data_6M85
# 
_entry.id   6M85 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.339 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6M85         
WWPDB D_1000235025 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6M85 
_pdbx_database_status.recvd_initial_deposition_date   2018-08-21 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Lee, S.-J.'    1 ? 
'Nichols, C.G.' 2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            J.Gen.Physiol. 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1540-7748 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            152 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
'Atomistic basis of opening and conduction in mammalian inward rectifier potassium (Kir2.2) channels.' 
_citation.year                      2020 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1085/jgp.201912422 
_citation.pdbx_database_id_PubMed   31744859 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Zangerl-Plessl, E.M.' 1 ? 
primary 'Lee, S.J.'            2 ? 
primary 'Maksaev, G.'          3 ? 
primary 'Bernsteiner, H.'      4 ? 
primary 'Ren, F.'              5 ? 
primary 'Yuan, P.'             6 ? 
primary 'Stary-Weinzinger, A.' 7 ? 
primary 'Nichols, C.G.'        8 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6M85 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     82.989 
_cell.length_a_esd                 ? 
_cell.length_b                     82.989 
_cell.length_b_esd                 ? 
_cell.length_c                     191.794 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6M85 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                79 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'I 4' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ATP-sensitive inward rectifier potassium channel 12' 39361.723 1 ? ? 'residues 38-369' ? 
2 non-polymer syn 'POTASSIUM ION'                                       39.098    6 ? ? ?                 ? 
3 water       nat water                                                 18.015    9 ? ? ?                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Inward rectifier K(+) channel Kir2.2,Potassium channel,inwardly rectifying subfamily J member 12' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MARRKCRNRFVKKNGQCNVEFTNMDDKPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPG
GDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLL
FSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIN
EDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTP
RCSAKDLVENKFLLSNSLEVLFQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MARRKCRNRFVKKNGQCNVEFTNMDDKPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPG
GDDTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLL
FSHNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEIN
EDSPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTP
RCSAKDLVENKFLLSNSLEVLFQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ARG n 
1 4   ARG n 
1 5   LYS n 
1 6   CYS n 
1 7   ARG n 
1 8   ASN n 
1 9   ARG n 
1 10  PHE n 
1 11  VAL n 
1 12  LYS n 
1 13  LYS n 
1 14  ASN n 
1 15  GLY n 
1 16  GLN n 
1 17  CYS n 
1 18  ASN n 
1 19  VAL n 
1 20  GLU n 
1 21  PHE n 
1 22  THR n 
1 23  ASN n 
1 24  MET n 
1 25  ASP n 
1 26  ASP n 
1 27  LYS n 
1 28  PRO n 
1 29  GLN n 
1 30  ARG n 
1 31  TYR n 
1 32  ILE n 
1 33  ALA n 
1 34  ASP n 
1 35  MET n 
1 36  PHE n 
1 37  THR n 
1 38  THR n 
1 39  CYS n 
1 40  VAL n 
1 41  ASP n 
1 42  ILE n 
1 43  ARG n 
1 44  TRP n 
1 45  ARG n 
1 46  TYR n 
1 47  MET n 
1 48  LEU n 
1 49  LEU n 
1 50  LEU n 
1 51  PHE n 
1 52  SER n 
1 53  LEU n 
1 54  ALA n 
1 55  PHE n 
1 56  LEU n 
1 57  VAL n 
1 58  SER n 
1 59  TRP n 
1 60  LEU n 
1 61  LEU n 
1 62  PHE n 
1 63  GLY n 
1 64  LEU n 
1 65  ILE n 
1 66  PHE n 
1 67  TRP n 
1 68  LEU n 
1 69  ILE n 
1 70  ALA n 
1 71  LEU n 
1 72  ILE n 
1 73  HIS n 
1 74  GLY n 
1 75  ASP n 
1 76  LEU n 
1 77  GLU n 
1 78  ASN n 
1 79  PRO n 
1 80  GLY n 
1 81  GLY n 
1 82  ASP n 
1 83  ASP n 
1 84  THR n 
1 85  PHE n 
1 86  LYS n 
1 87  PRO n 
1 88  CYS n 
1 89  VAL n 
1 90  LEU n 
1 91  GLN n 
1 92  VAL n 
1 93  ASN n 
1 94  GLY n 
1 95  PHE n 
1 96  VAL n 
1 97  ALA n 
1 98  ALA n 
1 99  PHE n 
1 100 LEU n 
1 101 PHE n 
1 102 SER n 
1 103 ILE n 
1 104 GLU n 
1 105 THR n 
1 106 GLN n 
1 107 THR n 
1 108 THR n 
1 109 ILE n 
1 110 GLY n 
1 111 TYR n 
1 112 GLY n 
1 113 PHE n 
1 114 ARG n 
1 115 CYS n 
1 116 VAL n 
1 117 THR n 
1 118 GLU n 
1 119 GLU n 
1 120 CYS n 
1 121 PRO n 
1 122 LEU n 
1 123 ALA n 
1 124 VAL n 
1 125 PHE n 
1 126 MET n 
1 127 VAL n 
1 128 VAL n 
1 129 VAL n 
1 130 GLN n 
1 131 SER n 
1 132 ILE n 
1 133 VAL n 
1 134 GLY n 
1 135 CYS n 
1 136 ILE n 
1 137 ILE n 
1 138 ASP n 
1 139 SER n 
1 140 PHE n 
1 141 MET n 
1 142 ILE n 
1 143 GLY n 
1 144 ALA n 
1 145 ILE n 
1 146 MET n 
1 147 ALA n 
1 148 LYS n 
1 149 MET n 
1 150 ALA n 
1 151 ARG n 
1 152 PRO n 
1 153 LYS n 
1 154 LYS n 
1 155 ARG n 
1 156 ALA n 
1 157 GLN n 
1 158 THR n 
1 159 LEU n 
1 160 LEU n 
1 161 PHE n 
1 162 SER n 
1 163 HIS n 
1 164 ASN n 
1 165 ALA n 
1 166 VAL n 
1 167 VAL n 
1 168 ALA n 
1 169 MET n 
1 170 ARG n 
1 171 ASP n 
1 172 GLY n 
1 173 LYS n 
1 174 LEU n 
1 175 CYS n 
1 176 LEU n 
1 177 MET n 
1 178 TRP n 
1 179 ARG n 
1 180 VAL n 
1 181 GLY n 
1 182 ASN n 
1 183 LEU n 
1 184 ARG n 
1 185 LYS n 
1 186 SER n 
1 187 HIS n 
1 188 ILE n 
1 189 VAL n 
1 190 GLU n 
1 191 ALA n 
1 192 HIS n 
1 193 VAL n 
1 194 ARG n 
1 195 ALA n 
1 196 GLN n 
1 197 LEU n 
1 198 ILE n 
1 199 LYS n 
1 200 PRO n 
1 201 ARG n 
1 202 ILE n 
1 203 THR n 
1 204 GLU n 
1 205 GLU n 
1 206 GLY n 
1 207 GLU n 
1 208 TYR n 
1 209 ILE n 
1 210 PRO n 
1 211 LEU n 
1 212 ASP n 
1 213 GLN n 
1 214 ILE n 
1 215 ASP n 
1 216 ILE n 
1 217 ASP n 
1 218 VAL n 
1 219 GLY n 
1 220 PHE n 
1 221 ASP n 
1 222 LYS n 
1 223 GLY n 
1 224 LEU n 
1 225 ASP n 
1 226 ARG n 
1 227 ILE n 
1 228 PHE n 
1 229 LEU n 
1 230 VAL n 
1 231 SER n 
1 232 PRO n 
1 233 ILE n 
1 234 THR n 
1 235 ILE n 
1 236 LEU n 
1 237 HIS n 
1 238 GLU n 
1 239 ILE n 
1 240 ASN n 
1 241 GLU n 
1 242 ASP n 
1 243 SER n 
1 244 PRO n 
1 245 LEU n 
1 246 PHE n 
1 247 GLY n 
1 248 ILE n 
1 249 SER n 
1 250 ARG n 
1 251 GLN n 
1 252 ASP n 
1 253 LEU n 
1 254 GLU n 
1 255 THR n 
1 256 ASP n 
1 257 ASP n 
1 258 PHE n 
1 259 GLU n 
1 260 ILE n 
1 261 VAL n 
1 262 VAL n 
1 263 ILE n 
1 264 LEU n 
1 265 GLU n 
1 266 GLY n 
1 267 MET n 
1 268 VAL n 
1 269 GLU n 
1 270 ALA n 
1 271 THR n 
1 272 ALA n 
1 273 MET n 
1 274 THR n 
1 275 THR n 
1 276 GLN n 
1 277 ALA n 
1 278 ARG n 
1 279 SER n 
1 280 SER n 
1 281 TYR n 
1 282 LEU n 
1 283 ALA n 
1 284 SER n 
1 285 GLU n 
1 286 ILE n 
1 287 LEU n 
1 288 TRP n 
1 289 GLY n 
1 290 HIS n 
1 291 ARG n 
1 292 PHE n 
1 293 GLU n 
1 294 PRO n 
1 295 VAL n 
1 296 LEU n 
1 297 PHE n 
1 298 GLU n 
1 299 GLU n 
1 300 LYS n 
1 301 ASN n 
1 302 GLN n 
1 303 TYR n 
1 304 LYS n 
1 305 VAL n 
1 306 ASP n 
1 307 TYR n 
1 308 SER n 
1 309 HIS n 
1 310 PHE n 
1 311 HIS n 
1 312 LYS n 
1 313 THR n 
1 314 TYR n 
1 315 GLU n 
1 316 VAL n 
1 317 PRO n 
1 318 SER n 
1 319 THR n 
1 320 PRO n 
1 321 ARG n 
1 322 CYS n 
1 323 SER n 
1 324 ALA n 
1 325 LYS n 
1 326 ASP n 
1 327 LEU n 
1 328 VAL n 
1 329 GLU n 
1 330 ASN n 
1 331 LYS n 
1 332 PHE n 
1 333 LEU n 
1 334 LEU n 
1 335 SER n 
1 336 ASN n 
1 337 SER n 
1 338 LEU n 
1 339 GLU n 
1 340 VAL n 
1 341 LEU n 
1 342 PHE n 
1 343 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   343 
_entity_src_gen.gene_src_common_name               Chicken 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 KCNJ12 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Gallus gallus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9031 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Komagataella pastoris' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     4922 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pPicZ 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    KCJ12_CHICK 
_struct_ref.pdbx_db_accession          F1NHE9 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RRKCRNRFVKKNGQCNVEFTNMDDKPQRYIADMFTTCVDIRWRYMLLLFSLAFLVSWLLFGLIFWLIALIHGDLENPGGD
DTFKPCVLQVNGFVAAFLFSIETQTTIGYGFRCVTEECPLAVFMVVVQSIVGCIIDSFMIGAIMAKMARPKKRAQTLLFS
HNAVVAMRDGKLCLMWRVGNLRKSHIVEAHVRAQLIKPRITEEGEYIPLDQIDIDVGFDKGLDRIFLVSPITILHEINED
SPLFGISRQDLETDDFEIVVILEGMVEATAMTTQARSSYLASEILWGHRFEPVLFEEKNQYKVDYSHFHKTYEVPSTPRC
SAKDLVENKFLL
;
_struct_ref.pdbx_align_begin           38 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6M85 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 3 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 334 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             F1NHE9 
_struct_ref_seq.db_align_beg                  38 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  369 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       38 
_struct_ref_seq.pdbx_auth_seq_align_end       369 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6M85 MET A 1   ? UNP F1NHE9 ? ? 'initiating methionine' 36  1  
1 6M85 ALA A 2   ? UNP F1NHE9 ? ? 'expression tag'        37  2  
1 6M85 SER A 335 ? UNP F1NHE9 ? ? 'expression tag'        370 3  
1 6M85 ASN A 336 ? UNP F1NHE9 ? ? 'expression tag'        371 4  
1 6M85 SER A 337 ? UNP F1NHE9 ? ? 'expression tag'        372 5  
1 6M85 LEU A 338 ? UNP F1NHE9 ? ? 'expression tag'        373 6  
1 6M85 GLU A 339 ? UNP F1NHE9 ? ? 'expression tag'        374 7  
1 6M85 VAL A 340 ? UNP F1NHE9 ? ? 'expression tag'        375 8  
1 6M85 LEU A 341 ? UNP F1NHE9 ? ? 'expression tag'        376 9  
1 6M85 PHE A 342 ? UNP F1NHE9 ? ? 'expression tag'        377 10 
1 6M85 GLN A 343 ? UNP F1NHE9 ? ? 'expression tag'        378 11 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
K   non-polymer         . 'POTASSIUM ION' ? 'K 1'            39.098  
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6M85 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.35 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         71.70 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              0.658 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          EVAPORATION 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    'PEG400, Trisodium Citrate, Tris' 
_exptl_crystal_grow.pdbx_pH_range   7.1-7.4 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.details                      'LR-Design detector positioner' 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-02-11 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Cryo-Cooled double crystal' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.98 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 24-ID-C' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.98 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-C 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6M85 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.700 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       17592 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.900 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.500 
_reflns.pdbx_Rmerge_I_obs                0.047 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            11.700 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.037 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.052 
_reflns.pdbx_Rpim_I_all                  0.020 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         114715 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
2.700 2.800  ? ? ? ? ? ? 1751 99.700  ? ? ? ? 0.866 ? ? ? ? ? ? ? ? 5.700 ? 0.937 ? ? 0.951 0.389 ? 1  1 0.833 ? 
2.800 2.910  ? ? ? ? ? ? 1722 100.000 ? ? ? ? 0.631 ? ? ? ? ? ? ? ? 6.500 ? 0.948 ? ? 0.687 0.269 ? 2  1 0.953 ? 
2.910 3.040  ? ? ? ? ? ? 1774 100.000 ? ? ? ? 0.424 ? ? ? ? ? ? ? ? 6.300 ? 0.959 ? ? 0.463 0.184 ? 3  1 0.958 ? 
3.040 3.200  ? ? ? ? ? ? 1774 100.000 ? ? ? ? 0.260 ? ? ? ? ? ? ? ? 6.500 ? 1.026 ? ? 0.283 0.111 ? 4  1 0.989 ? 
3.200 3.400  ? ? ? ? ? ? 1733 100.000 ? ? ? ? 0.155 ? ? ? ? ? ? ? ? 6.800 ? 1.084 ? ? 0.167 0.064 ? 5  1 0.995 ? 
3.400 3.660  ? ? ? ? ? ? 1764 100.000 ? ? ? ? 0.096 ? ? ? ? ? ? ? ? 6.700 ? 1.008 ? ? 0.104 0.040 ? 6  1 0.997 ? 
3.660 4.030  ? ? ? ? ? ? 1759 99.900  ? ? ? ? 0.061 ? ? ? ? ? ? ? ? 6.500 ? 1.162 ? ? 0.066 0.026 ? 7  1 0.998 ? 
4.030 4.620  ? ? ? ? ? ? 1773 99.900  ? ? ? ? 0.042 ? ? ? ? ? ? ? ? 6.900 ? 1.152 ? ? 0.046 0.017 ? 8  1 0.999 ? 
4.620 5.810  ? ? ? ? ? ? 1760 99.900  ? ? ? ? 0.035 ? ? ? ? ? ? ? ? 6.700 ? 1.042 ? ? 0.039 0.015 ? 9  1 0.999 ? 
5.810 50.000 ? ? ? ? ? ? 1782 99.400  ? ? ? ? 0.035 ? ? ? ? ? ? ? ? 6.600 ? 1.020 ? ? 0.039 0.015 ? 10 1 0.997 ? 
# 
_refine.aniso_B[1][1]                            4.4500 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][2]                            4.4500 
_refine.aniso_B[2][3]                            0.0000 
_refine.aniso_B[3][3]                            -8.8900 
_refine.B_iso_max                                197.640 
_refine.B_iso_mean                               107.8460 
_refine.B_iso_min                                65.710 
_refine.correlation_coeff_Fo_to_Fc               0.9110 
_refine.correlation_coeff_Fo_to_Fc_free          0.9390 
_refine.details                                  
'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES      : REFINED INDIVIDUALLY' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6M85 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.7100 
_refine.ls_d_res_low                             50.0000 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     16707 
_refine.ls_number_reflns_R_free                  866 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.8600 
_refine.ls_percent_reflns_R_free                 4.9000 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2291 
_refine.ls_R_factor_R_free                       0.2536 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2279 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.000 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      3SPC 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.4080 
_refine.pdbx_overall_ESU_R_Free                  0.2770 
_refine.pdbx_solvent_vdw_probe_radii             1.2000 
_refine.pdbx_solvent_ion_probe_radii             0.8000 
_refine.pdbx_solvent_shrinkage_radii             0.8000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             13.4450 
_refine.overall_SU_ML                            0.2650 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.7100 
_refine_hist.d_res_low                        50.0000 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             9 
_refine_hist.number_atoms_total               2616 
_refine_hist.pdbx_number_residues_total       327 
_refine_hist.pdbx_B_iso_mean_ligand           114.25 
_refine_hist.pdbx_B_iso_mean_solvent          81.26 
_refine_hist.pdbx_number_atoms_protein        2601 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.005  0.019  2669 ? r_bond_refined_d       ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  2558 ? r_bond_other_d         ? ? 
'X-RAY DIFFRACTION' ? 0.906  1.950  3617 ? r_angle_refined_deg    ? ? 
'X-RAY DIFFRACTION' ? 0.653  3.000  5863 ? r_angle_other_deg      ? ? 
'X-RAY DIFFRACTION' ? 5.458  5.000  327  ? r_dihedral_angle_1_deg ? ? 
'X-RAY DIFFRACTION' ? 32.496 23.607 122  ? r_dihedral_angle_2_deg ? ? 
'X-RAY DIFFRACTION' ? 14.613 15.000 459  ? r_dihedral_angle_3_deg ? ? 
'X-RAY DIFFRACTION' ? 15.954 15.000 17   ? r_dihedral_angle_4_deg ? ? 
'X-RAY DIFFRACTION' ? 0.052  0.200  412  ? r_chiral_restr         ? ? 
'X-RAY DIFFRACTION' ? 0.003  0.020  2985 ? r_gen_planes_refined   ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  636  ? r_gen_planes_other     ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.7100 
_refine_ls_shell.d_res_low                        2.7800 
_refine_ls_shell.number_reflns_all                1291 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             64 
_refine_ls_shell.number_reflns_R_work             1227 
_refine_ls_shell.percent_reflns_obs               99.5400 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.3440 
_refine_ls_shell.R_factor_R_free_error            0.0000 
_refine_ls_shell.R_factor_R_work                  0.3790 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     6M85 
_struct.title                        'Crystal Structure of Inward Rectifier Kir2.2 in a different salt condition' 
_struct.pdbx_descriptor              'ATP-sensitive inward rectifier potassium channel 12' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6M85 
_struct_keywords.text            'METAL TRANSPORT, Kir 2.2' 
_struct_keywords.pdbx_keywords   'METAL TRANSPORT' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 2 ? 
H N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 MET A 35  ? ILE A 42  ? MET A 70  ILE A 77  1 ? 8  
HELX_P HELX_P2 AA2 ARG A 43  ? GLY A 74  ? ARG A 78  GLY A 109 1 ? 32 
HELX_P HELX_P3 AA3 ASP A 75  ? ASN A 78  ? ASP A 110 ASN A 113 5 ? 4  
HELX_P HELX_P4 AA4 GLY A 94  ? THR A 107 ? GLY A 129 THR A 142 1 ? 14 
HELX_P HELX_P5 AA5 CYS A 120 ? ARG A 151 ? CYS A 155 ARG A 186 1 ? 32 
HELX_P HELX_P6 AA6 GLY A 219 ? GLY A 223 ? GLY A 254 GLY A 258 5 ? 5  
HELX_P HELX_P7 AA7 SER A 249 ? ASP A 256 ? SER A 284 ASP A 291 1 ? 8  
HELX_P HELX_P8 AA8 TYR A 307 ? PHE A 310 ? TYR A 342 PHE A 345 5 ? 4  
HELX_P HELX_P9 AA9 SER A 323 ? SER A 337 ? SER A 358 SER A 372 1 ? 15 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1  disulf ? ? A CYS 88  SG  ? ? ? 1_555 A CYS 120 SG ? ? A CYS 123 A CYS 155 1_555 ? ? ? ? ? ? ? 2.036 ? ? 
metalc1  metalc ? ? A THR 108 O   ? ? ? 1_555 F K   .   K  ? ? A THR 143 A K   405 1_555 ? ? ? ? ? ? ? 2.952 ? ? 
metalc2  metalc ? ? A THR 108 O   ? ? ? 1_555 F K   .   K  ? ? A THR 143 A K   405 4_455 ? ? ? ? ? ? ? 2.951 ? ? 
metalc3  metalc ? ? A THR 108 O   ? ? ? 1_555 G K   .   K  ? ? A THR 143 A K   406 1_555 ? ? ? ? ? ? ? 3.055 ? ? 
metalc4  metalc ? ? A THR 108 OG1 ? ? ? 1_555 G K   .   K  ? ? A THR 143 A K   406 1_555 ? ? ? ? ? ? ? 2.677 ? ? 
metalc5  metalc ? ? A THR 108 O   ? ? ? 1_555 G K   .   K  ? ? A THR 143 A K   406 4_455 ? ? ? ? ? ? ? 3.055 ? ? 
metalc6  metalc ? ? A THR 108 OG1 ? ? ? 1_555 G K   .   K  ? ? A THR 143 A K   406 4_455 ? ? ? ? ? ? ? 2.676 ? ? 
metalc7  metalc ? ? A ILE 109 O   ? ? ? 1_555 E K   .   K  ? ? A ILE 144 A K   404 1_555 ? ? ? ? ? ? ? 2.987 ? ? 
metalc8  metalc ? ? A ILE 109 O   ? ? ? 1_555 E K   .   K  ? ? A ILE 144 A K   404 4_455 ? ? ? ? ? ? ? 2.987 ? ? 
metalc9  metalc ? ? A ILE 109 O   ? ? ? 1_555 F K   .   K  ? ? A ILE 144 A K   405 1_555 ? ? ? ? ? ? ? 3.012 ? ? 
metalc10 metalc ? ? A ILE 109 O   ? ? ? 1_555 F K   .   K  ? ? A ILE 144 A K   405 4_455 ? ? ? ? ? ? ? 3.012 ? ? 
metalc11 metalc ? ? A GLY 110 O   ? ? ? 1_555 D K   .   K  ? ? A GLY 145 A K   403 1_555 ? ? ? ? ? ? ? 3.174 ? ? 
metalc12 metalc ? ? A GLY 110 O   ? ? ? 1_555 D K   .   K  ? ? A GLY 145 A K   403 4_455 ? ? ? ? ? ? ? 3.174 ? ? 
metalc13 metalc ? ? A GLY 110 O   ? ? ? 1_555 E K   .   K  ? ? A GLY 145 A K   404 1_555 ? ? ? ? ? ? ? 3.149 ? ? 
metalc14 metalc ? ? A GLY 110 O   ? ? ? 1_555 E K   .   K  ? ? A GLY 145 A K   404 4_455 ? ? ? ? ? ? ? 3.148 ? ? 
metalc15 metalc ? ? A TYR 111 O   ? ? ? 1_555 C K   .   K  ? ? A TYR 146 A K   402 1_555 ? ? ? ? ? ? ? 3.355 ? ? 
metalc16 metalc ? ? A TYR 111 O   ? ? ? 1_555 C K   .   K  ? ? A TYR 146 A K   402 4_455 ? ? ? ? ? ? ? 3.355 ? ? 
metalc17 metalc ? ? A TYR 111 O   ? ? ? 1_555 D K   .   K  ? ? A TYR 146 A K   403 1_555 ? ? ? ? ? ? ? 3.110 ? ? 
metalc18 metalc ? ? A TYR 111 O   ? ? ? 1_555 D K   .   K  ? ? A TYR 146 A K   403 4_455 ? ? ? ? ? ? ? 3.110 ? ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
metalc ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 3 ? 
AA3 ? 4 ? 
AA4 ? 3 ? 
AA5 ? 4 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? parallel      
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA7 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 VAL A 89  ? LEU A 90  ? VAL A 124 LEU A 125 
AA1 2 CYS A 115 ? VAL A 116 ? CYS A 150 VAL A 151 
AA2 1 LEU A 159 ? PHE A 161 ? LEU A 194 PHE A 196 
AA2 2 LYS A 173 ? ASN A 182 ? LYS A 208 ASN A 217 
AA2 3 ILE A 233 ? GLU A 238 ? ILE A 268 GLU A 273 
AA3 1 LEU A 159 ? PHE A 161 ? LEU A 194 PHE A 196 
AA3 2 LYS A 173 ? ASN A 182 ? LYS A 208 ASN A 217 
AA3 3 ALA A 165 ? ARG A 170 ? ALA A 200 ARG A 205 
AA3 4 ILE A 286 ? TRP A 288 ? ILE A 321 TRP A 323 
AA4 1 TYR A 208 ? ASP A 215 ? TYR A 243 ASP A 250 
AA4 2 ILE A 188 ? ILE A 202 ? ILE A 223 ILE A 237 
AA4 3 ARG A 226 ? ILE A 227 ? ARG A 261 ILE A 262 
AA5 1 TYR A 208 ? ASP A 215 ? TYR A 243 ASP A 250 
AA5 2 ILE A 188 ? ILE A 202 ? ILE A 223 ILE A 237 
AA5 3 GLU A 259 ? VAL A 268 ? GLU A 294 VAL A 303 
AA5 4 THR A 274 ? LEU A 282 ? THR A 309 LEU A 317 
AA6 1 HIS A 290 ? PHE A 292 ? HIS A 325 PHE A 327 
AA6 2 THR A 313 ? GLU A 315 ? THR A 348 GLU A 350 
AA7 1 LEU A 296 ? GLU A 299 ? LEU A 331 GLU A 334 
AA7 2 GLN A 302 ? VAL A 305 ? GLN A 337 VAL A 340 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 90  ? N LEU A 125 O CYS A 115 ? O CYS A 150 
AA2 1 2 N LEU A 160 ? N LEU A 195 O GLY A 181 ? O GLY A 216 
AA2 2 3 N TRP A 178 ? N TRP A 213 O ILE A 235 ? O ILE A 270 
AA3 1 2 N LEU A 160 ? N LEU A 195 O GLY A 181 ? O GLY A 216 
AA3 2 3 O CYS A 175 ? O CYS A 210 N ALA A 168 ? N ALA A 203 
AA3 3 4 N ALA A 165 ? N ALA A 200 O LEU A 287 ? O LEU A 322 
AA4 1 2 O ILE A 214 ? O ILE A 249 N LEU A 197 ? N LEU A 232 
AA4 2 3 N ALA A 191 ? N ALA A 226 O ILE A 227 ? O ILE A 262 
AA5 1 2 O ILE A 214 ? O ILE A 249 N LEU A 197 ? N LEU A 232 
AA5 2 3 N ILE A 198 ? N ILE A 233 O GLU A 259 ? O GLU A 294 
AA5 3 4 N ILE A 260 ? N ILE A 295 O TYR A 281 ? O TYR A 316 
AA6 1 2 N ARG A 291 ? N ARG A 326 O TYR A 314 ? O TYR A 349 
AA7 1 2 N GLU A 299 ? N GLU A 334 O GLN A 302 ? O GLN A 337 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A K 402 ? 8  'binding site for residue K A 402' 
AC2 Software A K 403 ? 16 'binding site for residue K A 403' 
AC3 Software A K 404 ? 16 'binding site for residue K A 404' 
AC4 Software A K 405 ? 16 'binding site for residue K A 405' 
AC5 Software A K 406 ? 8  'binding site for residue K A 406' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 8  TYR A 111 ? TYR A 146 . ? 4_455 ? 
2  AC1 8  TYR A 111 ? TYR A 146 . ? 1_555 ? 
3  AC1 8  TYR A 111 ? TYR A 146 . ? 3_565 ? 
4  AC1 8  TYR A 111 ? TYR A 146 . ? 2_465 ? 
5  AC1 8  K   D .   ? K   A 403 . ? 3_565 ? 
6  AC1 8  K   D .   ? K   A 403 . ? 4_455 ? 
7  AC1 8  K   D .   ? K   A 403 . ? 2_465 ? 
8  AC1 8  K   D .   ? K   A 403 . ? 1_555 ? 
9  AC2 16 GLY A 110 ? GLY A 145 . ? 4_455 ? 
10 AC2 16 GLY A 110 ? GLY A 145 . ? 1_555 ? 
11 AC2 16 GLY A 110 ? GLY A 145 . ? 3_565 ? 
12 AC2 16 GLY A 110 ? GLY A 145 . ? 2_465 ? 
13 AC2 16 TYR A 111 ? TYR A 146 . ? 4_455 ? 
14 AC2 16 TYR A 111 ? TYR A 146 . ? 2_465 ? 
15 AC2 16 TYR A 111 ? TYR A 146 . ? 3_565 ? 
16 AC2 16 TYR A 111 ? TYR A 146 . ? 1_555 ? 
17 AC2 16 K   C .   ? K   A 402 . ? 4_455 ? 
18 AC2 16 K   C .   ? K   A 402 . ? 3_565 ? 
19 AC2 16 K   C .   ? K   A 402 . ? 2_465 ? 
20 AC2 16 K   C .   ? K   A 402 . ? 1_555 ? 
21 AC2 16 K   E .   ? K   A 404 . ? 4_455 ? 
22 AC2 16 K   E .   ? K   A 404 . ? 3_565 ? 
23 AC2 16 K   E .   ? K   A 404 . ? 2_465 ? 
24 AC2 16 K   E .   ? K   A 404 . ? 1_555 ? 
25 AC3 16 ILE A 109 ? ILE A 144 . ? 4_455 ? 
26 AC3 16 ILE A 109 ? ILE A 144 . ? 1_555 ? 
27 AC3 16 ILE A 109 ? ILE A 144 . ? 3_565 ? 
28 AC3 16 ILE A 109 ? ILE A 144 . ? 2_465 ? 
29 AC3 16 GLY A 110 ? GLY A 145 . ? 4_455 ? 
30 AC3 16 GLY A 110 ? GLY A 145 . ? 1_555 ? 
31 AC3 16 GLY A 110 ? GLY A 145 . ? 2_465 ? 
32 AC3 16 GLY A 110 ? GLY A 145 . ? 3_565 ? 
33 AC3 16 K   D .   ? K   A 403 . ? 1_555 ? 
34 AC3 16 K   D .   ? K   A 403 . ? 2_465 ? 
35 AC3 16 K   D .   ? K   A 403 . ? 4_455 ? 
36 AC3 16 K   D .   ? K   A 403 . ? 3_565 ? 
37 AC3 16 K   F .   ? K   A 405 . ? 4_455 ? 
38 AC3 16 K   F .   ? K   A 405 . ? 3_565 ? 
39 AC3 16 K   F .   ? K   A 405 . ? 2_465 ? 
40 AC3 16 K   F .   ? K   A 405 . ? 1_555 ? 
41 AC4 16 THR A 108 ? THR A 143 . ? 1_555 ? 
42 AC4 16 THR A 108 ? THR A 143 . ? 3_565 ? 
43 AC4 16 THR A 108 ? THR A 143 . ? 4_455 ? 
44 AC4 16 THR A 108 ? THR A 143 . ? 2_465 ? 
45 AC4 16 ILE A 109 ? ILE A 144 . ? 4_455 ? 
46 AC4 16 ILE A 109 ? ILE A 144 . ? 2_465 ? 
47 AC4 16 ILE A 109 ? ILE A 144 . ? 1_555 ? 
48 AC4 16 ILE A 109 ? ILE A 144 . ? 3_565 ? 
49 AC4 16 K   E .   ? K   A 404 . ? 1_555 ? 
50 AC4 16 K   E .   ? K   A 404 . ? 4_455 ? 
51 AC4 16 K   E .   ? K   A 404 . ? 3_565 ? 
52 AC4 16 K   E .   ? K   A 404 . ? 2_465 ? 
53 AC4 16 K   G .   ? K   A 406 . ? 4_455 ? 
54 AC4 16 K   G .   ? K   A 406 . ? 3_565 ? 
55 AC4 16 K   G .   ? K   A 406 . ? 2_465 ? 
56 AC4 16 K   G .   ? K   A 406 . ? 1_555 ? 
57 AC5 8  THR A 108 ? THR A 143 . ? 1_555 ? 
58 AC5 8  THR A 108 ? THR A 143 . ? 4_455 ? 
59 AC5 8  THR A 108 ? THR A 143 . ? 2_465 ? 
60 AC5 8  THR A 108 ? THR A 143 . ? 3_565 ? 
61 AC5 8  K   F .   ? K   A 405 . ? 4_455 ? 
62 AC5 8  K   F .   ? K   A 405 . ? 3_565 ? 
63 AC5 8  K   F .   ? K   A 405 . ? 2_465 ? 
64 AC5 8  K   F .   ? K   A 405 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6M85 
_atom_sites.fract_transf_matrix[1][1]   0.012050 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012050 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005214 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
K 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . CYS A 1 6   ? -27.670 8.399  19.837  1.00 142.24 ? 41  CYS A N   1 
ATOM   2    C CA  . CYS A 1 6   ? -28.270 7.085  20.219  1.00 144.03 ? 41  CYS A CA  1 
ATOM   3    C C   . CYS A 1 6   ? -29.678 6.933  19.633  1.00 144.90 ? 41  CYS A C   1 
ATOM   4    O O   . CYS A 1 6   ? -29.964 5.957  18.940  1.00 141.90 ? 41  CYS A O   1 
ATOM   5    C CB  . CYS A 1 6   ? -28.297 6.935  21.743  1.00 140.64 ? 41  CYS A CB  1 
ATOM   6    N N   . ARG A 1 7   ? -30.544 7.907  19.910  1.00 148.38 ? 42  ARG A N   1 
ATOM   7    C CA  . ARG A 1 7   ? -31.879 7.968  19.309  1.00 145.31 ? 42  ARG A CA  1 
ATOM   8    C C   . ARG A 1 7   ? -31.763 8.713  17.983  1.00 141.50 ? 42  ARG A C   1 
ATOM   9    O O   . ARG A 1 7   ? -30.732 9.334  17.706  1.00 132.25 ? 42  ARG A O   1 
ATOM   10   C CB  . ARG A 1 7   ? -32.863 8.693  20.239  1.00 146.62 ? 42  ARG A CB  1 
ATOM   11   C CG  . ARG A 1 7   ? -34.258 8.083  20.269  1.00 150.69 ? 42  ARG A CG  1 
ATOM   12   C CD  . ARG A 1 7   ? -35.186 8.759  21.273  1.00 151.79 ? 42  ARG A CD  1 
ATOM   13   N NE  . ARG A 1 7   ? -34.527 9.086  22.542  1.00 151.43 ? 42  ARG A NE  1 
ATOM   14   C CZ  . ARG A 1 7   ? -34.175 10.311 22.942  1.00 149.90 ? 42  ARG A CZ  1 
ATOM   15   N NH1 . ARG A 1 7   ? -34.408 11.385 22.188  1.00 150.55 ? 42  ARG A NH1 1 
ATOM   16   N NH2 . ARG A 1 7   ? -33.582 10.468 24.120  1.00 149.08 ? 42  ARG A NH2 1 
ATOM   17   N N   . ASN A 1 8   ? -32.811 8.655  17.164  1.00 141.68 ? 43  ASN A N   1 
ATOM   18   C CA  . ASN A 1 8   ? -32.802 9.356  15.877  1.00 138.43 ? 43  ASN A CA  1 
ATOM   19   C C   . ASN A 1 8   ? -32.693 10.870 16.022  1.00 131.60 ? 43  ASN A C   1 
ATOM   20   O O   . ASN A 1 8   ? -33.200 11.464 16.974  1.00 130.58 ? 43  ASN A O   1 
ATOM   21   C CB  . ASN A 1 8   ? -34.026 8.992  15.024  1.00 138.94 ? 43  ASN A CB  1 
ATOM   22   C CG  . ASN A 1 8   ? -33.803 7.743  14.199  1.00 139.37 ? 43  ASN A CG  1 
ATOM   23   O OD1 . ASN A 1 8   ? -32.707 7.522  13.690  1.00 137.94 ? 43  ASN A OD1 1 
ATOM   24   N ND2 . ASN A 1 8   ? -34.839 6.924  14.055  1.00 139.47 ? 43  ASN A ND2 1 
ATOM   25   N N   . ARG A 1 9   ? -32.016 11.477 15.056  1.00 122.84 ? 44  ARG A N   1 
ATOM   26   C CA  . ARG A 1 9   ? -31.759 12.908 15.057  1.00 113.90 ? 44  ARG A CA  1 
ATOM   27   C C   . ARG A 1 9   ? -32.889 13.643 14.336  1.00 111.91 ? 44  ARG A C   1 
ATOM   28   O O   . ARG A 1 9   ? -33.173 13.373 13.166  1.00 105.11 ? 44  ARG A O   1 
ATOM   29   C CB  . ARG A 1 9   ? -30.396 13.176 14.414  1.00 110.83 ? 44  ARG A CB  1 
ATOM   30   C CG  . ARG A 1 9   ? -30.261 14.468 13.635  1.00 107.77 ? 44  ARG A CG  1 
ATOM   31   C CD  . ARG A 1 9   ? -28.796 14.730 13.334  1.00 105.30 ? 44  ARG A CD  1 
ATOM   32   N NE  . ARG A 1 9   ? -28.243 15.713 14.263  1.00 105.89 ? 44  ARG A NE  1 
ATOM   33   C CZ  . ARG A 1 9   ? -27.019 15.684 14.782  1.00 105.54 ? 44  ARG A CZ  1 
ATOM   34   N NH1 . ARG A 1 9   ? -26.161 14.708 14.494  1.00 105.96 ? 44  ARG A NH1 1 
ATOM   35   N NH2 . ARG A 1 9   ? -26.655 16.646 15.619  1.00 109.17 ? 44  ARG A NH2 1 
ATOM   36   N N   . PHE A 1 10  ? -33.525 14.564 15.057  1.00 109.56 ? 45  PHE A N   1 
ATOM   37   C CA  . PHE A 1 10  ? -34.660 15.337 14.554  1.00 107.33 ? 45  PHE A CA  1 
ATOM   38   C C   . PHE A 1 10  ? -34.242 16.347 13.484  1.00 101.38 ? 45  PHE A C   1 
ATOM   39   O O   . PHE A 1 10  ? -34.869 16.443 12.433  1.00 96.20  ? 45  PHE A O   1 
ATOM   40   C CB  . PHE A 1 10  ? -35.322 16.068 15.725  1.00 112.51 ? 45  PHE A CB  1 
ATOM   41   C CG  . PHE A 1 10  ? -36.702 16.588 15.432  1.00 116.47 ? 45  PHE A CG  1 
ATOM   42   C CD1 . PHE A 1 10  ? -37.032 17.907 15.715  1.00 118.28 ? 45  PHE A CD1 1 
ATOM   43   C CD2 . PHE A 1 10  ? -37.679 15.755 14.904  1.00 120.50 ? 45  PHE A CD2 1 
ATOM   44   C CE1 . PHE A 1 10  ? -38.308 18.386 15.468  1.00 123.13 ? 45  PHE A CE1 1 
ATOM   45   C CE2 . PHE A 1 10  ? -38.954 16.229 14.656  1.00 124.28 ? 45  PHE A CE2 1 
ATOM   46   C CZ  . PHE A 1 10  ? -39.270 17.546 14.935  1.00 123.50 ? 45  PHE A CZ  1 
ATOM   47   N N   . VAL A 1 11  ? -33.179 17.093 13.762  1.00 98.04  ? 46  VAL A N   1 
ATOM   48   C CA  . VAL A 1 11  ? -32.678 18.110 12.846  1.00 99.37  ? 46  VAL A CA  1 
ATOM   49   C C   . VAL A 1 11  ? -31.206 17.833 12.559  1.00 97.35  ? 46  VAL A C   1 
ATOM   50   O O   . VAL A 1 11  ? -30.418 17.674 13.485  1.00 90.97  ? 46  VAL A O   1 
ATOM   51   C CB  . VAL A 1 11  ? -32.831 19.528 13.447  1.00 100.26 ? 46  VAL A CB  1 
ATOM   52   C CG1 . VAL A 1 11  ? -32.260 20.589 12.510  1.00 96.73  ? 46  VAL A CG1 1 
ATOM   53   C CG2 . VAL A 1 11  ? -34.293 19.812 13.759  1.00 101.24 ? 46  VAL A CG2 1 
ATOM   54   N N   . LYS A 1 12  ? -30.846 17.777 11.279  1.00 96.43  ? 47  LYS A N   1 
ATOM   55   C CA  . LYS A 1 12  ? -29.474 17.488 10.868  1.00 99.75  ? 47  LYS A CA  1 
ATOM   56   C C   . LYS A 1 12  ? -28.573 18.689 11.094  1.00 100.64 ? 47  LYS A C   1 
ATOM   57   O O   . LYS A 1 12  ? -29.058 19.794 11.322  1.00 106.23 ? 47  LYS A O   1 
ATOM   58   C CB  . LYS A 1 12  ? -29.433 17.058 9.399   1.00 104.32 ? 47  LYS A CB  1 
ATOM   59   C CG  . LYS A 1 12  ? -30.153 15.745 9.147   1.00 108.76 ? 47  LYS A CG  1 
ATOM   60   C CD  . LYS A 1 12  ? -30.250 15.410 7.671   1.00 114.45 ? 47  LYS A CD  1 
ATOM   61   C CE  . LYS A 1 12  ? -31.144 14.198 7.471   1.00 122.88 ? 47  LYS A CE  1 
ATOM   62   N NZ  . LYS A 1 12  ? -31.228 13.783 6.045   1.00 129.74 ? 47  LYS A NZ  1 
ATOM   63   N N   . LYS A 1 13  ? -27.263 18.470 11.014  1.00 100.98 ? 48  LYS A N   1 
ATOM   64   C CA  . LYS A 1 13  ? -26.278 19.519 11.305  1.00 103.23 ? 48  LYS A CA  1 
ATOM   65   C C   . LYS A 1 13  ? -26.382 20.694 10.332  1.00 104.75 ? 48  LYS A C   1 
ATOM   66   O O   . LYS A 1 13  ? -26.008 21.818 10.677  1.00 105.77 ? 48  LYS A O   1 
ATOM   67   C CB  . LYS A 1 13  ? -24.847 18.970 11.268  1.00 102.96 ? 48  LYS A CB  1 
ATOM   68   C CG  . LYS A 1 13  ? -24.553 17.811 12.213  1.00 103.66 ? 48  LYS A CG  1 
ATOM   69   C CD  . LYS A 1 13  ? -24.581 18.199 13.681  1.00 102.35 ? 48  LYS A CD  1 
ATOM   70   C CE  . LYS A 1 13  ? -23.336 18.959 14.102  1.00 103.82 ? 48  LYS A CE  1 
ATOM   71   N NZ  . LYS A 1 13  ? -23.402 19.350 15.537  1.00 105.90 ? 48  LYS A NZ  1 
ATOM   72   N N   . ASN A 1 14  ? -26.885 20.429 9.126   1.00 101.85 ? 49  ASN A N   1 
ATOM   73   C CA  . ASN A 1 14  ? -27.072 21.468 8.104   1.00 101.37 ? 49  ASN A CA  1 
ATOM   74   C C   . ASN A 1 14  ? -28.435 22.177 8.157   1.00 98.94  ? 49  ASN A C   1 
ATOM   75   O O   . ASN A 1 14  ? -28.754 22.974 7.275   1.00 100.05 ? 49  ASN A O   1 
ATOM   76   C CB  . ASN A 1 14  ? -26.844 20.877 6.703   1.00 101.09 ? 49  ASN A CB  1 
ATOM   77   C CG  . ASN A 1 14  ? -27.869 19.816 6.331   1.00 102.13 ? 49  ASN A CG  1 
ATOM   78   O OD1 . ASN A 1 14  ? -28.759 19.481 7.110   1.00 104.53 ? 49  ASN A OD1 1 
ATOM   79   N ND2 . ASN A 1 14  ? -27.737 19.275 5.132   1.00 107.03 ? 49  ASN A ND2 1 
ATOM   80   N N   . GLY A 1 15  ? -29.237 21.877 9.177   1.00 96.39  ? 50  GLY A N   1 
ATOM   81   C CA  . GLY A 1 15  ? -30.548 22.494 9.343   1.00 95.75  ? 50  GLY A CA  1 
ATOM   82   C C   . GLY A 1 15  ? -31.704 21.637 8.862   1.00 98.21  ? 50  GLY A C   1 
ATOM   83   O O   . GLY A 1 15  ? -32.834 21.824 9.310   1.00 107.20 ? 50  GLY A O   1 
ATOM   84   N N   . GLN A 1 16  ? -31.433 20.703 7.951   1.00 101.09 ? 51  GLN A N   1 
ATOM   85   C CA  . GLN A 1 16  ? -32.473 19.843 7.383   1.00 101.92 ? 51  GLN A CA  1 
ATOM   86   C C   . GLN A 1 16  ? -33.195 19.052 8.461   1.00 100.17 ? 51  GLN A C   1 
ATOM   87   O O   . GLN A 1 16  ? -32.563 18.390 9.280   1.00 104.18 ? 51  GLN A O   1 
ATOM   88   C CB  . GLN A 1 16  ? -31.869 18.865 6.376   1.00 108.73 ? 51  GLN A CB  1 
ATOM   89   C CG  . GLN A 1 16  ? -31.514 19.481 5.028   1.00 115.50 ? 51  GLN A CG  1 
ATOM   90   C CD  . GLN A 1 16  ? -32.510 19.141 3.928   1.00 118.43 ? 51  GLN A CD  1 
ATOM   91   O OE1 . GLN A 1 16  ? -33.116 18.064 3.923   1.00 114.84 ? 51  GLN A OE1 1 
ATOM   92   N NE2 . GLN A 1 16  ? -32.668 20.054 2.976   1.00 120.91 ? 51  GLN A NE2 1 
ATOM   93   N N   . CYS A 1 17  ? -34.520 19.120 8.455   1.00 101.07 ? 52  CYS A N   1 
ATOM   94   C CA  . CYS A 1 17  ? -35.319 18.340 9.389   1.00 108.26 ? 52  CYS A CA  1 
ATOM   95   C C   . CYS A 1 17  ? -35.514 16.925 8.870   1.00 106.20 ? 52  CYS A C   1 
ATOM   96   O O   . CYS A 1 17  ? -35.836 16.719 7.703   1.00 105.20 ? 52  CYS A O   1 
ATOM   97   C CB  . CYS A 1 17  ? -36.661 19.017 9.640   1.00 112.09 ? 52  CYS A CB  1 
ATOM   98   S SG  . CYS A 1 17  ? -36.463 20.608 10.468  1.00 115.35 ? 52  CYS A SG  1 
ATOM   99   N N   . ASN A 1 18  ? -35.319 15.960 9.761   1.00 109.43 ? 53  ASN A N   1 
ATOM   100  C CA  . ASN A 1 18  ? -35.340 14.546 9.421   1.00 109.55 ? 53  ASN A CA  1 
ATOM   101  C C   . ASN A 1 18  ? -36.696 13.929 9.769   1.00 104.88 ? 53  ASN A C   1 
ATOM   102  O O   . ASN A 1 18  ? -36.792 13.061 10.636  1.00 107.47 ? 53  ASN A O   1 
ATOM   103  C CB  . ASN A 1 18  ? -34.202 13.852 10.175  1.00 115.59 ? 53  ASN A CB  1 
ATOM   104  C CG  . ASN A 1 18  ? -34.068 12.382 9.833   1.00 122.53 ? 53  ASN A CG  1 
ATOM   105  O OD1 . ASN A 1 18  ? -34.477 11.936 8.762   1.00 129.00 ? 53  ASN A OD1 1 
ATOM   106  N ND2 . ASN A 1 18  ? -33.486 11.618 10.750  1.00 126.00 ? 53  ASN A ND2 1 
ATOM   107  N N   . VAL A 1 19  ? -37.745 14.396 9.094   1.00 103.95 ? 54  VAL A N   1 
ATOM   108  C CA  . VAL A 1 19  ? -39.115 13.971 9.381   1.00 103.62 ? 54  VAL A CA  1 
