data_6MOL
# 
_entry.id   6MOL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6MOL         
WWPDB D_1000237323 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6MOL 
_pdbx_database_status.recvd_initial_deposition_date   2018-10-04 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Jude, K.M.'   1 0000-0002-3675-5136 
'Mohan, K.'    2 0000-0002-7163-6423 
'Garcia, K.C.' 3 0000-0001-9273-0278 
'Guo, Y.'      4 ?                   
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Science 
_citation.journal_id_ASTM           SCIEAS 
_citation.journal_id_CSD            0038 
_citation.journal_id_ISSN           1095-9203 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            364 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
'Topological control of cytokine receptor signaling induces differential effects in hematopoiesis.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1126/science.aav7532 
_citation.pdbx_database_id_PubMed   31123111 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Mohan, K.'      1  ? 
primary 'Ueda, G.'       2  ? 
primary 'Kim, A.R.'      3  ? 
primary 'Jude, K.M.'     4  ? 
primary 'Fallas, J.A.'   5  ? 
primary 'Guo, Y.'        6  ? 
primary 'Hafer, M.'      7  ? 
primary 'Miao, Y.'       8  ? 
primary 'Saxton, R.A.'   9  ? 
primary 'Piehler, J.'    10 ? 
primary 'Sankaran, V.G.' 11 ? 
primary 'Baker, D.'      12 ? 
primary 'Garcia, K.C.'   13 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6MOL 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     168.109 
_cell.length_a_esd                 ? 
_cell.length_b                     168.109 
_cell.length_b_esd                 ? 
_cell.length_c                     78.029 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6MOL 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                173 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 63' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Monoextended DARPin R12 (M_R12)' 48223.402 1 ? ? ? ? 
2 polymer     man 'Erythropoietin receptor'         25129.424 2 ? ? ? ? 
3 non-polymer syn GLYCEROL                          92.094    1 ? ? ? ? 
4 water       nat water                             18.015    2 ? ? ? ? 
# 
_entity_name_com.entity_id   2 
_entity_name_com.name        EPO-R 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;MGSDLGKKLLKAARAGQDDEVRILMANGADVNATDIWDATPLHLAALIGHLEIVEVLLKNGADVNASDITGTTPLHLAAT
MGHLEIVEVLLKYGADVNAYDLNGATPLHLAARMGHVEIVEVLLKYGADVNAQDAAGGTPLHEAARAGHLEIVEVLLKYG
ADVNAVDAAGGTPLHEAARAGHLEIVEVLLKYGADVNAVDAAGGTPLHEAARAGHLEIVEVLLKYGADVNAVDAAGGTPL
HEAARAGHLEIVEVLLKYGADVNAVDAAGGTPLHEAARAGHLEIVEVLLKYGADVNAVGTPLHKAARAGHLEIVEVLLKY
GADVNATDIWDATPLHLAALIGHLEIVEVLLKNGADVNASDITGTTPLHLAATMGHLEIVEVLLKYGADVNAYDLNGATP
LHLAARMGHVEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEILQAAALEHHHHHH
;
;MGSDLGKKLLKAARAGQDDEVRILMANGADVNATDIWDATPLHLAALIGHLEIVEVLLKNGADVNASDITGTTPLHLAAT
MGHLEIVEVLLKYGADVNAYDLNGATPLHLAARMGHVEIVEVLLKYGADVNAQDAAGGTPLHEAARAGHLEIVEVLLKYG
ADVNAVDAAGGTPLHEAARAGHLEIVEVLLKYGADVNAVDAAGGTPLHEAARAGHLEIVEVLLKYGADVNAVDAAGGTPL
HEAARAGHLEIVEVLLKYGADVNAVDAAGGTPLHEAARAGHLEIVEVLLKYGADVNAVGTPLHKAARAGHLEIVEVLLKY
GADVNATDIWDATPLHLAALIGHLEIVEVLLKNGADVNASDITGTTPLHLAATMGHLEIVEVLLKYGADVNAYDLNGATP
LHLAARMGHVEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEILQAAALEHHHHHH
;
A   ? 
2 'polypeptide(L)' no no 
;FAGSADPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGQYSFSYQLEDEPWKLCRLHQAPTARGAVRFW
CSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSA
GQGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDKEKAAA
;
;FAGSADPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGQYSFSYQLEDEPWKLCRLHQAPTARGAVRFW
CSLPTADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSA
GQGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDKEKAAA
;
B,C ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   ASP n 
1 5   LEU n 
1 6   GLY n 
1 7   LYS n 
1 8   LYS n 
1 9   LEU n 
1 10  LEU n 
1 11  LYS n 
1 12  ALA n 
1 13  ALA n 
1 14  ARG n 
1 15  ALA n 
1 16  GLY n 
1 17  GLN n 
1 18  ASP n 
1 19  ASP n 
1 20  GLU n 
1 21  VAL n 
1 22  ARG n 
1 23  ILE n 
1 24  LEU n 
1 25  MET n 
1 26  ALA n 
1 27  ASN n 
1 28  GLY n 
1 29  ALA n 
1 30  ASP n 
1 31  VAL n 
1 32  ASN n 
1 33  ALA n 
1 34  THR n 
1 35  ASP n 
1 36  ILE n 
1 37  TRP n 
1 38  ASP n 
1 39  ALA n 
1 40  THR n 
1 41  PRO n 
1 42  LEU n 
1 43  HIS n 
1 44  LEU n 
1 45  ALA n 
1 46  ALA n 
1 47  LEU n 
1 48  ILE n 
1 49  GLY n 
1 50  HIS n 
1 51  LEU n 
1 52  GLU n 
1 53  ILE n 
1 54  VAL n 
1 55  GLU n 
1 56  VAL n 
1 57  LEU n 
1 58  LEU n 
1 59  LYS n 
1 60  ASN n 
1 61  GLY n 
1 62  ALA n 
1 63  ASP n 
1 64  VAL n 
1 65  ASN n 
1 66  ALA n 
1 67  SER n 
1 68  ASP n 
1 69  ILE n 
1 70  THR n 
1 71  GLY n 
1 72  THR n 
1 73  THR n 
1 74  PRO n 
1 75  LEU n 
1 76  HIS n 
1 77  LEU n 
1 78  ALA n 
1 79  ALA n 
1 80  THR n 
1 81  MET n 
1 82  GLY n 
1 83  HIS n 
1 84  LEU n 
1 85  GLU n 
1 86  ILE n 
1 87  VAL n 
1 88  GLU n 
1 89  VAL n 
1 90  LEU n 
1 91  LEU n 
1 92  LYS n 
1 93  TYR n 
1 94  GLY n 
1 95  ALA n 
1 96  ASP n 
1 97  VAL n 
1 98  ASN n 
1 99  ALA n 
1 100 TYR n 
1 101 ASP n 
1 102 LEU n 
1 103 ASN n 
1 104 GLY n 
1 105 ALA n 
1 106 THR n 
1 107 PRO n 
1 108 LEU n 
1 109 HIS n 
1 110 LEU n 
1 111 ALA n 
1 112 ALA n 
1 113 ARG n 
1 114 MET n 
1 115 GLY n 
1 116 HIS n 
1 117 VAL n 
1 118 GLU n 
1 119 ILE n 
1 120 VAL n 
1 121 GLU n 
1 122 VAL n 
1 123 LEU n 
1 124 LEU n 
1 125 LYS n 
1 126 TYR n 
1 127 GLY n 
1 128 ALA n 
1 129 ASP n 
1 130 VAL n 
1 131 ASN n 
1 132 ALA n 
1 133 GLN n 
1 134 ASP n 
1 135 ALA n 
1 136 ALA n 
1 137 GLY n 
1 138 GLY n 
1 139 THR n 
1 140 PRO n 
1 141 LEU n 
1 142 HIS n 
1 143 GLU n 
1 144 ALA n 
1 145 ALA n 
1 146 ARG n 
1 147 ALA n 
1 148 GLY n 
1 149 HIS n 
1 150 LEU n 
1 151 GLU n 
1 152 ILE n 
1 153 VAL n 
1 154 GLU n 
1 155 VAL n 
1 156 LEU n 
1 157 LEU n 
1 158 LYS n 
1 159 TYR n 
1 160 GLY n 
1 161 ALA n 
1 162 ASP n 
1 163 VAL n 
1 164 ASN n 
1 165 ALA n 
1 166 VAL n 
1 167 ASP n 
1 168 ALA n 
1 169 ALA n 
1 170 GLY n 
1 171 GLY n 
1 172 THR n 
1 173 PRO n 
1 174 LEU n 
1 175 HIS n 
1 176 GLU n 
1 177 ALA n 
1 178 ALA n 
1 179 ARG n 
1 180 ALA n 
1 181 GLY n 
1 182 HIS n 
1 183 LEU n 
1 184 GLU n 
1 185 ILE n 
1 186 VAL n 
1 187 GLU n 
1 188 VAL n 
1 189 LEU n 
1 190 LEU n 
1 191 LYS n 
1 192 TYR n 
1 193 GLY n 
1 194 ALA n 
1 195 ASP n 
1 196 VAL n 
1 197 ASN n 
1 198 ALA n 
1 199 VAL n 
1 200 ASP n 
1 201 ALA n 
1 202 ALA n 
1 203 GLY n 
1 204 GLY n 
1 205 THR n 
1 206 PRO n 
1 207 LEU n 
1 208 HIS n 
1 209 GLU n 
1 210 ALA n 
1 211 ALA n 
1 212 ARG n 
1 213 ALA n 
1 214 GLY n 
1 215 HIS n 
1 216 LEU n 
1 217 GLU n 
1 218 ILE n 
1 219 VAL n 
1 220 GLU n 
1 221 VAL n 
1 222 LEU n 
1 223 LEU n 
1 224 LYS n 
1 225 TYR n 
1 226 GLY n 
1 227 ALA n 
1 228 ASP n 
1 229 VAL n 
1 230 ASN n 
1 231 ALA n 
1 232 VAL n 
1 233 ASP n 
1 234 ALA n 
1 235 ALA n 
1 236 GLY n 
1 237 GLY n 
1 238 THR n 
1 239 PRO n 
1 240 LEU n 
1 241 HIS n 
1 242 GLU n 
1 243 ALA n 
1 244 ALA n 
1 245 ARG n 
1 246 ALA n 
1 247 GLY n 
1 248 HIS n 
1 249 LEU n 
1 250 GLU n 
1 251 ILE n 
1 252 VAL n 
1 253 GLU n 
1 254 VAL n 
1 255 LEU n 
1 256 LEU n 
1 257 LYS n 
1 258 TYR n 
1 259 GLY n 
1 260 ALA n 
1 261 ASP n 
1 262 VAL n 
1 263 ASN n 
1 264 ALA n 
1 265 VAL n 
1 266 ASP n 
1 267 ALA n 
1 268 ALA n 
1 269 GLY n 
1 270 GLY n 
1 271 THR n 
1 272 PRO n 
1 273 LEU n 
1 274 HIS n 
1 275 GLU n 
1 276 ALA n 
1 277 ALA n 
1 278 ARG n 
1 279 ALA n 
1 280 GLY n 
1 281 HIS n 
1 282 LEU n 
1 283 GLU n 
1 284 ILE n 
1 285 VAL n 
1 286 GLU n 
1 287 VAL n 
1 288 LEU n 
1 289 LEU n 
1 290 LYS n 
1 291 TYR n 
1 292 GLY n 
1 293 ALA n 
1 294 ASP n 
1 295 VAL n 
1 296 ASN n 
1 297 ALA n 
1 298 VAL n 
1 299 GLY n 
1 300 THR n 
1 301 PRO n 
1 302 LEU n 
1 303 HIS n 
1 304 LYS n 
1 305 ALA n 
1 306 ALA n 
1 307 ARG n 
1 308 ALA n 
1 309 GLY n 
1 310 HIS n 
1 311 LEU n 
1 312 GLU n 
1 313 ILE n 
1 314 VAL n 
1 315 GLU n 
1 316 VAL n 
1 317 LEU n 
1 318 LEU n 
1 319 LYS n 
1 320 TYR n 
1 321 GLY n 
1 322 ALA n 
1 323 ASP n 
1 324 VAL n 
1 325 ASN n 
1 326 ALA n 
1 327 THR n 
1 328 ASP n 
1 329 ILE n 
1 330 TRP n 
1 331 ASP n 
1 332 ALA n 
1 333 THR n 
1 334 PRO n 
1 335 LEU n 
1 336 HIS n 
1 337 LEU n 
1 338 ALA n 
1 339 ALA n 
1 340 LEU n 
1 341 ILE n 
1 342 GLY n 
1 343 HIS n 
1 344 LEU n 
1 345 GLU n 
1 346 ILE n 
1 347 VAL n 
1 348 GLU n 
1 349 VAL n 
1 350 LEU n 
1 351 LEU n 
1 352 LYS n 
1 353 ASN n 
1 354 GLY n 
1 355 ALA n 
1 356 ASP n 
1 357 VAL n 
1 358 ASN n 
1 359 ALA n 
1 360 SER n 
1 361 ASP n 
1 362 ILE n 
1 363 THR n 
1 364 GLY n 
1 365 THR n 
1 366 THR n 
1 367 PRO n 
1 368 LEU n 
1 369 HIS n 
1 370 LEU n 
1 371 ALA n 
1 372 ALA n 
1 373 THR n 
1 374 MET n 
1 375 GLY n 
1 376 HIS n 
1 377 LEU n 
1 378 GLU n 
1 379 ILE n 
1 380 VAL n 
1 381 GLU n 
1 382 VAL n 
1 383 LEU n 
1 384 LEU n 
1 385 LYS n 
1 386 TYR n 
1 387 GLY n 
1 388 ALA n 
1 389 ASP n 
1 390 VAL n 
1 391 ASN n 
1 392 ALA n 
1 393 TYR n 
1 394 ASP n 
1 395 LEU n 
1 396 ASN n 
1 397 GLY n 
1 398 ALA n 
1 399 THR n 
1 400 PRO n 
1 401 LEU n 
1 402 HIS n 
1 403 LEU n 
1 404 ALA n 
1 405 ALA n 
1 406 ARG n 
1 407 MET n 
1 408 GLY n 
1 409 HIS n 
1 410 VAL n 
1 411 GLU n 
1 412 ILE n 
1 413 VAL n 
1 414 GLU n 
1 415 VAL n 
1 416 LEU n 
1 417 LEU n 
1 418 LYS n 
1 419 TYR n 
1 420 GLY n 
1 421 ALA n 
1 422 ASP n 
1 423 VAL n 
1 424 ASN n 
1 425 ALA n 
1 426 GLN n 
1 427 ASP n 
1 428 LYS n 
1 429 PHE n 
1 430 GLY n 
1 431 LYS n 
1 432 THR n 
1 433 ALA n 
1 434 PHE n 
1 435 ASP n 
1 436 ILE n 
1 437 SER n 
1 438 ILE n 
1 439 ASP n 
1 440 ASN n 
1 441 GLY n 
1 442 ASN n 
1 443 GLU n 
1 444 ASP n 
1 445 LEU n 
1 446 ALA n 
1 447 GLU n 
1 448 ILE n 
1 449 LEU n 
1 450 GLN n 
1 451 ALA n 
1 452 ALA n 
1 453 ALA n 
1 454 LEU n 
1 455 GLU n 
1 456 HIS n 
1 457 HIS n 
1 458 HIS n 
1 459 HIS n 
1 460 HIS n 
1 461 HIS n 
2 1   PHE n 
2 2   ALA n 
2 3   GLY n 
2 4   SER n 
2 5   ALA n 
2 6   ASP n 
2 7   PRO n 
2 8   LYS n 
2 9   PHE n 
2 10  GLU n 
2 11  SER n 
2 12  LYS n 
2 13  ALA n 
2 14  ALA n 
2 15  LEU n 
2 16  LEU n 
2 17  ALA n 
2 18  ALA n 
2 19  ARG n 
2 20  GLY n 
2 21  PRO n 
2 22  GLU n 
2 23  GLU n 
2 24  LEU n 
2 25  LEU n 
2 26  CYS n 
2 27  PHE n 
2 28  THR n 
2 29  GLU n 
2 30  ARG n 
2 31  LEU n 
2 32  GLU n 
2 33  ASP n 
2 34  LEU n 
2 35  VAL n 
2 36  CYS n 
2 37  PHE n 
2 38  TRP n 
2 39  GLU n 
2 40  GLU n 
2 41  ALA n 
2 42  ALA n 
2 43  SER n 
2 44  ALA n 
2 45  GLY n 
2 46  VAL n 
2 47  GLY n 
2 48  PRO n 
2 49  GLY n 
2 50  GLN n 
2 51  TYR n 
2 52  SER n 
2 53  PHE n 
2 54  SER n 
2 55  TYR n 
2 56  GLN n 
2 57  LEU n 
2 58  GLU n 
2 59  ASP n 
2 60  GLU n 
2 61  PRO n 
2 62  TRP n 
2 63  LYS n 
2 64  LEU n 
2 65  CYS n 
2 66  ARG n 
2 67  LEU n 
2 68  HIS n 
2 69  GLN n 
2 70  ALA n 
2 71  PRO n 
2 72  THR n 
2 73  ALA n 
2 74  ARG n 
2 75  GLY n 
2 76  ALA n 
2 77  VAL n 
2 78  ARG n 
2 79  PHE n 
2 80  TRP n 
2 81  CYS n 
2 82  SER n 
2 83  LEU n 
2 84  PRO n 
2 85  THR n 
2 86  ALA n 
2 87  ASP n 
2 88  THR n 
2 89  SER n 
2 90  SER n 
2 91  PHE n 
2 92  VAL n 
2 93  PRO n 
2 94  LEU n 
2 95  GLU n 
2 96  LEU n 
2 97  ARG n 
2 98  VAL n 
2 99  THR n 
2 100 ALA n 
2 101 ALA n 
2 102 SER n 
2 103 GLY n 
2 104 ALA n 
2 105 PRO n 
2 106 ARG n 
2 107 TYR n 
2 108 HIS n 
2 109 ARG n 
2 110 VAL n 
2 111 ILE n 
2 112 HIS n 
2 113 ILE n 
2 114 ASN n 
2 115 GLU n 
2 116 VAL n 
2 117 VAL n 
2 118 LEU n 
2 119 LEU n 
2 120 ASP n 
2 121 ALA n 
2 122 PRO n 
2 123 VAL n 
2 124 GLY n 
2 125 LEU n 
2 126 VAL n 
2 127 ALA n 
2 128 ARG n 
2 129 LEU n 
2 130 ALA n 
2 131 ASP n 
2 132 GLU n 
2 133 SER n 
2 134 GLY n 
2 135 HIS n 
2 136 VAL n 
2 137 VAL n 
2 138 LEU n 
2 139 ARG n 
2 140 TRP n 
2 141 LEU n 
2 142 PRO n 
2 143 PRO n 
2 144 PRO n 
2 145 GLU n 
2 146 THR n 
2 147 PRO n 
2 148 MET n 
2 149 THR n 
2 150 SER n 
2 151 HIS n 
2 152 ILE n 
2 153 ARG n 
2 154 TYR n 
2 155 GLU n 
2 156 VAL n 
2 157 ASP n 
2 158 VAL n 
2 159 SER n 
2 160 ALA n 
2 161 GLY n 
2 162 GLN n 
2 163 GLY n 
2 164 ALA n 
2 165 GLY n 
2 166 SER n 
2 167 VAL n 
2 168 GLN n 
2 169 ARG n 
2 170 VAL n 
2 171 GLU n 
2 172 ILE n 
2 173 LEU n 
2 174 GLU n 
2 175 GLY n 
2 176 ARG n 
2 177 THR n 
2 178 GLU n 
2 179 CYS n 
2 180 VAL n 
2 181 LEU n 
2 182 SER n 
2 183 ASN n 
2 184 LEU n 
2 185 ARG n 
2 186 GLY n 
2 187 ARG n 
2 188 THR n 
2 189 ARG n 
2 190 TYR n 
2 191 THR n 
2 192 PHE n 
2 193 ALA n 
2 194 VAL n 
2 195 ARG n 
2 196 ALA n 
2 197 ARG n 
2 198 MET n 
2 199 ALA n 
2 200 GLU n 
2 201 PRO n 
2 202 SER n 
2 203 PHE n 
2 204 GLY n 
2 205 GLY n 
2 206 PHE n 
2 207 TRP n 
2 208 SER n 
2 209 ALA n 
2 210 TRP n 
2 211 SER n 
2 212 GLU n 
2 213 PRO n 
2 214 VAL n 
2 215 SER n 
2 216 LEU n 
2 217 LEU n 
2 218 THR n 
2 219 PRO n 
2 220 SER n 
2 221 ASP n 
2 222 LEU n 
2 223 ASP n 
2 224 LYS n 
2 225 GLU n 
2 226 LYS n 
2 227 ALA n 
2 228 ALA n 
2 229 ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 461 ?     ? ?    ? ? ? ? ? ? 'synthetic construct' 32630 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 229 Human ? EPOR ? ? ? ? ? ? 'Homo sapiens'        9606  ? ? ? ? ? ? ? ? 'Trichoplusia ni'  
7111 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 PDB 6MOL       6MOL   ? 1 ? 1  
2 UNP EPOR_HUMAN P19235 ? 2 
;DPKFESKAALLAARGPEELLCFTERLEDLVCFWEEAASAGVGPGNYSFSYQLEDEPWKLCRLHQAPTARGAVRFWCSLPT
ADTSSFVPLELRVTAASGAPRYHRVIHINEVVLLDAPVGLVARLADESGHVVLRWLPPPETPMTSHIRYEVDVSAGNGAG
SVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLD
;
32 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6MOL A 1 ? 461 ? 6MOL   0  ? 460 ? 0 460 
2 2 6MOL B 6 ? 223 ? P19235 32 ? 249 ? 8 225 
3 2 6MOL C 6 ? 223 ? P19235 32 ? 249 ? 8 225 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
2 6MOL PHE B 1   ? UNP P19235 ?   ?   'expression tag'      3   1  
2 6MOL ALA B 2   ? UNP P19235 ?   ?   'expression tag'      4   2  
2 6MOL GLY B 3   ? UNP P19235 ?   ?   'expression tag'      5   3  
2 6MOL SER B 4   ? UNP P19235 ?   ?   'expression tag'      6   4  
2 6MOL ALA B 5   ? UNP P19235 ?   ?   'expression tag'      7   5  
2 6MOL GLN B 50  ? UNP P19235 ASN 76  'engineered mutation' 52  6  
2 6MOL GLN B 162 ? UNP P19235 ASN 188 'engineered mutation' 164 7  
2 6MOL LYS B 224 ? UNP P19235 ?   ?   'expression tag'      226 8  
2 6MOL GLU B 225 ? UNP P19235 ?   ?   'expression tag'      227 9  
2 6MOL LYS B 226 ? UNP P19235 ?   ?   'expression tag'      228 10 
2 6MOL ALA B 227 ? UNP P19235 ?   ?   'expression tag'      229 11 
2 6MOL ALA B 228 ? UNP P19235 ?   ?   'expression tag'      230 12 
2 6MOL ALA B 229 ? UNP P19235 ?   ?   'expression tag'      231 13 
3 6MOL PHE C 1   ? UNP P19235 ?   ?   'expression tag'      3   14 
3 6MOL ALA C 2   ? UNP P19235 ?   ?   'expression tag'      4   15 
3 6MOL GLY C 3   ? UNP P19235 ?   ?   'expression tag'      5   16 
3 6MOL SER C 4   ? UNP P19235 ?   ?   'expression tag'      6   17 
3 6MOL ALA C 5   ? UNP P19235 ?   ?   'expression tag'      7   18 
3 6MOL GLN C 50  ? UNP P19235 ASN 76  'engineered mutation' 52  19 
3 6MOL GLN C 162 ? UNP P19235 ASN 188 'engineered mutation' 164 20 
3 6MOL LYS C 224 ? UNP P19235 ?   ?   'expression tag'      226 21 
3 6MOL GLU C 225 ? UNP P19235 ?   ?   'expression tag'      227 22 
3 6MOL LYS C 226 ? UNP P19235 ?   ?   'expression tag'      228 23 
3 6MOL ALA C 227 ? UNP P19235 ?   ?   'expression tag'      229 24 
3 6MOL ALA C 228 ? UNP P19235 ?   ?   'expression tag'      230 25 
3 6MOL ALA C 229 ? UNP P19235 ?   ?   'expression tag'      231 26 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6MOL 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.24 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         61.99 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
;Seeded from 0.2 M NaCl, 0.1 M CAPS pH 10.5, 20% PEG 8000 into 0.2 M ammonium tartrate and 20% PEG 3350, with 10% glycerol, 10% ethylene glycol as cryoprotectant
;
_exptl_crystal_grow.pdbx_pH_range   7.3-10.5 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER X 16M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2018-07-01 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.033202 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 23-ID-B' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.033202 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   23-ID-B 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            109.2 
_reflns.entry_id                         6MOL 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.163 
_reflns.d_resolution_low                 44.969 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       14501 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             66.63 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  8.7 
_reflns.pdbx_Rmerge_I_obs                .198 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            6.22 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  .070 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     .995 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.163 
_reflns_shell.d_res_low                   3.4 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         .24 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           724 
_reflns_shell.percent_possible_all        17.3 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                2.046 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             6.8 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             .832 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                .491 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  
'Refined against elliptically truncated data 3.144 (0.894 a* - 0.447 b*) x 3.144 (b*) x 4.58 (c*)' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6MOL 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.163 
_refine.ls_d_res_low                             44.969 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     14484 
_refine.ls_number_reflns_R_free                  1370 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    66.72 
_refine.ls_percent_reflns_R_free                 9.46 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2232 
_refine.ls_R_factor_R_free                       0.2599 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2193 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      'predicted model, 1ERN' 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 32.40 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.43 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6511 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             2 
_refine_hist.number_atoms_total               6519 
_refine_hist.d_res_high                       3.163 
_refine_hist.d_res_low                        44.969 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.002  ? 6661 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.494  ? 9112 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 11.364 ? 3920 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.036  ? 1067 ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004  ? 1189 ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.1627 3.2757  . . 11  123  6.00   . . . 0.4329 . 0.4657 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2757 3.4068  . . 57  569  30.00  . . . 0.4264 . 0.3901 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4068 3.5618  . . 85  895  45.00  . . . 0.3830 . 0.3264 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5618 3.7495  . . 108 1059 55.00  . . . 0.3686 . 0.3083 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.7495 3.9843  . . 137 1293 67.00  . . . 0.3527 . 0.3119 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.9843 4.2917  . . 160 1515 77.00  . . . 0.3165 . 0.2726 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2917 4.7231  . . 181 1757 89.00  . . . 0.2424 . 0.2235 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.7231 5.4056  . . 206 1919 98.00  . . . 0.2573 . 0.2234 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.4056 6.8067  . . 218 1973 100.00 . . . 0.2687 . 0.2253 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.8067 44.9738 . . 207 2011 99.00  . . . 0.2008 . 0.1517 . . . . . . . . . . 
