data_6ML4
# 
_entry.id   6ML4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.321 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6ML4         
WWPDB D_1000237123 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6ML4 
_pdbx_database_status.recvd_initial_deposition_date   2018-09-26 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Horton, J.R.' 1 ? 
'Cheng, X.'    2 ? 
'Ren, R.'      3 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Nucleic Acids Res.' 
_citation.journal_id_ASTM           NARHAD 
_citation.journal_id_CSD            0389 
_citation.journal_id_ISSN           1362-4962 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            47 
_citation.language                  ? 
_citation.page_first                8388 
_citation.page_last                 8398 
_citation.title                     'Structural basis of specific DNA binding by the transcription factor ZBTB24.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1093/nar/gkz557 
_citation.pdbx_database_id_PubMed   31226215 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ren, R.'        1  ? 
primary 'Hardikar, S.'   2  ? 
primary 'Horton, J.R.'   3  ? 
primary 'Lu, Y.'         4  ? 
primary 'Zeng, Y.'       5  ? 
primary 'Singh, A.K.'    6  ? 
primary 'Lin, K.'        7  ? 
primary 'Coletta, L.D.'  8  ? 
primary 'Shen, J.'       9  ? 
primary 'Lin Kong, C.S.' 10 ? 
primary 'Hashimoto, H.'  11 ? 
primary 'Zhang, X.'      12 ? 
primary 'Chen, T.'       13 ? 
primary 'Cheng, X.'      14 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   92.40 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6ML4 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     46.277 
_cell.length_a_esd                 ? 
_cell.length_b                     68.807 
_cell.length_b_esd                 ? 
_cell.length_c                     48.434 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        2 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6ML4 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Zinc finger and BTB domain-containing protein 24'                           17274.033 1   ? ? 
'zinc fingers 4-8 (UNP residues 375-519)' ? 
2 polymer     syn 
;DNA (5'-D(*AP*CP*GP*CP*AP*GP*GP*TP*CP*CP*TP*GP*GP*AP*CP*GP*AP*AP*GP*C)-3')
;
6168.994  1   ? ? ?                                         ? 
3 polymer     syn 
;DNA (5'-D(*TP*GP*CP*TP*TP*CP*GP*TP*CP*CP*AP*GP*GP*AP*CP*CP*TP*GP*CP*G)-3')
;
6101.928  1   ? ? ?                                         ? 
4 non-polymer syn 'ZINC ION'                                                                   65.409    5   ? ? ? ? 
5 non-polymer syn 1,2-ETHANEDIOL                                                               62.068    3   ? ? ? ? 
6 water       nat water                                                                        18.015    353 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Bone morphogenetic protein-induced factor 1, Brain-specific protein 1, Zinc finger protein 450' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GPLGSKSFTCDQCGKYFSQKRQLKSHYRVHTGHSLPECSHCHRKFMDVSQLKKHLRTHTGEKPFTCEICGKSFTAKSSLQ
THIRIHRGEKPYSCSICGKCFSDSSAKRRHCILHTGKKPFSCPECGLQFARLDNLKAHLKIHSKEKHTADY
;
;GPLGSKSFTCDQCGKYFSQKRQLKSHYRVHTGHSLPECSHCHRKFMDVSQLKKHLRTHTGEKPFTCEICGKSFTAKSSLQ
THIRIHRGEKPYSCSICGKCFSDSSAKRRHCILHTGKKPFSCPECGLQFARLDNLKAHLKIHSKEKHTADY
;
A ? 
2 polydeoxyribonucleotide no no '(DA)(DC)(DG)(DC)(DA)(DG)(DG)(DT)(DC)(DC)(DT)(DG)(DG)(DA)(DC)(DG)(DA)(DA)(DG)(DC)' 
ACGCAGGTCCTGGACGAAGC E ? 
3 polydeoxyribonucleotide no no '(DT)(DG)(DC)(DT)(DT)(DC)(DG)(DT)(DC)(DC)(DA)(DG)(DG)(DA)(DC)(DC)(DT)(DG)(DC)(DG)' 
TGCTTCGTCCAGGACCTGCG F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   LYS n 
1 7   SER n 
1 8   PHE n 
1 9   THR n 
1 10  CYS n 
1 11  ASP n 
1 12  GLN n 
1 13  CYS n 
1 14  GLY n 
1 15  LYS n 
1 16  TYR n 
1 17  PHE n 
1 18  SER n 
1 19  GLN n 
1 20  LYS n 
1 21  ARG n 
1 22  GLN n 
1 23  LEU n 
1 24  LYS n 
1 25  SER n 
1 26  HIS n 
1 27  TYR n 
1 28  ARG n 
1 29  VAL n 
1 30  HIS n 
1 31  THR n 
1 32  GLY n 
1 33  HIS n 
1 34  SER n 
1 35  LEU n 
1 36  PRO n 
1 37  GLU n 
1 38  CYS n 
1 39  SER n 
1 40  HIS n 
1 41  CYS n 
1 42  HIS n 
1 43  ARG n 
1 44  LYS n 
1 45  PHE n 
1 46  MET n 
1 47  ASP n 
1 48  VAL n 
1 49  SER n 
1 50  GLN n 
1 51  LEU n 
1 52  LYS n 
1 53  LYS n 
1 54  HIS n 
1 55  LEU n 
1 56  ARG n 
1 57  THR n 
1 58  HIS n 
1 59  THR n 
1 60  GLY n 
1 61  GLU n 
1 62  LYS n 
1 63  PRO n 
1 64  PHE n 
1 65  THR n 
1 66  CYS n 
1 67  GLU n 
1 68  ILE n 
1 69  CYS n 
1 70  GLY n 
1 71  LYS n 
1 72  SER n 
1 73  PHE n 
1 74  THR n 
1 75  ALA n 
1 76  LYS n 
1 77  SER n 
1 78  SER n 
1 79  LEU n 
1 80  GLN n 
1 81  THR n 
1 82  HIS n 
1 83  ILE n 
1 84  ARG n 
1 85  ILE n 
1 86  HIS n 
1 87  ARG n 
1 88  GLY n 
1 89  GLU n 
1 90  LYS n 
1 91  PRO n 
1 92  TYR n 
1 93  SER n 
1 94  CYS n 
1 95  SER n 
1 96  ILE n 
1 97  CYS n 
1 98  GLY n 
1 99  LYS n 
1 100 CYS n 
1 101 PHE n 
1 102 SER n 
1 103 ASP n 
1 104 SER n 
1 105 SER n 
1 106 ALA n 
1 107 LYS n 
1 108 ARG n 
1 109 ARG n 
1 110 HIS n 
1 111 CYS n 
1 112 ILE n 
1 113 LEU n 
1 114 HIS n 
1 115 THR n 
1 116 GLY n 
1 117 LYS n 
1 118 LYS n 
1 119 PRO n 
1 120 PHE n 
1 121 SER n 
1 122 CYS n 
1 123 PRO n 
1 124 GLU n 
1 125 CYS n 
1 126 GLY n 
1 127 LEU n 
1 128 GLN n 
1 129 PHE n 
1 130 ALA n 
1 131 ARG n 
1 132 LEU n 
1 133 ASP n 
1 134 ASN n 
1 135 LEU n 
1 136 LYS n 
1 137 ALA n 
1 138 HIS n 
1 139 LEU n 
1 140 LYS n 
1 141 ILE n 
1 142 HIS n 
1 143 SER n 
1 144 LYS n 
1 145 GLU n 
1 146 LYS n 
1 147 HIS n 
1 148 THR n 
1 149 ALA n 
1 150 ASP n 
1 151 TYR n 
2 1   DA  n 
2 2   DC  n 
2 3   DG  n 
2 4   DC  n 
2 5   DA  n 
2 6   DG  n 
2 7   DG  n 
2 8   DT  n 
2 9   DC  n 
2 10  DC  n 
2 11  DT  n 
2 12  DG  n 
2 13  DG  n 
2 14  DA  n 
2 15  DC  n 
2 16  DG  n 
2 17  DA  n 
2 18  DA  n 
2 19  DG  n 
2 20  DC  n 
3 1   DT  n 
3 2   DG  n 
3 3   DC  n 
3 4   DT  n 
3 5   DT  n 
3 6   DC  n 
3 7   DG  n 
3 8   DT  n 
3 9   DC  n 
3 10  DC  n 
3 11  DA  n 
3 12  DG  n 
3 13  DG  n 
3 14  DA  n 
3 15  DC  n 
3 16  DC  n 
3 17  DT  n 
3 18  DG  n 
3 19  DC  n 
3 20  DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   151 
_entity_src_gen.gene_src_common_name               Mouse 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'Zbtb24, Bif1, Bsg1, Znf450' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Mus musculus' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     10090 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli BL21(DE3)' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     469008 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 20 'Mus musculus' Mouse 10090 ? 
3 1 sample 1 20 'Mus musculus' Mouse 10090 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP ZBT24_MOUSE Q80X44 ? 1 
;KSFTCDQCGKYFSQKRQLKSHYRVHTGHSLPECSHCHRKFMDVSQLKKHLRTHTGEKPFTCEICGKSFTAKSSLQTHIRI
HRGEKPYSCSICGKCFSDSSAKRRHCILHTGKKPFSCPECGLQFARLDNLKAHLKIHSKEKHTAD
;
375 
2 PDB 6ML4        6ML4   ? 2 ? 1   
3 PDB 6ML4        6ML4   ? 3 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6ML4 A 6 ? 150 ? Q80X44 375 ? 519 ? 375 519 
2 2 6ML4 E 1 ? 20  ? 6ML4   1   ? 20  ? 1   20  
3 3 6ML4 F 1 ? 20  ? 6ML4   1   ? 20  ? 1   20  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6ML4 GLY A 1   ? UNP Q80X44 ? ? 'expression tag' 370 1 
1 6ML4 PRO A 2   ? UNP Q80X44 ? ? 'expression tag' 371 2 
1 6ML4 LEU A 3   ? UNP Q80X44 ? ? 'expression tag' 372 3 
1 6ML4 GLY A 4   ? UNP Q80X44 ? ? 'expression tag' 373 4 
1 6ML4 SER A 5   ? UNP Q80X44 ? ? 'expression tag' 374 5 
1 6ML4 TYR A 151 ? UNP Q80X44 ? ? 'expression tag' 520 6 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ?                 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ?                 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ?                 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ?                 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ?                 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ?                 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ?                 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ?                 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ?                 'C10 H15 N2 O8 P' 322.208 
EDO non-polymer         . 1,2-ETHANEDIOL                       'ETHYLENE GLYCOL' 'C2 H6 O2'        62.068  
GLN 'L-peptide linking' y GLUTAMINE                            ?                 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ?                 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ?                 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ?                 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ?                 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ?                 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ?                 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ?                 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ?                 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ?                 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ?                 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ?                 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ?                 'C4 H9 N O3'      119.119 
TYR 'L-peptide linking' y TYROSINE                             ?                 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ?                 'C5 H11 N O2'     117.146 
ZN  non-polymer         . 'ZINC ION'                           ?                 'Zn 2'            65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6ML4 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.61 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         52.83 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '25% PEG3350, 0.1 M HEPES, pH 7.5, 0.2 M ammonium acetate' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         RIGAKU 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-07-24 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.5418 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.target                      ? 
_diffrn_source.type                        'RIGAKU MICROMAX-003' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.5418 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_synchrotron_site       ? 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6ML4 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.48 
_reflns.d_resolution_low                 28.04 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       40443 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             80.4 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  4.2 
_reflns.pdbx_Rmerge_I_obs                0.040 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            16.7 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.019 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  1.48 
_reflns_shell.d_res_low                   1.54 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.5 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           570 
_reflns_shell.percent_possible_all        11.3 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             1.1 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             0.530 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.530 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6ML4 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.482 
_refine.ls_d_res_low                             28.039 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     40368 
_refine.ls_number_reflns_R_free                  1981 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    80.20 
_refine.ls_percent_reflns_R_free                 4.91 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1917 
_refine.ls_R_factor_R_free                       0.2113 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1907 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'PDB entry 6ML3' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 23.98 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.18 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1131 
_refine_hist.pdbx_number_atoms_nucleic_acid   814 
_refine_hist.pdbx_number_atoms_ligand         17 
_refine_hist.number_atoms_solvent             353 
_refine_hist.number_atoms_total               2315 
_refine_hist.d_res_high                       1.482 
_refine_hist.d_res_low                        28.039 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003  ? 2106 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.532  ? 2996 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 24.423 ? 845  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.045  ? 321  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.003  ? 243  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.4824 1.5194  . . 15  267  8.00   . . . 0.3499 . 0.3781 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.5194 1.5605  . . 35  819  24.00  . . . 0.4428 . 0.3160 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.5605 1.6064  . . 80  1382 41.00  . . . 0.2881 . 0.2721 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.6064 1.6583  . . 107 2078 61.00  . . . 0.2728 . 0.2583 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.6583 1.7175  . . 172 3031 90.00  . . . 0.2390 . 0.2465 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7175 1.7863  . . 167 3404 100.00 . . . 0.2689 . 0.2430 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.7863 1.8676  . . 181 3420 100.00 . . . 0.2564 . 0.2264 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.8676 1.9660  . . 171 3375 100.00 . . . 0.2544 . 0.2182 . . . . . . . . . . 
'X-RAY DIFFRACTION' 1.9660 2.0891  . . 183 3424 100.00 . . . 0.2363 . 0.2077 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.0891 2.2504  . . 175 3409 100.00 . . . 0.1942 . 0.2046 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.2504 2.4767  . . 180 3413 100.00 . . . 0.2090 . 0.1953 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4767 2.8348  . . 173 3430 100.00 . . . 0.1906 . 0.1918 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8348 3.5704  . . 165 3439 99.00  . . . 0.1991 . 0.1763 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5704 28.0445 . . 177 3496 100.00 . . . 0.1789 . 0.1433 . . . . . . . . . . 
# 
_struct.entry_id                     6ML4 
_struct.title                        'BTB24 Zinc Fingers 4-8 with 19+1mer DNA Oligonucleotide (Sequence 3)' 
_struct.pdbx_descriptor              'CCAAT/enhancer-binding protein beta, 16-bp methylated oligonucleotide' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6ML4 
_struct_keywords.text            'protein-DNA complex, transcription, TRANSCRIPTION-DNA complex' 
_struct_keywords.pdbx_keywords   TRANSCRIPTION/DNA 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 4 ? 
F N N 4 ? 
G N N 4 ? 
H N N 4 ? 
I N N 5 ? 
J N N 5 ? 
K N N 5 ? 
L N N 6 ? 
M N N 6 ? 
N N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 GLN A 19  ? TYR A 27  ? GLN A 388 TYR A 396 1 ? 9  
HELX_P HELX_P2 AA2 TYR A 27  ? GLY A 32  ? TYR A 396 GLY A 401 1 ? 6  
HELX_P HELX_P3 AA3 ASP A 47  ? GLY A 60  ? ASP A 416 GLY A 429 1 ? 14 
HELX_P HELX_P4 AA4 ALA A 75  ? ARG A 87  ? ALA A 444 ARG A 456 1 ? 13 
HELX_P HELX_P5 AA5 ASP A 103 ? ILE A 112 ? ASP A 472 ILE A 481 1 ? 10 
HELX_P HELX_P6 AA6 LEU A 113 ? GLY A 116 ? LEU A 482 GLY A 485 5 ? 4  
HELX_P HELX_P7 AA7 ARG A 131 ? LYS A 146 ? ARG A 500 LYS A 515 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A CYS 10  SG  ? ? ? 1_555 D ZN .  ZN ? ? A CYS 379 A ZN 601 1_555 ? ? ? ? ? ? ?            2.316 ? 
metalc2  metalc ? ? A CYS 13  SG  ? ? ? 1_555 D ZN .  ZN ? ? A CYS 382 A ZN 601 1_555 ? ? ? ? ? ? ?            2.295 ? 
metalc3  metalc ? ? A HIS 26  NE2 ? ? ? 1_555 D ZN .  ZN ? ? A HIS 395 A ZN 601 1_555 ? ? ? ? ? ? ?            2.040 ? 
metalc4  metalc ? ? A HIS 30  NE2 ? ? ? 1_555 D ZN .  ZN ? ? A HIS 399 A ZN 601 1_555 ? ? ? ? ? ? ?            2.027 ? 
metalc5  metalc ? ? A CYS 38  SG  ? ? ? 1_555 E ZN .  ZN ? ? A CYS 407 A ZN 602 1_555 ? ? ? ? ? ? ?            2.305 ? 
metalc6  metalc ? ? A CYS 41  SG  ? ? ? 1_555 E ZN .  ZN ? ? A CYS 410 A ZN 602 1_555 ? ? ? ? ? ? ?            2.289 ? 
metalc7  metalc ? ? A HIS 54  NE2 ? ? ? 1_555 E ZN .  ZN ? ? A HIS 423 A ZN 602 1_555 ? ? ? ? ? ? ?            2.014 ? 
metalc8  metalc ? ? A HIS 58  NE2 ? ? ? 1_555 E ZN .  ZN ? ? A HIS 427 A ZN 602 1_555 ? ? ? ? ? ? ?            2.035 ? 
metalc9  metalc ? ? A CYS 66  SG  ? ? ? 1_555 F ZN .  ZN ? ? A CYS 435 A ZN 603 1_555 ? ? ? ? ? ? ?            2.303 ? 
metalc10 metalc ? ? A CYS 69  SG  ? ? ? 1_555 F ZN .  ZN ? ? A CYS 438 A ZN 603 1_555 ? ? ? ? ? ? ?            2.276 ? 
metalc11 metalc ? ? A HIS 82  NE2 ? ? ? 1_555 F ZN .  ZN ? ? A HIS 451 A ZN 603 1_555 ? ? ? ? ? ? ?            2.043 ? 
metalc12 metalc ? ? A HIS 86  NE2 ? ? ? 1_555 F ZN .  ZN ? ? A HIS 455 A ZN 603 1_555 ? ? ? ? ? ? ?            2.033 ? 
metalc13 metalc ? ? A CYS 94  SG  ? ? ? 1_555 G ZN .  ZN ? ? A CYS 463 A ZN 604 1_555 ? ? ? ? ? ? ?            2.330 ? 
metalc14 metalc ? ? A CYS 97  SG  ? ? ? 1_555 G ZN .  ZN ? ? A CYS 466 A ZN 604 1_555 ? ? ? ? ? ? ?            2.264 ? 
metalc15 metalc ? ? A HIS 110 NE2 ? ? ? 1_555 G ZN .  ZN ? ? A HIS 479 A ZN 604 1_555 ? ? ? ? ? ? ?            2.040 ? 
metalc16 metalc ? ? A HIS 114 NE2 ? ? ? 1_555 G ZN .  ZN ? ? A HIS 483 A ZN 604 1_555 ? ? ? ? ? ? ?            2.041 ? 
metalc17 metalc ? ? A CYS 122 SG  ? ? ? 1_555 H ZN .  ZN ? ? A CYS 491 A ZN 605 1_555 ? ? ? ? ? ? ?            2.272 ? 
metalc18 metalc ? ? A CYS 125 SG  ? ? ? 1_555 H ZN .  ZN ? ? A CYS 494 A ZN 605 1_555 ? ? ? ? ? ? ?            2.293 ? 
metalc19 metalc ? ? A HIS 138 NE2 ? ? ? 1_555 H ZN .  ZN ? ? A HIS 507 A ZN 605 1_555 ? ? ? ? ? ? ?            2.022 ? 
metalc20 metalc ? ? A HIS 142 NE2 ? ? ? 1_555 H ZN .  ZN ? ? A HIS 511 A ZN 605 1_555 ? ? ? ? ? ? ?            2.029 ? 
hydrog1  hydrog ? ? B DC  2   N3  ? ? ? 1_555 C DG 20 N1 ? ? E DC  2   F DG 20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DC  2   N4  ? ? ? 1_555 C DG 20 O6 ? ? E DC  2   F DG 20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DC  2   O2  ? ? ? 1_555 C DG 20 N2 ? ? E DC  2   F DG 20  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DG  3   N1  ? ? ? 1_555 C DC 19 N3 ? ? E DG  3   F DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  3   N2  ? ? ? 1_555 C DC 19 O2 ? ? E DG  3   F DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  3   O6  ? ? ? 1_555 C DC 19 N4 ? ? E DG  3   F DC 19  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DC  4   N3  ? ? ? 1_555 C DG 18 N1 ? ? E DC  4   F DG 18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DC  4   N4  ? ? ? 1_555 C DG 18 O6 ? ? E DC  4   F DG 18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DC  4   O2  ? ? ? 1_555 C DG 18 N2 ? ? E DC  4   F DG 18  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DA  5   N1  ? ? ? 1_555 C DT 17 N3 ? ? E DA  5   F DT 17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DA  5   N6  ? ? ? 1_555 C DT 17 O4 ? ? E DA  5   F DT 17  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DG  6   N1  ? ? ? 1_555 C DC 16 N3 ? ? E DG  6   F DC 16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  6   N2  ? ? ? 1_555 C DC 16 O2 ? ? E DG  6   F DC 16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DG  6   O6  ? ? ? 1_555 C DC 16 N4 ? ? E DG  6   F DC 16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DG  7   N1  ? ? ? 1_555 C DC 15 N3 ? ? E DG  7   F DC 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DG  7   N2  ? ? ? 1_555 C DC 15 O2 ? ? E DG  7   F DC 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DG  7   O6  ? ? ? 1_555 C DC 15 N4 ? ? E DG  7   F DC 15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DT  8   N3  ? ? ? 1_555 C DA 14 N1 ? ? E DT  8   F DA 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DT  8   O4  ? ? ? 1_555 C DA 14 N6 ? ? E DT  8   F DA 14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DC  9   N3  ? ? ? 1_555 C DG 13 N1 ? ? E DC  9   F DG 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DC  9   N4  ? ? ? 1_555 C DG 13 O6 ? ? E DC  9   F DG 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DC  9   O2  ? ? ? 1_555 C DG 13 N2 ? ? E DC  9   F DG 13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DC  10  N3  ? ? ? 1_555 C DG 12 N1 ? ? E DC  10  F DG 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog24 hydrog ? ? B DC  10  N4  ? ? ? 1_555 C DG 12 O6 ? ? E DC  10  F DG 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DC  10  O2  ? ? ? 1_555 C DG 12 N2 ? ? E DC  10  F DG 12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DT  11  N3  ? ? ? 1_555 C DA 11 N1 ? ? E DT  11  F DA 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DT  11  O4  ? ? ? 1_555 C DA 11 N6 ? ? E DT  11  F DA 11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DG  12  N1  ? ? ? 1_555 C DC 10 N3 ? ? E DG  12  F DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? B DG  12  N2  ? ? ? 1_555 C DC 10 O2 ? ? E DG  12  F DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? B DG  12  O6  ? ? ? 1_555 C DC 10 N4 ? ? E DG  12  F DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? B DG  13  N1  ? ? ? 1_555 C DC 9  N3 ? ? E DG  13  F DC 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? B DG  13  N2  ? ? ? 1_555 C DC 9  O2 ? ? E DG  13  F DC 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? B DG  13  O6  ? ? ? 1_555 C DC 9  N4 ? ? E DG  13  F DC 9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? B DA  14  N1  ? ? ? 1_555 C DT 8  N3 ? ? E DA  14  F DT 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? B DA  14  N6  ? ? ? 1_555 C DT 8  O4 ? ? E DA  14  F DT 8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? B DC  15  N3  ? ? ? 1_555 C DG 7  N1 ? ? E DC  15  F DG 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog37 hydrog ? ? B DC  15  N4  ? ? ? 1_555 C DG 7  O6 ? ? E DC  15  F DG 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog38 hydrog ? ? B DC  15  O2  ? ? ? 1_555 C DG 7  N2 ? ? E DC  15  F DG 7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog39 hydrog ? ? B DG  16  N1  ? ? ? 1_555 C DC 6  N3 ? ? E DG  16  F DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog40 hydrog ? ? B DG  16  N2  ? ? ? 1_555 C DC 6  O2 ? ? E DG  16  F DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog41 hydrog ? ? B DG  16  O6  ? ? ? 1_555 C DC 6  N4 ? ? E DG  16  F DC 6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog42 hydrog ? ? B DA  17  N1  ? ? ? 1_555 C DT 5  N3 ? ? E DA  17  F DT 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog43 hydrog ? ? B DA  17  N6  ? ? ? 1_555 C DT 5  O4 ? ? E DA  17  F DT 5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog44 hydrog ? ? B DA  18  N1  ? ? ? 1_555 C DT 4  N3 ? ? E DA  18  F DT 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog45 hydrog ? ? B DA  18  N6  ? ? ? 1_555 C DT 4  O4 ? ? E DA  18  F DT 4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog46 hydrog ? ? B DG  19  N1  ? ? ? 1_555 C DC 3  N3 ? ? E DG  19  F DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog47 hydrog ? ? B DG  19  N2  ? ? ? 1_555 C DC 3  O2 ? ? E DG  19  F DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog48 hydrog ? ? B DG  19  O6  ? ? ? 1_555 C DC 3  N4 ? ? E DG  19  F DC 3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog49 hydrog ? ? B DC  20  N3  ? ? ? 1_555 C DG 2  N1 ? ? E DC  20  F DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog50 hydrog ? ? B DC  20  N4  ? ? ? 1_555 C DG 2  O6 ? ? E DC  20  F DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog51 hydrog ? ? B DC  20  O2  ? ? ? 1_555 C DG 2  N2 ? ? E DC  20  F DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           4 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            373 
_struct_mon_prot_cis.auth_asym_id           A 
_struct_mon_prot_cis.pdbx_label_comp_id_2   SER 
_struct_mon_prot_cis.pdbx_label_seq_id_2    5 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    SER 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     374 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    A 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       0.38 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 PHE A 8   ? THR A 9   ? PHE A 377 THR A 378 
AA1 2 TYR A 16  ? PHE A 17  ? TYR A 385 PHE A 386 
AA2 1 PHE A 64  ? THR A 65  ? PHE A 433 THR A 434 
AA2 2 SER A 72  ? PHE A 73  ? SER A 441 PHE A 442 
AA3 1 TYR A 92  ? SER A 93  ? TYR A 461 SER A 462 
AA3 2 CYS A 100 ? PHE A 101 ? CYS A 469 PHE A 470 
AA4 1 PHE A 120 ? SER A 121 ? PHE A 489 SER A 490 
AA4 2 GLN A 128 ? PHE A 129 ? GLN A 497 PHE A 498 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N PHE A 8   ? N PHE A 377 O PHE A 17  ? O PHE A 386 
AA2 1 2 N PHE A 64  ? N PHE A 433 O PHE A 73  ? O PHE A 442 
AA3 1 2 N TYR A 92  ? N TYR A 461 O PHE A 101 ? O PHE A 470 
AA4 1 2 N PHE A 120 ? N PHE A 489 O PHE A 129 ? O PHE A 498 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN  601 ? 4 'binding site for residue ZN A 601'  
AC2 Software A ZN  602 ? 4 'binding site for residue ZN A 602'  
AC3 Software A ZN  603 ? 4 'binding site for residue ZN A 603'  
AC4 Software A ZN  604 ? 4 'binding site for residue ZN A 604'  
AC5 Software A ZN  605 ? 4 'binding site for residue ZN A 605'  
AC6 Software A EDO 606 ? 2 'binding site for residue EDO A 606' 
AC7 Software E EDO 501 ? 6 'binding site for residue EDO E 501' 
AC8 Software E EDO 502 ? 4 'binding site for residue EDO E 502' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 10  ? CYS A 379 . ? 1_555 ? 
2  AC1 4 CYS A 13  ? CYS A 382 . ? 1_555 ? 
3  AC1 4 HIS A 26  ? HIS A 395 . ? 1_555 ? 
4  AC1 4 HIS A 30  ? HIS A 399 . ? 1_555 ? 
5  AC2 4 CYS A 38  ? CYS A 407 . ? 1_555 ? 
6  AC2 4 CYS A 41  ? CYS A 410 . ? 1_555 ? 
7  AC2 4 HIS A 54  ? HIS A 423 . ? 1_555 ? 
8  AC2 4 HIS A 58  ? HIS A 427 . ? 1_555 ? 
9  AC3 4 CYS A 66  ? CYS A 435 . ? 1_555 ? 
10 AC3 4 CYS A 69  ? CYS A 438 . ? 1_555 ? 
11 AC3 4 HIS A 82  ? HIS A 451 . ? 1_555 ? 
12 AC3 4 HIS A 86  ? HIS A 455 . ? 1_555 ? 
13 AC4 4 CYS A 94  ? CYS A 463 . ? 1_555 ? 
14 AC4 4 CYS A 97  ? CYS A 466 . ? 1_555 ? 
15 AC4 4 HIS A 110 ? HIS A 479 . ? 1_555 ? 
16 AC4 4 HIS A 114 ? HIS A 483 . ? 1_555 ? 
17 AC5 4 CYS A 122 ? CYS A 491 . ? 1_555 ? 
18 AC5 4 CYS A 125 ? CYS A 494 . ? 1_555 ? 
19 AC5 4 HIS A 138 ? HIS A 507 . ? 1_555 ? 
20 AC5 4 HIS A 142 ? HIS A 511 . ? 1_555 ? 
21 AC6 2 PRO A 123 ? PRO A 492 . ? 1_555 ? 
22 AC6 2 GLU A 124 ? GLU A 493 . ? 1_555 ? 
23 AC7 6 LYS A 71  ? LYS A 440 . ? 1_555 ? 
24 AC7 6 HIS A 82  ? HIS A 451 . ? 1_555 ? 
25 AC7 6 DT  B 8   ? DT  E 8   . ? 1_555 ? 
26 AC7 6 DC  B 9   ? DC  E 9   . ? 1_555 ? 
27 AC7 6 HOH M .   ? HOH E 632 . ? 1_555 ? 
28 AC7 6 HOH M .   ? HOH E 668 . ? 1_555 ? 
29 AC8 4 DG  B 7   ? DG  E 7   . ? 1_555 ? 
30 AC8 4 DT  B 8   ? DT  E 8   . ? 1_555 ? 
31 AC8 4 HOH M .   ? HOH E 611 . ? 1_555 ? 
32 AC8 4 HOH M .   ? HOH E 643 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6ML4 
_atom_sites.fract_transf_matrix[1][1]   0.021609 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000907 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014533 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.020665 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 4   ? 35.872 31.786 38.407  1.00 37.98 ? 373 GLY A N     1 
ATOM   2    C  CA    . GLY A 1 4   ? 35.930 32.379 39.730  1.00 37.14 ? 373 GLY A CA    1 
ATOM   3    C  C     . GLY A 1 4   ? 37.334 32.758 40.163  1.00 35.89 ? 373 GLY A C     1 
ATOM   4    O  O     . GLY A 1 4   ? 38.016 31.981 40.833  1.00 41.75 ? 373 GLY A O     1 
ATOM   5    N  N     . SER A 1 5   ? 37.771 33.955 39.782  1.00 54.22 ? 374 SER A N     1 
ATOM   6    C  CA    . SER A 1 5   ? 36.946 34.865 38.996  1.00 44.17 ? 374 SER A CA    1 
ATOM   7    C  C     . SER A 1 5   ? 37.405 34.911 37.541  1.00 34.67 ? 374 SER A C     1 
ATOM   8    O  O     . SER A 1 5   ? 38.516 34.495 37.214  1.00 33.43 ? 374 SER A O     1 
ATOM   9    C  CB    . SER A 1 5   ? 36.968 36.268 39.604  1.00 46.70 ? 374 SER A CB    1 
ATOM   10   O  OG    . SER A 1 5   ? 38.290 36.773 39.671  1.00 47.91 ? 374 SER A OG    1 
ATOM   11   N  N     . LYS A 1 6   ? 36.535 35.417 36.670  1.00 28.33 ? 375 LYS A N     1 
ATOM   12   C  CA    . LYS A 1 6   ? 36.818 35.531 35.244  1.00 23.72 ? 375 LYS A CA    1 
ATOM   13   C  C     . LYS A 1 6   ? 36.533 36.961 34.815  1.00 23.64 ? 375 LYS A C     1 
ATOM   14   O  O     . LYS A 1 6   ? 35.396 37.430 34.929  1.00 21.72 ? 375 LYS A O     1 
ATOM   15   C  CB    . LYS A 1 6   ? 35.964 34.546 34.440  1.00 25.65 ? 375 LYS A CB    1 
ATOM   16   C  CG    . LYS A 1 6   ? 36.274 33.085 34.732  1.00 27.76 ? 375 LYS A CG    1 
ATOM   17   C  CD    . LYS A 1 6   ? 35.183 32.168 34.203  1.00 30.81 ? 375 LYS A CD    1 
ATOM   18   C  CE    . LYS A 1 6   ? 33.861 32.437 34.903  1.00 35.95 ? 375 LYS A CE    1 
ATOM   19   N  NZ    . LYS A 1 6   ? 32.788 31.506 34.458  1.00 40.62 ? 375 LYS A NZ    1 
ATOM   20   N  N     . SER A 1 7   ? 37.563 37.650 34.324  1.00 20.43 ? 376 SER A N     1 
ATOM   21   C  CA    . SER A 1 7   ? 37.450 39.052 33.950  1.00 21.20 ? 376 SER A CA    1 
ATOM   22   C  C     . SER A 1 7   ? 37.564 39.303 32.454  1.00 21.37 ? 376 SER A C     1 
ATOM   23   O  O     . SER A 1 7   ? 37.344 40.439 32.019  1.00 24.22 ? 376 SER A O     1 
ATOM   24   C  CB    . SER A 1 7   ? 38.507 39.888 34.685  1.00 22.90 ? 376 SER A CB    1 
ATOM   25   O  OG    . SER A 1 7   ? 39.817 39.499 34.312  1.00 23.14 ? 376 SER A OG    1 
ATOM   26   N  N     . PHE A 1 8   ? 37.899 38.292 31.658  1.00 22.37 ? 377 PHE A N     1 
ATOM   27   C  CA    . PHE A 1 8   ? 38.025 38.441 30.215  1.00 21.02 ? 377 PHE A CA    1 
ATOM   28   C  C     . PHE A 1 8   ? 36.778 37.887 29.539  1.00 24.83 ? 377 PHE A C     1 
ATOM   29   O  O     . PHE A 1 8   ? 36.356 36.763 29.830  1.00 28.76 ? 377 PHE A O     1 
ATOM   30   C  CB    . PHE A 1 8   ? 39.271 37.718 29.705  1.00 19.85 ? 377 PHE A CB    1 
ATOM   31   C  CG    . PHE A 1 8   ? 40.550 38.220 30.311  1.00 21.13 ? 377 PHE A CG    1 
ATOM   32   C  CD1   . PHE A 1 8   ? 41.225 39.289 29.746  1.00 26.83 ? 377 PHE A CD1   1 
ATOM   33   C  CD2   . PHE A 1 8   ? 41.075 37.626 31.447  1.00 22.14 ? 377 PHE A CD2   1 
ATOM   34   C  CE1   . PHE A 1 8   ? 42.401 39.756 30.303  1.00 29.40 ? 377 PHE A CE1   1 
ATOM   35   C  CE2   . PHE A 1 8   ? 42.250 38.088 32.008  1.00 25.61 ? 377 PHE A CE2   1 
ATOM   36   C  CZ    . PHE A 1 8   ? 42.915 39.154 31.435  1.00 29.05 ? 377 PHE A CZ    1 
ATOM   37   N  N     . THR A 1 9   ? 36.195 38.676 28.640  1.00 26.38 ? 378 THR A N     1 
ATOM   38   C  CA    . THR A 1 9   ? 34.964 38.310 27.956  1.00 27.72 ? 378 THR A CA    1 
ATOM   39   C  C     . THR A 1 9   ? 35.173 38.376 26.451  1.00 26.89 ? 378 THR A C     1 
ATOM   40   O  O     . THR A 1 9   ? 35.914 39.229 25.953  1.00 26.56 ? 378 THR A O     1 
ATOM   41   C  CB    . THR A 1 9   ? 33.816 39.248 28.347  1.00 30.20 ? 378 THR A CB    1 
ATOM   42   O  OG1   . THR A 1 9   ? 34.200 40.606 28.099  1.00 32.91 ? 378 THR A OG1   1 
ATOM   43   C  CG2   . THR A 1 9   ? 33.476 39.086 29.816  1.00 28.53 ? 378 THR A CG2   1 
ATOM   44   N  N     . CYS A 1 10  ? 34.514 37.470 25.735  1.00 25.03 ? 379 CYS A N     1 
ATOM   45   C  CA    . CYS A 1 10  ? 34.556 37.463 24.279  1.00 24.49 ? 379 CYS A CA    1 
ATOM   46   C  C     . CYS A 1 10  ? 33.494 38.417 23.749  1.00 24.80 ? 379 CYS A C     1 
ATOM   47   O  O     . CYS A 1 10  ? 32.311 38.281 24.077  1.00 27.90 ? 379 CYS A O     1 
ATOM   48   C  CB    . CYS A 1 10  ? 34.302 36.049 23.761  1.00 25.82 ? 379 CYS A CB    1 
ATOM   49   S  SG    . CYS A 1 10  ? 34.209 35.920 21.961  1.00 28.50 ? 379 CYS A SG    1 
ATOM   50   N  N     . ASP A 1 11  ? 33.912 39.380 22.929  1.00 27.76 ? 380 ASP A N     1 
ATOM   51   C  CA    . ASP A 1 11  ? 32.963 40.353 22.386  1.00 30.61 ? 380 ASP A CA    1 
ATOM   52   C  C     . ASP A 1 11  ? 32.081 39.787 21.267  1.00 34.47 ? 380 ASP A C     1 
ATOM   53   O  O     . ASP A 1 11  ? 31.403 40.571 20.590  1.00 39.50 ? 380 ASP A O     1 
ATOM   54   C  CB    . ASP A 1 11  ? 33.675 41.635 21.940  1.00 32.93 ? 380 ASP A CB    1 
ATOM   55   C  CG    . ASP A 1 11  ? 34.731 41.387 20.872  1.00 36.81 ? 380 ASP A CG    1 
ATOM   56   O  OD1   . ASP A 1 11  ? 34.711 40.318 20.228  1.00 38.37 ? 380 ASP A OD1   1 
ATOM   57   O  OD2   . ASP A 1 11  ? 35.591 42.272 20.679  1.00 40.04 ? 380 ASP A OD2   1 
ATOM   58   N  N     . GLN A 1 12  ? 32.072 38.474 21.056  1.00 32.29 ? 381 GLN A N     1 
ATOM   59   C  CA    . GLN A 1 12  ? 31.256 37.841 20.028  1.00 34.25 ? 381 GLN A CA    1 
ATOM   60   C  C     . GLN A 1 12  ? 30.192 36.915 20.592  1.00 35.52 ? 381 GLN A C     1 
ATOM   61   O  O     . GLN A 1 12  ? 29.049 36.945 20.130  1.00 39.03 ? 381 GLN A O     1 
ATOM   62   C  CB    . GLN A 1 12  ? 32.145 37.062 19.048  1.00 35.39 ? 381 GLN A CB    1 
ATOM   63   C  CG    . GLN A 1 12  ? 33.154 37.925 18.313  1.00 38.55 ? 381 GLN A CG    1 
ATOM   64   C  CD    . GLN A 1 12  ? 32.496 38.929 17.386  1.00 42.82 ? 381 GLN A CD    1 
ATOM   65   O  OE1   . GLN A 1 12  ? 31.578 38.592 16.638  1.00 44.28 ? 381 GLN A OE1   1 
ATOM   66   N  NE2   . GLN A 1 12  ? 32.960 40.172 17.435  1.00 43.53 ? 381 GLN A NE2   1 
ATOM   67   N  N     . CYS A 1 13  ? 30.537 36.086 21.580  1.00 32.65 ? 382 CYS A N     1 
ATOM   68   C  CA    . CYS A 1 13  ? 29.583 35.175 22.193  1.00 32.29 ? 382 CYS A CA    1 
ATOM   69   C  C     . CYS A 1 13  ? 29.380 35.403 23.684  1.00 31.63 ? 382 CYS A C     1 
ATOM   70   O  O     . CYS A 1 13  ? 28.461 34.809 24.259  1.00 33.96 ? 382 CYS A O     1 
ATOM   71   C  CB    . CYS A 1 13  ? 29.987 33.712 21.950  1.00 33.38 ? 382 CYS A CB    1 
ATOM   72   S  SG    . CYS A 1 13  ? 31.508 33.204 22.778  1.00 31.17 ? 382 CYS A SG    1 
ATOM   73   N  N     . GLY A 1 14  ? 30.202 36.233 24.325  1.00 29.73 ? 383 GLY A N     1 
ATOM   74   C  CA    . GLY A 1 14  ? 30.018 36.585 25.717  1.00 28.77 ? 383 GLY A CA    1 
ATOM   75   C  C     . GLY A 1 14  ? 30.615 35.628 26.726  1.00 27.88 ? 383 GLY A C     1 
ATOM   76   O  O     . GLY A 1 14  ? 30.394 35.812 27.930  1.00 28.74 ? 383 GLY A O     1 
ATOM   77   N  N     . LYS A 1 15  ? 31.364 34.621 26.285  1.00 26.00 ? 384 LYS A N     1 
ATOM   78   C  CA    . LYS A 1 15  ? 31.933 33.652 27.210  1.00 25.54 ? 384 LYS A CA    1 
ATOM   79   C  C     . LYS A 1 15  ? 33.047 34.282 28.041  1.00 25.91 ? 384 LYS A C     1 
ATOM   80   O  O     . LYS A 1 15  ? 33.760 35.183 27.590  1.00 26.37 ? 384 LYS A O     1 
ATOM   81   C  CB    . LYS A 1 15  ? 32.464 32.437 26.451  1.00 28.55 ? 384 LYS A CB    1 
ATOM   82   C  CG    . LYS A 1 15  ? 31.369 31.535 25.905  1.00 31.76 ? 384 LYS A CG    1 
ATOM   83   C  CD    . LYS A 1 15  ? 31.939 30.377 25.106  1.00 35.40 ? 384 LYS A CD    1 
ATOM   84   C  CE    . LYS A 1 15  ? 30.831 29.486 24.567  1.00 39.78 ? 384 LYS A CE    1 
ATOM   85   N  NZ    . LYS A 1 15  ? 31.363 28.378 23.726  1.00 43.85 ? 384 LYS A NZ    1 
ATOM   86   N  N     . TYR A 1 16  ? 33.188 33.793 29.269  1.00 23.72 ? 385 TYR A N     1 
ATOM   87   C  CA    . TYR A 1 16  ? 34.140 34.327 30.230  1.00 20.58 ? 385 TYR A CA    1 
ATOM   88   C  C     . TYR A 1 16  ? 35.394 33.465 30.288  1.00 20.72 ? 385 TYR A C     1 
ATOM   89   O  O     . TYR A 1 16  ? 35.352 32.254 30.056  1.00 20.65 ? 385 TYR A O     1 
ATOM   90   C  CB    . TYR A 1 16  ? 33.516 34.394 31.623  1.00 19.98 ? 385 TYR A CB    1 
ATOM   91   C  CG    . TYR A 1 16  ? 32.621 35.588 31.840  1.00 21.94 ? 385 TYR A CG    1 
ATOM   92   C  CD1   . TYR A 1 16  ? 33.071 36.695 32.548  1.00 20.54 ? 385 TYR A CD1   1 
ATOM   93   C  CD2   . TYR A 1 16  ? 31.328 35.611 31.339  1.00 21.29 ? 385 TYR A CD2   1 
ATOM   94   C  CE1   . TYR A 1 16  ? 32.255 37.791 32.754  1.00 21.84 ? 385 TYR A CE1   1 
ATOM   95   C  CE2   . TYR A 1 16  ? 30.505 36.701 31.538  1.00 22.31 ? 385 TYR A CE2   1 
ATOM   96   C  CZ    . TYR A 1 16  ? 30.973 37.788 32.245  1.00 24.51 ? 385 TYR A CZ    1 
ATOM   97   O  OH    . TYR A 1 16  ? 30.153 38.875 32.444  1.00 25.98 ? 385 TYR A OH    1 
ATOM   98   N  N     . PHE A 1 17  ? 36.515 34.110 30.606  1.00 18.77 ? 386 PHE A N     1 
ATOM   99   C  CA    . PHE A 1 17  ? 37.796 33.432 30.732  1.00 20.53 ? 386 PHE A CA    1 
ATOM   100  C  C     . PHE A 1 17  ? 38.605 34.103 31.829  1.00 22.90 ? 386 PHE A C     1 
ATOM   101  O  O     . PHE A 1 17  ? 38.521 35.317 32.028  1.00 21.73 ? 386 PHE A O     1 
ATOM   102  C  CB    . PHE A 1 17  ? 38.577 33.445 29.413  1.00 21.88 ? 386 PHE A CB    1 
ATOM   103  C  CG    . PHE A 1 17  ? 37.814 32.861 28.264  1.00 22.50 ? 386 PHE A CG    1 
ATOM   104  C  CD1   . PHE A 1 17  ? 37.825 31.496 28.033  1.00 25.46 ? 386 PHE A CD1   1 
ATOM   105  C  CD2   . PHE A 1 17  ? 37.066 33.673 27.430  1.00 21.03 ? 386 PHE A CD2   1 
ATOM   106  C  CE1   . PHE A 1 17  ? 37.113 30.954 26.984  1.00 27.19 ? 386 PHE A CE1   1 
ATOM   107  C  CE2   . PHE A 1 17  ? 36.351 33.138 26.381  1.00 22.42 ? 386 PHE A CE2   1 
ATOM   108  C  CZ    . PHE A 1 17  ? 36.372 31.778 26.158  1.00 25.61 ? 386 PHE A CZ    1 
ATOM   109  N  N     . SER A 1 18  ? 39.390 33.295 32.542  1.00 23.79 ? 387 SER A N     1 
ATOM   110  C  CA    . SER A 1 18  ? 40.190 33.812 33.644  1.00 26.36 ? 387 SER A CA    1 
ATOM   111  C  C     . SER A 1 18  ? 41.514 34.410 33.185  1.00 26.38 ? 387 SER A C     1 
ATOM   112  O  O     . SER A 1 18  ? 42.083 35.243 33.899  1.00 26.69 ? 387 SER A O     1 
ATOM   113  C  CB    . SER A 1 18  ? 40.444 32.709 34.674  1.00 30.77 ? 387 SER A CB    1 
ATOM   114  O  OG    . SER A 1 18  ? 41.191 31.648 34.108  1.00 35.67 ? 387 SER A OG    1 
ATOM   115  N  N     A GLN A 1 19  ? 42.018 34.011 32.019  0.50 26.37 ? 388 GLN A N     1 
ATOM   116  N  N     B GLN A 1 19  ? 42.007 34.014 32.012  0.50 26.36 ? 388 GLN A N     1 
ATOM   117  C  CA    A GLN A 1 19  ? 43.286 34.509 31.511  0.50 27.12 ? 388 GLN A CA    1 
ATOM   118  C  CA    B GLN A 1 19  ? 43.281 34.483 31.491  0.50 27.13 ? 388 GLN A CA    1 
ATOM   119  C  C     A GLN A 1 19  ? 43.109 35.014 30.087  0.50 26.64 ? 388 GLN A C     1 
ATOM   120  C  C     B GLN A 1 19  ? 43.083 35.035 30.088  0.50 26.61 ? 388 GLN A C     1 
ATOM   121  O  O     A GLN A 1 19  ? 42.281 34.504 29.328  0.50 26.30 ? 388 GLN A O     1 
ATOM   122  O  O     B GLN A 1 19  ? 42.214 34.577 29.341  0.50 26.48 ? 388 GLN A O     1 
ATOM   123  C  CB    A GLN A 1 19  ? 44.377 33.427 31.546  0.50 29.97 ? 388 GLN A CB    1 
ATOM   124  C  CB    B GLN A 1 19  ? 44.308 33.344 31.442  0.50 29.92 ? 388 GLN A CB    1 
ATOM   125  C  CG    A GLN A 1 19  ? 44.585 32.795 32.917  0.50 30.90 ? 388 GLN A CG    1 
ATOM   126  C  CG    B GLN A 1 19  ? 44.512 32.638 32.772  0.50 30.95 ? 388 GLN A CG    1 
ATOM   127  C  CD    A GLN A 1 19  ? 45.026 33.795 33.971  0.50 31.88 ? 388 GLN A CD    1 
ATOM   128  C  CD    B GLN A 1 19  ? 45.300 31.350 32.633  0.50 33.51 ? 388 GLN A CD    1 
ATOM   129  O  OE1   A GLN A 1 19  ? 45.608 34.834 33.657  0.50 33.40 ? 388 GLN A OE1   1 
ATOM   130  O  OE1   B GLN A 1 19  ? 45.607 30.913 31.525  0.50 34.67 ? 388 GLN A OE1   1 
ATOM   131  N  NE2   A GLN A 1 19  ? 44.749 33.484 35.232  0.50 33.38 ? 388 GLN A NE2   1 
ATOM   132  N  NE2   B GLN A 1 19  ? 45.630 30.735 33.762  0.50 34.54 ? 388 GLN A NE2   1 
ATOM   133  N  N     . LYS A 1 20  ? 43.900 36.032 29.737  1.00 27.43 ? 389 LYS A N     1 
ATOM   134  C  CA    . LYS A 1 20  ? 43.815 36.611 28.400  1.00 27.03 ? 389 LYS A CA    1 
ATOM   135  C  C     . LYS A 1 20  ? 44.214 35.606 27.328  1.00 25.25 ? 389 LYS A C     1 
ATOM   136  O  O     . LYS A 1 20  ? 43.655 35.622 26.225  1.00 25.59 ? 389 LYS A O     1 
ATOM   137  C  CB    . LYS A 1 20  ? 44.676 37.873 28.309  1.00 31.44 ? 389 LYS A CB    1 
ATOM   138  C  CG    . LYS A 1 20  ? 44.691 38.516 26.923  1.00 33.16 ? 389 LYS A CG    1 
ATOM   139  C  CD    . LYS A 1 20  ? 45.604 39.732 26.867  1.00 37.16 ? 389 LYS A CD    1 
ATOM   140  C  CE    . LYS A 1 20  ? 45.029 40.902 27.651  1.00 37.66 ? 389 LYS A CE    1 
ATOM   141  N  NZ    . LYS A 1 20  ? 45.873 42.122 27.523  1.00 40.17 ? 389 LYS A NZ    1 
ATOM   142  N  N     . ARG A 1 21  ? 45.171 34.724 27.632  1.00 25.59 ? 390 ARG A N     1 
ATOM   143  C  CA    . ARG A 1 21  ? 45.571 33.704 26.668  1.00 27.88 ? 390 ARG A CA    1 
ATOM   144  C  C     . ARG A 1 21  ? 44.436 32.730 26.379  1.00 26.62 ? 390 ARG A C     1 
ATOM   145  O  O     . ARG A 1 21  ? 44.341 32.198 25.267  1.00 28.02 ? 390 ARG A O     1 
ATOM   146  C  CB    . ARG A 1 21  ? 46.809 32.961 27.173  1.00 32.56 ? 390 ARG A CB    1 
ATOM   147  C  CG    . ARG A 1 21  ? 46.571 32.147 28.436  1.00 35.97 ? 390 ARG A CG    1 
ATOM   148  C  CD    . ARG A 1 21  ? 47.832 31.428 28.893  1.00 43.28 ? 390 ARG A CD    1 
ATOM   149  N  NE    . ARG A 1 21  ? 48.867 32.358 29.338  1.00 48.01 ? 390 ARG A NE    1 
ATOM   150  C  CZ    . ARG A 1 21  ? 48.944 32.860 30.567  1.00 51.21 ? 390 ARG A CZ    1 
ATOM   151  N  NH1   . ARG A 1 21  ? 48.043 32.528 31.482  1.00 50.29 ? 390 ARG A NH1   1 
ATOM   152  N  NH2   . ARG A 1 21  ? 49.922 33.698 30.883  1.00 55.58 ? 390 ARG A NH2   1 
ATOM   153  N  N     . GLN A 1 22  ? 43.566 32.486 27.362  1.00 24.97 ? 391 GLN A N     1 
ATOM   154  C  CA    . GLN A 1 22  ? 42.419 31.615 27.134  1.00 24.16 ? 391 GLN A CA    1 
ATOM   155  C  C     . GLN A 1 22  ? 41.407 32.277 26.209  1.00 22.00 ? 391 GLN A C     1 
ATOM   156  O  O     . GLN A 1 22  ? 40.817 31.614 25.349  1.00 21.30 ? 391 GLN A O     1 
ATOM   157  C  CB    . GLN A 1 22  ? 41.771 31.246 28.467  1.00 24.59 ? 391 GLN A CB    1 
ATOM   158  C  CG    . GLN A 1 22  ? 42.685 30.486 29.416  1.00 26.73 ? 391 GLN A CG    1 
ATOM   159  C  CD    . GLN A 1 22  ? 42.068 30.294 30.787  1.00 30.15 ? 391 GLN A CD    1 
ATOM   160  O  OE1   . GLN A 1 22  ? 41.302 31.134 31.257  1.00 29.04 ? 391 GLN A OE1   1 
ATOM   161  N  NE2   . GLN A 1 22  ? 42.396 29.181 31.434  1.00 31.80 ? 391 GLN A NE2   1 
ATOM   162  N  N     . LEU A 1 23  ? 41.194 33.584 26.374  1.00 19.46 ? 392 LEU A N     1 
ATOM   163  C  CA    . LEU A 1 23  ? 40.292 34.305 25.483  1.00 19.87 ? 392 LEU A CA    1 
ATOM   164  C  C     . LEU A 1 23  ? 40.841 34.353 24.064  1.00 22.58 ? 392 LEU A C     1 
ATOM   165  O  O     . LEU A 1 23  ? 40.088 34.196 23.096  1.00 23.72 ? 392 LEU A O     1 
ATOM   166  C  CB    . LEU A 1 23  ? 40.056 35.718 26.016  1.00 17.73 ? 392 LEU A CB    1 
ATOM   167  C  CG    . LEU A 1 23  ? 39.326 36.684 25.080  1.00 18.57 ? 392 LEU A CG    1 
ATOM   168  C  CD1   . LEU A 1 23  ? 37.925 36.180 24.774  1.00 18.69 ? 392 LEU A CD1   1 
ATOM   169  C  CD2   . LEU A 1 23  ? 39.282 38.085 25.673  1.00 19.25 ? 392 LEU A CD2   1 
ATOM   170  N  N     . LYS A 1 24  ? 42.151 34.567 23.922  1.00 24.95 ? 393 LYS A N     1 
ATOM   171  C  CA    . LYS A 1 24  ? 42.751 34.639 22.594  1.00 26.34 ? 393 LYS A CA    1 
ATOM   172  C  C     . LYS A 1 24  ? 42.650 33.304 21.868  1.00 26.78 ? 393 LYS A C     1 
ATOM   173  O  O     . LYS A 1 24  ? 42.407 33.264 20.656  1.00 27.17 ? 393 LYS A O     1 
ATOM   174  C  CB    . LYS A 1 24  ? 44.206 35.094 22.704  1.00 30.47 ? 393 LYS A CB    1 
ATOM   175  C  CG    . LYS A 1 24  ? 44.924 35.203 21.370  1.00 35.36 ? 393 LYS A CG    1 
ATOM   176  C  CD    . LYS A 1 24  ? 46.280 35.872 21.522  1.00 39.81 ? 393 LYS A CD    1 
ATOM   177  C  CE    . LYS A 1 24  ? 46.957 36.053 20.172  1.00 43.73 ? 393 LYS A CE    1 
ATOM   178  N  NZ    . LYS A 1 24  ? 48.213 36.847 20.276  1.00 48.78 ? 393 LYS A NZ    1 
ATOM   179  N  N     . SER A 1 25  ? 42.829 32.199 22.594  1.00 26.98 ? 394 SER A N     1 
ATOM   180  C  CA    . SER A 1 25  ? 42.708 30.882 21.976  1.00 27.25 ? 394 SER A CA    1 
ATOM   181  C  C     . SER A 1 25  ? 41.272 30.599 21.555  1.00 25.94 ? 394 SER A C     1 
ATOM   182  O  O     . SER A 1 25  ? 41.034 30.025 20.486  1.00 27.55 ? 394 SER A O     1 
ATOM   183  C  CB    . SER A 1 25  ? 43.216 29.807 22.936  1.00 30.22 ? 394 SER A CB    1 
ATOM   184  O  OG    . SER A 1 25  ? 43.172 28.522 22.340  1.00 32.56 ? 394 SER A OG    1 
ATOM   185  N  N     . HIS A 1 26  ? 40.302 30.998 22.381  1.00 25.22 ? 395 HIS A N     1 
ATOM   186  C  CA    . HIS A 1 26  ? 38.901 30.787 22.034  1.00 26.11 ? 395 HIS A CA    1 
ATOM   187  C  C     . HIS A 1 26  ? 38.477 31.657 20.858  1.00 27.15 ? 395 HIS A C     1 
ATOM   188  O  O     . HIS A 1 26  ? 37.678 31.225 20.019  1.00 29.38 ? 395 HIS A O     1 
ATOM   189  C  CB    . HIS A 1 26  ? 38.013 31.072 23.243  1.00 27.11 ? 395 HIS A CB    1 
ATOM   190  C  CG    . HIS A 1 26  ? 36.607 31.443 22.884  1.00 28.24 ? 395 HIS A CG    1 
ATOM   191  N  ND1   . HIS A 1 26  ? 35.648 30.507 22.561  1.00 29.89 ? 395 HIS A ND1   1 
ATOM   192  C  CD2   . HIS A 1 26  ? 36.001 32.651 22.784  1.00 27.91 ? 395 HIS A CD2   1 
ATOM   193  C  CE1   . HIS A 1 26  ? 34.511 31.121 22.285  1.00 29.80 ? 395 HIS A CE1   1 
ATOM   194  N  NE2   . HIS A 1 26  ? 34.698 32.422 22.411  1.00 31.67 ? 395 HIS A NE2   1 
ATOM   195  N  N     . TYR A 1 27  ? 39.000 32.885 20.780  1.00 24.81 ? 396 TYR A N     1 
ATOM   196  C  CA    . TYR A 1 27  ? 38.587 33.823 19.741  1.00 24.01 ? 396 TYR A CA    1 
ATOM   197  C  C     . TYR A 1 27  ? 38.877 33.305 18.340  1.00 26.91 ? 396 TYR A C     1 
ATOM   198  O  O     . TYR A 1 27  ? 38.350 33.854 17.367  1.00 30.82 ? 396 TYR A O     1 
ATOM   199  C  CB    . TYR A 1 27  ? 39.273 35.173 19.958  1.00 24.70 ? 396 TYR A CB    1 
ATOM   200  C  CG    . TYR A 1 27  ? 38.452 36.366 19.525  1.00 26.13 ? 396 TYR A CG    1 
ATOM   201  C  CD1   . TYR A 1 27  ? 37.390 36.816 20.298  1.00 26.84 ? 396 TYR A CD1   1 
ATOM   202  C  CD2   . TYR A 1 27  ? 38.744 37.050 18.352  1.00 29.07 ? 396 TYR A CD2   1 
ATOM   203  C  CE1   . TYR A 1 27  ? 36.636 37.909 19.912  1.00 27.11 ? 396 TYR A CE1   1 
ATOM   204  C  CE2   . TYR A 1 27  ? 37.996 38.145 17.957  1.00 30.28 ? 396 TYR A CE2   1 
ATOM   205  C  CZ    . TYR A 1 27  ? 36.942 38.570 18.742  1.00 29.90 ? 396 TYR A CZ    1 
ATOM   206  O  OH    . TYR A 1 27  ? 36.190 39.659 18.362  1.00 32.80 ? 396 TYR A OH    1 
ATOM   207  N  N     . ARG A 1 28  ? 39.690 32.257 18.216  1.00 24.92 ? 397 ARG A N     1 
ATOM   208  C  CA    . ARG A 1 28  ? 39.963 31.690 16.904  1.00 27.58 ? 397 ARG A CA    1 
ATOM   209  C  C     . ARG A 1 28  ? 38.706 31.124 16.260  1.00 28.61 ? 397 ARG A C     1 
ATOM   210  O  O     . ARG A 1 28  ? 38.595 31.113 15.030  1.00 31.61 ? 397 ARG A O     1 
ATOM   211  C  CB    . ARG A 1 28  ? 41.016 30.597 17.035  1.00 29.16 ? 397 ARG A CB    1 
ATOM   212  C  CG    . ARG A 1 28  ? 42.349 31.081 17.575  1.00 29.72 ? 397 ARG A CG    1 
ATOM   213  C  CD    . ARG A 1 28  ? 43.299 29.906 17.723  1.00 33.58 ? 397 ARG A CD    1 
ATOM   214  N  NE    . ARG A 1 28  ? 42.984 29.079 18.879  1.00 37.76 ? 397 ARG A NE    1 
ATOM   215  C  CZ    . ARG A 1 28  ? 43.338 27.798 18.987  1.00 43.02 ? 397 ARG A CZ    1 
ATOM   216  N  NH1   . ARG A 1 28  ? 44.010 27.173 18.003  1.00 46.54 ? 397 ARG A NH1   1 
ATOM   217  N  NH2   . ARG A 1 28  ? 43.017 27.124 20.084  1.00 44.12 ? 397 ARG A NH2   1 
ATOM   218  N  N     . VAL A 1 29  ? 37.760 30.634 17.067  1.00 28.43 ? 398 VAL A N     1 
ATOM   219  C  CA    . VAL A 1 29  ? 36.548 30.035 16.515  1.00 32.55 ? 398 VAL A CA    1 
ATOM   220  C  C     . VAL A 1 29  ? 35.699 31.058 15.769  1.00 31.78 ? 398 VAL A C     1 
ATOM   221  O  O     . VAL A 1 29  ? 34.891 30.683 14.909  1.00 33.80 ? 398 VAL A O     1 
ATOM   222  C  CB    . VAL A 1 29  ? 35.740 29.289 17.596  1.00 33.00 ? 398 VAL A CB    1 
ATOM   223  C  CG1   . VAL A 1 29  ? 36.639 28.365 18.406  1.00 32.62 ? 398 VAL A CG1   1 
ATOM   224  C  CG2   . VAL A 1 29  ? 35.014 30.286 18.489  1.00 30.22 ? 398 VAL A CG2   1 
ATOM   225  N  N     . HIS A 1 30  ? 35.861 32.345 16.073  1.00 29.94 ? 399 HIS A N     1 
ATOM   226  C  CA    . HIS A 1 30  ? 35.101 33.377 15.381  1.00 32.22 ? 399 HIS A CA    1 
ATOM   227  C  C     . HIS A 1 30  ? 35.851 33.943 14.181  1.00 35.46 ? 399 HIS A C     1 
ATOM   228  O  O     . HIS A 1 30  ? 35.233 34.272 13.162  1.00 39.32 ? 399 HIS A O     1 
ATOM   229  C  CB    . HIS A 1 30  ? 34.757 34.515 16.342  1.00 32.07 ? 399 HIS A CB    1 
ATOM   230  C  CG    . HIS A 1 30  ? 34.031 34.072 17.572  1.00 36.05 ? 399 HIS A CG    1 
ATOM   231  N  ND1   . HIS A 1 30  ? 32.766 33.527 17.535  1.00 38.94 ? 399 HIS A ND1   1 
ATOM   232  C  CD2   . HIS A 1 30  ? 34.391 34.100 18.877  1.00 35.33 ? 399 HIS A CD2   1 
ATOM   233  C  CE1   . HIS A 1 30  ? 32.378 33.237 18.764  1.00 37.51 ? 399 HIS A CE1   1 
ATOM   234  N  NE2   . HIS A 1 30  ? 33.345 33.576 19.597  1.00 37.03 ? 399 HIS A NE2   1 
ATOM   235  N  N     . THR A 1 31  ? 37.174 34.057 14.283  1.00 31.61 ? 400 THR A N     1 
ATOM   236  C  CA    . THR A 1 31  ? 37.979 34.631 13.216  1.00 33.08 ? 400 THR A CA    1 
ATOM   237  C  C     . THR A 1 31  ? 38.552 33.587 12.270  1.00 32.82 ? 400 THR A C     1 
ATOM   238  O  O     . THR A 1 31  ? 38.870 33.920 11.123  1.00 33.79 ? 400 THR A O     1 
ATOM   239  C  CB    . THR A 1 31  ? 39.140 35.433 13.811  1.00 34.79 ? 400 THR A CB    1 
ATOM   240  O  OG1   . THR A 1 31  ? 40.039 34.543 14.486  1.00 34.05 ? 400 THR A OG1   1 
ATOM   241  C  CG2   . THR A 1 31  ? 38.623 36.461 14.805  1.00 36.86 ? 400 THR A CG2   1 
ATOM   242  N  N     . GLY A 1 32  ? 38.692 32.340 12.718  1.00 30.39 ? 401 GLY A N     1 
ATOM   243  C  CA    . GLY A 1 32  ? 39.356 31.321 11.940  1.00 29.66 ? 401 GLY A CA    1 
ATOM   244  C  C     . GLY A 1 32  ? 40.866 31.372 11.983  1.00 30.09 ? 401 GLY A C     1 
ATOM   245  O  O     . GLY A 1 32  ? 41.511 30.439 11.493  1.00 29.71 ? 401 GLY A O     1 
ATOM   246  N  N     . HIS A 1 33  ? 41.452 32.423 12.554  1.00 30.68 ? 402 HIS A N     1 
ATOM   247  C  CA    . HIS A 1 33  ? 42.903 32.538 12.616  1.00 32.88 ? 402 HIS A CA    1 
ATOM   248  C  C     . HIS A 1 33  ? 43.491 31.376 13.407  1.00 30.54 ? 402 HIS A C     1 
ATOM   249  O  O     . HIS A 1 33  ? 43.044 31.073 14.515  1.00 29.56 ? 402 HIS A O     1 
ATOM   250  C  CB    . HIS A 1 33  ? 43.288 33.862 13.278  1.00 38.37 ? 402 HIS A CB    1 
ATOM   251  C  CG    . HIS A 1 33  ? 42.794 35.074 12.549  1.00 45.89 ? 402 HIS A CG    1 
ATOM   252  N  ND1   . HIS A 1 33  ? 42.257 35.017 11.281  1.00 47.16 ? 402 HIS A ND1   1 
ATOM   253  C  CD2   . HIS A 1 33  ? 42.759 36.378 12.913  1.00 50.15 ? 402 HIS A CD2   1 
ATOM   254  C  CE1   . HIS A 1 33  ? 41.912 36.234 10.896  1.00 49.41 ? 402 HIS A CE1   1 
ATOM   255  N  NE2   . HIS A 1 33  ? 42.207 37.077 11.868  1.00 51.83 ? 402 HIS A NE2   1 
ATOM   256  N  N     . SER A 1 34  ? 44.488 30.714 12.821  1.00 30.03 ? 403 SER A N     1 
ATOM   257  C  CA    . SER A 1 34  ? 45.252 29.647 13.462  1.00 29.22 ? 403 SER A CA    1 
ATOM   258  C  C     . SER A 1 34  ? 44.420 28.412 13.798  1.00 26.52 ? 403 SER A C     1 
ATOM   259  O  O     . SER A 1 34  ? 44.816 27.617 14.656  1.00 29.27 ? 403 SER A O     1 
ATOM   260  C  CB    . SER A 1 34  ? 46.034 30.141 14.687  1.00 33.23 ? 403 SER A CB    1 
ATOM   261  O  OG    . SER A 1 34  ? 46.896 31.216 14.347  1.00 37.85 ? 403 SER A OG    1 
ATOM   262  N  N     . LEU A 1 35  ? 43.276 28.228 13.150  1.00 20.55 ? 404 LEU A N     1 
ATOM   263  C  CA    . LEU A 1 35  ? 42.533 26.989 13.306  1.00 19.88 ? 404 LEU A CA    1 
ATOM   264  C  C     . LEU A 1 35  ? 43.170 25.902 12.448  1.00 19.25 ? 404 LEU A C     1 
ATOM   265  O  O     . LEU A 1 35  ? 43.891 26.201 11.493  1.00 22.59 ? 404 LEU A O     1 
ATOM   266  C  CB    . LEU A 1 35  ? 41.082 27.191 12.879  1.00 18.55 ? 404 LEU A CB    1 
ATOM   267  C  CG    . LEU A 1 35  ? 40.164 27.930 13.852  1.00 19.26 ? 404 LEU A CG    1 
ATOM   268  C  CD1   . LEU A 1 35  ? 38.735 27.941 13.330  1.00 17.03 ? 404 LEU A CD1   1 
ATOM   269  C  CD2   . LEU A 1 35  ? 40.228 27.299 15.236  1.00 19.56 ? 404 LEU A CD2   1 
ATOM   270  N  N     . PRO A 1 36  ? 42.945 24.632 12.783  1.00 16.55 ? 405 PRO A N     1 
ATOM   271  C  CA    . PRO A 1 36  ? 43.453 23.545 11.935  1.00 17.24 ? 405 PRO A CA    1 
ATOM   272  C  C     . PRO A 1 36  ? 43.005 23.711 10.491  1.00 16.86 ? 405 PRO A C     1 
ATOM   273  O  O     . PRO A 1 36  ? 41.812 23.809 10.196  1.00 16.25 ? 405 PRO A O     1 
ATOM   274  C  CB    . PRO A 1 36  ? 42.849 22.293 12.576  1.00 19.86 ? 405 PRO A CB    1 
ATOM   275  C  CG    . PRO A 1 36  ? 42.717 22.656 14.013  1.00 19.04 ? 405 PRO A CG    1 
ATOM   276  C  CD    . PRO A 1 36  ? 42.355 24.119 14.033  1.00 18.89 ? 405 PRO A CD    1 
ATOM   277  N  N     . GLU A 1 37  ? 43.980 23.746 9.586   1.00 17.15 ? 406 GLU A N     1 
ATOM   278  C  CA    . GLU A 1 37  ? 43.754 24.056 8.181   1.00 15.95 ? 406 GLU A CA    1 
ATOM   279  C  C     . GLU A 1 37  ? 44.117 22.849 7.329   1.00 16.49 ? 406 GLU A C     1 
ATOM   280  O  O     . GLU A 1 37  ? 45.217 22.300 7.457   1.00 18.14 ? 406 GLU A O     1 
ATOM   281  C  CB    . GLU A 1 37  ? 44.603 25.261 7.768   1.00 18.87 ? 406 GLU A CB    1 
ATOM   282  C  CG    . GLU A 1 37  ? 44.554 25.596 6.289   1.00 20.22 ? 406 GLU A CG    1 
ATOM   283  C  CD    . GLU A 1 37  ? 45.338 26.853 5.958   1.00 25.98 ? 406 GLU A CD    1 
ATOM   284  O  OE1   . GLU A 1 37  ? 45.547 27.684 6.867   1.00 28.94 ? 406 GLU A OE1   1 
ATOM   285  O  OE2   . GLU A 1 37  ? 45.750 27.007 4.789   1.00 25.97 ? 406 GLU A OE2   1 
ATOM   286  N  N     . CYS A 1 38  ? 43.193 22.443 6.463   1.00 13.59 ? 407 CYS A N     1 
ATOM   287  C  CA    . CYS A 1 38  ? 43.441 21.327 5.561   1.00 16.32 ? 407 CYS A CA    1 
ATOM   288  C  C     . CYS A 1 38  ? 44.519 21.708 4.553   1.00 15.58 ? 407 CYS A C     1 
ATOM   289  O  O     . CYS A 1 38  ? 44.473 22.788 3.960   1.00 15.87 ? 407 CYS A O     1 
ATOM   290  C  CB    . CYS A 1 38  ? 42.146 20.969 4.833   1.00 15.43 ? 407 CYS A CB    1 
ATOM   291  S  SG    . CYS A 1 38  ? 42.283 19.635 3.621   1.00 15.35 ? 407 CYS A SG    1 
ATOM   292  N  N     . SER A 1 39  ? 45.499 20.824 4.360   1.00 15.49 ? 408 SER A N     1 
ATOM   293  C  CA    . SER A 1 39  ? 46.569 21.118 3.413   1.00 16.86 ? 408 SER A CA    1 
ATOM   294  C  C     . SER A 1 39  ? 46.114 20.993 1.964   1.00 19.32 ? 408 SER A C     1 
ATOM   295  O  O     . SER A 1 39  ? 46.797 21.496 1.066   1.00 20.46 ? 408 SER A O     1 
ATOM   296  C  CB    . SER A 1 39  ? 47.769 20.206 3.670   1.00 18.67 ? 408 SER A CB    1 
ATOM   297  O  OG    . SER A 1 39  ? 47.414 18.843 3.512   1.00 19.00 ? 408 SER A OG    1 
ATOM   298  N  N     . HIS A 1 40  ? 44.971 20.350 1.719   1.00 16.30 ? 409 HIS A N     1 
ATOM   299  C  CA    A HIS A 1 40  ? 44.497 20.143 0.353   0.50 19.08 ? 409 HIS A CA    1 
ATOM   300  C  CA    B HIS A 1 40  ? 44.509 20.152 0.349   0.50 19.07 ? 409 HIS A CA    1 
ATOM   301  C  C     . HIS A 1 40  ? 43.698 21.343 -0.148  1.00 20.84 ? 409 HIS A C     1 
ATOM   302  O  O     . HIS A 1 40  ? 44.026 21.936 -1.181  1.00 24.00 ? 409 HIS A O     1 
ATOM   303  C  CB    A HIS A 1 40  ? 43.656 18.864 0.291   0.50 19.20 ? 409 HIS A CB    1 
ATOM   304  C  CB    B HIS A 1 40  ? 43.704 18.854 0.244   0.50 19.26 ? 409 HIS A CB    1 
ATOM   305  C  CG    A HIS A 1 40  ? 43.307 18.431 -1.099  0.50 22.64 ? 409 HIS A CG    1 
ATOM   306  C  CG    B HIS A 1 40  ? 44.487 17.627 0.598   0.50 20.68 ? 409 HIS A CG    1 
ATOM   307  N  ND1   A HIS A 1 40  ? 42.436 19.133 -1.903  0.50 25.38 ? 409 HIS A ND1   1 
ATOM   308  N  ND1   B HIS A 1 40  ? 45.527 17.159 -0.176  0.50 24.16 ? 409 HIS A ND1   1 
ATOM   309  C  CD2   A HIS A 1 40  ? 43.699 17.354 -1.821  0.50 24.62 ? 409 HIS A CD2   1 
ATOM   310  C  CD2   B HIS A 1 40  ? 44.381 16.773 1.643   0.50 20.68 ? 409 HIS A CD2   1 
ATOM   311  C  CE1   A HIS A 1 40  ? 42.313 18.514 -3.063  0.50 28.03 ? 409 HIS A CE1   1 
ATOM   312  C  CE1   B HIS A 1 40  ? 46.029 16.069 0.377   0.50 22.74 ? 409 HIS A CE1   1 
ATOM   313  N  NE2   A HIS A 1 40  ? 43.069 17.431 -3.039  0.50 27.35 ? 409 HIS A NE2   1 
ATOM   314  N  NE2   B HIS A 1 40  ? 45.351 15.813 1.482   0.50 20.92 ? 409 HIS A NE2   1 
ATOM   315  N  N     . CYS A 1 41  ? 42.639 21.713 0.576   1.00 19.07 ? 410 CYS A N     1 
ATOM   316  C  CA    . CYS A 1 41  ? 41.765 22.803 0.162   1.00 20.64 ? 410 CYS A CA    1 
ATOM   317  C  C     . CYS A 1 41  ? 41.938 24.078 0.973   1.00 23.17 ? 410 CYS A C     1 
ATOM   318  O  O     . CYS A 1 41  ? 41.386 25.114 0.586   1.00 22.57 ? 410 CYS A O     1 
ATOM   319  C  CB    . CYS A 1 41  ? 40.295 22.367 0.233   1.00 20.67 ? 410 CYS A CB    1 
