   6832  C  CG2   . THR C 2 419  ? 133.406 145.757 123.125 1.00 145.67 ? 419  THR C CG2   1 
ATOM   6833  N  N     . ARG C 2 420  ? 130.934 143.090 125.716 1.00 143.09 ? 420  ARG C N     1 
ATOM   6834  C  CA    . ARG C 2 420  ? 130.316 142.444 126.868 1.00 143.09 ? 420  ARG C CA    1 
ATOM   6835  C  C     . ARG C 2 420  ? 130.680 143.125 128.181 1.00 143.09 ? 420  ARG C C     1 
ATOM   6836  O  O     . ARG C 2 420  ? 129.877 143.113 129.120 1.00 143.09 ? 420  ARG C O     1 
ATOM   6837  C  CB    . ARG C 2 420  ? 130.712 140.969 126.922 1.00 143.09 ? 420  ARG C CB    1 
ATOM   6838  C  CG    . ARG C 2 420  ? 129.707 140.035 126.274 1.00 143.09 ? 420  ARG C CG    1 
ATOM   6839  C  CD    . ARG C 2 420  ? 129.986 139.879 124.792 1.00 143.09 ? 420  ARG C CD    1 
ATOM   6840  N  NE    . ARG C 2 420  ? 129.229 138.778 124.206 1.00 143.09 ? 420  ARG C NE    1 
ATOM   6841  C  CZ    . ARG C 2 420  ? 129.370 138.360 122.953 1.00 143.09 ? 420  ARG C CZ    1 
ATOM   6842  N  NH1   . ARG C 2 420  ? 130.246 138.950 122.151 1.00 143.09 ? 420  ARG C NH1   1 
ATOM   6843  N  NH2   . ARG C 2 420  ? 128.638 137.352 122.501 1.00 143.09 ? 420  ARG C NH2   1 
ATOM   6844  N  N     . GLU C 2 421  ? 131.872 143.718 128.271 1.00 155.19 ? 421  GLU C N     1 
ATOM   6845  C  CA    . GLU C 2 421  ? 132.274 144.361 129.517 1.00 155.19 ? 421  GLU C CA    1 
ATOM   6846  C  C     . GLU C 2 421  ? 131.642 145.738 129.677 1.00 155.19 ? 421  GLU C C     1 
ATOM   6847  O  O     . GLU C 2 421  ? 131.257 146.114 130.789 1.00 155.19 ? 421  GLU C O     1 
ATOM   6848  C  CB    . GLU C 2 421  ? 133.799 144.457 129.594 1.00 155.19 ? 421  GLU C CB    1 
ATOM   6849  C  CG    . GLU C 2 421  ? 134.440 145.333 128.528 1.00 155.19 ? 421  GLU C CG    1 
ATOM   6850  C  CD    . GLU C 2 421  ? 135.952 145.356 128.624 1.00 155.19 ? 421  GLU C CD    1 
ATOM   6851  O  OE1   . GLU C 2 421  ? 136.504 144.674 129.513 1.00 155.19 ? 421  GLU C OE1   1 
ATOM   6852  O  OE2   . GLU C 2 421  ? 136.590 146.058 127.811 1.00 155.19 ? 421  GLU C OE2   1 
ATOM   6853  N  N     . ARG C 2 422  ? 131.520 146.500 128.588 1.00 154.78 ? 422  ARG C N     1 
ATOM   6854  C  CA    . ARG C 2 422  ? 131.020 147.866 128.682 1.00 154.78 ? 422  ARG C CA    1 
ATOM   6855  C  C     . ARG C 2 422  ? 129.503 147.952 128.580 1.00 154.78 ? 422  ARG C C     1 
ATOM   6856  O  O     . ARG C 2 422  ? 128.976 149.053 128.390 1.00 154.78 ? 422  ARG C O     1 
ATOM   6857  C  CB    . ARG C 2 422  ? 131.666 148.730 127.599 1.00 154.78 ? 422  ARG C CB    1 
ATOM   6858  C  CG    . ARG C 2 422  ? 133.095 149.128 127.918 1.00 154.78 ? 422  ARG C CG    1 
ATOM   6859  C  CD    . ARG C 2 422  ? 133.948 149.246 126.667 1.00 154.78 ? 422  ARG C CD    1 
ATOM   6860  N  NE    . ARG C 2 422  ? 133.457 150.273 125.754 1.00 154.78 ? 422  ARG C NE    1 
ATOM   6861  C  CZ    . ARG C 2 422  ? 132.922 150.021 124.564 1.00 154.78 ? 422  ARG C CZ    1 
ATOM   6862  N  NH1   . ARG C 2 422  ? 132.506 151.017 123.796 1.00 154.78 ? 422  ARG C NH1   1 
ATOM   6863  N  NH2   . ARG C 2 422  ? 132.801 148.771 124.143 1.00 154.78 ? 422  ARG C NH2   1 
ATOM   6864  N  N     . ALA C 2 423  ? 128.794 146.833 128.697 1.00 139.65 ? 423  ALA C N     1 
ATOM   6865  C  CA    . ALA C 2 423  ? 127.338 146.813 128.631 1.00 139.65 ? 423  ALA C CA    1 
ATOM   6866  C  C     . ALA C 2 423  ? 126.787 146.728 130.049 1.00 139.65 ? 423  ALA C C     1 
ATOM   6867  O  O     . ALA C 2 423  ? 126.869 145.677 130.693 1.00 139.65 ? 423  ALA C O     1 
ATOM   6868  C  CB    . ALA C 2 423  ? 126.849 145.646 127.777 1.00 139.65 ? 423  ALA C CB    1 
ATOM   6869  N  N     . GLY C 2 424  ? 126.228 147.828 130.531 1.00 134.21 ? 424  GLY C N     1 
ATOM   6870  C  CA    . GLY C 2 424  ? 125.683 147.922 131.868 1.00 134.21 ? 424  GLY C CA    1 
ATOM   6871  C  C     . GLY C 2 424  ? 124.198 147.635 131.913 1.00 134.21 ? 424  GLY C C     1 
ATOM   6872  O  O     . GLY C 2 424  ? 123.653 146.906 131.076 1.00 134.21 ? 424  GLY C O     1 
ATOM   6873  N  N     . PHE C 2 425  ? 123.528 148.216 132.910 1.00 128.80 ? 425  PHE C N     1 
ATOM   6874  C  CA    . PHE C 2 425  ? 122.096 147.988 133.065 1.00 128.80 ? 425  PHE C CA    1 
ATOM   6875  C  C     . PHE C 2 425  ? 121.289 148.810 132.070 1.00 128.80 ? 425  PHE C C     1 
ATOM   6876  O  O     . PHE C 2 425  ? 120.230 148.369 131.609 1.00 128.80 ? 425  PHE C O     1 
ATOM   6877  C  CB    . PHE C 2 425  ? 121.662 148.317 134.492 1.00 128.80 ? 425  PHE C CB    1 
ATOM   6878  C  CG    . PHE C 2 425  ? 121.952 147.229 135.481 1.00 128.80 ? 425  PHE C CG    1 
ATOM   6879  C  CD1   . PHE C 2 425  ? 120.950 146.371 135.898 1.00 128.80 ? 425  PHE C CD1   1 
ATOM   6880  C  CD2   . PHE C 2 425  ? 123.224 147.070 136.002 1.00 128.80 ? 425  PHE C CD2   1 
ATOM   6881  C  CE1   . PHE C 2 425  ? 121.211 145.371 136.811 1.00 128.80 ? 425  PHE C CE1   1 
ATOM   6882  C  CE2   . PHE C 2 425  ? 123.492 146.072 136.917 1.00 128.80 ? 425  PHE C CE2   1 
ATOM   6883  C  CZ    . PHE C 2 425  ? 122.484 145.221 137.321 1.00 128.80 ? 425  PHE C CZ    1 
ATOM   6884  N  N     . ASP C 2 426  ? 121.772 150.005 131.725 1.00 132.72 ? 426  ASP C N     1 
ATOM   6885  C  CA    . ASP C 2 426  ? 120.975 150.927 130.922 1.00 132.72 ? 426  ASP C CA    1 
ATOM   6886  C  C     . ASP C 2 426  ? 120.732 150.390 129.517 1.00 132.72 ? 426  ASP C C     1 
ATOM   6887  O  O     . ASP C 2 426  ? 119.597 150.408 129.026 1.00 132.72 ? 426  ASP C O     1 
ATOM   6888  C  CB    . ASP C 2 426  ? 121.662 152.290 130.862 1.00 132.72 ? 426  ASP C CB    1 
ATOM   6889  C  CG    . ASP C 2 426  ? 123.133 152.183 130.525 1.00 132.72 ? 426  ASP C CG    1 
ATOM   6890  O  OD1   . ASP C 2 426  ? 123.751 153.222 130.210 1.00 132.72 ? 426  ASP C OD1   1 
ATOM   6891  O  OD2   . ASP C 2 426  ? 123.671 151.057 130.574 1.00 132.72 ? 426  ASP C OD2   1 
ATOM   6892  N  N     . VAL C 2 427  ? 121.783 149.912 128.852 1.00 124.54 ? 427  VAL C N     1 
ATOM   6893  C  CA    . VAL C 2 427  ? 121.630 149.427 127.485 1.00 124.54 ? 427  VAL C CA    1 
ATOM   6894  C  C     . VAL C 2 427  ? 120.835 148.126 127.458 1.00 124.54 ? 427  VAL C C     1 
ATOM   6895  O  O     . VAL C 2 427  ? 120.235 147.772 126.438 1.00 124.54 ? 427  VAL C O     1 
ATOM   6896  C  CB    . VAL C 2 427  ? 123.014 149.269 126.826 1.00 124.54 ? 427  VAL C CB    1 
ATOM   6897  C  CG1   . VAL C 2 427  ? 123.831 148.207 127.543 1.00 124.54 ? 427  VAL C CG1   1 
ATOM   6898  C  CG2   . VAL C 2 427  ? 122.878 148.954 125.344 1.00 124.54 ? 427  VAL C CG2   1 
ATOM   6899  N  N     . ARG C 2 428  ? 120.797 147.404 128.578 1.00 115.29 ? 428  ARG C N     1 
ATOM   6900  C  CA    . ARG C 2 428  ? 120.081 146.138 128.642 1.00 115.29 ? 428  ARG C CA    1 
ATOM   6901  C  C     . ARG C 2 428  ? 118.607 146.296 128.989 1.00 115.29 ? 428  ARG C C     1 
ATOM   6902  O  O     . ARG C 2 428  ? 117.849 145.333 128.836 1.00 115.29 ? 428  ARG C O     1 
ATOM   6903  C  CB    . ARG C 2 428  ? 120.738 145.215 129.668 1.00 115.29 ? 428  ARG C CB    1 
ATOM   6904  C  CG    . ARG C 2 428  ? 122.012 144.547 129.194 1.00 115.29 ? 428  ARG C CG    1 
ATOM   6905  C  CD    . ARG C 2 428  ? 122.536 143.596 130.251 1.00 115.29 ? 428  ARG C CD    1 
ATOM   6906  N  NE    . ARG C 2 428  ? 123.344 142.524 129.681 1.00 115.29 ? 428  ARG C NE    1 
ATOM   6907  C  CZ    . ARG C 2 428  ? 124.662 142.581 129.540 1.00 115.29 ? 428  ARG C CZ    1 
ATOM   6908  N  NH1   . ARG C 2 428  ? 125.324 143.659 129.934 1.00 115.29 ? 428  ARG C NH1   1 
ATOM   6909  N  NH2   . ARG C 2 428  ? 125.320 141.560 129.012 1.00 115.29 ? 428  ARG C NH2   1 
ATOM   6910  N  N     . ASP C 2 429  ? 118.179 147.470 129.446 1.00 120.31 ? 429  ASP C N     1 
ATOM   6911  C  CA    . ASP C 2 429  ? 116.805 147.630 129.897 1.00 120.31 ? 429  ASP C CA    1 
ATOM   6912  C  C     . ASP C 2 429  ? 115.845 147.704 128.715 1.00 120.31 ? 429  ASP C C     1 
ATOM   6913  O  O     . ASP C 2 429  ? 116.244 147.718 127.548 1.00 120.31 ? 429  ASP C O     1 
ATOM   6914  C  CB    . ASP C 2 429  ? 116.660 148.886 130.755 1.00 120.31 ? 429  ASP C CB    1 
ATOM   6915  C  CG    . ASP C 2 429  ? 117.317 148.744 132.111 1.00 120.31 ? 429  ASP C CG    1 
ATOM   6916  O  OD1   . ASP C 2 429  ? 117.392 147.607 132.620 1.00 120.31 ? 429  ASP C OD1   1 
ATOM   6917  O  OD2   . ASP C 2 429  ? 117.758 149.771 132.668 1.00 120.31 ? 429  ASP C OD2   1 
ATOM   6918  N  N     . VAL C 2 430  ? 114.558 147.747 129.039 1.00 109.24 ? 430  VAL C N     1 
ATOM   6919  C  CA    . VAL C 2 430  ? 113.501 147.893 128.047 1.00 109.24 ? 430  VAL C CA    1 
ATOM   6920  C  C     . VAL C 2 430  ? 112.977 149.320 128.140 1.00 109.24 ? 430  VAL C C     1 
ATOM   6921  O  O     . VAL C 2 430  ? 112.295 149.680 129.101 1.00 109.24 ? 430  VAL C O     1 
ATOM   6922  C  CB    . VAL C 2 430  ? 112.379 146.872 128.264 1.00 109.24 ? 430  VAL C CB    1 
ATOM   6923  C  CG1   . VAL C 2 430  ? 111.230 147.136 127.308 1.00 109.24 ? 430  VAL C CG1   1 
ATOM   6924  C  CG2   . VAL C 2 430  ? 112.908 145.461 128.090 1.00 109.24 ? 430  VAL C CG2   1 
ATOM   6925  N  N     . HIS C 2 431  ? 113.298 150.135 127.143 1.00 108.74 ? 431  HIS C N     1 
ATOM   6926  C  CA    . HIS C 2 431  ? 112.847 151.516 127.118 1.00 108.74 ? 431  HIS C CA    1 
ATOM   6927  C  C     . HIS C 2 431  ? 111.357 151.582 126.810 1.00 108.74 ? 431  HIS C C     1 
ATOM   6928  O  O     . HIS C 2 431  ? 110.758 150.623 126.317 1.00 108.74 ? 431  HIS C O     1 
ATOM   6929  C  CB    . HIS C 2 431  ? 113.635 152.315 126.081 1.00 108.74 ? 431  HIS C CB    1 
ATOM   6930  C  CG    . HIS C 2 431  ? 113.525 153.798 126.249 1.00 108.74 ? 431  HIS C CG    1 
ATOM   6931  N  ND1   . HIS C 2 431  ? 112.639 154.564 125.524 1.00 108.74 ? 431  HIS C ND1   1 
ATOM   6932  C  CD2   . HIS C 2 431  ? 114.188 154.654 127.061 1.00 108.74 ? 431  HIS C CD2   1 
ATOM   6933  C  CE1   . HIS C 2 431  ? 112.762 155.830 125.881 1.00 108.74 ? 431  HIS C CE1   1 
ATOM   6934  N  NE2   . HIS C 2 431  ? 113.695 155.912 126.811 1.00 108.74 ? 431  HIS C NE2   1 
ATOM   6935  N  N     . ARG C 2 432  ? 110.757 152.735 127.112 1.00 107.94 ? 432  ARG C N     1 
ATOM   6936  C  CA    . ARG C 2 432  ? 109.321 152.897 126.910 1.00 107.94 ? 432  ARG C CA    1 
ATOM   6937  C  C     . ARG C 2 432  ? 108.955 152.933 125.433 1.00 107.94 ? 432  ARG C C     1 
ATOM   6938  O  O     . ARG C 2 432  ? 107.775 152.821 125.086 1.00 107.94 ? 432  ARG C O     1 
ATOM   6939  C  CB    . ARG C 2 432  ? 108.836 154.171 127.597 1.00 107.94 ? 432  ARG C CB    1 
ATOM   6940  C  CG    . ARG C 2 432  ? 109.233 155.438 126.866 1.00 107.94 ? 432  ARG C CG    1 
ATOM   6941  C  CD    . ARG C 2 432  ? 108.597 156.665 127.486 1.00 107.94 ? 432  ARG C CD    1 
ATOM   6942  N  NE    . ARG C 2 432  ? 109.083 157.896 126.872 1.00 107.94 ? 432  ARG C NE    1 
ATOM   6943  C  CZ    . ARG C 2 432  ? 108.604 158.406 125.743 1.00 107.94 ? 432  ARG C CZ    1 
ATOM   6944  N  NH1   . ARG C 2 432  ? 107.623 157.791 125.099 1.00 107.94 ? 432  ARG C NH1   1 
ATOM   6945  N  NH2   . ARG C 2 432  ? 109.107 159.531 125.257 1.00 107.94 ? 432  ARG C NH2   1 
ATOM   6946  N  N     . THR C 2 433  ? 109.940 153.097 124.550 1.00 104.59 ? 433  THR C N     1 
ATOM   6947  C  CA    . THR C 2 433  ? 109.644 153.227 123.131 1.00 104.59 ? 433  THR C CA    1 
ATOM   6948  C  C     . THR C 2 433  ? 109.809 151.925 122.363 1.00 104.59 ? 433  THR C C     1 
ATOM   6949  O  O     . THR C 2 433  ? 109.680 151.935 121.135 1.00 104.59 ? 433  THR C O     1 
ATOM   6950  C  CB    . THR C 2 433  ? 110.528 154.303 122.505 1.00 104.59 ? 433  THR C CB    1 
ATOM   6951  O  OG1   . THR C 2 433  ? 111.885 154.108 122.917 1.00 104.59 ? 433  THR C OG1   1 
ATOM   6952  C  CG2   . THR C 2 433  ? 110.065 155.682 122.936 1.00 104.59 ? 433  THR C CG2   1 
ATOM   6953  N  N     . HIS C 2 434  ? 110.086 150.811 123.041 1.00 99.11  ? 434  HIS C N     1 
ATOM   6954  C  CA    . HIS C 2 434  ? 110.097 149.523 122.362 1.00 99.11  ? 434  HIS C CA    1 
ATOM   6955  C  C     . HIS C 2 434  ? 108.697 149.006 122.075 1.00 99.11  ? 434  HIS C C     1 
ATOM   6956  O  O     . HIS C 2 434  ? 108.563 147.993 121.380 1.00 99.11  ? 434  HIS C O     1 
ATOM   6957  C  CB    . HIS C 2 434  ? 110.861 148.484 123.182 1.00 99.11  ? 434  HIS C CB    1 
ATOM   6958  C  CG    . HIS C 2 434  ? 112.325 148.763 123.303 1.00 99.11  ? 434  HIS C CG    1 
ATOM   6959  N  ND1   . HIS C 2 434  ? 113.182 148.725 122.224 1.00 99.11  ? 434  HIS C ND1   1 
ATOM   6960  C  CD2   . HIS C 2 434  ? 113.089 149.063 124.379 1.00 99.11  ? 434  HIS C CD2   1 
ATOM   6961  C  CE1   . HIS C 2 434  ? 114.408 149.003 122.629 1.00 99.11  ? 434  HIS C CE1   1 
ATOM   6962  N  NE2   . HIS C 2 434  ? 114.379 149.212 123.932 1.00 99.11  ? 434  HIS C NE2   1 
ATOM   6963  N  N     . TYR C 2 435  ? 107.665 149.663 122.596 1.00 98.12  ? 435  TYR C N     1 
ATOM   6964  C  CA    . TYR C 2 435  ? 106.294 149.228 122.371 1.00 98.12  ? 435  TYR C CA    1 
ATOM   6965  C  C     . TYR C 2 435  ? 105.982 149.223 120.882 1.00 98.12  ? 435  TYR C C     1 
ATOM   6966  O  O     . TYR C 2 435  ? 105.916 150.280 120.248 1.00 98.12  ? 435  TYR C O     1 
ATOM   6967  C  CB    . TYR C 2 435  ? 105.333 150.152 123.118 1.00 98.12  ? 435  TYR C CB    1 
ATOM   6968  C  CG    . TYR C 2 435  ? 103.883 149.735 123.057 1.00 98.12  ? 435  TYR C CG    1 
ATOM   6969  C  CD1   . TYR C 2 435  ? 103.318 148.979 124.073 1.00 98.12  ? 435  TYR C CD1   1 
ATOM   6970  C  CD2   . TYR C 2 435  ? 103.075 150.107 121.994 1.00 98.12  ? 435  TYR C CD2   1 
ATOM   6971  C  CE1   . TYR C 2 435  ? 101.994 148.599 124.026 1.00 98.12  ? 435  TYR C CE1   1 
ATOM   6972  C  CE2   . TYR C 2 435  ? 101.752 149.730 121.938 1.00 98.12  ? 435  TYR C CE2   1 
ATOM   6973  C  CZ    . TYR C 2 435  ? 101.216 148.978 122.956 1.00 98.12  ? 435  TYR C CZ    1 
ATOM   6974  O  OH    . TYR C 2 435  ? 99.895  148.603 122.901 1.00 98.12  ? 435  TYR C OH    1 
ATOM   6975  N  N     . GLY C 2 436  ? 105.782 148.032 120.327 1.00 95.45  ? 436  GLY C N     1 
ATOM   6976  C  CA    . GLY C 2 436  ? 105.439 147.892 118.931 1.00 95.45  ? 436  GLY C CA    1 
ATOM   6977  C  C     . GLY C 2 436  ? 106.608 147.857 117.975 1.00 95.45  ? 436  GLY C C     1 
ATOM   6978  O  O     . GLY C 2 436  ? 106.388 147.761 116.761 1.00 95.45  ? 436  GLY C O     1 
ATOM   6979  N  N     . ARG C 2 437  ? 107.841 147.933 118.471 1.00 97.13  ? 437  ARG C N     1 
ATOM   6980  C  CA    . ARG C 2 437  ? 109.016 147.954 117.607 1.00 97.13  ? 437  ARG C CA    1 
ATOM   6981  C  C     . ARG C 2 437  ? 109.978 146.818 117.921 1.00 97.13  ? 437  ARG C C     1 
ATOM   6982  O  O     . ARG C 2 437  ? 110.539 146.222 116.997 1.00 97.13  ? 437  ARG C O     1 
ATOM   6983  C  CB    . ARG C 2 437  ? 109.719 149.310 117.723 1.00 97.13  ? 437  ARG C CB    1 
ATOM   6984  C  CG    . ARG C 2 437  ? 108.791 150.485 117.500 1.00 97.13  ? 437  ARG C CG    1 
ATOM   6985  C  CD    . ARG C 2 437  ? 109.483 151.812 117.736 1.00 97.13  ? 437  ARG C CD    1 
ATOM   6986  N  NE    . ARG C 2 437  ? 108.685 152.922 117.228 1.00 97.13  ? 437  ARG C NE    1 
ATOM   6987  C  CZ    . ARG C 2 437  ? 107.618 153.418 117.844 1.00 97.13  ? 437  ARG C CZ    1 
ATOM   6988  N  NH1   . ARG C 2 437  ? 107.218 152.910 119.000 1.00 97.13  ? 437  ARG C NH1   1 
ATOM   6989  N  NH2   . ARG C 2 437  ? 106.951 154.427 117.305 1.00 97.13  ? 437  ARG C NH2   1 
ATOM   6990  N  N     . ILE C 2 438  ? 110.190 146.497 119.194 1.00 92.76  ? 438  ILE C N     1 
ATOM   6991  C  CA    . ILE C 2 438  ? 111.089 145.425 119.601 1.00 92.76  ? 438  ILE C CA    1 
ATOM   6992  C  C     . ILE C 2 438  ? 110.378 144.583 120.649 1.00 92.76  ? 438  ILE C C     1 
ATOM   6993  O  O     . ILE C 2 438  ? 109.751 145.125 121.566 1.00 92.76  ? 438  ILE C O     1 
ATOM   6994  C  CB    . ILE C 2 438  ? 112.421 145.976 120.139 1.00 92.76  ? 438  ILE C CB    1 
ATOM   6995  C  CG1   . ILE C 2 438  ? 113.251 146.557 118.995 1.00 92.76  ? 438  ILE C CG1   1 
ATOM   6996  C  CG2   . ILE C 2 438  ? 113.205 144.894 120.854 1.00 92.76  ? 438  ILE C CG2   1 
ATOM   6997  C  CD1   . ILE C 2 438  ? 114.507 147.255 119.448 1.00 92.76  ? 438  ILE C CD1   1 
ATOM   6998  N  N     . CYS C 2 439  ? 110.468 143.266 120.507 1.00 100.24 ? 439  CYS C N     1 
ATOM   6999  C  CA    . CYS C 2 439  ? 109.797 142.370 121.435 1.00 100.24 ? 439  CYS C CA    1 
ATOM   7000  C  C     . CYS C 2 439  ? 110.388 142.521 122.831 1.00 100.24 ? 439  CYS C C     1 
ATOM   7001  O  O     . CYS C 2 439  ? 111.610 142.408 122.998 1.00 100.24 ? 439  CYS C O     1 
ATOM   7002  C  CB    . CYS C 2 439  ? 109.926 140.922 120.969 1.00 100.24 ? 439  CYS C CB    1 
ATOM   7003  S  SG    . CYS C 2 439  ? 108.685 139.809 121.656 1.00 100.24 ? 439  CYS C SG    1 
ATOM   7004  N  N     . PRO C 2 440  ? 109.570 142.784 123.851 1.00 99.46  ? 440  PRO C N     1 
ATOM   7005  C  CA    . PRO C 2 440  ? 110.109 142.871 125.214 1.00 99.46  ? 440  PRO C CA    1 
ATOM   7006  C  C     . PRO C 2 440  ? 110.338 141.519 125.860 1.00 99.46  ? 440  PRO C C     1 
ATOM   7007  O  O     . PRO C 2 440  ? 110.908 141.465 126.956 1.00 99.46  ? 440  PRO C O     1 
ATOM   7008  C  CB    . PRO C 2 440  ? 109.033 143.667 125.959 1.00 99.46  ? 440  PRO C CB    1 
ATOM   7009  C  CG    . PRO C 2 440  ? 107.772 143.296 125.258 1.00 99.46  ? 440  PRO C CG    1 
ATOM   7010  C  CD    . PRO C 2 440  ? 108.133 143.101 123.805 1.00 99.46  ? 440  PRO C CD    1 
ATOM   7011  N  N     . VAL C 2 441  ? 109.918 140.428 125.224 1.00 101.26 ? 441  VAL C N     1 
ATOM   7012  C  CA    . VAL C 2 441  ? 109.990 139.108 125.838 1.00 101.26 ? 441  VAL C CA    1 
ATOM   7013  C  C     . VAL C 2 441  ? 111.187 138.333 125.303 1.00 101.26 ? 441  VAL C C     1 
ATOM   7014  O  O     . VAL C 2 441  ? 112.045 137.889 126.074 1.00 101.26 ? 441  VAL C O     1 
ATOM   7015  C  CB    . VAL C 2 441  ? 108.686 138.324 125.611 1.00 101.26 ? 441  VAL C CB    1 
ATOM   7016  C  CG1   . VAL C 2 441  ? 108.904 136.845 125.866 1.00 101.26 ? 441  VAL C CG1   1 
ATOM   7017  C  CG2   . VAL C 2 441  ? 107.586 138.863 126.506 1.00 101.26 ? 441  VAL C CG2   1 
ATOM   7018  N  N     . GLU C 2 442  ? 111.257 138.165 123.985 1.00 106.35 ? 442  GLU C N     1 
ATOM   7019  C  CA    . GLU C 2 442  ? 112.235 137.271 123.367 1.00 106.35 ? 442  GLU C CA    1 
ATOM   7020  C  C     . GLU C 2 442  ? 113.616 137.911 123.424 1.00 106.35 ? 442  GLU C C     1 
ATOM   7021  O  O     . GLU C 2 442  ? 113.842 138.985 122.862 1.00 106.35 ? 442  GLU C O     1 
ATOM   7022  C  CB    . GLU C 2 442  ? 111.840 136.949 121.932 1.00 106.35 ? 442  GLU C CB    1 
ATOM   7023  C  CG    . GLU C 2 442  ? 112.887 136.149 121.181 1.00 106.35 ? 442  GLU C CG    1 
ATOM   7024  C  CD    . GLU C 2 442  ? 112.679 136.182 119.683 1.00 106.35 ? 442  GLU C CD    1 
ATOM   7025  O  OE1   . GLU C 2 442  ? 111.541 136.452 119.247 1.00 106.35 ? 442  GLU C OE1   1 
ATOM   7026  O  OE2   . GLU C 2 442  ? 113.654 135.941 118.941 1.00 106.35 ? 442  GLU C OE2   1 
ATOM   7027  N  N     . THR C 2 443  ? 114.543 137.238 124.098 1.00 108.55 ? 443  THR C N     1 
ATOM   7028  C  CA    . THR C 2 443  ? 115.936 137.650 124.176 1.00 108.55 ? 443  THR C CA    1 
ATOM   7029  C  C     . THR C 2 443  ? 116.742 136.474 124.702 1.00 108.55 ? 443  THR C C     1 
ATOM   7030  O  O     . THR C 2 443  ? 116.218 135.650 125.461 1.00 108.55 ? 443  THR C O     1 
ATOM   7031  C  CB    . THR C 2 443  ? 116.115 138.882 125.077 1.00 108.55 ? 443  THR C CB    1 
ATOM   7032  O  OG1   . THR C 2 443  ? 117.466 139.349 124.999 1.00 108.55 ? 443  THR C OG1   1 
ATOM   7033  C  CG2   . THR C 2 443  ? 115.784 138.556 126.520 1.00 108.55 ? 443  THR C CG2   1 
ATOM   7034  N  N     . PRO C 2 444  ? 118.003 136.346 124.294 1.00 110.62 ? 444  PRO C N     1 
ATOM   7035  C  CA    . PRO C 2 444  ? 118.819 135.229 124.783 1.00 110.62 ? 444  PRO C CA    1 
ATOM   7036  C  C     . PRO C 2 444  ? 118.973 135.264 126.293 1.00 110.62 ? 444  PRO C C     1 
ATOM   7037  O  O     . PRO C 2 444  ? 119.092 136.330 126.902 1.00 110.62 ? 444  PRO C O     1 
ATOM   7038  C  CB    . PRO C 2 444  ? 120.165 135.438 124.082 1.00 110.62 ? 444  PRO C CB    1 
ATOM   7039  C  CG    . PRO C 2 444  ? 119.824 136.192 122.854 1.00 110.62 ? 444  PRO C CG    1 
ATOM   7040  C  CD    . PRO C 2 444  ? 118.689 137.098 123.232 1.00 110.62 ? 444  PRO C CD    1 
ATOM   7041  N  N     . GLU C 2 445  ? 118.964 134.081 126.896 1.00 118.36 ? 445  GLU C N     1 
ATOM   7042  C  CA    . GLU C 2 445  ? 119.160 133.962 128.332 1.00 118.36 ? 445  GLU C CA    1 
ATOM   7043  C  C     . GLU C 2 445  ? 120.637 133.761 128.641 1.00 118.36 ? 445  GLU C C     1 
ATOM   7044  O  O     . GLU C 2 445  ? 121.325 132.979 127.979 1.00 118.36 ? 445  GLU C O     1 
ATOM   7045  C  CB    . GLU C 2 445  ? 118.342 132.797 128.887 1.00 118.36 ? 445  GLU C CB    1 
ATOM   7046  C  CG    . GLU C 2 445  ? 118.417 132.645 130.396 1.00 118.36 ? 445  GLU C CG    1 
ATOM   7047  C  CD    . GLU C 2 445  ? 118.373 133.977 131.119 1.00 118.36 ? 445  GLU C CD    1 
ATOM   7048  O  OE1   . GLU C 2 445  ? 119.449 134.488 131.497 1.00 118.36 ? 445  GLU C OE1   1 
ATOM   7049  O  OE2   . GLU C 2 445  ? 117.262 134.512 131.312 1.00 118.36 ? 445  GLU C OE2   1 
ATOM   7050  N  N     . GLY C 2 446  ? 121.122 134.471 129.649 1.00 119.41 ? 446  GLY C N     1 
ATOM   7051  C  CA    . GLY C 2 446  ? 122.510 134.383 130.043 1.00 119.41 ? 446  GLY C CA    1 
ATOM   7052  C  C     . GLY C 2 446  ? 123.240 135.706 129.938 1.00 119.41 ? 446  GLY C C     1 
ATOM   7053  O  O     . GLY C 2 446  ? 122.691 136.785 130.173 1.00 119.41 ? 446  GLY C O     1 
ATOM   7054  N  N     . ALA C 2 447  ? 124.522 135.608 129.577 1.00 117.89 ? 447  ALA C N     1 
ATOM   7055  C  CA    . ALA C 2 447  ? 125.363 136.797 129.496 1.00 117.89 ? 447  ALA C CA    1 
ATOM   7056  C  C     . ALA C 2 447  ? 124.907 137.745 128.397 1.00 117.89 ? 447  ALA C C     1 
ATOM   7057  O  O     . ALA C 2 447  ? 125.095 138.961 128.509 1.00 117.89 ? 447  ALA C O     1 
ATOM   7058  C  CB    . ALA C 2 447  ? 126.820 136.393 129.273 1.00 117.89 ? 447  ALA C CB    1 
ATOM   7059  N  N     . ASN C 2 448  ? 124.310 137.216 127.334 1.00 117.93 ? 448  ASN C N     1 
ATOM   7060  C  CA    . ASN C 2 448  ? 123.873 138.027 126.207 1.00 117.93 ? 448  ASN C CA    1 
ATOM   7061  C  C     . ASN C 2 448  ? 122.472 138.595 126.385 1.00 117.93 ? 448  ASN C C     1 
ATOM   7062  O  O     . ASN C 2 448  ? 121.878 139.046 125.401 1.00 117.93 ? 448  ASN C O     1 
ATOM   7063  C  CB    . ASN C 2 448  ? 123.929 137.208 124.915 1.00 117.93 ? 448  ASN C CB    1 
ATOM   7064  C  CG    . ASN C 2 448  ? 125.295 137.235 124.268 1.00 117.93 ? 448  ASN C CG    1 
ATOM   7065  O  OD1   . ASN C 2 448  ? 126.048 138.194 124.424 1.00 117.93 ? 448  ASN C OD1   1 
ATOM   7066  N  ND2   . ASN C 2 448  ? 125.623 136.179 123.534 1.00 117.93 ? 448  ASN C ND2   1 
ATOM   7067  N  N     . ILE C 2 449  ? 121.929 138.579 127.603 1.00 112.47 ? 449  ILE C N     1 
ATOM   7068  C  CA    . ILE C 2 449  ? 120.576 139.076 127.819 1.00 112.47 ? 449  ILE C CA    1 
ATOM   7069  C  C     . ILE C 2 449  ? 120.528 140.570 127.537 1.00 112.47 ? 449  ILE C C     1 
ATOM   7070  O  O     . ILE C 2 449  ? 121.463 141.314 127.857 1.00 112.47 ? 449  ILE C O     1 
ATOM   7071  C  CB    . ILE C 2 449  ? 120.107 138.746 129.244 1.00 112.47 ? 449  ILE C CB    1 
ATOM   7072  C  CG1   . ILE C 2 449  ? 118.612 139.030 129.396 1.00 112.47 ? 449  ILE C CG1   1 
ATOM   7073  C  CG2   . ILE C 2 449  ? 120.905 139.520 130.279 1.00 112.47 ? 449  ILE C CG2   1 
ATOM   7074  C  CD1   . ILE C 2 449  ? 118.039 138.558 130.710 1.00 112.47 ? 449  ILE C CD1   1 
ATOM   7075  N  N     . GLY C 2 450  ? 119.445 141.012 126.899 1.00 108.99 ? 450  GLY C N     1 
ATOM   7076  C  CA    . GLY C 2 450  ? 119.234 142.412 126.609 1.00 108.99 ? 450  GLY C CA    1 
ATOM   7077  C  C     . GLY C 2 450  ? 120.050 142.975 125.467 1.00 108.99 ? 450  GLY C C     1 
ATOM   7078  O  O     . GLY C 2 450  ? 119.647 143.984 124.879 1.00 108.99 ? 450  GLY C O     1 
ATOM   7079  N  N     . LEU C 2 451  ? 121.185 142.362 125.129 1.00 110.09 ? 451  LEU C N     1 
ATOM   7080  C  CA    . LEU C 2 451  ? 121.998 142.873 124.032 1.00 110.09 ? 451  LEU C CA    1 
ATOM   7081  C  C     . LEU C 2 451  ? 121.463 142.416 122.682 1.00 110.09 ? 451  LEU C C     1 
ATOM   7082  O  O     . LEU C 2 451  ? 121.559 143.150 121.693 1.00 110.09 ? 451  LEU C O     1 
ATOM   7083  C  CB    . LEU C 2 451  ? 123.450 142.433 124.206 1.00 110.09 ? 451  LEU C CB    1 
ATOM   7084  C  CG    . LEU C 2 451  ? 124.165 142.966 125.447 1.00 110.09 ? 451  LEU C CG    1 
ATOM   7085  C  CD1   . LEU C 2 451  ? 125.596 142.468 125.487 1.00 110.09 ? 451  LEU C CD1   1 
ATOM   7086  C  CD2   . LEU C 2 451  ? 124.123 144.482 125.470 1.00 110.09 ? 451  LEU C CD2   1 
ATOM   7087  N  N     . ILE C 2 452  ? 120.901 141.215 122.624 1.00 104.32 ? 452  ILE C N     1 
ATOM   7088  C  CA    . ILE C 2 452  ? 120.333 140.660 121.402 1.00 104.32 ? 452  ILE C CA    1 
ATOM   7089  C  C     . ILE C 2 452  ? 118.818 140.681 121.537 1.00 104.32 ? 452  ILE C C     1 
ATOM   7090  O  O     . ILE C 2 452  ? 118.276 140.273 122.571 1.00 104.32 ? 452  ILE C O     1 
ATOM   7091  C  CB    . ILE C 2 452  ? 120.842 139.235 121.149 1.00 104.32 ? 452  ILE C CB    1 
ATOM   7092  C  CG1   . ILE C 2 452  ? 122.367 139.188 121.232 1.00 104.32 ? 452  ILE C CG1   1 
ATOM   7093  C  CG2   . ILE C 2 452  ? 120.364 138.740 119.807 1.00 104.32 ? 452  ILE C CG2   1 
ATOM   7094  C  CD1   . ILE C 2 452  ? 123.060 139.737 120.012 1.00 104.32 ? 452  ILE C CD1   1 
ATOM   7095  N  N     . THR C 2 453  ? 118.127 141.148 120.500 1.00 103.85 ? 453  THR C N     1 
ATOM   7096  C  CA    . THR C 2 453  ? 116.677 141.258 120.525 1.00 103.85 ? 453  THR C CA    1 
ATOM   7097  C  C     . THR C 2 453  ? 116.109 140.825 119.179 1.00 103.85 ? 453  THR C C     1 
ATOM   7098  O  O     . THR C 2 453  ? 116.837 140.404 118.276 1.00 103.85 ? 453  THR C O     1 
ATOM   7099  C  CB    . THR C 2 453  ? 116.239 142.687 120.863 1.00 103.85 ? 453  THR C CB    1 
ATOM   7100  O  OG1   . THR C 2 453  ? 117.077 143.619 120.170 1.00 103.85 ? 453  THR C OG1   1 
ATOM   7101  C  CG2   . THR C 2 453  ? 116.337 142.938 122.359 1.00 103.85 ? 453  THR C CG2   1 
ATOM   7102  N  N     . SER C 2 454  ? 114.792 140.943 119.045 1.00 96.15  ? 454  SER C N     1 
ATOM   7103  C  CA    . SER C 2 454  ? 114.097 140.558 117.828 1.00 96.15  ? 454  SER C CA    1 
ATOM   7104  C  C     . SER C 2 454  ? 113.115 141.648 117.433 1.00 96.15  ? 454  SER C C     1 
ATOM   7105  O  O     . SER C 2 454  ? 112.505 142.290 118.293 1.00 96.15  ? 454  SER C O     1 
ATOM   7106  C  CB    . SER C 2 454  ? 113.357 139.230 118.005 1.00 96.15  ? 454  SER C CB    1 
ATOM   7107  O  OG    . SER C 2 454  ? 114.240 138.133 117.847 1.00 96.15  ? 454  SER C OG    1 
ATOM   7108  N  N     . LEU C 2 455  ? 112.978 141.857 116.127 1.00 91.54  ? 455  LEU C N     1 
ATOM   7109  C  CA    . LEU C 2 455  ? 112.031 142.835 115.616 1.00 91.54  ? 455  LEU C CA    1 
ATOM   7110  C  C     . LEU C 2 455  ? 110.609 142.457 116.007 1.00 91.54  ? 455  LEU C C     1 
ATOM   7111  O  O     . LEU C 2 455  ? 110.315 141.296 116.302 1.00 91.54  ? 455  LEU C O     1 
ATOM   7112  C  CB    . LEU C 2 455  ? 112.151 142.929 114.096 1.00 91.54  ? 455  LEU C CB    1 
ATOM   7113  C  CG    . LEU C 2 455  ? 111.739 144.245 113.442 1.00 91.54  ? 455  LEU C CG    1 
ATOM   7114  C  CD1   . LEU C 2 455  ? 112.498 145.403 114.055 1.00 91.54  ? 455  LEU C CD1   1 
ATOM   7115  C  CD2   . LEU C 2 455  ? 111.979 144.178 111.947 1.00 91.54  ? 455  LEU C CD2   1 
ATOM   7116  N  N     . ALA C 2 456  ? 109.721 143.447 116.007 1.00 95.29  ? 456  ALA C N     1 
ATOM   7117  C  CA    . ALA C 2 456  ? 108.323 143.187 116.304 1.00 95.29  ? 456  ALA C CA    1 
ATOM   7118  C  C     . ALA C 2 456  ? 107.641 142.525 115.111 1.00 95.29  ? 456  ALA C C     1 
ATOM   7119  O  O     . ALA C 2 456  ? 108.274 142.172 114.114 1.00 95.29  ? 456  ALA C O     1 
ATOM   7120  C  CB    . ALA C 2 456  ? 107.601 144.481 116.671 1.00 95.29  ? 456  ALA C CB    1 
ATOM   7121  N  N     . ALA C 2 457  ? 106.323 142.359 115.223 1.00 99.32  ? 457  ALA C N     1 
ATOM   7122  C  CA    . ALA C 2 457  ? 105.584 141.692 114.158 1.00 99.32  ? 457  ALA C CA    1 
ATOM   7123  C  C     . ALA C 2 457  ? 105.296 142.643 113.005 1.00 99.32  ? 457  ALA C C     1 
ATOM   7124  O  O     . ALA C 2 457  ? 105.744 142.414 111.876 1.00 99.32  ? 457  ALA C O     1 
ATOM   7125  C  CB    . ALA C 2 457  ? 104.285 141.107 114.708 1.00 99.32  ? 457  ALA C CB    1 
ATOM   7126  N  N     . TYR C 2 458  ? 104.558 143.717 113.266 1.00 104.09 ? 458  TYR C N     1 
ATOM   7127  C  CA    . TYR C 2 458  ? 104.190 144.675 112.233 1.00 104.09 ? 458  TYR C CA    1 
ATOM   7128  C  C     . TYR C 2 458  ? 105.273 145.710 111.967 1.00 104.09 ? 458  TYR C C     1 
ATOM   7129  O  O     . TYR C 2 458  ? 105.062 146.605 111.143 1.00 104.09 ? 458  TYR C O     1 
ATOM   7130  C  CB    . TYR C 2 458  ? 102.891 145.391 112.612 1.00 104.09 ? 458  TYR C CB    1 
ATOM   7131  C  CG    . TYR C 2 458  ? 101.652 144.535 112.501 1.00 104.09 ? 458  TYR C CG    1 
ATOM   7132  C  CD1   . TYR C 2 458  ? 101.374 143.559 113.443 1.00 104.09 ? 458  TYR C CD1   1 
ATOM   7133  C  CD2   . TYR C 2 458  ? 100.754 144.714 111.460 1.00 104.09 ? 458  TYR C CD2   1 
ATOM   7134  C  CE1   . TYR C 2 458  ? 100.244 142.779 113.349 1.00 104.09 ? 458  TYR C CE1   1 
ATOM   7135  C  CE2   . TYR C 2 458  ? 99.620  143.938 111.359 1.00 104.09 ? 458  TYR C CE2   1 
ATOM   7136  C  CZ    . TYR C 2 458  ? 99.370  142.974 112.306 1.00 104.09 ? 458  TYR C CZ    1 
ATOM   7137  O  OH    . TYR C 2 458  ? 98.241  142.197 112.210 1.00 104.09 ? 458  TYR C OH    1 
ATOM   7138  N  N     . ALA C 2 459  ? 106.418 145.612 112.633 1.00 101.78 ? 459  ALA C N     1 
ATOM   7139  C  CA    . ALA C 2 459  ? 107.453 146.625 112.512 1.00 101.78 ? 459  ALA C CA    1 
ATOM   7140  C  C     . ALA C 2 459  ? 108.158 146.535 111.166 1.00 101.78 ? 459  ALA C C     1 
ATOM   7141  O  O     . ALA C 2 459  ? 108.454 145.448 110.663 1.00 101.78 ? 459  ALA C O     1 
ATOM   7142  C  CB    . ALA C 2 459  ? 108.474 146.484 113.639 1.00 101.78 ? 459  ALA C CB    1 
ATOM   7143  N  N     . ARG C 2 460  ? 108.426 147.701 110.582 1.00 106.93 ? 460  ARG C N     1 
ATOM   7144  C  CA    . ARG C 2 460  ? 109.187 147.798 109.347 1.00 106.93 ? 460  ARG C CA    1 
ATOM   7145  C  C     . ARG C 2 460  ? 110.226 148.899 109.492 1.00 106.93 ? 460  ARG C C     1 
ATOM   7146  O  O     . ARG C 2 460  ? 110.054 149.835 110.276 1.00 106.93 ? 460  ARG C O     1 
ATOM   7147  C  CB    . ARG C 2 460  ? 108.285 148.076 108.138 1.00 106.93 ? 460  ARG C CB    1 
ATOM   7148  C  CG    . ARG C 2 460  ? 107.755 149.495 108.070 1.00 106.93 ? 460  ARG C CG    1 
ATOM   7149  C  CD    . ARG C 2 460  ? 107.213 149.823 106.689 1.00 106.93 ? 460  ARG C CD    1 
ATOM   7150  N  NE    . ARG C 2 460  ? 106.067 148.993 106.330 1.00 106.93 ? 460  ARG C NE    1 
ATOM   7151  C  CZ    . ARG C 2 460  ? 106.118 147.983 105.468 1.00 106.93 ? 460  ARG C CZ    1 
ATOM   7152  N  NH1   . ARG C 2 460  ? 107.261 147.675 104.874 1.00 106.93 ? 460  ARG C NH1   1 
ATOM   7153  N  NH2   . ARG C 2 460  ? 105.025 147.282 105.200 1.00 106.93 ? 460  ARG C NH2   1 
ATOM   7154  N  N     . VAL C 2 461  ? 111.309 148.773 108.734 1.00 108.30 ? 461  VAL C N     1 
ATOM   7155  C  CA    . VAL C 2 461  ? 112.414 149.723 108.789 1.00 108.30 ? 461  VAL C CA    1 
ATOM   7156  C  C     . VAL C 2 461  ? 112.363 150.598 107.545 1.00 108.30 ? 461  VAL C C     1 
ATOM   7157  O  O     . VAL C 2 461  ? 112.330 150.090 106.419 1.00 108.30 ? 461  VAL C O     1 
ATOM   7158  C  CB    . VAL C 2 461  ? 113.762 148.998 108.900 1.00 108.30 ? 461  VAL C CB    1 
ATOM   7159  C  CG1   . VAL C 2 461  ? 114.902 149.999 108.876 1.00 108.30 ? 461  VAL C CG1   1 
ATOM   7160  C  CG2   . VAL C 2 461  ? 113.807 148.161 110.164 1.00 108.30 ? 461  VAL C CG2   1 
ATOM   7161  N  N     . ASP C 2 462  ? 112.361 151.913 107.745 1.00 119.19 ? 462  ASP C N     1 
ATOM   7162  C  CA    . ASP C 2 462  ? 112.276 152.840 106.628 1.00 119.19 ? 462  ASP C CA    1 
ATOM   7163  C  C     . ASP C 2 462  ? 113.645 153.008 105.972 1.00 119.19 ? 462  ASP C C     1 
ATOM   7164  O  O     . ASP C 2 462  ? 114.610 152.304 106.281 1.00 119.19 ? 462  ASP C O     1 
ATOM   7165  C  CB    . ASP C 2 462  ? 111.715 154.181 107.095 1.00 119.19 ? 462  ASP C CB    1 
ATOM   7166  C  CG    . ASP C 2 462  ? 112.475 154.756 108.274 1.00 119.19 ? 462  ASP C CG    1 
ATOM   7167  O  OD1   . ASP C 2 462  ? 113.513 154.180 108.660 1.00 119.19 ? 462  ASP C OD1   1 
ATOM   7168  O  OD2   . ASP C 2 462  ? 112.029 155.787 108.819 1.00 119.19 ? 462  ASP C OD2   1 
ATOM   7169  N  N     . GLU C 2 463  ? 113.727 153.967 105.047 1.00 125.34 ? 463  GLU C N     1 
ATOM   7170  C  CA    . GLU C 2 463  ? 114.962 154.162 104.296 1.00 125.34 ? 463  GLU C CA    1 
ATOM   7171  C  C     . GLU C 2 463  ? 116.050 154.808 105.144 1.00 125.34 ? 463  GLU C C     1 
ATOM   7172  O  O     . GLU C 2 463  ? 117.239 154.582 104.896 1.00 125.34 ? 463  GLU C O     1 
ATOM   7173  C  CB    . GLU C 2 463  ? 114.692 155.001 103.046 1.00 125.34 ? 463  GLU C CB    1 
ATOM   7174  C  CG    . GLU C 2 463  ? 114.192 156.411 103.320 1.00 125.34 ? 463  GLU C CG    1 
ATOM   7175  C  CD    . GLU C 2 463  ? 112.714 156.458 103.655 1.00 125.34 ? 463  GLU C CD    1 
ATOM   7176  O  OE1   . GLU C 2 463  ? 112.025 155.436 103.456 1.00 125.34 ? 463  GLU C OE1   1 
ATOM   7177  O  OE2   . GLU C 2 463  ? 112.242 157.517 104.120 1.00 125.34 ? 463  GLU C OE2   1 
ATOM   7178  N  N     . LEU C 2 464  ? 115.674 155.610 106.141 1.00 116.81 ? 464  LEU C N     1 
ATOM   7179  C  CA    . LEU C 2 464  ? 116.669 156.249 106.992 1.00 116.81 ? 464  LEU C CA    1 
ATOM   7180  C  C     . LEU C 2 464  ? 117.224 155.314 108.056 1.00 116.81 ? 464  LEU C C     1 
ATOM   7181  O  O     . LEU C 2 464  ? 118.353 155.520 108.511 1.00 116.81 ? 464  LEU C O     1 