# 
_struct.entry_id                     6MOL 
_struct.title                        'Monoextended DARPin M_R12 complex with EpoR' 
_struct.pdbx_descriptor              'M_R12, Erythropoietin receptor' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6MOL 
_struct_keywords.text            'DARPin, complex, receptor, BIOSYNTHETIC PROTEIN' 
_struct_keywords.pdbx_keywords   'BIOSYNTHETIC PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 3 ? 
E N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 4   ? GLY A 16  ? ASP A 3   GLY A 15  1 ? 13 
HELX_P HELX_P2  AA2 GLN A 17  ? GLY A 28  ? GLN A 16  GLY A 27  1 ? 12 
HELX_P HELX_P3  AA3 THR A 40  ? GLY A 49  ? THR A 39  GLY A 48  1 ? 10 
HELX_P HELX_P4  AA4 HIS A 50  ? ASN A 60  ? HIS A 49  ASN A 59  1 ? 11 
HELX_P HELX_P5  AA5 THR A 73  ? GLY A 82  ? THR A 72  GLY A 81  1 ? 10 
HELX_P HELX_P6  AA6 HIS A 83  ? TYR A 93  ? HIS A 82  TYR A 92  1 ? 11 
HELX_P HELX_P7  AA7 THR A 106 ? GLY A 115 ? THR A 105 GLY A 114 1 ? 10 
HELX_P HELX_P8  AA8 HIS A 116 ? GLY A 127 ? HIS A 115 GLY A 126 1 ? 12 
HELX_P HELX_P9  AA9 THR A 139 ? GLY A 148 ? THR A 138 GLY A 147 1 ? 10 
HELX_P HELX_P10 AB1 HIS A 149 ? GLY A 160 ? HIS A 148 GLY A 159 1 ? 12 
HELX_P HELX_P11 AB2 THR A 172 ? GLY A 181 ? THR A 171 GLY A 180 1 ? 10 
HELX_P HELX_P12 AB3 HIS A 182 ? GLY A 193 ? HIS A 181 GLY A 192 1 ? 12 
HELX_P HELX_P13 AB4 THR A 205 ? GLY A 214 ? THR A 204 GLY A 213 1 ? 10 
HELX_P HELX_P14 AB5 HIS A 215 ? TYR A 225 ? HIS A 214 TYR A 224 1 ? 11 
HELX_P HELX_P15 AB6 THR A 238 ? GLY A 247 ? THR A 237 GLY A 246 1 ? 10 
HELX_P HELX_P16 AB7 HIS A 248 ? GLY A 259 ? HIS A 247 GLY A 258 1 ? 12 
HELX_P HELX_P17 AB8 THR A 271 ? GLY A 280 ? THR A 270 GLY A 279 1 ? 10 
HELX_P HELX_P18 AB9 HIS A 281 ? GLY A 292 ? HIS A 280 GLY A 291 1 ? 12 
HELX_P HELX_P19 AC1 THR A 300 ? GLY A 309 ? THR A 299 GLY A 308 1 ? 10 
HELX_P HELX_P20 AC2 HIS A 310 ? TYR A 320 ? HIS A 309 TYR A 319 1 ? 11 
HELX_P HELX_P21 AC3 THR A 333 ? GLY A 342 ? THR A 332 GLY A 341 1 ? 10 
HELX_P HELX_P22 AC4 HIS A 343 ? ASN A 353 ? HIS A 342 ASN A 352 1 ? 11 
HELX_P HELX_P23 AC5 THR A 366 ? GLY A 375 ? THR A 365 GLY A 374 1 ? 10 
HELX_P HELX_P24 AC6 HIS A 376 ? TYR A 386 ? HIS A 375 TYR A 385 1 ? 11 
HELX_P HELX_P25 AC7 THR A 399 ? GLY A 408 ? THR A 398 GLY A 407 1 ? 10 
HELX_P HELX_P26 AC8 HIS A 409 ? TYR A 419 ? HIS A 408 TYR A 418 1 ? 11 
HELX_P HELX_P27 AC9 THR A 432 ? GLY A 441 ? THR A 431 GLY A 440 1 ? 10 
HELX_P HELX_P28 AD1 ASN A 442 ? GLU A 455 ? ASN A 441 GLU A 454 1 ? 14 
HELX_P HELX_P29 AD2 PRO B 7   ? GLY B 20  ? PRO B 9   GLY B 22  1 ? 14 
HELX_P HELX_P30 AD3 ASN B 114 ? VAL B 116 ? ASN B 116 VAL B 118 5 ? 3  
HELX_P HELX_P31 AD4 MET B 148 ? SER B 150 ? MET B 150 SER B 152 5 ? 3  
HELX_P HELX_P32 AD5 PHE C 9   ? GLY C 20  ? PHE C 11  GLY C 22  1 ? 12 
HELX_P HELX_P33 AD6 ASN C 114 ? VAL C 116 ? ASN C 116 VAL C 118 5 ? 3  
HELX_P HELX_P34 AD7 MET C 148 ? SER C 150 ? MET C 150 SER C 152 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? B CYS 26 SG ? ? ? 1_555 B CYS 36 SG ? ? B CYS 28 B CYS 38 1_555 ? ? ? ? ? ? ? 2.034 ? 
disulf2 disulf ? ? B CYS 65 SG ? ? ? 1_555 B CYS 81 SG ? ? B CYS 67 B CYS 83 1_555 ? ? ? ? ? ? ? 2.039 ? 
disulf3 disulf ? ? C CYS 26 SG ? ? ? 1_555 C CYS 36 SG ? ? C CYS 28 C CYS 38 1_555 ? ? ? ? ? ? ? 2.036 ? 
disulf4 disulf ? ? C CYS 65 SG ? ? ? 1_555 C CYS 81 SG ? ? C CYS 67 C CYS 83 1_555 ? ? ? ? ? ? ? 2.034 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLU 200 B . ? GLU 202 B PRO 201 B ? PRO 203 B 1 1.13 
2 GLU 200 C . ? GLU 202 C PRO 201 C ? PRO 203 C 1 0.54 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 3 ? 
AA4 ? 4 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
AA7 ? 3 ? 
AA8 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU B 25  ? PHE B 27  ? LEU B 27  PHE B 29  
AA1 2 VAL B 35  ? ALA B 41  ? VAL B 37  ALA B 43  
AA1 3 ALA B 76  ? SER B 82  ? ALA B 78  SER B 84  
AA1 4 HIS B 68  ? THR B 72  ? HIS B 70  THR B 74  
AA2 1 LYS B 63  ? CYS B 65  ? LYS B 65  CYS B 67  
AA2 2 TYR B 51  ? GLN B 56  ? TYR B 53  GLN B 58  
AA2 3 PRO B 93  ? ALA B 100 ? PRO B 95  ALA B 102 
AA2 4 PRO B 105 ? HIS B 112 ? PRO B 107 HIS B 114 
AA3 1 VAL B 123 ? LEU B 129 ? VAL B 125 LEU B 131 
AA3 2 VAL B 136 ? LEU B 141 ? VAL B 138 LEU B 143 
AA3 3 GLU B 178 ? LEU B 181 ? GLU B 180 LEU B 183 
AA4 1 GLN B 168 ? ILE B 172 ? GLN B 170 ILE B 174 
AA4 2 ILE B 152 ? ALA B 160 ? ILE B 154 ALA B 162 
AA4 3 ARG B 189 ? MET B 198 ? ARG B 191 MET B 200 
AA4 4 VAL B 214 ? LEU B 217 ? VAL B 216 LEU B 219 
AA5 1 LEU C 25  ? PHE C 27  ? LEU C 27  PHE C 29  
AA5 2 VAL C 35  ? GLU C 40  ? VAL C 37  GLU C 42  
AA5 3 ALA C 76  ? SER C 82  ? ALA C 78  SER C 84  
AA5 4 HIS C 68  ? THR C 72  ? HIS C 70  THR C 74  
AA6 1 LYS C 63  ? CYS C 65  ? LYS C 65  CYS C 67  
AA6 2 TYR C 51  ? GLN C 56  ? TYR C 53  GLN C 58  
AA6 3 PRO C 93  ? ALA C 100 ? PRO C 95  ALA C 102 
AA6 4 PRO C 105 ? HIS C 112 ? PRO C 107 HIS C 114 
AA7 1 VAL C 123 ? LEU C 129 ? VAL C 125 LEU C 131 
AA7 2 VAL C 136 ? LEU C 141 ? VAL C 138 LEU C 143 
AA7 3 GLU C 178 ? VAL C 180 ? GLU C 180 VAL C 182 
AA8 1 GLN C 168 ? ILE C 172 ? GLN C 170 ILE C 174 
AA8 2 ILE C 152 ? ALA C 160 ? ILE C 154 ALA C 162 
AA8 3 ARG C 189 ? MET C 198 ? ARG C 191 MET C 200 
AA8 4 VAL C 214 ? LEU C 217 ? VAL C 216 LEU C 219 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU B 25  ? N LEU B 27  O PHE B 37  ? O PHE B 39  
AA1 2 3 N GLU B 40  ? N GLU B 42  O VAL B 77  ? O VAL B 79  
AA1 3 4 O ARG B 78  ? O ARG B 80  N ALA B 70  ? N ALA B 72  
AA2 1 2 O LYS B 63  ? O LYS B 65  N TYR B 55  ? N TYR B 57  
AA2 2 3 N SER B 52  ? N SER B 54  O THR B 99  ? O THR B 101 
AA2 3 4 N LEU B 96  ? N LEU B 98  O ARG B 109 ? O ARG B 111 
AA3 1 2 N ARG B 128 ? N ARG B 130 O VAL B 137 ? O VAL B 139 
AA3 2 3 N VAL B 136 ? N VAL B 138 O LEU B 181 ? O LEU B 183 
AA4 1 2 O GLN B 168 ? O GLN B 170 N VAL B 158 ? N VAL B 160 
AA4 2 3 N ARG B 153 ? N ARG B 155 O ARG B 197 ? O ARG B 199 
AA4 3 4 N PHE B 192 ? N PHE B 194 O VAL B 214 ? O VAL B 216 
AA5 1 2 N LEU C 25  ? N LEU C 27  O PHE C 37  ? O PHE C 39  
AA5 2 3 N CYS C 36  ? N CYS C 38  O CYS C 81  ? O CYS C 83  
AA5 3 4 O ARG C 78  ? O ARG C 80  N ALA C 70  ? N ALA C 72  
AA6 1 2 O LYS C 63  ? O LYS C 65  N TYR C 55  ? N TYR C 57  
AA6 2 3 N SER C 52  ? N SER C 54  O THR C 99  ? O THR C 101 
AA6 3 4 N LEU C 96  ? N LEU C 98  O ARG C 109 ? O ARG C 111 
AA7 1 2 N ARG C 128 ? N ARG C 130 O VAL C 137 ? O VAL C 139 
AA7 2 3 N LEU C 138 ? N LEU C 140 O CYS C 179 ? O CYS C 181 
AA8 1 2 O GLN C 168 ? O GLN C 170 N VAL C 158 ? N VAL C 160 
AA8 2 3 N ARG C 153 ? N ARG C 155 O ARG C 197 ? O ARG C 199 
AA8 3 4 N TYR C 190 ? N TYR C 192 O LEU C 216 ? O LEU C 218 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    GOL 
_struct_site.pdbx_auth_seq_id     501 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    5 
_struct_site.details              'binding site for residue GOL A 501' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 5 THR A 300 ? THR A 299 . ? 1_555 ? 
2 AC1 5 LYS A 304 ? LYS A 303 . ? 1_555 ? 
3 AC1 5 ASP A 328 ? ASP A 327 . ? 1_555 ? 
4 AC1 5 TRP B 62  ? TRP B 64  . ? 1_555 ? 
5 AC1 5 GLU B 95  ? GLU B 97  . ? 1_555 ? 
# 
_atom_sites.entry_id                    6MOL 
_atom_sites.fract_transf_matrix[1][1]   0.005949 
_atom_sites.fract_transf_matrix[1][2]   0.003434 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006869 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012816 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ASP A 1 4   ? -15.224 21.913 16.683  1.00 142.99 ? 3   ASP A N   1 
ATOM   2    C CA  . ASP A 1 4   ? -15.950 23.169 16.834  1.00 143.55 ? 3   ASP A CA  1 
ATOM   3    C C   . ASP A 1 4   ? -15.745 23.760 18.226  1.00 145.76 ? 3   ASP A C   1 
ATOM   4    O O   . ASP A 1 4   ? -15.356 24.919 18.367  1.00 145.42 ? 3   ASP A O   1 
ATOM   5    C CB  . ASP A 1 4   ? -17.442 22.962 16.565  1.00 147.05 ? 3   ASP A CB  1 
ATOM   6    C CG  . ASP A 1 4   ? -17.726 22.556 15.131  1.00 149.67 ? 3   ASP A CG  1 
ATOM   7    O OD1 . ASP A 1 4   ? -17.129 23.156 14.212  1.00 147.03 ? 3   ASP A OD1 1 
ATOM   8    O OD2 . ASP A 1 4   ? -18.543 21.633 14.924  1.00 154.11 ? 3   ASP A OD2 1 
ATOM   9    N N   . LEU A 1 5   ? -16.014 22.954 19.256  1.00 138.32 ? 4   LEU A N   1 
ATOM   10   C CA  . LEU A 1 5   ? -15.837 23.415 20.628  1.00 139.56 ? 4   LEU A CA  1 
ATOM   11   C C   . LEU A 1 5   ? -14.369 23.435 21.037  1.00 139.02 ? 4   LEU A C   1 
ATOM   12   O O   . LEU A 1 5   ? -13.974 24.260 21.869  1.00 139.40 ? 4   LEU A O   1 
ATOM   13   C CB  . LEU A 1 5   ? -16.642 22.539 21.593  1.00 142.89 ? 4   LEU A CB  1 
ATOM   14   C CG  . LEU A 1 5   ? -18.174 22.576 21.503  1.00 147.70 ? 4   LEU A CG  1 
ATOM   15   C CD1 . LEU A 1 5   ? -18.709 21.625 20.435  1.00 148.78 ? 4   LEU A CD1 1 
ATOM   16   C CD2 . LEU A 1 5   ? -18.809 22.274 22.855  1.00 152.28 ? 4   LEU A CD2 1 
ATOM   17   N N   . GLY A 1 6   ? -13.551 22.547 20.467  1.00 139.77 ? 5   GLY A N   1 
ATOM   18   C CA  . GLY A 1 6   ? -12.135 22.544 20.797  1.00 136.99 ? 5   GLY A CA  1 
ATOM   19   C C   . GLY A 1 6   ? -11.407 23.764 20.267  1.00 132.88 ? 5   GLY A C   1 
ATOM   20   O O   . GLY A 1 6   ? -10.571 24.349 20.960  1.00 130.81 ? 5   GLY A O   1 
ATOM   21   N N   . LYS A 1 7   ? -11.712 24.165 19.030  1.00 131.78 ? 6   LYS A N   1 
ATOM   22   C CA  . LYS A 1 7   ? -11.117 25.372 18.468  1.00 130.34 ? 6   LYS A CA  1 
ATOM   23   C C   . LYS A 1 7   ? -11.583 26.630 19.188  1.00 133.01 ? 6   LYS A C   1 
ATOM   24   O O   . LYS A 1 7   ? -10.881 27.646 19.152  1.00 131.95 ? 6   LYS A O   1 
ATOM   25   C CB  . LYS A 1 7   ? -11.442 25.476 16.977  1.00 130.31 ? 6   LYS A CB  1 
ATOM   26   N N   . LYS A 1 8   ? -12.750 26.585 19.834  1.00 131.44 ? 7   LYS A N   1 
ATOM   27   C CA  . LYS A 1 8   ? -13.220 27.727 20.608  1.00 133.06 ? 7   LYS A CA  1 
ATOM   28   C C   . LYS A 1 8   ? -12.463 27.877 21.920  1.00 134.54 ? 7   LYS A C   1 
ATOM   29   O O   . LYS A 1 8   ? -12.430 28.978 22.481  1.00 135.25 ? 7   LYS A O   1 
ATOM   30   C CB  . LYS A 1 8   ? -14.721 27.590 20.877  1.00 136.22 ? 7   LYS A CB  1 
ATOM   31   C CG  . LYS A 1 8   ? -15.434 28.901 21.176  1.00 142.05 ? 7   LYS A CG  1 
ATOM   32   C CD  . LYS A 1 8   ? -16.512 29.183 20.139  1.00 145.56 ? 7   LYS A CD  1 
ATOM   33   C CE  . LYS A 1 8   ? -17.259 30.473 20.441  1.00 150.31 ? 7   LYS A CE  1 
ATOM   34   N NZ  . LYS A 1 8   ? -18.327 30.743 19.437  1.00 153.67 ? 7   LYS A NZ  1 
ATOM   35   N N   . LEU A 1 9   ? -11.849 26.799 22.415  1.00 130.14 ? 8   LEU A N   1 
ATOM   36   C CA  . LEU A 1 9   ? -11.096 26.865 23.663  1.00 130.53 ? 8   LEU A CA  1 
ATOM   37   C C   . LEU A 1 9   ? -9.702  27.442 23.442  1.00 129.38 ? 8   LEU A C   1 
ATOM   38   O O   . LEU A 1 9   ? -9.260  28.318 24.194  1.00 129.79 ? 8   LEU A O   1 
ATOM   39   C CB  . LEU A 1 9   ? -11.004 25.476 24.297  1.00 131.17 ? 8   LEU A CB  1 
ATOM   40   C CG  . LEU A 1 9   ? -10.251 25.401 25.627  1.00 133.49 ? 8   LEU A CG  1 
ATOM   41   C CD1 . LEU A 1 9   ? -11.018 26.129 26.721  1.00 136.16 ? 8   LEU A CD1 1 
ATOM   42   C CD2 . LEU A 1 9   ? -9.986  23.957 26.021  1.00 134.54 ? 8   LEU A CD2 1 
ATOM   43   N N   . LEU A 1 10  ? -8.993  26.958 22.418  1.00 129.65 ? 9   LEU A N   1 
ATOM   44   C CA  . LEU A 1 10  ? -7.655  27.473 22.143  1.00 127.10 ? 9   LEU A CA  1 
ATOM   45   C C   . LEU A 1 10  ? -7.694  28.932 21.707  1.00 127.83 ? 9   LEU A C   1 
ATOM   46   O O   . LEU A 1 10  ? -6.749  29.682 21.977  1.00 126.61 ? 9   LEU A O   1 
ATOM   47   C CB  . LEU A 1 10  ? -6.961  26.608 21.087  1.00 124.53 ? 9   LEU A CB  1 
ATOM   48   C CG  . LEU A 1 10  ? -7.664  26.317 19.756  1.00 125.52 ? 9   LEU A CG  1 
ATOM   49   C CD1 . LEU A 1 10  ? -7.402  27.406 18.720  1.00 124.21 ? 9   LEU A CD1 1 
ATOM   50   C CD2 . LEU A 1 10  ? -7.240  24.956 19.223  1.00 124.93 ? 9   LEU A CD2 1 
ATOM   51   N N   . LYS A 1 11  ? -8.770  29.354 21.038  1.00 119.93 ? 10  LYS A N   1 
ATOM   52   C CA  . LYS A 1 11  ? -8.909  30.763 20.690  1.00 119.64 ? 10  LYS A CA  1 
ATOM   53   C C   . LYS A 1 11  ? -9.153  31.616 21.927  1.00 122.51 ? 10  LYS A C   1 
ATOM   54   O O   . LYS A 1 11  ? -8.692  32.761 21.992  1.00 122.07 ? 10  LYS A O   1 
ATOM   55   C CB  . LYS A 1 11  ? -10.043 30.948 19.681  1.00 121.17 ? 10  LYS A CB  1 
ATOM   56   N N   . ALA A 1 12  ? -9.865  31.073 22.917  1.00 120.17 ? 11  ALA A N   1 
ATOM   57   C CA  . ALA A 1 12  ? -10.090 31.794 24.164  1.00 122.13 ? 11  ALA A CA  1 
ATOM   58   C C   . ALA A 1 12  ? -8.864  31.745 25.068  1.00 122.62 ? 11  ALA A C   1 
ATOM   59   O O   . ALA A 1 12  ? -8.547  32.734 25.738  1.00 123.08 ? 11  ALA A O   1 
ATOM   60   C CB  . ALA A 1 12  ? -11.309 31.223 24.889  1.00 124.90 ? 11  ALA A CB  1 
ATOM   61   N N   . ALA A 1 13  ? -8.166  30.607 25.103  1.00 118.10 ? 12  ALA A N   1 
ATOM   62   C CA  . ALA A 1 13  ? -6.951  30.518 25.905  1.00 116.83 ? 12  ALA A CA  1 
ATOM   63   C C   . ALA A 1 13  ? -5.869  31.453 25.381  1.00 113.11 ? 12  ALA A C   1 
ATOM   64   O O   . ALA A 1 13  ? -5.036  31.935 26.156  1.00 111.99 ? 12  ALA A O   1 
ATOM   65   C CB  . ALA A 1 13  ? -6.442  29.078 25.938  1.00 117.71 ? 12  ALA A CB  1 
ATOM   66   N N   . ARG A 1 14  ? -5.865  31.721 24.073  1.00 110.99 ? 13  ARG A N   1 
ATOM   67   C CA  . ARG A 1 14  ? -4.898  32.663 23.521  1.00 108.78 ? 13  ARG A CA  1 
ATOM   68   C C   . ARG A 1 14  ? -5.255  34.099 23.881  1.00 112.04 ? 13  ARG A C   1 
ATOM   69   O O   . ARG A 1 14  ? -4.359  34.923 24.094  1.00 110.96 ? 13  ARG A O   1 
ATOM   70   C CB  . ARG A 1 14  ? -4.809  32.495 22.004  1.00 106.20 ? 13  ARG A CB  1 
ATOM   71   C CG  . ARG A 1 14  ? -3.694  33.296 21.351  1.00 105.47 ? 13  ARG A CG  1 
ATOM   72   C CD  . ARG A 1 14  ? -3.608  33.002 19.863  1.00 105.04 ? 13  ARG A CD  1 
ATOM   73   N NE  . ARG A 1 14  ? -4.845  33.347 19.169  1.00 108.48 ? 13  ARG A NE  1 
ATOM   74   C CZ  . ARG A 1 14  ? -5.097  33.048 17.899  1.00 111.61 ? 13  ARG A CZ  1 
ATOM   75   N NH1 . ARG A 1 14  ? -4.197  32.391 17.181  1.00 104.51 ? 13  ARG A NH1 1 
ATOM   76   N NH2 . ARG A 1 14  ? -6.250  33.401 17.348  1.00 109.59 ? 13  ARG A NH2 1 
ATOM   77   N N   . ALA A 1 15  ? -6.549  34.413 23.960  1.00 117.32 ? 14  ALA A N   1 
ATOM   78   C CA  . ALA A 1 15  ? -6.997  35.738 24.371  1.00 118.98 ? 14  ALA A CA  1 
ATOM   79   C C   . ALA A 1 15  ? -7.024  35.911 25.885  1.00 122.38 ? 14  ALA A C   1 
ATOM   80   O O   . ALA A 1 15  ? -7.162  37.045 26.359  1.00 123.08 ? 14  ALA A O   1 
ATOM   81   C CB  . ALA A 1 15  ? -8.385  36.029 23.795  1.00 120.50 ? 14  ALA A CB  1 
ATOM   82   N N   . GLY A 1 16  ? -6.909  34.827 26.647  1.00 122.85 ? 15  GLY A N   1 
ATOM   83   C CA  . GLY A 1 16  ? -6.765  34.931 28.087  1.00 124.53 ? 15  GLY A CA  1 
ATOM   84   C C   . GLY A 1 16  ? -8.009  35.346 28.840  1.00 128.32 ? 15  GLY A C   1 
ATOM   85   O O   . GLY A 1 16  ? -7.903  36.031 29.862  1.00 129.30 ? 15  GLY A O   1 
ATOM   86   N N   . GLN A 1 17  ? -9.191  34.949 28.368  1.00 127.58 ? 16  GLN A N   1 