ATOM   320  S  SG    . CYS A 1 41  ? 39.709 22.028 1.911   1.00 20.19 ? 410 CYS A SG    1 
ATOM   321  N  N     . HIS A 1 42  ? 42.661 24.029 2.090   1.00 20.19 ? 411 HIS A N     1 
ATOM   322  C  CA    . HIS A 1 42  ? 42.967 25.196 2.913   1.00 21.62 ? 411 HIS A CA    1 
ATOM   323  C  C     . HIS A 1 42  ? 41.753 25.780 3.623   1.00 21.97 ? 411 HIS A C     1 
ATOM   324  O  O     . HIS A 1 42  ? 41.797 26.922 4.088   1.00 21.60 ? 411 HIS A O     1 
ATOM   325  C  CB    . HIS A 1 42  ? 43.769 26.257 2.153   1.00 25.33 ? 411 HIS A CB    1 
ATOM   326  C  CG    . HIS A 1 42  ? 45.085 25.752 1.658   1.00 29.32 ? 411 HIS A CG    1 
ATOM   327  N  ND1   . HIS A 1 42  ? 46.134 25.473 2.506   1.00 30.38 ? 411 HIS A ND1   1 
ATOM   328  C  CD2   . HIS A 1 42  ? 45.516 25.444 0.411   1.00 32.98 ? 411 HIS A CD2   1 
ATOM   329  C  CE1   . HIS A 1 42  ? 47.159 25.029 1.803   1.00 32.83 ? 411 HIS A CE1   1 
ATOM   330  N  NE2   . HIS A 1 42  ? 46.811 25.002 0.529   1.00 34.27 ? 411 HIS A NE2   1 
ATOM   331  N  N     . ARG A 1 43  ? 40.668 25.019 3.723   1.00 19.75 ? 412 ARG A N     1 
ATOM   332  C  CA    . ARG A 1 43  ? 39.579 25.387 4.610   1.00 21.48 ? 412 ARG A CA    1 
ATOM   333  C  C     . ARG A 1 43  ? 39.927 24.975 6.037   1.00 20.38 ? 412 ARG A C     1 
ATOM   334  O  O     . ARG A 1 43  ? 40.755 24.092 6.272   1.00 20.37 ? 412 ARG A O     1 
ATOM   335  C  CB    . ARG A 1 43  ? 38.266 24.741 4.160   1.00 22.13 ? 412 ARG A CB    1 
ATOM   336  C  CG    . ARG A 1 43  ? 37.869 25.111 2.736   1.00 28.63 ? 412 ARG A CG    1 
ATOM   337  C  CD    . ARG A 1 43  ? 36.388 24.873 2.465   1.00 32.93 ? 412 ARG A CD    1 
ATOM   338  N  NE    . ARG A 1 43  ? 36.025 23.459 2.499   1.00 34.39 ? 412 ARG A NE    1 
ATOM   339  C  CZ    . ARG A 1 43  ? 36.127 22.636 1.461   1.00 38.16 ? 412 ARG A CZ    1 
ATOM   340  N  NH1   . ARG A 1 43  ? 36.594 23.081 0.302   1.00 38.76 ? 412 ARG A NH1   1 
ATOM   341  N  NH2   . ARG A 1 43  ? 35.766 21.366 1.581   1.00 38.32 ? 412 ARG A NH2   1 
ATOM   342  N  N     . LYS A 1 44  ? 39.293 25.635 6.997   1.00 18.50 ? 413 LYS A N     1 
ATOM   343  C  CA    . LYS A 1 44  ? 39.659 25.480 8.394   1.00 16.82 ? 413 LYS A CA    1 
ATOM   344  C  C     . LYS A 1 44  ? 38.520 24.857 9.188   1.00 16.80 ? 413 LYS A C     1 
ATOM   345  O  O     . LYS A 1 44  ? 37.348 24.948 8.816   1.00 17.36 ? 413 LYS A O     1 
ATOM   346  C  CB    . LYS A 1 44  ? 40.079 26.819 9.006   1.00 19.84 ? 413 LYS A CB    1 
ATOM   347  C  CG    . LYS A 1 44  ? 41.235 27.467 8.265   1.00 23.74 ? 413 LYS A CG    1 
ATOM   348  C  CD    . LYS A 1 44  ? 41.716 28.712 8.971   1.00 28.97 ? 413 LYS A CD    1 
ATOM   349  C  CE    . LYS A 1 44  ? 42.858 29.378 8.227   1.00 30.64 ? 413 LYS A CE    1 
ATOM   350  N  NZ    . LYS A 1 44  ? 43.366 30.562 8.975   1.00 32.67 ? 413 LYS A NZ    1 
ATOM   351  N  N     . PHE A 1 45  ? 38.889 24.208 10.292  1.00 15.48 ? 414 PHE A N     1 
ATOM   352  C  CA    . PHE A 1 45  ? 37.953 23.447 11.107  1.00 16.97 ? 414 PHE A CA    1 
ATOM   353  C  C     . PHE A 1 45  ? 38.263 23.672 12.581  1.00 17.55 ? 414 PHE A C     1 
ATOM   354  O  O     . PHE A 1 45  ? 39.350 24.124 12.946  1.00 17.89 ? 414 PHE A O     1 
ATOM   355  C  CB    . PHE A 1 45  ? 37.976 21.962 10.723  1.00 16.93 ? 414 PHE A CB    1 
ATOM   356  C  CG    . PHE A 1 45  ? 37.632 21.726 9.285   1.00 17.72 ? 414 PHE A CG    1 
ATOM   357  C  CD1   . PHE A 1 45  ? 36.316 21.543 8.901   1.00 20.50 ? 414 PHE A CD1   1 
ATOM   358  C  CD2   . PHE A 1 45  ? 38.617 21.736 8.310   1.00 17.94 ? 414 PHE A CD2   1 
ATOM   359  C  CE1   . PHE A 1 45  ? 35.988 21.351 7.577   1.00 21.60 ? 414 PHE A CE1   1 
ATOM   360  C  CE2   . PHE A 1 45  ? 38.295 21.548 6.985   1.00 19.97 ? 414 PHE A CE2   1 
ATOM   361  C  CZ    . PHE A 1 45  ? 36.978 21.359 6.618   1.00 21.61 ? 414 PHE A CZ    1 
ATOM   362  N  N     . MET A 1 46  ? 37.283 23.349 13.429  1.00 17.32 ? 415 MET A N     1 
ATOM   363  C  CA    . MET A 1 46  ? 37.344 23.760 14.829  1.00 17.38 ? 415 MET A CA    1 
ATOM   364  C  C     . MET A 1 46  ? 38.409 23.007 15.614  1.00 16.48 ? 415 MET A C     1 
ATOM   365  O  O     . MET A 1 46  ? 39.000 23.571 16.541  1.00 17.81 ? 415 MET A O     1 
ATOM   366  C  CB    . MET A 1 46  ? 35.974 23.606 15.485  1.00 18.64 ? 415 MET A CB    1 
ATOM   367  C  CG    . MET A 1 46  ? 34.913 24.525 14.909  1.00 22.98 ? 415 MET A CG    1 
ATOM   368  S  SD    . MET A 1 46  ? 35.371 26.268 15.016  1.00 27.41 ? 415 MET A SD    1 
ATOM   369  C  CE    . MET A 1 46  ? 33.961 27.040 14.225  1.00 30.76 ? 415 MET A CE    1 
ATOM   370  N  N     . ASP A 1 47  ? 38.661 21.745 15.280  1.00 13.98 ? 416 ASP A N     1 
ATOM   371  C  CA    . ASP A 1 47  ? 39.731 20.997 15.922  1.00 12.81 ? 416 ASP A CA    1 
ATOM   372  C  C     . ASP A 1 47  ? 40.290 19.983 14.931  1.00 14.69 ? 416 ASP A C     1 
ATOM   373  O  O     . ASP A 1 47  ? 39.761 19.800 13.831  1.00 14.50 ? 416 ASP A O     1 
ATOM   374  C  CB    . ASP A 1 47  ? 39.285 20.371 17.255  1.00 14.36 ? 416 ASP A CB    1 
ATOM   375  C  CG    . ASP A 1 47  ? 38.155 19.368 17.092  1.00 14.40 ? 416 ASP A CG    1 
ATOM   376  O  OD1   . ASP A 1 47  ? 38.367 18.333 16.427  1.00 14.05 ? 416 ASP A OD1   1 
ATOM   377  O  OD2   . ASP A 1 47  ? 37.064 19.599 17.659  1.00 16.64 ? 416 ASP A OD2   1 
ATOM   378  N  N     . VAL A 1 48  ? 41.376 19.320 15.336  1.00 11.42 ? 417 VAL A N     1 
ATOM   379  C  CA    . VAL A 1 48  ? 42.064 18.412 14.421  1.00 13.17 ? 417 VAL A CA    1 
ATOM   380  C  C     . VAL A 1 48  ? 41.215 17.189 14.099  1.00 14.85 ? 417 VAL A C     1 
ATOM   381  O  O     . VAL A 1 48  ? 41.371 16.581 13.032  1.00 14.23 ? 417 VAL A O     1 
ATOM   382  C  CB    . VAL A 1 48  ? 43.459 18.035 14.953  1.00 16.29 ? 417 VAL A CB    1 
ATOM   383  C  CG1   . VAL A 1 48  ? 44.284 19.293 15.183  1.00 18.48 ? 417 VAL A CG1   1 
ATOM   384  C  CG2   . VAL A 1 48  ? 43.347 17.223 16.242  1.00 18.31 ? 417 VAL A CG2   1 
ATOM   385  N  N     . SER A 1 49  ? 40.314 16.798 15.002  1.00 15.52 ? 418 SER A N     1 
ATOM   386  C  CA    . SER A 1 49  ? 39.437 15.667 14.714  1.00 12.38 ? 418 SER A CA    1 
ATOM   387  C  C     . SER A 1 49  ? 38.432 16.013 13.624  1.00 15.15 ? 418 SER A C     1 
ATOM   388  O  O     . SER A 1 49  ? 38.137 15.180 12.758  1.00 13.60 ? 418 SER A O     1 
ATOM   389  C  CB    . SER A 1 49  ? 38.719 15.214 15.984  1.00 14.54 ? 418 SER A CB    1 
ATOM   390  O  OG    . SER A 1 49  ? 37.814 14.150 15.735  1.00 14.43 ? 418 SER A OG    1 
ATOM   391  N  N     . GLN A 1 50  ? 37.891 17.233 13.651  1.00 10.52 ? 419 GLN A N     1 
ATOM   392  C  CA    . GLN A 1 50  ? 36.990 17.654 12.583  1.00 12.34 ? 419 GLN A CA    1 
ATOM   393  C  C     . GLN A 1 50  ? 37.733 17.759 11.258  1.00 12.54 ? 419 GLN A C     1 
ATOM   394  O  O     . GLN A 1 50  ? 37.163 17.491 10.194  1.00 12.40 ? 419 GLN A O     1 
ATOM   395  C  CB    . GLN A 1 50  ? 36.329 18.987 12.938  1.00 12.61 ? 419 GLN A CB    1 
ATOM   396  C  CG    . GLN A 1 50  ? 35.946 19.137 14.407  1.00 10.28 ? 419 GLN A CG    1 
ATOM   397  C  CD    . GLN A 1 50  ? 35.021 18.039 14.906  1.00 12.04 ? 419 GLN A CD    1 
ATOM   398  O  OE1   . GLN A 1 50  ? 34.254 17.453 14.141  1.00 13.21 ? 419 GLN A OE1   1 
ATOM   399  N  NE2   . GLN A 1 50  ? 35.089 17.758 16.203  1.00 12.34 ? 419 GLN A NE2   1 
ATOM   400  N  N     . LEU A 1 51  ? 39.010 18.146 11.305  1.00 10.72 ? 420 LEU A N     1 
ATOM   401  C  CA    . LEU A 1 51  ? 39.812 18.187 10.088  1.00 10.27 ? 420 LEU A CA    1 
ATOM   402  C  C     . LEU A 1 51  ? 40.030 16.786 9.534   1.00 12.31 ? 420 LEU A C     1 
ATOM   403  O  O     . LEU A 1 51  ? 39.938 16.568 8.320   1.00 13.68 ? 420 LEU A O     1 
ATOM   404  C  CB    . LEU A 1 51  ? 41.149 18.879 10.366  1.00 12.18 ? 420 LEU A CB    1 
ATOM   405  C  CG    . LEU A 1 51  ? 42.105 19.114 9.190   1.00 16.07 ? 420 LEU A CG    1 
ATOM   406  C  CD1   . LEU A 1 51  ? 42.875 20.399 9.403   1.00 22.68 ? 420 LEU A CD1   1 
ATOM   407  C  CD2   . LEU A 1 51  ? 43.077 17.957 9.008   1.00 17.72 ? 420 LEU A CD2   1 
ATOM   408  N  N     . LYS A 1 52  ? 40.316 15.821 10.411  1.00 12.14 ? 421 LYS A N     1 
ATOM   409  C  CA    . LYS A 1 52  ? 40.524 14.450 9.956   1.00 12.75 ? 421 LYS A CA    1 
ATOM   410  C  C     . LYS A 1 52  ? 39.254 13.868 9.345   1.00 13.09 ? 421 LYS A C     1 
ATOM   411  O  O     . LYS A 1 52  ? 39.323 13.118 8.365   1.00 14.60 ? 421 LYS A O     1 
ATOM   412  C  CB    . LYS A 1 52  ? 41.038 13.580 11.103  1.00 14.86 ? 421 LYS A CB    1 
ATOM   413  C  CG    . LYS A 1 52  ? 42.421 13.962 11.600  1.00 18.76 ? 421 LYS A CG    1 
ATOM   414  C  CD    . LYS A 1 52  ? 42.785 13.179 12.849  1.00 22.18 ? 421 LYS A CD    1 
ATOM   415  C  CE    . LYS A 1 52  ? 44.005 13.766 13.537  1.00 28.02 ? 421 LYS A CE    1 
ATOM   416  N  NZ    . LYS A 1 52  ? 44.372 12.989 14.753  1.00 32.44 ? 421 LYS A NZ    1 
ATOM   417  N  N     . LYS A 1 53  ? 38.088 14.198 9.910   1.00 14.88 ? 422 LYS A N     1 
ATOM   418  C  CA    . LYS A 1 53  ? 36.828 13.813 9.279   1.00 14.15 ? 422 LYS A CA    1 
ATOM   419  C  C     . LYS A 1 53  ? 36.723 14.414 7.885   1.00 14.71 ? 422 LYS A C     1 
ATOM   420  O  O     . LYS A 1 53  ? 36.323 13.739 6.929   1.00 14.58 ? 422 LYS A O     1 
ATOM   421  C  CB    . LYS A 1 53  ? 35.638 14.270 10.130  1.00 16.22 ? 422 LYS A CB    1 
ATOM   422  C  CG    . LYS A 1 53  ? 35.356 13.448 11.378  1.00 20.22 ? 422 LYS A CG    1 
ATOM   423  C  CD    . LYS A 1 53  ? 33.891 13.584 11.815  1.00 22.24 ? 422 LYS A CD    1 
ATOM   424  C  CE    . LYS A 1 53  ? 33.465 15.042 11.957  1.00 21.14 ? 422 LYS A CE    1 
ATOM   425  N  NZ    . LYS A 1 53  ? 32.017 15.191 12.297  1.00 14.14 ? 422 LYS A NZ    1 
ATOM   426  N  N     . HIS A 1 54  ? 37.086 15.690 7.754   1.00 13.15 ? 423 HIS A N     1 
ATOM   427  C  CA    . HIS A 1 54  ? 36.986 16.373 6.470   1.00 13.13 ? 423 HIS A CA    1 
ATOM   428  C  C     . HIS A 1 54  ? 37.928 15.780 5.432   1.00 15.98 ? 423 HIS A C     1 
ATOM   429  O  O     . HIS A 1 54  ? 37.638 15.844 4.231   1.00 15.80 ? 423 HIS A O     1 
ATOM   430  C  CB    . HIS A 1 54  ? 37.283 17.856 6.659   1.00 13.63 ? 423 HIS A CB    1 
ATOM   431  C  CG    . HIS A 1 54  ? 37.687 18.554 5.400   1.00 14.04 ? 423 HIS A CG    1 
ATOM   432  N  ND1   . HIS A 1 54  ? 36.778 18.941 4.439   1.00 15.29 ? 423 HIS A ND1   1 
ATOM   433  C  CD2   . HIS A 1 54  ? 38.903 18.935 4.943   1.00 17.22 ? 423 HIS A CD2   1 
ATOM   434  C  CE1   . HIS A 1 54  ? 37.416 19.532 3.445   1.00 18.59 ? 423 HIS A CE1   1 
ATOM   435  N  NE2   . HIS A 1 54  ? 38.707 19.542 3.727   1.00 16.58 ? 423 HIS A NE2   1 
ATOM   436  N  N     . LEU A 1 55  ? 39.053 15.204 5.868   1.00 16.56 ? 424 LEU A N     1 
ATOM   437  C  CA    . LEU A 1 55  ? 40.016 14.646 4.923   1.00 18.66 ? 424 LEU A CA    1 
ATOM   438  C  C     . LEU A 1 55  ? 39.389 13.579 4.036   1.00 17.66 ? 424 LEU A C     1 
ATOM   439  O  O     . LEU A 1 55  ? 39.809 13.405 2.885   1.00 18.86 ? 424 LEU A O     1 
ATOM   440  C  CB    . LEU A 1 55  ? 41.218 14.066 5.669   1.00 21.88 ? 424 LEU A CB    1 
ATOM   441  C  CG    . LEU A 1 55  ? 42.213 15.056 6.268   1.00 24.68 ? 424 LEU A CG    1 
ATOM   442  C  CD1   . LEU A 1 55  ? 43.369 14.311 6.915   1.00 25.63 ? 424 LEU A CD1   1 
ATOM   443  C  CD2   . LEU A 1 55  ? 42.719 16.010 5.200   1.00 28.00 ? 424 LEU A CD2   1 
ATOM   444  N  N     . ARG A 1 56  ? 38.384 12.863 4.543   1.00 18.41 ? 425 ARG A N     1 
ATOM   445  C  CA    . ARG A 1 56  ? 37.745 11.817 3.755   1.00 18.88 ? 425 ARG A CA    1 
ATOM   446  C  C     . ARG A 1 56  ? 36.983 12.370 2.557   1.00 19.01 ? 425 ARG A C     1 
ATOM   447  O  O     . ARG A 1 56  ? 36.702 11.616 1.619   1.00 19.55 ? 425 ARG A O     1 
ATOM   448  C  CB    . ARG A 1 56  ? 36.838 10.959 4.639   1.00 22.77 ? 425 ARG A CB    1 
ATOM   449  C  CG    . ARG A 1 56  ? 37.590 10.215 5.729   1.00 24.89 ? 425 ARG A CG    1 
ATOM   450  C  CD    . ARG A 1 56  ? 36.738 9.129  6.361   1.00 29.51 ? 425 ARG A CD    1 
ATOM   451  N  NE    . ARG A 1 56  ? 35.686 9.674  7.212   1.00 30.45 ? 425 ARG A NE    1 
ATOM   452  C  CZ    . ARG A 1 56  ? 35.826 9.898  8.514   1.00 33.07 ? 425 ARG A CZ    1 
ATOM   453  N  NH1   . ARG A 1 56  ? 36.977 9.625  9.114   1.00 31.71 ? 425 ARG A NH1   1 
ATOM   454  N  NH2   . ARG A 1 56  ? 34.817 10.395 9.218   1.00 33.83 ? 425 ARG A NH2   1 
ATOM   455  N  N     . THR A 1 57  ? 36.645 13.663 2.563   1.00 17.59 ? 426 THR A N     1 
ATOM   456  C  CA    . THR A 1 57  ? 36.021 14.261 1.388   1.00 17.10 ? 426 THR A CA    1 
ATOM   457  C  C     . THR A 1 57  ? 36.979 14.291 0.206   1.00 17.69 ? 426 THR A C     1 
ATOM   458  O  O     . THR A 1 57  ? 36.541 14.317 -0.950  1.00 19.59 ? 426 THR A O     1 
ATOM   459  C  CB    . THR A 1 57  ? 35.527 15.673 1.706   1.00 17.68 ? 426 THR A CB    1 
ATOM   460  O  OG1   . THR A 1 57  ? 36.648 16.525 1.974   1.00 18.97 ? 426 THR A OG1   1 
ATOM   461  C  CG2   . THR A 1 57  ? 34.601 15.661 2.915   1.00 18.01 ? 426 THR A CG2   1 
ATOM   462  N  N     . HIS A 1 58  ? 38.285 14.284 0.472   1.00 17.80 ? 427 HIS A N     1 
ATOM   463  C  CA    . HIS A 1 58  ? 39.284 14.290 -0.588  1.00 15.81 ? 427 HIS A CA    1 
ATOM   464  C  C     . HIS A 1 58  ? 39.724 12.891 -0.993  1.00 22.93 ? 427 HIS A C     1 
ATOM   465  O  O     . HIS A 1 58  ? 40.098 12.679 -2.153  1.00 25.49 ? 427 HIS A O     1 
ATOM   466  C  CB    . HIS A 1 58  ? 40.512 15.096 -0.153  1.00 15.48 ? 427 HIS A CB    1 
ATOM   467  C  CG    . HIS A 1 58  ? 40.214 16.527 0.166   1.00 18.08 ? 427 HIS A CG    1 
ATOM   468  N  ND1   . HIS A 1 58  ? 39.604 17.378 -0.731  1.00 21.08 ? 427 HIS A ND1   1 
ATOM   469  C  CD2   . HIS A 1 58  ? 40.448 17.260 1.281   1.00 17.94 ? 427 HIS A CD2   1 
ATOM   470  C  CE1   . HIS A 1 58  ? 39.470 18.572 -0.181  1.00 20.80 ? 427 HIS A CE1   1 
ATOM   471  N  NE2   . HIS A 1 58  ? 39.975 18.528 1.039   1.00 19.33 ? 427 HIS A NE2   1 
ATOM   472  N  N     . THR A 1 59  ? 39.687 11.934 -0.068  1.00 21.38 ? 428 THR A N     1 
ATOM   473  C  CA    . THR A 1 59  ? 40.144 10.581 -0.352  1.00 20.84 ? 428 THR A CA    1 
ATOM   474  C  C     . THR A 1 59  ? 39.029 9.654  -0.811  1.00 22.77 ? 428 THR A C     1 
ATOM   475  O  O     . THR A 1 59  ? 39.315 8.629  -1.440  1.00 27.34 ? 428 THR A O     1 
ATOM   476  C  CB    . THR A 1 59  ? 40.807 9.975  0.890   1.00 23.14 ? 428 THR A CB    1 
ATOM   477  O  OG1   . THR A 1 59  ? 39.816 9.747  1.900   1.00 23.25 ? 428 THR A OG1   1 
ATOM   478  C  CG2   . THR A 1 59  ? 41.870 10.915 1.436   1.00 22.92 ? 428 THR A CG2   1 
ATOM   479  N  N     . GLY A 1 60  ? 37.774 9.986  -0.520  1.00 23.00 ? 429 GLY A N     1 
ATOM   480  C  CA    . GLY A 1 60  ? 36.679 9.088  -0.815  1.00 22.02 ? 429 GLY A CA    1 
ATOM   481  C  C     . GLY A 1 60  ? 36.555 7.911  0.124   1.00 20.60 ? 429 GLY A C     1 
ATOM   482  O  O     . GLY A 1 60  ? 35.781 6.990  -0.162  1.00 20.95 ? 429 GLY A O     1 
ATOM   483  N  N     . GLU A 1 61  ? 37.289 7.910  1.234   1.00 20.61 ? 430 GLU A N     1 
ATOM   484  C  CA    . GLU A 1 61  ? 37.226 6.804  2.179   1.00 18.55 ? 430 GLU A CA    1 
ATOM   485  C  C     . GLU A 1 61  ? 35.871 6.782  2.876   1.00 17.33 ? 430 GLU A C     1 
ATOM   486  O  O     . GLU A 1 61  ? 35.381 7.817  3.340   1.00 17.66 ? 430 GLU A O     1 
ATOM   487  C  CB    . GLU A 1 61  ? 38.338 6.946  3.217   1.00 21.15 ? 430 GLU A CB    1 
ATOM   488  C  CG    . GLU A 1 61  ? 38.310 5.883  4.301   1.00 25.96 ? 430 GLU A CG    1 
ATOM   489  C  CD    . GLU A 1 61  ? 39.278 6.172  5.429   1.00 30.09 ? 430 GLU A CD    1 
ATOM   490  O  OE1   . GLU A 1 61  ? 39.646 5.228  6.160   1.00 32.73 ? 430 GLU A OE1   1 
ATOM   491  O  OE2   . GLU A 1 61  ? 39.672 7.347  5.581   1.00 33.31 ? 430 GLU A OE2   1 
ATOM   492  N  N     . LYS A 1 62  ? 35.262 5.599  2.942   1.00 16.17 ? 431 LYS A N     1 
ATOM   493  C  CA    . LYS A 1 62  ? 33.981 5.399  3.618   1.00 13.88 ? 431 LYS A CA    1 
ATOM   494  C  C     . LYS A 1 62  ? 34.156 4.227  4.576   1.00 15.38 ? 431 LYS A C     1 
ATOM   495  O  O     . LYS A 1 62  ? 33.896 3.073  4.218   1.00 16.51 ? 431 LYS A O     1 
ATOM   496  C  CB    . LYS A 1 62  ? 32.855 5.158  2.615   1.00 15.27 ? 431 LYS A CB    1 
ATOM   497  C  CG    . LYS A 1 62  ? 32.718 6.278  1.596   1.00 16.22 ? 431 LYS A CG    1 
ATOM   498  C  CD    . LYS A 1 62  ? 31.464 6.137  0.759   1.00 17.57 ? 431 LYS A CD    1 
ATOM   499  C  CE    . LYS A 1 62  ? 31.293 7.336  -0.161  1.00 20.27 ? 431 LYS A CE    1 
ATOM   500  N  NZ    . LYS A 1 62  ? 30.007 7.289  -0.910  1.00 22.58 ? 431 LYS A NZ    1 
ATOM   501  N  N     . PRO A 1 63  ? 34.595 4.490  5.804   1.00 15.71 ? 432 PRO A N     1 
ATOM   502  C  CA    . PRO A 1 63  ? 34.982 3.408  6.721   1.00 18.01 ? 432 PRO A CA    1 
ATOM   503  C  C     . PRO A 1 63  ? 33.847 2.818  7.551   1.00 14.97 ? 432 PRO A C     1 
ATOM   504  O  O     . PRO A 1 63  ? 34.126 2.007  8.437   1.00 17.71 ? 432 PRO A O     1 
ATOM   505  C  CB    . PRO A 1 63  ? 35.996 4.107  7.645   1.00 20.04 ? 432 PRO A CB    1 
ATOM   506  C  CG    . PRO A 1 63  ? 35.923 5.601  7.315   1.00 21.77 ? 432 PRO A CG    1 
ATOM   507  C  CD    . PRO A 1 63  ? 34.758 5.813  6.416   1.00 17.87 ? 432 PRO A CD    1 
ATOM   508  N  N     . PHE A 1 64  ? 32.596 3.186  7.296   1.00 14.66 ? 433 PHE A N     1 
ATOM   509  C  CA    . PHE A 1 64  ? 31.460 2.697  8.076   1.00 14.31 ? 433 PHE A CA    1 
ATOM   510  C  C     . PHE A 1 64  ? 30.537 1.919  7.143   1.00 12.13 ? 433 PHE A C     1 
ATOM   511  O  O     . PHE A 1 64  ? 29.709 2.509  6.442   1.00 13.87 ? 433 PHE A O     1 
ATOM   512  C  CB    . PHE A 1 64  ? 30.756 3.862  8.756   1.00 13.05 ? 433 PHE A CB    1 
ATOM   513  C  CG    . PHE A 1 64  ? 31.672 4.703  9.605   1.00 13.71 ? 433 PHE A CG    1 
ATOM   514  C  CD1   . PHE A 1 64  ? 32.243 5.860  9.100   1.00 14.38 ? 433 PHE A CD1   1 
ATOM   515  C  CD2   . PHE A 1 64  ? 31.972 4.328  10.905  1.00 12.96 ? 433 PHE A CD2   1 
ATOM   516  C  CE1   . PHE A 1 64  ? 33.084 6.634  9.878   1.00 13.11 ? 433 PHE A CE1   1 
ATOM   517  C  CE2   . PHE A 1 64  ? 32.814 5.099  11.688  1.00 16.49 ? 433 PHE A CE2   1 
ATOM   518  C  CZ    . PHE A 1 64  ? 33.370 6.253  11.172  1.00 16.92 ? 433 PHE A CZ    1 
ATOM   519  N  N     . THR A 1 65  ? 30.687 0.597  7.132   1.00 13.34 ? 434 THR A N     1 
ATOM   520  C  CA    . THR A 1 65  ? 29.971 -0.273 6.211   1.00 11.71 ? 434 THR A CA    1 
ATOM   521  C  C     . THR A 1 65  ? 28.763 -0.906 6.892   1.00 11.19 ? 434 THR A C     1 
ATOM   522  O  O     . THR A 1 65  ? 28.842 -1.353 8.040   1.00 12.68 ? 434 THR A O     1 
ATOM   523  C  CB    . THR A 1 65  ? 30.899 -1.376 5.694   1.00 12.64 ? 434 THR A CB    1 
ATOM   524  O  OG1   . THR A 1 65  ? 32.025 -0.784 5.034   1.00 14.37 ? 434 THR A OG1   1 
ATOM   525  C  CG2   . THR A 1 65  ? 30.166 -2.292 4.718   1.00 13.20 ? 434 THR A CG2   1 
ATOM   526  N  N     . CYS A 1 66  ? 27.649 -0.945 6.166   1.00 11.46 ? 435 CYS A N     1 
ATOM   527  C  CA    . CYS A 1 66  ? 26.442 -1.614 6.631   1.00 15.79 ? 435 CYS A CA    1 
ATOM   528  C  C     . CYS A 1 66  ? 26.599 -3.118 6.448   1.00 14.67 ? 435 CYS A C     1 
ATOM   529  O  O     . CYS A 1 66  ? 26.855 -3.589 5.334   1.00 12.84 ? 435 CYS A O     1 
ATOM   530  C  CB    . CYS A 1 66  ? 25.244 -1.106 5.834   1.00 16.16 ? 435 CYS A CB    1 
ATOM   531  S  SG    . CYS A 1 66  ? 23.703 -1.980 6.162   1.00 12.93 ? 435 CYS A SG    1 
ATOM   532  N  N     . GLU A 1 67  ? 26.443 -3.873 7.538   1.00 14.77 ? 436 GLU A N     1 
ATOM   533  C  CA    . GLU A 1 67  ? 26.582 -5.321 7.449   1.00 15.11 ? 436 GLU A CA    1 
ATOM   534  C  C     . GLU A 1 67  ? 25.375 -5.994 6.811   1.00 16.82 ? 436 GLU A C     1 
ATOM   535  O  O     . GLU A 1 67  ? 25.423 -7.202 6.563   1.00 19.30 ? 436 GLU A O     1 
ATOM   536  C  CB    . GLU A 1 67  ? 26.850 -5.926 8.829   1.00 19.06 ? 436 GLU A CB    1 
ATOM   537  C  CG    . GLU A 1 67  ? 25.749 -5.680 9.845   1.00 21.68 ? 436 GLU A CG    1 
ATOM   538  C  CD    . GLU A 1 67  ? 25.956 -6.461 11.129  1.00 25.09 ? 436 GLU A CD    1 
ATOM   539  O  OE1   . GLU A 1 67  ? 26.316 -7.655 11.049  1.00 29.70 ? 436 GLU A OE1   1 
ATOM   540  O  OE2   . GLU A 1 67  ? 25.767 -5.879 12.217  1.00 28.11 ? 436 GLU A OE2   1 
ATOM   541  N  N     . ILE A 1 68  ? 24.306 -5.254 6.534   1.00 17.63 ? 437 ILE A N     1 
ATOM   542  C  CA    . ILE A 1 68  ? 23.111 -5.835 5.927   1.00 18.12 ? 437 ILE A CA    1 
ATOM   543  C  C     . ILE A 1 68  ? 23.201 -5.834 4.407   1.00 19.60 ? 437 ILE A C     1 
ATOM   544  O  O     . ILE A 1 68  ? 22.967 -6.861 3.763   1.00 20.82 ? 437 ILE A O     1 
ATOM   545  C  CB    . ILE A 1 68  ? 21.844 -5.111 6.434   1.00 16.95 ? 437 ILE A CB    1 
ATOM   546  C  CG1   . ILE A 1 68  ? 21.717 -5.247 7.956   1.00 18.57 ? 437 ILE A CG1   1 
ATOM   547  C  CG2   . ILE A 1 68  ? 20.602 -5.660 5.746   1.00 16.34 ? 437 ILE A CG2   1 
ATOM   548  C  CD1   . ILE A 1 68  ? 20.561 -4.457 8.545   1.00 18.89 ? 437 ILE A CD1   1 
ATOM   549  N  N     . CYS A 1 69  ? 23.553 -4.692 3.805   1.00 14.41 ? 438 CYS A N     1 
ATOM   550  C  CA    . CYS A 1 69  ? 23.605 -4.574 2.355   1.00 16.08 ? 438 CYS A CA    1 
ATOM   551  C  C     . CYS A 1 69  ? 25.003 -4.364 1.791   1.00 15.56 ? 438 CYS A C     1 
ATOM   552  O  O     . CYS A 1 69  ? 25.179 -4.485 0.574   1.00 19.05 ? 438 CYS A O     1 
ATOM   553  C  CB    . CYS A 1 69  ? 22.686 -3.443 1.866   1.00 15.85 ? 438 CYS A CB    1 
ATOM   554  S  SG    . CYS A 1 69  ? 23.282 -1.785 2.246   1.00 13.99 ? 438 CYS A SG    1 
ATOM   555  N  N     . GLY A 1 70  ? 25.994 -4.041 2.622   1.00 14.93 ? 439 GLY A N     1 
ATOM   556  C  CA    . GLY A 1 70  ? 27.358 -3.887 2.167   1.00 16.21 ? 439 GLY A CA    1 
ATOM   557  C  C     . GLY A 1 70  ? 27.761 -2.486 1.755   1.00 13.58 ? 439 GLY A C     1 
ATOM   558  O  O     . GLY A 1 70  ? 28.943 -2.263 1.460   1.00 16.97 ? 439 GLY A O     1 
ATOM   559  N  N     . LYS A 1 71  ? 26.828 -1.538 1.718   1.00 12.19 ? 440 LYS A N     1 
ATOM   560  C  CA    . LYS A 1 71  ? 27.171 -0.172 1.351   1.00 12.80 ? 440 LYS A CA    1 
ATOM   561  C  C     . LYS A 1 71  ? 27.962 0.497  2.470   1.00 11.02 ? 440 LYS A C     1 
ATOM   562  O  O     . LYS A 1 71  ? 27.785 0.195  3.653   1.00 12.08 ? 440 LYS A O     1 
ATOM   563  C  CB    . LYS A 1 71  ? 25.904 0.633  1.059   1.00 13.11 ? 440 LYS A CB    1 
ATOM   564  C  CG    . LYS A 1 71  ? 25.120 0.127  -0.140  1.00 18.75 ? 440 LYS A CG    1 
ATOM   565  C  CD    . LYS A 1 71  ? 23.826 0.900  -0.336  1.00 23.29 ? 440 LYS A CD    1 
ATOM   566  C  CE    . LYS A 1 71  ? 23.023 0.333  -1.497  1.00 29.21 ? 440 LYS A CE    1 
ATOM   567  N  NZ    . LYS A 1 71  ? 21.728 1.045  -1.689  1.00 31.81 ? 440 LYS A NZ    1 
ATOM   568  N  N     . SER A 1 72  ? 28.844 1.417  2.086   1.00 11.34 ? 441 SER A N     1 
ATOM   569  C  CA    . SER A 1 72  ? 29.716 2.100  3.029   1.00 11.54 ? 441 SER A CA    1 
ATOM   570  C  C     . SER A 1 72  ? 29.387 3.586  3.086   1.00 12.51 ? 441 SER A C     1 
ATOM   571  O  O     . SER A 1 72  ? 28.867 4.163  2.125   1.00 13.53 ? 441 SER A O     1 
ATOM   572  C  CB    . SER A 1 72  ? 31.189 1.908  2.661   1.00 13.50 ? 441 SER A CB    1 
ATOM   573  O  OG    . SER A 1 72  ? 31.540 0.536  2.688   1.00 13.53 ? 441 SER A OG    1 
ATOM   574  N  N     . PHE A 1 73  ? 29.709 4.204  4.223   1.00 12.43 ? 442 PHE A N     1 
ATOM   575  C  CA    . PHE A 1 73  ? 29.338 5.585  4.496   1.00 10.57 ? 442 PHE A CA    1 
ATOM   576  C  C     . PHE A 1 73  ? 30.520 6.332  5.096   1.00 11.43 ? 442 PHE A C     1 
ATOM   577  O  O     . PHE A 1 73  ? 31.392 5.739  5.737   1.00 13.72 ? 442 PHE A O     1 
ATOM   578  C  CB    . PHE A 1 73  ? 28.128 5.650  5.438   1.00 10.16 ? 442 PHE A CB    1 
ATOM   579  C  CG    . PHE A 1 73  ? 26.924 4.948  4.896   1.00 10.96 ? 442 PHE A CG    1 
ATOM   580  C  CD1   . PHE A 1 73  ? 26.765 3.582  5.069   1.00 13.79 ? 442 PHE A CD1   1 
ATOM   581  C  CD2   . PHE A 1 73  ? 25.967 5.646  4.183   1.00 12.38 ? 442 PHE A CD2   1 
ATOM   582  C  CE1   . PHE A 1 73  ? 25.669 2.930  4.552   1.00 12.63 ? 442 PHE A CE1   1 
ATOM   583  C  CE2   . PHE A 1 73  ? 24.866 5.000  3.666   1.00 10.59 ? 442 PHE A CE2   1 
ATOM   584  C  CZ    . PHE A 1 73  ? 24.718 3.642  3.848   1.00 11.28 ? 442 PHE A CZ    1 
ATOM   585  N  N     . THR A 1 74  ? 30.536 7.650  4.881   1.00 12.09 ? 443 THR A N     1 
ATOM   586  C  CA    . THR A 1 74  ? 31.646 8.469  5.351   1.00 12.64 ? 443 THR A CA    1 
ATOM   587  C  C     . THR A 1 74  ? 31.603 8.710  6.854   1.00 14.11 ? 443 THR A C     1 
ATOM   588  O  O     . THR A 1 74  ? 32.646 9.004  7.450   1.00 13.14 ? 443 THR A O     1 
ATOM   589  C  CB    . THR A 1 74  ? 31.667 9.812  4.618   1.00 13.80 ? 443 THR A CB    1 
ATOM   590  O  OG1   . THR A 1 74  ? 30.571 10.620 5.067   1.00 13.33 ? 443 THR A OG1   1 
ATOM   591  C  CG2   . THR A 1 74  ? 31.555 9.605  3.114   1.00 13.81 ? 443 THR A CG2   1 
ATOM   592  N  N     . ALA A 1 75  ? 30.431 8.597  7.478   1.00 13.07 ? 444 ALA A N     1 
ATOM   593  C  CA    . ALA A 1 75  ? 30.283 8.869  8.900   1.00 12.93 ? 444 ALA A CA    1 
ATOM   594  C  C     . ALA A 1 75  ? 29.422 7.796  9.545   1.00 11.36 ? 444 ALA A C     1 
ATOM   595  O  O     . ALA A 1 75  ? 28.505 7.253  8.921   1.00 11.70 ? 444 ALA A O     1 
ATOM   596  C  CB    . ALA A 1 75  ? 29.663 10.248 9.155   1.00 13.91 ? 444 ALA A CB    1 
ATOM   597  N  N     . LYS A 1 76  ? 29.727 7.497  10.810  1.00 12.13 ? 445 LYS A N     1 
ATOM   598  C  CA    . LYS A 1 76  ? 28.958 6.491  11.532  1.00 12.80 ? 445 LYS A CA    1 
ATOM   599  C  C     . LYS A 1 76  ? 27.515 6.930  11.735  1.00 12.09 ? 445 LYS A C     1 
ATOM   600  O  O     . LYS A 1 76  ? 26.606 6.094  11.713  1.00 11.70 ? 445 LYS A O     1 
ATOM   601  C  CB    . LYS A 1 76  ? 29.618 6.168  12.875  1.00 15.35 ? 445 LYS A CB    1 
ATOM   602  C  CG    . LYS A 1 76  ? 28.911 5.057  13.649  1.00 18.47 ? 445 LYS A CG    1 
ATOM   603  C  CD    . LYS A 1 76  ? 29.478 4.885  15.049  1.00 22.57 ? 445 LYS A CD    1 
ATOM   604  C  CE    . LYS A 1 76  ? 30.887 4.324  15.015  1.00 24.45 ? 445 LYS A CE    1 
ATOM   605  N  NZ    . LYS A 1 76  ? 31.401 4.070  16.387  1.00 28.89 ? 445 LYS A NZ    1 
ATOM   606  N  N     . SER A 1 77  ? 27.289 8.230  11.928  1.00 11.87 ? 446 SER A N     1 
ATOM   607  C  CA    . SER A 1 77  ? 25.926 8.730  12.069  1.00 12.95 ? 446 SER A CA    1 
ATOM   608  C  C     . SER A 1 77  ? 25.107 8.449  10.816  1.00 12.00 ? 446 SER A C     1 
ATOM   609  O  O     . SER A 1 77  ? 23.922 8.105  10.902  1.00 11.62 ? 446 SER A O     1 
ATOM   610  C  CB    . SER A 1 77  ? 25.952 10.227 12.377  1.00 14.68 ? 446 SER A CB    1 
ATOM   611  O  OG    . SER A 1 77  ? 24.638 10.758 12.417  1.00 14.55 ? 446 SER A OG    1 
ATOM   612  N  N     . SER A 1 78  ? 25.725 8.583  9.640   1.00 10.20 ? 447 SER A N     1 
ATOM   613  C  CA    . SER A 1 78  ? 25.027 8.278  8.396   1.00 9.76  ? 447 SER A CA    1 
ATOM   614  C  C     . SER A 1 78  ? 24.700 6.794  8.297   1.00 8.40  ? 447 SER A C     1 
ATOM   615  O  O     . SER A 1 78  ? 23.622 6.420  7.820   1.00 10.36 ? 447 SER A O     1 
ATOM   616  C  CB    . SER A 1 78  ? 25.874 8.718  7.204   1.00 11.24 ? 447 SER A CB    1 
ATOM   617  O  OG    . SER A 1 78  ? 26.219 10.089 7.305   1.00 10.93 ? 447 SER A OG    1 
ATOM   618  N  N     . LEU A 1 79  ? 25.622 5.932  8.731   1.00 11.43 ? 448 LEU A N     1 
ATOM   619  C  CA    . LEU A 1 79  ? 25.337 4.502  8.760   1.00 10.21 ? 448 LEU A CA    1 
ATOM   620  C  C     . LEU A 1 79  ? 24.193 4.194  9.717   1.00 11.37 ? 448 LEU A C     1 
ATOM   621  O  O     . LEU A 1 79  ? 23.302 3.398  9.398   1.00 12.85 ? 448 LEU A O     1 
ATOM   622  C  CB    . LEU A 1 79  ? 26.593 3.730  9.162   1.00 10.51 ? 448 LEU A CB    1 
ATOM   623  C  CG    . LEU A 1 79  ? 26.371 2.245  9.450   1.00 11.32 ? 448 LEU A CG    1 
ATOM   624  C  CD1   . LEU A 1 79  ? 25.831 1.544  8.214   1.00 10.70 ? 448 LEU A CD1   1 
ATOM   625  C  CD2   . LEU A 1 79  ? 27.651 1.586  9.940   1.00 11.24 ? 448 LEU A CD2   1 
ATOM   626  N  N     . GLN A 1 80  ? 24.200 4.826  10.892  1.00 11.25 ? 449 GLN A N     1 
ATOM   627  C  CA    . GLN A 1 80  ? 23.131 4.625  11.865  1.00 11.96 ? 449 GLN A CA    1 
ATOM   628  C  C     . GLN A 1 80  ? 21.781 5.023  11.281  1.00 12.68 ? 449 GLN A C     1 
ATOM   629  O  O     . GLN A 1 80  ? 20.785 4.307  11.440  1.00 13.67 ? 449 GLN A O     1 
ATOM   630  C  CB    . GLN A 1 80  ? 23.440 5.436  13.124  1.00 13.04 ? 449 GLN A CB    1 
ATOM   631  C  CG    . GLN A 1 80  ? 22.413 5.319  14.232  1.00 16.96 ? 449 GLN A CG    1 
ATOM   632  C  CD    . GLN A 1 80  ? 22.812 6.110  15.464  1.00 19.68 ? 449 GLN A CD    1 
ATOM   633  O  OE1   . GLN A 1 80  ? 23.277 5.545  16.455  1.00 22.32 ? 449 GLN A OE1   1 
ATOM   634  N  NE2   . GLN A 1 80  ? 22.636 7.425  15.407  1.00 16.85 ? 449 GLN A NE2   1 
ATOM   635  N  N     . THR A 1 81  ? 21.732 6.167  10.596  1.00 9.34  ? 450 THR A N     1 
ATOM   636  C  CA    . THR A 1 81  ? 20.500 6.587  9.936   1.00 10.50 ? 450 THR A CA    1 
ATOM   637  C  C     . THR A 1 81  ? 20.104 5.605  8.840   1.00 11.18 ? 450 THR A C     1 
ATOM   638  O  O     . THR A 1 81  ? 18.920 5.284  8.678   1.00 12.48 ? 450 THR A O     1 
ATOM   639  C  CB    . THR A 1 81  ? 20.685 7.995  9.368   1.00 11.14 ? 450 THR A CB    1 
ATOM   640  O  OG1   . THR A 1 81  ? 20.830 8.929  10.447  1.00 10.90 ? 450 THR A OG1   1 
ATOM   641  C  CG2   . THR A 1 81  ? 19.499 8.397  8.504   1.00 13.30 ? 450 THR A CG2   1 
ATOM   642  N  N     . HIS A 1 82  ? 21.088 5.102  8.092   1.00 8.33  ? 451 HIS A N     1 
ATOM   643  C  CA    . HIS A 1 82  ? 20.811 4.167  7.006   1.00 11.19 ? 451 HIS A CA    1 
ATOM   644  C  C     . HIS A 1 82  ? 20.242 2.852  7.524   1.00 12.84 ? 451 HIS A C     1 
ATOM   645  O  O     . HIS A 1 82  ? 19.361 2.260  6.889   1.00 12.72 ? 451 HIS A O     1 
ATOM   646  C  CB    . HIS A 1 82  ? 22.093 3.913  6.216   1.00 9.46  ? 451 HIS A CB    1 
ATOM   647  C  CG    . HIS A 1 82  ? 22.036 2.699  5.342   1.00 11.00 ? 451 HIS A CG    1 
ATOM   648  N  ND1   . HIS A 1 82  ? 21.514 2.724  4.067   1.00 10.67 ? 451 HIS A ND1   1 
ATOM   649  C  CD2   . HIS A 1 82  ? 22.447 1.426  5.555   1.00 11.72 ? 451 HIS A CD2   1 
ATOM   650  C  CE1   . HIS A 1 82  ? 21.602 1.518  3.534   1.00 11.23 ? 451 HIS A CE1   1 
ATOM   651  N  NE2   . HIS A 1 82  ? 22.163 0.712  4.417   1.00 12.49 ? 451 HIS A NE2   1 
ATOM   652  N  N     . ILE A 1 83  ? 20.741 2.370  8.665   1.00 10.75 ? 452 ILE A N     1 
ATOM   653  C  CA    . ILE A 1 83  ? 20.283 1.089  9.196   1.00 12.24 ? 452 ILE A CA    1 
ATOM   654  C  C     . ILE A 1 83  ? 18.797 1.133  9.532   1.00 12.92 ? 452 ILE A C     1 
ATOM   655  O  O     . ILE A 1 83  ? 18.092 0.122  9.409   1.00 13.74 ? 452 ILE A O     1 
ATOM   656  C  CB    . ILE A 1 83  ? 21.161 0.651  10.389  1.00 12.05 ? 452 ILE A CB    1 
ATOM   657  C  CG1   . ILE A 1 83  ? 22.569 0.293  9.907   1.00 12.06 ? 452 ILE A CG1   1 
ATOM   658  C  CG2   . ILE A 1 83  ? 20.540 -0.526 11.127  1.00 13.02 ? 452 ILE A CG2   1 
ATOM   659  C  CD1   . ILE A 1 83  ? 23.524 -0.062 11.025  1.00 13.77 ? 452 ILE A CD1   1 
ATOM   660  N  N     . ARG A 1 84  ? 18.288 2.302  9.931   1.00 11.69 ? 453 ARG A N     1 
ATOM   661  C  CA    . ARG A 1 84  ? 16.863 2.422  10.226  1.00 12.24 ? 453 ARG A CA    1 
ATOM   662  C  C     . ARG A 1 84  ? 16.003 2.142  9.000   1.00 15.20 ? 453 ARG A C     1 
ATOM   663  O  O     . ARG A 1 84  ? 14.836 1.757  9.138   1.00 17.06 ? 453 ARG A O     1 
ATOM   664  C  CB    . ARG A 1 84  ? 16.548 3.804  10.804  1.00 13.48 ? 453 ARG A CB    1 
ATOM   665  C  CG    . ARG A 1 84  ? 17.119 4.037  12.195  1.00 15.04 ? 453 ARG A CG    1 
ATOM   666  C  CD    . ARG A 1 84  ? 16.469 5.232  12.876  1.00 14.91 ? 453 ARG A CD    1 
ATOM   667  N  NE    . ARG A 1 84  ? 16.706 6.479  12.156  1.00 15.33 ? 453 ARG A NE    1 
ATOM   668  C  CZ    . ARG A 1 84  ? 17.774 7.249  12.332  1.00 15.70 ? 453 ARG A CZ    1 
ATOM   669  N  NH1   . ARG A 1 84  ? 18.709 6.896  13.204  1.00 15.42 ? 453 ARG A NH1   1 
ATOM   670  N  NH2   . ARG A 1 84  ? 17.910 8.370  11.637  1.00 14.14 ? 453 ARG A NH2   1 
ATOM   671  N  N     . ILE A 1 85  ? 16.554 2.326  7.797   1.00 13.53 ? 454 ILE A N     1 
ATOM   672  C  CA    . ILE A 1 85  ? 15.806 2.016  6.580   1.00 13.57 ? 454 ILE A CA    1 
ATOM   673  C  C     . ILE A 1 85  ? 15.540 0.519  6.487   1.00 13.39 ? 454 ILE A C     1 
ATOM   674  O  O     . ILE A 1 85  ? 14.417 0.084  6.203   1.00 15.73 ? 454 ILE A O     1 
ATOM   675  C  CB    . ILE A 1 85  ? 16.548 2.542  5.337   1.00 13.84 ? 454 ILE A CB    1 
ATOM   676  C  CG1   . ILE A 1 85  ? 16.803 4.045  5.454   1.00 14.04 ? 454 ILE A CG1   1 
ATOM   677  C  CG2   . ILE A 1 85  ? 15.761 2.230  4.072   1.00 16.48 ? 454 ILE A CG2   1 
ATOM   678  C  CD1   . ILE A 1 85  ? 17.631 4.612  4.317   1.00 13.69 ? 454 ILE A CD1   1 
ATOM   679  N  N     . HIS A 1 86  ? 16.575 -0.292 6.727   1.00 14.36 ? 455 HIS A N     1 
ATOM   680  C  CA    . HIS A 1 86  ? 16.413 -1.741 6.673   1.00 15.56 ? 455 HIS A CA    1 
ATOM   681  C  C     . HIS A 1 86  ? 15.399 -2.223 7.701   1.00 18.20 ? 455 HIS A C     1 
ATOM   682  O  O     . HIS A 1 86  ? 14.581 -3.104 7.412   1.00 19.28 ? 455 HIS A O     1 
ATOM   683  C  CB    . HIS A 1 86  ? 17.757 -2.430 6.915   1.00 15.82 ? 455 HIS A CB    1 
ATOM   684  C  CG    . HIS A 1 86  ? 18.767 -2.206 5.833   1.00 15.00 ? 455 HIS A CG    1 
ATOM   685  N  ND1   . HIS A 1 86  ? 18.508 -2.467 4.505   1.00 18.04 ? 455 HIS A ND1   1 
ATOM   686  C  CD2   . HIS A 1 86  ? 20.047 -1.769 5.888   1.00 13.87 ? 455 HIS A CD2   1 
ATOM   687  C  CE1   . HIS A 1 86  ? 19.581 -2.188 3.786   1.00 16.91 ? 455 HIS A CE1   1 
ATOM   688  N  NE2   . HIS A 1 86  ? 20.530 -1.763 4.601   1.00 15.70 ? 455 HIS A NE2   1 
ATOM   689  N  N     . ARG A 1 87  ? 15.437 -1.660 8.905   1.00 17.34 ? 456 ARG A N     1 
ATOM   690  C  CA    . ARG A 1 87  ? 14.589 -2.114 9.998   1.00 17.64 ? 456 ARG A CA    1 
ATOM   691  C  C     . ARG A 1 87  ? 13.227 -1.433 10.024  1.00 17.56 ? 456 ARG A C     1 
ATOM   692  O  O     . ARG A 1 87  ? 12.434 -1.710 10.929  1.00 20.51 ? 456 ARG A O     1 
ATOM   693  C  CB    . ARG A 1 87  ? 15.303 -1.915 11.339  1.00 20.41 ? 456 ARG A CB    1 
ATOM   694  C  CG    . ARG A 1 87  ? 16.671 -2.577 11.413  1.00 22.41 ? 456 ARG A CG    1 
ATOM   695  C  CD    . ARG A 1 87  ? 17.309 -2.384 12.780  1.00 26.15 ? 456 ARG A CD    1 
ATOM   696  N  NE    . ARG A 1 87  ? 16.435 -2.845 13.855  1.00 33.04 ? 456 ARG A NE    1 
ATOM   697  C  CZ    . ARG A 1 87  ? 16.375 -4.102 14.281  1.00 37.00 ? 456 ARG A CZ    1 
ATOM   698  N  NH1   . ARG A 1 87  ? 17.139 -5.031 13.724  1.00 37.75 ? 456 ARG A NH1   1 
ATOM   699  N  NH2   . ARG A 1 87  ? 15.548 -4.431 15.265  1.00 40.08 ? 456 ARG A NH2   1 
ATOM   700  N  N     . GLY A 1 88  ? 12.937 -0.561 9.060   1.00 18.55 ? 457 GLY A N     1 
ATOM   701  C  CA    . GLY A 1 88  ? 11.655 0.123  9.040   1.00 19.37 ? 457 GLY A CA    1 
ATOM   702  C  C     . GLY A 1 88  ? 11.411 0.997  10.248  1.00 20.74 ? 457 GLY A C     1 
ATOM   703  O  O     . GLY A 1 88  ? 10.257 1.206  10.634  1.00 21.52 ? 457 GLY A O     1 
ATOM   704  N  N     . GLU A 1 89  ? 12.474 1.516  10.858  1.00 18.00 ? 458 GLU A N     1 
ATOM   705  C  CA    . GLU A 1 89  ? 12.374 2.304  12.082  1.00 16.84 ? 458 GLU A CA    1 
ATOM   706  C  C     . GLU A 1 89  ? 12.197 3.771  11.711  1.00 16.10 ? 458 GLU A C     1 
ATOM   707  O  O     . GLU A 1 89  ? 13.104 4.391  11.148  1.00 13.68 ? 458 GLU A O     1 
ATOM   708  C  CB    . GLU A 1 89  ? 13.625 2.098  12.930  1.00 17.23 ? 458 GLU A CB    1 
ATOM   709  C  CG    . GLU A 1 89  ? 13.768 0.681  13.455  1.00 19.52 ? 458 GLU A CG    1 
ATOM   710  C  CD    . GLU A 1 89  ? 15.070 0.458  14.190  1.00 21.26 ? 458 GLU A CD    1 
ATOM   711  O  OE1   . GLU A 1 89  ? 15.968 1.321  14.095  1.00 21.83 ? 458 GLU A OE1   1 
ATOM   712  O  OE2   . GLU A 1 89  ? 15.195 -0.585 14.865  1.00 22.74 ? 458 GLU A OE2   1 
ATOM   713  N  N     . LYS A 1 90  ? 11.023 4.327  12.025  1.00 17.04 ? 459 LYS A N     1 
ATOM   714  C  CA    . LYS A 1 90  ? 10.671 5.704  11.686  1.00 13.56 ? 459 LYS A CA    1 
ATOM   715  C  C     . LYS A 1 90  ? 10.324 6.455  12.968  1.00 14.14 ? 459 LYS A C     1 
ATOM   716  O  O     . LYS A 1 90  ? 9.141  6.659  13.281  1.00 16.48 ? 459 LYS A O     1 
ATOM   717  C  CB    . LYS A 1 90  ? 9.526  5.748  10.675  1.00 14.20 ? 459 LYS A CB    1 
ATOM   718  C  CG    . LYS A 1 90  ? 9.828  5.003  9.381   1.00 16.56 ? 459 LYS A CG    1 
ATOM   719  C  CD    . LYS A 1 90  ? 8.740  5.214  8.344   1.00 16.35 ? 459 LYS A CD    1 
ATOM   720  C  CE    . LYS A 1 90  ? 9.084  4.520  7.035   1.00 19.10 ? 459 LYS A CE    1 
ATOM   721  N  NZ    . LYS A 1 90  ? 8.037  4.745  5.998   1.00 22.55 ? 459 LYS A NZ    1 
ATOM   722  N  N     . PRO A 1 91  ? 11.330 6.880  13.737  1.00 15.70 ? 460 PRO A N     1 
ATOM   723  C  CA    . PRO A 1 91  ? 11.058 7.536  15.024  1.00 15.63 ? 460 PRO A CA    1 
ATOM   724  C  C     . PRO A 1 91  ? 10.713 9.013  14.916  1.00 17.34 ? 460 PRO A C     1 
ATOM   725  O  O     . PRO A 1 91  ? 10.319 9.611  15.927  1.00 22.92 ? 460 PRO A O     1 
ATOM   726  C  CB    . PRO A 1 91  ? 12.376 7.350  15.783  1.00 16.39 ? 460 PRO A CB    1 
ATOM   727  C  CG    . PRO A 1 91  ? 13.407 7.380  14.702  1.00 15.35 ? 460 PRO A CG    1 
ATOM   728  C  CD    . PRO A 1 91  ? 12.774 6.701  13.506  1.00 14.64 ? 460 PRO A CD    1 
ATOM   729  N  N     . TYR A 1 92  ? 10.853 9.620  13.741  1.00 13.24 ? 461 TYR A N     1 
ATOM   730  C  CA    . TYR A 1 92  ? 10.568 11.036 13.546  1.00 13.36 ? 461 TYR A CA    1 
ATOM   731  C  C     . TYR A 1 92  ? 9.213  11.175 12.867  1.00 15.44 ? 461 TYR A C     1 
ATOM   732  O  O     . TYR A 1 92  ? 8.996  10.611 11.789  1.00 19.83 ? 461 TYR A O     1 
ATOM   733  C  CB    . TYR A 1 92  ? 11.651 11.687 12.688  1.00 12.30 ? 461 TYR A CB    1 
ATOM   734  C  CG    . TYR A 1 92  ? 13.047 11.476 13.217  1.00 12.22 ? 461 TYR A CG    1 
ATOM   735  C  CD1   . TYR A 1 92  ? 13.904 10.559 12.621  1.00 12.82 ? 461 TYR A CD1   1 
ATOM   736  C  CD2   . TYR A 1 92  ? 13.506 12.183 14.320  1.00 17.97 ? 461 TYR A CD2   1 
ATOM   737  C  CE1   . TYR A 1 92  ? 15.183 10.360 13.105  1.00 14.38 ? 461 TYR A CE1   1 
ATOM   738  C  CE2   . TYR A 1 92  ? 14.783 11.989 14.810  1.00 19.22 ? 461 TYR A CE2   1 
ATOM   739  C  CZ    . TYR A 1 92  ? 15.618 11.077 14.200  1.00 18.65 ? 461 TYR A CZ    1 
ATOM   740  O  OH    . TYR A 1 92  ? 16.891 10.884 14.690  1.00 18.25 ? 461 TYR A OH    1 
ATOM   741  N  N     . SER A 1 93  ? 8.314  11.934 13.487  1.00 15.70 ? 462 SER A N     1 
ATOM   742  C  CA    . SER A 1 93  ? 6.965  12.109 12.974  1.00 14.70 ? 462 SER A CA    1 
ATOM   743  C  C     . SER A 1 93  ? 6.592  13.582 12.999  1.00 15.90 ? 462 SER A C     1 
ATOM   744  O  O     . SER A 1 93  ? 6.991  14.318 13.907  1.00 16.83 ? 462 SER A O     1 
ATOM   745  C  CB    . SER A 1 93  ? 5.952  11.320 13.808  1.00 18.10 ? 462 SER A CB    1 
ATOM   746  O  OG    . SER A 1 93  ? 5.864  11.838 15.122  1.00 25.38 ? 462 SER A OG    1 
ATOM   747  N  N     . CYS A 1 94  ? 5.817  14.002 12.003  1.00 13.53 ? 463 CYS A N     1 
ATOM   748  C  CA    . CYS A 1 94  ? 5.282  15.356 11.983  1.00 12.91 ? 463 CYS A CA    1 
ATOM   749  C  C     . CYS A 1 94  ? 4.122  15.444 12.965  1.00 14.72 ? 463 CYS A C     1 
ATOM   750  O  O     . CYS A 1 94  ? 3.164  14.669 12.877  1.00 15.95 ? 463 CYS A O     1 
ATOM   751  C  CB    . CYS A 1 94  ? 4.811  15.699 10.573  1.00 13.90 ? 463 CYS A CB    1 
ATOM   752  S  SG    . CYS A 1 94  ? 3.982  17.291 10.441  1.00 13.06 ? 463 CYS A SG    1 
ATOM   753  N  N     . SER A 1 95  ? 4.211  16.382 13.908  1.00 17.02 ? 464 SER A N     1 
ATOM   754  C  CA    . SER A 1 95  ? 3.153  16.537 14.899  1.00 20.41 ? 464 SER A CA    1 
ATOM   755  C  C     . SER A 1 95  ? 1.865  17.079 14.294  1.00 19.76 ? 464 SER A C     1 
ATOM   756  O  O     . SER A 1 95  ? 0.806  16.964 14.921  1.00 21.33 ? 464 SER A O     1 
ATOM   757  C  CB    . SER A 1 95  ? 3.617  17.456 16.031  1.00 23.57 ? 464 SER A CB    1 
ATOM   758  O  OG    . SER A 1 95  ? 3.896  18.761 15.548  1.00 27.81 ? 464 SER A OG    1 
ATOM   759  N  N     . ILE A 1 96  ? 1.927  17.655 13.094  1.00 14.36 ? 465 ILE A N     1 
ATOM   760  C  CA    . ILE A 1 96  ? 0.749  18.285 12.506  1.00 15.54 ? 465 ILE A CA    1 
ATOM   761  C  C     . ILE A 1 96  ? -0.108 17.266 11.765  1.00 16.23 ? 465 ILE A C     1 
ATOM   762  O  O     . ILE A 1 96  ? -1.329 17.212 11.950  1.00 16.82 ? 465 ILE A O     1 
ATOM   763  C  CB    . ILE A 1 96  ? 1.158  19.467 11.608  1.00 15.82 ? 465 ILE A CB    1 
ATOM   764  C  CG1   . ILE A 1 96  ? 1.887  20.527 12.436  1.00 21.16 ? 465 ILE A CG1   1 
ATOM   765  C  CG2   . ILE A 1 96  ? -0.061 20.065 10.923  1.00 15.86 ? 465 ILE A CG2   1 
ATOM   766  C  CD1   . ILE A 1 96  ? 2.358  21.717 11.638  1.00 25.13 ? 465 ILE A CD1   1 
ATOM   767  N  N     . CYS A 1 97  ? 0.513  16.443 10.916  1.00 14.70 ? 466 CYS A N     1 
ATOM   768  C  CA    . CYS A 1 97  ? -0.224 15.490 10.099  1.00 15.75 ? 466 CYS A CA    1 
ATOM   769  C  C     . CYS A 1 97  ? 0.081  14.028 10.398  1.00 15.36 ? 466 CYS A C     1 
ATOM   770  O  O     . CYS A 1 97  ? -0.617 13.154 9.872   1.00 18.31 ? 466 CYS A O     1 
ATOM   771  C  CB    . CYS A 1 97  ? 0.002  15.761 8.603   1.00 16.42 ? 466 CYS A CB    1 
ATOM   772  S  SG    . CYS A 1 97  ? 1.629  15.271 8.001   1.00 14.91 ? 466 CYS A SG    1 
ATOM   773  N  N     . GLY A 1 98  ? 1.093  13.732 11.211  1.00 14.38 ? 467 GLY A N     1 
ATOM   774  C  CA    . GLY A 1 98  ? 1.373  12.370 11.614  1.00 17.56 ? 467 GLY A CA    1 
ATOM   775  C  C     . GLY A 1 98  ? 2.267  11.574 10.689  1.00 16.65 ? 467 GLY A C     1 
ATOM   776  O  O     . GLY A 1 98  ? 2.535  10.400 10.980  1.00 19.02 ? 467 GLY A O     1 
ATOM   777  N  N     . LYS A 1 99  ? 2.733  12.160 9.586   1.00 15.48 ? 468 LYS A N     1 
ATOM   778  C  CA    . LYS A 1 99  ? 3.634  11.448 8.688   1.00 13.26 ? 468 LYS A CA    1 
ATOM   779  C  C     . LYS A 1 99  ? 4.949  11.159 9.402   1.00 12.11 ? 468 LYS A C     1 
ATOM   780  O  O     . LYS A 1 99  ? 5.520  12.039 10.056  1.00 12.50 ? 468 LYS A O     1 
ATOM   781  C  CB    . LYS A 1 99  ? 3.884  12.282 7.430   1.00 16.34 ? 468 LYS A CB    1 
ATOM   782  C  CG    . LYS A 1 99  ? 4.705  11.575 6.362   1.00 16.48 ? 468 LYS A CG    1 
ATOM   783  C  CD    . LYS A 1 99  ? 4.847  12.427 5.109   1.00 17.42 ? 468 LYS A CD    1 
ATOM   784  C  CE    . LYS A 1 99  ? 3.518  12.596 4.385   1.00 19.62 ? 468 LYS A CE    1 
ATOM   785  N  NZ    . LYS A 1 99  ? 3.026  11.305 3.827   1.00 23.62 ? 468 LYS A NZ    1 
ATOM   786  N  N     A CYS A 1 100 ? 5.431  9.926  9.274   0.50 13.18 ? 469 CYS A N     1 
ATOM   787  N  N     B CYS A 1 100 ? 5.426  9.924  9.280   0.50 13.19 ? 469 CYS A N     1 
ATOM   788  C  CA    A CYS A 1 100 ? 6.620  9.467  9.975   0.50 14.06 ? 469 CYS A CA    1 
ATOM   789  C  CA    B CYS A 1 100 ? 6.615  9.466  9.982   0.50 14.07 ? 469 CYS A CA    1 
ATOM   790  C  C     A CYS A 1 100 ? 7.769  9.256  8.998   0.50 12.91 ? 469 CYS A C     1 
ATOM   791  C  C     B CYS A 1 100 ? 7.765  9.241  9.007   0.50 12.91 ? 469 CYS A C     1 
ATOM   792  O  O     A CYS A 1 100 ? 7.559  8.986  7.811   0.50 12.55 ? 469 CYS A O     1 
ATOM   793  O  O     B CYS A 1 100 ? 7.553  8.943  7.829   0.50 12.68 ? 469 CYS A O     1 
ATOM   794  C  CB    A CYS A 1 100 ? 6.339  8.171  10.742  0.50 15.55 ? 469 CYS A CB    1 
ATOM   795  C  CB    B CYS A 1 100 ? 6.336  8.179  10.767  0.50 15.57 ? 469 CYS A CB    1 
ATOM   796  S  SG    A CYS A 1 100 ? 4.967  8.311  11.906  0.50 14.47 ? 469 CYS A SG    1 
ATOM   797  S  SG    B CYS A 1 100 ? 5.753  6.783  9.769   0.50 19.44 ? 469 CYS A SG    1 
ATOM   798  N  N     . PHE A 1 101 ? 8.990  9.385  9.514   1.00 11.76 ? 470 PHE A N     1 
ATOM   799  C  CA    . PHE A 1 101 ? 10.194 9.275  8.703   1.00 12.47 ? 470 PHE A CA    1 
ATOM   800  C  C     . PHE A 1 101 ? 11.283 8.559  9.487   1.00 11.06 ? 470 PHE A C     1 
ATOM   801  O  O     . PHE A 1 101 ? 11.365 8.669  10.713  1.00 14.17 ? 470 PHE A O     1 
ATOM   802  C  CB    . PHE A 1 101 ? 10.750 10.656 8.334   1.00 12.62 ? 470 PHE A CB    1 
ATOM   803  C  CG    . PHE A 1 101 ? 9.761  11.553 7.650   1.00 12.20 ? 470 PHE A CG    1 
ATOM   804  C  CD1   . PHE A 1 101 ? 9.740  11.654 6.271   1.00 15.25 ? 470 PHE A CD1   1 
ATOM   805  C  CD2   . PHE A 1 101 ? 8.863  12.309 8.388   1.00 14.33 ? 470 PHE A CD2   1 
ATOM   806  C  CE1   . PHE A 1 101 ? 8.838  12.483 5.639   1.00 19.67 ? 470 PHE A CE1   1 
ATOM   807  C  CE2   . PHE A 1 101 ? 7.958  13.139 7.761   1.00 15.35 ? 470 PHE A CE2   1 
ATOM   808  C  CZ    . PHE A 1 101 ? 7.947  13.227 6.385   1.00 16.85 ? 470 PHE A CZ    1 
ATOM   809  N  N     . SER A 1 102 ? 12.132 7.833  8.758   1.00 12.17 ? 471 SER A N     1 
ATOM   810  C  CA    . SER A 1 102 ? 13.356 7.301  9.342   1.00 11.47 ? 471 SER A CA    1 
ATOM   811  C  C     . SER A 1 102 ? 14.481 8.326  9.343   1.00 11.29 ? 471 SER A C     1 
ATOM   812  O  O     . SER A 1 102 ? 15.436 8.183  10.115  1.00 13.24 ? 471 SER A O     1 
ATOM   813  C  CB    . SER A 1 102 ? 13.809 6.055  8.577   1.00 11.86 ? 471 SER A CB    1 
ATOM   814  O  OG    . SER A 1 102 ? 14.193 6.371  7.250   1.00 13.25 ? 471 SER A OG    1 
ATOM   815  N  N     . ASP A 1 103 ? 14.385 9.353  8.504   1.00 10.43 ? 472 ASP A N     1 
ATOM   816  C  CA    . ASP A 1 103 ? 15.419 10.366 8.350   1.00 10.99 ? 472 ASP A CA    1 
ATOM   817  C  C     . ASP A 1 103 ? 14.970 11.643 9.047   1.00 10.86 ? 472 ASP A C     1 
ATOM   818  O  O     . ASP A 1 103 ? 13.878 12.153 8.775   1.00 10.40 ? 472 ASP A O     1 
ATOM   819  C  CB    . ASP A 1 103 ? 15.662 10.644 6.865   1.00 11.96 ? 472 ASP A CB    1 
ATOM   820  C  CG    . ASP A 1 103 ? 16.885 11.502 6.621   1.00 9.51  ? 472 ASP A CG    1 
ATOM   821  O  OD1   . ASP A 1 103 ? 17.951 10.940 6.295   1.00 12.93 ? 472 ASP A OD1   1 
ATOM   822  O  OD2   . ASP A 1 103 ? 16.773 12.735 6.756   1.00 11.50 ? 472 ASP A OD2   1 
ATOM   823  N  N     . SER A 1 104 ? 15.822 12.166 9.932   1.00 11.84 ? 473 SER A N     1 
ATOM   824  C  CA    . SER A 1 104 ? 15.457 13.355 10.694  1.00 13.58 ? 473 SER A CA    1 
ATOM   825  C  C     . SER A 1 104 ? 15.370 14.592 9.810   1.00 13.00 ? 473 SER A C     1 
ATOM   826  O  O     . SER A 1 104 ? 14.543 15.475 10.065  1.00 13.21 ? 473 SER A O     1 
ATOM   827  C  CB    . SER A 1 104 ? 16.453 13.579 11.833  1.00 14.61 ? 473 SER A CB    1 
ATOM   828  O  OG    . SER A 1 104 ? 17.769 13.765 11.335  1.00 19.37 ? 473 SER A OG    1 
ATOM   829  N  N     . SER A 1 105 ? 16.207 14.681 8.776   1.00 11.87 ? 474 SER A N     1 
ATOM   830  C  CA    . SER A 1 105 ? 16.146 15.827 7.877   1.00 9.47  ? 474 SER A CA    1 
ATOM   831  C  C     . SER A 1 105 ? 14.932 15.773 6.962   1.00 11.23 ? 474 SER A C     1 
ATOM   832  O  O     . SER A 1 105 ? 14.372 16.822 6.627   1.00 11.72 ? 474 SER A O     1 
ATOM   833  C  CB    . SER A 1 105 ? 17.442 15.949 7.069   1.00 9.63  ? 474 SER A CB    1 
ATOM   834  O  OG    . SER A 1 105 ? 18.536 16.260 7.920   1.00 13.72 ? 474 SER A OG    1 
ATOM   835  N  N     . ALA A 1 106 ? 14.513 14.574 6.550   1.00 10.56 ? 475 ALA A N     1 
ATOM   836  C  CA    . ALA A 1 106 ? 13.287 14.460 5.768   1.00 11.36 ? 475 ALA A CA    1 
ATOM   837  C  C     . ALA A 1 106 ? 12.083 14.935 6.570   1.00 11.70 ? 475 ALA A C     1 
ATOM   838  O  O     . ALA A 1 106 ? 11.176 15.575 6.025   1.00 12.87 ? 475 ALA A O     1 
ATOM   839  C  CB    . ALA A 1 106 ? 13.098 13.020 5.293   1.00 12.06 ? 475 ALA A CB    1 
ATOM   840  N  N     . LYS A 1 107 ? 12.063 14.640 7.870   1.00 10.92 ? 476 LYS A N     1 
ATOM   841  C  CA    . LYS A 1 107 ? 10.973 15.109 8.716   1.00 10.22 ? 476 LYS A CA    1 
ATOM   842  C  C     . LYS A 1 107 ? 11.001 16.626 8.846   1.00 13.06 ? 476 LYS A C     1 
ATOM   843  O  O     . LYS A 1 107 ? 9.975  17.292 8.678   1.00 14.57 ? 476 LYS A O     1 
ATOM   844  C  CB    . LYS A 1 107 ? 11.055 14.438 10.087  1.00 13.96 ? 476 LYS A CB    1 
ATOM   845  C  CG    . LYS A 1 107 ? 9.982  14.872 11.076  1.00 14.40 ? 476 LYS A CG    1 
ATOM   846  C  CD    . LYS A 1 107 ? 10.533 15.867 12.083  1.00 17.93 ? 476 LYS A CD    1 
ATOM   847  C  CE    . LYS A 1 107 ? 9.483  16.266 13.101  1.00 23.44 ? 476 LYS A CE    1 
ATOM   848  N  NZ    . LYS A 1 107 ? 10.018 17.262 14.066  1.00 28.19 ? 476 LYS A NZ    1 
ATOM   849  N  N     . ARG A 1 108 ? 12.175 17.185 9.145   1.00 11.83 ? 477 ARG A N     1 
ATOM   850  C  CA    . ARG A 1 108 ? 12.295 18.633 9.287   1.00 14.54 ? 477 ARG A CA    1 
ATOM   851  C  C     . ARG A 1 108 ? 11.922 19.345 7.994   1.00 15.52 ? 477 ARG A C     1 
ATOM   852  O  O     . ARG A 1 108 ? 11.247 20.382 8.018   1.00 15.50 ? 477 ARG A O     1 
ATOM   853  C  CB    . ARG A 1 108 ? 13.722 18.985 9.703   1.00 15.67 ? 477 ARG A CB    1 
ATOM   854  C  CG    . ARG A 1 108 ? 13.901 20.399 10.223  1.00 21.29 ? 477 ARG A CG    1 
ATOM   855  C  CD    . ARG A 1 108 ? 15.358 20.676 10.583  1.00 26.73 ? 477 ARG A CD    1 
ATOM   856  N  NE    . ARG A 1 108 ? 15.882 19.721 11.557  1.00 31.68 ? 477 ARG A NE    1 
ATOM   857  C  CZ    . ARG A 1 108 ? 16.718 18.729 11.262  1.00 33.81 ? 477 ARG A CZ    1 
ATOM   858  N  NH1   . ARG A 1 108 ? 17.135 18.556 10.014  1.00 29.91 ? 477 ARG A NH1   1 
ATOM   859  N  NH2   . ARG A 1 108 ? 17.139 17.910 12.216  1.00 35.55 ? 477 ARG A NH2   1 
ATOM   860  N  N     . ARG A 1 109 ? 12.349 18.797 6.854   1.00 11.57 ? 478 ARG A N     1 
ATOM   861  C  CA    . ARG A 1 109 ? 12.022 19.394 5.565   1.00 12.39 ? 478 ARG A CA    1 
ATOM   862  C  C     . ARG A 1 109 ? 10.524 19.336 5.298   1.00 14.17 ? 478 ARG A C     1 
ATOM   863  O  O     . ARG A 1 109 ? 9.949  20.277 4.740   1.00 15.84 ? 478 ARG A O     1 
ATOM   864  C  CB    . ARG A 1 109 ? 12.802 18.675 4.464   1.00 11.62 ? 478 ARG A CB    1 
ATOM   865  C  CG    . ARG A 1 109 ? 12.531 19.175 3.058   1.00 13.18 ? 478 ARG A CG    1 
ATOM   866  C  CD    . ARG A 1 109 ? 13.309 18.348 2.046   1.00 13.04 ? 478 ARG A CD    1 
ATOM   867  N  NE    . ARG A 1 109 ? 12.945 16.935 2.121   1.00 12.64 ? 478 ARG A NE    1 
ATOM   868  C  CZ    . ARG A 1 109 ? 13.581 15.963 1.474   1.00 11.46 ? 478 ARG A CZ    1 
ATOM   869  N  NH1   . ARG A 1 109 ? 14.624 16.245 0.703   1.00 10.57 ? 478 ARG A NH1   1 
ATOM   870  N  NH2   . ARG A 1 109 ? 13.179 14.706 1.602   1.00 12.37 ? 478 ARG A NH2   1 
ATOM   871  N  N     . HIS A 1 110 ? 9.876  18.241 5.697   1.00 12.07 ? 479 HIS A N     1 
ATOM   872  C  CA    . HIS A 1 110 ? 8.443  18.102 5.468   1.00 12.24 ? 479 HIS A CA    1 
ATOM   873  C  C     . HIS A 1 110 ? 7.648  19.108 6.288   1.00 14.14 ? 479 HIS A C     1 
ATOM   874  O  O     . HIS A 1 110 ? 6.691  19.710 5.785   1.00 14.59 ? 479 HIS A O     1 
ATOM   875  C  CB    . HIS A 1 110 ? 8.000  16.684 5.815   1.00 10.53 ? 479 HIS A CB    1 
ATOM   876  C  CG    . HIS A 1 110 ? 6.542  16.573 6.138   1.00 12.01 ? 479 HIS A CG    1 
ATOM   877  N  ND1   . HIS A 1 110 ? 5.577  16.403 5.169   1.00 12.27 ? 479 HIS A ND1   1 
ATOM   878  C  CD2   . HIS A 1 110 ? 5.883  16.626 7.320   1.00 13.08 ? 479 HIS A CD2   1 
ATOM   879  C  CE1   . HIS A 1 110 ? 4.387  16.348 5.741   1.00 14.24 ? 479 HIS A CE1   1 
ATOM   880  N  NE2   . HIS A 1 110 ? 4.545  16.482 7.045   1.00 13.74 ? 479 HIS A NE2   1 
ATOM   881  N  N     . CYS A 1 111 ? 8.024  19.297 7.556   1.00 14.05 ? 480 CYS A N     1 
ATOM   882  C  CA    . CYS A 1 111 ? 7.245  20.144 8.454   1.00 14.70 ? 480 CYS A CA    1 
ATOM   883  C  C     . CYS A 1 111 ? 7.169  21.585 7.969   1.00 14.39 ? 480 CYS A C     1 
ATOM   884  O  O     . CYS A 1 111 ? 6.232  22.303 8.337   1.00 15.21 ? 480 CYS A O     1 
ATOM   885  C  CB    . CYS A 1 111 ? 7.816  20.072 9.875   1.00 16.75 ? 480 CYS A CB    1 
ATOM   886  S  SG    . CYS A 1 111 ? 7.699  18.437 10.644  1.00 18.56 ? 480 CYS A SG    1 
ATOM   887  N  N     . ILE A 1 112 ? 8.136  22.022 7.156   1.00 16.19 ? 481 ILE A N     1 
ATOM   888  C  CA    . ILE A 1 112 ? 8.113  23.375 6.607   1.00 17.87 ? 481 ILE A CA    1 
ATOM   889  C  C     . ILE A 1 112 ? 6.904  23.580 5.703   1.00 15.30 ? 481 ILE A C     1 
ATOM   890  O  O     . ILE A 1 112 ? 6.378  24.696 5.593   1.00 14.99 ? 481 ILE A O     1 
ATOM   891  C  CB    . ILE A 1 112 ? 9.438  23.676 5.876   1.00 21.32 ? 481 ILE A CB    1 
ATOM   892  C  CG1   . ILE A 1 112 ? 10.617 23.611 6.847   1.00 25.73 ? 481 ILE A CG1   1 
ATOM   893  C  CG2   . ILE A 1 112 ? 9.387  25.035 5.193   1.00 25.85 ? 481 ILE A CG2   1 
ATOM   894  C  CD1   . ILE A 1 112 ? 11.950 23.871 6.187   1.00 29.00 ? 481 ILE A CD1   1 
ATOM   895  N  N     . LEU A 1 113 ? 6.427  22.508 5.063   1.00 12.83 ? 482 LEU A N     1 
ATOM   896  C  CA    . LEU A 1 113 ? 5.329  22.633 4.110   1.00 13.17 ? 482 LEU A CA    1 
ATOM   897  C  C     . LEU A 1 113 ? 4.041  23.095 4.776   1.00 15.46 ? 482 LEU A C     1 
ATOM   898  O  O     . LEU A 1 113 ? 3.188  23.697 4.115   1.00 16.76 ? 482 LEU A O     1 
ATOM   899  C  CB    . LEU A 1 113 ? 5.108  21.307 3.387   1.00 14.06 ? 482 LEU A CB    1 
ATOM   900  C  CG    . LEU A 1 113 ? 6.297  20.787 2.582   1.00 12.18 ? 482 LEU A CG    1 
ATOM   901  C  CD1   . LEU A 1 113 ? 5.943  19.470 1.912   1.00 13.80 ? 482 LEU A CD1   1 
ATOM   902  C  CD2   . LEU A 1 113 ? 6.736  21.826 1.559   1.00 13.74 ? 482 LEU A CD2   1 
ATOM   903  N  N     . HIS A 1 114 ? 3.876  22.820 6.072   1.00 13.76 ? 483 HIS A N     1 
ATOM   904  C  CA    . HIS A 1 114 ? 2.681  23.275 6.770   1.00 15.55 ? 483 HIS A CA    1 
ATOM   905  C  C     . HIS A 1 114 ? 2.673  24.783 6.993   1.00 17.71 ? 483 HIS A C     1 
ATOM   906  O  O     . HIS A 1 114 ? 1.618  25.340 7.308   1.00 21.20 ? 483 HIS A O     1 
ATOM   907  C  CB    . HIS A 1 114 ? 2.520  22.538 8.101   1.00 14.52 ? 483 HIS A CB    1 
ATOM   908  C  CG    . HIS A 1 114 ? 2.276  21.069 7.953   1.00 14.36 ? 483 HIS A CG    1 
ATOM   909  N  ND1   . HIS A 1 114 ? 1.073  20.554 7.522   1.00 15.74 ? 483 HIS A ND1   1 
ATOM   910  C  CD2   . HIS A 1 114 ? 3.080  20.004 8.184   1.00 16.18 ? 483 HIS A CD2   1 
ATOM   911  C  CE1   . HIS A 1 114 ? 1.147  19.236 7.489   1.00 14.39 ? 483 HIS A CE1   1 
ATOM   912  N  NE2   . HIS A 1 114 ? 2.354  18.876 7.887   1.00 15.75 ? 483 HIS A NE2   1 
ATOM   913  N  N     . THR A 1 115 ? 3.818  25.453 6.845   1.00 16.88 ? 484 THR A N     1 
ATOM   914  C  CA    . THR A 1 115 ? 3.866  26.905 6.968   1.00 19.29 ? 484 THR A CA    1 
ATOM   915  C  C     . THR A 1 115 ? 3.457  27.611 5.682   1.00 18.59 ? 484 THR A C     1 
ATOM   916  O  O     . THR A 1 115 ? 3.106  28.795 5.725   1.00 22.90 ? 484 THR A O     1 
ATOM   917  C  CB    . THR A 1 115 ? 5.271  27.356 7.377   1.00 23.38 ? 484 THR A CB    1 
ATOM   918  O  OG1   . THR A 1 115 ? 6.181  27.140 6.291   1.00 23.82 ? 484 THR A OG1   1 
ATOM   919  C  CG2   . THR A 1 115 ? 5.749  26.566 8.586   1.00 26.08 ? 484 THR A CG2   1 
ATOM   920  N  N     . GLY A 1 116 ? 3.498  26.917 4.547   1.00 19.66 ? 485 GLY A N     1 
ATOM   921  C  CA    . GLY A 1 116 ? 3.115  27.497 3.279   1.00 22.79 ? 485 GLY A CA    1 
ATOM   922  C  C     . GLY A 1 116 ? 4.124  28.442 2.667   1.00 21.75 ? 485 GLY A C     1 
ATOM   923  O  O     . GLY A 1 116 ? 3.830  29.043 1.627   1.00 23.56 ? 485 GLY A O     1 
ATOM   924  N  N     . LYS A 1 117 ? 5.301  28.594 3.270   1.00 18.38 ? 486 LYS A N     1 
ATOM   925  C  CA    . LYS A 1 117 ? 6.287  29.539 2.764   1.00 21.90 ? 486 LYS A CA    1 
ATOM   926  C  C     . LYS A 1 117 ? 6.934  29.005 1.492   1.00 18.54 ? 486 LYS A C     1 
ATOM   927  O  O     . LYS A 1 117 ? 7.324  27.835 1.421   1.00 20.97 ? 486 LYS A O     1 
ATOM   928  C  CB    . LYS A 1 117 ? 7.358  29.794 3.823   1.00 25.38 ? 486 LYS A CB    1 
ATOM   929  C  CG    . LYS A 1 117 ? 6.838  30.482 5.072   1.00 31.70 ? 486 LYS A CG    1 
ATOM   930  C  CD    . LYS A 1 117 ? 7.960  30.786 6.048   1.00 34.99 ? 486 LYS A CD    1 
ATOM   931  C  CE    . LYS A 1 117 ? 7.462  31.615 7.220   1.00 39.29 ? 486 LYS A CE    1 
ATOM   932  N  NZ    . LYS A 1 117 ? 6.864  32.900 6.765   1.00 43.89 ? 486 LYS A NZ    1 
ATOM   933  N  N     . LYS A 1 118 ? 7.040  29.870 0.485   1.00 18.72 ? 487 LYS A N     1 
ATOM   934  C  CA    . LYS A 1 118 ? 7.708  29.557 -0.779  1.00 19.11 ? 487 LYS A CA    1 
ATOM   935  C  C     . LYS A 1 118 ? 8.704  30.673 -1.058  1.00 17.16 ? 487 LYS A C     1 
ATOM   936  O  O     . LYS A 1 118 ? 8.440  31.571 -1.870  1.00 18.45 ? 487 LYS A O     1 
ATOM   937  C  CB    . LYS A 1 118 ? 6.694  29.395 -1.912  1.00 21.05 ? 487 LYS A CB    1 
ATOM   938  C  CG    . LYS A 1 118 ? 5.755  28.213 -1.725  1.00 24.60 ? 487 LYS A CG    1 