ATOM   7182  C  CB    . LEU C 2 464  ? 116.078 157.491 107.661 1.00 116.81 ? 464  LEU C CB    1 
ATOM   7183  C  CG    . LEU C 2 464  ? 116.257 158.812 106.912 1.00 116.81 ? 464  LEU C CG    1 
ATOM   7184  C  CD1   . LEU C 2 464  ? 115.302 158.907 105.735 1.00 116.81 ? 464  LEU C CD1   1 
ATOM   7185  C  CD2   . LEU C 2 464  ? 116.064 159.986 107.855 1.00 116.81 ? 464  LEU C CD2   1 
ATOM   7186  N  N     . GLY C 2 465  ? 116.466 154.300 108.460 1.00 113.22 ? 465  GLY C N     1 
ATOM   7187  C  CA    . GLY C 2 465  ? 116.927 153.343 109.440 1.00 113.22 ? 465  GLY C CA    1 
ATOM   7188  C  C     . GLY C 2 465  ? 116.200 153.355 110.764 1.00 113.22 ? 465  GLY C C     1 
ATOM   7189  O  O     . GLY C 2 465  ? 116.658 152.695 111.703 1.00 113.22 ? 465  GLY C O     1 
ATOM   7190  N  N     . PHE C 2 466  ? 115.091 154.078 110.874 1.00 110.63 ? 466  PHE C N     1 
ATOM   7191  C  CA    . PHE C 2 466  ? 114.309 154.107 112.100 1.00 110.63 ? 466  PHE C CA    1 
ATOM   7192  C  C     . PHE C 2 466  ? 113.154 153.121 112.003 1.00 110.63 ? 466  PHE C C     1 
ATOM   7193  O  O     . PHE C 2 466  ? 112.610 152.886 110.922 1.00 110.63 ? 466  PHE C O     1 
ATOM   7194  C  CB    . PHE C 2 466  ? 113.778 155.514 112.369 1.00 110.63 ? 466  PHE C CB    1 
ATOM   7195  C  CG    . PHE C 2 466  ? 114.856 156.539 112.558 1.00 110.63 ? 466  PHE C CG    1 
ATOM   7196  C  CD1   . PHE C 2 466  ? 114.854 157.710 111.822 1.00 110.63 ? 466  PHE C CD1   1 
ATOM   7197  C  CD2   . PHE C 2 466  ? 115.873 156.331 113.473 1.00 110.63 ? 466  PHE C CD2   1 
ATOM   7198  C  CE1   . PHE C 2 466  ? 115.844 158.653 111.994 1.00 110.63 ? 466  PHE C CE1   1 
ATOM   7199  C  CE2   . PHE C 2 466  ? 116.866 157.271 113.650 1.00 110.63 ? 466  PHE C CE2   1 
ATOM   7200  C  CZ    . PHE C 2 466  ? 116.852 158.434 112.909 1.00 110.63 ? 466  PHE C CZ    1 
ATOM   7201  N  N     . ILE C 2 467  ? 112.780 152.549 113.140 1.00 101.17 ? 467  ILE C N     1 
ATOM   7202  C  CA    . ILE C 2 467  ? 111.740 151.529 113.169 1.00 101.17 ? 467  ILE C CA    1 
ATOM   7203  C  C     . ILE C 2 467  ? 110.385 152.201 113.334 1.00 101.17 ? 467  ILE C C     1 
ATOM   7204  O  O     . ILE C 2 467  ? 110.156 152.934 114.303 1.00 101.17 ? 467  ILE C O     1 
ATOM   7205  C  CB    . ILE C 2 467  ? 111.999 150.521 114.297 1.00 101.17 ? 467  ILE C CB    1 
ATOM   7206  C  CG1   . ILE C 2 467  ? 113.352 149.843 114.100 1.00 101.17 ? 467  ILE C CG1   1 
ATOM   7207  C  CG2   . ILE C 2 467  ? 110.899 149.482 114.333 1.00 101.17 ? 467  ILE C CG2   1 
ATOM   7208  C  CD1   . ILE C 2 467  ? 113.774 148.990 115.267 1.00 101.17 ? 467  ILE C CD1   1 
ATOM   7209  N  N     . ARG C 2 468  ? 109.484 151.953 112.390 1.00 107.11 ? 468  ARG C N     1 
ATOM   7210  C  CA    . ARG C 2 468  ? 108.143 152.513 112.420 1.00 107.11 ? 468  ARG C CA    1 
ATOM   7211  C  C     . ARG C 2 468  ? 107.124 151.422 112.718 1.00 107.11 ? 468  ARG C C     1 
ATOM   7212  O  O     . ARG C 2 468  ? 107.349 150.242 112.438 1.00 107.11 ? 468  ARG C O     1 
ATOM   7213  C  CB    . ARG C 2 468  ? 107.795 153.192 111.094 1.00 107.11 ? 468  ARG C CB    1 
ATOM   7214  C  CG    . ARG C 2 468  ? 108.950 153.930 110.450 1.00 107.11 ? 468  ARG C CG    1 
ATOM   7215  C  CD    . ARG C 2 468  ? 108.641 154.263 109.004 1.00 107.11 ? 468  ARG C CD    1 
ATOM   7216  N  NE    . ARG C 2 468  ? 107.792 155.443 108.886 1.00 107.11 ? 468  ARG C NE    1 
ATOM   7217  C  CZ    . ARG C 2 468  ? 108.248 156.673 108.677 1.00 107.11 ? 468  ARG C CZ    1 
ATOM   7218  N  NH1   . ARG C 2 468  ? 109.550 156.887 108.561 1.00 107.11 ? 468  ARG C NH1   1 
ATOM   7219  N  NH2   . ARG C 2 468  ? 107.402 157.689 108.584 1.00 107.11 ? 468  ARG C NH2   1 
ATOM   7220  N  N     . THR C 2 469  ? 105.995 151.833 113.290 1.00 105.40 ? 469  THR C N     1 
ATOM   7221  C  CA    . THR C 2 469  ? 104.911 150.929 113.631 1.00 105.40 ? 469  THR C CA    1 
ATOM   7222  C  C     . THR C 2 469  ? 103.588 151.538 113.187 1.00 105.40 ? 469  THR C C     1 
ATOM   7223  O  O     . THR C 2 469  ? 103.468 152.767 113.111 1.00 105.40 ? 469  THR C O     1 
ATOM   7224  C  CB    . THR C 2 469  ? 104.894 150.643 115.142 1.00 105.40 ? 469  THR C CB    1 
ATOM   7225  O  OG1   . THR C 2 469  ? 103.862 149.699 115.452 1.00 105.40 ? 469  THR C OG1   1 
ATOM   7226  C  CG2   . THR C 2 469  ? 104.671 151.917 115.932 1.00 105.40 ? 469  THR C CG2   1 
ATOM   7227  N  N     . PRO C 2 470  ? 102.596 150.717 112.848 1.00 104.44 ? 470  PRO C N     1 
ATOM   7228  C  CA    . PRO C 2 470  ? 101.339 151.263 112.326 1.00 104.44 ? 470  PRO C CA    1 
ATOM   7229  C  C     . PRO C 2 470  ? 100.364 151.647 113.427 1.00 104.44 ? 470  PRO C C     1 
ATOM   7230  O  O     . PRO C 2 470  ? 100.363 151.075 114.520 1.00 104.44 ? 470  PRO C O     1 
ATOM   7231  C  CB    . PRO C 2 470  ? 100.785 150.107 111.487 1.00 104.44 ? 470  PRO C CB    1 
ATOM   7232  C  CG    . PRO C 2 470  ? 101.285 148.902 112.190 1.00 104.44 ? 470  PRO C CG    1 
ATOM   7233  C  CD    . PRO C 2 470  ? 102.675 149.259 112.647 1.00 104.44 ? 470  PRO C CD    1 
ATOM   7234  N  N     . TYR C 2 471  ? 99.523  152.631 113.118 1.00 108.69 ? 471  TYR C N     1 
ATOM   7235  C  CA    . TYR C 2 471  ? 98.445  153.052 113.998 1.00 108.69 ? 471  TYR C CA    1 
ATOM   7236  C  C     . TYR C 2 471  ? 97.245  153.454 113.156 1.00 108.69 ? 471  TYR C C     1 
ATOM   7237  O  O     . TYR C 2 471  ? 97.392  154.050 112.087 1.00 108.69 ? 471  TYR C O     1 
ATOM   7238  C  CB    . TYR C 2 471  ? 98.853  154.231 114.889 1.00 108.69 ? 471  TYR C CB    1 
ATOM   7239  C  CG    . TYR C 2 471  ? 99.941  153.916 115.882 1.00 108.69 ? 471  TYR C CG    1 
ATOM   7240  C  CD1   . TYR C 2 471  ? 101.188 154.509 115.781 1.00 108.69 ? 471  TYR C CD1   1 
ATOM   7241  C  CD2   . TYR C 2 471  ? 99.720  153.031 116.925 1.00 108.69 ? 471  TYR C CD2   1 
ATOM   7242  C  CE1   . TYR C 2 471  ? 102.185 154.230 116.687 1.00 108.69 ? 471  TYR C CE1   1 
ATOM   7243  C  CE2   . TYR C 2 471  ? 100.713 152.744 117.836 1.00 108.69 ? 471  TYR C CE2   1 
ATOM   7244  C  CZ    . TYR C 2 471  ? 101.944 153.345 117.712 1.00 108.69 ? 471  TYR C CZ    1 
ATOM   7245  O  OH    . TYR C 2 471  ? 102.938 153.063 118.618 1.00 108.69 ? 471  TYR C OH    1 
ATOM   7246  N  N     . ARG C 2 472  ? 96.055  153.125 113.648 1.00 118.66 ? 472  ARG C N     1 
ATOM   7247  C  CA    . ARG C 2 472  ? 94.819  153.524 112.993 1.00 118.66 ? 472  ARG C CA    1 
ATOM   7248  C  C     . ARG C 2 472  ? 94.425  154.928 113.427 1.00 118.66 ? 472  ARG C C     1 
ATOM   7249  O  O     . ARG C 2 472  ? 94.420  155.244 114.620 1.00 118.66 ? 472  ARG C O     1 
ATOM   7250  C  CB    . ARG C 2 472  ? 93.692  152.543 113.315 1.00 118.66 ? 472  ARG C CB    1 
ATOM   7251  C  CG    . ARG C 2 472  ? 93.851  151.184 112.664 1.00 118.66 ? 472  ARG C CG    1 
ATOM   7252  C  CD    . ARG C 2 472  ? 92.719  150.254 113.051 1.00 118.66 ? 472  ARG C CD    1 
ATOM   7253  N  NE    . ARG C 2 472  ? 92.791  149.867 114.455 1.00 118.66 ? 472  ARG C NE    1 
ATOM   7254  C  CZ    . ARG C 2 472  ? 91.854  149.165 115.083 1.00 118.66 ? 472  ARG C CZ    1 
ATOM   7255  N  NH1   . ARG C 2 472  ? 90.769  148.774 114.429 1.00 118.66 ? 472  ARG C NH1   1 
ATOM   7256  N  NH2   . ARG C 2 472  ? 92.002  148.853 116.363 1.00 118.66 ? 472  ARG C NH2   1 
ATOM   7257  N  N     . ARG C 2 473  ? 94.099  155.769 112.451 1.00 126.57 ? 473  ARG C N     1 
ATOM   7258  C  CA    . ARG C 2 473  ? 93.705  157.136 112.751 1.00 126.57 ? 473  ARG C CA    1 
ATOM   7259  C  C     . ARG C 2 473  ? 92.314  157.167 113.367 1.00 126.57 ? 473  ARG C C     1 
ATOM   7260  O  O     . ARG C 2 473  ? 91.404  156.461 112.926 1.00 126.57 ? 473  ARG C O     1 
ATOM   7261  C  CB    . ARG C 2 473  ? 93.731  157.991 111.487 1.00 126.57 ? 473  ARG C CB    1 
ATOM   7262  C  CG    . ARG C 2 473  ? 93.487  159.470 111.744 1.00 126.57 ? 473  ARG C CG    1 
ATOM   7263  C  CD    . ARG C 2 473  ? 93.505  160.262 110.454 1.00 126.57 ? 473  ARG C CD    1 
ATOM   7264  N  NE    . ARG C 2 473  ? 94.807  160.196 109.799 1.00 126.57 ? 473  ARG C NE    1 
ATOM   7265  C  CZ    . ARG C 2 473  ? 95.834  160.984 110.098 1.00 126.57 ? 473  ARG C CZ    1 
ATOM   7266  N  NH1   . ARG C 2 473  ? 95.713  161.905 111.042 1.00 126.57 ? 473  ARG C NH1   1 
ATOM   7267  N  NH2   . ARG C 2 473  ? 96.982  160.850 109.450 1.00 126.57 ? 473  ARG C NH2   1 
ATOM   7268  N  N     . VAL C 2 474  ? 92.153  157.996 114.393 1.00 127.18 ? 474  VAL C N     1 
ATOM   7269  C  CA    . VAL C 2 474  ? 90.878  158.179 115.072 1.00 127.18 ? 474  VAL C CA    1 
ATOM   7270  C  C     . VAL C 2 474  ? 90.527  159.655 114.983 1.00 127.18 ? 474  VAL C C     1 
ATOM   7271  O  O     . VAL C 2 474  ? 91.223  160.502 115.558 1.00 127.18 ? 474  VAL C O     1 
ATOM   7272  C  CB    . VAL C 2 474  ? 90.928  157.712 116.531 1.00 127.18 ? 474  VAL C CB    1 
ATOM   7273  C  CG1   . VAL C 2 474  ? 89.664  158.131 117.262 1.00 127.18 ? 474  VAL C CG1   1 
ATOM   7274  C  CG2   . VAL C 2 474  ? 91.114  156.208 116.596 1.00 127.18 ? 474  VAL C CG2   1 
ATOM   7275  N  N     . VAL C 2 475  ? 89.455  159.967 114.262 1.00 131.15 ? 475  VAL C N     1 
ATOM   7276  C  CA    . VAL C 2 475  ? 88.963  161.331 114.118 1.00 131.15 ? 475  VAL C CA    1 
ATOM   7277  C  C     . VAL C 2 475  ? 87.601  161.412 114.792 1.00 131.15 ? 475  VAL C C     1 
ATOM   7278  O  O     . VAL C 2 475  ? 86.755  160.528 114.609 1.00 131.15 ? 475  VAL C O     1 
ATOM   7279  C  CB    . VAL C 2 475  ? 88.892  161.751 112.638 1.00 131.15 ? 475  VAL C CB    1 
ATOM   7280  C  CG1   . VAL C 2 475  ? 88.045  160.775 111.834 1.00 131.15 ? 475  VAL C CG1   1 
ATOM   7281  C  CG2   . VAL C 2 475  ? 88.347  163.163 112.514 1.00 131.15 ? 475  VAL C CG2   1 
ATOM   7282  N  N     . GLY C 2 476  ? 87.396  162.462 115.584 1.00 136.28 ? 476  GLY C N     1 
ATOM   7283  C  CA    . GLY C 2 476  ? 86.195  162.566 116.387 1.00 136.28 ? 476  GLY C CA    1 
ATOM   7284  C  C     . GLY C 2 476  ? 86.053  161.384 117.322 1.00 136.28 ? 476  GLY C C     1 
ATOM   7285  O  O     . GLY C 2 476  ? 86.927  161.136 118.157 1.00 136.28 ? 476  GLY C O     1 
ATOM   7286  N  N     . GLY C 2 477  ? 84.953  160.645 117.193 1.00 136.07 ? 477  GLY C N     1 
ATOM   7287  C  CA    . GLY C 2 477  ? 84.769  159.405 117.916 1.00 136.07 ? 477  GLY C CA    1 
ATOM   7288  C  C     . GLY C 2 477  ? 84.772  158.159 117.061 1.00 136.07 ? 477  GLY C C     1 
ATOM   7289  O  O     . GLY C 2 477  ? 84.645  157.054 117.606 1.00 136.07 ? 477  GLY C O     1 
ATOM   7290  N  N     . VAL C 2 478  ? 84.916  158.284 115.745 1.00 135.05 ? 478  VAL C N     1 
ATOM   7291  C  CA    . VAL C 2 478  ? 84.865  157.153 114.827 1.00 135.05 ? 478  VAL C CA    1 
ATOM   7292  C  C     . VAL C 2 478  ? 86.287  156.723 114.495 1.00 135.05 ? 478  VAL C C     1 
ATOM   7293  O  O     . VAL C 2 478  ? 87.170  157.566 114.296 1.00 135.05 ? 478  VAL C O     1 
ATOM   7294  C  CB    . VAL C 2 478  ? 84.073  157.508 113.555 1.00 135.05 ? 478  VAL C CB    1 
ATOM   7295  C  CG1   . VAL C 2 478  ? 84.633  158.760 112.902 1.00 135.05 ? 478  VAL C CG1   1 
ATOM   7296  C  CG2   . VAL C 2 478  ? 84.074  156.346 112.577 1.00 135.05 ? 478  VAL C CG2   1 
ATOM   7297  N  N     . VAL C 2 479  ? 86.513  155.414 114.454 1.00 133.73 ? 479  VAL C N     1 
ATOM   7298  C  CA    . VAL C 2 479  ? 87.817  154.854 114.122 1.00 133.73 ? 479  VAL C CA    1 
ATOM   7299  C  C     . VAL C 2 479  ? 87.866  154.597 112.622 1.00 133.73 ? 479  VAL C C     1 
ATOM   7300  O  O     . VAL C 2 479  ? 87.090  153.794 112.096 1.00 133.73 ? 479  VAL C O     1 
ATOM   7301  C  CB    . VAL C 2 479  ? 88.084  153.563 114.910 1.00 133.73 ? 479  VAL C CB    1 
ATOM   7302  C  CG1   . VAL C 2 479  ? 89.315  152.858 114.369 1.00 133.73 ? 479  VAL C CG1   1 
ATOM   7303  C  CG2   . VAL C 2 479  ? 88.245  153.868 116.390 1.00 133.73 ? 479  VAL C CG2   1 
ATOM   7304  N  N     . THR C 2 480  ? 88.778  155.278 111.932 1.00 139.29 ? 480  THR C N     1 
ATOM   7305  C  CA    . THR C 2 480  ? 88.920  155.102 110.496 1.00 139.29 ? 480  THR C CA    1 
ATOM   7306  C  C     . THR C 2 480  ? 89.651  153.794 110.194 1.00 139.29 ? 480  THR C C     1 
ATOM   7307  O  O     . THR C 2 480  ? 89.944  152.989 111.082 1.00 139.29 ? 480  THR C O     1 
ATOM   7308  C  CB    . THR C 2 480  ? 89.658  156.289 109.883 1.00 139.29 ? 480  THR C CB    1 
ATOM   7309  O  OG1   . THR C 2 480  ? 90.790  156.620 110.695 1.00 139.29 ? 480  THR C OG1   1 
ATOM   7310  C  CG2   . THR C 2 480  ? 88.737  157.494 109.789 1.00 139.29 ? 480  THR C CG2   1 
ATOM   7311  N  N     . ASP C 2 481  ? 89.951  153.582 108.915 1.00 143.01 ? 481  ASP C N     1 
ATOM   7312  C  CA    . ASP C 2 481  ? 90.583  152.352 108.463 1.00 143.01 ? 481  ASP C CA    1 
ATOM   7313  C  C     . ASP C 2 481  ? 91.958  152.568 107.847 1.00 143.01 ? 481  ASP C C     1 
ATOM   7314  O  O     . ASP C 2 481  ? 92.693  151.595 107.658 1.00 143.01 ? 481  ASP C O     1 
ATOM   7315  C  CB    . ASP C 2 481  ? 89.679  151.638 107.455 1.00 143.01 ? 481  ASP C CB    1 
ATOM   7316  C  CG    . ASP C 2 481  ? 88.336  151.262 108.046 1.00 143.01 ? 481  ASP C CG    1 
ATOM   7317  O  OD1   . ASP C 2 481  ? 87.435  152.126 108.075 1.00 143.01 ? 481  ASP C OD1   1 
ATOM   7318  O  OD2   . ASP C 2 481  ? 88.183  150.103 108.483 1.00 143.01 ? 481  ASP C OD2   1 
ATOM   7319  N  N     . GLU C 2 482  ? 92.327  153.805 107.530 1.00 132.37 ? 482  GLU C N     1 
ATOM   7320  C  CA    . GLU C 2 482  ? 93.637  154.064 106.952 1.00 132.37 ? 482  GLU C CA    1 
ATOM   7321  C  C     . GLU C 2 482  ? 94.681  154.125 108.060 1.00 132.37 ? 482  GLU C C     1 
ATOM   7322  O  O     . GLU C 2 482  ? 94.475  154.779 109.087 1.00 132.37 ? 482  GLU C O     1 
ATOM   7323  C  CB    . GLU C 2 482  ? 93.618  155.354 106.129 1.00 132.37 ? 482  GLU C CB    1 
ATOM   7324  C  CG    . GLU C 2 482  ? 93.310  156.627 106.897 1.00 132.37 ? 482  GLU C CG    1 
ATOM   7325  C  CD    . GLU C 2 482  ? 94.560  157.302 107.420 1.00 132.37 ? 482  GLU C CD    1 
ATOM   7326  O  OE1   . GLU C 2 482  ? 95.653  157.016 106.890 1.00 132.37 ? 482  GLU C OE1   1 
ATOM   7327  O  OE2   . GLU C 2 482  ? 94.454  158.119 108.355 1.00 132.37 ? 482  GLU C OE2   1 
ATOM   7328  N  N     . VAL C 2 483  ? 95.788  153.416 107.864 1.00 118.33 ? 483  VAL C N     1 
ATOM   7329  C  CA    . VAL C 2 483  ? 96.835  153.286 108.869 1.00 118.33 ? 483  VAL C CA    1 
ATOM   7330  C  C     . VAL C 2 483  ? 97.960  154.254 108.541 1.00 118.33 ? 483  VAL C C     1 
ATOM   7331  O  O     . VAL C 2 483  ? 98.152  154.635 107.381 1.00 118.33 ? 483  VAL C O     1 
ATOM   7332  C  CB    . VAL C 2 483  ? 97.365  151.842 108.954 1.00 118.33 ? 483  VAL C CB    1 
ATOM   7333  C  CG1   . VAL C 2 483  ? 96.231  150.881 109.265 1.00 118.33 ? 483  VAL C CG1   1 
ATOM   7334  C  CG2   . VAL C 2 483  ? 98.056  151.452 107.662 1.00 118.33 ? 483  VAL C CG2   1 
ATOM   7335  N  N     . VAL C 2 484  ? 98.696  154.658 109.572 1.00 111.71 ? 484  VAL C N     1 
ATOM   7336  C  CA    . VAL C 2 484  ? 99.852  155.535 109.437 1.00 111.71 ? 484  VAL C CA    1 
ATOM   7337  C  C     . VAL C 2 484  ? 101.022 154.861 110.136 1.00 111.71 ? 484  VAL C C     1 
ATOM   7338  O  O     . VAL C 2 484  ? 100.890 154.410 111.280 1.00 111.71 ? 484  VAL C O     1 
ATOM   7339  C  CB    . VAL C 2 484  ? 99.590  156.926 110.033 1.00 111.71 ? 484  VAL C CB    1 
ATOM   7340  C  CG1   . VAL C 2 484  ? 100.774 157.840 109.781 1.00 111.71 ? 484  VAL C CG1   1 
ATOM   7341  C  CG2   . VAL C 2 484  ? 98.319  157.523 109.454 1.00 111.71 ? 484  VAL C CG2   1 
ATOM   7342  N  N     . TYR C 2 485  ? 102.157 154.780 109.448 1.00 110.26 ? 485  TYR C N     1 
ATOM   7343  C  CA    . TYR C 2 485  ? 103.370 154.230 110.038 1.00 110.26 ? 485  TYR C CA    1 
ATOM   7344  C  C     . TYR C 2 485  ? 104.171 155.362 110.667 1.00 110.26 ? 485  TYR C C     1 
ATOM   7345  O  O     . TYR C 2 485  ? 104.572 156.303 109.974 1.00 110.26 ? 485  TYR C O     1 
ATOM   7346  C  CB    . TYR C 2 485  ? 104.195 153.502 108.981 1.00 110.26 ? 485  TYR C CB    1 
ATOM   7347  C  CG    . TYR C 2 485  ? 103.793 152.061 108.774 1.00 110.26 ? 485  TYR C CG    1 
ATOM   7348  C  CD1   . TYR C 2 485  ? 102.863 151.712 107.806 1.00 110.26 ? 485  TYR C CD1   1 
ATOM   7349  C  CD2   . TYR C 2 485  ? 104.346 151.050 109.545 1.00 110.26 ? 485  TYR C CD2   1 
ATOM   7350  C  CE1   . TYR C 2 485  ? 102.494 150.398 107.614 1.00 110.26 ? 485  TYR C CE1   1 
ATOM   7351  C  CE2   . TYR C 2 485  ? 103.983 149.732 109.359 1.00 110.26 ? 485  TYR C CE2   1 
ATOM   7352  C  CZ    . TYR C 2 485  ? 103.057 149.412 108.393 1.00 110.26 ? 485  TYR C CZ    1 
ATOM   7353  O  OH    . TYR C 2 485  ? 102.693 148.100 108.205 1.00 110.26 ? 485  TYR C OH    1 
ATOM   7354  N  N     . MET C 2 486  ? 104.406 155.276 111.972 1.00 116.52 ? 486  MET C N     1 
ATOM   7355  C  CA    . MET C 2 486  ? 105.036 156.354 112.719 1.00 116.52 ? 486  MET C CA    1 
ATOM   7356  C  C     . MET C 2 486  ? 106.285 155.857 113.431 1.00 116.52 ? 486  MET C C     1 
ATOM   7357  O  O     . MET C 2 486  ? 106.384 154.679 113.787 1.00 116.52 ? 486  MET C O     1 
ATOM   7358  C  CB    . MET C 2 486  ? 104.067 156.950 113.742 1.00 116.52 ? 486  MET C CB    1 
ATOM   7359  C  CG    . MET C 2 486  ? 102.824 157.562 113.130 1.00 116.52 ? 486  MET C CG    1 
ATOM   7360  S  SD    . MET C 2 486  ? 102.193 158.943 114.098 1.00 116.52 ? 486  MET C SD    1 
ATOM   7361  C  CE    . MET C 2 486  ? 101.436 158.075 115.467 1.00 116.52 ? 486  MET C CE    1 
ATOM   7362  N  N     . THR C 2 487  ? 107.237 156.766 113.625 1.00 114.64 ? 487  THR C N     1 
ATOM   7363  C  CA    . THR C 2 487  ? 108.395 156.506 114.461 1.00 114.64 ? 487  THR C CA    1 
ATOM   7364  C  C     . THR C 2 487  ? 108.111 156.952 115.892 1.00 114.64 ? 487  THR C C     1 
ATOM   7365  O  O     . THR C 2 487  ? 107.034 157.462 116.209 1.00 114.64 ? 487  THR C O     1 
ATOM   7366  C  CB    . THR C 2 487  ? 109.627 157.225 113.918 1.00 114.64 ? 487  THR C CB    1 
ATOM   7367  O  OG1   . THR C 2 487  ? 109.472 158.637 114.100 1.00 114.64 ? 487  THR C OG1   1 
ATOM   7368  C  CG2   . THR C 2 487  ? 109.802 156.931 112.441 1.00 114.64 ? 487  THR C CG2   1 
ATOM   7369  N  N     . ALA C 2 488  ? 109.102 156.768 116.766 1.00 116.67 ? 488  ALA C N     1 
ATOM   7370  C  CA    . ALA C 2 488  ? 108.908 157.102 118.173 1.00 116.67 ? 488  ALA C CA    1 
ATOM   7371  C  C     . ALA C 2 488  ? 108.854 158.610 118.385 1.00 116.67 ? 488  ALA C C     1 
ATOM   7372  O  O     . ALA C 2 488  ? 108.033 159.104 119.169 1.00 116.67 ? 488  ALA C O     1 
ATOM   7373  C  CB    . ALA C 2 488  ? 110.017 156.480 119.018 1.00 116.67 ? 488  ALA C CB    1 
ATOM   7374  N  N     . THR C 2 489  ? 109.733 159.352 117.708 1.00 118.66 ? 489  THR C N     1 
ATOM   7375  C  CA    . THR C 2 489  ? 109.729 160.807 117.823 1.00 118.66 ? 489  THR C CA    1 
ATOM   7376  C  C     . THR C 2 489  ? 108.374 161.381 117.429 1.00 118.66 ? 489  THR C C     1 
ATOM   7377  O  O     . THR C 2 489  ? 107.846 162.278 118.096 1.00 118.66 ? 489  THR C O     1 
ATOM   7378  C  CB    . THR C 2 489  ? 110.841 161.400 116.959 1.00 118.66 ? 489  THR C CB    1 
ATOM   7379  O  OG1   . THR C 2 489  ? 112.113 161.099 117.544 1.00 118.66 ? 489  THR C OG1   1 
ATOM   7380  C  CG2   . THR C 2 489  ? 110.689 162.907 116.848 1.00 118.66 ? 489  THR C CG2   1 
ATOM   7381  N  N     . GLU C 2 490  ? 107.790 160.866 116.347 1.00 121.35 ? 490  GLU C N     1 
ATOM   7382  C  CA    . GLU C 2 490  ? 106.463 161.312 115.944 1.00 121.35 ? 490  GLU C CA    1 
ATOM   7383  C  C     . GLU C 2 490  ? 105.382 160.735 116.849 1.00 121.35 ? 490  GLU C C     1 
ATOM   7384  O  O     . GLU C 2 490  ? 104.326 161.352 117.023 1.00 121.35 ? 490  GLU C O     1 
ATOM   7385  C  CB    . GLU C 2 490  ? 106.206 160.925 114.489 1.00 121.35 ? 490  GLU C CB    1 
ATOM   7386  C  CG    . GLU C 2 490  ? 104.984 161.576 113.874 1.00 121.35 ? 490  GLU C CG    1 
ATOM   7387  C  CD    . GLU C 2 490  ? 104.811 161.211 112.414 1.00 121.35 ? 490  GLU C CD    1 
ATOM   7388  O  OE1   . GLU C 2 490  ? 105.709 160.543 111.859 1.00 121.35 ? 490  GLU C OE1   1 
ATOM   7389  O  OE2   . GLU C 2 490  ? 103.779 161.589 111.822 1.00 121.35 ? 490  GLU C OE2   1 
ATOM   7390  N  N     . GLU C 2 491  ? 105.629 159.562 117.435 1.00 118.97 ? 491  GLU C N     1 
ATOM   7391  C  CA    . GLU C 2 491  ? 104.627 158.928 118.285 1.00 118.97 ? 491  GLU C CA    1 
ATOM   7392  C  C     . GLU C 2 491  ? 104.447 159.689 119.592 1.00 118.97 ? 491  GLU C C     1 
ATOM   7393  O  O     . GLU C 2 491  ? 103.341 159.740 120.143 1.00 118.97 ? 491  GLU C O     1 
ATOM   7394  C  CB    . GLU C 2 491  ? 105.023 157.477 118.556 1.00 118.97 ? 491  GLU C CB    1 
ATOM   7395  C  CG    . GLU C 2 491  ? 104.202 156.776 119.617 1.00 118.97 ? 491  GLU C CG    1 
ATOM   7396  C  CD    . GLU C 2 491  ? 104.751 155.407 119.964 1.00 118.97 ? 491  GLU C CD    1 
ATOM   7397  O  OE1   . GLU C 2 491  ? 105.178 155.211 121.121 1.00 118.97 ? 491  GLU C OE1   1 
ATOM   7398  O  OE2   . GLU C 2 491  ? 104.758 154.527 119.078 1.00 118.97 ? 491  GLU C OE2   1 
ATOM   7399  N  N     . ASP C 2 492  ? 105.520 160.302 120.096 1.00 121.02 ? 492  ASP C N     1 
ATOM   7400  C  CA    . ASP C 2 492  ? 105.458 160.973 121.391 1.00 121.02 ? 492  ASP C CA    1 
ATOM   7401  C  C     . ASP C 2 492  ? 104.584 162.222 121.390 1.00 121.02 ? 492  ASP C C     1 
ATOM   7402  O  O     . ASP C 2 492  ? 104.511 162.900 122.420 1.00 121.02 ? 492  ASP C O     1 
ATOM   7403  C  CB    . ASP C 2 492  ? 106.867 161.347 121.855 1.00 121.02 ? 492  ASP C CB    1 
ATOM   7404  C  CG    . ASP C 2 492  ? 107.626 160.167 122.423 1.00 121.02 ? 492  ASP C CG    1 
ATOM   7405  O  OD1   . ASP C 2 492  ? 106.976 159.219 122.911 1.00 121.02 ? 492  ASP C OD1   1 
ATOM   7406  O  OD2   . ASP C 2 492  ? 108.874 160.189 122.389 1.00 121.02 ? 492  ASP C OD2   1 
ATOM   7407  N  N     . ARG C 2 493  ? 103.923 162.547 120.278 1.00 124.92 ? 493  ARG C N     1 
ATOM   7408  C  CA    . ARG C 2 493  ? 103.188 163.804 120.204 1.00 124.92 ? 493  ARG C CA    1 
ATOM   7409  C  C     . ARG C 2 493  ? 101.678 163.614 120.281 1.00 124.92 ? 493  ARG C C     1 
ATOM   7410  O  O     . ARG C 2 493  ? 100.942 164.604 120.354 1.00 124.92 ? 493  ARG C O     1 
ATOM   7411  C  CB    . ARG C 2 493  ? 103.552 164.546 118.918 1.00 124.92 ? 493  ARG C CB    1 
ATOM   7412  C  CG    . ARG C 2 493  ? 105.035 164.847 118.786 1.00 124.92 ? 493  ARG C CG    1 
ATOM   7413  C  CD    . ARG C 2 493  ? 105.501 164.738 117.346 1.00 124.92 ? 493  ARG C CD    1 
ATOM   7414  N  NE    . ARG C 2 493  ? 105.263 165.967 116.597 1.00 124.92 ? 493  ARG C NE    1 
ATOM   7415  C  CZ    . ARG C 2 493  ? 104.279 166.127 115.719 1.00 124.92 ? 493  ARG C CZ    1 
ATOM   7416  N  NH1   . ARG C 2 493  ? 103.439 165.132 115.476 1.00 124.92 ? 493  ARG C NH1   1 
ATOM   7417  N  NH2   . ARG C 2 493  ? 104.136 167.281 115.083 1.00 124.92 ? 493  ARG C NH2   1 
ATOM   7418  N  N     . TYR C 2 494  ? 101.192 162.376 120.265 1.00 121.75 ? 494  TYR C N     1 
ATOM   7419  C  CA    . TYR C 2 494  ? 99.762  162.120 120.279 1.00 121.75 ? 494  TYR C CA    1 
ATOM   7420  C  C     . TYR C 2 494  ? 99.372  161.258 121.478 1.00 121.75 ? 494  TYR C C     1 
ATOM   7421  O  O     . TYR C 2 494  ? 100.213 160.769 122.234 1.00 121.75 ? 494  TYR C O     1 
ATOM   7422  C  CB    . TYR C 2 494  ? 99.325  161.456 118.972 1.00 121.75 ? 494  TYR C CB    1 
ATOM   7423  C  CG    . TYR C 2 494  ? 99.894  162.092 117.727 1.00 121.75 ? 494  TYR C CG    1 
ATOM   7424  C  CD1   . TYR C 2 494  ? 99.383  163.286 117.240 1.00 121.75 ? 494  TYR C CD1   1 
ATOM   7425  C  CD2   . TYR C 2 494  ? 100.933 161.494 117.032 1.00 121.75 ? 494  TYR C CD2   1 
ATOM   7426  C  CE1   . TYR C 2 494  ? 99.895  163.869 116.101 1.00 121.75 ? 494  TYR C CE1   1 
ATOM   7427  C  CE2   . TYR C 2 494  ? 101.452 162.070 115.891 1.00 121.75 ? 494  TYR C CE2   1 
ATOM   7428  C  CZ    . TYR C 2 494  ? 100.929 163.257 115.430 1.00 121.75 ? 494  TYR C CZ    1 
ATOM   7429  O  OH    . TYR C 2 494  ? 101.443 163.836 114.294 1.00 121.75 ? 494  TYR C OH    1 
ATOM   7430  N  N     . THR C 2 495  ? 98.064  161.073 121.644 1.00 119.08 ? 495  THR C N     1 
ATOM   7431  C  CA    . THR C 2 495  ? 97.490  160.200 122.663 1.00 119.08 ? 495  THR C CA    1 
ATOM   7432  C  C     . THR C 2 495  ? 96.958  158.966 121.948 1.00 119.08 ? 495  THR C C     1 
ATOM   7433  O  O     . THR C 2 495  ? 96.090  159.079 121.076 1.00 119.08 ? 495  THR C O     1 
ATOM   7434  C  CB    . THR C 2 495  ? 96.377  160.906 123.432 1.00 119.08 ? 495  THR C CB    1 
ATOM   7435  O  OG1   . THR C 2 495  ? 96.941  161.916 124.278 1.00 119.08 ? 495  THR C OG1   1 
ATOM   7436  C  CG2   . THR C 2 495  ? 95.605  159.911 124.281 1.00 119.08 ? 495  THR C CG2   1 
ATOM   7437  N  N     . ILE C 2 496  ? 97.464  157.791 122.313 1.00 114.41 ? 496  ILE C N     1 
ATOM   7438  C  CA    . ILE C 2 496  ? 97.203  156.571 121.554 1.00 114.41 ? 496  ILE C CA    1 
ATOM   7439  C  C     . ILE C 2 496  ? 96.356  155.630 122.396 1.00 114.41 ? 496  ILE C C     1 
ATOM   7440  O  O     . ILE C 2 496  ? 96.793  155.176 123.458 1.00 114.41 ? 496  ILE C O     1 
ATOM   7441  C  CB    . ILE C 2 496  ? 98.506  155.891 121.117 1.00 114.41 ? 496  ILE C CB    1 
ATOM   7442  C  CG1   . ILE C 2 496  ? 99.284  156.810 120.179 1.00 114.41 ? 496  ILE C CG1   1 
ATOM   7443  C  CG2   . ILE C 2 496  ? 98.212  154.564 120.446 1.00 114.41 ? 496  ILE C CG2   1 
ATOM   7444  C  CD1   . ILE C 2 496  ? 100.710 156.398 119.987 1.00 114.41 ? 496  ILE C CD1   1 
ATOM   7445  N  N     . ALA C 2 497  ? 95.158  155.317 121.915 1.00 117.42 ? 497  ALA C N     1 
ATOM   7446  C  CA    . ALA C 2 497  ? 94.274  154.410 122.630 1.00 117.42 ? 497  ALA C CA    1 
ATOM   7447  C  C     . ALA C 2 497  ? 94.753  152.971 122.494 1.00 117.42 ? 497  ALA C C     1 
ATOM   7448  O  O     . ALA C 2 497  ? 95.717  152.677 121.784 1.00 117.42 ? 497  ALA C O     1 
ATOM   7449  C  CB    . ALA C 2 497  ? 92.842  154.532 122.112 1.00 117.42 ? 497  ALA C CB    1 
ATOM   7450  N  N     . GLN C 2 498  ? 94.064  152.070 123.188 1.00 119.16 ? 498  GLN C N     1 
ATOM   7451  C  CA    . GLN C 2 498  ? 94.428  150.662 123.152 1.00 119.16 ? 498  GLN C CA    1 
ATOM   7452  C  C     . GLN C 2 498  ? 93.636  149.928 122.077 1.00 119.16 ? 498  GLN C C     1 
ATOM   7453  O  O     . GLN C 2 498  ? 92.643  150.434 121.549 1.00 119.16 ? 498  GLN C O     1 
ATOM   7454  C  CB    . GLN C 2 498  ? 94.189  150.013 124.514 1.00 119.16 ? 498  GLN C CB    1 
ATOM   7455  C  CG    . GLN C 2 498  ? 95.333  150.196 125.493 1.00 119.16 ? 498  GLN C CG    1 
ATOM   7456  C  CD    . GLN C 2 498  ? 96.646  149.658 124.964 1.00 119.16 ? 498  GLN C CD    1 
ATOM   7457  O  OE1   . GLN C 2 498  ? 96.676  148.674 124.227 1.00 119.16 ? 498  GLN C OE1   1 
ATOM   7458  N  NE2   . GLN C 2 498  ? 97.743  150.303 125.340 1.00 119.16 ? 498  GLN C NE2   1 
ATOM   7459  N  N     . ALA C 2 499  ? 94.087  148.713 121.758 1.00 119.59 ? 499  ALA C N     1 
ATOM   7460  C  CA    . ALA C 2 499  ? 93.477  147.954 120.674 1.00 119.59 ? 499  ALA C CA    1 
ATOM   7461  C  C     . ALA C 2 499  ? 92.165  147.295 121.076 1.00 119.59 ? 499  ALA C C     1 
ATOM   7462  O  O     . ALA C 2 499  ? 91.285  147.132 120.225 1.00 119.59 ? 499  ALA C O     1 
ATOM   7463  C  CB    . ALA C 2 499  ? 94.450  146.891 120.166 1.00 119.59 ? 499  ALA C CB    1 
ATOM   7464  N  N     . ASN C 2 500  ? 92.010  146.913 122.340 1.00 122.93 ? 500  ASN C N     1 
ATOM   7465  C  CA    . ASN C 2 500  ? 90.841  146.162 122.777 1.00 122.93 ? 500  ASN C CA    1 
ATOM   7466  C  C     . ASN C 2 500  ? 89.749  147.034 123.383 1.00 122.93 ? 500  ASN C C     1 
ATOM   7467  O  O     . ASN C 2 500  ? 88.973  146.540 124.206 1.00 122.93 ? 500  ASN C O     1 
ATOM   7468  C  CB    . ASN C 2 500  ? 91.257  145.081 123.781 1.00 122.93 ? 500  ASN C CB    1 
ATOM   7469  C  CG    . ASN C 2 500  ? 91.987  145.645 124.985 1.00 122.93 ? 500  ASN C CG    1 
ATOM   7470  O  OD1   . ASN C 2 500  ? 91.997  146.853 125.217 1.00 122.93 ? 500  ASN C OD1   1 
ATOM   7471  N  ND2   . ASN C 2 500  ? 92.611  144.765 125.758 1.00 122.93 ? 500  ASN C ND2   1 
ATOM   7472  N  N     . THR C 2 501  ? 89.671  148.304 123.009 1.00 126.70 ? 501  THR C N     1 
ATOM   7473  C  CA    . THR C 2 501  ? 88.602  149.153 123.510 1.00 126.70 ? 501  THR C CA    1 
ATOM   7474  C  C     . THR C 2 501  ? 87.274  148.719 122.898 1.00 126.70 ? 501  THR C C     1 
ATOM   7475  O  O     . THR C 2 501  ? 87.244  148.301 121.732 1.00 126.70 ? 501  THR C O     1 
ATOM   7476  C  CB    . THR C 2 501  ? 88.876  150.620 123.185 1.00 126.70 ? 501  THR C CB    1 
ATOM   7477  O  OG1   . THR C 2 501  ? 88.935  150.793 121.765 1.00 126.70 ? 501  THR C OG1   1 
ATOM   7478  C  CG2   . THR C 2 501  ? 90.193  151.061 123.800 1.00 126.70 ? 501  THR C CG2   1 
ATOM   7479  N  N     . PRO C 2 502  ? 86.170  148.787 123.639 1.00 134.24 ? 502  PRO C N     1 
ATOM   7480  C  CA    . PRO C 2 502  ? 84.882  148.357 123.081 1.00 134.24 ? 502  PRO C CA    1 
ATOM   7481  C  C     . PRO C 2 502  ? 84.475  149.221 121.898 1.00 134.24 ? 502  PRO C C     1 
ATOM   7482  O  O     . PRO C 2 502  ? 84.679  150.437 121.891 1.00 134.24 ? 502  PRO C O     1 
ATOM   7483  C  CB    . PRO C 2 502  ? 83.912  148.519 124.257 1.00 134.24 ? 502  PRO C CB    1 
ATOM   7484  C  CG    . PRO C 2 502  ? 84.778  148.543 125.476 1.00 134.24 ? 502  PRO C CG    1 
ATOM   7485  C  CD    . PRO C 2 502  ? 86.058  149.186 125.051 1.00 134.24 ? 502  PRO C CD    1 
ATOM   7486  N  N     . LEU C 2 503  ? 83.892  148.578 120.891 1.00 137.74 ? 503  LEU C N     1 
ATOM   7487  C  CA    . LEU C 2 503  ? 83.511  149.243 119.655 1.00 137.74 ? 503  LEU C CA    1 
ATOM   7488  C  C     . LEU C 2 503  ? 82.131  148.782 119.218 1.00 137.74 ? 503  LEU C C     1 
ATOM   7489  O  O     . LEU C 2 503  ? 81.817  147.589 119.273 1.00 137.74 ? 503  LEU C O     1 
ATOM   7490  C  CB    . LEU C 2 503  ? 84.523  148.959 118.539 1.00 137.74 ? 503  LEU C CB    1 
ATOM   7491  C  CG    . LEU C 2 503  ? 85.822  149.763 118.548 1.00 137.74 ? 503  LEU C CG    1 
ATOM   7492  C  CD1   . LEU C 2 503  ? 86.765  149.250 117.476 1.00 137.74 ? 503  LEU C CD1   1 
ATOM   7493  C  CD2   . LEU C 2 503  ? 85.532  151.235 118.342 1.00 137.74 ? 503  LEU C CD2   1 
ATOM   7494  N  N     . GLU C 2 504  ? 81.309  149.734 118.787 1.00 150.62 ? 504  GLU C N     1 
ATOM   7495  C  CA    . GLU C 2 504  ? 80.040  149.452 118.126 1.00 150.62 ? 504  GLU C CA    1 
ATOM   7496  C  C     . GLU C 2 504  ? 80.142  150.001 116.708 1.00 150.62 ? 504  GLU C C     1 
ATOM   7497  O  O     . GLU C 2 504  ? 80.176  151.220 116.509 1.00 150.62 ? 504  GLU C O     1 
ATOM   7498  C  CB    . GLU C 2 504  ? 78.866  150.066 118.887 1.00 150.62 ? 504  GLU C CB    1 
ATOM   7499  C  CG    . GLU C 2 504  ? 79.111  151.474 119.400 1.00 150.62 ? 504  GLU C CG    1 
ATOM   7500  C  CD    . GLU C 2 504  ? 77.840  152.148 119.872 1.00 150.62 ? 504  GLU C CD    1 
ATOM   7501  O  OE1   . GLU C 2 504  ? 76.772  151.502 119.818 1.00 150.62 ? 504  GLU C OE1   1 
ATOM   7502  O  OE2   . GLU C 2 504  ? 77.907  153.322 120.293 1.00 150.62 ? 504  GLU C OE2   1 
ATOM   7503  N  N     . GLY C 2 505  ? 80.198  149.104 115.728 1.00 150.76 ? 505  GLY C N     1 
ATOM   7504  C  CA    . GLY C 2 505  ? 80.497  149.542 114.376 1.00 150.76 ? 505  GLY C CA    1 
ATOM   7505  C  C     . GLY C 2 505  ? 81.900  150.113 114.307 1.00 150.76 ? 505  GLY C C     1 
ATOM   7506  O  O     . GLY C 2 505  ? 82.897  149.409 114.506 1.00 150.76 ? 505  GLY C O     1 
ATOM   7507  N  N     . ASN C 2 506  ? 81.984  151.408 114.024 1.00 145.48 ? 506  ASN C N     1 
ATOM   7508  C  CA    . ASN C 2 506  ? 83.255  152.117 114.021 1.00 145.48 ? 506  ASN C CA    1 
ATOM   7509  C  C     . ASN C 2 506  ? 83.343  153.179 115.108 1.00 145.48 ? 506  ASN C C     1 
ATOM   7510  O  O     . ASN C 2 506  ? 84.305  153.953 115.120 1.00 145.48 ? 506  ASN C O     1 
ATOM   7511  C  CB    . ASN C 2 506  ? 83.496  152.760 112.653 1.00 145.48 ? 506  ASN C CB    1 
ATOM   7512  C  CG    . ASN C 2 506  ? 83.950  151.758 111.613 1.00 145.48 ? 506  ASN C CG    1 
ATOM   7513  O  OD1   . ASN C 2 506  ? 83.646  150.569 111.706 1.00 145.48 ? 506  ASN C OD1   1 
ATOM   7514  N  ND2   . ASN C 2 506  ? 84.686  152.233 110.616 1.00 145.48 ? 506  ASN C ND2   1 
ATOM   7515  N  N     . ARG C 2 507  ? 82.375  153.231 116.017 1.00 144.38 ? 507  ARG C N     1 
ATOM   7516  C  CA    . ARG C 2 507  ? 82.341  154.229 117.075 1.00 144.38 ? 507  ARG C CA    1 
ATOM   7517  C  C     . ARG C 2 507  ? 82.821  153.622 118.385 1.00 144.38 ? 507  ARG C C     1 
ATOM   7518  O  O     . ARG C 2 507  ? 82.444  152.500 118.737 1.00 144.38 ? 507  ARG C O     1 
ATOM   7519  C  CB    . ARG C 2 507  ? 80.927  154.788 117.247 1.00 144.38 ? 507  ARG C CB    1 
ATOM   7520  C  CG    . ARG C 2 507  ? 80.742  155.653 118.482 1.00 144.38 ? 507  ARG C CG    1 
ATOM   7521  C  CD    . ARG C 2 507  ? 79.466  156.471 118.393 1.00 144.38 ? 507  ARG C CD    1 
ATOM   7522  N  NE    . ARG C 2 507  ? 79.369  157.202 117.134 1.00 144.38 ? 507  ARG C NE    1 
ATOM   7523  C  CZ    . ARG C 2 507  ? 79.984  158.355 116.889 1.00 144.38 ? 507  ARG C CZ    1 
ATOM   7524  N  NH1   . ARG C 2 507  ? 80.744  158.915 117.820 1.00 144.38 ? 507  ARG C NH1   1 
ATOM   7525  N  NH2   . ARG C 2 507  ? 79.838  158.949 115.713 1.00 144.38 ? 507  ARG C NH2   1 
ATOM   7526  N  N     . ILE C 2 508  ? 83.659  154.368 119.103 1.00 138.80 ? 508  ILE C N     1 
ATOM   7527  C  CA    . ILE C 2 508  ? 84.125  153.928 120.413 1.00 138.80 ? 508  ILE C CA    1 
ATOM   7528  C  C     . ILE C 2 508  ? 82.946  153.933 121.376 1.00 138.80 ? 508  ILE C C     1 
ATOM   7529  O  O     . ILE C 2 508  ? 82.306  154.969 121.592 1.00 138.80 ? 508  ILE C O     1 
ATOM   7530  C  CB    . ILE C 2 508  ? 85.263  154.822 120.919 1.00 138.80 ? 508  ILE C CB    1 