ATOM   87   C CA  . GLN A 1 17  ? -10.440 35.207 29.086  1.00 129.99 ? 16  GLN A CA  1 
ATOM   88   C C   . GLN A 1 17  ? -10.636 34.081 30.093  1.00 133.15 ? 16  GLN A C   1 
ATOM   89   O O   . GLN A 1 17  ? -11.217 33.038 29.787  1.00 133.41 ? 16  GLN A O   1 
ATOM   90   C CB  . GLN A 1 17  ? -11.615 35.312 28.123  1.00 130.58 ? 16  GLN A CB  1 
ATOM   91   C CG  . GLN A 1 17  ? -11.449 36.345 27.022  1.00 133.79 ? 16  GLN A CG  1 
ATOM   92   C CD  . GLN A 1 17  ? -11.469 35.720 25.642  1.00 139.89 ? 16  GLN A CD  1 
ATOM   93   O OE1 . GLN A 1 17  ? -10.869 34.670 25.418  1.00 138.83 ? 16  GLN A OE1 1 
ATOM   94   N NE2 . GLN A 1 17  ? -12.169 36.357 24.710  1.00 136.88 ? 16  GLN A NE2 1 
ATOM   95   N N   . ASP A 1 18  ? -10.144 34.301 31.316  1.00 137.86 ? 17  ASP A N   1 
ATOM   96   C CA  . ASP A 1 18  ? -10.175 33.264 32.344  1.00 139.70 ? 17  ASP A CA  1 
ATOM   97   C C   . ASP A 1 18  ? -11.601 32.820 32.650  1.00 143.38 ? 17  ASP A C   1 
ATOM   98   O O   . ASP A 1 18  ? -11.883 31.619 32.740  1.00 144.10 ? 17  ASP A O   1 
ATOM   99   C CB  . ASP A 1 18  ? -9.479  33.771 33.610  1.00 141.15 ? 17  ASP A CB  1 
ATOM   100  C CG  . ASP A 1 18  ? -9.938  33.049 34.865  1.00 147.21 ? 17  ASP A CG  1 
ATOM   101  O OD1 . ASP A 1 18  ? -9.801  31.809 34.930  1.00 148.31 ? 17  ASP A OD1 1 
ATOM   102  O OD2 . ASP A 1 18  ? -10.426 33.727 35.794  1.00 150.54 ? 17  ASP A OD2 1 
ATOM   103  N N   . ASP A 1 19  ? -12.518 33.777 32.814  1.00 145.35 ? 18  ASP A N   1 
ATOM   104  C CA  . ASP A 1 19  ? -13.899 33.421 33.125  1.00 147.60 ? 18  ASP A CA  1 
ATOM   105  C C   . ASP A 1 19  ? -14.572 32.726 31.946  1.00 148.20 ? 18  ASP A C   1 
ATOM   106  O O   . ASP A 1 19  ? -15.386 31.815 32.138  1.00 149.61 ? 18  ASP A O   1 
ATOM   107  C CB  . ASP A 1 19  ? -14.683 34.666 33.541  1.00 149.30 ? 18  ASP A CB  1 
ATOM   108  C CG  . ASP A 1 19  ? -14.374 35.102 34.962  1.00 154.22 ? 18  ASP A CG  1 
ATOM   109  O OD1 . ASP A 1 19  ? -13.541 34.445 35.621  1.00 154.35 ? 18  ASP A OD1 1 
ATOM   110  O OD2 . ASP A 1 19  ? -14.968 36.101 35.421  1.00 157.54 ? 18  ASP A OD2 1 
ATOM   111  N N   . GLU A 1 20  ? -14.240 33.137 30.720  1.00 146.68 ? 19  GLU A N   1 
ATOM   112  C CA  . GLU A 1 20  ? -14.808 32.493 29.540  1.00 145.81 ? 19  GLU A CA  1 
ATOM   113  C C   . GLU A 1 20  ? -14.269 31.077 29.364  1.00 146.31 ? 19  GLU A C   1 
ATOM   114  O O   . GLU A 1 20  ? -15.021 30.162 29.005  1.00 146.67 ? 19  GLU A O   1 
ATOM   115  C CB  . GLU A 1 20  ? -14.523 33.341 28.299  1.00 144.16 ? 19  GLU A CB  1 
ATOM   116  C CG  . GLU A 1 20  ? -14.338 32.551 27.011  1.00 145.18 ? 19  GLU A CG  1 
ATOM   117  C CD  . GLU A 1 20  ? -15.646 32.051 26.433  1.00 152.56 ? 19  GLU A CD  1 
ATOM   118  O OE1 . GLU A 1 20  ? -16.484 32.890 26.043  1.00 151.80 ? 19  GLU A OE1 1 
ATOM   119  O OE2 . GLU A 1 20  ? -15.838 30.819 26.374  1.00 150.46 ? 19  GLU A OE2 1 
ATOM   120  N N   . VAL A 1 21  ? -12.975 30.874 29.622  1.00 143.43 ? 20  VAL A N   1 
ATOM   121  C CA  . VAL A 1 21  ? -12.364 29.563 29.409  1.00 142.39 ? 20  VAL A CA  1 
ATOM   122  C C   . VAL A 1 21  ? -12.985 28.525 30.338  1.00 146.19 ? 20  VAL A C   1 
ATOM   123  O O   . VAL A 1 21  ? -13.321 27.412 29.916  1.00 145.93 ? 20  VAL A O   1 
ATOM   124  C CB  . VAL A 1 21  ? -10.837 29.646 29.592  1.00 141.99 ? 20  VAL A CB  1 
ATOM   125  C CG1 . VAL A 1 21  ? -10.244 28.257 29.774  1.00 141.60 ? 20  VAL A CG1 1 
ATOM   126  C CG2 . VAL A 1 21  ? -10.197 30.338 28.397  1.00 139.30 ? 20  VAL A CG2 1 
ATOM   127  N N   . ARG A 1 22  ? -13.156 28.880 31.615  1.00 143.55 ? 21  ARG A N   1 
ATOM   128  C CA  . ARG A 1 22  ? -13.737 27.956 32.585  1.00 146.17 ? 21  ARG A CA  1 
ATOM   129  C C   . ARG A 1 22  ? -15.137 27.503 32.192  1.00 148.72 ? 21  ARG A C   1 
ATOM   130  O O   . ARG A 1 22  ? -15.567 26.422 32.611  1.00 150.12 ? 21  ARG A O   1 
ATOM   131  C CB  . ARG A 1 22  ? -13.767 28.601 33.974  1.00 148.63 ? 21  ARG A CB  1 
ATOM   132  C CG  . ARG A 1 22  ? -12.396 28.766 34.614  1.00 150.88 ? 21  ARG A CG  1 
ATOM   133  C CD  . ARG A 1 22  ? -12.494 29.456 35.967  1.00 156.20 ? 21  ARG A CD  1 
ATOM   134  N NE  . ARG A 1 22  ? -11.200 29.523 36.642  1.00 158.31 ? 21  ARG A NE  1 
ATOM   135  C CZ  . ARG A 1 22  ? -10.990 30.154 37.793  1.00 164.49 ? 21  ARG A CZ  1 
ATOM   136  N NH1 . ARG A 1 22  ? -11.990 30.779 38.400  1.00 162.79 ? 21  ARG A NH1 1 
ATOM   137  N NH2 . ARG A 1 22  ? -9.780  30.163 38.335  1.00 159.69 ? 21  ARG A NH2 1 
ATOM   138  N N   . ILE A 1 23  ? -15.853 28.301 31.397  1.00 149.60 ? 22  ILE A N   1 
ATOM   139  C CA  . ILE A 1 23  ? -17.168 27.887 30.919  1.00 150.63 ? 22  ILE A CA  1 
ATOM   140  C C   . ILE A 1 23  ? -17.030 26.834 29.825  1.00 150.03 ? 22  ILE A C   1 
ATOM   141  O O   . ILE A 1 23  ? -17.804 25.871 29.770  1.00 150.99 ? 22  ILE A O   1 
ATOM   142  C CB  . ILE A 1 23  ? -17.966 29.112 30.437  1.00 151.72 ? 22  ILE A CB  1 
ATOM   143  C CG1 . ILE A 1 23  ? -18.136 30.118 31.577  1.00 153.49 ? 22  ILE A CG1 1 
ATOM   144  C CG2 . ILE A 1 23  ? -19.322 28.691 29.885  1.00 153.04 ? 22  ILE A CG2 1 
ATOM   145  C CD1 . ILE A 1 23  ? -18.842 31.392 31.170  1.00 156.17 ? 22  ILE A CD1 1 
ATOM   146  N N   . LEU A 1 24  ? -16.039 26.994 28.944  1.00 148.73 ? 23  LEU A N   1 
ATOM   147  C CA  . LEU A 1 24  ? -15.839 26.026 27.870  1.00 146.75 ? 23  LEU A CA  1 
ATOM   148  C C   . LEU A 1 24  ? -15.343 24.690 28.410  1.00 148.37 ? 23  LEU A C   1 
ATOM   149  O O   . LEU A 1 24  ? -15.739 23.630 27.912  1.00 148.07 ? 23  LEU A O   1 
ATOM   150  C CB  . LEU A 1 24  ? -14.858 26.582 26.837  1.00 143.77 ? 23  LEU A CB  1 
ATOM   151  C CG  . LEU A 1 24  ? -15.402 27.599 25.834  1.00 144.59 ? 23  LEU A CG  1 
ATOM   152  C CD1 . LEU A 1 24  ? -14.263 28.278 25.091  1.00 142.53 ? 23  LEU A CD1 1 
ATOM   153  C CD2 . LEU A 1 24  ? -16.349 26.925 24.854  1.00 145.50 ? 23  LEU A CD2 1 
ATOM   154  N N   . MET A 1 25  ? -14.478 24.720 29.427  1.00 148.66 ? 24  MET A N   1 
ATOM   155  C CA  . MET A 1 25  ? -13.924 23.482 29.965  1.00 149.08 ? 24  MET A CA  1 
ATOM   156  C C   . MET A 1 25  ? -14.989 22.633 30.648  1.00 153.83 ? 24  MET A C   1 
ATOM   157  O O   . MET A 1 25  ? -14.834 21.410 30.745  1.00 155.54 ? 24  MET A O   1 
ATOM   158  C CB  . MET A 1 25  ? -12.788 23.796 30.941  1.00 150.01 ? 24  MET A CB  1 
ATOM   159  N N   . ALA A 1 26  ? -16.071 23.252 31.120  1.00 147.40 ? 25  ALA A N   1 
ATOM   160  C CA  . ALA A 1 26  ? -17.142 22.516 31.779  1.00 152.21 ? 25  ALA A CA  1 
ATOM   161  C C   . ALA A 1 26  ? -18.270 22.133 30.831  1.00 154.53 ? 25  ALA A C   1 
ATOM   162  O O   . ALA A 1 26  ? -18.978 21.153 31.091  1.00 158.10 ? 25  ALA A O   1 
ATOM   163  C CB  . ALA A 1 26  ? -17.709 23.335 32.942  1.00 154.84 ? 25  ALA A CB  1 
ATOM   164  N N   . ASN A 1 27  ? -18.457 22.880 29.740  1.00 153.51 ? 26  ASN A N   1 
ATOM   165  C CA  . ASN A 1 27  ? -19.509 22.540 28.785  1.00 154.55 ? 26  ASN A CA  1 
ATOM   166  C C   . ASN A 1 27  ? -19.164 21.277 28.007  1.00 155.44 ? 26  ASN A C   1 
ATOM   167  O O   . ASN A 1 27  ? -20.054 20.488 27.668  1.00 157.98 ? 26  ASN A O   1 
ATOM   168  C CB  . ASN A 1 27  ? -19.754 23.706 27.828  1.00 151.92 ? 26  ASN A CB  1 
ATOM   169  C CG  . ASN A 1 27  ? -20.631 24.784 28.432  1.00 160.45 ? 26  ASN A CG  1 
ATOM   170  O OD1 . ASN A 1 27  ? -20.828 24.835 29.646  1.00 161.27 ? 26  ASN A OD1 1 
ATOM   171  N ND2 . ASN A 1 27  ? -21.166 25.655 27.583  1.00 156.21 ? 26  ASN A ND2 1 
ATOM   172  N N   . GLY A 1 28  ? -17.884 21.070 27.707  1.00 151.32 ? 27  GLY A N   1 
ATOM   173  C CA  . GLY A 1 28  ? -17.466 19.876 27.002  1.00 150.90 ? 27  GLY A CA  1 
ATOM   174  C C   . GLY A 1 28  ? -16.445 20.124 25.912  1.00 147.45 ? 27  GLY A C   1 
ATOM   175  O O   . GLY A 1 28  ? -16.460 19.450 24.878  1.00 146.64 ? 27  GLY A O   1 
ATOM   176  N N   . ALA A 1 29  ? -15.553 21.086 26.126  1.00 145.26 ? 28  ALA A N   1 
ATOM   177  C CA  . ALA A 1 29  ? -14.488 21.369 25.176  1.00 140.92 ? 28  ALA A CA  1 
ATOM   178  C C   . ALA A 1 29  ? -13.267 20.517 25.492  1.00 140.30 ? 28  ALA A C   1 
ATOM   179  O O   . ALA A 1 29  ? -12.926 20.306 26.660  1.00 141.70 ? 28  ALA A O   1 
ATOM   180  C CB  . ALA A 1 29  ? -14.116 22.852 25.203  1.00 137.32 ? 28  ALA A CB  1 
ATOM   181  N N   . ASP A 1 30  ? -12.614 20.026 24.440  1.00 141.32 ? 29  ASP A N   1 
ATOM   182  C CA  . ASP A 1 30  ? -11.442 19.173 24.606  1.00 140.42 ? 29  ASP A CA  1 
ATOM   183  C C   . ASP A 1 30  ? -10.270 19.996 25.133  1.00 138.81 ? 29  ASP A C   1 
ATOM   184  O O   . ASP A 1 30  ? -9.908  21.021 24.548  1.00 136.81 ? 29  ASP A O   1 
ATOM   185  C CB  . ASP A 1 30  ? -11.084 18.507 23.281  1.00 139.07 ? 29  ASP A CB  1 
ATOM   186  C CG  . ASP A 1 30  ? -9.920  17.547 23.409  1.00 141.39 ? 29  ASP A CG  1 
ATOM   187  O OD1 . ASP A 1 30  ? -9.977  16.655 24.283  1.00 144.80 ? 29  ASP A OD1 1 
ATOM   188  O OD2 . ASP A 1 30  ? -8.955  17.676 22.629  1.00 139.56 ? 29  ASP A OD2 1 
ATOM   189  N N   . VAL A 1 31  ? -9.673  19.544 26.239  1.00 137.35 ? 30  VAL A N   1 
ATOM   190  C CA  . VAL A 1 31  ? -8.632  20.324 26.899  1.00 136.21 ? 30  VAL A CA  1 
ATOM   191  C C   . VAL A 1 31  ? -7.353  20.315 26.077  1.00 134.10 ? 30  VAL A C   1 
ATOM   192  O O   . VAL A 1 31  ? -6.548  21.256 26.146  1.00 132.77 ? 30  VAL A O   1 
ATOM   193  C CB  . VAL A 1 31  ? -8.391  19.785 28.322  1.00 139.86 ? 30  VAL A CB  1 
ATOM   194  C CG1 . VAL A 1 31  ? -7.514  20.750 29.115  1.00 139.87 ? 30  VAL A CG1 1 
ATOM   195  C CG2 . VAL A 1 31  ? -9.719  19.555 29.033  1.00 143.94 ? 30  VAL A CG2 1 
ATOM   196  N N   . ASN A 1 32  ? -7.144  19.267 25.290  1.00 133.98 ? 31  ASN A N   1 
ATOM   197  C CA  . ASN A 1 32  ? -5.922  19.076 24.513  1.00 130.94 ? 31  ASN A CA  1 
ATOM   198  C C   . ASN A 1 32  ? -6.287  19.025 23.028  1.00 130.23 ? 31  ASN A C   1 
ATOM   199  O O   . ASN A 1 32  ? -6.091  18.004 22.357  1.00 129.36 ? 31  ASN A O   1 
ATOM   200  C CB  . ASN A 1 32  ? -5.190  17.787 24.970  1.00 131.64 ? 31  ASN A CB  1 
ATOM   201  C CG  . ASN A 1 32  ? -4.781  17.834 26.434  1.00 140.52 ? 31  ASN A CG  1 
ATOM   202  O OD1 . ASN A 1 32  ? -4.407  18.888 26.951  1.00 139.05 ? 31  ASN A OD1 1 
ATOM   203  N ND2 . ASN A 1 32  ? -4.855  16.696 27.106  1.00 141.16 ? 31  ASN A ND2 1 
ATOM   204  N N   . ALA A 1 33  ? -6.851  20.122 22.524  1.00 132.52 ? 32  ALA A N   1 
ATOM   205  C CA  . ALA A 1 33  ? -7.224  20.218 21.119  1.00 131.00 ? 32  ALA A CA  1 
ATOM   206  C C   . ALA A 1 33  ? -6.014  20.583 20.268  1.00 129.24 ? 32  ALA A C   1 
ATOM   207  O O   . ALA A 1 33  ? -5.166  21.381 20.679  1.00 128.27 ? 32  ALA A O   1 
ATOM   208  C CB  . ALA A 1 33  ? -8.334  21.255 20.927  1.00 132.45 ? 32  ALA A CB  1 
ATOM   209  N N   . THR A 1 34  ? -5.944  19.999 19.072  1.00 132.99 ? 33  THR A N   1 
ATOM   210  C CA  . THR A 1 34  ? -4.810  20.195 18.178  1.00 130.26 ? 33  THR A CA  1 
ATOM   211  C C   . THR A 1 34  ? -4.996  21.465 17.354  1.00 130.61 ? 33  THR A C   1 
ATOM   212  O O   . THR A 1 34  ? -6.043  21.661 16.728  1.00 131.48 ? 33  THR A O   1 
ATOM   213  C CB  . THR A 1 34  ? -4.641  18.998 17.241  1.00 131.99 ? 33  THR A CB  1 
ATOM   214  O OG1 . THR A 1 34  ? -5.668  19.027 16.240  1.00 132.55 ? 33  THR A OG1 1 
ATOM   215  C CG2 . THR A 1 34  ? -4.735  17.689 18.016  1.00 132.77 ? 33  THR A CG2 1 
ATOM   216  N N   . ASP A 1 35  ? -3.978  22.322 17.360  1.00 126.57 ? 34  ASP A N   1 
ATOM   217  C CA  . ASP A 1 35  ? -3.952  23.512 16.523  1.00 125.69 ? 34  ASP A CA  1 
ATOM   218  C C   . ASP A 1 35  ? -3.488  23.149 15.111  1.00 125.06 ? 34  ASP A C   1 
ATOM   219  O O   . ASP A 1 35  ? -3.120  22.006 14.824  1.00 124.30 ? 34  ASP A O   1 
ATOM   220  C CB  . ASP A 1 35  ? -3.035  24.570 17.144  1.00 125.38 ? 34  ASP A CB  1 
ATOM   221  C CG  . ASP A 1 35  ? -3.234  25.952 16.551  1.00 128.62 ? 34  ASP A CG  1 
ATOM   222  O OD1 . ASP A 1 35  ? -4.070  26.097 15.637  1.00 130.03 ? 34  ASP A OD1 1 
ATOM   223  O OD2 . ASP A 1 35  ? -2.548  26.896 17.003  1.00 129.21 ? 34  ASP A OD2 1 
ATOM   224  N N   . ILE A 1 36  ? -3.523  24.140 14.215  1.00 115.33 ? 35  ILE A N   1 
ATOM   225  C CA  . ILE A 1 36  ? -2.957  23.952 12.880  1.00 114.50 ? 35  ILE A CA  1 
ATOM   226  C C   . ILE A 1 36  ? -1.476  23.611 12.985  1.00 112.64 ? 35  ILE A C   1 
ATOM   227  O O   . ILE A 1 36  ? -0.951  22.796 12.216  1.00 112.32 ? 35  ILE A O   1 
ATOM   228  C CB  . ILE A 1 36  ? -3.196  25.201 12.009  1.00 114.79 ? 35  ILE A CB  1 
ATOM   229  C CG1 . ILE A 1 36  ? -4.683  25.360 11.678  1.00 117.33 ? 35  ILE A CG1 1 
ATOM   230  C CG2 . ILE A 1 36  ? -2.380  25.133 10.726  1.00 113.68 ? 35  ILE A CG2 1 
ATOM   231  C CD1 . ILE A 1 36  ? -5.469  26.175 12.686  1.00 121.49 ? 35  ILE A CD1 1 
ATOM   232  N N   . TRP A 1 37  ? -0.783  24.218 13.948  1.00 119.15 ? 36  TRP A N   1 
ATOM   233  C CA  . TRP A 1 37  ? 0.594   23.873 14.269  1.00 117.29 ? 36  TRP A CA  1 
ATOM   234  C C   . TRP A 1 37  ? 0.681   22.887 15.431  1.00 119.02 ? 36  TRP A C   1 
ATOM   235  O O   . TRP A 1 37  ? 1.756   22.725 16.019  1.00 117.87 ? 36  TRP A O   1 
ATOM   236  C CB  . TRP A 1 37  ? 1.396   25.137 14.581  1.00 115.80 ? 36  TRP A CB  1 
ATOM   237  C CG  . TRP A 1 37  ? 1.390   26.156 13.476  1.00 115.72 ? 36  TRP A CG  1 
ATOM   238  C CD1 . TRP A 1 37  ? 0.371   27.003 13.149  1.00 118.19 ? 36  TRP A CD1 1 
ATOM   239  C CD2 . TRP A 1 37  ? 2.459   26.444 12.563  1.00 114.02 ? 36  TRP A CD2 1 
ATOM   240  N NE1 . TRP A 1 37  ? 0.735   27.794 12.086  1.00 117.52 ? 36  TRP A NE1 1 
ATOM   241  C CE2 . TRP A 1 37  ? 2.012   27.472 11.708  1.00 116.01 ? 36  TRP A CE2 1 
ATOM   242  C CE3 . TRP A 1 37  ? 3.748   25.930 12.383  1.00 112.62 ? 36  TRP A CE3 1 
ATOM   243  C CZ2 . TRP A 1 37  ? 2.807   27.996 10.690  1.00 114.90 ? 36  TRP A CZ2 1 
ATOM   244  C CZ3 . TRP A 1 37  ? 4.536   26.453 11.372  1.00 112.06 ? 36  TRP A CZ3 1 
ATOM   245  C CH2 . TRP A 1 37  ? 4.062   27.475 10.539  1.00 113.14 ? 36  TRP A CH2 1 
ATOM   246  N N   . ASP A 1 38  ? -0.437  22.244 15.779  1.00 119.06 ? 37  ASP A N   1 
ATOM   247  C CA  . ASP A 1 38  ? -0.482  21.194 16.802  1.00 120.10 ? 37  ASP A CA  1 
ATOM   248  C C   . ASP A 1 38  ? -0.095  21.724 18.183  1.00 121.76 ? 37  ASP A C   1 
ATOM   249  O O   . ASP A 1 38  ? 0.571   21.043 18.964  1.00 121.74 ? 37  ASP A O   1 
ATOM   250  C CB  . ASP A 1 38  ? 0.397   20.003 16.411  1.00 119.54 ? 37  ASP A CB  1 
ATOM   251  C CG  . ASP A 1 38  ? -0.148  19.244 15.215  1.00 122.67 ? 37  ASP A CG  1 
ATOM   252  O OD1 . ASP A 1 38  ? -1.366  18.962 15.192  1.00 124.31 ? 37  ASP A OD1 1 
ATOM   253  O OD2 . ASP A 1 38  ? 0.640   18.936 14.295  1.00 123.15 ? 37  ASP A OD2 1 
ATOM   254  N N   . ALA A 1 39  ? -0.532  22.941 18.495  1.00 118.49 ? 38  ALA A N   1 
ATOM   255  C CA  . ALA A 1 39  ? -0.295  23.553 19.797  1.00 119.37 ? 38  ALA A CA  1 
ATOM   256  C C   . ALA A 1 39  ? -1.557  23.435 20.644  1.00 123.44 ? 38  ALA A C   1 
ATOM   257  O O   . ALA A 1 39  ? -2.614  23.950 20.264  1.00 124.27 ? 38  ALA A O   1 