ATOM   939  C  CD    . LYS A 1 118 ? 4.714  28.137 -2.828  1.00 28.59 ? 487 LYS A CD    1 
ATOM   940  C  CE    . LYS A 1 118 ? 3.875  26.875 -2.704  1.00 32.76 ? 487 LYS A CE    1 
ATOM   941  N  NZ    . LYS A 1 118 ? 2.744  26.843 -3.672  1.00 36.79 ? 487 LYS A NZ    1 
ATOM   942  N  N     . PRO A 1 119 ? 9.865  30.652 -0.398  1.00 18.10 ? 488 PRO A N     1 
ATOM   943  C  CA    . PRO A 1 119 ? 10.792 31.786 -0.472  1.00 19.91 ? 488 PRO A CA    1 
ATOM   944  C  C     . PRO A 1 119 ? 11.725 31.769 -1.673  1.00 16.90 ? 488 PRO A C     1 
ATOM   945  O  O     . PRO A 1 119 ? 12.590 32.646 -1.769  1.00 16.68 ? 488 PRO A O     1 
ATOM   946  C  CB    . PRO A 1 119 ? 11.592 31.642 0.828   1.00 22.98 ? 488 PRO A CB    1 
ATOM   947  C  CG    . PRO A 1 119 ? 11.651 30.164 1.040   1.00 20.84 ? 488 PRO A CG    1 
ATOM   948  C  CD    . PRO A 1 119 ? 10.347 29.602 0.519   1.00 18.06 ? 488 PRO A CD    1 
ATOM   949  N  N     . PHE A 1 120 ? 11.588 30.813 -2.587  1.00 16.12 ? 489 PHE A N     1 
ATOM   950  C  CA    . PHE A 1 120 ? 12.484 30.684 -3.732  1.00 15.73 ? 489 PHE A CA    1 
ATOM   951  C  C     . PHE A 1 120 ? 11.696 30.986 -5.001  1.00 19.26 ? 489 PHE A C     1 
ATOM   952  O  O     . PHE A 1 120 ? 10.850 30.189 -5.422  1.00 20.16 ? 489 PHE A O     1 
ATOM   953  C  CB    . PHE A 1 120 ? 13.112 29.293 -3.766  1.00 16.10 ? 489 PHE A CB    1 
ATOM   954  C  CG    . PHE A 1 120 ? 13.769 28.904 -2.474  1.00 16.16 ? 489 PHE A CG    1 
ATOM   955  C  CD1   . PHE A 1 120 ? 13.234 27.903 -1.681  1.00 12.84 ? 489 PHE A CD1   1 
ATOM   956  C  CD2   . PHE A 1 120 ? 14.908 29.563 -2.037  1.00 17.06 ? 489 PHE A CD2   1 
ATOM   957  C  CE1   . PHE A 1 120 ? 13.833 27.552 -0.486  1.00 12.69 ? 489 PHE A CE1   1 
ATOM   958  C  CE2   . PHE A 1 120 ? 15.512 29.219 -0.843  1.00 18.38 ? 489 PHE A CE2   1 
ATOM   959  C  CZ    . PHE A 1 120 ? 14.973 28.212 -0.066  1.00 13.94 ? 489 PHE A CZ    1 
ATOM   960  N  N     . SER A 1 121 ? 11.980 32.136 -5.607  1.00 13.68 ? 490 SER A N     1 
ATOM   961  C  CA    . SER A 1 121 ? 11.227 32.647 -6.744  1.00 14.54 ? 490 SER A CA    1 
ATOM   962  C  C     . SER A 1 121 ? 12.084 32.590 -8.001  1.00 14.50 ? 490 SER A C     1 
ATOM   963  O  O     . SER A 1 121 ? 13.226 33.063 -8.001  1.00 13.87 ? 490 SER A O     1 
ATOM   964  C  CB    . SER A 1 121 ? 10.789 34.090 -6.485  1.00 15.71 ? 490 SER A CB    1 
ATOM   965  O  OG    . SER A 1 121 ? 10.205 34.662 -7.643  1.00 19.04 ? 490 SER A OG    1 
ATOM   966  N  N     . CYS A 1 122 ? 11.529 32.027 -9.066  1.00 15.13 ? 491 CYS A N     1 
ATOM   967  C  CA    . CYS A 1 122 ? 12.240 31.944 -10.333 1.00 16.26 ? 491 CYS A CA    1 
ATOM   968  C  C     . CYS A 1 122 ? 12.500 33.343 -10.878 1.00 12.78 ? 491 CYS A C     1 
ATOM   969  O  O     . CYS A 1 122 ? 11.545 34.109 -11.079 1.00 16.31 ? 491 CYS A O     1 
ATOM   970  C  CB    . CYS A 1 122 ? 11.428 31.143 -11.345 1.00 16.94 ? 491 CYS A CB    1 
ATOM   971  S  SG    . CYS A 1 122 ? 12.202 31.051 -12.975 1.00 16.08 ? 491 CYS A SG    1 
ATOM   972  N  N     . PRO A 1 123 ? 13.757 33.718 -11.131 1.00 14.45 ? 492 PRO A N     1 
ATOM   973  C  CA    . PRO A 1 123 ? 14.031 35.057 -11.671 1.00 16.14 ? 492 PRO A CA    1 
ATOM   974  C  C     . PRO A 1 123 ? 13.544 35.256 -13.095 1.00 17.74 ? 492 PRO A C     1 
ATOM   975  O  O     . PRO A 1 123 ? 13.505 36.402 -13.558 1.00 19.39 ? 492 PRO A O     1 
ATOM   976  C  CB    . PRO A 1 123 ? 15.559 35.162 -11.591 1.00 17.84 ? 492 PRO A CB    1 
ATOM   977  C  CG    . PRO A 1 123 ? 16.029 33.746 -11.658 1.00 16.11 ? 492 PRO A CG    1 
ATOM   978  C  CD    . PRO A 1 123 ? 14.990 32.936 -10.931 1.00 15.17 ? 492 PRO A CD    1 
ATOM   979  N  N     . GLU A 1 124 ? 13.166 34.188 -13.798 1.00 18.51 ? 493 GLU A N     1 
ATOM   980  C  CA    . GLU A 1 124 ? 12.720 34.307 -15.181 1.00 21.63 ? 493 GLU A CA    1 
ATOM   981  C  C     . GLU A 1 124 ? 11.209 34.472 -15.302 1.00 23.17 ? 493 GLU A C     1 
ATOM   982  O  O     . GLU A 1 124 ? 10.743 35.295 -16.097 1.00 26.32 ? 493 GLU A O     1 
ATOM   983  C  CB    . GLU A 1 124 ? 13.175 33.090 -15.994 1.00 22.65 ? 493 GLU A CB    1 
ATOM   984  C  CG    . GLU A 1 124 ? 14.653 32.753 -15.860 1.00 29.79 ? 493 GLU A CG    1 
ATOM   985  C  CD    . GLU A 1 124 ? 15.567 33.846 -16.384 1.00 40.30 ? 493 GLU A CD    1 
ATOM   986  O  OE1   . GLU A 1 124 ? 15.143 34.611 -17.276 1.00 44.98 ? 493 GLU A OE1   1 
ATOM   987  O  OE2   . GLU A 1 124 ? 16.714 33.937 -15.898 1.00 44.09 ? 493 GLU A OE2   1 
ATOM   988  N  N     . CYS A 1 125 ? 10.429 33.705 -14.534 1.00 19.99 ? 494 CYS A N     1 
ATOM   989  C  CA    . CYS A 1 125 ? 8.976  33.740 -14.646 1.00 23.09 ? 494 CYS A CA    1 
ATOM   990  C  C     . CYS A 1 125 ? 8.243  34.031 -13.344 1.00 22.70 ? 494 CYS A C     1 
ATOM   991  O  O     . CYS A 1 125 ? 7.022  34.222 -13.381 1.00 22.37 ? 494 CYS A O     1 
ATOM   992  C  CB    . CYS A 1 125 ? 8.437  32.428 -15.239 1.00 23.83 ? 494 CYS A CB    1 
ATOM   993  S  SG    . CYS A 1 125 ? 8.517  31.009 -14.122 1.00 22.76 ? 494 CYS A SG    1 
ATOM   994  N  N     . GLY A 1 126 ? 8.930  34.061 -12.204 1.00 19.43 ? 495 GLY A N     1 
ATOM   995  C  CA    . GLY A 1 126 ? 8.301  34.403 -10.947 1.00 20.52 ? 495 GLY A CA    1 
ATOM   996  C  C     . GLY A 1 126 ? 7.627  33.260 -10.219 1.00 19.36 ? 495 GLY A C     1 
ATOM   997  O  O     . GLY A 1 126 ? 7.016  33.495 -9.168  1.00 18.00 ? 495 GLY A O     1 
ATOM   998  N  N     . LEU A 1 127 ? 7.710  32.038 -10.737 1.00 20.24 ? 496 LEU A N     1 
ATOM   999  C  CA    . LEU A 1 127 ? 7.113  30.898 -10.056 1.00 21.94 ? 496 LEU A CA    1 
ATOM   1000 C  C     . LEU A 1 127 ? 7.843  30.645 -8.743  1.00 20.06 ? 496 LEU A C     1 
ATOM   1001 O  O     . LEU A 1 127 ? 9.075  30.580 -8.706  1.00 20.64 ? 496 LEU A O     1 
ATOM   1002 C  CB    . LEU A 1 127 ? 7.199  29.667 -10.957 1.00 24.86 ? 496 LEU A CB    1 
ATOM   1003 C  CG    . LEU A 1 127 ? 6.242  28.513 -10.659 1.00 30.93 ? 496 LEU A CG    1 
ATOM   1004 C  CD1   . LEU A 1 127 ? 4.803  29.003 -10.690 1.00 33.51 ? 496 LEU A CD1   1 
ATOM   1005 C  CD2   . LEU A 1 127 ? 6.453  27.387 -11.659 1.00 31.42 ? 496 LEU A CD2   1 
ATOM   1006 N  N     . GLN A 1 128 ? 7.082  30.512 -7.661  1.00 18.46 ? 497 GLN A N     1 
ATOM   1007 C  CA    . GLN A 1 128 ? 7.642  30.387 -6.324  1.00 15.68 ? 497 GLN A CA    1 
ATOM   1008 C  C     . GLN A 1 128 ? 7.622  28.934 -5.868  1.00 17.67 ? 497 GLN A C     1 
ATOM   1009 O  O     . GLN A 1 128 ? 6.669  28.198 -6.138  1.00 21.20 ? 497 GLN A O     1 
ATOM   1010 C  CB    . GLN A 1 128 ? 6.857  31.253 -5.339  1.00 18.94 ? 497 GLN A CB    1 
ATOM   1011 C  CG    . GLN A 1 128 ? 6.887  32.737 -5.676  1.00 24.67 ? 497 GLN A CG    1 
ATOM   1012 C  CD    . GLN A 1 128 ? 6.049  33.567 -4.726  1.00 33.09 ? 497 GLN A CD    1 
ATOM   1013 O  OE1   . GLN A 1 128 ? 6.577  34.243 -3.843  1.00 37.93 ? 497 GLN A OE1   1 
ATOM   1014 N  NE2   . GLN A 1 128 ? 4.734  33.525 -4.906  1.00 34.48 ? 497 GLN A NE2   1 
ATOM   1015 N  N     . PHE A 1 129 ? 8.680  28.533 -5.165  1.00 16.86 ? 498 PHE A N     1 
ATOM   1016 C  CA    . PHE A 1 129 ? 8.852  27.164 -4.707  1.00 18.08 ? 498 PHE A CA    1 
ATOM   1017 C  C     . PHE A 1 129 ? 9.207  27.156 -3.229  1.00 18.66 ? 498 PHE A C     1 
ATOM   1018 O  O     . PHE A 1 129 ? 9.925  28.038 -2.746  1.00 16.30 ? 498 PHE A O     1 
ATOM   1019 C  CB    . PHE A 1 129 ? 9.972  26.456 -5.478  1.00 18.21 ? 498 PHE A CB    1 
ATOM   1020 C  CG    . PHE A 1 129 ? 9.714  26.331 -6.952  1.00 19.71 ? 498 PHE A CG    1 
ATOM   1021 C  CD1   . PHE A 1 129 ? 10.099 27.335 -7.826  1.00 18.34 ? 498 PHE A CD1   1 
ATOM   1022 C  CD2   . PHE A 1 129 ? 9.092  25.206 -7.465  1.00 21.28 ? 498 PHE A CD2   1 
ATOM   1023 C  CE1   . PHE A 1 129 ? 9.863  27.218 -9.183  1.00 16.73 ? 498 PHE A CE1   1 
ATOM   1024 C  CE2   . PHE A 1 129 ? 8.855  25.084 -8.819  1.00 20.96 ? 498 PHE A CE2   1 
ATOM   1025 C  CZ    . PHE A 1 129 ? 9.241  26.091 -9.679  1.00 20.65 ? 498 PHE A CZ    1 
ATOM   1026 N  N     . ALA A 1 130 ? 8.700  26.150 -2.515  1.00 16.85 ? 499 ALA A N     1 
ATOM   1027 C  CA    . ALA A 1 130 ? 9.092  25.942 -1.128  1.00 15.59 ? 499 ALA A CA    1 
ATOM   1028 C  C     . ALA A 1 130 ? 10.489 25.352 -1.013  1.00 15.12 ? 499 ALA A C     1 
ATOM   1029 O  O     . ALA A 1 130 ? 11.128 25.501 0.035   1.00 15.63 ? 499 ALA A O     1 
ATOM   1030 C  CB    . ALA A 1 130 ? 8.078  25.031 -0.428  1.00 19.46 ? 499 ALA A CB    1 
ATOM   1031 N  N     . ARG A 1 131 ? 10.970 24.688 -2.061  1.00 17.92 ? 500 ARG A N     1 
ATOM   1032 C  CA    . ARG A 1 131 ? 12.240 23.979 -2.043  1.00 15.96 ? 500 ARG A CA    1 
ATOM   1033 C  C     . ARG A 1 131 ? 13.176 24.596 -3.068  1.00 15.55 ? 500 ARG A C     1 
ATOM   1034 O  O     . ARG A 1 131 ? 12.783 24.818 -4.218  1.00 16.05 ? 500 ARG A O     1 
ATOM   1035 C  CB    . ARG A 1 131 ? 12.024 22.505 -2.383  1.00 13.78 ? 500 ARG A CB    1 
ATOM   1036 C  CG    . ARG A 1 131 ? 11.347 21.706 -1.283  1.00 15.47 ? 500 ARG A CG    1 
ATOM   1037 C  CD    . ARG A 1 131 ? 12.373 20.992 -0.417  1.00 16.12 ? 500 ARG A CD    1 
ATOM   1038 N  NE    . ARG A 1 131 ? 13.199 20.081 -1.205  1.00 16.61 ? 500 ARG A NE    1 
ATOM   1039 C  CZ    . ARG A 1 131 ? 12.871 18.824 -1.485  1.00 18.96 ? 500 ARG A CZ    1 
ATOM   1040 N  NH1   . ARG A 1 131 ? 11.728 18.316 -1.042  1.00 21.02 ? 500 ARG A NH1   1 
ATOM   1041 N  NH2   . ARG A 1 131 ? 13.687 18.072 -2.210  1.00 19.88 ? 500 ARG A NH2   1 
ATOM   1042 N  N     . LEU A 1 132 ? 14.412 24.876 -2.650  1.00 14.29 ? 501 LEU A N     1 
ATOM   1043 C  CA    . LEU A 1 132 ? 15.409 25.348 -3.604  1.00 16.69 ? 501 LEU A CA    1 
ATOM   1044 C  C     . LEU A 1 132 ? 15.729 24.278 -4.640  1.00 17.33 ? 501 LEU A C     1 
ATOM   1045 O  O     . LEU A 1 132 ? 16.096 24.606 -5.774  1.00 17.09 ? 501 LEU A O     1 
ATOM   1046 C  CB    . LEU A 1 132 ? 16.674 25.797 -2.871  1.00 15.49 ? 501 LEU A CB    1 
ATOM   1047 C  CG    . LEU A 1 132 ? 17.775 26.429 -3.726  1.00 17.35 ? 501 LEU A CG    1 
ATOM   1048 C  CD1   . LEU A 1 132 ? 17.277 27.696 -4.412  1.00 17.82 ? 501 LEU A CD1   1 
ATOM   1049 C  CD2   . LEU A 1 132 ? 19.018 26.715 -2.893  1.00 18.49 ? 501 LEU A CD2   1 
ATOM   1050 N  N     . ASP A 1 133 ? 15.584 23.000 -4.273  1.00 16.82 ? 502 ASP A N     1 
ATOM   1051 C  CA    . ASP A 1 133 ? 15.772 21.912 -5.230  1.00 18.23 ? 502 ASP A CA    1 
ATOM   1052 C  C     . ASP A 1 133 ? 14.834 22.057 -6.419  1.00 16.36 ? 502 ASP A C     1 
ATOM   1053 O  O     . ASP A 1 133 ? 15.249 21.929 -7.577  1.00 18.30 ? 502 ASP A O     1 
ATOM   1054 C  CB    . ASP A 1 133 ? 15.524 20.561 -4.555  1.00 21.77 ? 502 ASP A CB    1 
ATOM   1055 C  CG    . ASP A 1 133 ? 16.620 20.177 -3.590  1.00 21.34 ? 502 ASP A CG    1 
ATOM   1056 O  OD1   . ASP A 1 133 ? 16.321 19.467 -2.605  1.00 20.57 ? 502 ASP A OD1   1 
ATOM   1057 O  OD2   . ASP A 1 133 ? 17.776 20.593 -3.810  1.00 22.06 ? 502 ASP A OD2   1 
ATOM   1058 N  N     . ASN A 1 134 ? 13.551 22.308 -6.146  1.00 14.94 ? 503 ASN A N     1 
ATOM   1059 C  CA    . ASN A 1 134 ? 12.580 22.414 -7.227  1.00 19.25 ? 503 ASN A CA    1 
ATOM   1060 C  C     . ASN A 1 134 ? 12.843 23.632 -8.101  1.00 17.53 ? 503 ASN A C     1 
ATOM   1061 O  O     . ASN A 1 134 ? 12.579 23.591 -9.307  1.00 19.28 ? 503 ASN A O     1 
ATOM   1062 C  CB    . ASN A 1 134 ? 11.155 22.439 -6.673  1.00 18.87 ? 503 ASN A CB    1 
ATOM   1063 C  CG    . ASN A 1 134 ? 10.806 21.184 -5.894  1.00 25.56 ? 503 ASN A CG    1 
ATOM   1064 O  OD1   . ASN A 1 134 ? 9.861  21.177 -5.105  1.00 31.49 ? 503 ASN A OD1   1 
ATOM   1065 N  ND2   . ASN A 1 134 ? 11.571 20.119 -6.106  1.00 24.54 ? 503 ASN A ND2   1 
ATOM   1066 N  N     . LEU A 1 135 ? 13.366 24.716 -7.521  1.00 13.81 ? 504 LEU A N     1 
ATOM   1067 C  CA    . LEU A 1 135 ? 13.712 25.880 -8.329  1.00 14.31 ? 504 LEU A CA    1 
ATOM   1068 C  C     . LEU A 1 135 ? 14.887 25.581 -9.253  1.00 14.31 ? 504 LEU A C     1 
ATOM   1069 O  O     . LEU A 1 135 ? 14.878 25.978 -10.424 1.00 17.10 ? 504 LEU A O     1 
ATOM   1070 C  CB    . LEU A 1 135 ? 14.014 27.084 -7.436  1.00 13.93 ? 504 LEU A CB    1 
ATOM   1071 C  CG    . LEU A 1 135 ? 14.528 28.320 -8.180  1.00 15.31 ? 504 LEU A CG    1 
ATOM   1072 C  CD1   . LEU A 1 135 ? 13.513 28.779 -9.217  1.00 17.10 ? 504 LEU A CD1   1 
ATOM   1073 C  CD2   . LEU A 1 135 ? 14.870 29.446 -7.213  1.00 17.08 ? 504 LEU A CD2   1 
ATOM   1074 N  N     . LYS A 1 136 ? 15.908 24.884 -8.745  1.00 12.93 ? 505 LYS A N     1 
ATOM   1075 C  CA    . LYS A 1 136 ? 17.039 24.500 -9.586  1.00 14.05 ? 505 LYS A CA    1 
ATOM   1076 C  C     . LYS A 1 136 ? 16.581 23.654 -10.766 1.00 15.62 ? 505 LYS A C     1 
ATOM   1077 O  O     . LYS A 1 136 ? 16.975 23.899 -11.912 1.00 16.21 ? 505 LYS A O     1 
ATOM   1078 C  CB    . LYS A 1 136 ? 18.073 23.732 -8.763  1.00 17.33 ? 505 LYS A CB    1 
ATOM   1079 C  CG    . LYS A 1 136 ? 18.653 24.497 -7.589  1.00 19.42 ? 505 LYS A CG    1 
ATOM   1080 C  CD    . LYS A 1 136 ? 19.787 23.714 -6.942  1.00 24.29 ? 505 LYS A CD    1 
ATOM   1081 C  CE    . LYS A 1 136 ? 20.214 24.334 -5.621  1.00 28.16 ? 505 LYS A CE    1 
ATOM   1082 N  NZ    . LYS A 1 136 ? 21.633 24.022 -5.286  1.00 32.28 ? 505 LYS A NZ    1 
ATOM   1083 N  N     . ALA A 1 137 ? 15.749 22.644 -10.502 1.00 17.81 ? 506 ALA A N     1 
ATOM   1084 C  CA    . ALA A 1 137 ? 15.251 21.801 -11.583 1.00 18.73 ? 506 ALA A CA    1 
ATOM   1085 C  C     . ALA A 1 137 ? 14.345 22.590 -12.519 1.00 18.53 ? 506 ALA A C     1 
ATOM   1086 O  O     . ALA A 1 137 ? 14.327 22.345 -13.732 1.00 22.19 ? 506 ALA A O     1 
ATOM   1087 C  CB    . ALA A 1 137 ? 14.514 20.592 -11.008 1.00 22.27 ? 506 ALA A CB    1 
ATOM   1088 N  N     . HIS A 1 138 ? 13.590 23.547 -11.973 1.00 16.59 ? 507 HIS A N     1 
ATOM   1089 C  CA    . HIS A 1 138 ? 12.714 24.370 -12.801 1.00 18.36 ? 507 HIS A CA    1 
ATOM   1090 C  C     . HIS A 1 138 ? 13.516 25.240 -13.759 1.00 19.81 ? 507 HIS A C     1 
ATOM   1091 O  O     . HIS A 1 138 ? 13.136 25.408 -14.923 1.00 20.95 ? 507 HIS A O     1 
ATOM   1092 C  CB    . HIS A 1 138 ? 11.828 25.241 -11.912 1.00 16.71 ? 507 HIS A CB    1 
ATOM   1093 C  CG    . HIS A 1 138 ? 11.092 26.311 -12.656 1.00 19.20 ? 507 HIS A CG    1 
ATOM   1094 N  ND1   . HIS A 1 138 ? 9.920  26.071 -13.340 1.00 21.80 ? 507 HIS A ND1   1 
ATOM   1095 C  CD2   . HIS A 1 138 ? 11.365 27.627 -12.827 1.00 17.97 ? 507 HIS A CD2   1 
ATOM   1096 C  CE1   . HIS A 1 138 ? 9.501  27.192 -13.898 1.00 21.64 ? 507 HIS A CE1   1 
ATOM   1097 N  NE2   . HIS A 1 138 ? 10.360 28.151 -13.603 1.00 22.49 ? 507 HIS A NE2   1 
ATOM   1098 N  N     . LEU A 1 139 ? 14.630 25.805 -13.284 1.00 16.86 ? 508 LEU A N     1 
ATOM   1099 C  CA    . LEU A 1 139 ? 15.439 26.673 -14.132 1.00 17.14 ? 508 LEU A CA    1 
ATOM   1100 C  C     . LEU A 1 139 ? 16.097 25.906 -15.271 1.00 23.01 ? 508 LEU A C     1 
ATOM   1101 O  O     . LEU A 1 139 ? 16.414 26.496 -16.310 1.00 25.29 ? 508 LEU A O     1 
ATOM   1102 C  CB    . LEU A 1 139 ? 16.483 27.410 -13.292 1.00 16.62 ? 508 LEU A CB    1 
ATOM   1103 C  CG    . LEU A 1 139 ? 15.950 28.592 -12.482 1.00 16.28 ? 508 LEU A CG    1 
ATOM   1104 C  CD1   . LEU A 1 139 ? 16.957 29.030 -11.436 1.00 18.59 ? 508 LEU A CD1   1 
ATOM   1105 C  CD2   . LEU A 1 139 ? 15.604 29.751 -13.404 1.00 18.80 ? 508 LEU A CD2   1 
ATOM   1106 N  N     . LYS A 1 140 ? 16.315 24.599 -15.099 1.00 24.32 ? 509 LYS A N     1 
ATOM   1107 C  CA    . LYS A 1 140 ? 16.837 23.795 -16.198 1.00 28.20 ? 509 LYS A CA    1 
ATOM   1108 C  C     . LYS A 1 140 ? 15.863 23.749 -17.368 1.00 31.40 ? 509 LYS A C     1 
ATOM   1109 O  O     . LYS A 1 140 ? 16.283 23.604 -18.522 1.00 34.04 ? 509 LYS A O     1 
ATOM   1110 C  CB    . LYS A 1 140 ? 17.165 22.380 -15.719 1.00 32.33 ? 509 LYS A CB    1 
ATOM   1111 C  CG    . LYS A 1 140 ? 18.420 22.279 -14.869 1.00 34.33 ? 509 LYS A CG    1 
ATOM   1112 C  CD    . LYS A 1 140 ? 18.717 20.833 -14.508 1.00 39.01 ? 509 LYS A CD    1 
ATOM   1113 C  CE    . LYS A 1 140 ? 19.975 20.714 -13.664 1.00 42.83 ? 509 LYS A CE    1 
ATOM   1114 N  NZ    . LYS A 1 140 ? 21.194 21.132 -14.412 1.00 48.37 ? 509 LYS A NZ    1 
ATOM   1115 N  N     . ILE A 1 141 ? 14.563 23.871 -17.091 1.00 31.32 ? 510 ILE A N     1 
ATOM   1116 C  CA    . ILE A 1 141 ? 13.574 23.920 -18.163 1.00 33.81 ? 510 ILE A CA    1 
ATOM   1117 C  C     . ILE A 1 141 ? 13.721 25.205 -18.967 1.00 34.97 ? 510 ILE A C     1 
ATOM   1118 O  O     . ILE A 1 141 ? 13.587 25.202 -20.197 1.00 38.65 ? 510 ILE A O     1 
ATOM   1119 C  CB    . ILE A 1 141 ? 12.154 23.749 -17.592 1.00 34.83 ? 510 ILE A CB    1 
ATOM   1120 C  CG1   . ILE A 1 141 ? 12.063 22.459 -16.777 1.00 37.24 ? 510 ILE A CG1   1 
ATOM   1121 C  CG2   . ILE A 1 141 ? 11.122 23.746 -18.710 1.00 37.20 ? 510 ILE A CG2   1 
ATOM   1122 C  CD1   . ILE A 1 141 ? 10.726 22.254 -16.111 1.00 39.66 ? 510 ILE A CD1   1 
ATOM   1123 N  N     . HIS A 1 142 ? 13.996 26.323 -18.289 1.00 29.59 ? 511 HIS A N     1 
ATOM   1124 C  CA    . HIS A 1 142 ? 14.266 27.569 -18.999 1.00 30.58 ? 511 HIS A CA    1 
ATOM   1125 C  C     . HIS A 1 142 ? 15.520 27.450 -19.855 1.00 31.93 ? 511 HIS A C     1 
ATOM   1126 O  O     . HIS A 1 142 ? 15.567 27.966 -20.977 1.00 37.13 ? 511 HIS A O     1 
ATOM   1127 C  CB    . HIS A 1 142 ? 14.407 28.724 -18.006 1.00 30.15 ? 511 HIS A CB    1 
ATOM   1128 C  CG    . HIS A 1 142 ? 13.119 29.144 -17.370 1.00 29.39 ? 511 HIS A CG    1 
ATOM   1129 N  ND1   . HIS A 1 142 ? 12.043 29.605 -18.098 1.00 31.67 ? 511 HIS A ND1   1 
ATOM   1130 C  CD2   . HIS A 1 142 ? 12.740 29.191 -16.070 1.00 27.27 ? 511 HIS A CD2   1 
ATOM   1131 C  CE1   . HIS A 1 142 ? 11.055 29.909 -17.276 1.00 30.19 ? 511 HIS A CE1   1 
ATOM   1132 N  NE2   . HIS A 1 142 ? 11.452 29.667 -16.040 1.00 29.04 ? 511 HIS A NE2   1 
ATOM   1133 N  N     . SER A 1 143 ? 16.549 26.772 -19.339 1.00 31.22 ? 512 SER A N     1 
ATOM   1134 C  CA    . SER A 1 143 ? 17.769 26.573 -20.115 1.00 37.09 ? 512 SER A CA    1 
ATOM   1135 C  C     . SER A 1 143 ? 17.506 25.707 -21.340 1.00 41.76 ? 512 SER A C     1 
ATOM   1136 O  O     . SER A 1 143 ? 18.060 25.956 -22.418 1.00 45.91 ? 512 SER A O     1 
ATOM   1137 C  CB    . SER A 1 143 ? 18.852 25.944 -19.239 1.00 39.01 ? 512 SER A CB    1 
ATOM   1138 O  OG    . SER A 1 143 ? 19.163 26.772 -18.132 1.00 41.24 ? 512 SER A OG    1 
ATOM   1139 N  N     . LYS A 1 144 ? 16.662 24.683 -21.194 1.00 42.87 ? 513 LYS A N     1 
ATOM   1140 C  CA    . LYS A 1 144 ? 16.327 23.834 -22.332 1.00 46.65 ? 513 LYS A CA    1 
ATOM   1141 C  C     . LYS A 1 144 ? 15.471 24.583 -23.346 1.00 51.37 ? 513 LYS A C     1 
ATOM   1142 O  O     . LYS A 1 144 ? 15.619 24.386 -24.557 1.00 56.76 ? 513 LYS A O     1 
ATOM   1143 C  CB    . LYS A 1 144 ? 15.616 22.570 -21.852 1.00 45.29 ? 513 LYS A CB    1 
ATOM   1144 N  N     . GLU A 1 145 ? 14.569 25.444 -22.869 1.00 51.32 ? 514 GLU A N     1 
ATOM   1145 C  CA    . GLU A 1 145 ? 13.740 26.225 -23.781 1.00 56.35 ? 514 GLU A CA    1 
ATOM   1146 C  C     . GLU A 1 145 ? 14.581 27.218 -24.573 1.00 66.60 ? 514 GLU A C     1 
ATOM   1147 O  O     . GLU A 1 145 ? 14.314 27.468 -25.755 1.00 68.28 ? 514 GLU A O     1 
ATOM   1148 C  CB    . GLU A 1 145 ? 12.642 26.949 -23.002 1.00 50.01 ? 514 GLU A CB    1 
ATOM   1149 N  N     . LYS A 1 146 ? 15.602 27.789 -23.942 1.00 38.24 ? 515 LYS A N     1 
ATOM   1150 C  CA    . LYS A 1 146 ? 16.492 28.729 -24.611 1.00 43.57 ? 515 LYS A CA    1 
ATOM   1151 C  C     . LYS A 1 146 ? 17.586 27.985 -25.371 1.00 46.91 ? 515 LYS A C     1 
ATOM   1152 O  O     . LYS A 1 146 ? 17.618 27.997 -26.601 1.00 49.93 ? 515 LYS A O     1 
ATOM   1153 C  CB    . LYS A 1 146 ? 17.104 29.689 -23.602 1.00 43.46 ? 515 LYS A CB    1 
ATOM   1154 O  "O5'" . DA  B 2 1   ? 6.299  15.547 -20.272 1.00 29.45 ? 1   DA  E "O5'" 1 
ATOM   1155 C  "C5'" . DA  B 2 1   ? 5.943  16.529 -21.238 1.00 28.75 ? 1   DA  E "C5'" 1 
ATOM   1156 C  "C4'" . DA  B 2 1   ? 5.556  17.842 -20.572 1.00 26.55 ? 1   DA  E "C4'" 1 
ATOM   1157 O  "O4'" . DA  B 2 1   ? 4.380  17.649 -19.743 1.00 23.07 ? 1   DA  E "O4'" 1 
ATOM   1158 C  "C3'" . DA  B 2 1   ? 6.612  18.448 -19.656 1.00 23.32 ? 1   DA  E "C3'" 1 
ATOM   1159 O  "O3'" . DA  B 2 1   ? 6.555  19.861 -19.741 1.00 24.97 ? 1   DA  E "O3'" 1 
ATOM   1160 C  "C2'" . DA  B 2 1   ? 6.184  17.955 -18.275 1.00 22.03 ? 1   DA  E "C2'" 1 
ATOM   1161 C  "C1'" . DA  B 2 1   ? 4.670  18.001 -18.402 1.00 21.17 ? 1   DA  E "C1'" 1 
ATOM   1162 N  N9    . DA  B 2 1   ? 3.963  17.061 -17.537 1.00 20.80 ? 1   DA  E N9    1 
ATOM   1163 C  C8    . DA  B 2 1   ? 3.037  17.359 -16.576 1.00 18.99 ? 1   DA  E C8    1 
ATOM   1164 N  N7    . DA  B 2 1   ? 2.539  16.303 -15.976 1.00 19.94 ? 1   DA  E N7    1 
ATOM   1165 C  C5    . DA  B 2 1   ? 3.181  15.240 -16.589 1.00 21.21 ? 1   DA  E C5    1 
ATOM   1166 C  C6    . DA  B 2 1   ? 3.098  13.846 -16.405 1.00 24.59 ? 1   DA  E C6    1 
ATOM   1167 N  N6    . DA  B 2 1   ? 2.294  13.268 -15.510 1.00 27.62 ? 1   DA  E N6    1 
ATOM   1168 N  N1    . DA  B 2 1   ? 3.875  13.066 -17.182 1.00 24.39 ? 1   DA  E N1    1 
ATOM   1169 C  C2    . DA  B 2 1   ? 4.680  13.647 -18.078 1.00 25.28 ? 1   DA  E C2    1 
ATOM   1170 N  N3    . DA  B 2 1   ? 4.840  14.940 -18.345 1.00 24.09 ? 1   DA  E N3    1 
ATOM   1171 C  C4    . DA  B 2 1   ? 4.057  15.690 -17.557 1.00 22.23 ? 1   DA  E C4    1 
ATOM   1172 P  P     . DC  B 2 2   ? 7.769  20.754 -19.190 1.00 26.58 ? 2   DC  E P     1 
ATOM   1173 O  OP1   . DC  B 2 2   ? 7.608  22.109 -19.763 1.00 27.56 ? 2   DC  E OP1   1 
ATOM   1174 O  OP2   . DC  B 2 2   ? 9.020  19.997 -19.416 1.00 30.79 ? 2   DC  E OP2   1 
ATOM   1175 O  "O5'" . DC  B 2 2   ? 7.519  20.811 -17.611 1.00 25.85 ? 2   DC  E "O5'" 1 
ATOM   1176 C  "C5'" . DC  B 2 2   ? 6.332  21.402 -17.099 1.00 23.48 ? 2   DC  E "C5'" 1 
ATOM   1177 C  "C4'" . DC  B 2 2   ? 6.193  21.144 -15.608 1.00 19.91 ? 2   DC  E "C4'" 1 
ATOM   1178 O  "O4'" . DC  B 2 2   ? 5.736  19.783 -15.378 1.00 20.34 ? 2   DC  E "O4'" 1 
ATOM   1179 C  "C3'" . DC  B 2 2   ? 7.483  21.286 -14.792 1.00 19.17 ? 2   DC  E "C3'" 1 
ATOM   1180 O  "O3'" . DC  B 2 2   ? 7.176  21.861 -13.538 1.00 24.17 ? 2   DC  E "O3'" 1 
ATOM   1181 C  "C2'" . DC  B 2 2   ? 7.917  19.836 -14.619 1.00 18.60 ? 2   DC  E "C2'" 1 
ATOM   1182 C  "C1'" . DC  B 2 2   ? 6.561  19.201 -14.398 1.00 18.81 ? 2   DC  E "C1'" 1 
ATOM   1183 N  N1    . DC  B 2 2   ? 6.532  17.729 -14.553 1.00 18.64 ? 2   DC  E N1    1 
ATOM   1184 C  C2    . DC  B 2 2   ? 5.493  17.006 -13.965 1.00 17.00 ? 2   DC  E C2    1 
ATOM   1185 O  O2    . DC  B 2 2   ? 4.622  17.615 -13.332 1.00 18.98 ? 2   DC  E O2    1 
ATOM   1186 N  N3    . DC  B 2 2   ? 5.467  15.660 -14.108 1.00 17.60 ? 2   DC  E N3    1 
ATOM   1187 C  C4    . DC  B 2 2   ? 6.425  15.045 -14.800 1.00 18.77 ? 2   DC  E C4    1 
ATOM   1188 N  N4    . DC  B 2 2   ? 6.356  13.715 -14.914 1.00 19.81 ? 2   DC  E N4    1 
ATOM   1189 C  C5    . DC  B 2 2   ? 7.497  15.766 -15.407 1.00 19.46 ? 2   DC  E C5    1 
ATOM   1190 C  C6    . DC  B 2 2   ? 7.513  17.094 -15.256 1.00 19.87 ? 2   DC  E C6    1 
ATOM   1191 P  P     . DG  B 2 3   ? 7.950  23.167 -13.020 1.00 31.22 ? 3   DG  E P     1 
ATOM   1192 O  OP1   . DG  B 2 3   ? 7.785  24.218 -14.051 1.00 38.12 ? 3   DG  E OP1   1 
ATOM   1193 O  OP2   . DG  B 2 3   ? 9.304  22.747 -12.594 1.00 33.39 ? 3   DG  E OP2   1 
ATOM   1194 O  "O5'" . DG  B 2 3   ? 7.129  23.585 -11.713 1.00 29.95 ? 3   DG  E "O5'" 1 
ATOM   1195 C  "C5'" . DG  B 2 3   ? 5.722  23.773 -11.798 1.00 27.47 ? 3   DG  E "C5'" 1 
ATOM   1196 C  "C4'" . DG  B 2 3   ? 4.991  22.917 -10.776 1.00 25.68 ? 3   DG  E "C4'" 1 
ATOM   1197 O  "O4'" . DG  B 2 3   ? 5.135  21.513 -11.112 1.00 22.84 ? 3   DG  E "O4'" 1 
ATOM   1198 C  "C3'" . DG  B 2 3   ? 5.477  23.064 -9.334  1.00 25.10 ? 3   DG  E "C3'" 1 
ATOM   1199 O  "O3'" . DG  B 2 3   ? 4.362  23.157 -8.468  1.00 25.29 ? 3   DG  E "O3'" 1 
ATOM   1200 C  "C2'" . DG  B 2 3   ? 6.276  21.780 -9.093  1.00 23.09 ? 3   DG  E "C2'" 1 
ATOM   1201 C  "C1'" . DG  B 2 3   ? 5.527  20.789 -9.967  1.00 21.12 ? 3   DG  E "C1'" 1 
ATOM   1202 N  N9    . DG  B 2 3   ? 6.336  19.657 -10.408 1.00 18.39 ? 3   DG  E N9    1 
ATOM   1203 C  C8    . DG  B 2 3   ? 7.514  19.710 -11.113 1.00 18.62 ? 3   DG  E C8    1 
ATOM   1204 N  N7    . DG  B 2 3   ? 8.007  18.536 -11.392 1.00 18.20 ? 3   DG  E N7    1 
ATOM   1205 C  C5    . DG  B 2 3   ? 7.095  17.644 -10.843 1.00 17.34 ? 3   DG  E C5    1 
ATOM   1206 C  C6    . DG  B 2 3   ? 7.099  16.228 -10.829 1.00 19.28 ? 3   DG  E C6    1 
ATOM   1207 O  O6    . DG  B 2 3   ? 7.938  15.457 -11.318 1.00 20.33 ? 3   DG  E O6    1 
ATOM   1208 N  N1    . DG  B 2 3   ? 5.986  15.717 -10.166 1.00 15.40 ? 3   DG  E N1    1 
ATOM   1209 C  C2    . DG  B 2 3   ? 4.997  16.477 -9.588  1.00 15.16 ? 3   DG  E C2    1 
ATOM   1210 N  N2    . DG  B 2 3   ? 4.002  15.803 -8.992  1.00 15.08 ? 3   DG  E N2    1 
ATOM   1211 N  N3    . DG  B 2 3   ? 4.981  17.804 -9.594  1.00 17.02 ? 3   DG  E N3    1 
ATOM   1212 C  C4    . DG  B 2 3   ? 6.057  18.318 -10.236 1.00 17.29 ? 3   DG  E C4    1 
ATOM   1213 P  P     . DC  B 2 4   ? 4.560  23.621 -6.944  1.00 28.62 ? 4   DC  E P     1 
ATOM   1214 O  OP1   . DC  B 2 4   ? 3.332  24.339 -6.533  1.00 32.35 ? 4   DC  E OP1   1 
ATOM   1215 O  OP2   . DC  B 2 4   ? 5.879  24.283 -6.842  1.00 30.82 ? 4   DC  E OP2   1 
ATOM   1216 O  "O5'" . DC  B 2 4   ? 4.653  22.246 -6.140  1.00 27.74 ? 4   DC  E "O5'" 1 
ATOM   1217 C  "C5'" . DC  B 2 4   ? 3.626  21.283 -6.277  1.00 24.90 ? 4   DC  E "C5'" 1 
ATOM   1218 C  "C4'" . DC  B 2 4   ? 4.053  19.953 -5.690  1.00 20.48 ? 4   DC  E "C4'" 1 
ATOM   1219 O  "O4'" . DC  B 2 4   ? 4.954  19.290 -6.588  1.00 20.45 ? 4   DC  E "O4'" 1 
ATOM   1220 C  "C3'" . DC  B 2 4   ? 4.795  20.038 -4.354  1.00 19.59 ? 4   DC  E "C3'" 1 
ATOM   1221 O  "O3'" . DC  B 2 4   ? 3.941  19.593 -3.318  1.00 16.63 ? 4   DC  E "O3'" 1 
ATOM   1222 C  "C2'" . DC  B 2 4   ? 6.018  19.109 -4.528  1.00 18.43 ? 4   DC  E "C2'" 1 
ATOM   1223 C  "C1'" . DC  B 2 4   ? 5.714  18.388 -5.836  1.00 17.42 ? 4   DC  E "C1'" 1 
ATOM   1224 N  N1    . DC  B 2 4   ? 6.914  18.017 -6.634  1.00 14.37 ? 4   DC  E N1    1 
ATOM   1225 C  C2    . DC  B 2 4   ? 7.182  16.668 -6.887  1.00 13.56 ? 4   DC  E C2    1 
ATOM   1226 O  O2    . DC  B 2 4   ? 6.428  15.806 -6.421  1.00 17.83 ? 4   DC  E O2    1 
ATOM   1227 N  N3    . DC  B 2 4   ? 8.268  16.344 -7.631  1.00 13.66 ? 4   DC  E N3    1 
ATOM   1228 C  C4    . DC  B 2 4   ? 9.058  17.304 -8.114  1.00 13.23 ? 4   DC  E C4    1 
ATOM   1229 N  N4    . DC  B 2 4   ? 10.115 16.933 -8.843  1.00 15.99 ? 4   DC  E N4    1 
ATOM   1230 C  C5    . DC  B 2 4   ? 8.796  18.686 -7.874  1.00 17.00 ? 4   DC  E C5    1 
ATOM   1231 C  C6    . DC  B 2 4   ? 7.721  18.994 -7.140  1.00 17.09 ? 4   DC  E C6    1 
ATOM   1232 P  P     . DA  B 2 5   ? 4.318  19.854 -1.780  1.00 16.19 ? 5   DA  E P     1 
ATOM   1233 O  OP1   . DA  B 2 5   ? 3.042  19.924 -1.034  1.00 18.98 ? 5   DA  E OP1   1 
ATOM   1234 O  OP2   . DA  B 2 5   ? 5.273  20.983 -1.709  1.00 16.84 ? 5   DA  E OP2   1 
ATOM   1235 O  "O5'" . DA  B 2 5   ? 5.098  18.529 -1.358  1.00 14.56 ? 5   DA  E "O5'" 1 
ATOM   1236 C  "C5'" . DA  B 2 5   ? 4.532  17.260 -1.637  1.00 12.91 ? 5   DA  E "C5'" 1 
ATOM   1237 C  "C4'" . DA  B 2 5   ? 5.567  16.170 -1.468  1.00 14.28 ? 5   DA  E "C4'" 1 
ATOM   1238 O  "O4'" . DA  B 2 5   ? 6.457  16.151 -2.618  1.00 13.60 ? 5   DA  E "O4'" 1 
ATOM   1239 C  "C3'" . DA  B 2 5   ? 6.477  16.327 -0.239  1.00 14.40 ? 5   DA  E "C3'" 1 
ATOM   1240 O  "O3'" . DA  B 2 5   ? 6.664  15.066 0.368   1.00 15.39 ? 5   DA  E "O3'" 1 
ATOM   1241 C  "C2'" . DA  B 2 5   ? 7.780  16.817 -0.855  1.00 15.15 ? 5   DA  E "C2'" 1 
ATOM   1242 C  "C1'" . DA  B 2 5   ? 7.766  16.011 -2.137  1.00 12.97 ? 5   DA  E "C1'" 1 
ATOM   1243 N  N9    . DA  B 2 5   ? 8.725  16.463 -3.138  1.00 12.10 ? 5   DA  E N9    1 
ATOM   1244 C  C8    . DA  B 2 5   ? 9.141  17.744 -3.371  1.00 12.67 ? 5   DA  E C8    1 
ATOM   1245 N  N7    . DA  B 2 5   ? 10.038 17.842 -4.325  1.00 12.83 ? 5   DA  E N7    1 
ATOM   1246 C  C5    . DA  B 2 5   ? 10.228 16.534 -4.736  1.00 11.45 ? 5   DA  E C5    1 
ATOM   1247 C  C6    . DA  B 2 5   ? 11.056 15.961 -5.720  1.00 13.38 ? 5   DA  E C6    1 
ATOM   1248 N  N6    . DA  B 2 5   ? 11.879 16.675 -6.494  1.00 13.13 ? 5   DA  E N6    1 
ATOM   1249 N  N1    . DA  B 2 5   ? 11.004 14.621 -5.877  1.00 12.69 ? 5   DA  E N1    1 
ATOM   1250 C  C2    . DA  B 2 5   ? 10.180 13.911 -5.098  1.00 13.14 ? 5   DA  E C2    1 
ATOM   1251 N  N3    . DA  B 2 5   ? 9.357  14.338 -4.142  1.00 11.57 ? 5   DA  E N3    1 
ATOM   1252 C  C4    . DA  B 2 5   ? 9.431  15.672 -4.011  1.00 11.11 ? 5   DA  E C4    1 
ATOM   1253 P  P     . DG  B 2 6   ? 6.582  14.899 1.961   1.00 23.89 ? 6   DG  E P     1 
ATOM   1254 O  OP1   . DG  B 2 6   ? 5.154  15.015 2.333   1.00 32.99 ? 6   DG  E OP1   1 
ATOM   1255 O  OP2   . DG  B 2 6   ? 7.592  15.786 2.583   1.00 33.32 ? 6   DG  E OP2   1 
ATOM   1256 O  "O5'" . DG  B 2 6   ? 7.056  13.391 2.189   1.00 23.46 ? 6   DG  E "O5'" 1 
ATOM   1257 C  "C5'" . DG  B 2 6   ? 6.557  12.363 1.345   1.00 27.73 ? 6   DG  E "C5'" 1 
ATOM   1258 C  "C4'" . DG  B 2 6   ? 7.690  11.518 0.789   1.00 24.22 ? 6   DG  E "C4'" 1 
ATOM   1259 O  "O4'" . DG  B 2 6   ? 8.383  12.247 -0.258  1.00 20.46 ? 6   DG  E "O4'" 1 
ATOM   1260 C  "C3'" . DG  B 2 6   ? 8.760  11.111 1.809   1.00 25.82 ? 6   DG  E "C3'" 1 
ATOM   1261 O  "O3'" . DG  B 2 6   ? 8.968  9.706  1.751   1.00 30.75 ? 6   DG  E "O3'" 1 
ATOM   1262 C  "C2'" . DG  B 2 6   ? 10.000 11.891 1.362   1.00 21.45 ? 6   DG  E "C2'" 1 
ATOM   1263 C  "C1'" . DG  B 2 6   ? 9.761  12.009 -0.129  1.00 18.01 ? 6   DG  E "C1'" 1 
ATOM   1264 N  N9    . DG  B 2 6   ? 10.493 13.107 -0.753  1.00 14.73 ? 6   DG  E N9    1 
ATOM   1265 C  C8    . DG  B 2 6   ? 10.361 14.448 -0.493  1.00 14.30 ? 6   DG  E C8    1 
ATOM   1266 N  N7    . DG  B 2 6   ? 11.154 15.197 -1.210  1.00 13.01 ? 6   DG  E N7    1 
ATOM   1267 C  C5    . DG  B 2 6   ? 11.859 14.291 -1.994  1.00 12.09 ? 6   DG  E C5    1 
ATOM   1268 C  C6    . DG  B 2 6   ? 12.862 14.511 -2.967  1.00 11.36 ? 6   DG  E C6    1 
ATOM   1269 O  O6    . DG  B 2 6   ? 13.341 15.587 -3.342  1.00 14.30 ? 6   DG  E O6    1 
ATOM   1270 N  N1    . DG  B 2 6   ? 13.312 13.315 -3.525  1.00 12.64 ? 6   DG  E N1    1 
ATOM   1271 C  C2    . DG  B 2 6   ? 12.849 12.067 -3.184  1.00 13.76 ? 6   DG  E C2    1 
ATOM   1272 N  N2    . DG  B 2 6   ? 13.402 11.030 -3.829  1.00 15.41 ? 6   DG  E N2    1 
ATOM   1273 N  N3    . DG  B 2 6   ? 11.910 11.849 -2.275  1.00 14.83 ? 6   DG  E N3    1 
ATOM   1274 C  C4    . DG  B 2 6   ? 11.463 13.002 -1.723  1.00 12.80 ? 6   DG  E C4    1 
ATOM   1275 P  P     . DG  B 2 7   ? 10.196 9.019  2.532   1.00 33.96 ? 7   DG  E P     1 
ATOM   1276 O  OP1   . DG  B 2 7   ? 9.755  7.650  2.877   1.00 41.18 ? 7   DG  E OP1   1 
ATOM   1277 O  OP2   . DG  B 2 7   ? 10.686 9.923  3.598   1.00 33.81 ? 7   DG  E OP2   1 
ATOM   1278 O  "O5'" . DG  B 2 7   ? 11.346 8.924  1.428   1.00 23.97 ? 7   DG  E "O5'" 1 
ATOM   1279 C  "C5'" . DG  B 2 7   ? 11.155 8.119  0.274   1.00 23.04 ? 7   DG  E "C5'" 1 
ATOM   1280 C  "C4'" . DG  B 2 7   ? 12.480 7.572  -0.230  1.00 19.32 ? 7   DG  E "C4'" 1 
ATOM   1281 O  "O4'" . DG  B 2 7   ? 13.185 8.598  -0.975  1.00 15.87 ? 7   DG  E "O4'" 1 
ATOM   1282 C  "C3'" . DG  B 2 7   ? 13.439 7.101  0.856   1.00 17.14 ? 7   DG  E "C3'" 1 
ATOM   1283 O  "O3'" . DG  B 2 7   ? 14.135 5.954  0.413   1.00 17.16 ? 7   DG  E "O3'" 1 
ATOM   1284 C  "C2'" . DG  B 2 7   ? 14.377 8.293  1.041   1.00 14.07 ? 7   DG  E "C2'" 1 
ATOM   1285 C  "C1'" . DG  B 2 7   ? 14.424 8.894  -0.359  1.00 14.99 ? 7   DG  E "C1'" 1 
ATOM   1286 N  N9    . DG  B 2 7   ? 14.578 10.344 -0.353  1.00 11.77 ? 7   DG  E N9    1 
ATOM   1287 C  C8    . DG  B 2 7   ? 13.810 11.246 0.340   1.00 11.34 ? 7   DG  E C8    1 
ATOM   1288 N  N7    . DG  B 2 7   ? 14.166 12.485 0.152   1.00 11.02 ? 7   DG  E N7    1 
ATOM   1289 C  C5    . DG  B 2 7   ? 15.237 12.402 -0.729  1.00 11.05 ? 7   DG  E C5    1 
ATOM   1290 C  C6    . DG  B 2 7   ? 16.031 13.427 -1.293  1.00 11.27 ? 7   DG  E C6    1 
ATOM   1291 O  O6    . DG  B 2 7   ? 15.941 14.650 -1.121  1.00 12.52 ? 7   DG  E O6    1 
ATOM   1292 N  N1    . DG  B 2 7   ? 17.012 12.913 -2.136  1.00 10.38 ? 7   DG  E N1    1 
ATOM   1293 C  C2    . DG  B 2 7   ? 17.203 11.579 -2.399  1.00 11.40 ? 7   DG  E C2    1 
ATOM   1294 N  N2    . DG  B 2 7   ? 18.204 11.279 -3.239  1.00 15.07 ? 7   DG  E N2    1 
ATOM   1295 N  N3    . DG  B 2 7   ? 16.465 10.606 -1.877  1.00 13.34 ? 7   DG  E N3    1 
ATOM   1296 C  C4    . DG  B 2 7   ? 15.503 11.090 -1.052  1.00 11.01 ? 7   DG  E C4    1 
ATOM   1297 P  P     . DT  B 2 8   ? 15.109 5.165  1.416   1.00 18.06 ? 8   DT  E P     1 
ATOM   1298 O  OP1   . DT  B 2 8   ? 15.188 3.774  0.918   1.00 20.55 ? 8   DT  E OP1   1 
ATOM   1299 O  OP2   . DT  B 2 8   ? 14.675 5.429  2.806   1.00 20.88 ? 8   DT  E OP2   1 
ATOM   1300 O  "O5'" . DT  B 2 8   ? 16.522 5.883  1.213   1.00 15.61 ? 8   DT  E "O5'" 1 
ATOM   1301 C  "C5'" . DT  B 2 8   ? 17.089 5.962  -0.081  1.00 16.03 ? 8   DT  E "C5'" 1 
ATOM   1302 C  "C4'" . DT  B 2 8   ? 18.317 6.853  -0.084  1.00 11.73 ? 8   DT  E "C4'" 1 
ATOM   1303 O  "O4'" . DT  B 2 8   ? 17.925 8.235  -0.030  1.00 12.66 ? 8   DT  E "O4'" 1 
ATOM   1304 C  "C3'" . DT  B 2 8   ? 19.284 6.651  1.091   1.00 11.32 ? 8   DT  E "C3'" 1 
ATOM   1305 O  "O3'" . DT  B 2 8   ? 20.491 6.074  0.615   1.00 11.40 ? 8   DT  E "O3'" 1 
ATOM   1306 C  "C2'" . DT  B 2 8   ? 19.515 8.073  1.646   1.00 10.09 ? 8   DT  E "C2'" 1 
ATOM   1307 C  "C1'" . DT  B 2 8   ? 18.997 8.949  0.515   1.00 12.01 ? 8   DT  E "C1'" 1 
ATOM   1308 N  N1    . DT  B 2 8   ? 18.506 10.288 0.944   1.00 11.35 ? 8   DT  E N1    1 
ATOM   1309 C  C2    . DT  B 2 8   ? 19.112 11.415 0.440   1.00 11.78 ? 8   DT  E C2    1 
ATOM   1310 O  O2    . DT  B 2 8   ? 20.047 11.378 -0.338  1.00 14.87 ? 8   DT  E O2    1 
ATOM   1311 N  N3    . DT  B 2 8   ? 18.585 12.596 0.882   1.00 11.11 ? 8   DT  E N3    1 
ATOM   1312 C  C4    . DT  B 2 8   ? 17.532 12.763 1.758   1.00 11.68 ? 8   DT  E C4    1 
ATOM   1313 O  O4    . DT  B 2 8   ? 17.130 13.871 2.095   1.00 11.98 ? 8   DT  E O4    1 
ATOM   1314 C  C5    . DT  B 2 8   ? 16.936 11.543 2.249   1.00 11.35 ? 8   DT  E C5    1 
ATOM   1315 C  C7    . DT  B 2 8   ? 15.785 11.601 3.207   1.00 11.72 ? 8   DT  E C7    1 
ATOM   1316 C  C6    . DT  B 2 8   ? 17.444 10.376 1.822   1.00 10.25 ? 8   DT  E C6    1 
ATOM   1317 P  P     . DC  B 2 9   ? 21.607 5.544  1.642   1.00 11.48 ? 9   DC  E P     1 
ATOM   1318 O  OP1   . DC  B 2 9   ? 22.280 4.402  0.982   1.00 12.63 ? 9   DC  E OP1   1 
ATOM   1319 O  OP2   . DC  B 2 9   ? 20.986 5.366  2.973   1.00 12.14 ? 9   DC  E OP2   1 
ATOM   1320 O  "O5'" . DC  B 2 9   ? 22.634 6.765  1.751   1.00 10.54 ? 9   DC  E "O5'" 1 
ATOM   1321 C  "C5'" . DC  B 2 9   ? 23.389 7.153  0.615   1.00 12.54 ? 9   DC  E "C5'" 1 
ATOM   1322 C  "C4'" . DC  B 2 9   ? 24.101 8.473  0.854   1.00 13.82 ? 9   DC  E "C4'" 1 
ATOM   1323 O  "O4'" . DC  B 2 9   ? 23.129 9.524  1.112   1.00 12.60 ? 9   DC  E "O4'" 1 
ATOM   1324 C  "C3'" . DC  B 2 9   ? 25.062 8.505  2.050   1.00 13.53 ? 9   DC  E "C3'" 1 
ATOM   1325 O  "O3'" . DC  B 2 9   ? 26.155 9.337  1.726   1.00 15.68 ? 9   DC  E "O3'" 1 
ATOM   1326 C  "C2'" . DC  B 2 9   ? 24.207 9.169  3.119   1.00 11.87 ? 9   DC  E "C2'" 1 
ATOM   1327 C  "C1'" . DC  B 2 9   ? 23.545 10.224 2.258   1.00 12.66 ? 9   DC  E "C1'" 1 
ATOM   1328 N  N1    . DC  B 2 9   ? 22.380 10.895 2.879   1.00 12.93 ? 9   DC  E N1    1 
ATOM   1329 C  C2    . DC  B 2 9   ? 22.181 12.257 2.644   1.00 11.41 ? 9   DC  E C2    1 
ATOM   1330 O  O2    . DC  B 2 9   ? 22.978 12.865 1.918   1.00 14.16 ? 9   DC  E O2    1 
ATOM   1331 N  N3    . DC  B 2 9   ? 21.119 12.873 3.212   1.00 10.05 ? 9   DC  E N3    1 
ATOM   1332 C  C4    . DC  B 2 9   ? 20.284 12.182 3.987   1.00 10.24 ? 9   DC  E C4    1 
ATOM   1333 N  N4    . DC  B 2 9   ? 19.251 12.836 4.526   1.00 12.58 ? 9   DC  E N4    1 
ATOM   1334 C  C5    . DC  B 2 9   ? 20.472 10.790 4.243   1.00 10.66 ? 9   DC  E C5    1 
ATOM   1335 C  C6    . DC  B 2 9   ? 21.525 10.193 3.675   1.00 11.57 ? 9   DC  E C6    1 
ATOM   1336 P  P     . DC  B 2 10  ? 27.671 8.830  1.868   1.00 13.11 ? 10  DC  E P     1 
ATOM   1337 O  OP1   . DC  B 2 10  ? 27.924 7.866  0.773   1.00 16.37 ? 10  DC  E OP1   1 
ATOM   1338 O  OP2   . DC  B 2 10  ? 27.921 8.441  3.273   1.00 12.04 ? 10  DC  E OP2   1 
ATOM   1339 O  "O5'" . DC  B 2 10  ? 28.509 10.155 1.568   1.00 16.86 ? 10  DC  E "O5'" 1 
ATOM   1340 C  "C5'" . DC  B 2 10  ? 28.263 10.879 0.369   1.00 18.01 ? 10  DC  E "C5'" 1 
ATOM   1341 C  "C4'" . DC  B 2 10  ? 28.246 12.373 0.628   1.00 17.26 ? 10  DC  E "C4'" 1 
ATOM   1342 O  "O4'" . DC  B 2 10  ? 27.030 12.741 1.324   1.00 14.77 ? 10  DC  E "O4'" 1 
ATOM   1343 C  "C3'" . DC  B 2 10  ? 29.403 12.893 1.483   1.00 19.19 ? 10  DC  E "C3'" 1 
ATOM   1344 O  "O3'" . DC  B 2 10  ? 30.019 13.987 0.830   1.00 22.83 ? 10  DC  E "O3'" 1 
ATOM   1345 C  "C2'" . DC  B 2 10  ? 28.732 13.319 2.793   1.00 17.23 ? 10  DC  E "C2'" 1 
ATOM   1346 C  "C1'" . DC  B 2 10  ? 27.339 13.683 2.319   1.00 15.60 ? 10  DC  E "C1'" 1 
ATOM   1347 N  N1    . DC  B 2 10  ? 26.297 13.596 3.376   1.00 13.40 ? 10  DC  E N1    1 
ATOM   1348 C  C2    . DC  B 2 10  ? 25.663 14.761 3.822   1.00 14.07 ? 10  DC  E C2    1 
ATOM   1349 O  O2    . DC  B 2 10  ? 25.993 15.850 3.339   1.00 16.34 ? 10  DC  E O2    1 
ATOM   1350 N  N3    . DC  B 2 10  ? 24.705 14.661 4.777   1.00 12.90 ? 10  DC  E N3    1 
ATOM   1351 C  C4    . DC  B 2 10  ? 24.379 13.467 5.274   1.00 16.39 ? 10  DC  E C4    1 
ATOM   1352 N  N4    . DC  B 2 10  ? 23.429 13.421 6.215   1.00 16.47 ? 10  DC  E N4    1 
ATOM   1353 C  C5    . DC  B 2 10  ? 25.012 12.269 4.829   1.00 12.29 ? 10  DC  E C5    1 
ATOM   1354 C  C6    . DC  B 2 10  ? 25.954 12.380 3.886   1.00 12.92 ? 10  DC  E C6    1 
ATOM   1355 P  P     . DT  B 2 11  ? 31.492 14.458 1.260   1.00 14.70 ? 11  DT  E P     1 
ATOM   1356 O  OP1   . DT  B 2 11  ? 32.161 14.978 0.047   1.00 17.30 ? 11  DT  E OP1   1 
ATOM   1357 O  OP2   . DT  B 2 11  ? 32.113 13.362 2.041   1.00 16.54 ? 11  DT  E OP2   1 
ATOM   1358 O  "O5'" . DT  B 2 11  ? 31.225 15.662 2.276   1.00 12.73 ? 11  DT  E "O5'" 1 
ATOM   1359 C  "C5'" . DT  B 2 11  ? 30.591 16.845 1.819   1.00 13.80 ? 11  DT  E "C5'" 1 
ATOM   1360 C  "C4'" . DT  B 2 11  ? 30.256 17.766 2.980   1.00 12.17 ? 11  DT  E "C4'" 1 
ATOM   1361 O  "O4'" . DT  B 2 11  ? 29.147 17.233 3.724   1.00 12.93 ? 11  DT  E "O4'" 1 
ATOM   1362 C  "C3'" . DT  B 2 11  ? 31.381 17.980 4.003   1.00 10.85 ? 11  DT  E "C3'" 1 
ATOM   1363 O  "O3'" . DT  B 2 11  ? 31.831 19.324 3.934   1.00 13.63 ? 11  DT  E "O3'" 1 
ATOM   1364 C  "C2'" . DT  B 2 11  ? 30.729 17.665 5.367   1.00 11.30 ? 11  DT  E "C2'" 1 
ATOM   1365 C  "C1'" . DT  B 2 11  ? 29.243 17.705 5.039   1.00 10.63 ? 11  DT  E "C1'" 1 
ATOM   1366 N  N1    . DT  B 2 11  ? 28.394 16.836 5.901   1.00 10.68 ? 11  DT  E N1    1 
ATOM   1367 C  C2    . DT  B 2 11  ? 27.364 17.401 6.617   1.00 10.58 ? 11  DT  E C2    1 
ATOM   1368 O  O2    . DT  B 2 11  ? 27.120 18.594 6.606   1.00 11.82 ? 11  DT  E O2    1 
ATOM   1369 N  N3    . DT  B 2 11  ? 26.629 16.517 7.358   1.00 11.71 ? 11  DT  E N3    1 
ATOM   1370 C  C4    . DT  B 2 11  ? 26.809 15.151 7.449   1.00 12.00 ? 11  DT  E C4    1 
ATOM   1371 O  O4    . DT  B 2 11  ? 26.091 14.440 8.146   1.00 14.13 ? 11  DT  E O4    1 
ATOM   1372 C  C5    . DT  B 2 11  ? 27.901 14.619 6.669   1.00 11.80 ? 11  DT  E C5    1 
ATOM   1373 C  C7    . DT  B 2 11  ? 28.193 13.149 6.689   1.00 15.38 ? 11  DT  E C7    1 
ATOM   1374 C  C6    . DT  B 2 11  ? 28.629 15.476 5.936   1.00 11.75 ? 11  DT  E C6    1 
ATOM   1375 P  P     . DG  B 2 12  ? 33.167 19.784 4.698   1.00 13.50 ? 12  DG  E P     1 
ATOM   1376 O  OP1   . DG  B 2 12  ? 33.769 20.869 3.892   1.00 16.09 ? 12  DG  E OP1   1 
ATOM   1377 O  OP2   . DG  B 2 12  ? 33.966 18.583 5.028   1.00 13.47 ? 12  DG  E OP2   1 
ATOM   1378 O  "O5'" . DG  B 2 12  ? 32.626 20.394 6.071   1.00 14.50 ? 12  DG  E "O5'" 1 
ATOM   1379 C  "C5'" . DG  B 2 12  ? 31.683 21.452 6.048   1.00 14.12 ? 12  DG  E "C5'" 1 
ATOM   1380 C  "C4'" . DG  B 2 12  ? 31.076 21.664 7.421   1.00 14.66 ? 12  DG  E "C4'" 1 
ATOM   1381 O  "O4'" . DG  B 2 12  ? 30.196 20.555 7.748   1.00 14.76 ? 12  DG  E "O4'" 1 
ATOM   1382 C  "C3'" . DG  B 2 12  ? 32.083 21.748 8.577   1.00 12.69 ? 12  DG  E "C3'" 1 
ATOM   1383 O  "O3'" . DG  B 2 12  ? 31.662 22.746 9.487   1.00 17.64 ? 12  DG  E "O3'" 1 
ATOM   1384 C  "C2'" . DG  B 2 12  ? 31.970 20.366 9.210   1.00 11.71 ? 12  DG  E "C2'" 1 
ATOM   1385 C  "C1'" . DG  B 2 12  ? 30.479 20.154 9.063   1.00 11.93 ? 12  DG  E "C1'" 1 
ATOM   1386 N  N9    . DG  B 2 12  ? 30.031 18.781 9.264   1.00 11.25 ? 12  DG  E N9    1 
ATOM   1387 C  C8    . DG  B 2 12  ? 30.670 17.626 8.885   1.00 10.34 ? 12  DG  E C8    1 
ATOM   1388 N  N7    . DG  B 2 12  ? 30.017 16.543 9.212   1.00 11.01 ? 12  DG  E N7    1 
ATOM   1389 C  C5    . DG  B 2 12  ? 28.874 17.015 9.850   1.00 9.96  ? 12  DG  E C5    1 
ATOM   1390 C  C6    . DG  B 2 12  ? 27.789 16.310 10.425  1.00 9.99  ? 12  DG  E C6    1 
ATOM   1391 O  O6    . DG  B 2 12  ? 27.615 15.087 10.486  1.00 12.79 ? 12  DG  E O6    1 
ATOM   1392 N  N1    . DG  B 2 12  ? 26.840 17.176 10.966  1.00 10.92 ? 12  DG  E N1    1 
ATOM   1393 C  C2    . DG  B 2 12  ? 26.929 18.546 10.956  1.00 10.82 ? 12  DG  E C2    1 
ATOM   1394 N  N2    . DG  B 2 12  ? 25.915 19.212 11.530  1.00 12.07 ? 12  DG  E N2    1 
ATOM   1395 N  N3    . DG  B 2 12  ? 27.939 19.217 10.422  1.00 10.97 ? 12  DG  E N3    1 
ATOM   1396 C  C4    . DG  B 2 12  ? 28.872 18.389 9.889   1.00 10.75 ? 12  DG  E C4    1 
ATOM   1397 P  P     . DG  B 2 13  ? 32.663 23.907 9.958   1.00 17.90 ? 13  DG  E P     1 
ATOM   1398 O  OP1   . DG  B 2 13  ? 32.859 24.813 8.804   1.00 20.49 ? 13  DG  E OP1   1 
ATOM   1399 O  OP2   . DG  B 2 13  ? 33.830 23.269 10.607  1.00 21.32 ? 13  DG  E OP2   1 
ATOM   1400 O  "O5'" . DG  B 2 13  ? 31.830 24.676 11.086  1.00 19.84 ? 13  DG  E "O5'" 1 
ATOM   1401 C  "C5'" . DG  B 2 13  ? 30.568 25.246 10.764  1.00 20.47 ? 13  DG  E "C5'" 1 
ATOM   1402 C  "C4'" . DG  B 2 13  ? 29.569 25.024 11.886  1.00 20.32 ? 13  DG  E "C4'" 1 
ATOM   1403 O  "O4'" . DG  B 2 13  ? 29.147 23.635 11.901  1.00 17.91 ? 13  DG  E "O4'" 1 
ATOM   1404 C  "C3'" . DG  B 2 13  ? 30.090 25.325 13.290  1.00 23.84 ? 13  DG  E "C3'" 1 
ATOM   1405 O  "O3'" . DG  B 2 13  ? 29.080 25.980 14.043  1.00 32.07 ? 13  DG  E "O3'" 1 
ATOM   1406 C  "C2'" . DG  B 2 13  ? 30.403 23.938 13.850  1.00 20.81 ? 13  DG  E "C2'" 1 
ATOM   1407 C  "C1'" . DG  B 2 13  ? 29.323 23.096 13.193  1.00 15.73 ? 13  DG  E "C1'" 1 
ATOM   1408 N  N9    . DG  B 2 13  ? 29.682 21.689 13.054  1.00 13.27 ? 13  DG  E N9    1 
ATOM   1409 C  C8    . DG  B 2 13  ? 30.769 21.176 12.389  1.00 12.20 ? 13  DG  E C8    1 
ATOM   1410 N  N7    . DG  B 2 13  ? 30.831 19.875 12.422  1.00 11.94 ? 13  DG  E N7    1 
ATOM   1411 C  C5    . DG  B 2 13  ? 29.711 19.500 13.152  1.00 12.12 ? 13  DG  E C5    1 
ATOM   1412 C  C6    . DG  B 2 13  ? 29.249 18.213 13.515  1.00 11.79 ? 13  DG  E C6    1 
ATOM   1413 O  O6    . DG  B 2 13  ? 29.757 17.115 13.254  1.00 13.10 ? 13  DG  E O6    1 
ATOM   1414 N  N1    . DG  B 2 13  ? 28.075 18.276 14.258  1.00 12.64 ? 13  DG  E N1    1 
ATOM   1415 C  C2    . DG  B 2 13  ? 27.427 19.437 14.605  1.00 14.48 ? 13  DG  E C2    1 
ATOM   1416 N  N2    . DG  B 2 13  ? 26.305 19.300 15.325  1.00 13.23 ? 13  DG  E N2    1 
ATOM   1417 N  N3    . DG  B 2 13  ? 27.848 20.650 14.271  1.00 14.06 ? 13  DG  E N3    1 
ATOM   1418 C  C4    . DG  B 2 13  ? 28.993 20.604 13.547  1.00 12.55 ? 13  DG  E C4    1 
ATOM   1419 P  P     . DA  B 2 14  ? 29.345 26.403 15.570  1.00 35.74 ? 14  DA  E P     1 
ATOM   1420 O  OP1   . DA  B 2 14  ? 28.620 27.672 15.805  1.00 42.99 ? 14  DA  E OP1   1 
ATOM   1421 O  OP2   . DA  B 2 14  ? 30.799 26.330 15.835  1.00 36.12 ? 14  DA  E OP2   1 
ATOM   1422 O  "O5'" . DA  B 2 14  ? 28.644 25.241 16.414  1.00 33.64 ? 14  DA  E "O5'" 1 
ATOM   1423 C  "C5'" . DA  B 2 14  ? 27.254 24.987 16.250  1.00 29.41 ? 14  DA  E "C5'" 1 
ATOM   1424 C  "C4'" . DA  B 2 14  ? 26.724 24.108 17.371  1.00 24.57 ? 14  DA  E "C4'" 1 
ATOM   1425 O  "O4'" . DA  B 2 14  ? 27.061 22.722 17.114  1.00 22.85 ? 14  DA  E "O4'" 1 
ATOM   1426 C  "C3'" . DA  B 2 14  ? 27.262 24.425 18.759  1.00 25.15 ? 14  DA  E "C3'" 1 
ATOM   1427 O  "O3'" . DA  B 2 14  ? 26.237 24.241 19.720  1.00 28.63 ? 14  DA  E "O3'" 1 
ATOM   1428 C  "C2'" . DA  B 2 14  ? 28.395 23.412 18.940  1.00 21.07 ? 14  DA  E "C2'" 1 
ATOM   1429 C  "C1'" . DA  B 2 14  ? 27.897 22.214 18.136  1.00 18.68 ? 14  DA  E "C1'" 1 
ATOM   1430 N  N9    . DA  B 2 14  ? 28.962 21.457 17.488  1.00 15.37 ? 14  DA  E N9    1 
ATOM   1431 C  C8    . DA  B 2 14  ? 30.006 21.963 16.765  1.00 14.83 ? 14  DA  E C8    1 
ATOM   1432 N  N7    . DA  B 2 14  ? 30.802 21.045 16.271  1.00 13.57 ? 14  DA  E N7    1 
ATOM   1433 C  C5    . DA  B 2 14  ? 30.234 19.853 16.690  1.00 12.58 ? 14  DA  E C5    1 
ATOM   1434 C  C6    . DA  B 2 14  ? 30.603 18.506 16.495  1.00 12.13 ? 14  DA  E C6    1 
ATOM   1435 N  N6    . DA  B 2 14  ? 31.680 18.131 15.794  1.00 10.48 ? 14  DA  E N6    1 
ATOM   1436 N  N1    . DA  B 2 14  ? 29.818 17.557 17.048  1.00 11.60 ? 14  DA  E N1    1 
ATOM   1437 C  C2    . DA  B 2 14  ? 28.741 17.937 17.748  1.00 12.17 ? 14  DA  E C2    1 
ATOM   1438 N  N3    . DA  B 2 14  ? 28.295 19.168 18.000  1.00 15.35 ? 14  DA  E N3    1 
ATOM   1439 C  C4    . DA  B 2 14  ? 29.095 20.088 17.437  1.00 13.45 ? 14  DA  E C4    1 
ATOM   1440 P  P     . DC  B 2 15  ? 26.399 24.853 21.195  1.00 32.16 ? 15  DC  E P     1 
ATOM   1441 O  OP1   . DC  B 2 15  ? 25.041 25.192 21.676  1.00 38.85 ? 15  DC  E OP1   1 
ATOM   1442 O  OP2   . DC  B 2 15  ? 27.448 25.896 21.136  1.00 33.05 ? 15  DC  E OP2   1 
ATOM   1443 O  "O5'" . DC  B 2 15  ? 26.971 23.629 22.051  1.00 28.85 ? 15  DC  E "O5'" 1 
ATOM   1444 C  "C5'" . DC  B 2 15  ? 26.245 22.411 22.108  1.00 26.60 ? 15  DC  E "C5'" 1 
ATOM   1445 C  "C4'" . DC  B 2 15  ? 27.052 21.323 22.793  1.00 25.95 ? 15  DC  E "C4'" 1 
ATOM   1446 O  "O4'" . DC  B 2 15  ? 27.894 20.641 21.824  1.00 22.33 ? 15  DC  E "O4'" 1 
ATOM   1447 C  "C3'" . DC  B 2 15  ? 27.999 21.799 23.906  1.00 27.42 ? 15  DC  E "C3'" 1 
ATOM   1448 O  "O3'" . DC  B 2 15  ? 27.931 20.887 24.987  1.00 28.47 ? 15  DC  E "O3'" 1 
ATOM   1449 C  "C2'" . DC  B 2 15  ? 29.364 21.722 23.229  1.00 23.36 ? 15  DC  E "C2'" 1 
ATOM   1450 C  "C1'" . DC  B 2 15  ? 29.158 20.466 22.409  1.00 20.98 ? 15  DC  E "C1'" 1 
ATOM   1451 N  N1    . DC  B 2 15  ? 30.172 20.239 21.349  1.00 17.25 ? 15  DC  E N1    1 
ATOM   1452 C  C2    . DC  B 2 15  ? 30.405 18.936 20.903  1.00 15.28 ? 15  DC  E C2    1 
ATOM   1453 O  O2    . DC  B 2 15  ? 29.751 18.006 21.394  1.00 16.47 ? 15  DC  E O2    1 
ATOM   1454 N  N3    . DC  B 2 15  ? 31.335 18.728 19.941  1.00 13.35 ? 15  DC  E N3    1 
ATOM   1455 C  C4    . DC  B 2 15  ? 32.018 19.758 19.440  1.00 12.88 ? 15  DC  E C4    1 
ATOM   1456 N  N4    . DC  B 2 15  ? 32.926 19.502 18.493  1.00 11.21 ? 15  DC  E N4    1 
ATOM   1457 C  C5    . DC  B 2 15  ? 31.798 21.096 19.886  1.00 15.60 ? 15  DC  E C5    1 
ATOM   1458 C  C6    . DC  B 2 15  ? 30.875 21.288 20.836  1.00 17.21 ? 15  DC  E C6    1 
ATOM   1459 P  P     . DG  B 2 16  ? 27.882 21.405 26.506  1.00 33.24 ? 16  DG  E P     1 
ATOM   1460 O  OP1   . DG  B 2 16  ? 26.588 22.095 26.700  1.00 34.40 ? 16  DG  E OP1   1 
ATOM   1461 O  OP2   . DG  B 2 16  ? 29.149 22.114 26.793  1.00 35.26 ? 16  DG  E OP2   1 
ATOM   1462 O  "O5'" . DG  B 2 16  ? 27.885 20.049 27.355  1.00 32.43 ? 16  DG  E "O5'" 1 
ATOM   1463 C  "C5'" . DG  B 2 16  ? 26.965 19.014 27.033  1.00 30.23 ? 16  DG  E "C5'" 1 
ATOM   1464 C  "C4'" . DG  B 2 16  ? 27.677 17.680 26.881  1.00 26.77 ? 16  DG  E "C4'" 1 
ATOM   1465 O  "O4'" . DG  B 2 16  ? 28.516 17.704 25.694  1.00 23.56 ? 16  DG  E "O4'" 1 
ATOM   1466 C  "C3'" . DG  B 2 16  ? 28.593 17.290 28.046  1.00 28.23 ? 16  DG  E "C3'" 1 
ATOM   1467 O  "O3'" . DG  B 2 16  ? 28.402 15.911 28.359  1.00 30.47 ? 16  DG  E "O3'" 1 
ATOM   1468 C  "C2'" . DG  B 2 16  ? 29.993 17.562 27.495  1.00 25.28 ? 16  DG  E "C2'" 1 
ATOM   1469 C  "C1'" . DG  B 2 16  ? 29.806 17.244 26.023  1.00 23.17 ? 16  DG  E "C1'" 1 
ATOM   1470 N  N9    . DG  B 2 16  ? 30.771 17.915 25.158  1.00 20.46 ? 16  DG  E N9    1 
ATOM   1471 C  C8    . DG  B 2 16  ? 31.010 19.266 25.072  1.00 20.72 ? 16  DG  E C8    1 
ATOM   1472 N  N7    . DG  B 2 16  ? 31.933 19.576 24.205  1.00 18.64 ? 16  DG  E N7    1 
ATOM   1473 C  C5    . DG  B 2 16  ? 32.334 18.352 23.684  1.00 17.91 ? 16  DG  E C5    1 
ATOM   1474 C  C6    . DG  B 2 16  ? 33.309 18.054 22.702  1.00 16.75 ? 16  DG  E C6    1 
ATOM   1475 O  O6    . DG  B 2 16  ? 34.037 18.839 22.077  1.00 15.96 ? 16  DG  E O6    1 
ATOM   1476 N  N1    . DG  B 2 16  ? 33.399 16.685 22.467  1.00 13.48 ? 16  DG  E N1    1 
ATOM   1477 C  C2    . DG  B 2 16  ? 32.644 15.726 23.099  1.00 15.28 ? 16  DG  E C2    1 
ATOM   1478 N  N2    . DG  B 2 16  ? 32.875 14.455 22.740  1.00 16.13 ? 16  DG  E N2    1 
ATOM   1479 N  N3    . DG  B 2 16  ? 31.728 15.992 24.020  1.00 17.43 ? 16  DG  E N3    1 
ATOM   1480 C  C4    . DG  B 2 16  ? 31.627 17.321 24.261  1.00 16.38 ? 16  DG  E C4    1 
ATOM   1481 P  P     . DA  B 2 17  ? 29.327 15.164 29.443  1.00 35.75 ? 17  DA  E P     1 
ATOM   1482 O  OP1   . DA  B 2 17  ? 28.435 14.254 30.193  1.00 40.82 ? 17  DA  E OP1   1 
ATOM   1483 O  OP2   . DA  B 2 17  ? 30.143 16.151 30.184  1.00 36.25 ? 17  DA  E OP2   1 
ATOM   1484 O  "O5'" . DA  B 2 17  ? 30.309 14.275 28.547  1.00 31.14 ? 17  DA  E "O5'" 1 
ATOM   1485 C  "C5'" . DA  B 2 17  ? 29.766 13.399 27.565  1.00 31.22 ? 17  DA  E "C5'" 1 
ATOM   1486 C  "C4'" . DA  B 2 17  ? 30.816 12.428 27.046  1.00 30.68 ? 17  DA  E "C4'" 1 
ATOM   1487 O  "O4'" . DA  B 2 17  ? 31.713 13.111 26.135  1.00 28.32 ? 17  DA  E "O4'" 1 
ATOM   1488 C  "C3'" . DA  B 2 17  ? 31.698 11.786 28.109  1.00 33.96 ? 17  DA  E "C3'" 1 
ATOM   1489 O  "O3'" . DA  B 2 17  ? 31.988 10.443 27.742  1.00 36.54 ? 17  DA  E "O3'" 1 
ATOM   1490 C  "C2'" . DA  B 2 17  ? 32.950 12.664 28.099  1.00 30.90 ? 17  DA  E "C2'" 1 
ATOM   1491 C  "C1'" . DA  B 2 17  ? 33.035 13.102 26.640  1.00 26.40 ? 17  DA  E "C1'" 1 
ATOM   1492 N  N9    . DA  B 2 17  ? 33.586 14.443 26.466  1.00 22.55 ? 17  DA  E N9    1 
ATOM   1493 C  C8    . DA  B 2 17  ? 33.212 15.575 27.134  1.00 22.50 ? 17  DA  E C8    1 
ATOM   1494 N  N7    . DA  B 2 17  ? 33.866 16.650 26.763  1.00 21.41 ? 17  DA  E N7    1 
ATOM   1495 C  C5    . DA  B 2 17  ? 34.726 16.193 25.777  1.00 18.20 ? 17  DA  E C5    1 
ATOM   1496 C  C6    . DA  B 2 17  ? 35.689 16.845 24.982  1.00 16.14 ? 17  DA  E C6    1 
ATOM   1497 N  N6    . DA  B 2 17  ? 35.948 18.153 25.069  1.00 18.00 ? 17  DA  E N6    1 
ATOM   1498 N  N1    . DA  B 2 17  ? 36.375 16.098 24.094  1.00 14.95 ? 17  DA  E N1    1 
ATOM   1499 C  C2    . DA  B 2 17  ? 36.111 14.789 24.012  1.00 17.61 ? 17  DA  E C2    1 
ATOM   1500 N  N3    . DA  B 2 17  ? 35.231 14.065 24.703  1.00 18.47 ? 17  DA  E N3    1 
ATOM   1501 C  C4    . DA  B 2 17  ? 34.565 14.835 25.578  1.00 20.24 ? 17  DA  E C4    1 
ATOM   1502 P  P     . DA  B 2 18  ? 32.874 9.509  28.702  1.00 40.69 ? 18  DA  E P     1 
ATOM   1503 O  OP1   . DA  B 2 18  ? 32.353 8.129  28.569  1.00 43.31 ? 18  DA  E OP1   1 
ATOM   1504 O  OP2   . DA  B 2 18  ? 32.946 10.147 30.035  1.00 42.81 ? 18  DA  E OP2   1 
ATOM   1505 O  "O5'" . DA  B 2 18  ? 34.330 9.570  28.047  1.00 34.55 ? 18  DA  E "O5'" 1 
ATOM   1506 C  "C5'" . DA  B 2 18  ? 34.516 9.145  26.707  1.00 29.55 ? 18  DA  E "C5'" 1 
ATOM   1507 C  "C4'" . DA  B 2 18  ? 35.936 9.411  26.248  1.00 26.86 ? 18  DA  E "C4'" 1 
ATOM   1508 O  "O4'" . DA  B 2 18  ? 36.143 10.839 26.108  1.00 23.89 ? 18  DA  E "O4'" 1 
ATOM   1509 C  "C3'" . DA  B 2 18  ? 37.031 8.902  27.192  1.00 29.18 ? 18  DA  E "C3'" 1 
ATOM   1510 O  "O3'" . DA  B 2 18  ? 37.965 8.112  26.460  1.00 30.02 ? 18  DA  E "O3'" 1 
ATOM   1511 C  "C2'" . DA  B 2 18  ? 37.665 10.184 27.746  1.00 27.29 ? 18  DA  E "C2'" 1 
ATOM   1512 C  "C1'" . DA  B 2 18  ? 37.401 11.182 26.633  1.00 23.00 ? 18  DA  E "C1'" 1 
ATOM   1513 N  N9    . DA  B 2 18  ? 37.338 12.564 27.097  1.00 21.29 ? 18  DA  E N9    1 
ATOM   1514 C  C8    . DA  B 2 18  ? 36.577 13.056 28.121  1.00 23.20 ? 18  DA  E C8    1 
ATOM   1515 N  N7    . DA  B 2 18  ? 36.717 14.346 28.313  1.00 22.97 ? 18  DA  E N7    1 
ATOM   1516 C  C5    . DA  B 2 18  ? 37.632 14.729 27.345  1.00 20.44 ? 18  DA  E C5    1 
ATOM   1517 C  C6    . DA  B 2 18  ? 38.203 15.974 27.019  1.00 18.34 ? 18  DA  E C6    1 
ATOM   1518 N  N6    . DA  B 2 18  ? 37.916 17.107 27.667  1.00 19.08 ? 18  DA  E N6    1 
ATOM   1519 N  N1    . DA  B 2 18  ? 39.083 16.010 25.997  1.00 17.25 ? 18  DA  E N1    1 
ATOM   1520 C  C2    . DA  B 2 18  ? 39.367 14.873 25.351  1.00 16.89 ? 18  DA  E C2    1 
ATOM   1521 N  N3    . DA  B 2 18  ? 38.896 13.646 25.566  1.00 17.53 ? 18  DA  E N3    1 
ATOM   1522 C  C4    . DA  B 2 18  ? 38.025 13.643 26.587  1.00 20.51 ? 18  DA  E C4    1 
ATOM   1523 P  P     . DG  B 2 19  ? 39.335 7.602  27.131  1.00 34.80 ? 19  DG  E P     1 
ATOM   1524 O  OP1   . DG  B 2 19  ? 39.590 6.251  26.586  1.00 39.68 ? 19  DG  E OP1   1 
ATOM   1525 O  OP2   . DG  B 2 19  ? 39.294 7.789  28.598  1.00 37.36 ? 19  DG  E OP2   1 
ATOM   1526 O  "O5'" . DG  B 2 19  ? 40.430 8.600  26.537  1.00 31.49 ? 19  DG  E "O5'" 1 
ATOM   1527 C  "C5'" . DG  B 2 19  ? 40.519 8.787  25.133  1.00 24.90 ? 19  DG  E "C5'" 1 
ATOM   1528 C  "C4'" . DG  B 2 19  ? 41.641 9.747  24.779  1.00 24.45 ? 19  DG  E "C4'" 1 
ATOM   1529 O  "O4'" . DG  B 2 19  ? 41.303 11.086 25.222  1.00 21.95 ? 19  DG  E "O4'" 1 
ATOM   1530 C  "C3'" . DG  B 2 19  ? 42.997 9.425  25.400  1.00 25.37 ? 19  DG  E "C3'" 1 
ATOM   1531 O  "O3'" . DG  B 2 19  ? 44.014 9.672  24.447  1.00 25.45 ? 19  DG  E "O3'" 1 
ATOM   1532 C  "C2'" . DG  B 2 19  ? 43.079 10.396 26.579  1.00 25.87 ? 19  DG  E "C2'" 1 
ATOM   1533 C  "C1'" . DG  B 2 19  ? 42.342 11.605 26.024  1.00 24.42 ? 19  DG  E "C1'" 1 
ATOM   1534 N  N9    . DG  B 2 19  ? 41.731 12.455 27.041  1.00 23.98 ? 19  DG  E N9    1 
ATOM   1535 C  C8    . DG  B 2 19  ? 40.805 12.079 27.983  1.00 22.22 ? 19  DG  E C8    1 
ATOM   1536 N  N7    . DG  B 2 19  ? 40.411 13.059 28.746  1.00 22.40 ? 19  DG  E N7    1 
ATOM   1537 C  C5    . DG  B 2 19  ? 41.111 14.161 28.273  1.00 21.47 ? 19  DG  E C5    1 
ATOM   1538 C  C6    . DG  B 2 19  ? 41.095 15.506 28.710  1.00 21.59 ? 19  DG  E C6    1 
ATOM   1539 O  O6    . DG  B 2 19  ? 40.433 16.004 29.630  1.00 24.01 ? 19  DG  E O6    1 
ATOM   1540 N  N1    . DG  B 2 19  ? 41.954 16.303 27.959  1.00 20.90 ? 19  DG  E N1    1 
ATOM   1541 C  C2    . DG  B 2 19  ? 42.731 15.856 26.917  1.00 21.21 ? 19  DG  E C2    1 
ATOM   1542 N  N2    . DG  B 2 19  ? 43.498 16.774 26.311  1.00 21.97 ? 19  DG  E N2    1 
ATOM   1543 N  N3    . DG  B 2 19  ? 42.756 14.597 26.496  1.00 21.94 ? 19  DG  E N3    1 
ATOM   1544 C  C4    . DG  B 2 19  ? 41.924 13.808 27.219  1.00 22.15 ? 19  DG  E C4    1 
ATOM   1545 P  P     . DC  B 2 20  ? 45.468 9.015  24.617  1.00 29.89 ? 20  DC  E P     1 
ATOM   1546 O  OP1   . DC  B 2 20  ? 45.959 8.705  23.256  1.00 33.07 ? 20  DC  E OP1   1 
ATOM   1547 O  OP2   . DC  B 2 20  ? 45.382 7.946  25.639  1.00 31.73 ? 20  DC  E OP2   1 
ATOM   1548 O  "O5'" . DC  B 2 20  ? 46.348 10.194 25.241  1.00 30.20 ? 20  DC  E "O5'" 1 
ATOM   1549 C  "C5'" . DC  B 2 20  ? 46.473 11.432 24.555  1.00 24.04 ? 20  DC  E "C5'" 1 
ATOM   1550 C  "C4'" . DC  B 2 20  ? 47.208 12.441 25.415  1.00 26.78 ? 20  DC  E "C4'" 1 
ATOM   1551 O  "O4'" . DC  B 2 20  ? 46.266 13.104 26.300  1.00 26.48 ? 20  DC  E "O4'" 1 
ATOM   1552 C  "C3'" . DC  B 2 20  ? 48.291 11.842 26.321  1.00 29.56 ? 20  DC  E "C3'" 1 
ATOM   1553 O  "O3'" . DC  B 2 20  ? 49.462 12.654 26.293  1.00 30.75 ? 20  DC  E "O3'" 1 
ATOM   1554 C  "C2'" . DC  B 2 20  ? 47.636 11.860 27.698  1.00 30.46 ? 20  DC  E "C2'" 1 
ATOM   1555 C  "C1'" . DC  B 2 20  ? 46.803 13.124 27.598  1.00 27.82 ? 20  DC  E "C1'" 1 
ATOM   1556 N  N1    . DC  B 2 20  ? 45.689 13.190 28.584  1.00 27.41 ? 20  DC  E N1    1 
ATOM   1557 C  C2    . DC  B 2 20  ? 45.255 14.434 29.054  1.00 25.46 ? 20  DC  E C2    1 