ATOM   7531  C  CG1   . ILE C 2 508  ? 86.520  154.605 120.077 1.00 138.80 ? 508  ILE C CG1   1 
ATOM   7532  C  CG2   . ILE C 2 508  ? 85.552  154.535 122.379 1.00 138.80 ? 508  ILE C CG2   1 
ATOM   7533  C  CD1   . ILE C 2 508  ? 87.698  155.439 120.519 1.00 138.80 ? 508  ILE C CD1   1 
ATOM   7534  N  N     . ALA C 2 509  ? 82.654  152.773 121.960 1.00 143.18 ? 509  ALA C N     1 
ATOM   7535  C  CA    . ALA C 2 509  ? 81.474  152.593 122.794 1.00 143.18 ? 509  ALA C CA    1 
ATOM   7536  C  C     . ALA C 2 509  ? 81.739  152.827 124.273 1.00 143.18 ? 509  ALA C C     1 
ATOM   7537  O  O     . ALA C 2 509  ? 80.788  153.036 125.031 1.00 143.18 ? 509  ALA C O     1 
ATOM   7538  C  CB    . ALA C 2 509  ? 80.901  151.187 122.594 1.00 143.18 ? 509  ALA C CB    1 
ATOM   7539  N  N     . ALA C 2 510  ? 82.995  152.800 124.704 1.00 142.35 ? 510  ALA C N     1 
ATOM   7540  C  CA    . ALA C 2 510  ? 83.343  152.991 126.102 1.00 142.35 ? 510  ALA C CA    1 
ATOM   7541  C  C     . ALA C 2 510  ? 83.365  154.475 126.439 1.00 142.35 ? 510  ALA C C     1 
ATOM   7542  O  O     . ALA C 2 510  ? 83.738  155.312 125.612 1.00 142.35 ? 510  ALA C O     1 
ATOM   7543  C  CB    . ALA C 2 510  ? 84.702  152.364 126.424 1.00 142.35 ? 510  ALA C CB    1 
ATOM   7544  N  N     . GLU C 2 511  ? 82.955  154.796 127.666 1.00 145.42 ? 511  GLU C N     1 
ATOM   7545  C  CA    . GLU C 2 511  ? 82.950  156.186 128.104 1.00 145.42 ? 511  GLU C CA    1 
ATOM   7546  C  C     . GLU C 2 511  ? 84.345  156.665 128.482 1.00 145.42 ? 511  GLU C C     1 
ATOM   7547  O  O     . GLU C 2 511  ? 84.653  157.850 128.318 1.00 145.42 ? 511  GLU C O     1 
ATOM   7548  C  CB    . GLU C 2 511  ? 81.991  156.360 129.283 1.00 145.42 ? 511  GLU C CB    1 
ATOM   7549  C  CG    . GLU C 2 511  ? 81.773  157.804 129.709 1.00 145.42 ? 511  GLU C CG    1 
ATOM   7550  C  CD    . GLU C 2 511  ? 82.760  158.258 130.767 1.00 145.42 ? 511  GLU C CD    1 
ATOM   7551  O  OE1   . GLU C 2 511  ? 82.993  157.497 131.729 1.00 145.42 ? 511  GLU C OE1   1 
ATOM   7552  O  OE2   . GLU C 2 511  ? 83.305  159.374 130.634 1.00 145.42 ? 511  GLU C OE2   1 
ATOM   7553  N  N     . ARG C 2 512  ? 85.193  155.772 128.983 1.00 138.30 ? 512  ARG C N     1 
ATOM   7554  C  CA    . ARG C 2 512  ? 86.559  156.106 129.359 1.00 138.30 ? 512  ARG C CA    1 
ATOM   7555  C  C     . ARG C 2 512  ? 87.485  155.009 128.860 1.00 138.30 ? 512  ARG C C     1 
ATOM   7556  O  O     . ARG C 2 512  ? 87.258  153.827 129.138 1.00 138.30 ? 512  ARG C O     1 
ATOM   7557  C  CB    . ARG C 2 512  ? 86.689  156.276 130.874 1.00 138.30 ? 512  ARG C CB    1 
ATOM   7558  C  CG    . ARG C 2 512  ? 85.888  155.271 131.680 1.00 138.30 ? 512  ARG C CG    1 
ATOM   7559  C  CD    . ARG C 2 512  ? 86.038  155.521 133.169 1.00 138.30 ? 512  ARG C CD    1 
ATOM   7560  N  NE    . ARG C 2 512  ? 87.354  155.126 133.660 1.00 138.30 ? 512  ARG C NE    1 
ATOM   7561  C  CZ    . ARG C 2 512  ? 87.891  155.570 134.791 1.00 138.30 ? 512  ARG C CZ    1 
ATOM   7562  N  NH1   . ARG C 2 512  ? 87.226  156.429 135.550 1.00 138.30 ? 512  ARG C NH1   1 
ATOM   7563  N  NH2   . ARG C 2 512  ? 89.095  155.157 135.162 1.00 138.30 ? 512  ARG C NH2   1 
ATOM   7564  N  N     . VAL C 2 513  ? 88.522  155.398 128.127 1.00 125.87 ? 513  VAL C N     1 
ATOM   7565  C  CA    . VAL C 2 513  ? 89.419  154.451 127.480 1.00 125.87 ? 513  VAL C CA    1 
ATOM   7566  C  C     . VAL C 2 513  ? 90.789  154.525 128.134 1.00 125.87 ? 513  VAL C C     1 
ATOM   7567  O  O     . VAL C 2 513  ? 91.156  155.527 128.758 1.00 125.87 ? 513  VAL C O     1 
ATOM   7568  C  CB    . VAL C 2 513  ? 89.527  154.718 125.966 1.00 125.87 ? 513  VAL C CB    1 
ATOM   7569  C  CG1   . VAL C 2 513  ? 88.168  154.576 125.306 1.00 125.87 ? 513  VAL C CG1   1 
ATOM   7570  C  CG2   . VAL C 2 513  ? 90.102  156.097 125.717 1.00 125.87 ? 513  VAL C CG2   1 
ATOM   7571  N  N     . VAL C 2 514  ? 91.548  153.445 127.988 1.00 118.53 ? 514  VAL C N     1 
ATOM   7572  C  CA    . VAL C 2 514  ? 92.923  153.381 128.465 1.00 118.53 ? 514  VAL C CA    1 
ATOM   7573  C  C     . VAL C 2 514  ? 93.839  153.750 127.307 1.00 118.53 ? 514  VAL C C     1 
ATOM   7574  O  O     . VAL C 2 514  ? 93.823  153.093 126.262 1.00 118.53 ? 514  VAL C O     1 
ATOM   7575  C  CB    . VAL C 2 514  ? 93.259  151.985 129.008 1.00 118.53 ? 514  VAL C CB    1 
ATOM   7576  C  CG1   . VAL C 2 514  ? 94.657  151.971 129.599 1.00 118.53 ? 514  VAL C CG1   1 
ATOM   7577  C  CG2   . VAL C 2 514  ? 92.230  151.558 130.040 1.00 118.53 ? 514  VAL C CG2   1 
ATOM   7578  N  N     . ALA C 2 515  ? 94.638  154.799 127.488 1.00 116.29 ? 515  ALA C N     1 
ATOM   7579  C  CA    . ALA C 2 515  ? 95.479  155.308 126.420 1.00 116.29 ? 515  ALA C CA    1 
ATOM   7580  C  C     . ALA C 2 515  ? 96.883  155.551 126.955 1.00 116.29 ? 515  ALA C C     1 
ATOM   7581  O  O     . ALA C 2 515  ? 97.140  155.478 128.161 1.00 116.29 ? 515  ALA C O     1 
ATOM   7582  C  CB    . ALA C 2 515  ? 94.891  156.587 125.815 1.00 116.29 ? 515  ALA C CB    1 
ATOM   7583  N  N     . ARG C 2 516  ? 97.794  155.832 126.032 1.00 113.61 ? 516  ARG C N     1 
ATOM   7584  C  CA    . ARG C 2 516  ? 99.185  156.121 126.330 1.00 113.61 ? 516  ARG C CA    1 
ATOM   7585  C  C     . ARG C 2 516  ? 99.518  157.534 125.880 1.00 113.61 ? 516  ARG C C     1 
ATOM   7586  O  O     . ARG C 2 516  ? 99.100  157.970 124.798 1.00 113.61 ? 516  ARG C O     1 
ATOM   7587  C  CB    . ARG C 2 516  ? 100.122 155.133 125.633 1.00 113.61 ? 516  ARG C CB    1 
ATOM   7588  C  CG    . ARG C 2 516  ? 99.965  153.695 126.072 1.00 113.61 ? 516  ARG C CG    1 
ATOM   7589  C  CD    . ARG C 2 516  ? 101.088 152.846 125.511 1.00 113.61 ? 516  ARG C CD    1 
ATOM   7590  N  NE    . ARG C 2 516  ? 100.939 152.638 124.075 1.00 113.61 ? 516  ARG C NE    1 
ATOM   7591  C  CZ    . ARG C 2 516  ? 101.729 153.182 123.157 1.00 113.61 ? 516  ARG C CZ    1 
ATOM   7592  N  NH1   . ARG C 2 516  ? 102.729 153.969 123.525 1.00 113.61 ? 516  ARG C NH1   1 
ATOM   7593  N  NH2   . ARG C 2 516  ? 101.519 152.942 121.871 1.00 113.61 ? 516  ARG C NH2   1 
ATOM   7594  N  N     . ARG C 2 517  ? 100.267 158.239 126.726 1.00 117.37 ? 517  ARG C N     1 
ATOM   7595  C  CA    . ARG C 2 517  ? 100.850 159.537 126.404 1.00 117.37 ? 517  ARG C CA    1 
ATOM   7596  C  C     . ARG C 2 517  ? 102.321 159.482 126.789 1.00 117.37 ? 517  ARG C C     1 
ATOM   7597  O  O     . ARG C 2 517  ? 102.649 159.447 127.980 1.00 117.37 ? 517  ARG C O     1 
ATOM   7598  C  CB    . ARG C 2 517  ? 100.141 160.671 127.142 1.00 117.37 ? 517  ARG C CB    1 
ATOM   7599  C  CG    . ARG C 2 517  ? 98.712  160.904 126.710 1.00 117.37 ? 517  ARG C CG    1 
ATOM   7600  C  CD    . ARG C 2 517  ? 98.046  161.946 127.588 1.00 117.37 ? 517  ARG C CD    1 
ATOM   7601  N  NE    . ARG C 2 517  ? 96.907  162.572 126.925 1.00 117.37 ? 517  ARG C NE    1 
ATOM   7602  C  CZ    . ARG C 2 517  ? 95.953  163.243 127.560 1.00 117.37 ? 517  ARG C CZ    1 
ATOM   7603  N  NH1   . ARG C 2 517  ? 96.000  163.375 128.877 1.00 117.37 ? 517  ARG C NH1   1 
ATOM   7604  N  NH2   . ARG C 2 517  ? 94.952  163.781 126.878 1.00 117.37 ? 517  ARG C NH2   1 
ATOM   7605  N  N     . LYS C 2 518  ? 103.199 159.472 125.787 1.00 120.91 ? 518  LYS C N     1 
ATOM   7606  C  CA    . LYS C 2 518  ? 104.641 159.356 126.008 1.00 120.91 ? 518  LYS C CA    1 
ATOM   7607  C  C     . LYS C 2 518  ? 104.966 158.126 126.849 1.00 120.91 ? 518  LYS C C     1 
ATOM   7608  O  O     . LYS C 2 518  ? 105.746 158.184 127.801 1.00 120.91 ? 518  LYS C O     1 
ATOM   7609  C  CB    . LYS C 2 518  ? 105.206 160.621 126.657 1.00 120.91 ? 518  LYS C CB    1 
ATOM   7610  C  CG    . LYS C 2 518  ? 105.156 161.855 125.777 1.00 120.91 ? 518  LYS C CG    1 
ATOM   7611  C  CD    . LYS C 2 518  ? 105.973 162.984 126.382 1.00 120.91 ? 518  LYS C CD    1 
ATOM   7612  C  CE    . LYS C 2 518  ? 105.813 164.268 125.590 1.00 120.91 ? 518  LYS C CE    1 
ATOM   7613  N  NZ    . LYS C 2 518  ? 104.422 164.791 125.666 1.00 120.91 ? 518  LYS C NZ    1 
ATOM   7614  N  N     . GLY C 2 519  ? 104.352 156.997 126.498 1.00 122.21 ? 519  GLY C N     1 
ATOM   7615  C  CA    . GLY C 2 519  ? 104.523 155.767 127.237 1.00 122.21 ? 519  GLY C CA    1 
ATOM   7616  C  C     . GLY C 2 519  ? 103.812 155.709 128.570 1.00 122.21 ? 519  GLY C C     1 
ATOM   7617  O  O     . GLY C 2 519  ? 103.750 154.633 129.176 1.00 122.21 ? 519  GLY C O     1 
ATOM   7618  N  N     . GLU C 2 520  ? 103.276 156.822 129.049 1.00 124.38 ? 520  GLU C N     1 
ATOM   7619  C  CA    . GLU C 2 520  ? 102.580 156.837 130.328 1.00 124.38 ? 520  GLU C CA    1 
ATOM   7620  C  C     . GLU C 2 520  ? 101.145 156.360 130.150 1.00 124.38 ? 520  GLU C C     1 
ATOM   7621  O  O     . GLU C 2 520  ? 100.420 156.912 129.312 1.00 124.38 ? 520  GLU C O     1 
ATOM   7622  C  CB    . GLU C 2 520  ? 102.599 158.243 130.919 1.00 124.38 ? 520  GLU C CB    1 
ATOM   7623  C  CG    . GLU C 2 520  ? 102.344 158.292 132.413 1.00 124.38 ? 520  GLU C CG    1 
ATOM   7624  C  CD    . GLU C 2 520  ? 103.508 157.756 133.219 1.00 124.38 ? 520  GLU C CD    1 
ATOM   7625  O  OE1   . GLU C 2 520  ? 103.265 157.117 134.264 1.00 124.38 ? 520  GLU C OE1   1 
ATOM   7626  O  OE2   . GLU C 2 520  ? 104.666 157.975 132.808 1.00 124.38 ? 520  GLU C OE2   1 
ATOM   7627  N  N     . PRO C 2 521  ? 100.699 155.346 130.889 1.00 114.90 ? 521  PRO C N     1 
ATOM   7628  C  CA    . PRO C 2 521  ? 99.289  154.948 130.816 1.00 114.90 ? 521  PRO C CA    1 
ATOM   7629  C  C     . PRO C 2 521  ? 98.403  155.956 131.529 1.00 114.90 ? 521  PRO C C     1 
ATOM   7630  O  O     . PRO C 2 521  ? 98.795  156.549 132.536 1.00 114.90 ? 521  PRO C O     1 
ATOM   7631  C  CB    . PRO C 2 521  ? 99.269  153.588 131.521 1.00 114.90 ? 521  PRO C CB    1 
ATOM   7632  C  CG    . PRO C 2 521  ? 100.426 153.641 132.455 1.00 114.90 ? 521  PRO C CG    1 
ATOM   7633  C  CD    . PRO C 2 521  ? 101.480 154.467 131.775 1.00 114.90 ? 521  PRO C CD    1 
ATOM   7634  N  N     . VAL C 2 522  ? 97.195  156.144 130.999 1.00 116.90 ? 522  VAL C N     1 
ATOM   7635  C  CA    . VAL C 2 522  ? 96.277  157.143 131.530 1.00 116.90 ? 522  VAL C CA    1 
ATOM   7636  C  C     . VAL C 2 522  ? 94.867  156.816 131.055 1.00 116.90 ? 522  VAL C C     1 
ATOM   7637  O  O     . VAL C 2 522  ? 94.674  156.071 130.091 1.00 116.90 ? 522  VAL C O     1 
ATOM   7638  C  CB    . VAL C 2 522  ? 96.718  158.566 131.107 1.00 116.90 ? 522  VAL C CB    1 
ATOM   7639  C  CG1   . VAL C 2 522  ? 96.505  158.772 129.622 1.00 116.90 ? 522  VAL C CG1   1 
ATOM   7640  C  CG2   . VAL C 2 522  ? 96.003  159.635 131.927 1.00 116.90 ? 522  VAL C CG2   1 
ATOM   7641  N  N     . ILE C 2 523  ? 93.876  157.344 131.768 1.00 122.54 ? 523  ILE C N     1 
ATOM   7642  C  CA    . ILE C 2 523  ? 92.475  157.201 131.390 1.00 122.54 ? 523  ILE C CA    1 
ATOM   7643  C  C     . ILE C 2 523  ? 92.036  158.475 130.682 1.00 122.54 ? 523  ILE C C     1 
ATOM   7644  O  O     . ILE C 2 523  ? 92.262  159.583 131.182 1.00 122.54 ? 523  ILE C O     1 
ATOM   7645  C  CB    . ILE C 2 523  ? 91.599  156.921 132.620 1.00 122.54 ? 523  ILE C CB    1 
ATOM   7646  C  CG1   . ILE C 2 523  ? 92.122  155.701 133.377 1.00 122.54 ? 523  ILE C CG1   1 
ATOM   7647  C  CG2   . ILE C 2 523  ? 90.154  156.711 132.204 1.00 122.54 ? 523  ILE C CG2   1 
ATOM   7648  C  CD1   . ILE C 2 523  ? 92.142  154.437 132.553 1.00 122.54 ? 523  ILE C CD1   1 
ATOM   7649  N  N     . VAL C 2 524  ? 91.407  158.321 129.517 1.00 126.33 ? 524  VAL C N     1 
ATOM   7650  C  CA    . VAL C 2 524  ? 91.094  159.456 128.656 1.00 126.33 ? 524  VAL C CA    1 
ATOM   7651  C  C     . VAL C 2 524  ? 89.652  159.340 128.186 1.00 126.33 ? 524  VAL C C     1 
ATOM   7652  O  O     . VAL C 2 524  ? 89.101  158.242 128.075 1.00 126.33 ? 524  VAL C O     1 
ATOM   7653  C  CB    . VAL C 2 524  ? 92.053  159.534 127.442 1.00 126.33 ? 524  VAL C CB    1 
ATOM   7654  C  CG1   . VAL C 2 524  ? 91.924  160.868 126.741 1.00 126.33 ? 524  VAL C CG1   1 
ATOM   7655  C  CG2   . VAL C 2 524  ? 93.486  159.308 127.866 1.00 126.33 ? 524  VAL C CG2   1 
ATOM   7656  N  N     . SER C 2 525  ? 89.039  160.493 127.913 1.00 134.18 ? 525  SER C N     1 
ATOM   7657  C  CA    . SER C 2 525  ? 87.746  160.557 127.253 1.00 134.18 ? 525  SER C CA    1 
ATOM   7658  C  C     . SER C 2 525  ? 87.925  160.373 125.746 1.00 134.18 ? 525  SER C C     1 
ATOM   7659  O  O     . SER C 2 525  ? 88.950  160.769 125.185 1.00 134.18 ? 525  SER C O     1 
ATOM   7660  C  CB    . SER C 2 525  ? 87.070  161.894 127.543 1.00 134.18 ? 525  SER C CB    1 
ATOM   7661  O  OG    . SER C 2 525  ? 86.094  162.206 126.565 1.00 134.18 ? 525  SER C OG    1 
ATOM   7662  N  N     . PRO C 2 526  ? 86.941  159.763 125.069 1.00 133.34 ? 526  PRO C N     1 
ATOM   7663  C  CA    . PRO C 2 526  ? 87.118  159.402 123.653 1.00 133.34 ? 526  PRO C CA    1 
ATOM   7664  C  C     . PRO C 2 526  ? 87.498  160.557 122.737 1.00 133.34 ? 526  PRO C C     1 
ATOM   7665  O  O     . PRO C 2 526  ? 88.225  160.355 121.760 1.00 133.34 ? 526  PRO C O     1 
ATOM   7666  C  CB    . PRO C 2 526  ? 85.747  158.831 123.270 1.00 133.34 ? 526  PRO C CB    1 
ATOM   7667  C  CG    . PRO C 2 526  ? 85.197  158.309 124.543 1.00 133.34 ? 526  PRO C CG    1 
ATOM   7668  C  CD    . PRO C 2 526  ? 85.667  159.255 125.608 1.00 133.34 ? 526  PRO C CD    1 
ATOM   7669  N  N     . GLU C 2 527  ? 87.015  161.766 123.032 1.00 134.38 ? 527  GLU C N     1 
ATOM   7670  C  CA    . GLU C 2 527  ? 87.254  162.890 122.132 1.00 134.38 ? 527  GLU C CA    1 
ATOM   7671  C  C     . GLU C 2 527  ? 88.728  163.262 122.052 1.00 134.38 ? 527  GLU C C     1 
ATOM   7672  O  O     . GLU C 2 527  ? 89.158  163.861 121.061 1.00 134.38 ? 527  GLU C O     1 
ATOM   7673  C  CB    . GLU C 2 527  ? 86.427  164.099 122.569 1.00 134.38 ? 527  GLU C CB    1 
ATOM   7674  C  CG    . GLU C 2 527  ? 84.993  164.079 122.068 1.00 134.38 ? 527  GLU C CG    1 
ATOM   7675  C  CD    . GLU C 2 527  ? 84.146  163.025 122.752 1.00 134.38 ? 527  GLU C CD    1 
ATOM   7676  O  OE1   . GLU C 2 527  ? 84.546  162.545 123.833 1.00 134.38 ? 527  GLU C OE1   1 
ATOM   7677  O  OE2   . GLU C 2 527  ? 83.080  162.673 122.205 1.00 134.38 ? 527  GLU C OE2   1 
ATOM   7678  N  N     . GLU C 2 528  ? 89.515  162.921 123.068 1.00 132.47 ? 528  GLU C N     1 
ATOM   7679  C  CA    . GLU C 2 528  ? 90.937  163.232 123.071 1.00 132.47 ? 528  GLU C CA    1 
ATOM   7680  C  C     . GLU C 2 528  ? 91.788  162.124 122.468 1.00 132.47 ? 528  GLU C C     1 
ATOM   7681  O  O     . GLU C 2 528  ? 93.018  162.236 122.474 1.00 132.47 ? 528  GLU C O     1 
ATOM   7682  C  CB    . GLU C 2 528  ? 91.414  163.522 124.495 1.00 132.47 ? 528  GLU C CB    1 
ATOM   7683  C  CG    . GLU C 2 528  ? 90.594  164.564 125.230 1.00 132.47 ? 528  GLU C CG    1 
ATOM   7684  C  CD    . GLU C 2 528  ? 90.589  164.342 126.728 1.00 132.47 ? 528  GLU C CD    1 
ATOM   7685  O  OE1   . GLU C 2 528  ? 89.864  163.438 127.194 1.00 132.47 ? 528  GLU C OE1   1 
ATOM   7686  O  OE2   . GLU C 2 528  ? 91.311  165.068 127.442 1.00 132.47 ? 528  GLU C OE2   1 
ATOM   7687  N  N     . VAL C 2 529  ? 91.174  161.064 121.955 1.00 131.09 ? 529  VAL C N     1 
ATOM   7688  C  CA    . VAL C 2 529  ? 91.903  159.957 121.350 1.00 131.09 ? 529  VAL C CA    1 
ATOM   7689  C  C     . VAL C 2 529  ? 92.183  160.320 119.897 1.00 131.09 ? 529  VAL C C     1 
ATOM   7690  O  O     . VAL C 2 529  ? 91.265  160.650 119.141 1.00 131.09 ? 529  VAL C O     1 
ATOM   7691  C  CB    . VAL C 2 529  ? 91.122  158.644 121.455 1.00 131.09 ? 529  VAL C CB    1 
ATOM   7692  C  CG1   . VAL C 2 529  ? 91.704  157.610 120.510 1.00 131.09 ? 529  VAL C CG1   1 
ATOM   7693  C  CG2   . VAL C 2 529  ? 91.147  158.134 122.881 1.00 131.09 ? 529  VAL C CG2   1 
ATOM   7694  N  N     . GLU C 2 530  ? 93.455  160.264 119.506 1.00 126.97 ? 530  GLU C N     1 
ATOM   7695  C  CA    . GLU C 2 530  ? 93.828  160.648 118.150 1.00 126.97 ? 530  GLU C CA    1 
ATOM   7696  C  C     . GLU C 2 530  ? 94.247  159.443 117.316 1.00 126.97 ? 530  GLU C C     1 
ATOM   7697  O  O     . GLU C 2 530  ? 93.973  159.396 116.113 1.00 126.97 ? 530  GLU C O     1 
ATOM   7698  C  CB    . GLU C 2 530  ? 94.940  161.693 118.200 1.00 126.97 ? 530  GLU C CB    1 
ATOM   7699  C  CG    . GLU C 2 530  ? 94.532  162.957 118.940 1.00 126.97 ? 530  GLU C CG    1 
ATOM   7700  C  CD    . GLU C 2 530  ? 95.673  163.937 119.110 1.00 126.97 ? 530  GLU C CD    1 
ATOM   7701  O  OE1   . GLU C 2 530  ? 96.828  163.557 118.834 1.00 126.97 ? 530  GLU C OE1   1 
ATOM   7702  O  OE2   . GLU C 2 530  ? 95.415  165.088 119.521 1.00 126.97 ? 530  GLU C OE2   1 
ATOM   7703  N  N     . PHE C 2 531  ? 94.908  158.464 117.931 1.00 118.31 ? 531  PHE C N     1 
ATOM   7704  C  CA    . PHE C 2 531  ? 95.311  157.250 117.238 1.00 118.31 ? 531  PHE C CA    1 
ATOM   7705  C  C     . PHE C 2 531  ? 94.882  156.041 118.058 1.00 118.31 ? 531  PHE C C     1 
ATOM   7706  O  O     . PHE C 2 531  ? 94.474  156.159 119.217 1.00 118.31 ? 531  PHE C O     1 
ATOM   7707  C  CB    . PHE C 2 531  ? 96.820  157.231 116.977 1.00 118.31 ? 531  PHE C CB    1 
ATOM   7708  C  CG    . PHE C 2 531  ? 97.244  158.095 115.830 1.00 118.31 ? 531  PHE C CG    1 
ATOM   7709  C  CD1   . PHE C 2 531  ? 97.962  159.256 116.048 1.00 118.31 ? 531  PHE C CD1   1 
ATOM   7710  C  CD2   . PHE C 2 531  ? 96.921  157.747 114.531 1.00 118.31 ? 531  PHE C CD2   1 
ATOM   7711  C  CE1   . PHE C 2 531  ? 98.353  160.051 114.992 1.00 118.31 ? 531  PHE C CE1   1 
ATOM   7712  C  CE2   . PHE C 2 531  ? 97.309  158.539 113.471 1.00 118.31 ? 531  PHE C CE2   1 
ATOM   7713  C  CZ    . PHE C 2 531  ? 98.026  159.693 113.702 1.00 118.31 ? 531  PHE C CZ    1 
ATOM   7714  N  N     . MET C 2 532  ? 94.980  154.866 117.442 1.00 117.67 ? 532  MET C N     1 
ATOM   7715  C  CA    . MET C 2 532  ? 94.596  153.618 118.083 1.00 117.67 ? 532  MET C CA    1 
ATOM   7716  C  C     . MET C 2 532  ? 95.526  152.517 117.597 1.00 117.67 ? 532  MET C C     1 
ATOM   7717  O  O     . MET C 2 532  ? 96.059  152.595 116.488 1.00 117.67 ? 532  MET C O     1 
ATOM   7718  C  CB    . MET C 2 532  ? 93.137  153.266 117.773 1.00 117.67 ? 532  MET C CB    1 
ATOM   7719  C  CG    . MET C 2 532  ? 92.589  152.079 118.543 1.00 117.67 ? 532  MET C CG    1 
ATOM   7720  S  SD    . MET C 2 532  ? 90.837  151.818 118.215 1.00 117.67 ? 532  MET C SD    1 
ATOM   7721  C  CE    . MET C 2 532  ? 90.567  150.247 119.028 1.00 117.67 ? 532  MET C CE    1 
ATOM   7722  N  N     . ASP C 2 533  ? 95.722  151.499 118.430 1.00 118.17 ? 533  ASP C N     1 
ATOM   7723  C  CA    . ASP C 2 533  ? 96.567  150.379 118.041 1.00 118.17 ? 533  ASP C CA    1 
ATOM   7724  C  C     . ASP C 2 533  ? 95.881  149.538 116.974 1.00 118.17 ? 533  ASP C C     1 
ATOM   7725  O  O     . ASP C 2 533  ? 94.660  149.591 116.805 1.00 118.17 ? 533  ASP C O     1 
ATOM   7726  C  CB    . ASP C 2 533  ? 96.894  149.514 119.256 1.00 118.17 ? 533  ASP C CB    1 
ATOM   7727  C  CG    . ASP C 2 533  ? 98.072  150.041 120.043 1.00 118.17 ? 533  ASP C CG    1 
ATOM   7728  O  OD1   . ASP C 2 533  ? 98.600  151.110 119.675 1.00 118.17 ? 533  ASP C OD1   1 
ATOM   7729  O  OD2   . ASP C 2 533  ? 98.472  149.387 121.030 1.00 118.17 ? 533  ASP C OD2   1 
ATOM   7730  N  N     . VAL C 2 534  ? 96.679  148.752 116.251 1.00 108.47 ? 534  VAL C N     1 
ATOM   7731  C  CA    . VAL C 2 534  ? 96.122  147.892 115.214 1.00 108.47 ? 534  VAL C CA    1 
ATOM   7732  C  C     . VAL C 2 534  ? 95.706  146.550 115.799 1.00 108.47 ? 534  VAL C C     1 
ATOM   7733  O  O     . VAL C 2 534  ? 94.578  146.088 115.589 1.00 108.47 ? 534  VAL C O     1 
ATOM   7734  C  CB    . VAL C 2 534  ? 97.132  147.721 114.067 1.00 108.47 ? 534  VAL C CB    1 
ATOM   7735  C  CG1   . VAL C 2 534  ? 96.618  146.714 113.056 1.00 108.47 ? 534  VAL C CG1   1 
ATOM   7736  C  CG2   . VAL C 2 534  ? 97.406  149.057 113.405 1.00 108.47 ? 534  VAL C CG2   1 
ATOM   7737  N  N     . SER C 2 535  ? 96.601  145.908 116.544 1.00 106.88 ? 535  SER C N     1 
ATOM   7738  C  CA    . SER C 2 535  ? 96.346  144.601 117.133 1.00 106.88 ? 535  SER C CA    1 
ATOM   7739  C  C     . SER C 2 535  ? 97.393  144.313 118.199 1.00 106.88 ? 535  SER C C     1 
ATOM   7740  O  O     . SER C 2 535  ? 98.507  144.843 118.125 1.00 106.88 ? 535  SER C O     1 
ATOM   7741  C  CB    . SER C 2 535  ? 96.362  143.515 116.055 1.00 106.88 ? 535  SER C CB    1 
ATOM   7742  O  OG    . SER C 2 535  ? 96.622  142.240 116.612 1.00 106.88 ? 535  SER C OG    1 
ATOM   7743  N  N     . PRO C 2 536  ? 97.078  143.498 119.210 1.00 99.90  ? 536  PRO C N     1 
ATOM   7744  C  CA    . PRO C 2 536  ? 98.114  143.131 120.189 1.00 99.90  ? 536  PRO C CA    1 
ATOM   7745  C  C     . PRO C 2 536  ? 99.309  142.435 119.562 1.00 99.90  ? 536  PRO C C     1 
ATOM   7746  O  O     . PRO C 2 536  ? 100.416 142.525 120.107 1.00 99.90  ? 536  PRO C O     1 
ATOM   7747  C  CB    . PRO C 2 536  ? 97.368  142.207 121.162 1.00 99.90  ? 536  PRO C CB    1 
ATOM   7748  C  CG    . PRO C 2 536  ? 95.933  142.569 121.006 1.00 99.90  ? 536  PRO C CG    1 
ATOM   7749  C  CD    . PRO C 2 536  ? 95.756  142.965 119.575 1.00 99.90  ? 536  PRO C CD    1 
ATOM   7750  N  N     . LYS C 2 537  ? 99.116  141.754 118.429 1.00 103.30 ? 537  LYS C N     1 
ATOM   7751  C  CA    . LYS C 2 537  ? 100.212 141.054 117.767 1.00 103.30 ? 537  LYS C CA    1 
ATOM   7752  C  C     . LYS C 2 537  ? 101.409 141.961 117.520 1.00 103.30 ? 537  LYS C C     1 
ATOM   7753  O  O     . LYS C 2 537  ? 102.553 141.494 117.524 1.00 103.30 ? 537  LYS C O     1 
ATOM   7754  C  CB    . LYS C 2 537  ? 99.733  140.466 116.440 1.00 103.30 ? 537  LYS C CB    1 
ATOM   7755  C  CG    . LYS C 2 537  ? 98.700  139.366 116.576 1.00 103.30 ? 537  LYS C CG    1 
ATOM   7756  C  CD    . LYS C 2 537  ? 98.447  138.692 115.239 1.00 103.30 ? 537  LYS C CD    1 
ATOM   7757  C  CE    . LYS C 2 537  ? 97.354  137.648 115.349 1.00 103.30 ? 537  LYS C CE    1 
ATOM   7758  N  NZ    . LYS C 2 537  ? 97.561  136.765 116.528 1.00 103.30 ? 537  LYS C NZ    1 
ATOM   7759  N  N     . GLN C 2 538  ? 101.173 143.258 117.314 1.00 98.78  ? 538  GLN C N     1 
ATOM   7760  C  CA    . GLN C 2 538  ? 102.263 144.159 116.965 1.00 98.78  ? 538  GLN C CA    1 
ATOM   7761  C  C     . GLN C 2 538  ? 103.180 144.453 118.141 1.00 98.78  ? 538  GLN C C     1 
ATOM   7762  O  O     . GLN C 2 538  ? 104.193 145.133 117.960 1.00 98.78  ? 538  GLN C O     1 
ATOM   7763  C  CB    . GLN C 2 538  ? 101.707 145.471 116.417 1.00 98.78  ? 538  GLN C CB    1 
ATOM   7764  C  CG    . GLN C 2 538  ? 101.172 146.403 117.483 1.00 98.78  ? 538  GLN C CG    1 
ATOM   7765  C  CD    . GLN C 2 538  ? 100.639 147.693 116.906 1.00 98.78  ? 538  GLN C CD    1 
ATOM   7766  O  OE1   . GLN C 2 538  ? 99.455  148.001 117.034 1.00 98.78  ? 538  GLN C OE1   1 
ATOM   7767  N  NE2   . GLN C 2 538  ? 101.511 148.456 116.262 1.00 98.78  ? 538  GLN C NE2   1 
ATOM   7768  N  N     . VAL C 2 539  ? 102.860 143.956 119.337 1.00 95.69  ? 539  VAL C N     1 
ATOM   7769  C  CA    . VAL C 2 539  ? 103.711 144.239 120.486 1.00 95.69  ? 539  VAL C CA    1 
ATOM   7770  C  C     . VAL C 2 539  ? 104.786 143.177 120.673 1.00 95.69  ? 539  VAL C C     1 
ATOM   7771  O  O     . VAL C 2 539  ? 105.786 143.430 121.354 1.00 95.69  ? 539  VAL C O     1 
ATOM   7772  C  CB    . VAL C 2 539  ? 102.852 144.380 121.754 1.00 95.69  ? 539  VAL C CB    1 
ATOM   7773  C  CG1   . VAL C 2 539  ? 103.659 144.980 122.892 1.00 95.69  ? 539  VAL C CG1   1 
ATOM   7774  C  CG2   . VAL C 2 539  ? 101.637 145.238 121.464 1.00 95.69  ? 539  VAL C CG2   1 
ATOM   7775  N  N     . PHE C 2 540  ? 104.628 142.006 120.064 1.00 96.76  ? 540  PHE C N     1 
ATOM   7776  C  CA    . PHE C 2 540  ? 105.534 140.891 120.277 1.00 96.76  ? 540  PHE C CA    1 
ATOM   7777  C  C     . PHE C 2 540  ? 106.164 140.450 118.963 1.00 96.76  ? 540  PHE C C     1 
ATOM   7778  O  O     . PHE C 2 540  ? 105.743 140.856 117.877 1.00 96.76  ? 540  PHE C O     1 
ATOM   7779  C  CB    . PHE C 2 540  ? 104.804 139.712 120.929 1.00 96.76  ? 540  PHE C CB    1 
ATOM   7780  C  CG    . PHE C 2 540  ? 104.167 140.054 122.240 1.00 96.76  ? 540  PHE C CG    1 
ATOM   7781  C  CD1   . PHE C 2 540  ? 102.895 140.593 122.285 1.00 96.76  ? 540  PHE C CD1   1 
ATOM   7782  C  CD2   . PHE C 2 540  ? 104.845 139.849 123.426 1.00 96.76  ? 540  PHE C CD2   1 
ATOM   7783  C  CE1   . PHE C 2 540  ? 102.310 140.915 123.489 1.00 96.76  ? 540  PHE C CE1   1 
ATOM   7784  C  CE2   . PHE C 2 540  ? 104.265 140.169 124.633 1.00 96.76  ? 540  PHE C CE2   1 
ATOM   7785  C  CZ    . PHE C 2 540  ? 102.995 140.703 124.664 1.00 96.76  ? 540  PHE C CZ    1 
ATOM   7786  N  N     . SER C 2 541  ? 107.184 139.606 119.080 1.00 99.75  ? 541  SER C N     1 
ATOM   7787  C  CA    . SER C 2 541  ? 107.882 139.085 117.917 1.00 99.75  ? 541  SER C CA    1 
ATOM   7788  C  C     . SER C 2 541  ? 107.069 137.964 117.273 1.00 99.75  ? 541  SER C C     1 
ATOM   7789  O  O     . SER C 2 541  ? 105.904 137.729 117.602 1.00 99.75  ? 541  SER C O     1 
ATOM   7790  C  CB    . SER C 2 541  ? 109.271 138.592 118.307 1.00 99.75  ? 541  SER C CB    1 
ATOM   7791  O  OG    . SER C 2 541  ? 109.209 137.299 118.877 1.00 99.75  ? 541  SER C OG    1 
ATOM   7792  N  N     . VAL C 2 542  ? 107.701 137.261 116.333 1.00 101.55 ? 542  VAL C N     1 
ATOM   7793  C  CA    . VAL C 2 542  ? 107.014 136.181 115.634 1.00 101.55 ? 542  VAL C CA    1 
ATOM   7794  C  C     . VAL C 2 542  ? 107.003 134.916 116.482 1.00 101.55 ? 542  VAL C C     1 
ATOM   7795  O  O     . VAL C 2 542  ? 105.996 134.200 116.537 1.00 101.55 ? 542  VAL C O     1 
ATOM   7796  C  CB    . VAL C 2 542  ? 107.664 135.945 114.260 1.00 101.55 ? 542  VAL C CB    1 
ATOM   7797  C  CG1   . VAL C 2 542  ? 107.322 134.564 113.731 1.00 101.55 ? 542  VAL C CG1   1 
ATOM   7798  C  CG2   . VAL C 2 542  ? 107.218 137.015 113.282 1.00 101.55 ? 542  VAL C CG2   1 
ATOM   7799  N  N     . ASN C 2 543  ? 108.112 134.623 117.163 1.00 103.97 ? 543  ASN C N     1 
ATOM   7800  C  CA    . ASN C 2 543  ? 108.165 133.451 118.032 1.00 103.97 ? 543  ASN C CA    1 
ATOM   7801  C  C     . ASN C 2 543  ? 107.148 133.557 119.160 1.00 103.97 ? 543  ASN C C     1 
ATOM   7802  O  O     . ASN C 2 543  ? 106.404 132.608 119.434 1.00 103.97 ? 543  ASN C O     1 
ATOM   7803  C  CB    . ASN C 2 543  ? 109.572 133.282 118.597 1.00 103.97 ? 543  ASN C CB    1 
ATOM   7804  C  CG    . ASN C 2 543  ? 110.567 132.852 117.549 1.00 103.97 ? 543  ASN C CG    1 
ATOM   7805  O  OD1   . ASN C 2 543  ? 111.045 133.668 116.764 1.00 103.97 ? 543  ASN C OD1   1 
ATOM   7806  N  ND2   . ASN C 2 543  ? 110.885 131.565 117.527 1.00 103.97 ? 543  ASN C ND2   1 
ATOM   7807  N  N     . THR C 2 544  ? 107.103 134.710 119.828 1.00 100.58 ? 544  THR C N     1 
ATOM   7808  C  CA    . THR C 2 544  ? 106.210 134.869 120.970 1.00 100.58 ? 544  THR C CA    1 
ATOM   7809  C  C     . THR C 2 544  ? 104.748 134.866 120.546 1.00 100.58 ? 544  THR C C     1 
ATOM   7810  O  O     . THR C 2 544  ? 103.877 134.466 121.326 1.00 100.58 ? 544  THR C O     1 
ATOM   7811  C  CB    . THR C 2 544  ? 106.545 136.160 121.715 1.00 100.58 ? 544  THR C CB    1 
ATOM   7812  O  OG1   . THR C 2 544  ? 107.964 136.254 121.883 1.00 100.58 ? 544  THR C OG1   1 
ATOM   7813  C  CG2   . THR C 2 544  ? 105.890 136.169 123.080 1.00 100.58 ? 544  THR C CG2   1 
ATOM   7814  N  N     . ASN C 2 545  ? 104.458 135.294 119.318 1.00 99.95  ? 545  ASN C N     1 
ATOM   7815  C  CA    . ASN C 2 545  ? 103.087 135.306 118.827 1.00 99.95  ? 545  ASN C CA    1 
ATOM   7816  C  C     . ASN C 2 545  ? 102.506 133.911 118.640 1.00 99.95  ? 545  ASN C C     1 
ATOM   7817  O  O     . ASN C 2 545  ? 101.332 133.796 118.277 1.00 99.95  ? 545  ASN C O     1 
ATOM   7818  C  CB    . ASN C 2 545  ? 103.017 136.069 117.506 1.00 99.95  ? 545  ASN C CB    1 
ATOM   7819  C  CG    . ASN C 2 545  ? 102.718 137.538 117.698 1.00 99.95  ? 545  ASN C CG    1 
ATOM   7820  O  OD1   . ASN C 2 545  ? 101.757 137.903 118.372 1.00 99.95  ? 545  ASN C OD1   1 
ATOM   7821  N  ND2   . ASN C 2 545  ? 103.543 138.393 117.109 1.00 99.95  ? 545  ASN C ND2   1 
ATOM   7822  N  N     . LEU C 2 546  ? 103.286 132.860 118.873 1.00 98.22  ? 546  LEU C N     1 
ATOM   7823  C  CA    . LEU C 2 546  ? 102.829 131.491 118.685 1.00 98.22  ? 546  LEU C CA    1 
ATOM   7824  C  C     . LEU C 2 546  ? 102.456 130.801 119.989 1.00 98.22  ? 546  LEU C C     1 
ATOM   7825  O  O     . LEU C 2 546  ? 102.066 129.631 119.961 1.00 98.22  ? 546  LEU C O     1 
ATOM   7826  C  CB    . LEU C 2 546  ? 103.905 130.675 117.965 1.00 98.22  ? 546  LEU C CB    1 
ATOM   7827  C  CG    . LEU C 2 546  ? 104.216 131.086 116.527 1.00 98.22  ? 546  LEU C CG    1 
ATOM   7828  C  CD1   . LEU C 2 546  ? 105.511 130.452 116.061 1.00 98.22  ? 546  LEU C CD1   1 
ATOM   7829  C  CD2   . LEU C 2 546  ? 103.072 130.700 115.610 1.00 98.22  ? 546  LEU C CD2   1 
ATOM   7830  N  N     . ILE C 2 547  ? 102.562 131.489 121.122 1.00 94.31  ? 547  ILE C N     1 
ATOM   7831  C  CA    . ILE C 2 547  ? 102.282 130.907 122.430 1.00 94.31  ? 547  ILE C CA    1 
ATOM   7832  C  C     . ILE C 2 547  ? 100.843 131.264 122.802 1.00 94.31  ? 547  ILE C C     1 
ATOM   7833  O  O     . ILE C 2 547  ? 100.583 132.420 123.167 1.00 94.31  ? 547  ILE C O     1 
ATOM   7834  C  CB    . ILE C 2 547  ? 103.265 131.412 123.492 1.00 94.31  ? 547  ILE C CB    1 
ATOM   7835  C  CG1   . ILE C 2 547  ? 104.704 131.215 123.020 1.00 94.31  ? 547  ILE C CG1   1 
ATOM   7836  C  CG2   . ILE C 2 547  ? 103.032 130.700 124.809 1.00 94.31  ? 547  ILE C CG2   1 
ATOM   7837  C  CD1   . ILE C 2 547  ? 105.734 131.724 123.998 1.00 94.31  ? 547  ILE C CD1   1 
ATOM   7838  N  N     . PRO C 2 548  ? 99.902  130.328 122.736 1.00 94.91  ? 548  PRO C N     1 
ATOM   7839  C  CA    . PRO C 2 548  ? 98.520  130.654 123.097 1.00 94.91  ? 548  PRO C CA    1 
ATOM   7840  C  C     . PRO C 2 548  ? 98.389  130.922 124.586 1.00 94.91  ? 548  PRO C C     1 
ATOM   7841  O  O     . PRO C 2 548  ? 99.206  130.477 125.394 1.00 94.91  ? 548  PRO C O     1 
ATOM   7842  C  CB    . PRO C 2 548  ? 97.747  129.398 122.689 1.00 94.91  ? 548  PRO C CB    1 
ATOM   7843  C  CG    . PRO C 2 548  ? 98.744  128.306 122.832 1.00 94.91  ? 548  PRO C CG    1 
ATOM   7844  C  CD    . PRO C 2 548  ? 100.065 128.900 122.421 1.00 94.91  ? 548  PRO C CD    1 
ATOM   7845  N  N     . PHE C 2 549  ? 97.339  131.664 124.940 1.00 98.08  ? 549  PHE C N     1 
ATOM   7846  C  CA    . PHE C 2 549  ? 97.064  132.034 126.327 1.00 98.08  ? 549  PHE C CA    1 
ATOM   7847  C  C     . PHE C 2 549  ? 98.265  132.713 126.976 1.00 98.08  ? 549  PHE C C     1 
ATOM   7848  O  O     . PHE C 2 549  ? 98.650  132.380 128.098 1.00 98.08  ? 549  PHE C O     1 
ATOM   7849  C  CB    . PHE C 2 549  ? 96.626  130.821 127.150 1.00 98.08  ? 549  PHE C CB    1 
ATOM   7850  C  CG    . PHE C 2 549  ? 95.342  130.210 126.683 1.00 98.08  ? 549  PHE C CG    1 
ATOM   7851  C  CD1   . PHE C 2 549  ? 94.146  130.884 126.841 1.00 98.08  ? 549  PHE C CD1   1 
ATOM   7852  C  CD2   . PHE C 2 549  ? 95.330  128.965 126.083 1.00 98.08  ? 549  PHE C CD2   1 
ATOM   7853  C  CE1   . PHE C 2 549  ? 92.962  130.327 126.412 1.00 98.08  ? 549  PHE C CE1   1 
ATOM   7854  C  CE2   . PHE C 2 549  ? 94.149  128.403 125.651 1.00 98.08  ? 549  PHE C CE2   1 
ATOM   7855  C  CZ    . PHE C 2 549  ? 92.963  129.086 125.815 1.00 98.08  ? 549  PHE C CZ    1 
ATOM   7856  N  N     . LEU C 2 550  ? 98.869  133.668 126.266 1.00 101.57 ? 550  LEU C N     1 
ATOM   7857  C  CA    . LEU C 2 550  ? 100.052 134.344 126.785 1.00 101.57 ? 550  LEU C CA    1 
ATOM   7858  C  C     . LEU C 2 550  ? 99.716  135.241 127.968 1.00 101.57 ? 550  LEU C C     1 
ATOM   7859  O  O     . LEU C 2 550  ? 100.579 135.502 128.812 1.00 101.57 ? 550  LEU C O     1 
ATOM   7860  C  CB    . LEU C 2 550  ? 100.714 135.154 125.672 1.00 101.57 ? 550  LEU C CB    1 
ATOM   7861  C  CG    . LEU C 2 550  ? 102.043 135.837 125.985 1.00 101.57 ? 550  LEU C CG    1 
ATOM   7862  C  CD1   . LEU C 2 550  ? 102.994 134.866 126.657 1.00 101.57 ? 550  LEU C CD1   1 
ATOM   7863  C  CD2   . LEU C 2 550  ? 102.652 136.394 124.717 1.00 101.57 ? 550  LEU C CD2   1 
ATOM   7864  N  N     . GLU C 2 551  ? 98.471  135.716 128.053 1.00 107.55 ? 551  GLU C N     1 
ATOM   7865  C  CA    . GLU C 2 551  ? 98.094  136.636 129.119 1.00 107.55 ? 551  GLU C CA    1 
ATOM   7866  C  C     . GLU C 2 551  ? 98.096  135.982 130.494 1.00 107.55 ? 551  GLU C C     1 
ATOM   7867  O  O     . GLU C 2 551  ? 97.846  136.667 131.490 1.00 107.55 ? 551  GLU C O     1 
ATOM   7868  C  CB    . GLU C 2 551  ? 96.716  137.234 128.830 1.00 107.55 ? 551  GLU C CB    1 
ATOM   7869  C  CG    . GLU C 2 551  ? 95.622  136.208 128.616 1.00 107.55 ? 551  GLU C CG    1 
ATOM   7870  C  CD    . GLU C 2 551  ? 95.467  135.817 127.162 1.00 107.55 ? 551  GLU C CD    1 
ATOM   7871  O  OE1   . GLU C 2 551  ? 94.364  136.002 126.609 1.00 107.55 ? 551  GLU C OE1   1 
ATOM   7872  O  OE2   . GLU C 2 551  ? 96.450  135.323 126.571 1.00 107.55 ? 551  GLU C OE2   1 
ATOM   7873  N  N     . HIS C 2 552  ? 98.368  134.682 130.577 1.00 103.17 ? 552  HIS C N     1 
ATOM   7874  C  CA    . HIS C 2 552  ? 98.418  133.979 131.851 1.00 103.17 ? 552  HIS C CA    1 
ATOM   7875  C  C     . HIS C 2 552  ? 99.811  133.475 132.201 1.00 103.17 ? 552  HIS C C     1 
ATOM   7876  O  O     . HIS C 2 552  ? 99.946  132.677 133.133 1.00 103.17 ? 552  HIS C O     1 
ATOM   7877  C  CB    . HIS C 2 552  ? 97.442  132.799 131.845 1.00 103.17 ? 552  HIS C CB    1 
ATOM   7878  C  CG    . HIS C 2 552  ? 96.037  133.176 131.499 1.00 103.17 ? 552  HIS C CG    1 
ATOM   7879  N  ND1   . HIS C 2 552  ? 95.080  133.438 132.456 1.00 103.17 ? 552  HIS C ND1   1 
ATOM   7880  C  CD2   . HIS C 2 552  ? 95.420  133.313 130.302 1.00 103.17 ? 552  HIS C CD2   1 