ATOM   258  C CB  . ALA A 1 39  ? 0.118   25.017 19.645  1.00 118.51 ? 38  ALA A CB  1 
ATOM   259  N N   . THR A 1 40  ? -1.446  22.760 21.788  1.00 118.39 ? 39  THR A N   1 
ATOM   260  C CA  . THR A 1 40  ? -2.584  22.594 22.676  1.00 121.26 ? 39  THR A CA  1 
ATOM   261  C C   . THR A 1 40  ? -2.914  23.914 23.372  1.00 123.59 ? 39  THR A C   1 
ATOM   262  O O   . THR A 1 40  ? -2.073  24.813 23.449  1.00 122.20 ? 39  THR A O   1 
ATOM   263  C CB  . THR A 1 40  ? -2.297  21.512 23.718  1.00 125.39 ? 39  THR A CB  1 
ATOM   264  O OG1 . THR A 1 40  ? -1.125  21.860 24.466  1.00 124.87 ? 39  THR A OG1 1 
ATOM   265  C CG2 . THR A 1 40  ? -2.089  20.162 23.047  1.00 124.02 ? 39  THR A CG2 1 
ATOM   266  N N   . PRO A 1 41  ? -4.144  24.061 23.876  1.00 118.31 ? 40  PRO A N   1 
ATOM   267  C CA  . PRO A 1 41  ? -4.480  25.273 24.641  1.00 119.85 ? 40  PRO A CA  1 
ATOM   268  C C   . PRO A 1 41  ? -3.591  25.501 25.851  1.00 121.69 ? 40  PRO A C   1 
ATOM   269  O O   . PRO A 1 41  ? -3.499  26.640 26.324  1.00 122.27 ? 40  PRO A O   1 
ATOM   270  C CB  . PRO A 1 41  ? -5.938  25.033 25.053  1.00 123.27 ? 40  PRO A CB  1 
ATOM   271  C CG  . PRO A 1 41  ? -6.474  24.146 23.986  1.00 123.78 ? 40  PRO A CG  1 
ATOM   272  C CD  . PRO A 1 41  ? -5.337  23.238 23.604  1.00 120.20 ? 40  PRO A CD  1 
ATOM   273  N N   . LEU A 1 42  ? -2.935  24.459 26.370  1.00 116.45 ? 41  LEU A N   1 
ATOM   274  C CA  . LEU A 1 42  ? -1.987  24.659 27.462  1.00 117.08 ? 41  LEU A CA  1 
ATOM   275  C C   . LEU A 1 42  ? -0.749  25.415 26.994  1.00 115.49 ? 41  LEU A C   1 
ATOM   276  O O   . LEU A 1 42  ? -0.157  26.172 27.772  1.00 116.09 ? 41  LEU A O   1 
ATOM   277  C CB  . LEU A 1 42  ? -1.594  23.314 28.072  1.00 117.99 ? 41  LEU A CB  1 
ATOM   278  C CG  . LEU A 1 42  ? -0.714  23.373 29.324  1.00 120.89 ? 41  LEU A CG  1 
ATOM   279  C CD1 . LEU A 1 42  ? -1.442  24.075 30.460  1.00 123.94 ? 41  LEU A CD1 1 
ATOM   280  C CD2 . LEU A 1 42  ? -0.279  21.979 29.744  1.00 122.32 ? 41  LEU A CD2 1 
ATOM   281  N N   . HIS A 1 43  ? -0.342  25.222 25.737  1.00 119.42 ? 42  HIS A N   1 
ATOM   282  C CA  . HIS A 1 43  ? 0.774   25.987 25.190  1.00 116.54 ? 42  HIS A CA  1 
ATOM   283  C C   . HIS A 1 43  ? 0.464   27.477 25.184  1.00 117.70 ? 42  HIS A C   1 
ATOM   284  O O   . HIS A 1 43  ? 1.247   28.291 25.688  1.00 117.32 ? 42  HIS A O   1 
ATOM   285  C CB  . HIS A 1 43  ? 1.098   25.515 23.773  1.00 113.79 ? 42  HIS A CB  1 
ATOM   286  C CG  . HIS A 1 43  ? 1.808   24.201 23.716  1.00 114.14 ? 42  HIS A CG  1 
ATOM   287  N ND1 . HIS A 1 43  ? 1.211   23.053 23.242  1.00 114.94 ? 42  HIS A ND1 1 
ATOM   288  C CD2 . HIS A 1 43  ? 3.069   23.854 24.064  1.00 113.93 ? 42  HIS A CD2 1 
ATOM   289  C CE1 . HIS A 1 43  ? 2.073   22.054 23.303  1.00 114.16 ? 42  HIS A CE1 1 
ATOM   290  N NE2 . HIS A 1 43  ? 3.209   22.514 23.797  1.00 113.66 ? 42  HIS A NE2 1 
ATOM   291  N N   . LEU A 1 44  ? -0.681  27.851 24.608  1.00 108.93 ? 43  LEU A N   1 
ATOM   292  C CA  . LEU A 1 44  ? -1.031  29.261 24.487  1.00 109.08 ? 43  LEU A CA  1 
ATOM   293  C C   . LEU A 1 44  ? -1.213  29.914 25.850  1.00 113.06 ? 43  LEU A C   1 
ATOM   294  O O   . LEU A 1 44  ? -0.943  31.111 26.005  1.00 112.88 ? 43  LEU A O   1 
ATOM   295  C CB  . LEU A 1 44  ? -2.298  29.407 23.645  1.00 109.67 ? 43  LEU A CB  1 
ATOM   296  C CG  . LEU A 1 44  ? -2.245  28.776 22.251  1.00 108.86 ? 43  LEU A CG  1 
ATOM   297  C CD1 . LEU A 1 44  ? -3.645  28.607 21.686  1.00 110.13 ? 43  LEU A CD1 1 
ATOM   298  C CD2 . LEU A 1 44  ? -1.387  29.610 21.312  1.00 107.13 ? 43  LEU A CD2 1 
ATOM   299  N N   . ALA A 1 45  ? -1.659  29.150 26.849  1.00 109.99 ? 44  ALA A N   1 
ATOM   300  C CA  . ALA A 1 45  ? -1.823  29.713 28.185  1.00 112.79 ? 44  ALA A CA  1 
ATOM   301  C C   . ALA A 1 45  ? -0.475  29.965 28.848  1.00 113.44 ? 44  ALA A C   1 
ATOM   302  O O   . ALA A 1 45  ? -0.292  30.985 29.524  1.00 114.48 ? 44  ALA A O   1 
ATOM   303  C CB  . ALA A 1 45  ? -2.682  28.785 29.044  1.00 115.78 ? 44  ALA A CB  1 
ATOM   304  N N   . ALA A 1 46  ? 0.481   29.051 28.664  1.00 110.28 ? 45  ALA A N   1 
ATOM   305  C CA  . ALA A 1 46  ? 1.804   29.228 29.250  1.00 109.80 ? 45  ALA A CA  1 
ATOM   306  C C   . ALA A 1 46  ? 2.602   30.326 28.560  1.00 108.50 ? 45  ALA A C   1 
ATOM   307  O O   . ALA A 1 46  ? 3.535   30.870 29.163  1.00 108.71 ? 45  ALA A O   1 
ATOM   308  C CB  . ALA A 1 46  ? 2.582   27.913 29.201  1.00 109.00 ? 45  ALA A CB  1 
ATOM   309  N N   . LEU A 1 47  ? 2.262   30.663 27.316  1.00 106.43 ? 46  LEU A N   1 
ATOM   310  C CA  . LEU A 1 47  ? 2.977   31.719 26.610  1.00 103.67 ? 46  LEU A CA  1 
ATOM   311  C C   . LEU A 1 47  ? 2.553   33.096 27.107  1.00 106.59 ? 46  LEU A C   1 
ATOM   312  O O   . LEU A 1 47  ? 3.400   33.930 27.446  1.00 106.00 ? 46  LEU A O   1 
ATOM   313  C CB  . LEU A 1 47  ? 2.745   31.589 25.103  1.00 100.76 ? 46  LEU A CB  1 
ATOM   314  C CG  . LEU A 1 47  ? 3.593   32.453 24.167  1.00 98.74  ? 46  LEU A CG  1 
ATOM   315  C CD1 . LEU A 1 47  ? 3.816   31.721 22.861  1.00 96.33  ? 46  LEU A CD1 1 
ATOM   316  C CD2 . LEU A 1 47  ? 2.941   33.802 23.904  1.00 99.85  ? 46  LEU A CD2 1 
ATOM   317  N N   . ILE A 1 48  ? 1.242   33.351 27.153  1.00 104.23 ? 47  ILE A N   1 
ATOM   318  C CA  . ILE A 1 48  ? 0.750   34.653 27.586  1.00 104.36 ? 47  ILE A CA  1 
ATOM   319  C C   . ILE A 1 48  ? 0.998   34.889 29.069  1.00 105.78 ? 47  ILE A C   1 
ATOM   320  O O   . ILE A 1 48  ? 0.985   36.041 29.519  1.00 105.48 ? 47  ILE A O   1 
ATOM   321  C CB  . ILE A 1 48  ? -0.748  34.796 27.262  1.00 106.17 ? 47  ILE A CB  1 
ATOM   322  C CG1 . ILE A 1 48  ? -1.557  33.730 28.003  1.00 109.41 ? 47  ILE A CG1 1 
ATOM   323  C CG2 . ILE A 1 48  ? -0.976  34.702 25.761  1.00 104.83 ? 47  ILE A CG2 1 
ATOM   324  C CD1 . ILE A 1 48  ? -3.054  33.867 27.829  1.00 111.56 ? 47  ILE A CD1 1 
ATOM   325  N N   . GLY A 1 49  ? 1.223   33.831 29.843  1.00 111.65 ? 48  GLY A N   1 
ATOM   326  C CA  . GLY A 1 49  ? 1.510   33.980 31.254  1.00 114.13 ? 48  GLY A CA  1 
ATOM   327  C C   . GLY A 1 49  ? 0.300   34.069 32.153  1.00 118.05 ? 48  GLY A C   1 
ATOM   328  O O   . GLY A 1 49  ? 0.382   34.682 33.224  1.00 119.17 ? 48  GLY A O   1 
ATOM   329  N N   . HIS A 1 50  ? -0.823  33.477 31.756  1.00 121.48 ? 49  HIS A N   1 
ATOM   330  C CA  . HIS A 1 50  ? -2.038  33.505 32.567  1.00 123.98 ? 49  HIS A CA  1 
ATOM   331  C C   . HIS A 1 50  ? -1.946  32.386 33.597  1.00 126.97 ? 49  HIS A C   1 
ATOM   332  O O   . HIS A 1 50  ? -2.282  31.234 33.313  1.00 126.97 ? 49  HIS A O   1 
ATOM   333  C CB  . HIS A 1 50  ? -3.276  33.357 31.691  1.00 124.35 ? 49  HIS A CB  1 
ATOM   334  C CG  . HIS A 1 50  ? -4.522  33.908 32.312  1.00 127.65 ? 49  HIS A CG  1 
ATOM   335  N ND1 . HIS A 1 50  ? -4.945  33.550 33.573  1.00 130.84 ? 49  HIS A ND1 1 
ATOM   336  C CD2 . HIS A 1 50  ? -5.433  34.795 31.846  1.00 128.19 ? 49  HIS A CD2 1 
ATOM   337  C CE1 . HIS A 1 50  ? -6.064  34.191 33.858  1.00 132.10 ? 49  HIS A CE1 1 
ATOM   338  N NE2 . HIS A 1 50  ? -6.383  34.952 32.827  1.00 130.64 ? 49  HIS A NE2 1 
ATOM   339  N N   . LEU A 1 51  ? -1.488  32.729 34.804  1.00 124.62 ? 50  LEU A N   1 
ATOM   340  C CA  . LEU A 1 51  ? -1.295  31.719 35.841  1.00 126.33 ? 50  LEU A CA  1 
ATOM   341  C C   . LEU A 1 51  ? -2.607  31.049 36.231  1.00 129.95 ? 50  LEU A C   1 
ATOM   342  O O   . LEU A 1 51  ? -2.619  29.859 36.567  1.00 130.83 ? 50  LEU A O   1 
ATOM   343  C CB  . LEU A 1 51  ? -0.633  32.352 37.066  1.00 127.32 ? 50  LEU A CB  1 
ATOM   344  C CG  . LEU A 1 51  ? -0.313  31.430 38.246  1.00 130.75 ? 50  LEU A CG  1 
ATOM   345  C CD1 . LEU A 1 51  ? 0.675   30.353 37.833  1.00 129.46 ? 50  LEU A CD1 1 
ATOM   346  C CD2 . LEU A 1 51  ? 0.218   32.228 39.428  1.00 132.45 ? 50  LEU A CD2 1 
ATOM   347  N N   . GLU A 1 52  ? -3.720  31.786 36.183  1.00 129.90 ? 51  GLU A N   1 
ATOM   348  C CA  . GLU A 1 52  ? -4.999  31.216 36.595  1.00 132.28 ? 51  GLU A CA  1 
ATOM   349  C C   . GLU A 1 52  ? -5.512  30.202 35.579  1.00 132.66 ? 51  GLU A C   1 
ATOM   350  O O   . GLU A 1 52  ? -6.140  29.205 35.953  1.00 134.27 ? 51  GLU A O   1 
ATOM   351  C CB  . GLU A 1 52  ? -6.020  32.333 36.814  1.00 133.92 ? 51  GLU A CB  1 
ATOM   352  C CG  . GLU A 1 52  ? -5.582  33.361 37.847  1.00 138.03 ? 51  GLU A CG  1 
ATOM   353  C CD  . GLU A 1 52  ? -5.717  34.787 37.349  1.00 143.47 ? 51  GLU A CD  1 
ATOM   354  O OE1 . GLU A 1 52  ? -6.862  35.267 37.211  1.00 142.55 ? 51  GLU A OE1 1 
ATOM   355  O OE2 . GLU A 1 52  ? -4.674  35.425 37.088  1.00 139.69 ? 51  GLU A OE2 1 
ATOM   356  N N   . ILE A 1 53  ? -5.256  30.437 34.291  1.00 130.00 ? 52  ILE A N   1 
ATOM   357  C CA  . ILE A 1 53  ? -5.673  29.476 33.275  1.00 128.88 ? 52  ILE A CA  1 
ATOM   358  C C   . ILE A 1 53  ? -4.745  28.266 33.257  1.00 129.15 ? 52  ILE A C   1 
ATOM   359  O O   . ILE A 1 53  ? -5.193  27.140 33.012  1.00 129.29 ? 52  ILE A O   1 
ATOM   360  C CB  . ILE A 1 53  ? -5.745  30.154 31.894  1.00 127.47 ? 52  ILE A CB  1 
ATOM   361  C CG1 . ILE A 1 53  ? -6.800  31.262 31.900  1.00 128.73 ? 52  ILE A CG1 1 
ATOM   362  C CG2 . ILE A 1 53  ? -6.059  29.138 30.803  1.00 126.28 ? 52  ILE A CG2 1 
ATOM   363  C CD1 . ILE A 1 53  ? -7.011  31.911 30.550  1.00 129.30 ? 52  ILE A CD1 1 
ATOM   364  N N   . VAL A 1 54  ? -3.453  28.467 33.527  1.00 128.15 ? 53  VAL A N   1 
ATOM   365  C CA  . VAL A 1 54  ? -2.507  27.354 33.517  1.00 127.26 ? 53  VAL A CA  1 
ATOM   366  C C   . VAL A 1 54  ? -2.842  26.352 34.616  1.00 131.24 ? 53  VAL A C   1 
ATOM   367  O O   . VAL A 1 54  ? -2.763  25.134 34.411  1.00 130.98 ? 53  VAL A O   1 
ATOM   368  C CB  . VAL A 1 54  ? -1.065  27.880 33.646  1.00 127.04 ? 53  VAL A CB  1 
ATOM   369  C CG1 . VAL A 1 54  ? -0.100  26.737 33.921  1.00 126.80 ? 53  VAL A CG1 1 
ATOM   370  C CG2 . VAL A 1 54  ? -0.660  28.624 32.385  1.00 123.98 ? 53  VAL A CG2 1 
ATOM   371  N N   . GLU A 1 55  ? -3.235  26.844 35.794  1.00 127.20 ? 54  GLU A N   1 
ATOM   372  C CA  . GLU A 1 55  ? -3.501  25.944 36.912  1.00 129.88 ? 54  GLU A CA  1 
ATOM   373  C C   . GLU A 1 55  ? -4.788  25.154 36.701  1.00 132.35 ? 54  GLU A C   1 
ATOM   374  O O   . GLU A 1 55  ? -4.847  23.962 37.024  1.00 133.35 ? 54  GLU A O   1 
ATOM   375  C CB  . GLU A 1 55  ? -3.563  26.730 38.223  1.00 132.59 ? 54  GLU A CB  1 
ATOM   376  C CG  . GLU A 1 55  ? -2.258  27.414 38.605  1.00 134.56 ? 54  GLU A CG  1 
ATOM   377  C CD  . GLU A 1 55  ? -2.275  27.961 40.021  1.00 142.84 ? 54  GLU A CD  1 
ATOM   378  O OE1 . GLU A 1 55  ? -2.555  27.183 40.958  1.00 143.14 ? 54  GLU A OE1 1 
ATOM   379  O OE2 . GLU A 1 55  ? -2.015  29.170 40.197  1.00 140.10 ? 54  GLU A OE2 1 
ATOM   380  N N   . VAL A 1 56  ? -5.829  25.795 36.163  1.00 133.05 ? 55  VAL A N   1 
ATOM   381  C CA  . VAL A 1 56  ? -7.099  25.101 35.979  1.00 134.43 ? 55  VAL A CA  1 
ATOM   382  C C   . VAL A 1 56  ? -7.038  24.105 34.829  1.00 133.57 ? 55  VAL A C   1 
ATOM   383  O O   . VAL A 1 56  ? -7.831  23.157 34.794  1.00 134.66 ? 55  VAL A O   1 
ATOM   384  C CB  . VAL A 1 56  ? -8.248  26.106 35.768  1.00 136.32 ? 55  VAL A CB  1 
ATOM   385  C CG1 . VAL A 1 56  ? -8.385  27.019 36.979  1.00 138.39 ? 55  VAL A CG1 1 
ATOM   386  C CG2 . VAL A 1 56  ? -8.032  26.916 34.501  1.00 133.35 ? 55  VAL A CG2 1 
ATOM   387  N N   . LEU A 1 57  ? -6.115  24.291 33.882  1.00 132.30 ? 56  LEU A N   1 
ATOM   388  C CA  . LEU A 1 57  ? -5.945  23.305 32.820  1.00 131.67 ? 56  LEU A CA  1 
ATOM   389  C C   . LEU A 1 57  ? -5.284  22.038 33.348  1.00 133.99 ? 56  LEU A C   1 
ATOM   390  O O   . LEU A 1 57  ? -5.721  20.924 33.036  1.00 136.47 ? 56  LEU A O   1 
ATOM   391  C CB  . LEU A 1 57  ? -5.127  23.901 31.674  1.00 126.79 ? 56  LEU A CB  1 
ATOM   392  C CG  . LEU A 1 57  ? -5.813  24.946 30.791  1.00 124.58 ? 56  LEU A CG  1 
ATOM   393  C CD1 . LEU A 1 57  ? -4.811  25.601 29.853  1.00 119.98 ? 56  LEU A CD1 1 
ATOM   394  C CD2 . LEU A 1 57  ? -6.951  24.317 30.003  1.00 126.46 ? 56  LEU A CD2 1 
ATOM   395  N N   . LEU A 1 58  ? -4.232  22.191 34.156  1.00 135.22 ? 57  LEU A N   1 
ATOM   396  C CA  . LEU A 1 58  ? -3.529  21.031 34.696  1.00 135.93 ? 57  LEU A CA  1 
ATOM   397  C C   . LEU A 1 58  ? -4.362  20.318 35.755  1.00 140.53 ? 57  LEU A C   1 
ATOM   398  O O   . LEU A 1 58  ? -4.338  19.085 35.845  1.00 141.14 ? 57  LEU A O   1 
ATOM   399  C CB  . LEU A 1 58  ? -2.182  21.462 35.274  1.00 135.56 ? 57  LEU A CB  1 
ATOM   400  C CG  . LEU A 1 58  ? -1.187  22.089 34.294  1.00 133.67 ? 57  LEU A CG  1 
ATOM   401  C CD1 . LEU A 1 58  ? -0.035  22.749 35.036  1.00 134.00 ? 57  LEU A CD1 1 
ATOM   402  C CD2 . LEU A 1 58  ? -0.668  21.040 33.324  1.00 132.32 ? 57  LEU A CD2 1 
ATOM   403  N N   . LYS A 1 59  ? -5.103  21.075 36.569  1.00 132.88 ? 58  LYS A N   1 
ATOM   404  C CA  . LYS A 1 59  ? -5.919  20.457 37.608  1.00 138.32 ? 58  LYS A CA  1 
ATOM   405  C C   . LYS A 1 59  ? -7.097  19.692 37.018  1.00 140.87 ? 58  LYS A C   1 
ATOM   406  O O   . LYS A 1 59  ? -7.543  18.698 37.603  1.00 145.54 ? 58  LYS A O   1 
ATOM   407  C CB  . LYS A 1 59  ? -6.415  21.518 38.590  1.00 139.40 ? 58  LYS A CB  1 
ATOM   408  N N   . ASN A 1 60  ? -7.611  20.133 35.870  1.00 139.68 ? 59  ASN A N   1 
ATOM   409  C CA  . ASN A 1 60  ? -8.715  19.464 35.197  1.00 141.85 ? 59  ASN A CA  1 
ATOM   410  C C   . ASN A 1 60  ? -8.236  18.512 34.106  1.00 140.61 ? 59  ASN A C   1 
ATOM   411  O O   . ASN A 1 60  ? -9.007  18.174 33.201  1.00 140.99 ? 59  ASN A O   1 
ATOM   412  C CB  . ASN A 1 60  ? -9.683  20.495 34.615  1.00 140.21 ? 59  ASN A CB  1 
ATOM   413  C CG  . ASN A 1 60  ? -11.094 19.956 34.472  1.00 147.67 ? 59  ASN A CG  1 
ATOM   414  O OD1 . ASN A 1 60  ? -11.559 19.169 35.299  1.00 150.30 ? 59  ASN A OD1 1 
ATOM   415  N ND2 . ASN A 1 60  ? -11.783 20.374 33.416  1.00 143.34 ? 59  ASN A ND2 1 
ATOM   416  N N   . GLY A 1 61  ? -6.980  18.078 34.170  1.00 144.42 ? 60  GLY A N   1 
ATOM   417  C CA  . GLY A 1 61  ? -6.451  17.148 33.193  1.00 142.78 ? 60  GLY A CA  1 
ATOM   418  C C   . GLY A 1 61  ? -6.017  17.809 31.901  1.00 138.69 ? 60  GLY A C   1 
ATOM   419  O O   . GLY A 1 61  ? -6.849  18.316 31.143  1.00 137.32 ? 60  GLY A O   1 
ATOM   420  N N   . ALA A 1 62  ? -4.712  17.808 31.640  1.00 140.42 ? 61  ALA A N   1 
ATOM   421  C CA  . ALA A 1 62  ? -4.176  18.377 30.413  1.00 135.73 ? 61  ALA A CA  1 
ATOM   422  C C   . ALA A 1 62  ? -2.842  17.712 30.111  1.00 134.25 ? 61  ALA A C   1 
ATOM   423  O O   . ALA A 1 62  ? -2.205  17.126 30.990  1.00 136.17 ? 61  ALA A O   1 
ATOM   424  C CB  . ALA A 1 62  ? -4.013  19.897 30.517  1.00 133.58 ? 61  ALA A CB  1 
ATOM   425  N N   . ASP A 1 63  ? -2.429  17.812 28.849  1.00 139.31 ? 62  ASP A N   1 
ATOM   426  C CA  . ASP A 1 63  ? -1.166  17.234 28.394  1.00 137.06 ? 62  ASP A CA  1 
ATOM   427  C C   . ASP A 1 63  ? -0.040  18.187 28.773  1.00 137.25 ? 62  ASP A C   1 
ATOM   428  O O   . ASP A 1 63  ? 0.181   19.204 28.111  1.00 135.00 ? 62  ASP A O   1 