ATOM   109  C C   . VAL A 1 19  ? -39.887 13.774 8.084   1.00 107.90 ? 54  VAL A C   1 
ATOM   110  O O   . VAL A 1 19  ? -39.939 14.681 7.256   1.00 110.61 ? 54  VAL A O   1 
ATOM   111  C CB  . VAL A 1 19  ? -39.869 15.023 10.222  1.00 103.77 ? 54  VAL A CB  1 
ATOM   112  C CG1 . VAL A 1 19  ? -41.220 14.484 10.680  1.00 105.98 ? 54  VAL A CG1 1 
ATOM   113  C CG2 . VAL A 1 19  ? -39.041 15.453 11.422  1.00 104.55 ? 54  VAL A CG2 1 
ATOM   114  N N   . GLU A 1 20  ? -40.491 12.599 7.913   1.00 110.29 ? 55  GLU A N   1 
ATOM   115  C CA  . GLU A 1 20  ? -41.347 12.338 6.752   1.00 115.25 ? 55  GLU A CA  1 
ATOM   116  C C   . GLU A 1 20  ? -42.816 12.450 7.128   1.00 110.97 ? 55  GLU A C   1 
ATOM   117  O O   . GLU A 1 20  ? -43.218 12.065 8.222   1.00 111.89 ? 55  GLU A O   1 
ATOM   118  C CB  . GLU A 1 20  ? -41.067 10.959 6.142   1.00 123.25 ? 55  GLU A CB  1 
ATOM   119  C CG  . GLU A 1 20  ? -40.271 11.001 4.843   1.00 129.92 ? 55  GLU A CG  1 
ATOM   120  C CD  . GLU A 1 20  ? -40.145 9.637  4.176   1.00 137.83 ? 55  GLU A CD  1 
ATOM   121  O OE1 . GLU A 1 20  ? -41.128 8.861  4.181   1.00 139.04 ? 55  GLU A OE1 1 
ATOM   122  O OE2 . GLU A 1 20  ? -39.058 9.342  3.633   1.00 140.00 ? 55  GLU A OE2 1 
ATOM   123  N N   . PHE A 1 21  ? -43.610 12.989 6.209   1.00 111.96 ? 56  PHE A N   1 
ATOM   124  C CA  . PHE A 1 21  ? -45.045 13.148 6.410   1.00 113.62 ? 56  PHE A CA  1 
ATOM   125  C C   . PHE A 1 21  ? -45.729 12.081 5.573   1.00 113.45 ? 56  PHE A C   1 
ATOM   126  O O   . PHE A 1 21  ? -45.353 11.859 4.422   1.00 112.29 ? 56  PHE A O   1 
ATOM   127  C CB  . PHE A 1 21  ? -45.509 14.538 5.957   1.00 114.00 ? 56  PHE A CB  1 
ATOM   128  C CG  . PHE A 1 21  ? -45.022 15.681 6.824   1.00 114.12 ? 56  PHE A CG  1 
ATOM   129  C CD1 . PHE A 1 21  ? -44.001 15.521 7.762   1.00 116.57 ? 56  PHE A CD1 1 
ATOM   130  C CD2 . PHE A 1 21  ? -45.573 16.942 6.668   1.00 113.51 ? 56  PHE A CD2 1 
ATOM   131  C CE1 . PHE A 1 21  ? -43.566 16.585 8.532   1.00 114.43 ? 56  PHE A CE1 1 
ATOM   132  C CE2 . PHE A 1 21  ? -45.138 18.005 7.434   1.00 113.31 ? 56  PHE A CE2 1 
ATOM   133  C CZ  . PHE A 1 21  ? -44.136 17.828 8.367   1.00 114.35 ? 56  PHE A CZ  1 
ATOM   134  N N   . THR A 1 22  ? -46.725 11.417 6.147   1.00 115.47 ? 57  THR A N   1 
ATOM   135  C CA  . THR A 1 22  ? -47.426 10.347 5.449   1.00 120.02 ? 57  THR A CA  1 
ATOM   136  C C   . THR A 1 22  ? -48.923 10.468 5.633   1.00 124.68 ? 57  THR A C   1 
ATOM   137  O O   . THR A 1 22  ? -49.398 11.110 6.572   1.00 123.84 ? 57  THR A O   1 
ATOM   138  C CB  . THR A 1 22  ? -47.017 8.954  5.969   1.00 122.99 ? 57  THR A CB  1 
ATOM   139  O OG1 . THR A 1 22  ? -47.597 8.724  7.260   1.00 125.58 ? 57  THR A OG1 1 
ATOM   140  C CG2 . THR A 1 22  ? -45.512 8.829  6.069   1.00 122.71 ? 57  THR A CG2 1 
ATOM   141  N N   . ASN A 1 23  ? -49.656 9.833  4.724   1.00 131.03 ? 58  ASN A N   1 
ATOM   142  C CA  . ASN A 1 23  ? -51.092 9.668  4.860   1.00 132.73 ? 58  ASN A CA  1 
ATOM   143  C C   . ASN A 1 23  ? -51.805 11.002 5.110   1.00 128.56 ? 58  ASN A C   1 
ATOM   144  O O   . ASN A 1 23  ? -52.652 11.120 5.995   1.00 126.85 ? 58  ASN A O   1 
ATOM   145  C CB  . ASN A 1 23  ? -51.371 8.664  5.982   1.00 136.84 ? 58  ASN A CB  1 
ATOM   146  C CG  . ASN A 1 23  ? -52.783 8.126  5.941   1.00 150.42 ? 58  ASN A CG  1 
ATOM   147  O OD1 . ASN A 1 23  ? -53.091 7.209  5.179   1.00 154.99 ? 58  ASN A OD1 1 
ATOM   148  N ND2 . ASN A 1 23  ? -53.655 8.700  6.756   1.00 161.24 ? 58  ASN A ND2 1 
ATOM   149  N N   . MET A 1 24  ? -51.449 12.009 4.320   1.00 130.89 ? 59  MET A N   1 
ATOM   150  C CA  . MET A 1 24  ? -52.040 13.332 4.471   1.00 136.99 ? 59  MET A CA  1 
ATOM   151  C C   . MET A 1 24  ? -53.380 13.397 3.756   1.00 142.95 ? 59  MET A C   1 
ATOM   152  O O   . MET A 1 24  ? -53.730 12.507 2.982   1.00 143.78 ? 59  MET A O   1 
ATOM   153  C CB  . MET A 1 24  ? -51.113 14.419 3.919   1.00 137.80 ? 59  MET A CB  1 
ATOM   154  C CG  . MET A 1 24  ? -49.692 14.383 4.468   1.00 140.15 ? 59  MET A CG  1 
ATOM   155  S SD  . MET A 1 24  ? -48.982 16.017 4.766   1.00 140.11 ? 59  MET A SD  1 
ATOM   156  C CE  . MET A 1 24  ? -49.540 16.928 3.328   1.00 139.85 ? 59  MET A CE  1 
ATOM   157  N N   . ASP A 1 25  ? -54.124 14.463 4.033   1.00 157.94 ? 60  ASP A N   1 
ATOM   158  C CA  . ASP A 1 25  ? -55.392 14.742 3.367   1.00 166.61 ? 60  ASP A CA  1 
ATOM   159  C C   . ASP A 1 25  ? -55.128 15.464 2.041   1.00 175.84 ? 60  ASP A C   1 
ATOM   160  O O   . ASP A 1 25  ? -54.175 16.241 1.929   1.00 177.13 ? 60  ASP A O   1 
ATOM   161  C CB  . ASP A 1 25  ? -56.274 15.600 4.282   1.00 166.75 ? 60  ASP A CB  1 
ATOM   162  C CG  . ASP A 1 25  ? -57.699 15.737 3.775   1.00 164.79 ? 60  ASP A CG  1 
ATOM   163  O OD1 . ASP A 1 25  ? -57.913 16.424 2.753   1.00 165.93 ? 60  ASP A OD1 1 
ATOM   164  O OD2 . ASP A 1 25  ? -58.610 15.174 4.415   1.00 157.39 ? 60  ASP A OD2 1 
ATOM   165  N N   . ASP A 1 26  ? -55.974 15.202 1.046   1.00 182.96 ? 61  ASP A N   1 
ATOM   166  C CA  . ASP A 1 26  ? -55.834 15.798 -0.284  1.00 185.75 ? 61  ASP A CA  1 
ATOM   167  C C   . ASP A 1 26  ? -56.926 16.836 -0.544  1.00 188.60 ? 61  ASP A C   1 
ATOM   168  O O   . ASP A 1 26  ? -58.116 16.531 -0.441  1.00 188.30 ? 61  ASP A O   1 
ATOM   169  C CB  . ASP A 1 26  ? -55.895 14.707 -1.357  1.00 181.17 ? 61  ASP A CB  1 
ATOM   170  N N   . LYS A 1 27  ? -56.513 18.060 -0.876  1.00 189.17 ? 62  LYS A N   1 
ATOM   171  C CA  . LYS A 1 27  ? -57.441 19.131 -1.246  1.00 187.88 ? 62  LYS A CA  1 
ATOM   172  C C   . LYS A 1 27  ? -57.445 19.320 -2.763  1.00 191.16 ? 62  LYS A C   1 
ATOM   173  O O   . LYS A 1 27  ? -56.426 19.101 -3.422  1.00 192.39 ? 62  LYS A O   1 
ATOM   174  C CB  . LYS A 1 27  ? -57.051 20.438 -0.553  1.00 180.49 ? 62  LYS A CB  1 
ATOM   175  N N   . PRO A 1 28  ? -58.599 19.728 -3.321  1.00 191.95 ? 63  PRO A N   1 
ATOM   176  C CA  . PRO A 1 28  ? -58.839 19.936 -4.751  1.00 187.97 ? 63  PRO A CA  1 
ATOM   177  C C   . PRO A 1 28  ? -57.956 21.031 -5.351  1.00 185.73 ? 63  PRO A C   1 
ATOM   178  O O   . PRO A 1 28  ? -56.996 20.729 -6.062  1.00 175.44 ? 63  PRO A O   1 
ATOM   179  C CB  . PRO A 1 28  ? -60.313 20.353 -4.799  1.00 181.56 ? 63  PRO A CB  1 
ATOM   180  N N   . ASP A 1 34  ? -52.428 26.817 -5.607  1.00 180.94 ? 69  ASP A N   1 
ATOM   181  C CA  . ASP A 1 34  ? -52.376 28.045 -6.395  1.00 184.48 ? 69  ASP A CA  1 
ATOM   182  C C   . ASP A 1 34  ? -51.387 27.925 -7.550  1.00 184.46 ? 69  ASP A C   1 
ATOM   183  O O   . ASP A 1 34  ? -50.566 27.008 -7.585  1.00 181.70 ? 69  ASP A O   1 
ATOM   184  C CB  . ASP A 1 34  ? -51.991 29.231 -5.509  1.00 184.52 ? 69  ASP A CB  1 
ATOM   185  N N   . MET A 1 35  ? -51.470 28.866 -8.487  1.00 187.99 ? 70  MET A N   1 
ATOM   186  C CA  . MET A 1 35  ? -50.615 28.868 -9.675  1.00 191.20 ? 70  MET A CA  1 
ATOM   187  C C   . MET A 1 35  ? -49.187 29.324 -9.372  1.00 192.75 ? 70  MET A C   1 
ATOM   188  O O   . MET A 1 35  ? -48.236 28.842 -9.992  1.00 192.09 ? 70  MET A O   1 
ATOM   189  C CB  . MET A 1 35  ? -51.217 29.769 -10.757 1.00 189.92 ? 70  MET A CB  1 
ATOM   190  N N   . PHE A 1 36  ? -49.041 30.251 -8.425  1.00 191.98 ? 71  PHE A N   1 
ATOM   191  C CA  . PHE A 1 36  ? -47.734 30.828 -8.092  1.00 190.22 ? 71  PHE A CA  1 
ATOM   192  C C   . PHE A 1 36  ? -46.811 29.815 -7.419  1.00 184.99 ? 71  PHE A C   1 
ATOM   193  O O   . PHE A 1 36  ? -45.606 29.806 -7.673  1.00 178.72 ? 71  PHE A O   1 
ATOM   194  C CB  . PHE A 1 36  ? -47.906 32.055 -7.188  1.00 193.28 ? 71  PHE A CB  1 
ATOM   195  C CG  . PHE A 1 36  ? -46.669 32.913 -7.077  1.00 196.43 ? 71  PHE A CG  1 
ATOM   196  C CD1 . PHE A 1 36  ? -46.132 33.536 -8.199  1.00 192.47 ? 71  PHE A CD1 1 
ATOM   197  C CD2 . PHE A 1 36  ? -46.051 33.112 -5.847  1.00 196.49 ? 71  PHE A CD2 1 
ATOM   198  C CE1 . PHE A 1 36  ? -45.001 34.331 -8.099  1.00 189.54 ? 71  PHE A CE1 1 
ATOM   199  C CE2 . PHE A 1 36  ? -44.919 33.905 -5.741  1.00 192.47 ? 71  PHE A CE2 1 
ATOM   200  C CZ  . PHE A 1 36  ? -44.393 34.516 -6.868  1.00 190.96 ? 71  PHE A CZ  1 
ATOM   201  N N   . THR A 1 37  ? -47.380 28.974 -6.558  1.00 183.54 ? 72  THR A N   1 
ATOM   202  C CA  . THR A 1 37  ? -46.623 27.914 -5.893  1.00 180.35 ? 72  THR A CA  1 
ATOM   203  C C   . THR A 1 37  ? -46.252 26.816 -6.893  1.00 176.85 ? 72  THR A C   1 
ATOM   204  O O   . THR A 1 37  ? -45.132 26.309 -6.873  1.00 172.14 ? 72  THR A O   1 
ATOM   205  C CB  . THR A 1 37  ? -47.416 27.299 -4.720  1.00 182.97 ? 72  THR A CB  1 
ATOM   206  O OG1 . THR A 1 37  ? -48.002 28.342 -3.929  1.00 179.58 ? 72  THR A OG1 1 
ATOM   207  C CG2 . THR A 1 37  ? -46.510 26.448 -3.835  1.00 184.92 ? 72  THR A CG2 1 
ATOM   208  N N   . THR A 1 38  ? -47.195 26.461 -7.764  1.00 177.38 ? 73  THR A N   1 
ATOM   209  C CA  . THR A 1 38  ? -46.956 25.482 -8.830  1.00 179.01 ? 73  THR A CA  1 
ATOM   210  C C   . THR A 1 38  ? -45.789 25.898 -9.724  1.00 178.90 ? 73  THR A C   1 
ATOM   211  O O   . THR A 1 38  ? -45.010 25.056 -10.177 1.00 180.20 ? 73  THR A O   1 
ATOM   212  C CB  . THR A 1 38  ? -48.203 25.313 -9.725  1.00 180.27 ? 73  THR A CB  1 
ATOM   213  O OG1 . THR A 1 38  ? -49.352 25.041 -8.913  1.00 186.13 ? 73  THR A OG1 1 
ATOM   214  C CG2 . THR A 1 38  ? -48.010 24.177 -10.724 1.00 179.84 ? 73  THR A CG2 1 
ATOM   215  N N   . CYS A 1 39  ? -45.684 27.201 -9.968  1.00 177.79 ? 74  CYS A N   1 
ATOM   216  C CA  . CYS A 1 39  ? -44.676 27.762 -10.861 1.00 175.76 ? 74  CYS A CA  1 
ATOM   217  C C   . CYS A 1 39  ? -43.246 27.625 -10.330 1.00 170.81 ? 74  CYS A C   1 
ATOM   218  O O   . CYS A 1 39  ? -42.334 27.259 -11.073 1.00 162.80 ? 74  CYS A O   1 
ATOM   219  C CB  . CYS A 1 39  ? -44.990 29.238 -11.113 1.00 176.55 ? 74  CYS A CB  1 
ATOM   220  S SG  . CYS A 1 39  ? -43.919 30.021 -12.332 1.00 177.64 ? 74  CYS A SG  1 
ATOM   221  N N   . VAL A 1 40  ? -43.056 27.925 -9.049  1.00 174.31 ? 75  VAL A N   1 
ATOM   222  C CA  . VAL A 1 40  ? -41.717 27.920 -8.445  1.00 178.46 ? 75  VAL A CA  1 
ATOM   223  C C   . VAL A 1 40  ? -41.205 26.516 -8.094  1.00 177.23 ? 75  VAL A C   1 
ATOM   224  O O   . VAL A 1 40  ? -40.002 26.328 -7.908  1.00 175.10 ? 75  VAL A O   1 
ATOM   225  C CB  . VAL A 1 40  ? -41.638 28.831 -7.191  1.00 179.39 ? 75  VAL A CB  1 
ATOM   226  C CG1 . VAL A 1 40  ? -42.050 30.256 -7.538  1.00 176.88 ? 75  VAL A CG1 1 
ATOM   227  C CG2 . VAL A 1 40  ? -42.481 28.294 -6.039  1.00 180.58 ? 75  VAL A CG2 1 
ATOM   228  N N   . ASP A 1 41  ? -42.110 25.541 -8.001  1.00 175.83 ? 76  ASP A N   1 
ATOM   229  C CA  . ASP A 1 41  ? -41.737 24.165 -7.659  1.00 172.53 ? 76  ASP A CA  1 
ATOM   230  C C   . ASP A 1 41  ? -41.104 23.439 -8.841  1.00 165.43 ? 76  ASP A C   1 
ATOM   231  O O   . ASP A 1 41  ? -39.993 22.920 -8.732  1.00 169.80 ? 76  ASP A O   1 
ATOM   232  C CB  . ASP A 1 41  ? -42.956 23.376 -7.168  1.00 175.80 ? 76  ASP A CB  1 
ATOM   233  C CG  . ASP A 1 41  ? -43.474 23.866 -5.825  1.00 180.11 ? 76  ASP A CG  1 
ATOM   234  O OD1 . ASP A 1 41  ? -42.720 24.545 -5.096  1.00 183.50 ? 76  ASP A OD1 1 
ATOM   235  O OD2 . ASP A 1 41  ? -44.641 23.566 -5.496  1.00 179.84 ? 76  ASP A OD2 1 
ATOM   236  N N   . ILE A 1 42  ? -41.829 23.393 -9.957  1.00 153.75 ? 77  ILE A N   1 
ATOM   237  C CA  . ILE A 1 42  ? -41.346 22.753 -11.194 1.00 146.42 ? 77  ILE A CA  1 
ATOM   238  C C   . ILE A 1 42  ? -39.934 23.209 -11.579 1.00 140.26 ? 77  ILE A C   1 
ATOM   239  O O   . ILE A 1 42  ? -39.604 24.388 -11.457 1.00 142.73 ? 77  ILE A O   1 
ATOM   240  C CB  . ILE A 1 42  ? -42.311 22.995 -12.385 1.00 147.08 ? 77  ILE A CB  1 
ATOM   241  C CG1 . ILE A 1 42  ? -42.569 24.497 -12.597 1.00 148.55 ? 77  ILE A CG1 1 
ATOM   242  C CG2 . ILE A 1 42  ? -43.621 22.249 -12.168 1.00 148.36 ? 77  ILE A CG2 1 
ATOM   243  C CD1 . ILE A 1 42  ? -43.679 24.810 -13.578 1.00 149.51 ? 77  ILE A CD1 1 
ATOM   244  N N   . ARG A 1 43  ? -39.111 22.267 -12.037 1.00 134.10 ? 78  ARG A N   1 
ATOM   245  C CA  . ARG A 1 43  ? -37.705 22.540 -12.366 1.00 134.46 ? 78  ARG A CA  1 
ATOM   246  C C   . ARG A 1 43  ? -37.543 23.330 -13.664 1.00 130.39 ? 78  ARG A C   1 
ATOM   247  O O   . ARG A 1 43  ? -38.495 23.489 -14.428 1.00 136.70 ? 78  ARG A O   1 
ATOM   248  C CB  . ARG A 1 43  ? -36.913 21.233 -12.471 1.00 141.26 ? 78  ARG A CB  1 
ATOM   249  C CG  . ARG A 1 43  ? -36.579 20.591 -11.135 1.00 149.43 ? 78  ARG A CG  1 
ATOM   250  C CD  . ARG A 1 43  ? -35.800 19.299 -11.334 1.00 158.91 ? 78  ARG A CD  1 
ATOM   251  N NE  . ARG A 1 43  ? -34.539 19.517 -12.047 1.00 164.41 ? 78  ARG A NE  1 
ATOM   252  C CZ  . ARG A 1 43  ? -33.748 18.549 -12.509 1.00 167.84 ? 78  ARG A CZ  1 
ATOM   253  N NH1 . ARG A 1 43  ? -34.065 17.267 -12.343 1.00 169.57 ? 78  ARG A NH1 1 
ATOM   254  N NH2 . ARG A 1 43  ? -32.625 18.865 -13.144 1.00 170.43 ? 78  ARG A NH2 1 
ATOM   255  N N   . TRP A 1 44  ? -36.326 23.813 -13.908 1.00 124.32 ? 79  TRP A N   1 
ATOM   256  C CA  . TRP A 1 44  ? -36.031 24.611 -15.097 1.00 122.22 ? 79  TRP A CA  1 
ATOM   257  C C   . TRP A 1 44  ? -36.280 23.832 -16.378 1.00 125.73 ? 79  TRP A C   1 
ATOM   258  O O   . TRP A 1 44  ? -37.149 24.202 -17.166 1.00 129.95 ? 79  TRP A O   1 
ATOM   259  C CB  . TRP A 1 44  ? -34.588 25.131 -15.077 1.00 119.57 ? 79  TRP A CB  1 
ATOM   260  C CG  . TRP A 1 44  ? -34.396 26.279 -14.144 1.00 119.52 ? 79  TRP A CG  1 
ATOM   261  C CD1 . TRP A 1 44  ? -33.642 26.297 -13.009 1.00 119.41 ? 79  TRP A CD1 1 
ATOM   262  C CD2 . TRP A 1 44  ? -34.988 27.581 -14.254 1.00 120.25 ? 79  TRP A CD2 1 
ATOM   263  N NE1 . TRP A 1 44  ? -33.721 27.530 -12.407 1.00 120.46 ? 79  TRP A NE1 1 
ATOM   264  C CE2 . TRP A 1 44  ? -34.541 28.337 -13.151 1.00 119.71 ? 79  TRP A CE2 1 
ATOM   265  C CE3 . TRP A 1 44  ? -35.850 28.181 -15.181 1.00 114.93 ? 79  TRP A CE3 1 
ATOM   266  C CZ2 . TRP A 1 44  ? -34.928 29.664 -12.947 1.00 119.61 ? 79  TRP A CZ2 1 
ATOM   267  C CZ3 . TRP A 1 44  ? -36.235 29.499 -14.976 1.00 116.19 ? 79  TRP A CZ3 1 
ATOM   268  C CH2 . TRP A 1 44  ? -35.773 30.226 -13.867 1.00 117.34 ? 79  TRP A CH2 1 
ATOM   269  N N   . ARG A 1 45  ? -35.534 22.747 -16.573 1.00 128.45 ? 80  ARG A N   1 
ATOM   270  C CA  . ARG A 1 45  ? -35.644 21.958 -17.803 1.00 132.19 ? 80  ARG A CA  1 
ATOM   271  C C   . ARG A 1 45  ? -37.088 21.503 -18.076 1.00 123.87 ? 80  ARG A C   1 
ATOM   272  O O   . ARG A 1 45  ? -37.489 21.390 -19.228 1.00 122.08 ? 80  ARG A O   1 
ATOM   273  C CB  . ARG A 1 45  ? -34.669 20.764 -17.793 1.00 142.22 ? 80  ARG A CB  1 
ATOM   274  C CG  . ARG A 1 45  ? -34.997 19.670 -16.788 1.00 152.91 ? 80  ARG A CG  1 
ATOM   275  C CD  . ARG A 1 45  ? -34.156 18.412 -16.969 1.00 161.79 ? 80  ARG A CD  1 
ATOM   276  N NE  . ARG A 1 45  ? -32.802 18.557 -16.436 1.00 169.44 ? 80  ARG A NE  1 
ATOM   277  C CZ  . ARG A 1 45  ? -31.905 17.573 -16.361 1.00 171.17 ? 80  ARG A CZ  1 
ATOM   278  N NH1 . ARG A 1 45  ? -32.200 16.346 -16.783 1.00 169.89 ? 80  ARG A NH1 1 
ATOM   279  N NH2 . ARG A 1 45  ? -30.700 17.819 -15.858 1.00 173.23 ? 80  ARG A NH2 1 
ATOM   280  N N   . TYR A 1 46  ? -37.865 21.261 -17.023 1.00 117.97 ? 81  TYR A N   1 
ATOM   281  C CA  . TYR A 1 46  ? -39.265 20.855 -17.178 1.00 125.62 ? 81  TYR A CA  1 
ATOM   282  C C   . TYR A 1 46  ? -40.162 22.037 -17.555 1.00 118.31 ? 81  TYR A C   1 
ATOM   283  O O   . TYR A 1 46  ? -41.068 21.891 -18.374 1.00 117.54 ? 81  TYR A O   1 
ATOM   284  C CB  . TYR A 1 46  ? -39.787 20.161 -15.905 1.00 135.90 ? 81  TYR A CB  1 
ATOM   285  C CG  . TYR A 1 46  ? -39.391 18.695 -15.780 1.00 147.77 ? 81  TYR A CG  1 
ATOM   286  C CD1 . TYR A 1 46  ? -40.284 17.747 -15.281 1.00 155.82 ? 81  TYR A CD1 1 
ATOM   287  C CD2 . TYR A 1 46  ? -38.129 18.256 -16.171 1.00 153.31 ? 81  TYR A CD2 1 
ATOM   288  C CE1 . TYR A 1 46  ? -39.921 16.410 -15.169 1.00 161.28 ? 81  TYR A CE1 1 
ATOM   289  C CE2 . TYR A 1 46  ? -37.756 16.927 -16.066 1.00 158.31 ? 81  TYR A CE2 1 
ATOM   290  C CZ  . TYR A 1 46  ? -38.654 16.006 -15.565 1.00 164.38 ? 81  TYR A CZ  1 
ATOM   291  O OH  . TYR A 1 46  ? -38.283 14.683 -15.461 1.00 167.47 ? 81  TYR A OH  1 
ATOM   292  N N   . MET A 1 47  ? -39.911 23.202 -16.966 1.00 113.96 ? 82  MET A N   1 
ATOM   293  C CA  . MET A 1 47  ? -40.697 24.395 -17.282 1.00 115.72 ? 82  MET A CA  1 
ATOM   294  C C   . MET A 1 47  ? -40.434 24.887 -18.706 1.00 116.51 ? 82  MET A C   1 
ATOM   295  O O   . MET A 1 47  ? -41.359 25.312 -19.400 1.00 117.00 ? 82  MET A O   1 
ATOM   296  C CB  . MET A 1 47  ? -40.410 25.522 -16.291 1.00 117.81 ? 82  MET A CB  1 
ATOM   297  C CG  . MET A 1 47  ? -41.519 26.556 -16.239 1.00 123.33 ? 82  MET A CG  1 
ATOM   298  S SD  . MET A 1 47  ? -41.158 27.917 -15.122 1.00 135.52 ? 82  MET A SD  1 
ATOM   299  C CE  . MET A 1 47  ? -39.933 28.810 -16.078 1.00 136.64 ? 82  MET A CE  1 
ATOM   300  N N   . LEU A 1 48  ? -39.175 24.825 -19.137 1.00 113.92 ? 83  LEU A N   1 
ATOM   301  C CA  . LEU A 1 48  ? -38.803 25.249 -20.486 1.00 112.73 ? 83  LEU A CA  1 
ATOM   302  C C   . LEU A 1 48  ? -39.369 24.312 -21.555 1.00 111.74 ? 83  LEU A C   1 
ATOM   303  O O   . LEU A 1 48  ? -39.760 24.764 -22.628 1.00 115.45 ? 83  LEU A O   1 
ATOM   304  C CB  . LEU A 1 48  ? -37.279 25.372 -20.622 1.00 113.78 ? 83  LEU A CB  1 
ATOM   305  C CG  . LEU A 1 48  ? -36.568 26.370 -19.686 1.00 113.04 ? 83  LEU A CG  1 
ATOM   306  C CD1 . LEU A 1 48  ? -35.118 26.569 -20.111 1.00 111.54 ? 83  LEU A CD1 1 
ATOM   307  C CD2 . LEU A 1 48  ? -37.284 27.714 -19.611 1.00 108.31 ? 83  LEU A CD2 1 
ATOM   308  N N   . LEU A 1 49  ? -39.418 23.016 -21.261 1.00 116.10 ? 84  LEU A N   1 
ATOM   309  C CA  . LEU A 1 49  ? -40.085 22.056 -22.147 1.00 119.37 ? 84  LEU A CA  1 
ATOM   310  C C   . LEU A 1 49  ? -41.586 22.326 -22.205 1.00 111.15 ? 84  LEU A C   1 
ATOM   311  O O   . LEU A 1 49  ? -42.197 22.248 -23.268 1.00 106.96 ? 84  LEU A O   1 
ATOM   312  C CB  . LEU A 1 49  ? -39.830 20.613 -21.700 1.00 128.52 ? 84  LEU A CB  1 
ATOM   313  C CG  . LEU A 1 49  ? -38.399 20.098 -21.901 1.00 136.91 ? 84  LEU A CG  1 
ATOM   314  C CD1 . LEU A 1 49  ? -38.210 18.780 -21.162 1.00 140.92 ? 84  LEU A CD1 1 
ATOM   315  C CD2 . LEU A 1 49  ? -38.039 19.948 -23.375 1.00 135.24 ? 84  LEU A CD2 1 
ATOM   316  N N   . LEU A 1 50  ? -42.169 22.651 -21.057 1.00 111.46 ? 85  LEU A N   1 
ATOM   317  C CA  . LEU A 1 50  ? -43.591 22.969 -20.976 1.00 114.49 ? 85  LEU A CA  1 
ATOM   318  C C   . LEU A 1 50  ? -43.948 24.183 -21.833 1.00 111.55 ? 85  LEU A C   1 
ATOM   319  O O   . LEU A 1 50  ? -44.954 24.172 -22.542 1.00 108.59 ? 85  LEU A O   1 
ATOM   320  C CB  . LEU A 1 50  ? -43.999 23.203 -19.517 1.00 118.34 ? 85  LEU A CB  1 
ATOM   321  C CG  . LEU A 1 50  ? -45.479 23.508 -19.252 1.00 127.52 ? 85  LEU A CG  1 
ATOM   322  C CD1 . LEU A 1 50  ? -45.848 23.107 -17.830 1.00 129.10 ? 85  LEU A CD1 1 
ATOM   323  C CD2 . LEU A 1 50  ? -45.834 24.974 -19.510 1.00 131.72 ? 85  LEU A CD2 1 
ATOM   324  N N   . PHE A 1 51  ? -43.124 25.226 -21.768 1.00 110.91 ? 86  PHE A N   1 
ATOM   325  C CA  . PHE A 1 51  ? -43.383 26.435 -22.548 1.00 110.18 ? 86  PHE A CA  1 
ATOM   326  C C   . PHE A 1 51  ? -43.168 26.207 -24.040 1.00 108.41 ? 86  PHE A C   1 
ATOM   327  O O   . PHE A 1 51  ? -43.991 26.629 -24.856 1.00 111.17 ? 86  PHE A O   1 
ATOM   328  C CB  . PHE A 1 51  ? -42.549 27.617 -22.039 1.00 113.04 ? 86  PHE A CB  1 
ATOM   329  C CG  . PHE A 1 51  ? -43.182 28.330 -20.877 1.00 116.12 ? 86  PHE A CG  1 
ATOM   330  C CD1 . PHE A 1 51  ? -42.614 28.282 -19.614 1.00 117.34 ? 86  PHE A CD1 1 
ATOM   331  C CD2 . PHE A 1 51  ? -44.374 29.027 -21.046 1.00 117.23 ? 86  PHE A CD2 1 
ATOM   332  C CE1 . PHE A 1 51  ? -43.210 28.928 -18.544 1.00 117.00 ? 86  PHE A CE1 1 
ATOM   333  C CE2 . PHE A 1 51  ? -44.976 29.673 -19.981 1.00 118.43 ? 86  PHE A CE2 1 
ATOM   334  C CZ  . PHE A 1 51  ? -44.393 29.622 -18.726 1.00 118.26 ? 86  PHE A CZ  1 
ATOM   335  N N   . SER A 1 52  ? -42.082 25.525 -24.396 1.00 101.53 ? 87  SER A N   1 
ATOM   336  C CA  . SER A 1 52  ? -41.849 25.155 -25.791 1.00 99.82  ? 87  SER A CA  1 
ATOM   337  C C   . SER A 1 52  ? -42.965 24.250 -26.323 1.00 99.52  ? 87  SER A C   1 
ATOM   338  O O   . SER A 1 52  ? -43.275 24.275 -27.514 1.00 105.75 ? 87  SER A O   1 
ATOM   339  C CB  . SER A 1 52  ? -40.479 24.502 -25.965 1.00 95.45  ? 87  SER A CB  1 
ATOM   340  O OG  . SER A 1 52  ? -40.208 23.615 -24.913 1.00 99.95  ? 87  SER A OG  1 
ATOM   341  N N   . LEU A 1 53  ? -43.569 23.458 -25.444 1.00 97.16  ? 88  LEU A N   1 
ATOM   342  C CA  . LEU A 1 53  ? -44.748 22.684 -25.809 1.00 102.29 ? 88  LEU A CA  1 
ATOM   343  C C   . LEU A 1 53  ? -45.938 23.609 -26.076 1.00 96.91  ? 88  LEU A C   1 
ATOM   344  O O   . LEU A 1 53  ? -46.657 23.432 -27.060 1.00 98.61  ? 88  LEU A O   1 
ATOM   345  C CB  . LEU A 1 53  ? -45.098 21.682 -24.707 1.00 108.89 ? 88  LEU A CB  1 
ATOM   346  C CG  . LEU A 1 53  ? -46.278 20.748 -24.999 1.00 111.06 ? 88  LEU A CG  1 
ATOM   347  C CD1 . LEU A 1 53  ? -45.818 19.516 -25.767 1.00 110.45 ? 88  LEU A CD1 1 
ATOM   348  C CD2 . LEU A 1 53  ? -46.974 20.358 -23.705 1.00 112.78 ? 88  LEU A CD2 1 
ATOM   349  N N   . ALA A 1 54  ? -46.146 24.586 -25.200 1.00 91.99  ? 89  ALA A N   1 
ATOM   350  C CA  . ALA A 1 54  ? -47.228 25.562 -25.381 1.00 94.80  ? 89  ALA A CA  1 
ATOM   351  C C   . ALA A 1 54  ? -47.107 26.353 -26.690 1.00 94.11  ? 89  ALA A C   1 
ATOM   352  O O   . ALA A 1 54  ? -48.119 26.734 -27.277 1.00 93.97  ? 89  ALA A O   1 
ATOM   353  C CB  . ALA A 1 54  ? -47.295 26.517 -24.198 1.00 94.37  ? 89  ALA A CB  1 
ATOM   354  N N   . PHE A 1 55  ? -45.878 26.600 -27.139 1.00 90.83  ? 90  PHE A N   1 
ATOM   355  C CA  . PHE A 1 55  ? -45.659 27.251 -28.426 1.00 93.22  ? 90  PHE A CA  1 
ATOM   356  C C   . PHE A 1 55  ? -46.040 26.335 -29.578 1.00 93.17  ? 90  PHE A C   1 
ATOM   357  O O   . PHE A 1 55  ? -46.811 26.721 -30.452 1.00 97.09  ? 90  PHE A O   1 
ATOM   358  C CB  . PHE A 1 55  ? -44.200 27.691 -28.586 1.00 95.97  ? 90  PHE A CB  1 
ATOM   359  C CG  . PHE A 1 55  ? -43.839 28.911 -27.787 1.00 95.79  ? 90  PHE A CG  1 
ATOM   360  C CD1 . PHE A 1 55  ? -42.736 28.904 -26.946 1.00 98.84  ? 90  PHE A CD1 1 
ATOM   361  C CD2 . PHE A 1 55  ? -44.597 30.071 -27.882 1.00 92.34  ? 90  PHE A CD2 1 
ATOM   362  C CE1 . PHE A 1 55  ? -42.400 30.028 -26.214 1.00 101.35 ? 90  PHE A CE1 1 
ATOM   363  C CE2 . PHE A 1 55  ? -44.267 31.196 -27.151 1.00 94.69  ? 90  PHE A CE2 1 
ATOM   364  C CZ  . PHE A 1 55  ? -43.169 31.175 -26.315 1.00 99.16  ? 90  PHE A CZ  1 
ATOM   365  N N   . LEU A 1 56  ? -45.483 25.129 -29.579 1.00 97.88  ? 91  LEU A N   1 
ATOM   366  C CA  . LEU A 1 56  ? -45.809 24.121 -30.589 1.00 98.56  ? 91  LEU A CA  1 
ATOM   367  C C   . LEU A 1 56  ? -47.309 23.920 -30.730 1.00 94.54  ? 91  LEU A C   1 
ATOM   368  O O   . LEU A 1 56  ? -47.836 23.931 -31.835 1.00 100.71 ? 91  LEU A O   1 
ATOM   369  C CB  . LEU A 1 56  ? -45.167 22.779 -30.239 1.00 101.45 ? 91  LEU A CB  1 
ATOM   370  C CG  . LEU A 1 56  ? -43.715 22.587 -30.660 1.00 105.82 ? 91  LEU A CG  1 
ATOM   371  C CD1 . LEU A 1 56  ? -43.140 21.357 -29.971 1.00 110.09 ? 91  LEU A CD1 1 
ATOM   372  C CD2 . LEU A 1 56  ? -43.603 22.464 -32.175 1.00 105.82 ? 91  LEU A CD2 1 
ATOM   373  N N   . VAL A 1 57  ? -47.991 23.741 -29.606 1.00 88.40  ? 92  VAL A N   1 
ATOM   374  C CA  . VAL A 1 57  ? -49.421 23.476 -29.626 1.00 90.14  ? 92  VAL A CA  1 
ATOM   375  C C   . VAL A 1 57  ? -50.180 24.635 -30.274 1.00 87.23  ? 92  VAL A C   1 
ATOM   376  O O   . VAL A 1 57  ? -51.038 24.412 -31.125 1.00 90.44  ? 92  VAL A O   1 
ATOM   377  C CB  . VAL A 1 57  ? -49.962 23.172 -28.209 1.00 92.42  ? 92  VAL A CB  1 
ATOM   378  C CG1 . VAL A 1 57  ? -51.490 23.186 -28.178 1.00 88.17  ? 92  VAL A CG1 1 
ATOM   379  C CG2 . VAL A 1 57  ? -49.431 21.825 -27.733 1.00 91.74  ? 92  VAL A CG2 1 
ATOM   380  N N   . SER A 1 58  ? -49.857 25.864 -29.884 1.00 85.70  ? 93  SER A N   1 
ATOM   381  C CA  . SER A 1 58  ? -50.508 27.043 -30.464 1.00 86.08  ? 93  SER A CA  1 
ATOM   382  C C   . SER A 1 58  ? -50.136 27.230 -31.935 1.00 84.50  ? 93  SER A C   1 
ATOM   383  O O   . SER A 1 58  ? -50.978 27.604 -32.747 1.00 88.33  ? 93  SER A O   1 
ATOM   384  C CB  . SER A 1 58  ? -50.167 28.301 -29.662 1.00 86.83  ? 93  SER A CB  1 
ATOM   385  O OG  . SER A 1 58  ? -48.803 28.310 -29.283 1.00 91.23  ? 93  SER A OG  1 
ATOM   386  N N   . TRP A 1 59  ? -48.885 26.951 -32.282 1.00 81.78  ? 94  TRP A N   1 
ATOM   387  C CA  . TRP A 1 59  ? -48.449 27.068 -33.668 1.00 86.57  ? 94  TRP A CA  1 
ATOM   388  C C   . TRP A 1 59  ? -49.083 26.011 -34.574 1.00 89.20  ? 94  TRP A C   1 
ATOM   389  O O   . TRP A 1 59  ? -49.381 26.293 -35.735 1.00 94.14  ? 94  TRP A O   1 
ATOM   390  C CB  . TRP A 1 59  ? -46.921 27.001 -33.773 1.00 89.29  ? 94  TRP A CB  1 
ATOM   391  C CG  . TRP A 1 59  ? -46.196 28.141 -33.107 1.00 86.41  ? 94  TRP A CG  1 
ATOM   392  C CD1 . TRP A 1 59  ? -46.692 29.378 -32.819 1.00 87.08  ? 94  TRP A CD1 1 
ATOM   393  C CD2 . TRP A 1 59  ? -44.830 28.148 -32.677 1.00 89.55  ? 94  TRP A CD2 1 
ATOM   394  N NE1 . TRP A 1 59  ? -45.726 30.149 -32.222 1.00 88.44  ? 94  TRP A NE1 1 
ATOM   395  C CE2 . TRP A 1 59  ? -44.572 29.420 -32.125 1.00 88.14  ? 94  TRP A CE2 1 
ATOM   396  C CE3 . TRP A 1 59  ? -43.799 27.200 -32.700 1.00 92.04  ? 94  TRP A CE3 1 
ATOM   397  C CZ2 . TRP A 1 59  ? -43.328 29.768 -31.594 1.00 86.72  ? 94  TRP A CZ2 1 
ATOM   398  C CZ3 . TRP A 1 59  ? -42.558 27.550 -32.175 1.00 89.63  ? 94  TRP A CZ3 1 
ATOM   399  C CH2 . TRP A 1 59  ? -42.337 28.823 -31.629 1.00 88.32  ? 94  TRP A CH2 1 
ATOM   400  N N   . LEU A 1 60  ? -49.276 24.800 -34.054 1.00 93.66  ? 95  LEU A N   1 
ATOM   401  C CA  . LEU A 1 60  ? -49.952 23.735 -34.809 1.00 95.10  ? 95  LEU A CA  1 
ATOM   402  C C   . LEU A 1 60  ? -51.453 23.984 -34.887 1.00 92.53  ? 95  LEU A C   1 
ATOM   403  O O   . LEU A 1 60  ? -52.062 23.794 -35.936 1.00 91.57  ? 95  LEU A O   1 
ATOM   404  C CB  . LEU A 1 60  ? -49.704 22.362 -34.180 1.00 96.82  ? 95  LEU A CB  1 
ATOM   405  C CG  . LEU A 1 60  ? -48.281 21.801 -34.235 1.00 100.24 ? 95  LEU A CG  1 
ATOM   406  C CD1 . LEU A 1 60  ? -48.192 20.549 -33.374 1.00 98.78  ? 95  LEU A CD1 1 
ATOM   407  C CD2 . LEU A 1 60  ? -47.842 21.505 -35.660 1.00 100.22 ? 95  LEU A CD2 1 
ATOM   408  N N   . LEU A 1 61  ? -52.048 24.403 -33.775 1.00 91.37  ? 96  LEU A N   1 
ATOM   409  C CA  . LEU A 1 61  ? -53.478 24.668 -33.741 1.00 93.95  ? 96  LEU A CA  1 
ATOM   410  C C   . LEU A 1 61  ? -53.841 25.649 -34.843 1.00 92.92  ? 96  LEU A C   1 
ATOM   411  O O   . LEU A 1 61  ? -54.659 25.343 -35.704 1.00 92.54  ? 96  LEU A O   1 
ATOM   412  C CB  . LEU A 1 61  ? -53.904 25.223 -32.380 1.00 102.30 ? 96  LEU A CB  1 
ATOM   413  C CG  . LEU A 1 61  ? -55.416 25.275 -32.132 1.00 111.66 ? 96  LEU A CG  1 
ATOM   414  C CD1 . LEU A 1 61  ? -55.957 23.878 -31.861 1.00 114.66 ? 96  LEU A CD1 1 
ATOM   415  C CD2 . LEU A 1 61  ? -55.753 26.209 -30.976 1.00 111.67 ? 96  LEU A CD2 1 
ATOM   416  N N   . PHE A 1 62  ? -53.202 26.816 -34.829 1.00 94.87  ? 97  PHE A N   1 
ATOM   417  C CA  . PHE A 1 62  ? -53.512 27.879 -35.790 1.00 91.40  ? 97  PHE A CA  1 
ATOM   418  C C   . PHE A 1 62  ? -53.060 27.519 -37.204 1.00 89.57  ? 97  PHE A C   1 
ATOM   419  O O   . PHE A 1 62  ? -53.728 27.862 -38.177 1.00 88.87  ? 97  PHE A O   1 
ATOM   420  C CB  . PHE A 1 62  ? -52.913 29.220 -35.336 1.00 90.12  ? 97  PHE A CB  1 
ATOM   421  C CG  . PHE A 1 62  ? -53.694 29.882 -34.228 1.00 85.14  ? 97  PHE A CG  1 
ATOM   422  C CD1 . PHE A 1 62  ? -53.274 29.791 -32.908 1.00 77.17  ? 97  PHE A CD1 1 
ATOM   423  C CD2 . PHE A 1 62  ? -54.868 30.579 -34.510 1.00 82.25  ? 97  PHE A CD2 1 
ATOM   424  C CE1 . PHE A 1 62  ? -53.998 30.387 -31.890 1.00 81.06  ? 97  PHE A CE1 1 
ATOM   425  C CE2 . PHE A 1 62  ? -55.597 31.178 -33.495 1.00 82.56  ? 97  PHE A CE2 1 
ATOM   426  C CZ  . PHE A 1 62  ? -55.164 31.080 -32.181 1.00 80.49  ? 97  PHE A CZ  1 
ATOM   427  N N   . GLY A 1 63  ? -51.937 26.816 -37.316 1.00 90.04  ? 98  GLY A N   1 
ATOM   428  C CA  . GLY A 1 63  ? -51.481 26.320 -38.607 1.00 91.65  ? 98  GLY A CA  1 
ATOM   429  C C   . GLY A 1 63  ? -52.563 25.485 -39.259 1.00 92.93  ? 98  GLY A C   1 
ATOM   430  O O   . GLY A 1 63  ? -52.889 25.677 -40.429 1.00 95.96  ? 98  GLY A O   1 
ATOM   431  N N   . LEU A 1 64  ? -53.133 24.570 -38.478 1.00 95.52  ? 99  LEU A N   1 
ATOM   432  C CA  . LEU A 1 64  ? -54.224 23.712 -38.928 1.00 95.58  ? 99  LEU A CA  1 
ATOM   433  C C   . LEU A 1 64  ? -55.458 24.522 -39.337 1.00 92.74  ? 99  LEU A C   1 
ATOM   434  O O   . LEU A 1 64  ? -56.084 24.230 -40.351 1.00 93.86  ? 99  LEU A O   1 
ATOM   435  C CB  . LEU A 1 64  ? -54.585 22.710 -37.823 1.00 100.73 ? 99  LEU A CB  1 
ATOM   436  C CG  . LEU A 1 64  ? -55.658 21.658 -38.121 1.00 106.57 ? 99  LEU A CG  1 
ATOM   437  C CD1 . LEU A 1 64  ? -55.238 20.766 -39.280 1.00 105.72 ? 99  LEU A CD1 1 
ATOM   438  C CD2 . LEU A 1 64  ? -55.935 20.832 -36.874 1.00 107.20 ? 99  LEU A CD2 1 
ATOM   439  N N   . ILE A 1 65  ? -55.798 25.541 -38.552 1.00 91.44  ? 100 ILE A N   1 
ATOM   440  C CA  . ILE A 1 65  ? -56.954 26.384 -38.850 1.00 87.70  ? 100 ILE A CA  1 
ATOM   441  C C   . ILE A 1 65  ? -56.756 27.165 -40.146 1.00 89.92  ? 100 ILE A C   1 
ATOM   442  O O   . ILE A 1 65  ? -57.681 27.269 -40.951 1.00 97.62  ? 100 ILE A O   1 
ATOM   443  C CB  . ILE A 1 65  ? -57.270 27.355 -37.693 1.00 88.11  ? 100 ILE A CB  1 
ATOM   444  C CG1 . ILE A 1 65  ? -57.735 26.570 -36.459 1.00 85.87  ? 100 ILE A CG1 1 
ATOM   445  C CG2 . ILE A 1 65  ? -58.349 28.354 -38.104 1.00 88.45  ? 100 ILE A CG2 1 
ATOM   446  C CD1 . ILE A 1 65  ? -57.815 27.393 -35.191 1.00 87.65  ? 100 ILE A CD1 1 
ATOM   447  N N   . PHE A 1 66  ? -55.561 27.714 -40.348 1.00 88.77  ? 101 PHE A N   1 
ATOM   448  C CA  . PHE A 1 66  ? -55.261 28.458 -41.579 1.00 86.62  ? 101 PHE A CA  1 
ATOM   449  C C   . PHE A 1 66  ? -55.218 27.538 -42.781 1.00 89.76  ? 101 PHE A C   1 
ATOM   450  O O   . PHE A 1 66  ? -55.572 27.947 -43.890 1.00 89.25  ? 101 PHE A O   1 
ATOM   451  C CB  . PHE A 1 66  ? -53.929 29.217 -41.481 1.00 84.91  ? 101 PHE A CB  1 
ATOM   452  C CG  . PHE A 1 66  ? -54.009 30.467 -40.661 1.00 82.38  ? 101 PHE A CG  1 
ATOM   453  C CD1 . PHE A 1 66  ? -53.215 30.628 -39.539 1.00 79.16  ? 101 PHE A CD1 1 
ATOM   454  C CD2 . PHE A 1 66  ? -54.903 31.476 -41.000 1.00 81.54  ? 101 PHE A CD2 1 
ATOM   455  C CE1 . PHE A 1 66  ? -53.305 31.774 -38.775 1.00 80.42  ? 101 PHE A CE1 1 
ATOM   456  C CE2 . PHE A 1 66  ? -54.996 32.624 -40.236 1.00 81.51  ? 101 PHE A CE2 1 
ATOM   457  C CZ  . PHE A 1 66  ? -54.195 32.775 -39.122 1.00 78.92  ? 101 PHE A CZ  1 
ATOM   458  N N   . TRP A 1 67  ? -54.762 26.307 -42.555 1.00 96.22  ? 102 TRP A N   1 
ATOM   459  C CA  . TRP A 1 67  ? -54.749 25.286 -43.593 1.00 97.65  ? 102 TRP A CA  1 
ATOM   460  C C   . TRP A 1 67  ? -56.173 24.914 -44.010 1.00 95.53  ? 102 TRP A C   1 
ATOM   461  O O   . TRP A 1 67  ? -56.456 24.814 -45.199 1.00 97.63  ? 102 TRP A O   1 
ATOM   462  C CB  . TRP A 1 67  ? -53.993 24.041 -43.127 1.00 99.16  ? 102 TRP A CB  1 
ATOM   463  C CG  . TRP A 1 67  ? -53.975 22.975 -44.166 1.00 107.70 ? 102 TRP A CG  1 
ATOM   464  C CD1 . TRP A 1 67  ? -53.157 22.905 -45.254 1.00 108.71 ? 102 TRP A CD1 1 
ATOM   465  C CD2 . TRP A 1 67  ? -54.835 21.835 -44.235 1.00 113.72 ? 102 TRP A CD2 1 
ATOM   466  N NE1 . TRP A 1 67  ? -53.446 21.786 -45.994 1.00 110.57 ? 102 TRP A NE1 1 
ATOM   467  C CE2 . TRP A 1 67  ? -54.473 21.110 -45.389 1.00 115.60 ? 102 TRP A CE2 1 
ATOM   468  C CE3 . TRP A 1 67  ? -55.877 21.353 -43.431 1.00 116.31 ? 102 TRP A CE3 1 
ATOM   469  C CZ2 . TRP A 1 67  ? -55.116 19.925 -45.760 1.00 118.58 ? 102 TRP A CZ2 1 
ATOM   470  C CZ3 . TRP A 1 67  ? -56.513 20.176 -43.800 1.00 116.11 ? 102 TRP A CZ3 1 
ATOM   471  C CH2 . TRP A 1 67  ? -56.130 19.477 -44.954 1.00 117.34 ? 102 TRP A CH2 1 
ATOM   472  N N   . LEU A 1 68  ? -57.060 24.713 -43.037 1.00 94.90  ? 103 LEU A N   1 
ATOM   473  C CA  . LEU A 1 68  ? -58.471 24.454 -43.336 1.00 100.41 ? 103 LEU A CA  1 
ATOM   474  C C   . LEU A 1 68  ? -59.068 25.573 -44.177 1.00 96.89  ? 103 LEU A C   1 
ATOM   475  O O   . LEU A 1 68  ? -59.705 25.318 -45.200 1.00 99.31  ? 103 LEU A O   1 
ATOM   476  C CB  . LEU A 1 68  ? -59.301 24.295 -42.055 1.00 106.32 ? 103 LEU A CB  1 
ATOM   477  C CG  . LEU A 1 68  ? -59.232 22.956 -41.319 1.00 110.83 ? 103 LEU A CG  1 
ATOM   478  C CD1 . LEU A 1 68  ? -60.206 22.961 -40.151 1.00 110.60 ? 103 LEU A CD1 1 
ATOM   479  C CD2 . LEU A 1 68  ? -59.527 21.796 -42.258 1.00 111.31 ? 103 LEU A CD2 1 
ATOM   480  N N   . ILE A 1 69  ? -58.860 26.811 -43.741 1.00 91.51  ? 104 ILE A N   1 
ATOM   481  C CA  . ILE A 1 69  ? -59.371 27.975 -44.464 1.00 90.87  ? 104 ILE A CA  1 
ATOM   482  C C   . ILE A 1 69  ? -58.863 27.998 -45.910 1.00 90.87  ? 104 ILE A C   1 
ATOM   483  O O   . ILE A 1 69  ? -59.612 28.336 -46.822 1.00 89.29  ? 104 ILE A O   1 
ATOM   484  C CB  . ILE A 1 69  ? -59.002 29.288 -43.745 1.00 92.38  ? 104 ILE A CB  1 
ATOM   485  C CG1 . ILE A 1 69  ? -59.792 29.417 -42.438 1.00 93.76  ? 104 ILE A CG1 1 
ATOM   486  C CG2 . ILE A 1 69  ? -59.279 30.493 -44.630 1.00 93.39  ? 104 ILE A CG2 1 
ATOM   487  C CD1 . ILE A 1 69  ? -59.251 30.470 -41.495 1.00 94.31  ? 104 ILE A CD1 1 
ATOM   488  N N   . ALA A 1 70  ? -57.602 27.625 -46.117 1.00 92.66  ? 105 ALA A N   1 
ATOM   489  C CA  . ALA A 1 70  ? -57.028 27.567 -47.464 1.00 95.34  ? 105 ALA A CA  1 
ATOM   490  C C   . ALA A 1 70  ? -57.741 26.528 -48.320 1.00 98.67  ? 105 ALA A C   1 
ATOM   491  O O   . ALA A 1 70  ? -58.149 26.815 -49.447 1.00 102.79 ? 105 ALA A O   1 
ATOM   492  C CB  . ALA A 1 70  ? -55.540 27.256 -47.399 1.00 95.16  ? 105 ALA A CB  1 
ATOM   493  N N   . LEU A 1 71  ? -57.879 25.325 -47.767 1.00 101.40 ? 106 LEU A N   1 
ATOM   494  C CA  . LEU A 1 71  ? -58.549 24.205 -48.432 1.00 105.44 ? 106 LEU A CA  1 
ATOM   495  C C   . LEU A 1 71  ? -59.956 24.557 -48.919 1.00 100.21 ? 106 LEU A C   1 
ATOM   496  O O   . LEU A 1 71  ? -60.257 24.432 -50.106 1.00 95.17  ? 106 LEU A O   1 
ATOM   497  C CB  . LEU A 1 71  ? -58.621 23.015 -47.471 1.00 109.81 ? 106 LEU A CB  1 
ATOM   498  C CG  . LEU A 1 71  ? -59.309 21.740 -47.950 1.00 109.82 ? 106 LEU A CG  1 
ATOM   499  C CD1 . LEU A 1 71  ? -58.608 21.182 -49.177 1.00 111.78 ? 106 LEU A CD1 1 
ATOM   500  C CD2 . LEU A 1 71  ? -59.329 20.721 -46.822 1.00 110.73 ? 106 LEU A CD2 1 
ATOM   501  N N   . ILE A 1 72  ? -60.802 25.014 -48.000 1.00 95.37  ? 107 ILE A N   1 
ATOM   502  C CA  . ILE A 1 72  ? -62.193 25.343 -48.319 1.00 98.61  ? 107 ILE A CA  1 
ATOM   503  C C   . ILE A 1 72  ? -62.303 26.491 -49.333 1.00 101.67 ? 107 ILE A C   1 
ATOM   504  O O   . ILE A 1 72  ? -63.238 26.529 -50.132 1.00 107.57 ? 107 ILE A O   1 