ATOM   1558 O  O2    . DC  B 2 20  ? 45.801 15.461 28.633  1.00 25.16 ? 20  DC  E O2    1 
ATOM   1559 N  N3    . DC  B 2 20  ? 44.243 14.477 29.955  1.00 25.72 ? 20  DC  E N3    1 
ATOM   1560 C  C4    . DC  B 2 20  ? 43.682 13.345 30.383  1.00 27.51 ? 20  DC  E C4    1 
ATOM   1561 N  N4    . DC  B 2 20  ? 42.687 13.436 31.272  1.00 27.04 ? 20  DC  E N4    1 
ATOM   1562 C  C5    . DC  B 2 20  ? 44.114 12.069 29.917  1.00 26.97 ? 20  DC  E C5    1 
ATOM   1563 C  C6    . DC  B 2 20  ? 45.112 12.039 29.029  1.00 27.79 ? 20  DC  E C6    1 
ATOM   1564 O  "O5'" . DT  C 3 1   ? 40.917 18.708 38.524  1.00 47.44 ? 1   DT  F "O5'" 1 
ATOM   1565 C  "C5'" . DT  C 3 1   ? 41.811 19.525 39.274  1.00 46.67 ? 1   DT  F "C5'" 1 
ATOM   1566 C  "C4'" . DT  C 3 1   ? 42.737 20.308 38.356  1.00 44.47 ? 1   DT  F "C4'" 1 
ATOM   1567 O  "O4'" . DT  C 3 1   ? 43.625 19.393 37.661  1.00 41.01 ? 1   DT  F "O4'" 1 
ATOM   1568 C  "C3'" . DT  C 3 1   ? 42.040 21.125 37.272  1.00 42.56 ? 1   DT  F "C3'" 1 
ATOM   1569 O  "O3'" . DT  C 3 1   ? 42.730 22.351 37.072  1.00 45.37 ? 1   DT  F "O3'" 1 
ATOM   1570 C  "C2'" . DT  C 3 1   ? 42.140 20.221 36.047  1.00 37.16 ? 1   DT  F "C2'" 1 
ATOM   1571 C  "C1'" . DT  C 3 1   ? 43.494 19.562 36.264  1.00 37.23 ? 1   DT  F "C1'" 1 
ATOM   1572 N  N1    . DT  C 3 1   ? 43.621 18.222 35.625  1.00 32.88 ? 1   DT  F N1    1 
ATOM   1573 C  C2    . DT  C 3 1   ? 44.566 18.028 34.644  1.00 28.92 ? 1   DT  F C2    1 
ATOM   1574 O  O2    . DT  C 3 1   ? 45.310 18.907 34.249  1.00 31.86 ? 1   DT  F O2    1 
ATOM   1575 N  N3    . DT  C 3 1   ? 44.608 16.757 34.135  1.00 27.24 ? 1   DT  F N3    1 
ATOM   1576 C  C4    . DT  C 3 1   ? 43.819 15.683 34.503  1.00 31.15 ? 1   DT  F C4    1 
ATOM   1577 O  O4    . DT  C 3 1   ? 43.933 14.577 33.985  1.00 31.97 ? 1   DT  F O4    1 
ATOM   1578 C  C5    . DT  C 3 1   ? 42.851 15.955 35.539  1.00 32.09 ? 1   DT  F C5    1 
ATOM   1579 C  C7    . DT  C 3 1   ? 41.937 14.869 36.022  1.00 34.87 ? 1   DT  F C7    1 
ATOM   1580 C  C6    . DT  C 3 1   ? 42.802 17.195 36.046  1.00 32.30 ? 1   DT  F C6    1 
ATOM   1581 P  P     . DG  C 3 2   ? 41.955 23.623 36.472  1.00 46.10 ? 2   DG  F P     1 
ATOM   1582 O  OP1   . DG  C 3 2   ? 42.439 24.821 37.195  1.00 51.61 ? 2   DG  F OP1   1 
ATOM   1583 O  OP2   . DG  C 3 2   ? 40.511 23.304 36.454  1.00 49.21 ? 2   DG  F OP2   1 
ATOM   1584 O  "O5'" . DG  C 3 2   ? 42.449 23.691 34.952  1.00 40.72 ? 2   DG  F "O5'" 1 
ATOM   1585 C  "C5'" . DG  C 3 2   ? 43.807 23.989 34.659  1.00 38.49 ? 2   DG  F "C5'" 1 
ATOM   1586 C  "C4'" . DG  C 3 2   ? 44.114 23.760 33.188  1.00 35.47 ? 2   DG  F "C4'" 1 
ATOM   1587 O  "O4'" . DG  C 3 2   ? 44.123 22.336 32.900  1.00 32.77 ? 2   DG  F "O4'" 1 
ATOM   1588 C  "C3'" . DG  C 3 2   ? 43.124 24.379 32.203  1.00 35.14 ? 2   DG  F "C3'" 1 
ATOM   1589 O  "O3'" . DG  C 3 2   ? 43.834 24.857 31.072  1.00 37.77 ? 2   DG  F "O3'" 1 
ATOM   1590 C  "C2'" . DG  C 3 2   ? 42.234 23.193 31.835  1.00 33.70 ? 2   DG  F "C2'" 1 
ATOM   1591 C  "C1'" . DG  C 3 2   ? 43.255 22.068 31.821  1.00 31.31 ? 2   DG  F "C1'" 1 
ATOM   1592 N  N9    . DG  C 3 2   ? 42.684 20.742 32.022  1.00 27.21 ? 2   DG  F N9    1 
ATOM   1593 C  C8    . DG  C 3 2   ? 41.596 20.416 32.792  1.00 27.14 ? 2   DG  F C8    1 
ATOM   1594 N  N7    . DG  C 3 2   ? 41.330 19.139 32.799  1.00 26.82 ? 2   DG  F N7    1 
ATOM   1595 C  C5    . DG  C 3 2   ? 42.306 18.584 31.983  1.00 24.48 ? 2   DG  F C5    1 
ATOM   1596 C  C6    . DG  C 3 2   ? 42.527 17.237 31.611  1.00 22.49 ? 2   DG  F C6    1 
ATOM   1597 O  O6    . DG  C 3 2   ? 41.881 16.234 31.944  1.00 25.72 ? 2   DG  F O6    1 
ATOM   1598 N  N1    . DG  C 3 2   ? 43.628 17.109 30.768  1.00 22.19 ? 2   DG  F N1    1 
ATOM   1599 C  C2    . DG  C 3 2   ? 44.415 18.152 30.339  1.00 22.38 ? 2   DG  F C2    1 
ATOM   1600 N  N2    . DG  C 3 2   ? 45.432 17.835 29.525  1.00 22.50 ? 2   DG  F N2    1 
ATOM   1601 N  N3    . DG  C 3 2   ? 44.218 19.417 30.680  1.00 24.87 ? 2   DG  F N3    1 
ATOM   1602 C  C4    . DG  C 3 2   ? 43.150 19.558 31.501  1.00 24.29 ? 2   DG  F C4    1 
ATOM   1603 P  P     . DC  C 3 3   ? 43.206 25.989 30.120  1.00 34.94 ? 3   DC  F P     1 
ATOM   1604 O  OP1   . DC  C 3 3   ? 43.828 27.278 30.495  1.00 39.11 ? 3   DC  F OP1   1 
ATOM   1605 O  OP2   . DC  C 3 3   ? 41.734 25.848 30.130  1.00 35.01 ? 3   DC  F OP2   1 
ATOM   1606 O  "O5'" . DC  C 3 3   ? 43.717 25.575 28.664  1.00 31.12 ? 3   DC  F "O5'" 1 
ATOM   1607 C  "C5'" . DC  C 3 3   ? 45.068 25.182 28.477  1.00 30.57 ? 3   DC  F "C5'" 1 
ATOM   1608 C  "C4'" . DC  C 3 3   ? 45.162 24.021 27.504  1.00 29.76 ? 3   DC  F "C4'" 1 
ATOM   1609 O  "O4'" . DC  C 3 3   ? 44.561 22.840 28.095  1.00 26.87 ? 3   DC  F "O4'" 1 
ATOM   1610 C  "C3'" . DC  C 3 3   ? 44.454 24.238 26.161  1.00 27.95 ? 3   DC  F "C3'" 1 
ATOM   1611 O  "O3'" . DC  C 3 3   ? 45.360 23.986 25.091  1.00 27.61 ? 3   DC  F "O3'" 1 
ATOM   1612 C  "C2'" . DC  C 3 3   ? 43.303 23.230 26.183  1.00 27.18 ? 3   DC  F "C2'" 1 
ATOM   1613 C  "C1'" . DC  C 3 3   ? 43.840 22.153 27.106  1.00 26.27 ? 3   DC  F "C1'" 1 
ATOM   1614 N  N1    . DC  C 3 3   ? 42.770 21.360 27.765  1.00 23.83 ? 3   DC  F N1    1 
ATOM   1615 C  C2    . DC  C 3 3   ? 42.788 19.965 27.673  1.00 20.77 ? 3   DC  F C2    1 
ATOM   1616 O  O2    . DC  C 3 3   ? 43.701 19.414 27.047  1.00 21.78 ? 3   DC  F O2    1 
ATOM   1617 N  N3    . DC  C 3 3   ? 41.803 19.256 28.278  1.00 20.28 ? 3   DC  F N3    1 
ATOM   1618 C  C4    . DC  C 3 3   ? 40.836 19.889 28.944  1.00 23.56 ? 3   DC  F C4    1 
ATOM   1619 N  N4    . DC  C 3 3   ? 39.887 19.147 29.524  1.00 21.74 ? 3   DC  F N4    1 
ATOM   1620 C  C5    . DC  C 3 3   ? 40.801 21.311 29.046  1.00 25.73 ? 3   DC  F C5    1 
ATOM   1621 C  C6    . DC  C 3 3   ? 41.777 21.999 28.446  1.00 25.79 ? 3   DC  F C6    1 
ATOM   1622 P  P     . DT  C 3 4   ? 44.851 23.940 23.566  1.00 28.93 ? 4   DT  F P     1 
ATOM   1623 O  OP1   . DT  C 3 4   ? 45.957 24.471 22.741  1.00 32.54 ? 4   DT  F OP1   1 
ATOM   1624 O  OP2   . DT  C 3 4   ? 43.507 24.550 23.453  1.00 28.95 ? 4   DT  F OP2   1 
ATOM   1625 O  "O5'" . DT  C 3 4   ? 44.707 22.380 23.265  1.00 25.15 ? 4   DT  F "O5'" 1 
ATOM   1626 C  "C5'" . DT  C 3 4   ? 45.811 21.522 23.494  1.00 23.58 ? 4   DT  F "C5'" 1 
ATOM   1627 C  "C4'" . DT  C 3 4   ? 45.482 20.099 23.092  1.00 21.48 ? 4   DT  F "C4'" 1 
ATOM   1628 O  "O4'" . DT  C 3 4   ? 44.439 19.578 23.953  1.00 18.55 ? 4   DT  F "O4'" 1 
ATOM   1629 C  "C3'" . DT  C 3 4   ? 44.982 19.928 21.658  1.00 21.42 ? 4   DT  F "C3'" 1 
ATOM   1630 O  "O3'" . DT  C 3 4   ? 45.643 18.823 21.063  1.00 19.36 ? 4   DT  F "O3'" 1 
ATOM   1631 C  "C2'" . DT  C 3 4   ? 43.481 19.671 21.826  1.00 18.76 ? 4   DT  F "C2'" 1 
ATOM   1632 C  "C1'" . DT  C 3 4   ? 43.436 18.972 23.172  1.00 16.99 ? 4   DT  F "C1'" 1 
ATOM   1633 N  N1    . DT  C 3 4   ? 42.145 19.131 23.893  1.00 16.11 ? 4   DT  F N1    1 
ATOM   1634 C  C2    . DT  C 3 4   ? 41.426 18.013 24.245  1.00 15.34 ? 4   DT  F C2    1 
ATOM   1635 O  O2    . DT  C 3 4   ? 41.780 16.878 23.978  1.00 16.60 ? 4   DT  F O2    1 
ATOM   1636 N  N3    . DT  C 3 4   ? 40.265 18.269 24.921  1.00 17.97 ? 4   DT  F N3    1 
ATOM   1637 C  C4    . DT  C 3 4   ? 39.761 19.506 25.278  1.00 20.17 ? 4   DT  F C4    1 
ATOM   1638 O  O4    . DT  C 3 4   ? 38.704 19.634 25.887  1.00 22.73 ? 4   DT  F O4    1 
ATOM   1639 C  C5    . DT  C 3 4   ? 40.565 20.637 24.884  1.00 20.06 ? 4   DT  F C5    1 
ATOM   1640 C  C7    . DT  C 3 4   ? 40.117 22.028 25.216  1.00 22.46 ? 4   DT  F C7    1 
ATOM   1641 C  C6    . DT  C 3 4   ? 41.708 20.398 24.222  1.00 17.51 ? 4   DT  F C6    1 
ATOM   1642 P  P     . DT  C 3 5   ? 45.457 18.503 19.501  1.00 19.16 ? 5   DT  F P     1 
ATOM   1643 O  OP1   . DT  C 3 5   ? 46.774 18.050 18.999  1.00 24.53 ? 5   DT  F OP1   1 
ATOM   1644 O  OP2   . DT  C 3 5   ? 44.780 19.655 18.864  1.00 22.44 ? 5   DT  F OP2   1 
ATOM   1645 O  "O5'" . DT  C 3 5   ? 44.442 17.270 19.491  1.00 17.43 ? 5   DT  F "O5'" 1 
ATOM   1646 C  "C5'" . DT  C 3 5   ? 44.759 16.097 20.220  1.00 19.70 ? 5   DT  F "C5'" 1 
ATOM   1647 C  "C4'" . DT  C 3 5   ? 43.544 15.199 20.355  1.00 16.23 ? 5   DT  F "C4'" 1 
ATOM   1648 O  "O4'" . DT  C 3 5   ? 42.546 15.843 21.176  1.00 15.11 ? 5   DT  F "O4'" 1 
ATOM   1649 C  "C3'" . DT  C 3 5   ? 42.845 14.838 19.037  1.00 16.38 ? 5   DT  F "C3'" 1 
ATOM   1650 O  "O3'" . DT  C 3 5   ? 42.851 13.425 18.875  1.00 17.36 ? 5   DT  F "O3'" 1 
ATOM   1651 C  "C2'" . DT  C 3 5   ? 41.417 15.392 19.202  1.00 16.76 ? 5   DT  F "C2'" 1 
ATOM   1652 C  "C1'" . DT  C 3 5   ? 41.279 15.462 20.712  1.00 17.99 ? 5   DT  F "C1'" 1 
ATOM   1653 N  N1    . DT  C 3 5   ? 40.286 16.461 21.194  1.00 17.90 ? 5   DT  F N1    1 
ATOM   1654 C  C2    . DT  C 3 5   ? 39.229 16.034 21.961  1.00 17.14 ? 5   DT  F C2    1 
ATOM   1655 O  O2    . DT  C 3 5   ? 39.050 14.868 22.258  1.00 15.99 ? 5   DT  F O2    1 
ATOM   1656 N  N3    . DT  C 3 5   ? 38.379 17.026 22.369  1.00 17.17 ? 5   DT  F N3    1 
ATOM   1657 C  C4    . DT  C 3 5   ? 38.481 18.377 22.095  1.00 16.62 ? 5   DT  F C4    1 
ATOM   1658 O  O4    . DT  C 3 5   ? 37.663 19.193 22.508  1.00 18.47 ? 5   DT  F O4    1 
ATOM   1659 C  C5    . DT  C 3 5   ? 39.615 18.760 21.287  1.00 15.75 ? 5   DT  F C5    1 
ATOM   1660 C  C7    . DT  C 3 5   ? 39.830 20.199 20.925  1.00 16.46 ? 5   DT  F C7    1 
ATOM   1661 C  C6    . DT  C 3 5   ? 40.455 17.795 20.882  1.00 15.71 ? 5   DT  F C6    1 
ATOM   1662 P  P     . DC  C 3 6   ? 42.131 12.736 17.615  1.00 19.53 ? 6   DC  F P     1 
ATOM   1663 O  OP1   . DC  C 3 6   ? 42.909 11.521 17.284  1.00 22.14 ? 6   DC  F OP1   1 
ATOM   1664 O  OP2   . DC  C 3 6   ? 41.895 13.761 16.574  1.00 21.05 ? 6   DC  F OP2   1 
ATOM   1665 O  "O5'" . DC  C 3 6   ? 40.711 12.296 18.196  1.00 17.45 ? 6   DC  F "O5'" 1 
ATOM   1666 C  "C5'" . DC  C 3 6   ? 40.647 11.514 19.374  1.00 17.09 ? 6   DC  F "C5'" 1 
ATOM   1667 C  "C4'" . DC  C 3 6   ? 39.209 11.311 19.801  1.00 15.78 ? 6   DC  F "C4'" 1 
ATOM   1668 O  "O4'" . DC  C 3 6   ? 38.659 12.564 20.237  1.00 15.86 ? 6   DC  F "O4'" 1 
ATOM   1669 C  "C3'" . DC  C 3 6   ? 38.278 10.801 18.699  1.00 15.85 ? 6   DC  F "C3'" 1 
ATOM   1670 O  "O3'" . DC  C 3 6   ? 37.905 9.462  18.984  1.00 17.68 ? 6   DC  F "O3'" 1 
ATOM   1671 C  "C2'" . DC  C 3 6   ? 37.069 11.760 18.726  1.00 14.25 ? 6   DC  F "C2'" 1 
ATOM   1672 C  "C1'" . DC  C 3 6   ? 37.277 12.555 20.011  1.00 14.03 ? 6   DC  F "C1'" 1 
ATOM   1673 N  N1    . DC  C 3 6   ? 36.829 13.970 19.928  1.00 13.30 ? 6   DC  F N1    1 
ATOM   1674 C  C2    . DC  C 3 6   ? 35.681 14.380 20.615  1.00 13.36 ? 6   DC  F C2    1 
ATOM   1675 O  O2    . DC  C 3 6   ? 35.037 13.550 21.267  1.00 16.22 ? 6   DC  F O2    1 
ATOM   1676 N  N3    . DC  C 3 6   ? 35.304 15.681 20.541  1.00 13.14 ? 6   DC  F N3    1 
ATOM   1677 C  C4    . DC  C 3 6   ? 36.025 16.547 19.827  1.00 14.55 ? 6   DC  F C4    1 
ATOM   1678 N  N4    . DC  C 3 6   ? 35.614 17.817 19.783  1.00 13.50 ? 6   DC  F N4    1 
ATOM   1679 C  C5    . DC  C 3 6   ? 37.201 16.148 19.127  1.00 13.29 ? 6   DC  F C5    1 
ATOM   1680 C  C6    . DC  C 3 6   ? 37.564 14.864 19.209  1.00 14.15 ? 6   DC  F C6    1 
ATOM   1681 P  P     . DG  C 3 7   ? 36.969 8.639  17.972  1.00 20.42 ? 7   DG  F P     1 
ATOM   1682 O  OP1   . DG  C 3 7   ? 37.324 7.208  18.114  1.00 23.56 ? 7   DG  F OP1   1 
ATOM   1683 O  OP2   . DG  C 3 7   ? 37.022 9.289  16.645  1.00 19.46 ? 7   DG  F OP2   1 
ATOM   1684 O  "O5'" . DG  C 3 7   ? 35.502 8.874  18.554  1.00 18.22 ? 7   DG  F "O5'" 1 
ATOM   1685 C  "C5'" . DG  C 3 7   ? 35.256 8.687  19.938  1.00 18.70 ? 7   DG  F "C5'" 1 
ATOM   1686 C  "C4'" . DG  C 3 7   ? 33.819 9.027  20.277  1.00 17.65 ? 7   DG  F "C4'" 1 
ATOM   1687 O  "O4'" . DG  C 3 7   ? 33.643 10.466 20.273  1.00 18.10 ? 7   DG  F "O4'" 1 
ATOM   1688 C  "C3'" . DG  C 3 7   ? 32.779 8.458  19.316  1.00 17.89 ? 7   DG  F "C3'" 1 
ATOM   1689 O  "O3'" . DG  C 3 7   ? 31.712 7.889  20.058  1.00 21.42 ? 7   DG  F "O3'" 1 
ATOM   1690 C  "C2'" . DG  C 3 7   ? 32.329 9.675  18.495  1.00 16.44 ? 7   DG  F "C2'" 1 
ATOM   1691 C  "C1'" . DG  C 3 7   ? 32.536 10.824 19.474  1.00 16.08 ? 7   DG  F "C1'" 1 
ATOM   1692 N  N9    . DG  C 3 7   ? 32.853 12.103 18.836  1.00 12.88 ? 7   DG  F N9    1 
ATOM   1693 C  C8    . DG  C 3 7   ? 33.758 12.318 17.825  1.00 13.28 ? 7   DG  F C8    1 
ATOM   1694 N  N7    . DG  C 3 7   ? 33.857 13.570 17.471  1.00 12.31 ? 7   DG  F N7    1 
ATOM   1695 C  C5    . DG  C 3 7   ? 32.969 14.233 18.309  1.00 12.02 ? 7   DG  F C5    1 
ATOM   1696 C  C6    . DG  C 3 7   ? 32.647 15.611 18.391  1.00 10.87 ? 7   DG  F C6    1 
ATOM   1697 O  O6    . DG  C 3 7   ? 33.099 16.547 17.717  1.00 11.50 ? 7   DG  F O6    1 
ATOM   1698 N  N1    . DG  C 3 7   ? 31.697 15.860 19.378  1.00 12.54 ? 7   DG  F N1    1 
ATOM   1699 C  C2    . DG  C 3 7   ? 31.129 14.902 20.183  1.00 13.65 ? 7   DG  F C2    1 
ATOM   1700 N  N2    . DG  C 3 7   ? 30.230 15.335 21.079  1.00 13.84 ? 7   DG  F N2    1 
ATOM   1701 N  N3    . DG  C 3 7   ? 31.423 13.607 20.118  1.00 14.59 ? 7   DG  F N3    1 
ATOM   1702 C  C4    . DG  C 3 7   ? 32.347 13.346 19.161  1.00 12.22 ? 7   DG  F C4    1 
ATOM   1703 P  P     . DT  C 3 8   ? 30.562 7.047  19.318  1.00 20.12 ? 8   DT  F P     1 
ATOM   1704 O  OP1   . DT  C 3 8   ? 30.098 6.015  20.274  1.00 24.00 ? 8   DT  F OP1   1 
ATOM   1705 O  OP2   . DT  C 3 8   ? 31.056 6.642  17.984  1.00 21.81 ? 8   DT  F OP2   1 
ATOM   1706 O  "O5'" . DT  C 3 8   ? 29.401 8.122  19.102  1.00 18.81 ? 8   DT  F "O5'" 1 
ATOM   1707 C  "C5'" . DT  C 3 8   ? 28.983 8.920  20.194  1.00 20.60 ? 8   DT  F "C5'" 1 
ATOM   1708 C  "C4'" . DT  C 3 8   ? 28.170 10.111 19.725  1.00 19.25 ? 8   DT  F "C4'" 1 
ATOM   1709 O  "O4'" . DT  C 3 8   ? 29.033 11.118 19.181  1.00 18.85 ? 8   DT  F "O4'" 1 
ATOM   1710 C  "C3'" . DT  C 3 8   ? 27.159 9.826  18.618  1.00 18.30 ? 8   DT  F "C3'" 1 
ATOM   1711 O  "O3'" . DT  C 3 8   ? 25.881 9.569  19.206  1.00 21.57 ? 8   DT  F "O3'" 1 
ATOM   1712 C  "C2'" . DT  C 3 8   ? 27.170 11.118 17.764  1.00 16.96 ? 8   DT  F "C2'" 1 
ATOM   1713 C  "C1'" . DT  C 3 8   ? 28.221 11.996 18.454  1.00 16.35 ? 8   DT  F "C1'" 1 
ATOM   1714 N  N1    . DT  C 3 8   ? 29.079 12.787 17.519  1.00 15.38 ? 8   DT  F N1    1 
ATOM   1715 C  C2    . DT  C 3 8   ? 29.045 14.160 17.584  1.00 12.83 ? 8   DT  F C2    1 
ATOM   1716 O  O2    . DT  C 3 8   ? 28.339 14.773 18.363  1.00 14.88 ? 8   DT  F O2    1 
ATOM   1717 N  N3    . DT  C 3 8   ? 29.870 14.798 16.697  1.00 12.76 ? 8   DT  F N3    1 
ATOM   1718 C  C4    . DT  C 3 8   ? 30.711 14.214 15.770  1.00 11.99 ? 8   DT  F C4    1 
ATOM   1719 O  O4    . DT  C 3 8   ? 31.416 14.877 15.014  1.00 13.49 ? 8   DT  F O4    1 
ATOM   1720 C  C5    . DT  C 3 8   ? 30.703 12.769 15.754  1.00 11.87 ? 8   DT  F C5    1 
ATOM   1721 C  C7    . DT  C 3 8   ? 31.576 12.023 14.790  1.00 14.15 ? 8   DT  F C7    1 
ATOM   1722 C  C6    . DT  C 3 8   ? 29.898 12.132 16.621  1.00 13.73 ? 8   DT  F C6    1 
ATOM   1723 P  P     . DC  C 3 9   ? 24.535 9.538  18.325  1.00 19.75 ? 9   DC  F P     1 
ATOM   1724 O  OP1   . DC  C 3 9   ? 23.561 8.720  19.084  1.00 24.56 ? 9   DC  F OP1   1 
ATOM   1725 O  OP2   . DC  C 3 9   ? 24.850 9.191  16.921  1.00 21.54 ? 9   DC  F OP2   1 
ATOM   1726 O  "O5'" . DC  C 3 9   ? 24.043 11.055 18.348  1.00 21.15 ? 9   DC  F "O5'" 1 
ATOM   1727 C  "C5'" . DC  C 3 9   ? 24.082 11.788 19.566  1.00 19.84 ? 9   DC  F "C5'" 1 
ATOM   1728 C  "C4'" . DC  C 3 9   ? 23.694 13.232 19.330  1.00 18.32 ? 9   DC  F "C4'" 1 
ATOM   1729 O  "O4'" . DC  C 3 9   ? 24.760 13.912 18.621  1.00 18.22 ? 9   DC  F "O4'" 1 
ATOM   1730 C  "C3'" . DC  C 3 9   ? 22.426 13.422 18.500  1.00 18.42 ? 9   DC  F "C3'" 1 
ATOM   1731 O  "O3'" . DC  C 3 9   ? 21.563 14.342 19.142  1.00 20.27 ? 9   DC  F "O3'" 1 
ATOM   1732 C  "C2'" . DC  C 3 9   ? 22.934 13.955 17.157  1.00 16.34 ? 9   DC  F "C2'" 1 
ATOM   1733 C  "C1'" . DC  C 3 9   ? 24.228 14.653 17.549  1.00 14.71 ? 9   DC  F "C1'" 1 
ATOM   1734 N  N1    . DC  C 3 9   ? 25.250 14.671 16.464  1.00 15.23 ? 9   DC  F N1    1 
ATOM   1735 C  C2    . DC  C 3 9   ? 25.877 15.873 16.117  1.00 15.85 ? 9   DC  F C2    1 
ATOM   1736 O  O2    . DC  C 3 9   ? 25.562 16.912 16.710  1.00 17.92 ? 9   DC  F O2    1 
ATOM   1737 N  N3    . DC  C 3 9   ? 26.814 15.865 15.135  1.00 10.61 ? 9   DC  F N3    1 
ATOM   1738 C  C4    . DC  C 3 9   ? 27.128 14.723 14.519  1.00 10.10 ? 9   DC  F C4    1 
ATOM   1739 N  N4    . DC  C 3 9   ? 28.056 14.766 13.558  1.00 9.70  ? 9   DC  F N4    1 
ATOM   1740 C  C5    . DC  C 3 9   ? 26.503 13.488 14.863  1.00 12.57 ? 9   DC  F C5    1 
ATOM   1741 C  C6    . DC  C 3 9   ? 25.580 13.509 15.831  1.00 11.99 ? 9   DC  F C6    1 
ATOM   1742 P  P     . DC  C 3 10  ? 20.039 14.491 18.662  1.00 24.81 ? 10  DC  F P     1 
ATOM   1743 O  OP1   . DC  C 3 10  ? 19.248 14.890 19.845  1.00 29.09 ? 10  DC  F OP1   1 
ATOM   1744 O  OP2   . DC  C 3 10  ? 19.670 13.277 17.898  1.00 24.95 ? 10  DC  F OP2   1 
ATOM   1745 O  "O5'" . DC  C 3 10  ? 20.088 15.716 17.642  1.00 21.47 ? 10  DC  F "O5'" 1 
ATOM   1746 C  "C5'" . DC  C 3 10  ? 20.790 16.891 18.000  1.00 23.51 ? 10  DC  F "C5'" 1 
ATOM   1747 C  "C4'" . DC  C 3 10  ? 21.111 17.719 16.774  1.00 21.64 ? 10  DC  F "C4'" 1 
ATOM   1748 O  "O4'" . DC  C 3 10  ? 22.198 17.115 16.046  1.00 20.59 ? 10  DC  F "O4'" 1 
ATOM   1749 C  "C3'" . DC  C 3 10  ? 19.960 17.859 15.773  1.00 24.66 ? 10  DC  F "C3'" 1 
ATOM   1750 O  "O3'" . DC  C 3 10  ? 19.541 19.213 15.726  1.00 28.23 ? 10  DC  F "O3'" 1 
ATOM   1751 C  "C2'" . DC  C 3 10  ? 20.557 17.396 14.430  1.00 25.17 ? 10  DC  F "C2'" 1 
ATOM   1752 C  "C1'" . DC  C 3 10  ? 22.054 17.451 14.696  1.00 20.95 ? 10  DC  F "C1'" 1 
ATOM   1753 N  N1    . DC  C 3 10  ? 22.852 16.489 13.884  1.00 18.90 ? 10  DC  F N1    1 
ATOM   1754 C  C2    . DC  C 3 10  ? 23.884 16.966 13.070  1.00 15.58 ? 10  DC  F C2    1 
ATOM   1755 O  O2    . DC  C 3 10  ? 24.109 18.182 13.033  1.00 15.81 ? 10  DC  F O2    1 
ATOM   1756 N  N3    . DC  C 3 10  ? 24.608 16.081 12.342  1.00 11.83 ? 10  DC  F N3    1 
ATOM   1757 C  C4    . DC  C 3 10  ? 24.334 14.777 12.410  1.00 17.68 ? 10  DC  F C4    1 
ATOM   1758 N  N4    . DC  C 3 10  ? 25.075 13.943 11.673  1.00 14.61 ? 10  DC  F N4    1 
ATOM   1759 C  C5    . DC  C 3 10  ? 23.287 14.272 13.237  1.00 17.95 ? 10  DC  F C5    1 
ATOM   1760 C  C6    . DC  C 3 10  ? 22.579 15.155 13.949  1.00 18.89 ? 10  DC  F C6    1 
ATOM   1761 P  P     . DA  C 3 11  ? 18.127 19.613 15.078  1.00 28.19 ? 11  DA  F P     1 
ATOM   1762 O  OP1   . DA  C 3 11  ? 17.392 20.408 16.086  1.00 35.82 ? 11  DA  F OP1   1 
ATOM   1763 O  OP2   . DA  C 3 11  ? 17.510 18.405 14.491  1.00 34.28 ? 11  DA  F OP2   1 
ATOM   1764 O  "O5'" . DA  C 3 11  ? 18.536 20.570 13.870  1.00 25.97 ? 11  DA  F "O5'" 1 
ATOM   1765 C  "C5'" . DA  C 3 11  ? 19.467 21.615 14.088  1.00 25.05 ? 11  DA  F "C5'" 1 
ATOM   1766 C  "C4'" . DA  C 3 11  ? 20.142 22.006 12.789  1.00 20.50 ? 11  DA  F "C4'" 1 
ATOM   1767 O  "O4'" . DA  C 3 11  ? 21.043 20.955 12.378  1.00 17.95 ? 11  DA  F "O4'" 1 
ATOM   1768 C  "C3'" . DA  C 3 11  ? 19.187 22.244 11.618  1.00 23.17 ? 11  DA  F "C3'" 1 
ATOM   1769 O  "O3'" . DA  C 3 11  ? 19.343 23.569 11.144  1.00 26.87 ? 11  DA  F "O3'" 1 
ATOM   1770 C  "C2'" . DA  C 3 11  ? 19.594 21.203 10.563  1.00 21.88 ? 11  DA  F "C2'" 1 
ATOM   1771 C  "C1'" . DA  C 3 11  ? 21.009 20.828 10.981  1.00 18.80 ? 11  DA  F "C1'" 1 
ATOM   1772 N  N9    . DA  C 3 11  ? 21.371 19.451 10.654  1.00 14.42 ? 11  DA  F N9    1 
ATOM   1773 C  C8    . DA  C 3 11  ? 20.720 18.318 11.053  1.00 17.64 ? 11  DA  F C8    1 
ATOM   1774 N  N7    . DA  C 3 11  ? 21.275 17.209 10.625  1.00 15.64 ? 11  DA  F N7    1 
ATOM   1775 C  C5    . DA  C 3 11  ? 22.370 17.643 9.899   1.00 13.92 ? 11  DA  F C5    1 
ATOM   1776 C  C6    . DA  C 3 11  ? 23.370 16.951 9.187   1.00 12.94 ? 11  DA  F C6    1 
ATOM   1777 N  N6    . DA  C 3 11  ? 23.417 15.617 9.094   1.00 14.01 ? 11  DA  F N6    1 
ATOM   1778 N  N1    . DA  C 3 11  ? 24.321 17.685 8.572   1.00 12.70 ? 11  DA  F N1    1 
ATOM   1779 C  C2    . DA  C 3 11  ? 24.269 19.020 8.668   1.00 11.76 ? 11  DA  F C2    1 
ATOM   1780 N  N3    . DA  C 3 11  ? 23.381 19.781 9.308   1.00 12.88 ? 11  DA  F N3    1 
ATOM   1781 C  C4    . DA  C 3 11  ? 22.448 19.024 9.908   1.00 14.16 ? 11  DA  F C4    1 
ATOM   1782 P  P     . DG  C 3 12  ? 18.378 24.141 9.997   1.00 30.10 ? 12  DG  F P     1 
ATOM   1783 O  OP1   . DG  C 3 12  ? 18.214 25.590 10.249  1.00 33.49 ? 12  DG  F OP1   1 
ATOM   1784 O  OP2   . DG  C 3 12  ? 17.189 23.266 9.899   1.00 32.02 ? 12  DG  F OP2   1 
ATOM   1785 O  "O5'" . DG  C 3 12  ? 19.228 23.938 8.663   1.00 25.08 ? 12  DG  F "O5'" 1 
ATOM   1786 C  "C5'" . DG  C 3 12  ? 20.617 24.211 8.666   1.00 20.96 ? 12  DG  F "C5'" 1 
ATOM   1787 C  "C4'" . DG  C 3 12  ? 21.268 23.656 7.417   1.00 19.48 ? 12  DG  F "C4'" 1 
ATOM   1788 O  "O4'" . DG  C 3 12  ? 21.492 22.241 7.571   1.00 17.77 ? 12  DG  F "O4'" 1 
ATOM   1789 C  "C3'" . DG  C 3 12  ? 20.442 23.816 6.136   1.00 20.48 ? 12  DG  F "C3'" 1 
ATOM   1790 O  "O3'" . DG  C 3 12  ? 21.108 24.696 5.250   1.00 25.52 ? 12  DG  F "O3'" 1 
ATOM   1791 C  "C2'" . DG  C 3 12  ? 20.343 22.391 5.560   1.00 20.64 ? 12  DG  F "C2'" 1 
ATOM   1792 C  "C1'" . DG  C 3 12  ? 21.449 21.656 6.301   1.00 15.87 ? 12  DG  F "C1'" 1 
ATOM   1793 N  N9    . DG  C 3 12  ? 21.207 20.226 6.459   1.00 14.35 ? 12  DG  F N9    1 
ATOM   1794 C  C8    . DG  C 3 12  ? 20.137 19.627 7.078   1.00 15.33 ? 12  DG  F C8    1 
ATOM   1795 N  N7    . DG  C 3 12  ? 20.195 18.324 7.070   1.00 12.03 ? 12  DG  F N7    1 
ATOM   1796 C  C5    . DG  C 3 12  ? 21.382 18.041 6.406   1.00 12.69 ? 12  DG  F C5    1 
ATOM   1797 C  C6    . DG  C 3 12  ? 21.980 16.795 6.093   1.00 10.47 ? 12  DG  F C6    1 
ATOM   1798 O  O6    . DG  C 3 12  ? 21.563 15.656 6.350   1.00 12.29 ? 12  DG  F O6    1 
ATOM   1799 N  N1    . DG  C 3 12  ? 23.184 16.960 5.410   1.00 11.76 ? 12  DG  F N1    1 
ATOM   1800 C  C2    . DG  C 3 12  ? 23.738 18.174 5.075   1.00 13.74 ? 12  DG  F C2    1 
ATOM   1801 N  N2    . DG  C 3 12  ? 24.906 18.136 4.417   1.00 14.77 ? 12  DG  F N2    1 
ATOM   1802 N  N3    . DG  C 3 12  ? 23.188 19.345 5.363   1.00 14.53 ? 12  DG  F N3    1 
ATOM   1803 C  C4    . DG  C 3 12  ? 22.017 19.202 6.026   1.00 13.04 ? 12  DG  F C4    1 
ATOM   1804 P  P     . DG  C 3 13  ? 20.421 25.139 3.867   1.00 30.62 ? 13  DG  F P     1 
ATOM   1805 O  OP1   . DG  C 3 13  ? 20.876 26.519 3.589   1.00 35.61 ? 13  DG  F OP1   1 
ATOM   1806 O  OP2   . DG  C 3 13  ? 18.973 24.843 3.930   1.00 33.62 ? 13  DG  F OP2   1 
ATOM   1807 O  "O5'" . DG  C 3 13  ? 21.069 24.149 2.795   1.00 28.61 ? 13  DG  F "O5'" 1 
ATOM   1808 C  "C5'" . DG  C 3 13  ? 22.471 23.928 2.800   1.00 25.26 ? 13  DG  F "C5'" 1 
ATOM   1809 C  "C4'" . DG  C 3 13  ? 22.827 22.716 1.964   1.00 21.50 ? 13  DG  F "C4'" 1 
ATOM   1810 O  "O4'" . DG  C 3 13  ? 22.414 21.508 2.650   1.00 18.83 ? 13  DG  F "O4'" 1 
ATOM   1811 C  "C3'" . DG  C 3 13  ? 22.170 22.668 0.579   1.00 23.88 ? 13  DG  F "C3'" 1 
ATOM   1812 O  "O3'" . DG  C 3 13  ? 23.158 22.440 -0.407  1.00 28.81 ? 13  DG  F "O3'" 1 
ATOM   1813 C  "C2'" . DG  C 3 13  ? 21.202 21.487 0.681   1.00 22.16 ? 13  DG  F "C2'" 1 
ATOM   1814 C  "C1'" . DG  C 3 13  ? 21.907 20.613 1.699   1.00 18.60 ? 13  DG  F "C1'" 1 
ATOM   1815 N  N9    . DG  C 3 13  ? 21.027 19.661 2.365   1.00 13.92 ? 13  DG  F N9    1 
ATOM   1816 C  C8    . DG  C 3 13  ? 19.848 19.932 3.015   1.00 14.26 ? 13  DG  F C8    1 
ATOM   1817 N  N7    . DG  C 3 13  ? 19.275 18.871 3.511   1.00 13.36 ? 13  DG  F N7    1 
ATOM   1818 C  C5    . DG  C 3 13  ? 20.131 17.830 3.166   1.00 11.83 ? 13  DG  F C5    1 
ATOM   1819 C  C6    . DG  C 3 13  ? 20.036 16.442 3.430   1.00 10.61 ? 13  DG  F C6    1 
ATOM   1820 O  O6    . DG  C 3 13  ? 19.147 15.835 4.043   1.00 10.84 ? 13  DG  F O6    1 
ATOM   1821 N  N1    . DG  C 3 13  ? 21.120 15.742 2.901   1.00 10.01 ? 13  DG  F N1    1 
ATOM   1822 C  C2    . DG  C 3 13  ? 22.160 16.313 2.206   1.00 10.73 ? 13  DG  F C2    1 
ATOM   1823 N  N2    . DG  C 3 13  ? 23.117 15.480 1.771   1.00 10.86 ? 13  DG  F N2    1 
ATOM   1824 N  N3    . DG  C 3 13  ? 22.258 17.610 1.953   1.00 11.98 ? 13  DG  F N3    1 
ATOM   1825 C  C4    . DG  C 3 13  ? 21.212 18.303 2.461   1.00 12.35 ? 13  DG  F C4    1 
ATOM   1826 P  P     . DA  C 3 14  ? 22.888 22.830 -1.941  1.00 32.45 ? 14  DA  F P     1 
ATOM   1827 O  OP1   . DA  C 3 14  ? 23.787 23.958 -2.270  1.00 38.58 ? 14  DA  F OP1   1 
ATOM   1828 O  OP2   . DA  C 3 14  ? 21.428 22.959 -2.150  1.00 33.16 ? 14  DA  F OP2   1 
ATOM   1829 O  "O5'" . DA  C 3 14  ? 23.374 21.540 -2.743  1.00 31.91 ? 14  DA  F "O5'" 1 
ATOM   1830 C  "C5'" . DA  C 3 14  ? 24.587 20.901 -2.378  1.00 30.43 ? 14  DA  F "C5'" 1 
ATOM   1831 C  "C4'" . DA  C 3 14  ? 24.679 19.530 -3.017  1.00 26.64 ? 14  DA  F "C4'" 1 
ATOM   1832 O  "O4'" . DA  C 3 14  ? 23.944 18.572 -2.214  1.00 22.42 ? 14  DA  F "O4'" 1 
ATOM   1833 C  "C3'" . DA  C 3 14  ? 24.109 19.446 -4.428  1.00 27.39 ? 14  DA  F "C3'" 1 
ATOM   1834 O  "O3'" . DA  C 3 14  ? 24.960 18.670 -5.250  1.00 28.93 ? 14  DA  F "O3'" 1 
ATOM   1835 C  "C2'" . DA  C 3 14  ? 22.744 18.785 -4.236  1.00 23.76 ? 14  DA  F "C2'" 1 
ATOM   1836 C  "C1'" . DA  C 3 14  ? 22.944 17.941 -2.983  1.00 20.48 ? 14  DA  F "C1'" 1 
ATOM   1837 N  N9    . DA  C 3 14  ? 21.741 17.847 -2.162  1.00 18.35 ? 14  DA  F N9    1 
ATOM   1838 C  C8    . DA  C 3 14  ? 20.903 18.870 -1.817  1.00 17.81 ? 14  DA  F C8    1 
ATOM   1839 N  N7    . DA  C 3 14  ? 19.895 18.499 -1.065  1.00 16.03 ? 14  DA  F N7    1 
ATOM   1840 C  C5    . DA  C 3 14  ? 20.086 17.137 -0.901  1.00 14.40 ? 14  DA  F C5    1 
ATOM   1841 C  C6    . DA  C 3 14  ? 19.357 16.153 -0.204  1.00 15.76 ? 14  DA  F C6    1 
ATOM   1842 N  N6    . DA  C 3 14  ? 18.241 16.414 0.486   1.00 14.24 ? 14  DA  F N6    1 
ATOM   1843 N  N1    . DA  C 3 14  ? 19.821 14.887 -0.244  1.00 13.55 ? 14  DA  F N1    1 
ATOM   1844 C  C2    . DA  C 3 14  ? 20.938 14.630 -0.935  1.00 13.56 ? 14  DA  F C2    1 
ATOM   1845 N  N3    . DA  C 3 14  ? 21.707 15.469 -1.629  1.00 15.69 ? 14  DA  F N3    1 
ATOM   1846 C  C4    . DA  C 3 14  ? 21.221 16.719 -1.571  1.00 16.47 ? 14  DA  F C4    1 
ATOM   1847 P  P     . DC  C 3 15  ? 24.727 18.627 -6.838  1.00 34.66 ? 15  DC  F P     1 
ATOM   1848 O  OP1   . DC  C 3 15  ? 26.059 18.561 -7.478  1.00 40.62 ? 15  DC  F OP1   1 
ATOM   1849 O  OP2   . DC  C 3 15  ? 23.783 19.708 -7.203  1.00 36.95 ? 15  DC  F OP2   1 
ATOM   1850 O  "O5'" . DC  C 3 15  ? 23.971 17.241 -7.063  1.00 31.34 ? 15  DC  F "O5'" 1 
ATOM   1851 C  "C5'" . DC  C 3 15  ? 24.538 16.046 -6.563  1.00 25.66 ? 15  DC  F "C5'" 1 
ATOM   1852 C  "C4'" . DC  C 3 15  ? 23.512 14.931 -6.538  1.00 23.58 ? 15  DC  F "C4'" 1 
ATOM   1853 O  "O4'" . DC  C 3 15  ? 22.550 15.171 -5.488  1.00 20.76 ? 15  DC  F "O4'" 1 
ATOM   1854 C  "C3'" . DC  C 3 15  ? 22.698 14.762 -7.828  1.00 28.12 ? 15  DC  F "C3'" 1 
ATOM   1855 O  "O3'" . DC  C 3 15  ? 22.931 13.465 -8.367  1.00 30.37 ? 15  DC  F "O3'" 1 
ATOM   1856 C  "C2'" . DC  C 3 15  ? 21.239 14.942 -7.378  1.00 25.12 ? 15  DC  F "C2'" 1 
ATOM   1857 C  "C1'" . DC  C 3 15  ? 21.328 14.627 -5.897  1.00 20.62 ? 15  DC  F "C1'" 1 
ATOM   1858 N  N1    . DC  C 3 15  ? 20.236 15.228 -5.085  1.00 19.14 ? 15  DC  F N1    1 
ATOM   1859 C  C2    . DC  C 3 15  ? 19.529 14.423 -4.189  1.00 20.07 ? 15  DC  F C2    1 
ATOM   1860 O  O2    . DC  C 3 15  ? 19.832 13.228 -4.087  1.00 19.49 ? 15  DC  F O2    1 
ATOM   1861 N  N3    . DC  C 3 15  ? 18.534 14.976 -3.454  1.00 16.20 ? 15  DC  F N3    1 
ATOM   1862 C  C4    . DC  C 3 15  ? 18.240 16.269 -3.594  1.00 17.56 ? 15  DC  F C4    1 
ATOM   1863 N  N4    . DC  C 3 15  ? 17.250 16.769 -2.847  1.00 17.32 ? 15  DC  F N4    1 
ATOM   1864 C  C5    . DC  C 3 15  ? 18.949 17.107 -4.506  1.00 19.77 ? 15  DC  F C5    1 
ATOM   1865 C  C6    . DC  C 3 15  ? 19.929 16.550 -5.225  1.00 20.55 ? 15  DC  F C6    1 
ATOM   1866 P  P     . DC  C 3 16  ? 22.108 12.936 -9.643  1.00 39.15 ? 16  DC  F P     1 
ATOM   1867 O  OP1   . DC  C 3 16  ? 23.025 12.057 -10.402 1.00 47.16 ? 16  DC  F OP1   1 
ATOM   1868 O  OP2   . DC  C 3 16  ? 21.463 14.079 -10.326 1.00 38.90 ? 16  DC  F OP2   1 
ATOM   1869 O  "O5'" . DC  C 3 16  ? 20.954 12.041 -8.996  1.00 37.88 ? 16  DC  F "O5'" 1 
ATOM   1870 C  "C5'" . DC  C 3 16  ? 21.284 11.081 -8.000  1.00 36.01 ? 16  DC  F "C5'" 1 
ATOM   1871 C  "C4'" . DC  C 3 16  ? 20.038 10.400 -7.465  1.00 33.14 ? 16  DC  F "C4'" 1 
ATOM   1872 O  "O4'" . DC  C 3 16  ? 19.289 11.326 -6.643  1.00 28.57 ? 16  DC  F "O4'" 1 
ATOM   1873 C  "C3'" . DC  C 3 16  ? 19.066 9.888  -8.534  1.00 35.89 ? 16  DC  F "C3'" 1 
ATOM   1874 O  "O3'" . DC  C 3 16  ? 18.793 8.511  -8.321  1.00 38.17 ? 16  DC  F "O3'" 1 
ATOM   1875 C  "C2'" . DC  C 3 16  ? 17.812 10.749 -8.342  1.00 27.41 ? 16  DC  F "C2'" 1 
ATOM   1876 C  "C1'" . DC  C 3 16  ? 17.919 11.140 -6.879  1.00 26.68 ? 16  DC  F "C1'" 1 
ATOM   1877 N  N1    . DC  C 3 16  ? 17.216 12.406 -6.545  1.00 20.76 ? 16  DC  F N1    1 
ATOM   1878 C  C2    . DC  C 3 16  ? 16.081 12.374 -5.730  1.00 17.98 ? 16  DC  F C2    1 
ATOM   1879 O  O2    . DC  C 3 16  ? 15.675 11.287 -5.302  1.00 21.95 ? 16  DC  F O2    1 
ATOM   1880 N  N3    . DC  C 3 16  ? 15.455 13.540 -5.432  1.00 15.32 ? 16  DC  F N3    1 
ATOM   1881 C  C4    . DC  C 3 16  ? 15.925 14.692 -5.913  1.00 16.54 ? 16  DC  F C4    1 
ATOM   1882 N  N4    . DC  C 3 16  ? 15.275 15.816 -5.593  1.00 16.01 ? 16  DC  F N4    1 
ATOM   1883 C  C5    . DC  C 3 16  ? 17.083 14.743 -6.745  1.00 18.17 ? 16  DC  F C5    1 
ATOM   1884 C  C6    . DC  C 3 16  ? 17.690 13.588 -7.031  1.00 20.85 ? 16  DC  F C6    1 
ATOM   1885 P  P     . DT  C 3 17  ? 18.127 7.629  -9.487  1.00 41.66 ? 17  DT  F P     1 
ATOM   1886 O  OP1   . DT  C 3 17  ? 18.623 6.244  -9.329  1.00 44.75 ? 17  DT  F OP1   1 
ATOM   1887 O  OP2   . DT  C 3 17  ? 18.317 8.339  -10.771 1.00 46.76 ? 17  DT  F OP2   1 
ATOM   1888 O  "O5'" . DT  C 3 17  ? 16.566 7.670  -9.154  1.00 38.53 ? 17  DT  F "O5'" 1 
ATOM   1889 C  "C5'" . DT  C 3 17  ? 16.096 7.177  -7.913  1.00 35.13 ? 17  DT  F "C5'" 1 
ATOM   1890 C  "C4'" . DT  C 3 17  ? 14.636 7.530  -7.721  1.00 29.95 ? 17  DT  F "C4'" 1 
ATOM   1891 O  "O4'" . DT  C 3 17  ? 14.520 8.920  -7.386  1.00 24.54 ? 17  DT  F "O4'" 1 
ATOM   1892 C  "C3'" . DT  C 3 17  ? 13.761 7.334  -8.958  1.00 32.86 ? 17  DT  F "C3'" 1 
ATOM   1893 O  "O3'" . DT  C 3 17  ? 13.002 6.145  -8.818  1.00 38.99 ? 17  DT  F "O3'" 1 
ATOM   1894 C  "C2'" . DT  C 3 17  ? 12.860 8.586  -9.004  1.00 27.13 ? 17  DT  F "C2'" 1 
ATOM   1895 C  "C1'" . DT  C 3 17  ? 13.233 9.348  -7.733  1.00 24.69 ? 17  DT  F "C1'" 1 
ATOM   1896 N  N1    . DT  C 3 17  ? 13.271 10.822 -7.909  1.00 21.63 ? 17  DT  F N1    1 
ATOM   1897 C  C2    . DT  C 3 17  ? 12.397 11.606 -7.196  1.00 17.50 ? 17  DT  F C2    1 
ATOM   1898 O  O2    . DT  C 3 17  ? 11.572 11.153 -6.423  1.00 16.92 ? 17  DT  F O2    1 
ATOM   1899 N  N3    . DT  C 3 17  ? 12.522 12.951 -7.421  1.00 15.93 ? 17  DT  F N3    1 
ATOM   1900 C  C4    . DT  C 3 17  ? 13.417 13.576 -8.270  1.00 17.86 ? 17  DT  F C4    1 
ATOM   1901 O  O4    . DT  C 3 17  ? 13.452 14.795 -8.405  1.00 18.81 ? 17  DT  F O4    1 
ATOM   1902 C  C5    . DT  C 3 17  ? 14.308 12.693 -8.986  1.00 22.42 ? 17  DT  F C5    1 
ATOM   1903 C  C7    . DT  C 3 17  ? 15.323 13.255 -9.937  1.00 24.44 ? 17  DT  F C7    1 
ATOM   1904 C  C6    . DT  C 3 17  ? 14.194 11.375 -8.772  1.00 21.82 ? 17  DT  F C6    1 
ATOM   1905 P  P     . DG  C 3 18  ? 12.072 5.622  -10.020 1.00 44.13 ? 18  DG  F P     1 
ATOM   1906 O  OP1   . DG  C 3 18  ? 12.193 4.148  -10.052 1.00 49.26 ? 18  DG  F OP1   1 
ATOM   1907 O  OP2   . DG  C 3 18  ? 12.370 6.409  -11.237 1.00 47.54 ? 18  DG  F OP2   1 
ATOM   1908 O  "O5'" . DG  C 3 18  ? 10.601 6.012  -9.544  1.00 37.67 ? 18  DG  F "O5'" 1 
ATOM   1909 C  "C5'" . DG  C 3 18  ? 10.176 5.671  -8.237  1.00 35.11 ? 18  DG  F "C5'" 1 
ATOM   1910 C  "C4'" . DG  C 3 18  ? 8.865  6.352  -7.905  1.00 33.60 ? 18  DG  F "C4'" 1 
ATOM   1911 O  "O4'" . DG  C 3 18  ? 9.081  7.779  -7.743  1.00 29.06 ? 18  DG  F "O4'" 1 
ATOM   1912 C  "C3'" . DG  C 3 18  ? 7.768  6.195  -8.956  1.00 37.73 ? 18  DG  F "C3'" 1 
ATOM   1913 O  "O3'" . DG  C 3 18  ? 6.542  5.896  -8.309  1.00 39.69 ? 18  DG  F "O3'" 1 
ATOM   1914 C  "C2'" . DG  C 3 18  ? 7.737  7.562  -9.648  1.00 35.60 ? 18  DG  F "C2'" 1 
ATOM   1915 C  "C1'" . DG  C 3 18  ? 8.159  8.500  -8.528  1.00 30.42 ? 18  DG  F "C1'" 1 
ATOM   1916 N  N9    . DG  C 3 18  ? 8.824  9.708  -9.007  1.00 27.77 ? 18  DG  F N9    1 
ATOM   1917 C  C8    . DG  C 3 18  ? 9.821  9.780  -9.949  1.00 28.12 ? 18  DG  F C8    1 
ATOM   1918 N  N7    . DG  C 3 18  ? 10.237 10.994 -10.175 1.00 26.98 ? 18  DG  F N7    1 
ATOM   1919 C  C5    . DG  C 3 18  ? 9.469  11.780 -9.328  1.00 22.29 ? 18  DG  F C5    1 
ATOM   1920 C  C6    . DG  C 3 18  ? 9.473  13.182 -9.134  1.00 17.89 ? 18  DG  F C6    1 
ATOM   1921 O  O6    . DG  C 3 18  ? 10.182 14.032 -9.692  1.00 21.15 ? 18  DG  F O6    1 
ATOM   1922 N  N1    . DG  C 3 18  ? 8.537  13.574 -8.181  1.00 15.25 ? 18  DG  F N1    1 
ATOM   1923 C  C2    . DG  C 3 18  ? 7.701  12.719 -7.502  1.00 16.26 ? 18  DG  F C2    1 
ATOM   1924 N  N2    . DG  C 3 18  ? 6.864  13.284 -6.620  1.00 17.95 ? 18  DG  F N2    1 
ATOM   1925 N  N3    . DG  C 3 18  ? 7.687  11.403 -7.674  1.00 20.87 ? 18  DG  F N3    1 
ATOM   1926 C  C4    . DG  C 3 18  ? 8.594  11.005 -8.599  1.00 21.11 ? 18  DG  F C4    1 
ATOM   1927 P  P     . DC  C 3 19  ? 5.204  5.587  -9.144  1.00 41.47 ? 19  DC  F P     1 
ATOM   1928 O  OP1   . DC  C 3 19  ? 4.736  4.249  -8.724  1.00 48.80 ? 19  DC  F OP1   1 
ATOM   1929 O  OP2   . DC  C 3 19  ? 5.414  5.857  -10.584 1.00 42.88 ? 19  DC  F OP2   1 
ATOM   1930 O  "O5'" . DC  C 3 19  ? 4.186  6.677  -8.583  1.00 37.39 ? 19  DC  F "O5'" 1 
ATOM   1931 C  "C5'" . DC  C 3 19  ? 4.237  7.033  -7.208  1.00 32.99 ? 19  DC  F "C5'" 1 
ATOM   1932 C  "C4'" . DC  C 3 19  ? 3.511  8.339  -6.963  1.00 30.51 ? 19  DC  F "C4'" 1 
ATOM   1933 O  "O4'" . DC  C 3 19  ? 4.338  9.447  -7.405  1.00 27.67 ? 19  DC  F "O4'" 1 
ATOM   1934 C  "C3'" . DC  C 3 19  ? 2.178  8.478  -7.695  1.00 34.42 ? 19  DC  F "C3'" 1 
ATOM   1935 O  "O3'" . DC  C 3 19  ? 1.207  9.032  -6.825  1.00 37.36 ? 19  DC  F "O3'" 1 
ATOM   1936 C  "C2'" . DC  C 3 19  ? 2.506  9.421  -8.853  1.00 28.81 ? 19  DC  F "C2'" 1 
ATOM   1937 C  "C1'" . DC  C 3 19  ? 3.587  10.297 -8.241  1.00 27.12 ? 19  DC  F "C1'" 1 
ATOM   1938 N  N1    . DC  C 3 19  ? 4.512  10.896 -9.241  1.00 25.40 ? 19  DC  F N1    1 
ATOM   1939 C  C2    . DC  C 3 19  ? 4.668  12.286 -9.297  1.00 22.44 ? 19  DC  F C2    1 
ATOM   1940 O  O2    . DC  C 3 19  ? 4.023  12.997 -8.518  1.00 25.19 ? 19  DC  F O2    1 
ATOM   1941 N  N3    . DC  C 3 19  ? 5.523  12.814 -10.208 1.00 20.69 ? 19  DC  F N3    1 
ATOM   1942 C  C4    . DC  C 3 19  ? 6.202  12.013 -11.031 1.00 24.08 ? 19  DC  F C4    1 
ATOM   1943 N  N4    . DC  C 3 19  ? 7.032  12.580 -11.911 1.00 23.69 ? 19  DC  F N4    1 
ATOM   1944 C  C5    . DC  C 3 19  ? 6.058  10.595 -10.987 1.00 25.36 ? 19  DC  F C5    1 
ATOM   1945 C  C6    . DC  C 3 19  ? 5.212  10.085 -10.085 1.00 28.70 ? 19  DC  F C6    1 
ATOM   1946 P  P     . DG  C 3 20  ? -0.348 8.693  -7.035  1.00 45.54 ? 20  DG  F P     1 
ATOM   1947 O  OP1   . DG  C 3 20  ? -0.925 8.385  -5.708  1.00 49.81 ? 20  DG  F OP1   1 
ATOM   1948 O  OP2   . DG  C 3 20  ? -0.442 7.700  -8.128  1.00 49.90 ? 20  DG  F OP2   1 
ATOM   1949 O  "O5'" . DG  C 3 20  ? -0.967 10.062 -7.582  1.00 43.68 ? 20  DG  F "O5'" 1 
ATOM   1950 C  "C5'" . DG  C 3 20  ? -0.810 11.262 -6.839  1.00 38.03 ? 20  DG  F "C5'" 1 
ATOM   1951 C  "C4'" . DG  C 3 20  ? -1.178 12.470 -7.681  1.00 35.66 ? 20  DG  F "C4'" 1 
ATOM   1952 O  "O4'" . DG  C 3 20  ? -0.064 12.822 -8.543  1.00 32.47 ? 20  DG  F "O4'" 1 
ATOM   1953 C  "C3'" . DG  C 3 20  ? -2.383 12.273 -8.602  1.00 38.11 ? 20  DG  F "C3'" 1 
ATOM   1954 O  "O3'" . DG  C 3 20  ? -3.187 13.443 -8.603  1.00 39.09 ? 20  DG  F "O3'" 1 
ATOM   1955 C  "C2'" . DG  C 3 20  ? -1.742 12.035 -9.967  1.00 37.28 ? 20  DG  F "C2'" 1 
ATOM   1956 C  "C1'" . DG  C 3 20  ? -0.509 12.919 -9.877  1.00 32.25 ? 20  DG  F "C1'" 1 
ATOM   1957 N  N9    . DG  C 3 20  ? 0.577  12.495 -10.751 1.00 30.95 ? 20  DG  F N9    1 
ATOM   1958 C  C8    . DG  C 3 20  ? 0.871  11.212 -11.141 1.00 32.90 ? 20  DG  F C8    1 
ATOM   1959 N  N7    . DG  C 3 20  ? 1.911  11.133 -11.923 1.00 30.48 ? 20  DG  F N7    1 
ATOM   1960 C  C5    . DG  C 3 20  ? 2.334  12.449 -12.060 1.00 30.36 ? 20  DG  F C5    1 
ATOM   1961 C  C6    . DG  C 3 20  ? 3.419  12.985 -12.790 1.00 26.91 ? 20  DG  F C6    1 
ATOM   1962 O  O6    . DG  C 3 20  ? 4.245  12.384 -13.489 1.00 28.42 ? 20  DG  F O6    1 
ATOM   1963 N  N1    . DG  C 3 20  ? 3.492  14.370 -12.663 1.00 24.73 ? 20  DG  F N1    1 
ATOM   1964 C  C2    . DG  C 3 20  ? 2.629  15.137 -11.918 1.00 23.55 ? 20  DG  F C2    1 
ATOM   1965 N  N2    . DG  C 3 20  ? 2.861  16.458 -11.913 1.00 22.74 ? 20  DG  F N2    1 
ATOM   1966 N  N3    . DG  C 3 20  ? 1.609  14.647 -11.225 1.00 25.45 ? 20  DG  F N3    1 
ATOM   1967 C  C4    . DG  C 3 20  ? 1.523  13.299 -11.343 1.00 26.55 ? 20  DG  F C4    1 
HETATM 1968 ZN ZN    . ZN  D 4 .   ? 33.400 33.778 21.613  1.00 28.53 ? 601 ZN  A ZN    1 
HETATM 1969 ZN ZN    . ZN  E 4 .   ? 40.277 19.895 2.516   1.00 17.28 ? 602 ZN  A ZN    1 
HETATM 1970 ZN ZN    . ZN  F 4 .   ? 22.491 -1.302 4.325   1.00 14.36 ? 603 ZN  A ZN    1 
HETATM 1971 ZN ZN    . ZN  G 4 .   ? 3.046  17.007 8.326   1.00 13.70 ? 604 ZN  A ZN    1 
HETATM 1972 ZN ZN    . ZN  H 4 .   ? 10.599 30.055 -14.240 1.00 21.08 ? 605 ZN  A ZN    1 
HETATM 1973 C  C1    . EDO I 5 .   ? 19.845 35.419 -13.735 1.00 35.91 ? 606 EDO A C1    1 
HETATM 1974 O  O1    . EDO I 5 .   ? 18.427 35.400 -13.930 1.00 34.13 ? 606 EDO A O1    1 
HETATM 1975 C  C2    . EDO I 5 .   ? 20.308 36.854 -13.515 1.00 37.40 ? 606 EDO A C2    1 
HETATM 1976 O  O2    . EDO I 5 .   ? 19.995 37.640 -14.671 1.00 39.23 ? 606 EDO A O2    1 
HETATM 1977 C  C1    . EDO J 5 .   ? 19.356 2.846  0.794   1.00 25.10 ? 501 EDO E C1    1 
HETATM 1978 O  O1    . EDO J 5 .   ? 20.621 2.223  0.541   1.00 19.85 ? 501 EDO E O1    1 
HETATM 1979 C  C2    . EDO J 5 .   ? 18.235 1.830  0.616   1.00 28.22 ? 501 EDO E C2    1 
HETATM 1980 O  O2    . EDO J 5 .   ? 18.447 0.731  1.509   1.00 29.74 ? 501 EDO E O2    1 
HETATM 1981 C  C1    . EDO K 5 .   ? 20.538 8.049  -2.891  1.00 38.86 ? 502 EDO E C1    1 
HETATM 1982 O  O1    . EDO K 5 .   ? 21.869 8.168  -3.405  1.00 41.78 ? 502 EDO E O1    1 
HETATM 1983 C  C2    . EDO K 5 .   ? 19.538 8.360  -3.996  1.00 38.23 ? 502 EDO E C2    1 
HETATM 1984 O  O2    . EDO K 5 .   ? 18.213 8.369  -3.450  1.00 42.64 ? 502 EDO E O2    1 
HETATM 1985 O  O     . HOH L 6 .   ? 19.113 15.677 11.524  1.00 38.54 ? 701 HOH A O     1 
HETATM 1986 O  O     . HOH L 6 .   ? 17.246 19.916 8.073   1.00 41.31 ? 702 HOH A O     1 
HETATM 1987 O  O     . HOH L 6 .   ? 30.962 32.015 33.030  1.00 24.15 ? 703 HOH A O     1 
HETATM 1988 O  O     . HOH L 6 .   ? 13.400 19.054 -7.186  1.00 29.06 ? 704 HOH A O     1 
HETATM 1989 O  O     . HOH L 6 .   ? 23.647 25.056 -4.528  1.00 29.27 ? 705 HOH A O     1 
HETATM 1990 O  O     . HOH L 6 .   ? 26.839 -9.481 12.587  1.00 21.98 ? 706 HOH A O     1 
HETATM 1991 O  O     . HOH L 6 .   ? 18.563 -5.387 11.754  1.00 38.85 ? 707 HOH A O     1 
HETATM 1992 O  O     . HOH L 6 .   ? 45.208 31.850 9.979   1.00 39.12 ? 708 HOH A O     1 
HETATM 1993 O  O     . HOH L 6 .   ? 18.279 32.290 -14.848 1.00 33.71 ? 709 HOH A O     1 
HETATM 1994 O  O     . HOH L 6 .   ? 49.970 35.350 32.771  1.00 41.05 ? 710 HOH A O     1 
HETATM 1995 O  O     . HOH L 6 .   ? 28.169 9.952  5.360   1.00 13.95 ? 711 HOH A O     1 
HETATM 1996 O  O     . HOH L 6 .   ? 41.663 35.395 16.224  1.00 27.68 ? 712 HOH A O     1 
HETATM 1997 O  O     . HOH L 6 .   ? 20.284 14.461 8.330   1.00 15.94 ? 713 HOH A O     1 
HETATM 1998 O  O     . HOH L 6 .   ? 34.435 6.631  -2.303  1.00 25.75 ? 714 HOH A O     1 
HETATM 1999 O  O     . HOH L 6 .   ? 30.343 5.658  -2.847  1.00 37.64 ? 715 HOH A O     1 
HETATM 2000 O  O     . HOH L 6 .   ? 13.900 20.072 -14.824 1.00 32.90 ? 716 HOH A O     1 
HETATM 2001 O  O     . HOH L 6 .   ? 8.817  22.862 -3.480  1.00 19.29 ? 717 HOH A O     1 
HETATM 2002 O  O     . HOH L 6 .   ? 44.988 28.281 10.463  1.00 27.05 ? 718 HOH A O     1 
HETATM 2003 O  O     . HOH L 6 .   ? 40.860 9.187  4.191   1.00 28.72 ? 719 HOH A O     1 
HETATM 2004 O  O     . HOH L 6 .   ? 7.569  10.620 16.628  1.00 31.24 ? 720 HOH A O     1 
HETATM 2005 O  O     . HOH L 6 .   ? 40.695 33.626 38.289  1.00 36.71 ? 721 HOH A O     1 
HETATM 2006 O  O     . HOH L 6 .   ? 19.847 11.871 7.812   1.00 11.42 ? 722 HOH A O     1 
HETATM 2007 O  O     . HOH L 6 .   ? 20.307 20.921 -4.329  1.00 28.23 ? 723 HOH A O     1 
HETATM 2008 O  O     . HOH L 6 .   ? 5.400  23.011 10.703  1.00 31.40 ? 724 HOH A O     1 
HETATM 2009 O  O     . HOH L 6 .   ? 47.894 24.068 -1.667  1.00 34.48 ? 725 HOH A O     1 
HETATM 2010 O  O     . HOH L 6 .   ? 34.670 9.956  1.597   1.00 18.00 ? 726 HOH A O     1 
HETATM 2011 O  O     . HOH L 6 .   ? 23.808 10.762 14.909  1.00 16.07 ? 727 HOH A O     1 
HETATM 2012 O  O     . HOH L 6 .   ? 36.200 21.617 19.107  1.00 30.18 ? 728 HOH A O     1 
HETATM 2013 O  O     . HOH L 6 .   ? 16.780 6.847  7.449   1.00 12.14 ? 729 HOH A O     1 
HETATM 2014 O  O     . HOH L 6 .   ? 16.594 -0.774 17.097  1.00 29.45 ? 730 HOH A O     1 
HETATM 2015 O  O     . HOH L 6 .   ? 7.777  35.705 -7.821  1.00 26.63 ? 731 HOH A O     1 
HETATM 2016 O  O     . HOH L 6 .   ? 42.827 34.959 18.655  1.00 25.65 ? 732 HOH A O     1 
HETATM 2017 O  O     . HOH L 6 .   ? 31.181 -1.097 0.602   1.00 21.39 ? 733 HOH A O     1 
HETATM 2018 O  O     . HOH L 6 .   ? 33.968 3.629  15.817  1.00 40.07 ? 734 HOH A O     1 
HETATM 2019 O  O     . HOH L 6 .   ? 38.511 16.795 -3.103  1.00 33.38 ? 735 HOH A O     1 
HETATM 2020 O  O     . HOH L 6 .   ? 26.319 -6.257 14.815  1.00 41.10 ? 736 HOH A O     1 
HETATM 2021 O  O     . HOH L 6 .   ? 36.626 30.033 30.931  1.00 42.40 ? 737 HOH A O     1 
HETATM 2022 O  O     . HOH L 6 .   ? 30.416 13.869 10.549  1.00 23.19 ? 738 HOH A O     1 
HETATM 2023 O  O     . HOH L 6 .   ? 45.810 29.256 3.269   1.00 30.22 ? 739 HOH A O     1 
HETATM 2024 O  O     . HOH L 6 .   ? 10.820 15.376 3.340   1.00 13.44 ? 740 HOH A O     1 
HETATM 2025 O  O     . HOH L 6 .   ? 16.158 -2.862 3.202   1.00 26.07 ? 741 HOH A O     1 
HETATM 2026 O  O     . HOH L 6 .   ? 41.153 11.180 7.813   1.00 25.66 ? 742 HOH A O     1 
HETATM 2027 O  O     . HOH L 6 .   ? 46.852 14.083 15.016  1.00 41.30 ? 743 HOH A O     1 
HETATM 2028 O  O     . HOH L 6 .   ? 2.520  9.188  13.419  1.00 44.81 ? 744 HOH A O     1 
HETATM 2029 O  O     . HOH L 6 .   ? 18.050 20.604 -0.831  1.00 29.06 ? 745 HOH A O     1 
HETATM 2030 O  O     . HOH L 6 .   ? 20.300 2.593  13.504  1.00 14.50 ? 746 HOH A O     1 
HETATM 2031 O  O     . HOH L 6 .   ? 34.557 17.985 9.534   1.00 15.41 ? 747 HOH A O     1 
HETATM 2032 O  O     . HOH L 6 .   ? 14.786 20.773 13.831  1.00 38.50 ? 748 HOH A O     1 
HETATM 2033 O  O     . HOH L 6 .   ? 19.042 10.687 13.008  1.00 31.11 ? 749 HOH A O     1 
HETATM 2034 O  O     . HOH L 6 .   ? 31.586 29.760 21.372  1.00 45.52 ? 750 HOH A O     1 
HETATM 2035 O  O     . HOH L 6 .   ? 34.244 10.357 11.896  1.00 31.97 ? 751 HOH A O     1 
HETATM 2036 O  O     . HOH L 6 .   ? 45.826 36.872 31.837  1.00 33.67 ? 752 HOH A O     1 
HETATM 2037 O  O     . HOH L 6 .   ? 9.254  33.902 -3.069  1.00 24.12 ? 753 HOH A O     1 
HETATM 2038 O  O     . HOH L 6 .   ? 6.112  25.656 2.577   1.00 22.28 ? 754 HOH A O     1 
HETATM 2039 O  O     . HOH L 6 .   ? 48.391 18.162 1.030   1.00 22.15 ? 755 HOH A O     1 
HETATM 2040 O  O     . HOH L 6 .   ? 49.419 22.315 0.810   1.00 19.22 ? 756 HOH A O     1 
HETATM 2041 O  O     . HOH L 6 .   ? 41.505 23.836 17.668  1.00 35.90 ? 757 HOH A O     1 
HETATM 2042 O  O     . HOH L 6 .   ? 10.104 21.627 2.338   1.00 14.63 ? 758 HOH A O     1 
HETATM 2043 O  O     . HOH L 6 .   ? 36.647 42.692 33.456  1.00 21.19 ? 759 HOH A O     1 
HETATM 2044 O  O     . HOH L 6 .   ? 43.316 30.672 35.579  1.00 36.19 ? 760 HOH A O     1 
HETATM 2045 O  O     . HOH L 6 .   ? 35.134 14.487 15.155  1.00 14.89 ? 761 HOH A O     1 
HETATM 2046 O  O     . HOH L 6 .   ? 40.088 36.897 35.207  1.00 25.68 ? 762 HOH A O     1 
HETATM 2047 O  O     . HOH L 6 .   ? 17.718 28.916 -16.631 1.00 34.92 ? 763 HOH A O     1 
HETATM 2048 O  O     . HOH L 6 .   ? 18.624 0.517  14.056  1.00 23.40 ? 764 HOH A O     1 
HETATM 2049 O  O     . HOH L 6 .   ? 33.854 41.604 25.529  1.00 43.67 ? 765 HOH A O     1 
HETATM 2050 O  O     . HOH L 6 .   ? 22.704 10.968 10.216  1.00 13.30 ? 766 HOH A O     1 
HETATM 2051 O  O     . HOH L 6 .   ? 8.190  36.383 -3.088  1.00 35.14 ? 767 HOH A O     1 
HETATM 2052 O  O     . HOH L 6 .   ? 22.548 8.316  6.087   1.00 11.87 ? 768 HOH A O     1 
HETATM 2053 O  O     . HOH L 6 .   ? 34.569 0.716  2.887   1.00 20.86 ? 769 HOH A O     1 
HETATM 2054 O  O     . HOH L 6 .   ? 10.901 22.060 10.221  1.00 22.54 ? 770 HOH A O     1 
HETATM 2055 O  O     . HOH L 6 .   ? 10.177 26.775 2.334   1.00 36.00 ? 771 HOH A O     1 
HETATM 2056 O  O     . HOH L 6 .   ? 34.363 23.470 4.748   1.00 24.21 ? 772 HOH A O     1 
HETATM 2057 O  O     . HOH L 6 .   ? 27.531 37.864 32.417  1.00 20.65 ? 773 HOH A O     1 
HETATM 2058 O  O     . HOH L 6 .   ? 7.710  15.997 16.045  1.00 43.49 ? 774 HOH A O     1 
HETATM 2059 O  O     . HOH L 6 .   ? 35.946 18.825 0.389   1.00 29.54 ? 775 HOH A O     1 
HETATM 2060 O  O     . HOH L 6 .   ? 44.981 18.315 5.521   1.00 18.72 ? 776 HOH A O     1 
HETATM 2061 O  O     . HOH L 6 .   ? 12.938 4.895  5.209   1.00 23.01 ? 777 HOH A O     1 
HETATM 2062 O  O     . HOH L 6 .   ? 21.051 8.505  13.222  1.00 14.62 ? 778 HOH A O     1 
HETATM 2063 O  O     . HOH L 6 .   ? 10.712 21.598 -10.014 1.00 24.87 ? 779 HOH A O     1 
HETATM 2064 O  O     . HOH L 6 .   ? 38.794 30.371 32.300  1.00 29.26 ? 780 HOH A O     1 
HETATM 2065 O  O     . HOH L 6 .   ? 31.305 31.872 30.121  1.00 24.06 ? 781 HOH A O     1 
HETATM 2066 O  O     . HOH L 6 .   ? 18.461 11.184 10.192  1.00 14.68 ? 782 HOH A O     1 
HETATM 2067 O  O     . HOH L 6 .   ? 35.600 26.045 10.753  1.00 27.88 ? 783 HOH A O     1 
HETATM 2068 O  O     . HOH L 6 .   ? 10.356 8.486  18.525  1.00 43.30 ? 784 HOH A O     1 
HETATM 2069 O  O     . HOH L 6 .   ? 6.423  18.132 14.215  1.00 30.71 ? 785 HOH A O     1 
HETATM 2070 O  O     . HOH L 6 .   ? 14.206 16.277 12.766  1.00 30.75 ? 786 HOH A O     1 
HETATM 2071 O  O     . HOH L 6 .   ? 16.239 18.708 0.133   1.00 18.86 ? 787 HOH A O     1 
HETATM 2072 O  O     . HOH L 6 .   ? 17.827 8.300  5.241   1.00 10.73 ? 788 HOH A O     1 
HETATM 2073 O  O     . HOH L 6 .   ? 40.182 28.866 25.750  1.00 32.25 ? 789 HOH A O     1 
HETATM 2074 O  O     . HOH L 6 .   ? 48.976 26.827 0.203   1.00 34.44 ? 790 HOH A O     1 
HETATM 2075 O  O     . HOH L 6 .   ? 47.029 35.184 29.748  1.00 29.86 ? 791 HOH A O     1 
HETATM 2076 O  O     . HOH L 6 .   ? 5.999  32.506 0.837   1.00 28.72 ? 792 HOH A O     1 
HETATM 2077 O  O     . HOH L 6 .   ? 26.841 -2.231 9.885   1.00 13.82 ? 793 HOH A O     1 
HETATM 2078 O  O     . HOH L 6 .   ? 36.463 3.443  1.487   1.00 28.84 ? 794 HOH A O     1 
HETATM 2079 O  O     . HOH L 6 .   ? 36.744 39.813 23.060  1.00 27.40 ? 795 HOH A O     1 
HETATM 2080 O  O     . HOH L 6 .   ? 38.073 12.317 13.002  1.00 31.28 ? 796 HOH A O     1 
HETATM 2081 O  O     . HOH L 6 .   ? 5.771  14.662 16.490  1.00 39.48 ? 797 HOH A O     1 
HETATM 2082 O  O     . HOH L 6 .   ? 1.586  10.305 6.125   1.00 29.41 ? 798 HOH A O     1 
HETATM 2083 O  O     . HOH L 6 .   ? 19.015 4.631  14.974  1.00 14.74 ? 799 HOH A O     1 
HETATM 2084 O  O     . HOH L 6 .   ? 44.875 10.359 13.659  1.00 34.66 ? 800 HOH A O     1 
HETATM 2085 O  O     . HOH L 6 .   ? 29.300 10.113 12.817  1.00 15.69 ? 801 HOH A O     1 
HETATM 2086 O  O     . HOH L 6 .   ? 15.504 22.149 -1.506  1.00 21.16 ? 802 HOH A O     1 
HETATM 2087 O  O     . HOH L 6 .   ? 29.335 1.886  -0.733  1.00 20.85 ? 803 HOH A O     1 
HETATM 2088 O  O     . HOH L 6 .   ? 5.344  9.696  3.159   1.00 32.26 ? 804 HOH A O     1 
HETATM 2089 O  O     . HOH L 6 .   ? 37.706 27.935 6.205   1.00 25.77 ? 805 HOH A O     1 
HETATM 2090 O  O     . HOH L 6 .   ? 4.256  31.231 -7.695  1.00 32.08 ? 806 HOH A O     1 
HETATM 2091 O  O     . HOH L 6 .   ? 15.225 24.423 0.121   1.00 19.54 ? 807 HOH A O     1 
HETATM 2092 O  O     . HOH L 6 .   ? 15.764 19.390 6.481   1.00 24.58 ? 808 HOH A O     1 
HETATM 2093 O  O     . HOH L 6 .   ? 44.580 43.169 29.974  1.00 39.65 ? 809 HOH A O     1 
HETATM 2094 O  O     . HOH L 6 .   ? 9.495  19.612 0.417   1.00 11.63 ? 810 HOH A O     1 
HETATM 2095 O  O     . HOH L 6 .   ? 12.201 2.024  5.796   1.00 24.77 ? 811 HOH A O     1 
HETATM 2096 O  O     . HOH L 6 .   ? 6.613  24.506 -3.872  1.00 16.86 ? 812 HOH A O     1 
HETATM 2097 O  O     . HOH L 6 .   ? 31.783 9.137  12.252  1.00 15.50 ? 813 HOH A O     1 
HETATM 2098 O  O     . HOH L 6 .   ? 11.260 7.086  5.987   1.00 17.04 ? 814 HOH A O     1 
HETATM 2099 O  O     . HOH L 6 .   ? 37.790 41.127 27.933  1.00 32.64 ? 815 HOH A O     1 
HETATM 2100 O  O     . HOH L 6 .   ? 10.687 19.806 12.601  1.00 31.91 ? 816 HOH A O     1 
HETATM 2101 O  O     . HOH L 6 .   ? 12.025 23.423 2.023   1.00 27.84 ? 817 HOH A O     1 
HETATM 2102 O  O     . HOH L 6 .   ? 3.559  28.767 -5.848  1.00 41.03 ? 818 HOH A O     1 
HETATM 2103 O  O     . HOH L 6 .   ? 39.836 12.022 15.001  1.00 26.58 ? 819 HOH A O     1 
HETATM 2104 O  O     . HOH L 6 .   ? 46.673 16.299 5.003   1.00 24.24 ? 820 HOH A O     1 
HETATM 2105 O  O     . HOH L 6 .   ? 3.664  7.913  7.827   1.00 24.81 ? 821 HOH A O     1 
HETATM 2106 O  O     . HOH L 6 .   ? 46.708 24.332 10.808  1.00 20.28 ? 822 HOH A O     1 
HETATM 2107 O  O     . HOH L 6 .   ? 19.896 25.601 -15.402 1.00 28.12 ? 823 HOH A O     1 
HETATM 2108 O  O     . HOH L 6 .   ? 46.576 45.106 27.495  1.00 26.84 ? 824 HOH A O     1 
HETATM 2109 O  O     . HOH L 6 .   ? 37.776 23.950 19.408  1.00 29.18 ? 825 HOH A O     1 
HETATM 2110 O  O     . HOH L 6 .   ? 37.133 27.739 22.737  1.00 53.05 ? 826 HOH A O     1 
HETATM 2111 O  O     . HOH L 6 .   ? 17.576 19.905 -8.289  1.00 30.75 ? 827 HOH A O     1 
HETATM 2112 O  O     . HOH L 6 .   ? 20.203 12.733 13.081  1.00 33.44 ? 828 HOH A O     1 
HETATM 2113 O  O     . HOH L 6 .   ? 5.199  5.210  7.333   1.00 45.70 ? 829 HOH A O     1 
HETATM 2114 O  O     . HOH L 6 .   ? 26.713 -2.889 12.710  1.00 26.05 ? 830 HOH A O     1 
HETATM 2115 O  O     . HOH L 6 .   ? 20.181 5.663  17.158  1.00 36.01 ? 831 HOH A O     1 
HETATM 2116 O  O     . HOH L 6 .   ? 49.048 42.220 27.907  1.00 45.11 ? 832 HOH A O     1 
HETATM 2117 O  O     . HOH L 6 .   ? 33.048 30.083 29.405  1.00 41.69 ? 833 HOH A O     1 
HETATM 2118 O  O     . HOH L 6 .   ? 41.144 28.339 34.335  1.00 37.55 ? 834 HOH A O     1 
HETATM 2119 O  O     . HOH L 6 .   ? 28.431 4.454  -1.514  1.00 27.52 ? 835 HOH A O     1 
HETATM 2120 O  O     . HOH L 6 .   ? 9.622  13.360 16.242  1.00 26.55 ? 836 HOH A O     1 
HETATM 2121 O  O     . HOH L 6 .   ? 22.955 -4.079 11.688  1.00 32.05 ? 837 HOH A O     1 
HETATM 2122 O  O     . HOH L 6 .   ? 8.406  34.006 0.484   1.00 40.25 ? 838 HOH A O     1 
HETATM 2123 O  O     . HOH L 6 .   ? -0.004 11.810 6.801   1.00 34.39 ? 839 HOH A O     1 
HETATM 2124 O  O     . HOH L 6 .   ? 18.410 20.506 -10.776 1.00 26.32 ? 840 HOH A O     1 
HETATM 2125 O  O     . HOH L 6 .   ? 6.485  37.507 -12.532 1.00 39.42 ? 841 HOH A O     1 
HETATM 2126 O  O     . HOH L 6 .   ? 31.040 10.497 -1.591  1.00 27.19 ? 842 HOH A O     1 
HETATM 2127 O  O     . HOH L 6 .   ? 30.738 40.274 26.442  1.00 41.54 ? 843 HOH A O     1 
HETATM 2128 O  O     . HOH L 6 .   ? 32.210 12.597 8.471   1.00 33.50 ? 844 HOH A O     1 
HETATM 2129 O  O     . HOH L 6 .   ? 24.216 -7.887 0.491   1.00 34.26 ? 845 HOH A O     1 
HETATM 2130 O  O     . HOH L 6 .   ? 36.436 8.332  12.409  1.00 29.34 ? 846 HOH A O     1 
HETATM 2131 O  O     . HOH L 6 .   ? 20.062 19.865 -6.517  1.00 38.74 ? 847 HOH A O     1 
HETATM 2132 O  O     . HOH L 6 .   ? 16.837 7.923  16.774  1.00 42.15 ? 848 HOH A O     1 
HETATM 2133 O  O     . HOH L 6 .   ? 10.339 37.511 -11.431 1.00 35.98 ? 849 HOH A O     1 
HETATM 2134 O  O     . HOH L 6 .   ? 14.449 21.695 6.239   1.00 35.36 ? 850 HOH A O     1 
HETATM 2135 O  O     . HOH L 6 .   ? 23.993 -2.910 13.463  1.00 38.70 ? 851 HOH A O     1 
HETATM 2136 O  O     . HOH L 6 .   ? 19.364 40.197 -17.280 1.00 48.97 ? 852 HOH A O     1 
HETATM 2137 O  O     . HOH L 6 .   ? 35.488 11.749 14.092  1.00 29.37 ? 853 HOH A O     1 
HETATM 2138 O  O     . HOH L 6 .   ? 19.948 -1.875 14.664  1.00 31.30 ? 854 HOH A O     1 
HETATM 2139 O  O     . HOH L 6 .   ? 50.533 24.761 0.693   1.00 24.52 ? 855 HOH A O     1 
HETATM 2140 O  O     . HOH L 6 .   ? 20.543 -3.973 12.579  1.00 34.28 ? 856 HOH A O     1 
HETATM 2141 O  O     . HOH L 6 .   ? 28.590 9.369  15.256  1.00 21.12 ? 857 HOH A O     1 
HETATM 2142 O  O     . HOH L 6 .   ? 28.959 32.588 29.390  1.00 37.21 ? 858 HOH A O     1 
HETATM 2143 O  O     . HOH L 6 .   ? 36.851 12.309 -4.204  1.00 41.09 ? 859 HOH A O     1 
HETATM 2144 O  O     . HOH L 6 .   ? 39.129 26.689 20.748  1.00 42.92 ? 860 HOH A O     1 
HETATM 2145 O  O     . HOH L 6 .   ? 32.580 14.633 6.742   1.00 25.09 ? 861 HOH A O     1 
HETATM 2146 O  O     . HOH L 6 .   ? 2.915  31.448 -1.245  1.00 50.12 ? 862 HOH A O     1 
HETATM 2147 O  O     . HOH L 6 .   ? 9.648  1.217  5.893   1.00 32.55 ? 863 HOH A O     1 
HETATM 2148 O  O     . HOH L 6 .   ? 46.808 24.243 13.471  1.00 46.14 ? 864 HOH A O     1 
HETATM 2149 O  O     . HOH L 6 .   ? 32.190 2.197  -0.841  1.00 33.56 ? 865 HOH A O     1 
HETATM 2150 O  O     . HOH L 6 .   ? 23.544 35.946 -14.250 1.00 19.85 ? 866 HOH A O     1 
HETATM 2151 O  O     . HOH L 6 .   ? 21.170 11.097 14.827  1.00 27.69 ? 867 HOH A O     1 
HETATM 2152 O  O     . HOH L 6 .   ? 30.935 -1.399 -1.910  1.00 42.25 ? 868 HOH A O     1 
HETATM 2153 O  O     . HOH L 6 .   ? 34.616 5.834  14.719  1.00 23.27 ? 869 HOH A O     1 
HETATM 2154 O  O     . HOH L 6 .   ? 33.454 8.603  -3.134  1.00 36.23 ? 870 HOH A O     1 
HETATM 2155 O  O     . HOH L 6 .   ? 38.928 3.211  9.715   1.00 25.45 ? 871 HOH A O     1 
HETATM 2156 O  O     . HOH L 6 .   ? 8.825  26.971 -18.224 1.00 39.71 ? 872 HOH A O     1 
HETATM 2157 O  O     . HOH L 6 .   ? 46.304 28.427 25.152  1.00 35.49 ? 873 HOH A O     1 
HETATM 2158 O  O     . HOH L 6 .   ? 32.434 4.203  -2.503  1.00 36.79 ? 874 HOH A O     1 
HETATM 2159 O  O     . HOH L 6 .   ? 42.478 10.593 5.242   1.00 31.48 ? 875 HOH A O     1 
HETATM 2160 O  O     . HOH L 6 .   ? 35.225 27.074 5.678   1.00 28.19 ? 876 HOH A O     1 
HETATM 2161 O  O     . HOH L 6 .   ? 34.922 2.072  0.110   1.00 43.34 ? 877 HOH A O     1 
HETATM 2162 O  O     . HOH L 6 .   ? 28.527 -0.081 -2.392  1.00 39.52 ? 878 HOH A O     1 
HETATM 2163 O  O     . HOH L 6 .   ? 42.634 2.808  8.435   1.00 36.96 ? 879 HOH A O     1 
HETATM 2164 O  O     . HOH L 6 .   ? 32.234 25.072 4.282   1.00 33.76 ? 880 HOH A O     1 
HETATM 2165 O  O     . HOH L 6 .   ? 34.311 28.793 27.378  1.00 40.73 ? 881 HOH A O     1 
HETATM 2166 O  O     . HOH L 6 .   ? 13.913 27.032 3.573   1.00 41.49 ? 882 HOH A O     1 
HETATM 2167 O  O     . HOH L 6 .   ? 11.345 28.070 4.394   1.00 32.42 ? 883 HOH A O     1 
HETATM 2168 O  O     . HOH L 6 .   ? 23.649 33.383 -14.771 1.00 28.61 ? 884 HOH A O     1 
HETATM 2169 O  O     . HOH M 6 .   ? 9.213  17.307 2.127   1.00 19.99 ? 601 HOH E O     1 
HETATM 2170 O  O     . HOH M 6 .   ? 3.050  15.927 2.257   1.00 30.71 ? 602 HOH E O     1 
HETATM 2171 O  O     . HOH M 6 .   ? 34.930 11.415 30.624  1.00 37.75 ? 603 HOH E O     1 
HETATM 2172 O  O     . HOH M 6 .   ? 10.550 5.287  3.096   1.00 36.83 ? 604 HOH E O     1 
HETATM 2173 O  O     . HOH M 6 .   ? 39.106 12.849 30.884  1.00 35.96 ? 605 HOH E O     1 
HETATM 2174 O  O     . HOH M 6 .   ? 38.697 15.685 31.439  1.00 34.73 ? 606 HOH E O     1 
HETATM 2175 O  O     . HOH M 6 .   ? 45.038 5.474  26.055  1.00 38.85 ? 607 HOH E O     1 
HETATM 2176 O  O     . HOH M 6 .   ? 5.657  26.417 -8.212  1.00 35.78 ? 608 HOH E O     1 
HETATM 2177 O  O     . HOH M 6 .   ? 9.839  18.288 -17.715 1.00 37.31 ? 609 HOH E O     1 