ATOM   429  C CB  . ASP A 1 63  ? -1.203  16.982 26.891  1.00 134.74 ? 62  ASP A CB  1 
ATOM   430  C CG  . ASP A 1 63  ? -0.041  16.130 26.409  1.00 135.88 ? 62  ASP A CG  1 
ATOM   431  O OD1 . ASP A 1 63  ? 0.741   15.647 27.255  1.00 137.40 ? 62  ASP A OD1 1 
ATOM   432  O OD2 . ASP A 1 63  ? 0.088   15.943 25.181  1.00 135.37 ? 62  ASP A OD2 1 
ATOM   433  N N   . VAL A 1 64  ? 0.679   17.858 29.847  1.00 129.54 ? 63  VAL A N   1 
ATOM   434  C CA  . VAL A 1 64  ? 1.760   18.724 30.308  1.00 128.92 ? 63  VAL A CA  1 
ATOM   435  C C   . VAL A 1 64  ? 3.020   18.525 29.468  1.00 126.90 ? 63  VAL A C   1 
ATOM   436  O O   . VAL A 1 64  ? 3.825   19.453 29.323  1.00 125.28 ? 63  VAL A O   1 
ATOM   437  C CB  . VAL A 1 64  ? 2.025   18.484 31.807  1.00 133.38 ? 63  VAL A CB  1 
ATOM   438  C CG1 . VAL A 1 64  ? 2.551   17.075 32.048  1.00 134.13 ? 63  VAL A CG1 1 
ATOM   439  C CG2 . VAL A 1 64  ? 2.980   19.531 32.365  1.00 133.29 ? 63  VAL A CG2 1 
ATOM   440  N N   . ASN A 1 65  ? 3.210   17.339 28.893  1.00 127.29 ? 64  ASN A N   1 
ATOM   441  C CA  . ASN A 1 65  ? 4.353   17.053 28.027  1.00 124.46 ? 64  ASN A CA  1 
ATOM   442  C C   . ASN A 1 65  ? 3.957   17.046 26.557  1.00 122.79 ? 64  ASN A C   1 
ATOM   443  O O   . ASN A 1 65  ? 4.397   16.186 25.788  1.00 121.17 ? 64  ASN A O   1 
ATOM   444  C CB  . ASN A 1 65  ? 4.996   15.724 28.415  1.00 125.77 ? 64  ASN A CB  1 
ATOM   445  C CG  . ASN A 1 65  ? 5.527   15.723 29.836  1.00 135.33 ? 64  ASN A CG  1 
ATOM   446  O OD1 . ASN A 1 65  ? 5.835   16.774 30.397  1.00 133.72 ? 64  ASN A OD1 1 
ATOM   447  N ND2 . ASN A 1 65  ? 5.641   14.537 30.424  1.00 134.74 ? 64  ASN A ND2 1 
ATOM   448  N N   . ALA A 1 66  ? 3.126   17.998 26.141  1.00 122.39 ? 65  ALA A N   1 
ATOM   449  C CA  . ALA A 1 66  ? 2.660   18.052 24.764  1.00 120.14 ? 65  ALA A CA  1 
ATOM   450  C C   . ALA A 1 66  ? 3.763   18.552 23.839  1.00 118.20 ? 65  ALA A C   1 
ATOM   451  O O   . ALA A 1 66  ? 4.551   19.429 24.203  1.00 117.44 ? 65  ALA A O   1 
ATOM   452  C CB  . ALA A 1 66  ? 1.432   18.954 24.650  1.00 121.08 ? 65  ALA A CB  1 
ATOM   453  N N   . SER A 1 67  ? 3.810   17.986 22.635  1.00 123.34 ? 66  SER A N   1 
ATOM   454  C CA  . SER A 1 67  ? 4.803   18.329 21.624  1.00 120.44 ? 66  SER A CA  1 
ATOM   455  C C   . SER A 1 67  ? 4.078   18.811 20.375  1.00 120.10 ? 66  SER A C   1 
ATOM   456  O O   . SER A 1 67  ? 3.257   18.080 19.811  1.00 120.48 ? 66  SER A O   1 
ATOM   457  C CB  . SER A 1 67  ? 5.695   17.125 21.305  1.00 121.08 ? 66  SER A CB  1 
ATOM   458  O OG  . SER A 1 67  ? 6.632   17.427 20.285  1.00 121.44 ? 66  SER A OG  1 
ATOM   459  N N   . ASP A 1 68  ? 4.377   20.036 19.948  1.00 115.26 ? 67  ASP A N   1 
ATOM   460  C CA  . ASP A 1 68  ? 3.740   20.614 18.775  1.00 114.09 ? 67  ASP A CA  1 
ATOM   461  C C   . ASP A 1 68  ? 4.544   20.259 17.523  1.00 113.10 ? 67  ASP A C   1 
ATOM   462  O O   . ASP A 1 68  ? 5.470   19.444 17.563  1.00 112.60 ? 67  ASP A O   1 
ATOM   463  C CB  . ASP A 1 68  ? 3.581   22.124 18.946  1.00 114.37 ? 67  ASP A CB  1 
ATOM   464  C CG  . ASP A 1 68  ? 4.905   22.858 18.930  1.00 115.93 ? 67  ASP A CG  1 
ATOM   465  O OD1 . ASP A 1 68  ? 5.922   22.265 19.347  1.00 115.85 ? 67  ASP A OD1 1 
ATOM   466  O OD2 . ASP A 1 68  ? 4.930   24.031 18.498  1.00 116.80 ? 67  ASP A OD2 1 
ATOM   467  N N   . ILE A 1 69  ? 4.196   20.879 16.391  1.00 112.74 ? 68  ILE A N   1 
ATOM   468  C CA  . ILE A 1 69  ? 4.848   20.559 15.125  1.00 111.58 ? 68  ILE A CA  1 
ATOM   469  C C   . ILE A 1 69  ? 6.310   20.988 15.117  1.00 110.51 ? 68  ILE A C   1 
ATOM   470  O O   . ILE A 1 69  ? 7.096   20.486 14.305  1.00 109.38 ? 68  ILE A O   1 
ATOM   471  C CB  . ILE A 1 69  ? 4.074   21.198 13.954  1.00 112.09 ? 68  ILE A CB  1 
ATOM   472  C CG1 . ILE A 1 69  ? 4.449   20.535 12.625  1.00 111.71 ? 68  ILE A CG1 1 
ATOM   473  C CG2 . ILE A 1 69  ? 4.328   22.698 13.894  1.00 111.38 ? 68  ILE A CG2 1 
ATOM   474  C CD1 . ILE A 1 69  ? 3.657   21.050 11.436  1.00 114.24 ? 68  ILE A CD1 1 
ATOM   475  N N   . THR A 1 70  ? 6.702   21.900 16.007  1.00 110.11 ? 69  THR A N   1 
ATOM   476  C CA  . THR A 1 70  ? 8.089   22.327 16.125  1.00 108.58 ? 69  THR A CA  1 
ATOM   477  C C   . THR A 1 70  ? 8.833   21.630 17.256  1.00 110.62 ? 69  THR A C   1 
ATOM   478  O O   . THR A 1 70  ? 10.047  21.817 17.384  1.00 109.47 ? 69  THR A O   1 
ATOM   479  C CB  . THR A 1 70  ? 8.163   23.844 16.337  1.00 110.12 ? 69  THR A CB  1 
ATOM   480  O OG1 . THR A 1 70  ? 7.472   24.194 17.543  1.00 111.37 ? 69  THR A OG1 1 
ATOM   481  C CG2 . THR A 1 70  ? 7.533   24.580 15.163  1.00 109.21 ? 69  THR A CG2 1 
ATOM   482  N N   . GLY A 1 71  ? 8.142   20.835 18.070  1.00 108.96 ? 70  GLY A N   1 
ATOM   483  C CA  . GLY A 1 71  ? 8.757   20.167 19.196  1.00 110.20 ? 70  GLY A CA  1 
ATOM   484  C C   . GLY A 1 71  ? 8.734   20.944 20.493  1.00 112.77 ? 70  GLY A C   1 
ATOM   485  O O   . GLY A 1 71  ? 9.260   20.452 21.499  1.00 114.07 ? 70  GLY A O   1 
ATOM   486  N N   . THR A 1 72  ? 8.140   22.135 20.505  1.00 110.65 ? 71  THR A N   1 
ATOM   487  C CA  . THR A 1 72  ? 8.105   22.965 21.701  1.00 112.02 ? 71  THR A CA  1 
ATOM   488  C C   . THR A 1 72  ? 7.065   22.438 22.684  1.00 116.23 ? 71  THR A C   1 
ATOM   489  O O   . THR A 1 72  ? 5.936   22.117 22.298  1.00 116.67 ? 71  THR A O   1 
ATOM   490  C CB  . THR A 1 72  ? 7.795   24.415 21.329  1.00 113.53 ? 71  THR A CB  1 
ATOM   491  O OG1 . THR A 1 72  ? 8.692   24.846 20.297  1.00 110.89 ? 71  THR A OG1 1 
ATOM   492  C CG2 . THR A 1 72  ? 7.952   25.325 22.539  1.00 114.43 ? 71  THR A CG2 1 
ATOM   493  N N   . THR A 1 73  ? 7.448   22.353 23.954  1.00 109.22 ? 72  THR A N   1 
ATOM   494  C CA  . THR A 1 73  ? 6.608   21.880 25.042  1.00 112.27 ? 72  THR A CA  1 
ATOM   495  C C   . THR A 1 73  ? 6.098   23.052 25.870  1.00 115.21 ? 72  THR A C   1 
ATOM   496  O O   . THR A 1 73  ? 6.635   24.161 25.788  1.00 113.93 ? 72  THR A O   1 
ATOM   497  C CB  . THR A 1 73  ? 7.398   20.912 25.933  1.00 116.37 ? 72  THR A CB  1 
ATOM   498  O OG1 . THR A 1 73  ? 8.536   21.586 26.483  1.00 116.35 ? 72  THR A OG1 1 
ATOM   499  C CG2 . THR A 1 73  ? 7.866   19.709 25.127  1.00 114.48 ? 72  THR A CG2 1 
ATOM   500  N N   . PRO A 1 74  ? 5.044   22.853 26.671  1.00 108.73 ? 73  PRO A N   1 
ATOM   501  C CA  . PRO A 1 74  ? 4.557   23.964 27.508  1.00 110.62 ? 73  PRO A CA  1 
ATOM   502  C C   . PRO A 1 74  ? 5.599   24.485 28.480  1.00 113.01 ? 73  PRO A C   1 
ATOM   503  O O   . PRO A 1 74  ? 5.623   25.690 28.762  1.00 113.18 ? 73  PRO A O   1 
ATOM   504  C CB  . PRO A 1 74  ? 3.356   23.350 28.240  1.00 114.20 ? 73  PRO A CB  1 
ATOM   505  C CG  . PRO A 1 74  ? 2.911   22.235 27.363  1.00 114.53 ? 73  PRO A CG  1 
ATOM   506  C CD  . PRO A 1 74  ? 4.170   21.671 26.775  1.00 110.84 ? 73  PRO A CD  1 
ATOM   507  N N   . LEU A 1 75  ? 6.466   23.613 29.001  1.00 108.89 ? 74  LEU A N   1 
ATOM   508  C CA  . LEU A 1 75  ? 7.541   24.074 29.871  1.00 109.99 ? 74  LEU A CA  1 
ATOM   509  C C   . LEU A 1 75  ? 8.573   24.888 29.101  1.00 108.56 ? 74  LEU A C   1 
ATOM   510  O O   . LEU A 1 75  ? 9.191   25.797 29.667  1.00 109.20 ? 74  LEU A O   1 
ATOM   511  C CB  . LEU A 1 75  ? 8.206   22.883 30.561  1.00 111.56 ? 74  LEU A CB  1 
ATOM   512  C CG  . LEU A 1 75  ? 9.234   23.208 31.647  1.00 114.87 ? 74  LEU A CG  1 
ATOM   513  C CD1 . LEU A 1 75  ? 8.578   23.934 32.813  1.00 117.57 ? 74  LEU A CD1 1 
ATOM   514  C CD2 . LEU A 1 75  ? 9.932   21.943 32.120  1.00 116.80 ? 74  LEU A CD2 1 
ATOM   515  N N   . HIS A 1 76  ? 8.770   24.581 27.815  1.00 113.22 ? 75  HIS A N   1 
ATOM   516  C CA  . HIS A 1 76  ? 9.693   25.364 26.999  1.00 110.27 ? 75  HIS A CA  1 
ATOM   517  C C   . HIS A 1 76  ? 9.209   26.799 26.837  1.00 110.77 ? 75  HIS A C   1 
ATOM   518  O O   . HIS A 1 76  ? 9.999   27.744 26.944  1.00 109.98 ? 75  HIS A O   1 
ATOM   519  C CB  . HIS A 1 76  ? 9.872   24.709 25.629  1.00 107.47 ? 75  HIS A CB  1 
ATOM   520  C CG  . HIS A 1 76  ? 10.920  23.641 25.596  1.00 108.38 ? 75  HIS A CG  1 
ATOM   521  N ND1 . HIS A 1 76  ? 10.794  22.498 24.836  1.00 107.94 ? 75  HIS A ND1 1 
ATOM   522  C CD2 . HIS A 1 76  ? 12.121  23.550 26.215  1.00 109.88 ? 75  HIS A CD2 1 
ATOM   523  C CE1 . HIS A 1 76  ? 11.867  21.744 24.995  1.00 108.04 ? 75  HIS A CE1 1 
ATOM   524  N NE2 . HIS A 1 76  ? 12.688  22.360 25.827  1.00 109.32 ? 75  HIS A NE2 1 
ATOM   525  N N   . LEU A 1 77  ? 7.913   26.981 26.573  1.00 102.62 ? 76  LEU A N   1 
ATOM   526  C CA  . LEU A 1 77  ? 7.379   28.327 26.396  1.00 102.12 ? 76  LEU A CA  1 
ATOM   527  C C   . LEU A 1 77  ? 7.485   29.137 27.680  1.00 106.06 ? 76  LEU A C   1 
ATOM   528  O O   . LEU A 1 77  ? 7.851   30.317 27.650  1.00 105.17 ? 76  LEU A O   1 
ATOM   529  C CB  . LEU A 1 77  ? 5.928   28.260 25.924  1.00 102.56 ? 76  LEU A CB  1 
ATOM   530  C CG  . LEU A 1 77  ? 5.704   27.852 24.469  1.00 101.33 ? 76  LEU A CG  1 
ATOM   531  C CD1 . LEU A 1 77  ? 4.225   27.632 24.214  1.00 102.54 ? 76  LEU A CD1 1 
ATOM   532  C CD2 . LEU A 1 77  ? 6.261   28.908 23.527  1.00 99.47  ? 76  LEU A CD2 1 
ATOM   533  N N   . ALA A 1 78  ? 7.171   28.517 28.820  1.00 104.28 ? 77  ALA A N   1 
ATOM   534  C CA  . ALA A 1 78  ? 7.249   29.232 30.089  1.00 107.26 ? 77  ALA A CA  1 
ATOM   535  C C   . ALA A 1 78  ? 8.687   29.580 30.452  1.00 108.36 ? 77  ALA A C   1 
ATOM   536  O O   . ALA A 1 78  ? 8.929   30.606 31.098  1.00 109.53 ? 77  ALA A O   1 
ATOM   537  C CB  . ALA A 1 78  ? 6.603   28.404 31.199  1.00 110.83 ? 77  ALA A CB  1 
ATOM   538  N N   . ALA A 1 79  ? 9.651   28.750 30.048  1.00 102.84 ? 78  ALA A N   1 
ATOM   539  C CA  . ALA A 1 79  ? 11.051  29.051 30.322  1.00 101.28 ? 78  ALA A CA  1 
ATOM   540  C C   . ALA A 1 79  ? 11.601  30.113 29.381  1.00 97.84  ? 78  ALA A C   1 
ATOM   541  O O   . ALA A 1 79  ? 12.488  30.881 29.771  1.00 96.59  ? 78  ALA A O   1 
ATOM   542  C CB  . ALA A 1 79  ? 11.896  27.780 30.227  1.00 101.92 ? 78  ALA A CB  1 
ATOM   543  N N   . THR A 1 80  ? 11.095  30.173 28.148  1.00 102.51 ? 79  THR A N   1 
ATOM   544  C CA  . THR A 1 80  ? 11.561  31.184 27.204  1.00 99.26  ? 79  THR A CA  1 
ATOM   545  C C   . THR A 1 80  ? 11.054  32.566 27.591  1.00 101.44 ? 79  THR A C   1 
ATOM   546  O O   . THR A 1 80  ? 11.814  33.541 27.597  1.00 100.52 ? 79  THR A O   1 
ATOM   547  C CB  . THR A 1 80  ? 11.114  30.827 25.786  1.00 98.58  ? 79  THR A CB  1 
ATOM   548  O OG1 . THR A 1 80  ? 11.598  29.522 25.444  1.00 97.94  ? 79  THR A OG1 1 
ATOM   549  C CG2 . THR A 1 80  ? 11.651  31.839 24.785  1.00 94.80  ? 79  THR A CG2 1 
ATOM   550  N N   . MET A 1 81  ? 9.766   32.669 27.921  1.00 101.85 ? 80  MET A N   1 
ATOM   551  C CA  . MET A 1 81  ? 9.198   33.964 28.278  1.00 102.96 ? 80  MET A CA  1 
ATOM   552  C C   . MET A 1 81  ? 9.699   34.433 29.639  1.00 107.16 ? 80  MET A C   1 
ATOM   553  O O   . MET A 1 81  ? 10.032  35.612 29.810  1.00 106.69 ? 80  MET A O   1 
ATOM   554  C CB  . MET A 1 81  ? 7.673   33.885 28.256  1.00 105.09 ? 80  MET A CB  1 
ATOM   555  C CG  . MET A 1 81  ? 7.104   33.506 26.899  1.00 103.41 ? 80  MET A CG  1 
ATOM   556  S SD  . MET A 1 81  ? 7.526   34.709 25.623  1.00 100.85 ? 80  MET A SD  1 
ATOM   557  C CE  . MET A 1 81  ? 8.016   33.626 24.284  1.00 96.36  ? 80  MET A CE  1 
ATOM   558  N N   . GLY A 1 82  ? 9.764   33.531 30.614  1.00 101.71 ? 81  GLY A N   1 
ATOM   559  C CA  . GLY A 1 82  ? 10.246  33.884 31.934  1.00 103.97 ? 81  GLY A CA  1 
ATOM   560  C C   . GLY A 1 82  ? 9.136   34.074 32.946  1.00 107.50 ? 81  GLY A C   1 
ATOM   561  O O   . GLY A 1 82  ? 9.127   35.058 33.691  1.00 107.73 ? 81  GLY A O   1 
ATOM   562  N N   . HIS A 1 83  ? 8.192   33.136 32.980  1.00 108.31 ? 82  HIS A N   1 
ATOM   563  C CA  . HIS A 1 83  ? 7.073   33.172 33.922  1.00 110.54 ? 82  HIS A CA  1 
ATOM   564  C C   . HIS A 1 83  ? 7.376   32.182 35.041  1.00 113.39 ? 82  HIS A C   1 
ATOM   565  O O   . HIS A 1 83  ? 7.021   31.005 34.968  1.00 113.98 ? 82  HIS A O   1 
ATOM   566  C CB  . HIS A 1 83  ? 5.759   32.849 33.221  1.00 111.19 ? 82  HIS A CB  1 
ATOM   567  C CG  . HIS A 1 83  ? 5.368   33.850 32.180  1.00 110.85 ? 82  HIS A CG  1 
ATOM   568  N ND1 . HIS A 1 83  ? 5.393   33.572 30.831  1.00 108.45 ? 82  HIS A ND1 1 
ATOM   569  C CD2 . HIS A 1 83  ? 4.945   35.132 32.292  1.00 111.25 ? 82  HIS A CD2 1 
ATOM   570  C CE1 . HIS A 1 83  ? 4.998   34.637 30.156  1.00 106.83 ? 82  HIS A CE1 1 
ATOM   571  N NE2 . HIS A 1 83  ? 4.722   35.598 31.019  1.00 108.71 ? 82  HIS A NE2 1 
ATOM   572  N N   . LEU A 1 84  ? 8.040   32.674 36.092  1.00 111.94 ? 83  LEU A N   1 
ATOM   573  C CA  . LEU A 1 84  ? 8.409   31.813 37.211  1.00 113.45 ? 83  LEU A CA  1 
ATOM   574  C C   . LEU A 1 84  ? 7.186   31.212 37.889  1.00 117.21 ? 83  LEU A C   1 
ATOM   575  O O   . LEU A 1 84  ? 7.241   30.075 38.373  1.00 118.42 ? 83  LEU A O   1 
ATOM   576  C CB  . LEU A 1 84  ? 9.242   32.599 38.224  1.00 113.42 ? 83  LEU A CB  1 
ATOM   577  C CG  . LEU A 1 84  ? 9.725   31.830 39.456  1.00 116.49 ? 83  LEU A CG  1 
ATOM   578  C CD1 . LEU A 1 84  ? 10.718  30.748 39.060  1.00 115.80 ? 83  LEU A CD1 1 
ATOM   579  C CD2 . LEU A 1 84  ? 10.330  32.776 40.481  1.00 117.08 ? 83  LEU A CD2 1 
ATOM   580  N N   . GLU A 1 85  ? 6.076   31.953 37.935  1.00 116.49 ? 84  GLU A N   1 
ATOM   581  C CA  . GLU A 1 85  ? 4.864   31.420 38.548  1.00 118.94 ? 84  GLU A CA  1 
ATOM   582  C C   . GLU A 1 85  ? 4.303   30.256 37.740  1.00 120.18 ? 84  GLU A C   1 
ATOM   583  O O   . GLU A 1 85  ? 3.786   29.289 38.311  1.00 122.00 ? 84  GLU A O   1 
ATOM   584  C CB  . GLU A 1 85  ? 3.821   32.528 38.697  1.00 120.12 ? 84  GLU A CB  1 
ATOM   585  N N   . ILE A 1 86  ? 4.402   30.326 36.412  1.00 120.87 ? 85  ILE A N   1 
ATOM   586  C CA  . ILE A 1 86  ? 3.896   29.242 35.576  1.00 120.43 ? 85  ILE A CA  1 
ATOM   587  C C   . ILE A 1 86  ? 4.899   28.090 35.509  1.00 121.06 ? 85  ILE A C   1 
ATOM   588  O O   . ILE A 1 86  ? 4.502   26.920 35.441  1.00 121.63 ? 85  ILE A O   1 
ATOM   589  C CB  . ILE A 1 86  ? 3.534   29.776 34.175  1.00 119.24 ? 85  ILE A CB  1 
ATOM   590  C CG1 . ILE A 1 86  ? 2.238   30.596 34.221  1.00 120.52 ? 85  ILE A CG1 1 
ATOM   591  C CG2 . ILE A 1 86  ? 3.390   28.642 33.169  1.00 118.06 ? 85  ILE A CG2 1 
ATOM   592  C CD1 . ILE A 1 86  ? 2.419   32.053 34.609  1.00 122.81 ? 85  ILE A CD1 1 
ATOM   593  N N   . VAL A 1 87  ? 6.201   28.391 35.550  1.00 117.74 ? 86  VAL A N   1 
ATOM   594  C CA  . VAL A 1 87  ? 7.218   27.340 35.509  1.00 117.20 ? 86  VAL A CA  1 
ATOM   595  C C   . VAL A 1 87  ? 7.082   26.416 36.713  1.00 120.94 ? 86  VAL A C   1 
ATOM   596  O O   . VAL A 1 87  ? 7.119   25.187 36.584  1.00 121.19 ? 86  VAL A O   1 
ATOM   597  C CB  . VAL A 1 87  ? 8.627   27.956 35.433  1.00 116.87 ? 86  VAL A CB  1 
ATOM   598  C CG1 . VAL A 1 87  ? 9.684   26.905 35.742  1.00 117.00 ? 86  VAL A CG1 1 
ATOM   599  C CG2 . VAL A 1 87  ? 8.871   28.568 34.064  1.00 114.17 ? 86  VAL A CG2 1 