ATOM   505  C CB  . ILE A 1 72  ? -63.004 25.673 -47.039 1.00 103.07 ? 107 ILE A CB  1 
ATOM   506  C CG1 . ILE A 1 72  ? -63.459 24.385 -46.341 1.00 106.23 ? 107 ILE A CG1 1 
ATOM   507  C CG2 . ILE A 1 72  ? -64.247 26.504 -47.351 1.00 102.97 ? 107 ILE A CG2 1 
ATOM   508  C CD1 . ILE A 1 72  ? -62.358 23.575 -45.692 1.00 108.14 ? 107 ILE A CD1 1 
ATOM   509  N N   . HIS A 1 73  ? -61.351 27.418 -49.302 1.00 100.93 ? 108 HIS A N   1 
ATOM   510  C CA  . HIS A 1 73  ? -61.376 28.574 -50.195 1.00 95.35  ? 108 HIS A CA  1 
ATOM   511  C C   . HIS A 1 73  ? -60.824 28.248 -51.586 1.00 95.76  ? 108 HIS A C   1 
ATOM   512  O O   . HIS A 1 73  ? -61.044 29.003 -52.537 1.00 95.38  ? 108 HIS A O   1 
ATOM   513  C CB  . HIS A 1 73  ? -60.587 29.721 -49.572 1.00 92.71  ? 108 HIS A CB  1 
ATOM   514  C CG  . HIS A 1 73  ? -60.976 31.071 -50.082 1.00 95.21  ? 108 HIS A CG  1 
ATOM   515  N ND1 . HIS A 1 73  ? -60.253 31.741 -51.045 1.00 97.36  ? 108 HIS A ND1 1 
ATOM   516  C CD2 . HIS A 1 73  ? -62.007 31.884 -49.749 1.00 95.02  ? 108 HIS A CD2 1 
ATOM   517  C CE1 . HIS A 1 73  ? -60.825 32.908 -51.289 1.00 98.84  ? 108 HIS A CE1 1 
ATOM   518  N NE2 . HIS A 1 73  ? -61.890 33.020 -50.515 1.00 97.00  ? 108 HIS A NE2 1 
ATOM   519  N N   . GLY A 1 74  ? -60.108 27.131 -51.700 1.00 94.60  ? 109 GLY A N   1 
ATOM   520  C CA  . GLY A 1 74  ? -59.497 26.722 -52.964 1.00 93.62  ? 109 GLY A CA  1 
ATOM   521  C C   . GLY A 1 74  ? -58.135 27.347 -53.193 1.00 94.49  ? 109 GLY A C   1 
ATOM   522  O O   . GLY A 1 74  ? -57.657 27.414 -54.330 1.00 93.64  ? 109 GLY A O   1 
ATOM   523  N N   . ASP A 1 75  ? -57.499 27.782 -52.104 1.00 98.61  ? 110 ASP A N   1 
ATOM   524  C CA  . ASP A 1 75  ? -56.214 28.480 -52.170 1.00 94.13  ? 110 ASP A CA  1 
ATOM   525  C C   . ASP A 1 75  ? -55.043 27.541 -52.468 1.00 93.95  ? 110 ASP A C   1 
ATOM   526  O O   . ASP A 1 75  ? -54.058 27.959 -53.064 1.00 94.39  ? 110 ASP A O   1 
ATOM   527  C CB  . ASP A 1 75  ? -55.949 29.226 -50.864 1.00 95.80  ? 110 ASP A CB  1 
ATOM   528  C CG  . ASP A 1 75  ? -57.015 30.255 -50.550 1.00 99.88  ? 110 ASP A CG  1 
ATOM   529  O OD1 . ASP A 1 75  ? -57.824 30.572 -51.447 1.00 93.30  ? 110 ASP A OD1 1 
ATOM   530  O OD2 . ASP A 1 75  ? -57.043 30.750 -49.399 1.00 108.91 ? 110 ASP A OD2 1 
ATOM   531  N N   . LEU A 1 76  ? -55.153 26.276 -52.073 1.00 93.43  ? 111 LEU A N   1 
ATOM   532  C CA  . LEU A 1 76  ? -54.094 25.302 -52.337 1.00 95.04  ? 111 LEU A CA  1 
ATOM   533  C C   . LEU A 1 76  ? -53.875 25.053 -53.836 1.00 98.89  ? 111 LEU A C   1 
ATOM   534  O O   . LEU A 1 76  ? -52.789 24.637 -54.234 1.00 102.92 ? 111 LEU A O   1 
ATOM   535  C CB  . LEU A 1 76  ? -54.381 23.982 -51.615 1.00 98.77  ? 111 LEU A CB  1 
ATOM   536  C CG  . LEU A 1 76  ? -54.501 24.046 -50.086 1.00 101.18 ? 111 LEU A CG  1 
ATOM   537  C CD1 . LEU A 1 76  ? -55.101 22.763 -49.532 1.00 100.87 ? 111 LEU A CD1 1 
ATOM   538  C CD2 . LEU A 1 76  ? -53.157 24.328 -49.433 1.00 103.54 ? 111 LEU A CD2 1 
ATOM   539  N N   . GLU A 1 77  ? -54.900 25.307 -54.655 1.00 107.47 ? 112 GLU A N   1 
ATOM   540  C CA  . GLU A 1 77  ? -54.791 25.205 -56.126 1.00 109.19 ? 112 GLU A CA  1 
ATOM   541  C C   . GLU A 1 77  ? -54.278 26.485 -56.805 1.00 105.39 ? 112 GLU A C   1 
ATOM   542  O O   . GLU A 1 77  ? -53.832 26.436 -57.952 1.00 99.10  ? 112 GLU A O   1 
ATOM   543  C CB  . GLU A 1 77  ? -56.141 24.818 -56.748 1.00 111.83 ? 112 GLU A CB  1 
ATOM   544  C CG  . GLU A 1 77  ? -56.359 23.319 -56.900 1.00 116.99 ? 112 GLU A CG  1 
ATOM   545  C CD  . GLU A 1 77  ? -56.621 22.615 -55.583 1.00 117.60 ? 112 GLU A CD  1 
ATOM   546  O OE1 . GLU A 1 77  ? -57.514 23.059 -54.830 1.00 117.37 ? 112 GLU A OE1 1 
ATOM   547  O OE2 . GLU A 1 77  ? -55.944 21.603 -55.309 1.00 117.31 ? 112 GLU A OE2 1 
ATOM   548  N N   . ASN A 1 78  ? -54.364 27.618 -56.109 1.00 106.39 ? 113 ASN A N   1 
ATOM   549  C CA  . ASN A 1 78  ? -53.908 28.910 -56.633 1.00 109.09 ? 113 ASN A CA  1 
ATOM   550  C C   . ASN A 1 78  ? -53.396 29.810 -55.489 1.00 108.15 ? 113 ASN A C   1 
ATOM   551  O O   . ASN A 1 78  ? -54.023 30.818 -55.155 1.00 104.68 ? 113 ASN A O   1 
ATOM   552  C CB  . ASN A 1 78  ? -55.053 29.586 -57.405 1.00 110.86 ? 113 ASN A CB  1 
ATOM   553  C CG  . ASN A 1 78  ? -54.601 30.806 -58.198 1.00 113.14 ? 113 ASN A CG  1 
ATOM   554  O OD1 . ASN A 1 78  ? -53.411 30.989 -58.467 1.00 117.05 ? 113 ASN A OD1 1 
ATOM   555  N ND2 . ASN A 1 78  ? -55.559 31.644 -58.584 1.00 110.87 ? 113 ASN A ND2 1 
ATOM   556  N N   . PRO A 1 79  ? -52.248 29.442 -54.883 1.00 106.94 ? 114 PRO A N   1 
ATOM   557  C CA  . PRO A 1 79  ? -51.784 30.089 -53.650 1.00 104.67 ? 114 PRO A CA  1 
ATOM   558  C C   . PRO A 1 79  ? -51.306 31.528 -53.824 1.00 104.80 ? 114 PRO A C   1 
ATOM   559  O O   . PRO A 1 79  ? -51.432 32.325 -52.895 1.00 107.32 ? 114 PRO A O   1 
ATOM   560  C CB  . PRO A 1 79  ? -50.619 29.196 -53.188 1.00 105.17 ? 114 PRO A CB  1 
ATOM   561  C CG  . PRO A 1 79  ? -50.601 28.013 -54.097 1.00 104.17 ? 114 PRO A CG  1 
ATOM   562  C CD  . PRO A 1 79  ? -51.286 28.432 -55.355 1.00 107.59 ? 114 PRO A CD  1 
ATOM   563  N N   . GLY A 1 80  ? -50.747 31.849 -54.988 1.00 103.03 ? 115 GLY A N   1 
ATOM   564  C CA  . GLY A 1 80  ? -50.338 33.217 -55.302 1.00 100.97 ? 115 GLY A CA  1 
ATOM   565  C C   . GLY A 1 80  ? -51.493 34.123 -55.703 1.00 103.38 ? 115 GLY A C   1 
ATOM   566  O O   . GLY A 1 80  ? -51.394 35.345 -55.580 1.00 106.05 ? 115 GLY A O   1 
ATOM   567  N N   . GLY A 1 81  ? -52.585 33.531 -56.186 1.00 104.66 ? 116 GLY A N   1 
ATOM   568  C CA  . GLY A 1 81  ? -53.740 34.293 -56.669 1.00 102.47 ? 116 GLY A CA  1 
ATOM   569  C C   . GLY A 1 81  ? -53.501 34.869 -58.052 1.00 101.50 ? 116 GLY A C   1 
ATOM   570  O O   . GLY A 1 81  ? -52.447 34.649 -58.651 1.00 101.31 ? 116 GLY A O   1 
ATOM   571  N N   . ASP A 1 82  ? -54.487 35.600 -58.562 1.00 105.58 ? 117 ASP A N   1 
ATOM   572  C CA  . ASP A 1 82  ? -54.363 36.293 -59.853 1.00 111.73 ? 117 ASP A CA  1 
ATOM   573  C C   . ASP A 1 82  ? -55.372 37.454 -59.931 1.00 115.32 ? 117 ASP A C   1 
ATOM   574  O O   . ASP A 1 82  ? -55.882 37.894 -58.895 1.00 107.28 ? 117 ASP A O   1 
ATOM   575  C CB  . ASP A 1 82  ? -54.504 35.298 -61.021 1.00 110.24 ? 117 ASP A CB  1 
ATOM   576  C CG  . ASP A 1 82  ? -55.821 34.527 -60.996 1.00 114.01 ? 117 ASP A CG  1 
ATOM   577  O OD1 . ASP A 1 82  ? -56.897 35.155 -60.873 1.00 110.97 ? 117 ASP A OD1 1 
ATOM   578  O OD2 . ASP A 1 82  ? -55.777 33.283 -61.117 1.00 115.23 ? 117 ASP A OD2 1 
ATOM   579  N N   . ASP A 1 83  ? -55.640 37.959 -61.138 1.00 122.02 ? 118 ASP A N   1 
ATOM   580  C CA  . ASP A 1 83  ? -56.570 39.083 -61.329 1.00 126.87 ? 118 ASP A CA  1 
ATOM   581  C C   . ASP A 1 83  ? -58.008 38.746 -60.939 1.00 125.00 ? 118 ASP A C   1 
ATOM   582  O O   . ASP A 1 83  ? -58.761 39.627 -60.519 1.00 120.12 ? 118 ASP A O   1 
ATOM   583  C CB  . ASP A 1 83  ? -56.548 39.571 -62.787 1.00 132.90 ? 118 ASP A CB  1 
ATOM   584  C CG  . ASP A 1 83  ? -55.243 40.265 -63.164 1.00 137.99 ? 118 ASP A CG  1 
ATOM   585  O OD1 . ASP A 1 83  ? -54.534 40.764 -62.260 1.00 142.37 ? 118 ASP A OD1 1 
ATOM   586  O OD2 . ASP A 1 83  ? -54.931 40.321 -64.374 1.00 134.04 ? 118 ASP A OD2 1 
ATOM   587  N N   . THR A 1 84  ? -58.383 37.476 -61.088 1.00 128.35 ? 119 THR A N   1 
ATOM   588  C CA  . THR A 1 84  ? -59.737 37.014 -60.776 1.00 127.18 ? 119 THR A CA  1 
ATOM   589  C C   . THR A 1 84  ? -59.862 36.421 -59.371 1.00 123.93 ? 119 THR A C   1 
ATOM   590  O O   . THR A 1 84  ? -60.940 36.473 -58.776 1.00 127.16 ? 119 THR A O   1 
ATOM   591  C CB  . THR A 1 84  ? -60.208 35.951 -61.792 1.00 128.03 ? 119 THR A CB  1 
ATOM   592  O OG1 . THR A 1 84  ? -59.422 34.760 -61.650 1.00 134.19 ? 119 THR A OG1 1 
ATOM   593  C CG2 . THR A 1 84  ? -60.086 36.470 -63.224 1.00 125.70 ? 119 THR A CG2 1 
ATOM   594  N N   . PHE A 1 85  ? -58.766 35.862 -58.850 1.00 119.32 ? 120 PHE A N   1 
ATOM   595  C CA  . PHE A 1 85  ? -58.785 35.109 -57.589 1.00 115.65 ? 120 PHE A CA  1 
ATOM   596  C C   . PHE A 1 85  ? -57.799 35.660 -56.556 1.00 112.48 ? 120 PHE A C   1 
ATOM   597  O O   . PHE A 1 85  ? -56.606 35.796 -56.840 1.00 111.48 ? 120 PHE A O   1 
ATOM   598  C CB  . PHE A 1 85  ? -58.455 33.640 -57.870 1.00 113.04 ? 120 PHE A CB  1 
ATOM   599  C CG  . PHE A 1 85  ? -58.580 32.749 -56.669 1.00 111.76 ? 120 PHE A CG  1 
ATOM   600  C CD1 . PHE A 1 85  ? -59.829 32.386 -56.191 1.00 110.56 ? 120 PHE A CD1 1 
ATOM   601  C CD2 . PHE A 1 85  ? -57.449 32.267 -56.018 1.00 111.43 ? 120 PHE A CD2 1 
ATOM   602  C CE1 . PHE A 1 85  ? -59.951 31.563 -55.084 1.00 111.41 ? 120 PHE A CE1 1 
ATOM   603  C CE2 . PHE A 1 85  ? -57.565 31.443 -54.910 1.00 109.15 ? 120 PHE A CE2 1 
ATOM   604  C CZ  . PHE A 1 85  ? -58.819 31.091 -54.443 1.00 109.37 ? 120 PHE A CZ  1 
ATOM   605  N N   . LYS A 1 86  ? -58.304 35.961 -55.359 1.00 107.24 ? 121 LYS A N   1 
ATOM   606  C CA  . LYS A 1 86  ? -57.464 36.372 -54.233 1.00 106.74 ? 121 LYS A CA  1 
ATOM   607  C C   . LYS A 1 86  ? -57.607 35.403 -53.052 1.00 104.28 ? 121 LYS A C   1 
ATOM   608  O O   . LYS A 1 86  ? -58.702 35.261 -52.501 1.00 102.31 ? 121 LYS A O   1 
ATOM   609  C CB  . LYS A 1 86  ? -57.819 37.786 -53.777 1.00 107.91 ? 121 LYS A CB  1 
ATOM   610  C CG  . LYS A 1 86  ? -56.948 38.281 -52.626 1.00 110.74 ? 121 LYS A CG  1 
ATOM   611  C CD  . LYS A 1 86  ? -56.566 39.744 -52.776 1.00 111.03 ? 121 LYS A CD  1 
ATOM   612  C CE  . LYS A 1 86  ? -57.746 40.667 -52.548 1.00 110.83 ? 121 LYS A CE  1 
ATOM   613  N NZ  . LYS A 1 86  ? -57.400 42.053 -52.955 1.00 115.32 ? 121 LYS A NZ  1 
ATOM   614  N N   . PRO A 1 87  ? -56.499 34.748 -52.644 1.00 99.89  ? 122 PRO A N   1 
ATOM   615  C CA  . PRO A 1 87  ? -56.549 33.836 -51.492 1.00 96.93  ? 122 PRO A CA  1 
ATOM   616  C C   . PRO A 1 87  ? -56.837 34.536 -50.167 1.00 95.41  ? 122 PRO A C   1 
ATOM   617  O O   . PRO A 1 87  ? -56.760 35.758 -50.079 1.00 96.33  ? 122 PRO A O   1 
ATOM   618  C CB  . PRO A 1 87  ? -55.143 33.216 -51.449 1.00 95.70  ? 122 PRO A CB  1 
ATOM   619  C CG  . PRO A 1 87  ? -54.468 33.599 -52.714 1.00 97.52  ? 122 PRO A CG  1 
ATOM   620  C CD  . PRO A 1 87  ? -55.158 34.809 -53.251 1.00 99.74  ? 122 PRO A CD  1 
ATOM   621  N N   . CYS A 1 88  ? -57.176 33.751 -49.150 1.00 97.59  ? 123 CYS A N   1 
ATOM   622  C CA  . CYS A 1 88  ? -57.269 34.251 -47.779 1.00 100.65 ? 123 CYS A CA  1 
ATOM   623  C C   . CYS A 1 88  ? -55.890 34.661 -47.255 1.00 95.04  ? 123 CYS A C   1 
ATOM   624  O O   . CYS A 1 88  ? -55.740 35.688 -46.597 1.00 93.15  ? 123 CYS A O   1 
ATOM   625  C CB  . CYS A 1 88  ? -57.855 33.174 -46.854 1.00 104.29 ? 123 CYS A CB  1 
ATOM   626  S SG  . CYS A 1 88  ? -59.540 32.651 -47.249 1.00 104.04 ? 123 CYS A SG  1 
ATOM   627  N N   . VAL A 1 89  ? -54.893 33.830 -47.540 1.00 89.25  ? 124 VAL A N   1 
ATOM   628  C CA  . VAL A 1 89  ? -53.533 34.056 -47.083 1.00 89.49  ? 124 VAL A CA  1 
ATOM   629  C C   . VAL A 1 89  ? -52.579 33.620 -48.183 1.00 88.51  ? 124 VAL A C   1 
ATOM   630  O O   . VAL A 1 89  ? -52.502 32.438 -48.519 1.00 92.79  ? 124 VAL A O   1 
ATOM   631  C CB  . VAL A 1 89  ? -53.232 33.265 -45.793 1.00 89.29  ? 124 VAL A CB  1 
ATOM   632  C CG1 . VAL A 1 89  ? -51.771 33.419 -45.395 1.00 92.36  ? 124 VAL A CG1 1 
ATOM   633  C CG2 . VAL A 1 89  ? -54.145 33.724 -44.663 1.00 89.35  ? 124 VAL A CG2 1 
ATOM   634  N N   . LEU A 1 90  ? -51.848 34.581 -48.732 1.00 81.64  ? 125 LEU A N   1 
ATOM   635  C CA  . LEU A 1 90  ? -50.956 34.320 -49.844 1.00 82.58  ? 125 LEU A CA  1 
ATOM   636  C C   . LEU A 1 90  ? -49.924 33.235 -49.522 1.00 84.14  ? 125 LEU A C   1 
ATOM   637  O O   . LEU A 1 90  ? -49.458 33.115 -48.393 1.00 83.29  ? 125 LEU A O   1 
ATOM   638  C CB  . LEU A 1 90  ? -50.257 35.614 -50.261 1.00 85.13  ? 125 LEU A CB  1 
ATOM   639  C CG  . LEU A 1 90  ? -51.173 36.646 -50.928 1.00 83.57  ? 125 LEU A CG  1 
ATOM   640  C CD1 . LEU A 1 90  ? -50.651 38.060 -50.733 1.00 85.00  ? 125 LEU A CD1 1 
ATOM   641  C CD2 . LEU A 1 90  ? -51.328 36.328 -52.407 1.00 82.90  ? 125 LEU A CD2 1 
ATOM   642  N N   . GLN A 1 91  ? -49.611 32.431 -50.532 1.00 88.44  ? 126 GLN A N   1 
ATOM   643  C CA  . GLN A 1 91  ? -48.565 31.413 -50.467 1.00 88.06  ? 126 GLN A CA  1 
ATOM   644  C C   . GLN A 1 91  ? -48.744 30.313 -49.407 1.00 89.79  ? 126 GLN A C   1 
ATOM   645  O O   . GLN A 1 91  ? -47.758 29.714 -48.967 1.00 92.20  ? 126 GLN A O   1 
ATOM   646  C CB  . GLN A 1 91  ? -47.194 32.089 -50.316 1.00 91.32  ? 126 GLN A CB  1 
ATOM   647  C CG  . GLN A 1 91  ? -46.897 33.140 -51.379 1.00 92.91  ? 126 GLN A CG  1 
ATOM   648  C CD  . GLN A 1 91  ? -46.972 32.600 -52.802 1.00 95.60  ? 126 GLN A CD  1 
ATOM   649  O OE1 . GLN A 1 91  ? -47.284 33.339 -53.734 1.00 95.96  ? 126 GLN A OE1 1 
ATOM   650  N NE2 . GLN A 1 91  ? -46.694 31.308 -52.973 1.00 96.68  ? 126 GLN A NE2 1 
ATOM   651  N N   . VAL A 1 92  ? -49.986 30.033 -49.010 1.00 90.29  ? 127 VAL A N   1 
ATOM   652  C CA  . VAL A 1 92  ? -50.276 28.830 -48.223 1.00 93.41  ? 127 VAL A CA  1 
ATOM   653  C C   . VAL A 1 92  ? -50.636 27.702 -49.195 1.00 97.30  ? 127 VAL A C   1 
ATOM   654  O O   . VAL A 1 92  ? -51.786 27.572 -49.627 1.00 92.89  ? 127 VAL A O   1 
ATOM   655  C CB  . VAL A 1 92  ? -51.393 29.052 -47.182 1.00 92.05  ? 127 VAL A CB  1 
ATOM   656  C CG1 . VAL A 1 92  ? -51.788 27.737 -46.517 1.00 91.03  ? 127 VAL A CG1 1 
ATOM   657  C CG2 . VAL A 1 92  ? -50.933 30.045 -46.125 1.00 93.24  ? 127 VAL A CG2 1 
ATOM   658  N N   . ASN A 1 93  ? -49.627 26.904 -49.536 1.00 97.91  ? 128 ASN A N   1 
ATOM   659  C CA  . ASN A 1 93  ? -49.748 25.846 -50.539 1.00 99.13  ? 128 ASN A CA  1 
ATOM   660  C C   . ASN A 1 93  ? -49.820 24.432 -49.948 1.00 99.80  ? 128 ASN A C   1 
ATOM   661  O O   . ASN A 1 93  ? -49.898 23.449 -50.687 1.00 101.18 ? 128 ASN A O   1 
ATOM   662  C CB  . ASN A 1 93  ? -48.575 25.940 -51.526 1.00 97.76  ? 128 ASN A CB  1 
ATOM   663  C CG  . ASN A 1 93  ? -47.226 25.704 -50.868 1.00 96.63  ? 128 ASN A CG  1 
ATOM   664  O OD1 . ASN A 1 93  ? -47.139 25.433 -49.673 1.00 100.48 ? 128 ASN A OD1 1 
ATOM   665  N ND2 . ASN A 1 93  ? -46.166 25.801 -51.653 1.00 100.94 ? 128 ASN A ND2 1 
ATOM   666  N N   . GLY A 1 94  ? -49.789 24.338 -48.620 1.00 101.93 ? 129 GLY A N   1 
ATOM   667  C CA  . GLY A 1 94  ? -49.810 23.052 -47.922 1.00 100.10 ? 129 GLY A CA  1 
ATOM   668  C C   . GLY A 1 94  ? -49.870 23.251 -46.420 1.00 99.81  ? 129 GLY A C   1 
ATOM   669  O O   . GLY A 1 94  ? -50.136 24.356 -45.947 1.00 103.19 ? 129 GLY A O   1 
ATOM   670  N N   . PHE A 1 95  ? -49.626 22.186 -45.663 1.00 105.82 ? 130 PHE A N   1 
ATOM   671  C CA  . PHE A 1 95  ? -49.626 22.283 -44.203 1.00 110.22 ? 130 PHE A CA  1 
ATOM   672  C C   . PHE A 1 95  ? -48.356 22.963 -43.697 1.00 101.89 ? 130 PHE A C   1 
ATOM   673  O O   . PHE A 1 95  ? -48.415 23.782 -42.778 1.00 97.85  ? 130 PHE A O   1 
ATOM   674  C CB  . PHE A 1 95  ? -49.784 20.910 -43.538 1.00 115.88 ? 130 PHE A CB  1 
ATOM   675  C CG  . PHE A 1 95  ? -49.927 20.984 -42.036 1.00 127.86 ? 130 PHE A CG  1 
ATOM   676  C CD1 . PHE A 1 95  ? -51.150 21.316 -41.455 1.00 128.89 ? 130 PHE A CD1 1 
ATOM   677  C CD2 . PHE A 1 95  ? -48.837 20.745 -41.201 1.00 132.91 ? 130 PHE A CD2 1 
ATOM   678  C CE1 . PHE A 1 95  ? -51.285 21.397 -40.077 1.00 128.33 ? 130 PHE A CE1 1 
ATOM   679  C CE2 . PHE A 1 95  ? -48.968 20.824 -39.821 1.00 133.39 ? 130 PHE A CE2 1 
ATOM   680  C CZ  . PHE A 1 95  ? -50.193 21.151 -39.259 1.00 131.19 ? 130 PHE A CZ  1 
ATOM   681  N N   . VAL A 1 96  ? -47.215 22.627 -44.293 1.00 95.11  ? 131 VAL A N   1 
ATOM   682  C CA  . VAL A 1 96  ? -45.942 23.220 -43.884 1.00 93.74  ? 131 VAL A CA  1 
ATOM   683  C C   . VAL A 1 96  ? -45.971 24.738 -44.064 1.00 92.52  ? 131 VAL A C   1 
ATOM   684  O O   . VAL A 1 96  ? -45.555 25.475 -43.174 1.00 92.50  ? 131 VAL A O   1 
ATOM   685  C CB  . VAL A 1 96  ? -44.746 22.587 -44.629 1.00 91.02  ? 131 VAL A CB  1 
ATOM   686  C CG1 . VAL A 1 96  ? -43.478 23.407 -44.436 1.00 92.93  ? 131 VAL A CG1 1 
ATOM   687  C CG2 . VAL A 1 96  ? -44.523 21.164 -44.135 1.00 88.76  ? 131 VAL A CG2 1 
ATOM   688  N N   . ALA A 1 97  ? -46.475 25.198 -45.205 1.00 93.58  ? 132 ALA A N   1 
ATOM   689  C CA  . ALA A 1 97  ? -46.681 26.629 -45.435 1.00 92.45  ? 132 ALA A CA  1 
ATOM   690  C C   . ALA A 1 97  ? -47.679 27.232 -44.438 1.00 92.43  ? 132 ALA A C   1 
ATOM   691  O O   . ALA A 1 97  ? -47.459 28.334 -43.928 1.00 96.58  ? 132 ALA A O   1 
ATOM   692  C CB  . ALA A 1 97  ? -47.147 26.874 -46.858 1.00 92.18  ? 132 ALA A CB  1 
ATOM   693  N N   . ALA A 1 98  ? -48.768 26.515 -44.166 1.00 89.13  ? 133 ALA A N   1 
ATOM   694  C CA  . ALA A 1 98  ? -49.748 26.952 -43.164 1.00 90.12  ? 133 ALA A CA  1 
ATOM   695  C C   . ALA A 1 98  ? -49.111 27.065 -41.785 1.00 89.30  ? 133 ALA A C   1 
ATOM   696  O O   . ALA A 1 98  ? -49.370 28.016 -41.048 1.00 92.28  ? 133 ALA A O   1 
ATOM   697  C CB  . ALA A 1 98  ? -50.923 25.992 -43.112 1.00 90.64  ? 133 ALA A CB  1 
ATOM   698  N N   . PHE A 1 99  ? -48.282 26.079 -41.455 1.00 86.04  ? 134 PHE A N   1 
ATOM   699  C CA  . PHE A 1 99  ? -47.557 26.030 -40.190 1.00 82.89  ? 134 PHE A CA  1 
ATOM   700  C C   . PHE A 1 99  ? -46.592 27.205 -40.092 1.00 82.54  ? 134 PHE A C   1 
ATOM   701  O O   . PHE A 1 99  ? -46.553 27.905 -39.083 1.00 85.78  ? 134 PHE A O   1 
ATOM   702  C CB  . PHE A 1 99  ? -46.801 24.695 -40.088 1.00 81.93  ? 134 PHE A CB  1 
ATOM   703  C CG  . PHE A 1 99  ? -46.114 24.463 -38.768 1.00 81.58  ? 134 PHE A CG  1 
ATOM   704  C CD1 . PHE A 1 99  ? -46.767 24.696 -37.567 1.00 79.87  ? 134 PHE A CD1 1 
ATOM   705  C CD2 . PHE A 1 99  ? -44.813 23.972 -38.733 1.00 84.51  ? 134 PHE A CD2 1 
ATOM   706  C CE1 . PHE A 1 99  ? -46.128 24.472 -36.361 1.00 82.45  ? 134 PHE A CE1 1 
ATOM   707  C CE2 . PHE A 1 99  ? -44.170 23.741 -37.528 1.00 81.96  ? 134 PHE A CE2 1 
ATOM   708  C CZ  . PHE A 1 99  ? -44.829 23.991 -36.341 1.00 82.17  ? 134 PHE A CZ  1 
ATOM   709  N N   . LEU A 1 100 ? -45.827 27.420 -41.154 1.00 81.91  ? 135 LEU A N   1 
ATOM   710  C CA  . LEU A 1 100 ? -44.892 28.538 -41.224 1.00 80.77  ? 135 LEU A CA  1 
ATOM   711  C C   . LEU A 1 100 ? -45.594 29.882 -41.038 1.00 81.21  ? 135 LEU A C   1 
ATOM   712  O O   . LEU A 1 100 ? -45.111 30.736 -40.295 1.00 86.64  ? 135 LEU A O   1 
ATOM   713  C CB  . LEU A 1 100 ? -44.143 28.523 -42.557 1.00 81.89  ? 135 LEU A CB  1 
ATOM   714  C CG  . LEU A 1 100 ? -43.124 27.394 -42.736 1.00 80.55  ? 135 LEU A CG  1 
ATOM   715  C CD1 . LEU A 1 100 ? -42.745 27.278 -44.202 1.00 84.32  ? 135 LEU A CD1 1 
ATOM   716  C CD2 . LEU A 1 100 ? -41.888 27.602 -41.871 1.00 79.86  ? 135 LEU A CD2 1 
ATOM   717  N N   . PHE A 1 101 ? -46.732 30.067 -41.698 1.00 79.06  ? 136 PHE A N   1 
ATOM   718  C CA  . PHE A 1 101 ? -47.501 31.300 -41.533 1.00 80.72  ? 136 PHE A CA  1 
ATOM   719  C C   . PHE A 1 101 ? -47.989 31.487 -40.094 1.00 78.77  ? 136 PHE A C   1 
ATOM   720  O O   . PHE A 1 101 ? -48.042 32.608 -39.598 1.00 82.51  ? 136 PHE A O   1 
ATOM   721  C CB  . PHE A 1 101 ? -48.690 31.351 -42.499 1.00 82.06  ? 136 PHE A CB  1 
ATOM   722  C CG  . PHE A 1 101 ? -49.556 32.564 -42.313 1.00 81.47  ? 136 PHE A CG  1 
ATOM   723  C CD1 . PHE A 1 101 ? -49.112 33.815 -42.722 1.00 83.84  ? 136 PHE A CD1 1 
ATOM   724  C CD2 . PHE A 1 101 ? -50.794 32.465 -41.699 1.00 79.23  ? 136 PHE A CD2 1 
ATOM   725  C CE1 . PHE A 1 101 ? -49.894 34.940 -42.537 1.00 80.53  ? 136 PHE A CE1 1 
ATOM   726  C CE2 . PHE A 1 101 ? -51.582 33.584 -41.515 1.00 77.99  ? 136 PHE A CE2 1 
ATOM   727  C CZ  . PHE A 1 101 ? -51.133 34.821 -41.935 1.00 79.38  ? 136 PHE A CZ  1 
ATOM   728  N N   . SER A 1 102 ? -48.348 30.395 -39.431 1.00 79.53  ? 137 SER A N   1 
ATOM   729  C CA  . SER A 1 102 ? -48.787 30.459 -38.037 1.00 81.41  ? 137 SER A CA  1 
ATOM   730  C C   . SER A 1 102 ? -47.643 30.895 -37.123 1.00 79.69  ? 137 SER A C   1 
ATOM   731  O O   . SER A 1 102 ? -47.807 31.797 -36.308 1.00 76.45  ? 137 SER A O   1 
ATOM   732  C CB  . SER A 1 102 ? -49.335 29.104 -37.578 1.00 80.72  ? 137 SER A CB  1 
ATOM   733  O OG  . SER A 1 102 ? -49.699 29.150 -36.208 1.00 82.48  ? 137 SER A OG  1 
ATOM   734  N N   . ILE A 1 103 ? -46.491 30.246 -37.275 1.00 77.85  ? 138 ILE A N   1 
ATOM   735  C CA  . ILE A 1 103 ? -45.287 30.592 -36.521 1.00 77.77  ? 138 ILE A CA  1 
ATOM   736  C C   . ILE A 1 103 ? -44.924 32.060 -36.755 1.00 75.65  ? 138 ILE A C   1 
ATOM   737  O O   . ILE A 1 103 ? -44.769 32.847 -35.807 1.00 68.30  ? 138 ILE A O   1 
ATOM   738  C CB  . ILE A 1 103 ? -44.085 29.709 -36.937 1.00 79.36  ? 138 ILE A CB  1 
ATOM   739  C CG1 . ILE A 1 103 ? -44.316 28.250 -36.523 1.00 80.99  ? 138 ILE A CG1 1 
ATOM   740  C CG2 . ILE A 1 103 ? -42.792 30.227 -36.312 1.00 80.47  ? 138 ILE A CG2 1 
ATOM   741  C CD1 . ILE A 1 103 ? -43.290 27.277 -37.061 1.00 79.48  ? 138 ILE A CD1 1 
ATOM   742  N N   . GLU A 1 104 ? -44.802 32.410 -38.030 1.00 71.66  ? 139 GLU A N   1 
ATOM   743  C CA  . GLU A 1 104 ? -44.463 33.768 -38.434 1.00 73.81  ? 139 GLU A CA  1 
ATOM   744  C C   . GLU A 1 104 ? -45.403 34.811 -37.845 1.00 73.38  ? 139 GLU A C   1 
ATOM   745  O O   . GLU A 1 104 ? -44.958 35.904 -37.490 1.00 76.23  ? 139 GLU A O   1 
ATOM   746  C CB  . GLU A 1 104 ? -44.418 33.870 -39.965 1.00 75.34  ? 139 GLU A CB  1 
ATOM   747  C CG  . GLU A 1 104 ? -43.160 33.233 -40.538 1.00 79.43  ? 139 GLU A CG  1 
ATOM   748  C CD  . GLU A 1 104 ? -43.310 32.758 -41.966 1.00 81.50  ? 139 GLU A CD  1 
ATOM   749  O OE1 . GLU A 1 104 ? -43.947 33.468 -42.769 1.00 83.48  ? 139 GLU A OE1 1 
ATOM   750  O OE2 . GLU A 1 104 ? -42.764 31.678 -42.286 1.00 78.39  ? 139 GLU A OE2 1 
ATOM   751  N N   . THR A 1 105 ? -46.685 34.475 -37.728 1.00 71.57  ? 140 THR A N   1 
ATOM   752  C CA  . THR A 1 105 ? -47.675 35.407 -37.197 1.00 73.11  ? 140 THR A CA  1 
ATOM   753  C C   . THR A 1 105 ? -47.568 35.562 -35.682 1.00 73.59  ? 140 THR A C   1 
ATOM   754  O O   . THR A 1 105 ? -47.577 36.681 -35.167 1.00 82.43  ? 140 THR A O   1 
ATOM   755  C CB  . THR A 1 105 ? -49.109 34.980 -37.577 1.00 74.28  ? 140 THR A CB  1 
ATOM   756  O OG1 . THR A 1 105 ? -49.230 34.937 -39.003 1.00 77.19  ? 140 THR A OG1 1 
ATOM   757  C CG2 . THR A 1 105 ? -50.143 35.957 -37.034 1.00 73.07  ? 140 THR A CG2 1 
ATOM   758  N N   . GLN A 1 106 ? -47.461 34.448 -34.969 1.00 76.84  ? 141 GLN A N   1 
ATOM   759  C CA  . GLN A 1 106 ? -47.484 34.465 -33.501 1.00 74.24  ? 141 GLN A CA  1 
ATOM   760  C C   . GLN A 1 106 ? -46.166 34.962 -32.917 1.00 73.66  ? 141 GLN A C   1 
ATOM   761  O O   . GLN A 1 106 ? -46.166 35.795 -32.020 1.00 73.33  ? 141 GLN A O   1 
ATOM   762  C CB  . GLN A 1 106 ? -47.811 33.076 -32.960 1.00 76.27  ? 141 GLN A CB  1 
ATOM   763  C CG  . GLN A 1 106 ? -48.260 33.061 -31.508 1.00 80.06  ? 141 GLN A CG  1 
ATOM   764  C CD  . GLN A 1 106 ? -48.762 31.698 -31.067 1.00 78.54  ? 141 GLN A CD  1 
ATOM   765  O OE1 . GLN A 1 106 ? -49.591 31.081 -31.732 1.00 81.50  ? 141 GLN A OE1 1 
ATOM   766  N NE2 . GLN A 1 106 ? -48.259 31.224 -29.943 1.00 81.76  ? 141 GLN A NE2 1 
ATOM   767  N N   . THR A 1 107 ? -45.046 34.455 -33.431 1.00 74.06  ? 142 THR A N   1 
ATOM   768  C CA  . THR A 1 107 ? -43.727 34.974 -33.063 1.00 71.87  ? 142 THR A CA  1 
ATOM   769  C C   . THR A 1 107 ? -43.604 36.414 -33.516 1.00 73.03  ? 142 THR A C   1 
ATOM   770  O O   . THR A 1 107 ? -42.746 37.159 -33.052 1.00 76.38  ? 142 THR A O   1 
ATOM   771  C CB  . THR A 1 107 ? -42.581 34.219 -33.764 1.00 71.50  ? 142 THR A CB  1 
ATOM   772  O OG1 . THR A 1 107 ? -42.726 34.336 -35.185 1.00 68.99  ? 142 THR A OG1 1 
ATOM   773  C CG2 . THR A 1 107 ? -42.548 32.755 -33.354 1.00 72.68  ? 142 THR A CG2 1 
ATOM   774  N N   . THR A 1 108 ? -44.457 36.763 -34.471 1.00 74.68  ? 143 THR A N   1 
ATOM   775  C CA  . THR A 1 108 ? -44.429 38.031 -35.166 1.00 72.85  ? 143 THR A CA  1 
ATOM   776  C C   . THR A 1 108 ? -43.136 38.186 -35.965 1.00 72.32  ? 143 THR A C   1 
ATOM   777  O O   . THR A 1 108 ? -42.678 39.318 -36.152 1.00 65.71  ? 143 THR A O   1 
ATOM   778  C CB  . THR A 1 108 ? -44.655 39.247 -34.228 1.00 73.53  ? 143 THR A CB  1 
ATOM   779  O OG1 . THR A 1 108 ? -43.395 39.722 -33.722 1.00 69.35  ? 143 THR A OG1 1 
ATOM   780  C CG2 . THR A 1 108 ? -45.598 38.927 -33.081 1.00 74.05  ? 143 THR A CG2 1 
ATOM   781  N N   . ILE A 1 109 ? -42.541 37.089 -36.446 1.00 75.95  ? 144 ILE A N   1 
ATOM   782  C CA  . ILE A 1 109 ? -41.422 37.200 -37.390 1.00 74.67  ? 144 ILE A CA  1 
ATOM   783  C C   . ILE A 1 109 ? -41.986 37.789 -38.673 1.00 78.17  ? 144 ILE A C   1 
ATOM   784  O O   . ILE A 1 109 ? -41.503 38.821 -39.146 1.00 83.36  ? 144 ILE A O   1 
ATOM   785  C CB  . ILE A 1 109 ? -40.753 35.861 -37.725 1.00 74.59  ? 144 ILE A CB  1 
ATOM   786  C CG1 . ILE A 1 109 ? -39.942 35.351 -36.545 1.00 75.11  ? 144 ILE A CG1 1 
ATOM   787  C CG2 . ILE A 1 109 ? -39.825 36.019 -38.921 1.00 77.68  ? 144 ILE A CG2 1 
ATOM   788  C CD1 . ILE A 1 109 ? -39.675 33.861 -36.613 1.00 73.78  ? 144 ILE A CD1 1 
ATOM   789  N N   . GLY A 1 110 ? -43.030 37.173 -39.212 1.00 81.00  ? 145 GLY A N   1 
ATOM   790  C CA  . GLY A 1 110 ? -43.707 37.664 -40.411 1.00 80.95  ? 145 GLY A CA  1 
ATOM   791  C C   . GLY A 1 110 ? -42.814 37.953 -41.612 1.00 80.76  ? 145 GLY A C   1 
ATOM   792  O O   . GLY A 1 110 ? -42.767 39.097 -42.076 1.00 79.95  ? 145 GLY A O   1 
ATOM   793  N N   . TYR A 1 111 ? -42.084 36.962 -42.118 1.00 80.02  ? 146 TYR A N   1 
ATOM   794  C CA  . TYR A 1 111 ? -41.227 37.197 -43.283 1.00 78.44  ? 146 TYR A CA  1 
ATOM   795  C C   . TYR A 1 111 ? -42.052 37.828 -44.404 1.00 79.53  ? 146 TYR A C   1 
ATOM   796  O O   . TYR A 1 111 ? -41.566 38.713 -45.112 1.00 81.25  ? 146 TYR A O   1 
ATOM   797  C CB  . TYR A 1 111 ? -40.568 35.923 -43.782 1.00 77.81  ? 146 TYR A CB  1 
ATOM   798  C CG  . TYR A 1 111 ? -39.683 35.240 -42.772 1.00 80.32  ? 146 TYR A CG  1 
ATOM   799  C CD1 . TYR A 1 111 ? -38.472 35.804 -42.372 1.00 80.98  ? 146 TYR A CD1 1 
ATOM   800  C CD2 . TYR A 1 111 ? -40.045 34.013 -42.228 1.00 79.47  ? 146 TYR A CD2 1 
ATOM   801  C CE1 . TYR A 1 111 ? -37.655 35.160 -41.453 1.00 77.68  ? 146 TYR A CE1 1 
ATOM   802  C CE2 . TYR A 1 111 ? -39.234 33.366 -41.313 1.00 76.43  ? 146 TYR A CE2 1 
ATOM   803  C CZ  . TYR A 1 111 ? -38.044 33.936 -40.934 1.00 73.84  ? 146 TYR A CZ  1 
ATOM   804  O OH  . TYR A 1 111 ? -37.263 33.274 -40.022 1.00 77.22  ? 146 TYR A OH  1 
ATOM   805  N N   . GLY A 1 112 ? -43.312 37.426 -44.530 1.00 77.89  ? 147 GLY A N   1 
ATOM   806  C CA  . GLY A 1 112 ? -44.259 38.150 -45.369 1.00 76.46  ? 147 GLY A CA  1 
ATOM   807  C C   . GLY A 1 112 ? -44.466 37.609 -46.765 1.00 75.04  ? 147 GLY A C   1 
ATOM   808  O O   . GLY A 1 112 ? -45.304 38.129 -47.494 1.00 77.50  ? 147 GLY A O   1 
ATOM   809  N N   . PHE A 1 113 ? -43.706 36.586 -47.154 1.00 76.80  ? 148 PHE A N   1 
ATOM   810  C CA  . PHE A 1 113 ? -43.971 35.876 -48.406 1.00 79.46  ? 148 PHE A CA  1 
ATOM   811  C C   . PHE A 1 113 ? -45.336 35.233 -48.272 1.00 80.69  ? 148 PHE A C   1 
ATOM   812  O O   . PHE A 1 113 ? -46.194 35.390 -49.136 1.00 88.18  ? 148 PHE A O   1 
ATOM   813  C CB  . PHE A 1 113 ? -42.904 34.811 -48.675 1.00 84.58  ? 148 PHE A CB  1 
ATOM   814  C CG  . PHE A 1 113 ? -43.137 34.021 -49.937 1.00 89.79  ? 148 PHE A CG  1 
ATOM   815  C CD1 . PHE A 1 113 ? -42.973 34.612 -51.182 1.00 93.43  ? 148 PHE A CD1 1 
ATOM   816  C CD2 . PHE A 1 113 ? -43.514 32.681 -49.881 1.00 94.18  ? 148 PHE A CD2 1 
ATOM   817  C CE1 . PHE A 1 113 ? -43.187 33.885 -52.349 1.00 95.94  ? 148 PHE A CE1 1 
ATOM   818  C CE2 . PHE A 1 113 ? -43.727 31.950 -51.045 1.00 92.98  ? 148 PHE A CE2 1 
ATOM   819  C CZ  . PHE A 1 113 ? -43.562 32.553 -52.280 1.00 91.72  ? 148 PHE A CZ  1 
ATOM   820  N N   . ARG A 1 114 ? -45.518 34.513 -47.170 1.00 79.15  ? 149 ARG A N   1 
ATOM   821  C CA  . ARG A 1 114 ? -46.833 34.104 -46.716 1.00 80.85  ? 149 ARG A CA  1 
ATOM   822  C C   . ARG A 1 114 ? -47.426 35.312 -45.999 1.00 83.16  ? 149 ARG A C   1 
ATOM   823  O O   . ARG A 1 114 ? -46.812 35.847 -45.072 1.00 85.38  ? 149 ARG A O   1 
ATOM   824  C CB  . ARG A 1 114 ? -46.722 32.908 -45.764 1.00 80.43  ? 149 ARG A CB  1 
ATOM   825  C CG  . ARG A 1 114 ? -46.213 31.634 -46.426 1.00 80.63  ? 149 ARG A CG  1 
ATOM   826  C CD  . ARG A 1 114 ? -45.587 30.671 -45.429 1.00 80.40  ? 149 ARG A CD  1 
ATOM   827  N NE  . ARG A 1 114 ? -44.260 31.122 -45.016 1.00 83.58  ? 149 ARG A NE  1 
ATOM   828  C CZ  . ARG A 1 114 ? -43.122 30.876 -45.668 1.00 87.50  ? 149 ARG A CZ  1 
ATOM   829  N NH1 . ARG A 1 114 ? -43.110 30.167 -46.793 1.00 89.48  ? 149 ARG A NH1 1 
ATOM   830  N NH2 . ARG A 1 114 ? -41.974 31.347 -45.190 1.00 89.74  ? 149 ARG A NH2 1 
ATOM   831  N N   . CYS A 1 115 ? -48.606 35.748 -46.428 1.00 83.20  ? 150 CYS A N   1 
ATOM   832  C CA  . CYS A 1 115 ? -49.192 36.994 -45.922 1.00 83.11  ? 150 CYS A CA  1 
ATOM   833  C C   . CYS A 1 115 ? -50.717 37.014 -46.011 1.00 80.24  ? 150 CYS A C   1 
ATOM   834  O O   . CYS A 1 115 ? -51.290 36.706 -47.056 1.00 80.25  ? 150 CYS A O   1 
ATOM   835  C CB  . CYS A 1 115 ? -48.625 38.183 -46.701 1.00 81.42  ? 150 CYS A CB  1 
ATOM   836  S SG  . CYS A 1 115 ? -49.412 39.761 -46.307 1.00 86.67  ? 150 CYS A SG  1 
ATOM   837  N N   . VAL A 1 116 ? -51.365 37.401 -44.918 1.00 79.98  ? 151 VAL A N   1 
ATOM   838  C CA  . VAL A 1 116 ? -52.821 37.508 -44.886 1.00 83.41  ? 151 VAL A CA  1 
ATOM   839  C C   . VAL A 1 116 ? -53.315 38.596 -45.840 1.00 83.43  ? 151 VAL A C   1 
ATOM   840  O O   . VAL A 1 116 ? -52.655 39.621 -46.022 1.00 76.48  ? 151 VAL A O   1 
ATOM   841  C CB  . VAL A 1 116 ? -53.351 37.788 -43.457 1.00 84.18  ? 151 VAL A CB  1 
ATOM   842  C CG1 . VAL A 1 116 ? -53.037 39.212 -43.014 1.00 84.48  ? 151 VAL A CG1 1 
ATOM   843  C CG2 . VAL A 1 116 ? -54.849 37.524 -43.375 1.00 85.48  ? 151 VAL A CG2 1 
ATOM   844  N N   . THR A 1 117 ? -54.480 38.351 -46.440 1.00 87.85  ? 152 THR A N   1 
ATOM   845  C CA  . THR A 1 117 ? -55.118 39.294 -47.361 1.00 88.82  ? 152 THR A CA  1 
ATOM   846  C C   . THR A 1 117 ? -56.401 39.870 -46.761 1.00 89.42  ? 152 THR A C   1 
ATOM   847  O O   . THR A 1 117 ? -56.783 39.536 -45.639 1.00 88.92  ? 152 THR A O   1 
ATOM   848  C CB  . THR A 1 117 ? -55.477 38.612 -48.689 1.00 86.50  ? 152 THR A CB  1 
ATOM   849  O OG1 . THR A 1 117 ? -56.624 37.776 -48.494 1.00 93.52  ? 152 THR A OG1 1 
ATOM   850  C CG2 . THR A 1 117 ? -54.308 37.782 -49.208 1.00 86.27  ? 152 THR A CG2 1 
ATOM   851  N N   . GLU A 1 118 ? -57.075 40.715 -47.536 1.00 97.34  ? 153 GLU A N   1 
ATOM   852  C CA  . GLU A 1 118 ? -58.307 41.380 -47.099 1.00 98.54  ? 153 GLU A CA  1 
ATOM   853  C C   . GLU A 1 118 ? -59.543 40.516 -47.367 1.00 95.54  ? 153 GLU A C   1 
ATOM   854  O O   . GLU A 1 118 ? -60.640 40.852 -46.932 1.00 95.92  ? 153 GLU A O   1 
ATOM   855  C CB  . GLU A 1 118 ? -58.490 42.726 -47.818 1.00 98.57  ? 153 GLU A CB  1 
ATOM   856  C CG  . GLU A 1 118 ? -57.210 43.425 -48.270 1.00 101.53 ? 153 GLU A CG  1 
ATOM   857  C CD  . GLU A 1 118 ? -56.906 43.208 -49.746 1.00 104.93 ? 153 GLU A CD  1 
ATOM   858  O OE1 . GLU A 1 118 ? -57.778 43.515 -50.585 1.00 106.05 ? 153 GLU A OE1 1 
ATOM   859  O OE2 . GLU A 1 118 ? -55.793 42.742 -50.072 1.00 111.57 ? 153 GLU A OE2 1 
ATOM   860  N N   . GLU A 1 119 ? -59.353 39.404 -48.072 1.00 97.68  ? 154 GLU A N   1 
ATOM   861  C CA  . GLU A 1 119 ? -60.451 38.637 -48.658 1.00 102.29 ? 154 GLU A CA  1 
ATOM   862  C C   . GLU A 1 119 ? -61.367 37.946 -47.648 1.00 101.49 ? 154 GLU A C   1 
ATOM   863  O O   . GLU A 1 119 ? -62.584 38.017 -47.778 1.00 105.62 ? 154 GLU A O   1 
ATOM   864  C CB  . GLU A 1 119 ? -59.880 37.586 -49.614 1.00 104.49 ? 154 GLU A CB  1 
ATOM   865  C CG  . GLU A 1 119 ? -60.918 36.816 -50.418 1.00 108.34 ? 154 GLU A CG  1 
ATOM   866  C CD  . GLU A 1 119 ? -61.526 37.617 -51.555 1.00 109.93 ? 154 GLU A CD  1 
ATOM   867  O OE1 . GLU A 1 119 ? -61.099 38.770 -51.805 1.00 107.80 ? 154 GLU A OE1 1 
ATOM   868  O OE2 . GLU A 1 119 ? -62.441 37.073 -52.208 1.00 108.21 ? 154 GLU A OE2 1 
ATOM   869  N N   . CYS A 1 120 ? -60.781 37.272 -46.663 1.00 101.43 ? 155 CYS A N   1 
ATOM   870  C CA  . CYS A 1 120 ? -61.526 36.370 -45.781 1.00 101.95 ? 155 CYS A CA  1 
ATOM   871  C C   . CYS A 1 120 ? -61.594 36.902 -44.348 1.00 106.15 ? 155 CYS A C   1 
ATOM   872  O O   . CYS A 1 120 ? -60.604 36.844 -43.616 1.00 111.26 ? 155 CYS A O   1 
ATOM   873  C CB  . CYS A 1 120 ? -60.882 34.979 -45.804 1.00 98.53  ? 155 CYS A CB  1 
ATOM   874  S SG  . CYS A 1 120 ? -60.538 34.410 -47.485 1.00 106.16 ? 155 CYS A SG  1 
ATOM   875  N N   . PRO A 1 121 ? -62.765 37.426 -43.938 1.00 104.68 ? 156 PRO A N   1 
ATOM   876  C CA  . PRO A 1 121 ? -62.946 37.908 -42.562 1.00 102.11 ? 156 PRO A CA  1 
ATOM   877  C C   . PRO A 1 121 ? -62.600 36.898 -41.462 1.00 97.26  ? 156 PRO A C   1 
ATOM   878  O O   . PRO A 1 121 ? -62.248 37.303 -40.353 1.00 97.57  ? 156 PRO A O   1 
ATOM   879  C CB  . PRO A 1 121 ? -64.435 38.261 -42.514 1.00 101.59 ? 156 PRO A CB  1 
ATOM   880  C CG  . PRO A 1 121 ? -64.760 38.653 -43.913 1.00 101.56 ? 156 PRO A CG  1 
ATOM   881  C CD  . PRO A 1 121 ? -63.918 37.772 -44.791 1.00 100.15 ? 156 PRO A CD  1 
ATOM   882  N N   . LEU A 1 122 ? -62.700 35.604 -41.755 1.00 94.34  ? 157 LEU A N   1 
ATOM   883  C CA  . LEU A 1 122 ? -62.339 34.585 -40.774 1.00 96.79  ? 157 LEU A CA  1 
ATOM   884  C C   . LEU A 1 122 ? -60.820 34.504 -40.591 1.00 94.03  ? 157 LEU A C   1 
ATOM   885  O O   . LEU A 1 122 ? -60.337 34.436 -39.463 1.00 98.50  ? 157 LEU A O   1 
ATOM   886  C CB  . LEU A 1 122 ? -62.910 33.215 -41.160 1.00 96.66  ? 157 LEU A CB  1 
ATOM   887  C CG  . LEU A 1 122 ? -62.729 32.114 -40.104 1.00 97.44  ? 157 LEU A CG  1 
ATOM   888  C CD1 . LEU A 1 122 ? -63.438 32.469 -38.806 1.00 93.65  ? 157 LEU A CD1 1 
ATOM   889  C CD2 . LEU A 1 122 ? -63.216 30.773 -40.628 1.00 100.24 ? 157 LEU A CD2 1 
ATOM   890  N N   . ALA A 1 123 ? -60.075 34.515 -41.695 1.00 90.80  ? 158 ALA A N   1 
ATOM   891  C CA  . ALA A 1 123 ? -58.604 34.538 -41.641 1.00 86.48  ? 158 ALA A CA  1 
ATOM   892  C C   . ALA A 1 123 ? -58.084 35.796 -40.942 1.00 87.41  ? 158 ALA A C   1 
ATOM   893  O O   . ALA A 1 123 ? -57.132 35.725 -40.165 1.00 90.14  ? 158 ALA A O   1 
ATOM   894  C CB  . ALA A 1 123 ? -58.014 34.437 -43.037 1.00 85.36  ? 158 ALA A CB  1 
ATOM   895  N N   . VAL A 1 124 ? -58.717 36.937 -41.213 1.00 84.28  ? 159 VAL A N   1 
ATOM   896  C CA  . VAL A 1 124 ? -58.402 38.179 -40.514 1.00 80.49  ? 159 VAL A CA  1 
ATOM   897  C C   . VAL A 1 124 ? -58.682 38.027 -39.026 1.00 85.87  ? 159 VAL A C   1 
ATOM   898  O O   . VAL A 1 124 ? -57.851 38.376 -38.188 1.00 89.94  ? 159 VAL A O   1 
ATOM   899  C CB  . VAL A 1 124 ? -59.217 39.363 -41.058 1.00 79.67  ? 159 VAL A CB  1 
ATOM   900  C CG1 . VAL A 1 124 ? -59.013 40.604 -40.192 1.00 81.11  ? 159 VAL A CG1 1 