HETATM 2178 O  O     . HOH M 6 .   ? 34.797 21.977 12.596  1.00 15.95 ? 610 HOH E O     1 
HETATM 2179 O  O     . HOH M 6 .   ? 15.718 8.459  -4.026  1.00 33.96 ? 611 HOH E O     1 
HETATM 2180 O  O     . HOH M 6 .   ? 30.999 25.213 7.045   1.00 36.49 ? 612 HOH E O     1 
HETATM 2181 O  O     . HOH M 6 .   ? 4.876  23.524 -2.082  1.00 19.10 ? 613 HOH E O     1 
HETATM 2182 O  O     . HOH M 6 .   ? 26.987 5.442  0.482   1.00 19.59 ? 614 HOH E O     1 
HETATM 2183 O  O     . HOH M 6 .   ? 0.933  21.206 -1.941  1.00 38.11 ? 615 HOH E O     1 
HETATM 2184 O  O     . HOH M 6 .   ? 33.760 19.121 27.659  1.00 35.29 ? 616 HOH E O     1 
HETATM 2185 O  O     . HOH M 6 .   ? 8.759  7.595  5.314   1.00 29.39 ? 617 HOH E O     1 
HETATM 2186 O  O     . HOH M 6 .   ? 15.340 3.604  -1.731  1.00 35.54 ? 618 HOH E O     1 
HETATM 2187 O  O     . HOH M 6 .   ? 33.595 17.037 7.162   1.00 13.63 ? 619 HOH E O     1 
HETATM 2188 O  O     . HOH M 6 .   ? 27.552 21.210 6.372   1.00 21.16 ? 620 HOH E O     1 
HETATM 2189 O  O     . HOH M 6 .   ? 32.861 18.217 11.956  1.00 13.79 ? 621 HOH E O     1 
HETATM 2190 O  O     . HOH M 6 .   ? 20.298 7.118  4.865   1.00 12.42 ? 622 HOH E O     1 
HETATM 2191 O  O     . HOH M 6 .   ? 31.535 13.187 4.645   1.00 16.50 ? 623 HOH E O     1 
HETATM 2192 O  O     . HOH M 6 .   ? 51.380 11.464 27.732  1.00 37.31 ? 624 HOH E O     1 
HETATM 2193 O  O     . HOH M 6 .   ? 35.051 24.613 7.217   1.00 18.39 ? 625 HOH E O     1 
HETATM 2194 O  O     . HOH M 6 .   ? 33.919 13.974 -1.772  1.00 42.44 ? 626 HOH E O     1 
HETATM 2195 O  O     . HOH M 6 .   ? 10.195 15.384 -12.854 1.00 29.96 ? 627 HOH E O     1 
HETATM 2196 O  O     . HOH M 6 .   ? 34.918 21.380 21.563  1.00 26.53 ? 628 HOH E O     1 
HETATM 2197 O  O     . HOH M 6 .   ? 34.557 21.477 17.520  1.00 22.04 ? 629 HOH E O     1 
HETATM 2198 O  O     . HOH M 6 .   ? 13.163 1.957  1.277   1.00 33.25 ? 630 HOH E O     1 
HETATM 2199 O  O     . HOH M 6 .   ? 43.310 14.591 23.801  1.00 18.04 ? 631 HOH E O     1 
HETATM 2200 O  O     . HOH M 6 .   ? 16.076 -0.689 1.466   1.00 40.49 ? 632 HOH E O     1 
HETATM 2201 O  O     . HOH M 6 .   ? 8.002  20.543 -1.712  1.00 14.42 ? 633 HOH E O     1 
HETATM 2202 O  O     . HOH M 6 .   ? 26.433 12.098 9.589   1.00 22.16 ? 634 HOH E O     1 
HETATM 2203 O  O     . HOH M 6 .   ? 10.614 18.334 -12.314 1.00 39.85 ? 635 HOH E O     1 
HETATM 2204 O  O     . HOH M 6 .   ? 32.253 21.652 1.703   1.00 35.81 ? 636 HOH E O     1 
HETATM 2205 O  O     . HOH M 6 .   ? 33.282 21.165 15.002  1.00 15.55 ? 637 HOH E O     1 
HETATM 2206 O  O     . HOH M 6 .   ? 8.030  12.053 -16.416 1.00 40.93 ? 638 HOH E O     1 
HETATM 2207 O  O     . HOH M 6 .   ? 46.509 16.212 26.032  1.00 32.46 ? 639 HOH E O     1 
HETATM 2208 O  O     . HOH M 6 .   ? 30.242 15.619 -1.899  1.00 36.30 ? 640 HOH E O     1 
HETATM 2209 O  O     . HOH M 6 .   ? 25.932 22.279 13.008  1.00 25.91 ? 641 HOH E O     1 
HETATM 2210 O  O     . HOH M 6 .   ? 2.366  18.845 -9.604  1.00 37.70 ? 642 HOH E O     1 
HETATM 2211 O  O     . HOH M 6 .   ? 22.314 10.515 -1.770  1.00 29.51 ? 643 HOH E O     1 
HETATM 2212 O  O     . HOH M 6 .   ? 27.072 17.841 1.641   1.00 18.46 ? 644 HOH E O     1 
HETATM 2213 O  O     . HOH M 6 .   ? 4.446  10.287 -17.141 1.00 37.09 ? 645 HOH E O     1 
HETATM 2214 O  O     . HOH M 6 .   ? 27.279 21.758 9.338   1.00 22.99 ? 646 HOH E O     1 
HETATM 2215 O  O     . HOH M 6 .   ? 15.255 7.821  4.231   1.00 14.70 ? 647 HOH E O     1 
HETATM 2216 O  O     . HOH M 6 .   ? 35.015 20.553 26.278  1.00 37.37 ? 648 HOH E O     1 
HETATM 2217 O  O     . HOH M 6 .   ? 36.338 17.537 29.996  1.00 38.72 ? 649 HOH E O     1 
HETATM 2218 O  O     . HOH M 6 .   ? 0.764  18.917 -2.425  1.00 41.93 ? 650 HOH E O     1 
HETATM 2219 O  O     . HOH M 6 .   ? 2.381  23.930 -3.867  1.00 32.66 ? 651 HOH E O     1 
HETATM 2220 O  O     . HOH M 6 .   ? 9.994  9.838  -2.979  1.00 27.16 ? 652 HOH E O     1 
HETATM 2221 O  O     . HOH M 6 .   ? 33.179 11.363 0.285   1.00 21.72 ? 653 HOH E O     1 
HETATM 2222 O  O     . HOH M 6 .   ? 11.887 19.059 -9.636  1.00 20.97 ? 654 HOH E O     1 
HETATM 2223 O  O     . HOH M 6 .   ? 33.018 22.245 24.003  1.00 35.14 ? 655 HOH E O     1 
HETATM 2224 O  O     . HOH M 6 .   ? 7.428  12.490 -3.034  1.00 19.38 ? 656 HOH E O     1 
HETATM 2225 O  O     . HOH M 6 .   ? 29.323 14.374 23.838  1.00 23.38 ? 657 HOH E O     1 
HETATM 2226 O  O     . HOH M 6 .   ? 25.912 19.613 19.600  1.00 37.17 ? 658 HOH E O     1 
HETATM 2227 O  O     . HOH M 6 .   ? 23.068 4.103  -1.848  1.00 38.72 ? 659 HOH E O     1 
HETATM 2228 O  O     . HOH M 6 .   ? 41.432 10.841 31.915  1.00 29.59 ? 660 HOH E O     1 
HETATM 2229 O  O     . HOH M 6 .   ? 41.582 9.186  29.840  1.00 36.40 ? 661 HOH E O     1 
HETATM 2230 O  O     . HOH M 6 .   ? 27.426 17.024 22.959  1.00 38.76 ? 662 HOH E O     1 
HETATM 2231 O  O     . HOH M 6 .   ? 26.521 8.087  -1.844  1.00 23.58 ? 663 HOH E O     1 
HETATM 2232 O  O     . HOH M 6 .   ? 24.432 12.353 -0.647  1.00 32.14 ? 664 HOH E O     1 
HETATM 2233 O  O     . HOH M 6 .   ? 4.147  15.045 -4.624  1.00 28.86 ? 665 HOH E O     1 
HETATM 2234 O  O     . HOH M 6 .   ? 22.397 10.809 7.286   1.00 11.54 ? 666 HOH E O     1 
HETATM 2235 O  O     . HOH M 6 .   ? 12.950 8.077  -4.163  1.00 39.68 ? 667 HOH E O     1 
HETATM 2236 O  O     . HOH M 6 .   ? 20.692 -1.020 0.475   1.00 30.67 ? 668 HOH E O     1 
HETATM 2237 O  O     . HOH M 6 .   ? 24.916 4.066  -0.491  1.00 27.32 ? 669 HOH E O     1 
HETATM 2238 O  O     . HOH M 6 .   ? 1.138  10.384 -15.303 1.00 31.20 ? 670 HOH E O     1 
HETATM 2239 O  O     . HOH M 6 .   ? 33.484 17.758 -0.520  1.00 40.90 ? 671 HOH E O     1 
HETATM 2240 O  O     . HOH M 6 .   ? 42.178 12.328 22.457  1.00 19.16 ? 672 HOH E O     1 
HETATM 2241 O  O     . HOH M 6 .   ? 24.515 6.554  -2.788  1.00 39.93 ? 673 HOH E O     1 
HETATM 2242 O  O     . HOH M 6 .   ? 13.105 9.076  5.509   1.00 14.90 ? 674 HOH E O     1 
HETATM 2243 O  O     . HOH M 6 .   ? 11.249 20.346 -13.456 1.00 47.03 ? 675 HOH E O     1 
HETATM 2244 O  O     . HOH M 6 .   ? 20.962 4.840  -2.364  1.00 43.10 ? 676 HOH E O     1 
HETATM 2245 O  O     . HOH M 6 .   ? 3.417  26.049 -9.866  1.00 38.35 ? 677 HOH E O     1 
HETATM 2246 O  O     . HOH M 6 .   ? 3.122  13.557 -0.113  1.00 32.18 ? 678 HOH E O     1 
HETATM 2247 O  O     . HOH M 6 .   ? 28.125 20.696 3.388   1.00 39.96 ? 679 HOH E O     1 
HETATM 2248 O  O     . HOH M 6 .   ? 45.866 14.225 22.867  1.00 31.20 ? 680 HOH E O     1 
HETATM 2249 O  O     . HOH M 6 .   ? 37.430 7.489  22.838  1.00 28.94 ? 681 HOH E O     1 
HETATM 2250 O  O     . HOH M 6 .   ? 25.639 24.847 12.119  1.00 38.96 ? 682 HOH E O     1 
HETATM 2251 O  O     . HOH M 6 .   ? 30.984 24.525 21.035  1.00 35.85 ? 683 HOH E O     1 
HETATM 2252 O  O     . HOH M 6 .   ? 27.424 15.788 -1.342  1.00 38.59 ? 684 HOH E O     1 
HETATM 2253 O  O     . HOH M 6 .   ? 27.066 25.219 9.032   1.00 38.98 ? 685 HOH E O     1 
HETATM 2254 O  O     . HOH M 6 .   ? 28.508 23.981 6.919   1.00 35.18 ? 686 HOH E O     1 
HETATM 2255 O  O     . HOH M 6 .   ? 7.646  8.865  -2.126  1.00 37.57 ? 687 HOH E O     1 
HETATM 2256 O  O     . HOH M 6 .   ? 23.977 20.179 24.438  1.00 40.47 ? 688 HOH E O     1 
HETATM 2257 O  O     . HOH M 6 .   ? 29.971 12.208 -2.731  1.00 45.56 ? 689 HOH E O     1 
HETATM 2258 O  O     . HOH M 6 .   ? 31.423 19.634 -0.138  1.00 36.96 ? 690 HOH E O     1 
HETATM 2259 O  O     . HOH M 6 .   ? 47.893 16.018 23.636  1.00 37.91 ? 691 HOH E O     1 
HETATM 2260 O  O     . HOH M 6 .   ? 28.618 19.093 -0.089  1.00 43.47 ? 692 HOH E O     1 
HETATM 2261 O  O     . HOH N 6 .   ? 16.856 9.885  -11.516 1.00 29.60 ? 101 HOH F O     1 
HETATM 2262 O  O     . HOH N 6 .   ? 48.915 18.971 19.234  1.00 39.46 ? 102 HOH F O     1 
HETATM 2263 O  O     . HOH N 6 .   ? 30.726 8.021  15.999  1.00 22.76 ? 103 HOH F O     1 
HETATM 2264 O  O     . HOH N 6 .   ? -0.605 8.083  -10.534 1.00 39.65 ? 104 HOH F O     1 
HETATM 2265 O  O     . HOH N 6 .   ? 45.772 28.514 29.665  1.00 37.91 ? 105 HOH F O     1 
HETATM 2266 O  O     . HOH N 6 .   ? 11.866 14.839 -11.323 1.00 34.84 ? 106 HOH F O     1 
HETATM 2267 O  O     . HOH N 6 .   ? 26.408 8.038  15.337  1.00 20.17 ? 107 HOH F O     1 
HETATM 2268 O  O     . HOH N 6 .   ? 42.396 19.914 18.120  1.00 14.97 ? 108 HOH F O     1 
HETATM 2269 O  O     . HOH N 6 .   ? 0.551  16.107 -9.425  1.00 33.39 ? 109 HOH F O     1 
HETATM 2270 O  O     . HOH N 6 .   ? 45.441 11.151 17.210  1.00 39.68 ? 110 HOH F O     1 
HETATM 2271 O  O     . HOH N 6 .   ? 20.084 10.780 17.513  1.00 32.03 ? 111 HOH F O     1 
HETATM 2272 O  O     . HOH N 6 .   ? 18.948 13.544 -10.163 1.00 38.51 ? 112 HOH F O     1 
HETATM 2273 O  O     . HOH N 6 .   ? 23.174 6.170  19.093  1.00 34.75 ? 113 HOH F O     1 
HETATM 2274 O  O     . HOH N 6 .   ? 4.470  9.943  -14.460 1.00 40.65 ? 114 HOH F O     1 
HETATM 2275 O  O     . HOH N 6 .   ? 45.354 22.214 18.507  1.00 33.11 ? 115 HOH F O     1 
HETATM 2276 O  O     . HOH N 6 .   ? 10.156 9.206  -5.316  1.00 37.52 ? 116 HOH F O     1 
HETATM 2277 O  O     . HOH N 6 .   ? 14.872 16.749 -9.508  1.00 28.11 ? 117 HOH F O     1 
HETATM 2278 O  O     . HOH N 6 .   ? 36.893 7.317  14.863  1.00 42.45 ? 118 HOH F O     1 
HETATM 2279 O  O     . HOH N 6 .   ? 12.199 11.678 -11.845 1.00 35.54 ? 119 HOH F O     1 
HETATM 2280 O  O     . HOH N 6 .   ? 34.750 10.067 15.451  1.00 18.11 ? 120 HOH F O     1 
HETATM 2281 O  O     . HOH N 6 .   ? 14.852 23.407 8.541   1.00 31.39 ? 121 HOH F O     1 
HETATM 2282 O  O     . HOH N 6 .   ? 37.308 21.328 27.480  1.00 26.29 ? 122 HOH F O     1 
HETATM 2283 O  O     . HOH N 6 .   ? 24.009 18.487 18.288  1.00 29.47 ? 123 HOH F O     1 
HETATM 2284 O  O     . HOH N 6 .   ? 26.608 15.306 20.389  1.00 22.79 ? 124 HOH F O     1 
HETATM 2285 O  O     . HOH N 6 .   ? 46.911 23.413 20.417  1.00 40.55 ? 125 HOH F O     1 
HETATM 2286 O  O     . HOH N 6 .   ? 35.184 11.613 23.183  1.00 21.36 ? 126 HOH F O     1 
HETATM 2287 O  O     . HOH N 6 .   ? 37.191 21.860 22.851  1.00 23.16 ? 127 HOH F O     1 
HETATM 2288 O  O     . HOH N 6 .   ? 46.969 15.812 17.443  1.00 31.24 ? 128 HOH F O     1 
HETATM 2289 O  O     . HOH N 6 .   ? 47.564 20.120 35.229  1.00 27.89 ? 129 HOH F O     1 
HETATM 2290 O  O     . HOH N 6 .   ? 48.265 24.693 24.202  1.00 39.68 ? 130 HOH F O     1 
HETATM 2291 O  O     . HOH N 6 .   ? 24.576 18.260 0.600   1.00 22.35 ? 131 HOH F O     1 
HETATM 2292 O  O     . HOH N 6 .   ? 24.098 8.882  21.804  1.00 35.51 ? 132 HOH F O     1 
HETATM 2293 O  O     . HOH N 6 .   ? 20.862 16.215 21.677  1.00 41.19 ? 133 HOH F O     1 
HETATM 2294 O  O     . HOH N 6 .   ? 43.138 11.962 34.491  1.00 44.16 ? 134 HOH F O     1 
HETATM 2295 O  O     . HOH N 6 .   ? 39.477 9.663  15.373  1.00 42.40 ? 135 HOH F O     1 
HETATM 2296 O  O     . HOH N 6 .   ? 37.589 20.126 30.787  1.00 36.49 ? 136 HOH F O     1 
HETATM 2297 O  O     . HOH N 6 .   ? 2.397  13.814 -6.390  1.00 33.01 ? 137 HOH F O     1 
HETATM 2298 O  O     . HOH N 6 .   ? 16.351 15.926 3.869   1.00 13.70 ? 138 HOH F O     1 
HETATM 2299 O  O     . HOH N 6 .   ? 8.475  10.740 -13.482 1.00 27.06 ? 139 HOH F O     1 
HETATM 2300 O  O     . HOH N 6 .   ? 24.428 22.387 9.078   1.00 22.33 ? 140 HOH F O     1 
HETATM 2301 O  O     . HOH N 6 .   ? 23.520 20.823 13.828  1.00 27.50 ? 141 HOH F O     1 
HETATM 2302 O  O     . HOH N 6 .   ? 24.826 21.633 5.624   1.00 24.71 ? 142 HOH F O     1 
HETATM 2303 O  O     . HOH N 6 .   ? 39.509 12.214 23.129  1.00 16.98 ? 143 HOH F O     1 
HETATM 2304 O  O     . HOH N 6 .   ? 39.262 17.682 34.126  1.00 44.82 ? 144 HOH F O     1 
HETATM 2305 O  O     . HOH N 6 .   ? 16.540 18.645 4.308   1.00 14.07 ? 145 HOH F O     1 
HETATM 2306 O  O     . HOH N 6 .   ? 20.835 9.502  19.449  1.00 33.10 ? 146 HOH F O     1 
HETATM 2307 O  O     . HOH N 6 .   ? 22.330 11.905 -3.621  1.00 38.56 ? 147 HOH F O     1 
HETATM 2308 O  O     . HOH N 6 .   ? 23.773 13.826 -2.767  1.00 31.23 ? 148 HOH F O     1 
HETATM 2309 O  O     . HOH N 6 .   ? 17.955 22.549 2.519   1.00 25.12 ? 149 HOH F O     1 
HETATM 2310 O  O     . HOH N 6 .   ? 30.339 11.957 22.218  1.00 25.62 ? 150 HOH F O     1 
HETATM 2311 O  O     . HOH N 6 .   ? 46.440 18.883 26.226  1.00 26.20 ? 151 HOH F O     1 
HETATM 2312 O  O     . HOH N 6 .   ? 15.797 18.089 -7.333  1.00 26.75 ? 152 HOH F O     1 
HETATM 2313 O  O     . HOH N 6 .   ? 41.928 8.770  17.071  1.00 34.92 ? 153 HOH F O     1 
HETATM 2314 O  O     . HOH N 6 .   ? 28.470 12.485 11.758  1.00 20.62 ? 154 HOH F O     1 
HETATM 2315 O  O     . HOH N 6 .   ? 46.776 20.777 31.216  1.00 24.84 ? 155 HOH F O     1 
HETATM 2316 O  O     . HOH N 6 .   ? 41.639 22.983 21.779  1.00 22.60 ? 156 HOH F O     1 
HETATM 2317 O  O     . HOH N 6 .   ? 16.450 15.663 14.839  1.00 36.24 ? 157 HOH F O     1 
HETATM 2318 O  O     . HOH N 6 .   ? 6.906  10.077 -5.129  1.00 49.13 ? 158 HOH F O     1 
HETATM 2319 O  O     . HOH N 6 .   ? 47.043 22.202 33.575  1.00 37.29 ? 159 HOH F O     1 
HETATM 2320 O  O     . HOH N 6 .   ? 48.390 17.134 21.376  1.00 41.12 ? 160 HOH F O     1 
HETATM 2321 O  O     . HOH N 6 .   ? 21.551 13.520 10.422  1.00 16.38 ? 161 HOH F O     1 
HETATM 2322 O  O     . HOH N 6 .   ? 25.906 20.590 2.794   1.00 39.93 ? 162 HOH F O     1 
HETATM 2323 O  O     . HOH N 6 .   ? 46.763 20.639 28.303  1.00 32.97 ? 163 HOH F O     1 
HETATM 2324 O  O     . HOH N 6 .   ? 42.192 27.830 26.368  1.00 32.97 ? 164 HOH F O     1 
HETATM 2325 O  O     . HOH N 6 .   ? 23.250 23.675 11.468  1.00 43.87 ? 165 HOH F O     1 
HETATM 2326 O  O     . HOH N 6 .   ? 37.655 10.215 22.807  1.00 24.93 ? 166 HOH F O     1 
HETATM 2327 O  O     . HOH N 6 .   ? 17.953 24.522 0.447   1.00 38.68 ? 167 HOH F O     1 
HETATM 2328 O  O     . HOH N 6 .   ? 25.345 14.878 -1.511  1.00 46.85 ? 168 HOH F O     1 
HETATM 2329 O  O     . HOH N 6 .   ? 42.286 22.406 19.293  1.00 28.92 ? 169 HOH F O     1 
HETATM 2330 O  O     . HOH N 6 .   ? 44.665 28.716 26.824  1.00 34.30 ? 170 HOH F O     1 
HETATM 2331 O  O     . HOH N 6 .   ? 17.934 15.653 -10.403 1.00 34.15 ? 171 HOH F O     1 
HETATM 2332 O  O     . HOH N 6 .   ? 46.200 12.463 20.726  1.00 29.73 ? 172 HOH F O     1 
HETATM 2333 O  O     . HOH N 6 .   ? 15.982 20.694 2.270   1.00 26.90 ? 173 HOH F O     1 
HETATM 2334 O  O     . HOH N 6 .   ? 33.021 8.208  14.585  1.00 17.61 ? 174 HOH F O     1 
HETATM 2335 O  O     . HOH N 6 .   ? 48.643 19.787 24.841  1.00 35.39 ? 175 HOH F O     1 
HETATM 2336 O  O     . HOH N 6 .   ? 17.712 12.380 -12.441 1.00 35.98 ? 176 HOH F O     1 
HETATM 2337 O  O     . HOH N 6 .   ? 38.863 23.733 21.913  1.00 31.94 ? 177 HOH F O     1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
5    N N     . SER A 5   ? 0.6672 0.8258 0.5672 -0.0107 0.0171  -0.0392 374 SER A N     
6    C CA    . SER A 5   ? 0.5387 0.6946 0.4450 0.0073  0.0267  -0.0695 374 SER A CA    
7    C C     . SER A 5   ? 0.4293 0.5247 0.3632 0.0138  0.0281  -0.0672 374 SER A C     
8    O O     . SER A 5   ? 0.4206 0.4813 0.3683 0.0123  0.0227  -0.0501 374 SER A O     
9    C CB    . SER A 5   ? 0.5710 0.7397 0.4636 0.0296  0.0180  -0.1101 374 SER A CB    
10   O OG    . SER A 5   ? 0.5978 0.7214 0.5013 0.0303  -0.0022 -0.1122 374 SER A OG    
11   N N     . LYS A 6   ? 0.3470 0.4407 0.2889 0.0235  0.0360  -0.0827 375 LYS A N     
12   C CA    . LYS A 6   ? 0.2961 0.3477 0.2573 0.0307  0.0385  -0.0800 375 LYS A CA    
13   C C     . LYS A 6   ? 0.2911 0.3398 0.2674 0.0468  0.0341  -0.1028 375 LYS A C     
14   O O     . LYS A 6   ? 0.2588 0.3345 0.2320 0.0546  0.0374  -0.1210 375 LYS A O     
15   C CB    . LYS A 6   ? 0.3243 0.3698 0.2803 0.0217  0.0449  -0.0693 375 LYS A CB    
16   C CG    . LYS A 6   ? 0.3600 0.3880 0.3069 0.0057  0.0382  -0.0452 375 LYS A CG    
17   C CD    . LYS A 6   ? 0.4026 0.4238 0.3442 -0.0103 0.0324  -0.0352 375 LYS A CD    
18   C CE    . LYS A 6   ? 0.4447 0.5336 0.3877 -0.0249 0.0368  -0.0309 375 LYS A CE    
19   N NZ    . LYS A 6   ? 0.5023 0.5922 0.4491 -0.0494 0.0246  -0.0104 375 LYS A NZ    
20   N N     . SER A 7   ? 0.2524 0.2731 0.2510 0.0516  0.0238  -0.0970 376 SER A N     
21   C CA    . SER A 7   ? 0.2591 0.2660 0.2806 0.0620  0.0084  -0.1106 376 SER A CA    
22   C C     . SER A 7   ? 0.2570 0.2526 0.3023 0.0631  0.0119  -0.0908 376 SER A C     
23   O O     . SER A 7   ? 0.2888 0.2728 0.3587 0.0685  -0.0041 -0.0943 376 SER A O     
24   C CB    . SER A 7   ? 0.2824 0.2699 0.3177 0.0600  -0.0188 -0.1129 376 SER A CB    
25   O OG    . SER A 7   ? 0.2801 0.2634 0.3358 0.0486  -0.0194 -0.0778 376 SER A OG    
26   N N     . PHE A 8   ? 0.2714 0.2705 0.3082 0.0607  0.0290  -0.0708 377 PHE A N     
27   C CA    . PHE A 8   ? 0.2494 0.2519 0.2975 0.0657  0.0352  -0.0528 377 PHE A CA    
28   C C     . PHE A 8   ? 0.3049 0.3091 0.3295 0.0675  0.0455  -0.0648 377 PHE A C     
29   O O     . PHE A 8   ? 0.3653 0.3642 0.3635 0.0632  0.0522  -0.0724 377 PHE A O     
30   C CB    . PHE A 8   ? 0.2310 0.2436 0.2798 0.0715  0.0461  -0.0284 377 PHE A CB    
31   C CG    . PHE A 8   ? 0.2335 0.2552 0.3141 0.0658  0.0338  -0.0073 377 PHE A CG    
32   C CD1   . PHE A 8   ? 0.2859 0.3260 0.4077 0.0601  0.0206  0.0227  377 PHE A CD1   
33   C CD2   . PHE A 8   ? 0.2509 0.2660 0.3241 0.0617  0.0305  -0.0107 377 PHE A CD2   
34   C CE1   . PHE A 8   ? 0.3030 0.3532 0.4607 0.0488  0.0024  0.0484  377 PHE A CE1   
35   C CE2   . PHE A 8   ? 0.2813 0.3065 0.3853 0.0535  0.0145  0.0109  377 PHE A CE2   
36   C CZ    . PHE A 8   ? 0.3048 0.3467 0.4523 0.0462  -0.0006 0.0402  377 PHE A CZ    
37   N N     . THR A 9   ? 0.3179 0.3283 0.3562 0.0703  0.0409  -0.0615 378 THR A N     
38   C CA    . THR A 9   ? 0.3386 0.3545 0.3600 0.0695  0.0450  -0.0700 378 THR A CA    
39   C C     . THR A 9   ? 0.3270 0.3514 0.3432 0.0744  0.0479  -0.0520 378 THR A C     
40   O O     . THR A 9   ? 0.3097 0.3478 0.3517 0.0766  0.0433  -0.0286 378 THR A O     
41   C CB    . THR A 9   ? 0.3594 0.3863 0.4018 0.0719  0.0348  -0.0847 378 THR A CB    
42   O OG1   . THR A 9   ? 0.3844 0.4030 0.4629 0.0778  0.0176  -0.0760 378 THR A OG1   
43   C CG2   . THR A 9   ? 0.3366 0.3745 0.3729 0.0727  0.0362  -0.1052 378 THR A CG2   
44   N N     . CYS A 10  ? 0.3162 0.3364 0.2986 0.0742  0.0517  -0.0599 379 CYS A N     
45   C CA    . CYS A 10  ? 0.3108 0.3451 0.2747 0.0820  0.0534  -0.0489 379 CYS A CA    
46   C C     . CYS A 10  ? 0.3020 0.3525 0.2878 0.0747  0.0415  -0.0414 379 CYS A C     
47   O O     . CYS A 10  ? 0.3417 0.3886 0.3297 0.0662  0.0344  -0.0551 379 CYS A O     
48   C CB    . CYS A 10  ? 0.3531 0.3632 0.2648 0.0870  0.0534  -0.0680 379 CYS A CB    
49   S SG    . CYS A 10  ? 0.3948 0.4241 0.2640 0.1019  0.0524  -0.0657 379 CYS A SG    
50   N N     . ASP A 11  ? 0.3236 0.3998 0.3312 0.0772  0.0376  -0.0134 380 ASP A N     
51   C CA    . ASP A 11  ? 0.3462 0.4353 0.3815 0.0713  0.0212  -0.0007 380 ASP A CA    
52   C C     . ASP A 11  ? 0.4034 0.5053 0.4011 0.0692  0.0189  -0.0033 380 ASP A C     
53   O O     . ASP A 11  ? 0.4535 0.5745 0.4728 0.0645  0.0046  0.0152  380 ASP A O     
54   C CB    . ASP A 11  ? 0.3539 0.4628 0.4345 0.0682  0.0083  0.0395  380 ASP A CB    
55   C CG    . ASP A 11  ? 0.3952 0.5488 0.4545 0.0716  0.0215  0.0722  380 ASP A CG    
56   O OD1   . ASP A 11  ? 0.4300 0.5959 0.4319 0.0832  0.0380  0.0566  380 ASP A OD1   
57   O OD2   . ASP A 11  ? 0.4133 0.5936 0.5144 0.0641  0.0125  0.1148  380 ASP A OD2   
58   N N     . GLN A 12  ? 0.3990 0.4853 0.3427 0.0724  0.0262  -0.0254 381 GLN A N     
59   C CA    . GLN A 12  ? 0.4380 0.5249 0.3384 0.0692  0.0155  -0.0338 381 GLN A CA    
60   C C     . GLN A 12  ? 0.4682 0.5241 0.3572 0.0538  0.0029  -0.0574 381 GLN A C     
61   O O     . GLN A 12  ? 0.5087 0.5746 0.3996 0.0403  -0.0144 -0.0544 381 GLN A O     
62   C CB    . GLN A 12  ? 0.4714 0.5634 0.3100 0.0893  0.0243  -0.0409 381 GLN A CB    
63   C CG    . GLN A 12  ? 0.4883 0.6381 0.3384 0.1018  0.0377  -0.0051 381 GLN A CG    
64   C CD    . GLN A 12  ? 0.5225 0.7132 0.3913 0.0898  0.0239  0.0277  381 GLN A CD    
65   O OE1   . GLN A 12  ? 0.5532 0.7424 0.3867 0.0853  0.0095  0.0172  381 GLN A OE1   
66   N NE2   . GLN A 12  ? 0.5008 0.7246 0.4284 0.0820  0.0220  0.0710  381 GLN A NE2   
67   N N     . CYS A 13  ? 0.4444 0.4693 0.3267 0.0523  0.0079  -0.0738 382 CYS A N     
68   C CA    . CYS A 13  ? 0.4477 0.4519 0.3274 0.0310  -0.0075 -0.0838 382 CYS A CA    
69   C C     . CYS A 13  ? 0.4196 0.4404 0.3418 0.0225  0.0017  -0.0798 382 CYS A C     
70   O O     . CYS A 13  ? 0.4432 0.4719 0.3751 0.0013  -0.0095 -0.0762 382 CYS A O     
71   C CB    . CYS A 13  ? 0.4980 0.4461 0.3242 0.0327  -0.0211 -0.1042 382 CYS A CB    
72   S SG    . CYS A 13  ? 0.4815 0.4021 0.3009 0.0531  -0.0029 -0.1128 382 CYS A SG    
73   N N     . GLY A 14  ? 0.3836 0.4155 0.3303 0.0370  0.0186  -0.0778 383 GLY A N     
74   C CA    . GLY A 14  ? 0.3542 0.4068 0.3323 0.0352  0.0258  -0.0801 383 GLY A CA    
75   C C     . GLY A 14  ? 0.3543 0.3879 0.3172 0.0283  0.0301  -0.0838 383 GLY A C     
76   O O     . GLY A 14  ? 0.3500 0.4110 0.3311 0.0255  0.0358  -0.0847 383 GLY A O     
77   N N     . LYS A 15  ? 0.3559 0.3470 0.2850 0.0293  0.0262  -0.0867 384 LYS A N     
78   C CA    . LYS A 15  ? 0.3612 0.3286 0.2806 0.0228  0.0246  -0.0861 384 LYS A CA    
79   C C     . LYS A 15  ? 0.3571 0.3348 0.2927 0.0361  0.0399  -0.0850 384 LYS A C     
80   O O     . LYS A 15  ? 0.3569 0.3416 0.3032 0.0524  0.0481  -0.0840 384 LYS A O     
81   C CB    . LYS A 15  ? 0.4313 0.3419 0.3115 0.0294  0.0111  -0.0952 384 LYS A CB    
82   C CG    . LYS A 15  ? 0.4877 0.3704 0.3489 0.0083  -0.0177 -0.0971 384 LYS A CG    
83   C CD    . LYS A 15  ? 0.5729 0.3846 0.3876 0.0241  -0.0384 -0.1178 384 LYS A CD    
84   C CE    . LYS A 15  ? 0.6486 0.4190 0.4437 -0.0014 -0.0792 -0.1212 384 LYS A CE    
85   N NZ    . LYS A 15  ? 0.7458 0.4334 0.4870 0.0218  -0.1072 -0.1528 384 LYS A NZ    
86   N N     . TYR A 16  ? 0.3267 0.3086 0.2660 0.0251  0.0391  -0.0798 385 TYR A N     
87   C CA    . TYR A 16  ? 0.2790 0.2719 0.2309 0.0330  0.0474  -0.0791 385 TYR A CA    
88   C C     . TYR A 16  ? 0.2960 0.2547 0.2365 0.0398  0.0461  -0.0726 385 TYR A C     
89   O O     . TYR A 16  ? 0.3127 0.2369 0.2350 0.0353  0.0351  -0.0704 385 TYR A O     
90   C CB    . TYR A 16  ? 0.2554 0.2893 0.2143 0.0200  0.0479  -0.0769 385 TYR A CB    
91   C CG    . TYR A 16  ? 0.2599 0.3380 0.2358 0.0294  0.0527  -0.0906 385 TYR A CG    
92   C CD1   . TYR A 16  ? 0.2357 0.3241 0.2209 0.0462  0.0530  -0.1069 385 TYR A CD1   
93   C CD2   . TYR A 16  ? 0.2396 0.3456 0.2237 0.0240  0.0517  -0.0887 385 TYR A CD2   
94   C CE1   . TYR A 16  ? 0.2374 0.3552 0.2372 0.0631  0.0516  -0.1255 385 TYR A CE1   
95   C CE2   . TYR A 16  ? 0.2314 0.3809 0.2355 0.0405  0.0555  -0.1028 385 TYR A CE2   
96   C CZ    . TYR A 16  ? 0.2560 0.4086 0.2666 0.0635  0.0556  -0.1247 385 TYR A CZ    
97   O OH    . TYR A 16  ? 0.2618 0.4356 0.2896 0.0819  0.0498  -0.1356 385 TYR A OH    
98   N N     . PHE A 17  ? 0.2637 0.2302 0.2193 0.0514  0.0523  -0.0688 386 PHE A N     
99   C CA    . PHE A 17  ? 0.2922 0.2410 0.2469 0.0620  0.0527  -0.0589 386 PHE A CA    
100  C C     . PHE A 17  ? 0.3083 0.2776 0.2842 0.0578  0.0510  -0.0502 386 PHE A C     
101  O O     . PHE A 17  ? 0.2820 0.2692 0.2743 0.0560  0.0487  -0.0548 386 PHE A O     
102  C CB    . PHE A 17  ? 0.3109 0.2577 0.2627 0.0877  0.0617  -0.0573 386 PHE A CB    
103  C CG    . PHE A 17  ? 0.3363 0.2613 0.2574 0.0953  0.0592  -0.0721 386 PHE A CG    
104  C CD1   . PHE A 17  ? 0.3985 0.2776 0.2912 0.1045  0.0472  -0.0836 386 PHE A CD1   
105  C CD2   . PHE A 17  ? 0.3115 0.2553 0.2321 0.0927  0.0619  -0.0751 386 PHE A CD2   
106  C CE1   . PHE A 17  ? 0.4416 0.2913 0.3004 0.1108  0.0364  -0.1021 386 PHE A CE1   
107  C CE2   . PHE A 17  ? 0.3462 0.2711 0.2346 0.0974  0.0553  -0.0888 386 PHE A CE2   
108  C CZ    . PHE A 17  ? 0.4135 0.2905 0.2692 0.1055  0.0414  -0.1040 386 PHE A CZ    
109  N N     . SER A 18  ? 0.3226 0.2830 0.2984 0.0566  0.0461  -0.0382 387 SER A N     
110  C CA    . SER A 18  ? 0.3436 0.3228 0.3353 0.0497  0.0393  -0.0286 387 SER A CA    
111  C C     . SER A 18  ? 0.3299 0.3210 0.3514 0.0627  0.0404  -0.0128 387 SER A C     
112  O O     . SER A 18  ? 0.3230 0.3278 0.3633 0.0534  0.0279  -0.0063 387 SER A O     
113  C CB    . SER A 18  ? 0.4045 0.3773 0.3875 0.0387  0.0300  -0.0146 387 SER A CB    
114  O OG    . SER A 18  ? 0.4744 0.4194 0.4615 0.0553  0.0293  -0.0036 387 SER A OG    
115  N N     A GLN A 19  ? 0.3278 0.3204 0.3537 0.0843  0.0524  -0.0050 388 GLN A N     
116  N N     B GLN A 19  ? 0.3278 0.3203 0.3535 0.0843  0.0524  -0.0052 388 GLN A N     
117  C CA    A GLN A 19  ? 0.3141 0.3422 0.3743 0.0973  0.0569  0.0206  388 GLN A CA    
118  C CA    B GLN A 19  ? 0.3145 0.3423 0.3741 0.0978  0.0573  0.0203  388 GLN A CA    
119  C C     A GLN A 19  ? 0.3000 0.3507 0.3616 0.1110  0.0702  0.0237  388 GLN A C     
120  C C     B GLN A 19  ? 0.2997 0.3500 0.3611 0.1105  0.0700  0.0234  388 GLN A C     
121  O O     A GLN A 19  ? 0.3132 0.3448 0.3414 0.1217  0.0783  0.0030  388 GLN A O     
122  O O     B GLN A 19  ? 0.3155 0.3467 0.3441 0.1200  0.0777  0.0026  388 GLN A O     
123  C CB    A GLN A 19  ? 0.3450 0.3809 0.4129 0.1202  0.0622  0.0352  388 GLN A CB    
124  C CB    B GLN A 19  ? 0.3463 0.3798 0.4106 0.1225  0.0636  0.0329  388 GLN A CB    
125  C CG    A GLN A 19  ? 0.3638 0.3793 0.4311 0.1055  0.0464  0.0393  388 GLN A CG    
126  C CG    B GLN A 19  ? 0.3672 0.3786 0.4303 0.1094  0.0482  0.0367  388 GLN A CG    
127  C CD    A GLN A 19  ? 0.3613 0.3975 0.4524 0.0791  0.0292  0.0535  388 GLN A CD    
128  C CD    B GLN A 19  ? 0.4020 0.4031 0.4682 0.1390  0.0498  0.0439  388 GLN A CD    
129  O OE1   A GLN A 19  ? 0.3602 0.4256 0.4834 0.0747  0.0250  0.0702  388 GLN A OE1   
130  O OE1   B GLN A 19  ? 0.4166 0.4239 0.4769 0.1756  0.0640  0.0368  388 GLN A OE1   
131  N NE2   A GLN A 19  ? 0.3905 0.4126 0.4651 0.0598  0.0145  0.0491  388 GLN A NE2   
132  N NE2   B GLN A 19  ? 0.4174 0.4044 0.4906 0.1271  0.0332  0.0569  388 GLN A NE2   
133  N N     . LYS A 20  ? 0.3074 0.3660 0.3690 0.1220  -0.0267 -0.0339 389 LYS A N     
134  C CA    . LYS A 20  ? 0.2887 0.3478 0.3904 0.1020  0.0003  -0.0273 389 LYS A CA    
135  C C     . LYS A 20  ? 0.2749 0.3183 0.3664 0.1117  0.0235  -0.0114 389 LYS A C     
136  O O     . LYS A 20  ? 0.2927 0.3136 0.3660 0.0995  0.0476  -0.0005 389 LYS A O     
137  C CB    . LYS A 20  ? 0.3001 0.4025 0.4920 0.0904  -0.0053 -0.0428 389 LYS A CB    
138  C CG    . LYS A 20  ? 0.3129 0.4089 0.5381 0.0700  0.0270  -0.0274 389 LYS A CG    
139  C CD    . LYS A 20  ? 0.3188 0.4513 0.6420 0.0533  0.0268  -0.0386 389 LYS A CD    
140  C CE    . LYS A 20  ? 0.3197 0.4479 0.6632 0.0401  0.0029  -0.0586 389 LYS A CE    
141  N NZ    . LYS A 20  ? 0.3086 0.4616 0.7561 0.0188  0.0038  -0.0699 389 LYS A NZ    
142  N N     . ARG A 21  ? 0.2725 0.3268 0.3731 0.1376  0.0135  -0.0132 390 ARG A N     
143  C CA    . ARG A 21  ? 0.3096 0.3478 0.4020 0.1520  0.0351  -0.0049 390 ARG A CA    
144  C C     . ARG A 21  ? 0.3414 0.3167 0.3535 0.1500  0.0451  0.0075  390 ARG A C     
145  O O     . ARG A 21  ? 0.3710 0.3256 0.3680 0.1510  0.0678  0.0097  390 ARG A O     
146  C CB    . ARG A 21  ? 0.3492 0.4121 0.4760 0.1861  0.0162  -0.0129 390 ARG A CB    
147  C CG    . ARG A 21  ? 0.4235 0.4525 0.4906 0.2085  -0.0167 -0.0063 390 ARG A CG    
148  C CD    . ARG A 21  ? 0.4973 0.5482 0.5990 0.2474  -0.0428 -0.0132 390 ARG A CD    
149  N NE    . ARG A 21  ? 0.5041 0.6285 0.6914 0.2456  -0.0646 -0.0354 390 ARG A NE    
150  C CZ    . ARG A 21  ? 0.5417 0.6841 0.7200 0.2495  -0.1034 -0.0459 390 ARG A CZ    
151  N NH1   . ARG A 21  ? 0.5780 0.6728 0.6600 0.2588  -0.1207 -0.0326 390 ARG A NH1   
152  N NH2   . ARG A 21  ? 0.5486 0.7540 0.8092 0.2424  -0.1220 -0.0704 390 ARG A NH2   
153  N N     . GLN A 22  ? 0.3471 0.2929 0.3089 0.1458  0.0303  0.0131  391 GLN A N     
154  C CA    . GLN A 22  ? 0.3754 0.2652 0.2774 0.1363  0.0424  0.0230  391 GLN A CA    
155  C C     . GLN A 22  ? 0.3485 0.2375 0.2501 0.1099  0.0580  0.0187  391 GLN A C     
156  O O     . GLN A 22  ? 0.3589 0.2152 0.2350 0.1049  0.0701  0.0183  391 GLN A O     
157  C CB    . GLN A 22  ? 0.4061 0.2696 0.2585 0.1352  0.0306  0.0329  391 GLN A CB    
158  C CG    . GLN A 22  ? 0.4441 0.2952 0.2765 0.1672  0.0091  0.0429  391 GLN A CG    
159  C CD    . GLN A 22  ? 0.5172 0.3435 0.2847 0.1664  0.0005  0.0571  391 GLN A CD    
160  O OE1   . GLN A 22  ? 0.4988 0.3465 0.2581 0.1461  0.0049  0.0491  391 GLN A OE1   
161  N NE2   . GLN A 22  ? 0.5711 0.3489 0.2883 0.1909  -0.0100 0.0791  391 GLN A NE2   
162  N N     . LEU A 23  ? 0.2954 0.2178 0.2263 0.0956  0.0533  0.0129  392 LEU A N     
163  C CA    . LEU A 23  ? 0.3009 0.2209 0.2333 0.0770  0.0619  0.0110  392 LEU A CA    
164  C C     . LEU A 23  ? 0.3331 0.2533 0.2716 0.0810  0.0785  0.0157  392 LEU A C     
165  O O     . LEU A 23  ? 0.3650 0.2632 0.2729 0.0756  0.0846  0.0158  392 LEU A O     
166  C CB    . LEU A 23  ? 0.2526 0.2011 0.2201 0.0656  0.0512  0.0036  392 LEU A CB    
167  C CG    . LEU A 23  ? 0.2607 0.2057 0.2390 0.0527  0.0546  0.0049  392 LEU A CG    
168  C CD1   . LEU A 23  ? 0.2812 0.2038 0.2252 0.0456  0.0538  0.0008  392 LEU A CD1   
169  C CD2   . LEU A 23  ? 0.2473 0.2136 0.2705 0.0452  0.0423  -0.0046 392 LEU A CD2   
170  N N     . LYS A 24  ? 0.3405 0.2892 0.3184 0.0912  0.0863  0.0174  393 LYS A N     
171  C CA    . LYS A 24  ? 0.3553 0.3093 0.3362 0.0945  0.1119  0.0232  393 LYS A CA    
172  C C     . LYS A 24  ? 0.3874 0.3101 0.3199 0.1101  0.1222  0.0176  393 LYS A C     
173  O O     . LYS A 24  ? 0.4091 0.3176 0.3055 0.1102  0.1383  0.0185  393 LYS A O     
174  C CB    . LYS A 24  ? 0.3686 0.3697 0.4193 0.0997  0.1229  0.0225  393 LYS A CB    
175  C CG    . LYS A 24  ? 0.4242 0.4380 0.4813 0.1013  0.1605  0.0304  393 LYS A CG    
176  C CD    . LYS A 24  ? 0.4314 0.5013 0.5801 0.0973  0.1757  0.0290  393 LYS A CD    
177  C CE    . LYS A 24  ? 0.4762 0.5590 0.6262 0.0929  0.2206  0.0402  393 LYS A CE    
178  N NZ    . LYS A 24  ? 0.4901 0.6268 0.7366 0.0778  0.2345  0.0388  393 LYS A NZ    
179  N N     . SER A 25  ? 0.3978 0.3038 0.3237 0.1252  0.1111  0.0112  394 SER A N     
180  C CA    . SER A 25  ? 0.4276 0.2936 0.3140 0.1401  0.1180  0.0018  394 SER A CA    
181  C C     . SER A 25  ? 0.4406 0.2661 0.2788 0.1233  0.1115  -0.0035 394 SER A C     
182  O O     . SER A 25  ? 0.4767 0.2840 0.2858 0.1248  0.1156  -0.0149 394 SER A O     
183  C CB    . SER A 25  ? 0.4690 0.3169 0.3623 0.1592  0.1033  0.0015  394 SER A CB    
184  O OG    . SER A 25  ? 0.5193 0.3300 0.3880 0.1668  0.1045  -0.0085 394 SER A OG    
185  N N     . HIS A 26  ? 0.4325 0.2546 0.2713 0.1037  0.0965  0.0017  395 HIS A N     
186  C CA    . HIS A 26  ? 0.4607 0.2573 0.2740 0.0860  0.0892  -0.0076 395 HIS A CA    
187  C C     . HIS A 26  ? 0.4736 0.2841 0.2740 0.0815  0.0887  -0.0112 395 HIS A C     
188  O O     . HIS A 26  ? 0.5188 0.3079 0.2898 0.0789  0.0814  -0.0265 395 HIS A O     
189  C CB    . HIS A 26  ? 0.4677 0.2685 0.2938 0.0673  0.0798  -0.0029 395 HIS A CB    
190  C CG    . HIS A 26  ? 0.4805 0.2840 0.3086 0.0475  0.0719  -0.0146 395 HIS A CG    
191  N ND1   . HIS A 26  ? 0.5142 0.2883 0.3331 0.0354  0.0692  -0.0297 395 HIS A ND1   
192  C CD2   . HIS A 26  ? 0.4599 0.2932 0.3073 0.0394  0.0628  -0.0167 395 HIS A CD2   
193  C CE1   . HIS A 26  ? 0.5003 0.2949 0.3369 0.0213  0.0575  -0.0424 395 HIS A CE1   
194  N NE2   . HIS A 26  ? 0.5080 0.3363 0.3591 0.0260  0.0530  -0.0335 395 HIS A NE2   
195  N N     . TYR A 27  ? 0.4264 0.2686 0.2477 0.0812  0.0936  0.0027  396 TYR A N     
196  C CA    . TYR A 27  ? 0.4217 0.2671 0.2235 0.0784  0.0921  0.0086  396 TYR A CA    
197  C C     . TYR A 27  ? 0.4820 0.3106 0.2300 0.0932  0.1050  0.0035  396 TYR A C     
198  O O     . TYR A 27  ? 0.5476 0.3678 0.2558 0.0951  0.0987  0.0076  396 TYR A O     
199  C CB    . TYR A 27  ? 0.4089 0.2809 0.2488 0.0736  0.1002  0.0282  396 TYR A CB    
200  C CG    . TYR A 27  ? 0.4304 0.2970 0.2655 0.0663  0.0869  0.0381  396 TYR A CG    
201  C CD1   . TYR A 27  ? 0.4293 0.3002 0.2902 0.0571  0.0632  0.0283  396 TYR A CD1   
202  C CD2   . TYR A 27  ? 0.4820 0.3372 0.2852 0.0711  0.0996  0.0587  396 TYR A CD2   
203  C CE1   . TYR A 27  ? 0.4339 0.2983 0.2979 0.0563  0.0467  0.0350  396 TYR A CE1   
204  C CE2   . TYR A 27  ? 0.5054 0.3453 0.2999 0.0692  0.0829  0.0724  396 TYR A CE2   
205  C CZ    . TYR A 27  ? 0.4873 0.3320 0.3169 0.0635  0.0535  0.0587  396 TYR A CZ    
206  O OH    . TYR A 27  ? 0.5298 0.3580 0.3582 0.0673  0.0327  0.0697  396 TYR A OH    
207  N N     . ARG A 28  ? 0.4591 0.2830 0.2047 0.1058  0.1187  -0.0062 397 ARG A N     
208  C CA    . ARG A 28  ? 0.5073 0.3250 0.2155 0.1163  0.1248  -0.0162 397 ARG A CA    
209  C C     . ARG A 28  ? 0.5438 0.3336 0.2095 0.1144  0.1002  -0.0387 397 ARG A C     
210  O O     . ARG A 28  ? 0.5977 0.3849 0.2183 0.1225  0.0983  -0.0455 397 ARG A O     
211  C CB    . ARG A 28  ? 0.5187 0.3404 0.2489 0.1294  0.1373  -0.0272 397 ARG A CB    
212  C CG    . ARG A 28  ? 0.4962 0.3551 0.2779 0.1345  0.1582  -0.0125 397 ARG A CG    
213  C CD    . ARG A 28  ? 0.5361 0.3983 0.3415 0.1526  0.1637  -0.0282 397 ARG A CD    
214  N NE    . ARG A 28  ? 0.5939 0.4282 0.4126 0.1559  0.1431  -0.0322 397 ARG A NE    
215  C CZ    . ARG A 28  ? 0.6668 0.4781 0.4898 0.1715  0.1378  -0.0469 397 ARG A CZ    
216  N NH1   . ARG A 28  ? 0.7098 0.5285 0.5300 0.1867  0.1513  -0.0661 397 ARG A NH1   
217  N NH2   . ARG A 28  ? 0.6901 0.4677 0.5184 0.1726  0.1202  -0.0421 397 ARG A NH2   
218  N N     . VAL A 29  ? 0.5424 0.3133 0.2246 0.1028  0.0813  -0.0524 398 VAL A N     
219  C CA    . VAL A 29  ? 0.6080 0.3587 0.2699 0.0968  0.0558  -0.0805 398 VAL A CA    
220  C C     . VAL A 29  ? 0.6066 0.3656 0.2353 0.0984  0.0351  -0.0800 398 VAL A C     
221  O O     . VAL A 29  ? 0.6423 0.3949 0.2469 0.1006  0.0101  -0.1045 398 VAL A O     
222  C CB    . VAL A 29  ? 0.6077 0.3377 0.3085 0.0776  0.0462  -0.0936 398 VAL A CB    
223  C CG1   . VAL A 29  ? 0.6012 0.3142 0.3239 0.0814  0.0637  -0.0847 398 VAL A CG1   
224  C CG2   . VAL A 29  ? 0.5543 0.3059 0.2880 0.0610  0.0388  -0.0806 398 VAL A CG2   
225  N N     . HIS A 30  ? 0.5770 0.3511 0.2095 0.0983  0.0408  -0.0526 399 HIS A N     
226  C CA    . HIS A 30  ? 0.6131 0.3918 0.2193 0.1030  0.0167  -0.0445 399 HIS A CA    
227  C C     . HIS A 30  ? 0.6759 0.4499 0.2216 0.1198  0.0329  -0.0211 399 HIS A C     
228  O O     . HIS A 30  ? 0.7427 0.5093 0.2418 0.1308  0.0094  -0.0222 399 HIS A O     
229  C CB    . HIS A 30  ? 0.5838 0.3840 0.2509 0.0896  0.0100  -0.0249 399 HIS A CB    
230  C CG    . HIS A 30  ? 0.6075 0.4221 0.3401 0.0701  0.0017  -0.0431 399 HIS A CG    
231  N ND1   . HIS A 30  ? 0.6368 0.4546 0.3883 0.0614  -0.0243 -0.0735 399 HIS A ND1   
232  C CD2   . HIS A 30  ? 0.5776 0.4058 0.3588 0.0573  0.0180  -0.0352 399 HIS A CD2   
233  C CE1   . HIS A 30  ? 0.5950 0.4265 0.4037 0.0414  -0.0161 -0.0795 399 HIS A CE1   
234  N NE2   . HIS A 30  ? 0.5844 0.4199 0.4028 0.0408  0.0080  -0.0558 399 HIS A NE2   
235  N N     . THR A 31  ? 0.4645 0.2391 0.4977 0.0358  0.0922  -0.0214 400 THR A N     
236  C CA    . THR A 31  ? 0.4941 0.2371 0.5258 0.0214  0.1034  -0.0128 400 THR A CA    
237  C C     . THR A 31  ? 0.4771 0.2579 0.5120 0.0117  0.0900  -0.0005 400 THR A C     
238  O O     . THR A 31  ? 0.5017 0.2559 0.5262 0.0097  0.1012  0.0175  400 THR A O     
239  C CB    . THR A 31  ? 0.5228 0.2360 0.5629 -0.0074 0.1172  -0.0451 400 THR A CB    
240  O OG1   . THR A 31  ? 0.4923 0.2567 0.5449 -0.0259 0.0968  -0.0708 400 THR A OG1   
241  C CG2   . THR A 31  ? 0.5647 0.2385 0.5975 0.0004  0.1307  -0.0628 400 THR A CG2   
242  N N     . GLY A 32  ? 0.4252 0.2604 0.4689 0.0076  0.0702  -0.0087 401 GLY A N     
243  C CA    . GLY A 32  ? 0.4033 0.2720 0.4518 -0.0033 0.0599  -0.0021 401 GLY A CA    
244  C C     . GLY A 32  ? 0.4024 0.2748 0.4660 -0.0313 0.0643  -0.0223 401 GLY A C     
245  O O     . GLY A 32  ? 0.3842 0.2888 0.4560 -0.0399 0.0567  -0.0205 401 GLY A O     
246  N N     . HIS A 33  ? 0.4164 0.2591 0.4901 -0.0462 0.0771  -0.0450 402 HIS A N     
247  C CA    . HIS A 33  ? 0.4302 0.2846 0.5343 -0.0754 0.0811  -0.0714 402 HIS A CA    
248  C C     . HIS A 33  ? 0.3757 0.2925 0.4923 -0.0763 0.0531  -0.0906 402 HIS A C     
249  O O     . HIS A 33  ? 0.3636 0.2957 0.4640 -0.0618 0.0365  -0.1011 402 HIS A O     
250  C CB    . HIS A 33  ? 0.5079 0.3232 0.6269 -0.0919 0.0973  -0.1009 402 HIS A CB    
251  C CG    . HIS A 33  ? 0.6298 0.3830 0.7306 -0.0853 0.1267  -0.0780 402 HIS A CG    
252  N ND1   . HIS A 33  ? 0.6633 0.3898 0.7386 -0.0699 0.1394  -0.0390 402 HIS A ND1   
253  C CD2   . HIS A 33  ? 0.6968 0.4126 0.7962 -0.0880 0.1438  -0.0881 402 HIS A CD2   
254  C CE1   . HIS A 33  ? 0.7147 0.3912 0.7714 -0.0607 0.1618  -0.0256 402 HIS A CE1   
255  N NE2   . HIS A 33  ? 0.7426 0.4099 0.8166 -0.0732 0.1674  -0.0544 402 HIS A NE2   
256  N N     . SER A 34  ? 0.3504 0.2988 0.4916 -0.0900 0.0509  -0.0932 403 SER A N     
257  C CA    . SER A 34  ? 0.3157 0.3218 0.4729 -0.0886 0.0260  -0.1112 403 SER A CA    
258  C C     . SER A 34  ? 0.2849 0.3125 0.4101 -0.0624 0.0092  -0.0913 403 SER A C     
259  O O     . SER A 34  ? 0.3091 0.3716 0.4314 -0.0519 -0.0109 -0.1039 403 SER A O     
260  C CB    . SER A 34  ? 0.3531 0.3792 0.5302 -0.0964 0.0102  -0.1531 403 SER A CB    
261  O OG    . SER A 34  ? 0.4075 0.4189 0.6118 -0.1147 0.0286  -0.1634 403 SER A OG    
262  N N     . LEU A 35  ? 0.2238 0.2307 0.3262 -0.0501 0.0179  -0.0617 404 LEU A N     
263  C CA    . LEU A 35  ? 0.2141 0.2418 0.2996 -0.0316 0.0085  -0.0457 404 LEU A CA    
264  C C     . LEU A 35  ? 0.1932 0.2472 0.2908 -0.0368 0.0066  -0.0377 404 LEU A C     
265  O O     . LEU A 35  ? 0.2320 0.2817 0.3447 -0.0523 0.0164  -0.0372 404 LEU A O     
266  C CB    . LEU A 35  ? 0.2091 0.2152 0.2803 -0.0185 0.0163  -0.0240 404 LEU A CB    
267  C CG    . LEU A 35  ? 0.2296 0.2139 0.2882 -0.0056 0.0205  -0.0284 404 LEU A CG    
268  C CD1   . LEU A 35  ? 0.2035 0.1810 0.2623 0.0099  0.0259  -0.0080 404 LEU A CD1   
269  C CD2   . LEU A 35  ? 0.2337 0.2328 0.2766 0.0046  0.0131  -0.0415 404 LEU A CD2   
270  N N     . PRO A 36  ? 0.1546 0.2302 0.2441 -0.0239 -0.0010 -0.0315 405 PRO A N     
271  C CA    . PRO A 36  ? 0.1536 0.2486 0.2530 -0.0274 0.0003  -0.0241 405 PRO A CA    
272  C C     . PRO A 36  ? 0.1550 0.2346 0.2510 -0.0350 0.0106  -0.0090 405 PRO A C     
273  O O     . PRO A 36  ? 0.1555 0.2230 0.2390 -0.0269 0.0109  0.0027  405 PRO A O     
274  C CB    . PRO A 36  ? 0.1887 0.2922 0.2738 -0.0102 -0.0022 -0.0164 405 PRO A CB    
275  C CG    . PRO A 36  ? 0.1860 0.2844 0.2530 0.0031  -0.0087 -0.0259 405 PRO A CG    
276  C CD    . PRO A 36  ? 0.1907 0.2683 0.2589 -0.0051 -0.0062 -0.0325 405 PRO A CD    
277  N N     . GLU A 37  ? 0.1544 0.2360 0.2612 -0.0483 0.0191  -0.0107 406 GLU A N     
278  C CA    . GLU A 37  ? 0.1525 0.2113 0.2424 -0.0530 0.0313  0.0034  406 GLU A CA    
279  C C     . GLU A 37  ? 0.1550 0.2292 0.2425 -0.0544 0.0342  0.0064  406 GLU A C     
280  O O     . GLU A 37  ? 0.1623 0.2558 0.2713 -0.0598 0.0375  -0.0032 406 GLU A O     
281  C CB    . GLU A 37  ? 0.1955 0.2288 0.2927 -0.0684 0.0501  -0.0003 406 GLU A CB    
282  C CG    . GLU A 37  ? 0.2341 0.2335 0.3005 -0.0698 0.0689  0.0175  406 GLU A CG    
283  C CD    . GLU A 37  ? 0.3176 0.2793 0.3903 -0.0855 0.0975  0.0163  406 GLU A CD    
284  O OE1   . GLU A 37  ? 0.3484 0.3059 0.4454 -0.0926 0.0972  0.0015  406 GLU A OE1   
285  O OE2   . GLU A 37  ? 0.3342 0.2708 0.3819 -0.0855 0.1158  0.0274  406 GLU A OE2   
286  N N     . CYS A 38  ? 0.1290 0.1958 0.1915 -0.0469 0.0308  0.0172  407 CYS A N     
287  C CA    . CYS A 38  ? 0.1633 0.2389 0.2178 -0.0489 0.0345  0.0166  407 CYS A CA    
288  C C     . CYS A 38  ? 0.1634 0.2217 0.2070 -0.0592 0.0553  0.0189  407 CYS A C     
289  O O     . CYS A 38  ? 0.1857 0.2121 0.2050 -0.0599 0.0661  0.0290  407 CYS A O     
290  C CB    . CYS A 38  ? 0.1604 0.2344 0.1915 -0.0392 0.0224  0.0212  407 CYS A CB    
291  S SG    . CYS A 38  ? 0.1630 0.2431 0.1770 -0.0422 0.0251  0.0141  407 CYS A SG    
292  N N     . SER A 39  ? 0.1515 0.2252 0.2119 -0.0642 0.0642  0.0111  408 SER A N     
293  C CA    . SER A 39  ? 0.1768 0.2334 0.2303 -0.0695 0.0836  0.0125  408 SER A CA    
294  C C     . SER A 39  ? 0.2351 0.2641 0.2349 -0.0692 0.0982  0.0224  408 SER A C     
295  O O     . SER A 39  ? 0.2647 0.2674 0.2451 -0.0706 0.1176  0.0278  408 SER A O     
296  C CB    . SER A 39  ? 0.1821 0.2612 0.2662 -0.0665 0.0819  0.0021  408 SER A CB    
297  O OG    . SER A 39  ? 0.1857 0.2736 0.2627 -0.0590 0.0766  0.0006  408 SER A OG    
298  N N     . HIS A 40  ? 0.2039 0.2379 0.1774 -0.0594 0.0789  0.0227  409 HIS A N     
299  C CA    A HIS A 40  ? 0.2661 0.2779 0.1808 -0.0509 0.0790  0.0270  409 HIS A CA    
300  C CA    B HIS A 40  ? 0.2661 0.2777 0.1807 -0.0510 0.0793  0.0271  409 HIS A CA    
301  C C     . HIS A 40  ? 0.3146 0.2952 0.1819 -0.0364 0.0718  0.0437  409 HIS A C     
302  O O     . HIS A 40  ? 0.3864 0.3263 0.1994 -0.0306 0.0913  0.0568  409 HIS A O     
303  C CB    A HIS A 40  ? 0.2580 0.2951 0.1762 -0.0468 0.0573  0.0123  409 HIS A CB    
304  C CB    B HIS A 40  ? 0.2596 0.2957 0.1764 -0.0470 0.0585  0.0123  409 HIS A CB    
305  C CG    A HIS A 40  ? 0.3257 0.3478 0.1866 -0.0395 0.0539  0.0070  409 HIS A CG    
306  C CG    B HIS A 40  ? 0.2595 0.3140 0.2123 -0.0563 0.0705  -0.0007 409 HIS A CG    
307  N ND1   A HIS A 40  ? 0.3842 0.3897 0.1904 -0.0223 0.0366  0.0148  409 HIS A ND1   
308  N ND1   B HIS A 40  ? 0.3114 0.3545 0.2520 -0.0615 0.0955  -0.0045 409 HIS A ND1   
309  C CD2   A HIS A 40  ? 0.3563 0.3771 0.2019 -0.0439 0.0637  -0.0072 409 HIS A CD2   
310  C CD2   B HIS A 40  ? 0.2366 0.3151 0.2339 -0.0577 0.0643  -0.0088 409 HIS A CD2   
311  C CE1   A HIS A 40  ? 0.4377 0.4343 0.1931 -0.0162 0.0329  0.0041  409 HIS A CE1   
312  C CE1   B HIS A 40  ? 0.2739 0.3355 0.2545 -0.0632 0.0995  -0.0146 409 HIS A CE1   
313  N NE2   A HIS A 40  ? 0.4187 0.4228 0.1976 -0.0311 0.0509  -0.0104 409 HIS A NE2   
314  N NE2   B HIS A 40  ? 0.2342 0.3156 0.2452 -0.0612 0.0828  -0.0163 409 HIS A NE2   
315  N N     . CYS A 41  ? 0.2819 0.2770 0.1658 -0.0273 0.0470  0.0449  410 CYS A N     
316  C CA    . CYS A 41  ? 0.3239 0.2930 0.1672 -0.0073 0.0365  0.0608  410 CYS A CA    
317  C C     . CYS A 41  ? 0.3571 0.3038 0.2192 -0.0094 0.0490  0.0720  410 CYS A C     
318  O O     . CYS A 41  ? 0.3735 0.2860 0.1979 0.0090  0.0488  0.0891  410 CYS A O     
319  C CB    . CYS A 41  ? 0.3103 0.3135 0.1613 0.0083  -0.0005 0.0517  410 CYS A CB    
320  S SG    . CYS A 41  ? 0.2648 0.3089 0.1934 -0.0006 -0.0118 0.0393  410 CYS A SG    
321  N N     . HIS A 42  ? 0.2954 0.2595 0.2121 -0.0284 0.0584  0.0611  411 HIS A N     
322  C CA    . HIS A 42  ? 0.3126 0.2570 0.2516 -0.0350 0.0710  0.0634  411 HIS A CA    
323  C C     . HIS A 42  ? 0.3149 0.2610 0.2588 -0.0191 0.0512  0.0670  411 HIS A C     
324  O O     . HIS A 42  ? 0.3187 0.2355 0.2665 -0.0196 0.0628  0.0713  411 HIS A O     
325  C CB    . HIS A 42  ? 0.3872 0.2773 0.2981 -0.0410 0.1066  0.0766  411 HIS A CB    
326  C CG    . HIS A 42  ? 0.4308 0.3271 0.3563 -0.0589 0.1294  0.0675  411 HIS A CG    
327  N ND1   . HIS A 42  ? 0.4102 0.3440 0.4001 -0.0762 0.1286  0.0448  411 HIS A ND1   
328  C CD2   . HIS A 42  ? 0.4947 0.3746 0.3836 -0.0543 0.1422  0.0729  411 HIS A CD2   
329  C CE1   . HIS A 42  ? 0.4377 0.3765 0.4333 -0.0811 0.1417  0.0389  411 HIS A CE1   
330  N NE2   . HIS A 42  ? 0.4870 0.3918 0.4234 -0.0704 0.1532  0.0552  411 HIS A NE2   
331  N N     . ARG A 43  ? 0.2740 0.2532 0.2233 -0.0064 0.0248  0.0629  412 ARG A N     
332  C CA    . ARG A 43  ? 0.2845 0.2759 0.2557 0.0057  0.0099  0.0615  412 ARG A CA    
333  C C     . ARG A 43  ? 0.2485 0.2632 0.2626 -0.0079 0.0117  0.0464  412 ARG A C     
334  O O     . ARG A 43  ? 0.2371 0.2705 0.2665 -0.0213 0.0154  0.0365  412 ARG A O     
335  C CB    . ARG A 43  ? 0.2822 0.3046 0.2542 0.0229  -0.0158 0.0588  412 ARG A CB    
336  C CG    . ARG A 43  ? 0.3882 0.3920 0.3078 0.0438  -0.0258 0.0716  412 ARG A CG    
337  C CD    . ARG A 43  ? 0.4263 0.4669 0.3580 0.0664  -0.0577 0.0652  412 ARG A CD    
338  N NE    . ARG A 43  ? 0.4163 0.5058 0.3846 0.0537  -0.0715 0.0417  412 ARG A NE    
339  C CZ    . ARG A 43  ? 0.4685 0.5694 0.4120 0.0521  -0.0825 0.0314  412 ARG A CZ    
340  N NH1   . ARG A 43  ? 0.5106 0.5770 0.3852 0.0650  -0.0813 0.0448  412 ARG A NH1   
341  N NH2   . ARG A 43  ? 0.4438 0.5843 0.4277 0.0378  -0.0906 0.0071  412 ARG A NH2   
342  N N     . LYS A 44  ? 0.2213 0.2320 0.2495 -0.0004 0.0095  0.0451  413 LYS A N     
343  C CA    . LYS A 44  ? 0.1881 0.2103 0.2406 -0.0084 0.0122  0.0316  413 LYS A CA    
344  C C     . LYS A 44  ? 0.1743 0.2197 0.2443 0.0026  0.0044  0.0281  413 LYS A C     
345  O O     . LYS A 44  ? 0.1771 0.2298 0.2528 0.0159  -0.0028 0.0334  413 LYS A O     
346  C CB    . LYS A 44  ? 0.2374 0.2279 0.2885 -0.0124 0.0233  0.0276  413 LYS A CB    
347  C CG    . LYS A 44  ? 0.2982 0.2620 0.3420 -0.0277 0.0400  0.0287  413 LYS A CG    
348  C CD    . LYS A 44  ? 0.3710 0.3049 0.4247 -0.0375 0.0536  0.0170  413 LYS A CD    
349  C CE    . LYS A 44  ? 0.4011 0.3053 0.4579 -0.0569 0.0784  0.0159  413 LYS A CE    
350  N NZ    . LYS A 44  ? 0.4291 0.3057 0.5066 -0.0719 0.0935  -0.0031 413 LYS A NZ    
351  N N     . PHE A 45  ? 0.1503 0.2080 0.2299 -0.0013 0.0071  0.0184  414 PHE A N     
352  C CA    . PHE A 45  ? 0.1599 0.2320 0.2527 0.0072  0.0098  0.0164  414 PHE A CA    
353  C C     . PHE A 45  ? 0.1745 0.2359 0.2563 0.0120  0.0160  0.0091  414 PHE A C     
354  O O     . PHE A 45  ? 0.1849 0.2394 0.2554 0.0064  0.0123  0.0007  414 PHE A O     
355  C CB    . PHE A 45  ? 0.1491 0.2418 0.2525 0.0020  0.0107  0.0153  414 PHE A CB    
356  C CG    . PHE A 45  ? 0.1537 0.2578 0.2617 -0.0015 0.0015  0.0169  414 PHE A CG    
357  C CD1   . PHE A 45  ? 0.1752 0.2976 0.3062 0.0048  -0.0047 0.0140  414 PHE A CD1   
358  C CD2   . PHE A 45  ? 0.1646 0.2628 0.2540 -0.0095 -0.0013 0.0189  414 PHE A CD2   
359  C CE1   . PHE A 45  ? 0.1851 0.3215 0.3139 0.0053  -0.0196 0.0112  414 PHE A CE1   
360  C CE2   . PHE A 45  ? 0.1920 0.2955 0.2714 -0.0089 -0.0101 0.0198  414 PHE A CE2   
361  C CZ    . PHE A 45  ? 0.2006 0.3240 0.2963 -0.0003 -0.0225 0.0152  414 PHE A CZ    
362  N N     . MET A 46  ? 0.1704 0.2314 0.2564 0.0228  0.0263  0.0098  415 MET A N     
363  C CA    . MET A 46  ? 0.1848 0.2278 0.2479 0.0327  0.0339  0.0033  415 MET A CA    
364  C C     . MET A 46  ? 0.1817 0.2260 0.2185 0.0360  0.0306  -0.0017 415 MET A C     
365  O O     . MET A 46  ? 0.2107 0.2446 0.2215 0.0420  0.0247  -0.0134 415 MET A O     
366  C CB    . MET A 46  ? 0.1990 0.2372 0.2720 0.0447  0.0529  0.0069  415 MET A CB    
367  C CG    . MET A 46  ? 0.2435 0.2845 0.3452 0.0488  0.0529  0.0091  415 MET A CG    
368  S SD    . MET A 46  ? 0.3169 0.3270 0.3975 0.0511  0.0467  0.0039  415 MET A SD    
369  C CE    . MET A 46  ? 0.3463 0.3613 0.4612 0.0653  0.0476  0.0130  415 MET A CE    
370  N N     . ASP A 47  ? 0.1442 0.2007 0.1862 0.0347  0.0331  0.0049  416 ASP A N     
371  C CA    . ASP A 47  ? 0.1370 0.1956 0.1542 0.0438  0.0278  0.0027  416 ASP A CA    
372  C C     . ASP A 47  ? 0.1489 0.2238 0.1854 0.0351  0.0261  0.0076  416 ASP A C     
373  O O     . ASP A 47  ? 0.1355 0.2175 0.1979 0.0220  0.0296  0.0112  416 ASP A O     
374  C CB    . ASP A 47  ? 0.1767 0.2127 0.1562 0.0660  0.0448  0.0090  416 ASP A CB    
375  C CG    . ASP A 47  ? 0.1751 0.2006 0.1712 0.0655  0.0735  0.0222  416 ASP A CG    
376  O OD1   . ASP A 47  ? 0.1629 0.1953 0.1759 0.0591  0.0780  0.0275  416 ASP A OD1   
377  O OD2   . ASP A 47  ? 0.2089 0.2185 0.2049 0.0707  0.0945  0.0248  416 ASP A OD2   
378  N N     . VAL A 48  ? 0.1159 0.1969 0.1212 0.0617  -0.0076 -0.0009 417 VAL A N     
379  C CA    . VAL A 48  ? 0.1373 0.2140 0.1492 0.0609  -0.0038 -0.0112 417 VAL A CA    
380  C C     . VAL A 48  ? 0.1773 0.2272 0.1598 0.0506  0.0053  -0.0041 417 VAL A C     
381  O O     . VAL A 48  ? 0.1668 0.2189 0.1548 0.0419  0.0126  -0.0093 417 VAL A O     
382  C CB    . VAL A 48  ? 0.1747 0.2453 0.1989 0.0847  -0.0177 -0.0284 417 VAL A CB    
383  C CG1   . VAL A 48  ? 0.1878 0.2754 0.2390 0.0774  -0.0203 -0.0358 417 VAL A CG1   
384  C CG2   . VAL A 48  ? 0.2285 0.2557 0.2115 0.1052  -0.0300 -0.0240 417 VAL A CG2   
385  N N     . SER A 49  ? 0.2055 0.2278 0.1564 0.0499  0.0078  0.0057  418 SER A N     
386  C CA    . SER A 49  ? 0.1826 0.1791 0.1087 0.0363  0.0216  0.0087  418 SER A CA    
387  C C     . SER A 49  ? 0.2013 0.2284 0.1459 0.0140  0.0315  0.0085  418 SER A C     
388  O O     . SER A 49  ? 0.1834 0.2069 0.1264 0.0031  0.0401  0.0040  418 SER A O     
389  C CB    . SER A 49  ? 0.2381 0.1912 0.1233 0.0383  0.0279  0.0161  418 SER A CB    
390  O OG    . SER A 49  ? 0.2526 0.1794 0.1163 0.0212  0.0470  0.0156  418 SER A OG    
391  N N     . GLN A 50  ? 0.1277 0.1837 0.0881 0.0092  0.0282  0.0116  419 GLN A N     
392  C CA    . GLN A 50  ? 0.1374 0.2201 0.1112 -0.0054 0.0317  0.0082  419 GLN A CA    
393  C C     . GLN A 50  ? 0.1324 0.2272 0.1169 -0.0055 0.0306  0.0034  419 GLN A C     
394  O O     . GLN A 50  ? 0.1285 0.2301 0.1125 -0.0150 0.0341  -0.0019 419 GLN A O     
395  C CB    . GLN A 50  ? 0.1298 0.2359 0.1134 -0.0061 0.0256  0.0117  419 GLN A CB    
396  C CG    . GLN A 50  ? 0.1080 0.2010 0.0816 -0.0029 0.0263  0.0173  419 GLN A CG    
397  C CD    . GLN A 50  ? 0.1448 0.2118 0.1007 -0.0144 0.0411  0.0137  419 GLN A CD    
398  O OE1   . GLN A 50  ? 0.1552 0.2291 0.1178 -0.0282 0.0496  0.0040  419 GLN A OE1   
399  N NE2   . GLN A 50  ? 0.1685 0.2015 0.0990 -0.0086 0.0458  0.0196  419 GLN A NE2   
400  N N     . LEU A 51  ? 0.1055 0.2019 0.0999 0.0050  0.0267  0.0020  420 LEU A N     
401  C CA    . LEU A 51  ? 0.0950 0.1969 0.0983 0.0024  0.0315  -0.0053 420 LEU A CA    
402  C C     . LEU A 51  ? 0.1281 0.2144 0.1253 -0.0006 0.0368  -0.0108 420 LEU A C     
403  O O     . LEU A 51  ? 0.1457 0.2338 0.1404 -0.0092 0.0430  -0.0150 420 LEU A O     
404  C CB    . LEU A 51  ? 0.1098 0.2195 0.1334 0.0121  0.0299  -0.0122 420 LEU A CB    
405  C CG    . LEU A 51  ? 0.1537 0.2672 0.1896 0.0067  0.0409  -0.0236 420 LEU A CG    
406  C CD1   . LEU A 51  ? 0.2310 0.3480 0.2829 0.0086  0.0419  -0.0277 420 LEU A CD1   
407  C CD2   . LEU A 51  ? 0.1730 0.2793 0.2208 0.0115  0.0423  -0.0363 420 LEU A CD2   
408  N N     . LYS A 52  ? 0.1356 0.2011 0.1245 0.0079  0.0342  -0.0110 421 LYS A N     
409  C CA    . LYS A 52  ? 0.1531 0.1989 0.1325 0.0061  0.0394  -0.0161 421 LYS A CA    
410  C C     . LYS A 52  ? 0.1619 0.2054 0.1300 -0.0104 0.0486  -0.0146 421 LYS A C     
411  O O     . LYS A 52  ? 0.1820 0.2228 0.1500 -0.0171 0.0544  -0.0205 421 LYS A O     
412  C CB    . LYS A 52  ? 0.1968 0.2099 0.1579 0.0223  0.0334  -0.0164 421 LYS A CB    
413  C CG    . LYS A 52  ? 0.2386 0.2571 0.2170 0.0430  0.0202  -0.0261 421 LYS A CG    
414  C CD    . LYS A 52  ? 0.3053 0.2836 0.2538 0.0651  0.0089  -0.0268 421 LYS A CD    
415  C CE    . LYS A 52  ? 0.3686 0.3582 0.3379 0.0895  -0.0095 -0.0403 421 LYS A CE    
416  N NZ    . LYS A 52  ? 0.4534 0.3957 0.3834 0.1175  -0.0253 -0.0426 421 LYS A NZ    
417  N N     . LYS A 53  ? 0.1855 0.2321 0.1478 -0.0172 0.0503  -0.0103 422 LYS A N     
418  C CA    . LYS A 53  ? 0.1734 0.2279 0.1364 -0.0329 0.0578  -0.0166 422 LYS A CA    
419  C C     . LYS A 53  ? 0.1688 0.2481 0.1420 -0.0360 0.0528  -0.0219 422 LYS A C     
420  O O     . LYS A 53  ? 0.1667 0.2476 0.1396 -0.0436 0.0566  -0.0306 422 LYS A O     
421  C CB    . LYS A 53  ? 0.1972 0.2579 0.1610 -0.0393 0.0601  -0.0165 422 LYS A CB    
422  C CG    . LYS A 53  ? 0.2674 0.2915 0.2095 -0.0420 0.0727  -0.0140 422 LYS A CG    
423  C CD    . LYS A 53  ? 0.2875 0.3197 0.2376 -0.0569 0.0825  -0.0225 422 LYS A CD    
424  C CE    . LYS A 53  ? 0.2557 0.3223 0.2254 -0.0527 0.0687  -0.0210 422 LYS A CE    
425  N NZ    . LYS A 53  ? 0.1585 0.2351 0.1438 -0.0641 0.0728  -0.0338 422 LYS A NZ    
426  N N     . HIS A 54  ? 0.1431 0.2363 0.1202 -0.0292 0.0450  -0.0175 423 HIS A N     
427  C CA    . HIS A 54  ? 0.1415 0.2441 0.1132 -0.0298 0.0416  -0.0214 423 HIS A CA    
428  C C     . HIS A 54  ? 0.1835 0.2737 0.1502 -0.0310 0.0487  -0.0254 423 HIS A C     
429  O O     . HIS A 54  ? 0.1863 0.2743 0.1395 -0.0333 0.0485  -0.0309 423 HIS A O     
430  C CB    . HIS A 54  ? 0.1465 0.2552 0.1163 -0.0228 0.0362  -0.0151 423 HIS A CB    
431  C CG    . HIS A 54  ? 0.1610 0.2583 0.1141 -0.0209 0.0375  -0.0167 423 HIS A CG    
432  N ND1   . HIS A 54  ? 0.1848 0.2796 0.1164 -0.0190 0.0302  -0.0213 423 HIS A ND1   
433  C CD2   . HIS A 54  ? 0.2070 0.2890 0.1581 -0.0199 0.0466  -0.0165 423 HIS A CD2   
434  C CE1   . HIS A 54  ? 0.2427 0.3121 0.1514 -0.0160 0.0356  -0.0202 423 HIS A CE1   
435  N NE2   . HIS A 54  ? 0.2148 0.2778 0.1373 -0.0186 0.0479  -0.0177 423 HIS A NE2   
436  N N     . LEU A 55  ? 0.1910 0.2715 0.1667 -0.0277 0.0538  -0.0250 424 LEU A N     
437  C CA    . LEU A 55  ? 0.2202 0.2918 0.1969 -0.0294 0.0616  -0.0320 424 LEU A CA    
438  C C     . LEU A 55  ? 0.2128 0.2784 0.1798 -0.0373 0.0649  -0.0373 424 LEU A C     
439  O O     . LEU A 55  ? 0.2325 0.2917 0.1924 -0.0406 0.0709  -0.0429 424 LEU A O     
440  C CB    . LEU A 55  ? 0.2580 0.3231 0.2503 -0.0211 0.0621  -0.0358 424 LEU A CB    
441  C CG    . LEU A 55  ? 0.2842 0.3586 0.2948 -0.0124 0.0601  -0.0389 424 LEU A CG    
442  C CD1   . LEU A 55  ? 0.2921 0.3616 0.3200 0.0002  0.0555  -0.0495 424 LEU A CD1   
443  C CD2   . LEU A 55  ? 0.3246 0.4026 0.3367 -0.0197 0.0716  -0.0447 424 LEU A CD2   
444  N N     . ARG A 56  ? 0.2223 0.2882 0.1889 -0.0415 0.0634  -0.0377 425 ARG A N     
445  C CA    . ARG A 56  ? 0.2305 0.2936 0.1934 -0.0502 0.0678  -0.0465 425 ARG A CA    
446  C C     . ARG A 56  ? 0.2311 0.3058 0.1852 -0.0516 0.0615  -0.0539 425 ARG A C     
447  O O     . ARG A 56  ? 0.2401 0.3127 0.1902 -0.0562 0.0635  -0.0634 425 ARG A O     
448  C CB    . ARG A 56  ? 0.2807 0.3381 0.2464 -0.0572 0.0731  -0.0491 425 ARG A CB    
449  C CG    . ARG A 56  ? 0.3193 0.3492 0.2771 -0.0520 0.0788  -0.0423 425 ARG A CG    
450  C CD    . ARG A 56  ? 0.3884 0.3967 0.3362 -0.0621 0.0916  -0.0465 425 ARG A CD    
451  N NE    . ARG A 56  ? 0.3972 0.4121 0.3475 -0.0680 0.0943  -0.0469 425 ARG A NE    
452  C CZ    . ARG A 56  ? 0.4424 0.4362 0.3779 -0.0618 0.0958  -0.0375 425 ARG A CZ    
453  N NH1   . ARG A 56  ? 0.4409 0.4062 0.3577 -0.0463 0.0913  -0.0284 425 ARG A NH1   
454  N NH2   . ARG A 56  ? 0.4483 0.4492 0.3878 -0.0694 0.1006  -0.0398 425 ARG A NH2   
455  N N     . THR A 57  ? 0.2126 0.2961 0.1597 -0.0455 0.0525  -0.0508 426 THR A N     
456  C CA    . THR A 57  ? 0.2131 0.2971 0.1396 -0.0407 0.0431  -0.0584 426 THR A CA    
457  C C     . THR A 57  ? 0.2366 0.2971 0.1387 -0.0393 0.0506  -0.0576 426 THR A C     
458  O O     . THR A 57  ? 0.2724 0.3228 0.1493 -0.0353 0.0448  -0.0659 426 THR A O     
459  C CB    . THR A 57  ? 0.2212 0.3119 0.1385 -0.0318 0.0315  -0.0547 426 THR A CB    
460  O OG1   . THR A 57  ? 0.2448 0.3219 0.1540 -0.0291 0.0390  -0.0422 426 THR A OG1   
461  C CG2   . THR A 57  ? 0.2090 0.3230 0.1525 -0.0349 0.0268  -0.0571 426 THR A CG2   
462  N N     . HIS A 58  ? 0.2389 0.2890 0.1484 -0.0417 0.0632  -0.0507 427 HIS A N     
463  C CA    . HIS A 58  ? 0.2259 0.2523 0.1223 -0.0421 0.0727  -0.0511 427 HIS A CA    
464  C C     . HIS A 58  ? 0.3132 0.3375 0.2207 -0.0490 0.0804  -0.0579 427 HIS A C     
465  O O     . HIS A 58  ? 0.3569 0.3632 0.2484 -0.0504 0.0859  -0.0614 427 HIS A O     
466  C CB    . HIS A 58  ? 0.2198 0.2398 0.1286 -0.0410 0.0809  -0.0460 427 HIS A CB    
467  C CG    . HIS A 58  ? 0.2577 0.2752 0.1543 -0.0346 0.0758  -0.0389 427 HIS A CG    
468  N ND1   . HIS A 58  ? 0.3146 0.3123 0.1739 -0.0280 0.0708  -0.0370 427 HIS A ND1   
469  C CD2   . HIS A 58  ? 0.2457 0.2756 0.1602 -0.0319 0.0738  -0.0340 427 HIS A CD2   
470  C CE1   . HIS A 58  ? 0.3122 0.3103 0.1678 -0.0222 0.0668  -0.0307 427 HIS A CE1   
471  N NE2   . HIS A 58  ? 0.2753 0.2938 0.1653 -0.0257 0.0693  -0.0286 427 HIS A NE2   
472  N N     . THR A 59  ? 0.2815 0.3189 0.2120 -0.0523 0.0816  -0.0594 428 THR A N     