ATOM   7881  C  CE1   . HIS C 2 552  ? 93.938  133.734 131.863 1.00 103.17 ? 552  HIS C CE1   1 
ATOM   7882  N  NE2   . HIS C 2 552  ? 94.117  133.665 130.556 1.00 103.17 ? 552  HIS C NE2   1 
ATOM   7883  N  N     . ASP C 2 553  ? 100.844 133.913 131.488 1.00 108.91 ? 553  ASP C N     1 
ATOM   7884  C  CA    . ASP C 2 553  ? 102.199 133.414 131.679 1.00 108.91 ? 553  ASP C CA    1 
ATOM   7885  C  C     . ASP C 2 553  ? 103.113 134.543 132.131 1.00 108.91 ? 553  ASP C C     1 
ATOM   7886  O  O     . ASP C 2 553  ? 103.007 135.670 131.636 1.00 108.91 ? 553  ASP C O     1 
ATOM   7887  C  CB    . ASP C 2 553  ? 102.739 132.793 130.390 1.00 108.91 ? 553  ASP C CB    1 
ATOM   7888  C  CG    . ASP C 2 553  ? 102.091 131.464 130.069 1.00 108.91 ? 553  ASP C CG    1 
ATOM   7889  O  OD1   . ASP C 2 553  ? 101.948 131.143 128.872 1.00 108.91 ? 553  ASP C OD1   1 
ATOM   7890  O  OD2   . ASP C 2 553  ? 101.721 130.740 131.015 1.00 108.91 ? 553  ASP C OD2   1 
ATOM   7891  N  N     . ASP C 2 554  ? 104.007 134.238 133.068 1.00 113.13 ? 554  ASP C N     1 
ATOM   7892  C  CA    . ASP C 2 554  ? 105.025 135.199 133.467 1.00 113.13 ? 554  ASP C CA    1 
ATOM   7893  C  C     . ASP C 2 554  ? 106.024 135.396 132.335 1.00 113.13 ? 554  ASP C C     1 
ATOM   7894  O  O     . ASP C 2 554  ? 106.248 134.497 131.520 1.00 113.13 ? 554  ASP C O     1 
ATOM   7895  C  CB    . ASP C 2 554  ? 105.736 134.718 134.733 1.00 113.13 ? 554  ASP C CB    1 
ATOM   7896  C  CG    . ASP C 2 554  ? 106.782 135.697 135.223 1.00 113.13 ? 554  ASP C CG    1 
ATOM   7897  O  OD1   . ASP C 2 554  ? 106.462 136.897 135.347 1.00 113.13 ? 554  ASP C OD1   1 
ATOM   7898  O  OD2   . ASP C 2 554  ? 107.924 135.267 135.487 1.00 113.13 ? 554  ASP C OD2   1 
ATOM   7899  N  N     . ALA C 2 555  ? 106.626 136.587 132.283 1.00 107.87 ? 555  ALA C N     1 
ATOM   7900  C  CA    . ALA C 2 555  ? 107.546 136.903 131.195 1.00 107.87 ? 555  ALA C CA    1 
ATOM   7901  C  C     . ALA C 2 555  ? 108.788 136.022 131.235 1.00 107.87 ? 555  ALA C C     1 
ATOM   7902  O  O     . ALA C 2 555  ? 109.283 135.587 130.188 1.00 107.87 ? 555  ALA C O     1 
ATOM   7903  C  CB    . ALA C 2 555  ? 107.936 138.379 131.252 1.00 107.87 ? 555  ALA C CB    1 
ATOM   7904  N  N     . ASN C 2 556  ? 109.307 135.750 132.435 1.00 109.24 ? 556  ASN C N     1 
ATOM   7905  C  CA    . ASN C 2 556  ? 110.522 134.949 132.558 1.00 109.24 ? 556  ASN C CA    1 
ATOM   7906  C  C     . ASN C 2 556  ? 110.339 133.545 132.000 1.00 109.24 ? 556  ASN C C     1 
ATOM   7907  O  O     . ASN C 2 556  ? 111.325 132.876 131.673 1.00 109.24 ? 556  ASN C O     1 
ATOM   7908  C  CB    . ASN C 2 556  ? 110.957 134.873 134.021 1.00 109.24 ? 556  ASN C CB    1 
ATOM   7909  C  CG    . ASN C 2 556  ? 111.107 136.238 134.653 1.00 109.24 ? 556  ASN C CG    1 
ATOM   7910  O  OD1   . ASN C 2 556  ? 112.100 136.931 134.432 1.00 109.24 ? 556  ASN C OD1   1 
ATOM   7911  N  ND2   . ASN C 2 556  ? 110.122 136.632 135.450 1.00 109.24 ? 556  ASN C ND2   1 
ATOM   7912  N  N     . ARG C 2 557  ? 109.095 133.079 131.888 1.00 104.99 ? 557  ARG C N     1 
ATOM   7913  C  CA    . ARG C 2 557  ? 108.849 131.731 131.392 1.00 104.99 ? 557  ARG C CA    1 
ATOM   7914  C  C     . ARG C 2 557  ? 108.422 131.747 129.929 1.00 104.99 ? 557  ARG C C     1 
ATOM   7915  O  O     . ARG C 2 557  ? 108.785 130.848 129.160 1.00 104.99 ? 557  ARG C O     1 
ATOM   7916  C  CB    . ARG C 2 557  ? 107.798 131.049 132.264 1.00 104.99 ? 557  ARG C CB    1 
ATOM   7917  C  CG    . ARG C 2 557  ? 107.658 129.566 132.025 1.00 104.99 ? 557  ARG C CG    1 
ATOM   7918  C  CD    . ARG C 2 557  ? 108.979 128.844 132.217 1.00 104.99 ? 557  ARG C CD    1 
ATOM   7919  N  NE    . ARG C 2 557  ? 109.599 129.150 133.501 1.00 104.99 ? 557  ARG C NE    1 
ATOM   7920  C  CZ    . ARG C 2 557  ? 110.720 128.588 133.938 1.00 104.99 ? 557  ARG C CZ    1 
ATOM   7921  N  NH1   . ARG C 2 557  ? 111.340 127.682 133.195 1.00 104.99 ? 557  ARG C NH1   1 
ATOM   7922  N  NH2   . ARG C 2 557  ? 111.220 128.926 135.117 1.00 104.99 ? 557  ARG C NH2   1 
ATOM   7923  N  N     . ALA C 2 558  ? 107.646 132.758 129.530 1.00 101.85 ? 558  ALA C N     1 
ATOM   7924  C  CA    . ALA C 2 558  ? 107.351 132.939 128.113 1.00 101.85 ? 558  ALA C CA    1 
ATOM   7925  C  C     . ALA C 2 558  ? 108.630 133.163 127.319 1.00 101.85 ? 558  ALA C C     1 
ATOM   7926  O  O     . ALA C 2 558  ? 108.711 132.797 126.141 1.00 101.85 ? 558  ALA C O     1 
ATOM   7927  C  CB    . ALA C 2 558  ? 106.387 134.107 127.922 1.00 101.85 ? 558  ALA C CB    1 
ATOM   7928  N  N     . LEU C 2 559  ? 109.646 133.750 127.955 1.00 102.58 ? 559  LEU C N     1 
ATOM   7929  C  CA    . LEU C 2 559  ? 110.952 133.884 127.321 1.00 102.58 ? 559  LEU C CA    1 
ATOM   7930  C  C     . LEU C 2 559  ? 111.524 132.520 126.958 1.00 102.58 ? 559  LEU C C     1 
ATOM   7931  O  O     . LEU C 2 559  ? 111.948 132.289 125.819 1.00 102.58 ? 559  LEU C O     1 
ATOM   7932  C  CB    . LEU C 2 559  ? 111.899 134.636 128.258 1.00 102.58 ? 559  LEU C CB    1 
ATOM   7933  C  CG    . LEU C 2 559  ? 113.305 135.005 127.788 1.00 102.58 ? 559  LEU C CG    1 
ATOM   7934  C  CD1   . LEU C 2 559  ? 113.707 136.326 128.410 1.00 102.58 ? 559  LEU C CD1   1 
ATOM   7935  C  CD2   . LEU C 2 559  ? 114.310 133.928 128.152 1.00 102.58 ? 559  LEU C CD2   1 
ATOM   7936  N  N     . MET C 2 560  ? 111.546 131.601 127.927 1.00 107.79 ? 560  MET C N     1 
ATOM   7937  C  CA    . MET C 2 560  ? 112.077 130.268 127.668 1.00 107.79 ? 560  MET C CA    1 
ATOM   7938  C  C     . MET C 2 560  ? 111.229 129.529 126.644 1.00 107.79 ? 560  MET C C     1 
ATOM   7939  O  O     . MET C 2 560  ? 111.756 128.774 125.824 1.00 107.79 ? 560  MET C O     1 
ATOM   7940  C  CB    . MET C 2 560  ? 112.162 129.470 128.967 1.00 107.79 ? 560  MET C CB    1 
ATOM   7941  C  CG    . MET C 2 560  ? 112.995 130.129 130.046 1.00 107.79 ? 560  MET C CG    1 
ATOM   7942  S  SD    . MET C 2 560  ? 113.070 129.137 131.547 1.00 107.79 ? 560  MET C SD    1 
ATOM   7943  C  CE    . MET C 2 560  ? 113.779 130.313 132.694 1.00 107.79 ? 560  MET C CE    1 
ATOM   7944  N  N     . GLY C 2 561  ? 109.913 129.737 126.672 1.00 102.82 ? 561  GLY C N     1 
ATOM   7945  C  CA    . GLY C 2 561  ? 109.061 129.117 125.666 1.00 102.82 ? 561  GLY C CA    1 
ATOM   7946  C  C     . GLY C 2 561  ? 109.388 129.587 124.261 1.00 102.82 ? 561  GLY C C     1 
ATOM   7947  O  O     . GLY C 2 561  ? 109.547 128.779 123.336 1.00 102.82 ? 561  GLY C O     1 
ATOM   7948  N  N     . SER C 2 562  ? 109.481 130.906 124.080 1.00 102.34 ? 562  SER C N     1 
ATOM   7949  C  CA    . SER C 2 562  ? 109.825 131.474 122.782 1.00 102.34 ? 562  SER C CA    1 
ATOM   7950  C  C     . SER C 2 562  ? 111.186 130.981 122.313 1.00 102.34 ? 562  SER C C     1 
ATOM   7951  O  O     . SER C 2 562  ? 111.380 130.673 121.132 1.00 102.34 ? 562  SER C O     1 
ATOM   7952  C  CB    . SER C 2 562  ? 109.805 133.001 122.862 1.00 102.34 ? 562  SER C CB    1 
ATOM   7953  O  OG    . SER C 2 562  ? 108.481 133.497 122.819 1.00 102.34 ? 562  SER C OG    1 
ATOM   7954  N  N     . ASN C 2 563  ? 112.150 130.906 123.233 1.00 102.87 ? 563  ASN C N     1 
ATOM   7955  C  CA    . ASN C 2 563  ? 113.482 130.447 122.855 1.00 102.87 ? 563  ASN C CA    1 
ATOM   7956  C  C     . ASN C 2 563  ? 113.486 128.970 122.487 1.00 102.87 ? 563  ASN C C     1 
ATOM   7957  O  O     . ASN C 2 563  ? 114.184 128.568 121.551 1.00 102.87 ? 563  ASN C O     1 
ATOM   7958  C  CB    . ASN C 2 563  ? 114.471 130.717 123.986 1.00 102.87 ? 563  ASN C CB    1 
ATOM   7959  C  CG    . ASN C 2 563  ? 115.079 132.099 123.905 1.00 102.87 ? 563  ASN C CG    1 
ATOM   7960  O  OD1   . ASN C 2 563  ? 115.023 132.752 122.865 1.00 102.87 ? 563  ASN C OD1   1 
ATOM   7961  N  ND2   . ASN C 2 563  ? 115.664 132.553 125.005 1.00 102.87 ? 563  ASN C ND2   1 
ATOM   7962  N  N     . MET C 2 564  ? 112.716 128.150 123.203 1.00 104.00 ? 564  MET C N     1 
ATOM   7963  C  CA    . MET C 2 564  ? 112.730 126.714 122.963 1.00 104.00 ? 564  MET C CA    1 
ATOM   7964  C  C     . MET C 2 564  ? 111.953 126.328 121.715 1.00 104.00 ? 564  MET C C     1 
ATOM   7965  O  O     . MET C 2 564  ? 112.217 125.268 121.138 1.00 104.00 ? 564  MET C O     1 
ATOM   7966  C  CB    . MET C 2 564  ? 112.171 125.972 124.175 1.00 104.00 ? 564  MET C CB    1 
ATOM   7967  C  CG    . MET C 2 564  ? 113.159 125.825 125.313 1.00 104.00 ? 564  MET C CG    1 
ATOM   7968  S  SD    . MET C 2 564  ? 112.443 124.960 126.716 1.00 104.00 ? 564  MET C SD    1 
ATOM   7969  C  CE    . MET C 2 564  ? 110.830 125.729 126.786 1.00 104.00 ? 564  MET C CE    1 
ATOM   7970  N  N     . GLN C 2 565  ? 110.992 127.151 121.288 1.00 100.63 ? 565  GLN C N     1 
ATOM   7971  C  CA    . GLN C 2 565  ? 110.312 126.862 120.028 1.00 100.63 ? 565  GLN C CA    1 
ATOM   7972  C  C     . GLN C 2 565  ? 111.284 126.805 118.857 1.00 100.63 ? 565  GLN C C     1 
ATOM   7973  O  O     . GLN C 2 565  ? 110.998 126.163 117.841 1.00 100.63 ? 565  GLN C O     1 
ATOM   7974  C  CB    . GLN C 2 565  ? 109.231 127.902 119.745 1.00 100.63 ? 565  GLN C CB    1 
ATOM   7975  C  CG    . GLN C 2 565  ? 107.913 127.629 120.427 1.00 100.63 ? 565  GLN C CG    1 
ATOM   7976  C  CD    . GLN C 2 565  ? 106.820 128.548 119.936 1.00 100.63 ? 565  GLN C CD    1 
ATOM   7977  O  OE1   . GLN C 2 565  ? 107.080 129.499 119.201 1.00 100.63 ? 565  GLN C OE1   1 
ATOM   7978  N  NE2   . GLN C 2 565  ? 105.587 128.262 120.327 1.00 100.63 ? 565  GLN C NE2   1 
ATOM   7979  N  N     . THR C 2 566  ? 112.435 127.469 118.977 1.00 100.23 ? 566  THR C N     1 
ATOM   7980  C  CA    . THR C 2 566  ? 113.401 127.487 117.885 1.00 100.23 ? 566  THR C CA    1 
ATOM   7981  C  C     . THR C 2 566  ? 114.150 126.165 117.771 1.00 100.23 ? 566  THR C C     1 
ATOM   7982  O  O     . THR C 2 566  ? 114.522 125.755 116.666 1.00 100.23 ? 566  THR C O     1 
ATOM   7983  C  CB    . THR C 2 566  ? 114.377 128.650 118.091 1.00 100.23 ? 566  THR C CB    1 
ATOM   7984  O  OG1   . THR C 2 566  ? 113.696 129.889 117.860 1.00 100.23 ? 566  THR C OG1   1 
ATOM   7985  C  CG2   . THR C 2 566  ? 115.562 128.554 117.150 1.00 100.23 ? 566  THR C CG2   1 
ATOM   7986  N  N     . GLN C 2 567  ? 114.339 125.461 118.885 1.00 99.46  ? 567  GLN C N     1 
ATOM   7987  C  CA    . GLN C 2 567  ? 115.163 124.262 118.915 1.00 99.46  ? 567  GLN C CA    1 
ATOM   7988  C  C     . GLN C 2 567  ? 114.373 122.979 118.698 1.00 99.46  ? 567  GLN C C     1 
ATOM   7989  O  O     . GLN C 2 567  ? 114.866 121.902 119.041 1.00 99.46  ? 567  GLN C O     1 
ATOM   7990  C  CB    . GLN C 2 567  ? 115.916 124.179 120.244 1.00 99.46  ? 567  GLN C CB    1 
ATOM   7991  C  CG    . GLN C 2 567  ? 116.520 125.496 120.685 1.00 99.46  ? 567  GLN C CG    1 
ATOM   7992  C  CD    . GLN C 2 567  ? 117.172 125.408 122.047 1.00 99.46  ? 567  GLN C CD    1 
ATOM   7993  O  OE1   . GLN C 2 567  ? 117.259 124.333 122.638 1.00 99.46  ? 567  GLN C OE1   1 
ATOM   7994  N  NE2   . GLN C 2 567  ? 117.633 126.543 122.555 1.00 99.46  ? 567  GLN C NE2   1 
ATOM   7995  N  N     . ALA C 2 568  ? 113.169 123.062 118.141 1.00 93.14  ? 568  ALA C N     1 
ATOM   7996  C  CA    . ALA C 2 568  ? 112.386 121.863 117.885 1.00 93.14  ? 568  ALA C CA    1 
ATOM   7997  C  C     . ALA C 2 568  ? 112.954 121.108 116.692 1.00 93.14  ? 568  ALA C C     1 
ATOM   7998  O  O     . ALA C 2 568  ? 113.495 121.712 115.762 1.00 93.14  ? 568  ALA C O     1 
ATOM   7999  C  CB    . ALA C 2 568  ? 110.925 122.227 117.634 1.00 93.14  ? 568  ALA C CB    1 
ATOM   8000  N  N     . VAL C 2 569  ? 112.827 119.786 116.716 1.00 89.27  ? 569  VAL C N     1 
ATOM   8001  C  CA    . VAL C 2 569  ? 113.364 118.933 115.660 1.00 89.27  ? 569  VAL C CA    1 
ATOM   8002  C  C     . VAL C 2 569  ? 112.212 118.441 114.792 1.00 89.27  ? 569  VAL C C     1 
ATOM   8003  O  O     . VAL C 2 569  ? 111.187 117.994 115.325 1.00 89.27  ? 569  VAL C O     1 
ATOM   8004  C  CB    . VAL C 2 569  ? 114.162 117.761 116.252 1.00 89.27  ? 569  VAL C CB    1 
ATOM   8005  C  CG1   . VAL C 2 569  ? 114.532 116.766 115.172 1.00 89.27  ? 569  VAL C CG1   1 
ATOM   8006  C  CG2   . VAL C 2 569  ? 115.407 118.275 116.949 1.00 89.27  ? 569  VAL C CG2   1 
ATOM   8007  N  N     . PRO C 2 570  ? 112.325 118.505 113.466 1.00 91.49  ? 570  PRO C N     1 
ATOM   8008  C  CA    . PRO C 2 570  ? 111.219 118.055 112.612 1.00 91.49  ? 570  PRO C CA    1 
ATOM   8009  C  C     . PRO C 2 570  ? 111.045 116.545 112.677 1.00 91.49  ? 570  PRO C C     1 
ATOM   8010  O  O     . PRO C 2 570  ? 111.951 115.782 112.337 1.00 91.49  ? 570  PRO C O     1 
ATOM   8011  C  CB    . PRO C 2 570  ? 111.641 118.515 111.210 1.00 91.49  ? 570  PRO C CB    1 
ATOM   8012  C  CG    . PRO C 2 570  ? 112.766 119.478 111.423 1.00 91.49  ? 570  PRO C CG    1 
ATOM   8013  C  CD    . PRO C 2 570  ? 113.440 119.048 112.678 1.00 91.49  ? 570  PRO C CD    1 
ATOM   8014  N  N     . LEU C 2 571  ? 109.867 116.119 113.118 1.00 93.56  ? 571  LEU C N     1 
ATOM   8015  C  CA    . LEU C 2 571  ? 109.527 114.709 113.217 1.00 93.56  ? 571  LEU C CA    1 
ATOM   8016  C  C     . LEU C 2 571  ? 108.972 114.208 111.890 1.00 93.56  ? 571  LEU C C     1 
ATOM   8017  O  O     . LEU C 2 571  ? 108.590 114.993 111.020 1.00 93.56  ? 571  LEU C O     1 
ATOM   8018  C  CB    . LEU C 2 571  ? 108.506 114.470 114.328 1.00 93.56  ? 571  LEU C CB    1 
ATOM   8019  C  CG    . LEU C 2 571  ? 108.668 115.302 115.600 1.00 93.56  ? 571  LEU C CG    1 
ATOM   8020  C  CD1   . LEU C 2 571  ? 107.534 115.017 116.562 1.00 93.56  ? 571  LEU C CD1   1 
ATOM   8021  C  CD2   . LEU C 2 571  ? 110.004 115.019 116.255 1.00 93.56  ? 571  LEU C CD2   1 
ATOM   8022  N  N     . ILE C 2 572  ? 108.929 112.882 111.744 1.00 98.10  ? 572  ILE C N     1 
ATOM   8023  C  CA    . ILE C 2 572  ? 108.418 112.297 110.508 1.00 98.10  ? 572  ILE C CA    1 
ATOM   8024  C  C     . ILE C 2 572  ? 106.900 112.192 110.557 1.00 98.10  ? 572  ILE C C     1 
ATOM   8025  O  O     . ILE C 2 572  ? 106.245 111.955 109.535 1.00 98.10  ? 572  ILE C O     1 
ATOM   8026  C  CB    . ILE C 2 572  ? 109.072 110.928 110.250 1.00 98.10  ? 572  ILE C CB    1 
ATOM   8027  C  CG1   . ILE C 2 572  ? 108.492 109.874 111.191 1.00 98.10  ? 572  ILE C CG1   1 
ATOM   8028  C  CG2   . ILE C 2 572  ? 110.576 111.021 110.416 1.00 98.10  ? 572  ILE C CG2   1 
ATOM   8029  C  CD1   . ILE C 2 572  ? 109.212 108.549 111.129 1.00 98.10  ? 572  ILE C CD1   1 
ATOM   8030  N  N     . ARG C 2 573  ? 106.317 112.362 111.742 1.00 103.50 ? 573  ARG C N     1 
ATOM   8031  C  CA    . ARG C 2 573  ? 104.873 112.351 111.917 1.00 103.50 ? 573  ARG C CA    1 
ATOM   8032  C  C     . ARG C 2 573  ? 104.371 113.582 112.659 1.00 103.50 ? 573  ARG C C     1 
ATOM   8033  O  O     . ARG C 2 573  ? 103.543 113.452 113.565 1.00 103.50 ? 573  ARG C O     1 
ATOM   8034  C  CB    . ARG C 2 573  ? 104.440 111.085 112.655 1.00 103.50 ? 573  ARG C CB    1 
ATOM   8035  C  CG    . ARG C 2 573  ? 104.590 109.820 111.838 1.00 103.50 ? 573  ARG C CG    1 
ATOM   8036  C  CD    . ARG C 2 573  ? 103.786 108.681 112.433 1.00 103.50 ? 573  ARG C CD    1 
ATOM   8037  N  NE    . ARG C 2 573  ? 102.355 108.964 112.430 1.00 103.50 ? 573  ARG C NE    1 
ATOM   8038  C  CZ    . ARG C 2 573  ? 101.420 108.070 112.729 1.00 103.50 ? 573  ARG C CZ    1 
ATOM   8039  N  NH1   . ARG C 2 573  ? 101.765 106.832 113.053 1.00 103.50 ? 573  ARG C NH1   1 
ATOM   8040  N  NH2   . ARG C 2 573  ? 100.140 108.412 112.701 1.00 103.50 ? 573  ARG C NH2   1 
ATOM   8041  N  N     . ALA C 2 574  ? 104.860 114.766 112.299 1.00 101.96 ? 574  ALA C N     1 
ATOM   8042  C  CA    . ALA C 2 574  ? 104.507 115.983 113.014 1.00 101.96 ? 574  ALA C CA    1 
ATOM   8043  C  C     . ALA C 2 574  ? 103.012 116.258 112.923 1.00 101.96 ? 574  ALA C C     1 
ATOM   8044  O  O     . ALA C 2 574  ? 102.338 115.825 111.986 1.00 101.96 ? 574  ALA C O     1 
ATOM   8045  C  CB    . ALA C 2 574  ? 105.295 117.167 112.454 1.00 101.96 ? 574  ALA C CB    1 
ATOM   8046  N  N     . GLN C 2 575  ? 102.500 116.983 113.913 1.00 103.75 ? 575  GLN C N     1 
ATOM   8047  C  CA    . GLN C 2 575  ? 101.096 117.351 113.979 1.00 103.75 ? 575  GLN C CA    1 
ATOM   8048  C  C     . GLN C 2 575  ? 100.975 118.820 114.345 1.00 103.75 ? 575  GLN C C     1 
ATOM   8049  O  O     . GLN C 2 575  ? 101.732 119.333 115.173 1.00 103.75 ? 575  GLN C O     1 
ATOM   8050  C  CB    . GLN C 2 575  ? 100.339 116.512 115.012 1.00 103.75 ? 575  GLN C CB    1 
ATOM   8051  C  CG    . GLN C 2 575  ? 100.263 115.037 114.696 1.00 103.75 ? 575  GLN C CG    1 
ATOM   8052  C  CD    . GLN C 2 575  ? 99.597  114.251 115.802 1.00 103.75 ? 575  GLN C CD    1 
ATOM   8053  O  OE1   . GLN C 2 575  ? 99.317  114.784 116.874 1.00 103.75 ? 575  GLN C OE1   1 
ATOM   8054  N  NE2   . GLN C 2 575  ? 99.335  112.976 115.548 1.00 103.75 ? 575  GLN C NE2   1 
ATOM   8055  N  N     . ALA C 2 576  ? 100.022 119.494 113.722 1.00 103.15 ? 576  ALA C N     1 
ATOM   8056  C  CA    . ALA C 2 576  ? 99.769  120.865 114.125 1.00 103.15 ? 576  ALA C CA    1 
ATOM   8057  C  C     . ALA C 2 576  ? 99.038  120.882 115.465 1.00 103.15 ? 576  ALA C C     1 
ATOM   8058  O  O     . ALA C 2 576  ? 98.209  120.011 115.736 1.00 103.15 ? 576  ALA C O     1 
ATOM   8059  C  CB    . ALA C 2 576  ? 98.945  121.591 113.070 1.00 103.15 ? 576  ALA C CB    1 
ATOM   8060  N  N     . PRO C 2 577  ? 99.335  121.857 116.320 1.00 96.69  ? 577  PRO C N     1 
ATOM   8061  C  CA    . PRO C 2 577  ? 98.770  121.844 117.673 1.00 96.69  ? 577  PRO C CA    1 
ATOM   8062  C  C     . PRO C 2 577  ? 97.257  121.973 117.664 1.00 96.69  ? 577  PRO C C     1 
ATOM   8063  O  O     . PRO C 2 577  ? 96.647  122.394 116.679 1.00 96.69  ? 577  PRO C O     1 
ATOM   8064  C  CB    . PRO C 2 577  ? 99.426  123.057 118.341 1.00 96.69  ? 577  PRO C CB    1 
ATOM   8065  C  CG    . PRO C 2 577  ? 99.816  123.941 117.210 1.00 96.69  ? 577  PRO C CG    1 
ATOM   8066  C  CD    . PRO C 2 577  ? 100.214 123.016 116.105 1.00 96.69  ? 577  PRO C CD    1 
ATOM   8067  N  N     . VAL C 2 578  ? 96.650  121.602 118.794 1.00 97.51  ? 578  VAL C N     1 
ATOM   8068  C  CA    . VAL C 2 578  ? 95.198  121.667 118.904 1.00 97.51  ? 578  VAL C CA    1 
ATOM   8069  C  C     . VAL C 2 578  ? 94.746  123.078 119.247 1.00 97.51  ? 578  VAL C C     1 
ATOM   8070  O  O     . VAL C 2 578  ? 93.604  123.456 118.964 1.00 97.51  ? 578  VAL C O     1 
ATOM   8071  C  CB    . VAL C 2 578  ? 94.694  120.649 119.941 1.00 97.51  ? 578  VAL C CB    1 
ATOM   8072  C  CG1   . VAL C 2 578  ? 94.977  119.237 119.468 1.00 97.51  ? 578  VAL C CG1   1 
ATOM   8073  C  CG2   . VAL C 2 578  ? 95.347  120.899 121.286 1.00 97.51  ? 578  VAL C CG2   1 
ATOM   8074  N  N     . VAL C 2 579  ? 95.617  123.875 119.856 1.00 98.39  ? 579  VAL C N     1 
ATOM   8075  C  CA    . VAL C 2 579  ? 95.316  125.257 120.206 1.00 98.39  ? 579  VAL C CA    1 
ATOM   8076  C  C     . VAL C 2 579  ? 96.349  126.136 119.517 1.00 98.39  ? 579  VAL C C     1 
ATOM   8077  O  O     . VAL C 2 579  ? 97.481  126.274 119.996 1.00 98.39  ? 579  VAL C O     1 
ATOM   8078  C  CB    . VAL C 2 579  ? 95.320  125.476 121.724 1.00 98.39  ? 579  VAL C CB    1 
ATOM   8079  C  CG1   . VAL C 2 579  ? 95.043  126.932 122.046 1.00 98.39  ? 579  VAL C CG1   1 
ATOM   8080  C  CG2   . VAL C 2 579  ? 94.295  124.576 122.389 1.00 98.39  ? 579  VAL C CG2   1 
ATOM   8081  N  N     . MET C 2 580  ? 95.963  126.729 118.394 1.00 106.37 ? 580  MET C N     1 
ATOM   8082  C  CA    . MET C 2 580  ? 96.833  127.592 117.612 1.00 106.37 ? 580  MET C CA    1 
ATOM   8083  C  C     . MET C 2 580  ? 96.500  129.052 117.884 1.00 106.37 ? 580  MET C C     1 
ATOM   8084  O  O     . MET C 2 580  ? 95.443  129.386 118.423 1.00 106.37 ? 580  MET C O     1 
ATOM   8085  C  CB    . MET C 2 580  ? 96.701  127.283 116.117 1.00 106.37 ? 580  MET C CB    1 
ATOM   8086  C  CG    . MET C 2 580  ? 97.031  125.851 115.746 1.00 106.37 ? 580  MET C CG    1 
ATOM   8087  S  SD    . MET C 2 580  ? 96.735  125.503 114.004 1.00 106.37 ? 580  MET C SD    1 
ATOM   8088  C  CE    . MET C 2 580  ? 94.948  125.439 113.975 1.00 106.37 ? 580  MET C CE    1 
ATOM   8089  N  N     . THR C 2 581  ? 97.426  129.930 117.504 1.00 106.76 ? 581  THR C N     1 
ATOM   8090  C  CA    . THR C 2 581  ? 97.233  131.363 117.658 1.00 106.76 ? 581  THR C CA    1 
ATOM   8091  C  C     . THR C 2 581  ? 96.846  132.057 116.361 1.00 106.76 ? 581  THR C C     1 
ATOM   8092  O  O     . THR C 2 581  ? 96.721  133.285 116.349 1.00 106.76 ? 581  THR C O     1 
ATOM   8093  C  CB    . THR C 2 581  ? 98.502  132.014 118.217 1.00 106.76 ? 581  THR C CB    1 
ATOM   8094  O  OG1   . THR C 2 581  ? 99.525  132.007 117.216 1.00 106.76 ? 581  THR C OG1   1 
ATOM   8095  C  CG2   . THR C 2 581  ? 98.990  131.258 119.438 1.00 106.76 ? 581  THR C CG2   1 
ATOM   8096  N  N     . GLY C 2 582  ? 96.654  131.310 115.277 1.00 111.76 ? 582  GLY C N     1 
ATOM   8097  C  CA    . GLY C 2 582  ? 96.267  131.887 114.010 1.00 111.76 ? 582  GLY C CA    1 
ATOM   8098  C  C     . GLY C 2 582  ? 97.403  132.414 113.165 1.00 111.76 ? 582  GLY C C     1 
ATOM   8099  O  O     . GLY C 2 582  ? 97.143  133.044 112.132 1.00 111.76 ? 582  GLY C O     1 
ATOM   8100  N  N     . LEU C 2 583  ? 98.652  132.186 113.566 1.00 110.05 ? 583  LEU C N     1 
ATOM   8101  C  CA    . LEU C 2 583  ? 99.804  132.665 112.818 1.00 110.05 ? 583  LEU C CA    1 
ATOM   8102  C  C     . LEU C 2 583  ? 100.655 131.540 112.246 1.00 110.05 ? 583  LEU C C     1 
ATOM   8103  O  O     . LEU C 2 583  ? 101.716 131.815 111.677 1.00 110.05 ? 583  LEU C O     1 
ATOM   8104  C  CB    . LEU C 2 583  ? 100.675 133.558 113.709 1.00 110.05 ? 583  LEU C CB    1 
ATOM   8105  C  CG    . LEU C 2 583  ? 101.459 134.656 112.994 1.00 110.05 ? 583  LEU C CG    1 
ATOM   8106  C  CD1   . LEU C 2 583  ? 100.499 135.643 112.357 1.00 110.05 ? 583  LEU C CD1   1 
ATOM   8107  C  CD2   . LEU C 2 583  ? 102.402 135.357 113.952 1.00 110.05 ? 583  LEU C CD2   1 
ATOM   8108  N  N     . GLU C 2 584  ? 100.219 130.286 112.375 1.00 112.70 ? 584  GLU C N     1 
ATOM   8109  C  CA    . GLU C 2 584  ? 101.031 129.168 111.914 1.00 112.70 ? 584  GLU C CA    1 
ATOM   8110  C  C     . GLU C 2 584  ? 101.121 129.095 110.396 1.00 112.70 ? 584  GLU C C     1 
ATOM   8111  O  O     . GLU C 2 584  ? 102.168 128.706 109.871 1.00 112.70 ? 584  GLU C O     1 
ATOM   8112  C  CB    . GLU C 2 584  ? 100.473 127.857 112.464 1.00 112.70 ? 584  GLU C CB    1 
ATOM   8113  C  CG    . GLU C 2 584  ? 100.910 127.550 113.882 1.00 112.70 ? 584  GLU C CG    1 
ATOM   8114  C  CD    . GLU C 2 584  ? 100.007 128.188 114.915 1.00 112.70 ? 584  GLU C CD    1 
ATOM   8115  O  OE1   . GLU C 2 584  ? 98.998  128.806 114.518 1.00 112.70 ? 584  GLU C OE1   1 
ATOM   8116  O  OE2   . GLU C 2 584  ? 100.305 128.075 116.122 1.00 112.70 ? 584  GLU C OE2   1 
ATOM   8117  N  N     . GLU C 2 585  ? 100.056 129.459 109.682 1.00 114.88 ? 585  GLU C N     1 
ATOM   8118  C  CA    . GLU C 2 585  ? 100.072 129.352 108.226 1.00 114.88 ? 585  GLU C CA    1 
ATOM   8119  C  C     . GLU C 2 585  ? 101.012 130.380 107.608 1.00 114.88 ? 585  GLU C C     1 
ATOM   8120  O  O     . GLU C 2 585  ? 101.752 130.073 106.664 1.00 114.88 ? 585  GLU C O     1 
ATOM   8121  C  CB    . GLU C 2 585  ? 98.653  129.510 107.679 1.00 114.88 ? 585  GLU C CB    1 
ATOM   8122  C  CG    . GLU C 2 585  ? 98.492  129.129 106.214 1.00 114.88 ? 585  GLU C CG    1 
ATOM   8123  C  CD    . GLU C 2 585  ? 98.851  130.258 105.267 1.00 114.88 ? 585  GLU C CD    1 
ATOM   8124  O  OE1   . GLU C 2 585  ? 98.822  131.428 105.700 1.00 114.88 ? 585  GLU C OE1   1 
ATOM   8125  O  OE2   . GLU C 2 585  ? 99.162  129.975 104.091 1.00 114.88 ? 585  GLU C OE2   1 
ATOM   8126  N  N     . ARG C 2 586  ? 100.993 131.610 108.126 1.00 109.86 ? 586  ARG C N     1 
ATOM   8127  C  CA    . ARG C 2 586  ? 101.832 132.662 107.563 1.00 109.86 ? 586  ARG C CA    1 
ATOM   8128  C  C     . ARG C 2 586  ? 103.311 132.351 107.744 1.00 109.86 ? 586  ARG C C     1 
ATOM   8129  O  O     . ARG C 2 586  ? 104.123 132.648 106.861 1.00 109.86 ? 586  ARG C O     1 
ATOM   8130  C  CB    . ARG C 2 586  ? 101.484 134.007 108.198 1.00 109.86 ? 586  ARG C CB    1 
ATOM   8131  C  CG    . ARG C 2 586  ? 100.329 134.723 107.525 1.00 109.86 ? 586  ARG C CG    1 
ATOM   8132  C  CD    . ARG C 2 586  ? 100.608 134.936 106.049 1.00 109.86 ? 586  ARG C CD    1 
ATOM   8133  N  NE    . ARG C 2 586  ? 101.906 135.564 105.827 1.00 109.86 ? 586  ARG C NE    1 
ATOM   8134  C  CZ    . ARG C 2 586  ? 102.095 136.876 105.740 1.00 109.86 ? 586  ARG C CZ    1 
ATOM   8135  N  NH1   . ARG C 2 586  ? 101.066 137.704 105.852 1.00 109.86 ? 586  ARG C NH1   1 
ATOM   8136  N  NH2   . ARG C 2 586  ? 103.311 137.360 105.538 1.00 109.86 ? 586  ARG C NH2   1 
ATOM   8137  N  N     . VAL C 2 587  ? 103.680 131.752 108.877 1.00 106.59 ? 587  VAL C N     1 
ATOM   8138  C  CA    . VAL C 2 587  ? 105.082 131.416 109.112 1.00 106.59 ? 587  VAL C CA    1 
ATOM   8139  C  C     . VAL C 2 587  ? 105.561 130.391 108.094 1.00 106.59 ? 587  VAL C C     1 
ATOM   8140  O  O     . VAL C 2 587  ? 106.647 130.526 107.517 1.00 106.59 ? 587  VAL C O     1 
ATOM   8141  C  CB    . VAL C 2 587  ? 105.276 130.916 110.554 1.00 106.59 ? 587  VAL C CB    1 
ATOM   8142  C  CG1   . VAL C 2 587  ? 106.659 130.314 110.726 1.00 106.59 ? 587  VAL C CG1   1 
ATOM   8143  C  CG2   . VAL C 2 587  ? 105.064 132.052 111.536 1.00 106.59 ? 587  VAL C CG2   1 
ATOM   8144  N  N     . VAL C 2 588  ? 104.755 129.357 107.848 1.00 108.70 ? 588  VAL C N     1 
ATOM   8145  C  CA    . VAL C 2 588  ? 105.135 128.339 106.874 1.00 108.70 ? 588  VAL C CA    1 
ATOM   8146  C  C     . VAL C 2 588  ? 105.195 128.936 105.475 1.00 108.70 ? 588  VAL C C     1 
ATOM   8147  O  O     . VAL C 2 588  ? 106.090 128.613 104.684 1.00 108.70 ? 588  VAL C O     1 
ATOM   8148  C  CB    . VAL C 2 588  ? 104.163 127.147 106.944 1.00 108.70 ? 588  VAL C CB    1 
ATOM   8149  C  CG1   . VAL C 2 588  ? 104.302 126.265 105.716 1.00 108.70 ? 588  VAL C CG1   1 
ATOM   8150  C  CG2   . VAL C 2 588  ? 104.408 126.345 108.208 1.00 108.70 ? 588  VAL C CG2   1 
ATOM   8151  N  N     . ARG C 2 589  ? 104.257 129.828 105.149 1.00 113.80 ? 589  ARG C N     1 
ATOM   8152  C  CA    . ARG C 2 589  ? 104.246 130.418 103.814 1.00 113.80 ? 589  ARG C CA    1 
ATOM   8153  C  C     . ARG C 2 589  ? 105.448 131.329 103.595 1.00 113.80 ? 589  ARG C C     1 
ATOM   8154  O  O     . ARG C 2 589  ? 106.010 131.367 102.495 1.00 113.80 ? 589  ARG C O     1 
ATOM   8155  C  CB    . ARG C 2 589  ? 102.945 131.186 103.588 1.00 113.80 ? 589  ARG C CB    1 
ATOM   8156  C  CG    . ARG C 2 589  ? 102.822 131.791 102.202 1.00 113.80 ? 589  ARG C CG    1 
ATOM   8157  C  CD    . ARG C 2 589  ? 101.471 132.452 102.004 1.00 113.80 ? 589  ARG C CD    1 
ATOM   8158  N  NE    . ARG C 2 589  ? 100.380 131.484 102.039 1.00 113.80 ? 589  ARG C NE    1 
ATOM   8159  C  CZ    . ARG C 2 589  ? 99.991  130.761 100.995 1.00 113.80 ? 589  ARG C CZ    1 
ATOM   8160  N  NH1   . ARG C 2 589  ? 100.605 130.896 99.828  1.00 113.80 ? 589  ARG C NH1   1 
ATOM   8161  N  NH2   . ARG C 2 589  ? 98.988  129.904 101.116 1.00 113.80 ? 589  ARG C NH2   1 
ATOM   8162  N  N     . ASP C 2 590  ? 105.862 132.066 104.627 1.00 112.29 ? 590  ASP C N     1 
ATOM   8163  C  CA    . ASP C 2 590  ? 106.938 133.036 104.451 1.00 112.29 ? 590  ASP C CA    1 
ATOM   8164  C  C     . ASP C 2 590  ? 108.311 132.408 104.643 1.00 112.29 ? 590  ASP C C     1 
ATOM   8165  O  O     . ASP C 2 590  ? 109.315 132.978 104.202 1.00 112.29 ? 590  ASP C O     1 
ATOM   8166  C  CB    . ASP C 2 590  ? 106.750 134.206 105.413 1.00 112.29 ? 590  ASP C CB    1 
ATOM   8167  C  CG    . ASP C 2 590  ? 105.682 135.172 104.949 1.00 112.29 ? 590  ASP C CG    1 
ATOM   8168  O  OD1   . ASP C 2 590  ? 105.097 134.937 103.871 1.00 112.29 ? 590  ASP C OD1   1 
ATOM   8169  O  OD2   . ASP C 2 590  ? 105.425 136.166 105.659 1.00 112.29 ? 590  ASP C OD2   1 
ATOM   8170  N  N     . SER C 2 591  ? 108.384 131.248 105.297 1.00 112.08 ? 591  SER C N     1 
ATOM   8171  C  CA    . SER C 2 591  ? 109.673 130.586 105.465 1.00 112.08 ? 591  SER C CA    1 
ATOM   8172  C  C     . SER C 2 591  ? 110.155 129.977 104.155 1.00 112.08 ? 591  SER C C     1 
ATOM   8173  O  O     . SER C 2 591  ? 111.315 129.566 104.044 1.00 112.08 ? 591  SER C O     1 
ATOM   8174  C  CB    . SER C 2 591  ? 109.574 129.513 106.547 1.00 112.08 ? 591  SER C CB    1 
ATOM   8175  O  OG    . SER C 2 591  ? 109.163 128.277 105.993 1.00 112.08 ? 591  SER C OG    1 
ATOM   8176  N  N     . LEU C 2 592  ? 109.274 129.898 103.160 1.00 114.05 ? 592  LEU C N     1 
ATOM   8177  C  CA    . LEU C 2 592  ? 109.503 129.354 101.823 1.00 114.05 ? 592  LEU C CA    1 
ATOM   8178  C  C     . LEU C 2 592  ? 109.838 127.869 101.872 1.00 114.05 ? 592  LEU C C     1 
ATOM   8179  O  O     . LEU C 2 592  ? 110.337 127.336 100.876 1.00 114.05 ? 592  LEU C O     1 
ATOM   8180  C  CB    . LEU C 2 592  ? 110.610 130.094 101.052 1.00 114.05 ? 592  LEU C CB    1 
ATOM   8181  C  CG    . LEU C 2 592  ? 110.240 131.483 100.530 1.00 114.05 ? 592  LEU C CG    1 
ATOM   8182  C  CD1   . LEU C 2 592  ? 111.161 131.885 99.394  1.00 114.05 ? 592  LEU C CD1   1 
ATOM   8183  C  CD2   . LEU C 2 592  ? 108.789 131.523 100.080 1.00 114.05 ? 592  LEU C CD2   1 
ATOM   8184  N  N     . ALA C 2 593  ? 109.588 127.186 102.990 1.00 113.95 ? 593  ALA C N     1 
ATOM   8185  C  CA    . ALA C 2 593  ? 109.838 125.751 103.054 1.00 113.95 ? 593  ALA C CA    1 
ATOM   8186  C  C     . ALA C 2 593  ? 108.876 124.989 102.151 1.00 113.95 ? 593  ALA C C     1 
ATOM   8187  O  O     . ALA C 2 593  ? 109.288 124.109 101.386 1.00 113.95 ? 593  ALA C O     1 
ATOM   8188  C  CB    . ALA C 2 593  ? 109.725 125.264 104.498 1.00 113.95 ? 593  ALA C CB    1 
ATOM   8189  N  N     . ALA C 2 594  ? 107.590 125.313 102.227 1.00 118.30 ? 594  ALA C N     1 
ATOM   8190  C  CA    . ALA C 2 594  ? 106.589 124.628 101.429 1.00 118.30 ? 594  ALA C CA    1 
ATOM   8191  C  C     . ALA C 2 594  ? 106.649 125.084 99.975  1.00 118.30 ? 594  ALA C C     1 
ATOM   8192  O  O     . ALA C 2 594  ? 107.388 126.001 99.610  1.00 118.30 ? 594  ALA C O     1 
ATOM   8193  C  CB    . ALA C 2 594  ? 105.191 124.871 101.996 1.00 118.30 ? 594  ALA C CB    1 
ATOM   8194  N  N     . LEU C 2 595  ? 105.854 124.422 99.142  1.00 119.69 ? 595  LEU C N     1 
ATOM   8195  C  CA    . LEU C 2 595  ? 105.767 124.715 97.718  1.00 119.69 ? 595  LEU C CA    1 
ATOM   8196  C  C     . LEU C 2 595  ? 104.315 124.980 97.351  1.00 119.69 ? 595  LEU C C     1 
ATOM   8197  O  O     . LEU C 2 595  ? 103.462 124.101 97.508  1.00 119.69 ? 595  LEU C O     1 
ATOM   8198  C  CB    . LEU C 2 595  ? 106.322 123.555 96.892  1.00 119.69 ? 595  LEU C CB    1 
ATOM   8199  C  CG    . LEU C 2 595  ? 106.221 123.689 95.375  1.00 119.69 ? 595  LEU C CG    1 
ATOM   8200  C  CD1   . LEU C 2 595  ? 107.432 124.421 94.825  1.00 119.69 ? 595  LEU C CD1   1 
ATOM   8201  C  CD2   . LEU C 2 595  ? 106.078 122.322 94.737  1.00 119.69 ? 595  LEU C CD2   1 
ATOM   8202  N  N     . TYR C 2 596  ? 104.038 126.185 96.859  1.00 121.92 ? 596  TYR C N     1 
ATOM   8203  C  CA    . TYR C 2 596  ? 102.676 126.621 96.596  1.00 121.92 ? 596  TYR C CA    1 
ATOM   8204  C  C     . TYR C 2 596  ? 102.445 126.750 95.098  1.00 121.92 ? 596  TYR C C     1 
ATOM   8205  O  O     . TYR C 2 596  ? 103.380 126.929 94.315  1.00 121.92 ? 596  TYR C O     1 
ATOM   8206  C  CB    . TYR C 2 596  ? 102.375 127.954 97.290  1.00 121.92 ? 596  TYR C CB    1 
ATOM   8207  C  CG    . TYR C 2 596  ? 102.285 127.838 98.791  1.00 121.92 ? 596  TYR C CG    1 
ATOM   8208  C  CD1   . TYR C 2 596  ? 103.381 128.115 99.593  1.00 121.92 ? 596  TYR C CD1   1 
ATOM   8209  C  CD2   . TYR C 2 596  ? 101.107 127.443 99.406  1.00 121.92 ? 596  TYR C CD2   1 
ATOM   8210  C  CE1   . TYR C 2 596  ? 103.306 128.007 100.964 1.00 121.92 ? 596  TYR C CE1   1 
ATOM   8211  C  CE2   . TYR C 2 596  ? 101.022 127.332 100.778 1.00 121.92 ? 596  TYR C CE2   1 
ATOM   8212  C  CZ    . TYR C 2 596  ? 102.125 127.615 101.552 1.00 121.92 ? 596  TYR C CZ    1 
ATOM   8213  O  OH    . TYR C 2 596  ? 102.045 127.507 102.920 1.00 121.92 ? 596  TYR C OH    1 
ATOM   8214  N  N     . ALA C 2 597  ? 101.175 126.658 94.710  1.00 133.53 ? 597  ALA C N     1 
ATOM   8215  C  CA    . ALA C 2 597  ? 100.793 126.767 93.310  1.00 133.53 ? 597  ALA C CA    1 
ATOM   8216  C  C     . ALA C 2 597  ? 100.836 128.222 92.867  1.00 133.53 ? 597  ALA C C     1 
ATOM   8217  O  O     . ALA C 2 597  ? 100.337 129.109 93.566  1.00 133.53 ? 597  ALA C O     1 
ATOM   8218  C  CB    . ALA C 2 597  ? 99.397  126.186 93.090  1.00 133.53 ? 597  ALA C CB    1 
ATOM   8219  N  N     . GLU C 2 598  ? 101.434 128.465 91.701  1.00 143.77 ? 598  GLU C N     1 
ATOM   8220  C  CA    . GLU C 2 598  ? 101.600 129.831 91.218  1.00 143.77 ? 598  GLU C CA    1 
ATOM   8221  C  C     . GLU C 2 598  ? 100.280 130.401 90.708  1.00 143.77 ? 598  GLU C C     1 
ATOM   8222  O  O     . GLU C 2 598  ? 99.915  131.538 91.026  1.00 143.77 ? 598  GLU C O     1 
ATOM   8223  C  CB    . GLU C 2 598  ? 102.671 129.865 90.126  1.00 143.77 ? 598  GLU C CB    1 
ATOM   8224  C  CG    . GLU C 2 598  ? 103.182 131.255 89.788  1.00 143.77 ? 598  GLU C CG    1 
ATOM   8225  C  CD    . GLU C 2 598  ? 102.344 131.944 88.730  1.00 143.77 ? 598  GLU C CD    1 
ATOM   8226  O  OE1   . GLU C 2 598  ? 101.710 131.236 87.920  1.00 143.77 ? 598  GLU C OE1   1 
ATOM   8227  O  OE2   . GLU C 2 598  ? 102.321 133.192 88.706  1.00 143.77 ? 598  GLU C OE2   1 
ATOM   8228  N  N     . GLU C 2 599  ? 99.552  129.625 89.910  1.00 147.28 ? 599  GLU C N     1 
ATOM   8229  C  CA    . GLU C 2 599  ? 98.308  130.073 89.299  1.00 147.28 ? 599  GLU C CA    1 