ATOM   901  C CG2 . VAL A 1 124 ? -58.828 39.650 -42.501 1.00 81.74  ? 159 VAL A CG2 1 
ATOM   902  N N   . PHE A 1 125 ? -59.860 37.507 -38.702 1.00 91.12  ? 160 PHE A N   1 
ATOM   903  C CA  . PHE A 1 125 ? -60.231 37.250 -37.314 1.00 93.51  ? 160 PHE A CA  1 
ATOM   904  C C   . PHE A 1 125 ? -59.203 36.334 -36.641 1.00 92.19  ? 160 PHE A C   1 
ATOM   905  O O   . PHE A 1 125 ? -58.831 36.551 -35.488 1.00 91.26  ? 160 PHE A O   1 
ATOM   906  C CB  . PHE A 1 125 ? -61.642 36.642 -37.249 1.00 94.01  ? 160 PHE A CB  1 
ATOM   907  C CG  . PHE A 1 125 ? -62.033 36.130 -35.887 1.00 94.31  ? 160 PHE A CG  1 
ATOM   908  C CD1 . PHE A 1 125 ? -62.463 37.003 -34.900 1.00 94.29  ? 160 PHE A CD1 1 
ATOM   909  C CD2 . PHE A 1 125 ? -61.980 34.769 -35.599 1.00 97.00  ? 160 PHE A CD2 1 
ATOM   910  C CE1 . PHE A 1 125 ? -62.828 36.534 -33.650 1.00 94.91  ? 160 PHE A CE1 1 
ATOM   911  C CE2 . PHE A 1 125 ? -62.343 34.292 -34.350 1.00 96.96  ? 160 PHE A CE2 1 
ATOM   912  C CZ  . PHE A 1 125 ? -62.769 35.177 -33.375 1.00 97.61  ? 160 PHE A CZ  1 
ATOM   913  N N   . MET A 1 126 ? -58.730 35.329 -37.374 1.00 88.17  ? 161 MET A N   1 
ATOM   914  C CA  . MET A 1 126 ? -57.800 34.349 -36.814 1.00 89.98  ? 161 MET A CA  1 
ATOM   915  C C   . MET A 1 126 ? -56.399 34.936 -36.541 1.00 89.87  ? 161 MET A C   1 
ATOM   916  O O   . MET A 1 126 ? -55.739 34.544 -35.575 1.00 86.86  ? 161 MET A O   1 
ATOM   917  C CB  . MET A 1 126 ? -57.716 33.112 -37.716 1.00 90.19  ? 161 MET A CB  1 
ATOM   918  C CG  . MET A 1 126 ? -57.779 31.793 -36.957 1.00 98.14  ? 161 MET A CG  1 
ATOM   919  S SD  . MET A 1 126 ? -59.271 31.563 -35.958 1.00 99.74  ? 161 MET A SD  1 
ATOM   920  C CE  . MET A 1 126 ? -60.532 31.589 -37.230 1.00 107.78 ? 161 MET A CE  1 
ATOM   921  N N   . VAL A 1 127 ? -55.955 35.878 -37.372 1.00 87.41  ? 162 VAL A N   1 
ATOM   922  C CA  . VAL A 1 127 ? -54.722 36.622 -37.092 1.00 84.15  ? 162 VAL A CA  1 
ATOM   923  C C   . VAL A 1 127 ? -54.897 37.498 -35.841 1.00 84.34  ? 162 VAL A C   1 
ATOM   924  O O   . VAL A 1 127 ? -53.995 37.585 -35.005 1.00 84.10  ? 162 VAL A O   1 
ATOM   925  C CB  . VAL A 1 127 ? -54.289 37.489 -38.294 1.00 85.31  ? 162 VAL A CB  1 
ATOM   926  C CG1 . VAL A 1 127 ? -53.150 38.435 -37.913 1.00 85.58  ? 162 VAL A CG1 1 
ATOM   927  C CG2 . VAL A 1 127 ? -53.871 36.607 -39.466 1.00 85.92  ? 162 VAL A CG2 1 
ATOM   928  N N   . VAL A 1 128 ? -56.057 38.137 -35.719 1.00 81.36  ? 163 VAL A N   1 
ATOM   929  C CA  . VAL A 1 128 ? -56.385 38.929 -34.536 1.00 79.75  ? 163 VAL A CA  1 
ATOM   930  C C   . VAL A 1 128 ? -56.309 38.061 -33.270 1.00 83.23  ? 163 VAL A C   1 
ATOM   931  O O   . VAL A 1 128 ? -55.732 38.475 -32.263 1.00 85.37  ? 163 VAL A O   1 
ATOM   932  C CB  . VAL A 1 128 ? -57.792 39.572 -34.664 1.00 80.54  ? 163 VAL A CB  1 
ATOM   933  C CG1 . VAL A 1 128 ? -58.276 40.139 -33.329 1.00 80.95  ? 163 VAL A CG1 1 
ATOM   934  C CG2 . VAL A 1 128 ? -57.797 40.658 -35.733 1.00 79.88  ? 163 VAL A CG2 1 
ATOM   935  N N   . VAL A 1 129 ? -56.880 36.859 -33.325 1.00 83.18  ? 164 VAL A N   1 
ATOM   936  C CA  . VAL A 1 129 ? -56.910 35.977 -32.156 1.00 83.47  ? 164 VAL A CA  1 
ATOM   937  C C   . VAL A 1 129 ? -55.518 35.428 -31.841 1.00 79.89  ? 164 VAL A C   1 
ATOM   938  O O   . VAL A 1 129 ? -55.083 35.475 -30.689 1.00 77.09  ? 164 VAL A O   1 
ATOM   939  C CB  . VAL A 1 129 ? -57.926 34.822 -32.332 1.00 88.51  ? 164 VAL A CB  1 
ATOM   940  C CG1 . VAL A 1 129 ? -57.816 33.811 -31.197 1.00 88.40  ? 164 VAL A CG1 1 
ATOM   941  C CG2 . VAL A 1 129 ? -59.345 35.376 -32.392 1.00 90.95  ? 164 VAL A CG2 1 
ATOM   942  N N   . GLN A 1 130 ? -54.825 34.920 -32.859 1.00 79.12  ? 165 GLN A N   1 
ATOM   943  C CA  . GLN A 1 130 ? -53.455 34.413 -32.684 1.00 80.57  ? 165 GLN A CA  1 
ATOM   944  C C   . GLN A 1 130 ? -52.493 35.457 -32.105 1.00 82.38  ? 165 GLN A C   1 
ATOM   945  O O   . GLN A 1 130 ? -51.625 35.114 -31.303 1.00 83.13  ? 165 GLN A O   1 
ATOM   946  C CB  . GLN A 1 130 ? -52.883 33.880 -34.001 1.00 76.43  ? 165 GLN A CB  1 
ATOM   947  C CG  . GLN A 1 130 ? -51.530 33.205 -33.828 1.00 75.79  ? 165 GLN A CG  1 
ATOM   948  C CD  . GLN A 1 130 ? -51.154 32.332 -35.011 1.00 81.39  ? 165 GLN A CD  1 
ATOM   949  O OE1 . GLN A 1 130 ? -51.458 32.655 -36.159 1.00 79.60  ? 165 GLN A OE1 1 
ATOM   950  N NE2 . GLN A 1 130 ? -50.477 31.220 -34.738 1.00 83.65  ? 165 GLN A NE2 1 
ATOM   951  N N   . SER A 1 131 ? -52.639 36.715 -32.524 1.00 78.99  ? 166 SER A N   1 
ATOM   952  C CA  . SER A 1 131 ? -51.813 37.801 -32.002 1.00 80.07  ? 166 SER A CA  1 
ATOM   953  C C   . SER A 1 131 ? -52.005 37.956 -30.504 1.00 83.09  ? 166 SER A C   1 
ATOM   954  O O   . SER A 1 131 ? -51.038 38.094 -29.757 1.00 90.49  ? 166 SER A O   1 
ATOM   955  C CB  . SER A 1 131 ? -52.144 39.130 -32.687 1.00 79.54  ? 166 SER A CB  1 
ATOM   956  O OG  . SER A 1 131 ? -51.722 39.131 -34.036 1.00 80.63  ? 166 SER A OG  1 
ATOM   957  N N   . ILE A 1 132 ? -53.260 37.933 -30.072 1.00 86.33  ? 167 ILE A N   1 
ATOM   958  C CA  . ILE A 1 132 ? -53.585 38.122 -28.663 1.00 87.69  ? 167 ILE A CA  1 
ATOM   959  C C   . ILE A 1 132 ? -53.135 36.928 -27.837 1.00 86.60  ? 167 ILE A C   1 
ATOM   960  O O   . ILE A 1 132 ? -52.595 37.096 -26.748 1.00 90.30  ? 167 ILE A O   1 
ATOM   961  C CB  . ILE A 1 132 ? -55.091 38.368 -28.463 1.00 88.27  ? 167 ILE A CB  1 
ATOM   962  C CG1 . ILE A 1 132 ? -55.482 39.704 -29.108 1.00 87.69  ? 167 ILE A CG1 1 
ATOM   963  C CG2 . ILE A 1 132 ? -55.434 38.366 -26.980 1.00 87.64  ? 167 ILE A CG2 1 
ATOM   964  C CD1 . ILE A 1 132 ? -56.969 39.878 -29.329 1.00 88.53  ? 167 ILE A CD1 1 
ATOM   965  N N   . VAL A 1 133 ? -53.359 35.726 -28.361 1.00 89.77  ? 168 VAL A N   1 
ATOM   966  C CA  . VAL A 1 133 ? -52.896 34.500 -27.707 1.00 89.09  ? 168 VAL A CA  1 
ATOM   967  C C   . VAL A 1 133 ? -51.373 34.526 -27.560 1.00 84.31  ? 168 VAL A C   1 
ATOM   968  O O   . VAL A 1 133 ? -50.837 34.159 -26.514 1.00 84.89  ? 168 VAL A O   1 
ATOM   969  C CB  . VAL A 1 133 ? -53.363 33.240 -28.477 1.00 89.15  ? 168 VAL A CB  1 
ATOM   970  C CG1 . VAL A 1 133 ? -52.613 31.992 -28.024 1.00 91.42  ? 168 VAL A CG1 1 
ATOM   971  C CG2 . VAL A 1 133 ? -54.862 33.046 -28.296 1.00 88.41  ? 168 VAL A CG2 1 
ATOM   972  N N   . GLY A 1 134 ? -50.692 34.976 -28.609 1.00 83.55  ? 169 GLY A N   1 
ATOM   973  C CA  . GLY A 1 134 ? -49.244 35.160 -28.587 1.00 83.46  ? 169 GLY A CA  1 
ATOM   974  C C   . GLY A 1 134 ? -48.763 36.060 -27.461 1.00 82.86  ? 169 GLY A C   1 
ATOM   975  O O   . GLY A 1 134 ? -47.835 35.702 -26.734 1.00 80.69  ? 169 GLY A O   1 
ATOM   976  N N   . CYS A 1 135 ? -49.388 37.228 -27.317 1.00 83.73  ? 170 CYS A N   1 
ATOM   977  C CA  . CYS A 1 135 ? -49.051 38.151 -26.228 1.00 86.36  ? 170 CYS A CA  1 
ATOM   978  C C   . CYS A 1 135 ? -49.260 37.524 -24.861 1.00 85.31  ? 170 CYS A C   1 
ATOM   979  O O   . CYS A 1 135 ? -48.463 37.734 -23.944 1.00 82.33  ? 170 CYS A O   1 
ATOM   980  C CB  . CYS A 1 135 ? -49.897 39.413 -26.301 1.00 90.52  ? 170 CYS A CB  1 
ATOM   981  S SG  . CYS A 1 135 ? -49.402 40.516 -27.621 1.00 110.01 ? 170 CYS A SG  1 
ATOM   982  N N   . ILE A 1 136 ? -50.349 36.777 -24.720 1.00 85.46  ? 171 ILE A N   1 
ATOM   983  C CA  . ILE A 1 136 ? -50.667 36.153 -23.448 1.00 89.72  ? 171 ILE A CA  1 
ATOM   984  C C   . ILE A 1 136 ? -49.625 35.095 -23.106 1.00 86.35  ? 171 ILE A C   1 
ATOM   985  O O   . ILE A 1 136 ? -49.063 35.109 -22.013 1.00 86.02  ? 171 ILE A O   1 
ATOM   986  C CB  . ILE A 1 136 ? -52.089 35.568 -23.443 1.00 94.52  ? 171 ILE A CB  1 
ATOM   987  C CG1 . ILE A 1 136 ? -53.109 36.713 -23.460 1.00 95.78  ? 171 ILE A CG1 1 
ATOM   988  C CG2 . ILE A 1 136 ? -52.309 34.690 -22.214 1.00 97.04  ? 171 ILE A CG2 1 
ATOM   989  C CD1 . ILE A 1 136 ? -54.527 36.276 -23.755 1.00 100.46 ? 171 ILE A CD1 1 
ATOM   990  N N   . ILE A 1 137 ? -49.345 34.200 -24.043 1.00 83.45  ? 172 ILE A N   1 
ATOM   991  C CA  . ILE A 1 137 ? -48.361 33.150 -23.801 1.00 84.39  ? 172 ILE A CA  1 
ATOM   992  C C   . ILE A 1 137 ? -47.007 33.752 -23.405 1.00 86.49  ? 172 ILE A C   1 
ATOM   993  O O   . ILE A 1 137 ? -46.411 33.337 -22.409 1.00 86.55  ? 172 ILE A O   1 
ATOM   994  C CB  . ILE A 1 137 ? -48.227 32.209 -25.018 1.00 85.62  ? 172 ILE A CB  1 
ATOM   995  C CG1 . ILE A 1 137 ? -49.494 31.353 -25.149 1.00 87.15  ? 172 ILE A CG1 1 
ATOM   996  C CG2 . ILE A 1 137 ? -47.005 31.308 -24.883 1.00 85.74  ? 172 ILE A CG2 1 
ATOM   997  C CD1 . ILE A 1 137 ? -49.589 30.575 -26.443 1.00 89.70  ? 172 ILE A CD1 1 
ATOM   998  N N   . ASP A 1 138 ? -46.549 34.744 -24.168 1.00 88.32  ? 173 ASP A N   1 
ATOM   999  C CA  . ASP A 1 138 ? -45.281 35.425 -23.897 1.00 87.13  ? 173 ASP A CA  1 
ATOM   1000 C C   . ASP A 1 138 ? -45.237 36.027 -22.501 1.00 84.75  ? 173 ASP A C   1 
ATOM   1001 O O   . ASP A 1 138 ? -44.301 35.778 -21.753 1.00 86.52  ? 173 ASP A O   1 
ATOM   1002 C CB  . ASP A 1 138 ? -45.036 36.536 -24.922 1.00 96.18  ? 173 ASP A CB  1 
ATOM   1003 C CG  . ASP A 1 138 ? -44.569 36.009 -26.265 1.00 102.94 ? 173 ASP A CG  1 
ATOM   1004 O OD1 . ASP A 1 138 ? -44.781 34.812 -26.565 1.00 113.04 ? 173 ASP A OD1 1 
ATOM   1005 O OD2 . ASP A 1 138 ? -43.985 36.807 -27.027 1.00 112.16 ? 173 ASP A OD2 1 
ATOM   1006 N N   . SER A 1 139 ? -46.254 36.815 -22.162 1.00 83.93  ? 174 SER A N   1 
ATOM   1007 C CA  . SER A 1 139 ? -46.342 37.471 -20.857 1.00 84.98  ? 174 SER A CA  1 
ATOM   1008 C C   . SER A 1 139 ? -46.307 36.479 -19.694 1.00 89.30  ? 174 SER A C   1 
ATOM   1009 O O   . SER A 1 139 ? -45.686 36.749 -18.659 1.00 91.66  ? 174 SER A O   1 
ATOM   1010 C CB  . SER A 1 139 ? -47.626 38.298 -20.762 1.00 85.89  ? 174 SER A CB  1 
ATOM   1011 O OG  . SER A 1 139 ? -47.697 39.264 -21.790 1.00 85.11  ? 174 SER A OG  1 
ATOM   1012 N N   . PHE A 1 140 ? -46.987 35.346 -19.858 1.00 87.15  ? 175 PHE A N   1 
ATOM   1013 C CA  . PHE A 1 140 ? -46.958 34.283 -18.854 1.00 91.51  ? 175 PHE A CA  1 
ATOM   1014 C C   . PHE A 1 140 ? -45.559 33.680 -18.721 1.00 89.12  ? 175 PHE A C   1 
ATOM   1015 O O   . PHE A 1 140 ? -45.102 33.394 -17.615 1.00 90.44  ? 175 PHE A O   1 
ATOM   1016 C CB  . PHE A 1 140 ? -47.984 33.186 -19.172 1.00 97.27  ? 175 PHE A CB  1 
ATOM   1017 C CG  . PHE A 1 140 ? -49.320 33.400 -18.517 1.00 103.72 ? 175 PHE A CG  1 
ATOM   1018 C CD1 . PHE A 1 140 ? -50.209 34.348 -19.011 1.00 108.74 ? 175 PHE A CD1 1 
ATOM   1019 C CD2 . PHE A 1 140 ? -49.688 32.661 -17.400 1.00 109.34 ? 175 PHE A CD2 1 
ATOM   1020 C CE1 . PHE A 1 140 ? -51.439 34.554 -18.407 1.00 109.29 ? 175 PHE A CE1 1 
ATOM   1021 C CE2 . PHE A 1 140 ? -50.917 32.863 -16.790 1.00 112.22 ? 175 PHE A CE2 1 
ATOM   1022 C CZ  . PHE A 1 140 ? -51.793 33.810 -17.294 1.00 112.46 ? 175 PHE A CZ  1 
ATOM   1023 N N   . MET A 1 141 ? -44.878 33.498 -19.843 1.00 86.48  ? 176 MET A N   1 
ATOM   1024 C CA  . MET A 1 141 ? -43.517 32.983 -19.817 1.00 91.57  ? 176 MET A CA  1 
ATOM   1025 C C   . MET A 1 141 ? -42.574 33.923 -19.070 1.00 95.18  ? 176 MET A C   1 
ATOM   1026 O O   . MET A 1 141 ? -41.710 33.468 -18.322 1.00 101.10 ? 176 MET A O   1 
ATOM   1027 C CB  . MET A 1 141 ? -43.010 32.738 -21.236 1.00 93.54  ? 176 MET A CB  1 
ATOM   1028 C CG  . MET A 1 141 ? -41.568 32.276 -21.301 1.00 98.11  ? 176 MET A CG  1 
ATOM   1029 S SD  . MET A 1 141 ? -41.223 31.388 -22.827 1.00 111.06 ? 176 MET A SD  1 
ATOM   1030 C CE  . MET A 1 141 ? -39.473 31.713 -22.998 1.00 113.32 ? 176 MET A CE  1 
ATOM   1031 N N   . ILE A 1 142 ? -42.743 35.228 -19.269 1.00 93.92  ? 177 ILE A N   1 
ATOM   1032 C CA  . ILE A 1 142 ? -41.910 36.216 -18.592 1.00 94.93  ? 177 ILE A CA  1 
ATOM   1033 C C   . ILE A 1 142 ? -42.191 36.160 -17.092 1.00 97.76  ? 177 ILE A C   1 
ATOM   1034 O O   . ILE A 1 142 ? -41.264 36.156 -16.286 1.00 108.30 ? 177 ILE A O   1 
ATOM   1035 C CB  . ILE A 1 142 ? -42.145 37.644 -19.144 1.00 93.91  ? 177 ILE A CB  1 
ATOM   1036 C CG1 . ILE A 1 142 ? -41.731 37.722 -20.621 1.00 93.54  ? 177 ILE A CG1 1 
ATOM   1037 C CG2 . ILE A 1 142 ? -41.344 38.677 -18.363 1.00 91.30  ? 177 ILE A CG2 1 
ATOM   1038 C CD1 . ILE A 1 142 ? -42.189 38.981 -21.326 1.00 88.36  ? 177 ILE A CD1 1 
ATOM   1039 N N   . GLY A 1 143 ? -43.470 36.105 -16.729 1.00 99.36  ? 178 GLY A N   1 
ATOM   1040 C CA  . GLY A 1 143 ? -43.888 36.034 -15.328 1.00 99.96  ? 178 GLY A CA  1 
ATOM   1041 C C   . GLY A 1 143 ? -43.450 34.762 -14.626 1.00 99.81  ? 178 GLY A C   1 
ATOM   1042 O O   . GLY A 1 143 ? -42.957 34.806 -13.500 1.00 102.98 ? 178 GLY A O   1 
ATOM   1043 N N   . ALA A 1 144 ? -43.632 33.625 -15.291 1.00 95.56  ? 179 ALA A N   1 
ATOM   1044 C CA  . ALA A 1 144 ? -43.195 32.344 -14.747 1.00 89.17  ? 179 ALA A CA  1 
ATOM   1045 C C   . ALA A 1 144 ? -41.688 32.301 -14.553 1.00 88.97  ? 179 ALA A C   1 
ATOM   1046 O O   . ALA A 1 144 ? -41.203 31.751 -13.573 1.00 97.13  ? 179 ALA A O   1 
ATOM   1047 C CB  . ALA A 1 144 ? -43.633 31.206 -15.647 1.00 87.43  ? 179 ALA A CB  1 
ATOM   1048 N N   . ILE A 1 145 ? -40.946 32.879 -15.486 1.00 92.99  ? 180 ILE A N   1 
ATOM   1049 C CA  . ILE A 1 145 ? -39.495 32.928 -15.362 1.00 96.68  ? 180 ILE A CA  1 
ATOM   1050 C C   . ILE A 1 145 ? -39.065 33.823 -14.200 1.00 103.20 ? 180 ILE A C   1 
ATOM   1051 O O   . ILE A 1 145 ? -38.142 33.469 -13.477 1.00 105.79 ? 180 ILE A O   1 
ATOM   1052 C CB  . ILE A 1 145 ? -38.821 33.347 -16.684 1.00 96.34  ? 180 ILE A CB  1 
ATOM   1053 C CG1 . ILE A 1 145 ? -38.767 32.141 -17.622 1.00 97.97  ? 180 ILE A CG1 1 
ATOM   1054 C CG2 . ILE A 1 145 ? -37.412 33.869 -16.441 1.00 98.64  ? 180 ILE A CG2 1 
ATOM   1055 C CD1 . ILE A 1 145 ? -38.421 32.470 -19.056 1.00 100.93 ? 180 ILE A CD1 1 
ATOM   1056 N N   . MET A 1 146 ? -39.732 34.960 -14.008 1.00 108.89 ? 181 MET A N   1 
ATOM   1057 C CA  . MET A 1 146 ? -39.413 35.841 -12.876 1.00 115.01 ? 181 MET A CA  1 
ATOM   1058 C C   . MET A 1 146 ? -39.805 35.243 -11.535 1.00 115.70 ? 181 MET A C   1 
ATOM   1059 O O   . MET A 1 146 ? -39.087 35.405 -10.551 1.00 115.69 ? 181 MET A O   1 
ATOM   1060 C CB  . MET A 1 146 ? -40.087 37.200 -13.020 1.00 120.35 ? 181 MET A CB  1 
ATOM   1061 C CG  . MET A 1 146 ? -39.362 38.123 -13.968 1.00 129.25 ? 181 MET A CG  1 
ATOM   1062 S SD  . MET A 1 146 ? -39.642 39.854 -13.569 1.00 142.18 ? 181 MET A SD  1 
ATOM   1063 C CE  . MET A 1 146 ? -39.234 40.572 -15.157 1.00 149.45 ? 181 MET A CE  1 
ATOM   1064 N N   . ALA A 1 147 ? -40.951 34.572 -11.496 1.00 114.25 ? 182 ALA A N   1 
ATOM   1065 C CA  . ALA A 1 147 ? -41.412 33.918 -10.284 1.00 113.83 ? 182 ALA A CA  1 
ATOM   1066 C C   . ALA A 1 147 ? -40.354 32.943 -9.783  1.00 117.50 ? 182 ALA A C   1 
ATOM   1067 O O   . ALA A 1 147 ? -39.956 32.988 -8.618  1.00 116.24 ? 182 ALA A O   1 
ATOM   1068 C CB  . ALA A 1 147 ? -42.721 33.192 -10.545 1.00 115.94 ? 182 ALA A CB  1 
ATOM   1069 N N   . LYS A 1 148 ? -39.894 32.077 -10.680 1.00 118.74 ? 183 LYS A N   1 
ATOM   1070 C CA  . LYS A 1 148 ? -38.881 31.080 -10.350 1.00 122.02 ? 183 LYS A CA  1 
ATOM   1071 C C   . LYS A 1 148 ? -37.510 31.720 -10.103 1.00 126.46 ? 183 LYS A C   1 
ATOM   1072 O O   . LYS A 1 148 ? -36.726 31.238 -9.284  1.00 128.88 ? 183 LYS A O   1 
ATOM   1073 C CB  . LYS A 1 148 ? -38.785 30.049 -11.475 1.00 123.20 ? 183 LYS A CB  1 
ATOM   1074 C CG  . LYS A 1 148 ? -37.926 28.846 -11.133 1.00 126.27 ? 183 LYS A CG  1 
ATOM   1075 C CD  . LYS A 1 148 ? -38.060 27.752 -12.177 1.00 125.86 ? 183 LYS A CD  1 
ATOM   1076 C CE  . LYS A 1 148 ? -37.316 26.501 -11.751 1.00 125.42 ? 183 LYS A CE  1 
ATOM   1077 N NZ  . LYS A 1 148 ? -37.870 25.921 -10.494 1.00 127.42 ? 183 LYS A NZ  1 
ATOM   1078 N N   . MET A 1 149 ? -37.231 32.802 -10.824 1.00 129.61 ? 184 MET A N   1 
ATOM   1079 C CA  . MET A 1 149 ? -35.986 33.552 -10.667 1.00 127.42 ? 184 MET A CA  1 
ATOM   1080 C C   . MET A 1 149 ? -35.942 34.222 -9.299  1.00 129.72 ? 184 MET A C   1 
ATOM   1081 O O   . MET A 1 149 ? -34.917 34.193 -8.627  1.00 132.71 ? 184 MET A O   1 
ATOM   1082 C CB  . MET A 1 149 ? -35.881 34.612 -11.768 1.00 126.14 ? 184 MET A CB  1 
ATOM   1083 C CG  . MET A 1 149 ? -34.477 35.056 -12.127 1.00 122.82 ? 184 MET A CG  1 
ATOM   1084 S SD  . MET A 1 149 ? -34.458 35.891 -13.729 1.00 120.31 ? 184 MET A SD  1 
ATOM   1085 C CE  . MET A 1 149 ? -34.559 34.497 -14.843 1.00 121.64 ? 184 MET A CE  1 
ATOM   1086 N N   . ALA A 1 150 ? -37.067 34.805 -8.890  1.00 135.86 ? 185 ALA A N   1 
ATOM   1087 C CA  . ALA A 1 150 ? -37.162 35.552 -7.632  1.00 138.27 ? 185 ALA A CA  1 
ATOM   1088 C C   . ALA A 1 150 ? -37.372 34.672 -6.396  1.00 139.09 ? 185 ALA A C   1 
ATOM   1089 O O   . ALA A 1 150 ? -37.081 35.103 -5.281  1.00 137.56 ? 185 ALA A O   1 
ATOM   1090 C CB  . ALA A 1 150 ? -38.277 36.585 -7.725  1.00 138.92 ? 185 ALA A CB  1 
ATOM   1091 N N   . ARG A 1 151 ? -37.878 33.453 -6.586  1.00 144.86 ? 186 ARG A N   1 
ATOM   1092 C CA  . ARG A 1 151 ? -38.169 32.549 -5.467  1.00 148.49 ? 186 ARG A CA  1 
ATOM   1093 C C   . ARG A 1 151 ? -37.552 31.159 -5.686  1.00 145.95 ? 186 ARG A C   1 
ATOM   1094 O O   . ARG A 1 151 ? -38.271 30.184 -5.919  1.00 138.55 ? 186 ARG A O   1 
ATOM   1095 C CB  . ARG A 1 151 ? -39.687 32.428 -5.259  1.00 155.41 ? 186 ARG A CB  1 
ATOM   1096 C CG  . ARG A 1 151 ? -40.428 33.753 -5.105  1.00 161.23 ? 186 ARG A CG  1 
ATOM   1097 C CD  . ARG A 1 151 ? -40.170 34.424 -3.761  1.00 163.74 ? 186 ARG A CD  1 
ATOM   1098 N NE  . ARG A 1 151 ? -40.428 35.868 -3.803  1.00 168.50 ? 186 ARG A NE  1 
ATOM   1099 C CZ  . ARG A 1 151 ? -41.635 36.443 -3.799  1.00 168.40 ? 186 ARG A CZ  1 
ATOM   1100 N NH1 . ARG A 1 151 ? -42.747 35.712 -3.762  1.00 172.19 ? 186 ARG A NH1 1 
ATOM   1101 N NH2 . ARG A 1 151 ? -41.732 37.769 -3.840  1.00 161.91 ? 186 ARG A NH2 1 
ATOM   1102 N N   . PRO A 1 152 ? -36.210 31.065 -5.608  1.00 149.57 ? 187 PRO A N   1 
ATOM   1103 C CA  . PRO A 1 152 ? -35.522 29.778 -5.736  1.00 154.94 ? 187 PRO A CA  1 
ATOM   1104 C C   . PRO A 1 152 ? -35.585 28.947 -4.454  1.00 159.65 ? 187 PRO A C   1 
ATOM   1105 O O   . PRO A 1 152 ? -35.887 29.486 -3.387  1.00 161.55 ? 187 PRO A O   1 
ATOM   1106 C CB  . PRO A 1 152 ? -34.078 30.186 -6.037  1.00 153.93 ? 187 PRO A CB  1 
ATOM   1107 C CG  . PRO A 1 152 ? -33.921 31.507 -5.371  1.00 152.24 ? 187 PRO A CG  1 
ATOM   1108 C CD  . PRO A 1 152 ? -35.261 32.182 -5.445  1.00 150.24 ? 187 PRO A CD  1 
ATOM   1109 N N   . LYS A 1 153 ? -35.294 27.651 -4.569  1.00 164.02 ? 188 LYS A N   1 
ATOM   1110 C CA  . LYS A 1 153 ? -35.323 26.729 -3.425  1.00 166.08 ? 188 LYS A CA  1 
ATOM   1111 C C   . LYS A 1 153 ? -33.945 26.157 -3.061  1.00 162.42 ? 188 LYS A C   1 
ATOM   1112 O O   . LYS A 1 153 ? -33.853 25.218 -2.270  1.00 152.91 ? 188 LYS A O   1 
ATOM   1113 C CB  . LYS A 1 153 ? -36.300 25.577 -3.700  1.00 169.63 ? 188 LYS A CB  1 
ATOM   1114 C CG  . LYS A 1 153 ? -37.738 25.996 -3.989  1.00 173.32 ? 188 LYS A CG  1 
ATOM   1115 C CD  . LYS A 1 153 ? -38.327 26.953 -2.953  1.00 175.23 ? 188 LYS A CD  1 
ATOM   1116 C CE  . LYS A 1 153 ? -38.214 26.447 -1.519  1.00 173.74 ? 188 LYS A CE  1 
ATOM   1117 N NZ  . LYS A 1 153 ? -38.846 25.115 -1.321  1.00 173.51 ? 188 LYS A NZ  1 
ATOM   1118 N N   . LYS A 1 154 ? -32.881 26.720 -3.631  1.00 166.75 ? 189 LYS A N   1 
ATOM   1119 C CA  . LYS A 1 154 ? -31.513 26.322 -3.292  1.00 169.38 ? 189 LYS A CA  1 
ATOM   1120 C C   . LYS A 1 154 ? -30.634 27.540 -3.000  1.00 168.42 ? 189 LYS A C   1 
ATOM   1121 O O   . LYS A 1 154 ? -29.481 27.605 -3.435  1.00 172.66 ? 189 LYS A O   1 
ATOM   1122 C CB  . LYS A 1 154 ? -30.903 25.460 -4.410  1.00 171.87 ? 189 LYS A CB  1 
ATOM   1123 C CG  . LYS A 1 154 ? -30.485 24.062 -3.975  1.00 172.61 ? 189 LYS A CG  1 
ATOM   1124 C CD  . LYS A 1 154 ? -31.675 23.135 -3.783  1.00 172.97 ? 189 LYS A CD  1 
ATOM   1125 C CE  . LYS A 1 154 ? -31.230 21.685 -3.658  1.00 173.69 ? 189 LYS A CE  1 
ATOM   1126 N NZ  . LYS A 1 154 ? -32.367 20.733 -3.799  1.00 173.58 ? 189 LYS A NZ  1 
ATOM   1127 N N   . ARG A 1 155 ? -31.178 28.501 -2.253  1.00 164.20 ? 190 ARG A N   1 
ATOM   1128 C CA  . ARG A 1 155 ? -30.390 29.644 -1.804  1.00 162.39 ? 190 ARG A CA  1 
ATOM   1129 C C   . ARG A 1 155 ? -29.312 29.148 -0.852  1.00 154.76 ? 190 ARG A C   1 
ATOM   1130 O O   . ARG A 1 155 ? -29.611 28.730 0.269   1.00 148.79 ? 190 ARG A O   1 
ATOM   1131 C CB  . ARG A 1 155 ? -31.264 30.694 -1.114  1.00 168.29 ? 190 ARG A CB  1 
ATOM   1132 C CG  . ARG A 1 155 ? -32.145 31.482 -2.068  1.00 174.22 ? 190 ARG A CG  1 
ATOM   1133 C CD  . ARG A 1 155 ? -32.861 32.631 -1.376  1.00 180.08 ? 190 ARG A CD  1 
ATOM   1134 N NE  . ARG A 1 155 ? -33.792 32.167 -0.342  1.00 188.23 ? 190 ARG A NE  1 
ATOM   1135 C CZ  . ARG A 1 155 ? -33.532 32.096 0.967   1.00 193.08 ? 190 ARG A CZ  1 
ATOM   1136 N NH1 . ARG A 1 155 ? -32.350 32.458 1.463   1.00 195.53 ? 190 ARG A NH1 1 
ATOM   1137 N NH2 . ARG A 1 155 ? -34.471 31.654 1.797   1.00 192.95 ? 190 ARG A NH2 1 
ATOM   1138 N N   . ALA A 1 156 ? -28.065 29.174 -1.322  1.00 149.45 ? 191 ALA A N   1 
ATOM   1139 C CA  . ALA A 1 156 ? -26.921 28.743 -0.527  1.00 143.10 ? 191 ALA A CA  1 
ATOM   1140 C C   . ALA A 1 156 ? -26.937 29.461 0.816   1.00 141.57 ? 191 ALA A C   1 
ATOM   1141 O O   . ALA A 1 156 ? -27.057 30.688 0.869   1.00 137.47 ? 191 ALA A O   1 
ATOM   1142 C CB  . ALA A 1 156 ? -25.621 29.027 -1.265  1.00 139.90 ? 191 ALA A CB  1 
ATOM   1143 N N   . GLN A 1 157 ? -26.846 28.686 1.894   1.00 138.27 ? 192 GLN A N   1 
ATOM   1144 C CA  . GLN A 1 157 ? -26.881 29.236 3.244   1.00 132.93 ? 192 GLN A CA  1 
ATOM   1145 C C   . GLN A 1 157 ? -25.792 30.292 3.429   1.00 122.64 ? 192 GLN A C   1 
ATOM   1146 O O   . GLN A 1 157 ? -24.650 30.102 3.015   1.00 122.68 ? 192 GLN A O   1 
ATOM   1147 C CB  . GLN A 1 157 ? -26.743 28.128 4.299   1.00 140.05 ? 192 GLN A CB  1 
ATOM   1148 C CG  . GLN A 1 157 ? -25.473 27.285 4.201   1.00 148.07 ? 192 GLN A CG  1 
ATOM   1149 C CD  . GLN A 1 157 ? -25.143 26.572 5.502   1.00 153.09 ? 192 GLN A CD  1 
ATOM   1150 O OE1 . GLN A 1 157 ? -25.963 25.821 6.033   1.00 156.69 ? 192 GLN A OE1 1 
ATOM   1151 N NE2 . GLN A 1 157 ? -23.936 26.801 6.022   1.00 148.39 ? 192 GLN A NE2 1 
ATOM   1152 N N   . THR A 1 158 ? -26.170 31.409 4.037   1.00 115.92 ? 193 THR A N   1 
ATOM   1153 C CA  . THR A 1 158 ? -25.245 32.509 4.309   1.00 111.43 ? 193 THR A CA  1 
ATOM   1154 C C   . THR A 1 158 ? -24.851 32.552 5.791   1.00 106.08 ? 193 THR A C   1 
ATOM   1155 O O   . THR A 1 158 ? -24.026 33.379 6.192   1.00 102.86 ? 193 THR A O   1 
ATOM   1156 C CB  . THR A 1 158 ? -25.843 33.870 3.867   1.00 113.49 ? 193 THR A CB  1 
ATOM   1157 O OG1 . THR A 1 158 ? -25.027 34.944 4.351   1.00 121.72 ? 193 THR A OG1 1 
ATOM   1158 C CG2 . THR A 1 158 ? -27.269 34.056 4.384   1.00 112.97 ? 193 THR A CG2 1 
ATOM   1159 N N   . LEU A 1 159 ? -25.425 31.646 6.586   1.00 100.56 ? 194 LEU A N   1 
ATOM   1160 C CA  . LEU A 1 159 ? -25.237 31.619 8.036   1.00 100.12 ? 194 LEU A CA  1 
ATOM   1161 C C   . LEU A 1 159 ? -24.631 30.302 8.485   1.00 98.01  ? 194 LEU A C   1 
ATOM   1162 O O   . LEU A 1 159 ? -25.041 29.235 8.018   1.00 98.41  ? 194 LEU A O   1 
ATOM   1163 C CB  . LEU A 1 159 ? -26.582 31.801 8.727   1.00 103.03 ? 194 LEU A CB  1 
ATOM   1164 C CG  . LEU A 1 159 ? -27.041 33.253 8.776   1.00 106.28 ? 194 LEU A CG  1 
ATOM   1165 C CD1 . LEU A 1 159 ? -28.525 33.327 9.101   1.00 105.67 ? 194 LEU A CD1 1 
ATOM   1166 C CD2 . LEU A 1 159 ? -26.193 34.019 9.785   1.00 110.12 ? 194 LEU A CD2 1 
ATOM   1167 N N   . LEU A 1 160 ? -23.682 30.382 9.415   1.00 95.33  ? 195 LEU A N   1 
ATOM   1168 C CA  . LEU A 1 160 ? -22.918 29.213 9.848   1.00 94.57  ? 195 LEU A CA  1 
ATOM   1169 C C   . LEU A 1 160 ? -23.021 28.979 11.352  1.00 91.26  ? 195 LEU A C   1 
ATOM   1170 O O   . LEU A 1 160 ? -22.860 29.910 12.139  1.00 93.32  ? 195 LEU A O   1 
ATOM   1171 C CB  . LEU A 1 160 ? -21.448 29.396 9.459   1.00 96.07  ? 195 LEU A CB  1 
ATOM   1172 C CG  . LEU A 1 160 ? -20.499 28.212 9.663   1.00 97.23  ? 195 LEU A CG  1 
ATOM   1173 C CD1 . LEU A 1 160 ? -20.943 26.994 8.868   1.00 97.05  ? 195 LEU A CD1 1 
ATOM   1174 C CD2 . LEU A 1 160 ? -19.084 28.613 9.276   1.00 98.41  ? 195 LEU A CD2 1 
ATOM   1175 N N   . PHE A 1 161 ? -23.299 27.734 11.737  1.00 92.44  ? 196 PHE A N   1 
ATOM   1176 C CA  . PHE A 1 161 ? -23.202 27.291 13.134  1.00 91.84  ? 196 PHE A CA  1 
ATOM   1177 C C   . PHE A 1 161 ? -21.931 26.477 13.317  1.00 93.11  ? 196 PHE A C   1 
ATOM   1178 O O   . PHE A 1 161 ? -21.458 25.833 12.376  1.00 99.26  ? 196 PHE A O   1 
ATOM   1179 C CB  . PHE A 1 161 ? -24.397 26.416 13.517  1.00 91.23  ? 196 PHE A CB  1 
ATOM   1180 C CG  . PHE A 1 161 ? -25.695 27.160 13.574  1.00 95.01  ? 196 PHE A CG  1 
ATOM   1181 C CD1 . PHE A 1 161 ? -26.527 27.214 12.467  1.00 93.60  ? 196 PHE A CD1 1 
ATOM   1182 C CD2 . PHE A 1 161 ? -26.082 27.812 14.735  1.00 96.12  ? 196 PHE A CD2 1 
ATOM   1183 C CE1 . PHE A 1 161 ? -27.722 27.902 12.517  1.00 93.61  ? 196 PHE A CE1 1 
ATOM   1184 C CE2 . PHE A 1 161 ? -27.277 28.504 14.791  1.00 94.65  ? 196 PHE A CE2 1 
ATOM   1185 C CZ  . PHE A 1 161 ? -28.098 28.549 13.681  1.00 95.75  ? 196 PHE A CZ  1 
ATOM   1186 N N   . SER A 1 162 ? -21.384 26.488 14.528  1.00 93.38  ? 197 SER A N   1 
ATOM   1187 C CA  . SER A 1 162 ? -20.225 25.654 14.843  1.00 92.87  ? 197 SER A CA  1 
ATOM   1188 C C   . SER A 1 162 ? -20.626 24.176 14.871  1.00 98.12  ? 197 SER A C   1 
ATOM   1189 O O   . SER A 1 162 ? -21.807 23.850 15.027  1.00 95.90  ? 197 SER A O   1 
ATOM   1190 C CB  . SER A 1 162 ? -19.619 26.072 16.180  1.00 88.43  ? 197 SER A CB  1 
ATOM   1191 O OG  . SER A 1 162 ? -20.597 26.069 17.199  1.00 86.78  ? 197 SER A OG  1 
ATOM   1192 N N   . HIS A 1 163 ? -19.643 23.288 14.723  1.00 104.32 ? 198 HIS A N   1 
ATOM   1193 C CA  . HIS A 1 163 ? -19.899 21.845 14.695  1.00 108.39 ? 198 HIS A CA  1 
ATOM   1194 C C   . HIS A 1 163 ? -20.291 21.367 16.082  1.00 102.47 ? 198 HIS A C   1 
ATOM   1195 O O   . HIS A 1 163 ? -21.109 20.460 16.226  1.00 96.56  ? 198 HIS A O   1 
ATOM   1196 C CB  . HIS A 1 163 ? -18.672 21.057 14.216  1.00 117.22 ? 198 HIS A CB  1 
ATOM   1197 C CG  . HIS A 1 163 ? -18.475 21.081 12.733  1.00 135.83 ? 198 HIS A CG  1 
ATOM   1198 N ND1 . HIS A 1 163 ? -19.409 20.585 11.848  1.00 144.16 ? 198 HIS A ND1 1 
ATOM   1199 C CD2 . HIS A 1 163 ? -17.441 21.525 11.978  1.00 146.32 ? 198 HIS A CD2 1 
ATOM   1200 C CE1 . HIS A 1 163 ? -18.966 20.736 10.612  1.00 147.24 ? 198 HIS A CE1 1 
ATOM   1201 N NE2 . HIS A 1 163 ? -17.773 21.303 10.663  1.00 148.56 ? 198 HIS A NE2 1 
ATOM   1202 N N   . ASN A 1 164 ? -19.698 21.987 17.098  1.00 101.04 ? 199 ASN A N   1 
ATOM   1203 C CA  . ASN A 1 164 ? -19.926 21.607 18.480  1.00 103.87 ? 199 ASN A CA  1 
ATOM   1204 C C   . ASN A 1 164 ? -20.433 22.776 19.302  1.00 102.89 ? 199 ASN A C   1 
ATOM   1205 O O   . ASN A 1 164 ? -20.135 23.934 19.009  1.00 102.44 ? 199 ASN A O   1 
ATOM   1206 C CB  . ASN A 1 164 ? -18.622 21.107 19.111  1.00 104.59 ? 199 ASN A CB  1 
ATOM   1207 C CG  . ASN A 1 164 ? -18.016 19.943 18.356  1.00 101.88 ? 199 ASN A CG  1 
ATOM   1208 O OD1 . ASN A 1 164 ? -16.912 20.043 17.825  1.00 102.47 ? 199 ASN A OD1 1 
ATOM   1209 N ND2 . ASN A 1 164 ? -18.744 18.837 18.291  1.00 101.45 ? 199 ASN A ND2 1 
ATOM   1210 N N   . ALA A 1 165 ? -21.212 22.450 20.328  1.00 103.79 ? 200 ALA A N   1 
ATOM   1211 C CA  . ALA A 1 165 ? -21.433 23.347 21.448  1.00 104.98 ? 200 ALA A CA  1 
ATOM   1212 C C   . ALA A 1 165 ? -20.406 22.989 22.519  1.00 104.40 ? 200 ALA A C   1 
ATOM   1213 O O   . ALA A 1 165 ? -19.739 21.953 22.427  1.00 101.99 ? 200 ALA A O   1 
ATOM   1214 C CB  . ALA A 1 165 ? -22.845 23.187 21.986  1.00 104.85 ? 200 ALA A CB  1 
ATOM   1215 N N   . VAL A 1 166 ? -20.271 23.846 23.526  1.00 101.57 ? 201 VAL A N   1 
ATOM   1216 C CA  . VAL A 1 166 ? -19.367 23.579 24.642  1.00 101.59 ? 201 VAL A CA  1 
ATOM   1217 C C   . VAL A 1 166 ? -20.017 23.948 25.968  1.00 102.34 ? 201 VAL A C   1 
ATOM   1218 O O   . VAL A 1 166 ? -20.962 24.736 26.006  1.00 108.27 ? 201 VAL A O   1 
ATOM   1219 C CB  . VAL A 1 166 ? -18.034 24.356 24.514  1.00 101.08 ? 201 VAL A CB  1 
ATOM   1220 C CG1 . VAL A 1 166 ? -17.381 24.096 23.163  1.00 99.86  ? 201 VAL A CG1 1 
ATOM   1221 C CG2 . VAL A 1 166 ? -18.244 25.849 24.727  1.00 101.54 ? 201 VAL A CG2 1 
ATOM   1222 N N   . VAL A 1 167 ? -19.501 23.368 27.048  1.00 99.08  ? 202 VAL A N   1 
ATOM   1223 C CA  . VAL A 1 167 ? -19.856 23.790 28.394  1.00 97.17  ? 202 VAL A CA  1 
ATOM   1224 C C   . VAL A 1 167 ? -18.604 24.309 29.092  1.00 98.02  ? 202 VAL A C   1 
ATOM   1225 O O   . VAL A 1 167 ? -17.549 23.686 29.030  1.00 100.49 ? 202 VAL A O   1 
ATOM   1226 C CB  . VAL A 1 167 ? -20.485 22.652 29.208  1.00 96.23  ? 202 VAL A CB  1 
ATOM   1227 C CG1 . VAL A 1 167 ? -20.796 23.119 30.624  1.00 98.22  ? 202 VAL A CG1 1 
ATOM   1228 C CG2 . VAL A 1 167 ? -21.745 22.155 28.515  1.00 99.73  ? 202 VAL A CG2 1 
ATOM   1229 N N   . ALA A 1 168 ? -18.733 25.461 29.741  1.00 97.54  ? 203 ALA A N   1 
ATOM   1230 C CA  . ALA A 1 168 ? -17.608 26.116 30.392  1.00 97.29  ? 203 ALA A CA  1 
ATOM   1231 C C   . ALA A 1 168 ? -18.092 27.270 31.268  1.00 101.74 ? 203 ALA A C   1 
ATOM   1232 O O   . ALA A 1 168 ? -19.257 27.670 31.202  1.00 107.74 ? 203 ALA A O   1 
ATOM   1233 C CB  . ALA A 1 168 ? -16.620 26.616 29.349  1.00 98.54  ? 203 ALA A CB  1 
ATOM   1234 N N   . MET A 1 169 ? -17.190 27.798 32.089  1.00 104.20 ? 204 MET A N   1 
ATOM   1235 C CA  . MET A 1 169 ? -17.525 28.886 33.001  1.00 106.90 ? 204 MET A CA  1 
ATOM   1236 C C   . MET A 1 169 ? -17.300 30.235 32.333  1.00 104.96 ? 204 MET A C   1 
ATOM   1237 O O   . MET A 1 169 ? -16.290 30.434 31.655  1.00 99.78  ? 204 MET A O   1 
ATOM   1238 C CB  . MET A 1 169 ? -16.674 28.808 34.274  1.00 106.98 ? 204 MET A CB  1 
ATOM   1239 C CG  . MET A 1 169 ? -16.871 27.542 35.094  1.00 110.52 ? 204 MET A CG  1 
ATOM   1240 S SD  . MET A 1 169 ? -18.509 27.385 35.831  1.00 113.55 ? 204 MET A SD  1 
ATOM   1241 C CE  . MET A 1 169 ? -18.479 28.720 37.027  1.00 107.40 ? 204 MET A CE  1 
ATOM   1242 N N   . ARG A 1 170 ? -18.250 31.150 32.516  1.00 105.63 ? 205 ARG A N   1 
ATOM   1243 C CA  . ARG A 1 170 ? -18.049 32.550 32.156  1.00 109.07 ? 205 ARG A CA  1 
ATOM   1244 C C   . ARG A 1 170 ? -18.643 33.446 33.234  1.00 107.43 ? 205 ARG A C   1 
ATOM   1245 O O   . ARG A 1 170 ? -19.815 33.321 33.574  1.00 110.50 ? 205 ARG A O   1 
ATOM   1246 C CB  . ARG A 1 170 ? -18.661 32.887 30.793  1.00 110.55 ? 205 ARG A CB  1 
ATOM   1247 C CG  . ARG A 1 170 ? -18.233 34.264 30.301  1.00 114.86 ? 205 ARG A CG  1 
ATOM   1248 C CD  . ARG A 1 170 ? -18.704 34.584 28.893  1.00 115.62 ? 205 ARG A CD  1 
ATOM   1249 N NE  . ARG A 1 170 ? -17.971 33.838 27.874  1.00 113.74 ? 205 ARG A NE  1 
ATOM   1250 C CZ  . ARG A 1 170 ? -17.997 34.109 26.571  1.00 112.42 ? 205 ARG A CZ  1 
ATOM   1251 N NH1 . ARG A 1 170 ? -18.717 35.124 26.098  1.00 111.67 ? 205 ARG A NH1 1 
ATOM   1252 N NH2 . ARG A 1 170 ? -17.294 33.361 25.730  1.00 112.70 ? 205 ARG A NH2 1 
ATOM   1253 N N   . ASP A 1 171 ? -17.816 34.342 33.765  1.00 108.31 ? 206 ASP A N   1 
ATOM   1254 C CA  . ASP A 1 171 ? -18.211 35.254 34.839  1.00 111.36 ? 206 ASP A CA  1 
ATOM   1255 C C   . ASP A 1 171 ? -18.964 34.549 35.973  1.00 112.89 ? 206 ASP A C   1 
ATOM   1256 O O   . ASP A 1 171 ? -20.037 34.984 36.398  1.00 117.75 ? 206 ASP A O   1 
ATOM   1257 C CB  . ASP A 1 171 ? -19.017 36.418 34.261  1.00 112.01 ? 206 ASP A CB  1 
ATOM   1258 C CG  . ASP A 1 171 ? -18.245 37.184 33.202  1.00 115.37 ? 206 ASP A CG  1 
ATOM   1259 O OD1 . ASP A 1 171 ? -18.876 37.855 32.361  1.00 116.84 ? 206 ASP A OD1 1 
ATOM   1260 O OD2 . ASP A 1 171 ? -16.998 37.109 33.203  1.00 117.72 ? 206 ASP A OD2 1 
ATOM   1261 N N   . GLY A 1 172 ? -18.382 33.450 36.446  1.00 108.82 ? 207 GLY A N   1 
ATOM   1262 C CA  . GLY A 1 172 ? -18.894 32.723 37.603  1.00 109.66 ? 207 GLY A CA  1 
ATOM   1263 C C   . GLY A 1 172 ? -20.099 31.832 37.358  1.00 109.69 ? 207 GLY A C   1 
ATOM   1264 O O   . GLY A 1 172 ? -20.759 31.421 38.311  1.00 107.37 ? 207 GLY A O   1 
ATOM   1265 N N   . LYS A 1 173 ? -20.385 31.513 36.095  1.00 112.08 ? 208 LYS A N   1 
ATOM   1266 C CA  . LYS A 1 173 ? -21.588 30.749 35.751  1.00 109.89 ? 208 LYS A CA  1 
ATOM   1267 C C   . LYS A 1 173 ? -21.308 29.668 34.709  1.00 104.50 ? 208 LYS A C   1 
ATOM   1268 O O   . LYS A 1 173 ? -20.572 29.893 33.747  1.00 98.01  ? 208 LYS A O   1 
ATOM   1269 C CB  . LYS A 1 173 ? -22.683 31.694 35.254  1.00 116.49 ? 208 LYS A CB  1 
ATOM   1270 C CG  . LYS A 1 173 ? -23.215 32.623 36.334  1.00 126.59 ? 208 LYS A CG  1 
ATOM   1271 C CD  . LYS A 1 173 ? -24.189 33.649 35.781  1.00 136.15 ? 208 LYS A CD  1 
ATOM   1272 C CE  . LYS A 1 173 ? -24.668 34.591 36.876  1.00 140.52 ? 208 LYS A CE  1 
ATOM   1273 N NZ  . LYS A 1 173 ? -25.594 35.637 36.357  1.00 143.62 ? 208 LYS A NZ  1 
ATOM   1274 N N   . LEU A 1 174 ? -21.906 28.496 34.913  1.00 103.21 ? 209 LEU A N   1 
ATOM   1275 C CA  . LEU A 1 174 ? -21.729 27.364 34.012  1.00 103.10 ? 209 LEU A CA  1 
ATOM   1276 C C   . LEU A 1 174 ? -22.661 27.542 32.826  1.00 104.50 ? 209 LEU A C   1 
ATOM   1277 O O   . LEU A 1 174 ? -23.875 27.647 33.003  1.00 105.71 ? 209 LEU A O   1 
ATOM   1278 C CB  . LEU A 1 174 ? -22.036 26.051 34.737  1.00 102.33 ? 209 LEU A CB  1 
ATOM   1279 C CG  . LEU A 1 174 ? -21.715 24.752 33.990  1.00 100.66 ? 209 LEU A CG  1 
ATOM   1280 C CD1 . LEU A 1 174 ? -20.222 24.618 33.737  1.00 99.75  ? 209 LEU A CD1 1 
ATOM   1281 C CD2 . LEU A 1 174 ? -22.240 23.553 34.765  1.00 98.92  ? 209 LEU A CD2 1 
ATOM   1282 N N   . CYS A 1 175 ? -22.091 27.572 31.621  1.00 104.92 ? 210 CYS A N   1 
ATOM   1283 C CA  . CYS A 1 175 ? -22.833 27.970 30.426  1.00 102.69 ? 210 CYS A CA  1 
ATOM   1284 C C   . CYS A 1 175 ? -22.725 26.973 29.290  1.00 100.02 ? 210 CYS A C   1 
ATOM   1285 O O   . CYS A 1 175 ? -21.666 26.399 29.062  1.00 101.52 ? 210 CYS A O   1 
ATOM   1286 C CB  . CYS A 1 175 ? -22.323 29.322 29.926  1.00 102.67 ? 210 CYS A CB  1 
ATOM   1287 S SG  . CYS A 1 175 ? -22.702 30.704 31.022  1.00 106.92 ? 210 CYS A SG  1 
ATOM   1288 N N   . LEU A 1 176 ? -23.833 26.787 28.579  1.00 99.70  ? 211 LEU A N   1 
ATOM   1289 C CA  . LEU A 1 176 ? -23.832 26.113 27.285  1.00 99.91  ? 211 LEU A CA  1 
ATOM   1290 C C   . LEU A 1 176 ? -23.581 27.175 26.219  1.00 95.91  ? 211 LEU A C   1 
ATOM   1291 O O   . LEU A 1 176 ? -24.212 28.229 26.241  1.00 95.83  ? 211 LEU A O   1 
ATOM   1292 C CB  . LEU A 1 176 ? -25.177 25.436 27.043  1.00 101.47 ? 211 LEU A CB  1 
ATOM   1293 C CG  . LEU A 1 176 ? -25.332 24.642 25.745  1.00 102.46 ? 211 LEU A CG  1 
ATOM   1294 C CD1 . LEU A 1 176 ? -24.424 23.420 25.739  1.00 102.88 ? 211 LEU A CD1 1 
ATOM   1295 C CD2 . LEU A 1 176 ? -26.782 24.229 25.563  1.00 100.47 ? 211 LEU A CD2 1 
ATOM   1296 N N   . MET A 1 177 ? -22.660 26.907 25.296  1.00 94.40  ? 212 MET A N   1 