473  C CA    . THR A 59  ? 0.2737 0.3052 0.2129 -0.0572 0.0891  -0.0657 428 THR A CA    
474  C C     . THR A 59  ? 0.2984 0.3334 0.2332 -0.0626 0.0859  -0.0726 428 THR A C     
475  O O     . THR A 59  ? 0.3589 0.3860 0.2940 -0.0673 0.0924  -0.0789 428 THR A O     
476  C CB    . THR A 59  ? 0.2960 0.3273 0.2559 -0.0534 0.0900  -0.0634 428 THR A CB    
477  O OG1   . THR A 59  ? 0.2959 0.3307 0.2567 -0.0534 0.0842  -0.0585 428 THR A OG1   
478  C CG2   . THR A 59  ? 0.2878 0.3228 0.2603 -0.0464 0.0907  -0.0623 428 THR A CG2   
479  N N     . GLY A 60  ? 0.2364 0.2902 0.3474 -0.0631 0.1272  -0.0251 429 GLY A N     
480  C CA    . GLY A 60  ? 0.2418 0.2903 0.3045 -0.0521 0.1151  -0.0208 429 GLY A CA    
481  C C     . GLY A 60  ? 0.2183 0.2725 0.2918 -0.0384 0.0916  -0.0388 429 GLY A C     
482  O O     . GLY A 60  ? 0.2333 0.2855 0.2772 -0.0306 0.0843  -0.0397 429 GLY A O     
483  N N     . GLU A 61  ? 0.2017 0.2636 0.3179 -0.0358 0.0786  -0.0521 430 GLU A N     
484  C CA    . GLU A 61  ? 0.1709 0.2376 0.2963 -0.0223 0.0551  -0.0628 430 GLU A CA    
485  C C     . GLU A 61  ? 0.1754 0.2204 0.2627 -0.0151 0.0369  -0.0509 430 GLU A C     
486  O O     . GLU A 61  ? 0.1874 0.2186 0.2651 -0.0192 0.0338  -0.0431 430 GLU A O     
487  C CB    . GLU A 61  ? 0.1812 0.2650 0.3572 -0.0218 0.0420  -0.0765 430 GLU A CB    
488  C CG    . GLU A 61  ? 0.2382 0.3269 0.4214 -0.0072 0.0144  -0.0806 430 GLU A CG    
489  C CD    . GLU A 61  ? 0.2705 0.3784 0.4944 -0.0068 -0.0054 -0.0914 430 GLU A CD    
490  O OE1   . GLU A 61  ? 0.2938 0.4139 0.5359 0.0054  -0.0271 -0.0935 430 GLU A OE1   
491  O OE2   . GLU A 61  ? 0.3047 0.4161 0.5448 -0.0190 -0.0004 -0.0974 430 GLU A OE2   
492  N N     . LYS A 62  ? 0.1670 0.2090 0.2386 -0.0050 0.0272  -0.0514 431 LYS A N     
493  C CA    . LYS A 62  ? 0.1539 0.1783 0.1952 0.0014  0.0125  -0.0412 431 LYS A CA    
494  C C     . LYS A 62  ? 0.1671 0.1948 0.2223 0.0123  -0.0049 -0.0451 431 LYS A C     
495  O O     . LYS A 62  ? 0.1816 0.2077 0.2381 0.0184  -0.0050 -0.0470 431 LYS A O     
496  C CB    . LYS A 62  ? 0.1856 0.2012 0.1933 0.0009  0.0196  -0.0334 431 LYS A CB    
497  C CG    . LYS A 62  ? 0.2039 0.2173 0.1949 -0.0085 0.0348  -0.0230 431 LYS A CG    
498  C CD    . LYS A 62  ? 0.2350 0.2426 0.1900 -0.0076 0.0340  -0.0125 431 LYS A CD    
499  C CE    . LYS A 62  ? 0.2764 0.2805 0.2132 -0.0153 0.0453  0.0057  431 LYS A CE    
500  N NZ    . LYS A 62  ? 0.3177 0.3197 0.2206 -0.0131 0.0384  0.0187  431 LYS A NZ    
501  N N     . PRO A 63  ? 0.1662 0.1984 0.2325 0.0145  -0.0205 -0.0458 432 PRO A N     
502  C CA    . PRO A 63  ? 0.1880 0.2265 0.2696 0.0255  -0.0393 -0.0443 432 PRO A CA    
503  C C     . PRO A 63  ? 0.1659 0.1876 0.2154 0.0316  -0.0499 -0.0300 432 PRO A C     
504  O O     . PRO A 63  ? 0.1972 0.2218 0.2540 0.0403  -0.0664 -0.0224 432 PRO A O     
505  C CB    . PRO A 63  ? 0.2007 0.2570 0.3036 0.0231  -0.0532 -0.0517 432 PRO A CB    
506  C CG    . PRO A 63  ? 0.2256 0.2786 0.3228 0.0096  -0.0395 -0.0582 432 PRO A CG    
507  C CD    . PRO A 63  ? 0.1936 0.2260 0.2593 0.0067  -0.0225 -0.0485 432 PRO A CD    
508  N N     . PHE A 64  ? 0.1778 0.1836 0.1957 0.0275  -0.0410 -0.0241 433 PHE A N     
509  C CA    . PHE A 64  ? 0.1868 0.1785 0.1785 0.0313  -0.0465 -0.0117 433 PHE A CA    
510  C C     . PHE A 64  ? 0.1635 0.1444 0.1530 0.0320  -0.0369 -0.0092 433 PHE A C     
511  O O     . PHE A 64  ? 0.1918 0.1682 0.1671 0.0268  -0.0276 -0.0101 433 PHE A O     
512  C CB    . PHE A 64  ? 0.1813 0.1678 0.1469 0.0256  -0.0447 -0.0114 433 PHE A CB    
513  C CG    . PHE A 64  ? 0.1840 0.1832 0.1537 0.0223  -0.0539 -0.0210 433 PHE A CG    
514  C CD1   . PHE A 64  ? 0.1850 0.1892 0.1720 0.0144  -0.0465 -0.0330 433 PHE A CD1   
515  C CD2   . PHE A 64  ? 0.1760 0.1833 0.1329 0.0261  -0.0707 -0.0175 433 PHE A CD2   
516  C CE1   . PHE A 64  ? 0.1609 0.1782 0.1589 0.0094  -0.0554 -0.0464 433 PHE A CE1   
517  C CE2   . PHE A 64  ? 0.2141 0.2380 0.1743 0.0219  -0.0826 -0.0306 433 PHE A CE2   
518  C CZ    . PHE A 64  ? 0.2098 0.2389 0.1940 0.0131  -0.0748 -0.0477 433 PHE A CZ    
519  N N     . THR A 65  ? 0.1737 0.1513 0.1819 0.0386  -0.0406 -0.0067 434 THR A N     
520  C CA    . THR A 65  ? 0.1534 0.1231 0.1686 0.0381  -0.0324 -0.0113 434 THR A CA    
521  C C     . THR A 65  ? 0.1554 0.1093 0.1603 0.0391  -0.0342 0.0022  434 THR A C     
522  O O     . THR A 65  ? 0.1770 0.1243 0.1805 0.0439  -0.0422 0.0175  434 THR A O     
523  C CB    . THR A 65  ? 0.1509 0.1247 0.2049 0.0439  -0.0314 -0.0219 434 THR A CB    
524  O OG1   . THR A 65  ? 0.1623 0.1539 0.2296 0.0416  -0.0254 -0.0358 434 THR A OG1   
525  C CG2   . THR A 65  ? 0.1572 0.1240 0.2205 0.0415  -0.0223 -0.0337 434 THR A CG2   
526  N N     . CYS A 66  ? 0.1623 0.1126 0.1607 0.0338  -0.0269 -0.0025 435 CYS A N     
527  C CA    . CYS A 66  ? 0.2210 0.1586 0.2202 0.0326  -0.0252 0.0070  435 CYS A CA    
528  C C     . CYS A 66  ? 0.1990 0.1262 0.2322 0.0358  -0.0248 0.0045  435 CYS A C     
529  O O     . CYS A 66  ? 0.1677 0.1000 0.2203 0.0344  -0.0213 -0.0152 435 CYS A O     
530  C CB    . CYS A 66  ? 0.2272 0.1696 0.2172 0.0260  -0.0205 0.0001  435 CYS A CB    
531  S SG    . CYS A 66  ? 0.1846 0.1168 0.1898 0.0220  -0.0162 0.0057  435 CYS A SG    
532  N N     . GLU A 67  ? 0.2027 0.1151 0.2435 0.0396  -0.0271 0.0243  436 GLU A N     
533  C CA    . GLU A 67  ? 0.1989 0.1020 0.2732 0.0410  -0.0238 0.0240  436 GLU A CA    
534  C C     . GLU A 67  ? 0.2166 0.1127 0.3099 0.0328  -0.0154 0.0136  436 GLU A C     
535  O O     . GLU A 67  ? 0.2392 0.1298 0.3641 0.0316  -0.0118 0.0082  436 GLU A O     
536  C CB    . GLU A 67  ? 0.2544 0.1492 0.3208 0.0455  -0.0271 0.0492  436 GLU A CB    
537  C CG    . GLU A 67  ? 0.3004 0.1871 0.3363 0.0406  -0.0225 0.0671  436 GLU A CG    
538  C CD    . GLU A 67  ? 0.3505 0.2265 0.3764 0.0440  -0.0254 0.0903  436 GLU A CD    
539  O OE1   . GLU A 67  ? 0.4012 0.2682 0.4589 0.0473  -0.0260 0.0946  436 GLU A OE1   
540  O OE2   . GLU A 67  ? 0.4018 0.2784 0.3879 0.0428  -0.0273 0.1035  436 GLU A OE2   
541  N N     . ILE A 68  ? 0.2304 0.1288 0.3106 0.0270  -0.0133 0.0094  437 ILE A N     
542  C CA    . ILE A 68  ? 0.2294 0.1268 0.3322 0.0181  -0.0077 -0.0032 437 ILE A CA    
543  C C     . ILE A 68  ? 0.2404 0.1538 0.3506 0.0140  -0.0102 -0.0354 437 ILE A C     
544  O O     . ILE A 68  ? 0.2455 0.1607 0.3847 0.0090  -0.0073 -0.0526 437 ILE A O     
545  C CB    . ILE A 68  ? 0.2188 0.1208 0.3043 0.0124  -0.0037 0.0077  437 ILE A CB    
546  C CG1   . ILE A 68  ? 0.2481 0.1360 0.3215 0.0142  0.0029  0.0371  437 ILE A CG1   
547  C CG2   . ILE A 68  ? 0.1990 0.1056 0.3160 0.0028  -0.0008 -0.0080 437 ILE A CG2   
548  C CD1   . ILE A 68  ? 0.2554 0.1495 0.3127 0.0089  0.0116  0.0451  437 ILE A CD1   
549  N N     . CYS A 69  ? 0.1797 0.1118 0.2559 0.0145  -0.0143 -0.0416 438 CYS A N     
550  C CA    . CYS A 69  ? 0.1969 0.1481 0.2661 0.0095  -0.0161 -0.0680 438 CYS A CA    
551  C C     . CYS A 69  ? 0.1906 0.1499 0.2508 0.0132  -0.0127 -0.0788 438 CYS A C     
552  O O     . CYS A 69  ? 0.2315 0.2066 0.2855 0.0082  -0.0102 -0.1031 438 CYS A O     
553  C CB    . CYS A 69  ? 0.1979 0.1669 0.2374 0.0053  -0.0225 -0.0646 438 CYS A CB    
554  S SG    . CYS A 69  ? 0.1858 0.1586 0.1872 0.0105  -0.0231 -0.0439 438 CYS A SG    
555  N N     . GLY A 70  ? 0.1853 0.1378 0.2442 0.0208  -0.0122 -0.0630 439 GLY A N     
556  C CA    . GLY A 70  ? 0.1972 0.1594 0.2593 0.0241  -0.0076 -0.0738 439 GLY A CA    
557  C C     . GLY A 70  ? 0.1706 0.1484 0.1971 0.0212  -0.0060 -0.0696 439 GLY A C     
558  O O     . GLY A 70  ? 0.2084 0.1956 0.2409 0.0226  0.0003  -0.0768 439 GLY A O     
559  N N     . LYS A 71  ? 0.1619 0.1424 0.1589 0.0172  -0.0102 -0.0577 440 LYS A N     
560  C CA    . LYS A 71  ? 0.1756 0.1658 0.1450 0.0146  -0.0079 -0.0498 440 LYS A CA    
561  C C     . LYS A 71  ? 0.1536 0.1374 0.1277 0.0189  -0.0090 -0.0365 440 LYS A C     
562  O O     . LYS A 71  ? 0.1678 0.1404 0.1509 0.0236  -0.0150 -0.0268 440 LYS A O     
563  C CB    . LYS A 71  ? 0.1862 0.1791 0.1328 0.0115  -0.0138 -0.0389 440 LYS A CB    
564  C CG    . LYS A 71  ? 0.2561 0.2626 0.1939 0.0061  -0.0175 -0.0529 440 LYS A CG    
565  C CD    . LYS A 71  ? 0.3162 0.3282 0.2406 0.0053  -0.0279 -0.0394 440 LYS A CD    
566  C CE    . LYS A 71  ? 0.3874 0.4184 0.3041 -0.0003 -0.0368 -0.0552 440 LYS A CE    
567  N NZ    . LYS A 71  ? 0.4186 0.4590 0.3309 0.0006  -0.0510 -0.0410 440 LYS A NZ    
568  N N     . SER A 72  ? 0.1571 0.1496 0.1242 0.0161  -0.0028 -0.0365 441 SER A N     
569  C CA    . SER A 72  ? 0.1569 0.1481 0.1336 0.0180  -0.0046 -0.0300 441 SER A CA    
570  C C     . SER A 72  ? 0.1760 0.1642 0.1351 0.0135  -0.0028 -0.0188 441 SER A C     
571  O O     . SER A 72  ? 0.1940 0.1842 0.1356 0.0092  0.0022  -0.0137 441 SER A O     
572  C CB    . SER A 72  ? 0.1693 0.1738 0.1700 0.0177  0.0027  -0.0424 441 SER A CB    
573  O OG    . SER A 72  ? 0.1604 0.1657 0.1882 0.0240  0.0010  -0.0533 441 SER A OG    
574  N N     . PHE A 73  ? 0.1744 0.1582 0.1395 0.0146  -0.0076 -0.0151 442 PHE A N     
575  C CA    . PHE A 73  ? 0.1557 0.1325 0.1133 0.0109  -0.0053 -0.0081 442 PHE A CA    
576  C C     . PHE A 73  ? 0.1592 0.1409 0.1343 0.0073  -0.0048 -0.0148 442 PHE A C     
577  O O     . PHE A 73  ? 0.1803 0.1713 0.1698 0.0100  -0.0125 -0.0225 442 PHE A O     
578  C CB    . PHE A 73  ? 0.1574 0.1237 0.1048 0.0144  -0.0107 -0.0026 442 PHE A CB    
579  C CG    . PHE A 73  ? 0.1709 0.1352 0.1105 0.0167  -0.0118 0.0022  442 PHE A CG    
580  C CD1   . PHE A 73  ? 0.2053 0.1699 0.1486 0.0197  -0.0158 -0.0007 442 PHE A CD1   
581  C CD2   . PHE A 73  ? 0.1910 0.1537 0.1254 0.0159  -0.0102 0.0100  442 PHE A CD2   
582  C CE1   . PHE A 73  ? 0.1908 0.1551 0.1341 0.0197  -0.0168 -0.0002 442 PHE A CE1   
583  C CE2   . PHE A 73  ? 0.1680 0.1341 0.1002 0.0173  -0.0144 0.0118  442 PHE A CE2   
584  C CZ    . PHE A 73  ? 0.1746 0.1421 0.1119 0.0181  -0.0171 0.0046  442 PHE A CZ    
585  N N     . THR A 74  ? 0.1682 0.1440 0.1473 0.0012  0.0029  -0.0115 443 THR A N     
586  C CA    . THR A 74  ? 0.1653 0.1462 0.1686 -0.0052 0.0049  -0.0212 443 THR A CA    
587  C C     . THR A 74  ? 0.1839 0.1643 0.1879 -0.0039 -0.0069 -0.0317 443 THR A C     
588  O O     . THR A 74  ? 0.1609 0.1531 0.1854 -0.0081 -0.0124 -0.0450 443 THR A O     
589  C CB    . THR A 74  ? 0.1801 0.1510 0.1932 -0.0133 0.0192  -0.0130 443 THR A CB    
590  O OG1   . THR A 74  ? 0.1817 0.1352 0.1896 -0.0114 0.0184  -0.0075 443 THR A OG1   
591  C CG2   . THR A 74  ? 0.1844 0.1575 0.1828 -0.0150 0.0305  0.0013  443 THR A CG2   
592  N N     . ALA A 75  ? 0.1813 0.1516 0.1637 0.0008  -0.0104 -0.0279 444 ALA A N     
593  C CA    . ALA A 75  ? 0.1820 0.1533 0.1559 0.0005  -0.0180 -0.0391 444 ALA A CA    
594  C C     . ALA A 75  ? 0.1715 0.1416 0.1184 0.0076  -0.0240 -0.0313 444 ALA A C     
595  O O     . ALA A 75  ? 0.1806 0.1431 0.1208 0.0115  -0.0191 -0.0195 444 ALA A O     
596  C CB    . ALA A 75  ? 0.1964 0.1542 0.1780 -0.0043 -0.0080 -0.0463 444 ALA A CB    
597  N N     . LYS A 76  ? 0.1834 0.1626 0.1149 0.0083  -0.0351 -0.0374 445 LYS A N     
598  C CA    . LYS A 76  ? 0.2017 0.1786 0.1059 0.0136  -0.0383 -0.0259 445 LYS A CA    
599  C C     . LYS A 76  ? 0.2008 0.1657 0.0928 0.0124  -0.0239 -0.0254 445 LYS A C     
600  O O     . LYS A 76  ? 0.2008 0.1599 0.0838 0.0158  -0.0195 -0.0126 445 LYS A O     
601  C CB    . LYS A 76  ? 0.2363 0.2274 0.1195 0.0142  -0.0542 -0.0288 445 LYS A CB    
602  C CG    . LYS A 76  ? 0.2832 0.2733 0.1452 0.0165  -0.0526 -0.0092 445 LYS A CG    
603  C CD    . LYS A 76  ? 0.3358 0.3435 0.1783 0.0123  -0.0638 -0.0070 445 LYS A CD    
604  C CE    . LYS A 76  ? 0.3480 0.3701 0.2110 0.0168  -0.0834 -0.0020 445 LYS A CE    
605  N NZ    . LYS A 76  ? 0.4058 0.4454 0.2466 0.0123  -0.0980 0.0051  445 LYS A NZ    
606  N N     . SER A 77  ? 0.1967 0.1579 0.0963 0.0075  -0.0153 -0.0406 446 SER A N     
607  C CA    . SER A 77  ? 0.2137 0.1649 0.1136 0.0078  -0.0002 -0.0423 446 SER A CA    
608  C C     . SER A 77  ? 0.1983 0.1414 0.1161 0.0124  0.0044  -0.0262 446 SER A C     
609  O O     . SER A 77  ? 0.1946 0.1351 0.1117 0.0150  0.0117  -0.0203 446 SER A O     
610  C CB    . SER A 77  ? 0.2313 0.1777 0.1488 0.0027  0.0085  -0.0634 446 SER A CB    
611  O OG    . SER A 77  ? 0.2287 0.1656 0.1586 0.0050  0.0240  -0.0656 446 SER A OG    
612  N N     . SER A 78  ? 0.1706 0.1126 0.1044 0.0125  0.0004  -0.0199 447 SER A N     
613  C CA    . SER A 78  ? 0.1630 0.1022 0.1057 0.0159  0.0012  -0.0058 447 SER A CA    
614  C C     . SER A 78  ? 0.1477 0.0919 0.0795 0.0186  -0.0038 0.0015  447 SER A C     
615  O O     . SER A 78  ? 0.1707 0.1146 0.1085 0.0207  -0.0023 0.0079  447 SER A O     
616  C CB    . SER A 78  ? 0.1782 0.1178 0.1312 0.0136  0.0003  -0.0008 447 SER A CB    
617  O OG    . SER A 78  ? 0.1711 0.1027 0.1415 0.0098  0.0066  -0.0058 447 SER A OG    
618  N N     . LEU A 79  ? 0.1877 0.1366 0.1101 0.0188  -0.0107 0.0004  448 LEU A N     
619  C CA    . LEU A 79  ? 0.1733 0.1220 0.0927 0.0215  -0.0140 0.0080  448 LEU A CA    
620  C C     . LEU A 79  ? 0.1925 0.1369 0.1026 0.0213  -0.0072 0.0130  448 LEU A C     
621  O O     . LEU A 79  ? 0.2089 0.1508 0.1283 0.0215  -0.0040 0.0190  448 LEU A O     
622  C CB    . LEU A 79  ? 0.1758 0.1293 0.0943 0.0239  -0.0237 0.0086  448 LEU A CB    
623  C CG    . LEU A 79  ? 0.1869 0.1354 0.1076 0.0276  -0.0268 0.0193  448 LEU A CG    
624  C CD1   . LEU A 79  ? 0.1740 0.1196 0.1131 0.0273  -0.0230 0.0172  448 LEU A CD1   
625  C CD2   . LEU A 79  ? 0.1825 0.1359 0.1088 0.0325  -0.0391 0.0229  448 LEU A CD2   
626  N N     . GLN A 80  ? 0.1964 0.1417 0.0895 0.0195  -0.0033 0.0081  449 GLN A N     
627  C CA    . GLN A 80  ? 0.2101 0.1537 0.0906 0.0177  0.0083  0.0113  449 GLN A CA    
628  C C     . GLN A 80  ? 0.2116 0.1537 0.1165 0.0177  0.0195  0.0094  449 GLN A C     
629  O O     . GLN A 80  ? 0.2219 0.1636 0.1340 0.0165  0.0278  0.0164  449 GLN A O     
630  C CB    . GLN A 80  ? 0.2306 0.1793 0.0853 0.0143  0.0118  -0.0004 449 GLN A CB    
631  C CG    . GLN A 80  ? 0.2867 0.2367 0.1211 0.0108  0.0285  0.0000  449 GLN A CG    
632  C CD    . GLN A 80  ? 0.3256 0.2879 0.1343 0.0058  0.0303  -0.0166 449 GLN A CD    
633  O OE1   . GLN A 80  ? 0.3613 0.3391 0.1477 0.0031  0.0228  -0.0090 449 GLN A OE1   
634  N NE2   . GLN A 80  ? 0.2861 0.2462 0.1077 0.0043  0.0391  -0.0397 449 GLN A NE2   
635  N N     . THR A 81  ? 0.1635 0.1052 0.0863 0.0191  0.0194  0.0017  450 THR A N     
636  C CA    . THR A 81  ? 0.1681 0.1109 0.1200 0.0216  0.0248  0.0030  450 THR A CA    
637  C C     . THR A 81  ? 0.1711 0.1184 0.1355 0.0225  0.0158  0.0125  450 THR A C     
638  O O     . THR A 81  ? 0.1785 0.1313 0.1644 0.0227  0.0196  0.0144  450 THR A O     
639  C CB    . THR A 81  ? 0.1715 0.1103 0.1413 0.0241  0.0239  -0.0012 450 THR A CB    
640  O OG1   . THR A 81  ? 0.1708 0.1055 0.1380 0.0220  0.0349  -0.0166 450 THR A OG1   
641  C CG2   . THR A 81  ? 0.1868 0.1286 0.1900 0.0292  0.0231  0.0059  450 THR A CG2   
642  N N     . HIS A 82  ? 0.1382 0.0855 0.0928 0.0223  0.0048  0.0150  451 HIS A N     
643  C CA    . HIS A 82  ? 0.1692 0.1223 0.1336 0.0219  -0.0032 0.0174  451 HIS A CA    
644  C C     . HIS A 82  ? 0.1883 0.1395 0.1601 0.0192  0.0009  0.0192  451 HIS A C     
645  O O     . HIS A 82  ? 0.1776 0.1353 0.1704 0.0173  -0.0016 0.0173  451 HIS A O     
646  C CB    . HIS A 82  ? 0.1509 0.1050 0.1036 0.0215  -0.0108 0.0152  451 HIS A CB    
647  C CG    . HIS A 82  ? 0.1663 0.1257 0.1259 0.0198  -0.0162 0.0108  451 HIS A CG    
648  N ND1   . HIS A 82  ? 0.1570 0.1280 0.1204 0.0184  -0.0231 0.0076  451 HIS A ND1   
649  C CD2   . HIS A 82  ? 0.1751 0.1298 0.1404 0.0191  -0.0163 0.0076  451 HIS A CD2   
650  C CE1   . HIS A 82  ? 0.1607 0.1352 0.1308 0.0156  -0.0258 -0.0026 451 HIS A CE1   
651  N NE2   . HIS A 82  ? 0.1787 0.1413 0.1546 0.0164  -0.0207 -0.0024 451 HIS A NE2   
652  N N     . ILE A 83  ? 0.1698 0.1129 0.1259 0.0185  0.0063  0.0238  452 ILE A N     
653  C CA    . ILE A 83  ? 0.1881 0.1251 0.1520 0.0155  0.0120  0.0315  452 ILE A CA    
654  C C     . ILE A 83  ? 0.1888 0.1300 0.1722 0.0116  0.0251  0.0322  452 ILE A C     
655  O O     . ILE A 83  ? 0.1917 0.1314 0.1990 0.0072  0.0293  0.0350  452 ILE A O     
656  C CB    . ILE A 83  ? 0.1971 0.1257 0.1351 0.0166  0.0128  0.0425  452 ILE A CB    
657  C CG1   . ILE A 83  ? 0.1982 0.1255 0.1347 0.0211  -0.0013 0.0411  452 ILE A CG1   
658  C CG2   . ILE A 83  ? 0.2106 0.1296 0.1543 0.0131  0.0228  0.0577  452 ILE A CG2   
659  C CD1   . ILE A 83  ? 0.2280 0.1517 0.1434 0.0244  -0.0069 0.0532  452 ILE A CD1   
660  N N     . ARG A 84  ? 0.1718 0.1188 0.1534 0.0128  0.0330  0.0274  453 ARG A N     
661  C CA    . ARG A 84  ? 0.1671 0.1217 0.1764 0.0100  0.0474  0.0254  453 ARG A CA    
662  C C     . ARG A 84  ? 0.1870 0.1535 0.2370 0.0099  0.0373  0.0210  453 ARG A C     
663  O O     . ARG A 84  ? 0.1966 0.1714 0.2804 0.0057  0.0469  0.0197  453 ARG A O     
664  C CB    . ARG A 84  ? 0.1819 0.1407 0.1898 0.0128  0.0582  0.0168  453 ARG A CB    
665  C CG    . ARG A 84  ? 0.2170 0.1699 0.1845 0.0101  0.0709  0.0157  453 ARG A CG    
666  C CD    . ARG A 84  ? 0.2107 0.1694 0.1865 0.0105  0.0888  0.0007  453 ARG A CD    
667  N NE    . ARG A 84  ? 0.2098 0.1675 0.2053 0.0171  0.0791  -0.0090 453 ARG A NE    
668  C CZ    . ARG A 84  ? 0.2240 0.1752 0.1974 0.0180  0.0728  -0.0166 453 ARG A CZ    
669  N NH1   . ARG A 84  ? 0.2356 0.1849 0.1652 0.0135  0.0716  -0.0176 453 ARG A NH1   
670  N NH2   . ARG A 84  ? 0.1972 0.1444 0.1955 0.0231  0.0668  -0.0218 453 ARG A NH2   
671  N N     . ILE A 85  ? 0.1655 0.1358 0.2126 0.0134  0.0183  0.0178  454 ILE A N     
672  C CA    . ILE A 85  ? 0.1510 0.1369 0.2278 0.0125  0.0045  0.0122  454 ILE A CA    
673  C C     . ILE A 85  ? 0.1430 0.1275 0.2381 0.0047  0.0058  0.0080  454 ILE A C     
674  O O     . ILE A 85  ? 0.1552 0.1529 0.2896 0.0000  0.0052  0.0019  454 ILE A O     
675  C CB    . ILE A 85  ? 0.1589 0.1501 0.2168 0.0166  -0.0139 0.0111  454 ILE A CB    
676  C CG1   . ILE A 85  ? 0.1658 0.1538 0.2139 0.0234  -0.0129 0.0178  454 ILE A CG1   
677  C CG2   . ILE A 85  ? 0.1780 0.1903 0.2577 0.0150  -0.0312 0.0046  454 ILE A CG2   
678  C CD1   . ILE A 85  ? 0.1679 0.1581 0.1942 0.0260  -0.0263 0.0221  454 ILE A CD1   
679  N N     . HIS A 86  ? 0.1676 0.1360 0.2420 0.0032  0.0073  0.0107  455 HIS A N     
680  C CA    . HIS A 86  ? 0.1772 0.1383 0.2757 -0.0037 0.0101  0.0075  455 HIS A CA    
681  C C     . HIS A 86  ? 0.2037 0.1602 0.3277 -0.0102 0.0294  0.0165  455 HIS A C     
682  O O     . HIS A 86  ? 0.2022 0.1624 0.3681 -0.0183 0.0320  0.0097  455 HIS A O     
683  C CB    . HIS A 86  ? 0.1936 0.1361 0.2713 -0.0012 0.0094  0.0127  455 HIS A CB    
684  C CG    . HIS A 86  ? 0.1867 0.1352 0.2480 0.0029  -0.0047 0.0007  455 HIS A CG    
685  N ND1   . HIS A 86  ? 0.2159 0.1792 0.2905 -0.0005 -0.0156 -0.0182 455 HIS A ND1   
686  C CD2   . HIS A 86  ? 0.1833 0.1275 0.2164 0.0087  -0.0081 0.0037  455 HIS A CD2   
687  C CE1   . HIS A 86  ? 0.2082 0.1750 0.2592 0.0029  -0.0222 -0.0250 455 HIS A CE1   
688  N NE2   . HIS A 86  ? 0.2037 0.1588 0.2339 0.0085  -0.0173 -0.0119 455 HIS A NE2   
689  N N     . ARG A 87  ? 0.2031 0.1530 0.3029 -0.0084 0.0446  0.0299  456 ARG A N     
690  C CA    . ARG A 87  ? 0.2037 0.1489 0.3176 -0.0158 0.0681  0.0411  456 ARG A CA    
691  C C     . ARG A 87  ? 0.1843 0.1499 0.3331 -0.0184 0.0786  0.0323  456 ARG A C     
692  O O     . ARG A 87  ? 0.2166 0.1822 0.3804 -0.0257 0.1030  0.0394  456 ARG A O     
693  C CB    . ARG A 87  ? 0.2598 0.1915 0.3241 -0.0139 0.0804  0.0585  456 ARG A CB    
694  C CG    . ARG A 87  ? 0.3002 0.2145 0.3369 -0.0095 0.0679  0.0697  456 ARG A CG    
695  C CD    . ARG A 87  ? 0.3664 0.2740 0.3530 -0.0077 0.0748  0.0870  456 ARG A CD    
696  N NE    . ARG A 87  ? 0.4538 0.3631 0.4384 -0.0157 0.0935  0.0975  456 ARG A NE    
697  C CZ    . ARG A 87  ? 0.5047 0.4034 0.4979 -0.0199 0.0951  0.1125  456 ARG A CZ    
698  N NH1   . ARG A 87  ? 0.5132 0.3994 0.5216 -0.0161 0.0794  0.1160  456 ARG A NH1   
699  N NH2   . ARG A 87  ? 0.5448 0.4452 0.5330 -0.0281 0.1138  0.1233  456 ARG A NH2   
700  N N     . GLY A 88  ? 0.2338 0.1319 0.3390 0.0257  0.0917  0.0600  457 GLY A N     
701  C CA    . GLY A 88  ? 0.2442 0.1510 0.3407 0.0112  0.0721  0.0491  457 GLY A CA    
702  C C     . GLY A 88  ? 0.2393 0.1972 0.3515 0.0107  0.0636  0.0603  457 GLY A C     
703  O O     . GLY A 88  ? 0.2433 0.2134 0.3610 0.0026  0.0528  0.0609  457 GLY A O     
704  N N     . GLU A 89  ? 0.1930 0.1798 0.3110 0.0191  0.0684  0.0705  458 GLU A N     
705  C CA    . GLU A 89  ? 0.1623 0.1911 0.2864 0.0184  0.0606  0.0800  458 GLU A CA    
706  C C     . GLU A 89  ? 0.1593 0.1926 0.2597 0.0137  0.0504  0.0644  458 GLU A C     
707  O O     . GLU A 89  ? 0.1329 0.1637 0.2233 0.0157  0.0513  0.0596  458 GLU A O     
708  C CB    . GLU A 89  ? 0.1536 0.2083 0.2926 0.0263  0.0660  0.0994  458 GLU A CB    
709  C CG    . GLU A 89  ? 0.1763 0.2280 0.3374 0.0337  0.0727  0.1144  458 GLU A CG    
710  C CD    . GLU A 89  ? 0.1894 0.2601 0.3584 0.0425  0.0710  0.1311  458 GLU A CD    
711  O OE1   . GLU A 89  ? 0.1962 0.2780 0.3553 0.0417  0.0657  0.1312  458 GLU A OE1   
712  O OE2   . GLU A 89  ? 0.1999 0.2759 0.3883 0.0495  0.0743  0.1464  458 GLU A OE2   
713  N N     . LYS A 90  ? 0.1706 0.2115 0.2655 0.0085  0.0422  0.0594  459 LYS A N     
714  C CA    . LYS A 90  ? 0.1326 0.1750 0.2074 0.0050  0.0344  0.0460  459 LYS A CA    
715  C C     . LYS A 90  ? 0.1333 0.2010 0.2028 0.0070  0.0317  0.0516  459 LYS A C     
716  O O     . LYS A 90  ? 0.1611 0.2335 0.2316 0.0070  0.0310  0.0528  459 LYS A O     
717  C CB    . LYS A 90  ? 0.1488 0.1717 0.2192 -0.0018 0.0291  0.0354  459 LYS A CB    
718  C CG    . LYS A 90  ? 0.1918 0.1817 0.2555 -0.0049 0.0309  0.0267  459 LYS A CG    
719  C CD    . LYS A 90  ? 0.1985 0.1708 0.2519 -0.0151 0.0210  0.0163  459 LYS A CD    
720  C CE    . LYS A 90  ? 0.2529 0.1857 0.2873 -0.0187 0.0223  0.0047  459 LYS A CE    
721  N NZ    . LYS A 90  ? 0.3067 0.2234 0.3268 -0.0319 0.0087  -0.0044 459 LYS A NZ    
722  N N     . PRO A 91  ? 0.1504 0.2336 0.2124 0.0087  0.0304  0.0567  460 PRO A N     
723  C CA    . PRO A 91  ? 0.1490 0.2494 0.1955 0.0102  0.0280  0.0603  460 PRO A CA    
724  C C     . PRO A 91  ? 0.1827 0.2738 0.2024 0.0085  0.0234  0.0450  460 PRO A C     
725  O O     . PRO A 91  ? 0.2585 0.3547 0.2577 0.0113  0.0241  0.0450  460 PRO A O     
726  C CB    . PRO A 91  ? 0.1524 0.2706 0.1998 0.0090  0.0247  0.0727  460 PRO A CB    
727  C CG    . PRO A 91  ? 0.1393 0.2482 0.1956 0.0067  0.0238  0.0697  460 PRO A CG    
728  C CD    . PRO A 91  ? 0.1340 0.2203 0.2018 0.0092  0.0312  0.0623  460 PRO A CD    
729  N N     . TYR A 92  ? 0.1368 0.2123 0.1538 0.0050  0.0204  0.0325  461 TYR A N     
730  C CA    . TYR A 92  ? 0.1490 0.2140 0.1446 0.0037  0.0172  0.0194  461 TYR A CA    
731  C C     . TYR A 92  ? 0.1757 0.2331 0.1780 0.0062  0.0211  0.0158  461 TYR A C     
732  O O     . TYR A 92  ? 0.2286 0.2794 0.2455 0.0031  0.0200  0.0149  461 TYR A O     
733  C CB    . TYR A 92  ? 0.1392 0.1964 0.1316 -0.0017 0.0109  0.0124  461 TYR A CB    
734  C CG    . TYR A 92  ? 0.1332 0.2029 0.1282 -0.0057 0.0055  0.0220  461 TYR A CG    
735  C CD1   . TYR A 92  ? 0.1317 0.2068 0.1488 -0.0044 0.0089  0.0319  461 TYR A CD1   
736  C CD2   . TYR A 92  ? 0.2111 0.2862 0.1855 -0.0110 -0.0029 0.0227  461 TYR A CD2   
737  C CE1   . TYR A 92  ? 0.1424 0.2347 0.1692 -0.0072 0.0047  0.0466  461 TYR A CE1   
738  C CE2   . TYR A 92  ? 0.2196 0.3108 0.1998 -0.0175 -0.0114 0.0357  461 TYR A CE2   
739  C CZ    . TYR A 92  ? 0.1983 0.3015 0.2089 -0.0152 -0.0073 0.0498  461 TYR A CZ    
740  O OH    . TYR A 92  ? 0.1817 0.3066 0.2051 -0.0209 -0.0149 0.0684  461 TYR A OH    
741  N N     . SER A 93  ? 0.1831 0.2404 0.1732 0.0118  0.0260  0.0151  462 SER A N     
742  C CA    . SER A 93  ? 0.1664 0.2234 0.1689 0.0150  0.0304  0.0182  462 SER A CA    
743  C C     . SER A 93  ? 0.1915 0.2374 0.1750 0.0199  0.0347  0.0102  462 SER A C     
744  O O     . SER A 93  ? 0.2154 0.2527 0.1712 0.0236  0.0376  0.0041  462 SER A O     
745  C CB    . SER A 93  ? 0.1992 0.2716 0.2170 0.0215  0.0382  0.0346  462 SER A CB    
746  O OG    . SER A 93  ? 0.2983 0.3732 0.2929 0.0313  0.0472  0.0367  462 SER A OG    
747  N N     . CYS A 94  ? 0.1577 0.2018 0.1546 0.0194  0.0346  0.0110  463 CYS A N     
748  C CA    . CYS A 94  ? 0.1568 0.1912 0.1426 0.0265  0.0420  0.0076  463 CYS A CA    
749  C C     . CYS A 94  ? 0.1771 0.2183 0.1640 0.0402  0.0573  0.0205  463 CYS A C     
750  O O     . CYS A 94  ? 0.1768 0.2369 0.1922 0.0416  0.0595  0.0376  463 CYS A O     
751  C CB    . CYS A 94  ? 0.1627 0.1985 0.1669 0.0215  0.0368  0.0092  463 CYS A CB    
752  S SG    . CYS A 94  ? 0.1559 0.1834 0.1571 0.0322  0.0484  0.0113  463 CYS A SG    
753  N N     . SER A 95  ? 0.2228 0.2468 0.1773 0.0502  0.0682  0.0134  464 SER A N     
754  C CA    . SER A 95  ? 0.2666 0.2916 0.2174 0.0649  0.0840  0.0253  464 SER A CA    
755  C C     . SER A 95  ? 0.2477 0.2780 0.2249 0.0724  0.0919  0.0395  464 SER A C     
756  O O     . SER A 95  ? 0.2623 0.2987 0.2494 0.0829  0.1012  0.0562  464 SER A O     
757  C CB    . SER A 95  ? 0.3310 0.3273 0.2372 0.0686  0.0876  0.0107  464 SER A CB    
758  O OG    . SER A 95  ? 0.3980 0.3695 0.2892 0.0667  0.0868  -0.0028 464 SER A OG    
759  N N     . ILE A 96  ? 0.1754 0.2048 0.1652 0.0675  0.0881  0.0362  465 ILE A N     
760  C CA    . ILE A 96  ? 0.1800 0.2157 0.1947 0.0738  0.0943  0.0523  465 ILE A CA    
761  C C     . ILE A 96  ? 0.1630 0.2313 0.2222 0.0663  0.0855  0.0743  465 ILE A C     
762  O O     . ILE A 96  ? 0.1602 0.2391 0.2398 0.0727  0.0901  0.0965  465 ILE A O     
763  C CB    . ILE A 96  ? 0.1908 0.2110 0.1994 0.0719  0.0936  0.0411  465 ILE A CB    
764  C CG1   . ILE A 96  ? 0.2854 0.2684 0.2500 0.0760  0.0988  0.0209  465 ILE A CG1   
765  C CG2   . ILE A 96  ? 0.1775 0.2090 0.2160 0.0774  0.0990  0.0620  465 ILE A CG2   
766  C CD1   . ILE A 96  ? 0.3439 0.3080 0.3028 0.0731  0.0972  0.0103  465 ILE A CD1   
767  N N     . CYS A 97  ? 0.1361 0.2152 0.2074 0.0501  0.0693  0.0687  466 CYS A N     
768  C CA    . CYS A 97  ? 0.1295 0.2318 0.2373 0.0372  0.0552  0.0861  466 CYS A CA    
769  C C     . CYS A 97  ? 0.1212 0.2282 0.2342 0.0272  0.0452  0.0860  466 CYS A C     
770  O O     . CYS A 97  ? 0.1438 0.2659 0.2858 0.0154  0.0333  0.1014  466 CYS A O     
771  C CB    . CYS A 97  ? 0.1378 0.2371 0.2491 0.0225  0.0384  0.0794  466 CYS A CB    
772  S SG    . CYS A 97  ? 0.1364 0.2126 0.2175 0.0090  0.0236  0.0507  466 CYS A SG    
773  N N     . GLY A 98  ? 0.1219 0.2159 0.2087 0.0302  0.0485  0.0710  467 GLY A N     
774  C CA    . GLY A 98  ? 0.1577 0.2571 0.2525 0.0238  0.0427  0.0742  467 GLY A CA    
775  C C     . GLY A 98  ? 0.1521 0.2382 0.2424 0.0078  0.0265  0.0604  467 GLY A C     
776  O O     . GLY A 98  ? 0.1794 0.2660 0.2773 0.0030  0.0231  0.0634  467 GLY A O     
777  N N     . LYS A 99  ? 0.1457 0.2187 0.2239 0.0011  0.0186  0.0468  468 LYS A N     
778  C CA    . LYS A 99  ? 0.1263 0.1829 0.1946 -0.0104 0.0075  0.0337  468 LYS A CA    
779  C C     . LYS A 99  ? 0.1198 0.1688 0.1715 -0.0057 0.0126  0.0238  468 LYS A C     
780  O O     . LYS A 99  ? 0.1302 0.1789 0.1658 0.0019  0.0188  0.0178  468 LYS A O     
781  C CB    . LYS A 99  ? 0.1725 0.2194 0.2289 -0.0153 0.0010  0.0236  468 LYS A CB    
782  C CG    . LYS A 99  ? 0.1858 0.2129 0.2276 -0.0250 -0.0077 0.0114  468 LYS A CG    
783  C CD    . LYS A 99  ? 0.2039 0.2247 0.2334 -0.0287 -0.0132 0.0045  468 LYS A CD    
784  C CE    . LYS A 99  ? 0.2234 0.2549 0.2671 -0.0377 -0.0235 0.0167  468 LYS A CE    
785  N NZ    . LYS A 99  ? 0.2773 0.2984 0.3219 -0.0529 -0.0370 0.0193  468 LYS A NZ    
786  N N     A CYS A 100 ? 0.1345 0.1759 0.1901 -0.0111 0.0093  0.0234  469 CYS A N     
787  N N     B CYS A 100 ? 0.1347 0.1762 0.1904 -0.0111 0.0094  0.0234  469 CYS A N     
788  C CA    A CYS A 100 ? 0.1487 0.1886 0.1970 -0.0067 0.0144  0.0207  469 CYS A CA    
789  C CA    B CYS A 100 ? 0.1488 0.1888 0.1971 -0.0067 0.0144  0.0208  469 CYS A CA    
790  C C     A CYS A 100 ? 0.1441 0.1660 0.1806 -0.0100 0.0122  0.0096  469 CYS A C     
791  C C     B CYS A 100 ? 0.1440 0.1659 0.1807 -0.0100 0.0123  0.0097  469 CYS A C     
792  O O     A CYS A 100 ? 0.1464 0.1519 0.1785 -0.0167 0.0071  0.0038  469 CYS A O     
793  O O     B CYS A 100 ? 0.1480 0.1534 0.1805 -0.0167 0.0071  0.0040  469 CYS A O     
794  C CB    A CYS A 100 ? 0.1589 0.2061 0.2258 -0.0064 0.0172  0.0338  469 CYS A CB    
795  C CB    B CYS A 100 ? 0.1590 0.2065 0.2259 -0.0062 0.0173  0.0340  469 CYS A CB    
796  S SG    A CYS A 100 ? 0.1313 0.2030 0.2153 0.0004  0.0232  0.0522  469 CYS A SG    
797  S SG    B CYS A 100 ? 0.2090 0.2380 0.2914 -0.0187 0.0093  0.0367  469 CYS A SG    
798  N N     . PHE A 101 ? 0.1305 0.1559 0.1606 -0.0052 0.0163  0.0087  470 PHE A N     
799  C CA    . PHE A 101 ? 0.1458 0.1592 0.1689 -0.0049 0.0180  0.0034  470 PHE A CA    
800  C C     . PHE A 101 ? 0.1222 0.1441 0.1541 -0.0003 0.0237  0.0133  470 PHE A C     
801  O O     . PHE A 101 ? 0.1542 0.1945 0.1897 0.0014  0.0232  0.0213  470 PHE A O     
802  C CB    . PHE A 101 ? 0.1510 0.1662 0.1621 -0.0046 0.0152  -0.0035 470 PHE A CB    
803  C CG    . PHE A 101 ? 0.1491 0.1603 0.1543 -0.0076 0.0107  -0.0100 470 PHE A CG    
804  C CD1   . PHE A 101 ? 0.1945 0.1926 0.1923 -0.0106 0.0084  -0.0160 470 PHE A CD1   
805  C CD2   . PHE A 101 ? 0.1726 0.1933 0.1787 -0.0060 0.0104  -0.0081 470 PHE A CD2   
806  C CE1   . PHE A 101 ? 0.2509 0.2499 0.2467 -0.0138 0.0034  -0.0183 470 PHE A CE1   
807  C CE2   . PHE A 101 ? 0.1857 0.2055 0.1918 -0.0071 0.0083  -0.0097 470 PHE A CE2   
808  C CZ    . PHE A 101 ? 0.2087 0.2199 0.2118 -0.0119 0.0036  -0.0139 470 PHE A CZ    
809  N N     . SER A 102 ? 0.1402 0.1483 0.1739 0.0027  0.0302  0.0144  471 SER A N     
810  C CA    . SER A 102 ? 0.1231 0.1428 0.1698 0.0085  0.0371  0.0280  471 SER A CA    
811  C C     . SER A 102 ? 0.1168 0.1505 0.1617 0.0089  0.0342  0.0314  471 SER A C     
812  O O     . SER A 102 ? 0.1303 0.1840 0.1885 0.0104  0.0346  0.0466  471 SER A O     
813  C CB    . SER A 102 ? 0.1345 0.1306 0.1855 0.0146  0.0496  0.0307  471 SER A CB    
814  O OG    . SER A 102 ? 0.1648 0.1395 0.1990 0.0171  0.0539  0.0209  471 SER A OG    
815  N N     . ASP A 103 ? 0.1130 0.1388 0.1446 0.0063  0.0299  0.0202  472 ASP A N     
816  C CA    . ASP A 103 ? 0.1160 0.1527 0.1488 0.0051  0.0262  0.0242  472 ASP A CA    
817  C C     . ASP A 103 ? 0.1155 0.1597 0.1373 -0.0027 0.0139  0.0172  472 ASP A C     
818  O O     . ASP A 103 ? 0.1171 0.1510 0.1271 -0.0042 0.0118  0.0050  472 ASP A O     
819  C CB    . ASP A 103 ? 0.1363 0.1566 0.1616 0.0090  0.0321  0.0181  472 ASP A CB    
820  C CG    . ASP A 103 ? 0.0975 0.1315 0.1322 0.0093  0.0308  0.0284  472 ASP A CG    
821  O OD1   . ASP A 103 ? 0.1348 0.1732 0.1834 0.0175  0.0417  0.0432  472 ASP A OD1   
822  O OD2   . ASP A 103 ? 0.1224 0.1620 0.1526 0.0020  0.0200  0.0235  472 ASP A OD2   
823  N N     . SER A 104 ? 0.1217 0.1820 0.1462 -0.0079 0.0058  0.0260  473 SER A N     
824  C CA    . SER A 104 ? 0.1504 0.2091 0.1563 -0.0156 -0.0051 0.0174  473 SER A CA    
825  C C     . SER A 104 ? 0.1497 0.1957 0.1485 -0.0182 -0.0082 0.0072  473 SER A C     
826  O O     . SER A 104 ? 0.1619 0.1960 0.1438 -0.0199 -0.0108 -0.0046 473 SER A O     
827  C CB    . SER A 104 ? 0.1584 0.2333 0.1635 -0.0242 -0.0166 0.0291  473 SER A CB    
828  O OG    . SER A 104 ? 0.2081 0.2951 0.2327 -0.0279 -0.0206 0.0431  473 SER A OG    
829  N N     . SER A 105 ? 0.1300 0.1784 0.1426 -0.0167 -0.0058 0.0135  474 SER A N     
830  C CA    . SER A 105 ? 0.1038 0.1430 0.1131 -0.0185 -0.0079 0.0068  474 SER A CA    
831  C C     . SER A 105 ? 0.1334 0.1589 0.1343 -0.0128 -0.0009 -0.0049 474 SER A C     
832  O O     . SER A 105 ? 0.1445 0.1620 0.1388 -0.0146 -0.0035 -0.0124 474 SER A O     
833  C CB    . SER A 105 ? 0.0961 0.1456 0.1244 -0.0174 -0.0062 0.0212  474 SER A CB    
834  O OG    . SER A 105 ? 0.1386 0.2042 0.1785 -0.0268 -0.0175 0.0353  474 SER A OG    
835  N N     . ALA A 106 ? 0.1259 0.1476 0.1276 -0.0071 0.0070  -0.0051 475 ALA A N     
836  C CA    . ALA A 106 ? 0.1427 0.1527 0.1360 -0.0059 0.0090  -0.0142 475 ALA A CA    
837  C C     . ALA A 106 ? 0.1484 0.1590 0.1372 -0.0080 0.0054  -0.0192 475 ALA A C     
838  O O     . ALA A 106 ? 0.1654 0.1721 0.1516 -0.0084 0.0044  -0.0232 475 ALA A O     
839  C CB    . ALA A 106 ? 0.1554 0.1557 0.1471 -0.0026 0.0155  -0.0139 475 ALA A CB    
840  N N     . LYS A 107 ? 0.1366 0.1535 0.1249 -0.0082 0.0048  -0.0165 476 LYS A N     
841  C CA    . LYS A 107 ? 0.1303 0.1465 0.1114 -0.0068 0.0054  -0.0194 476 LYS A CA    
842  C C     . LYS A 107 ? 0.1731 0.1805 0.1426 -0.0078 0.0032  -0.0256 476 LYS A C     
843  O O     . LYS A 107 ? 0.1948 0.1966 0.1624 -0.0042 0.0072  -0.0281 476 LYS A O     
844  C CB    . LYS A 107 ? 0.1760 0.2003 0.1542 -0.0056 0.0065  -0.0142 476 LYS A CB    
845  C CG    . LYS A 107 ? 0.1859 0.2086 0.1525 -0.0008 0.0110  -0.0153 476 LYS A CG    
846  C CD    . LYS A 107 ? 0.2420 0.2558 0.1833 -0.0028 0.0077  -0.0209 476 LYS A CD    
847  C CE    . LYS A 107 ? 0.3206 0.3271 0.2428 0.0055  0.0168  -0.0224 476 LYS A CE    
848  N NZ    . LYS A 107 ? 0.3989 0.3869 0.2855 0.0024  0.0130  -0.0315 476 LYS A NZ    
849  N N     . ARG A 108 ? 0.1599 0.1656 0.1240 -0.0134 -0.0032 -0.0260 477 ARG A N     
850  C CA    . ARG A 108 ? 0.2033 0.1944 0.1549 -0.0167 -0.0069 -0.0326 477 ARG A CA    
851  C C     . ARG A 108 ? 0.2135 0.2006 0.1754 -0.0145 -0.0041 -0.0338 477 ARG A C     
852  O O     . ARG A 108 ? 0.2200 0.1939 0.1751 -0.0118 -0.0006 -0.0385 477 ARG A O     
853  C CB    . ARG A 108 ? 0.2178 0.2103 0.1672 -0.0271 -0.0185 -0.0293 477 ARG A CB    
854  C CG    . ARG A 108 ? 0.3031 0.2733 0.2323 -0.0344 -0.0256 -0.0377 477 ARG A CG    
855  C CD    . ARG A 108 ? 0.3697 0.3446 0.3012 -0.0491 -0.0418 -0.0305 477 ARG A CD    
856  N NE    . ARG A 108 ? 0.4284 0.4191 0.3562 -0.0532 -0.0478 -0.0226 477 ARG A NE    
857  C CZ    . ARG A 108 ? 0.4375 0.4551 0.3921 -0.0531 -0.0487 -0.0062 477 ARG A CZ    
858  N NH1   . ARG A 108 ? 0.3754 0.4038 0.3571 -0.0483 -0.0428 0.0022  477 ARG A NH1   
859  N NH2   . ARG A 108 ? 0.4548 0.4880 0.4079 -0.0564 -0.0535 0.0033  477 ARG A NH2   
860  N N     . ARG A 109 ? 0.1553 0.1524 0.1318 -0.0143 -0.0039 -0.0284 478 ARG A N     
861  C CA    . ARG A 109 ? 0.1637 0.1597 0.1472 -0.0123 -0.0020 -0.0276 478 ARG A CA    
862  C C     . ARG A 109 ? 0.1861 0.1821 0.1703 -0.0080 0.0026  -0.0283 478 ARG A C     
863  O O     . ARG A 109 ? 0.2066 0.2002 0.1951 -0.0061 0.0044  -0.0269 478 ARG A O     
864  C CB    . ARG A 109 ? 0.1491 0.1526 0.1398 -0.0114 -0.0008 -0.0219 478 ARG A CB    
865  C CG    . ARG A 109 ? 0.1680 0.1717 0.1610 -0.0093 0.0011  -0.0199 478 ARG A CG    
866  C CD    . ARG A 109 ? 0.1664 0.1719 0.1572 -0.0059 0.0056  -0.0154 478 ARG A CD    
867  N NE    . ARG A 109 ? 0.1664 0.1660 0.1479 -0.0046 0.0084  -0.0190 478 ARG A NE    
868  C CZ    . ARG A 109 ? 0.1562 0.1490 0.1301 0.0001  0.0154  -0.0172 478 ARG A CZ    
869  N NH1   . ARG A 109 ? 0.1437 0.1388 0.1192 0.0058  0.0219  -0.0097 478 ARG A NH1   
870  N NH2   . ARG A 109 ? 0.1745 0.1563 0.1394 0.0002  0.0176  -0.0215 478 ARG A NH2   
871  N N     . HIS A 110 ? 0.1579 0.1586 0.1421 -0.0067 0.0042  -0.0272 479 HIS A N     
872  C CA    . HIS A 110 ? 0.1561 0.1616 0.1473 -0.0045 0.0065  -0.0228 479 HIS A CA    
873  C C     . HIS A 110 ? 0.1819 0.1832 0.1721 0.0020  0.0136  -0.0215 479 HIS A C     
874  O O     . HIS A 110 ? 0.1827 0.1880 0.1835 0.0053  0.0170  -0.0146 479 HIS A O     
875  C CB    . HIS A 110 ? 0.1315 0.1424 0.1262 -0.0060 0.0057  -0.0196 479 HIS A CB    
876  C CG    . HIS A 110 ? 0.1434 0.1630 0.1498 -0.0036 0.0083  -0.0107 479 HIS A CG    
877  N ND1   . HIS A 110 ? 0.1404 0.1674 0.1585 -0.0084 0.0029  -0.0028 479 HIS A ND1   
878  C CD2   . HIS A 110 ? 0.1548 0.1786 0.1636 0.0032  0.0159  -0.0056 479 HIS A CD2   
879  C CE1   . HIS A 110 ? 0.1562 0.1950 0.1900 -0.0050 0.0067  0.0096  479 HIS A CE1   
880  N NE2   . HIS A 110 ? 0.1526 0.1889 0.1804 0.0038  0.0166  0.0079  479 HIS A NE2   
881  N N     . CYS A 111 ? 0.1887 0.1807 0.1643 0.0044  0.0168  -0.0268 480 CYS A N     
882  C CA    . CYS A 111 ? 0.2041 0.1846 0.1698 0.0132  0.0273  -0.0272 480 CYS A CA    
883  C C     . CYS A 111 ? 0.2052 0.1712 0.1702 0.0159  0.0312  -0.0293 480 CYS A C     
884  O O     . CYS A 111 ? 0.2192 0.1761 0.1826 0.0263  0.0440  -0.0256 480 CYS A O     
885  C CB    . CYS A 111 ? 0.2427 0.2110 0.1826 0.0134  0.0281  -0.0347 480 CYS A CB    
886  S SG    . CYS A 111 ? 0.2579 0.2451 0.2021 0.0137  0.0275  -0.0278 480 CYS A SG    
887  N N     . ILE A 112 ? 0.2277 0.1914 0.1960 0.0082  0.0225  -0.0327 481 ILE A N     
888  C CA    . ILE A 112 ? 0.2518 0.2029 0.2241 0.0100  0.0256  -0.0325 481 ILE A CA    
889  C C     . ILE A 112 ? 0.2069 0.1728 0.2015 0.0167  0.0323  -0.0193 481 ILE A C     
890  O O     . ILE A 112 ? 0.2047 0.1600 0.2047 0.0239  0.0417  -0.0151 481 ILE A O     
891  C CB    . ILE A 112 ? 0.2939 0.2455 0.2706 0.0002  0.0146  -0.0343 481 ILE A CB    
892  C CG1   . ILE A 112 ? 0.3595 0.2993 0.3187 -0.0084 0.0061  -0.0425 481 ILE A CG1   
893  C CG2   . ILE A 112 ? 0.3515 0.2929 0.3379 0.0018  0.0177  -0.0310 481 ILE A CG2   
894  C CD1   . ILE A 112 ? 0.3954 0.3407 0.3658 -0.0178 -0.0044 -0.0385 481 ILE A CD1   
895  N N     . LEU A 113 ? 0.1635 0.1526 0.1713 0.0137  0.0270  -0.0113 482 LEU A N     
896  C CA    . LEU A 113 ? 0.1545 0.1618 0.1841 0.0156  0.0279  0.0041  482 LEU A CA    
897  C C     . LEU A 113 ? 0.1792 0.1880 0.2201 0.0276  0.0422  0.0159  482 LEU A C     
898  O O     . LEU A 113 ? 0.1842 0.2056 0.2469 0.0319  0.0464  0.0320  482 LEU A O     
899  C CB    . LEU A 113 ? 0.1582 0.1834 0.1925 0.0065  0.0163  0.0083  482 LEU A CB    
900  C CG    . LEU A 113 ? 0.1397 0.1616 0.1614 -0.0017 0.0067  -0.0009 482 LEU A CG    
901  C CD1   . LEU A 113 ? 0.1586 0.1881 0.1775 -0.0101 -0.0028 0.0013  482 LEU A CD1   
902  C CD2   . LEU A 113 ? 0.1582 0.1806 0.1834 -0.0016 0.0060  0.0022  482 LEU A CD2   
903  N N     . HIS A 114 ? 0.1658 0.1639 0.1932 0.0345  0.0511  0.0111  483 HIS A N     
904  C CA    . HIS A 114 ? 0.1859 0.1833 0.2217 0.0499  0.0695  0.0241  483 HIS A CA    
905  C C     . HIS A 114 ? 0.2255 0.1952 0.2522 0.0614  0.0850  0.0210  483 HIS A C     
906  O O     . HIS A 114 ? 0.2666 0.2353 0.3036 0.0753  0.1020  0.0356  483 HIS A O     
907  C CB    . HIS A 114 ? 0.1797 0.1725 0.1994 0.0557  0.0767  0.0208  483 HIS A CB    
908  C CG    . HIS A 114 ? 0.1638 0.1829 0.1988 0.0466  0.0649  0.0285  483 HIS A CG    
909  N ND1   . HIS A 114 ? 0.1609 0.2083 0.2291 0.0467  0.0642  0.0515  483 HIS A ND1   
910  C CD2   . HIS A 114 ? 0.1904 0.2104 0.2138 0.0365  0.0531  0.0179  483 HIS A CD2   
911  C CE1   . HIS A 114 ? 0.1377 0.1978 0.2111 0.0358  0.0515  0.0522  483 HIS A CE1   
912  N NE2   . HIS A 114 ? 0.1695 0.2128 0.2161 0.0309  0.0463  0.0319  483 HIS A NE2   
913  N N     . THR A 115 ? 0.2290 0.1753 0.2372 0.0543  0.0782  0.0042  484 THR A N     
914  C CA    . THR A 115 ? 0.2729 0.1875 0.2726 0.0626  0.0910  0.0005  484 THR A CA    
915  C C     . THR A 115 ? 0.2471 0.1786 0.2806 0.0640  0.0918  0.0174  484 THR A C     
916  O O     . THR A 115 ? 0.3073 0.2200 0.3428 0.0724  0.1048  0.0221  484 THR A O     
917  C CB    . THR A 115 ? 0.3458 0.2281 0.3145 0.0513  0.0805  -0.0219 484 THR A CB    
918  O OG1   . THR A 115 ? 0.3394 0.2412 0.3243 0.0369  0.0621  -0.0212 484 THR A OG1   
919  C CG2   . THR A 115 ? 0.3931 0.2673 0.3305 0.0464  0.0745  -0.0352 484 THR A CG2   
920  N N     . GLY A 116 ? 0.2416 0.2083 0.2970 0.0530  0.0758  0.0271  485 GLY A N     
921  C CA    . GLY A 116 ? 0.2646 0.2519 0.3494 0.0527  0.0741  0.0450  485 GLY A CA    
922  C C     . GLY A 116 ? 0.2571 0.2294 0.3398 0.0478  0.0697  0.0382  485 GLY A C     
923  O O     . GLY A 116 ? 0.2664 0.2554 0.3735 0.0489  0.0698  0.0548  485 GLY A O     
924  N N     . LYS A 117 ? 0.2325 0.1766 0.2894 0.0414  0.0647  0.0176  486 LYS A N     
925  C CA    . LYS A 117 ? 0.2811 0.2107 0.3403 0.0356  0.0600  0.0140  486 LYS A CA    
926  C C     . LYS A 117 ? 0.2239 0.1845 0.2959 0.0255  0.0449  0.0208  486 LYS A C     
927  O O     . LYS A 117 ? 0.2534 0.2283 0.3151 0.0184  0.0346  0.0152  486 LYS A O     
928  C CB    . LYS A 117 ? 0.3474 0.2403 0.3766 0.0285  0.0555  -0.0070 486 LYS A CB    
929  C CG    . LYS A 117 ? 0.4496 0.3006 0.4544 0.0385  0.0714  -0.0171 486 LYS A CG    
930  C CD    . LYS A 117 ? 0.5150 0.3292 0.4852 0.0265  0.0611  -0.0378 486 LYS A CD    
931  C CE    . LYS A 117 ? 0.5888 0.3728 0.5312 0.0335  0.0702  -0.0460 486 LYS A CE    
932  N NZ    . LYS A 117 ? 0.6465 0.4173 0.6039 0.0429  0.0838  -0.0368 486 LYS A NZ    
933  N N     . LYS A 118 ? 0.2166 0.1853 0.3093 0.0263  0.0457  0.0338  487 LYS A N     
934  C CA    . LYS A 118 ? 0.2103 0.2047 0.3112 0.0193  0.0346  0.0416  487 LYS A CA    
935  C C     . LYS A 118 ? 0.1866 0.1673 0.2979 0.0167  0.0344  0.0439  487 LYS A C     
936  O O     . LYS A 118 ? 0.1925 0.1819 0.3265 0.0211  0.0393  0.0601  487 LYS A O     
937  C CB    . LYS A 118 ? 0.2182 0.2452 0.3362 0.0220  0.0341  0.0615  487 LYS A CB    
938  C CG    . LYS A 118 ? 0.2605 0.3028 0.3713 0.0204  0.0299  0.0619  487 LYS A CG    
939  C CD    . LYS A 118 ? 0.2944 0.3690 0.4227 0.0194  0.0253  0.0843  487 LYS A CD    
940  C CE    . LYS A 118 ? 0.3447 0.4337 0.4663 0.0131  0.0165  0.0855  487 LYS A CE    
941  N NZ    . LYS A 118 ? 0.3786 0.5000 0.5193 0.0089  0.0087  0.1105  487 LYS A NZ    
942  N N     . PRO A 119 ? 0.2093 0.1707 0.3078 0.0086  0.0276  0.0307  488 PRO A N     
943  C CA    . PRO A 119 ? 0.2338 0.1779 0.3446 0.0034  0.0254  0.0337  488 PRO A CA    
944  C C     . PRO A 119 ? 0.1806 0.1517 0.3098 -0.0002 0.0191  0.0487  488 PRO A C     
945  O O     . PRO A 119 ? 0.1759 0.1372 0.3207 -0.0059 0.0157  0.0548  488 PRO A O     
946  C CB    . PRO A 119 ? 0.2903 0.2051 0.3779 -0.0066 0.0173  0.0154  488 PRO A CB    
947  C CG    . PRO A 119 ? 0.2617 0.1964 0.3337 -0.0077 0.0124  0.0091  488 PRO A CG    
948  C CD    . PRO A 119 ? 0.2189 0.1740 0.2935 0.0026  0.0207  0.0149  488 PRO A CD    
949  N N     . PHE A 120 ? 0.1614 0.1636 0.2875 0.0030  0.0179  0.0554  489 PHE A N     
950  C CA    . PHE A 120 ? 0.1453 0.1712 0.2812 0.0028  0.0155  0.0694  489 PHE A CA    
951  C C     . PHE A 120 ? 0.1786 0.2281 0.3249 0.0099  0.0203  0.0866  489 PHE A C     
952  O O     . PHE A 120 ? 0.1905 0.2539 0.3217 0.0120  0.0194  0.0859  489 PHE A O     
953  C CB    . PHE A 120 ? 0.1535 0.1893 0.2689 0.0013  0.0117  0.0625  489 PHE A CB    
954  C CG    . PHE A 120 ? 0.1633 0.1811 0.2696 -0.0060 0.0060  0.0486  489 PHE A CG    
955  C CD1   . PHE A 120 ? 0.1308 0.1419 0.2154 -0.0064 0.0049  0.0335  489 PHE A CD1   
956  C CD2   . PHE A 120 ? 0.1725 0.1818 0.2938 -0.0140 0.0000  0.0529  489 PHE A CD2   
957  C CE1   . PHE A 120 ? 0.1365 0.1338 0.2119 -0.0132 -0.0008 0.0229  489 PHE A CE1   
958  C CE2   . PHE A 120 ? 0.1973 0.1924 0.3088 -0.0231 -0.0083 0.0423  489 PHE A CE2   
959  C CZ    . PHE A 120 ? 0.1509 0.1405 0.2383 -0.0220 -0.0081 0.0272  489 PHE A CZ    
960  N N     . SER A 121 ? 0.1742 0.1340 0.2117 -0.0024 -0.0278 -0.0191 490 SER A N     
961  C CA    . SER A 121 ? 0.1874 0.1384 0.2266 -0.0040 -0.0360 -0.0103 490 SER A CA    
962  C C     . SER A 121 ? 0.1934 0.1343 0.2233 -0.0263 -0.0384 -0.0024 490 SER A C     
963  O O     . SER A 121 ? 0.1920 0.1199 0.2151 -0.0383 -0.0398 -0.0023 490 SER A O     
964  C CB    . SER A 121 ? 0.2160 0.1353 0.2458 0.0135  -0.0478 -0.0141 490 SER A CB    
965  O OG    . SER A 121 ? 0.2627 0.1693 0.2914 0.0130  -0.0586 -0.0016 490 SER A OG    
966  N N     . CYS A 122 ? 0.1981 0.1498 0.2268 -0.0325 -0.0395 0.0048  491 CYS A N     
967  C CA    . CYS A 122 ? 0.2201 0.1668 0.2309 -0.0487 -0.0392 0.0118  491 CYS A CA    
968  C C     . CYS A 122 ? 0.1887 0.1091 0.1877 -0.0545 -0.0494 0.0243  491 CYS A C     
969  O O     . CYS A 122 ? 0.2390 0.1438 0.2368 -0.0439 -0.0624 0.0310  491 CYS A O     
970  C CB    . CYS A 122 ? 0.2280 0.1851 0.2304 -0.0525 -0.0436 0.0135  491 CYS A CB    
971  S SG    . CYS A 122 ? 0.2307 0.1835 0.1967 -0.0660 -0.0417 0.0200  491 CYS A SG    
972  N N     . PRO A 123 ? 0.2135 0.1297 0.2057 -0.0711 -0.0448 0.0311  492 PRO A N     
973  C CA    . PRO A 123 ? 0.2487 0.1354 0.2293 -0.0822 -0.0552 0.0481  492 PRO A CA    
974  C C     . PRO A 123 ? 0.2786 0.1596 0.2359 -0.0873 -0.0609 0.0673  492 PRO A C     
975  O O     . PRO A 123 ? 0.3123 0.1659 0.2586 -0.0907 -0.0712 0.0830  492 PRO A O     
976  C CB    . PRO A 123 ? 0.2604 0.1691 0.2482 -0.0977 -0.0440 0.0506  492 PRO A CB    
977  C CG    . PRO A 123 ? 0.2239 0.1714 0.2169 -0.0987 -0.0278 0.0437  492 PRO A CG    
978  C CD    . PRO A 123 ? 0.2111 0.1555 0.2098 -0.0791 -0.0296 0.0262  492 PRO A CD    
979  N N     . GLU A 124 ? 0.2825 0.1916 0.2292 -0.0832 -0.0546 0.0623  493 GLU A N     
980  C CA    . GLU A 124 ? 0.3321 0.2413 0.2485 -0.0864 -0.0619 0.0776  493 GLU A CA    
981  C C     . GLU A 124 ? 0.3522 0.2558 0.2725 -0.0703 -0.0820 0.0784  493 GLU A C     
982  O O     . GLU A 124 ? 0.4035 0.2910 0.3055 -0.0682 -0.0970 0.0986  493 GLU A O     
983  C CB    . GLU A 124 ? 0.3433 0.2813 0.2358 -0.0902 -0.0479 0.0685  493 GLU A CB    
984  C CG    . GLU A 124 ? 0.4255 0.3857 0.3208 -0.0981 -0.0247 0.0670  493 GLU A CG    
985  C CD    . GLU A 124 ? 0.5599 0.5230 0.4482 -0.1171 -0.0194 0.0954  493 GLU A CD    
986  O OE1   . GLU A 124 ? 0.6331 0.5795 0.4963 -0.1226 -0.0300 0.1166  493 GLU A OE1   
987  O OE2   . GLU A 124 ? 0.5930 0.5783 0.5039 -0.1272 -0.0062 0.0984  493 GLU A OE2   
988  N N     . CYS A 125 ? 0.2970 0.2193 0.2432 -0.0589 -0.0829 0.0607  494 CYS A N     
989  C CA    . CYS A 125 ? 0.3263 0.2638 0.2870 -0.0452 -0.1007 0.0636  494 CYS A CA    
990  C C     . CYS A 125 ? 0.3061 0.2517 0.3046 -0.0244 -0.1005 0.0568  494 CYS A C     
991  O O     . CYS A 125 ? 0.2875 0.2566 0.3058 -0.0085 -0.1137 0.0629  494 CYS A O     
992  C CB    . CYS A 125 ? 0.3279 0.2940 0.2834 -0.0554 -0.1058 0.0538  494 CYS A CB    
993  S SG    . CYS A 125 ? 0.3005 0.2819 0.2825 -0.0605 -0.0908 0.0321  494 CYS A SG    
994  N N     . GLY A 126 ? 0.2653 0.1995 0.2734 -0.0219 -0.0862 0.0449  495 GLY A N     
995  C CA    . GLY A 126 ? 0.2688 0.2096 0.3014 0.0019  -0.0837 0.0368  495 GLY A CA    
996  C C     . GLY A 126 ? 0.2290 0.2168 0.2897 0.0041  -0.0740 0.0292  495 GLY A C     
997  O O     . GLY A 126 ? 0.1994 0.2050 0.2795 0.0264  -0.0682 0.0250  495 GLY A O     
998  N N     . LEU A 127 ? 0.2346 0.2399 0.2945 -0.0176 -0.0720 0.0280  496 LEU A N     
999  C CA    . LEU A 127 ? 0.2358 0.2763 0.3216 -0.0226 -0.0647 0.0252  496 LEU A CA    
1000 C C     . LEU A 127 ? 0.2140 0.2478 0.3005 -0.0165 -0.0465 0.0163  496 LEU A C     
1001 O O     . LEU A 127 ? 0.2375 0.2436 0.3031 -0.0229 -0.0402 0.0089  496 LEU A O     
1002 C CB    . LEU A 127 ? 0.2778 0.3157 0.3511 -0.0486 -0.0707 0.0225  496 LEU A CB    
1003 C CG    . LEU A 127 ? 0.3347 0.4042 0.4361 -0.0636 -0.0743 0.0261  496 LEU A CG    
1004 C CD1   . LEU A 127 ? 0.3368 0.4595 0.4768 -0.0563 -0.0870 0.0407  496 LEU A CD1   
1005 C CD2   . LEU A 127 ? 0.3603 0.4020 0.4314 -0.0843 -0.0811 0.0164  496 LEU A CD2   
1006 N N     . GLN A 128 ? 0.1742 0.2416 0.2854 -0.0029 -0.0379 0.0190  497 GLN A N     
1007 C CA    . GLN A 128 ? 0.1415 0.2068 0.2476 0.0076  -0.0223 0.0120  497 GLN A CA    
1008 C C     . GLN A 128 ? 0.1578 0.2400 0.2736 -0.0090 -0.0125 0.0182  497 GLN A C     
1009 O O     . GLN A 128 ? 0.1847 0.2962 0.3245 -0.0232 -0.0156 0.0302  497 GLN A O     
1010 C CB    . GLN A 128 ? 0.1715 0.2609 0.2875 0.0395  -0.0161 0.0110  497 GLN A CB    
1011 C CG    . GLN A 128 ? 0.2607 0.3155 0.3610 0.0605  -0.0282 0.0037  497 GLN A CG    
1012 C CD    . GLN A 128 ? 0.3601 0.4329 0.4641 0.1009  -0.0218 -0.0018 497 GLN A CD    
1013 O OE1   . GLN A 128 ? 0.4421 0.4812 0.5177 0.1195  -0.0194 -0.0187 497 GLN A OE1   
1014 N NE2   . GLN A 128 ? 0.3478 0.4767 0.4857 0.1163  -0.0202 0.0115  497 GLN A NE2   
1015 N N     . PHE A 129 ? 0.1601 0.2224 0.2582 -0.0086 -0.0034 0.0120  498 PHE A N     
1016 C CA    . PHE A 129 ? 0.1746 0.2378 0.2744 -0.0211 0.0045  0.0196  498 PHE A CA    
1017 C C     . PHE A 129 ? 0.1808 0.2555 0.2725 -0.0044 0.0176  0.0211  498 PHE A C     
1018 O O     . PHE A 129 ? 0.1603 0.2245 0.2344 0.0114  0.0169  0.0084  498 PHE A O     
1019 C CB    . PHE A 129 ? 0.1962 0.2201 0.2755 -0.0331 0.0007  0.0118  498 PHE A CB    
1020 C CG    . PHE A 129 ? 0.2219 0.2310 0.2960 -0.0482 -0.0118 0.0080  498 PHE A CG    
1021 C CD1   . PHE A 129 ? 0.2114 0.2124 0.2731 -0.0451 -0.0183 0.0016  498 PHE A CD1   
1022 C CD2   . PHE A 129 ? 0.2442 0.2436 0.3209 -0.0678 -0.0193 0.0119  498 PHE A CD2   
1023 C CE1   . PHE A 129 ? 0.1990 0.1892 0.2475 -0.0571 -0.0299 -0.0005 498 PHE A CE1   
1024 C CE2   . PHE A 129 ? 0.2504 0.2351 0.3110 -0.0778 -0.0322 0.0041  498 PHE A CE2   
1025 C CZ    . PHE A 129 ? 0.2519 0.2345 0.2983 -0.0730 -0.0380 -0.0012 498 PHE A CZ    
1026 N N     . ALA A 130 ? 0.1479 0.2424 0.2497 -0.0108 0.0275  0.0382  499 ALA A N     
1027 C CA    . ALA A 130 ? 0.1337 0.2388 0.2199 0.0040  0.0399  0.0436  499 ALA A CA    
1028 C C     . ALA A 130 ? 0.1474 0.2159 0.2111 0.0037  0.0365  0.0383  499 ALA A C     
1029 O O     . ALA A 130 ? 0.1584 0.2325 0.2028 0.0197  0.0403  0.0366  499 ALA A O     
1030 C CB    . ALA A 130 ? 0.1647 0.3058 0.2690 -0.0056 0.0529  0.0711  499 ALA A CB    
1031 N N     . ARG A 131 ? 0.1940 0.2292 0.2578 -0.0109 0.0288  0.0349  500 ARG A N     
1032 C CA    . ARG A 131 ? 0.1841 0.1909 0.2314 -0.0056 0.0276  0.0319  500 ARG A CA    
1033 C C     . ARG A 131 ? 0.1842 0.1797 0.2270 -0.0043 0.0207  0.0136  500 ARG A C     
1034 O O     . ARG A 131 ? 0.1925 0.1788 0.2386 -0.0157 0.0156  0.0075  500 ARG A O     
1035 C CB    . ARG A 131 ? 0.1688 0.1408 0.2140 -0.0188 0.0268  0.0439  500 ARG A CB    
1036 C CG    . ARG A 131 ? 0.1868 0.1660 0.2349 -0.0242 0.0344  0.0701  500 ARG A CG    
1037 C CD    . ARG A 131 ? 0.2083 0.1687 0.2355 -0.0064 0.0374  0.0795  500 ARG A CD    
1038 N NE    . ARG A 131 ? 0.2366 0.1436 0.2509 -0.0024 0.0303  0.0716  500 ARG A NE    
1039 C CZ    . ARG A 131 ? 0.2870 0.1403 0.2933 -0.0153 0.0258  0.0830  500 ARG A CZ    
1040 N NH1   . ARG A 131 ? 0.3097 0.1623 0.3266 -0.0407 0.0271  0.1079  500 ARG A NH1   
1041 N NH2   . ARG A 131 ? 0.3228 0.1227 0.3100 -0.0027 0.0199  0.0700  500 ARG A NH2   
1042 N N     . LEU A 132 ? 0.1681 0.1708 0.2042 0.0082  0.0199  0.0078  501 LEU A N     
1043 C CA    . LEU A 132 ? 0.1980 0.2010 0.2351 0.0065  0.0165  -0.0032 501 LEU A CA    
1044 C C     . LEU A 132 ? 0.2166 0.1960 0.2461 0.0073  0.0203  -0.0051 501 LEU A C     
1045 O O     . LEU A 132 ? 0.2147 0.1941 0.2406 0.0030  0.0207  -0.0129 501 LEU A O     
1046 C CB    . LEU A 132 ? 0.1739 0.2013 0.2134 0.0159  0.0127  -0.0057 501 LEU A CB    
1047 C CG    . LEU A 132 ? 0.1884 0.2329 0.2379 0.0094  0.0102  -0.0112 501 LEU A CG    
1048 C CD1   . LEU A 132 ? 0.1970 0.2331 0.2471 -0.0079 0.0042  -0.0155 501 LEU A CD1   
1049 C CD2   . LEU A 132 ? 0.1879 0.2666 0.2478 0.0146  0.0028  -0.0104 501 LEU A CD2   
1050 N N     . ASP A 133 ? 0.2212 0.1752 0.2426 0.0139  0.0230  0.0021  502 ASP A N     
1051 C CA    . ASP A 133 ? 0.2581 0.1720 0.2626 0.0176  0.0239  -0.0044 502 ASP A CA    
1052 C C     . ASP A 133 ? 0.2429 0.1386 0.2400 -0.0025 0.0176  -0.0129 502 ASP A C     
1053 O O     . ASP A 133 ? 0.2782 0.1602 0.2569 0.0013  0.0182  -0.0265 502 ASP A O     
1054 C CB    . ASP A 133 ? 0.3199 0.1931 0.3141 0.0227  0.0232  0.0078  502 ASP A CB    
1055 C CG    . ASP A 133 ? 0.3110 0.1954 0.3047 0.0495  0.0271  0.0167  502 ASP A CG    
1056 O OD1   . ASP A 133 ? 0.3088 0.1753 0.2975 0.0517  0.0263  0.0352  502 ASP A OD1   
1057 O OD2   . ASP A 133 ? 0.3072 0.2240 0.3072 0.0672  0.0303  0.0084  502 ASP A OD2   
1058 N N     . ASN A 134 ? 0.2184 0.1204 0.2289 -0.0219 0.0116  -0.0041 503 ASN A N     
1059 C CA    . ASN A 134 ? 0.2771 0.1695 0.2847 -0.0418 0.0009  -0.0096 503 ASN A CA    
1060 C C     . ASN A 134 ? 0.2485 0.1641 0.2535 -0.0406 -0.0003 -0.0180 503 ASN A C     
1061 O O     . ASN A 134 ? 0.2814 0.1828 0.2683 -0.0491 -0.0082 -0.0266 503 ASN A O     
1062 C CB    . ASN A 134 ? 0.2575 0.1692 0.2905 -0.0608 -0.0046 0.0061  503 ASN A CB    
1063 C CG    . ASN A 134 ? 0.3495 0.2366 0.3850 -0.0701 -0.0038 0.0213  503 ASN A CG    
1064 O OD1   . ASN A 134 ? 0.4067 0.3246 0.4653 -0.0809 -0.0008 0.0400  503 ASN A OD1   
1065 N ND2   . ASN A 134 ? 0.3636 0.1964 0.3725 -0.0627 -0.0050 0.0146  503 ASN A ND2   
1066 N N     . LEU A 135 ? 0.1868 0.1330 0.2047 -0.0318 0.0052  -0.0148 504 LEU A N     
1067 C CA    . LEU A 135 ? 0.1900 0.1494 0.2042 -0.0342 0.0031  -0.0178 504 LEU A CA    
1068 C C     . LEU A 135 ? 0.1977 0.1541 0.1920 -0.0280 0.0108  -0.0250 504 LEU A C     
1069 O O     . LEU A 135 ? 0.2389 0.1947 0.2162 -0.0342 0.0089  -0.0268 504 LEU A O     
1070 C CB    . LEU A 135 ? 0.1733 0.1534 0.2027 -0.0300 0.0030  -0.0139 504 LEU A CB    
1071 C CG    . LEU A 135 ? 0.1907 0.1749 0.2163 -0.0369 -0.0009 -0.0125 504 LEU A CG    
1072 C CD1   . LEU A 135 ? 0.2193 0.1936 0.2369 -0.0448 -0.0101 -0.0088 504 LEU A CD1   
1073 C CD2   . LEU A 135 ? 0.2082 0.1969 0.2436 -0.0355 -0.0062 -0.0123 504 LEU A CD2   
1074 N N     . LYS A 136 ? 0.1788 0.1387 0.1739 -0.0124 0.0205  -0.0271 505 LYS A N     
1075 C CA    . LYS A 136 ? 0.1955 0.1635 0.1749 0.0012  0.0319  -0.0337 505 LYS A CA    
1076 C C     . LYS A 136 ? 0.2404 0.1703 0.1826 0.0029  0.0301  -0.0471 505 LYS A C     
1077 O O     . LYS A 136 ? 0.2523 0.1919 0.1716 0.0054  0.0363  -0.0521 505 LYS A O     
1078 C CB    . LYS A 136 ? 0.2301 0.2089 0.2193 0.0244  0.0404  -0.0330 505 LYS A CB    
1079 C CG    . LYS A 136 ? 0.2331 0.2517 0.2533 0.0227  0.0379  -0.0224 505 LYS A CG    
1080 C CD    . LYS A 136 ? 0.2846 0.3239 0.3145 0.0487  0.0442  -0.0198 505 LYS A CD    
1081 C CE    . LYS A 136 ? 0.3140 0.3875 0.3683 0.0456  0.0353  -0.0109 505 LYS A CE    
1082 N NZ    . LYS A 136 ? 0.3431 0.4655 0.4177 0.0665  0.0389  -0.0055 505 LYS A NZ    
1083 N N     . ALA A 137 ? 0.2864 0.1715 0.2188 -0.0003 0.0205  -0.0523 506 ALA A N     
1084 C CA    . ALA A 137 ? 0.3271 0.1650 0.2195 -0.0033 0.0120  -0.0689 506 ALA A CA    
1085 C C     . ALA A 137 ? 0.3243 0.1719 0.2079 -0.0254 -0.0010 -0.0684 506 ALA A C     
1086 O O     . ALA A 137 ? 0.3909 0.2195 0.2328 -0.0241 -0.0051 -0.0828 506 ALA A O     
1087 C CB    . ALA A 137 ? 0.3912 0.1750 0.2801 -0.0110 -0.0001 -0.0701 506 ALA A CB    
1088 N N     . HIS A 138 ? 0.2783 0.1555 0.1966 -0.0416 -0.0080 -0.0523 507 HIS A N     
1089 C CA    . HIS A 138 ? 0.2979 0.1877 0.2120 -0.0574 -0.0220 -0.0479 507 HIS A CA    
1090 C C     . HIS A 138 ? 0.3170 0.2266 0.2091 -0.0512 -0.0133 -0.0458 507 HIS A C     
1091 O O     . HIS A 138 ? 0.3438 0.2483 0.2041 -0.0576 -0.0230 -0.0487 507 HIS A O     
1092 C CB    . HIS A 138 ? 0.2535 0.1715 0.2101 -0.0659 -0.0284 -0.0314 507 HIS A CB    
1093 C CG    . HIS A 138 ? 0.2790 0.2145 0.2360 -0.0733 -0.0415 -0.0229 507 HIS A CG    
1094 N ND1   . HIS A 138 ? 0.3125 0.2491 0.2667 -0.0858 -0.0611 -0.0224 507 HIS A ND1   
1095 C CD2   . HIS A 138 ? 0.2574 0.2079 0.2176 -0.0690 -0.0398 -0.0122 507 HIS A CD2   
1096 C CE1   . HIS A 138 ? 0.3047 0.2586 0.2589 -0.0863 -0.0715 -0.0115 507 HIS A CE1   
1097 N NE2   . HIS A 138 ? 0.3137 0.2708 0.2699 -0.0753 -0.0579 -0.0047 507 HIS A NE2   
1098 N N     . LEU A 139 ? 0.2654 0.2014 0.1740 -0.0416 0.0035  -0.0380 508 LEU A N     
1099 C CA    . LEU A 139 ? 0.2649 0.2269 0.1596 -0.0419 0.0135  -0.0288 508 LEU A CA    
1100 C C     . LEU A 139 ? 0.3554 0.3146 0.2042 -0.0278 0.0258  -0.0419 508 LEU A C     
1101 O O     . LEU A 139 ? 0.3865 0.3649 0.2093 -0.0307 0.0319  -0.0335 508 LEU A O     
1102 C CB    . LEU A 139 ? 0.2358 0.2306 0.1652 -0.0415 0.0249  -0.0162 508 LEU A CB    
1103 C CG    . LEU A 139 ? 0.2220 0.2156 0.1807 -0.0546 0.0119  -0.0040 508 LEU A CG    
1104 C CD1   . LEU A 139 ? 0.2337 0.2500 0.2225 -0.0550 0.0174  0.0009  508 LEU A CD1   
1105 C CD2   . LEU A 139 ? 0.2597 0.2497 0.2047 -0.0683 0.0034  0.0114  508 LEU A CD2   