ATOM   600  N N   . GLU A 1 88  ? 6.922   26.998 37.905  1.00 121.30 ? 87  GLU A N   1 
ATOM   601  C CA  . GLU A 1 88  ? 6.802   26.193 39.117  1.00 123.80 ? 87  GLU A CA  1 
ATOM   602  C C   . GLU A 1 88  ? 5.510   25.384 39.135  1.00 126.66 ? 87  GLU A C   1 
ATOM   603  O O   . GLU A 1 88  ? 5.459   24.314 39.752  1.00 128.35 ? 87  GLU A O   1 
ATOM   604  C CB  . GLU A 1 88  ? 6.886   27.090 40.353  1.00 125.57 ? 87  GLU A CB  1 
ATOM   605  C CG  . GLU A 1 88  ? 8.257   27.715 40.577  1.00 127.42 ? 87  GLU A CG  1 
ATOM   606  C CD  . GLU A 1 88  ? 8.292   28.645 41.778  1.00 134.82 ? 87  GLU A CD  1 
ATOM   607  O OE1 . GLU A 1 88  ? 7.246   29.248 42.098  1.00 134.13 ? 87  GLU A OE1 1 
ATOM   608  O OE2 . GLU A 1 88  ? 9.367   28.768 42.404  1.00 132.27 ? 87  GLU A OE2 1 
ATOM   609  N N   . VAL A 1 89  ? 4.461   25.874 38.470  1.00 123.77 ? 88  VAL A N   1 
ATOM   610  C CA  . VAL A 1 89  ? 3.206   25.130 38.412  1.00 125.20 ? 88  VAL A CA  1 
ATOM   611  C C   . VAL A 1 89  ? 3.331   23.944 37.463  1.00 125.01 ? 88  VAL A C   1 
ATOM   612  O O   . VAL A 1 89  ? 2.834   22.848 37.750  1.00 126.49 ? 88  VAL A O   1 
ATOM   613  C CB  . VAL A 1 89  ? 2.051   26.065 38.010  1.00 126.38 ? 88  VAL A CB  1 
ATOM   614  C CG1 . VAL A 1 89  ? 0.820   25.262 37.619  1.00 127.33 ? 88  VAL A CG1 1 
ATOM   615  C CG2 . VAL A 1 89  ? 1.722   27.013 39.152  1.00 128.12 ? 88  VAL A CG2 1 
ATOM   616  N N   . LEU A 1 90  ? 3.998   24.139 36.324  1.00 123.39 ? 89  LEU A N   1 
ATOM   617  C CA  . LEU A 1 90  ? 4.167   23.051 35.366  1.00 121.71 ? 89  LEU A CA  1 
ATOM   618  C C   . LEU A 1 90  ? 5.011   21.926 35.951  1.00 123.69 ? 89  LEU A C   1 
ATOM   619  O O   . LEU A 1 90  ? 4.662   20.746 35.831  1.00 124.16 ? 89  LEU A O   1 
ATOM   620  C CB  . LEU A 1 90  ? 4.795   23.583 34.079  1.00 118.38 ? 89  LEU A CB  1 
ATOM   621  C CG  . LEU A 1 90  ? 3.889   24.430 33.189  1.00 118.41 ? 89  LEU A CG  1 
ATOM   622  C CD1 . LEU A 1 90  ? 4.694   25.098 32.087  1.00 115.52 ? 89  LEU A CD1 1 
ATOM   623  C CD2 . LEU A 1 90  ? 2.780   23.570 32.600  1.00 119.08 ? 89  LEU A CD2 1 
ATOM   624  N N   . LEU A 1 91  ? 6.128   22.276 36.593  1.00 118.80 ? 90  LEU A N   1 
ATOM   625  C CA  . LEU A 1 91  ? 7.003   21.262 37.171  1.00 121.08 ? 90  LEU A CA  1 
ATOM   626  C C   . LEU A 1 91  ? 6.308   20.481 38.277  1.00 126.45 ? 90  LEU A C   1 
ATOM   627  O O   . LEU A 1 91  ? 6.550   19.279 38.433  1.00 129.21 ? 90  LEU A O   1 
ATOM   628  C CB  . LEU A 1 91  ? 8.278   21.915 37.702  1.00 119.35 ? 90  LEU A CB  1 
ATOM   629  C CG  . LEU A 1 91  ? 9.199   22.519 36.643  1.00 116.56 ? 90  LEU A CG  1 
ATOM   630  C CD1 . LEU A 1 91  ? 10.314  23.317 37.296  1.00 116.54 ? 90  LEU A CD1 1 
ATOM   631  C CD2 . LEU A 1 91  ? 9.769   21.424 35.756  1.00 116.03 ? 90  LEU A CD2 1 
ATOM   632  N N   . LYS A 1 92  ? 5.442   21.139 39.051  1.00 123.98 ? 91  LYS A N   1 
ATOM   633  C CA  . LYS A 1 92  ? 4.713   20.433 40.098  1.00 127.07 ? 91  LYS A CA  1 
ATOM   634  C C   . LYS A 1 92  ? 3.689   19.467 39.517  1.00 128.69 ? 91  LYS A C   1 
ATOM   635  O O   . LYS A 1 92  ? 3.353   18.463 40.156  1.00 130.87 ? 91  LYS A O   1 
ATOM   636  C CB  . LYS A 1 92  ? 4.030   21.434 41.030  1.00 129.65 ? 91  LYS A CB  1 
ATOM   637  N N   . TYR A 1 93  ? 3.184   19.747 38.312  1.00 126.32 ? 92  TYR A N   1 
ATOM   638  C CA  . TYR A 1 93  ? 2.214   18.883 37.649  1.00 128.11 ? 92  TYR A CA  1 
ATOM   639  C C   . TYR A 1 93  ? 2.865   17.889 36.693  1.00 127.06 ? 92  TYR A C   1 
ATOM   640  O O   . TYR A 1 93  ? 2.252   17.505 35.687  1.00 126.49 ? 92  TYR A O   1 
ATOM   641  C CB  . TYR A 1 93  ? 1.166   19.728 36.921  1.00 126.03 ? 92  TYR A CB  1 
ATOM   642  C CG  . TYR A 1 93  ? -0.001  20.136 37.796  1.00 129.18 ? 92  TYR A CG  1 
ATOM   643  C CD1 . TYR A 1 93  ? -1.108  19.308 37.939  1.00 133.29 ? 92  TYR A CD1 1 
ATOM   644  C CD2 . TYR A 1 93  ? 0.004   21.345 38.482  1.00 128.25 ? 92  TYR A CD2 1 
ATOM   645  C CE1 . TYR A 1 93  ? -2.177  19.671 38.738  1.00 136.35 ? 92  TYR A CE1 1 
ATOM   646  C CE2 . TYR A 1 93  ? -1.063  21.717 39.285  1.00 131.30 ? 92  TYR A CE2 1 
ATOM   647  C CZ  . TYR A 1 93  ? -2.150  20.876 39.408  1.00 135.33 ? 92  TYR A CZ  1 
ATOM   648  O OH  . TYR A 1 93  ? -3.214  21.238 40.203  1.00 138.53 ? 92  TYR A OH  1 
ATOM   649  N N   . GLY A 1 94  ? 4.092   17.466 36.978  1.00 136.12 ? 93  GLY A N   1 
ATOM   650  C CA  . GLY A 1 94  ? 4.724   16.413 36.207  1.00 134.52 ? 93  GLY A CA  1 
ATOM   651  C C   . GLY A 1 94  ? 5.245   16.820 34.847  1.00 132.08 ? 93  GLY A C   1 
ATOM   652  O O   . GLY A 1 94  ? 5.136   16.044 33.889  1.00 130.28 ? 93  GLY A O   1 
ATOM   653  N N   . ALA A 1 95  ? 5.813   18.016 34.731  1.00 133.59 ? 94  ALA A N   1 
ATOM   654  C CA  . ALA A 1 95  ? 6.400   18.444 33.472  1.00 130.07 ? 94  ALA A CA  1 
ATOM   655  C C   . ALA A 1 95  ? 7.739   17.754 33.244  1.00 130.34 ? 94  ALA A C   1 
ATOM   656  O O   . ALA A 1 95  ? 8.465   17.434 34.189  1.00 132.08 ? 94  ALA A O   1 
ATOM   657  C CB  . ALA A 1 95  ? 6.588   19.961 33.448  1.00 129.41 ? 94  ALA A CB  1 
ATOM   658  N N   . ASP A 1 96  ? 8.058   17.519 31.973  1.00 132.23 ? 95  ASP A N   1 
ATOM   659  C CA  . ASP A 1 96  ? 9.332   16.913 31.600  1.00 130.91 ? 95  ASP A CA  1 
ATOM   660  C C   . ASP A 1 96  ? 10.426  17.965 31.740  1.00 131.26 ? 95  ASP A C   1 
ATOM   661  O O   . ASP A 1 96  ? 10.533  18.876 30.912  1.00 128.66 ? 95  ASP A O   1 
ATOM   662  C CB  . ASP A 1 96  ? 9.270   16.362 30.179  1.00 128.54 ? 95  ASP A CB  1 
ATOM   663  C CG  . ASP A 1 96  ? 10.433  15.437 29.857  1.00 130.94 ? 95  ASP A CG  1 
ATOM   664  O OD1 . ASP A 1 96  ? 11.212  15.109 30.779  1.00 132.90 ? 95  ASP A OD1 1 
ATOM   665  O OD2 . ASP A 1 96  ? 10.570  15.038 28.681  1.00 130.57 ? 95  ASP A OD2 1 
ATOM   666  N N   . VAL A 1 97  ? 11.235  17.846 32.795  1.00 121.48 ? 96  VAL A N   1 
ATOM   667  C CA  . VAL A 1 97  ? 12.247  18.860 33.075  1.00 121.11 ? 96  VAL A CA  1 
ATOM   668  C C   . VAL A 1 97  ? 13.357  18.830 32.030  1.00 119.58 ? 96  VAL A C   1 
ATOM   669  O O   . VAL A 1 97  ? 13.997  19.855 31.764  1.00 118.17 ? 96  VAL A O   1 
ATOM   670  C CB  . VAL A 1 97  ? 12.793  18.673 34.505  1.00 125.26 ? 96  VAL A CB  1 
ATOM   671  C CG1 . VAL A 1 97  ? 13.472  17.319 34.653  1.00 126.07 ? 96  VAL A CG1 1 
ATOM   672  C CG2 . VAL A 1 97  ? 13.740  19.808 34.880  1.00 124.84 ? 96  VAL A CG2 1 
ATOM   673  N N   . ASN A 1 98  ? 13.594  17.677 31.405  1.00 119.45 ? 97  ASN A N   1 
ATOM   674  C CA  . ASN A 1 98  ? 14.638  17.572 30.393  1.00 116.89 ? 97  ASN A CA  1 
ATOM   675  C C   . ASN A 1 98  ? 14.064  17.155 29.044  1.00 115.28 ? 97  ASN A C   1 
ATOM   676  O O   . ASN A 1 98  ? 14.516  16.172 28.449  1.00 114.35 ? 97  ASN A O   1 
ATOM   677  C CB  . ASN A 1 98  ? 15.721  16.585 30.836  1.00 118.63 ? 97  ASN A CB  1 
ATOM   678  C CG  . ASN A 1 98  ? 16.550  17.105 31.998  1.00 127.92 ? 97  ASN A CG  1 
ATOM   679  O OD1 . ASN A 1 98  ? 17.364  18.015 31.837  1.00 125.25 ? 97  ASN A OD1 1 
ATOM   680  N ND2 . ASN A 1 98  ? 16.356  16.519 33.173  1.00 128.13 ? 97  ASN A ND2 1 
ATOM   681  N N   . ALA A 1 99  ? 13.072  17.891 28.554  1.00 117.30 ? 98  ALA A N   1 
ATOM   682  C CA  . ALA A 1 99  ? 12.529  17.655 27.226  1.00 114.55 ? 98  ALA A CA  1 
ATOM   683  C C   . ALA A 1 99  ? 13.339  18.420 26.184  1.00 112.72 ? 98  ALA A C   1 
ATOM   684  O O   . ALA A 1 99  ? 14.030  19.393 26.493  1.00 112.48 ? 98  ALA A O   1 
ATOM   685  C CB  . ALA A 1 99  ? 11.058  18.067 27.160  1.00 115.03 ? 98  ALA A CB  1 
ATOM   686  N N   . TYR A 1 100 ? 13.248  17.965 24.935  1.00 114.46 ? 99  TYR A N   1 
ATOM   687  C CA  . TYR A 1 100 ? 13.970  18.598 23.842  1.00 111.59 ? 99  TYR A CA  1 
ATOM   688  C C   . TYR A 1 100 ? 13.062  18.714 22.625  1.00 110.61 ? 99  TYR A C   1 
ATOM   689  O O   . TYR A 1 100 ? 12.188  17.872 22.398  1.00 110.96 ? 99  TYR A O   1 
ATOM   690  C CB  . TYR A 1 100 ? 15.252  17.825 23.486  1.00 111.81 ? 99  TYR A CB  1 
ATOM   691  C CG  . TYR A 1 100 ? 15.029  16.541 22.717  1.00 112.15 ? 99  TYR A CG  1 
ATOM   692  C CD1 . TYR A 1 100 ? 14.551  15.400 23.348  1.00 114.88 ? 99  TYR A CD1 1 
ATOM   693  C CD2 . TYR A 1 100 ? 15.315  16.467 21.359  1.00 110.30 ? 99  TYR A CD2 1 
ATOM   694  C CE1 . TYR A 1 100 ? 14.353  14.225 22.645  1.00 115.01 ? 99  TYR A CE1 1 
ATOM   695  C CE2 . TYR A 1 100 ? 15.120  15.298 20.649  1.00 110.62 ? 99  TYR A CE2 1 
ATOM   696  C CZ  . TYR A 1 100 ? 14.640  14.181 21.296  1.00 114.93 ? 99  TYR A CZ  1 
ATOM   697  O OH  . TYR A 1 100 ? 14.447  13.018 20.589  1.00 115.37 ? 99  TYR A OH  1 
ATOM   698  N N   . ASP A 1 101 ? 13.278  19.772 21.850  1.00 110.38 ? 100 ASP A N   1 
ATOM   699  C CA  . ASP A 1 101 ? 12.496  20.079 20.665  1.00 108.42 ? 100 ASP A CA  1 
ATOM   700  C C   . ASP A 1 101 ? 13.249  19.619 19.414  1.00 107.80 ? 100 ASP A C   1 
ATOM   701  O O   . ASP A 1 101 ? 14.098  18.722 19.477  1.00 108.34 ? 100 ASP A O   1 
ATOM   702  C CB  . ASP A 1 101 ? 12.181  21.580 20.644  1.00 107.96 ? 100 ASP A CB  1 
ATOM   703  C CG  . ASP A 1 101 ? 13.422  22.439 20.803  1.00 110.21 ? 100 ASP A CG  1 
ATOM   704  O OD1 . ASP A 1 101 ? 14.512  21.875 21.034  1.00 110.84 ? 100 ASP A OD1 1 
ATOM   705  O OD2 . ASP A 1 101 ? 13.309  23.679 20.697  1.00 111.07 ? 100 ASP A OD2 1 
ATOM   706  N N   . LEU A 1 102 ? 12.944  20.230 18.266  1.00 106.60 ? 101 LEU A N   1 
ATOM   707  C CA  . LEU A 1 102 ? 13.656  19.885 17.039  1.00 105.15 ? 101 LEU A CA  1 
ATOM   708  C C   . LEU A 1 102 ? 15.075  20.438 17.050  1.00 105.27 ? 101 LEU A C   1 
ATOM   709  O O   . LEU A 1 102 ? 15.998  19.804 16.525  1.00 104.98 ? 101 LEU A O   1 
ATOM   710  C CB  . LEU A 1 102 ? 12.884  20.394 15.823  1.00 103.93 ? 101 LEU A CB  1 
ATOM   711  C CG  . LEU A 1 102 ? 11.672  19.552 15.423  1.00 106.32 ? 101 LEU A CG  1 
ATOM   712  C CD1 . LEU A 1 102 ? 10.890  20.228 14.312  1.00 105.65 ? 101 LEU A CD1 1 
ATOM   713  C CD2 . LEU A 1 102 ? 12.114  18.158 14.999  1.00 107.75 ? 101 LEU A CD2 1 
ATOM   714  N N   . ASN A 1 103 ? 15.270  21.617 17.642  1.00 98.61  ? 102 ASN A N   1 
ATOM   715  C CA  . ASN A 1 103 ? 16.613  22.165 17.788  1.00 97.46  ? 102 ASN A CA  1 
ATOM   716  C C   . ASN A 1 103 ? 17.416  21.452 18.865  1.00 98.63  ? 102 ASN A C   1 
ATOM   717  O O   . ASN A 1 103 ? 18.644  21.588 18.898  1.00 98.19  ? 102 ASN A O   1 
ATOM   718  C CB  . ASN A 1 103 ? 16.541  23.657 18.109  1.00 96.27  ? 102 ASN A CB  1 
ATOM   719  C CG  . ASN A 1 103 ? 16.270  24.501 16.885  1.00 99.16  ? 102 ASN A CG  1 
ATOM   720  O OD1 . ASN A 1 103 ? 16.877  24.298 15.834  1.00 96.51  ? 102 ASN A OD1 1 
ATOM   721  N ND2 . ASN A 1 103 ? 15.352  25.452 17.012  1.00 96.00  ? 102 ASN A ND2 1 
ATOM   722  N N   . GLY A 1 104 ? 16.758  20.698 19.739  1.00 100.22 ? 103 GLY A N   1 
ATOM   723  C CA  . GLY A 1 104 ? 17.423  20.070 20.858  1.00 102.41 ? 103 GLY A CA  1 
ATOM   724  C C   . GLY A 1 104 ? 17.535  20.929 22.095  1.00 104.90 ? 103 GLY A C   1 
ATOM   725  O O   . GLY A 1 104 ? 18.227  20.536 23.041  1.00 106.89 ? 103 GLY A O   1 
ATOM   726  N N   . ALA A 1 105 ? 16.877  22.086 22.121  1.00 102.00 ? 104 ALA A N   1 
ATOM   727  C CA  . ALA A 1 105 ? 16.971  22.995 23.253  1.00 103.36 ? 104 ALA A CA  1 
ATOM   728  C C   . ALA A 1 105 ? 16.114  22.498 24.411  1.00 107.20 ? 104 ALA A C   1 
ATOM   729  O O   . ALA A 1 105 ? 14.924  22.214 24.240  1.00 106.88 ? 104 ALA A O   1 
ATOM   730  C CB  . ALA A 1 105 ? 16.540  24.402 22.841  1.00 101.66 ? 104 ALA A CB  1 
ATOM   731  N N   . THR A 1 106 ? 16.723  22.393 25.583  1.00 101.07 ? 105 THR A N   1 
ATOM   732  C CA  . THR A 1 106 ? 16.031  22.026 26.810  1.00 104.03 ? 105 THR A CA  1 
ATOM   733  C C   . THR A 1 106 ? 15.502  23.275 27.498  1.00 106.12 ? 105 THR A C   1 
ATOM   734  O O   . THR A 1 106 ? 15.881  24.398 27.155  1.00 104.57 ? 105 THR A O   1 
ATOM   735  C CB  . THR A 1 106 ? 16.984  21.256 27.724  1.00 109.39 ? 105 THR A CB  1 
ATOM   736  O OG1 . THR A 1 106 ? 18.115  22.076 28.039  1.00 110.05 ? 105 THR A OG1 1 
ATOM   737  C CG2 . THR A 1 106 ? 17.461  19.981 27.043  1.00 108.14 ? 105 THR A CG2 1 
ATOM   738  N N   . PRO A 1 107 ? 14.597  23.124 28.474  1.00 100.77 ? 106 PRO A N   1 
ATOM   739  C CA  . PRO A 1 107 ? 14.141  24.311 29.218  1.00 102.08 ? 106 PRO A CA  1 
ATOM   740  C C   . PRO A 1 107 ? 15.271  25.067 29.892  1.00 104.51 ? 106 PRO A C   1 
ATOM   741  O O   . PRO A 1 107 ? 15.158  26.283 30.095  1.00 104.42 ? 106 PRO A O   1 
ATOM   742  C CB  . PRO A 1 107 ? 13.161  23.724 30.243  1.00 105.63 ? 106 PRO A CB  1 
ATOM   743  C CG  . PRO A 1 107 ? 12.667  22.475 29.610  1.00 106.13 ? 106 PRO A CG  1 
ATOM   744  C CD  . PRO A 1 107 ? 13.838  21.918 28.854  1.00 102.98 ? 106 PRO A CD  1 
ATOM   745  N N   . LEU A 1 108 ? 16.362  24.384 30.244  1.00 98.65  ? 107 LEU A N   1 
ATOM   746  C CA  . LEU A 1 108 ? 17.517  25.074 30.805  1.00 98.86  ? 107 LEU A CA  1 
ATOM   747  C C   . LEU A 1 108 ? 18.270  25.861 29.739  1.00 97.51  ? 107 LEU A C   1 
ATOM   748  O O   . LEU A 1 108 ? 18.829  26.922 30.036  1.00 96.93  ? 107 LEU A O   1 
ATOM   749  C CB  . LEU A 1 108 ? 18.447  24.068 31.487  1.00 100.22 ? 107 LEU A CB  1 
ATOM   750  C CG  . LEU A 1 108 ? 19.559  24.633 32.374  1.00 102.04 ? 107 LEU A CG  1 
ATOM   751  C CD1 . LEU A 1 108 ? 18.973  25.386 33.558  1.00 103.27 ? 107 LEU A CD1 1 
ATOM   752  C CD2 . LEU A 1 108 ? 20.485  23.524 32.847  1.00 103.99 ? 107 LEU A CD2 1 
ATOM   753  N N   . HIS A 1 109 ? 18.294  25.363 28.499  1.00 101.44 ? 108 HIS A N   1 
ATOM   754  C CA  . HIS A 1 109 ? 18.954  26.089 27.418  1.00 98.20  ? 108 HIS A CA  1 
ATOM   755  C C   . HIS A 1 109 ? 18.273  27.426 27.160  1.00 97.85  ? 108 HIS A C   1 
ATOM   756  O O   . HIS A 1 109 ? 18.932  28.469 27.082  1.00 97.09  ? 108 HIS A O   1 
ATOM   757  C CB  . HIS A 1 109 ? 18.963  25.249 26.140  1.00 95.46  ? 108 HIS A CB  1 
ATOM   758  C CG  . HIS A 1 109 ? 20.115  24.300 26.041  1.00 97.14  ? 108 HIS A CG  1 
ATOM   759  N ND1 . HIS A 1 109 ? 19.982  22.944 26.245  1.00 98.71  ? 108 HIS A ND1 1 
ATOM   760  C CD2 . HIS A 1 109 ? 21.420  24.510 25.748  1.00 97.45  ? 108 HIS A CD2 1 
ATOM   761  C CE1 . HIS A 1 109 ? 21.156  22.360 26.086  1.00 98.97  ? 108 HIS A CE1 1 
ATOM   762  N NE2 . HIS A 1 109 ? 22.046  23.288 25.784  1.00 98.40  ? 108 HIS A NE2 1 
ATOM   763  N N   . LEU A 1 110 ? 16.946  27.411 27.025  1.00 98.58  ? 109 LEU A N   1 
ATOM   764  C CA  . LEU A 1 110 ? 16.218  28.630 26.688  1.00 96.98  ? 109 LEU A CA  1 
ATOM   765  C C   . LEU A 1 110 ? 16.232  29.624 27.844  1.00 101.07 ? 109 LEU A C   1 
ATOM   766  O O   . LEU A 1 110 ? 16.339  30.836 27.626  1.00 99.77  ? 109 LEU A O   1 
ATOM   767  C CB  . LEU A 1 110 ? 14.786  28.280 26.284  1.00 96.22  ? 109 LEU A CB  1 
ATOM   768  C CG  . LEU A 1 110 ? 14.645  27.388 25.047  1.00 95.00  ? 109 LEU A CG  1 
ATOM   769  C CD1 . LEU A 1 110 ? 13.244  26.800 24.956  1.00 95.68  ? 109 LEU A CD1 1 
ATOM   770  C CD2 . LEU A 1 110 ? 14.980  28.167 23.784  1.00 92.12  ? 109 LEU A CD2 1 