ATOM   1297 C CA  . MET A 1 177 ? -22.262 27.908 24.303  1.00 95.79  ? 212 MET A CA  1 
ATOM   1298 C C   . MET A 1 177 ? -22.110 27.312 22.913  1.00 94.90  ? 212 MET A C   1 
ATOM   1299 O O   . MET A 1 177 ? -21.507 26.254 22.745  1.00 99.16  ? 212 MET A O   1 
ATOM   1300 C CB  . MET A 1 177 ? -20.936 28.573 24.692  1.00 98.10  ? 212 MET A CB  1 
ATOM   1301 C CG  . MET A 1 177 ? -20.878 29.116 26.109  1.00 101.49 ? 212 MET A CG  1 
ATOM   1302 S SD  . MET A 1 177 ? -19.402 30.114 26.424  1.00 104.13 ? 212 MET A SD  1 
ATOM   1303 C CE  . MET A 1 177 ? -18.105 28.891 26.256  1.00 111.91 ? 212 MET A CE  1 
ATOM   1304 N N   . TRP A 1 178 ? -22.659 28.005 21.921  1.00 94.07  ? 213 TRP A N   1 
ATOM   1305 C CA  . TRP A 1 178 ? -22.426 27.678 20.521  1.00 92.02  ? 213 TRP A CA  1 
ATOM   1306 C C   . TRP A 1 178 ? -22.116 28.965 19.774  1.00 93.24  ? 213 TRP A C   1 
ATOM   1307 O O   . TRP A 1 178 ? -22.426 30.059 20.250  1.00 98.19  ? 213 TRP A O   1 
ATOM   1308 C CB  . TRP A 1 178 ? -23.624 26.950 19.907  1.00 89.42  ? 213 TRP A CB  1 
ATOM   1309 C CG  . TRP A 1 178 ? -24.919 27.708 19.947  1.00 89.97  ? 213 TRP A CG  1 
ATOM   1310 C CD1 . TRP A 1 178 ? -25.467 28.440 18.941  1.00 92.44  ? 213 TRP A CD1 1 
ATOM   1311 C CD2 . TRP A 1 178 ? -25.838 27.784 21.043  1.00 91.51  ? 213 TRP A CD2 1 
ATOM   1312 N NE1 . TRP A 1 178 ? -26.667 28.978 19.340  1.00 92.22  ? 213 TRP A NE1 1 
ATOM   1313 C CE2 . TRP A 1 178 ? -26.918 28.588 20.627  1.00 92.72  ? 213 TRP A CE2 1 
ATOM   1314 C CE3 . TRP A 1 178 ? -25.853 27.250 22.336  1.00 92.75  ? 213 TRP A CE3 1 
ATOM   1315 C CZ2 . TRP A 1 178 ? -28.001 28.878 21.461  1.00 93.61  ? 213 TRP A CZ2 1 
ATOM   1316 C CZ3 . TRP A 1 178 ? -26.927 27.537 23.163  1.00 91.63  ? 213 TRP A CZ3 1 
ATOM   1317 C CH2 . TRP A 1 178 ? -27.986 28.344 22.723  1.00 92.69  ? 213 TRP A CH2 1 
ATOM   1318 N N   . ARG A 1 179 ? -21.486 28.827 18.615  1.00 92.37  ? 214 ARG A N   1 
ATOM   1319 C CA  . ARG A 1 179 ? -21.022 29.972 17.849  1.00 93.16  ? 214 ARG A CA  1 
ATOM   1320 C C   . ARG A 1 179 ? -21.818 30.106 16.557  1.00 91.52  ? 214 ARG A C   1 
ATOM   1321 O O   . ARG A 1 179 ? -22.128 29.111 15.903  1.00 89.20  ? 214 ARG A O   1 
ATOM   1322 C CB  . ARG A 1 179 ? -19.529 29.824 17.546  1.00 96.07  ? 214 ARG A CB  1 
ATOM   1323 C CG  . ARG A 1 179 ? -18.949 30.913 16.654  1.00 102.49 ? 214 ARG A CG  1 
ATOM   1324 C CD  . ARG A 1 179 ? -17.450 30.742 16.461  1.00 104.89 ? 214 ARG A CD  1 
ATOM   1325 N NE  . ARG A 1 179 ? -16.657 31.510 17.422  1.00 107.52 ? 214 ARG A NE  1 
ATOM   1326 C CZ  . ARG A 1 179 ? -15.358 31.320 17.652  1.00 107.57 ? 214 ARG A CZ  1 
ATOM   1327 N NH1 . ARG A 1 179 ? -14.680 30.376 17.006  1.00 105.39 ? 214 ARG A NH1 1 
ATOM   1328 N NH2 . ARG A 1 179 ? -14.730 32.077 18.543  1.00 108.48 ? 214 ARG A NH2 1 
ATOM   1329 N N   . VAL A 1 180 ? -22.147 31.347 16.206  1.00 91.55  ? 215 VAL A N   1 
ATOM   1330 C CA  . VAL A 1 180 ? -22.792 31.662 14.937  1.00 89.66  ? 215 VAL A CA  1 
ATOM   1331 C C   . VAL A 1 180 ? -22.002 32.743 14.226  1.00 90.76  ? 215 VAL A C   1 
ATOM   1332 O O   . VAL A 1 180 ? -21.470 33.656 14.860  1.00 87.86  ? 215 VAL A O   1 
ATOM   1333 C CB  . VAL A 1 180 ? -24.255 32.131 15.097  1.00 91.28  ? 215 VAL A CB  1 
ATOM   1334 C CG1 . VAL A 1 180 ? -25.117 30.986 15.597  1.00 94.33  ? 215 VAL A CG1 1 
ATOM   1335 C CG2 . VAL A 1 180 ? -24.369 33.342 16.018  1.00 90.39  ? 215 VAL A CG2 1 
ATOM   1336 N N   . GLY A 1 181 ? -21.934 32.623 12.905  1.00 90.81  ? 216 GLY A N   1 
ATOM   1337 C CA  . GLY A 1 181 ? -21.221 33.576 12.079  1.00 91.67  ? 216 GLY A CA  1 
ATOM   1338 C C   . GLY A 1 181 ? -21.917 33.795 10.754  1.00 93.74  ? 216 GLY A C   1 
ATOM   1339 O O   . GLY A 1 181 ? -22.663 32.932 10.273  1.00 89.14  ? 216 GLY A O   1 
ATOM   1340 N N   . ASN A 1 182 ? -21.649 34.960 10.173  1.00 97.29  ? 217 ASN A N   1 
ATOM   1341 C CA  . ASN A 1 182 ? -22.243 35.399 8.922   1.00 100.98 ? 217 ASN A CA  1 
ATOM   1342 C C   . ASN A 1 182 ? -21.202 35.263 7.826   1.00 104.11 ? 217 ASN A C   1 
ATOM   1343 O O   . ASN A 1 182 ? -20.120 35.819 7.947   1.00 115.60 ? 217 ASN A O   1 
ATOM   1344 C CB  . ASN A 1 182 ? -22.665 36.866 9.073   1.00 98.42  ? 217 ASN A CB  1 
ATOM   1345 C CG  . ASN A 1 182 ? -23.395 37.409 7.859   1.00 99.55  ? 217 ASN A CG  1 
ATOM   1346 O OD1 . ASN A 1 182 ? -23.695 36.687 6.906   1.00 102.43 ? 217 ASN A OD1 1 
ATOM   1347 N ND2 . ASN A 1 182 ? -23.691 38.701 7.894   1.00 102.07 ? 217 ASN A ND2 1 
ATOM   1348 N N   . LEU A 1 183 ? -21.521 34.524 6.764   1.00 104.95 ? 218 LEU A N   1 
ATOM   1349 C CA  . LEU A 1 183 ? -20.563 34.274 5.675   1.00 105.82 ? 218 LEU A CA  1 
ATOM   1350 C C   . LEU A 1 183 ? -20.424 35.408 4.633   1.00 109.43 ? 218 LEU A C   1 
ATOM   1351 O O   . LEU A 1 183 ? -19.655 35.268 3.684   1.00 106.95 ? 218 LEU A O   1 
ATOM   1352 C CB  . LEU A 1 183 ? -20.920 32.971 4.953   1.00 102.96 ? 218 LEU A CB  1 
ATOM   1353 C CG  . LEU A 1 183 ? -20.914 31.695 5.796   1.00 104.95 ? 218 LEU A CG  1 
ATOM   1354 C CD1 . LEU A 1 183 ? -21.329 30.500 4.953   1.00 102.69 ? 218 LEU A CD1 1 
ATOM   1355 C CD2 . LEU A 1 183 ? -19.550 31.454 6.426   1.00 107.05 ? 218 LEU A CD2 1 
ATOM   1356 N N   . ARG A 1 184 ? -21.148 36.516 4.799   1.00 112.18 ? 219 ARG A N   1 
ATOM   1357 C CA  . ARG A 1 184 ? -21.086 37.635 3.846   1.00 112.20 ? 219 ARG A CA  1 
ATOM   1358 C C   . ARG A 1 184 ? -20.841 38.971 4.542   1.00 109.60 ? 219 ARG A C   1 
ATOM   1359 O O   . ARG A 1 184 ? -20.956 39.081 5.763   1.00 102.46 ? 219 ARG A O   1 
ATOM   1360 C CB  . ARG A 1 184 ? -22.383 37.725 3.036   1.00 115.07 ? 219 ARG A CB  1 
ATOM   1361 C CG  . ARG A 1 184 ? -22.809 36.431 2.357   1.00 119.76 ? 219 ARG A CG  1 
ATOM   1362 C CD  . ARG A 1 184 ? -21.877 36.030 1.222   1.00 123.88 ? 219 ARG A CD  1 
ATOM   1363 N NE  . ARG A 1 184 ? -22.165 34.676 0.744   1.00 127.18 ? 219 ARG A NE  1 
ATOM   1364 C CZ  . ARG A 1 184 ? -23.124 34.352 -0.124  1.00 126.69 ? 219 ARG A CZ  1 
ATOM   1365 N NH1 . ARG A 1 184 ? -23.926 35.280 -0.647  1.00 128.43 ? 219 ARG A NH1 1 
ATOM   1366 N NH2 . ARG A 1 184 ? -23.286 33.080 -0.472  1.00 123.89 ? 219 ARG A NH2 1 
ATOM   1367 N N   . LYS A 1 185 ? -20.505 39.983 3.748   1.00 114.75 ? 220 LYS A N   1 
ATOM   1368 C CA  . LYS A 1 185 ? -20.268 41.334 4.265   1.00 123.94 ? 220 LYS A CA  1 
ATOM   1369 C C   . LYS A 1 185 ? -21.571 42.113 4.449   1.00 121.58 ? 220 LYS A C   1 
ATOM   1370 O O   . LYS A 1 185 ? -21.604 43.108 5.182   1.00 119.11 ? 220 LYS A O   1 
ATOM   1371 C CB  . LYS A 1 185 ? -19.318 42.107 3.345   1.00 130.75 ? 220 LYS A CB  1 
ATOM   1372 C CG  . LYS A 1 185 ? -17.934 41.489 3.207   1.00 137.06 ? 220 LYS A CG  1 
ATOM   1373 C CD  . LYS A 1 185 ? -17.218 41.390 4.547   1.00 142.09 ? 220 LYS A CD  1 
ATOM   1374 C CE  . LYS A 1 185 ? -15.734 41.104 4.378   1.00 147.64 ? 220 LYS A CE  1 
ATOM   1375 N NZ  . LYS A 1 185 ? -14.963 42.301 3.939   1.00 151.51 ? 220 LYS A NZ  1 
ATOM   1376 N N   . SER A 1 186 ? -22.634 41.662 3.780   1.00 114.81 ? 221 SER A N   1 
ATOM   1377 C CA  . SER A 1 186 ? -23.977 42.189 4.013   1.00 112.46 ? 221 SER A CA  1 
ATOM   1378 C C   . SER A 1 186 ? -24.507 41.697 5.366   1.00 106.92 ? 221 SER A C   1 
ATOM   1379 O O   . SER A 1 186 ? -24.028 40.699 5.914   1.00 101.64 ? 221 SER A O   1 
ATOM   1380 C CB  . SER A 1 186 ? -24.924 41.782 2.879   1.00 115.66 ? 221 SER A CB  1 
ATOM   1381 O OG  . SER A 1 186 ? -24.975 40.373 2.729   1.00 123.31 ? 221 SER A OG  1 
ATOM   1382 N N   . HIS A 1 187 ? -25.508 42.399 5.887   1.00 99.12  ? 222 HIS A N   1 
ATOM   1383 C CA  . HIS A 1 187 ? -25.949 42.218 7.265   1.00 95.77  ? 222 HIS A CA  1 
ATOM   1384 C C   . HIS A 1 187 ? -27.245 41.430 7.407   1.00 89.70  ? 222 HIS A C   1 
ATOM   1385 O O   . HIS A 1 187 ? -27.898 41.084 6.423   1.00 89.21  ? 222 HIS A O   1 
ATOM   1386 C CB  . HIS A 1 187 ? -26.110 43.588 7.913   1.00 99.60  ? 222 HIS A CB  1 
ATOM   1387 C CG  . HIS A 1 187 ? -24.880 44.433 7.824   1.00 105.99 ? 222 HIS A CG  1 
ATOM   1388 N ND1 . HIS A 1 187 ? -23.859 44.356 8.745   1.00 107.59 ? 222 HIS A ND1 1 
ATOM   1389 C CD2 . HIS A 1 187 ? -24.496 45.355 6.910   1.00 110.40 ? 222 HIS A CD2 1 
ATOM   1390 C CE1 . HIS A 1 187 ? -22.903 45.202 8.407   1.00 111.36 ? 222 HIS A CE1 1 
ATOM   1391 N NE2 . HIS A 1 187 ? -23.265 45.823 7.299   1.00 112.49 ? 222 HIS A NE2 1 
ATOM   1392 N N   . ILE A 1 188 ? -27.587 41.132 8.656   1.00 85.56  ? 223 ILE A N   1 
ATOM   1393 C CA  . ILE A 1 188 ? -28.851 40.514 9.001   1.00 82.51  ? 223 ILE A CA  1 
ATOM   1394 C C   . ILE A 1 188 ? -29.593 41.484 9.885   1.00 80.79  ? 223 ILE A C   1 
ATOM   1395 O O   . ILE A 1 188 ? -29.113 41.850 10.949  1.00 83.17  ? 223 ILE A O   1 
ATOM   1396 C CB  . ILE A 1 188 ? -28.658 39.198 9.754   1.00 87.68  ? 223 ILE A CB  1 
ATOM   1397 C CG1 . ILE A 1 188 ? -27.605 38.361 9.040   1.00 94.26  ? 223 ILE A CG1 1 
ATOM   1398 C CG2 . ILE A 1 188 ? -29.979 38.439 9.847   1.00 88.28  ? 223 ILE A CG2 1 
ATOM   1399 C CD1 . ILE A 1 188 ? -27.500 36.950 9.556   1.00 100.73 ? 223 ILE A CD1 1 
ATOM   1400 N N   . VAL A 1 189 ? -30.763 41.903 9.423   1.00 83.01  ? 224 VAL A N   1 
ATOM   1401 C CA  . VAL A 1 189 ? -31.565 42.886 10.116  1.00 79.41  ? 224 VAL A CA  1 
ATOM   1402 C C   . VAL A 1 189 ? -32.447 42.161 11.118  1.00 80.83  ? 224 VAL A C   1 
ATOM   1403 O O   . VAL A 1 189 ? -32.922 41.054 10.850  1.00 77.80  ? 224 VAL A O   1 
ATOM   1404 C CB  . VAL A 1 189 ? -32.421 43.689 9.121   1.00 78.95  ? 224 VAL A CB  1 
ATOM   1405 C CG1 . VAL A 1 189 ? -33.280 44.715 9.845   1.00 78.31  ? 224 VAL A CG1 1 
ATOM   1406 C CG2 . VAL A 1 189 ? -31.515 44.366 8.102   1.00 81.86  ? 224 VAL A CG2 1 
ATOM   1407 N N   . GLU A 1 190 ? -32.637 42.784 12.281  1.00 80.40  ? 225 GLU A N   1 
ATOM   1408 C CA  . GLU A 1 190 ? -33.483 42.245 13.338  1.00 75.31  ? 225 GLU A CA  1 
ATOM   1409 C C   . GLU A 1 190 ? -33.197 40.761 13.539  1.00 76.42  ? 225 GLU A C   1 
ATOM   1410 O O   . GLU A 1 190 ? -34.101 39.924 13.524  1.00 82.03  ? 225 GLU A O   1 
ATOM   1411 C CB  . GLU A 1 190 ? -34.949 42.507 13.012  1.00 73.90  ? 225 GLU A CB  1 
ATOM   1412 C CG  . GLU A 1 190 ? -35.318 43.978 13.104  1.00 77.28  ? 225 GLU A CG  1 
ATOM   1413 C CD  . GLU A 1 190 ? -36.696 44.302 12.552  1.00 82.32  ? 225 GLU A CD  1 
ATOM   1414 O OE1 . GLU A 1 190 ? -37.335 43.419 11.937  1.00 83.54  ? 225 GLU A OE1 1 
ATOM   1415 O OE2 . GLU A 1 190 ? -37.144 45.459 12.727  1.00 88.60  ? 225 GLU A OE2 1 
ATOM   1416 N N   . ALA A 1 191 ? -31.913 40.456 13.706  1.00 76.12  ? 226 ALA A N   1 
ATOM   1417 C CA  . ALA A 1 191 ? -31.451 39.087 13.866  1.00 75.52  ? 226 ALA A CA  1 
ATOM   1418 C C   . ALA A 1 191 ? -31.573 38.693 15.318  1.00 77.03  ? 226 ALA A C   1 
ATOM   1419 O O   . ALA A 1 191 ? -31.280 39.491 16.216  1.00 77.65  ? 226 ALA A O   1 
ATOM   1420 C CB  . ALA A 1 191 ? -30.007 38.954 13.416  1.00 75.86  ? 226 ALA A CB  1 
ATOM   1421 N N   . HIS A 1 192 ? -31.994 37.459 15.557  1.00 72.03  ? 227 HIS A N   1 
ATOM   1422 C CA  . HIS A 1 192 ? -32.137 36.986 16.919  1.00 71.61  ? 227 HIS A CA  1 
ATOM   1423 C C   . HIS A 1 192 ? -32.094 35.464 16.969  1.00 68.70  ? 227 HIS A C   1 
ATOM   1424 O O   . HIS A 1 192 ? -32.407 34.808 15.989  1.00 66.00  ? 227 HIS A O   1 
ATOM   1425 C CB  . HIS A 1 192 ? -33.449 37.492 17.493  1.00 68.15  ? 227 HIS A CB  1 
ATOM   1426 C CG  . HIS A 1 192 ? -34.640 36.829 16.896  1.00 66.04  ? 227 HIS A CG  1 
ATOM   1427 N ND1 . HIS A 1 192 ? -35.105 37.138 15.643  1.00 68.06  ? 227 HIS A ND1 1 
ATOM   1428 C CD2 . HIS A 1 192 ? -35.433 35.837 17.358  1.00 71.45  ? 227 HIS A CD2 1 
ATOM   1429 C CE1 . HIS A 1 192 ? -36.150 36.382 15.364  1.00 68.16  ? 227 HIS A CE1 1 
ATOM   1430 N NE2 . HIS A 1 192 ? -36.370 35.584 16.388  1.00 70.67  ? 227 HIS A NE2 1 
ATOM   1431 N N   . VAL A 1 193 ? -31.738 34.928 18.133  1.00 70.70  ? 228 VAL A N   1 
ATOM   1432 C CA  . VAL A 1 193 ? -31.474 33.499 18.298  1.00 74.65  ? 228 VAL A CA  1 
ATOM   1433 C C   . VAL A 1 193 ? -32.456 32.792 19.235  1.00 77.72  ? 228 VAL A C   1 
ATOM   1434 O O   . VAL A 1 193 ? -33.065 33.403 20.117  1.00 83.04  ? 228 VAL A O   1 
ATOM   1435 C CB  . VAL A 1 193 ? -30.045 33.250 18.835  1.00 74.49  ? 228 VAL A CB  1 
ATOM   1436 C CG1 . VAL A 1 193 ? -29.014 33.517 17.752  1.00 74.68  ? 228 VAL A CG1 1 
ATOM   1437 C CG2 . VAL A 1 193 ? -29.759 34.105 20.063  1.00 74.94  ? 228 VAL A CG2 1 
ATOM   1438 N N   . ARG A 1 194 ? -32.591 31.491 19.025  1.00 77.02  ? 229 ARG A N   1 
ATOM   1439 C CA  . ARG A 1 194 ? -33.356 30.623 19.904  1.00 78.37  ? 229 ARG A CA  1 
ATOM   1440 C C   . ARG A 1 194 ? -32.633 29.291 20.048  1.00 80.93  ? 229 ARG A C   1 
ATOM   1441 O O   . ARG A 1 194 ? -31.706 28.982 19.290  1.00 78.96  ? 229 ARG A O   1 
ATOM   1442 C CB  . ARG A 1 194 ? -34.732 30.343 19.326  1.00 79.35  ? 229 ARG A CB  1 
ATOM   1443 C CG  . ARG A 1 194 ? -35.575 31.565 19.075  1.00 86.21  ? 229 ARG A CG  1 
ATOM   1444 C CD  . ARG A 1 194 ? -36.758 31.213 18.194  1.00 92.16  ? 229 ARG A CD  1 
ATOM   1445 N NE  . ARG A 1 194 ? -37.663 30.297 18.880  1.00 98.19  ? 229 ARG A NE  1 
ATOM   1446 C CZ  . ARG A 1 194 ? -38.756 29.768 18.336  1.00 100.41 ? 229 ARG A CZ  1 
ATOM   1447 N NH1 . ARG A 1 194 ? -39.091 30.057 17.077  1.00 91.82  ? 229 ARG A NH1 1 
ATOM   1448 N NH2 . ARG A 1 194 ? -39.513 28.943 19.062  1.00 98.35  ? 229 ARG A NH2 1 
ATOM   1449 N N   . ALA A 1 195 ? -33.083 28.499 21.012  1.00 81.67  ? 230 ALA A N   1 
ATOM   1450 C CA  . ALA A 1 195 ? -32.561 27.162 21.208  1.00 84.65  ? 230 ALA A CA  1 
ATOM   1451 C C   . ALA A 1 195 ? -33.586 26.304 21.933  1.00 85.41  ? 230 ALA A C   1 
ATOM   1452 O O   . ALA A 1 195 ? -34.422 26.819 22.671  1.00 88.88  ? 230 ALA A O   1 
ATOM   1453 C CB  . ALA A 1 195 ? -31.257 27.224 21.982  1.00 86.58  ? 230 ALA A CB  1 
ATOM   1454 N N   . GLN A 1 196 ? -33.524 24.997 21.705  1.00 91.12  ? 231 GLN A N   1 
ATOM   1455 C CA  . GLN A 1 196 ? -34.475 24.057 22.297  1.00 92.92  ? 231 GLN A CA  1 
ATOM   1456 C C   . GLN A 1 196 ? -33.818 22.728 22.631  1.00 93.55  ? 231 GLN A C   1 
ATOM   1457 O O   . GLN A 1 196 ? -32.965 22.250 21.888  1.00 93.41  ? 231 GLN A O   1 
ATOM   1458 C CB  . GLN A 1 196 ? -35.627 23.792 21.332  1.00 90.85  ? 231 GLN A CB  1 
ATOM   1459 C CG  . GLN A 1 196 ? -36.510 24.995 21.060  1.00 93.99  ? 231 GLN A CG  1 
ATOM   1460 C CD  . GLN A 1 196 ? -37.805 24.625 20.358  1.00 95.98  ? 231 GLN A CD  1 
ATOM   1461 O OE1 . GLN A 1 196 ? -38.859 25.204 20.632  1.00 104.48 ? 231 GLN A OE1 1 
ATOM   1462 N NE2 . GLN A 1 196 ? -37.736 23.657 19.451  1.00 91.96  ? 231 GLN A NE2 1 
ATOM   1463 N N   . LEU A 1 197 ? -34.229 22.134 23.747  1.00 96.03  ? 232 LEU A N   1 
ATOM   1464 C CA  . LEU A 1 197 ? -33.868 20.760 24.067  1.00 97.95  ? 232 LEU A CA  1 
ATOM   1465 C C   . LEU A 1 197 ? -34.972 19.833 23.565  1.00 97.76  ? 232 LEU A C   1 
ATOM   1466 O O   . LEU A 1 197 ? -36.127 19.955 23.971  1.00 95.94  ? 232 LEU A O   1 
ATOM   1467 C CB  . LEU A 1 197 ? -33.673 20.598 25.572  1.00 100.55 ? 232 LEU A CB  1 
ATOM   1468 C CG  . LEU A 1 197 ? -33.129 19.244 26.044  1.00 100.20 ? 232 LEU A CG  1 
ATOM   1469 C CD1 . LEU A 1 197 ? -32.058 19.441 27.104  1.00 100.65 ? 232 LEU A CD1 1 
ATOM   1470 C CD2 . LEU A 1 197 ? -34.241 18.346 26.567  1.00 102.81 ? 232 LEU A CD2 1 
ATOM   1471 N N   . ILE A 1 198 ? -34.609 18.917 22.672  1.00 101.76 ? 233 ILE A N   1 
ATOM   1472 C CA  . ILE A 1 198 ? -35.552 17.965 22.095  1.00 107.92 ? 233 ILE A CA  1 
ATOM   1473 C C   . ILE A 1 198 ? -35.331 16.587 22.710  1.00 108.34 ? 233 ILE A C   1 
ATOM   1474 O O   . ILE A 1 198 ? -34.244 16.022 22.590  1.00 111.53 ? 233 ILE A O   1 
ATOM   1475 C CB  . ILE A 1 198 ? -35.373 17.845 20.561  1.00 110.86 ? 233 ILE A CB  1 
ATOM   1476 C CG1 . ILE A 1 198 ? -35.371 19.224 19.885  1.00 112.40 ? 233 ILE A CG1 1 
ATOM   1477 C CG2 . ILE A 1 198 ? -36.454 16.955 19.958  1.00 110.49 ? 233 ILE A CG2 1 
ATOM   1478 C CD1 . ILE A 1 198 ? -36.665 20.001 20.019  1.00 114.60 ? 233 ILE A CD1 1 
ATOM   1479 N N   . LYS A 1 199 ? -36.353 16.063 23.383  1.00 111.68 ? 234 LYS A N   1 
ATOM   1480 C CA  . LYS A 1 199 ? -36.361 14.665 23.829  1.00 114.31 ? 234 LYS A CA  1 
ATOM   1481 C C   . LYS A 1 199 ? -37.779 14.229 24.191  1.00 110.82 ? 234 LYS A C   1 
ATOM   1482 O O   . LYS A 1 199 ? -38.620 15.073 24.510  1.00 110.46 ? 234 LYS A O   1 
ATOM   1483 C CB  . LYS A 1 199 ? -35.411 14.445 25.020  1.00 116.48 ? 234 LYS A CB  1 
ATOM   1484 C CG  . LYS A 1 199 ? -35.918 14.933 26.367  1.00 121.42 ? 234 LYS A CG  1 
ATOM   1485 C CD  . LYS A 1 199 ? -34.964 14.527 27.479  1.00 127.71 ? 234 LYS A CD  1 
ATOM   1486 C CE  . LYS A 1 199 ? -35.485 14.940 28.847  1.00 132.50 ? 234 LYS A CE  1 
ATOM   1487 N NZ  . LYS A 1 199 ? -34.418 14.876 29.885  1.00 135.89 ? 234 LYS A NZ  1 
ATOM   1488 N N   . PRO A 1 200 ? -38.052 12.911 24.144  1.00 109.55 ? 235 PRO A N   1 
ATOM   1489 C CA  . PRO A 1 200 ? -39.358 12.425 24.576  1.00 107.28 ? 235 PRO A CA  1 
ATOM   1490 C C   . PRO A 1 200 ? -39.459 12.418 26.088  1.00 107.28 ? 235 PRO A C   1 
ATOM   1491 O O   . PRO A 1 200 ? -38.439 12.343 26.775  1.00 106.73 ? 235 PRO A O   1 
ATOM   1492 C CB  . PRO A 1 200 ? -39.398 10.992 24.049  1.00 102.97 ? 235 PRO A CB  1 
ATOM   1493 C CG  . PRO A 1 200 ? -37.976 10.577 23.985  1.00 105.30 ? 235 PRO A CG  1 
ATOM   1494 C CD  . PRO A 1 200 ? -37.169 11.812 23.714  1.00 107.52 ? 235 PRO A CD  1 
ATOM   1495 N N   . ARG A 1 201 ? -40.678 12.514 26.601  1.00 106.82 ? 236 ARG A N   1 
ATOM   1496 C CA  . ARG A 1 201 ? -40.903 12.342 28.027  1.00 111.41 ? 236 ARG A CA  1 
ATOM   1497 C C   . ARG A 1 201 ? -42.336 11.901 28.285  1.00 114.54 ? 236 ARG A C   1 
ATOM   1498 O O   . ARG A 1 201 ? -43.202 12.008 27.411  1.00 112.41 ? 236 ARG A O   1 
ATOM   1499 C CB  . ARG A 1 201 ? -40.568 13.629 28.803  1.00 110.23 ? 236 ARG A CB  1 
ATOM   1500 C CG  . ARG A 1 201 ? -41.722 14.609 28.954  1.00 107.44 ? 236 ARG A CG  1 
ATOM   1501 C CD  . ARG A 1 201 ? -41.274 15.944 29.520  1.00 104.97 ? 236 ARG A CD  1 
ATOM   1502 N NE  . ARG A 1 201 ? -42.258 16.986 29.227  1.00 106.20 ? 236 ARG A NE  1 
ATOM   1503 C CZ  . ARG A 1 201 ? -43.343 17.250 29.955  1.00 104.73 ? 236 ARG A CZ  1 
ATOM   1504 N NH1 . ARG A 1 201 ? -43.615 16.566 31.060  1.00 105.31 ? 236 ARG A NH1 1 
ATOM   1505 N NH2 . ARG A 1 201 ? -44.165 18.220 29.573  1.00 108.60 ? 236 ARG A NH2 1 
ATOM   1506 N N   . ILE A 1 202 ? -42.560 11.389 29.492  1.00 118.97 ? 237 ILE A N   1 
ATOM   1507 C CA  . ILE A 1 202 ? -43.887 11.019 29.955  1.00 119.45 ? 237 ILE A CA  1 
ATOM   1508 C C   . ILE A 1 202 ? -44.231 11.970 31.090  1.00 115.63 ? 237 ILE A C   1 
ATOM   1509 O O   . ILE A 1 202 ? -43.425 12.167 32.000  1.00 109.27 ? 237 ILE A O   1 
ATOM   1510 C CB  . ILE A 1 202 ? -43.942 9.559  30.460  1.00 123.02 ? 237 ILE A CB  1 
ATOM   1511 C CG1 . ILE A 1 202 ? -43.292 8.606  29.447  1.00 125.61 ? 237 ILE A CG1 1 
ATOM   1512 C CG2 . ILE A 1 202 ? -45.384 9.137  30.709  1.00 122.81 ? 237 ILE A CG2 1 
ATOM   1513 C CD1 . ILE A 1 202 ? -42.892 7.267  30.028  1.00 125.24 ? 237 ILE A CD1 1 
ATOM   1514 N N   . THR A 1 203 ? -45.418 12.567 31.031  1.00 115.38 ? 238 THR A N   1 
ATOM   1515 C CA  . THR A 1 203 ? -45.863 13.479 32.083  1.00 115.80 ? 238 THR A CA  1 
ATOM   1516 C C   . THR A 1 203 ? -46.245 12.666 33.313  1.00 118.29 ? 238 THR A C   1 
ATOM   1517 O O   . THR A 1 203 ? -46.394 11.445 33.235  1.00 122.10 ? 238 THR A O   1 
ATOM   1518 C CB  . THR A 1 203 ? -47.065 14.338 31.638  1.00 115.71 ? 238 THR A CB  1 
ATOM   1519 O OG1 . THR A 1 203 ? -48.181 13.498 31.316  1.00 115.76 ? 238 THR A OG1 1 
ATOM   1520 C CG2 . THR A 1 203 ? -46.705 15.186 30.424  1.00 117.66 ? 238 THR A CG2 1 
ATOM   1521 N N   . GLU A 1 204 ? -46.409 13.341 34.447  1.00 119.29 ? 239 GLU A N   1 
ATOM   1522 C CA  . GLU A 1 204 ? -46.800 12.664 35.686  1.00 119.05 ? 239 GLU A CA  1 
ATOM   1523 C C   . GLU A 1 204 ? -48.168 11.975 35.570  1.00 116.95 ? 239 GLU A C   1 
ATOM   1524 O O   . GLU A 1 204 ? -48.444 11.025 36.304  1.00 119.57 ? 239 GLU A O   1 
ATOM   1525 C CB  . GLU A 1 204 ? -46.780 13.638 36.870  1.00 119.95 ? 239 GLU A CB  1 
ATOM   1526 C CG  . GLU A 1 204 ? -47.855 14.714 36.842  1.00 120.13 ? 239 GLU A CG  1 
ATOM   1527 C CD  . GLU A 1 204 ? -47.579 15.831 37.830  1.00 123.94 ? 239 GLU A CD  1 
ATOM   1528 O OE1 . GLU A 1 204 ? -48.414 16.054 38.734  1.00 118.38 ? 239 GLU A OE1 1 
ATOM   1529 O OE2 . GLU A 1 204 ? -46.517 16.481 37.706  1.00 127.21 ? 239 GLU A OE2 1 
ATOM   1530 N N   . GLU A 1 205 ? -49.005 12.444 34.643  1.00 111.53 ? 240 GLU A N   1 
ATOM   1531 C CA  . GLU A 1 205 ? -50.299 11.816 34.358  1.00 108.07 ? 240 GLU A CA  1 
ATOM   1532 C C   . GLU A 1 205 ? -50.190 10.675 33.341  1.00 106.07 ? 240 GLU A C   1 
ATOM   1533 O O   . GLU A 1 205 ? -51.205 10.144 32.901  1.00 106.32 ? 240 GLU A O   1 
ATOM   1534 C CB  . GLU A 1 205 ? -51.309 12.854 33.844  1.00 109.40 ? 240 GLU A CB  1 
ATOM   1535 C CG  . GLU A 1 205 ? -51.628 13.980 34.822  1.00 111.88 ? 240 GLU A CG  1 
ATOM   1536 C CD  . GLU A 1 205 ? -50.677 15.161 34.734  1.00 113.41 ? 240 GLU A CD  1 
ATOM   1537 O OE1 . GLU A 1 205 ? -49.676 15.078 33.993  1.00 118.23 ? 240 GLU A OE1 1 
ATOM   1538 O OE2 . GLU A 1 205 ? -50.929 16.181 35.412  1.00 117.35 ? 240 GLU A OE2 1 
ATOM   1539 N N   . GLY A 1 206 ? -48.971 10.308 32.957  1.00 109.63 ? 241 GLY A N   1 
ATOM   1540 C CA  . GLY A 1 206 ? -48.752 9.171  32.065  1.00 115.31 ? 241 GLY A CA  1 
ATOM   1541 C C   . GLY A 1 206 ? -49.010 9.434  30.591  1.00 117.41 ? 241 GLY A C   1 
ATOM   1542 O O   . GLY A 1 206 ? -49.351 8.513  29.849  1.00 118.60 ? 241 GLY A O   1 
ATOM   1543 N N   . GLU A 1 207 ? -48.845 10.684 30.162  1.00 122.93 ? 242 GLU A N   1 
ATOM   1544 C CA  . GLU A 1 207 ? -48.969 11.043 28.747  1.00 118.01 ? 242 GLU A CA  1 
ATOM   1545 C C   . GLU A 1 207 ? -47.599 10.983 28.094  1.00 116.05 ? 242 GLU A C   1 
ATOM   1546 O O   . GLU A 1 207 ? -46.625 11.489 28.651  1.00 112.35 ? 242 GLU A O   1 
ATOM   1547 C CB  . GLU A 1 207 ? -49.530 12.457 28.591  1.00 115.93 ? 242 GLU A CB  1 
ATOM   1548 C CG  . GLU A 1 207 ? -49.876 12.829 27.157  1.00 114.39 ? 242 GLU A CG  1 
ATOM   1549 C CD  . GLU A 1 207 ? -50.474 14.218 27.034  1.00 113.28 ? 242 GLU A CD  1 
ATOM   1550 O OE1 . GLU A 1 207 ? -50.941 14.567 25.929  1.00 111.20 ? 242 GLU A OE1 1 
ATOM   1551 O OE2 . GLU A 1 207 ? -50.479 14.964 28.036  1.00 112.86 ? 242 GLU A OE2 1 
ATOM   1552 N N   . TYR A 1 208 ? -47.530 10.369 26.915  1.00 112.87 ? 243 TYR A N   1 
ATOM   1553 C CA  . TYR A 1 208 ? -46.281 10.274 26.168  1.00 112.01 ? 243 TYR A CA  1 
ATOM   1554 C C   . TYR A 1 208 ? -46.192 11.390 25.127  1.00 112.04 ? 243 TYR A C   1 
ATOM   1555 O O   . TYR A 1 208 ? -47.096 11.562 24.303  1.00 113.20 ? 243 TYR A O   1 
ATOM   1556 C CB  . TYR A 1 208 ? -46.155 8.905  25.490  1.00 108.43 ? 243 TYR A CB  1 
ATOM   1557 C CG  . TYR A 1 208 ? -44.837 8.704  24.760  1.00 105.66 ? 243 TYR A CG  1 
ATOM   1558 C CD1 . TYR A 1 208 ? -43.623 8.766  25.447  1.00 102.35 ? 243 TYR A CD1 1 
ATOM   1559 C CD2 . TYR A 1 208 ? -44.804 8.449  23.387  1.00 102.31 ? 243 TYR A CD2 1 
ATOM   1560 C CE1 . TYR A 1 208 ? -42.416 8.584  24.789  1.00 97.85  ? 243 TYR A CE1 1 
ATOM   1561 C CE2 . TYR A 1 208 ? -43.600 8.263  22.722  1.00 99.82  ? 243 TYR A CE2 1 
ATOM   1562 C CZ  . TYR A 1 208 ? -42.411 8.334  23.428  1.00 99.57  ? 243 TYR A CZ  1 
ATOM   1563 O OH  . TYR A 1 208 ? -41.213 8.154  22.774  1.00 101.35 ? 243 TYR A OH  1 
ATOM   1564 N N   . ILE A 1 209 ? -45.100 12.149 25.185  1.00 108.94 ? 244 ILE A N   1 
ATOM   1565 C CA  . ILE A 1 209 ? -44.801 13.175 24.196  1.00 106.19 ? 244 ILE A CA  1 
ATOM   1566 C C   . ILE A 1 209 ? -43.571 12.699 23.427  1.00 103.60 ? 244 ILE A C   1 
ATOM   1567 O O   . ILE A 1 209 ? -42.464 12.725 23.966  1.00 103.32 ? 244 ILE A O   1 
ATOM   1568 C CB  . ILE A 1 209 ? -44.532 14.541 24.862  1.00 106.16 ? 244 ILE A CB  1 
ATOM   1569 C CG1 . ILE A 1 209 ? -45.741 14.969 25.705  1.00 106.23 ? 244 ILE A CG1 1 
ATOM   1570 C CG2 . ILE A 1 209 ? -44.238 15.601 23.808  1.00 105.48 ? 244 ILE A CG2 1 
ATOM   1571 C CD1 . ILE A 1 209 ? -45.424 16.024 26.742  1.00 106.74 ? 244 ILE A CD1 1 
ATOM   1572 N N   . PRO A 1 210 ? -43.764 12.227 22.177  1.00 99.28  ? 245 PRO A N   1 
ATOM   1573 C CA  . PRO A 1 210 ? -42.678 11.671 21.363  1.00 98.69  ? 245 PRO A CA  1 
ATOM   1574 C C   . PRO A 1 210 ? -41.438 12.558 21.257  1.00 104.97 ? 245 PRO A C   1 
ATOM   1575 O O   . PRO A 1 210 ? -40.321 12.053 21.344  1.00 110.61 ? 245 PRO A O   1 
ATOM   1576 C CB  . PRO A 1 210 ? -43.328 11.503 19.990  1.00 98.35  ? 245 PRO A CB  1 
ATOM   1577 C CG  . PRO A 1 210 ? -44.763 11.269 20.285  1.00 97.79  ? 245 PRO A CG  1 
ATOM   1578 C CD  . PRO A 1 210 ? -45.070 12.092 21.503  1.00 98.61  ? 245 PRO A CD  1 
ATOM   1579 N N   . LEU A 1 211 ? -41.637 13.857 21.052  1.00 109.70 ? 246 LEU A N   1 
ATOM   1580 C CA  . LEU A 1 211 ? -40.535 14.819 21.028  1.00 108.27 ? 246 LEU A CA  1 
ATOM   1581 C C   . LEU A 1 211 ? -40.991 16.146 21.609  1.00 103.26 ? 246 LEU A C   1 
ATOM   1582 O O   . LEU A 1 211 ? -41.479 17.015 20.888  1.00 107.58 ? 246 LEU A O   1 
ATOM   1583 C CB  . LEU A 1 211 ? -40.009 15.026 19.598  1.00 109.95 ? 246 LEU A CB  1 
ATOM   1584 C CG  . LEU A 1 211 ? -39.060 13.969 19.015  1.00 115.08 ? 246 LEU A CG  1 
ATOM   1585 C CD1 . LEU A 1 211 ? -38.568 14.409 17.642  1.00 115.84 ? 246 LEU A CD1 1 
ATOM   1586 C CD2 . LEU A 1 211 ? -37.873 13.684 19.930  1.00 113.17 ? 246 LEU A CD2 1 
ATOM   1587 N N   . ASP A 1 212 ? -40.838 16.294 22.919  1.00 101.53 ? 247 ASP A N   1 
ATOM   1588 C CA  . ASP A 1 212 ? -41.164 17.549 23.578  1.00 100.53 ? 247 ASP A CA  1 
ATOM   1589 C C   . ASP A 1 212 ? -40.042 18.542 23.326  1.00 99.71  ? 247 ASP A C   1 
ATOM   1590 O O   . ASP A 1 212 ? -38.863 18.185 23.366  1.00 98.37  ? 247 ASP A O   1 
ATOM   1591 C CB  . ASP A 1 212 ? -41.365 17.348 25.082  1.00 102.49 ? 247 ASP A CB  1 
ATOM   1592 C CG  . ASP A 1 212 ? -42.124 18.499 25.732  1.00 105.77 ? 247 ASP A CG  1 
ATOM   1593 O OD1 . ASP A 1 212 ? -42.922 19.172 25.042  1.00 108.00 ? 247 ASP A OD1 1 
ATOM   1594 O OD2 . ASP A 1 212 ? -41.930 18.722 26.944  1.00 107.39 ? 247 ASP A OD2 1 
ATOM   1595 N N   . GLN A 1 213 ? -40.421 19.787 23.056  1.00 98.70  ? 248 GLN A N   1 
ATOM   1596 C CA  . GLN A 1 213 ? -39.471 20.848 22.752  1.00 96.01  ? 248 GLN A CA  1 
ATOM   1597 C C   . GLN A 1 213 ? -39.476 21.825 23.914  1.00 94.30  ? 248 GLN A C   1 
ATOM   1598 O O   . GLN A 1 213 ? -40.506 22.414 24.231  1.00 103.22 ? 248 GLN A O   1 
ATOM   1599 C CB  . GLN A 1 213 ? -39.856 21.544 21.444  1.00 95.02  ? 248 GLN A CB  1 
ATOM   1600 C CG  . GLN A 1 213 ? -40.279 20.571 20.349  1.00 97.57  ? 248 GLN A CG  1 
ATOM   1601 C CD  . GLN A 1 213 ? -40.521 21.229 19.004  1.00 97.34  ? 248 GLN A CD  1 
ATOM   1602 O OE1 . GLN A 1 213 ? -39.936 22.264 18.690  1.00 102.10 ? 248 GLN A OE1 1 
ATOM   1603 N NE2 . GLN A 1 213 ? -41.378 20.617 18.193  1.00 98.19  ? 248 GLN A NE2 1 
ATOM   1604 N N   . ILE A 1 214 ? -38.324 21.978 24.557  1.00 92.69  ? 249 ILE A N   1 
ATOM   1605 C CA  . ILE A 1 214 ? -38.211 22.752 25.784  1.00 93.39  ? 249 ILE A CA  1 
ATOM   1606 C C   . ILE A 1 214 ? -37.215 23.876 25.576  1.00 90.00  ? 249 ILE A C   1 
ATOM   1607 O O   . ILE A 1 214 ? -36.054 23.628 25.253  1.00 90.64  ? 249 ILE A O   1 
ATOM   1608 C CB  . ILE A 1 214 ? -37.757 21.859 26.954  1.00 98.80  ? 249 ILE A CB  1 
ATOM   1609 C CG1 . ILE A 1 214 ? -38.895 20.911 27.356  1.00 105.83 ? 249 ILE A CG1 1 
ATOM   1610 C CG2 . ILE A 1 214 ? -37.325 22.701 28.146  1.00 96.29  ? 249 ILE A CG2 1 
ATOM   1611 C CD1 . ILE A 1 214 ? -38.431 19.642 28.042  1.00 109.92 ? 249 ILE A CD1 1 
ATOM   1612 N N   . ASP A 1 215 ? -37.672 25.108 25.784  1.00 87.56  ? 250 ASP A N   1 
ATOM   1613 C CA  . ASP A 1 215 ? -36.866 26.283 25.491  1.00 85.15  ? 250 ASP A CA  1 
ATOM   1614 C C   . ASP A 1 215 ? -35.540 26.244 26.231  1.00 83.34  ? 250 ASP A C   1 
ATOM   1615 O O   . ASP A 1 215 ? -35.452 25.750 27.354  1.00 85.75  ? 250 ASP A O   1 
ATOM   1616 C CB  . ASP A 1 215 ? -37.614 27.571 25.857  1.00 85.33  ? 250 ASP A CB  1 
ATOM   1617 C CG  . ASP A 1 215 ? -36.835 28.823 25.479  1.00 91.19  ? 250 ASP A CG  1 
ATOM   1618 O OD1 . ASP A 1 215 ? -36.761 29.128 24.266  1.00 95.02  ? 250 ASP A OD1 1 
ATOM   1619 O OD2 . ASP A 1 215 ? -36.286 29.491 26.387  1.00 90.18  ? 250 ASP A OD2 1 
ATOM   1620 N N   . ILE A 1 216 ? -34.512 26.755 25.571  1.00 85.79  ? 251 ILE A N   1 
ATOM   1621 C CA  . ILE A 1 216 ? -33.228 27.007 26.194  1.00 88.61  ? 251 ILE A CA  1 
ATOM   1622 C C   . ILE A 1 216 ? -33.081 28.519 26.191  1.00 83.34  ? 251 ILE A C   1 
ATOM   1623 O O   . ILE A 1 216 ? -33.031 29.143 25.140  1.00 90.49  ? 251 ILE A O   1 
ATOM   1624 C CB  . ILE A 1 216 ? -32.087 26.310 25.428  1.00 90.54  ? 251 ILE A CB  1 
ATOM   1625 C CG1 . ILE A 1 216 ? -32.267 24.793 25.505  1.00 92.19  ? 251 ILE A CG1 1 
ATOM   1626 C CG2 . ILE A 1 216 ? -30.728 26.688 25.997  1.00 90.69  ? 251 ILE A CG2 1 
ATOM   1627 C CD1 . ILE A 1 216 ? -31.262 24.019 24.684  1.00 96.57  ? 251 ILE A CD1 1 
ATOM   1628 N N   . ASP A 1 217 ? -33.041 29.101 27.379  1.00 86.96  ? 252 ASP A N   1 
ATOM   1629 C CA  . ASP A 1 217 ? -33.063 30.547 27.534  1.00 86.15  ? 252 ASP A CA  1 
ATOM   1630 C C   . ASP A 1 217 ? -31.750 31.160 27.075  1.00 83.75  ? 252 ASP A C   1 
ATOM   1631 O O   . ASP A 1 217 ? -30.700 30.872 27.641  1.00 86.11  ? 252 ASP A O   1 
ATOM   1632 C CB  . ASP A 1 217 ? -33.326 30.898 29.000  1.00 86.40  ? 252 ASP A CB  1 
ATOM   1633 C CG  . ASP A 1 217 ? -33.581 32.373 29.219  1.00 89.63  ? 252 ASP A CG  1 
ATOM   1634 O OD1 . ASP A 1 217 ? -33.220 33.194 28.349  1.00 93.88  ? 252 ASP A OD1 1 
ATOM   1635 O OD2 . ASP A 1 217 ? -34.134 32.710 30.286  1.00 93.18  ? 252 ASP A OD2 1 
ATOM   1636 N N   . VAL A 1 218 ? -31.817 32.007 26.050  1.00 84.78  ? 253 VAL A N   1 
ATOM   1637 C CA  . VAL A 1 218 ? -30.643 32.755 25.592  1.00 86.35  ? 253 VAL A CA  1 
ATOM   1638 C C   . VAL A 1 218 ? -30.834 34.273 25.705  1.00 83.64  ? 253 VAL A C   1 
ATOM   1639 O O   . VAL A 1 218 ? -30.155 35.030 25.014  1.00 88.32  ? 253 VAL A O   1 
ATOM   1640 C CB  . VAL A 1 218 ? -30.234 32.361 24.157  1.00 86.56  ? 253 VAL A CB  1 
ATOM   1641 C CG1 . VAL A 1 218 ? -29.791 30.908 24.118  1.00 88.00  ? 253 VAL A CG1 1 
ATOM   1642 C CG2 . VAL A 1 218 ? -31.374 32.587 23.177  1.00 91.10  ? 253 VAL A CG2 1 
ATOM   1643 N N   . GLY A 1 219 ? -31.743 34.707 26.582  1.00 81.28  ? 254 GLY A N   1 
ATOM   1644 C CA  . GLY A 1 219 ? -31.889 36.127 26.932  1.00 82.92  ? 254 GLY A CA  1 
ATOM   1645 C C   . GLY A 1 219 ? -33.148 36.841 26.456  1.00 84.83  ? 254 GLY A C   1 
ATOM   1646 O O   . GLY A 1 219 ? -33.189 38.081 26.437  1.00 81.42  ? 254 GLY A O   1 
ATOM   1647 N N   . PHE A 1 220 ? -34.183 36.078 26.102  1.00 80.81  ? 255 PHE A N   1 
ATOM   1648 C CA  . PHE A 1 220 ? -35.408 36.649 25.541  1.00 77.22  ? 255 PHE A CA  1 
ATOM   1649 C C   . PHE A 1 220 ? -36.059 37.730 26.397  1.00 77.28  ? 255 PHE A C   1 
ATOM   1650 O O   . PHE A 1 220 ? -36.606 38.698 25.863  1.00 83.91  ? 255 PHE A O   1 
ATOM   1651 C CB  . PHE A 1 220 ? -36.457 35.563 25.274  1.00 75.00  ? 255 PHE A CB  1 
ATOM   1652 C CG  . PHE A 1 220 ? -37.769 36.113 24.791  1.00 72.96  ? 255 PHE A CG  1 
ATOM   1653 C CD1 . PHE A 1 220 ? -37.926 36.499 23.465  1.00 73.11  ? 255 PHE A CD1 1 
ATOM   1654 C CD2 . PHE A 1 220 ? -38.834 36.285 25.666  1.00 73.37  ? 255 PHE A CD2 1 
ATOM   1655 C CE1 . PHE A 1 220 ? -39.124 37.030 23.020  1.00 71.28  ? 255 PHE A CE1 1 
ATOM   1656 C CE2 . PHE A 1 220 ? -40.036 36.818 25.224  1.00 72.61  ? 255 PHE A CE2 1 
ATOM   1657 C CZ  . PHE A 1 220 ? -40.179 37.195 23.902  1.00 71.72  ? 255 PHE A CZ  1 
ATOM   1658 N N   . ASP A 1 221 ? -36.030 37.562 27.712  1.00 76.49  ? 256 ASP A N   1 
ATOM   1659 C CA  . ASP A 1 221 ? -36.812 38.434 28.589  1.00 81.11  ? 256 ASP A CA  1 
ATOM   1660 C C   . ASP A 1 221 ? -36.203 39.815 28.812  1.00 81.72  ? 256 ASP A C   1 
ATOM   1661 O O   . ASP A 1 221 ? -36.889 40.730 29.292  1.00 82.04  ? 256 ASP A O   1 
ATOM   1662 C CB  . ASP A 1 221 ? -37.109 37.728 29.910  1.00 84.13  ? 256 ASP A CB  1 
ATOM   1663 C CG  . ASP A 1 221 ? -38.026 36.529 29.720  1.00 94.65  ? 256 ASP A CG  1 
ATOM   1664 O OD1 . ASP A 1 221 ? -39.197 36.733 29.298  1.00 98.19  ? 256 ASP A OD1 1 
ATOM   1665 O OD2 . ASP A 1 221 ? -37.571 35.388 29.970  1.00 96.07  ? 256 ASP A OD2 1 
ATOM   1666 N N   . LYS A 1 222 ? -34.931 39.972 28.451  1.00 86.94  ? 257 LYS A N   1 
ATOM   1667 C CA  . LYS A 1 222 ? -34.259 41.265 28.535  1.00 92.44  ? 257 LYS A CA  1 
ATOM   1668 C C   . LYS A 1 222 ? -33.809 41.721 27.149  1.00 88.87  ? 257 LYS A C   1 
ATOM   1669 O O   . LYS A 1 222 ? -33.025 42.665 27.022  1.00 92.94  ? 257 LYS A O   1 
ATOM   1670 C CB  . LYS A 1 222 ? -33.062 41.181 29.483  1.00 100.00 ? 257 LYS A CB  1 
ATOM   1671 C CG  . LYS A 1 222 ? -33.410 40.726 30.895  1.00 108.15 ? 257 LYS A CG  1 
ATOM   1672 C CD  . LYS A 1 222 ? -32.268 39.959 31.563  1.00 122.10 ? 257 LYS A CD  1 
ATOM   1673 C CE  . LYS A 1 222 ? -31.958 38.613 30.896  1.00 126.47 ? 257 LYS A CE  1 
ATOM   1674 N NZ  . LYS A 1 222 ? -33.148 37.732 30.696  1.00 125.62 ? 257 LYS A NZ  1 
ATOM   1675 N N   . GLY A 1 223 ? -34.313 41.054 26.114  1.00 80.95  ? 258 GLY A N   1 
ATOM   1676 C CA  . GLY A 1 223 ? -33.978 41.393 24.734  1.00 80.73  ? 258 GLY A CA  1 
ATOM   1677 C C   . GLY A 1 223 ? -32.644 40.862 24.234  1.00 78.16  ? 258 GLY A C   1 
ATOM   1678 O O   . GLY A 1 223 ? -32.311 41.024 23.067  1.00 78.17  ? 258 GLY A O   1 
ATOM   1679 N N   . LEU A 1 224 ? -31.882 40.191 25.090  1.00 79.75  ? 259 LEU A N   1 
ATOM   1680 C CA  . LEU A 1 224 ? -30.503 39.840 24.753  1.00 76.16  ? 259 LEU A CA  1 
ATOM   1681 C C   . LEU A 1 224 ? -30.394 38.681 23.764  1.00 74.63  ? 259 LEU A C   1 
ATOM   1682 O O   . LEU A 1 224 ? -29.304 38.340 23.328  1.00 75.89  ? 259 LEU A O   1 
ATOM   1683 C CB  . LEU A 1 224 ? -29.722 39.529 26.022  1.00 79.30  ? 259 LEU A CB  1 
ATOM   1684 C CG  . LEU A 1 224 ? -29.682 40.664 27.045  1.00 79.65  ? 259 LEU A CG  1 
ATOM   1685 C CD1 . LEU A 1 224 ? -28.894 40.214 28.265  1.00 80.11  ? 259 LEU A CD1 1 
ATOM   1686 C CD2 . LEU A 1 224 ? -29.092 41.930 26.440  1.00 78.05  ? 259 LEU A CD2 1 
ATOM   1687 N N   . ASP A 1 225 ? -31.524 38.079 23.410  1.00 78.43  ? 260 ASP A N   1 
ATOM   1688 C CA  . ASP A 1 225 ? -31.569 37.119 22.315  1.00 79.06  ? 260 ASP A CA  1 
ATOM   1689 C C   . ASP A 1 225 ? -31.338 37.796 20.954  1.00 81.21  ? 260 ASP A C   1 
ATOM   1690 O O   . ASP A 1 225 ? -31.019 37.122 19.971  1.00 76.65  ? 260 ASP A O   1 
ATOM   1691 C CB  . ASP A 1 225 ? -32.908 36.377 22.321  1.00 82.12  ? 260 ASP A CB  1 
ATOM   1692 C CG  . ASP A 1 225 ? -34.078 37.259 21.897  1.00 82.67  ? 260 ASP A CG  1 