ATOM   8230  C  C     . GLU C 2 599  ? 97.327  128.903 89.272  1.00 147.28 ? 599  GLU C C     1 
ATOM   8231  O  O     . GLU C 2 599  ? 97.676  127.769 89.611  1.00 147.28 ? 599  GLU C O     1 
ATOM   8232  C  CB    . GLU C 2 599  ? 98.579  130.642 87.897  1.00 147.28 ? 599  GLU C CB    1 
ATOM   8233  C  CG    . GLU C 2 599  ? 97.392  131.281 87.186  1.00 147.28 ? 599  GLU C CG    1 
ATOM   8234  C  CD    . GLU C 2 599  ? 96.862  132.501 87.912  1.00 147.28 ? 599  GLU C CD    1 
ATOM   8235  O  OE1   . GLU C 2 599  ? 97.644  133.153 88.635  1.00 147.28 ? 599  GLU C OE1   1 
ATOM   8236  O  OE2   . GLU C 2 599  ? 95.660  132.806 87.764  1.00 147.28 ? 599  GLU C OE2   1 
ATOM   8237  N  N     . ASP C 2 600  ? 96.084  129.186 88.891  1.00 148.34 ? 600  ASP C N     1 
ATOM   8238  C  CA    . ASP C 2 600  ? 95.081  128.144 88.731  1.00 148.34 ? 600  ASP C CA    1 
ATOM   8239  C  C     . ASP C 2 600  ? 95.545  127.100 87.721  1.00 148.34 ? 600  ASP C C     1 
ATOM   8240  O  O     . ASP C 2 600  ? 96.343  127.380 86.823  1.00 148.34 ? 600  ASP C O     1 
ATOM   8241  C  CB    . ASP C 2 600  ? 93.755  128.750 88.273  1.00 148.34 ? 600  ASP C CB    1 
ATOM   8242  C  CG    . ASP C 2 600  ? 93.048  129.509 89.376  1.00 148.34 ? 600  ASP C CG    1 
ATOM   8243  O  OD1   . ASP C 2 600  ? 92.162  128.923 90.030  1.00 148.34 ? 600  ASP C OD1   1 
ATOM   8244  O  OD2   . ASP C 2 600  ? 93.380  130.694 89.590  1.00 148.34 ? 600  ASP C OD2   1 
ATOM   8245  N  N     . GLY C 2 601  ? 95.031  125.887 87.873  1.00 141.60 ? 601  GLY C N     1 
ATOM   8246  C  CA    . GLY C 2 601  ? 95.402  124.820 86.967  1.00 141.60 ? 601  GLY C CA    1 
ATOM   8247  C  C     . GLY C 2 601  ? 95.068  123.469 87.555  1.00 141.60 ? 601  GLY C C     1 
ATOM   8248  O  O     . GLY C 2 601  ? 94.348  123.362 88.550  1.00 141.60 ? 601  GLY C O     1 
ATOM   8249  N  N     . GLU C 2 602  ? 95.607  122.434 86.918  1.00 137.03 ? 602  GLU C N     1 
ATOM   8250  C  CA    . GLU C 2 602  ? 95.366  121.055 87.311  1.00 137.03 ? 602  GLU C CA    1 
ATOM   8251  C  C     . GLU C 2 602  ? 96.692  120.319 87.419  1.00 137.03 ? 602  GLU C C     1 
ATOM   8252  O  O     . GLU C 2 602  ? 97.602  120.542 86.615  1.00 137.03 ? 602  GLU C O     1 
ATOM   8253  C  CB    . GLU C 2 602  ? 94.453  120.346 86.305  1.00 137.03 ? 602  GLU C CB    1 
ATOM   8254  C  CG    . GLU C 2 602  ? 94.054  118.940 86.709  1.00 137.03 ? 602  GLU C CG    1 
ATOM   8255  C  CD    . GLU C 2 602  ? 93.009  118.346 85.788  1.00 137.03 ? 602  GLU C CD    1 
ATOM   8256  O  OE1   . GLU C 2 602  ? 92.643  119.012 84.797  1.00 137.03 ? 602  GLU C OE1   1 
ATOM   8257  O  OE2   . GLU C 2 602  ? 92.553  117.215 86.057  1.00 137.03 ? 602  GLU C OE2   1 
ATOM   8258  N  N     . VAL C 2 603  ? 96.795  119.444 88.413  1.00 127.71 ? 603  VAL C N     1 
ATOM   8259  C  CA    . VAL C 2 603  ? 98.005  118.655 88.617  1.00 127.71 ? 603  VAL C CA    1 
ATOM   8260  C  C     . VAL C 2 603  ? 98.064  117.573 87.548  1.00 127.71 ? 603  VAL C C     1 
ATOM   8261  O  O     . VAL C 2 603  ? 97.110  116.809 87.370  1.00 127.71 ? 603  VAL C O     1 
ATOM   8262  C  CB    . VAL C 2 603  ? 98.038  118.045 90.023  1.00 127.71 ? 603  VAL C CB    1 
ATOM   8263  C  CG1   . VAL C 2 603  ? 99.263  117.164 90.185  1.00 127.71 ? 603  VAL C CG1   1 
ATOM   8264  C  CG2   . VAL C 2 603  ? 98.025  119.141 91.073  1.00 127.71 ? 603  VAL C CG2   1 
ATOM   8265  N  N     . ALA C 2 604  ? 99.187  117.507 86.832  1.00 127.84 ? 604  ALA C N     1 
ATOM   8266  C  CA    . ALA C 2 604  ? 99.330  116.516 85.774  1.00 127.84 ? 604  ALA C CA    1 
ATOM   8267  C  C     . ALA C 2 604  ? 100.057 115.271 86.264  1.00 127.84 ? 604  ALA C C     1 
ATOM   8268  O  O     . ALA C 2 604  ? 99.618  114.148 85.997  1.00 127.84 ? 604  ALA C O     1 
ATOM   8269  C  CB    . ALA C 2 604  ? 100.062 117.124 84.578  1.00 127.84 ? 604  ALA C CB    1 
ATOM   8270  N  N     . LYS C 2 605  ? 101.167 115.446 86.978  1.00 128.35 ? 605  LYS C N     1 
ATOM   8271  C  CA    . LYS C 2 605  ? 101.947 114.323 87.477  1.00 128.35 ? 605  LYS C CA    1 
ATOM   8272  C  C     . LYS C 2 605  ? 102.384 114.599 88.906  1.00 128.35 ? 605  LYS C C     1 
ATOM   8273  O  O     . LYS C 2 605  ? 102.800 115.714 89.227  1.00 128.35 ? 605  LYS C O     1 
ATOM   8274  C  CB    . LYS C 2 605  ? 103.182 114.067 86.604  1.00 128.35 ? 605  LYS C CB    1 
ATOM   8275  C  CG    . LYS C 2 605  ? 102.869 113.694 85.168  1.00 128.35 ? 605  LYS C CG    1 
ATOM   8276  C  CD    . LYS C 2 605  ? 104.140 113.543 84.354  1.00 128.35 ? 605  LYS C CD    1 
ATOM   8277  C  CE    . LYS C 2 605  ? 103.839 113.044 82.953  1.00 128.35 ? 605  LYS C CE    1 
ATOM   8278  N  NZ    . LYS C 2 605  ? 105.088 112.800 82.184  1.00 128.35 ? 605  LYS C NZ    1 
ATOM   8279  N  N     . VAL C 2 606  ? 102.306 113.578 89.756  1.00 127.00 ? 606  VAL C N     1 
ATOM   8280  C  CA    . VAL C 2 606  ? 102.757 113.691 91.139  1.00 127.00 ? 606  VAL C CA    1 
ATOM   8281  C  C     . VAL C 2 606  ? 103.603 112.469 91.471  1.00 127.00 ? 606  VAL C C     1 
ATOM   8282  O  O     . VAL C 2 606  ? 103.173 111.331 91.256  1.00 127.00 ? 606  VAL C O     1 
ATOM   8283  C  CB    . VAL C 2 606  ? 101.587 113.836 92.130  1.00 127.00 ? 606  VAL C CB    1 
ATOM   8284  C  CG1   . VAL C 2 606  ? 100.577 112.712 91.958  1.00 127.00 ? 606  VAL C CG1   1 
ATOM   8285  C  CG2   . VAL C 2 606  ? 102.105 113.867 93.555  1.00 127.00 ? 606  VAL C CG2   1 
ATOM   8286  N  N     . ASP C 2 607  ? 104.806 112.703 91.983  1.00 129.67 ? 607  ASP C N     1 
ATOM   8287  C  CA    . ASP C 2 607  ? 105.750 111.647 92.303  1.00 129.67 ? 607  ASP C CA    1 
ATOM   8288  C  C     . ASP C 2 607  ? 106.594 112.092 93.489  1.00 129.67 ? 607  ASP C C     1 
ATOM   8289  O  O     . ASP C 2 607  ? 106.654 113.277 93.826  1.00 129.67 ? 607  ASP C O     1 
ATOM   8290  C  CB    . ASP C 2 607  ? 106.629 111.310 91.088  1.00 129.67 ? 607  ASP C CB    1 
ATOM   8291  C  CG    . ASP C 2 607  ? 107.587 110.167 91.353  1.00 129.67 ? 607  ASP C CG    1 
ATOM   8292  O  OD1   . ASP C 2 607  ? 107.361 109.415 92.321  1.00 129.67 ? 607  ASP C OD1   1 
ATOM   8293  O  OD2   . ASP C 2 607  ? 108.565 110.019 90.590  1.00 129.67 ? 607  ASP C OD2   1 
ATOM   8294  N  N     . GLY C 2 608  ? 107.249 111.124 94.132  1.00 126.40 ? 608  GLY C N     1 
ATOM   8295  C  CA    . GLY C 2 608  ? 108.059 111.441 95.297  1.00 126.40 ? 608  GLY C CA    1 
ATOM   8296  C  C     . GLY C 2 608  ? 109.238 112.343 94.983  1.00 126.40 ? 608  GLY C C     1 
ATOM   8297  O  O     . GLY C 2 608  ? 109.887 112.867 95.892  1.00 126.40 ? 608  GLY C O     1 
ATOM   8298  N  N     . ASN C 2 609  ? 109.535 112.538 93.698  1.00 124.66 ? 609  ASN C N     1 
ATOM   8299  C  CA    . ASN C 2 609  ? 110.683 113.340 93.299  1.00 124.66 ? 609  ASN C CA    1 
ATOM   8300  C  C     . ASN C 2 609  ? 110.309 114.710 92.750  1.00 124.66 ? 609  ASN C C     1 
ATOM   8301  O  O     . ASN C 2 609  ? 111.042 115.675 92.991  1.00 124.66 ? 609  ASN C O     1 
ATOM   8302  C  CB    . ASN C 2 609  ? 111.510 112.591 92.251  1.00 124.66 ? 609  ASN C CB    1 
ATOM   8303  C  CG    . ASN C 2 609  ? 112.409 111.540 92.865  1.00 124.66 ? 609  ASN C CG    1 
ATOM   8304  O  OD1   . ASN C 2 609  ? 112.565 111.476 94.083  1.00 124.66 ? 609  ASN C OD1   1 
ATOM   8305  N  ND2   . ASN C 2 609  ? 113.007 110.708 92.022  1.00 124.66 ? 609  ASN C ND2   1 
ATOM   8306  N  N     . ARG C 2 610  ? 109.201 114.824 92.023  1.00 126.33 ? 610  ARG C N     1 
ATOM   8307  C  CA    . ARG C 2 610  ? 108.844 116.090 91.399  1.00 126.33 ? 610  ARG C CA    1 
ATOM   8308  C  C     . ARG C 2 610  ? 107.344 116.128 91.157  1.00 126.33 ? 610  ARG C C     1 
ATOM   8309  O  O     . ARG C 2 610  ? 106.664 115.099 91.193  1.00 126.33 ? 610  ARG C O     1 
ATOM   8310  C  CB    . ARG C 2 610  ? 109.603 116.301 90.085  1.00 126.33 ? 610  ARG C CB    1 
ATOM   8311  C  CG    . ARG C 2 610  ? 108.917 115.704 88.867  1.00 126.33 ? 610  ARG C CG    1 
ATOM   8312  C  CD    . ARG C 2 610  ? 109.079 114.197 88.818  1.00 126.33 ? 610  ARG C CD    1 
ATOM   8313  N  NE    . ARG C 2 610  ? 108.645 113.645 87.540  1.00 126.33 ? 610  ARG C NE    1 
ATOM   8314  C  CZ    . ARG C 2 610  ? 107.387 113.337 87.249  1.00 126.33 ? 610  ARG C CZ    1 
ATOM   8315  N  NH1   . ARG C 2 610  ? 106.432 113.527 88.147  1.00 126.33 ? 610  ARG C NH1   1 
ATOM   8316  N  NH2   . ARG C 2 610  ? 107.082 112.840 86.059  1.00 126.33 ? 610  ARG C NH2   1 
ATOM   8317  N  N     . ILE C 2 611  ? 106.838 117.334 90.907  1.00 123.49 ? 611  ILE C N     1 
ATOM   8318  C  CA    . ILE C 2 611  ? 105.424 117.560 90.632  1.00 123.49 ? 611  ILE C CA    1 
ATOM   8319  C  C     . ILE C 2 611  ? 105.312 118.360 89.343  1.00 123.49 ? 611  ILE C C     1 
ATOM   8320  O  O     . ILE C 2 611  ? 105.911 119.434 89.222  1.00 123.49 ? 611  ILE C O     1 
ATOM   8321  C  CB    . ILE C 2 611  ? 104.723 118.295 91.786  1.00 123.49 ? 611  ILE C CB    1 
ATOM   8322  C  CG1   . ILE C 2 611  ? 104.618 117.386 93.008  1.00 123.49 ? 611  ILE C CG1   1 
ATOM   8323  C  CG2   . ILE C 2 611  ? 103.347 118.766 91.358  1.00 123.49 ? 611  ILE C CG2   1 
ATOM   8324  C  CD1   . ILE C 2 611  ? 103.869 118.003 94.161  1.00 123.49 ? 611  ILE C CD1   1 
ATOM   8325  N  N     . VAL C 2 612  ? 104.539 117.850 88.389  1.00 128.25 ? 612  VAL C N     1 
ATOM   8326  C  CA    . VAL C 2 612  ? 104.332 118.495 87.098  1.00 128.25 ? 612  VAL C CA    1 
ATOM   8327  C  C     . VAL C 2 612  ? 102.908 119.028 87.054  1.00 128.25 ? 612  VAL C C     1 
ATOM   8328  O  O     . VAL C 2 612  ? 101.946 118.255 87.158  1.00 128.25 ? 612  VAL C O     1 
ATOM   8329  C  CB    . VAL C 2 612  ? 104.592 117.523 85.936  1.00 128.25 ? 612  VAL C CB    1 
ATOM   8330  C  CG1   . VAL C 2 612  ? 104.109 118.122 84.631  1.00 128.25 ? 612  VAL C CG1   1 
ATOM   8331  C  CG2   . VAL C 2 612  ? 106.069 117.179 85.858  1.00 128.25 ? 612  VAL C CG2   1 
ATOM   8332  N  N     . VAL C 2 613  ? 102.777 120.342 86.882  1.00 132.90 ? 613  VAL C N     1 
ATOM   8333  C  CA    . VAL C 2 613  ? 101.502 121.044 86.960  1.00 132.90 ? 613  VAL C CA    1 
ATOM   8334  C  C     . VAL C 2 613  ? 101.213 121.691 85.612  1.00 132.90 ? 613  VAL C C     1 
ATOM   8335  O  O     . VAL C 2 613  ? 102.117 122.242 84.971  1.00 132.90 ? 613  VAL C O     1 
ATOM   8336  C  CB    . VAL C 2 613  ? 101.513 122.099 88.082  1.00 132.90 ? 613  VAL C CB    1 
ATOM   8337  C  CG1   . VAL C 2 613  ? 100.253 122.946 88.044  1.00 132.90 ? 613  VAL C CG1   1 
ATOM   8338  C  CG2   . VAL C 2 613  ? 101.668 121.429 89.434  1.00 132.90 ? 613  VAL C CG2   1 
ATOM   8339  N  N     . ARG C 2 614  ? 99.952  121.623 85.186  1.00 141.50 ? 614  ARG C N     1 
ATOM   8340  C  CA    . ARG C 2 614  ? 99.481  122.291 83.978  1.00 141.50 ? 614  ARG C CA    1 
ATOM   8341  C  C     . ARG C 2 614  ? 98.629  123.484 84.395  1.00 141.50 ? 614  ARG C C     1 
ATOM   8342  O  O     . ARG C 2 614  ? 97.574  123.315 85.014  1.00 141.50 ? 614  ARG C O     1 
ATOM   8343  C  CB    . ARG C 2 614  ? 98.684  121.330 83.100  1.00 141.50 ? 614  ARG C CB    1 
ATOM   8344  C  CG    . ARG C 2 614  ? 97.781  122.016 82.090  1.00 141.50 ? 614  ARG C CG    1 
ATOM   8345  C  CD    . ARG C 2 614  ? 97.232  121.026 81.078  1.00 141.50 ? 614  ARG C CD    1 
ATOM   8346  N  NE    . ARG C 2 614  ? 98.197  119.980 80.753  1.00 141.50 ? 614  ARG C NE    1 
ATOM   8347  C  CZ    . ARG C 2 614  ? 99.212  120.135 79.909  1.00 141.50 ? 614  ARG C CZ    1 
ATOM   8348  N  NH1   . ARG C 2 614  ? 100.041 119.127 79.675  1.00 141.50 ? 614  ARG C NH1   1 
ATOM   8349  N  NH2   . ARG C 2 614  ? 99.398  121.296 79.297  1.00 141.50 ? 614  ARG C NH2   1 
ATOM   8350  N  N     . TYR C 2 615  ? 99.088  124.687 84.063  1.00 144.69 ? 615  TYR C N     1 
ATOM   8351  C  CA    . TYR C 2 615  ? 98.360  125.898 84.400  1.00 144.69 ? 615  TYR C CA    1 
ATOM   8352  C  C     . TYR C 2 615  ? 97.338  126.221 83.312  1.00 144.69 ? 615  TYR C C     1 
ATOM   8353  O  O     . TYR C 2 615  ? 97.234  125.533 82.294  1.00 144.69 ? 615  TYR C O     1 
ATOM   8354  C  CB    . TYR C 2 615  ? 99.327  127.061 84.610  1.00 144.69 ? 615  TYR C CB    1 
ATOM   8355  C  CG    . TYR C 2 615  ? 100.114 126.966 85.895  1.00 144.69 ? 615  TYR C CG    1 
ATOM   8356  C  CD1   . TYR C 2 615  ? 101.495 127.078 85.896  1.00 144.69 ? 615  TYR C CD1   1 
ATOM   8357  C  CD2   . TYR C 2 615  ? 99.474  126.756 87.106  1.00 144.69 ? 615  TYR C CD2   1 
ATOM   8358  C  CE1   . TYR C 2 615  ? 102.216 126.990 87.070  1.00 144.69 ? 615  TYR C CE1   1 
ATOM   8359  C  CE2   . TYR C 2 615  ? 100.188 126.664 88.283  1.00 144.69 ? 615  TYR C CE2   1 
ATOM   8360  C  CZ    . TYR C 2 615  ? 101.557 126.781 88.259  1.00 144.69 ? 615  TYR C CZ    1 
ATOM   8361  O  OH    . TYR C 2 615  ? 102.270 126.692 89.431  1.00 144.69 ? 615  TYR C OH    1 
ATOM   8362  N  N     . GLU C 2 616  ? 96.565  127.286 83.534  1.00 152.72 ? 616  GLU C N     1 
ATOM   8363  C  CA    . GLU C 2 616  ? 95.570  127.694 82.548  1.00 152.72 ? 616  GLU C CA    1 
ATOM   8364  C  C     . GLU C 2 616  ? 96.231  128.216 81.280  1.00 152.72 ? 616  GLU C C     1 
ATOM   8365  O  O     . GLU C 2 616  ? 95.658  128.123 80.188  1.00 152.72 ? 616  GLU C O     1 
ATOM   8366  C  CB    . GLU C 2 616  ? 94.644  128.755 83.143  1.00 152.72 ? 616  GLU C CB    1 
ATOM   8367  C  CG    . GLU C 2 616  ? 93.956  128.329 84.425  1.00 152.72 ? 616  GLU C CG    1 
ATOM   8368  C  CD    . GLU C 2 616  ? 92.526  127.888 84.195  1.00 152.72 ? 616  GLU C CD    1 
ATOM   8369  O  OE1   . GLU C 2 616  ? 92.220  127.419 83.079  1.00 152.72 ? 616  GLU C OE1   1 
ATOM   8370  O  OE2   . GLU C 2 616  ? 91.707  128.009 85.131  1.00 152.72 ? 616  GLU C OE2   1 
ATOM   8371  N  N     . ASP C 2 617  ? 97.438  128.773 81.405  1.00 155.46 ? 617  ASP C N     1 
ATOM   8372  C  CA    . ASP C 2 617  ? 98.154  129.283 80.242  1.00 155.46 ? 617  ASP C CA    1 
ATOM   8373  C  C     . ASP C 2 617  ? 98.529  128.179 79.264  1.00 155.46 ? 617  ASP C C     1 
ATOM   8374  O  O     . ASP C 2 617  ? 98.823  128.470 78.100  1.00 155.46 ? 617  ASP C O     1 
ATOM   8375  C  CB    . ASP C 2 617  ? 99.415  130.024 80.685  1.00 155.46 ? 617  ASP C CB    1 
ATOM   8376  C  CG    . ASP C 2 617  ? 99.110  131.209 81.577  1.00 155.46 ? 617  ASP C CG    1 
ATOM   8377  O  OD1   . ASP C 2 617  ? 98.003  131.773 81.458  1.00 155.46 ? 617  ASP C OD1   1 
ATOM   8378  O  OD2   . ASP C 2 617  ? 99.978  131.574 82.398  1.00 155.46 ? 617  ASP C OD2   1 
ATOM   8379  N  N     . GLY C 2 618  ? 98.525  126.923 79.706  1.00 153.59 ? 618  GLY C N     1 
ATOM   8380  C  CA    . GLY C 2 618  ? 98.949  125.813 78.889  1.00 153.59 ? 618  GLY C CA    1 
ATOM   8381  C  C     . GLY C 2 618  ? 100.375 125.366 79.121  1.00 153.59 ? 618  GLY C C     1 
ATOM   8382  O  O     . GLY C 2 618  ? 100.732 124.251 78.726  1.00 153.59 ? 618  GLY C O     1 
ATOM   8383  N  N     . ARG C 2 619  ? 101.199 126.202 79.747  1.00 148.69 ? 619  ARG C N     1 
ATOM   8384  C  CA    . ARG C 2 619  ? 102.578 125.830 80.020  1.00 148.69 ? 619  ARG C CA    1 
ATOM   8385  C  C     . ARG C 2 619  ? 102.639 124.742 81.084  1.00 148.69 ? 619  ARG C C     1 
ATOM   8386  O  O     . ARG C 2 619  ? 101.890 124.763 82.064  1.00 148.69 ? 619  ARG C O     1 
ATOM   8387  C  CB    . ARG C 2 619  ? 103.379 127.054 80.462  1.00 148.69 ? 619  ARG C CB    1 
ATOM   8388  C  CG    . ARG C 2 619  ? 102.775 127.802 81.634  1.00 148.69 ? 619  ARG C CG    1 
ATOM   8389  C  CD    . ARG C 2 619  ? 103.359 129.198 81.751  1.00 148.69 ? 619  ARG C CD    1 
ATOM   8390  N  NE    . ARG C 2 619  ? 103.082 129.797 83.052  1.00 148.69 ? 619  ARG C NE    1 
ATOM   8391  C  CZ    . ARG C 2 619  ? 103.964 129.872 84.042  1.00 148.69 ? 619  ARG C CZ    1 
ATOM   8392  N  NH1   . ARG C 2 619  ? 103.625 130.434 85.193  1.00 148.69 ? 619  ARG C NH1   1 
ATOM   8393  N  NH2   . ARG C 2 619  ? 105.188 129.388 83.880  1.00 148.69 ? 619  ARG C NH2   1 
ATOM   8394  N  N     . LEU C 2 620  ? 103.537 123.784 80.880  1.00 139.13 ? 620  LEU C N     1 
ATOM   8395  C  CA    . LEU C 2 620  ? 103.711 122.651 81.780  1.00 139.13 ? 620  LEU C CA    1 
ATOM   8396  C  C     . LEU C 2 620  ? 104.922 122.923 82.664  1.00 139.13 ? 620  LEU C C     1 
ATOM   8397  O  O     . LEU C 2 620  ? 106.064 122.856 82.198  1.00 139.13 ? 620  LEU C O     1 
ATOM   8398  C  CB    . LEU C 2 620  ? 103.888 121.360 80.986  1.00 139.13 ? 620  LEU C CB    1 
ATOM   8399  C  CG    . LEU C 2 620  ? 103.405 120.066 81.637  1.00 139.13 ? 620  LEU C CG    1 
ATOM   8400  C  CD1   . LEU C 2 620  ? 102.024 120.253 82.232  1.00 139.13 ? 620  LEU C CD1   1 
ATOM   8401  C  CD2   . LEU C 2 620  ? 103.404 118.932 80.627  1.00 139.13 ? 620  LEU C CD2   1 
ATOM   8402  N  N     . VAL C 2 621  ? 104.677 123.228 83.935  1.00 133.15 ? 621  VAL C N     1 
ATOM   8403  C  CA    . VAL C 2 621  ? 105.735 123.589 84.871  1.00 133.15 ? 621  VAL C CA    1 
ATOM   8404  C  C     . VAL C 2 621  ? 106.091 122.360 85.693  1.00 133.15 ? 621  VAL C C     1 
ATOM   8405  O  O     . VAL C 2 621  ? 105.236 121.502 85.941  1.00 133.15 ? 621  VAL C O     1 
ATOM   8406  C  CB    . VAL C 2 621  ? 105.302 124.758 85.771  1.00 133.15 ? 621  VAL C CB    1 
ATOM   8407  C  CG1   . VAL C 2 621  ? 106.479 125.283 86.576  1.00 133.15 ? 621  VAL C CG1   1 
ATOM   8408  C  CG2   . VAL C 2 621  ? 104.704 125.866 84.925  1.00 133.15 ? 621  VAL C CG2   1 
ATOM   8409  N  N     . GLU C 2 622  ? 107.352 122.260 86.098  1.00 131.46 ? 622  GLU C N     1 
ATOM   8410  C  CA    . GLU C 2 622  ? 107.840 121.129 86.875  1.00 131.46 ? 622  GLU C CA    1 
ATOM   8411  C  C     . GLU C 2 622  ? 108.591 121.648 88.092  1.00 131.46 ? 622  GLU C C     1 
ATOM   8412  O  O     . GLU C 2 622  ? 109.597 122.351 87.952  1.00 131.46 ? 622  GLU C O     1 
ATOM   8413  C  CB    . GLU C 2 622  ? 108.743 120.234 86.027  1.00 131.46 ? 622  GLU C CB    1 
ATOM   8414  C  CG    . GLU C 2 622  ? 109.650 119.327 86.836  1.00 131.46 ? 622  GLU C CG    1 
ATOM   8415  C  CD    . GLU C 2 622  ? 109.975 118.037 86.113  1.00 131.46 ? 622  GLU C CD    1 
ATOM   8416  O  OE1   . GLU C 2 622  ? 109.423 117.816 85.015  1.00 131.46 ? 622  GLU C OE1   1 
ATOM   8417  O  OE2   . GLU C 2 622  ? 110.782 117.245 86.642  1.00 131.46 ? 622  GLU C OE2   1 
ATOM   8418  N  N     . TYR C 2 623  ? 108.101 121.307 89.278  1.00 127.47 ? 623  TYR C N     1 
ATOM   8419  C  CA    . TYR C 2 623  ? 108.768 121.661 90.522  1.00 127.47 ? 623  TYR C CA    1 
ATOM   8420  C  C     . TYR C 2 623  ? 109.452 120.428 91.089  1.00 127.47 ? 623  TYR C C     1 
ATOM   8421  O  O     . TYR C 2 623  ? 108.765 119.456 91.444  1.00 127.47 ? 623  TYR C O     1 
ATOM   8422  C  CB    . TYR C 2 623  ? 107.774 122.224 91.538  1.00 127.47 ? 623  TYR C CB    1 
ATOM   8423  C  CG    . TYR C 2 623  ? 106.905 123.345 91.023  1.00 127.47 ? 623  TYR C CG    1 
ATOM   8424  C  CD1   . TYR C 2 623  ? 107.340 124.661 91.064  1.00 127.47 ? 623  TYR C CD1   1 
ATOM   8425  C  CD2   . TYR C 2 623  ? 105.642 123.089 90.512  1.00 127.47 ? 623  TYR C CD2   1 
ATOM   8426  C  CE1   . TYR C 2 623  ? 106.545 125.689 90.601  1.00 127.47 ? 623  TYR C CE1   1 
ATOM   8427  C  CE2   . TYR C 2 623  ? 104.840 124.110 90.047  1.00 127.47 ? 623  TYR C CE2   1 
ATOM   8428  C  CZ    . TYR C 2 623  ? 105.297 125.408 90.094  1.00 127.47 ? 623  TYR C CZ    1 
ATOM   8429  O  OH    . TYR C 2 623  ? 104.500 126.428 89.631  1.00 127.47 ? 623  TYR C OH    1 
ATOM   8430  N  N     . PRO C 2 624  ? 110.776 120.401 91.175  1.00 124.56 ? 624  PRO C N     1 
ATOM   8431  C  CA    . PRO C 2 624  ? 111.445 119.310 91.883  1.00 124.56 ? 624  PRO C CA    1 
ATOM   8432  C  C     . PRO C 2 624  ? 111.408 119.533 93.384  1.00 124.56 ? 624  PRO C C     1 
ATOM   8433  O  O     . PRO C 2 624  ? 111.535 120.656 93.878  1.00 124.56 ? 624  PRO C O     1 
ATOM   8434  C  CB    . PRO C 2 624  ? 112.879 119.373 91.348  1.00 124.56 ? 624  PRO C CB    1 
ATOM   8435  C  CG    . PRO C 2 624  ? 113.074 120.809 91.010  1.00 124.56 ? 624  PRO C CG    1 
ATOM   8436  C  CD    . PRO C 2 624  ? 111.735 121.329 90.550  1.00 124.56 ? 624  PRO C CD    1 
ATOM   8437  N  N     . LEU C 2 625  ? 111.228 118.438 94.113  1.00 124.53 ? 625  LEU C N     1 
ATOM   8438  C  CA    . LEU C 2 625  ? 111.113 118.477 95.562  1.00 124.53 ? 625  LEU C CA    1 
ATOM   8439  C  C     . LEU C 2 625  ? 112.450 118.138 96.203  1.00 124.53 ? 625  LEU C C     1 
ATOM   8440  O  O     . LEU C 2 625  ? 113.042 117.094 95.912  1.00 124.53 ? 625  LEU C O     1 
ATOM   8441  C  CB    . LEU C 2 625  ? 110.041 117.503 96.054  1.00 124.53 ? 625  LEU C CB    1 
ATOM   8442  C  CG    . LEU C 2 625  ? 108.709 117.538 95.306  1.00 124.53 ? 625  LEU C CG    1 
ATOM   8443  C  CD1   . LEU C 2 625  ? 107.771 116.474 95.843  1.00 124.53 ? 625  LEU C CD1   1 
ATOM   8444  C  CD2   . LEU C 2 625  ? 108.077 118.912 95.412  1.00 124.53 ? 625  LEU C CD2   1 
ATOM   8445  N  N     . ARG C 2 626  ? 112.921 119.025 97.073  1.00 133.18 ? 626  ARG C N     1 
ATOM   8446  C  CA    . ARG C 2 626  ? 114.134 118.772 97.837  1.00 133.18 ? 626  ARG C CA    1 
ATOM   8447  C  C     . ARG C 2 626  ? 113.865 117.634 98.812  1.00 133.18 ? 626  ARG C C     1 
ATOM   8448  O  O     . ARG C 2 626  ? 113.069 117.785 99.745  1.00 133.18 ? 626  ARG C O     1 
ATOM   8449  C  CB    . ARG C 2 626  ? 114.575 120.033 98.574  1.00 133.18 ? 626  ARG C CB    1 
ATOM   8450  C  CG    . ARG C 2 626  ? 115.959 119.939 99.185  1.00 133.18 ? 626  ARG C CG    1 
ATOM   8451  C  CD    . ARG C 2 626  ? 116.148 120.958 100.295 1.00 133.18 ? 626  ARG C CD    1 
ATOM   8452  N  NE    . ARG C 2 626  ? 116.327 122.310 99.777  1.00 133.18 ? 626  ARG C NE    1 
ATOM   8453  C  CZ    . ARG C 2 626  ? 115.588 123.351 100.143 1.00 133.18 ? 626  ARG C CZ    1 
ATOM   8454  N  NH1   . ARG C 2 626  ? 114.617 123.196 101.032 1.00 133.18 ? 626  ARG C NH1   1 
ATOM   8455  N  NH2   . ARG C 2 626  ? 115.819 124.548 99.621  1.00 133.18 ? 626  ARG C NH2   1 
ATOM   8456  N  N     . ARG C 2 627  ? 114.523 116.498 98.600  1.00 126.16 ? 627  ARG C N     1 
ATOM   8457  C  CA    . ARG C 2 627  ? 114.213 115.267 99.315  1.00 126.16 ? 627  ARG C CA    1 
ATOM   8458  C  C     . ARG C 2 627  ? 115.430 114.812 100.105 1.00 126.16 ? 627  ARG C C     1 
ATOM   8459  O  O     . ARG C 2 627  ? 116.505 114.605 99.531  1.00 126.16 ? 627  ARG C O     1 
ATOM   8460  C  CB    . ARG C 2 627  ? 113.767 114.176 98.341  1.00 126.16 ? 627  ARG C CB    1 
ATOM   8461  C  CG    . ARG C 2 627  ? 113.486 112.845 99.000  1.00 126.16 ? 627  ARG C CG    1 
ATOM   8462  C  CD    . ARG C 2 627  ? 112.189 112.888 99.782  1.00 126.16 ? 627  ARG C CD    1 
ATOM   8463  N  NE    . ARG C 2 627  ? 111.026 112.895 98.902  1.00 126.16 ? 627  ARG C NE    1 
ATOM   8464  C  CZ    . ARG C 2 627  ? 109.769 112.879 99.329  1.00 126.16 ? 627  ARG C CZ    1 
ATOM   8465  N  NH1   . ARG C 2 627  ? 109.511 112.852 100.629 1.00 126.16 ? 627  ARG C NH1   1 
ATOM   8466  N  NH2   . ARG C 2 627  ? 108.771 112.886 98.458  1.00 126.16 ? 627  ARG C NH2   1 
ATOM   8467  N  N     . PHE C 2 628  ? 115.249 114.645 101.415 1.00 123.37 ? 628  PHE C N     1 
ATOM   8468  C  CA    . PHE C 2 628  ? 116.289 114.155 102.321 1.00 123.37 ? 628  PHE C CA    1 
ATOM   8469  C  C     . PHE C 2 628  ? 117.584 114.948 102.168 1.00 123.37 ? 628  PHE C C     1 
ATOM   8470  O  O     . PHE C 2 628  ? 118.653 114.403 101.885 1.00 123.37 ? 628  PHE C O     1 
ATOM   8471  C  CB    . PHE C 2 628  ? 116.527 112.660 102.118 1.00 123.37 ? 628  PHE C CB    1 
ATOM   8472  C  CG    . PHE C 2 628  ? 115.405 111.801 102.619 1.00 123.37 ? 628  PHE C CG    1 
ATOM   8473  C  CD1   . PHE C 2 628  ? 115.051 111.816 103.957 1.00 123.37 ? 628  PHE C CD1   1 
ATOM   8474  C  CD2   . PHE C 2 628  ? 114.700 110.985 101.754 1.00 123.37 ? 628  PHE C CD2   1 
ATOM   8475  C  CE1   . PHE C 2 628  ? 114.017 111.030 104.423 1.00 123.37 ? 628  PHE C CE1   1 
ATOM   8476  C  CE2   . PHE C 2 628  ? 113.665 110.196 102.213 1.00 123.37 ? 628  PHE C CE2   1 
ATOM   8477  C  CZ    . PHE C 2 628  ? 113.323 110.218 103.549 1.00 123.37 ? 628  PHE C CZ    1 
ATOM   8478  N  N     . TYR C 2 629  ? 117.476 116.257 102.362 1.00 122.23 ? 629  TYR C N     1 
ATOM   8479  C  CA    . TYR C 2 629  ? 118.626 117.145 102.331 1.00 122.23 ? 629  TYR C CA    1 
ATOM   8480  C  C     . TYR C 2 629  ? 119.048 117.488 103.751 1.00 122.23 ? 629  TYR C C     1 
ATOM   8481  O  O     . TYR C 2 629  ? 118.208 117.649 104.640 1.00 122.23 ? 629  TYR C O     1 
ATOM   8482  C  CB    . TYR C 2 629  ? 118.295 118.417 101.551 1.00 122.23 ? 629  TYR C CB    1 
ATOM   8483  C  CG    . TYR C 2 629  ? 119.372 119.472 101.597 1.00 122.23 ? 629  TYR C CG    1 
ATOM   8484  C  CD1   . TYR C 2 629  ? 120.565 119.305 100.908 1.00 122.23 ? 629  TYR C CD1   1 
ATOM   8485  C  CD2   . TYR C 2 629  ? 119.191 120.640 102.323 1.00 122.23 ? 629  TYR C CD2   1 
ATOM   8486  C  CE1   . TYR C 2 629  ? 121.551 120.270 100.947 1.00 122.23 ? 629  TYR C CE1   1 
ATOM   8487  C  CE2   . TYR C 2 629  ? 120.170 121.611 102.367 1.00 122.23 ? 629  TYR C CE2   1 
ATOM   8488  C  CZ    . TYR C 2 629  ? 121.347 121.421 101.678 1.00 122.23 ? 629  TYR C CZ    1 
ATOM   8489  O  OH    . TYR C 2 629  ? 122.324 122.387 101.722 1.00 122.23 ? 629  TYR C OH    1 
ATOM   8490  N  N     . ARG C 2 630  ? 120.356 117.595 103.961 1.00 110.07 ? 630  ARG C N     1 
ATOM   8491  C  CA    . ARG C 2 630  ? 120.911 117.814 105.290 1.00 110.07 ? 630  ARG C CA    1 
ATOM   8492  C  C     . ARG C 2 630  ? 121.014 119.308 105.565 1.00 110.07 ? 630  ARG C C     1 
ATOM   8493  O  O     . ARG C 2 630  ? 121.605 120.052 104.775 1.00 110.07 ? 630  ARG C O     1 
ATOM   8494  C  CB    . ARG C 2 630  ? 122.281 117.153 105.417 1.00 110.07 ? 630  ARG C CB    1 
ATOM   8495  C  CG    . ARG C 2 630  ? 123.041 117.573 106.655 1.00 110.07 ? 630  ARG C CG    1 
ATOM   8496  C  CD    . ARG C 2 630  ? 124.501 117.184 106.574 1.00 110.07 ? 630  ARG C CD    1 
ATOM   8497  N  NE    . ARG C 2 630  ? 125.064 116.962 107.900 1.00 110.07 ? 630  ARG C NE    1 
ATOM   8498  C  CZ    . ARG C 2 630  ? 125.625 117.914 108.636 1.00 110.07 ? 630  ARG C CZ    1 
ATOM   8499  N  NH1   . ARG C 2 630  ? 125.696 119.154 108.174 1.00 110.07 ? 630  ARG C NH1   1 
ATOM   8500  N  NH2   . ARG C 2 630  ? 126.113 117.629 109.834 1.00 110.07 ? 630  ARG C NH2   1 
ATOM   8501  N  N     . SER C 2 631  ? 120.443 119.744 106.685 1.00 112.07 ? 631  SER C N     1 
ATOM   8502  C  CA    . SER C 2 631  ? 120.529 121.134 107.098 1.00 112.07 ? 631  SER C CA    1 
ATOM   8503  C  C     . SER C 2 631  ? 121.898 121.416 107.712 1.00 112.07 ? 631  SER C C     1 
ATOM   8504  O  O     . SER C 2 631  ? 122.783 120.558 107.753 1.00 112.07 ? 631  SER C O     1 
ATOM   8505  C  CB    . SER C 2 631  ? 119.411 121.465 108.082 1.00 112.07 ? 631  SER C CB    1 
ATOM   8506  O  OG    . SER C 2 631  ? 119.578 120.748 109.290 1.00 112.07 ? 631  SER C OG    1 
ATOM   8507  N  N     . ASN C 2 632  ? 122.078 122.644 108.202 1.00 109.70 ? 632  ASN C N     1 
ATOM   8508  C  CA    . ASN C 2 632  ? 123.360 123.019 108.789 1.00 109.70 ? 632  ASN C CA    1 
ATOM   8509  C  C     . ASN C 2 632  ? 123.561 122.367 110.150 1.00 109.70 ? 632  ASN C C     1 
ATOM   8510  O  O     . ASN C 2 632  ? 124.698 122.114 110.563 1.00 109.70 ? 632  ASN C O     1 
ATOM   8511  C  CB    . ASN C 2 632  ? 123.461 124.538 108.902 1.00 109.70 ? 632  ASN C CB    1 
ATOM   8512  C  CG    . ASN C 2 632  ? 123.963 125.181 107.631 1.00 109.70 ? 632  ASN C CG    1 
ATOM   8513  O  OD1   . ASN C 2 632  ? 124.092 124.523 106.600 1.00 109.70 ? 632  ASN C OD1   1 
ATOM   8514  N  ND2   . ASN C 2 632  ? 124.248 126.475 107.694 1.00 109.70 ? 632  ASN C ND2   1 
ATOM   8515  N  N     . GLN C 2 633  ? 122.473 122.086 110.863 1.00 110.30 ? 633  GLN C N     1 
ATOM   8516  C  CA    . GLN C 2 633  ? 122.550 121.539 112.209 1.00 110.30 ? 633  GLN C CA    1 
ATOM   8517  C  C     . GLN C 2 633  ? 122.487 120.020 112.243 1.00 110.30 ? 633  GLN C C     1 
ATOM   8518  O  O     . GLN C 2 633  ? 122.608 119.434 113.322 1.00 110.30 ? 633  GLN C O     1 
ATOM   8519  C  CB    . GLN C 2 633  ? 121.429 122.117 113.076 1.00 110.30 ? 633  GLN C CB    1 
ATOM   8520  C  CG    . GLN C 2 633  ? 121.222 123.607 112.904 1.00 110.30 ? 633  GLN C CG    1 
ATOM   8521  C  CD    . GLN C 2 633  ? 122.505 124.390 113.064 1.00 110.30 ? 633  GLN C CD    1 
ATOM   8522  O  OE1   . GLN C 2 633  ? 123.004 124.986 112.112 1.00 110.30 ? 633  GLN C OE1   1 
ATOM   8523  N  NE2   . GLN C 2 633  ? 123.050 124.389 114.274 1.00 110.30 ? 633  GLN C NE2   1 
ATOM   8524  N  N     . GLY C 2 634  ? 122.301 119.369 111.100 1.00 107.97 ? 634  GLY C N     1 
ATOM   8525  C  CA    . GLY C 2 634  ? 122.256 117.924 111.054 1.00 107.97 ? 634  GLY C CA    1 
ATOM   8526  C  C     . GLY C 2 634  ? 120.879 117.319 110.922 1.00 107.97 ? 634  GLY C C     1 
ATOM   8527  O  O     . GLY C 2 634  ? 120.770 116.091 110.837 1.00 107.97 ? 634  GLY C O     1 
ATOM   8528  N  N     . THR C 2 635  ? 119.829 118.131 110.900 1.00 108.52 ? 635  THR C N     1 
ATOM   8529  C  CA    . THR C 2 635  ? 118.485 117.612 110.710 1.00 108.52 ? 635  THR C CA    1 
ATOM   8530  C  C     . THR C 2 635  ? 118.217 117.375 109.231 1.00 108.52 ? 635  THR C C     1 
ATOM   8531  O  O     . THR C 2 635  ? 118.880 117.941 108.358 1.00 108.52 ? 635  THR C O     1 
ATOM   8532  C  CB    . THR C 2 635  ? 117.445 118.578 111.275 1.00 108.52 ? 635  THR C CB    1 
ATOM   8533  O  OG1   . THR C 2 635  ? 117.467 119.796 110.523 1.00 108.52 ? 635  THR C OG1   1 
ATOM   8534  C  CG2   . THR C 2 635  ? 117.743 118.883 112.731 1.00 108.52 ? 635  THR C CG2   1 
ATOM   8535  N  N     . ALA C 2 636  ? 117.233 116.526 108.953 1.00 110.44 ? 636  ALA C N     1 
ATOM   8536  C  CA    . ALA C 2 636  ? 116.886 116.169 107.585 1.00 110.44 ? 636  ALA C CA    1 
ATOM   8537  C  C     . ALA C 2 636  ? 115.666 116.968 107.145 1.00 110.44 ? 636  ALA C C     1 
ATOM   8538  O  O     . ALA C 2 636  ? 114.571 116.788 107.687 1.00 110.44 ? 636  ALA C O     1 
ATOM   8539  C  CB    . ALA C 2 636  ? 116.617 114.670 107.468 1.00 110.44 ? 636  ALA C CB    1 
ATOM   8540  N  N     . LEU C 2 637  ? 115.857 117.844 106.164 1.00 117.93 ? 637  LEU C N     1 
ATOM   8541  C  CA    . LEU C 2 637  ? 114.768 118.627 105.591 1.00 117.93 ? 637  LEU C CA    1 
ATOM   8542  C  C     . LEU C 2 637  ? 114.334 117.964 104.291 1.00 117.93 ? 637  LEU C C     1 
ATOM   8543  O  O     . LEU C 2 637  ? 115.172 117.615 103.454 1.00 117.93 ? 637  LEU C O     1 
ATOM   8544  C  CB    . LEU C 2 637  ? 115.202 120.070 105.354 1.00 117.93 ? 637  LEU C CB    1 
ATOM   8545  C  CG    . LEU C 2 637  ? 115.910 120.764 106.515 1.00 117.93 ? 637  LEU C CG    1 
ATOM   8546  C  CD1   . LEU C 2 637  ? 116.327 122.168 106.116 1.00 117.93 ? 637  LEU C CD1   1 
ATOM   8547  C  CD2   . LEU C 2 637  ? 115.015 120.796 107.741 1.00 117.93 ? 637  LEU C CD2   1 
ATOM   8548  N  N     . ASP C 2 638  ? 113.027 117.790 104.120 1.00 124.59 ? 638  ASP C N     1 
ATOM   8549  C  CA    . ASP C 2 638  ? 112.498 117.159 102.922 1.00 124.59 ? 638  ASP C CA    1 
ATOM   8550  C  C     . ASP C 2 638  ? 111.072 117.632 102.692 1.00 124.59 ? 638  ASP C C     1 
ATOM   8551  O  O     . ASP C 2 638  ? 110.368 117.987 103.640 1.00 124.59 ? 638  ASP C O     1 
ATOM   8552  C  CB    . ASP C 2 638  ? 112.538 115.632 103.032 1.00 124.59 ? 638  ASP C CB    1 
ATOM   8553  C  CG    . ASP C 2 638  ? 111.582 115.097 104.076 1.00 124.59 ? 638  ASP C CG    1 
ATOM   8554  O  OD1   . ASP C 2 638  ? 111.382 115.776 105.105 1.00 124.59 ? 638  ASP C OD1   1 
ATOM   8555  O  OD2   . ASP C 2 638  ? 111.031 113.996 103.871 1.00 124.59 ? 638  ASP C OD2   1 
ATOM   8556  N  N     . GLN C 2 639  ? 110.658 117.635 101.431 1.00 123.36 ? 639  GLN C N     1 
ATOM   8557  C  CA    . GLN C 2 639  ? 109.308 118.018 101.051 1.00 123.36 ? 639  GLN C CA    1 
ATOM   8558  C  C     . GLN C 2 639  ? 108.520 116.784 100.641 1.00 123.36 ? 639  GLN C C     1 
ATOM   8559  O  O     . GLN C 2 639  ? 109.088 115.809 100.142 1.00 123.36 ? 639  GLN C O     1 
ATOM   8560  C  CB    . GLN C 2 639  ? 109.329 119.032 99.908  1.00 123.36 ? 639  GLN C CB    1 
ATOM   8561  C  CG    . GLN C 2 639  ? 109.787 120.417 100.322 1.00 123.36 ? 639  GLN C CG    1 
ATOM   8562  C  CD    . GLN C 2 639  ? 110.072 121.312 99.137  1.00 123.36 ? 639  GLN C CD    1 
ATOM   8563  O  OE1   . GLN C 2 639  ? 110.506 120.847 98.085  1.00 123.36 ? 639  GLN C OE1   1 
ATOM   8564  N  NE2   . GLN C 2 639  ? 109.828 122.606 99.301  1.00 123.36 ? 639  GLN C NE2   1 
ATOM   8565  N  N     . ARG C 2 640  ? 107.209 116.831 100.859 1.00 122.68 ? 640  ARG C N     1 
ATOM   8566  C  CA    . ARG C 2 640  ? 106.348 115.711 100.542 1.00 122.68 ? 640  ARG C CA    1 
ATOM   8567  C  C     . ARG C 2 640  ? 105.152 116.177 99.725  1.00 122.68 ? 640  ARG C C     1 
ATOM   8568  O  O     . ARG C 2 640  ? 104.506 117.167 100.083 1.00 122.68 ? 640  ARG C O     1 
ATOM   8569  C  CB    . ARG C 2 640  ? 105.854 115.020 101.820 1.00 122.68 ? 640  ARG C CB    1 
ATOM   8570  C  CG    . ARG C 2 640  ? 106.953 114.359 102.631 1.00 122.68 ? 640  ARG C CG    1 
ATOM   8571  C  CD    . ARG C 2 640  ? 106.377 113.564 103.788 1.00 122.68 ? 640  ARG C CD    1 
ATOM   8572  N  NE    . ARG C 2 640  ? 105.836 114.429 104.830 1.00 122.68 ? 640  ARG C NE    1 
ATOM   8573  C  CZ    . ARG C 2 640  ? 106.530 114.853 105.881 1.00 122.68 ? 640  ARG C CZ    1 
ATOM   8574  N  NH1   . ARG C 2 640  ? 107.795 114.488 106.031 1.00 122.68 ? 640  ARG C NH1   1 
ATOM   8575  N  NH2   . ARG C 2 640  ? 105.959 115.639 106.783 1.00 122.68 ? 640  ARG C NH2   1 
ATOM   8576  N  N     . PRO C 2 641  ? 104.832 115.491 98.629  1.00 117.83 ? 641  PRO C N     1 
ATOM   8577  C  CA    . PRO C 2 641  ? 103.682 115.901 97.814  1.00 117.83 ? 641  PRO C CA    1 
ATOM   8578  C  C     . PRO C 2 641  ? 102.378 115.661 98.559  1.00 117.83 ? 641  PRO C C     1 
ATOM   8579  O  O     . PRO C 2 641  ? 102.211 114.643 99.234  1.00 117.83 ? 641  PRO C O     1 