ATOM   771  N N   . ALA A 1 111 ? 16.128  29.131 29.082  1.00 97.74  ? 110 ALA A N   1 
ATOM   772  C CA  . ALA A 1 111 ? 16.160  30.024 30.235  1.00 99.80  ? 110 ALA A CA  1 
ATOM   773  C C   . ALA A 1 111 ? 17.518  30.697 30.386  1.00 100.18 ? 110 ALA A C   1 
ATOM   774  O O   . ALA A 1 111 ? 17.591  31.856 30.812  1.00 99.99  ? 110 ALA A O   1 
ATOM   775  C CB  . ALA A 1 111 ? 15.802  29.255 31.509  1.00 102.56 ? 110 ALA A CB  1 
ATOM   776  N N   . ALA A 1 112 ? 18.600  29.993 30.045  1.00 97.71  ? 111 ALA A N   1 
ATOM   777  C CA  . ALA A 1 112 ? 19.925  30.597 30.137  1.00 96.77  ? 111 ALA A CA  1 
ATOM   778  C C   . ALA A 1 112 ? 20.149  31.614 29.025  1.00 95.66  ? 111 ALA A C   1 
ATOM   779  O O   . ALA A 1 112 ? 20.823  32.631 29.231  1.00 94.69  ? 111 ALA A O   1 
ATOM   780  C CB  . ALA A 1 112 ? 21.001  29.514 30.099  1.00 97.15  ? 111 ALA A CB  1 
ATOM   781  N N   . ARG A 1 113 ? 19.593  31.358 27.838  1.00 99.62  ? 112 ARG A N   1 
ATOM   782  C CA  . ARG A 1 113 ? 19.763  32.292 26.731  1.00 96.10  ? 112 ARG A CA  1 
ATOM   783  C C   . ARG A 1 113 ? 18.987  33.580 26.974  1.00 97.14  ? 112 ARG A C   1 
ATOM   784  O O   . ARG A 1 113 ? 19.493  34.676 26.706  1.00 95.70  ? 112 ARG A O   1 
ATOM   785  C CB  . ARG A 1 113 ? 19.329  31.640 25.418  1.00 92.63  ? 112 ARG A CB  1 
ATOM   786  C CG  . ARG A 1 113 ? 19.582  32.507 24.194  1.00 91.56  ? 112 ARG A CG  1 
ATOM   787  C CD  . ARG A 1 113 ? 19.459  31.713 22.904  1.00 91.37  ? 112 ARG A CD  1 
ATOM   788  N NE  . ARG A 1 113 ? 18.089  31.286 22.643  1.00 93.22  ? 112 ARG A NE  1 
ATOM   789  C CZ  . ARG A 1 113 ? 17.710  30.624 21.554  1.00 95.84  ? 112 ARG A CZ  1 
ATOM   790  N NH1 . ARG A 1 113 ? 18.601  30.313 20.621  1.00 90.23  ? 112 ARG A NH1 1 
ATOM   791  N NH2 . ARG A 1 113 ? 16.442  30.274 21.395  1.00 91.87  ? 112 ARG A NH2 1 
ATOM   792  N N   . MET A 1 114 ? 17.761  33.470 27.485  1.00 93.94  ? 113 MET A N   1 
ATOM   793  C CA  . MET A 1 114 ? 16.978  34.655 27.806  1.00 94.22  ? 113 MET A CA  1 
ATOM   794  C C   . MET A 1 114 ? 17.406  35.297 29.119  1.00 97.92  ? 113 MET A C   1 
ATOM   795  O O   . MET A 1 114 ? 17.181  36.497 29.308  1.00 97.21  ? 113 MET A O   1 
ATOM   796  C CB  . MET A 1 114 ? 15.491  34.302 27.850  1.00 95.37  ? 113 MET A CB  1 
ATOM   797  C CG  . MET A 1 114 ? 14.982  33.682 26.559  1.00 93.01  ? 113 MET A CG  1 
ATOM   798  S SD  . MET A 1 114 ? 15.428  34.664 25.114  1.00 89.50  ? 113 MET A SD  1 
ATOM   799  C CE  . MET A 1 114 ? 14.796  33.637 23.790  1.00 85.70  ? 113 MET A CE  1 
ATOM   800  N N   . GLY A 1 115 ? 18.014  34.532 30.023  1.00 96.29  ? 114 GLY A N   1 
ATOM   801  C CA  . GLY A 1 115 ? 18.594  35.091 31.228  1.00 96.52  ? 114 GLY A CA  1 
ATOM   802  C C   . GLY A 1 115 ? 17.636  35.254 32.390  1.00 99.54  ? 114 GLY A C   1 
ATOM   803  O O   . GLY A 1 115 ? 17.581  36.323 33.006  1.00 99.08  ? 114 GLY A O   1 
ATOM   804  N N   . HIS A 1 116 ? 16.881  34.207 32.707  1.00 96.36  ? 115 HIS A N   1 
ATOM   805  C CA  . HIS A 1 116 ? 15.971  34.202 33.851  1.00 98.23  ? 115 HIS A CA  1 
ATOM   806  C C   . HIS A 1 116 ? 16.595  33.327 34.935  1.00 100.23 ? 115 HIS A C   1 
ATOM   807  O O   . HIS A 1 116 ? 16.451  32.102 34.916  1.00 101.20 ? 115 HIS A O   1 
ATOM   808  C CB  . HIS A 1 116 ? 14.587  33.703 33.448  1.00 99.85  ? 115 HIS A CB  1 
ATOM   809  C CG  . HIS A 1 116 ? 13.981  34.460 32.307  1.00 99.69  ? 115 HIS A CG  1 
ATOM   810  N ND1 . HIS A 1 116 ? 13.624  35.787 32.401  1.00 99.73  ? 115 HIS A ND1 1 
ATOM   811  C CD2 . HIS A 1 116 ? 13.667  34.073 31.048  1.00 98.90  ? 115 HIS A CD2 1 
ATOM   812  C CE1 . HIS A 1 116 ? 13.118  36.187 31.247  1.00 98.04  ? 115 HIS A CE1 1 
ATOM   813  N NE2 . HIS A 1 116 ? 13.132  35.166 30.410  1.00 97.26  ? 115 HIS A NE2 1 
ATOM   814  N N   . VAL A 1 117 ? 17.280  33.966 35.887  1.00 100.47 ? 116 VAL A N   1 
ATOM   815  C CA  . VAL A 1 117 ? 18.042  33.225 36.889  1.00 100.84 ? 116 VAL A CA  1 
ATOM   816  C C   . VAL A 1 117 ? 17.111  32.476 37.836  1.00 104.60 ? 116 VAL A C   1 
ATOM   817  O O   . VAL A 1 117 ? 17.429  31.369 38.289  1.00 105.70 ? 116 VAL A O   1 
ATOM   818  C CB  . VAL A 1 117 ? 18.991  34.175 37.646  1.00 100.33 ? 116 VAL A CB  1 
ATOM   819  C CG1 . VAL A 1 117 ? 18.219  35.334 38.258  1.00 100.13 ? 116 VAL A CG1 1 
ATOM   820  C CG2 . VAL A 1 117 ? 19.770  33.419 38.713  1.00 101.35 ? 116 VAL A CG2 1 
ATOM   821  N N   . GLU A 1 118 ? 15.950  33.056 38.150  1.00 101.18 ? 117 GLU A N   1 
ATOM   822  C CA  . GLU A 1 118 ? 15.005  32.366 39.023  1.00 103.68 ? 117 GLU A CA  1 
ATOM   823  C C   . GLU A 1 118 ? 14.507  31.078 38.380  1.00 105.87 ? 117 GLU A C   1 
ATOM   824  O O   . GLU A 1 118 ? 14.397  30.044 39.048  1.00 107.53 ? 117 GLU A O   1 
ATOM   825  C CB  . GLU A 1 118 ? 13.830  33.281 39.370  1.00 104.98 ? 117 GLU A CB  1 
ATOM   826  C CG  . GLU A 1 118 ? 14.156  34.390 40.362  1.00 107.69 ? 117 GLU A CG  1 
ATOM   827  C CD  . GLU A 1 118 ? 14.638  35.659 39.688  1.00 111.51 ? 117 GLU A CD  1 
ATOM   828  O OE1 . GLU A 1 118 ? 14.922  35.619 38.472  1.00 108.31 ? 117 GLU A OE1 1 
ATOM   829  O OE2 . GLU A 1 118 ? 14.725  36.701 40.373  1.00 108.88 ? 117 GLU A OE2 1 
ATOM   830  N N   . ILE A 1 119 ? 14.210  31.119 37.080  1.00 102.41 ? 118 ILE A N   1 
ATOM   831  C CA  . ILE A 1 119 ? 13.757  29.918 36.387  1.00 102.86 ? 118 ILE A CA  1 
ATOM   832  C C   . ILE A 1 119 ? 14.904  28.924 36.234  1.00 103.66 ? 118 ILE A C   1 
ATOM   833  O O   . ILE A 1 119 ? 14.689  27.705 36.272  1.00 104.71 ? 118 ILE A O   1 
ATOM   834  C CB  . ILE A 1 119 ? 13.127  30.294 35.029  1.00 102.42 ? 118 ILE A CB  1 
ATOM   835  C CG1 . ILE A 1 119 ? 11.752  30.945 35.229  1.00 103.55 ? 118 ILE A CG1 1 
ATOM   836  C CG2 . ILE A 1 119 ? 12.995  29.078 34.125  1.00 102.28 ? 118 ILE A CG2 1 
ATOM   837  C CD1 . ILE A 1 119 ? 11.790  32.440 35.489  1.00 105.27 ? 118 ILE A CD1 1 
ATOM   838  N N   . VAL A 1 120 ? 16.135  29.418 36.086  1.00 103.20 ? 119 VAL A N   1 
ATOM   839  C CA  . VAL A 1 120 ? 17.289  28.528 35.969  1.00 102.74 ? 119 VAL A CA  1 
ATOM   840  C C   . VAL A 1 120 ? 17.491  27.742 37.259  1.00 105.88 ? 119 VAL A C   1 
ATOM   841  O O   . VAL A 1 120 ? 17.683  26.520 37.240  1.00 106.65 ? 119 VAL A O   1 
ATOM   842  C CB  . VAL A 1 120 ? 18.548  29.330 35.593  1.00 101.83 ? 119 VAL A CB  1 
ATOM   843  C CG1 . VAL A 1 120 ? 19.802  28.515 35.869  1.00 101.72 ? 119 VAL A CG1 1 
ATOM   844  C CG2 . VAL A 1 120 ? 18.493  29.743 34.131  1.00 99.93  ? 119 VAL A CG2 1 
ATOM   845  N N   . GLU A 1 121 ? 17.447  28.432 38.402  1.00 108.25 ? 120 GLU A N   1 
ATOM   846  C CA  . GLU A 1 121 ? 17.658  27.761 39.680  1.00 109.91 ? 120 GLU A CA  1 
ATOM   847  C C   . GLU A 1 121 ? 16.546  26.768 39.995  1.00 113.35 ? 120 GLU A C   1 
ATOM   848  O O   . GLU A 1 121 ? 16.806  25.727 40.609  1.00 114.64 ? 120 GLU A O   1 
ATOM   849  C CB  . GLU A 1 121 ? 17.779  28.793 40.802  1.00 110.30 ? 120 GLU A CB  1 
ATOM   850  C CG  . GLU A 1 121 ? 19.113  29.523 40.836  1.00 111.22 ? 120 GLU A CG  1 
ATOM   851  C CD  . GLU A 1 121 ? 19.194  30.531 41.965  1.00 117.35 ? 120 GLU A CD  1 
ATOM   852  O OE1 . GLU A 1 121 ? 18.206  31.266 42.179  1.00 116.34 ? 120 GLU A OE1 1 
ATOM   853  O OE2 . GLU A 1 121 ? 20.241  30.583 42.645  1.00 114.18 ? 120 GLU A OE2 1 
ATOM   854  N N   . VAL A 1 122 ? 15.309  27.067 39.588  1.00 109.56 ? 121 VAL A N   1 
ATOM   855  C CA  . VAL A 1 122 ? 14.196  26.162 39.866  1.00 111.65 ? 121 VAL A CA  1 
ATOM   856  C C   . VAL A 1 122 ? 14.319  24.888 39.039  1.00 112.56 ? 121 VAL A C   1 
ATOM   857  O O   . VAL A 1 122 ? 14.064  23.783 39.534  1.00 114.28 ? 121 VAL A O   1 
ATOM   858  C CB  . VAL A 1 122 ? 12.854  26.876 39.618  1.00 113.24 ? 121 VAL A CB  1 
ATOM   859  C CG1 . VAL A 1 122 ? 11.710  25.874 39.581  1.00 115.13 ? 121 VAL A CG1 1 
ATOM   860  C CG2 . VAL A 1 122 ? 12.606  27.921 40.694  1.00 113.90 ? 121 VAL A CG2 1 
ATOM   861  N N   . LEU A 1 123 ? 14.713  25.016 37.769  1.00 108.74 ? 122 LEU A N   1 
ATOM   862  C CA  . LEU A 1 123 ? 14.861  23.838 36.921  1.00 108.72 ? 122 LEU A CA  1 
ATOM   863  C C   . LEU A 1 123 ? 16.008  22.954 37.393  1.00 110.40 ? 122 LEU A C   1 
ATOM   864  O O   . LEU A 1 123 ? 15.888  21.723 37.398  1.00 112.96 ? 122 LEU A O   1 
ATOM   865  C CB  . LEU A 1 123 ? 15.071  24.261 35.468  1.00 104.44 ? 122 LEU A CB  1 
ATOM   866  C CG  . LEU A 1 123 ? 13.847  24.843 34.761  1.00 103.10 ? 122 LEU A CG  1 
ATOM   867  C CD1 . LEU A 1 123 ? 14.241  25.430 33.418  1.00 100.52 ? 122 LEU A CD1 1 
ATOM   868  C CD2 . LEU A 1 123 ? 12.780  23.775 34.587  1.00 105.74 ? 122 LEU A CD2 1 
ATOM   869  N N   . LEU A 1 124 ? 17.126  23.561 37.796  1.00 111.34 ? 123 LEU A N   1 
ATOM   870  C CA  . LEU A 1 124 ? 18.253  22.779 38.294  1.00 111.71 ? 123 LEU A CA  1 
ATOM   871  C C   . LEU A 1 124 ? 17.913  22.092 39.611  1.00 115.32 ? 123 LEU A C   1 
ATOM   872  O O   . LEU A 1 124 ? 18.330  20.952 39.849  1.00 116.37 ? 123 LEU A O   1 
ATOM   873  C CB  . LEU A 1 124 ? 19.482  23.674 38.452  1.00 110.06 ? 123 LEU A CB  1 
ATOM   874  C CG  . LEU A 1 124 ? 20.205  24.038 37.155  1.00 109.13 ? 123 LEU A CG  1 
ATOM   875  C CD1 . LEU A 1 124 ? 21.147  25.210 37.373  1.00 107.69 ? 123 LEU A CD1 1 
ATOM   876  C CD2 . LEU A 1 124 ? 20.964  22.832 36.623  1.00 109.75 ? 123 LEU A CD2 1 
ATOM   877  N N   . LYS A 1 125 ? 17.156  22.768 40.480  1.00 114.41 ? 124 LYS A N   1 
ATOM   878  C CA  . LYS A 1 125 ? 16.722  22.151 41.728  1.00 116.83 ? 124 LYS A CA  1 
ATOM   879  C C   . LYS A 1 125 ? 15.680  21.065 41.502  1.00 119.51 ? 124 LYS A C   1 
ATOM   880  O O   . LYS A 1 125 ? 15.535  20.177 42.348  1.00 121.69 ? 124 LYS A O   1 
ATOM   881  C CB  . LYS A 1 125 ? 16.169  23.214 42.678  1.00 118.18 ? 124 LYS A CB  1 
ATOM   882  N N   . TYR A 1 126 ? 14.950  21.117 40.385  1.00 116.54 ? 125 TYR A N   1 
ATOM   883  C CA  . TYR A 1 126 ? 13.983  20.076 40.062  1.00 116.55 ? 125 TYR A CA  1 
ATOM   884  C C   . TYR A 1 126 ? 14.625  18.863 39.405  1.00 115.35 ? 125 TYR A C   1 
ATOM   885  O O   . TYR A 1 126 ? 14.005  17.794 39.372  1.00 115.79 ? 125 TYR A O   1 
ATOM   886  C CB  . TYR A 1 126 ? 12.891  20.632 39.147  1.00 116.23 ? 125 TYR A CB  1 
ATOM   887  C CG  . TYR A 1 126 ? 11.537  20.744 39.807  1.00 119.11 ? 125 TYR A CG  1 
ATOM   888  C CD1 . TYR A 1 126 ? 10.634  19.689 39.769  1.00 120.16 ? 125 TYR A CD1 1 
ATOM   889  C CD2 . TYR A 1 126 ? 11.160  21.905 40.469  1.00 121.01 ? 125 TYR A CD2 1 
ATOM   890  C CE1 . TYR A 1 126 ? 9.394   19.787 40.372  1.00 122.19 ? 125 TYR A CE1 1 
ATOM   891  C CE2 . TYR A 1 126 ? 9.921   22.013 41.074  1.00 123.06 ? 125 TYR A CE2 1 
ATOM   892  C CZ  . TYR A 1 126 ? 9.043   20.952 41.022  1.00 125.55 ? 125 TYR A CZ  1 
ATOM   893  O OH  . TYR A 1 126 ? 7.810   21.057 41.624  1.00 127.33 ? 125 TYR A OH  1 
ATOM   894  N N   . GLY A 1 127 ? 15.839  19.001 38.880  1.00 122.94 ? 126 GLY A N   1 
ATOM   895  C CA  . GLY A 1 127 ? 16.534  17.875 38.289  1.00 120.76 ? 126 GLY A CA  1 
ATOM   896  C C   . GLY A 1 127 ? 16.854  18.050 36.819  1.00 118.43 ? 126 GLY A C   1 
ATOM   897  O O   . GLY A 1 127 ? 16.655  17.129 36.022  1.00 117.46 ? 126 GLY A O   1 
ATOM   898  N N   . ALA A 1 128 ? 17.352  19.224 36.446  1.00 122.81 ? 127 ALA A N   1 
ATOM   899  C CA  . ALA A 1 128 ? 17.738  19.491 35.069  1.00 119.82 ? 127 ALA A CA  1 
ATOM   900  C C   . ALA A 1 128 ? 19.213  19.174 34.865  1.00 117.88 ? 127 ALA A C   1 
ATOM   901  O O   . ALA A 1 128 ? 20.053  19.494 35.711  1.00 117.44 ? 127 ALA A O   1 
ATOM   902  C CB  . ALA A 1 128 ? 17.460  20.949 34.699  1.00 120.08 ? 127 ALA A CB  1 
ATOM   903  N N   . ASP A 1 129 ? 19.520  18.537 33.737  1.00 116.51 ? 128 ASP A N   1 
ATOM   904  C CA  . ASP A 1 129 ? 20.901  18.205 33.398  1.00 113.55 ? 128 ASP A CA  1 
ATOM   905  C C   . ASP A 1 129 ? 21.641  19.478 33.005  1.00 111.88 ? 128 ASP A C   1 
ATOM   906  O O   . ASP A 1 129 ? 21.321  20.104 31.990  1.00 111.11 ? 128 ASP A O   1 
ATOM   907  C CB  . ASP A 1 129 ? 20.937  17.177 32.272  1.00 113.63 ? 128 ASP A CB  1 
ATOM   908  C CG  . ASP A 1 129 ? 22.350  16.800 31.871  1.00 114.11 ? 128 ASP A CG  1 
ATOM   909  O OD1 . ASP A 1 129 ? 23.128  16.379 32.753  1.00 114.09 ? 128 ASP A OD1 1 
ATOM   910  O OD2 . ASP A 1 129 ? 22.683  16.917 30.674  1.00 114.38 ? 128 ASP A OD2 1 
ATOM   911  N N   . VAL A 1 130 ? 22.635  19.862 33.811  1.00 108.24 ? 129 VAL A N   1 
ATOM   912  C CA  . VAL A 1 130 ? 23.359  21.104 33.561  1.00 105.46 ? 129 VAL A CA  1 
ATOM   913  C C   . VAL A 1 130 ? 24.238  20.987 32.319  1.00 102.81 ? 129 VAL A C   1 
ATOM   914  O O   . VAL A 1 130 ? 24.535  21.994 31.664  1.00 100.60 ? 129 VAL A O   1 
ATOM   915  C CB  . VAL A 1 130 ? 24.174  21.494 34.810  1.00 106.80 ? 129 VAL A CB  1 
ATOM   916  C CG1 . VAL A 1 130 ? 25.232  20.443 35.118  1.00 105.46 ? 129 VAL A CG1 1 
ATOM   917  C CG2 . VAL A 1 130 ? 24.801  22.875 34.644  1.00 104.70 ? 129 VAL A CG2 1 
ATOM   918  N N   . ASN A 1 131 ? 24.655  19.773 31.964  1.00 107.00 ? 130 ASN A N   1 
ATOM   919  C CA  . ASN A 1 131 ? 25.506  19.541 30.797  1.00 104.52 ? 130 ASN A CA  1 
ATOM   920  C C   . ASN A 1 131 ? 24.714  19.016 29.606  1.00 107.21 ? 130 ASN A C   1 
ATOM   921  O O   . ASN A 1 131 ? 25.189  18.149 28.867  1.00 107.27 ? 130 ASN A O   1 
ATOM   922  C CB  . ASN A 1 131 ? 26.641  18.582 31.152  1.00 103.94 ? 130 ASN A CB  1 
ATOM   923  C CG  . ASN A 1 131 ? 27.681  19.216 32.057  1.00 108.89 ? 130 ASN A CG  1 
ATOM   924  O OD1 . ASN A 1 131 ? 27.455  20.278 32.636  1.00 106.50 ? 130 ASN A OD1 1 
ATOM   925  N ND2 . ASN A 1 131 ? 28.832  18.564 32.181  1.00 105.44 ? 130 ASN A ND2 1 
ATOM   926  N N   . ALA A 1 132 ? 23.503  19.522 29.394  1.00 99.71  ? 131 ALA A N   1 
ATOM   927  C CA  . ALA A 1 132 ? 22.709  19.103 28.248  1.00 101.73 ? 131 ALA A CA  1 
ATOM   928  C C   . ALA A 1 132 ? 23.267  19.706 26.963  1.00 101.69 ? 131 ALA A C   1 
ATOM   929  O O   . ALA A 1 132 ? 23.764  20.834 26.946  1.00 99.39  ? 131 ALA A O   1 
ATOM   930  C CB  . ALA A 1 132 ? 21.248  19.513 28.430  1.00 104.46 ? 131 ALA A CB  1 
ATOM   931  N N   . GLN A 1 133 ? 23.179  18.941 25.877  1.00 95.06  ? 132 GLN A N   1 
ATOM   932  C CA  . GLN A 1 133 ? 23.684  19.367 24.579  1.00 95.19  ? 132 GLN A CA  1 
ATOM   933  C C   . GLN A 1 133 ? 22.586  19.237 23.534  1.00 99.57  ? 132 GLN A C   1 
ATOM   934  O O   . GLN A 1 133 ? 21.887  18.221 23.480  1.00 101.11 ? 132 GLN A O   1 
ATOM   935  C CB  . GLN A 1 133 ? 24.911  18.546 24.164  1.00 94.78  ? 132 GLN A CB  1 
ATOM   936  C CG  . GLN A 1 133 ? 26.067  18.615 25.154  1.00 95.42  ? 132 GLN A CG  1 
ATOM   937  C CD  . GLN A 1 133 ? 27.268  17.792 24.719  1.00 99.53  ? 132 GLN A CD  1 
ATOM   938  O OE1 . GLN A 1 133 ? 27.341  17.327 23.580  1.00 99.89  ? 132 GLN A OE1 1 
ATOM   939  N NE2 . GLN A 1 133 ? 28.217  17.608 25.629  1.00 93.98  ? 132 GLN A NE2 1 
ATOM   940  N N   . ASP A 1 134 ? 22.443  20.267 22.705  1.00 94.27  ? 133 ASP A N   1 
ATOM   941  C CA  . ASP A 1 134 ? 21.422  20.320 21.673  1.00 96.18  ? 133 ASP A CA  1 