ATOM   1693 O OD1 . ASP A 1 225 ? -34.794 36.852 20.953  1.00 85.02  ? 260 ASP A OD1 1 
ATOM   1694 O OD2 . ASP A 1 225 ? -34.275 38.344 22.499  1.00 75.96  ? 260 ASP A OD2 1 
ATOM   1695 N N   . ARG A 1 226 ? -31.515 39.120 20.908  1.00 81.46  ? 261 ARG A N   1 
ATOM   1696 C CA  . ARG A 1 226 ? -31.286 39.919 19.703  1.00 81.07  ? 261 ARG A CA  1 
ATOM   1697 C C   . ARG A 1 226 ? -29.805 40.224 19.551  1.00 82.21  ? 261 ARG A C   1 
ATOM   1698 O O   . ARG A 1 226 ? -29.174 40.698 20.489  1.00 82.90  ? 261 ARG A O   1 
ATOM   1699 C CB  . ARG A 1 226 ? -32.036 41.253 19.796  1.00 79.67  ? 261 ARG A CB  1 
ATOM   1700 C CG  . ARG A 1 226 ? -33.540 41.134 19.998  1.00 76.46  ? 261 ARG A CG  1 
ATOM   1701 C CD  . ARG A 1 226 ? -34.042 42.169 20.989  1.00 76.53  ? 261 ARG A CD  1 
ATOM   1702 N NE  . ARG A 1 226 ? -34.149 43.500 20.415  1.00 79.57  ? 261 ARG A NE  1 
ATOM   1703 C CZ  . ARG A 1 226 ? -33.870 44.636 21.049  1.00 84.00  ? 261 ARG A CZ  1 
ATOM   1704 N NH1 . ARG A 1 226 ? -33.424 44.642 22.300  1.00 81.07  ? 261 ARG A NH1 1 
ATOM   1705 N NH2 . ARG A 1 226 ? -34.036 45.790 20.414  1.00 94.17  ? 261 ARG A NH2 1 
ATOM   1706 N N   . ILE A 1 227 ? -29.259 39.978 18.366  1.00 82.54  ? 262 ILE A N   1 
ATOM   1707 C CA  . ILE A 1 227 ? -27.837 40.193 18.132  1.00 81.88  ? 262 ILE A CA  1 
ATOM   1708 C C   . ILE A 1 227 ? -27.562 41.080 16.918  1.00 81.02  ? 262 ILE A C   1 
ATOM   1709 O O   . ILE A 1 227 ? -28.371 41.188 16.004  1.00 83.25  ? 262 ILE A O   1 
ATOM   1710 C CB  . ILE A 1 227 ? -27.079 38.858 17.979  1.00 84.80  ? 262 ILE A CB  1 
ATOM   1711 C CG1 . ILE A 1 227 ? -27.577 38.076 16.762  1.00 86.03  ? 262 ILE A CG1 1 
ATOM   1712 C CG2 . ILE A 1 227 ? -27.232 38.020 19.243  1.00 87.42  ? 262 ILE A CG2 1 
ATOM   1713 C CD1 . ILE A 1 227 ? -26.740 36.856 16.454  1.00 88.47  ? 262 ILE A CD1 1 
ATOM   1714 N N   . PHE A 1 228 ? -26.406 41.724 16.952  1.00 82.75  ? 263 PHE A N   1 
ATOM   1715 C CA  . PHE A 1 228 ? -25.882 42.491 15.844  1.00 81.95  ? 263 PHE A CA  1 
ATOM   1716 C C   . PHE A 1 228 ? -24.647 41.727 15.388  1.00 82.14  ? 263 PHE A C   1 
ATOM   1717 O O   . PHE A 1 228 ? -23.584 41.841 15.988  1.00 82.82  ? 263 PHE A O   1 
ATOM   1718 C CB  . PHE A 1 228 ? -25.550 43.907 16.317  1.00 78.96  ? 263 PHE A CB  1 
ATOM   1719 C CG  . PHE A 1 228 ? -24.686 44.689 15.372  1.00 80.31  ? 263 PHE A CG  1 
ATOM   1720 C CD1 . PHE A 1 228 ? -24.963 44.725 14.013  1.00 83.81  ? 263 PHE A CD1 1 
ATOM   1721 C CD2 . PHE A 1 228 ? -23.611 45.423 15.852  1.00 83.58  ? 263 PHE A CD2 1 
ATOM   1722 C CE1 . PHE A 1 228 ? -24.167 45.458 13.146  1.00 82.77  ? 263 PHE A CE1 1 
ATOM   1723 C CE2 . PHE A 1 228 ? -22.818 46.166 14.992  1.00 85.51  ? 263 PHE A CE2 1 
ATOM   1724 C CZ  . PHE A 1 228 ? -23.095 46.182 13.637  1.00 83.13  ? 263 PHE A CZ  1 
ATOM   1725 N N   . LEU A 1 229 ? -24.811 40.928 14.338  1.00 83.96  ? 264 LEU A N   1 
ATOM   1726 C CA  . LEU A 1 229 ? -23.828 39.918 13.963  1.00 88.95  ? 264 LEU A CA  1 
ATOM   1727 C C   . LEU A 1 229 ? -22.915 40.387 12.849  1.00 93.59  ? 264 LEU A C   1 
ATOM   1728 O O   . LEU A 1 229 ? -23.261 40.277 11.674  1.00 99.25  ? 264 LEU A O   1 
ATOM   1729 C CB  . LEU A 1 229 ? -24.542 38.637 13.522  1.00 87.46  ? 264 LEU A CB  1 
ATOM   1730 C CG  . LEU A 1 229 ? -23.657 37.446 13.169  1.00 88.75  ? 264 LEU A CG  1 
ATOM   1731 C CD1 . LEU A 1 229 ? -22.836 37.023 14.376  1.00 92.31  ? 264 LEU A CD1 1 
ATOM   1732 C CD2 . LEU A 1 229 ? -24.506 36.286 12.674  1.00 91.49  ? 264 LEU A CD2 1 
ATOM   1733 N N   . VAL A 1 230 ? -21.742 40.892 13.221  1.00 99.09  ? 265 VAL A N   1 
ATOM   1734 C CA  . VAL A 1 230 ? -20.716 41.253 12.249  1.00 99.43  ? 265 VAL A CA  1 
ATOM   1735 C C   . VAL A 1 230 ? -19.661 40.149 12.212  1.00 97.89  ? 265 VAL A C   1 
ATOM   1736 O O   . VAL A 1 230 ? -19.592 39.389 11.247  1.00 94.52  ? 265 VAL A O   1 
ATOM   1737 C CB  . VAL A 1 230 ? -20.079 42.612 12.577  1.00 99.91  ? 265 VAL A CB  1 
ATOM   1738 C CG1 . VAL A 1 230 ? -19.170 43.055 11.438  1.00 102.32 ? 265 VAL A CG1 1 
ATOM   1739 C CG2 . VAL A 1 230 ? -21.164 43.645 12.845  1.00 99.60  ? 265 VAL A CG2 1 
ATOM   1740 N N   . SER A 1 231 ? -18.856 40.052 13.266  1.00 95.97  ? 266 SER A N   1 
ATOM   1741 C CA  . SER A 1 231 ? -17.899 38.963 13.401  1.00 93.50  ? 266 SER A CA  1 
ATOM   1742 C C   . SER A 1 231 ? -18.572 37.854 14.200  1.00 91.81  ? 266 SER A C   1 
ATOM   1743 O O   . SER A 1 231 ? -19.514 38.116 14.945  1.00 88.50  ? 266 SER A O   1 
ATOM   1744 C CB  . SER A 1 231 ? -16.628 39.437 14.103  1.00 92.34  ? 266 SER A CB  1 
ATOM   1745 O OG  . SER A 1 231 ? -16.903 39.889 15.416  1.00 91.44  ? 266 SER A OG  1 
ATOM   1746 N N   . PRO A 1 232 ? -18.097 36.611 14.049  1.00 91.10  ? 267 PRO A N   1 
ATOM   1747 C CA  . PRO A 1 232 ? -18.756 35.512 14.742  1.00 92.25  ? 267 PRO A CA  1 
ATOM   1748 C C   . PRO A 1 232 ? -18.999 35.794 16.224  1.00 91.37  ? 267 PRO A C   1 
ATOM   1749 O O   . PRO A 1 232 ? -18.097 36.253 16.920  1.00 96.51  ? 267 PRO A O   1 
ATOM   1750 C CB  . PRO A 1 232 ? -17.772 34.359 14.553  1.00 93.16  ? 267 PRO A CB  1 
ATOM   1751 C CG  . PRO A 1 232 ? -17.185 34.633 13.208  1.00 92.58  ? 267 PRO A CG  1 
ATOM   1752 C CD  . PRO A 1 232 ? -17.011 36.128 13.176  1.00 91.40  ? 267 PRO A CD  1 
ATOM   1753 N N   . ILE A 1 233 ? -20.224 35.547 16.677  1.00 87.04  ? 268 ILE A N   1 
ATOM   1754 C CA  . ILE A 1 233 ? -20.593 35.727 18.075  1.00 85.41  ? 268 ILE A CA  1 
ATOM   1755 C C   . ILE A 1 233 ? -20.799 34.356 18.717  1.00 86.71  ? 268 ILE A C   1 
ATOM   1756 O O   . ILE A 1 233 ? -21.148 33.385 18.040  1.00 84.54  ? 268 ILE A O   1 
ATOM   1757 C CB  . ILE A 1 233 ? -21.861 36.603 18.209  1.00 87.12  ? 268 ILE A CB  1 
ATOM   1758 C CG1 . ILE A 1 233 ? -21.517 38.061 17.908  1.00 88.28  ? 268 ILE A CG1 1 
ATOM   1759 C CG2 . ILE A 1 233 ? -22.458 36.518 19.607  1.00 89.59  ? 268 ILE A CG2 1 
ATOM   1760 C CD1 . ILE A 1 233 ? -22.704 39.001 17.925  1.00 92.61  ? 268 ILE A CD1 1 
ATOM   1761 N N   . THR A 1 234 ? -20.546 34.285 20.022  1.00 86.28  ? 269 THR A N   1 
ATOM   1762 C CA  . THR A 1 234 ? -20.782 33.084 20.805  1.00 88.00  ? 269 THR A CA  1 
ATOM   1763 C C   . THR A 1 234 ? -22.053 33.292 21.630  1.00 89.65  ? 269 THR A C   1 
ATOM   1764 O O   . THR A 1 234 ? -22.138 34.230 22.427  1.00 91.14  ? 269 THR A O   1 
ATOM   1765 C CB  . THR A 1 234 ? -19.574 32.782 21.721  1.00 86.40  ? 269 THR A CB  1 
ATOM   1766 O OG1 . THR A 1 234 ? -18.442 32.442 20.914  1.00 84.64  ? 269 THR A OG1 1 
ATOM   1767 C CG2 . THR A 1 234 ? -19.865 31.622 22.668  1.00 86.92  ? 269 THR A CG2 1 
ATOM   1768 N N   . ILE A 1 235 ? -23.033 32.412 21.430  1.00 87.35  ? 270 ILE A N   1 
ATOM   1769 C CA  . ILE A 1 235 ? -24.310 32.494 22.130  1.00 89.38  ? 270 ILE A CA  1 
ATOM   1770 C C   . ILE A 1 235 ? -24.182 31.804 23.478  1.00 94.73  ? 270 ILE A C   1 
ATOM   1771 O O   . ILE A 1 235 ? -23.575 30.740 23.568  1.00 97.43  ? 270 ILE A O   1 
ATOM   1772 C CB  . ILE A 1 235 ? -25.441 31.814 21.332  1.00 92.08  ? 270 ILE A CB  1 
ATOM   1773 C CG1 . ILE A 1 235 ? -25.493 32.339 19.885  1.00 91.43  ? 270 ILE A CG1 1 
ATOM   1774 C CG2 . ILE A 1 235 ? -26.779 32.004 22.042  1.00 92.57  ? 270 ILE A CG2 1 
ATOM   1775 C CD1 . ILE A 1 235 ? -25.563 33.849 19.760  1.00 90.99  ? 270 ILE A CD1 1 
ATOM   1776 N N   . LEU A 1 236 ? -24.768 32.405 24.514  1.00 98.39  ? 271 LEU A N   1 
ATOM   1777 C CA  . LEU A 1 236 ? -24.631 31.924 25.892  1.00 97.30  ? 271 LEU A CA  1 
ATOM   1778 C C   . LEU A 1 236 ? -25.970 31.514 26.481  1.00 96.64  ? 271 LEU A C   1 
ATOM   1779 O O   . LEU A 1 236 ? -26.922 32.296 26.482  1.00 99.35  ? 271 LEU A O   1 
ATOM   1780 C CB  . LEU A 1 236 ? -24.053 33.023 26.783  1.00 100.85 ? 271 LEU A CB  1 
ATOM   1781 C CG  . LEU A 1 236 ? -22.655 33.538 26.448  1.00 106.05 ? 271 LEU A CG  1 
ATOM   1782 C CD1 . LEU A 1 236 ? -22.442 34.944 26.994  1.00 111.73 ? 271 LEU A CD1 1 
ATOM   1783 C CD2 . LEU A 1 236 ? -21.610 32.592 27.002  1.00 109.02 ? 271 LEU A CD2 1 
ATOM   1784 N N   . HIS A 1 237 ? -26.031 30.292 26.994  1.00 98.35  ? 272 HIS A N   1 
ATOM   1785 C CA  . HIS A 1 237 ? -27.149 29.851 27.814  1.00 97.06  ? 272 HIS A CA  1 
ATOM   1786 C C   . HIS A 1 237 ? -26.641 29.571 29.221  1.00 98.48  ? 272 HIS A C   1 
ATOM   1787 O O   . HIS A 1 237 ? -25.953 28.577 29.443  1.00 98.93  ? 272 HIS A O   1 
ATOM   1788 C CB  . HIS A 1 237 ? -27.781 28.593 27.227  1.00 94.58  ? 272 HIS A CB  1 
ATOM   1789 C CG  . HIS A 1 237 ? -28.696 27.882 28.172  1.00 95.28  ? 272 HIS A CG  1 
ATOM   1790 N ND1 . HIS A 1 237 ? -29.860 28.448 28.647  1.00 97.77  ? 272 HIS A ND1 1 
ATOM   1791 C CD2 . HIS A 1 237 ? -28.621 26.652 28.730  1.00 94.22  ? 272 HIS A CD2 1 
ATOM   1792 C CE1 . HIS A 1 237 ? -30.463 27.597 29.457  1.00 96.60  ? 272 HIS A CE1 1 
ATOM   1793 N NE2 . HIS A 1 237 ? -29.733 26.499 29.523  1.00 95.90  ? 272 HIS A NE2 1 
ATOM   1794 N N   . GLU A 1 238 ? -26.965 30.454 30.163  1.00 105.38 ? 273 GLU A N   1 
ATOM   1795 C CA  . GLU A 1 238 ? -26.648 30.214 31.569  1.00 109.44 ? 273 GLU A CA  1 
ATOM   1796 C C   . GLU A 1 238 ? -27.470 29.036 32.063  1.00 106.49 ? 273 GLU A C   1 
ATOM   1797 O O   . GLU A 1 238 ? -28.696 29.022 31.927  1.00 105.24 ? 273 GLU A O   1 
ATOM   1798 C CB  . GLU A 1 238 ? -26.955 31.436 32.433  1.00 115.94 ? 273 GLU A CB  1 
ATOM   1799 C CG  . GLU A 1 238 ? -26.034 32.619 32.186  1.00 126.91 ? 273 GLU A CG  1 
ATOM   1800 C CD  . GLU A 1 238 ? -26.513 33.884 32.877  1.00 134.80 ? 273 GLU A CD  1 
ATOM   1801 O OE1 . GLU A 1 238 ? -27.099 33.782 33.979  1.00 138.58 ? 273 GLU A OE1 1 
ATOM   1802 O OE2 . GLU A 1 238 ? -26.301 34.981 32.316  1.00 134.15 ? 273 GLU A OE2 1 
ATOM   1803 N N   . ILE A 1 239 ? -26.782 28.047 32.619  1.00 99.30  ? 274 ILE A N   1 
ATOM   1804 C CA  . ILE A 1 239 ? -27.434 26.890 33.203  1.00 96.69  ? 274 ILE A CA  1 
ATOM   1805 C C   . ILE A 1 239 ? -27.703 27.206 34.678  1.00 97.79  ? 274 ILE A C   1 
ATOM   1806 O O   . ILE A 1 239 ? -26.773 27.299 35.486  1.00 95.94  ? 274 ILE A O   1 
ATOM   1807 C CB  . ILE A 1 239 ? -26.566 25.629 33.051  1.00 93.21  ? 274 ILE A CB  1 
ATOM   1808 C CG1 . ILE A 1 239 ? -26.222 25.403 31.575  1.00 93.73  ? 274 ILE A CG1 1 
ATOM   1809 C CG2 . ILE A 1 239 ? -27.295 24.416 33.604  1.00 94.38  ? 274 ILE A CG2 1 
ATOM   1810 C CD1 . ILE A 1 239 ? -25.047 24.480 31.341  1.00 92.00  ? 274 ILE A CD1 1 
ATOM   1811 N N   . ASN A 1 240 ? -28.979 27.407 35.003  1.00 93.70  ? 275 ASN A N   1 
ATOM   1812 C CA  . ASN A 1 240 ? -29.410 27.726 36.360  1.00 93.64  ? 275 ASN A CA  1 
ATOM   1813 C C   . ASN A 1 240 ? -30.679 26.953 36.703  1.00 93.54  ? 275 ASN A C   1 
ATOM   1814 O O   . ASN A 1 240 ? -31.120 26.115 35.916  1.00 92.30  ? 275 ASN A O   1 
ATOM   1815 C CB  . ASN A 1 240 ? -29.613 29.242 36.518  1.00 92.21  ? 275 ASN A CB  1 
ATOM   1816 C CG  . ASN A 1 240 ? -30.678 29.808 35.581  1.00 94.60  ? 275 ASN A CG  1 
ATOM   1817 O OD1 . ASN A 1 240 ? -31.672 29.149 35.245  1.00 92.68  ? 275 ASN A OD1 1 
ATOM   1818 N ND2 . ASN A 1 240 ? -30.476 31.051 35.167  1.00 92.72  ? 275 ASN A ND2 1 
ATOM   1819 N N   . GLU A 1 241 ? -31.247 27.224 37.877  1.00 96.55  ? 276 GLU A N   1 
ATOM   1820 C CA  . GLU A 1 241 ? -32.500 26.597 38.322  1.00 103.84 ? 276 GLU A CA  1 
ATOM   1821 C C   . GLU A 1 241 ? -33.440 26.269 37.167  1.00 106.64 ? 276 GLU A C   1 
ATOM   1822 O O   . GLU A 1 241 ? -33.905 25.137 37.033  1.00 109.02 ? 276 GLU A O   1 
ATOM   1823 C CB  . GLU A 1 241 ? -33.250 27.525 39.280  1.00 112.61 ? 276 GLU A CB  1 
ATOM   1824 C CG  . GLU A 1 241 ? -32.562 27.801 40.606  1.00 122.41 ? 276 GLU A CG  1 
ATOM   1825 C CD  . GLU A 1 241 ? -33.401 28.686 41.508  1.00 130.54 ? 276 GLU A CD  1 
ATOM   1826 O OE1 . GLU A 1 241 ? -33.797 29.785 41.060  1.00 131.02 ? 276 GLU A OE1 1 
ATOM   1827 O OE2 . GLU A 1 241 ? -33.661 28.281 42.663  1.00 134.43 ? 276 GLU A OE2 1 
ATOM   1828 N N   . ASP A 1 242 ? -33.699 27.278 36.334  1.00 106.38 ? 277 ASP A N   1 
ATOM   1829 C CA  . ASP A 1 242 ? -34.730 27.212 35.301  1.00 101.75 ? 277 ASP A CA  1 
ATOM   1830 C C   . ASP A 1 242 ? -34.297 26.488 34.029  1.00 99.22  ? 277 ASP A C   1 
ATOM   1831 O O   . ASP A 1 242 ? -35.137 26.157 33.193  1.00 101.47 ? 277 ASP A O   1 
ATOM   1832 C CB  . ASP A 1 242 ? -35.196 28.625 34.952  1.00 103.55 ? 277 ASP A CB  1 
ATOM   1833 C CG  . ASP A 1 242 ? -35.706 29.386 36.163  1.00 107.14 ? 277 ASP A CG  1 
ATOM   1834 O OD1 . ASP A 1 242 ? -36.526 28.823 36.917  1.00 106.99 ? 277 ASP A OD1 1 
ATOM   1835 O OD2 . ASP A 1 242 ? -35.285 30.546 36.362  1.00 109.43 ? 277 ASP A OD2 1 
ATOM   1836 N N   . SER A 1 243 ? -32.997 26.252 33.874  1.00 97.43  ? 278 SER A N   1 
ATOM   1837 C CA  . SER A 1 243 ? -32.485 25.520 32.718  1.00 96.97  ? 278 SER A CA  1 
ATOM   1838 C C   . SER A 1 243 ? -32.869 24.044 32.801  1.00 98.06  ? 278 SER A C   1 
ATOM   1839 O O   . SER A 1 243 ? -32.962 23.499 33.898  1.00 100.85 ? 278 SER A O   1 
ATOM   1840 C CB  . SER A 1 243 ? -30.962 25.647 32.640  1.00 95.89  ? 278 SER A CB  1 
ATOM   1841 O OG  . SER A 1 243 ? -30.429 24.847 31.604  1.00 95.38  ? 278 SER A OG  1 
ATOM   1842 N N   . PRO A 1 244 ? -33.086 23.390 31.644  1.00 102.90 ? 279 PRO A N   1 
ATOM   1843 C CA  . PRO A 1 244 ? -33.289 21.939 31.640  1.00 104.90 ? 279 PRO A CA  1 
ATOM   1844 C C   . PRO A 1 244 ? -31.979 21.148 31.730  1.00 104.23 ? 279 PRO A C   1 
ATOM   1845 O O   . PRO A 1 244 ? -32.012 19.918 31.787  1.00 106.18 ? 279 PRO A O   1 
ATOM   1846 C CB  . PRO A 1 244 ? -33.984 21.671 30.293  1.00 106.38 ? 279 PRO A CB  1 
ATOM   1847 C CG  . PRO A 1 244 ? -33.985 22.965 29.543  1.00 105.37 ? 279 PRO A CG  1 
ATOM   1848 C CD  . PRO A 1 244 ? -33.118 23.937 30.278  1.00 105.84 ? 279 PRO A CD  1 
ATOM   1849 N N   . LEU A 1 245 ? -30.845 21.849 31.726  1.00 102.71 ? 280 LEU A N   1 
ATOM   1850 C CA  . LEU A 1 245 ? -29.537 21.231 31.918  1.00 104.49 ? 280 LEU A CA  1 
ATOM   1851 C C   . LEU A 1 245 ? -28.991 21.476 33.331  1.00 103.87 ? 280 LEU A C   1 
ATOM   1852 O O   . LEU A 1 245 ? -27.802 21.280 33.585  1.00 103.55 ? 280 LEU A O   1 
ATOM   1853 C CB  . LEU A 1 245 ? -28.557 21.786 30.882  1.00 106.98 ? 280 LEU A CB  1 
ATOM   1854 C CG  . LEU A 1 245 ? -29.021 21.742 29.423  1.00 104.53 ? 280 LEU A CG  1 
ATOM   1855 C CD1 . LEU A 1 245 ? -27.914 22.243 28.509  1.00 101.50 ? 280 LEU A CD1 1 
ATOM   1856 C CD2 . LEU A 1 245 ? -29.448 20.335 29.031  1.00 106.28 ? 280 LEU A CD2 1 
ATOM   1857 N N   . PHE A 1 246 ? -29.866 21.886 34.247  1.00 104.92 ? 281 PHE A N   1 
ATOM   1858 C CA  . PHE A 1 246 ? -29.478 22.262 35.610  1.00 102.91 ? 281 PHE A CA  1 
ATOM   1859 C C   . PHE A 1 246 ? -28.870 21.095 36.385  1.00 108.23 ? 281 PHE A C   1 
ATOM   1860 O O   . PHE A 1 246 ? -27.903 21.277 37.127  1.00 104.22 ? 281 PHE A O   1 
ATOM   1861 C CB  . PHE A 1 246 ? -30.704 22.801 36.356  1.00 97.76  ? 281 PHE A CB  1 
ATOM   1862 C CG  . PHE A 1 246 ? -30.404 23.378 37.713  1.00 91.89  ? 281 PHE A CG  1 
ATOM   1863 C CD1 . PHE A 1 246 ? -29.410 24.335 37.880  1.00 90.38  ? 281 PHE A CD1 1 
ATOM   1864 C CD2 . PHE A 1 246 ? -31.149 22.989 38.824  1.00 91.69  ? 281 PHE A CD2 1 
ATOM   1865 C CE1 . PHE A 1 246 ? -29.153 24.884 39.128  1.00 90.58  ? 281 PHE A CE1 1 
ATOM   1866 C CE2 . PHE A 1 246 ? -30.896 23.531 40.074  1.00 90.95  ? 281 PHE A CE2 1 
ATOM   1867 C CZ  . PHE A 1 246 ? -29.898 24.482 40.226  1.00 92.04  ? 281 PHE A CZ  1 
ATOM   1868 N N   . GLY A 1 247 ? -29.439 19.903 36.200  1.00 114.13 ? 282 GLY A N   1 
ATOM   1869 C CA  . GLY A 1 247 ? -28.992 18.707 36.911  1.00 117.24 ? 282 GLY A CA  1 
ATOM   1870 C C   . GLY A 1 247 ? -28.038 17.811 36.142  1.00 117.14 ? 282 GLY A C   1 
ATOM   1871 O O   . GLY A 1 247 ? -27.807 16.671 36.548  1.00 122.08 ? 282 GLY A O   1 
ATOM   1872 N N   . ILE A 1 248 ? -27.468 18.320 35.050  1.00 115.41 ? 283 ILE A N   1 
ATOM   1873 C CA  . ILE A 1 248 ? -26.606 17.516 34.184  1.00 116.51 ? 283 ILE A CA  1 
ATOM   1874 C C   . ILE A 1 248 ? -25.121 17.869 34.346  1.00 117.50 ? 283 ILE A C   1 
ATOM   1875 O O   . ILE A 1 248 ? -24.694 18.995 34.080  1.00 111.25 ? 283 ILE A O   1 
ATOM   1876 C CB  . ILE A 1 248 ? -27.061 17.608 32.709  1.00 117.65 ? 283 ILE A CB  1 
ATOM   1877 C CG1 . ILE A 1 248 ? -28.323 16.753 32.522  1.00 122.04 ? 283 ILE A CG1 1 
ATOM   1878 C CG2 . ILE A 1 248 ? -25.965 17.139 31.756  1.00 116.41 ? 283 ILE A CG2 1 
ATOM   1879 C CD1 . ILE A 1 248 ? -28.973 16.867 31.159  1.00 128.74 ? 283 ILE A CD1 1 
ATOM   1880 N N   . SER A 1 249 ? -24.356 16.877 34.800  1.00 121.62 ? 284 SER A N   1 
ATOM   1881 C CA  . SER A 1 249 ? -22.905 16.963 34.938  1.00 117.30 ? 284 SER A CA  1 
ATOM   1882 C C   . SER A 1 249 ? -22.216 16.413 33.695  1.00 111.67 ? 284 SER A C   1 
ATOM   1883 O O   . SER A 1 249 ? -22.862 15.841 32.819  1.00 110.97 ? 284 SER A O   1 
ATOM   1884 C CB  . SER A 1 249 ? -22.467 16.138 36.141  1.00 115.22 ? 284 SER A CB  1 
ATOM   1885 O OG  . SER A 1 249 ? -22.756 14.766 35.926  1.00 112.67 ? 284 SER A OG  1 
ATOM   1886 N N   . ARG A 1 250 ? -20.897 16.565 33.639  1.00 109.32 ? 285 ARG A N   1 
ATOM   1887 C CA  . ARG A 1 250 ? -20.106 16.048 32.526  1.00 108.98 ? 285 ARG A CA  1 
ATOM   1888 C C   . ARG A 1 250 ? -20.306 14.545 32.333  1.00 111.79 ? 285 ARG A C   1 
ATOM   1889 O O   . ARG A 1 250 ? -20.331 14.061 31.203  1.00 112.71 ? 285 ARG A O   1 
ATOM   1890 C CB  . ARG A 1 250 ? -18.621 16.346 32.745  1.00 109.66 ? 285 ARG A CB  1 
ATOM   1891 C CG  . ARG A 1 250 ? -17.718 15.781 31.661  1.00 112.37 ? 285 ARG A CG  1 
ATOM   1892 C CD  . ARG A 1 250 ? -16.294 16.282 31.801  1.00 115.00 ? 285 ARG A CD  1 
ATOM   1893 N NE  . ARG A 1 250 ? -15.380 15.542 30.937  1.00 120.16 ? 285 ARG A NE  1 
ATOM   1894 C CZ  . ARG A 1 250 ? -14.077 15.791 30.824  1.00 127.01 ? 285 ARG A CZ  1 
ATOM   1895 N NH1 . ARG A 1 250 ? -13.509 16.773 31.520  1.00 127.28 ? 285 ARG A NH1 1 
ATOM   1896 N NH2 . ARG A 1 250 ? -13.335 15.052 30.007  1.00 132.04 ? 285 ARG A NH2 1 
ATOM   1897 N N   . GLN A 1 251 ? -20.441 13.812 33.436  1.00 119.15 ? 286 GLN A N   1 
ATOM   1898 C CA  . GLN A 1 251 ? -20.667 12.368 33.374  1.00 124.63 ? 286 GLN A CA  1 
ATOM   1899 C C   . GLN A 1 251 ? -22.067 12.049 32.838  1.00 123.82 ? 286 GLN A C   1 
ATOM   1900 O O   . GLN A 1 251 ? -22.243 11.101 32.071  1.00 119.60 ? 286 GLN A O   1 
ATOM   1901 C CB  . GLN A 1 251 ? -20.454 11.726 34.750  1.00 128.27 ? 286 GLN A CB  1 
ATOM   1902 C CG  . GLN A 1 251 ? -20.349 10.205 34.712  1.00 133.60 ? 286 GLN A CG  1 
ATOM   1903 C CD  . GLN A 1 251 ? -19.917 9.601  36.042  1.00 140.97 ? 286 GLN A CD  1 
ATOM   1904 O OE1 . GLN A 1 251 ? -19.021 10.117 36.715  1.00 141.15 ? 286 GLN A OE1 1 
ATOM   1905 N NE2 . GLN A 1 251 ? -20.546 8.491  36.419  1.00 141.98 ? 286 GLN A NE2 1 
ATOM   1906 N N   . ASP A 1 252 ? -23.057 12.846 33.236  1.00 122.94 ? 287 ASP A N   1 
ATOM   1907 C CA  . ASP A 1 252 ? -24.422 12.683 32.733  1.00 120.90 ? 287 ASP A CA  1 
ATOM   1908 C C   . ASP A 1 252 ? -24.492 12.940 31.229  1.00 121.06 ? 287 ASP A C   1 
ATOM   1909 O O   . ASP A 1 252 ? -25.303 12.334 30.535  1.00 115.10 ? 287 ASP A O   1 
ATOM   1910 C CB  . ASP A 1 252 ? -25.391 13.622 33.458  1.00 120.89 ? 287 ASP A CB  1 
ATOM   1911 C CG  . ASP A 1 252 ? -25.541 13.291 34.933  1.00 122.85 ? 287 ASP A CG  1 
ATOM   1912 O OD1 . ASP A 1 252 ? -25.843 12.124 35.263  1.00 125.81 ? 287 ASP A OD1 1 
ATOM   1913 O OD2 . ASP A 1 252 ? -25.367 14.205 35.766  1.00 121.14 ? 287 ASP A OD2 1 
ATOM   1914 N N   . LEU A 1 253 ? -23.632 13.828 30.734  1.00 123.36 ? 288 LEU A N   1 
ATOM   1915 C CA  . LEU A 1 253 ? -23.624 14.208 29.321  1.00 128.11 ? 288 LEU A CA  1 
ATOM   1916 C C   . LEU A 1 253 ? -23.267 13.034 28.412  1.00 131.64 ? 288 LEU A C   1 
ATOM   1917 O O   . LEU A 1 253 ? -24.023 12.699 27.500  1.00 138.04 ? 288 LEU A O   1 
ATOM   1918 C CB  . LEU A 1 253 ? -22.649 15.369 29.092  1.00 129.58 ? 288 LEU A CB  1 
ATOM   1919 C CG  . LEU A 1 253 ? -22.752 16.133 27.771  1.00 130.35 ? 288 LEU A CG  1 
ATOM   1920 C CD1 . LEU A 1 253 ? -24.088 16.854 27.664  1.00 132.34 ? 288 LEU A CD1 1 
ATOM   1921 C CD2 . LEU A 1 253 ? -21.602 17.122 27.649  1.00 131.84 ? 288 LEU A CD2 1 
ATOM   1922 N N   . GLU A 1 254 ? -22.124 12.406 28.672  1.00 137.01 ? 289 GLU A N   1 
ATOM   1923 C CA  . GLU A 1 254 ? -21.677 11.243 27.891  1.00 141.41 ? 289 GLU A CA  1 
ATOM   1924 C C   . GLU A 1 254 ? -22.601 10.022 28.038  1.00 137.04 ? 289 GLU A C   1 
ATOM   1925 O O   . GLU A 1 254 ? -22.552 9.106  27.218  1.00 130.94 ? 289 GLU A O   1 
ATOM   1926 C CB  . GLU A 1 254 ? -20.231 10.876 28.257  1.00 148.08 ? 289 GLU A CB  1 
ATOM   1927 C CG  . GLU A 1 254 ? -20.042 10.383 29.690  1.00 153.19 ? 289 GLU A CG  1 
ATOM   1928 C CD  . GLU A 1 254 ? -18.750 10.859 30.341  1.00 154.85 ? 289 GLU A CD  1 
ATOM   1929 O OE1 . GLU A 1 254 ? -18.285 11.983 30.039  1.00 156.25 ? 289 GLU A OE1 1 
ATOM   1930 O OE2 . GLU A 1 254 ? -18.205 10.110 31.181  1.00 150.49 ? 289 GLU A OE2 1 
ATOM   1931 N N   . THR A 1 255 ? -23.429 10.019 29.083  1.00 136.74 ? 290 THR A N   1 
ATOM   1932 C CA  . THR A 1 255 ? -24.464 9.002  29.282  1.00 139.93 ? 290 THR A CA  1 
ATOM   1933 C C   . THR A 1 255 ? -25.791 9.376  28.611  1.00 138.32 ? 290 THR A C   1 
ATOM   1934 O O   . THR A 1 255 ? -26.474 8.510  28.057  1.00 130.32 ? 290 THR A O   1 
ATOM   1935 C CB  . THR A 1 255 ? -24.746 8.799  30.787  1.00 145.36 ? 290 THR A CB  1 
ATOM   1936 O OG1 . THR A 1 255 ? -23.516 8.565  31.482  1.00 148.24 ? 290 THR A OG1 1 
ATOM   1937 C CG2 . THR A 1 255 ? -25.701 7.627  31.021  1.00 146.53 ? 290 THR A CG2 1 
ATOM   1938 N N   . ASP A 1 256 ? -26.152 10.660 28.678  1.00 138.45 ? 291 ASP A N   1 
ATOM   1939 C CA  . ASP A 1 256 ? -27.475 11.130 28.241  1.00 133.93 ? 291 ASP A CA  1 
ATOM   1940 C C   . ASP A 1 256 ? -27.725 10.985 26.749  1.00 131.02 ? 291 ASP A C   1 
ATOM   1941 O O   . ASP A 1 256 ? -26.797 10.826 25.951  1.00 124.98 ? 291 ASP A O   1 
ATOM   1942 C CB  . ASP A 1 256 ? -27.717 12.603 28.636  1.00 131.67 ? 291 ASP A CB  1 
ATOM   1943 C CG  . ASP A 1 256 ? -28.702 12.755 29.787  1.00 130.32 ? 291 ASP A CG  1 
ATOM   1944 O OD1 . ASP A 1 256 ? -29.703 12.010 29.818  1.00 132.85 ? 291 ASP A OD1 1 
ATOM   1945 O OD2 . ASP A 1 256 ? -28.489 13.635 30.649  1.00 125.96 ? 291 ASP A OD2 1 
ATOM   1946 N N   . ASP A 1 257 ? -29.006 11.058 26.399  1.00 128.15 ? 292 ASP A N   1 
ATOM   1947 C CA  . ASP A 1 257 ? -29.453 11.014 25.019  1.00 130.04 ? 292 ASP A CA  1 
ATOM   1948 C C   . ASP A 1 257 ? -30.490 12.118 24.794  1.00 128.45 ? 292 ASP A C   1 
ATOM   1949 O O   . ASP A 1 257 ? -31.677 11.946 25.083  1.00 127.61 ? 292 ASP A O   1 
ATOM   1950 C CB  . ASP A 1 257 ? -30.043 9.635  24.710  1.00 133.84 ? 292 ASP A CB  1 
ATOM   1951 C CG  . ASP A 1 257 ? -30.223 9.389  23.224  1.00 136.57 ? 292 ASP A CG  1 
ATOM   1952 O OD1 . ASP A 1 257 ? -30.793 8.334  22.875  1.00 136.36 ? 292 ASP A OD1 1 
ATOM   1953 O OD2 . ASP A 1 257 ? -29.798 10.235 22.407  1.00 137.45 ? 292 ASP A OD2 1 
ATOM   1954 N N   . PHE A 1 258 ? -30.018 13.261 24.305  1.00 121.71 ? 293 PHE A N   1 
ATOM   1955 C CA  . PHE A 1 258 ? -30.892 14.375 23.952  1.00 114.18 ? 293 PHE A CA  1 
ATOM   1956 C C   . PHE A 1 258 ? -30.278 15.207 22.828  1.00 110.02 ? 293 PHE A C   1 
ATOM   1957 O O   . PHE A 1 258 ? -29.088 15.085 22.524  1.00 104.10 ? 293 PHE A O   1 
ATOM   1958 C CB  . PHE A 1 258 ? -31.192 15.252 25.178  1.00 111.67 ? 293 PHE A CB  1 
ATOM   1959 C CG  . PHE A 1 258 ? -29.986 15.958 25.739  1.00 110.52 ? 293 PHE A CG  1 
ATOM   1960 C CD1 . PHE A 1 258 ? -29.485 17.103 25.131  1.00 107.13 ? 293 PHE A CD1 1 
ATOM   1961 C CD2 . PHE A 1 258 ? -29.362 15.489 26.885  1.00 112.87 ? 293 PHE A CD2 1 
ATOM   1962 C CE1 . PHE A 1 258 ? -28.380 17.755 25.646  1.00 105.29 ? 293 PHE A CE1 1 
ATOM   1963 C CE2 . PHE A 1 258 ? -28.254 16.140 27.406  1.00 113.34 ? 293 PHE A CE2 1 
ATOM   1964 C CZ  . PHE A 1 258 ? -27.763 17.275 26.785  1.00 109.41 ? 293 PHE A CZ  1 
ATOM   1965 N N   . GLU A 1 259 ? -31.108 16.055 22.227  1.00 109.97 ? 294 GLU A N   1 
ATOM   1966 C CA  . GLU A 1 259 ? -30.712 16.902 21.105  1.00 105.24 ? 294 GLU A CA  1 
ATOM   1967 C C   . GLU A 1 259 ? -31.035 18.349 21.433  1.00 101.35 ? 294 GLU A C   1 
ATOM   1968 O O   . GLU A 1 259 ? -32.125 18.646 21.919  1.00 102.31 ? 294 GLU A O   1 
ATOM   1969 C CB  . GLU A 1 259 ? -31.477 16.485 19.848  1.00 102.81 ? 294 GLU A CB  1 
ATOM   1970 C CG  . GLU A 1 259 ? -31.097 17.242 18.584  1.00 100.46 ? 294 GLU A CG  1 
ATOM   1971 C CD  . GLU A 1 259 ? -31.839 16.740 17.352  1.00 103.72 ? 294 GLU A CD  1 
ATOM   1972 O OE1 . GLU A 1 259 ? -31.531 17.205 16.232  1.00 104.49 ? 294 GLU A OE1 1 
ATOM   1973 O OE2 . GLU A 1 259 ? -32.734 15.877 17.493  1.00 103.51 ? 294 GLU A OE2 1 
ATOM   1974 N N   . ILE A 1 260 ? -30.088 19.244 21.175  1.00 96.63  ? 295 ILE A N   1 
ATOM   1975 C CA  . ILE A 1 260 ? -30.341 20.675 21.276  1.00 95.41  ? 295 ILE A CA  1 
ATOM   1976 C C   . ILE A 1 260 ? -30.398 21.284 19.878  1.00 94.45  ? 295 ILE A C   1 
ATOM   1977 O O   . ILE A 1 260 ? -29.399 21.287 19.154  1.00 93.97  ? 295 ILE A O   1 
ATOM   1978 C CB  . ILE A 1 260 ? -29.263 21.395 22.106  1.00 97.47  ? 295 ILE A CB  1 
ATOM   1979 C CG1 . ILE A 1 260 ? -29.275 20.864 23.542  1.00 97.19  ? 295 ILE A CG1 1 
ATOM   1980 C CG2 . ILE A 1 260 ? -29.489 22.908 22.084  1.00 95.57  ? 295 ILE A CG2 1 
ATOM   1981 C CD1 . ILE A 1 260 ? -28.173 21.425 24.410  1.00 98.30  ? 295 ILE A CD1 1 
ATOM   1982 N N   . VAL A 1 261 ? -31.571 21.789 19.503  1.00 92.48  ? 296 VAL A N   1 
ATOM   1983 C CA  . VAL A 1 261 ? -31.732 22.510 18.244  1.00 92.53  ? 296 VAL A CA  1 
ATOM   1984 C C   . VAL A 1 261 ? -31.422 23.989 18.467  1.00 89.18  ? 296 VAL A C   1 
ATOM   1985 O O   . VAL A 1 261 ? -31.853 24.570 19.459  1.00 86.68  ? 296 VAL A O   1 
ATOM   1986 C CB  . VAL A 1 261 ? -33.159 22.359 17.689  1.00 94.27  ? 296 VAL A CB  1 
ATOM   1987 C CG1 . VAL A 1 261 ? -33.324 23.161 16.407  1.00 96.41  ? 296 VAL A CG1 1 
ATOM   1988 C CG2 . VAL A 1 261 ? -33.475 20.893 17.440  1.00 96.82  ? 296 VAL A CG2 1 
ATOM   1989 N N   . VAL A 1 262 ? -30.669 24.586 17.548  1.00 87.73  ? 297 VAL A N   1 
ATOM   1990 C CA  . VAL A 1 262 ? -30.324 26.005 17.635  1.00 90.66  ? 297 VAL A CA  1 
ATOM   1991 C C   . VAL A 1 262 ? -30.802 26.726 16.388  1.00 91.64  ? 297 VAL A C   1 
ATOM   1992 O O   . VAL A 1 262 ? -30.676 26.210 15.278  1.00 95.44  ? 297 VAL A O   1 
ATOM   1993 C CB  . VAL A 1 262 ? -28.814 26.249 17.827  1.00 90.07  ? 297 VAL A CB  1 
ATOM   1994 C CG1 . VAL A 1 262 ? -28.386 25.803 19.215  1.00 92.56  ? 297 VAL A CG1 1 
ATOM   1995 C CG2 . VAL A 1 262 ? -27.991 25.555 16.752  1.00 91.91  ? 297 VAL A CG2 1 
ATOM   1996 N N   . ILE A 1 263 ? -31.352 27.922 16.585  1.00 89.50  ? 298 ILE A N   1 
ATOM   1997 C CA  . ILE A 1 263 ? -31.978 28.674 15.510  1.00 83.98  ? 298 ILE A CA  1 
ATOM   1998 C C   . ILE A 1 263 ? -31.444 30.104 15.475  1.00 84.47  ? 298 ILE A C   1 
ATOM   1999 O O   . ILE A 1 263 ? -31.221 30.718 16.519  1.00 88.11  ? 298 ILE A O   1 
ATOM   2000 C CB  . ILE A 1 263 ? -33.505 28.682 15.694  1.00 82.39  ? 298 ILE A CB  1 
ATOM   2001 C CG1 . ILE A 1 263 ? -34.066 27.265 15.503  1.00 80.87  ? 298 ILE A CG1 1 
ATOM   2002 C CG2 . ILE A 1 263 ? -34.167 29.655 14.723  1.00 85.73  ? 298 ILE A CG2 1 
ATOM   2003 C CD1 . ILE A 1 263 ? -35.432 27.043 16.119  1.00 78.72  ? 298 ILE A CD1 1 
ATOM   2004 N N   . LEU A 1 264 ? -31.218 30.614 14.269  1.00 82.42  ? 299 LEU A N   1 
ATOM   2005 C CA  . LEU A 1 264 ? -30.939 32.030 14.061  1.00 82.17  ? 299 LEU A CA  1 
ATOM   2006 C C   . LEU A 1 264 ? -31.914 32.552 13.021  1.00 78.91  ? 299 LEU A C   1 
ATOM   2007 O O   . LEU A 1 264 ? -32.021 31.991 11.931  1.00 81.43  ? 299 LEU A O   1 
ATOM   2008 C CB  . LEU A 1 264 ? -29.497 32.246 13.595  1.00 84.26  ? 299 LEU A CB  1 
ATOM   2009 C CG  . LEU A 1 264 ? -29.091 33.683 13.226  1.00 86.90  ? 299 LEU A CG  1 
ATOM   2010 C CD1 . LEU A 1 264 ? -29.567 34.703 14.244  1.00 86.96  ? 299 LEU A CD1 1 
ATOM   2011 C CD2 . LEU A 1 264 ? -27.583 33.784 13.070  1.00 89.86  ? 299 LEU A CD2 1 
ATOM   2012 N N   . GLU A 1 265 ? -32.637 33.612 13.367  1.00 75.39  ? 300 GLU A N   1 
ATOM   2013 C CA  . GLU A 1 265 ? -33.619 34.197 12.464  1.00 75.44  ? 300 GLU A CA  1 
ATOM   2014 C C   . GLU A 1 265 ? -33.333 35.667 12.234  1.00 76.42  ? 300 GLU A C   1 
ATOM   2015 O O   . GLU A 1 265 ? -32.809 36.358 13.106  1.00 75.29  ? 300 GLU A O   1 
ATOM   2016 C CB  . GLU A 1 265 ? -35.031 34.015 13.016  1.00 76.25  ? 300 GLU A CB  1 
ATOM   2017 C CG  . GLU A 1 265 ? -35.514 32.575 12.956  1.00 80.20  ? 300 GLU A CG  1 
ATOM   2018 C CD  . GLU A 1 265 ? -36.814 32.335 13.701  1.00 82.10  ? 300 GLU A CD  1 
ATOM   2019 O OE1 . GLU A 1 265 ? -36.987 32.853 14.830  1.00 85.97  ? 300 GLU A OE1 1 
ATOM   2020 O OE2 . GLU A 1 265 ? -37.668 31.606 13.156  1.00 81.79  ? 300 GLU A OE2 1 
ATOM   2021 N N   . GLY A 1 266 ? -33.676 36.134 11.042  1.00 82.49  ? 301 GLY A N   1 
ATOM   2022 C CA  . GLY A 1 266 ? -33.531 37.536 10.697  1.00 84.14  ? 301 GLY A CA  1 
ATOM   2023 C C   . GLY A 1 266 ? -33.724 37.788 9.217   1.00 83.56  ? 301 GLY A C   1 
ATOM   2024 O O   . GLY A 1 266 ? -33.756 36.858 8.408   1.00 84.79  ? 301 GLY A O   1 
ATOM   2025 N N   . MET A 1 267 ? -33.842 39.062 8.872   1.00 82.06  ? 302 MET A N   1 
ATOM   2026 C CA  . MET A 1 267 ? -33.983 39.480 7.489   1.00 85.16  ? 302 MET A CA  1 
ATOM   2027 C C   . MET A 1 267 ? -32.586 39.636 6.898   1.00 85.03  ? 302 MET A C   1 
ATOM   2028 O O   . MET A 1 267 ? -31.812 40.487 7.336   1.00 86.32  ? 302 MET A O   1 
ATOM   2029 C CB  . MET A 1 267 ? -34.757 40.801 7.423   1.00 86.58  ? 302 MET A CB  1 
ATOM   2030 C CG  . MET A 1 267 ? -35.570 40.992 6.159   1.00 88.74  ? 302 MET A CG  1 
ATOM   2031 S SD  . MET A 1 267 ? -34.563 40.994 4.673   1.00 96.70  ? 302 MET A SD  1 
ATOM   2032 C CE  . MET A 1 267 ? -33.509 42.420 4.948   1.00 94.90  ? 302 MET A CE  1 
ATOM   2033 N N   . VAL A 1 268 ? -32.266 38.807 5.911   1.00 83.35  ? 303 VAL A N   1 
ATOM   2034 C CA  . VAL A 1 268 ? -30.940 38.811 5.308   1.00 85.28  ? 303 VAL A CA  1 
ATOM   2035 C C   . VAL A 1 268 ? -30.903 39.758 4.120   1.00 88.84  ? 303 VAL A C   1 
ATOM   2036 O O   . VAL A 1 268 ? -31.587 39.523 3.128   1.00 89.84  ? 303 VAL A O   1 
ATOM   2037 C CB  . VAL A 1 268 ? -30.546 37.399 4.847   1.00 86.21  ? 303 VAL A CB  1 
ATOM   2038 C CG1 . VAL A 1 268 ? -29.207 37.419 4.130   1.00 87.73  ? 303 VAL A CG1 1 
ATOM   2039 C CG2 . VAL A 1 268 ? -30.504 36.453 6.038   1.00 85.67  ? 303 VAL A CG2 1 
ATOM   2040 N N   . GLU A 1 269 ? -30.095 40.816 4.228   1.00 96.33  ? 304 GLU A N   1 
ATOM   2041 C CA  . GLU A 1 269 ? -29.934 41.823 3.165   1.00 97.16  ? 304 GLU A CA  1 
ATOM   2042 C C   . GLU A 1 269 ? -29.599 41.210 1.802   1.00 100.10 ? 304 GLU A C   1 
ATOM   2043 O O   . GLU A 1 269 ? -30.119 41.644 0.775   1.00 106.72 ? 304 GLU A O   1 
ATOM   2044 C CB  . GLU A 1 269 ? -28.828 42.822 3.530   1.00 97.42  ? 304 GLU A CB  1 
ATOM   2045 C CG  . GLU A 1 269 ? -29.199 43.875 4.568   1.00 101.44 ? 304 GLU A CG  1 
ATOM   2046 C CD  . GLU A 1 269 ? -28.042 44.823 4.875   1.00 107.95 ? 304 GLU A CD  1 
ATOM   2047 O OE1 . GLU A 1 269 ? -26.961 44.672 4.259   1.00 107.71 ? 304 GLU A OE1 1 
ATOM   2048 O OE2 . GLU A 1 269 ? -28.201 45.719 5.738   1.00 108.36 ? 304 GLU A OE2 1 
ATOM   2049 N N   . ALA A 1 270 ? -28.724 40.208 1.802   1.00 104.68 ? 305 ALA A N   1 
ATOM   2050 C CA  . ALA A 1 270 ? -28.267 39.563 0.564   1.00 109.82 ? 305 ALA A CA  1 
ATOM   2051 C C   . ALA A 1 270 ? -29.406 39.008 -0.301  1.00 111.45 ? 305 ALA A C   1 
ATOM   2052 O O   . ALA A 1 270 ? -29.358 39.109 -1.528  1.00 116.71 ? 305 ALA A O   1 
ATOM   2053 C CB  . ALA A 1 270 ? -27.273 38.455 0.891   1.00 108.50 ? 305 ALA A CB  1 
ATOM   2054 N N   . THR A 1 271 ? -30.413 38.422 0.346   1.00 108.71 ? 306 THR A N   1 
ATOM   2055 C CA  . THR A 1 271 ? -31.524 37.768 -0.344  1.00 107.53 ? 306 THR A CA  1 
ATOM   2056 C C   . THR A 1 271 ? -32.853 38.510 -0.185  1.00 104.10 ? 306 THR A C   1 
ATOM   2057 O O   . THR A 1 271 ? -33.864 38.100 -0.756  1.00 106.78 ? 306 THR A O   1 
ATOM   2058 C CB  . THR A 1 271 ? -31.714 36.329 0.180   1.00 111.58 ? 306 THR A CB  1 
ATOM   2059 O OG1 . THR A 1 271 ? -32.169 36.363 1.540   1.00 112.10 ? 306 THR A OG1 1 
ATOM   2060 C CG2 . THR A 1 271 ? -30.402 35.545 0.102   1.00 110.95 ? 306 THR A CG2 1 
ATOM   2061 N N   . ALA A 1 272 ? -32.852 39.584 0.601   1.00 100.62 ? 307 ALA A N   1 
ATOM   2062 C CA  . ALA A 1 272 ? -34.058 40.367 0.883   1.00 100.73 ? 307 ALA A CA  1 
ATOM   2063 C C   . ALA A 1 272 ? -35.237 39.558 1.452   1.00 104.10 ? 307 ALA A C   1 
ATOM   2064 O O   . ALA A 1 272 ? -36.395 39.934 1.253   1.00 103.94 ? 307 ALA A O   1 
ATOM   2065 C CB  . ALA A 1 272 ? -34.489 41.119 -0.366  1.00 100.03 ? 307 ALA A CB  1 
ATOM   2066 N N   . MET A 1 273 ? -34.950 38.472 2.171   1.00 106.19 ? 308 MET A N   1 
ATOM   2067 C CA  . MET A 1 273 ? -36.007 37.635 2.752   1.00 109.45 ? 308 MET A CA  1 
ATOM   2068 C C   . MET A 1 273 ? -35.705 37.226 4.187   1.00 99.81  ? 308 MET A C   1 
ATOM   2069 O O   . MET A 1 273 ? -34.550 37.038 4.564   1.00 99.62  ? 308 MET A O   1 
ATOM   2070 C CB  . MET A 1 273 ? -36.236 36.389 1.896   1.00 119.85 ? 308 MET A CB  1 
ATOM   2071 C CG  . MET A 1 273 ? -37.041 36.663 0.635   1.00 131.66 ? 308 MET A CG  1 
ATOM   2072 S SD  . MET A 1 273 ? -37.518 35.165 -0.248  1.00 152.08 ? 308 MET A SD  1 
ATOM   2073 C CE  . MET A 1 273 ? -35.914 34.505 -0.700  1.00 147.91 ? 308 MET A CE  1 
ATOM   2074 N N   . THR A 1 274 ? -36.761 37.099 4.985   1.00 94.10  ? 309 THR A N   1 
ATOM   2075 C CA  . THR A 1 274 ? -36.636 36.628 6.357   1.00 91.40  ? 309 THR A CA  1 
ATOM   2076 C C   . THR A 1 274 ? -36.203 35.177 6.305   1.00 87.42  ? 309 THR A C   1 
ATOM   2077 O O   . THR A 1 274 ? -36.801 34.373 5.593   1.00 93.09  ? 309 THR A O   1 
ATOM   2078 C CB  . THR A 1 274 ? -37.957 36.749 7.146   1.00 89.14  ? 309 THR A CB  1 
ATOM   2079 O OG1 . THR A 1 274 ? -38.523 38.041 6.934   1.00 92.00  ? 309 THR A OG1 1 
ATOM   2080 C CG2 . THR A 1 274 ? -37.712 36.581 8.626   1.00 92.57  ? 309 THR A CG2 1 
ATOM   2081 N N   . THR A 1 275 ? -35.161 34.853 7.058   1.00 82.14  ? 310 THR A N   1 
ATOM   2082 C CA  . THR A 1 275 ? -34.545 33.543 6.985   1.00 81.51  ? 310 THR A CA  1 
ATOM   2083 C C   . THR A 1 275 ? -34.546 32.887 8.353   1.00 82.98  ? 310 THR A C   1 
ATOM   2084 O O   . THR A 1 275 ? -34.465 33.562 9.380   1.00 81.23  ? 310 THR A O   1 
ATOM   2085 C CB  . THR A 1 275 ? -33.092 33.652 6.492   1.00 82.45  ? 310 THR A CB  1 
ATOM   2086 O OG1 . THR A 1 275 ? -33.040 34.495 5.336   1.00 86.24  ? 310 THR A OG1 1 
ATOM   2087 C CG2 . THR A 1 275 ? -32.539 32.288 6.143   1.00 83.40  ? 310 THR A CG2 1 
ATOM   2088 N N   . GLN A 1 276 ? -34.651 31.562 8.349   1.00 84.25  ? 311 GLN A N   1 