ATOM   8580  C  CB    . PRO C 2 641  ? 103.796 115.015 96.571  1.00 117.83 ? 641  PRO C CB    1 
ATOM   8581  C  CG    . PRO C 2 641  ? 104.527 113.809 97.047  1.00 117.83 ? 641  PRO C CG    1 
ATOM   8582  C  CD    . PRO C 2 641  ? 105.494 114.293 98.090  1.00 117.83 ? 641  PRO C CD    1 
ATOM   8583  N  N     . ARG C 2 642  ? 101.454 116.610 98.435  1.00 119.66 ? 642  ARG C N     1 
ATOM   8584  C  CA    . ARG C 2 642  ? 100.181 116.551 99.136  1.00 119.66 ? 642  ARG C CA    1 
ATOM   8585  C  C     . ARG C 2 642  ? 98.982  116.596 98.201  1.00 119.66 ? 642  ARG C C     1 
ATOM   8586  O  O     . ARG C 2 642  ? 97.865  116.850 98.661  1.00 119.66 ? 642  ARG C O     1 
ATOM   8587  C  CB    . ARG C 2 642  ? 100.085 117.697 100.147 1.00 119.66 ? 642  ARG C CB    1 
ATOM   8588  C  CG    . ARG C 2 642  ? 100.895 117.477 101.412 1.00 119.66 ? 642  ARG C CG    1 
ATOM   8589  C  CD    . ARG C 2 642  ? 100.317 116.357 102.255 1.00 119.66 ? 642  ARG C CD    1 
ATOM   8590  N  NE    . ARG C 2 642  ? 101.030 116.205 103.520 1.00 119.66 ? 642  ARG C NE    1 
ATOM   8591  C  CZ    . ARG C 2 642  ? 101.801 115.166 103.823 1.00 119.66 ? 642  ARG C CZ    1 
ATOM   8592  N  NH1   . ARG C 2 642  ? 101.959 114.180 102.953 1.00 119.66 ? 642  ARG C NH1   1 
ATOM   8593  N  NH2   . ARG C 2 642  ? 102.412 115.112 104.998 1.00 119.66 ? 642  ARG C NH2   1 
ATOM   8594  N  N     . VAL C 2 643  ? 99.181  116.360 96.906  1.00 121.63 ? 643  VAL C N     1 
ATOM   8595  C  CA    . VAL C 2 643  ? 98.099  116.371 95.934  1.00 121.63 ? 643  VAL C CA    1 
ATOM   8596  C  C     . VAL C 2 643  ? 98.084  115.034 95.202  1.00 121.63 ? 643  VAL C C     1 
ATOM   8597  O  O     . VAL C 2 643  ? 98.902  114.150 95.453  1.00 121.63 ? 643  VAL C O     1 
ATOM   8598  C  CB    . VAL C 2 643  ? 98.217  117.538 94.937  1.00 121.63 ? 643  VAL C CB    1 
ATOM   8599  C  CG1   . VAL C 2 643  ? 98.229  118.864 95.674  1.00 121.63 ? 643  VAL C CG1   1 
ATOM   8600  C  CG2   . VAL C 2 643  ? 99.467  117.383 94.093  1.00 121.63 ? 643  VAL C CG2   1 
ATOM   8601  N  N     . VAL C 2 644  ? 97.132  114.900 94.283  1.00 126.32 ? 644  VAL C N     1 
ATOM   8602  C  CA    . VAL C 2 644  ? 96.935  113.675 93.525  1.00 126.32 ? 644  VAL C CA    1 
ATOM   8603  C  C     . VAL C 2 644  ? 96.697  114.050 92.067  1.00 126.32 ? 644  VAL C C     1 
ATOM   8604  O  O     . VAL C 2 644  ? 96.255  115.157 91.752  1.00 126.32 ? 644  VAL C O     1 
ATOM   8605  C  CB    . VAL C 2 644  ? 95.763  112.842 94.092  1.00 126.32 ? 644  VAL C CB    1 
ATOM   8606  C  CG1   . VAL C 2 644  ? 94.465  113.634 94.028  1.00 126.32 ? 644  VAL C CG1   1 
ATOM   8607  C  CG2   . VAL C 2 644  ? 95.635  111.493 93.392  1.00 126.32 ? 644  VAL C CG2   1 
ATOM   8608  N  N     . VAL C 2 645  ? 97.022  113.115 91.170  1.00 127.97 ? 645  VAL C N     1 
ATOM   8609  C  CA    . VAL C 2 645  ? 96.829  113.342 89.743  1.00 127.97 ? 645  VAL C CA    1 
ATOM   8610  C  C     . VAL C 2 645  ? 95.371  113.675 89.467  1.00 127.97 ? 645  VAL C C     1 
ATOM   8611  O  O     . VAL C 2 645  ? 94.457  112.999 89.953  1.00 127.97 ? 645  VAL C O     1 
ATOM   8612  C  CB    . VAL C 2 645  ? 97.281  112.111 88.943  1.00 127.97 ? 645  VAL C CB    1 
ATOM   8613  C  CG1   . VAL C 2 645  ? 96.721  112.156 87.530  1.00 127.97 ? 645  VAL C CG1   1 
ATOM   8614  C  CG2   . VAL C 2 645  ? 98.794  112.030 88.907  1.00 127.97 ? 645  VAL C CG2   1 
ATOM   8615  N  N     . GLY C 2 646  ? 95.149  114.727 88.682  1.00 131.65 ? 646  GLY C N     1 
ATOM   8616  C  CA    . GLY C 2 646  ? 93.815  115.153 88.324  1.00 131.65 ? 646  GLY C CA    1 
ATOM   8617  C  C     . GLY C 2 646  ? 93.170  116.131 89.278  1.00 131.65 ? 646  GLY C C     1 
ATOM   8618  O  O     . GLY C 2 646  ? 92.037  116.560 89.025  1.00 131.65 ? 646  GLY C O     1 
ATOM   8619  N  N     . GLN C 2 647  ? 93.846  116.501 90.362  1.00 132.29 ? 647  GLN C N     1 
ATOM   8620  C  CA    . GLN C 2 647  ? 93.285  117.441 91.320  1.00 132.29 ? 647  GLN C CA    1 
ATOM   8621  C  C     . GLN C 2 647  ? 93.326  118.857 90.763  1.00 132.29 ? 647  GLN C C     1 
ATOM   8622  O  O     . GLN C 2 647  ? 94.320  119.276 90.164  1.00 132.29 ? 647  GLN C O     1 
ATOM   8623  C  CB    . GLN C 2 647  ? 94.049  117.373 92.642  1.00 132.29 ? 647  GLN C CB    1 
ATOM   8624  C  CG    . GLN C 2 647  ? 93.660  118.442 93.645  1.00 132.29 ? 647  GLN C CG    1 
ATOM   8625  C  CD    . GLN C 2 647  ? 94.225  118.174 95.023  1.00 132.29 ? 647  GLN C CD    1 
ATOM   8626  O  OE1   . GLN C 2 647  ? 94.855  117.144 95.258  1.00 132.29 ? 647  GLN C OE1   1 
ATOM   8627  N  NE2   . GLN C 2 647  ? 94.003  119.103 95.944  1.00 132.29 ? 647  GLN C NE2   1 
ATOM   8628  N  N     . ARG C 2 648  ? 92.237  119.592 90.964  1.00 141.93 ? 648  ARG C N     1 
ATOM   8629  C  CA    . ARG C 2 648  ? 92.152  120.974 90.511  1.00 141.93 ? 648  ARG C CA    1 
ATOM   8630  C  C     . ARG C 2 648  ? 92.650  121.897 91.615  1.00 141.93 ? 648  ARG C C     1 
ATOM   8631  O  O     . ARG C 2 648  ? 92.164  121.834 92.749  1.00 141.93 ? 648  ARG C O     1 
ATOM   8632  C  CB    . ARG C 2 648  ? 90.716  121.318 90.125  1.00 141.93 ? 648  ARG C CB    1 
ATOM   8633  C  CG    . ARG C 2 648  ? 90.563  122.659 89.436  1.00 141.93 ? 648  ARG C CG    1 
ATOM   8634  C  CD    . ARG C 2 648  ? 91.159  122.623 88.041  1.00 141.93 ? 648  ARG C CD    1 
ATOM   8635  N  NE    . ARG C 2 648  ? 90.969  123.885 87.332  1.00 141.93 ? 648  ARG C NE    1 
ATOM   8636  C  CZ    . ARG C 2 648  ? 91.524  124.174 86.160  1.00 141.93 ? 648  ARG C CZ    1 
ATOM   8637  N  NH1   . ARG C 2 648  ? 92.309  123.290 85.559  1.00 141.93 ? 648  ARG C NH1   1 
ATOM   8638  N  NH2   . ARG C 2 648  ? 91.295  125.347 85.588  1.00 141.93 ? 648  ARG C NH2   1 
ATOM   8639  N  N     . VAL C 2 649  ? 93.617  122.750 91.290  1.00 138.61 ? 649  VAL C N     1 
ATOM   8640  C  CA    . VAL C 2 649  ? 94.212  123.655 92.263  1.00 138.61 ? 649  VAL C CA    1 
ATOM   8641  C  C     . VAL C 2 649  ? 94.031  125.088 91.789  1.00 138.61 ? 649  VAL C C     1 
ATOM   8642  O  O     . VAL C 2 649  ? 94.042  125.376 90.588  1.00 138.61 ? 649  VAL C O     1 
ATOM   8643  C  CB    . VAL C 2 649  ? 95.705  123.345 92.502  1.00 138.61 ? 649  VAL C CB    1 
ATOM   8644  C  CG1   . VAL C 2 649  ? 95.861  121.995 93.174  1.00 138.61 ? 649  VAL C CG1   1 
ATOM   8645  C  CG2   . VAL C 2 649  ? 96.472  123.383 91.192  1.00 138.61 ? 649  VAL C CG2   1 
ATOM   8646  N  N     . ARG C 2 650  ? 93.858  125.990 92.749  1.00 145.03 ? 650  ARG C N     1 
ATOM   8647  C  CA    . ARG C 2 650  ? 93.735  127.411 92.477  1.00 145.03 ? 650  ARG C CA    1 
ATOM   8648  C  C     . ARG C 2 650  ? 95.031  128.120 92.857  1.00 145.03 ? 650  ARG C C     1 
ATOM   8649  O  O     . ARG C 2 650  ? 96.018  127.500 93.258  1.00 145.03 ? 650  ARG C O     1 
ATOM   8650  C  CB    . ARG C 2 650  ? 92.540  127.997 93.230  1.00 145.03 ? 650  ARG C CB    1 
ATOM   8651  C  CG    . ARG C 2 650  ? 91.199  127.470 92.753  1.00 145.03 ? 650  ARG C CG    1 
ATOM   8652  C  CD    . ARG C 2 650  ? 90.057  128.074 93.545  1.00 145.03 ? 650  ARG C CD    1 
ATOM   8653  N  NE    . ARG C 2 650  ? 90.095  127.669 94.946  1.00 145.03 ? 650  ARG C NE    1 
ATOM   8654  C  CZ    . ARG C 2 650  ? 89.337  128.203 95.898  1.00 145.03 ? 650  ARG C CZ    1 
ATOM   8655  N  NH1   . ARG C 2 650  ? 88.477  129.167 95.599  1.00 145.03 ? 650  ARG C NH1   1 
ATOM   8656  N  NH2   . ARG C 2 650  ? 89.437  127.773 97.148  1.00 145.03 ? 650  ARG C NH2   1 
ATOM   8657  N  N     . LYS C 2 651  ? 95.026  129.443 92.726  1.00 140.77 ? 651  LYS C N     1 
ATOM   8658  C  CA    . LYS C 2 651  ? 96.210  130.232 93.036  1.00 140.77 ? 651  LYS C CA    1 
ATOM   8659  C  C     . LYS C 2 651  ? 96.461  130.228 94.538  1.00 140.77 ? 651  LYS C C     1 
ATOM   8660  O  O     . LYS C 2 651  ? 95.580  130.591 95.324  1.00 140.77 ? 651  LYS C O     1 
ATOM   8661  C  CB    . LYS C 2 651  ? 96.043  131.659 92.524  1.00 140.77 ? 651  LYS C CB    1 
ATOM   8662  C  CG    . LYS C 2 651  ? 97.247  132.547 92.773  1.00 140.77 ? 651  LYS C CG    1 
ATOM   8663  C  CD    . LYS C 2 651  ? 97.035  133.936 92.198  1.00 140.77 ? 651  LYS C CD    1 
ATOM   8664  C  CE    . LYS C 2 651  ? 98.317  134.748 92.240  1.00 140.77 ? 651  LYS C CE    1 
ATOM   8665  N  NZ    . LYS C 2 651  ? 99.481  133.970 91.735  1.00 140.77 ? 651  LYS C NZ    1 
ATOM   8666  N  N     . GLY C 2 652  ? 97.660  129.815 94.936  1.00 134.23 ? 652  GLY C N     1 
ATOM   8667  C  CA    . GLY C 2 652  ? 98.049  129.827 96.329  1.00 134.23 ? 652  GLY C CA    1 
ATOM   8668  C  C     . GLY C 2 652  ? 97.759  128.564 97.106  1.00 134.23 ? 652  GLY C C     1 
ATOM   8669  O  O     . GLY C 2 652  ? 97.999  128.539 98.319  1.00 134.23 ? 652  GLY C O     1 
ATOM   8670  N  N     . ASP C 2 653  ? 97.255  127.518 96.459  1.00 135.82 ? 653  ASP C N     1 
ATOM   8671  C  CA    . ASP C 2 653  ? 96.996  126.267 97.154  1.00 135.82 ? 653  ASP C CA    1 
ATOM   8672  C  C     . ASP C 2 653  ? 98.300  125.542 97.458  1.00 135.82 ? 653  ASP C C     1 
ATOM   8673  O  O     . ASP C 2 653  ? 99.339  125.799 96.844  1.00 135.82 ? 653  ASP C O     1 
ATOM   8674  C  CB    . ASP C 2 653  ? 96.081  125.365 96.328  1.00 135.82 ? 653  ASP C CB    1 
ATOM   8675  C  CG    . ASP C 2 653  ? 94.762  126.026 95.994  1.00 135.82 ? 653  ASP C CG    1 
ATOM   8676  O  OD1   . ASP C 2 653  ? 94.084  125.560 95.055  1.00 135.82 ? 653  ASP C OD1   1 
ATOM   8677  O  OD2   . ASP C 2 653  ? 94.403  127.012 96.670  1.00 135.82 ? 653  ASP C OD2   1 
ATOM   8678  N  N     . LEU C 2 654  ? 98.233  124.626 98.419  1.00 122.09 ? 654  LEU C N     1 
ATOM   8679  C  CA    . LEU C 2 654  ? 99.416  123.883 98.827  1.00 122.09 ? 654  LEU C CA    1 
ATOM   8680  C  C     . LEU C 2 654  ? 99.658  122.710 97.887  1.00 122.09 ? 654  LEU C C     1 
ATOM   8681  O  O     . LEU C 2 654  ? 98.731  121.967 97.551  1.00 122.09 ? 654  LEU C O     1 
ATOM   8682  C  CB    . LEU C 2 654  ? 99.255  123.385 100.261 1.00 122.09 ? 654  LEU C CB    1 
ATOM   8683  C  CG    . LEU C 2 654  ? 100.484 122.715 100.871 1.00 122.09 ? 654  LEU C CG    1 
ATOM   8684  C  CD1   . LEU C 2 654  ? 101.576 123.738 101.119 1.00 122.09 ? 654  LEU C CD1   1 
ATOM   8685  C  CD2   . LEU C 2 654  ? 100.113 122.000 102.156 1.00 122.09 ? 654  LEU C CD2   1 
ATOM   8686  N  N     . LEU C 2 655  ? 100.910 122.543 97.464  1.00 120.15 ? 655  LEU C N     1 
ATOM   8687  C  CA    . LEU C 2 655  ? 101.306 121.435 96.607  1.00 120.15 ? 655  LEU C CA    1 
ATOM   8688  C  C     . LEU C 2 655  ? 102.221 120.458 97.334  1.00 120.15 ? 655  LEU C C     1 
ATOM   8689  O  O     . LEU C 2 655  ? 101.976 119.249 97.319  1.00 120.15 ? 655  LEU C O     1 
ATOM   8690  C  CB    . LEU C 2 655  ? 101.992 121.963 95.341  1.00 120.15 ? 655  LEU C CB    1 
ATOM   8691  C  CG    . LEU C 2 655  ? 101.109 122.732 94.361  1.00 120.15 ? 655  LEU C CG    1 
ATOM   8692  C  CD1   . LEU C 2 655  ? 101.911 123.148 93.142  1.00 120.15 ? 655  LEU C CD1   1 
ATOM   8693  C  CD2   . LEU C 2 655  ? 99.912  121.892 93.958  1.00 120.15 ? 655  LEU C CD2   1 
ATOM   8694  N  N     . ALA C 2 656  ? 103.275 120.954 97.974  1.00 121.19 ? 656  ALA C N     1 
ATOM   8695  C  CA    . ALA C 2 656  ? 104.220 120.118 98.696  1.00 121.19 ? 656  ALA C CA    1 
ATOM   8696  C  C     . ALA C 2 656  ? 104.365 120.629 100.119 1.00 121.19 ? 656  ALA C C     1 
ATOM   8697  O  O     . ALA C 2 656  ? 104.514 121.834 100.344 1.00 121.19 ? 656  ALA C O     1 
ATOM   8698  C  CB    . ALA C 2 656  ? 105.587 120.098 98.007  1.00 121.19 ? 656  ALA C CB    1 
ATOM   8699  N  N     . ASP C 2 657  ? 104.324 119.709 101.076 1.00 120.40 ? 657  ASP C N     1 
ATOM   8700  C  CA    . ASP C 2 657  ? 104.424 120.072 102.480 1.00 120.40 ? 657  ASP C CA    1 
ATOM   8701  C  C     . ASP C 2 657  ? 105.880 120.080 102.922 1.00 120.40 ? 657  ASP C C     1 
ATOM   8702  O  O     . ASP C 2 657  ? 106.575 119.064 102.840 1.00 120.40 ? 657  ASP C O     1 
ATOM   8703  C  CB    . ASP C 2 657  ? 103.618 119.096 103.336 1.00 120.40 ? 657  ASP C CB    1 
ATOM   8704  C  CG    . ASP C 2 657  ? 103.001 119.757 104.550 1.00 120.40 ? 657  ASP C CG    1 
ATOM   8705  O  OD1   . ASP C 2 657  ? 103.271 120.955 104.777 1.00 120.40 ? 657  ASP C OD1   1 
ATOM   8706  O  OD2   . ASP C 2 657  ? 102.238 119.082 105.271 1.00 120.40 ? 657  ASP C OD2   1 
ATOM   8707  N  N     . GLY C 2 658  ? 106.338 121.235 103.394 1.00 114.32 ? 658  GLY C N     1 
ATOM   8708  C  CA    . GLY C 2 658  ? 107.712 121.401 103.800 1.00 114.32 ? 658  GLY C CA    1 
ATOM   8709  C  C     . GLY C 2 658  ? 108.057 120.628 105.056 1.00 114.32 ? 658  GLY C C     1 
ATOM   8710  O  O     . GLY C 2 658  ? 107.251 119.856 105.583 1.00 114.32 ? 658  GLY C O     1 
ATOM   8711  N  N     . PRO C 2 659  ? 109.272 120.824 105.561 1.00 112.45 ? 659  PRO C N     1 
ATOM   8712  C  CA    . PRO C 2 659  ? 109.671 120.142 106.794 1.00 112.45 ? 659  PRO C CA    1 
ATOM   8713  C  C     . PRO C 2 659  ? 108.978 120.742 108.003 1.00 112.45 ? 659  PRO C C     1 
ATOM   8714  O  O     . PRO C 2 659  ? 108.844 121.962 108.130 1.00 112.45 ? 659  PRO C O     1 
ATOM   8715  C  CB    . PRO C 2 659  ? 111.189 120.366 106.857 1.00 112.45 ? 659  PRO C CB    1 
ATOM   8716  C  CG    . PRO C 2 659  ? 111.569 120.998 105.543 1.00 112.45 ? 659  PRO C CG    1 
ATOM   8717  C  CD    . PRO C 2 659  ? 110.346 121.672 105.029 1.00 112.45 ? 659  PRO C CD    1 
ATOM   8718  N  N     . ALA C 2 660  ? 108.533 119.859 108.897 1.00 109.53 ? 660  ALA C N     1 
ATOM   8719  C  CA    . ALA C 2 660  ? 107.834 120.255 110.119 1.00 109.53 ? 660  ALA C CA    1 
ATOM   8720  C  C     . ALA C 2 660  ? 106.605 121.102 109.799 1.00 109.53 ? 660  ALA C C     1 
ATOM   8721  O  O     . ALA C 2 660  ? 106.444 122.218 110.296 1.00 109.53 ? 660  ALA C O     1 
ATOM   8722  C  CB    . ALA C 2 660  ? 108.771 120.991 111.077 1.00 109.53 ? 660  ALA C CB    1 
ATOM   8723  N  N     . SER C 2 661  ? 105.730 120.564 108.955 1.00 111.45 ? 661  SER C N     1 
ATOM   8724  C  CA    . SER C 2 661  ? 104.490 121.230 108.594 1.00 111.45 ? 661  SER C CA    1 
ATOM   8725  C  C     . SER C 2 661  ? 103.447 120.182 108.241 1.00 111.45 ? 661  SER C C     1 
ATOM   8726  O  O     . SER C 2 661  ? 103.762 119.148 107.648 1.00 111.45 ? 661  SER C O     1 
ATOM   8727  C  CB    . SER C 2 661  ? 104.686 122.197 107.422 1.00 111.45 ? 661  SER C CB    1 
ATOM   8728  O  OG    . SER C 2 661  ? 104.996 121.497 106.233 1.00 111.45 ? 661  SER C OG    1 
ATOM   8729  N  N     . GLU C 2 662  ? 102.201 120.458 108.617 1.00 113.41 ? 662  GLU C N     1 
ATOM   8730  C  CA    . GLU C 2 662  ? 101.084 119.549 108.381 1.00 113.41 ? 662  GLU C CA    1 
ATOM   8731  C  C     . GLU C 2 662  ? 99.975  120.325 107.685 1.00 113.41 ? 662  GLU C C     1 
ATOM   8732  O  O     . GLU C 2 662  ? 99.218  121.050 108.340 1.00 113.41 ? 662  GLU C O     1 
ATOM   8733  C  CB    . GLU C 2 662  ? 100.587 118.935 109.690 1.00 113.41 ? 662  GLU C CB    1 
ATOM   8734  C  CG    . GLU C 2 662  ? 99.381  118.029 109.533 1.00 113.41 ? 662  GLU C CG    1 
ATOM   8735  C  CD    . GLU C 2 662  ? 98.692  117.744 110.852 1.00 113.41 ? 662  GLU C CD    1 
ATOM   8736  O  OE1   . GLU C 2 662  ? 98.856  118.547 111.794 1.00 113.41 ? 662  GLU C OE1   1 
ATOM   8737  O  OE2   . GLU C 2 662  ? 97.988  116.718 110.947 1.00 113.41 ? 662  GLU C OE2   1 
ATOM   8738  N  N     . ASN C 2 663  ? 99.889  120.177 106.363 1.00 114.94 ? 663  ASN C N     1 
ATOM   8739  C  CA    . ASN C 2 663  ? 98.886  120.867 105.550 1.00 114.94 ? 663  ASN C CA    1 
ATOM   8740  C  C     . ASN C 2 663  ? 99.005  122.381 105.691 1.00 114.94 ? 663  ASN C C     1 
ATOM   8741  O  O     . ASN C 2 663  ? 98.015  123.093 105.865 1.00 114.94 ? 663  ASN C O     1 
ATOM   8742  C  CB    . ASN C 2 663  ? 97.473  120.396 105.896 1.00 114.94 ? 663  ASN C CB    1 
ATOM   8743  C  CG    . ASN C 2 663  ? 97.353  118.889 105.916 1.00 114.94 ? 663  ASN C CG    1 
ATOM   8744  O  OD1   . ASN C 2 663  ? 98.035  118.191 105.167 1.00 114.94 ? 663  ASN C OD1   1 
ATOM   8745  N  ND2   . ASN C 2 663  ? 96.483  118.376 106.777 1.00 114.94 ? 663  ASN C ND2   1 
ATOM   8746  N  N     . GLY C 2 664  ? 100.236 122.878 105.614 1.00 112.23 ? 664  GLY C N     1 
ATOM   8747  C  CA    . GLY C 2 664  ? 100.492 124.300 105.656 1.00 112.23 ? 664  GLY C CA    1 
ATOM   8748  C  C     . GLY C 2 664  ? 100.598 124.905 107.037 1.00 112.23 ? 664  GLY C C     1 
ATOM   8749  O  O     . GLY C 2 664  ? 100.999 126.069 107.153 1.00 112.23 ? 664  GLY C O     1 
ATOM   8750  N  N     . PHE C 2 665  ? 100.251 124.165 108.084 1.00 106.90 ? 665  PHE C N     1 
ATOM   8751  C  CA    . PHE C 2 665  ? 100.348 124.655 109.451 1.00 106.90 ? 665  PHE C CA    1 
ATOM   8752  C  C     . PHE C 2 665  ? 101.664 124.207 110.069 1.00 106.90 ? 665  PHE C C     1 
ATOM   8753  O  O     . PHE C 2 665  ? 102.114 123.080 109.845 1.00 106.90 ? 665  PHE C O     1 
ATOM   8754  C  CB    . PHE C 2 665  ? 99.176  124.157 110.296 1.00 106.90 ? 665  PHE C CB    1 
ATOM   8755  C  CG    . PHE C 2 665  ? 97.836  124.616 109.803 1.00 106.90 ? 665  PHE C CG    1 
ATOM   8756  C  CD1   . PHE C 2 665  ? 97.284  125.797 110.263 1.00 106.90 ? 665  PHE C CD1   1 
ATOM   8757  C  CD2   . PHE C 2 665  ? 97.126  123.864 108.885 1.00 106.90 ? 665  PHE C CD2   1 
ATOM   8758  C  CE1   . PHE C 2 665  ? 96.051  126.222 109.812 1.00 106.90 ? 665  PHE C CE1   1 
ATOM   8759  C  CE2   . PHE C 2 665  ? 95.893  124.283 108.432 1.00 106.90 ? 665  PHE C CE2   1 
ATOM   8760  C  CZ    . PHE C 2 665  ? 95.355  125.464 108.896 1.00 106.90 ? 665  PHE C CZ    1 
ATOM   8761  N  N     . LEU C 2 666  ? 102.277 125.095 110.846 1.00 101.94 ? 666  LEU C N     1 
ATOM   8762  C  CA    . LEU C 2 666  ? 103.552 124.784 111.477 1.00 101.94 ? 666  LEU C CA    1 
ATOM   8763  C  C     . LEU C 2 666  ? 103.374 123.681 112.510 1.00 101.94 ? 666  LEU C C     1 
ATOM   8764  O  O     . LEU C 2 666  ? 102.592 123.821 113.453 1.00 101.94 ? 666  LEU C O     1 
ATOM   8765  C  CB    . LEU C 2 666  ? 104.134 126.036 112.127 1.00 101.94 ? 666  LEU C CB    1 
ATOM   8766  C  CG    . LEU C 2 666  ? 105.579 125.914 112.608 1.00 101.94 ? 666  LEU C CG    1 
ATOM   8767  C  CD1   . LEU C 2 666  ? 106.521 125.757 111.428 1.00 101.94 ? 666  LEU C CD1   1 
ATOM   8768  C  CD2   . LEU C 2 666  ? 105.964 127.116 113.448 1.00 101.94 ? 666  LEU C CD2   1 
ATOM   8769  N  N     . ALA C 2 667  ? 104.104 122.585 112.330 1.00 104.02 ? 667  ALA C N     1 
ATOM   8770  C  CA    . ALA C 2 667  ? 103.991 121.403 113.181 1.00 104.02 ? 667  ALA C CA    1 
ATOM   8771  C  C     . ALA C 2 667  ? 105.379 121.041 113.698 1.00 104.02 ? 667  ALA C C     1 
ATOM   8772  O  O     . ALA C 2 667  ? 106.147 120.362 113.010 1.00 104.02 ? 667  ALA C O     1 
ATOM   8773  C  CB    . ALA C 2 667  ? 103.364 120.245 112.415 1.00 104.02 ? 667  ALA C CB    1 
ATOM   8774  N  N     . LEU C 2 668  ? 105.698 121.488 114.909 1.00 97.95  ? 668  LEU C N     1 
ATOM   8775  C  CA    . LEU C 2 668  ? 106.993 121.227 115.521 1.00 97.95  ? 668  LEU C CA    1 
ATOM   8776  C  C     . LEU C 2 668  ? 106.946 120.130 116.574 1.00 97.95  ? 668  LEU C C     1 
ATOM   8777  O  O     . LEU C 2 668  ? 107.995 119.761 117.110 1.00 97.95  ? 668  LEU C O     1 
ATOM   8778  C  CB    . LEU C 2 668  ? 107.548 122.510 116.143 1.00 97.95  ? 668  LEU C CB    1 
ATOM   8779  C  CG    . LEU C 2 668  ? 107.742 123.692 115.194 1.00 97.95  ? 668  LEU C CG    1 
ATOM   8780  C  CD1   . LEU C 2 668  ? 108.001 124.965 115.978 1.00 97.95  ? 668  LEU C CD1   1 
ATOM   8781  C  CD2   . LEU C 2 668  ? 108.878 123.414 114.230 1.00 97.95  ? 668  LEU C CD2   1 
ATOM   8782  N  N     . GLY C 2 669  ? 105.772 119.603 116.882 1.00 97.29  ? 669  GLY C N     1 
ATOM   8783  C  CA    . GLY C 2 669  ? 105.665 118.596 117.912 1.00 97.29  ? 669  GLY C CA    1 
ATOM   8784  C  C     . GLY C 2 669  ? 104.464 117.710 117.691 1.00 97.29  ? 669  GLY C C     1 
ATOM   8785  O  O     . GLY C 2 669  ? 104.058 117.463 116.555 1.00 97.29  ? 669  GLY C O     1 
ATOM   8786  N  N     . GLN C 2 670  ? 103.893 117.231 118.794 1.00 96.69  ? 670  GLN C N     1 
ATOM   8787  C  CA    . GLN C 2 670  ? 102.751 116.332 118.732 1.00 96.69  ? 670  GLN C CA    1 
ATOM   8788  C  C     . GLN C 2 670  ? 101.795 116.602 119.884 1.00 96.69  ? 670  GLN C C     1 
ATOM   8789  O  O     . GLN C 2 670  ? 102.178 117.126 120.934 1.00 96.69  ? 670  GLN C O     1 
ATOM   8790  C  CB    . GLN C 2 670  ? 103.196 114.868 118.753 1.00 96.69  ? 670  GLN C CB    1 
ATOM   8791  C  CG    . GLN C 2 670  ? 103.611 114.341 117.396 1.00 96.69  ? 670  GLN C CG    1 
ATOM   8792  C  CD    . GLN C 2 670  ? 104.392 113.053 117.492 1.00 96.69  ? 670  GLN C CD    1 
ATOM   8793  O  OE1   . GLN C 2 670  ? 104.818 112.656 118.574 1.00 96.69  ? 670  GLN C OE1   1 
ATOM   8794  N  NE2   . GLN C 2 670  ? 104.586 112.392 116.359 1.00 96.69  ? 670  GLN C NE2   1 
ATOM   8795  N  N     . ASN C 2 671  ? 100.535 116.232 119.669 1.00 97.67  ? 671  ASN C N     1 
ATOM   8796  C  CA    . ASN C 2 671  ? 99.486  116.362 120.671 1.00 97.67  ? 671  ASN C CA    1 
ATOM   8797  C  C     . ASN C 2 671  ? 99.401  115.064 121.462 1.00 97.67  ? 671  ASN C C     1 
ATOM   8798  O  O     . ASN C 2 671  ? 99.140  114.001 120.890 1.00 97.67  ? 671  ASN C O     1 
ATOM   8799  C  CB    . ASN C 2 671  ? 98.142  116.677 120.018 1.00 97.67  ? 671  ASN C CB    1 
ATOM   8800  C  CG    . ASN C 2 671  ? 98.250  117.747 118.958 1.00 97.67  ? 671  ASN C CG    1 
ATOM   8801  O  OD1   . ASN C 2 671  ? 98.995  118.713 119.110 1.00 97.67  ? 671  ASN C OD1   1 
ATOM   8802  N  ND2   . ASN C 2 671  ? 97.507  117.581 117.873 1.00 97.67  ? 671  ASN C ND2   1 
ATOM   8803  N  N     . VAL C 2 672  ? 99.618  115.151 122.770 1.00 94.66  ? 672  VAL C N     1 
ATOM   8804  C  CA    . VAL C 2 672  ? 99.628  113.979 123.631 1.00 94.66  ? 672  VAL C CA    1 
ATOM   8805  C  C     . VAL C 2 672  ? 98.650  114.189 124.777 1.00 94.66  ? 672  VAL C C     1 
ATOM   8806  O  O     . VAL C 2 672  ? 98.420  115.309 125.241 1.00 94.66  ? 672  VAL C O     1 
ATOM   8807  C  CB    . VAL C 2 672  ? 101.038 113.673 124.167 1.00 94.66  ? 672  VAL C CB    1 
ATOM   8808  C  CG1   . VAL C 2 672  ? 101.970 113.324 123.025 1.00 94.66  ? 672  VAL C CG1   1 
ATOM   8809  C  CG2   . VAL C 2 672  ? 101.574 114.863 124.936 1.00 94.66  ? 672  VAL C CG2   1 
ATOM   8810  N  N     . LEU C 2 673  ? 98.071  113.083 125.235 1.00 94.35  ? 673  LEU C N     1 
ATOM   8811  C  CA    . LEU C 2 673  ? 97.131  113.097 126.348 1.00 94.35  ? 673  LEU C CA    1 
ATOM   8812  C  C     . LEU C 2 673  ? 97.911  113.050 127.655 1.00 94.35  ? 673  LEU C C     1 
ATOM   8813  O  O     . LEU C 2 673  ? 98.400  111.988 128.054 1.00 94.35  ? 673  LEU C O     1 
ATOM   8814  C  CB    . LEU C 2 673  ? 96.169  111.916 126.247 1.00 94.35  ? 673  LEU C CB    1 
ATOM   8815  C  CG    . LEU C 2 673  ? 94.884  111.998 127.067 1.00 94.35  ? 673  LEU C CG    1 
ATOM   8816  C  CD1   . LEU C 2 673  ? 94.100  113.245 126.705 1.00 94.35  ? 673  LEU C CD1   1 
ATOM   8817  C  CD2   . LEU C 2 673  ? 94.046  110.753 126.848 1.00 94.35  ? 673  LEU C CD2   1 
ATOM   8818  N  N     . VAL C 2 674  ? 98.024  114.196 128.320 1.00 92.21  ? 674  VAL C N     1 
ATOM   8819  C  CA    . VAL C 2 674  ? 98.838  114.347 129.516 1.00 92.21  ? 674  VAL C CA    1 
ATOM   8820  C  C     . VAL C 2 674  ? 97.931  114.484 130.730 1.00 92.21  ? 674  VAL C C     1 
ATOM   8821  O  O     . VAL C 2 674  ? 96.851  115.084 130.656 1.00 92.21  ? 674  VAL C O     1 
ATOM   8822  C  CB    . VAL C 2 674  ? 99.787  115.559 129.395 1.00 92.21  ? 674  VAL C CB    1 
ATOM   8823  C  CG1   . VAL C 2 674  ? 99.006  116.857 129.358 1.00 92.21  ? 674  VAL C CG1   1 
ATOM   8824  C  CG2   . VAL C 2 674  ? 100.792 115.570 130.529 1.00 92.21  ? 674  VAL C CG2   1 
ATOM   8825  N  N     . ALA C 2 675  ? 98.370  113.905 131.846 1.00 92.57  ? 675  ALA C N     1 
ATOM   8826  C  CA    . ALA C 2 675  ? 97.707  114.032 133.136 1.00 92.57  ? 675  ALA C CA    1 
ATOM   8827  C  C     . ALA C 2 675  ? 98.667  114.705 134.103 1.00 92.57  ? 675  ALA C C     1 
ATOM   8828  O  O     . ALA C 2 675  ? 99.871  114.433 134.073 1.00 92.57  ? 675  ALA C O     1 
ATOM   8829  C  CB    . ALA C 2 675  ? 97.279  112.666 133.674 1.00 92.57  ? 675  ALA C CB    1 
ATOM   8830  N  N     . ILE C 2 676  ? 98.142  115.576 134.958 1.00 94.80  ? 676  ILE C N     1 
ATOM   8831  C  CA    . ILE C 2 676  ? 98.968  116.368 135.863 1.00 94.80  ? 676  ILE C CA    1 
ATOM   8832  C  C     . ILE C 2 676  ? 98.881  115.751 137.253 1.00 94.80  ? 676  ILE C C     1 
ATOM   8833  O  O     . ILE C 2 676  ? 97.864  115.888 137.941 1.00 94.80  ? 676  ILE C O     1 
ATOM   8834  C  CB    . ILE C 2 676  ? 98.536  117.839 135.876 1.00 94.80  ? 676  ILE C CB    1 
ATOM   8835  C  CG1   . ILE C 2 676  ? 98.758  118.463 134.500 1.00 94.80  ? 676  ILE C CG1   1 
ATOM   8836  C  CG2   . ILE C 2 676  ? 99.315  118.606 136.924 1.00 94.80  ? 676  ILE C CG2   1 
ATOM   8837  C  CD1   . ILE C 2 676  ? 98.256  119.879 134.389 1.00 94.80  ? 676  ILE C CD1   1 
ATOM   8838  N  N     . MET C 2 677  ? 99.957  115.083 137.676 1.00 99.36  ? 677  MET C N     1 
ATOM   8839  C  CA    . MET C 2 677  ? 100.024 114.437 138.982 1.00 99.36  ? 677  MET C CA    1 
ATOM   8840  C  C     . MET C 2 677  ? 101.447 113.982 139.280 1.00 99.36  ? 677  MET C C     1 
ATOM   8841  O  O     . MET C 2 677  ? 102.219 113.711 138.352 1.00 99.36  ? 677  MET C O     1 
ATOM   8842  C  CB    . MET C 2 677  ? 99.078  113.237 139.041 1.00 99.36  ? 677  MET C CB    1 
ATOM   8843  C  CG    . MET C 2 677  ? 99.457  112.117 138.089 1.00 99.36  ? 677  MET C CG    1 
ATOM   8844  S  SD    . MET C 2 677  ? 98.354  110.699 138.179 1.00 99.36  ? 677  MET C SD    1 
ATOM   8845  C  CE    . MET C 2 677  ? 98.648  110.155 139.858 1.00 99.36  ? 677  MET C CE    1 
ATOM   8846  N  N     . PRO C 2 678  ? 101.838 113.896 140.549 1.00 104.10 ? 678  PRO C N     1 
ATOM   8847  C  CA    . PRO C 2 678  ? 103.128 113.281 140.878 1.00 104.10 ? 678  PRO C CA    1 
ATOM   8848  C  C     . PRO C 2 678  ? 103.037 111.768 140.786 1.00 104.10 ? 678  PRO C C     1 
ATOM   8849  O  O     . PRO C 2 678  ? 102.027 111.162 141.148 1.00 104.10 ? 678  PRO C O     1 
ATOM   8850  C  CB    . PRO C 2 678  ? 103.386 113.736 142.321 1.00 104.10 ? 678  PRO C CB    1 
ATOM   8851  C  CG    . PRO C 2 678  ? 102.364 114.806 142.598 1.00 104.10 ? 678  PRO C CG    1 
ATOM   8852  C  CD    . PRO C 2 678  ? 101.196 114.482 141.733 1.00 104.10 ? 678  PRO C CD    1 
ATOM   8853  N  N     . PHE C 2 679  ? 104.111 111.152 140.295 1.00 105.29 ? 679  PHE C N     1 
ATOM   8854  C  CA    . PHE C 2 679  ? 104.104 109.717 140.022 1.00 105.29 ? 679  PHE C CA    1 
ATOM   8855  C  C     . PHE C 2 679  ? 105.364 109.077 140.589 1.00 105.29 ? 679  PHE C C     1 
ATOM   8856  O  O     . PHE C 2 679  ? 106.402 109.053 139.921 1.00 105.29 ? 679  PHE C O     1 
ATOM   8857  C  CB    . PHE C 2 679  ? 103.991 109.444 138.524 1.00 105.29 ? 679  PHE C CB    1 
ATOM   8858  C  CG    . PHE C 2 679  ? 103.557 108.050 138.199 1.00 105.29 ? 679  PHE C CG    1 
ATOM   8859  C  CD1   . PHE C 2 679  ? 102.246 107.657 138.397 1.00 105.29 ? 679  PHE C CD1   1 
ATOM   8860  C  CD2   . PHE C 2 679  ? 104.462 107.127 137.711 1.00 105.29 ? 679  PHE C CD2   1 
ATOM   8861  C  CE1   . PHE C 2 679  ? 101.844 106.372 138.103 1.00 105.29 ? 679  PHE C CE1   1 
ATOM   8862  C  CE2   . PHE C 2 679  ? 104.066 105.841 137.418 1.00 105.29 ? 679  PHE C CE2   1 
ATOM   8863  C  CZ    . PHE C 2 679  ? 102.755 105.462 137.613 1.00 105.29 ? 679  PHE C CZ    1 
ATOM   8864  N  N     . ASP C 2 680  ? 105.262 108.551 141.811 1.00 111.98 ? 680  ASP C N     1 
ATOM   8865  C  CA    . ASP C 2 680  ? 106.286 107.708 142.422 1.00 111.98 ? 680  ASP C CA    1 
ATOM   8866  C  C     . ASP C 2 680  ? 107.682 108.314 142.373 1.00 111.98 ? 680  ASP C C     1 
ATOM   8867  O  O     . ASP C 2 680  ? 108.674 107.586 142.276 1.00 111.98 ? 680  ASP C O     1 
ATOM   8868  C  CB    . ASP C 2 680  ? 106.301 106.335 141.749 1.00 111.98 ? 680  ASP C CB    1 
ATOM   8869  C  CG    . ASP C 2 680  ? 105.272 105.393 142.332 1.00 111.98 ? 680  ASP C CG    1 
ATOM   8870  O  OD1   . ASP C 2 680  ? 104.960 105.526 143.533 1.00 111.98 ? 680  ASP C OD1   1 
ATOM   8871  O  OD2   . ASP C 2 680  ? 104.775 104.519 141.592 1.00 111.98 ? 680  ASP C OD2   1 
ATOM   8872  N  N     . GLY C 2 681  ? 107.775 109.638 142.441 1.00 107.03 ? 681  GLY C N     1 
ATOM   8873  C  CA    . GLY C 2 681  ? 109.063 110.295 142.440 1.00 107.03 ? 681  GLY C CA    1 
ATOM   8874  C  C     . GLY C 2 681  ? 109.761 110.361 141.102 1.00 107.03 ? 681  GLY C C     1 
ATOM   8875  O  O     . GLY C 2 681  ? 110.848 110.944 141.023 1.00 107.03 ? 681  GLY C O     1 
ATOM   8876  N  N     . TYR C 2 682  ? 109.182 109.789 140.048 1.00 101.26 ? 682  TYR C N     1 
ATOM   8877  C  CA    . TYR C 2 682  ? 109.772 109.896 138.722 1.00 101.26 ? 682  TYR C CA    1 
ATOM   8878  C  C     . TYR C 2 682  ? 109.561 111.265 138.091 1.00 101.26 ? 682  TYR C C     1 
ATOM   8879  O  O     . TYR C 2 682  ? 110.156 111.541 137.047 1.00 101.26 ? 682  TYR C O     1 
ATOM   8880  C  CB    . TYR C 2 682  ? 109.203 108.818 137.799 1.00 101.26 ? 682  TYR C CB    1 
ATOM   8881  C  CG    . TYR C 2 682  ? 109.729 107.428 138.065 1.00 101.26 ? 682  TYR C CG    1 
ATOM   8882  C  CD1   . TYR C 2 682  ? 111.051 107.105 137.802 1.00 101.26 ? 682  TYR C CD1   1 
ATOM   8883  C  CD2   . TYR C 2 682  ? 108.901 106.435 138.567 1.00 101.26 ? 682  TYR C CD2   1 
ATOM   8884  C  CE1   . TYR C 2 682  ? 111.535 105.836 138.039 1.00 101.26 ? 682  TYR C CE1   1 
ATOM   8885  C  CE2   . TYR C 2 682  ? 109.376 105.163 138.807 1.00 101.26 ? 682  TYR C CE2   1 
ATOM   8886  C  CZ    . TYR C 2 682  ? 110.694 104.870 138.542 1.00 101.26 ? 682  TYR C CZ    1 
ATOM   8887  O  OH    . TYR C 2 682  ? 111.174 103.604 138.779 1.00 101.26 ? 682  TYR C OH    1 
ATOM   8888  N  N     . ASN C 2 683  ? 108.727 112.114 138.684 1.00 105.84 ? 683  ASN C N     1 
ATOM   8889  C  CA    . ASN C 2 683  ? 108.548 113.489 138.239 1.00 105.84 ? 683  ASN C CA    1 
ATOM   8890  C  C     . ASN C 2 683  ? 109.387 114.476 139.035 1.00 105.84 ? 683  ASN C C     1 
ATOM   8891  O  O     . ASN C 2 683  ? 109.224 115.687 138.858 1.00 105.84 ? 683  ASN C O     1 
ATOM   8892  C  CB    . ASN C 2 683  ? 107.077 113.896 138.339 1.00 105.84 ? 683  ASN C CB    1 
ATOM   8893  C  CG    . ASN C 2 683  ? 106.152 112.891 137.709 1.00 105.84 ? 683  ASN C CG    1 
ATOM   8894  O  OD1   . ASN C 2 683  ? 105.278 112.337 138.373 1.00 105.84 ? 683  ASN C OD1   1 
ATOM   8895  N  ND2   . ASN C 2 683  ? 106.330 112.652 136.419 1.00 105.84 ? 683  ASN C ND2   1 
ATOM   8896  N  N     . PHE C 2 684  ? 110.260 113.988 139.910 1.00 107.34 ? 684  PHE C N     1 
ATOM   8897  C  CA    . PHE C 2 684  ? 110.983 114.857 140.826 1.00 107.34 ? 684  PHE C CA    1 
ATOM   8898  C  C     . PHE C 2 684  ? 111.820 115.883 140.073 1.00 107.34 ? 684  PHE C C     1 
ATOM   8899  O  O     . PHE C 2 684  ? 112.714 115.533 139.299 1.00 107.34 ? 684  PHE C O     1 
ATOM   8900  C  CB    . PHE C 2 684  ? 111.873 114.016 141.739 1.00 107.34 ? 684  PHE C CB    1 
ATOM   8901  C  CG    . PHE C 2 684  ? 112.475 114.783 142.874 1.00 107.34 ? 684  PHE C CG    1 
ATOM   8902  C  CD1   . PHE C 2 684  ? 111.774 114.962 144.052 1.00 107.34 ? 684  PHE C CD1   1 
ATOM   8903  C  CD2   . PHE C 2 684  ? 113.745 115.317 142.768 1.00 107.34 ? 684  PHE C CD2   1 
ATOM   8904  C  CE1   . PHE C 2 684  ? 112.326 115.665 145.100 1.00 107.34 ? 684  PHE C CE1   1 
ATOM   8905  C  CE2   . PHE C 2 684  ? 114.303 116.020 143.814 1.00 107.34 ? 684  PHE C CE2   1 
ATOM   8906  C  CZ    . PHE C 2 684  ? 113.593 116.195 144.981 1.00 107.34 ? 684  PHE C CZ    1 
ATOM   8907  N  N     . GLU C 2 685  ? 111.515 117.159 140.307 1.00 115.06 ? 685  GLU C N     1 
ATOM   8908  C  CA    . GLU C 2 685  ? 112.300 118.280 139.791 1.00 115.06 ? 685  GLU C CA    1 
ATOM   8909  C  C     . GLU C 2 685  ? 112.390 118.260 138.266 1.00 115.06 ? 685  GLU C C     1 
ATOM   8910  O  O     . GLU C 2 685  ? 113.454 118.041 137.682 1.00 115.06 ? 685  GLU C O     1 
ATOM   8911  C  CB    . GLU C 2 685  ? 113.693 118.310 140.421 1.00 115.06 ? 685  GLU C CB    1 
ATOM   8912  C  CG    . GLU C 2 685  ? 113.709 118.824 141.852 1.00 115.06 ? 685  GLU C CG    1 
ATOM   8913  C  CD    . GLU C 2 685  ? 113.801 120.336 141.940 1.00 115.06 ? 685  GLU C CD    1 
ATOM   8914  O  OE1   . GLU C 2 685  ? 113.348 121.022 141.001 1.00 115.06 ? 685  GLU C OE1   1 
ATOM   8915  O  OE2   . GLU C 2 685  ? 114.325 120.840 142.955 1.00 115.06 ? 685  GLU C OE2   1 
ATOM   8916  N  N     . ASP C 2 686  ? 111.244 118.467 137.621 1.00 115.03 ? 686  ASP C N     1 
ATOM   8917  C  CA    . ASP C 2 686  ? 111.072 118.708 136.188 1.00 115.03 ? 686  ASP C CA    1 
ATOM   8918  C  C     . ASP C 2 686  ? 111.198 117.450 135.337 1.00 115.03 ? 686  ASP C C     1 
ATOM   8919  O  O     . ASP C 2 686  ? 111.105 117.557 134.110 1.00 115.03 ? 686  ASP C O     1 
ATOM   8920  C  CB    . ASP C 2 686  ? 112.050 119.758 135.634 1.00 115.03 ? 686  ASP C CB    1 
ATOM   8921  C  CG    . ASP C 2 686  ? 111.929 121.096 136.334 1.00 115.03 ? 686  ASP C CG    1 
ATOM   8922  O  OD1   . ASP C 2 686  ? 112.286 121.180 137.527 1.00 115.03 ? 686  ASP C OD1   1 
ATOM   8923  O  OD2   . ASP C 2 686  ? 111.481 122.066 135.688 1.00 115.03 ? 686  ASP C OD2   1 
ATOM   8924  N  N     . ALA C 2 687  ? 111.410 116.275 135.922 1.00 103.60 ? 687  ALA C N     1 
ATOM   8925  C  CA    . ALA C 2 687  ? 111.464 115.065 135.117 1.00 103.60 ? 687  ALA C CA    1 
ATOM   8926  C  C     . ALA C 2 687  ? 110.091 114.764 134.522 1.00 103.60 ? 687  ALA C C     1 
ATOM   8927  O  O     . ALA C 2 687  ? 109.072 115.334 134.920 1.00 103.60 ? 687  ALA C O     1 
ATOM   8928  C  CB    . ALA C 2 687  ? 111.955 113.887 135.954 1.00 103.60 ? 687  ALA C CB    1 