1106 N N     . LYS A 140 ? 0.3862 0.3184 0.2195 -0.0100 0.0302  -0.0618 509 LYS A N     
1107 C CA    . LYS A 140 ? 0.4582 0.3763 0.2371 0.0107  0.0408  -0.0810 509 LYS A CA    
1108 C C     . LYS A 140 ? 0.5250 0.4136 0.2544 -0.0019 0.0219  -0.0912 509 LYS A C     
1109 O O     . LYS A 140 ? 0.5724 0.4674 0.2537 0.0114  0.0307  -0.1005 509 LYS A O     
1110 C CB    . LYS A 140 ? 0.5279 0.4047 0.2959 0.0353  0.0445  -0.1019 509 LYS A CB    
1111 C CG    . LYS A 140 ? 0.5285 0.4439 0.3320 0.0591  0.0658  -0.0938 509 LYS A CG    
1112 C CD    . LYS A 140 ? 0.6028 0.4773 0.4019 0.0831  0.0643  -0.1085 509 LYS A CD    
1113 C CE    . LYS A 140 ? 0.6234 0.5427 0.4614 0.1071  0.0808  -0.0971 509 LYS A CE    
1114 N NZ    . LYS A 140 ? 0.6694 0.6552 0.5134 0.1211  0.1022  -0.0910 509 LYS A NZ    
1115 N N     . ILE A 141 ? 0.5256 0.3930 0.2715 -0.0263 -0.0046 -0.0877 510 ILE A N     
1116 C CA    . ILE A 141 ? 0.5727 0.4266 0.2852 -0.0403 -0.0280 -0.0926 510 ILE A CA    
1117 C C     . ILE A 141 ? 0.5811 0.4716 0.2758 -0.0459 -0.0243 -0.0724 510 ILE A C     
1118 O O     . ILE A 141 ? 0.6412 0.5341 0.2932 -0.0419 -0.0300 -0.0764 510 ILE A O     
1119 C CB    . ILE A 141 ? 0.5744 0.4193 0.3296 -0.0625 -0.0544 -0.0866 510 ILE A CB    
1120 C CG1   . ILE A 141 ? 0.6080 0.4221 0.3851 -0.0597 -0.0545 -0.0971 510 ILE A CG1   
1121 C CG2   . ILE A 141 ? 0.6099 0.4566 0.3470 -0.0737 -0.0783 -0.0885 510 ILE A CG2   
1122 C CD1   . ILE A 141 ? 0.6202 0.4416 0.4450 -0.0811 -0.0721 -0.0847 510 ILE A CD1   
1123 N N     . HIS A 142 ? 0.4855 0.4100 0.2287 -0.0518 -0.0154 -0.0461 511 HIS A N     
1124 C CA    . HIS A 142 ? 0.4921 0.4454 0.2245 -0.0582 -0.0110 -0.0206 511 HIS A CA    
1125 C C     . HIS A 142 ? 0.5142 0.4929 0.2062 -0.0442 0.0166  -0.0202 511 HIS A C     
1126 O O     . HIS A 142 ? 0.5897 0.5822 0.2388 -0.0469 0.0180  -0.0070 511 HIS A O     
1127 C CB    . HIS A 142 ? 0.4621 0.4321 0.2513 -0.0678 -0.0090 0.0035  511 HIS A CB    
1128 C CG    . HIS A 142 ? 0.4464 0.4022 0.2681 -0.0757 -0.0333 0.0081  511 HIS A CG    
1129 N ND1   . HIS A 142 ? 0.4821 0.4332 0.2880 -0.0817 -0.0565 0.0174  511 HIS A ND1   
1130 C CD2   . HIS A 142 ? 0.4046 0.3580 0.2735 -0.0750 -0.0365 0.0063  511 HIS A CD2   
1131 C CE1   . HIS A 142 ? 0.4495 0.4005 0.2971 -0.0823 -0.0715 0.0210  511 HIS A CE1   
1132 N NE2   . HIS A 142 ? 0.4228 0.3745 0.3062 -0.0782 -0.0583 0.0139  511 HIS A NE2   
1133 N N     . SER A 143 ? 0.4963 0.4881 0.2020 -0.0263 0.0399  -0.0319 512 SER A N     
1134 C CA    . SER A 143 ? 0.5687 0.5984 0.2422 -0.0064 0.0703  -0.0317 512 SER A CA    
1135 C C     . SER A 143 ? 0.6568 0.6605 0.2693 0.0061  0.0657  -0.0568 512 SER A C     
1136 O O     . SER A 143 ? 0.7185 0.7327 0.2933 0.0108  0.0822  -0.0474 512 SER A O     
1137 C CB    . SER A 143 ? 0.5731 0.6245 0.2845 0.0146  0.0919  -0.0394 512 SER A CB    
1138 O OG    . SER A 143 ? 0.5695 0.6499 0.3475 -0.0034 0.0913  -0.0168 512 SER A OG    
1139 N N     . LYS A 144 ? 0.6887 0.6471 0.2931 0.0126  0.0421  -0.0863 513 LYS A N     
1140 C CA    . LYS A 144 ? 0.7600 0.6957 0.3169 0.0191  0.0323  -0.1118 513 LYS A CA    
1141 C C     . LYS A 144 ? 0.8261 0.7731 0.3527 0.0049  0.0117  -0.0996 513 LYS A C     
1142 O O     . LYS A 144 ? 0.9070 0.8645 0.3849 0.0086  0.0159  -0.1086 513 LYS A O     
1143 C CB    . LYS A 144 ? 0.7610 0.6351 0.3248 0.0201  0.0106  -0.1394 513 LYS A CB    
1144 N N     . GLU A 145 ? 0.8196 0.7577 0.3727 -0.0141 -0.0099 -0.0776 514 GLU A N     
1145 C CA    . GLU A 145 ? 0.8878 0.8337 0.4194 -0.0251 -0.0308 -0.0607 514 GLU A CA    
1146 C C     . GLU A 145 ? 1.0141 0.9973 0.5190 -0.0156 -0.0082 -0.0310 514 GLU A C     
1147 O O     . GLU A 145 ? 1.0475 1.0392 0.5076 -0.0091 -0.0158 -0.0253 514 GLU A O     
1148 C CB    . GLU A 145 ? 0.7953 0.7305 0.3741 -0.0498 -0.0557 -0.0419 514 GLU A CB    
1154 O "O5'" . DA  B 1   ? 0.4664 0.4308 0.2217 0.0084  -0.1181 -0.0230 1   DA  E "O5'" 
1155 C "C5'" . DA  B 1   ? 0.4550 0.4349 0.2027 -0.0005 -0.1170 -0.0088 1   DA  E "C5'" 
1156 C "C4'" . DA  B 1   ? 0.4221 0.3930 0.1936 -0.0292 -0.1080 0.0131  1   DA  E "C4'" 
1157 O "O4'" . DA  B 1   ? 0.3844 0.3135 0.1788 -0.0370 -0.1166 0.0118  1   DA  E "O4'" 
1158 C "C3'" . DA  B 1   ? 0.3689 0.3641 0.1531 -0.0415 -0.0916 0.0226  1   DA  E "C3'" 
1159 O "O3'" . DA  B 1   ? 0.3875 0.3838 0.1775 -0.0643 -0.0875 0.0450  1   DA  E "O3'" 
1160 C "C2'" . DA  B 1   ? 0.3558 0.3181 0.1633 -0.0431 -0.0931 0.0143  1   DA  E "C2'" 
1161 C "C1'" . DA  B 1   ? 0.3534 0.2805 0.1706 -0.0472 -0.1061 0.0166  1   DA  E "C1'" 
1162 N N9    . DA  B 1   ? 0.3515 0.2543 0.1845 -0.0455 -0.1156 0.0088  1   DA  E N9    
1163 C C8    . DA  B 1   ? 0.3232 0.2159 0.1824 -0.0550 -0.1166 0.0171  1   DA  E C8    
1164 N N7    . DA  B 1   ? 0.3358 0.2164 0.2053 -0.0557 -0.1275 0.0134  1   DA  E N7    
1165 C C5    . DA  B 1   ? 0.3640 0.2329 0.2090 -0.0441 -0.1366 -0.0011 1   DA  E C5    
1166 C C6    . DA  B 1   ? 0.4149 0.2607 0.2586 -0.0375 -0.1479 -0.0091 1   DA  E C6    
1167 N N6    . DA  B 1   ? 0.4499 0.2839 0.3157 -0.0496 -0.1554 0.0011  1   DA  E N6    
1168 N N1    . DA  B 1   ? 0.4239 0.2623 0.2406 -0.0168 -0.1525 -0.0254 1   DA  E N1    
1169 C C2    . DA  B 1   ? 0.4323 0.2996 0.2287 -0.0044 -0.1429 -0.0315 1   DA  E C2    
1170 N N3    . DA  B 1   ? 0.4083 0.3029 0.2041 -0.0138 -0.1314 -0.0206 1   DA  E N3    
1171 C C4    . DA  B 1   ? 0.3788 0.2660 0.2000 -0.0340 -0.1288 -0.0058 1   DA  E C4    
1172 P P     . DC  B 2   ? 0.3965 0.4221 0.1914 -0.0847 -0.0764 0.0620  2   DC  E P     
1173 O OP1   . DC  B 2   ? 0.4135 0.4311 0.2025 -0.1071 -0.0815 0.0863  2   DC  E OP1   
1174 O OP2   . DC  B 2   ? 0.4336 0.5167 0.2195 -0.0706 -0.0662 0.0547  2   DC  E OP2   
1175 O "O5'" . DC  B 2   ? 0.3909 0.3812 0.2102 -0.0888 -0.0750 0.0554  2   DC  E "O5'" 
1176 C "C5'" . DC  B 2   ? 0.3726 0.3162 0.2033 -0.0921 -0.0837 0.0574  2   DC  E "C5'" 
1177 C "C4'" . DC  B 2   ? 0.3252 0.2537 0.1775 -0.0876 -0.0806 0.0479  2   DC  E "C4'" 
1178 O "O4'" . DC  B 2   ? 0.3277 0.2566 0.1885 -0.0722 -0.0813 0.0326  2   DC  E "O4'" 
1179 C "C3'" . DC  B 2   ? 0.3073 0.2565 0.1645 -0.0960 -0.0709 0.0493  2   DC  E "C3'" 
1180 O "O3'" . DC  B 2   ? 0.3747 0.2977 0.2460 -0.0974 -0.0735 0.0484  2   DC  E "O3'" 
1181 C "C2'" . DC  B 2   ? 0.2916 0.2638 0.1513 -0.0791 -0.0638 0.0326  2   DC  E "C2'" 
1182 C "C1'" . DC  B 2   ? 0.3010 0.2427 0.1711 -0.0687 -0.0728 0.0246  2   DC  E "C1'" 
1183 N N1    . DC  B 2   ? 0.3008 0.2422 0.1651 -0.0537 -0.0777 0.0101  2   DC  E N1    
1184 C C2    . DC  B 2   ? 0.2830 0.2014 0.1617 -0.0517 -0.0875 0.0071  2   DC  E C2    
1185 O O2    . DC  B 2   ? 0.3036 0.2161 0.2014 -0.0582 -0.0882 0.0159  2   DC  E O2    
1186 N N3    . DC  B 2   ? 0.2986 0.2034 0.1668 -0.0419 -0.0994 -0.0041 2   DC  E N3    
1187 C C4    . DC  B 2   ? 0.3198 0.2327 0.1607 -0.0261 -0.1009 -0.0170 2   DC  E C4    
1188 N N4    . DC  B 2   ? 0.3480 0.2336 0.1709 -0.0126 -0.1193 -0.0306 2   DC  E N4    
1189 C C5    . DC  B 2   ? 0.3200 0.2718 0.1478 -0.0230 -0.0868 -0.0151 2   DC  E C5    
1190 C C6    . DC  B 2   ? 0.3160 0.2810 0.1580 -0.0413 -0.0758 0.0011  2   DC  E C6    
1191 P P     . DG  B 3   ? 0.4702 0.3804 0.3356 -0.1171 -0.0787 0.0611  3   DG  E P     
1192 O OP1   . DG  B 3   ? 0.5709 0.4621 0.4154 -0.1330 -0.0917 0.0790  3   DG  E OP1   
1193 O OP2   . DG  B 3   ? 0.4827 0.4325 0.3535 -0.1244 -0.0669 0.0603  3   DG  E OP2   
1194 O "O5'" . DG  B 3   ? 0.4624 0.3369 0.3387 -0.1033 -0.0860 0.0522  3   DG  E "O5'" 
1195 C "C5'" . DG  B 3   ? 0.4385 0.2904 0.3147 -0.0869 -0.0952 0.0490  3   DG  E "C5'" 
1196 C "C4'" . DG  B 3   ? 0.4027 0.2708 0.3023 -0.0669 -0.0888 0.0371  3   DG  E "C4'" 
1197 O "O4'" . DG  B 3   ? 0.3538 0.2497 0.2643 -0.0674 -0.0785 0.0327  3   DG  E "O4'" 
1198 C "C3'" . DG  B 3   ? 0.3912 0.2613 0.3013 -0.0606 -0.0855 0.0302  3   DG  E "C3'" 
1199 O "O3'" . DG  B 3   ? 0.3890 0.2627 0.3094 -0.0377 -0.0903 0.0252  3   DG  E "O3'" 
1200 C "C2'" . DG  B 3   ? 0.3498 0.2525 0.2748 -0.0647 -0.0698 0.0251  3   DG  E "C2'" 
1201 C "C1'" . DG  B 3   ? 0.3208 0.2331 0.2484 -0.0618 -0.0699 0.0253  3   DG  E "C1'" 
1202 N N9    . DG  B 3   ? 0.2817 0.2108 0.2061 -0.0647 -0.0626 0.0201  3   DG  E N9    
1203 C C8    . DG  B 3   ? 0.2849 0.2288 0.1937 -0.0722 -0.0572 0.0207  3   DG  E C8    
1204 N N7    . DG  B 3   ? 0.2763 0.2358 0.1793 -0.0635 -0.0539 0.0115  3   DG  E N7    
1205 C C5    . DG  B 3   ? 0.2663 0.2107 0.1817 -0.0554 -0.0601 0.0066  3   DG  E C5    
1206 C C6    . DG  B 3   ? 0.2948 0.2328 0.2051 -0.0456 -0.0665 -0.0027 3   DG  E C6    
1207 O O6    . DG  B 3   ? 0.3131 0.2567 0.2029 -0.0342 -0.0676 -0.0136 3   DG  E O6    
1208 N N1    . DG  B 3   ? 0.2442 0.1689 0.1720 -0.0484 -0.0757 0.0025  3   DG  E N1    
1209 C C2    . DG  B 3   ? 0.2322 0.1634 0.1807 -0.0535 -0.0753 0.0135  3   DG  E C2    
1210 N N2    . DG  B 3   ? 0.2241 0.1593 0.1897 -0.0570 -0.0844 0.0219  3   DG  E N2    
1211 N N3    . DG  B 3   ? 0.2543 0.1890 0.2034 -0.0542 -0.0696 0.0171  3   DG  E N3    
1212 C C4    . DG  B 3   ? 0.2635 0.1981 0.1952 -0.0578 -0.0636 0.0140  3   DG  E C4    
1213 P P     . DC  B 4   ? 0.4298 0.3026 0.3549 -0.0216 -0.0923 0.0166  4   DC  E P     
1214 O OP1   . DC  B 4   ? 0.4812 0.3492 0.3989 0.0070  -0.1058 0.0132  4   DC  E OP1   
1215 O OP2   . DC  B 4   ? 0.4711 0.3182 0.3819 -0.0393 -0.0959 0.0169  4   DC  E OP2   
1216 O "O5'" . DC  B 4   ? 0.3943 0.3116 0.3483 -0.0188 -0.0756 0.0140  4   DC  E "O5'" 
1217 C "C5'" . DC  B 4   ? 0.3424 0.2899 0.3137 -0.0147 -0.0730 0.0196  4   DC  E "C5'" 
1218 C "C4'" . DC  B 4   ? 0.2716 0.2444 0.2622 -0.0210 -0.0622 0.0199  4   DC  E "C4'" 
1219 O "O4'" . DC  B 4   ? 0.2792 0.2381 0.2598 -0.0369 -0.0583 0.0175  4   DC  E "O4'" 
1220 C "C3'" . DC  B 4   ? 0.2539 0.2379 0.2525 -0.0126 -0.0546 0.0132  4   DC  E "C3'" 
1221 O "O3'" . DC  B 4   ? 0.1964 0.2197 0.2157 0.0011  -0.0536 0.0189  4   DC  E "O3'" 
1222 C "C2'" . DC  B 4   ? 0.2403 0.2218 0.2380 -0.0264 -0.0452 0.0092  4   DC  E "C2'" 
1223 C "C1'" . DC  B 4   ? 0.2336 0.2050 0.2231 -0.0371 -0.0500 0.0131  4   DC  E "C1'" 
1224 N N1    . DC  B 4   ? 0.2033 0.1667 0.1761 -0.0449 -0.0456 0.0067  4   DC  E N1    
1225 C C2    . DC  B 4   ? 0.1947 0.1575 0.1628 -0.0434 -0.0473 0.0024  4   DC  E C2    
1226 O O2    . DC  B 4   ? 0.2454 0.2074 0.2248 -0.0428 -0.0544 0.0072  4   DC  E O2    
1227 N N3    . DC  B 4   ? 0.2019 0.1671 0.1501 -0.0418 -0.0440 -0.0058 4   DC  E N3    
1228 C C4    . DC  B 4   ? 0.1956 0.1728 0.1342 -0.0482 -0.0376 -0.0044 4   DC  E C4    
1229 N N4    . DC  B 4   ? 0.2300 0.2275 0.1500 -0.0444 -0.0336 -0.0099 4   DC  E N4    
1230 C C5    . DC  B 4   ? 0.2439 0.2139 0.1881 -0.0578 -0.0384 0.0039  4   DC  E C5    
1231 C C6    . DC  B 4   ? 0.2441 0.2025 0.2026 -0.0524 -0.0433 0.0065  4   DC  E C6    
1232 P P     . DA  B 5   ? 0.1805 0.2260 0.2086 0.0191  -0.0479 0.0125  5   DA  E P     
1233 O OP1   . DA  B 5   ? 0.1948 0.2894 0.2370 0.0404  -0.0515 0.0210  5   DA  E OP1   
1234 O OP2   . DA  B 5   ? 0.2081 0.2159 0.2157 0.0217  -0.0515 -0.0006 5   DA  E OP2   
1235 O "O5'" . DA  B 5   ? 0.1515 0.2086 0.1930 0.0059  -0.0374 0.0148  5   DA  E "O5'" 
1236 C "C5'" . DA  B 5   ? 0.1223 0.1929 0.1755 -0.0072 -0.0402 0.0282  5   DA  E "C5'" 
1237 C "C4'" . DA  B 5   ? 0.1446 0.2022 0.1957 -0.0165 -0.0355 0.0243  5   DA  E "C4'" 
1238 O "O4'" . DA  B 5   ? 0.1551 0.1774 0.1843 -0.0244 -0.0354 0.0133  5   DA  E "O4'" 
1239 C "C3'" . DA  B 5   ? 0.1396 0.2116 0.1961 -0.0050 -0.0244 0.0158  5   DA  E "C3'" 
1240 O "O3'" . DA  B 5   ? 0.1462 0.2277 0.2109 -0.0092 -0.0242 0.0226  5   DA  E "O3'" 
1241 C "C2'" . DA  B 5   ? 0.1648 0.2090 0.2020 -0.0088 -0.0193 0.0005  5   DA  E "C2'" 
1242 C "C1'" . DA  B 5   ? 0.1490 0.1710 0.1728 -0.0205 -0.0257 0.0022  5   DA  E "C1'" 
1243 N N9    . DA  B 5   ? 0.1495 0.1571 0.1533 -0.0256 -0.0230 -0.0068 5   DA  E N9    
1244 C C8    . DA  B 5   ? 0.1602 0.1641 0.1571 -0.0301 -0.0212 -0.0087 5   DA  E C8    
1245 N N7    . DA  B 5   ? 0.1678 0.1715 0.1481 -0.0386 -0.0192 -0.0111 5   DA  E N7    
1246 C C5    . DA  B 5   ? 0.1522 0.1580 0.1250 -0.0323 -0.0194 -0.0157 5   DA  E C5    
1247 C C6    . DA  B 5   ? 0.1811 0.1950 0.1325 -0.0288 -0.0188 -0.0222 5   DA  E C6    
1248 N N6    . DA  B 5   ? 0.1749 0.2099 0.1141 -0.0366 -0.0143 -0.0200 5   DA  E N6    
1249 N N1    . DA  B 5   ? 0.1804 0.1818 0.1202 -0.0158 -0.0262 -0.0297 5   DA  E N1    
1250 C C2    . DA  B 5   ? 0.1883 0.1704 0.1405 -0.0149 -0.0340 -0.0257 5   DA  E C2    
1251 N N3    . DA  B 5   ? 0.1585 0.1452 0.1359 -0.0216 -0.0323 -0.0151 5   DA  E N3    
1252 C C4    . DA  B 5   ? 0.1457 0.1453 0.1312 -0.0264 -0.0241 -0.0130 5   DA  E C4    
1253 P P     . DG  B 6   ? 0.2328 0.3907 0.2841 0.1487  0.0208  0.1083  6   DG  E P     
1254 O OP1   . DG  B 6   ? 0.3145 0.5378 0.4014 0.1643  0.0341  0.1362  6   DG  E OP1   
1255 O OP2   . DG  B 6   ? 0.3975 0.5087 0.3598 0.1704  0.0237  0.0754  6   DG  E OP2   
1256 O "O5'" . DG  B 6   ? 0.1998 0.3795 0.3122 0.1163  0.0251  0.1369  6   DG  E "O5'" 
1257 C "C5'" . DG  B 6   ? 0.2265 0.4096 0.4174 0.0800  0.0020  0.1563  6   DG  E "C5'" 
1258 C "C4'" . DG  B 6   ? 0.1985 0.3298 0.3922 0.0524  -0.0197 0.1420  6   DG  E "C4'" 
1259 O "O4'" . DG  B 6   ? 0.2007 0.2556 0.3210 0.0483  -0.0344 0.0928  6   DG  E "O4'" 
1260 C "C3'" . DG  B 6   ? 0.2259 0.3610 0.3941 0.0545  0.0016  0.1434  6   DG  E "C3'" 
1261 O "O3'" . DG  B 6   ? 0.2695 0.4030 0.4957 0.0238  -0.0158 0.1620  6   DG  E "O3'" 
1262 C "C2'" . DG  B 6   ? 0.2245 0.2878 0.3029 0.0549  -0.0006 0.0928  6   DG  E "C2'" 
1263 C "C1'" . DG  B 6   ? 0.1966 0.2154 0.2723 0.0390  -0.0289 0.0712  6   DG  E "C1'" 
1264 N N9    . DG  B 6   ? 0.1974 0.1647 0.1975 0.0428  -0.0308 0.0366  6   DG  E N9    
1265 C C8    . DG  B 6   ? 0.2115 0.1680 0.1640 0.0633  -0.0256 0.0265  6   DG  E C8    
1266 N N7    . DG  B 6   ? 0.2288 0.1360 0.1295 0.0547  -0.0356 0.0044  6   DG  E N7    
1267 C C5    . DG  B 6   ? 0.2183 0.1133 0.1276 0.0335  -0.0405 -0.0009 6   DG  E C5    
1268 C C6    . DG  B 6   ? 0.2321 0.0967 0.1027 0.0222  -0.0456 -0.0140 6   DG  E C6    
1269 O O6    . DG  B 6   ? 0.2891 0.1318 0.1223 0.0193  -0.0481 -0.0165 6   DG  E O6    
1270 N N1    . DG  B 6   ? 0.2431 0.1100 0.1271 0.0167  -0.0501 -0.0189 6   DG  E N1    
1271 C C2    . DG  B 6   ? 0.2358 0.1177 0.1692 0.0154  -0.0586 -0.0126 6   DG  E C2    
1272 N N2    . DG  B 6   ? 0.2621 0.1301 0.1934 0.0164  -0.0734 -0.0246 6   DG  E N2    
1273 N N3    . DG  B 6   ? 0.2230 0.1349 0.2055 0.0163  -0.0554 0.0082  6   DG  E N3    
1274 C C4    . DG  B 6   ? 0.1993 0.1226 0.1644 0.0282  -0.0418 0.0134  6   DG  E C4    
1275 P P     . DG  B 7   ? 0.3198 0.4430 0.5274 0.0190  -0.0055 0.1598  7   DG  E P     
1276 O OP1   . DG  B 7   ? 0.3795 0.5246 0.6606 -0.0077 -0.0176 0.1987  7   DG  E OP1   
1277 O OP2   . DG  B 7   ? 0.3342 0.4731 0.4773 0.0507  0.0290  0.1517  7   DG  E OP2   
1278 O "O5'" . DG  B 7   ? 0.2373 0.2811 0.3921 0.0046  -0.0281 0.1083  7   DG  E "O5'" 
1279 C "C5'" . DG  B 7   ? 0.2286 0.2344 0.4124 -0.0127 -0.0691 0.0981  7   DG  E "C5'" 
1280 C "C4'" . DG  B 7   ? 0.2129 0.1693 0.3519 -0.0150 -0.0817 0.0624  7   DG  E "C4'" 
1281 O "O4'" . DG  B 7   ? 0.2030 0.1328 0.2671 -0.0038 -0.0691 0.0274  7   DG  E "O4'" 
1282 C "C3'" . DG  B 7   ? 0.1827 0.1527 0.3157 -0.0161 -0.0624 0.0688  7   DG  E "C3'" 
1283 O "O3'" . DG  B 7   ? 0.1939 0.1277 0.3303 -0.0211 -0.0929 0.0522  7   DG  E "O3'" 
1284 C "C2'" . DG  B 7   ? 0.1694 0.1344 0.2306 -0.0035 -0.0312 0.0445  7   DG  E "C2'" 
1285 C "C1'" . DG  B 7   ? 0.2044 0.1371 0.2279 -0.0006 -0.0438 0.0173  7   DG  E "C1'" 
1286 N N9    . DG  B 7   ? 0.1793 0.1107 0.1572 0.0063  -0.0246 0.0098  7   DG  E N9    
1287 C C8    . DG  B 7   ? 0.1681 0.1175 0.1453 0.0166  -0.0122 0.0228  7   DG  E C8    
1288 N N7    . DG  B 7   ? 0.1869 0.1154 0.1165 0.0220  -0.0091 0.0095  7   DG  E N7    
1289 C C5    . DG  B 7   ? 0.2022 0.1096 0.1079 0.0105  -0.0138 -0.0049 7   DG  E C5    
1290 C C6    . DG  B 7   ? 0.2244 0.1128 0.0909 0.0052  -0.0147 -0.0108 7   DG  E C6    
1291 O O6    . DG  B 7   ? 0.2543 0.1246 0.0970 0.0069  -0.0202 -0.0094 7   DG  E O6    
1292 N N1    . DG  B 7   ? 0.2144 0.1080 0.0719 -0.0001 -0.0130 -0.0151 7   DG  E N1    
1293 C C2    . DG  B 7   ? 0.2193 0.1218 0.0921 0.0055  -0.0163 -0.0232 7   DG  E C2    
1294 N N2    . DG  B 7   ? 0.2682 0.1826 0.1218 0.0122  -0.0130 -0.0283 7   DG  E N2    
1295 N N3    . DG  B 7   ? 0.2314 0.1350 0.1406 0.0070  -0.0254 -0.0218 7   DG  E N3    
1296 C C4    . DG  B 7   ? 0.1925 0.1042 0.1216 0.0062  -0.0208 -0.0079 7   DG  E C4    
1297 P P     . DT  B 8   ? 0.2025 0.1418 0.3417 -0.0238 -0.0851 0.0579  8   DT  E P     
1298 O OP1   . DT  B 8   ? 0.2331 0.1538 0.3941 -0.0263 -0.1284 0.0471  8   DT  E OP1   
1299 O OP2   . DT  B 8   ? 0.2122 0.2032 0.3781 -0.0251 -0.0535 0.0977  8   DT  E OP2   
1300 O "O5'" . DT  B 8   ? 0.2002 0.1282 0.2648 -0.0103 -0.0603 0.0212  8   DT  E "O5'" 
1301 C "C5'" . DT  B 8   ? 0.2287 0.1293 0.2511 0.0016  -0.0735 -0.0121 8   DT  E "C5'" 
1302 C "C4'" . DT  B 8   ? 0.1865 0.1002 0.1590 0.0081  -0.0432 -0.0262 8   DT  E "C4'" 
1303 O "O4'" . DT  B 8   ? 0.2006 0.1238 0.1566 0.0038  -0.0234 -0.0182 8   DT  E "O4'" 
1304 C "C3'" . DT  B 8   ? 0.1758 0.1040 0.1504 0.0047  -0.0267 -0.0210 8   DT  E "C3'" 
1305 O "O3'" . DT  B 8   ? 0.1839 0.1111 0.1381 0.0167  -0.0318 -0.0410 8   DT  E "O3'" 
1306 C "C2'" . DT  B 8   ? 0.1637 0.1041 0.1157 0.0010  -0.0018 -0.0140 8   DT  E "C2'" 
1307 C "C1'" . DT  B 8   ? 0.1967 0.1302 0.1293 0.0018  -0.0038 -0.0187 8   DT  E "C1'" 
1308 N N1    . DT  B 8   ? 0.1938 0.1248 0.1126 0.0000  0.0050  -0.0098 8   DT  E N1    
1309 C C2    . DT  B 8   ? 0.2108 0.1348 0.1019 -0.0047 0.0067  -0.0116 8   DT  E C2    
1310 O O2    . DT  B 8   ? 0.2495 0.1840 0.1315 -0.0080 0.0089  -0.0133 8   DT  E O2    
1311 N N3    . DT  B 8   ? 0.2128 0.1210 0.0884 -0.0023 0.0031  -0.0073 8   DT  E N3    
1312 C C4    . DT  B 8   ? 0.2189 0.1277 0.0972 0.0129  0.0044  -0.0031 8   DT  E C4    
1313 O O4    . DT  B 8   ? 0.2369 0.1280 0.0902 0.0247  -0.0031 -0.0045 8   DT  E O4    
1314 C C5    . DT  B 8   ? 0.1943 0.1289 0.1080 0.0173  0.0119  0.0069  8   DT  E C5    
1315 C C7    . DT  B 8   ? 0.1859 0.1463 0.1130 0.0371  0.0206  0.0250  8   DT  E C7    
1316 C C6    . DT  B 8   ? 0.1718 0.1107 0.1069 0.0066  0.0083  0.0038  8   DT  E C6    
1317 P P     . DC  B 9   ? 0.1798 0.1168 0.1395 0.0164  -0.0247 -0.0413 9   DC  E P     
1318 O OP1   . DC  B 9   ? 0.2007 0.1281 0.1512 0.0364  -0.0467 -0.0634 9   DC  E OP1   
1319 O OP2   . DC  B 9   ? 0.1789 0.1156 0.1667 0.0048  -0.0211 -0.0188 9   DC  E OP2   
1320 O "O5'" . DC  B 9   ? 0.1672 0.1282 0.1051 0.0126  0.0003  -0.0389 9   DC  E "O5'" 
1321 C "C5'" . DC  B 9   ? 0.1917 0.1756 0.1090 0.0221  0.0070  -0.0446 9   DC  E "C5'" 
1322 C "C4'" . DC  B 9   ? 0.2015 0.2051 0.1186 0.0066  0.0220  -0.0270 9   DC  E "C4'" 
1323 O "O4'" . DC  B 9   ? 0.1958 0.1752 0.1078 -0.0059 0.0203  -0.0182 9   DC  E "O4'" 
1324 C "C3'" . DC  B 9   ? 0.1909 0.1988 0.1243 -0.0018 0.0227  -0.0219 9   DC  E "C3'" 
1325 O "O3'" . DC  B 9   ? 0.2037 0.2441 0.1480 -0.0116 0.0279  -0.0043 9   DC  E "O3'" 
1326 C "C2'" . DC  B 9   ? 0.1831 0.1561 0.1117 -0.0097 0.0174  -0.0175 9   DC  E "C2'" 
1327 C "C1'" . DC  B 9   ? 0.1989 0.1669 0.1151 -0.0156 0.0173  -0.0105 9   DC  E "C1'" 
1328 N N1    . DC  B 9   ? 0.2165 0.1554 0.1196 -0.0126 0.0122  -0.0094 9   DC  E N1    
1329 C C2    . DC  B 9   ? 0.2085 0.1289 0.0962 -0.0186 0.0022  -0.0031 9   DC  E C2    
1330 O O2    . DC  B 9   ? 0.2379 0.1687 0.1315 -0.0332 -0.0020 0.0085  9   DC  E O2    
1331 N N3    . DC  B 9   ? 0.2057 0.1018 0.0744 -0.0056 -0.0042 -0.0059 9   DC  E N3    
1332 C C4    . DC  B 9   ? 0.2046 0.1088 0.0757 0.0115  0.0055  -0.0068 9   DC  E C4    
1333 N N4    . DC  B 9   ? 0.2418 0.1389 0.0971 0.0319  0.0031  -0.0052 9   DC  E N4    
1334 C C5    . DC  B 9   ? 0.1942 0.1202 0.0905 0.0103  0.0157  -0.0046 9   DC  E C5    
1335 C C6    . DC  B 9   ? 0.1986 0.1339 0.1069 -0.0014 0.0155  -0.0101 9   DC  E C6    
1336 P P     . DC  B 10  ? 0.1485 0.2334 0.1163 -0.0067 0.0323  0.0011  10  DC  E P     
1337 O OP1   . DC  B 10  ? 0.1820 0.3045 0.1356 0.0230  0.0425  -0.0101 10  DC  E OP1   
1338 O OP2   . DC  B 10  ? 0.1421 0.1974 0.1181 -0.0102 0.0208  -0.0086 10  DC  E OP2   
1339 O "O5'" . DC  B 10  ? 0.1751 0.2940 0.1716 -0.0297 0.0319  0.0375  10  DC  E "O5'" 
1340 C "C5'" . DC  B 10  ? 0.1827 0.3282 0.1736 -0.0331 0.0414  0.0589  10  DC  E "C5'" 
1341 C "C4'" . DC  B 10  ? 0.1748 0.2956 0.1853 -0.0658 0.0208  0.0870  10  DC  E "C4'" 
1342 O "O4'" . DC  B 10  ? 0.1788 0.2246 0.1576 -0.0665 0.0038  0.0628  10  DC  E "O4'" 
1343 C "C3'" . DC  B 10  ? 0.1813 0.3077 0.2400 -0.0891 -0.0018 0.1104  10  DC  E "C3'" 
1344 O "O3'" . DC  B 10  ? 0.2082 0.3593 0.3000 -0.1043 -0.0141 0.1474  10  DC  E "O3'" 
1345 C "C2'" . DC  B 10  ? 0.1942 0.2321 0.2283 -0.0917 -0.0335 0.0842  10  DC  E "C2'" 
1346 C "C1'" . DC  B 10  ? 0.1991 0.2024 0.1911 -0.0838 -0.0289 0.0708  10  DC  E "C1'" 
1347 N N1    . DC  B 10  ? 0.2051 0.1467 0.1573 -0.0657 -0.0392 0.0390  10  DC  E N1    
1348 C C2    . DC  B 10  ? 0.2408 0.1248 0.1691 -0.0650 -0.0692 0.0360  10  DC  E C2    
1349 O O2    . DC  B 10  ? 0.2674 0.1413 0.2122 -0.0860 -0.0937 0.0591  10  DC  E O2    
1350 N N3    . DC  B 10  ? 0.2523 0.0975 0.1403 -0.0373 -0.0725 0.0111  10  DC  E N3    
1351 C C4    . DC  B 10  ? 0.2922 0.1564 0.1740 -0.0198 -0.0473 -0.0021 10  DC  E C4    
1352 N N4    . DC  B 10  ? 0.3121 0.1541 0.1598 0.0092  -0.0467 -0.0147 10  DC  E N4    
1353 C C5    . DC  B 10  ? 0.2158 0.1255 0.1259 -0.0273 -0.0243 0.0003  10  DC  E C5    
1354 C C6    . DC  B 10  ? 0.2019 0.1477 0.1412 -0.0458 -0.0211 0.0169  10  DC  E C6    
1355 P P     . DT  B 11  ? 0.2249 0.1999 0.1337 -0.0637 -0.0033 -0.0446 11  DT  E P     
1356 O OP1   . DT  B 11  ? 0.2598 0.2451 0.1526 -0.0630 0.0066  -0.0490 11  DT  E OP1   
1357 O OP2   . DT  B 11  ? 0.2512 0.2096 0.1675 -0.0592 -0.0081 -0.0569 11  DT  E OP2   
1358 O "O5'" . DT  B 11  ? 0.1916 0.1742 0.1178 -0.0611 0.0021  -0.0293 11  DT  E "O5'" 
1359 C "C5'" . DT  B 11  ? 0.2042 0.1951 0.1250 -0.0609 0.0041  -0.0155 11  DT  E "C5'" 
1360 C "C4'" . DT  B 11  ? 0.1784 0.1699 0.1141 -0.0540 0.0059  -0.0060 11  DT  E "C4'" 
1361 O "O4'" . DT  B 11  ? 0.1805 0.1840 0.1267 -0.0537 -0.0025 -0.0009 11  DT  E "O4'" 
1362 C "C3'" . DT  B 11  ? 0.1605 0.1434 0.1082 -0.0510 0.0131  -0.0132 11  DT  E "C3'" 
1363 O "O3'" . DT  B 11  ? 0.1998 0.1741 0.1438 -0.0497 0.0193  -0.0077 11  DT  E "O3'" 
1364 C "C2'" . DT  B 11  ? 0.1599 0.1478 0.1215 -0.0466 0.0082  -0.0106 11  DT  E "C2'" 
1365 C "C1'" . DT  B 11  ? 0.1467 0.1508 0.1063 -0.0463 0.0011  0.0005  11  DT  E "C1'" 
1366 N N1    . DT  B 11  ? 0.1385 0.1588 0.1084 -0.0503 -0.0056 0.0044  11  DT  E N1    
1367 C C2    . DT  B 11  ? 0.1261 0.1706 0.1051 -0.0425 -0.0060 0.0136  11  DT  E C2    
1368 O O2    . DT  B 11  ? 0.1416 0.1880 0.1196 -0.0286 -0.0025 0.0165  11  DT  E O2    
1369 N N3    . DT  B 11  ? 0.1302 0.1964 0.1182 -0.0512 -0.0112 0.0193  11  DT  E N3    
1370 C C4    . DT  B 11  ? 0.1382 0.1938 0.1240 -0.0680 -0.0187 0.0182  11  DT  E C4    
1371 O O4    . DT  B 11  ? 0.1570 0.2312 0.1488 -0.0794 -0.0243 0.0272  11  DT  E O4    
1372 C C5    . DT  B 11  ? 0.1509 0.1723 0.1251 -0.0710 -0.0200 0.0060  11  DT  E C5    
1373 C C7    . DT  B 11  ? 0.2064 0.2044 0.1736 -0.0838 -0.0307 0.0013  11  DT  E C7    
1374 C C6    . DT  B 11  ? 0.1557 0.1669 0.1240 -0.0616 -0.0122 -0.0008 11  DT  E C6    
1375 P P     . DG  B 12  ? 0.1974 0.1647 0.1508 -0.0518 0.0262  -0.0147 12  DG  E P     
1376 O OP1   . DG  B 12  ? 0.2370 0.1961 0.1784 -0.0603 0.0318  -0.0082 12  DG  E OP1   
1377 O OP2   . DG  B 12  ? 0.1904 0.1671 0.1544 -0.0520 0.0269  -0.0277 12  DG  E OP2   
1378 O "O5'" . DG  B 12  ? 0.2102 0.1693 0.1714 -0.0425 0.0225  -0.0121 12  DG  E "O5'" 
1379 C "C5'" . DG  B 12  ? 0.2117 0.1605 0.1644 -0.0339 0.0191  -0.0025 12  DG  E "C5'" 
1380 C "C4'" . DG  B 12  ? 0.2150 0.1666 0.1755 -0.0209 0.0162  -0.0048 12  DG  E "C4'" 
1381 O "O4'" . DG  B 12  ? 0.2041 0.1826 0.1739 -0.0193 0.0132  -0.0033 12  DG  E "O4'" 
1382 C "C3'" . DG  B 12  ? 0.1902 0.1342 0.1576 -0.0228 0.0183  -0.0149 12  DG  E "C3'" 
1383 O "O3'" . DG  B 12  ? 0.2589 0.1902 0.2211 -0.0096 0.0158  -0.0168 12  DG  E "O3'" 
1384 C "C2'" . DG  B 12  ? 0.1666 0.1327 0.1457 -0.0242 0.0171  -0.0182 12  DG  E "C2'" 
1385 C "C1'" . DG  B 12  ? 0.1634 0.1478 0.1420 -0.0175 0.0138  -0.0093 12  DG  E "C1'" 
1386 N N9    . DG  B 12  ? 0.1462 0.1497 0.1317 -0.0248 0.0100  -0.0067 12  DG  E N9    
1387 C C8    . DG  B 12  ? 0.1365 0.1337 0.1228 -0.0354 0.0074  -0.0108 12  DG  E C8    
1388 N N7    . DG  B 12  ? 0.1406 0.1484 0.1294 -0.0422 0.0010  -0.0057 12  DG  E N7    
1389 C C5    . DG  B 12  ? 0.1177 0.1502 0.1104 -0.0370 0.0015  0.0030  12  DG  E C5    
1390 C C6    . DG  B 12  ? 0.1072 0.1676 0.1049 -0.0443 -0.0030 0.0136  12  DG  E C6    
1391 O O6    . DG  B 12  ? 0.1433 0.2023 0.1401 -0.0600 -0.0108 0.0188  12  DG  E O6    
1392 N N1    . DG  B 12  ? 0.1068 0.1988 0.1095 -0.0318 0.0014  0.0185  12  DG  E N1    
1393 C C2    . DG  B 12  ? 0.1087 0.1942 0.1085 -0.0123 0.0069  0.0124  12  DG  E C2    
1394 N N2    . DG  B 12  ? 0.1121 0.2305 0.1161 0.0035  0.0096  0.0154  12  DG  E N2    
1395 N N3    . DG  B 12  ? 0.1250 0.1747 0.1172 -0.0087 0.0089  0.0043  12  DG  E N3    
1396 C C4    . DG  B 12  ? 0.1293 0.1592 0.1199 -0.0229 0.0071  0.0007  12  DG  E C4    
1397 P P     . DG  B 13  ? 0.2760 0.1741 0.2299 -0.0133 0.0145  -0.0235 13  DG  E P     
1398 O OP1   . DG  B 13  ? 0.3225 0.1937 0.2624 -0.0210 0.0133  -0.0148 13  DG  E OP1   
1399 O OP2   . DG  B 13  ? 0.3118 0.2207 0.2777 -0.0246 0.0164  -0.0323 13  DG  E OP2   
1400 O "O5'" . DG  B 13  ? 0.3063 0.1953 0.2522 0.0084  0.0102  -0.0294 13  DG  E "O5'" 
1401 C "C5'" . DG  B 13  ? 0.3175 0.2049 0.2552 0.0279  0.0071  -0.0238 13  DG  E "C5'" 
1402 C "C4'" . DG  B 13  ? 0.3037 0.2221 0.2463 0.0486  0.0081  -0.0294 13  DG  E "C4'" 
1403 O "O4'" . DG  B 13  ? 0.2524 0.2164 0.2118 0.0399  0.0122  -0.0230 13  DG  E "O4'" 
1404 C "C3'" . DG  B 13  ? 0.3529 0.2629 0.2901 0.0537  0.0076  -0.0441 13  DG  E "C3'" 
1405 O "O3'" . DG  B 13  ? 0.4574 0.3754 0.3857 0.0821  0.0064  -0.0515 13  DG  E "O3'" 
1406 C "C2'" . DG  B 13  ? 0.2970 0.2439 0.2497 0.0397  0.0122  -0.0425 13  DG  E "C2'" 
1407 C "C1'" . DG  B 13  ? 0.2168 0.2002 0.1807 0.0398  0.0145  -0.0296 13  DG  E "C1'" 
1408 N N9    . DG  B 13  ? 0.1755 0.1773 0.1513 0.0204  0.0155  -0.0236 13  DG  E N9    
1409 C C8    . DG  B 13  ? 0.1664 0.1514 0.1458 0.0037  0.0150  -0.0241 13  DG  E C8    
1410 N N7    . DG  B 13  ? 0.1552 0.1559 0.1424 -0.0069 0.0137  -0.0201 13  DG  E N7    
1411 C C5    . DG  B 13  ? 0.1470 0.1774 0.1361 -0.0020 0.0134  -0.0136 13  DG  E C5    
1412 C C6    . DG  B 13  ? 0.1339 0.1862 0.1279 -0.0132 0.0103  -0.0045 13  DG  E C6    
1413 O O6    . DG  B 13  ? 0.1536 0.1949 0.1492 -0.0265 0.0053  -0.0024 13  DG  E O6    
1414 N N1    . DG  B 13  ? 0.1317 0.2215 0.1271 -0.0074 0.0125  0.0025  13  DG  E N1    
1415 C C2    . DG  B 13  ? 0.1507 0.2558 0.1435 0.0130  0.0174  -0.0022 13  DG  E C2    
1416 N N2    . DG  B 13  ? 0.1178 0.2707 0.1142 0.0184  0.0207  0.0045  13  DG  E N2    
1417 N N3    . DG  B 13  ? 0.1578 0.2330 0.1433 0.0273  0.0182  -0.0127 13  DG  E N3    
1418 C C4    . DG  B 13  ? 0.1517 0.1896 0.1356 0.0159  0.0160  -0.0163 13  DG  E C4    
1419 P P     . DA  B 14  ? 0.5094 0.4226 0.4258 0.0939  0.0055  -0.0693 14  DA  E P     
1420 O OP1   . DA  B 14  ? 0.6105 0.5076 0.5154 0.1159  -0.0001 -0.0740 14  DA  E OP1   
1421 O OP2   . DA  B 14  ? 0.5230 0.4106 0.4389 0.0694  0.0027  -0.0739 14  DA  E OP2   
1422 O "O5'" . DA  B 14  ? 0.4566 0.4352 0.3863 0.0963  0.0136  -0.0657 14  DA  E "O5'" 
1423 C "C5'" . DA  B 14  ? 0.3840 0.4105 0.3231 0.1119  0.0181  -0.0576 14  DA  E "C5'" 
1424 C "C4'" . DA  B 14  ? 0.3011 0.3850 0.2476 0.1093  0.0243  -0.0542 14  DA  E "C4'" 
1425 O "O4'" . DA  B 14  ? 0.2687 0.3708 0.2287 0.0814  0.0259  -0.0402 14  DA  E "O4'" 
1426 C "C3'" . DA  B 14  ? 0.3160 0.3902 0.2496 0.1104  0.0225  -0.0656 14  DA  E "C3'" 
1427 O "O3'" . DA  B 14  ? 0.3424 0.4675 0.2780 0.1201  0.0262  -0.0627 14  DA  E "O3'" 
1428 C "C2'" . DA  B 14  ? 0.2657 0.3342 0.2007 0.0870  0.0229  -0.0637 14  DA  E "C2'" 
1429 C "C1'" . DA  B 14  ? 0.2188 0.3181 0.1727 0.0700  0.0256  -0.0441 14  DA  E "C1'" 
1430 N N9    . DA  B 14  ? 0.1837 0.2550 0.1454 0.0457  0.0209  -0.0381 14  DA  E N9    
1431 C C8    . DA  B 14  ? 0.1920 0.2187 0.1526 0.0396  0.0170  -0.0446 14  DA  E C8    
1432 N N7    . DA  B 14  ? 0.1755 0.1947 0.1455 0.0206  0.0146  -0.0389 14  DA  E N7    
1433 C C5    . DA  B 14  ? 0.1506 0.2015 0.1260 0.0132  0.0148  -0.0275 14  DA  E C5    
1434 C C6    . DA  B 14  ? 0.1424 0.1939 0.1246 -0.0037 0.0103  -0.0184 14  DA  E C6    
1435 N N6    . DA  B 14  ? 0.1281 0.1543 0.1156 -0.0120 0.0067  -0.0221 14  DA  E N6    
1436 N N1    . DA  B 14  ? 0.1265 0.2059 0.1085 -0.0113 0.0090  -0.0053 14  DA  E N1    
1437 C C2    . DA  B 14  ? 0.1224 0.2389 0.1009 -0.0027 0.0146  -0.0017 14  DA  E C2    
1438 N N3    . DA  B 14  ? 0.1611 0.2873 0.1347 0.0180  0.0206  -0.0121 14  DA  E N3    
1439 C C4    . DA  B 14  ? 0.1514 0.2374 0.1223 0.0255  0.0191  -0.0251 14  DA  E C4    
1440 P P     . DC  B 15  ? 0.3932 0.5162 0.3123 0.1310  0.0246  -0.0762 15  DC  E P     
1441 O OP1   . DC  B 15  ? 0.4624 0.6309 0.3827 0.1517  0.0271  -0.0760 15  DC  E OP1   
1442 O OP2   . DC  B 15  ? 0.4310 0.4897 0.3352 0.1325  0.0171  -0.0909 15  DC  E OP2   
1443 O "O5'" . DC  B 15  ? 0.3429 0.4904 0.2629 0.1101  0.0275  -0.0690 15  DC  E "O5'" 
1444 C "C5'" . DC  B 15  ? 0.2921 0.4928 0.2256 0.0968  0.0325  -0.0504 15  DC  E "C5'" 
1445 C "C4'" . DC  B 15  ? 0.2839 0.4893 0.2129 0.0753  0.0318  -0.0428 15  DC  E "C4'" 
1446 O "O4'" . DC  B 15  ? 0.2450 0.4243 0.1790 0.0577  0.0293  -0.0372 15  DC  E "O4'" 
1447 C "C3'" . DC  B 15  ? 0.3167 0.4984 0.2266 0.0798  0.0279  -0.0577 15  DC  E "C3'" 
1448 O "O3'" . DC  B 15  ? 0.3204 0.5363 0.2251 0.0685  0.0290  -0.0466 15  DC  E "O3'" 
1449 C "C2'" . DC  B 15  ? 0.2818 0.4158 0.1899 0.0683  0.0217  -0.0636 15  DC  E "C2'" 
1450 C "C1'" . DC  B 15  ? 0.2409 0.3943 0.1620 0.0503  0.0238  -0.0448 15  DC  E "C1'" 
1451 N N1    . DC  B 15  ? 0.2041 0.3141 0.1371 0.0368  0.0170  -0.0444 15  DC  E N1    
1452 C C2    . DC  B 15  ? 0.1754 0.2851 0.1202 0.0164  0.0127  -0.0275 15  DC  E C2    
1453 O O2    . DC  B 15  ? 0.1805 0.3216 0.1236 0.0067  0.0133  -0.0114 15  DC  E O2    
1454 N N3    . DC  B 15  ? 0.1587 0.2339 0.1147 0.0075  0.0074  -0.0294 15  DC  E N3    
1455 C C4    . DC  B 15  ? 0.1622 0.2084 0.1189 0.0135  0.0071  -0.0437 15  DC  E C4    
1456 N N4    . DC  B 15  ? 0.1449 0.1680 0.1132 0.0034  0.0039  -0.0443 15  DC  E N4    
1457 C C5    . DC  B 15  ? 0.2035 0.2422 0.1469 0.0299  0.0095  -0.0583 15  DC  E C5    
1458 C C6    . DC  B 15  ? 0.2179 0.2870 0.1492 0.0435  0.0140  -0.0599 15  DC  E C6    
1459 P P     . DG  B 16  ? 0.3817 0.6125 0.2687 0.0805  0.0294  -0.0573 16  DG  E P     
1460 O OP1   . DG  B 16  ? 0.3838 0.6485 0.2749 0.1007  0.0349  -0.0613 16  DG  E OP1   
1461 O OP2   . DG  B 16  ? 0.4288 0.6108 0.3001 0.0836  0.0218  -0.0757 16  DG  E OP2   
1462 O "O5'" . DG  B 16  ? 0.3610 0.6260 0.2450 0.0597  0.0297  -0.0371 16  DG  E "O5'" 
1463 C "C5'" . DG  B 16  ? 0.3152 0.6180 0.2153 0.0435  0.0328  -0.0138 16  DG  E "C5'" 
1464 C "C4'" . DG  B 16  ? 0.2772 0.5639 0.1759 0.0166  0.0259  0.0053  16  DG  E "C4'" 
1465 O "O4'" . DG  B 16  ? 0.2495 0.4934 0.1522 0.0138  0.0210  0.0002  16  DG  E "O4'" 
1466 C "C3'" . DG  B 16  ? 0.3063 0.5826 0.1838 0.0105  0.0196  0.0068  16  DG  E "C3'" 
1467 O "O3'" . DG  B 16  ? 0.3309 0.6186 0.2083 -0.0139 0.0148  0.0332  16  DG  E "O3'" 
1468 C "C2'" . DG  B 16  ? 0.2875 0.5142 0.1588 0.0129  0.0105  -0.0066 16  DG  E "C2'" 
1469 C "C1'" . DG  B 16  ? 0.2592 0.4732 0.1481 0.0054  0.0108  -0.0001 16  DG  E "C1'" 
1470 N N9    . DG  B 16  ? 0.2371 0.4129 0.1275 0.0131  0.0065  -0.0187 16  DG  E N9    
1471 C C8    . DG  B 16  ? 0.2476 0.4037 0.1361 0.0313  0.0090  -0.0426 16  DG  E C8    
1472 N N7    . DG  B 16  ? 0.2309 0.3470 0.1302 0.0287  0.0031  -0.0520 16  DG  E N7    
1473 C C5    . DG  B 16  ? 0.2196 0.3277 0.1332 0.0112  -0.0029 -0.0348 16  DG  E C5    
1474 C C6    . DG  B 16  ? 0.2098 0.2857 0.1410 0.0031  -0.0094 -0.0361 16  DG  E C6    
1475 O O6    . DG  B 16  ? 0.2052 0.2568 0.1443 0.0056  -0.0102 -0.0500 16  DG  E O6    
1476 N N1    . DG  B 16  ? 0.1669 0.2407 0.1047 -0.0095 -0.0157 -0.0187 16  DG  E N1    
1477 C C2    . DG  B 16  ? 0.1861 0.2808 0.1136 -0.0185 -0.0174 0.0008  16  DG  E C2    
1478 N N2    . DG  B 16  ? 0.2014 0.2782 0.1331 -0.0309 -0.0273 0.0156  16  DG  E N2    
1479 N N3    . DG  B 16  ? 0.2062 0.3372 0.1187 -0.0158 -0.0102 0.0055  16  DG  E N3    
1480 C C4    . DG  B 16  ? 0.1925 0.3307 0.0994 0.0015  -0.0025 -0.0145 16  DG  E C4    
1481 P P     . DA  B 17  ? 0.4102 0.6824 0.2656 -0.0243 0.0044  0.0428  17  DA  E P     
1482 O OP1   . DA  B 17  ? 0.4630 0.7701 0.3177 -0.0418 0.0060  0.0658  17  DA  E OP1   
1483 O OP2   . DA  B 17  ? 0.4260 0.6873 0.2640 -0.0059 0.0030  0.0200  17  DA  E OP2   
1484 O "O5'" . DA  B 17  ? 0.3669 0.5914 0.2248 -0.0374 -0.0100 0.0526  17  DA  E "O5'" 
1485 C "C5'" . DA  B 17  ? 0.3653 0.5822 0.2388 -0.0547 -0.0125 0.0697  17  DA  E "C5'" 
1486 C "C4'" . DA  B 17  ? 0.3763 0.5432 0.2463 -0.0647 -0.0302 0.0791  17  DA  E "C4'" 
1487 O "O4'" . DA  B 17  ? 0.3524 0.4957 0.2278 -0.0518 -0.0336 0.0600  17  DA  E "O4'" 
1488 C "C3'" . DA  B 17  ? 0.4301 0.5788 0.2813 -0.0664 -0.0437 0.0872  17  DA  E "C3'" 
1489 O "O3'" . DA  B 17  ? 0.4759 0.5854 0.3271 -0.0811 -0.0597 0.1058  17  DA  E "O3'" 
1490 C "C2'" . DA  B 17  ? 0.3971 0.5322 0.2450 -0.0475 -0.0493 0.0640  17  DA  E "C2'" 
1491 C "C1'" . DA  B 17  ? 0.3383 0.4585 0.2063 -0.0437 -0.0464 0.0514  17  DA  E "C1'" 
1492 N N9    . DA  B 17  ? 0.2868 0.4066 0.1636 -0.0260 -0.0396 0.0225  17  DA  E N9    
1493 C C8    . DA  B 17  ? 0.2814 0.4280 0.1454 -0.0143 -0.0294 0.0073  17  DA  E C8    
1494 N N7    . DA  B 17  ? 0.2707 0.3994 0.1433 -0.0024 -0.0283 -0.0172 17  DA  E N7    
1495 C C5    . DA  B 17  ? 0.2331 0.3303 0.1281 -0.0074 -0.0361 -0.0170 17  DA  E C5    
1496 C C6    . DA  B 17  ? 0.2089 0.2824 0.1220 -0.0037 -0.0381 -0.0346 17  DA  E C6    
1497 N N6    . DA  B 17  ? 0.2353 0.3037 0.1451 0.0035  -0.0348 -0.0552 17  DA  E N6    
1498 N N1    . DA  B 17  ? 0.1935 0.2485 0.1263 -0.0083 -0.0443 -0.0301 17  DA  E N1    
1499 C C2    . DA  B 17  ? 0.2292 0.2790 0.1609 -0.0147 -0.0506 -0.0110 17  DA  E C2    
1500 N N3    . DA  B 17  ? 0.2420 0.3039 0.1560 -0.0222 -0.0518 0.0085  17  DA  E N3    
1501 C C4    . DA  B 17  ? 0.2603 0.3509 0.1576 -0.0190 -0.0431 0.0053  17  DA  E C4    
1502 P P     . DA  B 18  ? 0.5438 0.6257 0.3767 -0.0825 -0.0776 0.1183  18  DA  E P     
1503 O OP1   . DA  B 18  ? 0.5858 0.6427 0.4171 -0.1039 -0.0872 0.1414  18  DA  E OP1   
1504 O OP2   . DA  B 18  ? 0.5651 0.6800 0.3816 -0.0743 -0.0713 0.1131  18  DA  E OP2   
1505 O "O5'" . DA  B 18  ? 0.4764 0.5205 0.3159 -0.0658 -0.0932 0.1039  18  DA  E "O5'" 
1506 C "C5'" . DA  B 18  ? 0.4196 0.4291 0.2741 -0.0668 -0.1005 0.1018  18  DA  E "C5'" 
1507 C "C4'" . DA  B 18  ? 0.3881 0.3769 0.2557 -0.0465 -0.1120 0.0820  18  DA  E "C4'" 
1508 O "O4'" . DA  B 18  ? 0.3353 0.3543 0.2181 -0.0354 -0.0957 0.0564  18  DA  E "O4'" 
1509 C "C3'" . DA  B 18  ? 0.4246 0.4016 0.2823 -0.0357 -0.1299 0.0855  18  DA  E "C3'" 
1510 O "O3'" . DA  B 18  ? 0.4443 0.3815 0.3147 -0.0228 -0.1467 0.0809  18  DA  E "O3'" 
1511 C "C2'" . DA  B 18  ? 0.3876 0.4003 0.2491 -0.0242 -0.1244 0.0644  18  DA  E "C2'" 
1512 C "C1'" . DA  B 18  ? 0.3219 0.3436 0.2083 -0.0215 -0.1050 0.0426  18  DA  E "C1'" 
1513 N N9    . DA  B 18  ? 0.2905 0.3434 0.1751 -0.0174 -0.0922 0.0245  18  DA  E N9    
1514 C C8    . DA  B 18  ? 0.3131 0.3951 0.1734 -0.0210 -0.0847 0.0284  18  DA  E C8    
1515 N N7    . DA  B 18  ? 0.3049 0.4023 0.1656 -0.0128 -0.0759 0.0054  18  DA  E N7    
1516 C C5    . DA  B 18  ? 0.2700 0.3485 0.1582 -0.0076 -0.0778 -0.0115 18  DA  E C5    
1517 C C6    . DA  B 18  ? 0.2399 0.3172 0.1398 -0.0027 -0.0733 -0.0361 18  DA  E C6    
1518 N N6    . DA  B 18  ? 0.2515 0.3393 0.1342 0.0011  -0.0676 -0.0513 18  DA  E N6    
1519 N N1    . DA  B 18  ? 0.2214 0.2852 0.1490 -0.0025 -0.0756 -0.0446 18  DA  E N1    
1520 C C2    . DA  B 18  ? 0.2160 0.2681 0.1578 -0.0021 -0.0817 -0.0331 18  DA  E C2    
1521 N N3    . DA  B 18  ? 0.2308 0.2735 0.1617 -0.0040 -0.0885 -0.0124 18  DA  E N3    
1522 C C4    . DA  B 18  ? 0.2730 0.3294 0.1770 -0.0091 -0.0863 -0.0006 18  DA  E C4    
1523 P P     . DG  B 19  ? 0.5075 0.4350 0.3796 -0.0035 -0.1645 0.0777  19  DG  E P     
1524 O OP1   . DG  B 19  ? 0.5862 0.4634 0.4581 0.0022  -0.1791 0.0849  19  DG  E OP1   
1525 O OP2   . DG  B 19  ? 0.5381 0.4919 0.3895 -0.0078 -0.1640 0.0877  19  DG  E OP2   
1526 O "O5'" . DG  B 19  ? 0.4479 0.3990 0.3494 0.0146  -0.1634 0.0484  19  DG  E "O5'" 
1527 C "C5'" . DG  B 19  ? 0.3581 0.3023 0.2859 0.0195  -0.1522 0.0312  19  DG  E "C5'" 
1528 C "C4'" . DG  B 19  ? 0.3314 0.3083 0.2891 0.0320  -0.1459 0.0051  19  DG  E "C4'" 
1529 O "O4'" . DG  B 19  ? 0.2901 0.2981 0.2457 0.0208  -0.1308 -0.0034 19  DG  E "O4'" 
1530 C "C3'" . DG  B 19  ? 0.3361 0.3253 0.3026 0.0503  -0.1655 0.0004  19  DG  E "C3'" 
1531 O "O3'" . DG  B 19  ? 0.3193 0.3274 0.3201 0.0640  -0.1620 -0.0209 19  DG  E "O3'" 
1532 C "C2'" . DG  B 19  ? 0.3349 0.3573 0.2907 0.0415  -0.1635 -0.0016 19  DG  E "C2'" 
1533 C "C1'" . DG  B 19  ? 0.3108 0.3453 0.2717 0.0273  -0.1398 -0.0135 19  DG  E "C1'" 
1534 N N9    . DG  B 19  ? 0.3074 0.3586 0.2450 0.0167  -0.1336 -0.0127 19  DG  E N9    
1535 C C8    . DG  B 19  ? 0.2969 0.3454 0.2018 0.0092  -0.1351 0.0064  19  DG  E C8    
1536 N N7    . DG  B 19  ? 0.2975 0.3682 0.1855 0.0042  -0.1269 -0.0012 19  DG  E N7    
1537 C C5    . DG  B 19  ? 0.2753 0.3555 0.1850 0.0067  -0.1215 -0.0262 19  DG  E C5    
1538 C C6    . DG  B 19  ? 0.2753 0.3676 0.1773 0.0033  -0.1137 -0.0446 19  DG  E C6    
1539 O O6    . DG  B 19  ? 0.3128 0.4114 0.1882 0.0014  -0.1077 -0.0447 19  DG  E O6    
1540 N N1    . DG  B 19  ? 0.2580 0.3487 0.1875 0.0010  -0.1103 -0.0622 19  DG  E N1    
1541 C C2    . DG  B 19  ? 0.2514 0.3418 0.2125 0.0036  -0.1131 -0.0639 19  DG  E C2    
1542 N N2    . DG  B 19  ? 0.2524 0.3472 0.2352 -0.0030 -0.1069 -0.0778 19  DG  E N2    
1543 N N3    . DG  B 19  ? 0.2607 0.3435 0.2294 0.0119  -0.1206 -0.0512 19  DG  E N3    
1544 C C4    . DG  B 19  ? 0.2760 0.3482 0.2173 0.0121  -0.1247 -0.0317 19  DG  E C4    
1545 P P     . DC  B 20  ? 0.3652 0.3861 0.3842 0.0868  -0.1753 -0.0272 20  DC  E P     
1546 O OP1   . DC  B 20  ? 0.3969 0.4186 0.4410 0.1018  -0.1702 -0.0431 20  DC  E OP1   
1547 O OP2   . DC  B 20  ? 0.4073 0.3987 0.3995 0.0915  -0.1920 -0.0064 20  DC  E OP2   
1548 O "O5'" . DC  B 20  ? 0.3464 0.4191 0.3820 0.0801  -0.1702 -0.0392 20  DC  E "O5'" 
1549 C "C5'" . DC  B 20  ? 0.2519 0.3533 0.3082 0.0675  -0.1534 -0.0561 20  DC  E "C5'" 
1550 C "C4'" . DC  B 20  ? 0.2737 0.4093 0.3346 0.0563  -0.1529 -0.0622 20  DC  E "C4'" 
1551 O "O4'" . DC  B 20  ? 0.2837 0.4076 0.3147 0.0406  -0.1502 -0.0566 20  DC  E "O4'" 
1552 C "C3'" . DC  B 20  ? 0.3017 0.4550 0.3663 0.0690  -0.1696 -0.0573 20  DC  E "C3'" 
1553 O "O3'" . DC  B 20  ? 0.2940 0.4898 0.3845 0.0628  -0.1670 -0.0698 20  DC  E "O3'" 
1554 C "C2'" . DC  B 20  ? 0.3295 0.4690 0.3587 0.0605  -0.1780 -0.0433 20  DC  E "C2'" 
1555 C "C1'" . DC  B 20  ? 0.3002 0.4379 0.3189 0.0401  -0.1624 -0.0515 20  DC  E "C1'" 
1556 N N1    . DC  B 20  ? 0.3133 0.4345 0.2936 0.0319  -0.1630 -0.0400 20  DC  E N1    
1557 C C2    . DC  B 20  ? 0.2922 0.4180 0.2573 0.0174  -0.1536 -0.0497 20  DC  E C2    
1558 O O2    . DC  B 20  ? 0.2792 0.4150 0.2617 0.0094  -0.1464 -0.0656 20  DC  E O2    
1559 N N3    . DC  B 20  ? 0.3101 0.4276 0.2395 0.0127  -0.1523 -0.0408 20  DC  E N3    
1560 C C4    . DC  B 20  ? 0.3427 0.4503 0.2523 0.0170  -0.1599 -0.0193 20  DC  E C4    
1561 N N4    . DC  B 20  ? 0.3489 0.4553 0.2231 0.0095  -0.1566 -0.0091 20  DC  E N4    
1562 C C5    . DC  B 20  ? 0.3357 0.4303 0.2589 0.0292  -0.1709 -0.0069 20  DC  E C5    
1563 C C6    . DC  B 20  ? 0.3324 0.4328 0.2905 0.0385  -0.1724 -0.0195 20  DC  E C6    
1564 O "O5'" . DT  C 1   ? 0.6867 0.7479 0.3678 -0.0031 -0.1175 -0.0556 1   DT  F "O5'" 
1565 C "C5'" . DT  C 1   ? 0.6796 0.7396 0.3540 -0.0053 -0.1292 -0.0704 1   DT  F "C5'" 
1566 C "C4'" . DT  C 1   ? 0.6412 0.6959 0.3524 -0.0042 -0.1338 -0.0844 1   DT  F "C4'" 
1567 O "O4'" . DT  C 1   ? 0.5862 0.6456 0.3262 -0.0068 -0.1446 -0.0713 1   DT  F "O4'" 
1568 C "C3'" . DT  C 1   ? 0.6138 0.6597 0.3434 0.0027  -0.1185 -0.0965 1   DT  F "C3'" 
1569 O "O3'" . DT  C 1   ? 0.6500 0.6824 0.3916 0.0008  -0.1251 -0.1148 1   DT  F "O3'" 
1570 C "C2'" . DT  C 1   ? 0.5356 0.5833 0.2928 0.0023  -0.1166 -0.0821 1   DT  F "C2'" 
1571 C "C1'" . DT  C 1   ? 0.5297 0.5845 0.3004 -0.0031 -0.1354 -0.0747 1   DT  F "C1'" 
1572 N N1    . DT  C 1   ? 0.4665 0.5276 0.2552 -0.0012 -0.1394 -0.0570 1   DT  F N1    
1573 C C2    . DT  C 1   ? 0.4022 0.4679 0.2289 0.0005  -0.1456 -0.0600 1   DT  F C2    
1574 O O2    . DT  C 1   ? 0.4328 0.4998 0.2780 -0.0039 -0.1472 -0.0739 1   DT  F O2    
1575 N N3    . DT  C 1   ? 0.3745 0.4435 0.2169 0.0060  -0.1503 -0.0462 1   DT  F N3    
1576 C C4    . DT  C 1   ? 0.4318 0.4969 0.2548 0.0071  -0.1510 -0.0269 1   DT  F C4    
1577 O O4    . DT  C 1   ? 0.4378 0.4992 0.2777 0.0129  -0.1577 -0.0160 1   DT  F O4    
1578 C C5    . DT  C 1   ? 0.4575 0.5225 0.2392 -0.0005 -0.1436 -0.0211 1   DT  F C5    
1579 C C7    . DT  C 1   ? 0.4969 0.5695 0.2586 -0.0035 -0.1403 0.0011  1   DT  F C7    
1580 C C6    . DT  C 1   ? 0.4661 0.5282 0.2329 -0.0025 -0.1378 -0.0380 1   DT  F C6    
1581 P P     . DG  C 2   ? 0.6641 0.6776 0.4099 0.0080  -0.1156 -0.1320 2   DG  F P     
1582 O OP1   . DG  C 2   ? 0.7423 0.7416 0.4771 0.0064  -0.1263 -0.1512 2   DG  F OP1   
1583 O OP2   . DG  C 2   ? 0.7034 0.7272 0.4390 0.0190  -0.0987 -0.1289 2   DG  F OP2   
1584 O "O5'" . DG  C 2   ? 0.5889 0.5911 0.3674 0.0015  -0.1164 -0.1275 2   DG  F "O5'" 
1585 C "C5'" . DG  C 2   ? 0.5554 0.5549 0.3523 -0.0123 -0.1298 -0.1295 2   DG  F "C5'" 
1586 C "C4'" . DG  C 2   ? 0.5073 0.5068 0.3335 -0.0198 -0.1267 -0.1221 2   DG  F "C4'" 
1587 O "O4'" . DG  C 2   ? 0.4621 0.4833 0.2998 -0.0149 -0.1235 -0.1072 2   DG  F "O4'" 
1588 C "C3'" . DG  C 2   ? 0.5099 0.4878 0.3374 -0.0159 -0.1165 -0.1247 2   DG  F "C3'" 
1589 O "O3'" . DG  C 2   ? 0.5388 0.5088 0.3876 -0.0325 -0.1205 -0.1240 2   DG  F "O3'" 
1590 C "C2'" . DG  C 2   ? 0.4863 0.4794 0.3149 -0.0048 -0.1039 -0.1121 2   DG  F "C2'" 
1591 C "C1'" . DG  C 2   ? 0.4424 0.4592 0.2879 -0.0101 -0.1110 -0.1018 2   DG  F "C1'" 
1592 N N9    . DG  C 2   ? 0.3872 0.4188 0.2277 -0.0009 -0.1062 -0.0881 2   DG  F N9    
1593 C C8    . DG  C 2   ? 0.3941 0.4281 0.2089 0.0066  -0.0982 -0.0830 2   DG  F C8    
1594 N N7    . DG  C 2   ? 0.3868 0.4318 0.2005 0.0085  -0.0978 -0.0667 2   DG  F N7    
1595 C C5    . DG  C 2   ? 0.3460 0.3953 0.1889 0.0066  -0.1068 -0.0638 2   DG  F C5    
1596 C C6    . DG  C 2   ? 0.3138 0.3697 0.1709 0.0100  -0.1135 -0.0502 2   DG  F C6    
1597 O O6    . DG  C 2   ? 0.3602 0.4144 0.2027 0.0118  -0.1145 -0.0341 2   DG  F O6    
1598 N N1    . DG  C 2   ? 0.2950 0.3603 0.1877 0.0097  -0.1204 -0.0568 2   DG  F N1    
1599 C C2    . DG  C 2   ? 0.2898 0.3610 0.1997 0.0014  -0.1197 -0.0709 2   DG  F C2    
1600 N N2    . DG  C 2   ? 0.2725 0.3640 0.2186 -0.0006 -0.1233 -0.0753 2   DG  F N2    
1601 N N3    . DG  C 2   ? 0.3312 0.3895 0.2244 -0.0055 -0.1160 -0.0800 2   DG  F N3    
1602 C C4    . DG  C 2   ? 0.3386 0.3848 0.1994 0.0001  -0.1102 -0.0772 2   DG  F C4    
1603 P P     . DC  C 3   ? 0.5148 0.4499 0.3628 -0.0357 -0.1190 -0.1279 3   DC  F P     
1604 O OP1   . DC  C 3   ? 0.5770 0.4886 0.4203 -0.0471 -0.1325 -0.1385 3   DC  F OP1   
1605 O OP2   . DC  C 3   ? 0.5231 0.4496 0.3575 -0.0146 -0.1082 -0.1283 3   DC  F OP2   
1606 O "O5'" . DC  C 3   ? 0.4542 0.4009 0.3272 -0.0521 -0.1156 -0.1169 3   DC  F "O5'" 
1607 C "C5'" . DC  C 3   ? 0.4285 0.4077 0.3251 -0.0697 -0.1204 -0.1148 3   DC  F "C5'" 
1608 C "C4'" . DC  C 3   ? 0.4020 0.4094 0.3193 -0.0704 -0.1126 -0.1050 3   DC  F "C4'" 
1609 O "O4'" . DC  C 3   ? 0.3633 0.3825 0.2753 -0.0470 -0.1076 -0.1010 3   DC  F "O4'" 
1610 C "C3'" . DC  C 3   ? 0.3840 0.3749 0.3032 -0.0755 -0.1037 -0.0979 3   DC  F "C3'" 
1611 O "O3'" . DC  C 3   ? 0.3591 0.3824 0.3074 -0.0942 -0.0975 -0.0908 3   DC  F "O3'" 
1612 C "C2'" . DC  C 3   ? 0.3750 0.3692 0.2885 -0.0513 -0.0907 -0.0919 3   DC  F "C2'" 
1613 C "C1'" . DC  C 3   ? 0.3507 0.3756 0.2719 -0.0405 -0.0948 -0.0933 3   DC  F "C1'" 
1614 N N1    . DC  C 3   ? 0.3264 0.3487 0.2302 -0.0200 -0.0890 -0.0882 3   DC  F N1    
1615 C C2    . DC  C 3   ? 0.2762 0.3197 0.1934 -0.0116 -0.0858 -0.0782 3   DC  F C2    
1616 O O2    . DC  C 3   ? 0.2720 0.3380 0.2174 -0.0161 -0.0880 -0.0781 3   DC  F O2    
1617 N N3    . DC  C 3   ? 0.2772 0.3175 0.1757 0.0005  -0.0818 -0.0699 3   DC  F N3    
1618 C C4    . DC  C 3   ? 0.3323 0.3601 0.2029 0.0061  -0.0777 -0.0741 3   DC  F C4    
1619 N N4    . DC  C 3   ? 0.3125 0.3477 0.1659 0.0136  -0.0720 -0.0648 3   DC  F N4    
1620 C C5    . DC  C 3   ? 0.3696 0.3774 0.2305 0.0030  -0.0797 -0.0876 3   DC  F C5    
1621 C C6    . DC  C 3   ? 0.3680 0.3684 0.2437 -0.0106 -0.0874 -0.0934 3   DC  F C6    
1622 P P     . DT  C 4   ? 0.3748 0.3976 0.3269 -0.1049 -0.0836 -0.0795 4   DT  F P     
1623 O OP1   . DT  C 4   ? 0.4072 0.4514 0.3780 -0.1308 -0.0816 -0.0735 4   DT  F OP1   
1624 O OP2   . DT  C 4   ? 0.4011 0.3734 0.3255 -0.0944 -0.0837 -0.0759 4   DT  F OP2   
1625 O "O5'" . DT  C 4   ? 0.3070 0.3687 0.2801 -0.0855 -0.0704 -0.0778 4   DT  F "O5'" 
1626 C "C5'" . DT  C 4   ? 0.2614 0.3713 0.2631 -0.0832 -0.0731 -0.0851 4   DT  F "C5'" 
1627 C "C4'" . DT  C 4   ? 0.2229 0.3534 0.2400 -0.0623 -0.0647 -0.0836 4   DT  F "C4'" 
1628 O "O4'" . DT  C 4   ? 0.2026 0.3034 0.1987 -0.0409 -0.0669 -0.0783 4   DT  F "O4'" 
1629 C "C3'" . DT  C 4   ? 0.2189 0.3543 0.2404 -0.0675 -0.0494 -0.0778 4   DT  F "C3'" 
1630 O "O3'" . DT  C 4   ? 0.1674 0.3487 0.2194 -0.0595 -0.0457 -0.0861 4   DT  F "O3'" 
1631 C "C2'" . DT  C 4   ? 0.2063 0.3017 0.2046 -0.0505 -0.0452 -0.0685 4   DT  F "C2'" 
1632 C "C1'" . DT  C 4   ? 0.1867 0.2784 0.1805 -0.0322 -0.0552 -0.0704 4   DT  F "C1'" 
1633 N N1    . DT  C 4   ? 0.1961 0.2544 0.1615 -0.0214 -0.0540 -0.0638 4   DT  F N1    
1634 C C2    . DT  C 4   ? 0.1883 0.2451 0.1497 -0.0068 -0.0530 -0.0565 4   DT  F C2    
1635 O O2    . DT  C 4   ? 0.1936 0.2650 0.1722 -0.0004 -0.0561 -0.0551 4   DT  F O2    
1636 N N3    . DT  C 4   ? 0.2360 0.2743 0.1724 -0.0005 -0.0498 -0.0519 4   DT  F N3    
1637 C C4    . DT  C 4   ? 0.2763 0.2966 0.1934 -0.0015 -0.0489 -0.0579 4   DT  F C4    
1638 O O4    . DT  C 4   ? 0.3171 0.3312 0.2152 0.0077  -0.0452 -0.0576 4   DT  F O4    
1639 C C5    . DT  C 4   ? 0.2769 0.2878 0.1977 -0.0147 -0.0543 -0.0658 4   DT  F C5    
1640 C C7    . DT  C 4   ? 0.3245 0.3050 0.2241 -0.0150 -0.0598 -0.0743 4   DT  F C7    
1641 C C6    . DT  C 4   ? 0.2300 0.2614 0.1738 -0.0268 -0.0558 -0.0663 4   DT  F C6    
1642 P P     . DT  C 5   ? 0.1543 0.3579 0.2157 -0.0655 -0.0303 -0.0859 5   DT  F P     
1643 O OP1   . DT  C 5   ? 0.1957 0.4505 0.2856 -0.0650 -0.0257 -0.0973 5   DT  F OP1   
1644 O OP2   . DT  C 5   ? 0.2150 0.3871 0.2504 -0.0864 -0.0237 -0.0727 5   DT  F OP2   
1645 O "O5'" . DT  C 5   ? 0.1404 0.3231 0.1986 -0.0387 -0.0297 -0.0832 5   DT  F "O5'" 
1646 C "C5'" . DT  C 5   ? 0.1618 0.3516 0.2350 -0.0160 -0.0420 -0.0904 5   DT  F "C5'" 
1647 C "C4'" . DT  C 5   ? 0.1346 0.2885 0.1934 0.0004  -0.0436 -0.0804 5   DT  F "C4'" 
1648 O "O4'" . DT  C 5   ? 0.1433 0.2590 0.1720 -0.0029 -0.0429 -0.0663 5   DT  F "O4'" 
1649 C "C3'" . DT  C 5   ? 0.1364 0.2903 0.1958 0.0002  -0.0317 -0.0796 5   DT  F "C3'" 
1650 O "O3'" . DT  C 5   ? 0.1432 0.2989 0.2174 0.0196  -0.0408 -0.0867 5   DT  F "O3'" 
1651 C "C2'" . DT  C 5   ? 0.1644 0.2778 0.1946 -0.0045 -0.0255 -0.0626 5   DT  F "C2'" 
1652 C "C1'" . DT  C 5   ? 0.1909 0.2849 0.2076 0.0013  -0.0358 -0.0566 5   DT  F "C1'" 
1653 N N1    . DT  C 5   ? 0.2072 0.2749 0.1978 -0.0039 -0.0308 -0.0475 5   DT  F N1    
1654 C C2    . DT  C 5   ? 0.2087 0.2593 0.1831 0.0042  -0.0320 -0.0381 5   DT  F C2    
1655 O O2    . DT  C 5   ? 0.1938 0.2430 0.1709 0.0115  -0.0382 -0.0327 5   DT  F O2    
1656 N N3    . DT  C 5   ? 0.2207 0.2565 0.1751 0.0029  -0.0272 -0.0359 5   DT  F N3    
1657 C C4    . DT  C 5   ? 0.2196 0.2448 0.1670 -0.0044 -0.0257 -0.0412 5   DT  F C4    
1658 O O4    . DT  C 5   ? 0.2542 0.2633 0.1845 -0.0002 -0.0250 -0.0425 5   DT  F O4    
1659 C C5    . DT  C 5   ? 0.2004 0.2363 0.1617 -0.0177 -0.0265 -0.0460 5   DT  F C5    
1660 C C7    . DT  C 5   ? 0.2187 0.2370 0.1696 -0.0323 -0.0288 -0.0477 5   DT  F C7    
1661 C C6    . DT  C 5   ? 0.1839 0.2462 0.1669 -0.0173 -0.0270 -0.0495 5   DT  F C6    
1662 P P     . DC  C 6   ? 0.1711 0.3241 0.2469 0.0240  -0.0338 -0.0893 6   DC  F P     
1663 O OP1   . DC  C 6   ? 0.1879 0.3626 0.2905 0.0437  -0.0457 -0.1095 6   DC  F OP1   
1664 O OP2   . DC  C 6   ? 0.1893 0.3550 0.2557 0.0048  -0.0161 -0.0865 6   DC  F OP2   
1665 O "O5'" . DC  C 6   ? 0.1682 0.2737 0.2213 0.0275  -0.0383 -0.0700 6   DC  F "O5'" 
1666 C "C5'" . DC  C 6   ? 0.1727 0.2552 0.2213 0.0375  -0.0554 -0.0625 6   DC  F "C5'" 
1667 C "C4'" . DC  C 6   ? 0.1748 0.2248 0.1999 0.0324  -0.0541 -0.0423 6   DC  F "C4'" 
1668 O "O4'" . DC  C 6   ? 0.1822 0.2313 0.1892 0.0215  -0.0414 -0.0340 6   DC  F "O4'" 
1669 C "C3'" . DC  C 6   ? 0.1783 0.2199 0.2041 0.0313  -0.0487 -0.0408 6   DC  F "C3'" 
1670 O "O3'" . DC  C 6   ? 0.2103 0.2261 0.2353 0.0373  -0.0660 -0.0343 6   DC  F "O3'" 
1671 C "C2'" . DC  C 6   ? 0.1662 0.2022 0.1731 0.0196  -0.0338 -0.0276 6   DC  F "C2'" 
1672 C "C1'" . DC  C 6   ? 0.1678 0.2036 0.1618 0.0170  -0.0338 -0.0223 6   DC  F "C1'" 
1673 N N1    . DC  C 6   ? 0.1615 0.1999 0.1441 0.0104  -0.0211 -0.0218 6   DC  F N1    
1674 C C2    . DC  C 6   ? 0.1701 0.2019 0.1357 0.0095  -0.0166 -0.0128 6   DC  F C2    
1675 O O2    . DC  C 6   ? 0.2093 0.2386 0.1684 0.0094  -0.0204 -0.0025 6   DC  F O2    
1676 N N3    . DC  C 6   ? 0.1711 0.2006 0.1277 0.0085  -0.0097 -0.0163 6   DC  F N3    
1677 C C4    . DC  C 6   ? 0.1885 0.2160 0.1486 0.0033  -0.0085 -0.0234 6   DC  F C4    
1678 N N4    . DC  C 6   ? 0.1834 0.1981 0.1316 0.0022  -0.0071 -0.0253 6   DC  F N4    
1679 C C5    . DC  C 6   ? 0.1630 0.2034 0.1387 -0.0015 -0.0101 -0.0296 6   DC  F C5    
1680 C C6    . DC  C 6   ? 0.1669 0.2154 0.1553 0.0048  -0.0159 -0.0310 6   DC  F C6    
1681 P P     . DG  C 7   ? 0.2497 0.2503 0.2760 0.0363  -0.0677 -0.0332 7   DG  F P     
1682 O OP1   . DG  C 7   ? 0.2955 0.2700 0.3296 0.0477  -0.0934 -0.0372 7   DG  F OP1   
1683 O OP2   . DG  C 7   ? 0.2266 0.2521 0.2606 0.0347  -0.0512 -0.0468 7   DG  F OP2   
1684 O "O5'" . DG  C 7   ? 0.2329 0.2210 0.2383 0.0209  -0.0606 -0.0095 7   DG  F "O5'" 
1685 C "C5'" . DG  C 7   ? 0.2484 0.2247 0.2375 0.0147  -0.0682 0.0079  7   DG  F "C5'" 
1686 C "C4'" . DG  C 7   ? 0.2382 0.2205 0.2119 0.0002  -0.0563 0.0248  7   DG  F "C4'" 
1687 O "O4'" . DG  C 7   ? 0.2372 0.2427 0.2078 0.0013  -0.0373 0.0188  7   DG  F "O4'" 
1688 C "C3'" . DG  C 7   ? 0.2412 0.2182 0.2202 -0.0067 -0.0556 0.0285  7   DG  F "C3'" 
1689 O "O3'" . DG  C 7   ? 0.2917 0.2648 0.2573 -0.0232 -0.0595 0.0498  7   DG  F "O3'" 
1690 C "C2'" . DG  C 7   ? 0.2137 0.2140 0.1969 -0.0046 -0.0357 0.0196  7   DG  F "C2'" 
1691 C "C1'" . DG  C 7   ? 0.2077 0.2226 0.1806 -0.0028 -0.0260 0.0199  7   DG  F "C1'" 
1692 N N9    . DG  C 7   ? 0.1629 0.1877 0.1387 0.0028  -0.0149 0.0077  7   DG  F N9    
1693 C C8    . DG  C 7   ? 0.1644 0.1899 0.1502 0.0063  -0.0142 -0.0049 7   DG  F C8    
1694 N N7    . DG  C 7   ? 0.1518 0.1826 0.1333 0.0053  -0.0058 -0.0095 7   DG  F N7    
1695 C C5    . DG  C 7   ? 0.1517 0.1831 0.1220 0.0062  -0.0020 -0.0033 7   DG  F C5    
1696 C C6    . DG  C 7   ? 0.1408 0.1701 0.1021 0.0088  0.0025  -0.0067 7   DG  F C6    
1697 O O6    . DG  C 7   ? 0.1526 0.1734 0.1110 0.0065  0.0027  -0.0114 7   DG  F O6    
1698 N N1    . DG  C 7   ? 0.1616 0.1997 0.1152 0.0138  0.0050  -0.0043 7   DG  F N1    
1699 C C2    . DG  C 7   ? 0.1715 0.2232 0.1239 0.0107  0.0053  0.0043  7   DG  F C2    
1700 N N2    . DG  C 7   ? 0.1702 0.2413 0.1145 0.0145  0.0105  0.0037  7   DG  F N2    
1701 N N3    . DG  C 7   ? 0.1835 0.2302 0.1408 0.0036  -0.0008 0.0125  7   DG  F N3    
1702 C C4    . DG  C 7   ? 0.1542 0.1885 0.1215 0.0044  -0.0052 0.0064  7   DG  F C4    
1703 P P     . DT  C 8   ? 0.2765 0.2417 0.2465 -0.0365 -0.0645 0.0586  8   DT  F P     
1704 O OP1   . DT  C 8   ? 0.3367 0.2840 0.2913 -0.0562 -0.0802 0.0824  8   DT  F OP1   
1705 O OP2   . DT  C 8   ? 0.2979 0.2474 0.2834 -0.0245 -0.0717 0.0403  8   DT  F OP2   
1706 O "O5'" . DT  C 8   ? 0.2463 0.2503 0.2181 -0.0407 -0.0419 0.0589  8   DT  F "O5'" 
1707 C "C5'" . DT  C 8   ? 0.2631 0.2959 0.2236 -0.0440 -0.0291 0.0652  8   DT  F "C5'" 
1708 C "C4'" . DT  C 8   ? 0.2330 0.2974 0.2010 -0.0365 -0.0117 0.0554  8   DT  F "C4'" 
1709 O "O4'" . DT  C 8   ? 0.2295 0.2860 0.2008 -0.0198 -0.0072 0.0386  8   DT  F "O4'" 
1710 C "C3'" . DT  C 8   ? 0.2140 0.2859 0.1955 -0.0417 -0.0114 0.0559  8   DT  F "C3'" 
1711 O "O3'" . DT  C 8   ? 0.2442 0.3495 0.2259 -0.0574 -0.0066 0.0687  8   DT  F "O3'" 
1712 C "C2'" . DT  C 8   ? 0.1923 0.2719 0.1802 -0.0248 -0.0020 0.0398  8   DT  F "C2'" 
1713 C "C1'" . DT  C 8   ? 0.1901 0.2629 0.1682 -0.0138 0.0017  0.0319  8   DT  F "C1'" 
1714 N N1    . DT  C 8   ? 0.1826 0.2394 0.1624 -0.0036 0.0022  0.0192  8   DT  F N1    
1715 C C2    . DT  C 8   ? 0.1508 0.2110 0.1256 0.0058  0.0076  0.0115  8   DT  F C2    
1716 O O2    . DT  C 8   ? 0.1722 0.2496 0.1436 0.0112  0.0121  0.0100  8   DT  F O2    
1717 N N3    . DT  C 8   ? 0.1560 0.1999 0.1290 0.0080  0.0063  0.0045  8   DT  F N3    
1718 C C4    . DT  C 8   ? 0.1477 0.1831 0.1249 0.0033  0.0035  0.0016  8   DT  F C4    
1719 O O4    . DT  C 8   ? 0.1697 0.1994 0.1433 0.0017  0.0044  -0.0037 8   DT  F O4    
1720 C C5    . DT  C 8   ? 0.1438 0.1782 0.1289 -0.0005 -0.0021 0.0047  8   DT  F C5    
1721 C C7    . DT  C 8   ? 0.1723 0.2011 0.1642 -0.0005 -0.0070 -0.0045 8   DT  F C7    
1722 C C6    . DT  C 8   ? 0.1657 0.2055 0.1507 -0.0047 -0.0042 0.0148  8   DT  F C6    
1723 P P     . DC  C 9   ? 0.2066 0.3388 0.2051 -0.0633 -0.0036 0.0688  9   DC  F P     
1724 O OP1   . DC  C 9   ? 0.2585 0.4190 0.2557 -0.0893 -0.0042 0.0876  9   DC  F OP1   
1725 O OP2   . DC  C 9   ? 0.2368 0.3382 0.2434 -0.0584 -0.0132 0.0611  9   DC  F OP2   
1726 O "O5'" . DC  C 9   ? 0.2107 0.3776 0.2154 -0.0433 0.0107  0.0537  9   DC  F "O5'" 
1727 C "C5'" . DC  C 9   ? 0.1891 0.3808 0.1841 -0.0365 0.0207  0.0498  9   DC  F "C5'" 
1728 C "C4'" . DC  C 9   ? 0.1615 0.3712 0.1636 -0.0124 0.0274  0.0309  9   DC  F "C4'" 
1729 O "O4'" . DC  C 9   ? 0.1769 0.3423 0.1732 0.0015  0.0218  0.0218  9   DC  F "O4'" 
1730 C "C3'" . DC  C 9   ? 0.1457 0.3857 0.1683 -0.0086 0.0275  0.0267  9   DC  F "C3'" 
1731 O "O3'" . DC  C 9   ? 0.1519 0.4367 0.1815 0.0069  0.0348  0.0130  9   DC  F "O3'" 
1732 C "C2'" . DC  C 9   ? 0.1331 0.3314 0.1564 0.0041  0.0188  0.0197  9   DC  F "C2'" 
1733 C "C1'" . DC  C 9   ? 0.1298 0.2935 0.1358 0.0139  0.0187  0.0133  9   DC  F "C1'" 
1734 N N1    . DC  C 9   ? 0.1528 0.2733 0.1525 0.0133  0.0118  0.0131  9   DC  F N1    
1735 C C2    . DC  C 9   ? 0.1720 0.2680 0.1623 0.0253  0.0088  0.0045  9   DC  F C2    
1736 O O2    . DC  C 9   ? 0.1970 0.2993 0.1847 0.0394  0.0090  -0.0045 9   DC  F O2    
1737 N N3    . DC  C 9   ? 0.1174 0.1846 0.1009 0.0201  0.0047  0.0054  9   DC  F N3    
1738 C C4    . DC  C 9   ? 0.1110 0.1745 0.0984 0.0089  0.0034  0.0099  9   DC  F C4    
1739 N N4    . DC  C 9   ? 0.1140 0.1597 0.0950 0.0051  0.0013  0.0069  9   DC  F N4    
1740 C C5    . DC  C 9   ? 0.1339 0.2127 0.1309 0.0000  0.0029  0.0169  9   DC  F C5    
1741 C C6    . DC  C 9   ? 0.1158 0.2222 0.1178 -0.0002 0.0072  0.0206  9   DC  F C6    
1742 P P     . DC  C 10  ? 0.1893 0.5132 0.2400 0.0111  0.0328  0.0066  10  DC  F P     
1743 O OP1   . DC  C 10  ? 0.2309 0.5944 0.2800 0.0159  0.0383  -0.0035 10  DC  F OP1   