ATOM   2089 C CA  . GLN A 1 276 ? -34.464 30.754 9.542   1.00 80.11  ? 311 GLN A CA  1 
ATOM   2090 C C   . GLN A 1 276 ? -33.329 29.784 9.253   1.00 80.91  ? 311 GLN A C   1 
ATOM   2091 O O   . GLN A 1 276 ? -33.502 28.846 8.480   1.00 80.18  ? 311 GLN A O   1 
ATOM   2092 C CB  . GLN A 1 276 ? -35.746 29.994 9.879   1.00 78.37  ? 311 GLN A CB  1 
ATOM   2093 C CG  . GLN A 1 276 ? -35.570 28.911 10.931  1.00 82.37  ? 311 GLN A CG  1 
ATOM   2094 C CD  . GLN A 1 276 ? -36.887 28.312 11.388  1.00 82.86  ? 311 GLN A CD  1 
ATOM   2095 O OE1 . GLN A 1 276 ? -37.258 27.215 10.979  1.00 81.03  ? 311 GLN A OE1 1 
ATOM   2096 N NE2 . GLN A 1 276 ? -37.599 29.033 12.238  1.00 82.90  ? 311 GLN A NE2 1 
ATOM   2097 N N   . ALA A 1 277 ? -32.166 30.036 9.846   1.00 81.54  ? 312 ALA A N   1 
ATOM   2098 C CA  . ALA A 1 277 ? -31.049 29.097 9.794   1.00 81.69  ? 312 ALA A CA  1 
ATOM   2099 C C   . ALA A 1 277 ? -31.154 28.147 10.976  1.00 82.70  ? 312 ALA A C   1 
ATOM   2100 O O   . ALA A 1 277 ? -31.583 28.543 12.052  1.00 89.64  ? 312 ALA A O   1 
ATOM   2101 C CB  . ALA A 1 277 ? -29.725 29.838 9.822   1.00 81.78  ? 312 ALA A CB  1 
ATOM   2102 N N   . ARG A 1 278 ? -30.759 26.896 10.768  1.00 89.53  ? 313 ARG A N   1 
ATOM   2103 C CA  . ARG A 1 278 ? -30.887 25.856 11.785  1.00 89.77  ? 313 ARG A CA  1 
ATOM   2104 C C   . ARG A 1 278 ? -29.635 25.010 11.893  1.00 86.88  ? 313 ARG A C   1 
ATOM   2105 O O   . ARG A 1 278 ? -28.885 24.856 10.928  1.00 85.50  ? 313 ARG A O   1 
ATOM   2106 C CB  . ARG A 1 278 ? -32.043 24.923 11.428  1.00 96.61  ? 313 ARG A CB  1 
ATOM   2107 C CG  . ARG A 1 278 ? -33.397 25.355 11.947  1.00 99.84  ? 313 ARG A CG  1 
ATOM   2108 C CD  . ARG A 1 278 ? -34.517 24.624 11.223  1.00 101.07 ? 313 ARG A CD  1 
ATOM   2109 N NE  . ARG A 1 278 ? -35.012 25.408 10.093  1.00 106.18 ? 313 ARG A NE  1 
ATOM   2110 C CZ  . ARG A 1 278 ? -34.704 25.209 8.813   1.00 106.56 ? 313 ARG A CZ  1 
ATOM   2111 N NH1 . ARG A 1 278 ? -33.902 24.218 8.441   1.00 104.24 ? 313 ARG A NH1 1 
ATOM   2112 N NH2 . ARG A 1 278 ? -35.220 26.016 7.890   1.00 111.99 ? 313 ARG A NH2 1 
ATOM   2113 N N   . SER A 1 279 ? -29.426 24.455 13.080  1.00 91.35  ? 314 SER A N   1 
ATOM   2114 C CA  . SER A 1 279 ? -28.509 23.333 13.263  1.00 95.25  ? 314 SER A CA  1 
ATOM   2115 C C   . SER A 1 279 ? -28.882 22.557 14.517  1.00 95.65  ? 314 SER A C   1 
ATOM   2116 O O   . SER A 1 279 ? -29.847 22.898 15.201  1.00 96.44  ? 314 SER A O   1 
ATOM   2117 C CB  . SER A 1 279 ? -27.052 23.788 13.335  1.00 95.44  ? 314 SER A CB  1 
ATOM   2118 O OG  . SER A 1 279 ? -26.192 22.665 13.203  1.00 93.88  ? 314 SER A OG  1 
ATOM   2119 N N   . SER A 1 280 ? -28.115 21.511 14.809  1.00 99.86  ? 315 SER A N   1 
ATOM   2120 C CA  . SER A 1 280 ? -28.411 20.630 15.930  1.00 96.83  ? 315 SER A CA  1 
ATOM   2121 C C   . SER A 1 280 ? -27.151 20.202 16.660  1.00 96.21  ? 315 SER A C   1 
ATOM   2122 O O   . SER A 1 280 ? -26.086 20.070 16.057  1.00 96.79  ? 315 SER A O   1 
ATOM   2123 C CB  . SER A 1 280 ? -29.137 19.391 15.426  1.00 93.69  ? 315 SER A CB  1 
ATOM   2124 O OG  . SER A 1 280 ? -29.230 18.412 16.438  1.00 91.83  ? 315 SER A OG  1 
ATOM   2125 N N   . TYR A 1 281 ? -27.288 19.988 17.965  1.00 98.48  ? 316 TYR A N   1 
ATOM   2126 C CA  . TYR A 1 281 ? -26.235 19.381 18.774  1.00 100.14 ? 316 TYR A CA  1 
ATOM   2127 C C   . TYR A 1 281 ? -26.816 18.225 19.575  1.00 102.87 ? 316 TYR A C   1 
ATOM   2128 O O   . TYR A 1 281 ? -27.659 18.427 20.455  1.00 103.19 ? 316 TYR A O   1 
ATOM   2129 C CB  . TYR A 1 281 ? -25.612 20.405 19.723  1.00 97.95  ? 316 TYR A CB  1 
ATOM   2130 C CG  . TYR A 1 281 ? -25.045 21.605 19.012  1.00 97.21  ? 316 TYR A CG  1 
ATOM   2131 C CD1 . TYR A 1 281 ? -23.929 21.484 18.197  1.00 94.67  ? 316 TYR A CD1 1 
ATOM   2132 C CD2 . TYR A 1 281 ? -25.628 22.862 19.148  1.00 98.24  ? 316 TYR A CD2 1 
ATOM   2133 C CE1 . TYR A 1 281 ? -23.408 22.579 17.535  1.00 96.38  ? 316 TYR A CE1 1 
ATOM   2134 C CE2 . TYR A 1 281 ? -25.109 23.966 18.491  1.00 97.38  ? 316 TYR A CE2 1 
ATOM   2135 C CZ  . TYR A 1 281 ? -24.000 23.817 17.684  1.00 96.81  ? 316 TYR A CZ  1 
ATOM   2136 O OH  . TYR A 1 281 ? -23.477 24.906 17.025  1.00 98.68  ? 316 TYR A OH  1 
ATOM   2137 N N   . LEU A 1 282 ? -26.387 17.010 19.243  1.00 105.04 ? 317 LEU A N   1 
ATOM   2138 C CA  . LEU A 1 282 ? -26.652 15.850 20.084  1.00 103.24 ? 317 LEU A CA  1 
ATOM   2139 C C   . LEU A 1 282 ? -25.823 15.983 21.356  1.00 101.33 ? 317 LEU A C   1 
ATOM   2140 O O   . LEU A 1 282 ? -24.793 16.663 21.363  1.00 102.10 ? 317 LEU A O   1 
ATOM   2141 C CB  . LEU A 1 282 ? -26.298 14.558 19.348  1.00 101.79 ? 317 LEU A CB  1 
ATOM   2142 C CG  . LEU A 1 282 ? -27.278 14.150 18.243  1.00 105.21 ? 317 LEU A CG  1 
ATOM   2143 C CD1 . LEU A 1 282 ? -26.663 13.114 17.312  1.00 102.99 ? 317 LEU A CD1 1 
ATOM   2144 C CD2 . LEU A 1 282 ? -28.578 13.627 18.841  1.00 106.10 ? 317 LEU A CD2 1 
ATOM   2145 N N   . ALA A 1 283 ? -26.276 15.345 22.431  1.00 102.36 ? 318 ALA A N   1 
ATOM   2146 C CA  . ALA A 1 283 ? -25.523 15.318 23.688  1.00 103.80 ? 318 ALA A CA  1 
ATOM   2147 C C   . ALA A 1 283 ? -24.052 14.950 23.451  1.00 101.93 ? 318 ALA A C   1 
ATOM   2148 O O   . ALA A 1 283 ? -23.152 15.556 24.036  1.00 97.34  ? 318 ALA A O   1 
ATOM   2149 C CB  . ALA A 1 283 ? -26.166 14.344 24.668  1.00 103.61 ? 318 ALA A CB  1 
ATOM   2150 N N   . SER A 1 284 ? -23.823 13.981 22.565  1.00 102.52 ? 319 SER A N   1 
ATOM   2151 C CA  . SER A 1 284 ? -22.472 13.526 22.221  1.00 103.77 ? 319 SER A CA  1 
ATOM   2152 C C   . SER A 1 284 ? -21.638 14.514 21.385  1.00 107.85 ? 319 SER A C   1 
ATOM   2153 O O   . SER A 1 284 ? -20.450 14.271 21.161  1.00 110.78 ? 319 SER A O   1 
ATOM   2154 C CB  . SER A 1 284 ? -22.546 12.175 21.501  1.00 103.27 ? 319 SER A CB  1 
ATOM   2155 O OG  . SER A 1 284 ? -23.458 12.210 20.420  1.00 103.23 ? 319 SER A OG  1 
ATOM   2156 N N   . GLU A 1 285 ? -22.246 15.606 20.918  1.00 111.30 ? 320 GLU A N   1 
ATOM   2157 C CA  . GLU A 1 285 ? -21.525 16.658 20.186  1.00 106.18 ? 320 GLU A CA  1 
ATOM   2158 C C   . GLU A 1 285 ? -21.239 17.889 21.053  1.00 105.98 ? 320 GLU A C   1 
ATOM   2159 O O   . GLU A 1 285 ? -20.617 18.845 20.585  1.00 98.77  ? 320 GLU A O   1 
ATOM   2160 C CB  . GLU A 1 285 ? -22.308 17.062 18.939  1.00 105.59 ? 320 GLU A CB  1 
ATOM   2161 C CG  . GLU A 1 285 ? -22.356 15.969 17.878  1.00 109.70 ? 320 GLU A CG  1 
ATOM   2162 C CD  . GLU A 1 285 ? -23.573 16.048 16.969  1.00 113.00 ? 320 GLU A CD  1 
ATOM   2163 O OE1 . GLU A 1 285 ? -24.557 16.729 17.324  1.00 117.52 ? 320 GLU A OE1 1 
ATOM   2164 O OE2 . GLU A 1 285 ? -23.559 15.418 15.892  1.00 114.86 ? 320 GLU A OE2 1 
ATOM   2165 N N   . ILE A 1 286 ? -21.685 17.861 22.310  1.00 107.01 ? 321 ILE A N   1 
ATOM   2166 C CA  . ILE A 1 286 ? -21.394 18.932 23.265  1.00 109.35 ? 321 ILE A CA  1 
ATOM   2167 C C   . ILE A 1 286 ? -20.119 18.588 24.034  1.00 107.18 ? 321 ILE A C   1 
ATOM   2168 O O   . ILE A 1 286 ? -20.057 17.560 24.705  1.00 112.46 ? 321 ILE A O   1 
ATOM   2169 C CB  . ILE A 1 286 ? -22.550 19.130 24.272  1.00 109.06 ? 321 ILE A CB  1 
ATOM   2170 C CG1 . ILE A 1 286 ? -23.864 19.418 23.534  1.00 106.23 ? 321 ILE A CG1 1 
ATOM   2171 C CG2 . ILE A 1 286 ? -22.220 20.253 25.252  1.00 108.02 ? 321 ILE A CG2 1 
ATOM   2172 C CD1 . ILE A 1 286 ? -25.101 19.234 24.386  1.00 105.79 ? 321 ILE A CD1 1 
ATOM   2173 N N   . LEU A 1 287 ? -19.115 19.456 23.943  1.00 103.80 ? 322 LEU A N   1 
ATOM   2174 C CA  . LEU A 1 287 ? -17.826 19.222 24.587  1.00 100.14 ? 322 LEU A CA  1 
ATOM   2175 C C   . LEU A 1 287 ? -17.725 19.925 25.932  1.00 100.43 ? 322 LEU A C   1 
ATOM   2176 O O   . LEU A 1 287 ? -17.429 21.120 25.993  1.00 98.67  ? 322 LEU A O   1 
ATOM   2177 C CB  . LEU A 1 287 ? -16.689 19.704 23.685  1.00 99.89  ? 322 LEU A CB  1 
ATOM   2178 C CG  . LEU A 1 287 ? -16.706 19.186 22.249  1.00 101.49 ? 322 LEU A CG  1 
ATOM   2179 C CD1 . LEU A 1 287 ? -15.433 19.620 21.539  1.00 100.16 ? 322 LEU A CD1 1 
ATOM   2180 C CD2 . LEU A 1 287 ? -16.886 17.674 22.200  1.00 100.44 ? 322 LEU A CD2 1 
ATOM   2181 N N   . TRP A 1 288 ? -17.952 19.179 27.011  1.00 100.76 ? 323 TRP A N   1 
ATOM   2182 C CA  . TRP A 1 288 ? -17.799 19.729 28.358  1.00 102.80 ? 323 TRP A CA  1 
ATOM   2183 C C   . TRP A 1 288 ? -16.346 20.157 28.619  1.00 102.29 ? 323 TRP A C   1 
ATOM   2184 O O   . TRP A 1 288 ? -15.404 19.485 28.198  1.00 100.88 ? 323 TRP A O   1 
ATOM   2185 C CB  . TRP A 1 288 ? -18.255 18.712 29.409  1.00 100.47 ? 323 TRP A CB  1 
ATOM   2186 C CG  . TRP A 1 288 ? -18.471 19.307 30.770  1.00 99.51  ? 323 TRP A CG  1 
ATOM   2187 C CD1 . TRP A 1 288 ? -17.514 19.757 31.629  1.00 99.44  ? 323 TRP A CD1 1 
ATOM   2188 C CD2 . TRP A 1 288 ? -19.728 19.501 31.433  1.00 98.60  ? 323 TRP A CD2 1 
ATOM   2189 N NE1 . TRP A 1 288 ? -18.094 20.226 32.781  1.00 103.92 ? 323 TRP A NE1 1 
ATOM   2190 C CE2 . TRP A 1 288 ? -19.452 20.078 32.688  1.00 100.57 ? 323 TRP A CE2 1 
ATOM   2191 C CE3 . TRP A 1 288 ? -21.059 19.246 31.086  1.00 98.49  ? 323 TRP A CE3 1 
ATOM   2192 C CZ2 . TRP A 1 288 ? -20.458 20.409 33.599  1.00 101.51 ? 323 TRP A CZ2 1 
ATOM   2193 C CZ3 . TRP A 1 288 ? -22.060 19.572 31.993  1.00 101.03 ? 323 TRP A CZ3 1 
ATOM   2194 C CH2 . TRP A 1 288 ? -21.752 20.148 33.236  1.00 101.46 ? 323 TRP A CH2 1 
ATOM   2195 N N   . GLY A 1 289 ? -16.178 21.286 29.302  1.00 103.69 ? 324 GLY A N   1 
ATOM   2196 C CA  . GLY A 1 289 ? -14.856 21.797 29.654  1.00 106.13 ? 324 GLY A CA  1 
ATOM   2197 C C   . GLY A 1 289 ? -14.049 22.345 28.488  1.00 112.27 ? 324 GLY A C   1 
ATOM   2198 O O   . GLY A 1 289 ? -12.820 22.284 28.507  1.00 114.22 ? 324 GLY A O   1 
ATOM   2199 N N   . HIS A 1 290 ? -14.733 22.891 27.481  1.00 119.86 ? 325 HIS A N   1 
ATOM   2200 C CA  . HIS A 1 290 ? -14.071 23.468 26.304  1.00 117.34 ? 325 HIS A CA  1 
ATOM   2201 C C   . HIS A 1 290 ? -14.487 24.909 26.067  1.00 113.77 ? 325 HIS A C   1 
ATOM   2202 O O   . HIS A 1 290 ? -15.500 25.371 26.592  1.00 116.86 ? 325 HIS A O   1 
ATOM   2203 C CB  . HIS A 1 290 ? -14.390 22.652 25.053  1.00 122.05 ? 325 HIS A CB  1 
ATOM   2204 C CG  . HIS A 1 290 ? -13.558 21.418 24.903  1.00 126.68 ? 325 HIS A CG  1 
ATOM   2205 N ND1 . HIS A 1 290 ? -12.494 21.341 24.031  1.00 127.40 ? 325 HIS A ND1 1 
ATOM   2206 C CD2 . HIS A 1 290 ? -13.638 20.210 25.507  1.00 127.07 ? 325 HIS A CD2 1 
ATOM   2207 C CE1 . HIS A 1 290 ? -11.954 20.138 24.104  1.00 128.30 ? 325 HIS A CE1 1 
ATOM   2208 N NE2 . HIS A 1 290 ? -12.630 19.432 24.993  1.00 130.66 ? 325 HIS A NE2 1 
ATOM   2209 N N   . ARG A 1 291 ? -13.689 25.601 25.258  1.00 112.52 ? 326 ARG A N   1 
ATOM   2210 C CA  . ARG A 1 291 ? -13.945 26.984 24.855  1.00 108.80 ? 326 ARG A CA  1 
ATOM   2211 C C   . ARG A 1 291 ? -13.510 27.176 23.405  1.00 106.00 ? 326 ARG A C   1 
ATOM   2212 O O   . ARG A 1 291 ? -12.597 26.501 22.941  1.00 109.32 ? 326 ARG A O   1 
ATOM   2213 C CB  . ARG A 1 291 ? -13.205 27.953 25.785  1.00 109.78 ? 326 ARG A CB  1 
ATOM   2214 C CG  . ARG A 1 291 ? -14.089 28.543 26.876  1.00 115.44 ? 326 ARG A CG  1 
ATOM   2215 C CD  . ARG A 1 291 ? -13.351 28.873 28.166  1.00 116.63 ? 326 ARG A CD  1 
ATOM   2216 N NE  . ARG A 1 291 ? -12.093 29.594 27.964  1.00 119.26 ? 326 ARG A NE  1 
ATOM   2217 C CZ  . ARG A 1 291 ? -11.366 30.131 28.946  1.00 122.09 ? 326 ARG A CZ  1 
ATOM   2218 N NH1 . ARG A 1 291 ? -11.764 30.060 30.216  1.00 116.20 ? 326 ARG A NH1 1 
ATOM   2219 N NH2 . ARG A 1 291 ? -10.234 30.764 28.656  1.00 125.97 ? 326 ARG A NH2 1 
ATOM   2220 N N   . PHE A 1 292 ? -14.169 28.088 22.692  1.00 103.86 ? 327 PHE A N   1 
ATOM   2221 C CA  . PHE A 1 292 ? -13.897 28.299 21.265  1.00 100.99 ? 327 PHE A CA  1 
ATOM   2222 C C   . PHE A 1 292 ? -12.621 29.105 21.036  1.00 101.92 ? 327 PHE A C   1 
ATOM   2223 O O   . PHE A 1 292 ? -12.278 29.988 21.824  1.00 91.45  ? 327 PHE A O   1 
ATOM   2224 C CB  . PHE A 1 292 ? -15.073 29.010 20.577  1.00 100.47 ? 327 PHE A CB  1 
ATOM   2225 C CG  . PHE A 1 292 ? -16.308 28.163 20.456  1.00 94.65  ? 327 PHE A CG  1 
ATOM   2226 C CD1 . PHE A 1 292 ? -16.371 27.135 19.526  1.00 92.36  ? 327 PHE A CD1 1 
ATOM   2227 C CD2 . PHE A 1 292 ? -17.408 28.397 21.267  1.00 92.27  ? 327 PHE A CD2 1 
ATOM   2228 C CE1 . PHE A 1 292 ? -17.507 26.350 19.411  1.00 90.42  ? 327 PHE A CE1 1 
ATOM   2229 C CE2 . PHE A 1 292 ? -18.544 27.613 21.162  1.00 91.19  ? 327 PHE A CE2 1 
ATOM   2230 C CZ  . PHE A 1 292 ? -18.595 26.589 20.233  1.00 90.77  ? 327 PHE A CZ  1 
ATOM   2231 N N   . GLU A 1 293 ? -11.928 28.790 19.946  1.00 106.11 ? 328 GLU A N   1 
ATOM   2232 C CA  . GLU A 1 293 ? -10.772 29.563 19.515  1.00 115.72 ? 328 GLU A CA  1 
ATOM   2233 C C   . GLU A 1 293 ? -11.256 30.914 19.017  1.00 114.44 ? 328 GLU A C   1 
ATOM   2234 O O   . GLU A 1 293 ? -12.186 30.971 18.215  1.00 121.76 ? 328 GLU A O   1 
ATOM   2235 C CB  . GLU A 1 293 ? -10.032 28.849 18.376  1.00 126.28 ? 328 GLU A CB  1 
ATOM   2236 C CG  . GLU A 1 293 ? -9.128  27.701 18.808  1.00 133.86 ? 328 GLU A CG  1 
ATOM   2237 C CD  . GLU A 1 293 ? -7.781  28.162 19.344  1.00 140.08 ? 328 GLU A CD  1 
ATOM   2238 O OE1 . GLU A 1 293 ? -7.239  29.171 18.841  1.00 144.87 ? 328 GLU A OE1 1 
ATOM   2239 O OE2 . GLU A 1 293 ? -7.254  27.505 20.267  1.00 145.70 ? 328 GLU A OE2 1 
ATOM   2240 N N   . PRO A 1 294 ? -10.643 32.010 19.492  1.00 113.52 ? 329 PRO A N   1 
ATOM   2241 C CA  . PRO A 1 294 ? -10.951 33.300 18.881  1.00 115.54 ? 329 PRO A CA  1 
ATOM   2242 C C   . PRO A 1 294 ? -10.683 33.315 17.375  1.00 114.11 ? 329 PRO A C   1 
ATOM   2243 O O   . PRO A 1 294 ? -9.774  32.627 16.898  1.00 115.91 ? 329 PRO A O   1 
ATOM   2244 C CB  . PRO A 1 294 ? -10.010 34.264 19.609  1.00 115.61 ? 329 PRO A CB  1 
ATOM   2245 C CG  . PRO A 1 294 ? -9.824  33.648 20.950  1.00 115.57 ? 329 PRO A CG  1 
ATOM   2246 C CD  . PRO A 1 294 ? -9.828  32.161 20.710  1.00 115.08 ? 329 PRO A CD  1 
ATOM   2247 N N   . VAL A 1 295 ? -11.496 34.075 16.646  1.00 110.19 ? 330 VAL A N   1 
ATOM   2248 C CA  . VAL A 1 295 ? -11.327 34.261 15.202  1.00 105.94 ? 330 VAL A CA  1 
ATOM   2249 C C   . VAL A 1 295 ? -11.020 35.713 14.837  1.00 102.71 ? 330 VAL A C   1 
ATOM   2250 O O   . VAL A 1 295 ? -10.438 35.977 13.789  1.00 109.07 ? 330 VAL A O   1 
ATOM   2251 C CB  . VAL A 1 295 ? -12.575 33.799 14.420  1.00 107.34 ? 330 VAL A CB  1 
ATOM   2252 C CG1 . VAL A 1 295 ? -12.778 32.300 14.579  1.00 109.80 ? 330 VAL A CG1 1 
ATOM   2253 C CG2 . VAL A 1 295 ? -13.823 34.550 14.868  1.00 107.43 ? 330 VAL A CG2 1 
ATOM   2254 N N   . LEU A 1 296 ? -11.410 36.642 15.706  1.00 100.58 ? 331 LEU A N   1 
ATOM   2255 C CA  . LEU A 1 296 ? -11.290 38.072 15.443  1.00 101.68 ? 331 LEU A CA  1 
ATOM   2256 C C   . LEU A 1 296 ? -9.966  38.596 15.970  1.00 103.46 ? 331 LEU A C   1 
ATOM   2257 O O   . LEU A 1 296 ? -9.680  38.449 17.160  1.00 107.97 ? 331 LEU A O   1 
ATOM   2258 C CB  . LEU A 1 296 ? -12.434 38.827 16.132  1.00 97.96  ? 331 LEU A CB  1 
ATOM   2259 C CG  . LEU A 1 296 ? -12.434 40.355 16.028  1.00 96.01  ? 331 LEU A CG  1 
ATOM   2260 C CD1 . LEU A 1 296 ? -12.621 40.797 14.587  1.00 95.97  ? 331 LEU A CD1 1 
ATOM   2261 C CD2 . LEU A 1 296 ? -13.514 40.961 16.910  1.00 100.43 ? 331 LEU A CD2 1 
ATOM   2262 N N   . PHE A 1 297 ? -9.171  39.211 15.093  1.00 104.77 ? 332 PHE A N   1 
ATOM   2263 C CA  A PHE A 1 297 ? -7.891  39.814 15.475  0.50 108.40 ? 332 PHE A CA  1 
ATOM   2264 C CA  B PHE A 1 297 ? -7.918  39.839 15.510  0.50 105.78 ? 332 PHE A CA  1 
ATOM   2265 C C   . PHE A 1 297 ? -7.751  41.218 14.884  1.00 108.87 ? 332 PHE A C   1 
ATOM   2266 O O   . PHE A 1 297 ? -8.164  41.462 13.749  1.00 114.50 ? 332 PHE A O   1 
ATOM   2267 C CB  A PHE A 1 297 ? -6.727  38.933 15.004  0.50 107.92 ? 332 PHE A CB  1 
ATOM   2268 C CB  B PHE A 1 297 ? -6.704  38.938 15.222  0.50 102.52 ? 332 PHE A CB  1 
ATOM   2269 C CG  A PHE A 1 297 ? -6.831  37.499 15.449  0.50 106.18 ? 332 PHE A CG  1 
ATOM   2270 C CG  B PHE A 1 297 ? -6.484  38.631 13.765  0.50 96.73  ? 332 PHE A CG  1 
ATOM   2271 C CD1 A PHE A 1 297 ? -6.339  37.103 16.682  0.50 104.05 ? 332 PHE A CD1 1 
ATOM   2272 C CD1 B PHE A 1 297 ? -5.560  39.349 13.025  0.50 93.35  ? 332 PHE A CD1 1 
ATOM   2273 C CD2 A PHE A 1 297 ? -7.427  36.549 14.635  0.50 105.88 ? 332 PHE A CD2 1 
ATOM   2274 C CD2 B PHE A 1 297 ? -7.174  37.601 13.146  0.50 95.10  ? 332 PHE A CD2 1 
ATOM   2275 C CE1 A PHE A 1 297 ? -6.437  35.787 17.093  0.50 105.11 ? 332 PHE A CE1 1 
ATOM   2276 C CE1 B PHE A 1 297 ? -5.343  39.059 11.691  0.50 93.99  ? 332 PHE A CE1 1 
ATOM   2277 C CE2 A PHE A 1 297 ? -7.529  35.231 15.039  0.50 105.72 ? 332 PHE A CE2 1 
ATOM   2278 C CE2 B PHE A 1 297 ? -6.963  37.308 11.811  0.50 94.55  ? 332 PHE A CE2 1 
ATOM   2279 C CZ  A PHE A 1 297 ? -7.033  34.850 16.270  0.50 105.26 ? 332 PHE A CZ  1 
ATOM   2280 C CZ  B PHE A 1 297 ? -6.045  38.037 11.082  0.50 93.36  ? 332 PHE A CZ  1 
ATOM   2281 N N   . GLU A 1 298 ? -7.160  42.126 15.656  1.00 114.08 ? 333 GLU A N   1 
ATOM   2282 C CA  . GLU A 1 298 ? -6.924  43.497 15.225  1.00 118.07 ? 333 GLU A CA  1 
ATOM   2283 C C   . GLU A 1 298 ? -5.618  43.571 14.440  1.00 125.73 ? 333 GLU A C   1 
ATOM   2284 O O   . GLU A 1 298 ? -4.617  42.981 14.845  1.00 132.53 ? 333 GLU A O   1 
ATOM   2285 C CB  . GLU A 1 298 ? -6.853  44.419 16.447  1.00 116.76 ? 333 GLU A CB  1 
ATOM   2286 C CG  . GLU A 1 298 ? -6.855  45.902 16.111  1.00 117.22 ? 333 GLU A CG  1 
ATOM   2287 C CD  . GLU A 1 298 ? -6.807  46.803 17.335  1.00 115.77 ? 333 GLU A CD  1 
ATOM   2288 O OE1 . GLU A 1 298 ? -6.705  46.287 18.470  1.00 117.75 ? 333 GLU A OE1 1 
ATOM   2289 O OE2 . GLU A 1 298 ? -6.870  48.038 17.158  1.00 107.88 ? 333 GLU A OE2 1 
ATOM   2290 N N   . GLU A 1 299 ? -5.633  44.284 13.316  1.00 134.40 ? 334 GLU A N   1 
ATOM   2291 C CA  . GLU A 1 299 ? -4.426  44.499 12.515  1.00 140.39 ? 334 GLU A CA  1 
ATOM   2292 C C   . GLU A 1 299 ? -4.422  45.903 11.919  1.00 146.47 ? 334 GLU A C   1 
ATOM   2293 O O   . GLU A 1 299 ? -5.470  46.420 11.537  1.00 154.68 ? 334 GLU A O   1 
ATOM   2294 C CB  . GLU A 1 299 ? -4.323  43.453 11.401  1.00 137.96 ? 334 GLU A CB  1 
ATOM   2295 C CG  . GLU A 1 299 ? -5.417  43.542 10.346  1.00 142.39 ? 334 GLU A CG  1 
ATOM   2296 C CD  . GLU A 1 299 ? -5.178  42.623 9.167   1.00 147.77 ? 334 GLU A CD  1 
ATOM   2297 O OE1 . GLU A 1 299 ? -4.376  41.672 9.296   1.00 152.78 ? 334 GLU A OE1 1 
ATOM   2298 O OE2 . GLU A 1 299 ? -5.800  42.855 8.107   1.00 144.48 ? 334 GLU A OE2 1 
ATOM   2299 N N   . LYS A 1 300 ? -3.245  46.519 11.848  1.00 149.35 ? 335 LYS A N   1 
ATOM   2300 C CA  . LYS A 1 300 ? -3.094  47.840 11.232  1.00 151.77 ? 335 LYS A CA  1 
ATOM   2301 C C   . LYS A 1 300 ? -4.240  48.793 11.619  1.00 148.38 ? 335 LYS A C   1 
ATOM   2302 O O   . LYS A 1 300 ? -4.316  49.229 12.768  1.00 141.50 ? 335 LYS A O   1 
ATOM   2303 C CB  . LYS A 1 300 ? -2.978  47.695 9.710   1.00 149.05 ? 335 LYS A CB  1 
ATOM   2304 N N   . ASN A 1 301 ? -5.127  49.096 10.667  1.00 149.18 ? 336 ASN A N   1 
ATOM   2305 C CA  . ASN A 1 301 ? -6.288  49.962 10.904  1.00 150.06 ? 336 ASN A CA  1 
ATOM   2306 C C   . ASN A 1 301 ? -7.602  49.262 10.533  1.00 145.45 ? 336 ASN A C   1 
ATOM   2307 O O   . ASN A 1 301 ? -8.499  49.871 9.943   1.00 147.42 ? 336 ASN A O   1 
ATOM   2308 C CB  . ASN A 1 301 ? -6.153  51.267 10.106  1.00 149.20 ? 336 ASN A CB  1 
ATOM   2309 C CG  . ASN A 1 301 ? -5.045  52.164 10.623  1.00 148.11 ? 336 ASN A CG  1 
ATOM   2310 O OD1 . ASN A 1 301 ? -4.525  51.970 11.722  1.00 154.40 ? 336 ASN A OD1 1 
ATOM   2311 N ND2 . ASN A 1 301 ? -4.687  53.167 9.832   1.00 145.53 ? 336 ASN A ND2 1 
ATOM   2312 N N   . GLN A 1 302 ? -7.714  47.984 10.886  1.00 137.92 ? 337 GLN A N   1 
ATOM   2313 C CA  . GLN A 1 302 ? -8.814  47.150 10.413  1.00 130.64 ? 337 GLN A CA  1 
ATOM   2314 C C   . GLN A 1 302 ? -8.893  45.845 11.207  1.00 127.76 ? 337 GLN A C   1 
ATOM   2315 O O   . GLN A 1 302 ? -7.868  45.285 11.588  1.00 133.14 ? 337 GLN A O   1 
ATOM   2316 C CB  . GLN A 1 302 ? -8.584  46.852 8.930   1.00 127.74 ? 337 GLN A CB  1 
ATOM   2317 C CG  . GLN A 1 302 ? -9.643  46.013 8.246   1.00 127.89 ? 337 GLN A CG  1 
ATOM   2318 C CD  . GLN A 1 302 ? -9.164  45.485 6.910   1.00 127.09 ? 337 GLN A CD  1 
ATOM   2319 O OE1 . GLN A 1 302 ? -9.625  45.923 5.857   1.00 128.44 ? 337 GLN A OE1 1 
ATOM   2320 N NE2 . GLN A 1 302 ? -8.222  44.545 6.946   1.00 124.01 ? 337 GLN A NE2 1 
ATOM   2321 N N   . TYR A 1 303 ? -10.108 45.361 11.456  1.00 119.95 ? 338 TYR A N   1 
ATOM   2322 C CA  . TYR A 1 303 ? -10.290 44.067 12.114  1.00 114.54 ? 338 TYR A CA  1 
ATOM   2323 C C   . TYR A 1 303 ? -10.352 42.956 11.088  1.00 112.06 ? 338 TYR A C   1 
ATOM   2324 O O   . TYR A 1 303 ? -10.682 43.192 9.927   1.00 112.20 ? 338 TYR A O   1 
ATOM   2325 C CB  . TYR A 1 303 ? -11.557 44.059 12.959  1.00 112.41 ? 338 TYR A CB  1 
ATOM   2326 C CG  . TYR A 1 303 ? -11.434 44.904 14.191  1.00 111.37 ? 338 TYR A CG  1 
ATOM   2327 C CD1 . TYR A 1 303 ? -10.829 44.405 15.340  1.00 111.98 ? 338 TYR A CD1 1 
ATOM   2328 C CD2 . TYR A 1 303 ? -11.905 46.211 14.208  1.00 110.56 ? 338 TYR A CD2 1 
ATOM   2329 C CE1 . TYR A 1 303 ? -10.704 45.183 16.478  1.00 109.95 ? 338 TYR A CE1 1 
ATOM   2330 C CE2 . TYR A 1 303 ? -11.788 46.995 15.340  1.00 110.76 ? 338 TYR A CE2 1 
ATOM   2331 C CZ  . TYR A 1 303 ? -11.187 46.478 16.471  1.00 109.52 ? 338 TYR A CZ  1 
ATOM   2332 O OH  . TYR A 1 303 ? -11.068 47.254 17.596  1.00 110.97 ? 338 TYR A OH  1 
ATOM   2333 N N   . LYS A 1 304 ? -10.045 41.738 11.519  1.00 108.37 ? 339 LYS A N   1 
ATOM   2334 C CA  . LYS A 1 304 ? -10.020 40.613 10.602  1.00 110.03 ? 339 LYS A CA  1 
ATOM   2335 C C   . LYS A 1 304 ? -10.510 39.335 11.269  1.00 103.66 ? 339 LYS A C   1 
ATOM   2336 O O   . LYS A 1 304 ? -10.259 39.106 12.448  1.00 100.03 ? 339 LYS A O   1 
ATOM   2337 C CB  . LYS A 1 304 ? -8.607  40.421 10.051  1.00 118.26 ? 339 LYS A CB  1 
ATOM   2338 C CG  . LYS A 1 304 ? -8.567  40.177 8.552   1.00 127.61 ? 339 LYS A CG  1 
ATOM   2339 C CD  . LYS A 1 304 ? -7.183  39.761 8.080   1.00 133.94 ? 339 LYS A CD  1 
ATOM   2340 C CE  . LYS A 1 304 ? -6.912  40.229 6.657   1.00 137.35 ? 339 LYS A CE  1 
ATOM   2341 N NZ  . LYS A 1 304 ? -5.602  39.733 6.150   1.00 139.82 ? 339 LYS A NZ  1 
ATOM   2342 N N   . VAL A 1 305 ? -11.210 38.510 10.498  1.00 101.96 ? 340 VAL A N   1 
ATOM   2343 C CA  . VAL A 1 305 ? -11.749 37.249 10.983  1.00 103.90 ? 340 VAL A CA  1 
ATOM   2344 C C   . VAL A 1 305 ? -11.098 36.120 10.199  1.00 107.45 ? 340 VAL A C   1 
ATOM   2345 O O   . VAL A 1 305 ? -11.210 36.064 8.974   1.00 106.14 ? 340 VAL A O   1 
ATOM   2346 C CB  . VAL A 1 305 ? -13.284 37.174 10.801  1.00 106.18 ? 340 VAL A CB  1 
ATOM   2347 C CG1 . VAL A 1 305 ? -13.819 35.816 11.238  1.00 106.89 ? 340 VAL A CG1 1 
ATOM   2348 C CG2 . VAL A 1 305 ? -13.975 38.281 11.584  1.00 106.77 ? 340 VAL A CG2 1 
ATOM   2349 N N   . ASP A 1 306 ? -10.412 35.231 10.909  1.00 110.36 ? 341 ASP A N   1 
ATOM   2350 C CA  . ASP A 1 306 ? -9.859  34.028 10.304  1.00 111.33 ? 341 ASP A CA  1 
ATOM   2351 C C   . ASP A 1 306 ? -10.825 32.876 10.551  1.00 110.80 ? 341 ASP A C   1 
ATOM   2352 O O   . ASP A 1 306 ? -10.900 32.337 11.656  1.00 111.21 ? 341 ASP A O   1 
ATOM   2353 C CB  . ASP A 1 306 ? -8.485  33.714 10.888  1.00 114.12 ? 341 ASP A CB  1 
ATOM   2354 C CG  . ASP A 1 306 ? -7.903  32.430 10.341  1.00 114.71 ? 341 ASP A CG  1 
ATOM   2355 O OD1 . ASP A 1 306 ? -7.731  32.329 9.107   1.00 117.99 ? 341 ASP A OD1 1 
ATOM   2356 O OD2 . ASP A 1 306 ? -7.622  31.518 11.145  1.00 116.39 ? 341 ASP A OD2 1 
ATOM   2357 N N   . TYR A 1 307 ? -11.556 32.496 9.512   1.00 111.08 ? 342 TYR A N   1 
ATOM   2358 C CA  . TYR A 1 307 ? -12.631 31.514 9.650   1.00 112.85 ? 342 TYR A CA  1 
ATOM   2359 C C   . TYR A 1 307 ? -12.173 30.062 9.829   1.00 113.35 ? 342 TYR A C   1 
ATOM   2360 O O   . TYR A 1 307 ? -13.006 29.186 10.059  1.00 113.04 ? 342 TYR A O   1 
ATOM   2361 C CB  . TYR A 1 307 ? -13.616 31.629 8.476   1.00 114.36 ? 342 TYR A CB  1 
ATOM   2362 C CG  . TYR A 1 307 ? -14.794 32.538 8.768   1.00 114.47 ? 342 TYR A CG  1 
ATOM   2363 C CD1 . TYR A 1 307 ? -15.978 32.022 9.290   1.00 114.57 ? 342 TYR A CD1 1 
ATOM   2364 C CD2 . TYR A 1 307 ? -14.724 33.908 8.532   1.00 111.85 ? 342 TYR A CD2 1 
ATOM   2365 C CE1 . TYR A 1 307 ? -17.061 32.842 9.562   1.00 116.15 ? 342 TYR A CE1 1 
ATOM   2366 C CE2 . TYR A 1 307 ? -15.802 34.737 8.803   1.00 113.68 ? 342 TYR A CE2 1 
ATOM   2367 C CZ  . TYR A 1 307 ? -16.968 34.198 9.317   1.00 114.20 ? 342 TYR A CZ  1 
ATOM   2368 O OH  . TYR A 1 307 ? -18.045 35.008 9.591   1.00 109.83 ? 342 TYR A OH  1 
ATOM   2369 N N   . SER A 1 308 ? -10.870 29.796 9.735   1.00 120.61 ? 343 SER A N   1 
ATOM   2370 C CA  . SER A 1 308 ? -10.345 28.452 10.022  1.00 123.73 ? 343 SER A CA  1 
ATOM   2371 C C   . SER A 1 308 ? -10.542 28.064 11.482  1.00 125.04 ? 343 SER A C   1 
ATOM   2372 O O   . SER A 1 308 ? -10.832 26.907 11.781  1.00 123.32 ? 343 SER A O   1 
ATOM   2373 C CB  . SER A 1 308 ? -8.860  28.343 9.669   1.00 124.29 ? 343 SER A CB  1 
ATOM   2374 O OG  . SER A 1 308 ? -8.283  29.621 9.480   1.00 125.65 ? 343 SER A OG  1 
ATOM   2375 N N   . HIS A 1 309 ? -10.393 29.034 12.381  1.00 130.42 ? 344 HIS A N   1 
ATOM   2376 C CA  . HIS A 1 309 ? -10.562 28.793 13.817  1.00 133.14 ? 344 HIS A CA  1 
ATOM   2377 C C   . HIS A 1 309 ? -12.026 28.856 14.267  1.00 128.11 ? 344 HIS A C   1 
ATOM   2378 O O   . HIS A 1 309 ? -12.303 28.806 15.464  1.00 127.59 ? 344 HIS A O   1 
ATOM   2379 C CB  . HIS A 1 309 ? -9.735  29.794 14.638  1.00 137.39 ? 344 HIS A CB  1 
ATOM   2380 C CG  . HIS A 1 309 ? -8.288  29.846 14.258  1.00 142.86 ? 344 HIS A CG  1 
ATOM   2381 N ND1 . HIS A 1 309 ? -7.548  28.717 13.977  1.00 145.49 ? 344 HIS A ND1 1 
ATOM   2382 C CD2 . HIS A 1 309 ? -7.440  30.894 14.129  1.00 145.12 ? 344 HIS A CD2 1 
ATOM   2383 C CE1 . HIS A 1 309 ? -6.310  29.068 13.678  1.00 147.66 ? 344 HIS A CE1 1 
ATOM   2384 N NE2 . HIS A 1 309 ? -6.218  30.383 13.764  1.00 149.64 ? 344 HIS A NE2 1 
ATOM   2385 N N   . PHE A 1 310 ? -12.957 28.954 13.319  1.00 124.17 ? 345 PHE A N   1 
ATOM   2386 C CA  . PHE A 1 310 ? -14.378 29.071 13.636  1.00 116.23 ? 345 PHE A CA  1 
ATOM   2387 C C   . PHE A 1 310 ? -14.857 27.898 14.483  1.00 110.73 ? 345 PHE A C   1 
ATOM   2388 O O   . PHE A 1 310 ? -15.410 28.092 15.567  1.00 104.25 ? 345 PHE A O   1 
ATOM   2389 C CB  . PHE A 1 310 ? -15.211 29.162 12.351  1.00 114.64 ? 345 PHE A CB  1 
ATOM   2390 C CG  . PHE A 1 310 ? -16.671 29.426 12.592  1.00 109.02 ? 345 PHE A CG  1 
ATOM   2391 C CD1 . PHE A 1 310 ? -17.137 30.725 12.764  1.00 106.21 ? 345 PHE A CD1 1 
ATOM   2392 C CD2 . PHE A 1 310 ? -17.578 28.377 12.654  1.00 101.52 ? 345 PHE A CD2 1 
ATOM   2393 C CE1 . PHE A 1 310 ? -18.479 30.970 12.993  1.00 103.86 ? 345 PHE A CE1 1 
ATOM   2394 C CE2 . PHE A 1 310 ? -18.920 28.616 12.885  1.00 100.45 ? 345 PHE A CE2 1 
ATOM   2395 C CZ  . PHE A 1 310 ? -19.372 29.914 13.054  1.00 102.30 ? 345 PHE A CZ  1 
ATOM   2396 N N   . HIS A 1 311 ? -14.620 26.686 13.993  1.00 109.80 ? 346 HIS A N   1 
ATOM   2397 C CA  . HIS A 1 311 ? -15.111 25.477 14.656  1.00 111.14 ? 346 HIS A CA  1 
ATOM   2398 C C   . HIS A 1 311 ? -14.175 24.962 15.756  1.00 109.66 ? 346 HIS A C   1 
ATOM   2399 O O   . HIS A 1 311 ? -14.522 24.017 16.457  1.00 110.35 ? 346 HIS A O   1 
ATOM   2400 C CB  . HIS A 1 311 ? -15.325 24.354 13.633  1.00 110.16 ? 346 HIS A CB  1 
ATOM   2401 C CG  . HIS A 1 311 ? -16.183 24.742 12.468  1.00 109.73 ? 346 HIS A CG  1 
ATOM   2402 N ND1 . HIS A 1 311 ? -17.548 24.558 12.453  1.00 109.61 ? 346 HIS A ND1 1 
ATOM   2403 C CD2 . HIS A 1 311 ? -15.867 25.288 11.271  1.00 109.88 ? 346 HIS A CD2 1 
ATOM   2404 C CE1 . HIS A 1 311 ? -18.038 24.976 11.301  1.00 106.88 ? 346 HIS A CE1 1 
ATOM   2405 N NE2 . HIS A 1 311 ? -17.038 25.424 10.564  1.00 107.91 ? 346 HIS A NE2 1 
ATOM   2406 N N   . LYS A 1 312 ? -13.005 25.576 15.916  1.00 112.81 ? 347 LYS A N   1 
ATOM   2407 C CA  . LYS A 1 312 ? -11.960 25.011 16.773  1.00 119.46 ? 347 LYS A CA  1 
ATOM   2408 C C   . LYS A 1 312 ? -12.101 25.395 18.245  1.00 120.01 ? 347 LYS A C   1 
ATOM   2409 O O   . LYS A 1 312 ? -12.476 26.521 18.574  1.00 116.84 ? 347 LYS A O   1 
ATOM   2410 C CB  . LYS A 1 312 ? -10.571 25.380 16.237  1.00 124.33 ? 347 LYS A CB  1 
ATOM   2411 C CG  . LYS A 1 312 ? -10.200 24.581 14.995  1.00 130.08 ? 347 LYS A CG  1 
ATOM   2412 C CD  . LYS A 1 312 ? -8.918  25.069 14.345  1.00 135.84 ? 347 LYS A CD  1 
ATOM   2413 C CE  . LYS A 1 312 ? -8.692  24.395 13.000  1.00 140.35 ? 347 LYS A CE  1 
ATOM   2414 N NZ  . LYS A 1 312 ? -7.662  25.101 12.187  1.00 145.12 ? 347 LYS A NZ  1 
ATOM   2415 N N   . THR A 1 313 ? -11.783 24.439 19.118  1.00 126.27 ? 348 THR A N   1 
ATOM   2416 C CA  . THR A 1 313 ? -11.926 24.597 20.565  1.00 126.86 ? 348 THR A CA  1 
ATOM   2417 C C   . THR A 1 313 ? -10.637 24.227 21.295  1.00 121.26 ? 348 THR A C   1 
ATOM   2418 O O   . THR A 1 313 ? -9.710  23.681 20.696  1.00 121.34 ? 348 THR A O   1 
ATOM   2419 C CB  . THR A 1 313 ? -13.060 23.702 21.114  1.00 133.09 ? 348 THR A CB  1 
ATOM   2420 O OG1 . THR A 1 313 ? -12.673 22.322 21.044  1.00 129.66 ? 348 THR A OG1 1 
ATOM   2421 C CG2 . THR A 1 313 ? -14.348 23.908 20.320  1.00 133.83 ? 348 THR A CG2 1 
ATOM   2422 N N   . TYR A 1 314 ? -10.590 24.528 22.592  1.00 118.74 ? 349 TYR A N   1 
ATOM   2423 C CA  . TYR A 1 314 ? -9.470  24.136 23.449  1.00 112.50 ? 349 TYR A CA  1 
ATOM   2424 C C   . TYR A 1 314 ? -9.939  23.806 24.866  1.00 119.67 ? 349 TYR A C   1 
ATOM   2425 O O   . TYR A 1 314 ? -10.908 24.387 25.356  1.00 122.22 ? 349 TYR A O   1 
ATOM   2426 C CB  . TYR A 1 314 ? -8.395  25.226 23.475  1.00 105.71 ? 349 TYR A CB  1 
ATOM   2427 C CG  . TYR A 1 314 ? -8.808  26.538 24.105  1.00 104.86 ? 349 TYR A CG  1 
ATOM   2428 C CD1 . TYR A 1 314 ? -8.787  26.710 25.486  1.00 110.26 ? 349 TYR A CD1 1 
ATOM   2429 C CD2 . TYR A 1 314 ? -9.183  27.620 23.320  1.00 107.17 ? 349 TYR A CD2 1 
ATOM   2430 C CE1 . TYR A 1 314 ? -9.149  27.916 26.069  1.00 110.79 ? 349 TYR A CE1 1 
ATOM   2431 C CE2 . TYR A 1 314 ? -9.545  28.831 23.893  1.00 108.63 ? 349 TYR A CE2 1 
ATOM   2432 C CZ  . TYR A 1 314 ? -9.526  28.975 25.266  1.00 109.86 ? 349 TYR A CZ  1 
ATOM   2433 O OH  . TYR A 1 314 ? -9.887  30.174 25.837  1.00 109.22 ? 349 TYR A OH  1 
ATOM   2434 N N   . GLU A 1 315 ? -9.237  22.880 25.518  1.00 126.47 ? 350 GLU A N   1 
ATOM   2435 C CA  . GLU A 1 315 ? -9.631  22.390 26.842  1.00 126.84 ? 350 GLU A CA  1 
ATOM   2436 C C   . GLU A 1 315 ? -9.405  23.413 27.953  1.00 122.61 ? 350 GLU A C   1 
ATOM   2437 O O   . GLU A 1 315 ? -8.426  24.162 27.938  1.00 114.26 ? 350 GLU A O   1 
ATOM   2438 C CB  . GLU A 1 315 ? -8.874  21.104 27.195  1.00 134.10 ? 350 GLU A CB  1 
ATOM   2439 C CG  . GLU A 1 315 ? -9.264  19.896 26.357  1.00 139.06 ? 350 GLU A CG  1 
ATOM   2440 C CD  . GLU A 1 315 ? -8.775  18.588 26.953  1.00 139.87 ? 350 GLU A CD  1 
ATOM   2441 O OE1 . GLU A 1 315 ? -7.631  18.547 27.454  1.00 141.41 ? 350 GLU A OE1 1 
ATOM   2442 O OE2 . GLU A 1 315 ? -9.539  17.600 26.920  1.00 137.84 ? 350 GLU A OE2 1 
ATOM   2443 N N   . VAL A 1 316 ? -10.331 23.429 28.908  1.00 120.91 ? 351 VAL A N   1 
ATOM   2444 C CA  . VAL A 1 316 ? -10.176 24.172 30.151  1.00 122.18 ? 351 VAL A CA  1 
ATOM   2445 C C   . VAL A 1 316 ? -10.351 23.176 31.300  1.00 127.16 ? 351 VAL A C   1 
ATOM   2446 O O   . VAL A 1 316 ? -11.480 22.885 31.708  1.00 123.36 ? 351 VAL A O   1 
ATOM   2447 C CB  . VAL A 1 316 ? -11.196 25.323 30.257  1.00 120.13 ? 351 VAL A CB  1 
ATOM   2448 C CG1 . VAL A 1 316 ? -11.075 26.028 31.605  1.00 115.32 ? 351 VAL A CG1 1 
ATOM   2449 C CG2 . VAL A 1 316 ? -10.997 26.300 29.103  1.00 120.57 ? 351 VAL A CG2 1 
ATOM   2450 N N   . PRO A 1 317 ? -9.229  22.631 31.813  1.00 133.04 ? 352 PRO A N   1 
ATOM   2451 C CA  . PRO A 1 317 ? -9.303  21.606 32.863  1.00 128.74 ? 352 PRO A CA  1 
ATOM   2452 C C   . PRO A 1 317 ? -9.803  22.108 34.227  1.00 120.32 ? 352 PRO A C   1 
ATOM   2453 O O   . PRO A 1 317 ? -10.270 21.303 35.036  1.00 113.72 ? 352 PRO A O   1 
ATOM   2454 C CB  . PRO A 1 317 ? -7.861  21.091 32.958  1.00 131.73 ? 352 PRO A CB  1 
ATOM   2455 C CG  . PRO A 1 317 ? -7.012  22.183 32.407  1.00 131.87 ? 352 PRO A CG  1 
ATOM   2456 C CD  . PRO A 1 317 ? -7.841  22.886 31.379  1.00 131.38 ? 352 PRO A CD  1 
ATOM   2457 N N   . SER A 1 318 ? -9.719  23.418 34.472  1.00 114.21 ? 353 SER A N   1 
ATOM   2458 C CA  . SER A 1 318 ? -10.276 24.019 35.695  1.00 112.96 ? 353 SER A CA  1 
ATOM   2459 C C   . SER A 1 318 ? -11.814 24.048 35.716  1.00 112.47 ? 353 SER A C   1 
ATOM   2460 O O   . SER A 1 318 ? -12.419 24.392 36.734  1.00 105.86 ? 353 SER A O   1 
ATOM   2461 C CB  . SER A 1 318 ? -9.730  25.437 35.892  1.00 109.78 ? 353 SER A CB  1 
ATOM   2462 O OG  . SER A 1 318 ? -9.870  26.201 34.714  1.00 110.52 ? 353 SER A OG  1 
ATOM   2463 N N   . THR A 1 319 ? -12.438 23.698 34.592  1.00 113.44 ? 354 THR A N   1 
ATOM   2464 C CA  . THR A 1 319 ? -13.886 23.570 34.511  1.00 110.74 ? 354 THR A CA  1 
ATOM   2465 C C   . THR A 1 319 ? -14.397 22.478 35.452  1.00 107.36 ? 354 THR A C   1 
ATOM   2466 O O   . THR A 1 319 ? -13.977 21.324 35.350  1.00 112.37 ? 354 THR A O   1 
ATOM   2467 C CB  . THR A 1 319 ? -14.327 23.227 33.073  1.00 112.60 ? 354 THR A CB  1 
ATOM   2468 O OG1 . THR A 1 319 ? -13.942 24.286 32.187  1.00 115.60 ? 354 THR A OG1 1 
ATOM   2469 C CG2 . THR A 1 319 ? -15.841 23.024 32.991  1.00 113.98 ? 354 THR A CG2 1 
ATOM   2470 N N   . PRO A 1 320 ? -15.305 22.840 36.375  1.00 105.15 ? 355 PRO A N   1 
ATOM   2471 C CA  . PRO A 1 320 ? -15.994 21.837 37.189  1.00 106.13 ? 355 PRO A CA  1 
ATOM   2472 C C   . PRO A 1 320 ? -16.633 20.737 36.342  1.00 107.35 ? 355 PRO A C   1 
ATOM   2473 O O   . PRO A 1 320 ? -17.103 21.008 35.236  1.00 111.31 ? 355 PRO A O   1 
ATOM   2474 C CB  . PRO A 1 320 ? -17.083 22.649 37.894  1.00 105.57 ? 355 PRO A CB  1 
ATOM   2475 C CG  . PRO A 1 320 ? -16.529 24.027 37.982  1.00 106.24 ? 355 PRO A CG  1 
ATOM   2476 C CD  . PRO A 1 320 ? -15.668 24.215 36.767  1.00 105.56 ? 355 PRO A CD  1 
ATOM   2477 N N   . ARG A 1 321 ? -16.643 19.513 36.863  1.00 105.19 ? 356 ARG A N   1 
ATOM   2478 C CA  . ARG A 1 321 ? -17.245 18.374 36.172  1.00 105.02 ? 356 ARG A CA  1 
ATOM   2479 C C   . ARG A 1 321 ? -18.632 18.028 36.709  1.00 105.29 ? 356 ARG A C   1 
ATOM   2480 O O   . ARG A 1 321 ? -19.287 17.126 36.186  1.00 107.89 ? 356 ARG A O   1 
ATOM   2481 C CB  . ARG A 1 321 ? -16.345 17.145 36.288  1.00 106.88 ? 356 ARG A CB  1 
ATOM   2482 C CG  . ARG A 1 321 ? -14.924 17.361 35.802  1.00 109.85 ? 356 ARG A CG  1 
ATOM   2483 C CD  . ARG A 1 321 ? -14.242 16.031 35.529  1.00 115.17 ? 356 ARG A CD  1 
ATOM   2484 N NE  . ARG A 1 321 ? -12.822 16.192 35.223  1.00 122.82 ? 356 ARG A NE  1 