ATOM   8929  N  N     . ILE C 2 688  ? 110.069 113.854 133.552 1.00 94.08  ? 688  ILE C N     1 
ATOM   8930  C  CA    . ILE C 2 688  ? 108.869 113.565 132.777 1.00 94.08  ? 688  ILE C CA    1 
ATOM   8931  C  C     . ILE C 2 688  ? 108.782 112.067 132.529 1.00 94.08  ? 688  ILE C C     1 
ATOM   8932  O  O     . ILE C 2 688  ? 109.757 111.444 132.096 1.00 94.08  ? 688  ILE C O     1 
ATOM   8933  C  CB    . ILE C 2 688  ? 108.866 114.337 131.442 1.00 94.08  ? 688  ILE C CB    1 
ATOM   8934  C  CG1   . ILE C 2 688  ? 108.477 115.796 131.668 1.00 94.08  ? 688  ILE C CG1   1 
ATOM   8935  C  CG2   . ILE C 2 688  ? 107.928 113.688 130.445 1.00 94.08  ? 688  ILE C CG2   1 
ATOM   8936  C  CD1   . ILE C 2 688  ? 108.482 116.625 130.409 1.00 94.08  ? 688  ILE C CD1   1 
ATOM   8937  N  N     . VAL C 2 689  ? 107.612 111.491 132.795 1.00 91.99  ? 689  VAL C N     1 
ATOM   8938  C  CA    . VAL C 2 689  ? 107.339 110.083 132.536 1.00 91.99  ? 689  VAL C CA    1 
ATOM   8939  C  C     . VAL C 2 689  ? 106.496 109.985 131.275 1.00 91.99  ? 689  VAL C C     1 
ATOM   8940  O  O     . VAL C 2 689  ? 105.529 110.738 131.108 1.00 91.99  ? 689  VAL C O     1 
ATOM   8941  C  CB    . VAL C 2 689  ? 106.622 109.417 133.721 1.00 91.99  ? 689  VAL C CB    1 
ATOM   8942  C  CG1   . VAL C 2 689  ? 106.648 107.909 133.570 1.00 91.99  ? 689  VAL C CG1   1 
ATOM   8943  C  CG2   . VAL C 2 689  ? 107.264 109.834 135.020 1.00 91.99  ? 689  VAL C CG2   1 
ATOM   8944  N  N     . ILE C 2 690  ? 106.859 109.059 130.388 1.00 94.45  ? 690  ILE C N     1 
ATOM   8945  C  CA    . ILE C 2 690  ? 106.145 108.863 129.136 1.00 94.45  ? 690  ILE C CA    1 
ATOM   8946  C  C     . ILE C 2 690  ? 105.745 107.400 129.012 1.00 94.45  ? 690  ILE C C     1 
ATOM   8947  O  O     . ILE C 2 690  ? 106.309 106.517 129.660 1.00 94.45  ? 690  ILE C O     1 
ATOM   8948  C  CB    . ILE C 2 690  ? 106.978 109.292 127.912 1.00 94.45  ? 690  ILE C CB    1 
ATOM   8949  C  CG1   . ILE C 2 690  ? 108.169 108.354 127.727 1.00 94.45  ? 690  ILE C CG1   1 
ATOM   8950  C  CG2   . ILE C 2 690  ? 107.447 110.724 128.061 1.00 94.45  ? 690  ILE C CG2   1 
ATOM   8951  C  CD1   . ILE C 2 690  ? 108.884 108.536 126.414 1.00 94.45  ? 690  ILE C CD1   1 
ATOM   8952  N  N     . SER C 2 691  ? 104.753 107.155 128.163 1.00 106.63 ? 691  SER C N     1 
ATOM   8953  C  CA    . SER C 2 691  ? 104.271 105.809 127.902 1.00 106.63 ? 691  SER C CA    1 
ATOM   8954  C  C     . SER C 2 691  ? 105.038 105.186 126.746 1.00 106.63 ? 691  SER C C     1 
ATOM   8955  O  O     . SER C 2 691  ? 105.637 105.892 125.930 1.00 106.63 ? 691  SER C O     1 
ATOM   8956  C  CB    . SER C 2 691  ? 102.776 105.824 127.582 1.00 106.63 ? 691  SER C CB    1 
ATOM   8957  O  OG    . SER C 2 691  ? 102.405 104.668 126.853 1.00 106.63 ? 691  SER C OG    1 
ATOM   8958  N  N     . GLU C 2 692  ? 105.017 103.854 126.681 1.00 113.28 ? 692  GLU C N     1 
ATOM   8959  C  CA    . GLU C 2 692  ? 105.647 103.166 125.562 1.00 113.28 ? 692  GLU C CA    1 
ATOM   8960  C  C     . GLU C 2 692  ? 104.777 103.198 124.315 1.00 113.28 ? 692  GLU C C     1 
ATOM   8961  O  O     . GLU C 2 692  ? 105.261 102.880 123.223 1.00 113.28 ? 692  GLU C O     1 
ATOM   8962  C  CB    . GLU C 2 692  ? 105.966 101.722 125.948 1.00 113.28 ? 692  GLU C CB    1 
ATOM   8963  C  CG    . GLU C 2 692  ? 107.177 101.151 125.237 1.00 113.28 ? 692  GLU C CG    1 
ATOM   8964  C  CD    . GLU C 2 692  ? 107.627 99.831  125.827 1.00 113.28 ? 692  GLU C CD    1 
ATOM   8965  O  OE1   . GLU C 2 692  ? 106.906 99.288  126.689 1.00 113.28 ? 692  GLU C OE1   1 
ATOM   8966  O  OE2   . GLU C 2 692  ? 108.704 99.339  125.433 1.00 113.28 ? 692  GLU C OE2   1 
ATOM   8967  N  N     . GLU C 2 693  ? 103.500 103.564 124.457 1.00 114.17 ? 693  GLU C N     1 
ATOM   8968  C  CA    . GLU C 2 693  ? 102.638 103.725 123.293 1.00 114.17 ? 693  GLU C CA    1 
ATOM   8969  C  C     . GLU C 2 693  ? 103.188 104.764 122.327 1.00 114.17 ? 693  GLU C C     1 
ATOM   8970  O  O     . GLU C 2 693  ? 102.990 104.647 121.113 1.00 114.17 ? 693  GLU C O     1 
ATOM   8971  C  CB    . GLU C 2 693  ? 101.229 104.111 123.737 1.00 114.17 ? 693  GLU C CB    1 
ATOM   8972  C  CG    . GLU C 2 693  ? 100.384 102.937 124.183 1.00 114.17 ? 693  GLU C CG    1 
ATOM   8973  C  CD    . GLU C 2 693  ? 99.965  102.055 123.027 1.00 114.17 ? 693  GLU C CD    1 
ATOM   8974  O  OE1   . GLU C 2 693  ? 99.816  102.579 121.904 1.00 114.17 ? 693  GLU C OE1   1 
ATOM   8975  O  OE2   . GLU C 2 693  ? 99.783  100.838 123.240 1.00 114.17 ? 693  GLU C OE2   1 
ATOM   8976  N  N     . LEU C 2 694  ? 103.869 105.788 122.844 1.00 107.96 ? 694  LEU C N     1 
ATOM   8977  C  CA    . LEU C 2 694  ? 104.483 106.785 121.975 1.00 107.96 ? 694  LEU C CA    1 
ATOM   8978  C  C     . LEU C 2 694  ? 105.518 106.146 121.058 1.00 107.96 ? 694  LEU C C     1 
ATOM   8979  O  O     . LEU C 2 694  ? 105.591 106.464 119.866 1.00 107.96 ? 694  LEU C O     1 
ATOM   8980  C  CB    . LEU C 2 694  ? 105.116 107.891 122.816 1.00 107.96 ? 694  LEU C CB    1 
ATOM   8981  C  CG    . LEU C 2 694  ? 104.156 108.735 123.654 1.00 107.96 ? 694  LEU C CG    1 
ATOM   8982  C  CD1   . LEU C 2 694  ? 104.848 109.990 124.149 1.00 107.96 ? 694  LEU C CD1   1 
ATOM   8983  C  CD2   . LEU C 2 694  ? 102.919 109.089 122.850 1.00 107.96 ? 694  LEU C CD2   1 
ATOM   8984  N  N     . LEU C 2 695  ? 106.328 105.237 121.600 1.00 108.99 ? 695  LEU C N     1 
ATOM   8985  C  CA    . LEU C 2 695  ? 107.322 104.556 120.778 1.00 108.99 ? 695  LEU C CA    1 
ATOM   8986  C  C     . LEU C 2 695  ? 106.672 103.520 119.873 1.00 108.99 ? 695  LEU C C     1 
ATOM   8987  O  O     . LEU C 2 695  ? 107.171 103.249 118.774 1.00 108.99 ? 695  LEU C O     1 
ATOM   8988  C  CB    . LEU C 2 695  ? 108.378 103.901 121.665 1.00 108.99 ? 695  LEU C CB    1 
ATOM   8989  C  CG    . LEU C 2 695  ? 109.085 104.800 122.678 1.00 108.99 ? 695  LEU C CG    1 
ATOM   8990  C  CD1   . LEU C 2 695  ? 110.301 104.095 123.248 1.00 108.99 ? 695  LEU C CD1   1 
ATOM   8991  C  CD2   . LEU C 2 695  ? 109.483 106.114 122.035 1.00 108.99 ? 695  LEU C CD2   1 
ATOM   8992  N  N     . LYS C 2 696  ? 105.564 102.924 120.319 1.00 110.84 ? 696  LYS C N     1 
ATOM   8993  C  CA    . LYS C 2 696  ? 104.942 101.853 119.546 1.00 110.84 ? 696  LYS C CA    1 
ATOM   8994  C  C     . LYS C 2 696  ? 104.424 102.353 118.204 1.00 110.84 ? 696  LYS C C     1 
ATOM   8995  O  O     . LYS C 2 696  ? 104.559 101.665 117.185 1.00 110.84 ? 696  LYS C O     1 
ATOM   8996  C  CB    . LYS C 2 696  ? 103.812 101.212 120.351 1.00 110.84 ? 696  LYS C CB    1 
ATOM   8997  C  CG    . LYS C 2 696  ? 104.292 100.216 121.391 1.00 110.84 ? 696  LYS C CG    1 
ATOM   8998  C  CD    . LYS C 2 696  ? 103.128 99.492  122.039 1.00 110.84 ? 696  LYS C CD    1 
ATOM   8999  C  CE    . LYS C 2 696  ? 103.608 98.530  123.110 1.00 110.84 ? 696  LYS C CE    1 
ATOM   9000  N  NZ    . LYS C 2 696  ? 102.470 97.909  123.840 1.00 110.84 ? 696  LYS C NZ    1 
ATOM   9001  N  N     . ARG C 2 697  ? 103.834 103.545 118.175 1.00 110.72 ? 697  ARG C N     1 
ATOM   9002  C  CA    . ARG C 2 697  ? 103.296 104.097 116.940 1.00 110.72 ? 697  ARG C CA    1 
ATOM   9003  C  C     . ARG C 2 697  ? 104.184 105.179 116.336 1.00 110.72 ? 697  ARG C C     1 
ATOM   9004  O  O     . ARG C 2 697  ? 103.677 106.059 115.633 1.00 110.72 ? 697  ARG C O     1 
ATOM   9005  C  CB    . ARG C 2 697  ? 101.881 104.635 117.169 1.00 110.72 ? 697  ARG C CB    1 
ATOM   9006  C  CG    . ARG C 2 697  ? 101.766 105.749 118.189 1.00 110.72 ? 697  ARG C CG    1 
ATOM   9007  C  CD    . ARG C 2 697  ? 100.312 106.154 118.357 1.00 110.72 ? 697  ARG C CD    1 
ATOM   9008  N  NE    . ARG C 2 697  ? 100.150 107.303 119.241 1.00 110.72 ? 697  ARG C NE    1 
ATOM   9009  C  CZ    . ARG C 2 697  ? 99.644  107.233 120.467 1.00 110.72 ? 697  ARG C CZ    1 
ATOM   9010  N  NH1   . ARG C 2 697  ? 99.249  106.067 120.956 1.00 110.72 ? 697  ARG C NH1   1 
ATOM   9011  N  NH2   . ARG C 2 697  ? 99.532  108.329 121.204 1.00 110.72 ? 697  ARG C NH2   1 
ATOM   9012  N  N     . ASP C 2 698  ? 105.491 105.128 116.596 1.00 112.12 ? 698  ASP C N     1 
ATOM   9013  C  CA    . ASP C 2 698  ? 106.484 105.977 115.939 1.00 112.12 ? 698  ASP C CA    1 
ATOM   9014  C  C     . ASP C 2 698  ? 106.232 107.464 116.162 1.00 112.12 ? 698  ASP C C     1 
ATOM   9015  O  O     . ASP C 2 698  ? 106.373 108.266 115.237 1.00 112.12 ? 698  ASP C O     1 
ATOM   9016  C  CB    . ASP C 2 698  ? 106.567 105.678 114.440 1.00 112.12 ? 698  ASP C CB    1 
ATOM   9017  C  CG    . ASP C 2 698  ? 107.583 104.602 114.118 1.00 112.12 ? 698  ASP C CG    1 
ATOM   9018  O  OD1   . ASP C 2 698  ? 107.467 103.972 113.047 1.00 112.12 ? 698  ASP C OD1   1 
ATOM   9019  O  OD2   . ASP C 2 698  ? 108.500 104.385 114.939 1.00 112.12 ? 698  ASP C OD2   1 
ATOM   9020  N  N     . PHE C 2 699  ? 105.860 107.850 117.376 1.00 100.68 ? 699  PHE C N     1 
ATOM   9021  C  CA    . PHE C 2 699  ? 105.796 109.261 117.722 1.00 100.68 ? 699  PHE C CA    1 
ATOM   9022  C  C     . PHE C 2 699  ? 107.174 109.757 118.132 1.00 100.68 ? 699  PHE C C     1 
ATOM   9023  O  O     . PHE C 2 699  ? 107.993 108.996 118.655 1.00 100.68 ? 699  PHE C O     1 
ATOM   9024  C  CB    . PHE C 2 699  ? 104.797 109.497 118.852 1.00 100.68 ? 699  PHE C CB    1 
ATOM   9025  C  CG    . PHE C 2 699  ? 103.411 109.818 118.378 1.00 100.68 ? 699  PHE C CG    1 
ATOM   9026  C  CD1   . PHE C 2 699  ? 103.007 109.489 117.097 1.00 100.68 ? 699  PHE C CD1   1 
ATOM   9027  C  CD2   . PHE C 2 699  ? 102.513 110.460 119.213 1.00 100.68 ? 699  PHE C CD2   1 
ATOM   9028  C  CE1   . PHE C 2 699  ? 101.733 109.788 116.660 1.00 100.68 ? 699  PHE C CE1   1 
ATOM   9029  C  CE2   . PHE C 2 699  ? 101.240 110.761 118.782 1.00 100.68 ? 699  PHE C CE2   1 
ATOM   9030  C  CZ    . PHE C 2 699  ? 100.848 110.424 117.504 1.00 100.68 ? 699  PHE C CZ    1 
ATOM   9031  N  N     . TYR C 2 700  ? 107.428 111.041 117.882 1.00 96.11  ? 700  TYR C N     1 
ATOM   9032  C  CA    . TYR C 2 700  ? 108.680 111.694 118.264 1.00 96.11  ? 700  TYR C CA    1 
ATOM   9033  C  C     . TYR C 2 700  ? 109.891 111.041 117.608 1.00 96.11  ? 700  TYR C C     1 
ATOM   9034  O  O     . TYR C 2 700  ? 111.007 111.115 118.126 1.00 96.11  ? 700  TYR C O     1 
ATOM   9035  C  CB    . TYR C 2 700  ? 108.847 111.724 119.785 1.00 96.11  ? 700  TYR C CB    1 
ATOM   9036  C  CG    . TYR C 2 700  ? 107.880 112.656 120.466 1.00 96.11  ? 700  TYR C CG    1 
ATOM   9037  C  CD1   . TYR C 2 700  ? 106.903 112.170 121.318 1.00 96.11  ? 700  TYR C CD1   1 
ATOM   9038  C  CD2   . TYR C 2 700  ? 107.937 114.022 120.247 1.00 96.11  ? 700  TYR C CD2   1 
ATOM   9039  C  CE1   . TYR C 2 700  ? 106.014 113.019 121.938 1.00 96.11  ? 700  TYR C CE1   1 
ATOM   9040  C  CE2   . TYR C 2 700  ? 107.054 114.878 120.862 1.00 96.11  ? 700  TYR C CE2   1 
ATOM   9041  C  CZ    . TYR C 2 700  ? 106.094 114.372 121.706 1.00 96.11  ? 700  TYR C CZ    1 
ATOM   9042  O  OH    . TYR C 2 700  ? 105.210 115.223 122.322 1.00 96.11  ? 700  TYR C OH    1 
ATOM   9043  N  N     . THR C 2 701  ? 109.685 110.393 116.468 1.00 101.44 ? 701  THR C N     1 
ATOM   9044  C  CA    . THR C 2 701  ? 110.766 109.793 115.702 1.00 101.44 ? 701  THR C CA    1 
ATOM   9045  C  C     . THR C 2 701  ? 111.304 110.807 114.703 1.00 101.44 ? 701  THR C C     1 
ATOM   9046  O  O     . THR C 2 701  ? 110.554 111.342 113.881 1.00 101.44 ? 701  THR C O     1 
ATOM   9047  C  CB    . THR C 2 701  ? 110.288 108.540 114.967 1.00 101.44 ? 701  THR C CB    1 
ATOM   9048  O  OG1   . THR C 2 701  ? 109.779 107.594 115.914 1.00 101.44 ? 701  THR C OG1   1 
ATOM   9049  C  CG2   . THR C 2 701  ? 111.432 107.911 114.196 1.00 101.44 ? 701  THR C CG2   1 
ATOM   9050  N  N     . SER C 2 702  ? 112.607 111.065 114.775 1.00 100.01 ? 702  SER C N     1 
ATOM   9051  C  CA    . SER C 2 702  ? 113.236 112.076 113.941 1.00 100.01 ? 702  SER C CA    1 
ATOM   9052  C  C     . SER C 2 702  ? 114.396 111.462 113.176 1.00 100.01 ? 702  SER C C     1 
ATOM   9053  O  O     . SER C 2 702  ? 114.974 110.461 113.606 1.00 100.01 ? 702  SER C O     1 
ATOM   9054  C  CB    . SER C 2 702  ? 113.729 113.257 114.781 1.00 100.01 ? 702  SER C CB    1 
ATOM   9055  O  OG    . SER C 2 702  ? 115.031 113.015 115.278 1.00 100.01 ? 702  SER C OG    1 
ATOM   9056  N  N     . ILE C 2 703  ? 114.729 112.067 112.044 1.00 98.80  ? 703  ILE C N     1 
ATOM   9057  C  CA    . ILE C 2 703  ? 115.804 111.591 111.183 1.00 98.80  ? 703  ILE C CA    1 
ATOM   9058  C  C     . ILE C 2 703  ? 116.946 112.594 111.219 1.00 98.80  ? 703  ILE C C     1 
ATOM   9059  O  O     . ILE C 2 703  ? 116.734 113.804 111.086 1.00 98.80  ? 703  ILE C O     1 
ATOM   9060  C  CB    . ILE C 2 703  ? 115.296 111.379 109.745 1.00 98.80  ? 703  ILE C CB    1 
ATOM   9061  C  CG1   . ILE C 2 703  ? 114.280 110.239 109.705 1.00 98.80  ? 703  ILE C CG1   1 
ATOM   9062  C  CG2   . ILE C 2 703  ? 116.450 111.092 108.806 1.00 98.80  ? 703  ILE C CG2   1 
ATOM   9063  C  CD1   . ILE C 2 703  ? 113.698 109.999 108.335 1.00 98.80  ? 703  ILE C CD1   1 
ATOM   9064  N  N     . HIS C 2 704  ? 118.165 112.092 111.401 1.00 102.96 ? 704  HIS C N     1 
ATOM   9065  C  CA    . HIS C 2 704  ? 119.350 112.934 111.438 1.00 102.96 ? 704  HIS C CA    1 
ATOM   9066  C  C     . HIS C 2 704  ? 120.369 112.400 110.448 1.00 102.96 ? 704  HIS C C     1 
ATOM   9067  O  O     . HIS C 2 704  ? 120.402 111.199 110.170 1.00 102.96 ? 704  HIS C O     1 
ATOM   9068  C  CB    . HIS C 2 704  ? 119.957 112.988 112.841 1.00 102.96 ? 704  HIS C CB    1 
ATOM   9069  C  CG    . HIS C 2 704  ? 119.080 113.661 113.848 1.00 102.96 ? 704  HIS C CG    1 
ATOM   9070  N  ND1   . HIS C 2 704  ? 119.342 114.921 114.339 1.00 102.96 ? 704  HIS C ND1   1 
ATOM   9071  C  CD2   . HIS C 2 704  ? 117.941 113.250 114.452 1.00 102.96 ? 704  HIS C CD2   1 
ATOM   9072  C  CE1   . HIS C 2 704  ? 118.401 115.258 115.202 1.00 102.96 ? 704  HIS C CE1   1 
ATOM   9073  N  NE2   . HIS C 2 704  ? 117.540 114.261 115.290 1.00 102.96 ? 704  HIS C NE2   1 
ATOM   9074  N  N     . ILE C 2 705  ? 121.199 113.294 109.920 1.00 105.02 ? 705  ILE C N     1 
ATOM   9075  C  CA    . ILE C 2 705  ? 122.177 112.948 108.898 1.00 105.02 ? 705  ILE C CA    1 
ATOM   9076  C  C     . ILE C 2 705  ? 123.533 113.492 109.321 1.00 105.02 ? 705  ILE C C     1 
ATOM   9077  O  O     . ILE C 2 705  ? 123.678 114.696 109.558 1.00 105.02 ? 705  ILE C O     1 
ATOM   9078  C  CB    . ILE C 2 705  ? 121.775 113.498 107.517 1.00 105.02 ? 705  ILE C CB    1 
ATOM   9079  C  CG1   . ILE C 2 705  ? 120.745 112.577 106.865 1.00 105.02 ? 705  ILE C CG1   1 
ATOM   9080  C  CG2   . ILE C 2 705  ? 122.990 113.638 106.621 1.00 105.02 ? 705  ILE C CG2   1 
ATOM   9081  C  CD1   . ILE C 2 705  ? 120.332 113.013 105.484 1.00 105.02 ? 705  ILE C CD1   1 
ATOM   9082  N  N     . GLU C 2 706  ? 124.518 112.606 109.421 1.00 116.35 ? 706  GLU C N     1 
ATOM   9083  C  CA    . GLU C 2 706  ? 125.888 112.975 109.740 1.00 116.35 ? 706  GLU C CA    1 
ATOM   9084  C  C     . GLU C 2 706  ? 126.745 112.836 108.491 1.00 116.35 ? 706  GLU C C     1 
ATOM   9085  O  O     . GLU C 2 706  ? 126.512 111.951 107.663 1.00 116.35 ? 706  GLU C O     1 
ATOM   9086  C  CB    . GLU C 2 706  ? 126.446 112.100 110.865 1.00 116.35 ? 706  GLU C CB    1 
ATOM   9087  C  CG    . GLU C 2 706  ? 127.809 112.532 111.373 1.00 116.35 ? 706  GLU C CG    1 
ATOM   9088  C  CD    . GLU C 2 706  ? 127.753 113.835 112.145 1.00 116.35 ? 706  GLU C CD    1 
ATOM   9089  O  OE1   . GLU C 2 706  ? 126.744 114.071 112.841 1.00 116.35 ? 706  GLU C OE1   1 
ATOM   9090  O  OE2   . GLU C 2 706  ? 128.718 114.623 112.056 1.00 116.35 ? 706  GLU C OE2   1 
ATOM   9091  N  N     . ARG C 2 707  ? 127.735 113.712 108.357 1.00 119.50 ? 707  ARG C N     1 
ATOM   9092  C  CA    . ARG C 2 707  ? 128.564 113.778 107.163 1.00 119.50 ? 707  ARG C CA    1 
ATOM   9093  C  C     . ARG C 2 707  ? 130.034 113.708 107.552 1.00 119.50 ? 707  ARG C C     1 
ATOM   9094  O  O     . ARG C 2 707  ? 130.503 114.501 108.375 1.00 119.50 ? 707  ARG C O     1 
ATOM   9095  C  CB    . ARG C 2 707  ? 128.273 115.057 106.376 1.00 119.50 ? 707  ARG C CB    1 
ATOM   9096  C  CG    . ARG C 2 707  ? 129.471 115.669 105.680 1.00 119.50 ? 707  ARG C CG    1 
ATOM   9097  C  CD    . ARG C 2 707  ? 129.118 117.028 105.107 1.00 119.50 ? 707  ARG C CD    1 
ATOM   9098  N  NE    . ARG C 2 707  ? 130.291 117.747 104.622 1.00 119.50 ? 707  ARG C NE    1 
ATOM   9099  C  CZ    . ARG C 2 707  ? 130.307 119.047 104.351 1.00 119.50 ? 707  ARG C CZ    1 
ATOM   9100  N  NH1   . ARG C 2 707  ? 129.211 119.773 104.519 1.00 119.50 ? 707  ARG C NH1   1 
ATOM   9101  N  NH2   . ARG C 2 707  ? 131.418 119.621 103.913 1.00 119.50 ? 707  ARG C NH2   1 
ATOM   9102  N  N     . TYR C 2 708  ? 130.748 112.750 106.970 1.00 122.75 ? 708  TYR C N     1 
ATOM   9103  C  CA    . TYR C 2 708  ? 132.177 112.587 107.175 1.00 122.75 ? 708  TYR C CA    1 
ATOM   9104  C  C     . TYR C 2 708  ? 132.913 112.914 105.884 1.00 122.75 ? 708  TYR C C     1 
ATOM   9105  O  O     . TYR C 2 708  ? 132.368 112.770 104.786 1.00 122.75 ? 708  TYR C O     1 
ATOM   9106  C  CB    . TYR C 2 708  ? 132.517 111.164 107.624 1.00 122.75 ? 708  TYR C CB    1 
ATOM   9107  C  CG    . TYR C 2 708  ? 131.697 110.693 108.798 1.00 122.75 ? 708  TYR C CG    1 
ATOM   9108  C  CD1   . TYR C 2 708  ? 130.635 109.822 108.621 1.00 122.75 ? 708  TYR C CD1   1 
ATOM   9109  C  CD2   . TYR C 2 708  ? 131.984 111.122 110.085 1.00 122.75 ? 708  TYR C CD2   1 
ATOM   9110  C  CE1   . TYR C 2 708  ? 129.882 109.389 109.691 1.00 122.75 ? 708  TYR C CE1   1 
ATOM   9111  C  CE2   . TYR C 2 708  ? 131.236 110.695 111.162 1.00 122.75 ? 708  TYR C CE2   1 
ATOM   9112  C  CZ    . TYR C 2 708  ? 130.186 109.828 110.958 1.00 122.75 ? 708  TYR C CZ    1 
ATOM   9113  O  OH    . TYR C 2 708  ? 129.436 109.398 112.027 1.00 122.75 ? 708  TYR C OH    1 
ATOM   9114  N  N     . GLU C 2 709  ? 134.160 113.354 106.024 1.00 138.31 ? 709  GLU C N     1 
ATOM   9115  C  CA    . GLU C 2 709  ? 134.955 113.776 104.882 1.00 138.31 ? 709  GLU C CA    1 
ATOM   9116  C  C     . GLU C 2 709  ? 136.410 113.395 105.105 1.00 138.31 ? 709  GLU C C     1 
ATOM   9117  O  O     . GLU C 2 709  ? 136.958 113.581 106.194 1.00 138.31 ? 709  GLU C O     1 
ATOM   9118  C  CB    . GLU C 2 709  ? 134.829 115.287 104.647 1.00 138.31 ? 709  GLU C CB    1 
ATOM   9119  C  CG    . GLU C 2 709  ? 135.703 115.824 103.531 1.00 138.31 ? 709  GLU C CG    1 
ATOM   9120  C  CD    . GLU C 2 709  ? 135.588 117.327 103.377 1.00 138.31 ? 709  GLU C CD    1 
ATOM   9121  O  OE1   . GLU C 2 709  ? 135.978 118.054 104.314 1.00 138.31 ? 709  GLU C OE1   1 
ATOM   9122  O  OE2   . GLU C 2 709  ? 135.105 117.782 102.319 1.00 138.31 ? 709  GLU C OE2   1 
ATOM   9123  N  N     . ILE C 2 710  ? 137.029 112.860 104.058 1.00 147.34 ? 710  ILE C N     1 
ATOM   9124  C  CA    . ILE C 2 710  ? 138.437 112.482 104.095 1.00 147.34 ? 710  ILE C CA    1 
ATOM   9125  C  C     . ILE C 2 710  ? 139.105 113.023 102.841 1.00 147.34 ? 710  ILE C C     1 
ATOM   9126  O  O     . ILE C 2 710  ? 138.483 113.112 101.779 1.00 147.34 ? 710  ILE C O     1 
ATOM   9127  C  CB    . ILE C 2 710  ? 138.609 110.952 104.214 1.00 147.34 ? 710  ILE C CB    1 
ATOM   9128  C  CG1   . ILE C 2 710  ? 140.072 110.592 104.467 1.00 147.34 ? 710  ILE C CG1   1 
ATOM   9129  C  CG2   . ILE C 2 710  ? 138.090 110.251 102.970 1.00 147.34 ? 710  ILE C CG2   1 
ATOM   9130  C  CD1   . ILE C 2 710  ? 140.318 109.108 104.599 1.00 147.34 ? 710  ILE C CD1   1 
ATOM   9131  N  N     . GLU C 2 711  ? 140.372 113.403 102.970 1.00 158.77 ? 711  GLU C N     1 
ATOM   9132  C  CA    . GLU C 2 711  ? 141.140 113.954 101.865 1.00 158.77 ? 711  GLU C CA    1 
ATOM   9133  C  C     . GLU C 2 711  ? 142.337 113.066 101.561 1.00 158.77 ? 711  GLU C C     1 
ATOM   9134  O  O     . GLU C 2 711  ? 142.926 112.467 102.466 1.00 158.77 ? 711  GLU C O     1 
ATOM   9135  C  CB    . GLU C 2 711  ? 141.631 115.371 102.176 1.00 158.77 ? 711  GLU C CB    1 
ATOM   9136  C  CG    . GLU C 2 711  ? 140.536 116.416 102.276 1.00 158.77 ? 711  GLU C CG    1 
ATOM   9137  C  CD    . GLU C 2 711  ? 139.995 116.563 103.684 1.00 158.77 ? 711  GLU C CD    1 
ATOM   9138  O  OE1   . GLU C 2 711  ? 139.737 117.711 104.104 1.00 158.77 ? 711  GLU C OE1   1 
ATOM   9139  O  OE2   . GLU C 2 711  ? 139.834 115.536 104.376 1.00 158.77 ? 711  GLU C OE2   1 
ATOM   9140  N  N     . ALA C 2 712  ? 142.686 112.985 100.283 1.00 172.77 ? 712  ALA C N     1 
ATOM   9141  C  CA    . ALA C 2 712  ? 143.940 112.397 99.836  1.00 172.77 ? 712  ALA C CA    1 
ATOM   9142  C  C     . ALA C 2 712  ? 144.826 113.533 99.348  1.00 172.77 ? 712  ALA C C     1 
ATOM   9143  O  O     . ALA C 2 712  ? 144.410 114.319 98.493  1.00 172.77 ? 712  ALA C O     1 
ATOM   9144  C  CB    . ALA C 2 712  ? 143.709 111.369 98.730  1.00 172.77 ? 712  ALA C CB    1 
ATOM   9145  N  N     . ARG C 2 713  ? 146.030 113.634 99.901  1.00 184.43 ? 713  ARG C N     1 
ATOM   9146  C  CA    . ARG C 2 713  ? 146.930 114.725 99.565  1.00 184.43 ? 713  ARG C CA    1 
ATOM   9147  C  C     . ARG C 2 713  ? 148.308 114.178 99.226  1.00 184.43 ? 713  ARG C C     1 
ATOM   9148  O  O     . ARG C 2 713  ? 148.631 113.022 99.511  1.00 184.43 ? 713  ARG C O     1 
ATOM   9149  C  CB    . ARG C 2 713  ? 147.022 115.749 100.707 1.00 184.43 ? 713  ARG C CB    1 
ATOM   9150  C  CG    . ARG C 2 713  ? 147.282 115.148 102.075 1.00 184.43 ? 713  ARG C CG    1 
ATOM   9151  C  CD    . ARG C 2 713  ? 146.841 116.102 103.172 1.00 184.43 ? 713  ARG C CD    1 
ATOM   9152  N  NE    . ARG C 2 713  ? 147.357 115.718 104.482 1.00 184.43 ? 713  ARG C NE    1 
ATOM   9153  C  CZ    . ARG C 2 713  ? 148.502 116.158 104.992 1.00 184.43 ? 713  ARG C CZ    1 
ATOM   9154  N  NH1   . ARG C 2 713  ? 149.256 117.002 104.301 1.00 184.43 ? 713  ARG C NH1   1 
ATOM   9155  N  NH2   . ARG C 2 713  ? 148.894 115.756 106.193 1.00 184.43 ? 713  ARG C NH2   1 
ATOM   9156  N  N     . ASP C 2 714  ? 149.117 115.030 98.604  1.00 186.91 ? 714  ASP C N     1 
ATOM   9157  C  CA    . ASP C 2 714  ? 150.440 114.615 98.163  1.00 186.91 ? 714  ASP C CA    1 
ATOM   9158  C  C     . ASP C 2 714  ? 151.452 114.756 99.292  1.00 186.91 ? 714  ASP C C     1 
ATOM   9159  O  O     . ASP C 2 714  ? 151.620 115.834 99.869  1.00 186.91 ? 714  ASP C O     1 
ATOM   9160  C  CB    . ASP C 2 714  ? 150.881 115.441 96.956  1.00 186.91 ? 714  ASP C CB    1 
ATOM   9161  C  CG    . ASP C 2 714  ? 150.239 114.974 95.666  1.00 186.91 ? 714  ASP C CG    1 
ATOM   9162  O  OD1   . ASP C 2 714  ? 150.084 113.747 95.489  1.00 186.91 ? 714  ASP C OD1   1 
ATOM   9163  O  OD2   . ASP C 2 714  ? 149.890 115.832 94.829  1.00 186.91 ? 714  ASP C OD2   1 
ATOM   9164  N  N     . THR C 2 715  ? 152.126 113.655 99.603  1.00 187.51 ? 715  THR C N     1 
ATOM   9165  C  CA    . THR C 2 715  ? 153.171 113.625 100.611 1.00 187.51 ? 715  THR C CA    1 
ATOM   9166  C  C     . THR C 2 715  ? 154.512 113.399 99.925  1.00 187.51 ? 715  THR C C     1 
ATOM   9167  O  O     . THR C 2 715  ? 154.619 112.630 98.966  1.00 187.51 ? 715  THR C O     1 
ATOM   9168  C  CB    . THR C 2 715  ? 152.904 112.525 101.653 1.00 187.51 ? 715  THR C CB    1 
ATOM   9169  O  OG1   . THR C 2 715  ? 151.726 112.852 102.401 1.00 187.51 ? 715  THR C OG1   1 
ATOM   9170  C  CG2   . THR C 2 715  ? 154.075 112.382 102.615 1.00 187.51 ? 715  THR C CG2   1 
ATOM   9171  N  N     . LYS C 2 716  ? 155.538 114.102 100.418 1.00 188.17 ? 716  LYS C N     1 
ATOM   9172  C  CA    . LYS C 2 716  ? 156.877 113.992 99.848  1.00 188.17 ? 716  LYS C CA    1 
ATOM   9173  C  C     . LYS C 2 716  ? 157.367 112.551 99.784  1.00 188.17 ? 716  LYS C C     1 
ATOM   9174  O  O     . LYS C 2 716  ? 158.169 112.221 98.904  1.00 188.17 ? 716  LYS C O     1 
ATOM   9175  C  CB    . LYS C 2 716  ? 157.865 114.840 100.654 1.00 188.17 ? 716  LYS C CB    1 
ATOM   9176  C  CG    . LYS C 2 716  ? 157.659 116.353 100.551 1.00 188.17 ? 716  LYS C CG    1 
ATOM   9177  C  CD    . LYS C 2 716  ? 156.855 116.754 99.320  1.00 188.17 ? 716  LYS C CD    1 
ATOM   9178  C  CE    . LYS C 2 716  ? 156.677 118.261 99.241  1.00 188.17 ? 716  LYS C CE    1 
ATOM   9179  N  NZ    . LYS C 2 716  ? 155.825 118.657 98.086  1.00 188.17 ? 716  LYS C NZ    1 
ATOM   9180  N  N     . LEU C 2 717  ? 156.903 111.691 100.687 1.00 190.58 ? 717  LEU C N     1 
ATOM   9181  C  CA    . LEU C 2 717  ? 157.224 110.273 100.661 1.00 190.58 ? 717  LEU C CA    1 
ATOM   9182  C  C     . LEU C 2 717  ? 156.343 109.492 99.693  1.00 190.58 ? 717  LEU C C     1 
ATOM   9183  O  O     . LEU C 2 717  ? 156.413 108.260 99.662  1.00 190.58 ? 717  LEU C O     1 
ATOM   9184  C  CB    . LEU C 2 717  ? 157.104 109.690 102.073 1.00 190.58 ? 717  LEU C CB    1 
ATOM   9185  C  CG    . LEU C 2 717  ? 157.864 108.405 102.404 1.00 190.58 ? 717  LEU C CG    1 
ATOM   9186  C  CD1   . LEU C 2 717  ? 159.355 108.591 102.188 1.00 190.58 ? 717  LEU C CD1   1 
ATOM   9187  C  CD2   . LEU C 2 717  ? 157.580 107.989 103.833 1.00 190.58 ? 717  LEU C CD2   1 
ATOM   9188  N  N     . GLY C 2 718  ? 155.524 110.178 98.898  1.00 190.13 ? 718  GLY C N     1 
ATOM   9189  C  CA    . GLY C 2 718  ? 154.632 109.527 97.970  1.00 190.13 ? 718  GLY C CA    1 
ATOM   9190  C  C     . GLY C 2 718  ? 153.191 109.950 98.173  1.00 190.13 ? 718  GLY C C     1 
ATOM   9191  O  O     . GLY C 2 718  ? 152.781 110.333 99.272  1.00 190.13 ? 718  GLY C O     1 
ATOM   9192  N  N     . PRO C 2 719  ? 152.391 109.884 97.111  1.00 188.00 ? 719  PRO C N     1 
ATOM   9193  C  CA    . PRO C 2 719  ? 151.005 110.358 97.207  1.00 188.00 ? 719  PRO C CA    1 
ATOM   9194  C  C     . PRO C 2 719  ? 150.124 109.370 97.956  1.00 188.00 ? 719  PRO C C     1 
ATOM   9195  O  O     . PRO C 2 719  ? 150.324 108.155 97.892  1.00 188.00 ? 719  PRO C O     1 
ATOM   9196  C  CB    . PRO C 2 719  ? 150.569 110.489 95.741  1.00 188.00 ? 719  PRO C CB    1 
ATOM   9197  C  CG    . PRO C 2 719  ? 151.834 110.351 94.926  1.00 188.00 ? 719  PRO C CG    1 
ATOM   9198  C  CD    . PRO C 2 719  ? 152.736 109.487 95.739  1.00 188.00 ? 719  PRO C CD    1 
ATOM   9199  N  N     . GLU C 2 720  ? 149.140 109.909 98.671  1.00 183.37 ? 720  GLU C N     1 
ATOM   9200  C  CA    . GLU C 2 720  ? 148.162 109.069 99.347  1.00 183.37 ? 720  GLU C CA    1 
ATOM   9201  C  C     . GLU C 2 720  ? 147.198 108.470 98.332  1.00 183.37 ? 720  GLU C C     1 
ATOM   9202  O  O     . GLU C 2 720  ? 146.830 109.114 97.346  1.00 183.37 ? 720  GLU C O     1 
ATOM   9203  C  CB    . GLU C 2 720  ? 147.394 109.880 100.388 1.00 183.37 ? 720  GLU C CB    1 
ATOM   9204  C  CG    . GLU C 2 720  ? 148.267 110.471 101.480 1.00 183.37 ? 720  GLU C CG    1 
ATOM   9205  C  CD    . GLU C 2 720  ? 147.548 111.536 102.280 1.00 183.37 ? 720  GLU C CD    1 
ATOM   9206  O  OE1   . GLU C 2 720  ? 146.538 112.072 101.778 1.00 183.37 ? 720  GLU C OE1   1 
ATOM   9207  O  OE2   . GLU C 2 720  ? 147.991 111.840 103.407 1.00 183.37 ? 720  GLU C OE2   1 
ATOM   9208  N  N     . ARG C 2 721  ? 146.785 107.230 98.576  1.00 179.91 ? 721  ARG C N     1 
ATOM   9209  C  CA    . ARG C 2 721  ? 145.943 106.499 97.643  1.00 179.91 ? 721  ARG C CA    1 
ATOM   9210  C  C     . ARG C 2 721  ? 144.696 105.987 98.347  1.00 179.91 ? 721  ARG C C     1 
ATOM   9211  O  O     . ARG C 2 721  ? 144.745 105.602 99.519  1.00 179.91 ? 721  ARG C O     1 
ATOM   9212  C  CB    . ARG C 2 721  ? 146.698 105.322 97.020  1.00 179.91 ? 721  ARG C CB    1 
ATOM   9213  C  CG    . ARG C 2 721  ? 147.724 105.721 95.978  1.00 179.91 ? 721  ARG C CG    1 
ATOM   9214  C  CD    . ARG C 2 721  ? 148.024 104.563 95.043  1.00 179.91 ? 721  ARG C CD    1 
ATOM   9215  N  NE    . ARG C 2 721  ? 149.458 104.378 94.846  1.00 179.91 ? 721  ARG C NE    1 
ATOM   9216  C  CZ    . ARG C 2 721  ? 150.240 103.683 95.666  1.00 179.91 ? 721  ARG C CZ    1 
ATOM   9217  N  NH1   . ARG C 2 721  ? 149.727 103.104 96.743  1.00 179.91 ? 721  ARG C NH1   1 
ATOM   9218  N  NH2   . ARG C 2 721  ? 151.535 103.566 95.410  1.00 179.91 ? 721  ARG C NH2   1 
ATOM   9219  N  N     . ILE C 2 722  ? 143.583 105.983 97.621  1.00 169.86 ? 722  ILE C N     1 
ATOM   9220  C  CA    . ILE C 2 722  ? 142.340 105.385 98.091  1.00 169.86 ? 722  ILE C CA    1 
ATOM   9221  C  C     . ILE C 2 722  ? 142.170 104.065 97.349  1.00 169.86 ? 722  ILE C C     1 
ATOM   9222  O  O     . ILE C 2 722  ? 141.989 104.047 96.130  1.00 169.86 ? 722  ILE C O     1 
ATOM   9223  C  CB    . ILE C 2 722  ? 141.144 106.314 97.859  1.00 169.86 ? 722  ILE C CB    1 
ATOM   9224  C  CG1   . ILE C 2 722  ? 141.294 107.591 98.685  1.00 169.86 ? 722  ILE C CG1   1 
ATOM   9225  C  CG2   . ILE C 2 722  ? 139.848 105.602 98.204  1.00 169.86 ? 722  ILE C CG2   1 
ATOM   9226  C  CD1   . ILE C 2 722  ? 140.119 108.533 98.567  1.00 169.86 ? 722  ILE C CD1   1 
ATOM   9227  N  N     . THR C 2 723  ? 142.227 102.957 98.083  1.00 177.25 ? 723  THR C N     1 
ATOM   9228  C  CA    . THR C 2 723  ? 142.260 101.646 97.455  1.00 177.25 ? 723  THR C CA    1 
ATOM   9229  C  C     . THR C 2 723  ? 141.710 100.616 98.431  1.00 177.25 ? 723  THR C C     1 
ATOM   9230  O  O     . THR C 2 723  ? 141.871 100.734 99.648  1.00 177.25 ? 723  THR C O     1 
ATOM   9231  C  CB    . THR C 2 723  ? 143.691 101.288 97.015  1.00 177.25 ? 723  THR C CB    1 
ATOM   9232  O  OG1   . THR C 2 723  ? 144.116 102.197 95.992  1.00 177.25 ? 723  THR C OG1   1 
ATOM   9233  C  CG2   . THR C 2 723  ? 143.773 99.869  96.469  1.00 177.25 ? 723  THR C CG2   1 
ATOM   9234  N  N     . ARG C 2 724  ? 141.048 99.599  97.876  1.00 178.70 ? 724  ARG C N     1 
ATOM   9235  C  CA    . ARG C 2 724  ? 140.501 98.503  98.662  1.00 178.70 ? 724  ARG C CA    1 
ATOM   9236  C  C     . ARG C 2 724  ? 141.573 97.644  99.321  1.00 178.70 ? 724  ARG C C     1 
ATOM   9237  O  O     . ARG C 2 724  ? 141.244 96.837  100.196 1.00 178.70 ? 724  ARG C O     1 
ATOM   9238  C  CB    . ARG C 2 724  ? 139.620 97.621  97.772  1.00 178.70 ? 724  ARG C CB    1 
ATOM   9239  C  CG    . ARG C 2 724  ? 138.557 96.826  98.512  1.00 178.70 ? 724  ARG C CG    1 
ATOM   9240  C  CD    . ARG C 2 724  ? 137.958 95.756  97.613  1.00 178.70 ? 724  ARG C CD    1 
ATOM   9241  N  NE    . ARG C 2 724  ? 136.707 95.225  98.145  1.00 178.70 ? 724  ARG C NE    1 
ATOM   9242  C  CZ    . ARG C 2 724  ? 136.630 94.322  99.117  1.00 178.70 ? 724  ARG C CZ    1 
ATOM   9243  N  NH1   . ARG C 2 724  ? 137.736 93.841  99.668  1.00 178.70 ? 724  ARG C NH1   1 
ATOM   9244  N  NH2   . ARG C 2 724  ? 135.447 93.898  99.538  1.00 178.70 ? 724  ARG C NH2   1 
ATOM   9245  N  N     . ASP C 2 725  ? 142.839 97.800  98.940  1.00 191.17 ? 725  ASP C N     1 
ATOM   9246  C  CA    . ASP C 2 725  ? 143.916 96.964  99.466  1.00 191.17 ? 725  ASP C CA    1 
ATOM   9247  C  C     . ASP C 2 725  ? 144.507 97.668  100.682 1.00 191.17 ? 725  ASP C C     1 
ATOM   9248  O  O     . ASP C 2 725  ? 145.130 98.724  100.562 1.00 191.17 ? 725  ASP C O     1 
ATOM   9249  C  CB    . ASP C 2 725  ? 144.968 96.708  98.391  1.00 191.17 ? 725  ASP C CB    1 
ATOM   9250  C  CG    . ASP C 2 725  ? 146.012 95.683  98.814  1.00 191.17 ? 725  ASP C CG    1 
ATOM   9251  O  OD1   . ASP C 2 725  ? 146.513 94.956  97.929  1.00 191.17 ? 725  ASP C OD1   1 
ATOM   9252  O  OD2   . ASP C 2 725  ? 146.335 95.593  100.017 1.00 191.17 ? 725  ASP C OD2   1 
ATOM   9253  N  N     . ILE C 2 726  ? 144.314 97.077  101.856 1.00 195.09 ? 726  ILE C N     1 
ATOM   9254  C  CA    . ILE C 2 726  ? 144.816 97.610  103.115 1.00 195.09 ? 726  ILE C CA    1 
ATOM   9255  C  C     . ILE C 2 726  ? 145.555 96.484  103.831 1.00 195.09 ? 726  ILE C C     1 
ATOM   9256  O  O     . ILE C 2 726  ? 145.053 95.359  103.891 1.00 195.09 ? 726  ILE C O     1 
ATOM   9257  C  CB    . ILE C 2 726  ? 143.692 98.170  104.003 1.00 195.09 ? 726  ILE C CB    1 
ATOM   9258  C  CG1   . ILE C 2 726  ? 142.656 98.921  103.165 1.00 195.09 ? 726  ILE C CG1   1 
ATOM   9259  C  CG2   . ILE C 2 726  ? 144.264 99.101  105.056 1.00 195.09 ? 726  ILE C CG2   1 
ATOM   9260  C  CD1   . ILE C 2 726  ? 143.142 100.243 102.631 1.00 195.09 ? 726  ILE C CD1   1 
ATOM   9261  N  N     . PRO C 2 727  ? 146.740 96.730  104.386 1.00 204.13 ? 727  PRO C N     1 
ATOM   9262  C  CA    . PRO C 2 727  ? 147.503 95.642  105.015 1.00 204.13 ? 727  PRO C CA    1 
ATOM   9263  C  C     . PRO C 2 727  ? 146.847 95.128  106.290 1.00 204.13 ? 727  PRO C C     1 
ATOM   9264  O  O     . PRO C 2 727  ? 146.248 95.889  107.053 1.00 204.13 ? 727  PRO C O     1 
ATOM   9265  C  CB    . PRO C 2 727  ? 148.863 96.287  105.309 1.00 204.13 ? 727  PRO C CB    1 
ATOM   9266  C  CG    . PRO C 2 727  ? 148.924 97.500  104.432 1.00 204.13 ? 727  PRO C CG    1 
ATOM   9267  C  CD    . PRO C 2 727  ? 147.517 97.978  104.305 1.00 204.13 ? 727  PRO C CD    1 
ATOM   9268  N  N     . HIS C 2 728  ? 146.964 93.816  106.511 1.00 205.74 ? 728  HIS C N     1 
ATOM   9269  C  CA    . HIS C 2 728  ? 146.621 93.171  107.780 1.00 205.74 ? 728  HIS C CA    1 
ATOM   9270  C  C     . HIS C 2 728  ? 145.150 93.333  108.152 1.00 205.74 ? 728  HIS C C     1 
ATOM   9271  O  O     . HIS C 2 728  ? 144.819 93.493  109.329 1.00 205.74 ? 728  HIS C O     1 
ATOM   9272  C  CB    . HIS C 2 728  ? 147.508 93.684  108.919 1.00 205.74 ? 728  HIS C CB    1 
ATOM   9273  C  CG    . HIS C 2 728  ? 148.969 93.453  108.696 1.00 205.74 ? 728  HIS C CG    1 
ATOM   9274  N  ND1   . HIS C 2 728  ? 149.679 94.087  107.699 1.00 205.74 ? 728  HIS C ND1   1 
ATOM   9275  C  CD2   . HIS C 2 728  ? 149.855 92.657  109.340 1.00 205.74 ? 728  HIS C CD2   1 
ATOM   9276  C  CE1   . HIS C 2 728  ? 150.939 93.691  107.738 1.00 205.74 ? 728  HIS C CE1   1 
ATOM   9277  N  NE2   . HIS C 2 728  ? 151.072 92.824  108.725 1.00 205.74 ? 728  HIS C NE2   1 
ATOM   9278  N  N     . LEU C 2 729  ? 144.253 93.299  107.172 1.00 193.59 ? 729  LEU C N     1 