1744 O OP2   . DC  C 10  ? 0.1878 0.5122 0.2481 -0.0126 0.0283  0.0230  10  DC  F OP2   
1745 O "O5'" . DC  C 10  ? 0.1502 0.4565 0.2092 0.0399  0.0251  -0.0090 10  DC  F "O5'" 
1746 C "C5'" . DC  C 10  ? 0.1885 0.4697 0.2350 0.0624  0.0231  -0.0232 10  DC  F "C5'" 
1747 C "C4'" . DC  C 10  ? 0.1825 0.4148 0.2251 0.0768  0.0083  -0.0271 10  DC  F "C4'" 
1748 O "O4'" . DC  C 10  ? 0.1897 0.3748 0.2178 0.0586  0.0057  -0.0128 10  DC  F "O4'" 
1749 C "C3'" . DC  C 10  ? 0.2073 0.4598 0.2698 0.0856  -0.0012 -0.0299 10  DC  F "C3'" 
1750 O "O3'" . DC  C 10  ? 0.2550 0.4987 0.3187 0.1147  -0.0132 -0.0475 10  DC  F "O3'" 
1751 C "C2'" . DC  C 10  ? 0.2328 0.4389 0.2845 0.0705  -0.0096 -0.0156 10  DC  F "C2'" 
1752 C "C1'" . DC  C 10  ? 0.2026 0.3628 0.2306 0.0624  -0.0063 -0.0111 10  DC  F "C1'" 
1753 N N1    . DC  C 10  ? 0.1883 0.3222 0.2077 0.0417  -0.0062 0.0012  10  DC  F N1    
1754 C C2    . DC  C 10  ? 0.1667 0.2576 0.1677 0.0397  -0.0120 0.0029  10  DC  F C2    
1755 O O2    . DC  C 10  ? 0.1809 0.2489 0.1710 0.0516  -0.0190 -0.0020 10  DC  F O2    
1756 N N3    . DC  C 10  ? 0.1258 0.2027 0.1211 0.0241  -0.0108 0.0087  10  DC  F N3    
1757 C C4    . DC  C 10  ? 0.1908 0.2839 0.1969 0.0125  -0.0081 0.0129  10  DC  F C4    
1758 N N4    . DC  C 10  ? 0.1592 0.2359 0.1599 0.0019  -0.0098 0.0137  10  DC  F N4    
1759 C C5    . DC  C 10  ? 0.1771 0.3056 0.1993 0.0102  -0.0046 0.0156  10  DC  F C5    
1760 C C6    . DC  C 10  ? 0.1785 0.3318 0.2073 0.0243  -0.0018 0.0096  10  DC  F C6    
1761 P P     . DA  C 11  ? 0.3879 0.5058 0.1773 0.0694  0.0270  0.0171  11  DA  F P     
1762 O OP1   . DA  C 11  ? 0.4906 0.6203 0.2500 0.0918  0.0438  -0.0022 11  DA  F OP1   
1763 O OP2   . DA  C 11  ? 0.4286 0.6020 0.2718 0.0512  0.0292  0.0416  11  DA  F OP2   
1764 O "O5'" . DA  C 11  ? 0.3740 0.4413 0.1714 0.0871  0.0177  0.0040  11  DA  F "O5'" 
1765 C "C5'" . DA  C 11  ? 0.3974 0.3937 0.1605 0.0947  0.0049  -0.0148 11  DA  F "C5'" 
1766 C "C4'" . DA  C 11  ? 0.3483 0.2980 0.1327 0.0879  -0.0061 -0.0135 11  DA  F "C4'" 
1767 O "O4'" . DA  C 11  ? 0.3043 0.2551 0.1226 0.0526  -0.0144 0.0004  11  DA  F "O4'" 
1768 C "C3'" . DA  C 11  ? 0.3694 0.3369 0.1741 0.1051  0.0001  -0.0092 11  DA  F "C3'" 
1769 O "O3'" . DA  C 11  ? 0.4441 0.3516 0.2251 0.1236  -0.0096 -0.0222 11  DA  F "O3'" 
1770 C "C2'" . DA  C 11  ? 0.3357 0.3163 0.1793 0.0762  -0.0026 0.0090  11  DA  F "C2'" 
1771 C "C1'" . DA  C 11  ? 0.3056 0.2564 0.1523 0.0470  -0.0123 0.0075  11  DA  F "C1'" 
1772 N N9    . DA  C 11  ? 0.2247 0.2083 0.1148 0.0192  -0.0169 0.0200  11  DA  F N9    
1773 C C8    . DA  C 11  ? 0.2393 0.2786 0.1522 0.0118  -0.0176 0.0343  11  DA  F C8    
1774 N N7    . DA  C 11  ? 0.1954 0.2480 0.1507 -0.0131 -0.0296 0.0410  11  DA  F N7    
1775 C C5    . DA  C 11  ? 0.1861 0.1952 0.1477 -0.0224 -0.0317 0.0276  11  DA  F C5    
1776 C C6    . DA  C 11  ? 0.1605 0.1657 0.1654 -0.0457 -0.0398 0.0208  11  DA  F C6    
1777 N N6    . DA  C 11  ? 0.1518 0.1856 0.1949 -0.0525 -0.0469 0.0233  11  DA  F N6    
1778 N N1    . DA  C 11  ? 0.1718 0.1370 0.1738 -0.0528 -0.0327 0.0068  11  DA  F N1    
1779 C C2    . DA  C 11  ? 0.1886 0.1126 0.1456 -0.0385 -0.0241 0.0038  11  DA  F C2    
1780 N N3    . DA  C 11  ? 0.2191 0.1364 0.1340 -0.0132 -0.0220 0.0075  11  DA  F N3    
1781 C C4    . DA  C 11  ? 0.2175 0.1828 0.1378 -0.0054 -0.0235 0.0177  11  DA  F C4    
1782 P P     . DG  C 12  ? 0.4843 0.3871 0.2723 0.1461  -0.0136 -0.0207 12  DG  F P     
1783 O OP1   . DG  C 12  ? 0.5548 0.4058 0.3119 0.1764  -0.0271 -0.0411 12  DG  F OP1   
1784 O OP2   . DG  C 12  ? 0.4717 0.4500 0.2948 0.1542  -0.0021 -0.0125 12  DG  F OP2   
1785 O "O5'" . DG  C 12  ? 0.4321 0.2963 0.2247 0.1163  -0.0195 -0.0046 12  DG  F "O5'" 
1786 C "C5'" . DG  C 12  ? 0.4005 0.2142 0.1816 0.0908  -0.0234 -0.0055 12  DG  F "C5'" 
1787 C "C4'" . DG  C 12  ? 0.3792 0.1860 0.1748 0.0598  -0.0186 0.0081  12  DG  F "C4'" 
1788 O "O4'" . DG  C 12  ? 0.3261 0.1879 0.1613 0.0403  -0.0110 0.0128  12  DG  F "O4'" 
1789 C "C3'" . DG  C 12  ? 0.3976 0.1987 0.1817 0.0686  -0.0216 0.0188  12  DG  F "C3'" 
1790 O "O3'" . DG  C 12  ? 0.4948 0.2293 0.2456 0.0535  -0.0263 0.0244  12  DG  F "O3'" 
1791 C "C2'" . DG  C 12  ? 0.3695 0.2257 0.1890 0.0513  -0.0129 0.0277  12  DG  F "C2'" 
1792 C "C1'" . DG  C 12  ? 0.2938 0.1674 0.1420 0.0265  -0.0066 0.0219  12  DG  F "C1'" 
1793 N N9    . DG  C 12  ? 0.2395 0.1747 0.1311 0.0176  -0.0059 0.0265  12  DG  F N9    
1794 C C8    . DG  C 12  ? 0.2288 0.2157 0.1380 0.0329  -0.0079 0.0327  12  DG  F C8    
1795 N N7    . DG  C 12  ? 0.1591 0.1890 0.1090 0.0163  -0.0120 0.0392  12  DG  F N7    
1796 C C5    . DG  C 12  ? 0.1705 0.1784 0.1333 -0.0078 -0.0124 0.0318  12  DG  F C5    
1797 C C6    . DG  C 12  ? 0.1180 0.1524 0.1274 -0.0299 -0.0199 0.0287  12  DG  F C6    
1798 O O6    . DG  C 12  ? 0.1142 0.1917 0.1611 -0.0344 -0.0324 0.0362  12  DG  F O6    
1799 N N1    . DG  C 12  ? 0.1416 0.1486 0.1565 -0.0489 -0.0129 0.0142  12  DG  F N1    
1800 C C2    . DG  C 12  ? 0.1956 0.1537 0.1728 -0.0511 0.0003  0.0092  12  DG  F C2    
1801 N N2    . DG  C 12  ? 0.2073 0.1528 0.2013 -0.0748 0.0108  -0.0045 12  DG  F N2    
1802 N N3    . DG  C 12  ? 0.2321 0.1572 0.1628 -0.0321 0.0019  0.0160  12  DG  F N3    
1803 C C4    . DG  C 12  ? 0.2050 0.1582 0.1323 -0.0089 -0.0051 0.0246  12  DG  F C4    
1804 P P     . DG  C 13  ? 0.5818 0.2828 0.2989 0.0585  -0.0369 0.0379  13  DG  F P     
1805 O OP1   . DG  C 13  ? 0.6768 0.3140 0.3624 0.0512  -0.0486 0.0374  13  DG  F OP1   
1806 O OP2   . DG  C 13  ? 0.6006 0.3426 0.3342 0.0919  -0.0467 0.0362  13  DG  F OP2   
1807 O "O5'" . DG  C 13  ? 0.5479 0.2678 0.2715 0.0237  -0.0199 0.0469  13  DG  F "O5'" 
1808 C "C5'" . DG  C 13  ? 0.5027 0.2178 0.2392 -0.0111 -0.0023 0.0428  13  DG  F "C5'" 
1809 C "C4'" . DG  C 13  ? 0.4334 0.1907 0.1928 -0.0338 0.0137  0.0418  13  DG  F "C4'" 
1810 O "O4'" . DG  C 13  ? 0.3600 0.1837 0.1719 -0.0229 0.0111  0.0348  13  DG  F "O4'" 
1811 C "C3'" . DG  C 13  ? 0.4762 0.2272 0.2039 -0.0325 0.0100  0.0506  13  DG  F "C3'" 
1812 O "O3'" . DG  C 13  ? 0.5400 0.2916 0.2631 -0.0641 0.0292  0.0459  13  DG  F "O3'" 
1813 C "C2'" . DG  C 13  ? 0.4265 0.2313 0.1840 -0.0138 0.0018  0.0509  13  DG  F "C2'" 
1814 C "C1'" . DG  C 13  ? 0.3448 0.1986 0.1632 -0.0239 0.0108  0.0379  13  DG  F "C1'" 
1815 N N9    . DG  C 13  ? 0.2518 0.1630 0.1142 -0.0057 -0.0002 0.0385  13  DG  F N9    
1816 C C8    . DG  C 13  ? 0.2505 0.1766 0.1148 0.0234  -0.0113 0.0444  13  DG  F C8    
1817 N N7    . DG  C 13  ? 0.2043 0.1890 0.1144 0.0281  -0.0161 0.0467  13  DG  F N7    
1818 C C5    . DG  C 13  ? 0.1685 0.1722 0.1089 0.0029  -0.0137 0.0413  13  DG  F C5    
1819 C C6    . DG  C 13  ? 0.1173 0.1735 0.1122 -0.0056 -0.0233 0.0421  13  DG  F C6    
1820 O O6    . DG  C 13  ? 0.0961 0.1948 0.1210 0.0038  -0.0329 0.0524  13  DG  F O6    
1821 N N1    . DG  C 13  ? 0.1015 0.1593 0.1197 -0.0288 -0.0217 0.0286  13  DG  F N1    
1822 C C2    . DG  C 13  ? 0.1311 0.1526 0.1239 -0.0444 -0.0055 0.0161  13  DG  F C2    
1823 N N2    . DG  C 13  ? 0.1146 0.1533 0.1448 -0.0646 -0.0028 -0.0022 13  DG  F N2    
1824 N N3    . DG  C 13  ? 0.1814 0.1541 0.1196 -0.0415 0.0064  0.0203  13  DG  F N3    
1825 C C4    . DG  C 13  ? 0.1974 0.1604 0.1116 -0.0165 -0.0018 0.0332  13  DG  F C4    
1826 P P     . DA  C 14  ? 0.6102 0.3363 0.2865 -0.0711 0.0269  0.0533  14  DA  F P     
1827 O OP1   . DA  C 14  ? 0.7108 0.3957 0.3593 -0.0930 0.0349  0.0567  14  DA  F OP1   
1828 O OP2   . DA  C 14  ? 0.6260 0.3456 0.2882 -0.0409 0.0009  0.0621  14  DA  F OP2   
1829 O "O5'" . DA  C 14  ? 0.5841 0.3519 0.2764 -0.0893 0.0457  0.0418  14  DA  F "O5'" 
1830 C "C5'" . DA  C 14  ? 0.5392 0.3407 0.2763 -0.1115 0.0685  0.0239  14  DA  F "C5'" 
1831 C "C4'" . DA  C 14  ? 0.4685 0.3157 0.2280 -0.1191 0.0781  0.0084  14  DA  F "C4'" 
1832 O "O4'" . DA  C 14  ? 0.3886 0.2739 0.1893 -0.1011 0.0618  0.0074  14  DA  F "O4'" 
1833 C "C3'" . DA  C 14  ? 0.5003 0.3328 0.2077 -0.1170 0.0743  0.0139  14  DA  F "C3'" 
1834 O "O3'" . DA  C 14  ? 0.5060 0.3683 0.2249 -0.1380 0.0968  -0.0079 14  DA  F "O3'" 
1835 C "C2'" . DA  C 14  ? 0.4489 0.2956 0.1585 -0.0885 0.0470  0.0222  14  DA  F "C2'" 
1836 C "C1'" . DA  C 14  ? 0.3660 0.2627 0.1495 -0.0848 0.0451  0.0110  14  DA  F "C1'" 
1837 N N9    . DA  C 14  ? 0.3263 0.2368 0.1340 -0.0539 0.0173  0.0242  14  DA  F N9    
1838 C C8    . DA  C 14  ? 0.3426 0.2173 0.1166 -0.0336 0.0039  0.0420  14  DA  F C8    
1839 N N7    . DA  C 14  ? 0.2955 0.2043 0.1093 -0.0083 -0.0148 0.0468  14  DA  F N7    
1840 C C5    . DA  C 14  ? 0.2361 0.2011 0.1098 -0.0151 -0.0167 0.0364  14  DA  F C5    
1841 C C6    . DA  C 14  ? 0.2149 0.2343 0.1497 -0.0027 -0.0334 0.0394  14  DA  F C6    
1842 N N6    . DA  C 14  ? 0.1863 0.2212 0.1335 0.0201  -0.0445 0.0520  14  DA  F N6    
1843 N N1    . DA  C 14  ? 0.1567 0.2154 0.1428 -0.0160 -0.0386 0.0280  14  DA  F N1    
1844 C C2    . DA  C 14  ? 0.1610 0.2116 0.1425 -0.0366 -0.0251 0.0089  14  DA  F C2    
1845 N N3    . DA  C 14  ? 0.2192 0.2293 0.1477 -0.0508 -0.0019 0.0025  14  DA  F N3    
1846 C C4    . DA  C 14  ? 0.2625 0.2277 0.1355 -0.0407 0.0001  0.0201  14  DA  F C4    
1847 P P     . DC  C 15  ? 0.6042 0.4494 0.2632 -0.1429 0.0999  -0.0059 15  DC  F P     
1848 O OP1   . DC  C 15  ? 0.6718 0.5335 0.3379 -0.1722 0.1325  -0.0256 15  DC  F OP1   
1849 O OP2   . DC  C 15  ? 0.6714 0.4609 0.2715 -0.1296 0.0774  0.0215  15  DC  F OP2   
1850 O "O5'" . DC  C 15  ? 0.5442 0.4272 0.2194 -0.1255 0.0845  -0.0189 15  DC  F "O5'" 
1851 C "C5'" . DC  C 15  ? 0.4296 0.3719 0.1735 -0.1313 0.0934  -0.0491 15  DC  F "C5'" 
1852 C "C4'" . DC  C 15  ? 0.3862 0.3571 0.1528 -0.1072 0.0608  -0.0555 15  DC  F "C4'" 
1853 O "O4'" . DC  C 15  ? 0.3425 0.3092 0.1369 -0.0835 0.0316  -0.0304 15  DC  F "O4'" 
1854 C "C3'" . DC  C 15  ? 0.4755 0.4204 0.1727 -0.0963 0.0450  -0.0511 15  DC  F "C3'" 
1855 O "O3'" . DC  C 15  ? 0.4777 0.4671 0.2093 -0.0949 0.0408  -0.0857 15  DC  F "O3'" 
1856 C "C2'" . DC  C 15  ? 0.4445 0.3706 0.1392 -0.0668 0.0038  -0.0233 15  DC  F "C2'" 
1857 C "C1'" . DC  C 15  ? 0.3415 0.3111 0.1308 -0.0595 -0.0020 -0.0223 15  DC  F "C1'" 
1858 N N1    . DC  C 15  ? 0.3255 0.2814 0.1202 -0.0367 -0.0244 0.0052  15  DC  F N1    
1859 C C2    . DC  C 15  ? 0.2959 0.2991 0.1675 -0.0193 -0.0484 0.0091  15  DC  F C2    
1860 O O2    . DC  C 15  ? 0.2534 0.3011 0.1858 -0.0238 -0.0565 -0.0073 15  DC  F O2    
1861 N N3    . DC  C 15  ? 0.2454 0.2455 0.1245 0.0009  -0.0624 0.0299  15  DC  F N3    
1862 C C4    . DC  C 15  ? 0.3003 0.2486 0.1184 0.0079  -0.0593 0.0433  15  DC  F C4    
1863 N N4    . DC  C 15  ? 0.2858 0.2432 0.1292 0.0299  -0.0702 0.0553  15  DC  F N4    
1864 C C5    . DC  C 15  ? 0.3738 0.2649 0.1124 -0.0102 -0.0420 0.0429  15  DC  F C5    
1865 C C6    . DC  C 15  ? 0.3852 0.2837 0.1117 -0.0340 -0.0222 0.0253  15  DC  F C6    
1866 P P     . DC  C 16  ? 0.3012 0.7346 0.4516 -0.0950 0.0822  -0.2771 16  DC  F P     
1867 O OP1   . DC  C 16  ? 0.3628 0.8582 0.5707 -0.0850 0.1008  -0.3264 16  DC  F OP1   
1868 O OP2   . DC  C 16  ? 0.3389 0.7567 0.3826 -0.1456 0.0825  -0.2428 16  DC  F OP2   
1869 O "O5'" . DC  C 16  ? 0.3157 0.6515 0.4720 -0.0525 0.0596  -0.2693 16  DC  F "O5'" 
1870 C "C5'" . DC  C 16  ? 0.2749 0.5816 0.5118 -0.0020 0.0438  -0.2791 16  DC  F "C5'" 
1871 C "C4'" . DC  C 16  ? 0.2732 0.4861 0.5000 0.0236  0.0247  -0.2580 16  DC  F "C4'" 
1872 O "O4'" . DC  C 16  ? 0.2583 0.4071 0.4199 0.0187  0.0028  -0.1938 16  DC  F "O4'" 
1873 C "C3'" . DC  C 16  ? 0.3206 0.5242 0.5189 0.0062  0.0341  -0.2739 16  DC  F "C3'" 
1874 O "O3'" . DC  C 16  ? 0.3458 0.5087 0.5958 0.0334  0.0208  -0.2803 16  DC  F "O3'" 
1875 C "C2'" . DC  C 16  ? 0.2573 0.4075 0.3767 -0.0123 0.0221  -0.2269 16  DC  F "C2'" 
1876 C "C1'" . DC  C 16  ? 0.2632 0.3642 0.3863 0.0138  0.0001  -0.1768 16  DC  F "C1'" 
1877 N N1    . DC  C 16  ? 0.2281 0.2934 0.2672 -0.0020 -0.0137 -0.1227 16  DC  F N1    
1878 C C2    . DC  C 16  ? 0.2216 0.2217 0.2397 0.0196  -0.0285 -0.0791 16  DC  F C2    
1879 O O2    . DC  C 16  ? 0.2639 0.2361 0.3339 0.0444  -0.0293 -0.0809 16  DC  F O2    
1880 N N3    . DC  C 16  ? 0.2237 0.1933 0.1650 0.0133  -0.0418 -0.0355 16  DC  F N3    
1881 C C4    . DC  C 16  ? 0.2517 0.2408 0.1358 -0.0169 -0.0461 -0.0321 16  DC  F C4    
1882 N N4    . DC  C 16  ? 0.2646 0.2300 0.1138 -0.0119 -0.0507 0.0065  16  DC  F N4    
1883 C C5    . DC  C 16  ? 0.2436 0.2983 0.1484 -0.0472 -0.0307 -0.0698 16  DC  F C5    
1884 C C6    . DC  C 16  ? 0.2370 0.3342 0.2209 -0.0367 -0.0122 -0.1153 16  DC  F C6    
1885 P P     . DT  C 17  ? 0.3907 0.5540 0.6382 0.0235  0.0254  -0.3086 17  DT  F P     
1886 O OP1   . DT  C 17  ? 0.4134 0.5635 0.7232 0.0511  0.0138  -0.3313 17  DT  F OP1   
1887 O OP2   . DT  C 17  ? 0.4508 0.6761 0.6498 -0.0098 0.0480  -0.3277 17  DT  F OP2   
1888 O "O5'" . DT  C 17  ? 0.3847 0.4786 0.6007 0.0184  0.0108  -0.2730 17  DT  F "O5'" 
1889 C "C5'" . DT  C 17  ? 0.3531 0.3834 0.5985 0.0417  -0.0084 -0.2357 17  DT  F "C5'" 
1890 C "C4'" . DT  C 17  ? 0.3129 0.2972 0.5280 0.0300  -0.0170 -0.2023 17  DT  F "C4'" 
1891 O "O4'" . DT  C 17  ? 0.2626 0.2521 0.4176 0.0205  -0.0147 -0.1692 17  DT  F "O4'" 
1892 C "C3'" . DT  C 17  ? 0.3540 0.3481 0.5464 0.0023  -0.0171 -0.2255 17  DT  F "C3'" 
1893 O "O3'" . DT  C 17  ? 0.4298 0.3822 0.6693 0.0086  -0.0328 -0.2208 17  DT  F "O3'" 
1894 C "C2'" . DT  C 17  ? 0.3042 0.2962 0.4306 -0.0218 -0.0207 -0.1922 17  DT  F "C2'" 
1895 C "C1'" . DT  C 17  ? 0.2829 0.2601 0.3950 -0.0006 -0.0208 -0.1415 17  DT  F "C1'" 
1896 N N1    . DT  C 17  ? 0.2645 0.2617 0.2956 -0.0189 -0.0195 -0.1165 17  DT  F N1    
1897 C C2    . DT  C 17  ? 0.2361 0.2027 0.2262 -0.0110 -0.0307 -0.0608 17  DT  F C2    
1898 O O2    . DT  C 17  ? 0.2296 0.1647 0.2487 0.0087  -0.0359 -0.0286 17  DT  F O2    
1899 N N3    . DT  C 17  ? 0.2394 0.2137 0.1520 -0.0268 -0.0356 -0.0433 17  DT  F N3    
1900 C C4    . DT  C 17  ? 0.2644 0.2758 0.1383 -0.0563 -0.0287 -0.0692 17  DT  F C4    
1901 O O4    . DT  C 17  ? 0.2891 0.2931 0.1325 -0.0548 -0.0314 -0.0371 17  DT  F O4    
1902 C C5    . DT  C 17  ? 0.2905 0.3465 0.2149 -0.0643 -0.0096 -0.1235 17  DT  F C5    
1903 C C7    . DT  C 17  ? 0.3050 0.4075 0.2159 -0.0850 0.0079  -0.1308 17  DT  F C7    
1904 C C6    . DT  C 17  ? 0.2617 0.3075 0.2597 -0.0426 -0.0072 -0.1488 17  DT  F C6    
1905 P P     . DG  C 18  ? 0.4994 0.4496 0.7276 -0.0149 -0.0422 -0.2439 18  DG  F P     
1906 O OP1   . DG  C 18  ? 0.5553 0.4781 0.8385 0.0002  -0.0549 -0.2644 18  DG  F OP1   
1907 O OP2   . DG  C 18  ? 0.5489 0.5475 0.7099 -0.0349 -0.0282 -0.2680 18  DG  F OP2   
1908 O "O5'" . DG  C 18  ? 0.4278 0.3477 0.6560 -0.0321 -0.0573 -0.1972 18  DG  F "O5'" 
1909 C "C5'" . DG  C 18  ? 0.3925 0.2724 0.6693 -0.0164 -0.0638 -0.1484 18  DG  F "C5'" 
1910 C "C4'" . DG  C 18  ? 0.3768 0.2549 0.6450 -0.0320 -0.0698 -0.0956 18  DG  F "C4'" 
1911 O "O4'" . DG  C 18  ? 0.3341 0.2426 0.5275 -0.0270 -0.0573 -0.0715 18  DG  F "O4'" 
1912 C "C3'" . DG  C 18  ? 0.4237 0.3153 0.6943 -0.0651 -0.0875 -0.1101 18  DG  F "C3'" 
1913 O "O3'" . DG  C 18  ? 0.4354 0.3174 0.7553 -0.0715 -0.0961 -0.0558 18  DG  F "O3'" 
1914 C "C2'" . DG  C 18  ? 0.4115 0.3452 0.5960 -0.0772 -0.0825 -0.1122 18  DG  F "C2'" 
1915 C "C1'" . DG  C 18  ? 0.3565 0.2915 0.5077 -0.0512 -0.0657 -0.0651 18  DG  F "C1'" 
1916 N N9    . DG  C 18  ? 0.3421 0.3025 0.4106 -0.0568 -0.0585 -0.0760 18  DG  F N9    
1917 C C8    . DG  C 18  ? 0.3492 0.3328 0.3863 -0.0710 -0.0505 -0.1283 18  DG  F C8    
1918 N N7    . DG  C 18  ? 0.3531 0.3558 0.3160 -0.0804 -0.0455 -0.1184 18  DG  F N7    
1919 C C5    . DG  C 18  ? 0.3077 0.2911 0.2483 -0.0664 -0.0546 -0.0605 18  DG  F C5    
1920 C C6    . DG  C 18  ? 0.2792 0.2581 0.1424 -0.0661 -0.0607 -0.0277 18  DG  F C6    
1921 O O6    . DG  C 18  ? 0.3233 0.3162 0.1639 -0.0663 -0.0483 -0.0314 18  DG  F O6    
1922 N N1    . DG  C 18  ? 0.2529 0.2105 0.1159 -0.0401 -0.0691 0.0228  18  DG  F N1    
1923 C C2    . DG  C 18  ? 0.2445 0.1967 0.1767 -0.0224 -0.0665 0.0444  18  DG  F C2    
1924 N N2    . DG  C 18  ? 0.2669 0.2191 0.1960 0.0065  -0.0579 0.0805  18  DG  F N2    
1925 N N3    . DG  C 18  ? 0.2773 0.2309 0.2847 -0.0301 -0.0622 0.0202  18  DG  F N3    
1926 C C4    . DG  C 18  ? 0.2774 0.2418 0.2828 -0.0500 -0.0590 -0.0344 18  DG  F C4    
1927 P P     . DC  C 19  ? 0.4462 0.3474 0.7820 -0.1007 -0.1164 -0.0549 19  DC  F P     
1928 O OP1   . DC  C 19  ? 0.5261 0.3996 0.9283 -0.1013 -0.1245 -0.0398 19  DC  F OP1   
1929 O OP2   . DC  C 19  ? 0.4793 0.3982 0.7519 -0.1169 -0.1242 -0.1093 19  DC  F OP2   
1930 O "O5'" . DC  C 19  ? 0.3832 0.3204 0.7171 -0.1030 -0.1142 0.0069  19  DC  F "O5'" 
1931 C "C5'" . DC  C 19  ? 0.3280 0.2630 0.6623 -0.0729 -0.0906 0.0641  19  DC  F "C5'" 
1932 C "C4'" . DC  C 19  ? 0.2987 0.2757 0.5847 -0.0599 -0.0839 0.1049  19  DC  F "C4'" 
1933 O "O4'" . DC  C 19  ? 0.2938 0.2716 0.4858 -0.0505 -0.0820 0.0795  19  DC  F "O4'" 
1934 C "C3'" . DC  C 19  ? 0.3246 0.3441 0.6392 -0.0848 -0.1048 0.1122  19  DC  F "C3'" 
1935 O "O3'" . DC  C 19  ? 0.3434 0.4015 0.6748 -0.0647 -0.0921 0.1729  19  DC  F "O3'" 
1936 C "C2'" . DC  C 19  ? 0.2798 0.3074 0.5074 -0.0937 -0.1201 0.0712  19  DC  F "C2'" 
1937 C "C1'" . DC  C 19  ? 0.2901 0.2988 0.4416 -0.0640 -0.0990 0.0774  19  DC  F "C1'" 
1938 N N1    . DC  C 19  ? 0.2975 0.2994 0.3682 -0.0773 -0.1046 0.0310  19  DC  F N1    
1939 C C2    . DC  C 19  ? 0.2886 0.2930 0.2709 -0.0677 -0.1071 0.0456  19  DC  F C2    
1940 O O2    . DC  C 19  ? 0.3258 0.3349 0.2964 -0.0418 -0.1068 0.0911  19  DC  F O2    
1941 N N3    . DC  C 19  ? 0.2918 0.2926 0.2016 -0.0868 -0.1100 0.0099  19  DC  F N3    
1942 C C4    . DC  C 19  ? 0.3295 0.3333 0.2521 -0.1089 -0.1058 -0.0421 19  DC  F C4    
1943 N N4    . DC  C 19  ? 0.3380 0.3483 0.2139 -0.1043 -0.0880 -0.0639 19  DC  F N4    
1944 C C5    . DC  C 19  ? 0.3189 0.3163 0.3286 -0.1116 -0.1055 -0.0644 19  DC  F C5    
1945 C C6    . DC  C 19  ? 0.3389 0.3311 0.4205 -0.0983 -0.1072 -0.0248 19  DC  F C6    
1946 P P     . DG  C 20  ? 0.3993 0.5131 0.8178 -0.0877 -0.1068 0.2020  20  DG  F P     
1947 O OP1   . DG  C 20  ? 0.4283 0.5643 0.8999 -0.0679 -0.0780 0.2638  20  DG  F OP1   
1948 O OP2   . DG  C 20  ? 0.4527 0.5430 0.9004 -0.1243 -0.1346 0.1524  20  DG  F OP2   
1949 O "O5'" . DG  C 20  ? 0.3816 0.5380 0.7399 -0.0743 -0.1212 0.2037  20  DG  F "O5'" 
1950 C "C5'" . DG  C 20  ? 0.3343 0.4934 0.6174 -0.0300 -0.1015 0.2296  20  DG  F "C5'" 
1951 C "C4'" . DG  C 20  ? 0.3290 0.4931 0.5327 -0.0263 -0.1189 0.2043  20  DG  F "C4'" 
1952 O "O4'" . DG  C 20  ? 0.3292 0.4516 0.4530 -0.0395 -0.1376 0.1648  20  DG  F "O4'" 
1953 C "C3'" . DG  C 20  ? 0.3253 0.5366 0.5862 -0.0512 -0.1524 0.2030  20  DG  F "C3'" 
1954 O "O3'" . DG  C 20  ? 0.3500 0.5740 0.5612 -0.0240 -0.1474 0.2044  20  DG  F "O3'" 
1955 C "C2'" . DG  C 20  ? 0.3376 0.5188 0.5600 -0.0880 -0.1866 0.1498  20  DG  F "C2'" 
1956 C "C1'" . DG  C 20  ? 0.3272 0.4607 0.4373 -0.0692 -0.1726 0.1349  20  DG  F "C1'" 
1957 N N9    . DG  C 20  ? 0.3353 0.4349 0.4056 -0.0995 -0.1816 0.0850  20  DG  F N9    
1958 C C8    . DG  C 20  ? 0.3453 0.4325 0.4723 -0.1266 -0.1825 0.0502  20  DG  F C8    
1959 N N7    . DG  C 20  ? 0.3447 0.4031 0.4102 -0.1374 -0.1762 0.0009  20  DG  F N7    
1960 C C5    . DG  C 20  ? 0.3777 0.4282 0.3476 -0.1201 -0.1656 0.0083  20  DG  F C5    
1961 C C6    . DG  C 20  ? 0.3633 0.3963 0.2628 -0.1153 -0.1436 -0.0222 20  DG  F C6    
1962 O O6    . DG  C 20  ? 0.3841 0.4135 0.2823 -0.1230 -0.1345 -0.0637 20  DG  F O6    
1963 N N1    . DG  C 20  ? 0.3556 0.3776 0.2063 -0.0922 -0.1294 0.0013  20  DG  F N1    
1964 C C2    . DG  C 20  ? 0.3380 0.3616 0.1952 -0.0686 -0.1306 0.0345  20  DG  F C2    
1965 N N2    . DG  C 20  ? 0.3438 0.3503 0.1698 -0.0509 -0.1157 0.0395  20  DG  F N2    
1966 N N3    . DG  C 20  ? 0.3383 0.3837 0.2449 -0.0659 -0.1467 0.0624  20  DG  F N3    
1967 C C4    . DG  C 20  ? 0.3257 0.3894 0.2935 -0.0959 -0.1682 0.0554  20  DG  F C4    
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   370 ?   ?   ?   A . n 
A 1 2   PRO 2   371 ?   ?   ?   A . n 
A 1 3   LEU 3   372 ?   ?   ?   A . n 
A 1 4   GLY 4   373 373 GLY GLY A . n 
A 1 5   SER 5   374 374 SER SER A . n 
A 1 6   LYS 6   375 375 LYS LYS A . n 
A 1 7   SER 7   376 376 SER SER A . n 
A 1 8   PHE 8   377 377 PHE PHE A . n 
A 1 9   THR 9   378 378 THR THR A . n 
A 1 10  CYS 10  379 379 CYS CYS A . n 
A 1 11  ASP 11  380 380 ASP ASP A . n 
A 1 12  GLN 12  381 381 GLN GLN A . n 
A 1 13  CYS 13  382 382 CYS CYS A . n 
A 1 14  GLY 14  383 383 GLY GLY A . n 
A 1 15  LYS 15  384 384 LYS LYS A . n 
A 1 16  TYR 16  385 385 TYR TYR A . n 
A 1 17  PHE 17  386 386 PHE PHE A . n 
A 1 18  SER 18  387 387 SER SER A . n 
A 1 19  GLN 19  388 388 GLN GLN A . n 
A 1 20  LYS 20  389 389 LYS LYS A . n 
A 1 21  ARG 21  390 390 ARG ARG A . n 
A 1 22  GLN 22  391 391 GLN GLN A . n 
A 1 23  LEU 23  392 392 LEU LEU A . n 
A 1 24  LYS 24  393 393 LYS LYS A . n 
A 1 25  SER 25  394 394 SER SER A . n 
A 1 26  HIS 26  395 395 HIS HIS A . n 
A 1 27  TYR 27  396 396 TYR TYR A . n 
A 1 28  ARG 28  397 397 ARG ARG A . n 
A 1 29  VAL 29  398 398 VAL VAL A . n 
A 1 30  HIS 30  399 399 HIS HIS A . n 
A 1 31  THR 31  400 400 THR THR A . n 
A 1 32  GLY 32  401 401 GLY GLY A . n 
A 1 33  HIS 33  402 402 HIS HIS A . n 
A 1 34  SER 34  403 403 SER SER A . n 
A 1 35  LEU 35  404 404 LEU LEU A . n 
A 1 36  PRO 36  405 405 PRO PRO A . n 
A 1 37  GLU 37  406 406 GLU GLU A . n 
A 1 38  CYS 38  407 407 CYS CYS A . n 
A 1 39  SER 39  408 408 SER SER A . n 
A 1 40  HIS 40  409 409 HIS HIS A . n 
A 1 41  CYS 41  410 410 CYS CYS A . n 
A 1 42  HIS 42  411 411 HIS HIS A . n 
A 1 43  ARG 43  412 412 ARG ARG A . n 
A 1 44  LYS 44  413 413 LYS LYS A . n 
A 1 45  PHE 45  414 414 PHE PHE A . n 
A 1 46  MET 46  415 415 MET MET A . n 
A 1 47  ASP 47  416 416 ASP ASP A . n 
A 1 48  VAL 48  417 417 VAL VAL A . n 
A 1 49  SER 49  418 418 SER SER A . n 
A 1 50  GLN 50  419 419 GLN GLN A . n 
A 1 51  LEU 51  420 420 LEU LEU A . n 
A 1 52  LYS 52  421 421 LYS LYS A . n 
A 1 53  LYS 53  422 422 LYS LYS A . n 
A 1 54  HIS 54  423 423 HIS HIS A . n 
A 1 55  LEU 55  424 424 LEU LEU A . n 
A 1 56  ARG 56  425 425 ARG ARG A . n 
A 1 57  THR 57  426 426 THR THR A . n 
A 1 58  HIS 58  427 427 HIS HIS A . n 
A 1 59  THR 59  428 428 THR THR A . n 
A 1 60  GLY 60  429 429 GLY GLY A . n 
A 1 61  GLU 61  430 430 GLU GLU A . n 
A 1 62  LYS 62  431 431 LYS LYS A . n 
A 1 63  PRO 63  432 432 PRO PRO A . n 
A 1 64  PHE 64  433 433 PHE PHE A . n 
A 1 65  THR 65  434 434 THR THR A . n 
A 1 66  CYS 66  435 435 CYS CYS A . n 
A 1 67  GLU 67  436 436 GLU GLU A . n 
A 1 68  ILE 68  437 437 ILE ILE A . n 
A 1 69  CYS 69  438 438 CYS CYS A . n 
A 1 70  GLY 70  439 439 GLY GLY A . n 
A 1 71  LYS 71  440 440 LYS LYS A . n 
A 1 72  SER 72  441 441 SER SER A . n 
A 1 73  PHE 73  442 442 PHE PHE A . n 
A 1 74  THR 74  443 443 THR THR A . n 
A 1 75  ALA 75  444 444 ALA ALA A . n 
A 1 76  LYS 76  445 445 LYS LYS A . n 
A 1 77  SER 77  446 446 SER SER A . n 
A 1 78  SER 78  447 447 SER SER A . n 
A 1 79  LEU 79  448 448 LEU LEU A . n 
A 1 80  GLN 80  449 449 GLN GLN A . n 
A 1 81  THR 81  450 450 THR THR A . n 
A 1 82  HIS 82  451 451 HIS HIS A . n 
A 1 83  ILE 83  452 452 ILE ILE A . n 
A 1 84  ARG 84  453 453 ARG ARG A . n 
A 1 85  ILE 85  454 454 ILE ILE A . n 
A 1 86  HIS 86  455 455 HIS HIS A . n 
A 1 87  ARG 87  456 456 ARG ARG A . n 
A 1 88  GLY 88  457 457 GLY GLY A . n 
A 1 89  GLU 89  458 458 GLU GLU A . n 
A 1 90  LYS 90  459 459 LYS LYS A . n 
A 1 91  PRO 91  460 460 PRO PRO A . n 
A 1 92  TYR 92  461 461 TYR TYR A . n 
A 1 93  SER 93  462 462 SER SER A . n 
A 1 94  CYS 94  463 463 CYS CYS A . n 
A 1 95  SER 95  464 464 SER SER A . n 
A 1 96  ILE 96  465 465 ILE ILE A . n 
A 1 97  CYS 97  466 466 CYS CYS A . n 
A 1 98  GLY 98  467 467 GLY GLY A . n 
A 1 99  LYS 99  468 468 LYS LYS A . n 
A 1 100 CYS 100 469 469 CYS CYS A . n 
A 1 101 PHE 101 470 470 PHE PHE A . n 
A 1 102 SER 102 471 471 SER SER A . n 
A 1 103 ASP 103 472 472 ASP ASP A . n 
A 1 104 SER 104 473 473 SER SER A . n 
A 1 105 SER 105 474 474 SER SER A . n 
A 1 106 ALA 106 475 475 ALA ALA A . n 
A 1 107 LYS 107 476 476 LYS LYS A . n 
A 1 108 ARG 108 477 477 ARG ARG A . n 
A 1 109 ARG 109 478 478 ARG ARG A . n 
A 1 110 HIS 110 479 479 HIS HIS A . n 
A 1 111 CYS 111 480 480 CYS CYS A . n 
A 1 112 ILE 112 481 481 ILE ILE A . n 
A 1 113 LEU 113 482 482 LEU LEU A . n 
A 1 114 HIS 114 483 483 HIS HIS A . n 
A 1 115 THR 115 484 484 THR THR A . n 
A 1 116 GLY 116 485 485 GLY GLY A . n 
A 1 117 LYS 117 486 486 LYS LYS A . n 
A 1 118 LYS 118 487 487 LYS LYS A . n 
A 1 119 PRO 119 488 488 PRO PRO A . n 
A 1 120 PHE 120 489 489 PHE PHE A . n 
A 1 121 SER 121 490 490 SER SER A . n 
A 1 122 CYS 122 491 491 CYS CYS A . n 
A 1 123 PRO 123 492 492 PRO PRO A . n 
A 1 124 GLU 124 493 493 GLU GLU A . n 
A 1 125 CYS 125 494 494 CYS CYS A . n 
A 1 126 GLY 126 495 495 GLY GLY A . n 
A 1 127 LEU 127 496 496 LEU LEU A . n 
A 1 128 GLN 128 497 497 GLN GLN A . n 
A 1 129 PHE 129 498 498 PHE PHE A . n 
A 1 130 ALA 130 499 499 ALA ALA A . n 
A 1 131 ARG 131 500 500 ARG ARG A . n 
A 1 132 LEU 132 501 501 LEU LEU A . n 
A 1 133 ASP 133 502 502 ASP ASP A . n 
A 1 134 ASN 134 503 503 ASN ASN A . n 
A 1 135 LEU 135 504 504 LEU LEU A . n 
A 1 136 LYS 136 505 505 LYS LYS A . n 
A 1 137 ALA 137 506 506 ALA ALA A . n 
A 1 138 HIS 138 507 507 HIS HIS A . n 
A 1 139 LEU 139 508 508 LEU LEU A . n 
A 1 140 LYS 140 509 509 LYS LYS A . n 
A 1 141 ILE 141 510 510 ILE ILE A . n 
A 1 142 HIS 142 511 511 HIS HIS A . n 
A 1 143 SER 143 512 512 SER SER A . n 
A 1 144 LYS 144 513 513 LYS LYS A . n 
A 1 145 GLU 145 514 514 GLU GLU A . n 
A 1 146 LYS 146 515 515 LYS LYS A . n 
A 1 147 HIS 147 516 ?   ?   ?   A . n 
A 1 148 THR 148 517 ?   ?   ?   A . n 
A 1 149 ALA 149 518 ?   ?   ?   A . n 
A 1 150 ASP 150 519 ?   ?   ?   A . n 
A 1 151 TYR 151 520 ?   ?   ?   A . n 
B 2 1   DA  1   1   1   DA  DA  E . n 
B 2 2   DC  2   2   2   DC  DC  E . n 
B 2 3   DG  3   3   3   DG  DG  E . n 
B 2 4   DC  4   4   4   DC  DC  E . n 
B 2 5   DA  5   5   5   DA  DA  E . n 
B 2 6   DG  6   6   6   DG  DG  E . n 
B 2 7   DG  7   7   7   DG  DG  E . n 
B 2 8   DT  8   8   8   DT  DT  E . n 
B 2 9   DC  9   9   9   DC  DC  E . n 
B 2 10  DC  10  10  10  DC  DC  E . n 
B 2 11  DT  11  11  11  DT  DT  E . n 
B 2 12  DG  12  12  12  DG  DG  E . n 
B 2 13  DG  13  13  13  DG  DG  E . n 
B 2 14  DA  14  14  14  DA  DA  E . n 
B 2 15  DC  15  15  15  DC  DC  E . n 
B 2 16  DG  16  16  16  DG  DG  E . n 
B 2 17  DA  17  17  17  DA  DA  E . n 
B 2 18  DA  18  18  18  DA  DA  E . n 
B 2 19  DG  19  19  19  DG  DG  E . n 
B 2 20  DC  20  20  20  DC  DC  E . n 
C 3 1   DT  1   1   1   DT  DT  F . n 
C 3 2   DG  2   2   2   DG  DG  F . n 
C 3 3   DC  3   3   3   DC  DC  F . n 
C 3 4   DT  4   4   4   DT  DT  F . n 
C 3 5   DT  5   5   5   DT  DT  F . n 
C 3 6   DC  6   6   6   DC  DC  F . n 
C 3 7   DG  7   7   7   DG  DG  F . n 
C 3 8   DT  8   8   8   DT  DT  F . n 
C 3 9   DC  9   9   9   DC  DC  F . n 
C 3 10  DC  10  10  10  DC  DC  F . n 
C 3 11  DA  11  11  11  DA  DA  F . n 
C 3 12  DG  12  12  12  DG  DG  F . n 
C 3 13  DG  13  13  13  DG  DG  F . n 
C 3 14  DA  14  14  14  DA  DA  F . n 
C 3 15  DC  15  15  15  DC  DC  F . n 
C 3 16  DC  16  16  16  DC  DC  F . n 
C 3 17  DT  17  17  17  DT  DT  F . n 
C 3 18  DG  18  18  18  DG  DG  F . n 
C 3 19  DC  19  19  19  DC  DC  F . n 
C 3 20  DG  20  20  20  DG  DG  F . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 ZN  1   601 4   ZN  ZN  A . 
E 4 ZN  1   602 5   ZN  ZN  A . 
F 4 ZN  1   603 6   ZN  ZN  A . 
G 4 ZN  1   604 7   ZN  ZN  A . 
H 4 ZN  1   605 8   ZN  ZN  A . 
I 5 EDO 1   606 502 EDO EDO A . 
J 5 EDO 1   501 501 EDO EDO E . 
K 5 EDO 1   502 503 EDO EDO E . 
L 6 HOH 1   701 235 HOH HOH A . 
L 6 HOH 2   702 329 HOH HOH A . 
L 6 HOH 3   703 85  HOH HOH A . 
L 6 HOH 4   704 167 HOH HOH A . 
L 6 HOH 5   705 226 HOH HOH A . 
L 6 HOH 6   706 347 HOH HOH A . 
L 6 HOH 7   707 319 HOH HOH A . 
L 6 HOH 8   708 229 HOH HOH A . 
L 6 HOH 9   709 288 HOH HOH A . 
L 6 HOH 10  710 208 HOH HOH A . 
L 6 HOH 11  711 1   HOH HOH A . 
L 6 HOH 12  712 172 HOH HOH A . 
L 6 HOH 13  713 44  HOH HOH A . 
L 6 HOH 14  714 83  HOH HOH A . 
L 6 HOH 15  715 214 HOH HOH A . 
L 6 HOH 16  716 331 HOH HOH A . 
L 6 HOH 17  717 105 HOH HOH A . 
L 6 HOH 18  718 177 HOH HOH A . 
L 6 HOH 19  719 281 HOH HOH A . 
L 6 HOH 20  720 293 HOH HOH A . 
L 6 HOH 21  721 356 HOH HOH A . 
L 6 HOH 22  722 60  HOH HOH A . 
L 6 HOH 23  723 283 HOH HOH A . 
L 6 HOH 24  724 100 HOH HOH A . 
L 6 HOH 25  725 277 HOH HOH A . 
L 6 HOH 26  726 55  HOH HOH A . 
L 6 HOH 27  727 113 HOH HOH A . 
L 6 HOH 28  728 78  HOH HOH A . 
L 6 HOH 29  729 67  HOH HOH A . 
L 6 HOH 30  730 126 HOH HOH A . 
L 6 HOH 31  731 144 HOH HOH A . 
L 6 HOH 32  732 145 HOH HOH A . 
L 6 HOH 33  733 16  HOH HOH A . 
L 6 HOH 34  734 287 HOH HOH A . 
L 6 HOH 35  735 285 HOH HOH A . 
L 6 HOH 36  736 360 HOH HOH A . 
L 6 HOH 37  737 341 HOH HOH A . 
L 6 HOH 38  738 28  HOH HOH A . 
L 6 HOH 39  739 182 HOH HOH A . 
L 6 HOH 40  740 24  HOH HOH A . 
L 6 HOH 41  741 286 HOH HOH A . 
L 6 HOH 42  742 278 HOH HOH A . 
L 6 HOH 43  743 353 HOH HOH A . 
L 6 HOH 44  744 253 HOH HOH A . 
L 6 HOH 45  745 89  HOH HOH A . 
L 6 HOH 46  746 38  HOH HOH A . 
L 6 HOH 47  747 21  HOH HOH A . 
L 6 HOH 48  748 369 HOH HOH A . 
L 6 HOH 49  749 95  HOH HOH A . 
L 6 HOH 50  750 258 HOH HOH A . 
L 6 HOH 51  751 289 HOH HOH A . 
L 6 HOH 52  752 250 HOH HOH A . 
L 6 HOH 53  753 156 HOH HOH A . 
L 6 HOH 54  754 75  HOH HOH A . 
L 6 HOH 55  755 81  HOH HOH A . 
L 6 HOH 56  756 104 HOH HOH A . 
L 6 HOH 57  757 201 HOH HOH A . 
L 6 HOH 58  758 63  HOH HOH A . 
L 6 HOH 59  759 132 HOH HOH A . 
L 6 HOH 60  760 257 HOH HOH A . 
L 6 HOH 61  761 62  HOH HOH A . 
L 6 HOH 62  762 150 HOH HOH A . 
L 6 HOH 63  763 299 HOH HOH A . 
L 6 HOH 64  764 65  HOH HOH A . 
L 6 HOH 65  765 217 HOH HOH A . 
L 6 HOH 66  766 56  HOH HOH A . 
L 6 HOH 67  767 239 HOH HOH A . 
L 6 HOH 68  768 2   HOH HOH A . 
L 6 HOH 69  769 41  HOH HOH A . 
L 6 HOH 70  770 79  HOH HOH A . 
L 6 HOH 71  771 222 HOH HOH A . 
L 6 HOH 72  772 102 HOH HOH A . 
L 6 HOH 73  773 66  HOH HOH A . 
L 6 HOH 74  774 358 HOH HOH A . 
L 6 HOH 75  775 210 HOH HOH A . 
L 6 HOH 76  776 114 HOH HOH A . 
L 6 HOH 77  777 3   HOH HOH A . 
L 6 HOH 78  778 64  HOH HOH A . 
L 6 HOH 79  779 117 HOH HOH A . 
L 6 HOH 80  780 187 HOH HOH A . 
L 6 HOH 81  781 273 HOH HOH A . 
L 6 HOH 82  782 15  HOH HOH A . 
L 6 HOH 83  783 284 HOH HOH A . 
L 6 HOH 84  784 357 HOH HOH A . 
L 6 HOH 85  785 10  HOH HOH A . 
L 6 HOH 86  786 307 HOH HOH A . 
L 6 HOH 87  787 6   HOH HOH A . 
L 6 HOH 88  788 18  HOH HOH A . 
L 6 HOH 89  789 295 HOH HOH A . 
L 6 HOH 90  790 352 HOH HOH A . 
L 6 HOH 91  791 176 HOH HOH A . 
L 6 HOH 92  792 131 HOH HOH A . 
L 6 HOH 93  793 43  HOH HOH A . 
L 6 HOH 94  794 236 HOH HOH A . 
L 6 HOH 95  795 133 HOH HOH A . 
L 6 HOH 96  796 30  HOH HOH A . 
L 6 HOH 97  797 370 HOH HOH A . 
L 6 HOH 98  798 209 HOH HOH A . 
L 6 HOH 99  799 48  HOH HOH A . 
L 6 HOH 100 800 263 HOH HOH A . 
L 6 HOH 101 801 14  HOH HOH A . 
L 6 HOH 102 802 130 HOH HOH A . 
L 6 HOH 103 803 97  HOH HOH A . 
L 6 HOH 104 804 147 HOH HOH A . 
L 6 HOH 105 805 91  HOH HOH A . 
L 6 HOH 106 806 254 HOH HOH A . 
L 6 HOH 107 807 50  HOH HOH A . 
L 6 HOH 108 808 108 HOH HOH A . 
L 6 HOH 109 809 349 HOH HOH A . 
L 6 HOH 110 810 25  HOH HOH A . 
L 6 HOH 111 811 84  HOH HOH A . 
L 6 HOH 112 812 80  HOH HOH A . 
L 6 HOH 113 813 20  HOH HOH A . 
L 6 HOH 114 814 4   HOH HOH A . 
L 6 HOH 115 815 359 HOH HOH A . 
L 6 HOH 116 816 216 HOH HOH A . 
L 6 HOH 117 817 143 HOH HOH A . 
L 6 HOH 118 818 314 HOH HOH A . 
L 6 HOH 119 819 31  HOH HOH A . 
L 6 HOH 120 820 136 HOH HOH A . 
L 6 HOH 121 821 51  HOH HOH A . 
L 6 HOH 122 822 115 HOH HOH A . 
L 6 HOH 123 823 327 HOH HOH A . 
L 6 HOH 124 824 275 HOH HOH A . 
L 6 HOH 125 825 200 HOH HOH A . 
L 6 HOH 126 826 264 HOH HOH A . 
L 6 HOH 127 827 72  HOH HOH A . 
L 6 HOH 128 828 232 HOH HOH A . 
L 6 HOH 129 829 316 HOH HOH A . 
L 6 HOH 130 830 175 HOH HOH A . 
L 6 HOH 131 831 340 HOH HOH A . 
L 6 HOH 132 832 318 HOH HOH A . 
L 6 HOH 133 833 274 HOH HOH A . 
L 6 HOH 134 834 244 HOH HOH A . 
L 6 HOH 135 835 112 HOH HOH A . 
L 6 HOH 136 836 255 HOH HOH A . 
L 6 HOH 137 837 223 HOH HOH A . 
L 6 HOH 138 838 246 HOH HOH A . 
L 6 HOH 139 839 173 HOH HOH A . 
L 6 HOH 140 840 168 HOH HOH A . 
L 6 HOH 141 841 271 HOH HOH A . 
L 6 HOH 142 842 279 HOH HOH A . 
L 6 HOH 143 843 192 HOH HOH A . 
L 6 HOH 144 844 374 HOH HOH A . 
L 6 HOH 145 845 294 HOH HOH A . 
L 6 HOH 146 846 231 HOH HOH A . 
L 6 HOH 147 847 336 HOH HOH A . 
L 6 HOH 148 848 207 HOH HOH A . 
L 6 HOH 149 849 171 HOH HOH A . 
L 6 HOH 150 850 166 HOH HOH A . 
L 6 HOH 151 851 181 HOH HOH A . 
L 6 HOH 152 852 149 HOH HOH A . 
L 6 HOH 153 853 19  HOH HOH A . 
L 6 HOH 154 854 164 HOH HOH A . 
L 6 HOH 155 855 157 HOH HOH A . 
L 6 HOH 156 856 233 HOH HOH A . 
L 6 HOH 157 857 7   HOH HOH A . 
L 6 HOH 158 858 94  HOH HOH A . 
L 6 HOH 159 859 354 HOH HOH A . 
L 6 HOH 160 860 261 HOH HOH A . 
L 6 HOH 161 861 53  HOH HOH A . 
L 6 HOH 162 862 193 HOH HOH A . 
L 6 HOH 163 863 267 HOH HOH A . 
L 6 HOH 164 864 230 HOH HOH A . 
L 6 HOH 165 865 111 HOH HOH A . 
L 6 HOH 166 866 153 HOH HOH A . 
L 6 HOH 167 867 135 HOH HOH A . 
L 6 HOH 168 868 128 HOH HOH A . 
L 6 HOH 169 869 154 HOH HOH A . 
L 6 HOH 170 870 165 HOH HOH A . 
L 6 HOH 171 871 305 HOH HOH A . 
L 6 HOH 172 872 249 HOH HOH A . 
L 6 HOH 173 873 196 HOH HOH A . 
L 6 HOH 174 874 40  HOH HOH A . 
L 6 HOH 175 875 52  HOH HOH A . 
L 6 HOH 176 876 161 HOH HOH A . 
L 6 HOH 177 877 355 HOH HOH A . 
L 6 HOH 178 878 266 HOH HOH A . 
L 6 HOH 179 879 158 HOH HOH A . 
L 6 HOH 180 880 212 HOH HOH A . 
L 6 HOH 181 881 202 HOH HOH A . 
L 6 HOH 182 882 365 HOH HOH A . 
L 6 HOH 183 883 312 HOH HOH A . 
L 6 HOH 184 884 303 HOH HOH A . 
M 6 HOH 1   601 33  HOH HOH E . 
M 6 HOH 2   602 162 HOH HOH E . 
M 6 HOH 3   603 332 HOH HOH E . 
M 6 HOH 4   604 342 HOH HOH E . 
M 6 HOH 5   605 238 HOH HOH E . 
M 6 HOH 6   606 241 HOH HOH E . 
M 6 HOH 7   607 368 HOH HOH E . 
M 6 HOH 8   608 297 HOH HOH E . 
M 6 HOH 9   609 248 HOH HOH E . 
M 6 HOH 10  610 109 HOH HOH E . 
M 6 HOH 11  611 300 HOH HOH E . 
M 6 HOH 12  612 321 HOH HOH E . 
M 6 HOH 13  613 57  HOH HOH E . 
M 6 HOH 14  614 17  HOH HOH E . 
M 6 HOH 15  615 335 HOH HOH E . 
M 6 HOH 16  616 92  HOH HOH E . 
M 6 HOH 17  617 298 HOH HOH E . 
M 6 HOH 18  618 343 HOH HOH E . 
M 6 HOH 19  619 12  HOH HOH E . 
M 6 HOH 20  620 45  HOH HOH E . 
M 6 HOH 21  621 22  HOH HOH E . 
M 6 HOH 22  622 5   HOH HOH E . 
M 6 HOH 23  623 87  HOH HOH E . 
M 6 HOH 24  624 243 HOH HOH E . 
M 6 HOH 25  625 47  HOH HOH E . 
M 6 HOH 26  626 42  HOH HOH E . 
M 6 HOH 27  627 186 HOH HOH E . 
M 6 HOH 28  628 140 HOH HOH E . 
M 6 HOH 29  629 76  HOH HOH E . 
M 6 HOH 30  630 99  HOH HOH E . 
M 6 HOH 31  631 61  HOH HOH E . 
M 6 HOH 32  632 183 HOH HOH E . 
M 6 HOH 33  633 26  HOH HOH E . 
M 6 HOH 34  634 122 HOH HOH E . 
M 6 HOH 35  635 103 HOH HOH E . 
M 6 HOH 36  636 213 HOH HOH E . 
M 6 HOH 37  637 46  HOH HOH E . 
M 6 HOH 38  638 364 HOH HOH E . 
M 6 HOH 39  639 68  HOH HOH E . 
M 6 HOH 40  640 313 HOH HOH E . 
M 6 HOH 41  641 137 HOH HOH E . 
M 6 HOH 42  642 269 HOH HOH E . 
M 6 HOH 43  643 301 HOH HOH E . 
M 6 HOH 44  644 107 HOH HOH E . 
M 6 HOH 45  645 330 HOH HOH E . 
M 6 HOH 46  646 54  HOH HOH E . 
M 6 HOH 47  647 8   HOH HOH E . 
M 6 HOH 48  648 362 HOH HOH E . 
M 6 HOH 49  649 260 HOH HOH E . 
M 6 HOH 50  650 151 HOH HOH E . 
M 6 HOH 51  651 160 HOH HOH E . 
M 6 HOH 52  652 265 HOH HOH E . 
M 6 HOH 53  653 110 HOH HOH E . 
M 6 HOH 54  654 59  HOH HOH E . 
M 6 HOH 55  655 315 HOH HOH E . 
M 6 HOH 56  656 74  HOH HOH E . 
M 6 HOH 57  657 116 HOH HOH E . 
M 6 HOH 58  658 320 HOH HOH E . 
M 6 HOH 59  659 371 HOH HOH E . 
M 6 HOH 60  660 282 HOH HOH E . 
M 6 HOH 61  661 180 HOH HOH E . 
M 6 HOH 62  662 39  HOH HOH E . 
M 6 HOH 63  663 124 HOH HOH E . 
M 6 HOH 64  664 82  HOH HOH E . 
M 6 HOH 65  665 86  HOH HOH E . 
M 6 HOH 66  666 35  HOH HOH E . 
M 6 HOH 67  667 120 HOH HOH E . 
M 6 HOH 68  668 290 HOH HOH E . 
M 6 HOH 69  669 184 HOH HOH E . 
M 6 HOH 70  670 218 HOH HOH E . 
M 6 HOH 71  671 337 HOH HOH E . 
M 6 HOH 72  672 77  HOH HOH E . 
M 6 HOH 73  673 304 HOH HOH E . 
M 6 HOH 74  674 34  HOH HOH E . 
M 6 HOH 75  675 351 HOH HOH E . 
M 6 HOH 76  676 373 HOH HOH E . 
M 6 HOH 77  677 339 HOH HOH E . 
M 6 HOH 78  678 291 HOH HOH E . 
M 6 HOH 79  679 309 HOH HOH E . 
M 6 HOH 80  680 280 HOH HOH E . 
M 6 HOH 81  681 159 HOH HOH E . 
M 6 HOH 82  682 324 HOH HOH E . 
M 6 HOH 83  683 345 HOH HOH E . 
M 6 HOH 84  684 129 HOH HOH E . 
M 6 HOH 85  685 323 HOH HOH E . 
M 6 HOH 86  686 322 HOH HOH E . 
M 6 HOH 87  687 141 HOH HOH E . 
M 6 HOH 88  688 237 HOH HOH E . 
M 6 HOH 89  689 88  HOH HOH E . 
M 6 HOH 90  690 338 HOH HOH E . 
M 6 HOH 91  691 270 HOH HOH E . 
M 6 HOH 92  692 308 HOH HOH E . 
N 6 HOH 1   101 325 HOH HOH F . 
N 6 HOH 2   102 334 HOH HOH F . 
N 6 HOH 3   103 138 HOH HOH F . 
N 6 HOH 4   104 245 HOH HOH F . 
N 6 HOH 5   105 197 HOH HOH F . 
N 6 HOH 6   106 242 HOH HOH F . 
N 6 HOH 7   107 27  HOH HOH F . 
N 6 HOH 8   108 23  HOH HOH F . 
N 6 HOH 9   109 220 HOH HOH F . 
N 6 HOH 10  110 90  HOH HOH F . 
N 6 HOH 11  111 205 HOH HOH F . 
N 6 HOH 12  112 240 HOH HOH F . 
N 6 HOH 13  113 179 HOH HOH F . 
N 6 HOH 14  114 363 HOH HOH F . 
N 6 HOH 15  115 199 HOH HOH F . 
N 6 HOH 16  116 251 HOH HOH F . 
N 6 HOH 17  117 58  HOH HOH F . 
N 6 HOH 18  118 32  HOH HOH F . 
N 6 HOH 19  119 227 HOH HOH F . 
N 6 HOH 20  120 11  HOH HOH F . 
N 6 HOH 21  121 317 HOH HOH F . 
N 6 HOH 22  122 71  HOH HOH F . 
N 6 HOH 23  123 204 HOH HOH F . 
N 6 HOH 24  124 98  HOH HOH F . 
N 6 HOH 25  125 247 HOH HOH F . 
N 6 HOH 26  126 69  HOH HOH F . 
N 6 HOH 27  127 123 HOH HOH F . 
N 6 HOH 28  128 276 HOH HOH F . 
N 6 HOH 29  129 178 HOH HOH F . 
N 6 HOH 30  130 198 HOH HOH F . 
N 6 HOH 31  131 36  HOH HOH F . 
N 6 HOH 32  132 206 HOH HOH F . 
N 6 HOH 33  133 310 HOH HOH F . 
N 6 HOH 34  134 256 HOH HOH F . 
N 6 HOH 35  135 366 HOH HOH F . 
N 6 HOH 36  136 191 HOH HOH F . 
N 6 HOH 37  137 185 HOH HOH F . 
N 6 HOH 38  138 13  HOH HOH F . 
N 6 HOH 39  139 142 HOH HOH F . 
N 6 HOH 40  140 121 HOH HOH F . 
N 6 HOH 41  141 118 HOH HOH F . 
N 6 HOH 42  142 49  HOH HOH F . 
N 6 HOH 43  143 73  HOH HOH F . 
N 6 HOH 44  144 268 HOH HOH F . 
N 6 HOH 45  145 37  HOH HOH F . 
N 6 HOH 46  146 333 HOH HOH F . 
N 6 HOH 47  147 306 HOH HOH F . 
N 6 HOH 48  148 224 HOH HOH F . 
N 6 HOH 49  149 148 HOH HOH F . 
N 6 HOH 50  150 234 HOH HOH F . 
N 6 HOH 51  151 169 HOH HOH F . 
N 6 HOH 52  152 101 HOH HOH F . 
N 6 HOH 53  153 367 HOH HOH F . 
N 6 HOH 54  154 106 HOH HOH F . 
N 6 HOH 55  155 292 HOH HOH F . 
N 6 HOH 56  156 127 HOH HOH F . 
N 6 HOH 57  157 361 HOH HOH F . 
N 6 HOH 58  158 139 HOH HOH F . 
N 6 HOH 59  159 302 HOH HOH F . 
N 6 HOH 60  160 119 HOH HOH F . 
N 6 HOH 61  161 70  HOH HOH F . 
N 6 HOH 62  162 348 HOH HOH F . 
N 6 HOH 63  163 125 HOH HOH F . 
N 6 HOH 64  164 296 HOH HOH F . 
N 6 HOH 65  165 211 HOH HOH F . 
N 6 HOH 66  166 155 HOH HOH F . 
N 6 HOH 67  167 228 HOH HOH F . 
N 6 HOH 68  168 96  HOH HOH F . 
N 6 HOH 69  169 163 HOH HOH F . 
N 6 HOH 70  170 195 HOH HOH F . 
N 6 HOH 71  171 219 HOH HOH F . 
N 6 HOH 72  172 189 HOH HOH F . 
N 6 HOH 73  173 152 HOH HOH F . 
N 6 HOH 74  174 9   HOH HOH F . 
N 6 HOH 75  175 146 HOH HOH F . 
N 6 HOH 76  176 344 HOH HOH F . 
N 6 HOH 77  177 134 HOH HOH F . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L,M,N 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6110  ? 
1 MORE         -38   ? 
1 'SSA (A^2)'  14550 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG  ? A CYS 10  ? A CYS 379 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 SG  ? A CYS 13  ? A CYS 382 ? 1_555 116.3 ? 
2  SG  ? A CYS 10  ? A CYS 379 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 NE2 ? A HIS 26  ? A HIS 395 ? 1_555 109.5 ? 
3  SG  ? A CYS 13  ? A CYS 382 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 NE2 ? A HIS 26  ? A HIS 395 ? 1_555 99.2  ? 
4  SG  ? A CYS 10  ? A CYS 379 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 NE2 ? A HIS 30  ? A HIS 399 ? 1_555 104.5 ? 
5  SG  ? A CYS 13  ? A CYS 382 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 NE2 ? A HIS 30  ? A HIS 399 ? 1_555 117.2 ? 
6  NE2 ? A HIS 26  ? A HIS 395 ? 1_555 ZN ? D ZN . ? A ZN 601 ? 1_555 NE2 ? A HIS 30  ? A HIS 399 ? 1_555 109.9 ? 
7  SG  ? A CYS 38  ? A CYS 407 ? 1_555 ZN ? E ZN . ? A ZN 602 ? 1_555 SG  ? A CYS 41  ? A CYS 410 ? 1_555 116.6 ? 
8  SG  ? A CYS 38  ? A CYS 407 ? 1_555 ZN ? E ZN . ? A ZN 602 ? 1_555 NE2 ? A HIS 54  ? A HIS 423 ? 1_555 111.7 ? 
9  SG  ? A CYS 41  ? A CYS 410 ? 1_555 ZN ? E ZN . ? A ZN 602 ? 1_555 NE2 ? A HIS 54  ? A HIS 423 ? 1_555 97.4  ? 
10 SG  ? A CYS 38  ? A CYS 407 ? 1_555 ZN ? E ZN . ? A ZN 602 ? 1_555 NE2 ? A HIS 58  ? A HIS 427 ? 1_555 113.7 ? 
11 SG  ? A CYS 41  ? A CYS 410 ? 1_555 ZN ? E ZN . ? A ZN 602 ? 1_555 NE2 ? A HIS 58  ? A HIS 427 ? 1_555 113.4 ? 
12 NE2 ? A HIS 54  ? A HIS 423 ? 1_555 ZN ? E ZN . ? A ZN 602 ? 1_555 NE2 ? A HIS 58  ? A HIS 427 ? 1_555 101.7 ? 
13 SG  ? A CYS 66  ? A CYS 435 ? 1_555 ZN ? F ZN . ? A ZN 603 ? 1_555 SG  ? A CYS 69  ? A CYS 438 ? 1_555 118.9 ? 
14 SG  ? A CYS 66  ? A CYS 435 ? 1_555 ZN ? F ZN . ? A ZN 603 ? 1_555 NE2 ? A HIS 82  ? A HIS 451 ? 1_555 109.8 ? 
15 SG  ? A CYS 69  ? A CYS 438 ? 1_555 ZN ? F ZN . ? A ZN 603 ? 1_555 NE2 ? A HIS 82  ? A HIS 451 ? 1_555 107.8 ? 
16 SG  ? A CYS 66  ? A CYS 435 ? 1_555 ZN ? F ZN . ? A ZN 603 ? 1_555 NE2 ? A HIS 86  ? A HIS 455 ? 1_555 109.4 ? 
17 SG  ? A CYS 69  ? A CYS 438 ? 1_555 ZN ? F ZN . ? A ZN 603 ? 1_555 NE2 ? A HIS 86  ? A HIS 455 ? 1_555 114.3 ? 
18 NE2 ? A HIS 82  ? A HIS 451 ? 1_555 ZN ? F ZN . ? A ZN 603 ? 1_555 NE2 ? A HIS 86  ? A HIS 455 ? 1_555 93.6  ? 
19 SG  ? A CYS 94  ? A CYS 463 ? 1_555 ZN ? G ZN . ? A ZN 604 ? 1_555 SG  ? A CYS 97  ? A CYS 466 ? 1_555 118.4 ? 
20 SG  ? A CYS 94  ? A CYS 463 ? 1_555 ZN ? G ZN . ? A ZN 604 ? 1_555 NE2 ? A HIS 110 ? A HIS 479 ? 1_555 107.8 ? 
21 SG  ? A CYS 97  ? A CYS 466 ? 1_555 ZN ? G ZN . ? A ZN 604 ? 1_555 NE2 ? A HIS 110 ? A HIS 479 ? 1_555 99.9  ? 
22 SG  ? A CYS 94  ? A CYS 463 ? 1_555 ZN ? G ZN . ? A ZN 604 ? 1_555 NE2 ? A HIS 114 ? A HIS 483 ? 1_555 102.7 ? 
23 SG  ? A CYS 97  ? A CYS 466 ? 1_555 ZN ? G ZN . ? A ZN 604 ? 1_555 NE2 ? A HIS 114 ? A HIS 483 ? 1_555 117.3 ? 
24 NE2 ? A HIS 110 ? A HIS 479 ? 1_555 ZN ? G ZN . ? A ZN 604 ? 1_555 NE2 ? A HIS 114 ? A HIS 483 ? 1_555 110.5 ? 
25 SG  ? A CYS 122 ? A CYS 491 ? 1_555 ZN ? H ZN . ? A ZN 605 ? 1_555 SG  ? A CYS 125 ? A CYS 494 ? 1_555 115.4 ? 
26 SG  ? A CYS 122 ? A CYS 491 ? 1_555 ZN ? H ZN . ? A ZN 605 ? 1_555 NE2 ? A HIS 138 ? A HIS 507 ? 1_555 108.7 ? 
27 SG  ? A CYS 125 ? A CYS 494 ? 1_555 ZN ? H ZN . ? A ZN 605 ? 1_555 NE2 ? A HIS 138 ? A HIS 507 ? 1_555 105.6 ? 
28 SG  ? A CYS 122 ? A CYS 491 ? 1_555 ZN ? H ZN . ? A ZN 605 ? 1_555 NE2 ? A HIS 142 ? A HIS 511 ? 1_555 106.3 ? 
29 SG  ? A CYS 125 ? A CYS 494 ? 1_555 ZN ? H ZN . ? A ZN 605 ? 1_555 NE2 ? A HIS 142 ? A HIS 511 ? 1_555 120.5 ? 
30 NE2 ? A HIS 138 ? A HIS 507 ? 1_555 ZN ? H ZN . ? A ZN 605 ? 1_555 NE2 ? A HIS 142 ? A HIS 511 ? 1_555 98.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2019-07-03 
2 'Structure model' 1 1 2019-10-30 
3 'Structure model' 1 2 2020-01-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'            
2 2 'Structure model' 'Database references'        
3 3 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation           
2 2 'Structure model' citation_author    
3 3 'Structure model' pdbx_audit_support 
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_volume'                 
2 2 'Structure model' '_citation.page_first'                     
3 2 'Structure model' '_citation.page_last'                      
4 2 'Structure model' '_citation.title'                          
5 3 'Structure model' '_pdbx_audit_support.funding_organization' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined 36.1974 35.8123 28.8499  0.2442 0.2309 0.2186 0.0668  0.0578  -0.0706 9.9331 4.2879 7.8107 
-1.0109 5.5224  -3.3839 0.1123  0.1327  0.1656  -0.1725 -0.3022 -0.1516 0.4215  -0.0587 0.2318  
'X-RAY DIFFRACTION' 2  ? refined 40.6916 33.1745 22.3183  0.3240 0.2064 0.2100 0.0909  0.0985  0.0140  8.2635 9.0984 5.8793 
-1.8280 0.4771  2.5790  0.0201  0.3039  -0.0119 -0.4801 -0.0887 -0.6017 0.5988  0.4890  0.0714  
'X-RAY DIFFRACTION' 3  ? refined 41.5509 24.8905 7.9771   0.1373 0.1668 0.1949 -0.0311 0.0227  0.0228  4.7326 7.3227 4.8396 
-2.2687 -2.8717 2.1512  0.1116  0.1476  0.4894  -0.4135 0.1254  -0.2129 -0.6597 0.0188  -0.2029 
'X-RAY DIFFRACTION' 4  ? refined 38.7287 15.0530 7.3696   0.1297 0.2077 0.1089 -0.0232 0.0497  -0.0191 0.5387 4.7842 3.0300 
-1.0180 -0.8745 3.8024  -0.1584 0.1478  -0.2326 -0.0350 0.0991  -0.1385 0.3261  -0.1272 0.0065  
'X-RAY DIFFRACTION' 5  ? refined 25.5780 2.5380  7.1451   0.1239 0.0749 0.0636 0.0241  -0.0192 0.0097  6.7950 4.9899 2.1232 0.5959 
-0.7386 0.8072  0.0147  -0.0810 -0.2459 0.1835  0.0760  -0.0391 0.0572  0.0893  -0.0851 
'X-RAY DIFFRACTION' 6  ? refined 8.7744  16.5355 7.9213   0.0956 0.1048 0.0780 -0.0020 0.0101  -0.0225 2.8266 3.6040 2.7604 
-0.0659 -0.5106 -3.0458 -0.0285 -0.1753 -0.0003 0.1756  0.1078  0.1425  -0.1567 -0.0741 -0.0879 
'X-RAY DIFFRACTION' 7  ? refined 12.9786 27.1905 -11.0536 0.1568 0.1117 0.1393 -0.0534 -0.0135 -0.0171 5.8289 4.8558 8.5005 
-1.0617 1.6652  -1.7370 -0.1249 0.4045  -0.0961 -0.5666 0.1211  0.1810  0.2984  0.0707  0.0543  
'X-RAY DIFFRACTION' 8  ? refined 6.3430  18.5954 -10.5388 0.2296 0.1648 0.1549 -0.0601 -0.0624 0.0147  3.6492 0.6359 7.6243 
-1.4798 3.9679  -1.2875 -0.0309 0.3078  0.0627  -0.3843 0.1065  0.1933  -0.0961 0.2745  -0.0323 
'X-RAY DIFFRACTION' 9  ? refined 17.7541 10.6403 1.1344   0.1548 0.0850 0.0766 0.0030  0.0050  -0.0042 6.8393 6.1435 6.4441 
-5.0506 6.3412  -3.4873 -0.0134 -0.0377 -0.4073 -0.1530 0.1873  0.3693  -0.2067 -0.0716 -0.2098 
'X-RAY DIFFRACTION' 10 ? refined 33.3322 17.0245 19.7061  0.1360 0.1779 0.1036 -0.0123 -0.0086 -0.0243 3.5782 2.1310 5.9846 0.0831 
1.7593  -0.1275 0.0511  -0.5748 -0.0336 0.2659  0.1750  -0.1045 -0.0123 -0.4178 -0.1686 
'X-RAY DIFFRACTION' 11 ? refined 36.2006 16.4610 22.8661  0.1621 0.1922 0.0976 0.0114  -0.0190 -0.0224 4.2328 2.4386 5.3260 0.7870 
2.8679  1.0452  0.0019  -0.3713 -0.0299 0.3127  0.1202  -0.1857 -0.1273 0.0028  -0.1103 
'X-RAY DIFFRACTION' 12 ? refined 21.3123 19.4198 2.8824   0.2323 0.1567 0.1141 -0.0097 0.0012  0.0348  4.8291 6.8894 3.1186 0.8147 
3.8029  1.5830  -0.0788 0.1322  0.1047  -0.4999 0.2481  -0.1313 -1.1191 -0.3460 -0.2112 
'X-RAY DIFFRACTION' 13 ? refined 9.4104  10.3677 -8.8258  0.2688 0.2351 0.2999 -0.0512 -0.0516 -0.0708 5.5308 6.9047 7.2960 
-0.9544 3.6563  -0.1476 -0.4215 1.0737  -1.8474 -0.5539 0.8384  0.1686  0.2471  0.1431  -0.4942 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 374 through 388 )
;
'X-RAY DIFFRACTION' 2  2  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 389 through 399 )
;
'X-RAY DIFFRACTION' 3  3  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 400 through 416 )
;
'X-RAY DIFFRACTION' 4  4  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 417 through 428 )
;
'X-RAY DIFFRACTION' 5  5  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 429 through 456 )
;
'X-RAY DIFFRACTION' 6  6  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 457 through 489 )
;
'X-RAY DIFFRACTION' 7  7  ? ? ? ? ? ? ? ? ? 
;chain 'A' and (resid 490 through 514 )
;
'X-RAY DIFFRACTION' 8  8  ? ? ? ? ? ? ? ? ? 
;chain 'E' and (resid 1 through 5 )
;
'X-RAY DIFFRACTION' 9  9  ? ? ? ? ? ? ? ? ? 
;chain 'E' and (resid 6 through 10 )
;
'X-RAY DIFFRACTION' 10 10 ? ? ? ? ? ? ? ? ? 
;chain 'E' and (resid 11 through 20 )
;
'X-RAY DIFFRACTION' 11 11 ? ? ? ? ? ? ? ? ? 
;chain 'F' and (resid 1 through 10 )
;
'X-RAY DIFFRACTION' 12 12 ? ? ? ? ? ? ? ? ? 
;chain 'F' and (resid 11 through 15 )
;
'X-RAY DIFFRACTION' 13 13 ? ? ? ? ? ? ? ? ? 
;chain 'F' and (resid 16 through 20 )
;
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? '(1.13_2998: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? CrysalisPro ? ? ? .                  2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? Aimless     ? ? ? .                  3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? .                  4 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             "O4'" 
_pdbx_validate_rmsd_angle.auth_asym_id_1             E 
_pdbx_validate_rmsd_angle.auth_comp_id_1             DA 
_pdbx_validate_rmsd_angle.auth_seq_id_1              5 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             "C1'" 
_pdbx_validate_rmsd_angle.auth_asym_id_2             E 
_pdbx_validate_rmsd_angle.auth_comp_id_2             DA 
_pdbx_validate_rmsd_angle.auth_seq_id_2              5 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             N9 
_pdbx_validate_rmsd_angle.auth_asym_id_3             E 
_pdbx_validate_rmsd_angle.auth_comp_id_3             DA 
_pdbx_validate_rmsd_angle.auth_seq_id_3              5 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                110.35 
_pdbx_validate_rmsd_angle.angle_target_value         108.30 
_pdbx_validate_rmsd_angle.angle_deviation            2.05 
_pdbx_validate_rmsd_angle.angle_standard_deviation   0.30 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 513 ? CG  ? A LYS 144 CG  
2  1 Y 1 A LYS 513 ? CD  ? A LYS 144 CD  
3  1 Y 1 A LYS 513 ? CE  ? A LYS 144 CE  
4  1 Y 1 A LYS 513 ? NZ  ? A LYS 144 NZ  
5  1 Y 1 A GLU 514 ? CG  ? A GLU 145 CG  
6  1 Y 1 A GLU 514 ? CD  ? A GLU 145 CD  
7  1 Y 1 A GLU 514 ? OE1 ? A GLU 145 OE1 
8  1 Y 1 A GLU 514 ? OE2 ? A GLU 145 OE2 
9  1 Y 1 A LYS 515 ? CG  ? A LYS 146 CG  
10 1 Y 1 A LYS 515 ? CD  ? A LYS 146 CD  
11 1 Y 1 A LYS 515 ? CE  ? A LYS 146 CE  
12 1 Y 1 A LYS 515 ? NZ  ? A LYS 146 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 370 ? A GLY 1   
2 1 Y 1 A PRO 371 ? A PRO 2   
3 1 Y 1 A LEU 372 ? A LEU 3   
4 1 Y 1 A HIS 516 ? A HIS 147 
5 1 Y 1 A THR 517 ? A THR 148 
6 1 Y 1 A ALA 518 ? A ALA 149 
7 1 Y 1 A ASP 519 ? A ASP 150 
8 1 Y 1 A TYR 520 ? A TYR 151 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
6ML4 'double helix'        
6ML4 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DC 2  1_555 C DG 20 1_555 0.241  -0.246 -0.211 2.632   -2.677  2.644  1  E_DC2:DG20_F  E 2  ? F 20 ? 19 1 
1 B DG 3  1_555 C DC 19 1_555 -0.093 -0.087 0.436  0.817   -17.823 -0.431 2  E_DG3:DC19_F  E 3  ? F 19 ? 19 1 
1 B DC 4  1_555 C DG 18 1_555 0.243  -0.148 0.247  -6.924  -7.820  3.799  3  E_DC4:DG18_F  E 4  ? F 18 ? 19 1 
1 B DA 5  1_555 C DT 17 1_555 0.192  -0.144 0.219  10.436  -4.030  5.793  4  E_DA5:DT17_F  E 5  ? F 17 ? 20 1 
1 B DG 6  1_555 C DC 16 1_555 -0.239 -0.134 0.310  10.232  -8.671  1.287  5  E_DG6:DC16_F  E 6  ? F 16 ? 19 1 
1 B DG 7  1_555 C DC 15 1_555 -0.522 -0.161 -0.202 -11.117 -12.861 3.336  6  E_DG7:DC15_F  E 7  ? F 15 ? 19 1 
1 B DT 8  1_555 C DA 14 1_555 -0.007 -0.066 0.157  -5.828  -10.233 5.435  7  E_DT8:DA14_F  E 8  ? F 14 ? 20 1 
1 B DC 9  1_555 C DG 13 1_555 0.297  -0.116 -0.265 4.797   -5.169  4.085  8  E_DC9:DG13_F  E 9  ? F 13 ? 19 1 
1 B DC 10 1_555 C DG 12 1_555 0.045  -0.198 0.493  -6.340  -14.488 -0.975 9  E_DC10:DG12_F E 10 ? F 12 ? 19 1 
1 B DT 11 1_555 C DA 11 1_555 0.008  -0.126 0.445  -1.281  -10.565 0.154  10 E_DT11:DA11_F E 11 ? F 11 ? 20 1 
1 B DG 12 1_555 C DC 10 1_555 -0.192 -0.128 0.289  10.334  -6.768  3.976  11 E_DG12:DC10_F E 12 ? F 10 ? 19 1 
1 B DG 13 1_555 C DC 9  1_555 0.011  -0.149 0.117  -1.266  -18.558 -0.865 12 E_DG13:DC9_F  E 13 ? F 9  ? 19 1 
1 B DA 14 1_555 C DT 8  1_555 -0.043 -0.095 0.360  -2.400  -13.806 9.078  13 E_DA14:DT8_F  E 14 ? F 8  ? 20 1 
1 B DC 15 1_555 C DG 7  1_555 0.456  -0.092 0.060  11.557  -8.903  2.110  14 E_DC15:DG7_F  E 15 ? F 7  ? 19 1 
1 B DG 16 1_555 C DC 6  1_555 0.020  -0.115 0.680  16.043  -10.178 -0.770 15 E_DG16:DC6_F  E 16 ? F 6  ? 19 1 
1 B DA 17 1_555 C DT 5  1_555 -0.006 -0.111 0.401  7.322   -20.035 4.597  16 E_DA17:DT5_F  E 17 ? F 5  ? 20 1 
1 B DA 18 1_555 C DT 4  1_555 0.086  -0.181 0.631  7.340   -19.642 2.328  17 E_DA18:DT4_F  E 18 ? F 4  ? 20 1 
1 B DG 19 1_555 C DC 3  1_555 -0.241 -0.025 0.272  -7.814  -16.436 2.692  18 E_DG19:DC3_F  E 19 ? F 3  ? 19 1 
1 B DC 20 1_555 C DG 2  1_555 0.359  -0.192 0.034  0.882   -6.370  3.681  19 E_DC20:DG2_F  E 20 ? F 2  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DC 2  1_555 C DG 20 1_555 B DG 3  1_555 C DC 19 1_555 -0.513 1.020  3.407 -6.377 1.385  37.092 1.390  -0.084 3.479 2.157  
9.930  37.642 1  EE_DC2DG3:DC19DG20_FF   E 2  ? F 20 ? E 3  ? F 19 ? 
1 B DG 3  1_555 C DC 19 1_555 B DC 4  1_555 C DG 18 1_555 0.723  -0.463 3.480 2.690  -0.673 35.872 -0.647 -0.759 3.531 -1.090 
-4.359 35.975 2  EE_DG3DC4:DG18DC19_FF   E 3  ? F 19 ? E 4  ? F 18 ? 
1 B DC 4  1_555 C DG 18 1_555 B DA 5  1_555 C DT 17 1_555 0.700  0.209  2.982 0.963  6.107  28.898 -0.787 -1.185 2.983 12.063 
-1.902 29.538 3  EE_DC4DA5:DT17DG18_FF   E 4  ? F 18 ? E 5  ? F 17 ? 
1 B DA 5  1_555 C DT 17 1_555 B DG 6  1_555 C DC 16 1_555 -0.647 -0.360 3.298 -4.795 0.452  33.166 -0.700 0.317  3.350 0.788  
8.345  33.504 4  EE_DA5DG6:DC16DT17_FF   E 5  ? F 17 ? E 6  ? F 16 ? 
1 B DG 6  1_555 C DC 16 1_555 B DG 7  1_555 C DC 15 1_555 -0.480 -1.161 3.767 1.423  3.539  36.586 -2.385 0.981  3.622 5.618  
-2.258 36.777 5  EE_DG6DG7:DC15DC16_FF   E 6  ? F 16 ? E 7  ? F 15 ? 
1 B DG 7  1_555 C DC 15 1_555 B DT 8  1_555 C DA 14 1_555 0.237  -0.516 3.160 -2.682 2.969  29.092 -1.628 -1.019 3.060 5.876  
5.307  29.360 6  EE_DG7DT8:DA14DC15_FF   E 7  ? F 15 ? E 8  ? F 14 ? 
1 B DT 8  1_555 C DA 14 1_555 B DC 9  1_555 C DG 13 1_555 0.630  0.325  3.150 4.225  5.047  37.267 -0.135 -0.439 3.215 7.823  
-6.549 37.824 7  EE_DT8DC9:DG13DA14_FF   E 8  ? F 14 ? E 9  ? F 13 ? 
1 B DC 9  1_555 C DG 13 1_555 B DC 10 1_555 C DG 12 1_555 -1.068 -0.167 3.691 -7.784 -1.086 35.227 -0.090 0.441  3.836 -1.767 
12.667 36.066 8  EE_DC9DC10:DG12DG13_FF  E 9  ? F 13 ? E 10 ? F 12 ? 
1 B DC 10 1_555 C DG 12 1_555 B DT 11 1_555 C DA 11 1_555 -0.246 -0.829 3.212 0.025  0.911  30.620 -1.744 0.470  3.187 1.726  
-0.048 30.633 9  EE_DC10DT11:DA11DG12_FF E 10 ? F 12 ? E 11 ? F 11 ? 
1 B DT 11 1_555 C DA 11 1_555 B DG 12 1_555 C DC 10 1_555 0.636  0.091  2.997 1.710  6.255  30.800 -0.913 -0.876 2.987 11.615 
-3.175 31.459 10 EE_DT11DG12:DC10DA11_FF E 11 ? F 11 ? E 12 ? F 10 ? 
1 B DG 12 1_555 C DC 10 1_555 B DG 13 1_555 C DC 9  1_555 -1.409 0.331  3.519 -3.887 2.730  37.588 0.125  1.622  3.656 4.216  
6.004  37.876 11 EE_DG12DG13:DC9DC10_FF  E 12 ? F 10 ? E 13 ? F 9  ? 
1 B DG 13 1_555 C DC 9  1_555 B DA 14 1_555 C DT 8  1_555 0.154  -0.146 3.169 -4.318 -0.168 38.658 -0.200 -0.738 3.135 -0.252 
6.499  38.890 12 EE_DG13DA14:DT8DC9_FF   E 13 ? F 9  ? E 14 ? F 8  ? 
1 B DA 14 1_555 C DT 8  1_555 B DC 15 1_555 C DG 7  1_555 -0.467 -0.254 2.910 1.521  5.387  26.852 -1.704 1.315  2.777 11.442 
-3.231 27.419 13 EE_DA14DC15:DG7DT8_FF   E 14 ? F 8  ? E 15 ? F 7  ? 
1 B DC 15 1_555 C DG 7  1_555 B DG 16 1_555 C DC 6  1_555 -0.316 0.471  3.214 -7.232 -2.331 36.307 1.050  -0.461 3.181 -3.691 
11.452 37.068 14 EE_DC15DG16:DC6DG7_FF   E 15 ? F 7  ? E 16 ? F 6  ? 
1 B DG 16 1_555 C DC 6  1_555 B DA 17 1_555 C DT 5  1_555 -0.119 -0.750 3.440 0.596  -5.339 39.368 -0.441 0.250  3.506 -7.880 
-0.880 39.719 15 EE_DG16DA17:DT5DC6_FF   E 16 ? F 6  ? E 17 ? F 5  ? 
1 B DA 17 1_555 C DT 5  1_555 B DA 18 1_555 C DT 4  1_555 -0.099 -0.409 3.133 -2.307 -4.351 36.158 -0.071 -0.150 3.159 -6.970 
3.695  36.481 16 EE_DA17DA18:DT4DT5_FF   E 17 ? F 5  ? E 18 ? F 4  ? 
1 B DA 18 1_555 C DT 4  1_555 B DG 19 1_555 C DC 3  1_555 -0.074 -0.685 3.554 0.107  -1.629 37.413 -0.834 0.130  3.579 -2.538 
-0.166 37.448 17 EE_DA18DG19:DC3DT4_FF   E 18 ? F 4  ? E 19 ? F 3  ? 
1 B DG 19 1_555 C DC 3  1_555 B DC 20 1_555 C DG 2  1_555 0.321  0.374  3.077 2.662  1.213  36.517 0.437  -0.164 3.103 1.933  
-4.240 36.630 18 EE_DG19DC20:DG2DC3_FF   E 19 ? F 3  ? E 20 ? F 2  ? 
# 
_pdbx_audit_support.funding_organization   
'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 
_pdbx_audit_support.country                'United States' 
_pdbx_audit_support.grant_number           GM049245-23 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'ZINC ION'     ZN  
5 1,2-ETHANEDIOL EDO 
6 water          HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   'native gel electrophoresis' 
_pdbx_struct_assembly_auth_evidence.details                ? 
#