ATOM   2485 C CZ  . ARG A 1 321 ? -12.035 15.233 34.736  1.00 129.04 ? 356 ARG A CZ  1 
ATOM   2486 N NH1 . ARG A 1 321 ? -12.517 14.018 34.482  1.00 131.56 ? 356 ARG A NH1 1 
ATOM   2487 N NH2 . ARG A 1 321 ? -10.751 15.491 34.494  1.00 128.46 ? 356 ARG A NH2 1 
ATOM   2488 N N   . CYS A 1 322 ? -19.073 18.730 37.752  1.00 105.28 ? 357 CYS A N   1 
ATOM   2489 C CA  . CYS A 1 322 ? -20.387 18.486 38.345  1.00 108.88 ? 357 CYS A CA  1 
ATOM   2490 C C   . CYS A 1 322 ? -21.448 19.361 37.689  1.00 109.23 ? 357 CYS A C   1 
ATOM   2491 O O   . CYS A 1 322 ? -21.127 20.322 36.990  1.00 107.11 ? 357 CYS A O   1 
ATOM   2492 C CB  . CYS A 1 322 ? -20.354 18.766 39.846  1.00 109.28 ? 357 CYS A CB  1 
ATOM   2493 S SG  . CYS A 1 322 ? -19.975 20.484 40.264  1.00 112.63 ? 357 CYS A SG  1 
ATOM   2494 N N   . SER A 1 323 ? -22.713 19.029 37.937  1.00 107.49 ? 358 SER A N   1 
ATOM   2495 C CA  . SER A 1 323 ? -23.836 19.802 37.410  1.00 107.30 ? 358 SER A CA  1 
ATOM   2496 C C   . SER A 1 323 ? -23.910 21.196 38.040  1.00 107.43 ? 358 SER A C   1 
ATOM   2497 O O   . SER A 1 323 ? -23.219 21.483 39.021  1.00 101.81 ? 358 SER A O   1 
ATOM   2498 C CB  . SER A 1 323 ? -25.159 19.063 37.642  1.00 104.81 ? 358 SER A CB  1 
ATOM   2499 O OG  . SER A 1 323 ? -25.599 19.195 38.985  1.00 97.45  ? 358 SER A OG  1 
ATOM   2500 N N   . ALA A 1 324 ? -24.751 22.051 37.458  1.00 111.90 ? 359 ALA A N   1 
ATOM   2501 C CA  . ALA A 1 324 ? -25.002 23.398 37.983  1.00 110.40 ? 359 ALA A CA  1 
ATOM   2502 C C   . ALA A 1 324 ? -25.783 23.347 39.297  1.00 109.56 ? 359 ALA A C   1 
ATOM   2503 O O   . ALA A 1 324 ? -25.594 24.198 40.168  1.00 106.84 ? 359 ALA A O   1 
ATOM   2504 C CB  . ALA A 1 324 ? -25.752 24.236 36.958  1.00 112.42 ? 359 ALA A CB  1 
ATOM   2505 N N   . LYS A 1 325 ? -26.666 22.359 39.429  1.00 108.36 ? 360 LYS A N   1 
ATOM   2506 C CA  . LYS A 1 325 ? -27.351 22.099 40.693  1.00 110.11 ? 360 LYS A CA  1 
ATOM   2507 C C   . LYS A 1 325 ? -26.340 21.771 41.792  1.00 112.37 ? 360 LYS A C   1 
ATOM   2508 O O   . LYS A 1 325 ? -26.428 22.300 42.898  1.00 115.80 ? 360 LYS A O   1 
ATOM   2509 C CB  . LYS A 1 325 ? -28.348 20.947 40.537  1.00 111.60 ? 360 LYS A CB  1 
ATOM   2510 C CG  . LYS A 1 325 ? -29.161 20.663 41.788  1.00 118.31 ? 360 LYS A CG  1 
ATOM   2511 C CD  . LYS A 1 325 ? -30.142 19.520 41.588  1.00 123.93 ? 360 LYS A CD  1 
ATOM   2512 C CE  . LYS A 1 325 ? -30.945 19.273 42.857  1.00 128.31 ? 360 LYS A CE  1 
ATOM   2513 N NZ  . LYS A 1 325 ? -31.836 18.086 42.742  1.00 132.24 ? 360 LYS A NZ  1 
ATOM   2514 N N   . ASP A 1 326 ? -25.382 20.902 41.477  1.00 114.28 ? 361 ASP A N   1 
ATOM   2515 C CA  . ASP A 1 326 ? -24.334 20.527 42.425  1.00 114.96 ? 361 ASP A CA  1 
ATOM   2516 C C   . ASP A 1 326 ? -23.468 21.732 42.782  1.00 116.13 ? 361 ASP A C   1 
ATOM   2517 O O   . ASP A 1 326 ? -23.151 21.938 43.947  1.00 113.94 ? 361 ASP A O   1 
ATOM   2518 C CB  . ASP A 1 326 ? -23.459 19.395 41.867  1.00 116.54 ? 361 ASP A CB  1 
ATOM   2519 C CG  . ASP A 1 326 ? -24.226 18.083 41.680  1.00 120.16 ? 361 ASP A CG  1 
ATOM   2520 O OD1 . ASP A 1 326 ? -25.314 17.914 42.280  1.00 119.73 ? 361 ASP A OD1 1 
ATOM   2521 O OD2 . ASP A 1 326 ? -23.734 17.216 40.924  1.00 119.49 ? 361 ASP A OD2 1 
ATOM   2522 N N   . LEU A 1 327 ? -23.093 22.529 41.784  1.00 122.93 ? 362 LEU A N   1 
ATOM   2523 C CA  . LEU A 1 327 ? -22.339 23.763 42.037  1.00 128.56 ? 362 LEU A CA  1 
ATOM   2524 C C   . LEU A 1 327 ? -23.080 24.698 42.993  1.00 134.38 ? 362 LEU A C   1 
ATOM   2525 O O   . LEU A 1 327 ? -22.463 25.331 43.850  1.00 141.16 ? 362 LEU A O   1 
ATOM   2526 C CB  . LEU A 1 327 ? -22.023 24.509 40.732  1.00 128.45 ? 362 LEU A CB  1 
ATOM   2527 C CG  . LEU A 1 327 ? -20.683 24.207 40.056  1.00 130.41 ? 362 LEU A CG  1 
ATOM   2528 C CD1 . LEU A 1 327 ? -20.534 25.049 38.798  1.00 129.96 ? 362 LEU A CD1 1 
ATOM   2529 C CD2 . LEU A 1 327 ? -19.513 24.455 41.000  1.00 133.25 ? 362 LEU A CD2 1 
ATOM   2530 N N   . VAL A 1 328 ? -24.398 24.785 42.839  1.00 140.07 ? 363 VAL A N   1 
ATOM   2531 C CA  . VAL A 1 328 ? -25.221 25.611 43.719  1.00 145.86 ? 363 VAL A CA  1 
ATOM   2532 C C   . VAL A 1 328 ? -25.274 24.992 45.113  1.00 145.29 ? 363 VAL A C   1 
ATOM   2533 O O   . VAL A 1 328 ? -24.901 25.638 46.093  1.00 145.60 ? 363 VAL A O   1 
ATOM   2534 C CB  . VAL A 1 328 ? -26.653 25.801 43.157  1.00 148.68 ? 363 VAL A CB  1 
ATOM   2535 C CG1 . VAL A 1 328 ? -27.584 26.415 44.199  1.00 145.51 ? 363 VAL A CG1 1 
ATOM   2536 C CG2 . VAL A 1 328 ? -26.620 26.666 41.902  1.00 149.48 ? 363 VAL A CG2 1 
ATOM   2537 N N   . GLU A 1 329 ? -25.718 23.738 45.189  1.00 144.78 ? 364 GLU A N   1 
ATOM   2538 C CA  . GLU A 1 329 ? -25.912 23.051 46.475  1.00 145.48 ? 364 GLU A CA  1 
ATOM   2539 C C   . GLU A 1 329 ? -24.625 22.885 47.298  1.00 145.06 ? 364 GLU A C   1 
ATOM   2540 O O   . GLU A 1 329 ? -24.690 22.737 48.517  1.00 149.12 ? 364 GLU A O   1 
ATOM   2541 C CB  . GLU A 1 329 ? -26.593 21.692 46.267  1.00 145.74 ? 364 GLU A CB  1 
ATOM   2542 C CG  . GLU A 1 329 ? -28.062 21.803 45.873  1.00 147.64 ? 364 GLU A CG  1 
ATOM   2543 C CD  . GLU A 1 329 ? -28.778 20.463 45.844  1.00 148.64 ? 364 GLU A CD  1 
ATOM   2544 O OE1 . GLU A 1 329 ? -28.121 19.433 45.579  1.00 153.03 ? 364 GLU A OE1 1 
ATOM   2545 O OE2 . GLU A 1 329 ? -30.006 20.442 46.079  1.00 144.03 ? 364 GLU A OE2 1 
ATOM   2546 N N   . ASN A 1 330 ? -23.470 22.911 46.637  1.00 144.87 ? 365 ASN A N   1 
ATOM   2547 C CA  . ASN A 1 330 ? -22.183 22.943 47.335  1.00 145.39 ? 365 ASN A CA  1 
ATOM   2548 C C   . ASN A 1 330 ? -21.974 24.251 48.104  1.00 155.47 ? 365 ASN A C   1 
ATOM   2549 O O   . ASN A 1 330 ? -21.501 24.233 49.241  1.00 167.36 ? 365 ASN A O   1 
ATOM   2550 C CB  . ASN A 1 330 ? -21.015 22.742 46.354  1.00 139.95 ? 365 ASN A CB  1 
ATOM   2551 C CG  . ASN A 1 330 ? -20.819 21.287 45.944  1.00 130.35 ? 365 ASN A CG  1 
ATOM   2552 O OD1 . ASN A 1 330 ? -21.674 20.425 46.180  1.00 118.72 ? 365 ASN A OD1 1 
ATOM   2553 N ND2 . ASN A 1 330 ? -19.683 21.011 45.314  1.00 121.42 ? 365 ASN A ND2 1 
ATOM   2554 N N   . LYS A 1 331 ? -22.323 25.377 47.484  1.00 162.57 ? 366 LYS A N   1 
ATOM   2555 C CA  . LYS A 1 331 ? -22.112 26.699 48.092  1.00 166.36 ? 366 LYS A CA  1 
ATOM   2556 C C   . LYS A 1 331 ? -22.983 26.960 49.324  1.00 169.29 ? 366 LYS A C   1 
ATOM   2557 O O   . LYS A 1 331 ? -22.533 27.611 50.267  1.00 164.64 ? 366 LYS A O   1 
ATOM   2558 C CB  . LYS A 1 331 ? -22.330 27.813 47.063  1.00 167.11 ? 366 LYS A CB  1 
ATOM   2559 C CG  . LYS A 1 331 ? -21.241 27.896 46.009  1.00 168.23 ? 366 LYS A CG  1 
ATOM   2560 C CD  . LYS A 1 331 ? -21.444 29.096 45.099  1.00 168.18 ? 366 LYS A CD  1 
ATOM   2561 C CE  . LYS A 1 331 ? -20.317 29.219 44.088  1.00 168.07 ? 366 LYS A CE  1 
ATOM   2562 N NZ  . LYS A 1 331 ? -20.468 30.429 43.235  1.00 167.79 ? 366 LYS A NZ  1 
ATOM   2563 N N   . PHE A 1 332 ? -24.222 26.468 49.312  1.00 178.08 ? 367 PHE A N   1 
ATOM   2564 C CA  . PHE A 1 332 ? -25.115 26.600 50.472  1.00 186.08 ? 367 PHE A CA  1 
ATOM   2565 C C   . PHE A 1 332 ? -24.654 25.726 51.641  1.00 188.32 ? 367 PHE A C   1 
ATOM   2566 O O   . PHE A 1 332 ? -24.879 26.073 52.802  1.00 197.64 ? 367 PHE A O   1 
ATOM   2567 C CB  . PHE A 1 332 ? -26.572 26.261 50.111  1.00 188.32 ? 367 PHE A CB  1 
ATOM   2568 C CG  . PHE A 1 332 ? -27.239 27.277 49.212  1.00 192.07 ? 367 PHE A CG  1 
ATOM   2569 C CD1 . PHE A 1 332 ? -27.220 28.634 49.525  1.00 190.29 ? 367 PHE A CD1 1 
ATOM   2570 C CD2 . PHE A 1 332 ? -27.914 26.871 48.064  1.00 191.49 ? 367 PHE A CD2 1 
ATOM   2571 C CE1 . PHE A 1 332 ? -27.838 29.562 48.702  1.00 188.46 ? 367 PHE A CE1 1 
ATOM   2572 C CE2 . PHE A 1 332 ? -28.535 27.796 47.239  1.00 187.68 ? 367 PHE A CE2 1 
ATOM   2573 C CZ  . PHE A 1 332 ? -28.497 29.142 47.558  1.00 187.62 ? 367 PHE A CZ  1 
ATOM   2574 N N   . LEU A 1 333 ? -24.013 24.598 51.334  1.00 183.51 ? 368 LEU A N   1 
ATOM   2575 C CA  . LEU A 1 333 ? -23.442 23.729 52.365  1.00 176.06 ? 368 LEU A CA  1 
ATOM   2576 C C   . LEU A 1 333 ? -22.118 24.312 52.869  1.00 172.28 ? 368 LEU A C   1 
ATOM   2577 O O   . LEU A 1 333 ? -21.880 24.362 54.077  1.00 169.90 ? 368 LEU A O   1 
ATOM   2578 C CB  . LEU A 1 333 ? -23.248 22.305 51.833  1.00 171.54 ? 368 LEU A CB  1 
ATOM   2579 C CG  . LEU A 1 333 ? -23.327 21.189 52.881  1.00 169.61 ? 368 LEU A CG  1 
ATOM   2580 C CD1 . LEU A 1 333 ? -23.628 19.850 52.220  1.00 167.01 ? 368 LEU A CD1 1 
ATOM   2581 C CD2 . LEU A 1 333 ? -22.055 21.112 53.716  1.00 170.72 ? 368 LEU A CD2 1 
ATOM   2582 N N   . LEU A 1 334 ? -21.268 24.760 51.945  1.00 169.13 ? 369 LEU A N   1 
ATOM   2583 C CA  . LEU A 1 334 ? -20.044 25.486 52.297  1.00 168.86 ? 369 LEU A CA  1 
ATOM   2584 C C   . LEU A 1 334 ? -20.391 26.922 52.717  1.00 175.89 ? 369 LEU A C   1 
ATOM   2585 O O   . LEU A 1 334 ? -20.073 27.894 52.022  1.00 173.95 ? 369 LEU A O   1 
ATOM   2586 C CB  . LEU A 1 334 ? -19.053 25.484 51.125  1.00 163.58 ? 369 LEU A CB  1 
ATOM   2587 C CG  . LEU A 1 334 ? -17.646 26.017 51.422  1.00 158.35 ? 369 LEU A CG  1 
ATOM   2588 C CD1 . LEU A 1 334 ? -16.884 25.046 52.313  1.00 155.67 ? 369 LEU A CD1 1 
ATOM   2589 C CD2 . LEU A 1 334 ? -16.882 26.287 50.133  1.00 154.41 ? 369 LEU A CD2 1 
ATOM   2590 N N   . SER A 1 335 ? -21.038 27.029 53.876  1.00 178.21 ? 370 SER A N   1 
ATOM   2591 C CA  . SER A 1 335 ? -21.540 28.296 54.418  1.00 174.45 ? 370 SER A CA  1 
ATOM   2592 C C   . SER A 1 335 ? -22.172 28.020 55.785  1.00 173.37 ? 370 SER A C   1 
ATOM   2593 O O   . SER A 1 335 ? -21.849 28.685 56.770  1.00 170.01 ? 370 SER A O   1 
ATOM   2594 C CB  . SER A 1 335 ? -22.568 28.946 53.481  1.00 171.16 ? 370 SER A CB  1 
ATOM   2595 O OG  . SER A 1 335 ? -22.686 30.333 53.746  1.00 167.51 ? 370 SER A OG  1 
ATOM   2596 N N   . ASN A 1 336 ? -23.071 27.035 55.825  1.00 173.24 ? 371 ASN A N   1 
ATOM   2597 C CA  . ASN A 1 336 ? -23.641 26.528 57.078  1.00 175.07 ? 371 ASN A CA  1 
ATOM   2598 C C   . ASN A 1 336 ? -22.576 25.938 58.003  1.00 180.28 ? 371 ASN A C   1 
ATOM   2599 O O   . ASN A 1 336 ? -22.558 26.226 59.204  1.00 180.45 ? 371 ASN A O   1 
ATOM   2600 C CB  . ASN A 1 336 ? -24.700 25.455 56.795  1.00 170.42 ? 371 ASN A CB  1 
ATOM   2601 C CG  . ASN A 1 336 ? -25.954 26.016 56.150  1.00 168.69 ? 371 ASN A CG  1 
ATOM   2602 O OD1 . ASN A 1 336 ? -26.077 27.223 55.941  1.00 169.32 ? 371 ASN A OD1 1 
ATOM   2603 N ND2 . ASN A 1 336 ? -26.898 25.136 55.832  1.00 164.61 ? 371 ASN A ND2 1 
ATOM   2604 N N   . SER A 1 337 ? -21.704 25.104 57.434  1.00 181.15 ? 372 SER A N   1 
ATOM   2605 C CA  . SER A 1 337 ? -20.608 24.476 58.176  1.00 174.99 ? 372 SER A CA  1 
ATOM   2606 C C   . SER A 1 337 ? -19.377 24.309 57.289  1.00 168.75 ? 372 SER A C   1 
ATOM   2607 O O   . SER A 1 337 ? -18.412 25.066 57.401  1.00 159.87 ? 372 SER A O   1 
ATOM   2608 C CB  . SER A 1 337 ? -21.044 23.113 58.727  1.00 172.28 ? 372 SER A CB  1 
ATOM   2609 O OG  . SER A 1 337 ? -21.367 22.209 57.684  1.00 167.40 ? 372 SER A OG  1 
HETATM 2610 K K   . K   B 2 .   ? -41.494 41.494 -53.675 0.25 102.42 ? 401 K   A K   1 
HETATM 2611 K K   . K   C 2 .   ? -41.494 41.494 -46.988 0.25 164.92 ? 402 K   A K   1 
HETATM 2612 K K   . K   D 2 .   ? -41.494 41.494 -43.722 0.25 97.12  ? 403 K   A K   1 
HETATM 2613 K K   . K   E 2 .   ? -41.494 41.494 -40.480 0.25 161.97 ? 404 K   A K   1 
HETATM 2614 K K   . K   F 2 .   ? -41.494 41.494 -37.757 0.25 77.08  ? 405 K   A K   1 
HETATM 2615 K K   . K   G 2 .   ? -41.494 41.494 -34.364 0.25 82.00  ? 406 K   A K   1 
HETATM 2616 O O   . HOH H 3 .   ? -19.572 36.513 11.138  1.00 90.94  ? 501 HOH A O   1 
HETATM 2617 O O   . HOH H 3 .   ? -58.006 36.943 -46.019 1.00 77.86  ? 502 HOH A O   1 
HETATM 2618 O O   . HOH H 3 .   ? -45.033 35.932 -42.807 1.00 71.86  ? 503 HOH A O   1 
HETATM 2619 O O   . HOH H 3 .   ? -43.535 34.620 -45.224 1.00 89.16  ? 504 HOH A O   1 
HETATM 2620 O O   . HOH H 3 .   ? -29.478 32.471 29.563  1.00 84.06  ? 505 HOH A O   1 
HETATM 2621 O O   . HOH H 3 .   ? -34.450 32.924 16.361  1.00 76.75  ? 506 HOH A O   1 
HETATM 2622 O O   . HOH H 3 .   ? -34.856 35.489 29.215  1.00 78.96  ? 507 HOH A O   1 
HETATM 2623 O O   . HOH H 3 .   ? -29.179 29.909 18.448  1.00 85.07  ? 508 HOH A O   1 
HETATM 2624 O O   . HOH H 3 .   ? -34.525 33.089 25.664  1.00 76.65  ? 509 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   36  ?   ?   ?   A . n 
A 1 2   ALA 2   37  ?   ?   ?   A . n 
A 1 3   ARG 3   38  ?   ?   ?   A . n 
A 1 4   ARG 4   39  ?   ?   ?   A . n 
A 1 5   LYS 5   40  ?   ?   ?   A . n 
A 1 6   CYS 6   41  41  CYS CYS A . n 
A 1 7   ARG 7   42  42  ARG ARG A . n 
A 1 8   ASN 8   43  43  ASN ASN A . n 
A 1 9   ARG 9   44  44  ARG ARG A . n 
A 1 10  PHE 10  45  45  PHE PHE A . n 
A 1 11  VAL 11  46  46  VAL VAL A . n 
A 1 12  LYS 12  47  47  LYS LYS A . n 
A 1 13  LYS 13  48  48  LYS LYS A . n 
A 1 14  ASN 14  49  49  ASN ASN A . n 
A 1 15  GLY 15  50  50  GLY GLY A . n 
A 1 16  GLN 16  51  51  GLN GLN A . n 
A 1 17  CYS 17  52  52  CYS CYS A . n 
A 1 18  ASN 18  53  53  ASN ASN A . n 
A 1 19  VAL 19  54  54  VAL VAL A . n 
A 1 20  GLU 20  55  55  GLU GLU A . n 
A 1 21  PHE 21  56  56  PHE PHE A . n 
A 1 22  THR 22  57  57  THR THR A . n 
A 1 23  ASN 23  58  58  ASN ASN A . n 
A 1 24  MET 24  59  59  MET MET A . n 
A 1 25  ASP 25  60  60  ASP ASP A . n 
A 1 26  ASP 26  61  61  ASP ASP A . n 
A 1 27  LYS 27  62  62  LYS LYS A . n 
A 1 28  PRO 28  63  63  PRO PRO A . n 
A 1 29  GLN 29  64  ?   ?   ?   A . n 
A 1 30  ARG 30  65  ?   ?   ?   A . n 
A 1 31  TYR 31  66  ?   ?   ?   A . n 
A 1 32  ILE 32  67  ?   ?   ?   A . n 
A 1 33  ALA 33  68  ?   ?   ?   A . n 
A 1 34  ASP 34  69  69  ASP ASP A . n 
A 1 35  MET 35  70  70  MET MET A . n 
A 1 36  PHE 36  71  71  PHE PHE A . n 
A 1 37  THR 37  72  72  THR THR A . n 
A 1 38  THR 38  73  73  THR THR A . n 
A 1 39  CYS 39  74  74  CYS CYS A . n 
A 1 40  VAL 40  75  75  VAL VAL A . n 
A 1 41  ASP 41  76  76  ASP ASP A . n 
A 1 42  ILE 42  77  77  ILE ILE A . n 
A 1 43  ARG 43  78  78  ARG ARG A . n 
A 1 44  TRP 44  79  79  TRP TRP A . n 
A 1 45  ARG 45  80  80  ARG ARG A . n 
A 1 46  TYR 46  81  81  TYR TYR A . n 
A 1 47  MET 47  82  82  MET MET A . n 
A 1 48  LEU 48  83  83  LEU LEU A . n 
A 1 49  LEU 49  84  84  LEU LEU A . n 
A 1 50  LEU 50  85  85  LEU LEU A . n 
A 1 51  PHE 51  86  86  PHE PHE A . n 
A 1 52  SER 52  87  87  SER SER A . n 
A 1 53  LEU 53  88  88  LEU LEU A . n 
A 1 54  ALA 54  89  89  ALA ALA A . n 
A 1 55  PHE 55  90  90  PHE PHE A . n 
A 1 56  LEU 56  91  91  LEU LEU A . n 
A 1 57  VAL 57  92  92  VAL VAL A . n 
A 1 58  SER 58  93  93  SER SER A . n 
A 1 59  TRP 59  94  94  TRP TRP A . n 
A 1 60  LEU 60  95  95  LEU LEU A . n 
A 1 61  LEU 61  96  96  LEU LEU A . n 
A 1 62  PHE 62  97  97  PHE PHE A . n 
A 1 63  GLY 63  98  98  GLY GLY A . n 
A 1 64  LEU 64  99  99  LEU LEU A . n 
A 1 65  ILE 65  100 100 ILE ILE A . n 
A 1 66  PHE 66  101 101 PHE PHE A . n 
A 1 67  TRP 67  102 102 TRP TRP A . n 
A 1 68  LEU 68  103 103 LEU LEU A . n 
A 1 69  ILE 69  104 104 ILE ILE A . n 
A 1 70  ALA 70  105 105 ALA ALA A . n 
A 1 71  LEU 71  106 106 LEU LEU A . n 
A 1 72  ILE 72  107 107 ILE ILE A . n 
A 1 73  HIS 73  108 108 HIS HIS A . n 
A 1 74  GLY 74  109 109 GLY GLY A . n 
A 1 75  ASP 75  110 110 ASP ASP A . n 
A 1 76  LEU 76  111 111 LEU LEU A . n 
A 1 77  GLU 77  112 112 GLU GLU A . n 
A 1 78  ASN 78  113 113 ASN ASN A . n 
A 1 79  PRO 79  114 114 PRO PRO A . n 
A 1 80  GLY 80  115 115 GLY GLY A . n 
A 1 81  GLY 81  116 116 GLY GLY A . n 
A 1 82  ASP 82  117 117 ASP ASP A . n 
A 1 83  ASP 83  118 118 ASP ASP A . n 
A 1 84  THR 84  119 119 THR THR A . n 
A 1 85  PHE 85  120 120 PHE PHE A . n 
A 1 86  LYS 86  121 121 LYS LYS A . n 
A 1 87  PRO 87  122 122 PRO PRO A . n 
A 1 88  CYS 88  123 123 CYS CYS A . n 
A 1 89  VAL 89  124 124 VAL VAL A . n 
A 1 90  LEU 90  125 125 LEU LEU A . n 
A 1 91  GLN 91  126 126 GLN GLN A . n 
A 1 92  VAL 92  127 127 VAL VAL A . n 
A 1 93  ASN 93  128 128 ASN ASN A . n 
A 1 94  GLY 94  129 129 GLY GLY A . n 
A 1 95  PHE 95  130 130 PHE PHE A . n 
A 1 96  VAL 96  131 131 VAL VAL A . n 
A 1 97  ALA 97  132 132 ALA ALA A . n 
A 1 98  ALA 98  133 133 ALA ALA A . n 
A 1 99  PHE 99  134 134 PHE PHE A . n 
A 1 100 LEU 100 135 135 LEU LEU A . n 
A 1 101 PHE 101 136 136 PHE PHE A . n 
A 1 102 SER 102 137 137 SER SER A . n 
A 1 103 ILE 103 138 138 ILE ILE A . n 
A 1 104 GLU 104 139 139 GLU GLU A . n 
A 1 105 THR 105 140 140 THR THR A . n 
A 1 106 GLN 106 141 141 GLN GLN A . n 
A 1 107 THR 107 142 142 THR THR A . n 
A 1 108 THR 108 143 143 THR THR A . n 
A 1 109 ILE 109 144 144 ILE ILE A . n 
A 1 110 GLY 110 145 145 GLY GLY A . n 
A 1 111 TYR 111 146 146 TYR TYR A . n 
A 1 112 GLY 112 147 147 GLY GLY A . n 
A 1 113 PHE 113 148 148 PHE PHE A . n 
A 1 114 ARG 114 149 149 ARG ARG A . n 
A 1 115 CYS 115 150 150 CYS CYS A . n 
A 1 116 VAL 116 151 151 VAL VAL A . n 
A 1 117 THR 117 152 152 THR THR A . n 
A 1 118 GLU 118 153 153 GLU GLU A . n 
A 1 119 GLU 119 154 154 GLU GLU A . n 
A 1 120 CYS 120 155 155 CYS CYS A . n 
A 1 121 PRO 121 156 156 PRO PRO A . n 
A 1 122 LEU 122 157 157 LEU LEU A . n 
A 1 123 ALA 123 158 158 ALA ALA A . n 
A 1 124 VAL 124 159 159 VAL VAL A . n 
A 1 125 PHE 125 160 160 PHE PHE A . n 
A 1 126 MET 126 161 161 MET MET A . n 
A 1 127 VAL 127 162 162 VAL VAL A . n 
A 1 128 VAL 128 163 163 VAL VAL A . n 
A 1 129 VAL 129 164 164 VAL VAL A . n 
A 1 130 GLN 130 165 165 GLN GLN A . n 
A 1 131 SER 131 166 166 SER SER A . n 
A 1 132 ILE 132 167 167 ILE ILE A . n 
A 1 133 VAL 133 168 168 VAL VAL A . n 
A 1 134 GLY 134 169 169 GLY GLY A . n 
A 1 135 CYS 135 170 170 CYS CYS A . n 
A 1 136 ILE 136 171 171 ILE ILE A . n 
A 1 137 ILE 137 172 172 ILE ILE A . n 
A 1 138 ASP 138 173 173 ASP ASP A . n 
A 1 139 SER 139 174 174 SER SER A . n 
A 1 140 PHE 140 175 175 PHE PHE A . n 
A 1 141 MET 141 176 176 MET MET A . n 
A 1 142 ILE 142 177 177 ILE ILE A . n 
A 1 143 GLY 143 178 178 GLY GLY A . n 
A 1 144 ALA 144 179 179 ALA ALA A . n 
A 1 145 ILE 145 180 180 ILE ILE A . n 
A 1 146 MET 146 181 181 MET MET A . n 
A 1 147 ALA 147 182 182 ALA ALA A . n 
A 1 148 LYS 148 183 183 LYS LYS A . n 
A 1 149 MET 149 184 184 MET MET A . n 
A 1 150 ALA 150 185 185 ALA ALA A . n 
A 1 151 ARG 151 186 186 ARG ARG A . n 
A 1 152 PRO 152 187 187 PRO PRO A . n 
A 1 153 LYS 153 188 188 LYS LYS A . n 
A 1 154 LYS 154 189 189 LYS LYS A . n 
A 1 155 ARG 155 190 190 ARG ARG A . n 
A 1 156 ALA 156 191 191 ALA ALA A . n 
A 1 157 GLN 157 192 192 GLN GLN A . n 
A 1 158 THR 158 193 193 THR THR A . n 
A 1 159 LEU 159 194 194 LEU LEU A . n 
A 1 160 LEU 160 195 195 LEU LEU A . n 
A 1 161 PHE 161 196 196 PHE PHE A . n 
A 1 162 SER 162 197 197 SER SER A . n 
A 1 163 HIS 163 198 198 HIS HIS A . n 
A 1 164 ASN 164 199 199 ASN ASN A . n 
A 1 165 ALA 165 200 200 ALA ALA A . n 
A 1 166 VAL 166 201 201 VAL VAL A . n 
A 1 167 VAL 167 202 202 VAL VAL A . n 
A 1 168 ALA 168 203 203 ALA ALA A . n 
A 1 169 MET 169 204 204 MET MET A . n 
A 1 170 ARG 170 205 205 ARG ARG A . n 
A 1 171 ASP 171 206 206 ASP ASP A . n 
A 1 172 GLY 172 207 207 GLY GLY A . n 
A 1 173 LYS 173 208 208 LYS LYS A . n 
A 1 174 LEU 174 209 209 LEU LEU A . n 
A 1 175 CYS 175 210 210 CYS CYS A . n 
A 1 176 LEU 176 211 211 LEU LEU A . n 
A 1 177 MET 177 212 212 MET MET A . n 
A 1 178 TRP 178 213 213 TRP TRP A . n 
A 1 179 ARG 179 214 214 ARG ARG A . n 
A 1 180 VAL 180 215 215 VAL VAL A . n 
A 1 181 GLY 181 216 216 GLY GLY A . n 
A 1 182 ASN 182 217 217 ASN ASN A . n 
A 1 183 LEU 183 218 218 LEU LEU A . n 
A 1 184 ARG 184 219 219 ARG ARG A . n 
A 1 185 LYS 185 220 220 LYS LYS A . n 
A 1 186 SER 186 221 221 SER SER A . n 
A 1 187 HIS 187 222 222 HIS HIS A . n 
A 1 188 ILE 188 223 223 ILE ILE A . n 
A 1 189 VAL 189 224 224 VAL VAL A . n 
A 1 190 GLU 190 225 225 GLU GLU A . n 
A 1 191 ALA 191 226 226 ALA ALA A . n 
A 1 192 HIS 192 227 227 HIS HIS A . n 
A 1 193 VAL 193 228 228 VAL VAL A . n 
A 1 194 ARG 194 229 229 ARG ARG A . n 
A 1 195 ALA 195 230 230 ALA ALA A . n 
A 1 196 GLN 196 231 231 GLN GLN A . n 
A 1 197 LEU 197 232 232 LEU LEU A . n 
A 1 198 ILE 198 233 233 ILE ILE A . n 
A 1 199 LYS 199 234 234 LYS LYS A . n 
A 1 200 PRO 200 235 235 PRO PRO A . n 
A 1 201 ARG 201 236 236 ARG ARG A . n 
A 1 202 ILE 202 237 237 ILE ILE A . n 
A 1 203 THR 203 238 238 THR THR A . n 
A 1 204 GLU 204 239 239 GLU GLU A . n 
A 1 205 GLU 205 240 240 GLU GLU A . n 
A 1 206 GLY 206 241 241 GLY GLY A . n 
A 1 207 GLU 207 242 242 GLU GLU A . n 
A 1 208 TYR 208 243 243 TYR TYR A . n 
A 1 209 ILE 209 244 244 ILE ILE A . n 
A 1 210 PRO 210 245 245 PRO PRO A . n 
A 1 211 LEU 211 246 246 LEU LEU A . n 
A 1 212 ASP 212 247 247 ASP ASP A . n 
A 1 213 GLN 213 248 248 GLN GLN A . n 
A 1 214 ILE 214 249 249 ILE ILE A . n 
A 1 215 ASP 215 250 250 ASP ASP A . n 
A 1 216 ILE 216 251 251 ILE ILE A . n 
A 1 217 ASP 217 252 252 ASP ASP A . n 
A 1 218 VAL 218 253 253 VAL VAL A . n 
A 1 219 GLY 219 254 254 GLY GLY A . n 
A 1 220 PHE 220 255 255 PHE PHE A . n 
A 1 221 ASP 221 256 256 ASP ASP A . n 
A 1 222 LYS 222 257 257 LYS LYS A . n 
A 1 223 GLY 223 258 258 GLY GLY A . n 
A 1 224 LEU 224 259 259 LEU LEU A . n 
A 1 225 ASP 225 260 260 ASP ASP A . n 
A 1 226 ARG 226 261 261 ARG ARG A . n 
A 1 227 ILE 227 262 262 ILE ILE A . n 
A 1 228 PHE 228 263 263 PHE PHE A . n 
A 1 229 LEU 229 264 264 LEU LEU A . n 
A 1 230 VAL 230 265 265 VAL VAL A . n 
A 1 231 SER 231 266 266 SER SER A . n 
A 1 232 PRO 232 267 267 PRO PRO A . n 
A 1 233 ILE 233 268 268 ILE ILE A . n 
A 1 234 THR 234 269 269 THR THR A . n 
A 1 235 ILE 235 270 270 ILE ILE A . n 
A 1 236 LEU 236 271 271 LEU LEU A . n 
A 1 237 HIS 237 272 272 HIS HIS A . n 
A 1 238 GLU 238 273 273 GLU GLU A . n 
A 1 239 ILE 239 274 274 ILE ILE A . n 
A 1 240 ASN 240 275 275 ASN ASN A . n 
A 1 241 GLU 241 276 276 GLU GLU A . n 
A 1 242 ASP 242 277 277 ASP ASP A . n 
A 1 243 SER 243 278 278 SER SER A . n 
A 1 244 PRO 244 279 279 PRO PRO A . n 
A 1 245 LEU 245 280 280 LEU LEU A . n 
A 1 246 PHE 246 281 281 PHE PHE A . n 
A 1 247 GLY 247 282 282 GLY GLY A . n 
A 1 248 ILE 248 283 283 ILE ILE A . n 
A 1 249 SER 249 284 284 SER SER A . n 
A 1 250 ARG 250 285 285 ARG ARG A . n 
A 1 251 GLN 251 286 286 GLN GLN A . n 
A 1 252 ASP 252 287 287 ASP ASP A . n 
A 1 253 LEU 253 288 288 LEU LEU A . n 
A 1 254 GLU 254 289 289 GLU GLU A . n 
A 1 255 THR 255 290 290 THR THR A . n 
A 1 256 ASP 256 291 291 ASP ASP A . n 
A 1 257 ASP 257 292 292 ASP ASP A . n 
A 1 258 PHE 258 293 293 PHE PHE A . n 
A 1 259 GLU 259 294 294 GLU GLU A . n 
A 1 260 ILE 260 295 295 ILE ILE A . n 
A 1 261 VAL 261 296 296 VAL VAL A . n 
A 1 262 VAL 262 297 297 VAL VAL A . n 
A 1 263 ILE 263 298 298 ILE ILE A . n 
A 1 264 LEU 264 299 299 LEU LEU A . n 
A 1 265 GLU 265 300 300 GLU GLU A . n 
A 1 266 GLY 266 301 301 GLY GLY A . n 
A 1 267 MET 267 302 302 MET MET A . n 
A 1 268 VAL 268 303 303 VAL VAL A . n 
A 1 269 GLU 269 304 304 GLU GLU A . n 
A 1 270 ALA 270 305 305 ALA ALA A . n 
A 1 271 THR 271 306 306 THR THR A . n 
A 1 272 ALA 272 307 307 ALA ALA A . n 
A 1 273 MET 273 308 308 MET MET A . n 
A 1 274 THR 274 309 309 THR THR A . n 
A 1 275 THR 275 310 310 THR THR A . n 
A 1 276 GLN 276 311 311 GLN GLN A . n 
A 1 277 ALA 277 312 312 ALA ALA A . n 
A 1 278 ARG 278 313 313 ARG ARG A . n 
A 1 279 SER 279 314 314 SER SER A . n 
A 1 280 SER 280 315 315 SER SER A . n 
A 1 281 TYR 281 316 316 TYR TYR A . n 
A 1 282 LEU 282 317 317 LEU LEU A . n 
A 1 283 ALA 283 318 318 ALA ALA A . n 
A 1 284 SER 284 319 319 SER SER A . n 
A 1 285 GLU 285 320 320 GLU GLU A . n 
A 1 286 ILE 286 321 321 ILE ILE A . n 
A 1 287 LEU 287 322 322 LEU LEU A . n 
A 1 288 TRP 288 323 323 TRP TRP A . n 
A 1 289 GLY 289 324 324 GLY GLY A . n 
A 1 290 HIS 290 325 325 HIS HIS A . n 
A 1 291 ARG 291 326 326 ARG ARG A . n 
A 1 292 PHE 292 327 327 PHE PHE A . n 
A 1 293 GLU 293 328 328 GLU GLU A . n 
A 1 294 PRO 294 329 329 PRO PRO A . n 
A 1 295 VAL 295 330 330 VAL VAL A . n 
A 1 296 LEU 296 331 331 LEU LEU A . n 
A 1 297 PHE 297 332 332 PHE PHE A . n 
A 1 298 GLU 298 333 333 GLU GLU A . n 
A 1 299 GLU 299 334 334 GLU GLU A . n 
A 1 300 LYS 300 335 335 LYS LYS A . n 
A 1 301 ASN 301 336 336 ASN ASN A . n 
A 1 302 GLN 302 337 337 GLN GLN A . n 
A 1 303 TYR 303 338 338 TYR TYR A . n 
A 1 304 LYS 304 339 339 LYS LYS A . n 
A 1 305 VAL 305 340 340 VAL VAL A . n 
A 1 306 ASP 306 341 341 ASP ASP A . n 
A 1 307 TYR 307 342 342 TYR TYR A . n 
A 1 308 SER 308 343 343 SER SER A . n 
A 1 309 HIS 309 344 344 HIS HIS A . n 
A 1 310 PHE 310 345 345 PHE PHE A . n 
A 1 311 HIS 311 346 346 HIS HIS A . n 
A 1 312 LYS 312 347 347 LYS LYS A . n 
A 1 313 THR 313 348 348 THR THR A . n 
A 1 314 TYR 314 349 349 TYR TYR A . n 
A 1 315 GLU 315 350 350 GLU GLU A . n 
A 1 316 VAL 316 351 351 VAL VAL A . n 
A 1 317 PRO 317 352 352 PRO PRO A . n 
A 1 318 SER 318 353 353 SER SER A . n 
A 1 319 THR 319 354 354 THR THR A . n 
A 1 320 PRO 320 355 355 PRO PRO A . n 
A 1 321 ARG 321 356 356 ARG ARG A . n 
A 1 322 CYS 322 357 357 CYS CYS A . n 
A 1 323 SER 323 358 358 SER SER A . n 
A 1 324 ALA 324 359 359 ALA ALA A . n 
A 1 325 LYS 325 360 360 LYS LYS A . n 
A 1 326 ASP 326 361 361 ASP ASP A . n 
A 1 327 LEU 327 362 362 LEU LEU A . n 
A 1 328 VAL 328 363 363 VAL VAL A . n 
A 1 329 GLU 329 364 364 GLU GLU A . n 
A 1 330 ASN 330 365 365 ASN ASN A . n 
A 1 331 LYS 331 366 366 LYS LYS A . n 
A 1 332 PHE 332 367 367 PHE PHE A . n 
A 1 333 LEU 333 368 368 LEU LEU A . n 
A 1 334 LEU 334 369 369 LEU LEU A . n 
A 1 335 SER 335 370 370 SER SER A . n 
A 1 336 ASN 336 371 371 ASN ASN A . n 
A 1 337 SER 337 372 372 SER SER A . n 
A 1 338 LEU 338 373 ?   ?   ?   A . n 
A 1 339 GLU 339 374 ?   ?   ?   A . n 
A 1 340 VAL 340 375 ?   ?   ?   A . n 
A 1 341 LEU 341 376 ?   ?   ?   A . n 
A 1 342 PHE 342 377 ?   ?   ?   A . n 
A 1 343 GLN 343 378 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 K   1 401 401 K   K   A . 
C 2 K   1 402 402 K   K   A . 
D 2 K   1 403 403 K   K   A . 
E 2 K   1 404 404 K   K   A . 
F 2 K   1 405 405 K   K   A . 
G 2 K   1 406 406 K   K   A . 
H 3 HOH 1 501 505 HOH HOH A . 
H 3 HOH 2 502 502 HOH HOH A . 
H 3 HOH 3 503 501 HOH HOH A . 
H 3 HOH 4 504 510 HOH HOH A . 
H 3 HOH 5 505 506 HOH HOH A . 
H 3 HOH 6 506 503 HOH HOH A . 
H 3 HOH 7 507 507 HOH HOH A . 
H 3 HOH 8 508 504 HOH HOH A . 
H 3 HOH 9 509 508 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1,2,3,4 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 27680 ? 
1 MORE         -162  ? 
1 'SSA (A^2)'  56130 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
2 'crystal symmetry operation' 2_465 -x-1,-y+1,z -1.0000000000 0.0000000000  0.0000000000 -82.9890000000 0.0000000000  
-1.0000000000 0.0000000000 82.9890000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
3 'crystal symmetry operation' 3_565 -y,x+1,z    0.0000000000  -1.0000000000 0.0000000000 0.0000000000   1.0000000000  
0.0000000000  0.0000000000 82.9890000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 
4 'crystal symmetry operation' 4_455 y-1,-x,z    0.0000000000  1.0000000000  0.0000000000 -82.9890000000 -1.0000000000 
0.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000 0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A K 401 ? B K . 
2 1 A K 402 ? C K . 
3 1 A K 403 ? D K . 
4 1 A K 404 ? E K . 
5 1 A K 405 ? F K . 
6 1 A K 406 ? G K . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O   ? A THR 108 ? A THR 143 ? 1_555 K ? F K . ? A K 405 ? 1_555 O   ? A THR 108 ? A THR 143 ? 1_555 0.0  ? 
2  O   ? A THR 108 ? A THR 143 ? 1_555 K ? F K . ? A K 405 ? 1_555 O   ? A ILE 109 ? A ILE 144 ? 1_555 66.1 ? 
3  O   ? A THR 108 ? A THR 143 ? 1_555 K ? F K . ? A K 405 ? 1_555 O   ? A ILE 109 ? A ILE 144 ? 1_555 66.1 ? 
4  O   ? A THR 108 ? A THR 143 ? 1_555 K ? F K . ? A K 405 ? 1_555 O   ? A ILE 109 ? A ILE 144 ? 1_555 66.1 ? 
5  O   ? A THR 108 ? A THR 143 ? 1_555 K ? F K . ? A K 405 ? 1_555 O   ? A ILE 109 ? A ILE 144 ? 1_555 66.1 ? 
6  O   ? A ILE 109 ? A ILE 144 ? 1_555 K ? F K . ? A K 405 ? 1_555 O   ? A ILE 109 ? A ILE 144 ? 1_555 0.0  ? 
7  O   ? A THR 108 ? A THR 143 ? 1_555 K ? G K . ? A K 406 ? 1_555 OG1 ? A THR 108 ? A THR 143 ? 1_555 52.7 ? 
8  O   ? A THR 108 ? A THR 143 ? 1_555 K ? G K . ? A K 406 ? 1_555 O   ? A THR 108 ? A THR 143 ? 1_555 0.0  ? 
9  OG1 ? A THR 108 ? A THR 143 ? 1_555 K ? G K . ? A K 406 ? 1_555 O   ? A THR 108 ? A THR 143 ? 1_555 52.7 ? 
10 O   ? A THR 108 ? A THR 143 ? 1_555 K ? G K . ? A K 406 ? 1_555 OG1 ? A THR 108 ? A THR 143 ? 1_555 52.7 ? 
11 OG1 ? A THR 108 ? A THR 143 ? 1_555 K ? G K . ? A K 406 ? 1_555 OG1 ? A THR 108 ? A THR 143 ? 1_555 0.0  ? 
12 O   ? A THR 108 ? A THR 143 ? 1_555 K ? G K . ? A K 406 ? 1_555 OG1 ? A THR 108 ? A THR 143 ? 1_555 52.7 ? 
13 O   ? A ILE 109 ? A ILE 144 ? 1_555 K ? E K . ? A K 404 ? 1_555 O   ? A ILE 109 ? A ILE 144 ? 1_555 0.0  ? 
14 O   ? A ILE 109 ? A ILE 144 ? 1_555 K ? E K . ? A K 404 ? 1_555 O   ? A GLY 110 ? A GLY 145 ? 1_555 62.9 ? 
15 O   ? A ILE 109 ? A ILE 144 ? 1_555 K ? E K . ? A K 404 ? 1_555 O   ? A GLY 110 ? A GLY 145 ? 1_555 62.9 ? 
16 O   ? A ILE 109 ? A ILE 144 ? 1_555 K ? E K . ? A K 404 ? 1_555 O   ? A GLY 110 ? A GLY 145 ? 1_555 62.9 ? 
17 O   ? A ILE 109 ? A ILE 144 ? 1_555 K ? E K . ? A K 404 ? 1_555 O   ? A GLY 110 ? A GLY 145 ? 1_555 62.9 ? 
18 O   ? A GLY 110 ? A GLY 145 ? 1_555 K ? E K . ? A K 404 ? 1_555 O   ? A GLY 110 ? A GLY 145 ? 1_555 0.0  ? 
19 O   ? A GLY 110 ? A GLY 145 ? 1_555 K ? D K . ? A K 403 ? 1_555 O   ? A GLY 110 ? A GLY 145 ? 1_555 0.0  ? 
20 O   ? A GLY 110 ? A GLY 145 ? 1_555 K ? D K . ? A K 403 ? 1_555 O   ? A TYR 111 ? A TYR 146 ? 1_555 63.1 ? 
21 O   ? A GLY 110 ? A GLY 145 ? 1_555 K ? D K . ? A K 403 ? 1_555 O   ? A TYR 111 ? A TYR 146 ? 1_555 63.1 ? 
22 O   ? A GLY 110 ? A GLY 145 ? 1_555 K ? D K . ? A K 403 ? 1_555 O   ? A TYR 111 ? A TYR 146 ? 1_555 63.1 ? 
23 O   ? A GLY 110 ? A GLY 145 ? 1_555 K ? D K . ? A K 403 ? 1_555 O   ? A TYR 111 ? A TYR 146 ? 1_555 63.1 ? 
24 O   ? A TYR 111 ? A TYR 146 ? 1_555 K ? D K . ? A K 403 ? 1_555 O   ? A TYR 111 ? A TYR 146 ? 1_555 0.0  ? 
25 O   ? A TYR 111 ? A TYR 146 ? 1_555 K ? C K . ? A K 402 ? 1_555 O   ? A TYR 111 ? A TYR 146 ? 1_555 0.0  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2019-09-04 
2 'Structure model' 1 1 2019-12-18 
3 'Structure model' 1 2 2021-03-17 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Author supporting evidence' 
2 3 'Structure model' 'Database references'        
3 3 'Structure model' 'Derived calculations'       
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' pdbx_audit_support     
2 3 'Structure model' citation               
3 3 'Structure model' citation_author        
4 3 'Structure model' pdbx_struct_conn_angle 
5 3 'Structure model' struct_conn            
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_pdbx_audit_support.funding_organization'    
2  3 'Structure model' '_citation.country'                           
3  3 'Structure model' '_citation.journal_abbrev'                    
4  3 'Structure model' '_citation.journal_id_CSD'                    
5  3 'Structure model' '_citation.journal_id_ISSN'                   
6  3 'Structure model' '_citation.journal_volume'                    
7  3 'Structure model' '_citation.pdbx_database_id_DOI'              
8  3 'Structure model' '_citation.pdbx_database_id_PubMed'           
9  3 'Structure model' '_citation.title'                             
10 3 'Structure model' '_citation.year'                              
11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id'  
12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id'   
13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 
14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id'  
15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id'  
16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id'   
17 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 
18 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id'  
19 3 'Structure model' '_pdbx_struct_conn_angle.value'               
20 3 'Structure model' '_struct_conn.pdbx_dist_value'                
21 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
22 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
23 3 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
24 3 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
25 3 'Structure model' '_struct_conn.ptnr1_label_seq_id'             
26 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
27 3 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
28 3 'Structure model' '_struct_conn.ptnr2_symmetry'                 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .        1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? SCALEPACK   ? ? ? .        2 
? refinement        ? ? ? ? ? ? ? ? ? ? ? REFMAC      ? ? ? 5.8.0073 3 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.24     4 
? phasing           ? ? ? ? ? ? ? ? ? ? ? MOLREP      ? ? ? .        5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 VAL A 265 ? ? -101.29 -71.61  
2 1 LYS A 335 ? ? 41.88   -108.70 
3 1 SER A 370 ? ? -177.76 -51.22  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A CYS 41  ? SG  ? A CYS 6   SG  
2  1 Y 1 A ASP 61  ? CG  ? A ASP 26  CG  
3  1 Y 1 A ASP 61  ? OD1 ? A ASP 26  OD1 
4  1 Y 1 A ASP 61  ? OD2 ? A ASP 26  OD2 
5  1 Y 1 A LYS 62  ? CG  ? A LYS 27  CG  
6  1 Y 1 A LYS 62  ? CD  ? A LYS 27  CD  
7  1 Y 1 A LYS 62  ? CE  ? A LYS 27  CE  
8  1 Y 1 A LYS 62  ? NZ  ? A LYS 27  NZ  
9  1 Y 1 A PRO 63  ? CG  ? A PRO 28  CG  
10 1 Y 1 A PRO 63  ? CD  ? A PRO 28  CD  
11 1 Y 1 A ASP 69  ? CG  ? A ASP 34  CG  
12 1 Y 1 A ASP 69  ? OD1 ? A ASP 34  OD1 
13 1 Y 1 A ASP 69  ? OD2 ? A ASP 34  OD2 
14 1 Y 1 A MET 70  ? CG  ? A MET 35  CG  
15 1 Y 1 A MET 70  ? SD  ? A MET 35  SD  
16 1 Y 1 A MET 70  ? CE  ? A MET 35  CE  
17 1 Y 1 A LYS 335 ? CG  ? A LYS 300 CG  
18 1 Y 1 A LYS 335 ? CD  ? A LYS 300 CD  
19 1 Y 1 A LYS 335 ? CE  ? A LYS 300 CE  
20 1 Y 1 A LYS 335 ? NZ  ? A LYS 300 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 36  ? A MET 1   
2  1 Y 1 A ALA 37  ? A ALA 2   
3  1 Y 1 A ARG 38  ? A ARG 3   
4  1 Y 1 A ARG 39  ? A ARG 4   
5  1 Y 1 A LYS 40  ? A LYS 5   
6  1 Y 1 A GLN 64  ? A GLN 29  
7  1 Y 1 A ARG 65  ? A ARG 30  
8  1 Y 1 A TYR 66  ? A TYR 31  
9  1 Y 1 A ILE 67  ? A ILE 32  
10 1 Y 1 A ALA 68  ? A ALA 33  
11 1 Y 1 A LEU 373 ? A LEU 338 
12 1 Y 1 A GLU 374 ? A GLU 339 
13 1 Y 1 A VAL 375 ? A VAL 340 
14 1 Y 1 A LEU 376 ? A LEU 341 
15 1 Y 1 A PHE 377 ? A PHE 342 
16 1 Y 1 A GLN 378 ? A GLN 343 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Human Genome Research Institute (NIH/NHGRI)' 'United States' HL54171        1 
'American Heart Association'                                                         'United States' 15POST22390016 2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'POTASSIUM ION' K   
3 water           HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'gel filtration' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#