ATOM   9279  C  CA    . LEU C 2 729  ? 142.822 93.332  107.436 1.00 193.59 ? 729  LEU C CA    1 
ATOM   9280  C  C     . LEU C 2 729  ? 142.150 92.090  106.874 1.00 193.59 ? 729  LEU C C     1 
ATOM   9281  O  O     . LEU C 2 729  ? 142.336 91.742  105.704 1.00 193.59 ? 729  LEU C O     1 
ATOM   9282  C  CB    . LEU C 2 729  ? 142.158 94.579  106.852 1.00 193.59 ? 729  LEU C CB    1 
ATOM   9283  C  CG    . LEU C 2 729  ? 142.508 95.897  107.541 1.00 193.59 ? 729  LEU C CG    1 
ATOM   9284  C  CD1   . LEU C 2 729  ? 141.814 97.051  106.852 1.00 193.59 ? 729  LEU C CD1   1 
ATOM   9285  C  CD2   . LEU C 2 729  ? 142.133 95.854  109.009 1.00 193.59 ? 729  LEU C CD2   1 
ATOM   9286  N  N     . SER C 2 730  ? 141.371 91.429  107.723 1.00 186.61 ? 730  SER C N     1 
ATOM   9287  C  CA    . SER C 2 730  ? 140.557 90.311  107.288 1.00 186.61 ? 730  SER C CA    1 
ATOM   9288  C  C     . SER C 2 730  ? 139.501 90.777  106.289 1.00 186.61 ? 730  SER C C     1 
ATOM   9289  O  O     . SER C 2 730  ? 139.150 91.958  106.215 1.00 186.61 ? 730  SER C O     1 
ATOM   9290  C  CB    . SER C 2 730  ? 139.890 89.642  108.488 1.00 186.61 ? 730  SER C CB    1 
ATOM   9291  O  OG    . SER C 2 730  ? 139.051 88.582  108.070 1.00 186.61 ? 730  SER C OG    1 
ATOM   9292  N  N     . GLU C 2 731  ? 138.992 89.822  105.509 1.00 183.57 ? 731  GLU C N     1 
ATOM   9293  C  CA    . GLU C 2 731  ? 137.994 90.154  104.499 1.00 183.57 ? 731  GLU C CA    1 
ATOM   9294  C  C     . GLU C 2 731  ? 136.693 90.633  105.130 1.00 183.57 ? 731  GLU C C     1 
ATOM   9295  O  O     . GLU C 2 731  ? 135.981 91.448  104.531 1.00 183.57 ? 731  GLU C O     1 
ATOM   9296  C  CB    . GLU C 2 731  ? 137.738 88.947  103.596 1.00 183.57 ? 731  GLU C CB    1 
ATOM   9297  C  CG    . GLU C 2 731  ? 136.773 89.219  102.453 1.00 183.57 ? 731  GLU C CG    1 
ATOM   9298  C  CD    . GLU C 2 731  ? 137.050 90.537  101.755 1.00 183.57 ? 731  GLU C CD    1 
ATOM   9299  O  OE1   . GLU C 2 731  ? 138.209 90.765  101.347 1.00 183.57 ? 731  GLU C OE1   1 
ATOM   9300  O  OE2   . GLU C 2 731  ? 136.110 91.348  101.617 1.00 183.57 ? 731  GLU C OE2   1 
ATOM   9301  N  N     . ALA C 2 732  ? 136.367 90.142  106.329 1.00 179.97 ? 732  ALA C N     1 
ATOM   9302  C  CA    . ALA C 2 732  ? 135.149 90.578  107.003 1.00 179.97 ? 732  ALA C CA    1 
ATOM   9303  C  C     . ALA C 2 732  ? 135.141 92.086  107.217 1.00 179.97 ? 732  ALA C C     1 
ATOM   9304  O  O     . ALA C 2 732  ? 134.087 92.727  107.134 1.00 179.97 ? 732  ALA C O     1 
ATOM   9305  C  CB    . ALA C 2 732  ? 134.995 89.846  108.336 1.00 179.97 ? 732  ALA C CB    1 
ATOM   9306  N  N     . ALA C 2 733  ? 136.308 92.672  107.491 1.00 174.98 ? 733  ALA C N     1 
ATOM   9307  C  CA    . ALA C 2 733  ? 136.381 94.118  107.667 1.00 174.98 ? 733  ALA C CA    1 
ATOM   9308  C  C     . ALA C 2 733  ? 136.253 94.852  106.340 1.00 174.98 ? 733  ALA C C     1 
ATOM   9309  O  O     . ALA C 2 733  ? 135.914 96.040  106.321 1.00 174.98 ? 733  ALA C O     1 
ATOM   9310  C  CB    . ALA C 2 733  ? 137.687 94.499  108.361 1.00 174.98 ? 733  ALA C CB    1 
ATOM   9311  N  N     . LEU C 2 734  ? 136.522 94.172  105.228 1.00 175.47 ? 734  LEU C N     1 
ATOM   9312  C  CA    . LEU C 2 734  ? 136.412 94.759  103.901 1.00 175.47 ? 734  LEU C CA    1 
ATOM   9313  C  C     . LEU C 2 734  ? 135.213 94.236  103.124 1.00 175.47 ? 734  LEU C C     1 
ATOM   9314  O  O     . LEU C 2 734  ? 135.184 94.361  101.896 1.00 175.47 ? 734  LEU C O     1 
ATOM   9315  C  CB    . LEU C 2 734  ? 137.694 94.498  103.104 1.00 175.47 ? 734  LEU C CB    1 
ATOM   9316  C  CG    . LEU C 2 734  ? 138.986 95.071  103.688 1.00 175.47 ? 734  LEU C CG    1 
ATOM   9317  C  CD1   . LEU C 2 734  ? 140.077 95.096  102.635 1.00 175.47 ? 734  LEU C CD1   1 
ATOM   9318  C  CD2   . LEU C 2 734  ? 138.755 96.462  104.256 1.00 175.47 ? 734  LEU C CD2   1 
ATOM   9319  N  N     . ARG C 2 735  ? 134.230 93.652  103.810 1.00 169.58 ? 735  ARG C N     1 
ATOM   9320  C  CA    . ARG C 2 735  ? 133.094 93.044  103.125 1.00 169.58 ? 735  ARG C CA    1 
ATOM   9321  C  C     . ARG C 2 735  ? 132.226 94.092  102.438 1.00 169.58 ? 735  ARG C C     1 
ATOM   9322  O  O     . ARG C 2 735  ? 131.805 93.912  101.290 1.00 169.58 ? 735  ARG C O     1 
ATOM   9323  C  CB    . ARG C 2 735  ? 132.269 92.231  104.123 1.00 169.58 ? 735  ARG C CB    1 
ATOM   9324  C  CG    . ARG C 2 735  ? 131.084 91.506  103.515 1.00 169.58 ? 735  ARG C CG    1 
ATOM   9325  C  CD    . ARG C 2 735  ? 129.985 91.327  104.546 1.00 169.58 ? 735  ARG C CD    1 
ATOM   9326  N  NE    . ARG C 2 735  ? 130.531 91.117  105.883 1.00 169.58 ? 735  ARG C NE    1 
ATOM   9327  C  CZ    . ARG C 2 735  ? 129.815 91.174  107.000 1.00 169.58 ? 735  ARG C CZ    1 
ATOM   9328  N  NH1   . ARG C 2 735  ? 128.516 91.436  106.945 1.00 169.58 ? 735  ARG C NH1   1 
ATOM   9329  N  NH2   . ARG C 2 735  ? 130.398 90.971  108.174 1.00 169.58 ? 735  ARG C NH2   1 
ATOM   9330  N  N     . ASP C 2 736  ? 131.952 95.197  103.126 1.00 165.64 ? 736  ASP C N     1 
ATOM   9331  C  CA    . ASP C 2 736  ? 131.001 96.191  102.651 1.00 165.64 ? 736  ASP C CA    1 
ATOM   9332  C  C     . ASP C 2 736  ? 131.615 97.219  101.707 1.00 165.64 ? 736  ASP C C     1 
ATOM   9333  O  O     . ASP C 2 736  ? 130.884 98.054  101.165 1.00 165.64 ? 736  ASP C O     1 
ATOM   9334  C  CB    . ASP C 2 736  ? 130.345 96.897  103.842 1.00 165.64 ? 736  ASP C CB    1 
ATOM   9335  C  CG    . ASP C 2 736  ? 131.355 97.548  104.774 1.00 165.64 ? 736  ASP C CG    1 
ATOM   9336  O  OD1   . ASP C 2 736  ? 132.523 97.737  104.373 1.00 165.64 ? 736  ASP C OD1   1 
ATOM   9337  O  OD2   . ASP C 2 736  ? 130.976 97.875  105.918 1.00 165.64 ? 736  ASP C OD2   1 
ATOM   9338  N  N     . LEU C 2 737  ? 132.927 97.182  101.497 1.00 163.67 ? 737  LEU C N     1 
ATOM   9339  C  CA    . LEU C 2 737  ? 133.583 98.119  100.598 1.00 163.67 ? 737  LEU C CA    1 
ATOM   9340  C  C     . LEU C 2 737  ? 133.429 97.662  99.155  1.00 163.67 ? 737  LEU C C     1 
ATOM   9341  O  O     . LEU C 2 737  ? 133.359 96.463  98.874  1.00 163.67 ? 737  LEU C O     1 
ATOM   9342  C  CB    . LEU C 2 737  ? 135.067 98.251  100.944 1.00 163.67 ? 737  LEU C CB    1 
ATOM   9343  C  CG    . LEU C 2 737  ? 135.400 99.063  102.194 1.00 163.67 ? 737  LEU C CG    1 
ATOM   9344  C  CD1   . LEU C 2 737  ? 136.903 99.187  102.370 1.00 163.67 ? 737  LEU C CD1   1 
ATOM   9345  C  CD2   . LEU C 2 737  ? 134.753 100.430 102.120 1.00 163.67 ? 737  LEU C CD2   1 
ATOM   9346  N  N     . ASP C 2 738  ? 133.373 98.626  98.240  1.00 165.65 ? 738  ASP C N     1 
ATOM   9347  C  CA    . ASP C 2 738  ? 133.369 98.319  96.817  1.00 165.65 ? 738  ASP C CA    1 
ATOM   9348  C  C     . ASP C 2 738  ? 134.808 98.112  96.347  1.00 165.65 ? 738  ASP C C     1 
ATOM   9349  O  O     . ASP C 2 738  ? 135.739 98.000  97.148  1.00 165.65 ? 738  ASP C O     1 
ATOM   9350  C  CB    . ASP C 2 738  ? 132.644 99.411  96.030  1.00 165.65 ? 738  ASP C CB    1 
ATOM   9351  C  CG    . ASP C 2 738  ? 133.317 100.771 96.135  1.00 165.65 ? 738  ASP C CG    1 
ATOM   9352  O  OD1   . ASP C 2 738  ? 134.413 100.876 96.725  1.00 165.65 ? 738  ASP C OD1   1 
ATOM   9353  O  OD2   . ASP C 2 738  ? 132.740 101.751 95.618  1.00 165.65 ? 738  ASP C OD2   1 
ATOM   9354  N  N     . GLU C 2 739  ? 135.006 98.064  95.029  1.00 169.45 ? 739  GLU C N     1 
ATOM   9355  C  CA    . GLU C 2 739  ? 136.355 97.918  94.492  1.00 169.45 ? 739  GLU C CA    1 
ATOM   9356  C  C     . GLU C 2 739  ? 137.187 99.173  94.730  1.00 169.45 ? 739  GLU C C     1 
ATOM   9357  O  O     . GLU C 2 739  ? 138.415 99.098  94.859  1.00 169.45 ? 739  GLU C O     1 
ATOM   9358  C  CB    . GLU C 2 739  ? 136.296 97.581  92.999  1.00 169.45 ? 739  GLU C CB    1 
ATOM   9359  C  CG    . GLU C 2 739  ? 135.946 98.747  92.081  1.00 169.45 ? 739  GLU C CG    1 
ATOM   9360  C  CD    . GLU C 2 739  ? 134.560 99.307  92.337  1.00 169.45 ? 739  GLU C CD    1 
ATOM   9361  O  OE1   . GLU C 2 739  ? 134.361 100.523 92.136  1.00 169.45 ? 739  GLU C OE1   1 
ATOM   9362  O  OE2   . GLU C 2 739  ? 133.668 98.531  92.738  1.00 169.45 ? 739  GLU C OE2   1 
ATOM   9363  N  N     . GLU C 2 740  ? 136.540 100.337 94.793  1.00 165.93 ? 740  GLU C N     1 
ATOM   9364  C  CA    . GLU C 2 740  ? 137.249 101.598 94.961  1.00 165.93 ? 740  GLU C CA    1 
ATOM   9365  C  C     . GLU C 2 740  ? 137.397 102.024 96.416  1.00 165.93 ? 740  GLU C C     1 
ATOM   9366  O  O     . GLU C 2 740  ? 137.653 103.205 96.673  1.00 165.93 ? 740  GLU C O     1 
ATOM   9367  C  CB    . GLU C 2 740  ? 136.542 102.709 94.179  1.00 165.93 ? 740  GLU C CB    1 
ATOM   9368  C  CG    . GLU C 2 740  ? 136.757 102.632 92.681  1.00 165.93 ? 740  GLU C CG    1 
ATOM   9369  C  CD    . GLU C 2 740  ? 136.350 103.906 91.971  1.00 165.93 ? 740  GLU C CD    1 
ATOM   9370  O  OE1   . GLU C 2 740  ? 135.851 104.830 92.647  1.00 165.93 ? 740  GLU C OE1   1 
ATOM   9371  O  OE2   . GLU C 2 740  ? 136.532 103.985 90.738  1.00 165.93 ? 740  GLU C OE2   1 
ATOM   9372  N  N     . GLY C 2 741  ? 137.239 101.107 97.368  1.00 163.86 ? 741  GLY C N     1 
ATOM   9373  C  CA    . GLY C 2 741  ? 137.474 101.404 98.765  1.00 163.86 ? 741  GLY C CA    1 
ATOM   9374  C  C     . GLY C 2 741  ? 136.423 102.254 99.444  1.00 163.86 ? 741  GLY C C     1 
ATOM   9375  O  O     . GLY C 2 741  ? 136.587 102.580 100.625 1.00 163.86 ? 741  GLY C O     1 
ATOM   9376  N  N     . VAL C 2 742  ? 135.370 102.641 98.742  1.00 152.80 ? 742  VAL C N     1 
ATOM   9377  C  CA    . VAL C 2 742  ? 134.285 103.421 99.324  1.00 152.80 ? 742  VAL C CA    1 
ATOM   9378  C  C     . VAL C 2 742  ? 133.143 102.477 99.672  1.00 152.80 ? 742  VAL C C     1 
ATOM   9379  O  O     . VAL C 2 742  ? 132.899 101.493 98.967  1.00 152.80 ? 742  VAL C O     1 
ATOM   9380  C  CB    . VAL C 2 742  ? 133.832 104.526 98.351  1.00 152.80 ? 742  VAL C CB    1 
ATOM   9381  C  CG1   . VAL C 2 742  ? 132.670 105.318 98.926  1.00 152.80 ? 742  VAL C CG1   1 
ATOM   9382  C  CG2   . VAL C 2 742  ? 134.997 105.444 98.020  1.00 152.80 ? 742  VAL C CG2   1 
ATOM   9383  N  N     . VAL C 2 743  ? 132.447 102.758 100.777 1.00 140.44 ? 743  VAL C N     1 
ATOM   9384  C  CA    . VAL C 2 743  ? 131.315 101.924 101.158 1.00 140.44 ? 743  VAL C CA    1 
ATOM   9385  C  C     . VAL C 2 743  ? 130.215 102.033 100.115 1.00 140.44 ? 743  VAL C C     1 
ATOM   9386  O  O     . VAL C 2 743  ? 129.985 103.098 99.527  1.00 140.44 ? 743  VAL C O     1 
ATOM   9387  C  CB    . VAL C 2 743  ? 130.794 102.310 102.551 1.00 140.44 ? 743  VAL C CB    1 
ATOM   9388  C  CG1   . VAL C 2 743  ? 131.823 101.979 103.607 1.00 140.44 ? 743  VAL C CG1   1 
ATOM   9389  C  CG2   . VAL C 2 743  ? 130.450 103.788 102.596 1.00 140.44 ? 743  VAL C CG2   1 
ATOM   9390  N  N     . ARG C 2 744  ? 129.538 100.917 99.869  1.00 130.39 ? 744  ARG C N     1 
ATOM   9391  C  CA    . ARG C 2 744  ? 128.407 100.904 98.956  1.00 130.39 ? 744  ARG C CA    1 
ATOM   9392  C  C     . ARG C 2 744  ? 127.206 101.575 99.606  1.00 130.39 ? 744  ARG C C     1 
ATOM   9393  O  O     . ARG C 2 744  ? 127.002 101.475 100.819 1.00 130.39 ? 744  ARG C O     1 
ATOM   9394  C  CB    . ARG C 2 744  ? 128.060 99.470  98.558  1.00 130.39 ? 744  ARG C CB    1 
ATOM   9395  C  CG    . ARG C 2 744  ? 127.907 98.528  99.737  1.00 130.39 ? 744  ARG C CG    1 
ATOM   9396  C  CD    . ARG C 2 744  ? 127.109 97.293  99.364  1.00 130.39 ? 744  ARG C CD    1 
ATOM   9397  N  NE    . ARG C 2 744  ? 126.767 96.493  100.536 1.00 130.39 ? 744  ARG C NE    1 
ATOM   9398  C  CZ    . ARG C 2 744  ? 125.606 96.569  101.177 1.00 130.39 ? 744  ARG C CZ    1 
ATOM   9399  N  NH1   . ARG C 2 744  ? 124.670 97.411  100.761 1.00 130.39 ? 744  ARG C NH1   1 
ATOM   9400  N  NH2   . ARG C 2 744  ? 125.379 95.804  102.236 1.00 130.39 ? 744  ARG C NH2   1 
ATOM   9401  N  N     . ILE C 2 745  ? 126.413 102.271 98.789  1.00 122.82 ? 745  ILE C N     1 
ATOM   9402  C  CA    . ILE C 2 745  ? 125.243 102.967 99.307  1.00 122.82 ? 745  ILE C CA    1 
ATOM   9403  C  C     . ILE C 2 745  ? 124.248 101.955 99.850  1.00 122.82 ? 745  ILE C C     1 
ATOM   9404  O  O     . ILE C 2 745  ? 123.883 100.988 99.169  1.00 122.82 ? 745  ILE C O     1 
ATOM   9405  C  CB    . ILE C 2 745  ? 124.617 103.841 98.211  1.00 122.82 ? 745  ILE C CB    1 
ATOM   9406  C  CG1   . ILE C 2 745  ? 125.563 104.984 97.843  1.00 122.82 ? 745  ILE C CG1   1 
ATOM   9407  C  CG2   . ILE C 2 745  ? 123.275 104.385 98.664  1.00 122.82 ? 745  ILE C CG2   1 
ATOM   9408  C  CD1   . ILE C 2 745  ? 124.969 105.983 96.880  1.00 122.82 ? 745  ILE C CD1   1 
ATOM   9409  N  N     . GLY C 2 746  ? 123.805 102.172 101.086 1.00 122.39 ? 746  GLY C N     1 
ATOM   9410  C  CA    . GLY C 2 746  ? 122.843 101.305 101.727 1.00 122.39 ? 746  GLY C CA    1 
ATOM   9411  C  C     . GLY C 2 746  ? 123.414 100.383 102.782 1.00 122.39 ? 746  GLY C C     1 
ATOM   9412  O  O     . GLY C 2 746  ? 122.642 99.818  103.567 1.00 122.39 ? 746  GLY C O     1 
ATOM   9413  N  N     . ALA C 2 747  ? 124.731 100.211 102.827 1.00 125.54 ? 747  ALA C N     1 
ATOM   9414  C  CA    . ALA C 2 747  ? 125.332 99.338  103.824 1.00 125.54 ? 747  ALA C CA    1 
ATOM   9415  C  C     . ALA C 2 747  ? 125.294 99.993  105.197 1.00 125.54 ? 747  ALA C C     1 
ATOM   9416  O  O     . ALA C 2 747  ? 125.543 101.192 105.340 1.00 125.54 ? 747  ALA C O     1 
ATOM   9417  C  CB    . ALA C 2 747  ? 126.773 99.006  103.442 1.00 125.54 ? 747  ALA C CB    1 
ATOM   9418  N  N     . GLU C 2 748  ? 124.976 99.197  106.213 1.00 124.96 ? 748  GLU C N     1 
ATOM   9419  C  CA    . GLU C 2 748  ? 124.917 99.680  107.585 1.00 124.96 ? 748  GLU C CA    1 
ATOM   9420  C  C     . GLU C 2 748  ? 126.323 99.704  108.169 1.00 124.96 ? 748  GLU C C     1 
ATOM   9421  O  O     . GLU C 2 748  ? 127.070 98.728  108.044 1.00 124.96 ? 748  GLU C O     1 
ATOM   9422  C  CB    . GLU C 2 748  ? 123.999 98.802  108.431 1.00 124.96 ? 748  GLU C CB    1 
ATOM   9423  C  CG    . GLU C 2 748  ? 124.047 99.114  109.915 1.00 124.96 ? 748  GLU C CG    1 
ATOM   9424  C  CD    . GLU C 2 748  ? 123.031 98.322  110.708 1.00 124.96 ? 748  GLU C CD    1 
ATOM   9425  O  OE1   . GLU C 2 748  ? 122.588 97.262  110.218 1.00 124.96 ? 748  GLU C OE1   1 
ATOM   9426  O  OE2   . GLU C 2 748  ? 122.672 98.759  111.822 1.00 124.96 ? 748  GLU C OE2   1 
ATOM   9427  N  N     . VAL C 2 749  ? 126.681 100.816 108.803 1.00 123.01 ? 749  VAL C N     1 
ATOM   9428  C  CA    . VAL C 2 749  ? 127.988 100.985 109.423 1.00 123.01 ? 749  VAL C CA    1 
ATOM   9429  C  C     . VAL C 2 749  ? 127.804 101.186 110.920 1.00 123.01 ? 749  VAL C C     1 
ATOM   9430  O  O     . VAL C 2 749  ? 126.851 101.841 111.361 1.00 123.01 ? 749  VAL C O     1 
ATOM   9431  C  CB    . VAL C 2 749  ? 128.766 102.158 108.794 1.00 123.01 ? 749  VAL C CB    1 
ATOM   9432  C  CG1   . VAL C 2 749  ? 129.012 101.888 107.322 1.00 123.01 ? 749  VAL C CG1   1 
ATOM   9433  C  CG2   . VAL C 2 749  ? 128.013 103.461 108.974 1.00 123.01 ? 749  VAL C CG2   1 
ATOM   9434  N  N     . LYS C 2 750  ? 128.718 100.616 111.692 1.00 127.51 ? 750  LYS C N     1 
ATOM   9435  C  CA    . LYS C 2 750  ? 128.726 100.639 113.145 1.00 127.51 ? 750  LYS C CA    1 
ATOM   9436  C  C     . LYS C 2 750  ? 130.057 101.199 113.619 1.00 127.51 ? 750  LYS C C     1 
ATOM   9437  O  O     . LYS C 2 750  ? 130.996 101.328 112.826 1.00 127.51 ? 750  LYS C O     1 
ATOM   9438  C  CB    . LYS C 2 750  ? 128.508 99.226  113.708 1.00 127.51 ? 750  LYS C CB    1 
ATOM   9439  C  CG    . LYS C 2 750  ? 127.058 98.779  113.696 1.00 127.51 ? 750  LYS C CG    1 
ATOM   9440  C  CD    . LYS C 2 750  ? 126.799 97.716  114.747 1.00 127.51 ? 750  LYS C CD    1 
ATOM   9441  C  CE    . LYS C 2 750  ? 125.311 97.461  114.915 1.00 127.51 ? 750  LYS C CE    1 
ATOM   9442  N  NZ    . LYS C 2 750  ? 125.024 96.619  116.108 1.00 127.51 ? 750  LYS C NZ    1 
ATOM   9443  N  N     . PRO C 2 751  ? 130.164 101.572 114.895 1.00 129.54 ? 751  PRO C N     1 
ATOM   9444  C  CA    . PRO C 2 751  ? 131.438 102.093 115.406 1.00 129.54 ? 751  PRO C CA    1 
ATOM   9445  C  C     . PRO C 2 751  ? 132.598 101.149 115.126 1.00 129.54 ? 751  PRO C C     1 
ATOM   9446  O  O     . PRO C 2 751  ? 132.559 99.965  115.466 1.00 129.54 ? 751  PRO C O     1 
ATOM   9447  C  CB    . PRO C 2 751  ? 131.179 102.234 116.908 1.00 129.54 ? 751  PRO C CB    1 
ATOM   9448  C  CG    . PRO C 2 751  ? 129.728 102.481 117.007 1.00 129.54 ? 751  PRO C CG    1 
ATOM   9449  C  CD    . PRO C 2 751  ? 129.085 101.703 115.892 1.00 129.54 ? 751  PRO C CD    1 
ATOM   9450  N  N     . GLY C 2 752  ? 133.643 101.688 114.501 1.00 133.71 ? 752  GLY C N     1 
ATOM   9451  C  CA    . GLY C 2 752  ? 134.829 100.937 114.168 1.00 133.71 ? 752  GLY C CA    1 
ATOM   9452  C  C     . GLY C 2 752  ? 134.941 100.537 112.712 1.00 133.71 ? 752  GLY C C     1 
ATOM   9453  O  O     . GLY C 2 752  ? 136.059 100.329 112.228 1.00 133.71 ? 752  GLY C O     1 
ATOM   9454  N  N     . ASP C 2 753  ? 133.820 100.422 112.005 1.00 136.66 ? 753  ASP C N     1 
ATOM   9455  C  CA    . ASP C 2 753  ? 133.851 99.993  110.614 1.00 136.66 ? 753  ASP C CA    1 
ATOM   9456  C  C     . ASP C 2 753  ? 134.548 101.029 109.738 1.00 136.66 ? 753  ASP C C     1 
ATOM   9457  O  O     . ASP C 2 753  ? 134.745 102.181 110.132 1.00 136.66 ? 753  ASP C O     1 
ATOM   9458  C  CB    . ASP C 2 753  ? 132.434 99.741  110.104 1.00 136.66 ? 753  ASP C CB    1 
ATOM   9459  C  CG    . ASP C 2 753  ? 131.632 98.855  111.035 1.00 136.66 ? 753  ASP C CG    1 
ATOM   9460  O  OD1   . ASP C 2 753  ? 132.248 98.151  111.862 1.00 136.66 ? 753  ASP C OD1   1 
ATOM   9461  O  OD2   . ASP C 2 753  ? 130.387 98.860  110.940 1.00 136.66 ? 753  ASP C OD2   1 
ATOM   9462  N  N     . ILE C 2 754  ? 134.914 100.606 108.533 1.00 140.93 ? 754  ILE C N     1 
ATOM   9463  C  CA    . ILE C 2 754  ? 135.691 101.443 107.626 1.00 140.93 ? 754  ILE C CA    1 
ATOM   9464  C  C     . ILE C 2 754  ? 134.760 102.083 106.607 1.00 140.93 ? 754  ILE C C     1 
ATOM   9465  O  O     . ILE C 2 754  ? 133.961 101.396 105.960 1.00 140.93 ? 754  ILE C O     1 
ATOM   9466  C  CB    . ILE C 2 754  ? 136.787 100.618 106.935 1.00 140.93 ? 754  ILE C CB    1 
ATOM   9467  C  CG1   . ILE C 2 754  ? 137.925 100.325 107.911 1.00 140.93 ? 754  ILE C CG1   1 
ATOM   9468  C  CG2   . ILE C 2 754  ? 137.308 101.341 105.704 1.00 140.93 ? 754  ILE C CG2   1 
ATOM   9469  C  CD1   . ILE C 2 754  ? 138.912 99.303  107.403 1.00 140.93 ? 754  ILE C CD1   1 
ATOM   9470  N  N     . LEU C 2 755  ? 134.861 103.403 106.459 1.00 141.92 ? 755  LEU C N     1 
ATOM   9471  C  CA    . LEU C 2 755  ? 134.067 104.129 105.473 1.00 141.92 ? 755  LEU C CA    1 
ATOM   9472  C  C     . LEU C 2 755  ? 134.822 104.295 104.157 1.00 141.92 ? 755  LEU C C     1 
ATOM   9473  O  O     . LEU C 2 755  ? 134.268 104.049 103.081 1.00 141.92 ? 755  LEU C O     1 
ATOM   9474  C  CB    . LEU C 2 755  ? 133.653 105.495 106.030 1.00 141.92 ? 755  LEU C CB    1 
ATOM   9475  C  CG    . LEU C 2 755  ? 132.704 105.480 107.227 1.00 141.92 ? 755  LEU C CG    1 
ATOM   9476  C  CD1   . LEU C 2 755  ? 132.094 106.851 107.432 1.00 141.92 ? 755  LEU C CD1   1 
ATOM   9477  C  CD2   . LEU C 2 755  ? 131.619 104.440 107.027 1.00 141.92 ? 755  LEU C CD2   1 
ATOM   9478  N  N     . VAL C 2 756  ? 136.082 104.715 104.228 1.00 149.42 ? 756  VAL C N     1 
ATOM   9479  C  CA    . VAL C 2 756  ? 136.911 104.931 103.049 1.00 149.42 ? 756  VAL C CA    1 
ATOM   9480  C  C     . VAL C 2 756  ? 138.305 104.403 103.352 1.00 149.42 ? 756  VAL C C     1 
ATOM   9481  O  O     . VAL C 2 756  ? 138.942 104.845 104.315 1.00 149.42 ? 756  VAL C O     1 
ATOM   9482  C  CB    . VAL C 2 756  ? 136.971 106.415 102.650 1.00 149.42 ? 756  VAL C CB    1 
ATOM   9483  C  CG1   . VAL C 2 756  ? 138.171 106.676 101.756 1.00 149.42 ? 756  VAL C CG1   1 
ATOM   9484  C  CG2   . VAL C 2 756  ? 135.687 106.828 101.953 1.00 149.42 ? 756  VAL C CG2   1 
ATOM   9485  N  N     . GLY C 2 757  ? 138.775 103.464 102.537 1.00 162.58 ? 757  GLY C N     1 
ATOM   9486  C  CA    . GLY C 2 757  ? 140.111 102.931 102.729 1.00 162.58 ? 757  GLY C CA    1 
ATOM   9487  C  C     . GLY C 2 757  ? 141.160 103.834 102.105 1.00 162.58 ? 757  GLY C C     1 
ATOM   9488  O  O     . GLY C 2 757  ? 141.022 104.294 100.970 1.00 162.58 ? 757  GLY C O     1 
ATOM   9489  N  N     . ARG C 2 758  ? 142.225 104.088 102.861 1.00 170.38 ? 758  ARG C N     1 
ATOM   9490  C  CA    . ARG C 2 758  ? 143.285 104.975 102.407 1.00 170.38 ? 758  ARG C CA    1 
ATOM   9491  C  C     . ARG C 2 758  ? 144.617 104.489 102.957 1.00 170.38 ? 758  ARG C C     1 
ATOM   9492  O  O     . ARG C 2 758  ? 144.737 104.201 104.151 1.00 170.38 ? 758  ARG C O     1 
ATOM   9493  C  CB    . ARG C 2 758  ? 143.025 106.420 102.842 1.00 170.38 ? 758  ARG C CB    1 
ATOM   9494  C  CG    . ARG C 2 758  ? 144.011 107.424 102.278 1.00 170.38 ? 758  ARG C CG    1 
ATOM   9495  C  CD    . ARG C 2 758  ? 143.784 108.801 102.871 1.00 170.38 ? 758  ARG C CD    1 
ATOM   9496  N  NE    . ARG C 2 758  ? 143.774 108.768 104.330 1.00 170.38 ? 758  ARG C NE    1 
ATOM   9497  C  CZ    . ARG C 2 758  ? 143.781 109.850 105.099 1.00 170.38 ? 758  ARG C CZ    1 
ATOM   9498  N  NH1   . ARG C 2 758  ? 143.798 111.056 104.550 1.00 170.38 ? 758  ARG C NH1   1 
ATOM   9499  N  NH2   . ARG C 2 758  ? 143.772 109.728 106.419 1.00 170.38 ? 758  ARG C NH2   1 
ATOM   9500  N  N     . THR C 2 759  ? 145.611 104.404 102.079 1.00 182.84 ? 759  THR C N     1 
ATOM   9501  C  CA    . THR C 2 759  ? 146.947 103.951 102.433 1.00 182.84 ? 759  THR C CA    1 
ATOM   9502  C  C     . THR C 2 759  ? 147.948 105.082 102.247 1.00 182.84 ? 759  THR C C     1 
ATOM   9503  O  O     . THR C 2 759  ? 147.868 105.853 101.286 1.00 182.84 ? 759  THR C O     1 
ATOM   9504  C  CB    . THR C 2 759  ? 147.369 102.750 101.582 1.00 182.84 ? 759  THR C CB    1 
ATOM   9505  O  OG1   . THR C 2 759  ? 147.319 103.106 100.195 1.00 182.84 ? 759  THR C OG1   1 
ATOM   9506  C  CG2   . THR C 2 759  ? 146.446 101.571 101.830 1.00 182.84 ? 759  THR C CG2   1 
ATOM   9507  N  N     . SER C 2 760  ? 148.898 105.174 103.175 1.00 188.74 ? 760  SER C N     1 
ATOM   9508  C  CA    . SER C 2 760  ? 149.934 106.198 103.113 1.00 188.74 ? 760  SER C CA    1 
ATOM   9509  C  C     . SER C 2 760  ? 151.298 105.557 103.307 1.00 188.74 ? 760  SER C C     1 
ATOM   9510  O  O     . SER C 2 760  ? 151.455 104.666 104.141 1.00 188.74 ? 760  SER C O     1 
ATOM   9511  C  CB    . SER C 2 760  ? 149.713 107.283 104.169 1.00 188.74 ? 760  SER C CB    1 
ATOM   9512  O  OG    . SER C 2 760  ? 148.742 108.220 103.739 1.00 188.74 ? 760  SER C OG    1 
ATOM   9513  N  N     . PHE C 2 761  ? 152.286 106.022 102.545 1.00 194.95 ? 761  PHE C N     1 
ATOM   9514  C  CA    . PHE C 2 761  ? 153.604 105.399 102.568 1.00 194.95 ? 761  PHE C CA    1 
ATOM   9515  C  C     . PHE C 2 761  ? 154.220 105.483 103.960 1.00 194.95 ? 761  PHE C C     1 
ATOM   9516  O  O     . PHE C 2 761  ? 154.219 106.545 104.590 1.00 194.95 ? 761  PHE C O     1 
ATOM   9517  C  CB    . PHE C 2 761  ? 154.515 106.059 101.538 1.00 194.95 ? 761  PHE C CB    1 
ATOM   9518  C  CG    . PHE C 2 761  ? 154.214 105.655 100.126 1.00 194.95 ? 761  PHE C CG    1 
ATOM   9519  C  CD1   . PHE C 2 761  ? 153.539 106.511 99.275  1.00 194.95 ? 761  PHE C CD1   1 
ATOM   9520  C  CD2   . PHE C 2 761  ? 154.600 104.413 99.652  1.00 194.95 ? 761  PHE C CD2   1 
ATOM   9521  C  CE1   . PHE C 2 761  ? 153.259 106.140 97.975  1.00 194.95 ? 761  PHE C CE1   1 
ATOM   9522  C  CE2   . PHE C 2 761  ? 154.322 104.036 98.353  1.00 194.95 ? 761  PHE C CE2   1 
ATOM   9523  C  CZ    . PHE C 2 761  ? 153.651 104.900 97.514  1.00 194.95 ? 761  PHE C CZ    1 
ATOM   9524  N  N     . LYS C 2 762  ? 154.741 104.353 104.435 1.00 207.08 ? 762  LYS C N     1 
ATOM   9525  C  CA    . LYS C 2 762  ? 155.272 104.270 105.790 1.00 207.08 ? 762  LYS C CA    1 
ATOM   9526  C  C     . LYS C 2 762  ? 156.472 105.189 105.963 1.00 207.08 ? 762  LYS C C     1 
ATOM   9527  O  O     . LYS C 2 762  ? 157.446 105.110 105.209 1.00 207.08 ? 762  LYS C O     1 
ATOM   9528  C  CB    . LYS C 2 762  ? 155.669 102.829 106.113 1.00 207.08 ? 762  LYS C CB    1 
ATOM   9529  C  CG    . LYS C 2 762  ? 154.689 102.093 107.009 1.00 207.08 ? 762  LYS C CG    1 
ATOM   9530  C  CD    . LYS C 2 762  ? 155.368 100.933 107.718 1.00 207.08 ? 762  LYS C CD    1 
ATOM   9531  C  CE    . LYS C 2 762  ? 154.422 100.246 108.689 1.00 207.08 ? 762  LYS C CE    1 
ATOM   9532  N  NZ    . LYS C 2 762  ? 155.035 99.030  109.292 1.00 207.08 ? 762  LYS C NZ    1 
ATOM   9533  N  N     . GLY C 2 763  ? 156.397 106.060 106.966 1.00 225.61 ? 763  GLY C N     1 
ATOM   9534  C  CA    . GLY C 2 763  ? 157.535 106.906 107.280 1.00 225.61 ? 763  GLY C CA    1 
ATOM   9535  C  C     . GLY C 2 763  ? 158.736 106.076 107.697 1.00 225.61 ? 763  GLY C C     1 
ATOM   9536  O  O     . GLY C 2 763  ? 158.616 105.108 108.452 1.00 225.61 ? 763  GLY C O     1 
ATOM   9537  N  N     . GLU C 2 764  ? 159.904 106.457 107.184 1.00 241.29 ? 764  GLU C N     1 
ATOM   9538  C  CA    . GLU C 2 764  ? 161.127 105.721 107.477 1.00 241.29 ? 764  GLU C CA    1 
ATOM   9539  C  C     . GLU C 2 764  ? 161.416 105.731 108.972 1.00 241.29 ? 764  GLU C C     1 
ATOM   9540  O  O     . GLU C 2 764  ? 161.598 106.791 109.577 1.00 241.29 ? 764  GLU C O     1 
ATOM   9541  C  CB    . GLU C 2 764  ? 162.302 106.323 106.706 1.00 241.29 ? 764  GLU C CB    1 
ATOM   9542  C  CG    . GLU C 2 764  ? 163.624 105.610 106.939 1.00 241.29 ? 764  GLU C CG    1 
ATOM   9543  C  CD    . GLU C 2 764  ? 163.616 104.181 106.428 1.00 241.29 ? 764  GLU C CD    1 
ATOM   9544  O  OE1   . GLU C 2 764  ? 162.877 103.895 105.462 1.00 241.29 ? 764  GLU C OE1   1 
ATOM   9545  O  OE2   . GLU C 2 764  ? 164.350 103.344 106.993 1.00 241.29 ? 764  GLU C OE2   1 
ATOM   9546  N  N     . SER C 2 765  ? 161.457 104.540 109.565 1.00 255.58 ? 765  SER C N     1 
ATOM   9547  C  CA    . SER C 2 765  ? 161.715 104.397 110.989 1.00 255.58 ? 765  SER C CA    1 
ATOM   9548  C  C     . SER C 2 765  ? 162.440 103.081 111.227 1.00 255.58 ? 765  SER C C     1 
ATOM   9549  O  O     . SER C 2 765  ? 162.131 102.063 110.601 1.00 255.58 ? 765  SER C O     1 
ATOM   9550  C  CB    . SER C 2 765  ? 160.419 104.447 111.806 1.00 255.58 ? 765  SER C CB    1 
ATOM   9551  O  OG    . SER C 2 765  ? 159.403 103.669 111.198 1.00 255.58 ? 765  SER C OG    1 
ATOM   9552  N  N     . GLU C 2 766  ? 163.408 103.113 112.140 1.00 266.93 ? 766  GLU C N     1 
ATOM   9553  C  CA    . GLU C 2 766  ? 164.183 101.924 112.465 1.00 266.93 ? 766  GLU C CA    1 
ATOM   9554  C  C     . GLU C 2 766  ? 163.357 100.994 113.340 1.00 266.93 ? 766  GLU C C     1 
ATOM   9555  O  O     . GLU C 2 766  ? 162.846 101.434 114.379 1.00 266.93 ? 766  GLU C O     1 
ATOM   9556  C  CB    . GLU C 2 766  ? 165.469 102.293 113.182 1.00 266.93 ? 766  GLU C CB    1 
ATOM   9557  C  CG    . GLU C 2 766  ? 166.215 101.087 113.728 1.00 266.93 ? 766  GLU C CG    1 
ATOM   9558  C  CD    . GLU C 2 766  ? 167.394 101.470 114.594 1.00 266.93 ? 766  GLU C CD    1 
ATOM   9559  O  OE1   . GLU C 2 766  ? 167.201 101.646 115.816 1.00 266.93 ? 766  GLU C OE1   1 
ATOM   9560  O  OE2   . GLU C 2 766  ? 168.513 101.586 114.054 1.00 266.93 ? 766  GLU C OE2   1 
ATOM   9561  N  N     . PRO C 2 767  ? 163.193 99.727  112.970 1.00 302.55 ? 767  PRO C N     1 
ATOM   9562  C  CA    . PRO C 2 767  ? 162.488 98.790  113.852 1.00 302.55 ? 767  PRO C CA    1 
ATOM   9563  C  C     . PRO C 2 767  ? 163.290 98.525  115.118 1.00 302.55 ? 767  PRO C C     1 
ATOM   9564  O  O     . PRO C 2 767  ? 164.470 98.169  115.065 1.00 302.55 ? 767  PRO C O     1 
ATOM   9565  C  CB    . PRO C 2 767  ? 162.348 97.528  112.991 1.00 302.55 ? 767  PRO C CB    1 
ATOM   9566  C  CG    . PRO C 2 767  ? 163.425 97.647  111.962 1.00 302.55 ? 767  PRO C CG    1 
ATOM   9567  C  CD    . PRO C 2 767  ? 163.567 99.111  111.686 1.00 302.55 ? 767  PRO C CD    1 
ATOM   9568  N  N     . THR C 2 768  ? 162.639 98.722  116.262 1.00 332.00 ? 768  THR C N     1 
ATOM   9569  C  CA    . THR C 2 768  ? 163.254 98.424  117.545 1.00 332.00 ? 768  THR C CA    1 
ATOM   9570  C  C     . THR C 2 768  ? 163.656 96.948  117.588 1.00 332.00 ? 768  THR C C     1 
ATOM   9571  O  O     . THR C 2 768  ? 162.940 96.093  117.058 1.00 332.00 ? 768  THR C O     1 
ATOM   9572  C  CB    . THR C 2 768  ? 162.279 98.752  118.679 1.00 332.00 ? 768  THR C CB    1 
ATOM   9573  O  OG1   . THR C 2 768  ? 161.931 100.141 118.620 1.00 332.00 ? 768  THR C OG1   1 
ATOM   9574  C  CG2   . THR C 2 768  ? 162.885 98.456  120.044 1.00 332.00 ? 768  THR C CG2   1 
ATOM   9575  N  N     . PRO C 2 769  ? 164.815 96.627  118.177 1.00 330.07 ? 769  PRO C N     1 
ATOM   9576  C  CA    . PRO C 2 769  ? 165.245 95.219  118.246 1.00 330.07 ? 769  PRO C CA    1 
ATOM   9577  C  C     . PRO C 2 769  ? 164.174 94.255  118.732 1.00 330.07 ? 769  PRO C C     1 
ATOM   9578  O  O     . PRO C 2 769  ? 164.161 93.095  118.300 1.00 330.07 ? 769  PRO C O     1 
ATOM   9579  C  CB    . PRO C 2 769  ? 166.433 95.278  119.211 1.00 330.07 ? 769  PRO C CB    1 
ATOM   9580  C  CG    . PRO C 2 769  ? 167.031 96.617  118.950 1.00 330.07 ? 769  PRO C CG    1 
ATOM   9581  C  CD    . PRO C 2 769  ? 165.884 97.545  118.616 1.00 330.07 ? 769  PRO C CD    1 
ATOM   9582  N  N     . GLU C 2 770  ? 163.264 94.696  119.605 1.00 347.66 ? 770  GLU C N     1 
ATOM   9583  C  CA    . GLU C 2 770  ? 162.130 93.850  119.963 1.00 347.66 ? 770  GLU C CA    1 
ATOM   9584  C  C     . GLU C 2 770  ? 161.240 93.597  118.750 1.00 347.66 ? 770  GLU C C     1 
ATOM   9585  O  O     . GLU C 2 770  ? 160.826 92.459  118.493 1.00 347.66 ? 770  GLU C O     1 
ATOM   9586  C  CB    . GLU C 2 770  ? 161.341 94.479  121.119 1.00 347.66 ? 770  GLU C CB    1 
ATOM   9587  C  CG    . GLU C 2 770  ? 160.590 95.763  120.782 1.00 347.66 ? 770  GLU C CG    1 
ATOM   9588  C  CD    . GLU C 2 770  ? 159.739 96.266  121.931 1.00 347.66 ? 770  GLU C CD    1 
ATOM   9589  O  OE1   . GLU C 2 770  ? 158.613 96.741  121.674 1.00 347.66 ? 770  GLU C OE1   1 
ATOM   9590  O  OE2   . GLU C 2 770  ? 160.195 96.188  123.091 1.00 347.66 ? 770  GLU C OE2   1 
ATOM   9591  N  N     . GLU C 2 771  ? 160.966 94.643  117.965 1.00 349.61 ? 771  GLU C N     1 
ATOM   9592  C  CA    . GLU C 2 771  ? 160.162 94.465  116.763 1.00 349.61 ? 771  GLU C CA    1 
ATOM   9593  C  C     . GLU C 2 771  ? 160.922 93.690  115.697 1.00 349.61 ? 771  GLU C C     1 
ATOM   9594  O  O     . GLU C 2 771  ? 160.309 92.954  114.918 1.00 349.61 ? 771  GLU C O     1 
ATOM   9595  C  CB    . GLU C 2 771  ? 159.707 95.821  116.222 1.00 349.61 ? 771  GLU C CB    1 
ATOM   9596  C  CG    . GLU C 2 771  ? 158.670 96.510  117.094 1.00 349.61 ? 771  GLU C CG    1 
ATOM   9597  C  CD    . GLU C 2 771  ? 158.153 97.796  116.482 1.00 349.61 ? 771  GLU C CD    1 
ATOM   9598  O  OE1   . GLU C 2 771  ? 158.695 98.221  115.441 1.00 349.61 ? 771  GLU C OE1   1 
ATOM   9599  O  OE2   . GLU C 2 771  ? 157.202 98.380  117.042 1.00 349.61 ? 771  GLU C OE2   1 
ATOM   9600  N  N     . ARG C 2 772  ? 162.248 93.831  115.650 1.00 347.10 ? 772  ARG C N     1 
ATOM   9601  C  CA    . ARG C 2 772  ? 163.045 92.988  114.763 1.00 347.10 ? 772  ARG C CA    1 
ATOM   9602  C  C     . ARG C 2 772  ? 162.905 91.520  115.147 1.00 347.10 ? 772  ARG C C     1 
ATOM   9603  O  O     . ARG C 2 772  ? 162.765 90.648  114.281 1.00 347.10 ? 772  ARG C O     1 
ATOM   9604  C  CB    . ARG C 2 772  ? 164.511 93.423  114.801 1.00 347.10 ? 772  ARG C CB    1 
ATOM   9605  C  CG    . ARG C 2 772  ? 164.790 94.732  114.080 1.00 347.10 ? 772  ARG C CG    1 
ATOM   9606  C  CD    . ARG C 2 772  ? 165.141 94.496  112.619 1.00 347.10 ? 772  ARG C CD    1 
ATOM   9607  N  NE    . ARG C 2 772  ? 166.482 93.940  112.459 1.00 347.10 ? 772  ARG C NE    1 
ATOM   9608  C  CZ    . ARG C 2 772  ? 167.106 93.818  111.291 1.00 347.10 ? 772  ARG C CZ    1 
ATOM   9609  N  NH1   . ARG C 2 772  ? 166.510 94.214  110.175 1.00 347.10 ? 772  ARG C NH1   1 
ATOM   9610  N  NH2   . ARG C 2 772  ? 168.325 93.301  111.239 1.00 347.10 ? 772  ARG C NH2   1 
ATOM   9611  N  N     . LEU C 2 773  ? 162.924 91.231  116.451 1.00 361.57 ? 773  LEU C N     1 
ATOM   9612  C  CA    . LEU C 2 773  ? 162.734 89.858  116.911 1.00 361.57 ? 773  LEU C CA    1 
ATOM   9613  C  C     . LEU C 2 773  ? 161.349 89.339  116.544 1.00 361.57 ? 773  LEU C C     1 
ATOM   9614  O  O     . LEU C 2 773  ? 161.207 88.189  116.109 1.00 361.57 ? 773  LEU C O     1 
ATOM   9615  C  CB    . LEU C 2 773  ? 162.965 89.778  118.422 1.00 361.57 ? 773  LEU C CB    1 
ATOM   9616  C  CG    . LEU C 2 773  ? 162.627 88.474  119.151 1.00 361.57 ? 773  LEU C CG    1 
ATOM   9617  C  CD1   . LEU C 2 773  ? 163.685 88.168  120.197 1.00 361.57 ? 773  LEU C CD1   1 
ATOM   9618  C  CD2   . LEU C 2 773  ? 161.254 88.553  119.804 1.00 361.57 ? 773  LEU C CD2   1 
ATOM   9619  N  N     . LEU C 2 774  ? 160.315 90.168  116.720 1.00 365.11 ? 774  LEU C N     1 
ATOM   9620  C  CA    . LEU C 2 774  ? 158.965 89.749  116.341 1.00 365.11 ? 774  LEU C CA    1 
ATOM   9621  C  C     . LEU C 2 774  ? 158.871 89.479  114.843 1.00 365.11 ? 774  LEU C C     1 
ATOM   9622  O  O     . LEU C 2 774  ? 158.297 88.471  114.417 1.00 365.11 ? 774  LEU C O     1 
ATOM   9623  C  CB    . LEU C 2 774  ? 157.931 90.796  116.763 1.00 365.11 ? 774  LEU C CB    1 
ATOM   9624  C  CG    . LEU C 2 774  ? 158.001 91.398  118.166 1.00 365.11 ? 774  LEU C CG    1 
ATOM   9625  C  CD1   . LEU C 2 774  ? 157.005 92.540  118.315 1.00 365.11 ? 774  LEU C CD1   1 
ATOM   9626  C  CD2   . LEU C 2 774  ? 157.758 90.330  119.222 1.00 365.11 ? 774  LEU C CD2   1 
ATOM   9627  N  N     . ARG C 2 775  ? 159.436 90.370  114.025 1.00 361.02 ? 775  ARG C N     1 
ATOM   9628  C  CA