ATOM   942  C C   . ASP A 1 134 ? 21.991  19.786 20.354  1.00 97.26  ? 133 ASP A C   1 
ATOM   943  O O   . ASP A 1 134 ? 23.015  19.090 20.338  1.00 96.68  ? 133 ASP A O   1 
ATOM   944  C CB  . ASP A 1 134 ? 20.902  21.757 21.548  1.00 97.17  ? 133 ASP A CB  1 
ATOM   945  C CG  . ASP A 1 134 ? 21.992  22.742 21.165  1.00 99.48  ? 133 ASP A CG  1 
ATOM   946  O OD1 . ASP A 1 134 ? 23.163  22.502 21.525  1.00 97.75  ? 133 ASP A OD1 1 
ATOM   947  O OD2 . ASP A 1 134 ? 21.675  23.758 20.504  1.00 102.08 ? 133 ASP A OD2 1 
ATOM   948  N N   . ALA A 1 135 ? 21.326  20.106 19.239  1.00 94.74  ? 134 ALA A N   1 
ATOM   949  C CA  . ALA A 1 135 ? 21.820  19.684 17.933  1.00 93.87  ? 134 ALA A CA  1 
ATOM   950  C C   . ALA A 1 135 ? 23.129  20.371 17.575  1.00 94.55  ? 134 ALA A C   1 
ATOM   951  O O   . ALA A 1 135 ? 23.963  19.786 16.875  1.00 93.64  ? 134 ALA A O   1 
ATOM   952  C CB  . ALA A 1 135 ? 20.770  19.962 16.860  1.00 93.91  ? 134 ALA A CB  1 
ATOM   953  N N   . ALA A 1 136 ? 23.326  21.607 18.037  1.00 93.93  ? 135 ALA A N   1 
ATOM   954  C CA  . ALA A 1 136 ? 24.590  22.290 17.799  1.00 92.59  ? 135 ALA A CA  1 
ATOM   955  C C   . ALA A 1 136 ? 25.703  21.766 18.696  1.00 91.42  ? 135 ALA A C   1 
ATOM   956  O O   . ALA A 1 136 ? 26.882  21.984 18.397  1.00 90.29  ? 135 ALA A O   1 
ATOM   957  C CB  . ALA A 1 136 ? 24.423  23.797 17.999  1.00 91.89  ? 135 ALA A CB  1 
ATOM   958  N N   . GLY A 1 137 ? 25.357  21.079 19.780  1.00 98.51  ? 136 GLY A N   1 
ATOM   959  C CA  . GLY A 1 137 ? 26.339  20.540 20.695  1.00 96.51  ? 136 GLY A CA  1 
ATOM   960  C C   . GLY A 1 137 ? 26.751  21.459 21.821  1.00 93.77  ? 136 GLY A C   1 
ATOM   961  O O   . GLY A 1 137 ? 27.738  21.164 22.506  1.00 90.44  ? 136 GLY A O   1 
ATOM   962  N N   . GLY A 1 138 ? 26.031  22.554 22.041  1.00 96.38  ? 137 GLY A N   1 
ATOM   963  C CA  . GLY A 1 138 ? 26.375  23.519 23.073  1.00 91.42  ? 137 GLY A CA  1 
ATOM   964  C C   . GLY A 1 138 ? 25.575  23.292 24.347  1.00 91.96  ? 137 GLY A C   1 
ATOM   965  O O   . GLY A 1 138 ? 24.403  22.918 24.300  1.00 95.07  ? 137 GLY A O   1 
ATOM   966  N N   . THR A 1 139 ? 26.227  23.528 25.478  1.00 88.35  ? 138 THR A N   1 
ATOM   967  C CA  . THR A 1 139 ? 25.589  23.412 26.780  1.00 88.50  ? 138 THR A CA  1 
ATOM   968  C C   . THR A 1 139 ? 24.805  24.682 27.086  1.00 89.86  ? 138 THR A C   1 
ATOM   969  O O   . THR A 1 139 ? 24.949  25.695 26.400  1.00 88.35  ? 138 THR A O   1 
ATOM   970  C CB  . THR A 1 139 ? 26.648  23.146 27.849  1.00 88.26  ? 138 THR A CB  1 
ATOM   971  O OG1 . THR A 1 139 ? 27.622  24.197 27.835  1.00 84.14  ? 138 THR A OG1 1 
ATOM   972  C CG2 . THR A 1 139 ? 27.339  21.814 27.595  1.00 88.46  ? 138 THR A CG2 1 
ATOM   973  N N   . PRO A 1 140 ? 23.938  24.658 28.104  1.00 87.84  ? 139 PRO A N   1 
ATOM   974  C CA  . PRO A 1 140 ? 23.297  25.911 28.535  1.00 88.48  ? 139 PRO A CA  1 
ATOM   975  C C   . PRO A 1 140 ? 24.292  26.987 28.931  1.00 86.63  ? 139 PRO A C   1 
ATOM   976  O O   . PRO A 1 140 ? 23.944  28.174 28.898  1.00 87.24  ? 139 PRO A O   1 
ATOM   977  C CB  . PRO A 1 140 ? 22.437  25.474 29.727  1.00 92.52  ? 139 PRO A CB  1 
ATOM   978  C CG  . PRO A 1 140 ? 22.131  24.049 29.451  1.00 94.89  ? 139 PRO A CG  1 
ATOM   979  C CD  . PRO A 1 140 ? 23.364  23.489 28.795  1.00 90.59  ? 139 PRO A CD  1 
ATOM   980  N N   . LEU A 1 141 ? 25.518  26.611 29.303  1.00 87.05  ? 140 LEU A N   1 
ATOM   981  C CA  . LEU A 1 141 ? 26.547  27.611 29.559  1.00 83.89  ? 140 LEU A CA  1 
ATOM   982  C C   . LEU A 1 141 ? 26.953  28.329 28.278  1.00 81.96  ? 140 LEU A C   1 
ATOM   983  O O   . LEU A 1 141 ? 27.315  29.510 28.321  1.00 80.32  ? 140 LEU A O   1 
ATOM   984  C CB  . LEU A 1 141 ? 27.762  26.959 30.216  1.00 84.18  ? 140 LEU A CB  1 
ATOM   985  C CG  . LEU A 1 141 ? 28.750  27.905 30.899  1.00 83.67  ? 140 LEU A CG  1 
ATOM   986  C CD1 . LEU A 1 141 ? 28.095  28.591 32.088  1.00 86.03  ? 140 LEU A CD1 1 
ATOM   987  C CD2 . LEU A 1 141 ? 29.998  27.156 31.328  1.00 84.73  ? 140 LEU A CD2 1 
ATOM   988  N N   . HIS A 1 142 ? 26.898  27.638 27.136  1.00 86.27  ? 141 HIS A N   1 
ATOM   989  C CA  . HIS A 1 142 ? 27.148  28.297 25.858  1.00 84.68  ? 141 HIS A CA  1 
ATOM   990  C C   . HIS A 1 142 ? 26.097  29.364 25.581  1.00 87.76  ? 141 HIS A C   1 
ATOM   991  O O   . HIS A 1 142 ? 26.428  30.501 25.226  1.00 85.35  ? 141 HIS A O   1 
ATOM   992  C CB  . HIS A 1 142 ? 27.175  27.269 24.725  1.00 87.11  ? 141 HIS A CB  1 
ATOM   993  C CG  . HIS A 1 142 ? 28.458  26.505 24.626  1.00 86.56  ? 141 HIS A CG  1 
ATOM   994  N ND1 . HIS A 1 142 ? 28.624  25.252 25.176  1.00 88.57  ? 141 HIS A ND1 1 
ATOM   995  C CD2 . HIS A 1 142 ? 29.636  26.815 24.035  1.00 84.54  ? 141 HIS A CD2 1 
ATOM   996  C CE1 . HIS A 1 142 ? 29.849  24.824 24.929  1.00 87.03  ? 141 HIS A CE1 1 
ATOM   997  N NE2 . HIS A 1 142 ? 30.484  25.754 24.238  1.00 84.85  ? 141 HIS A NE2 1 
ATOM   998  N N   . GLU A 1 143 ? 24.818  29.010 25.733  1.00 83.10  ? 142 GLU A N   1 
ATOM   999  C CA  . GLU A 1 143 ? 23.754  29.987 25.524  1.00 85.57  ? 142 GLU A CA  1 
ATOM   1000 C C   . GLU A 1 143 ? 23.834  31.128 26.529  1.00 86.45  ? 142 GLU A C   1 
ATOM   1001 O O   . GLU A 1 143 ? 23.462  32.262 26.209  1.00 86.67  ? 142 GLU A O   1 
ATOM   1002 C CB  . GLU A 1 143 ? 22.386  29.308 25.605  1.00 91.14  ? 142 GLU A CB  1 
ATOM   1003 C CG  . GLU A 1 143 ? 22.140  28.236 24.553  1.00 96.70  ? 142 GLU A CG  1 
ATOM   1004 C CD  . GLU A 1 143 ? 21.733  28.805 23.203  1.00 105.15 ? 142 GLU A CD  1 
ATOM   1005 O OE1 . GLU A 1 143 ? 22.436  29.696 22.681  1.00 100.25 ? 142 GLU A OE1 1 
ATOM   1006 O OE2 . GLU A 1 143 ? 20.700  28.357 22.664  1.00 107.87 ? 142 GLU A OE2 1 
ATOM   1007 N N   . ALA A 1 144 ? 24.315  30.853 27.743  1.00 85.57  ? 143 ALA A N   1 
ATOM   1008 C CA  . ALA A 1 144 ? 24.439  31.916 28.734  1.00 87.24  ? 143 ALA A CA  1 
ATOM   1009 C C   . ALA A 1 144 ? 25.645  32.802 28.446  1.00 84.47  ? 143 ALA A C   1 
ATOM   1010 O O   . ALA A 1 144 ? 25.590  34.019 28.655  1.00 86.00  ? 143 ALA A O   1 
ATOM   1011 C CB  . ALA A 1 144 ? 24.527  31.319 30.136  1.00 90.27  ? 143 ALA A CB  1 
ATOM   1012 N N   . ALA A 1 145 ? 26.738  32.212 27.958  1.00 83.91  ? 144 ALA A N   1 
ATOM   1013 C CA  . ALA A 1 145 ? 27.922  32.988 27.606  1.00 80.99  ? 144 ALA A CA  1 
ATOM   1014 C C   . ALA A 1 145 ? 27.720  33.796 26.331  1.00 79.42  ? 144 ALA A C   1 
ATOM   1015 O O   . ALA A 1 145 ? 28.294  34.881 26.196  1.00 77.97  ? 144 ALA A O   1 
ATOM   1016 C CB  . ALA A 1 145 ? 29.135  32.068 27.453  1.00 78.47  ? 144 ALA A CB  1 
ATOM   1017 N N   . ARG A 1 146 ? 26.931  33.290 25.381  1.00 79.68  ? 145 ARG A N   1 
ATOM   1018 C CA  . ARG A 1 146 ? 26.682  34.059 24.166  1.00 78.56  ? 145 ARG A CA  1 
ATOM   1019 C C   . ARG A 1 146 ? 25.802  35.269 24.453  1.00 82.34  ? 145 ARG A C   1 
ATOM   1020 O O   . ARG A 1 146 ? 26.005  36.343 23.874  1.00 80.36  ? 145 ARG A O   1 
ATOM   1021 C CB  . ARG A 1 146 ? 26.049  33.169 23.097  1.00 80.61  ? 145 ARG A CB  1 
ATOM   1022 N N   . ALA A 1 147 ? 24.827  35.118 25.352  1.00 86.85  ? 146 ALA A N   1 
ATOM   1023 C CA  . ALA A 1 147 ? 23.946  36.232 25.686  1.00 89.98  ? 146 ALA A CA  1 
ATOM   1024 C C   . ALA A 1 147 ? 24.605  37.197 26.665  1.00 92.19  ? 146 ALA A C   1 
ATOM   1025 O O   . ALA A 1 147 ? 24.413  38.414 26.563  1.00 92.72  ? 146 ALA A O   1 
ATOM   1026 C CB  . ALA A 1 147 ? 22.628  35.708 26.257  1.00 95.47  ? 146 ALA A CB  1 
ATOM   1027 N N   . GLY A 1 148 ? 25.379  36.679 27.617  1.00 85.24  ? 147 GLY A N   1 
ATOM   1028 C CA  . GLY A 1 148 ? 26.100  37.524 28.549  1.00 87.40  ? 147 GLY A CA  1 
ATOM   1029 C C   . GLY A 1 148 ? 25.373  37.773 29.855  1.00 96.12  ? 147 GLY A C   1 
ATOM   1030 O O   . GLY A 1 148 ? 25.209  38.923 30.271  1.00 98.65  ? 147 GLY A O   1 
ATOM   1031 N N   . HIS A 1 149 ? 24.934  36.703 30.513  1.00 91.74  ? 148 HIS A N   1 
ATOM   1032 C CA  . HIS A 1 149 ? 24.256  36.784 31.804  1.00 98.73  ? 148 HIS A CA  1 
ATOM   1033 C C   . HIS A 1 149 ? 25.205  36.251 32.871  1.00 102.26 ? 148 HIS A C   1 
ATOM   1034 O O   . HIS A 1 149 ? 25.516  35.055 32.891  1.00 99.53  ? 148 HIS A O   1 
ATOM   1035 C CB  . HIS A 1 149 ? 22.945  36.000 31.787  1.00 100.80 ? 148 HIS A CB  1 
ATOM   1036 C CG  . HIS A 1 149 ? 21.994  36.435 30.715  1.00 99.55  ? 148 HIS A CG  1 
ATOM   1037 N ND1 . HIS A 1 149 ? 21.325  37.639 30.757  1.00 101.18 ? 148 HIS A ND1 1 
ATOM   1038 C CD2 . HIS A 1 149 ? 21.594  35.821 29.576  1.00 97.04  ? 148 HIS A CD2 1 
ATOM   1039 C CE1 . HIS A 1 149 ? 20.557  37.751 29.687  1.00 98.67  ? 148 HIS A CE1 1 
ATOM   1040 N NE2 . HIS A 1 149 ? 20.701  36.661 28.955  1.00 96.72  ? 148 HIS A NE2 1 
ATOM   1041 N N   . LEU A 1 150 ? 25.658  37.138 33.759  1.00 91.97  ? 149 LEU A N   1 
ATOM   1042 C CA  . LEU A 1 150 ? 26.650  36.750 34.757  1.00 94.86  ? 149 LEU A CA  1 
ATOM   1043 C C   . LEU A 1 150 ? 26.061  35.795 35.787  1.00 98.92  ? 149 LEU A C   1 
ATOM   1044 O O   . LEU A 1 150 ? 26.658  34.758 36.099  1.00 94.64  ? 149 LEU A O   1 
ATOM   1045 C CB  . LEU A 1 150 ? 27.215  37.993 35.445  1.00 97.38  ? 149 LEU A CB  1 
ATOM   1046 C CG  . LEU A 1 150 ? 28.246  37.733 36.544  1.00 98.76  ? 149 LEU A CG  1 
ATOM   1047 C CD1 . LEU A 1 150 ? 29.582  37.322 35.945  1.00 94.03  ? 149 LEU A CD1 1 
ATOM   1048 C CD2 . LEU A 1 150 ? 28.405  38.952 37.440  1.00 101.49 ? 149 LEU A CD2 1 
ATOM   1049 N N   . GLU A 1 151 ? 24.887  36.128 36.330  1.00 99.66  ? 150 GLU A N   1 
ATOM   1050 C CA  . GLU A 1 151 ? 24.340  35.341 37.430  1.00 100.79 ? 150 GLU A CA  1 
ATOM   1051 C C   . GLU A 1 151 ? 23.947  33.938 36.986  1.00 99.72  ? 150 GLU A C   1 
ATOM   1052 O O   . GLU A 1 151 ? 24.038  32.994 37.778  1.00 98.75  ? 150 GLU A O   1 
ATOM   1053 C CB  . GLU A 1 151 ? 23.144  36.060 38.054  1.00 104.10 ? 150 GLU A CB  1 
ATOM   1054 C CG  . GLU A 1 151 ? 23.177  36.067 39.576  1.00 109.14 ? 150 GLU A CG  1 
ATOM   1055 C CD  . GLU A 1 151 ? 21.900  36.602 40.195  1.00 117.48 ? 150 GLU A CD  1 
ATOM   1056 O OE1 . GLU A 1 151 ? 21.207  37.407 39.540  1.00 115.74 ? 150 GLU A OE1 1 
ATOM   1057 O OE2 . GLU A 1 151 ? 21.589  36.209 41.340  1.00 116.95 ? 150 GLU A OE2 1 
ATOM   1058 N N   . ILE A 1 152 ? 23.513  33.776 35.735  1.00 102.08 ? 151 ILE A N   1 
ATOM   1059 C CA  . ILE A 1 152 ? 23.192  32.441 35.240  1.00 98.60  ? 151 ILE A CA  1 
ATOM   1060 C C   . ILE A 1 152 ? 24.461  31.606 35.109  1.00 93.77  ? 151 ILE A C   1 
ATOM   1061 O O   . ILE A 1 152 ? 24.468  30.408 35.418  1.00 92.90  ? 151 ILE A O   1 
ATOM   1062 C CB  . ILE A 1 152 ? 22.421  32.529 33.909  1.00 95.49  ? 151 ILE A CB  1 
ATOM   1063 C CG1 . ILE A 1 152 ? 20.965  32.940 34.148  1.00 99.98  ? 151 ILE A CG1 1 
ATOM   1064 C CG2 . ILE A 1 152 ? 22.464  31.203 33.167  1.00 91.06  ? 151 ILE A CG2 1 
ATOM   1065 C CD1 . ILE A 1 152 ? 20.745  34.432 34.285  1.00 102.90 ? 151 ILE A CD1 1 
ATOM   1066 N N   . VAL A 1 153 ? 25.558  32.228 34.671  1.00 102.68 ? 152 VAL A N   1 
ATOM   1067 C CA  . VAL A 1 153 ? 26.823  31.509 34.552  1.00 96.63  ? 152 VAL A CA  1 
ATOM   1068 C C   . VAL A 1 153 ? 27.319  31.063 35.923  1.00 99.69  ? 152 VAL A C   1 
ATOM   1069 O O   . VAL A 1 153 ? 27.767  29.923 36.094  1.00 96.68  ? 152 VAL A O   1 
ATOM   1070 C CB  . VAL A 1 153 ? 27.866  32.379 33.826  1.00 94.03  ? 152 VAL A CB  1 
ATOM   1071 C CG1 . VAL A 1 153 ? 29.251  31.766 33.947  1.00 89.03  ? 152 VAL A CG1 1 
ATOM   1072 C CG2 . VAL A 1 153 ? 27.489  32.547 32.362  1.00 89.79  ? 152 VAL A CG2 1 
ATOM   1073 N N   . GLU A 1 154 ? 27.243  31.948 36.921  1.00 95.86  ? 153 GLU A N   1 
ATOM   1074 C CA  . GLU A 1 154 ? 27.689  31.586 38.264  1.00 97.56  ? 153 GLU A CA  1 
ATOM   1075 C C   . GLU A 1 154 ? 26.855  30.446 38.836  1.00 100.21 ? 153 GLU A C   1 
ATOM   1076 O O   . GLU A 1 154 ? 27.377  29.587 39.556  1.00 99.28  ? 153 GLU A O   1 
ATOM   1077 C CB  . GLU A 1 154 ? 27.634  32.805 39.186  1.00 103.24 ? 153 GLU A CB  1 
ATOM   1078 C CG  . GLU A 1 154 ? 28.812  33.757 39.042  1.00 105.03 ? 153 GLU A CG  1 
ATOM   1079 C CD  . GLU A 1 154 ? 28.747  34.921 40.015  1.00 115.75 ? 153 GLU A CD  1 
ATOM   1080 O OE1 . GLU A 1 154 ? 27.734  35.653 40.008  1.00 117.83 ? 153 GLU A OE1 1 
ATOM   1081 O OE2 . GLU A 1 154 ? 29.707  35.100 40.795  1.00 112.88 ? 153 GLU A OE2 1 
ATOM   1082 N N   . VAL A 1 155 ? 25.559  30.418 38.523  1.00 99.18  ? 154 VAL A N   1 
ATOM   1083 C CA  . VAL A 1 155 ? 24.696  29.360 39.037  1.00 100.81 ? 154 VAL A CA  1 
ATOM   1084 C C   . VAL A 1 155 ? 24.988  28.039 38.333  1.00 97.31  ? 154 VAL A C   1 
ATOM   1085 O O   . VAL A 1 155 ? 25.084  26.987 38.977  1.00 97.39  ? 154 VAL A O   1 
ATOM   1086 C CB  . VAL A 1 155 ? 23.217  29.766 38.902  1.00 105.70 ? 154 VAL A CB  1 
ATOM   1087 C CG1 . VAL A 1 155 ? 22.308  28.567 39.128  1.00 106.43 ? 154 VAL A CG1 1 
ATOM   1088 C CG2 . VAL A 1 155 ? 22.883  30.876 39.888  1.00 109.82 ? 154 VAL A CG2 1 
ATOM   1089 N N   . LEU A 1 156 ? 25.141  28.071 37.006  1.00 97.38  ? 155 LEU A N   1 
ATOM   1090 C CA  . LEU A 1 156 ? 25.398  26.840 36.263  1.00 93.62  ? 155 LEU A CA  1 
ATOM   1091 C C   . LEU A 1 156 ? 26.727  26.214 36.667  1.00 93.73  ? 155 LEU A C   1 
ATOM   1092 O O   . LEU A 1 156 ? 26.818  24.994 36.848  1.00 95.99  ? 155 LEU A O   1 
ATOM   1093 C CB  . LEU A 1 156 ? 25.373  27.119 34.761  1.00 89.60  ? 155 LEU A CB  1 
ATOM   1094 C CG  . LEU A 1 156 ? 24.010  27.467 34.166  1.00 93.68  ? 155 LEU A CG  1 
ATOM   1095 C CD1 . LEU A 1 156 ? 24.153  27.830 32.699  1.00 90.14  ? 155 LEU A CD1 1 
ATOM   1096 C CD2 . LEU A 1 156 ? 23.039  26.310 34.345  1.00 96.49  ? 155 LEU A CD2 1 
ATOM   1097 N N   . LEU A 1 157 ? 27.770  27.035 36.813  1.00 98.71  ? 156 LEU A N   1 
ATOM   1098 C CA  . LEU A 1 157 ? 29.069  26.513 37.223  1.00 96.20  ? 156 LEU A CA  1 
ATOM   1099 C C   . LEU A 1 157 ? 29.038  25.980 38.649  1.00 101.27 ? 156 LEU A C   1 
ATOM   1100 O O   . LEU A 1 157 ? 29.812  25.076 38.987  1.00 100.87 ? 156 LEU A O   1 
ATOM   1101 C CB  . LEU A 1 157 ? 30.136  27.596 37.083  1.00 93.95  ? 156 LEU A CB  1 
ATOM   1102 C CG  . LEU A 1 157 ? 30.462  28.027 35.654  1.00 90.51  ? 156 LEU A CG  1 
ATOM   1103 C CD1 . LEU A 1 157 ? 31.394  29.226 35.660  1.00 89.59  ? 156 LEU A CD1 1 
ATOM   1104 C CD2 . LEU A 1 157 ? 31.076  26.872 34.883  1.00 86.97  ? 156 LEU A CD2 1 
ATOM   1105 N N   . LYS A 1 158 ? 28.161  26.521 39.497  1.00 93.30  ? 157 LYS A N   1 
ATOM   1106 C CA  . LYS A 1 158 ? 28.056  26.018 40.863  1.00 99.01  ? 157 LYS A CA  1 
ATOM   1107 C C   . LYS A 1 158 ? 27.337  24.677 40.912  1.00 101.48 ? 157 LYS A C   1 
ATOM   1108 O O   . LYS A 1 158 ? 27.626  23.854 41.789  1.00 106.28 ? 157 LYS A O   1 
ATOM   1109 C CB  . LYS A 1 158 ? 27.343  27.040 41.748  1.00 101.19 ? 157 LYS A CB  1 
ATOM   1110 N N   . TYR A 1 159 ? 26.403  24.437 39.988  1.00 97.58  ? 158 TYR A N   1 
ATOM   1111 C CA  . TYR A 1 159 ? 25.700  23.161 39.942  1.00 98.59  ? 158 TYR A CA  1 
ATOM   1112 C C   . TYR A 1 159 ? 26.503  22.070 39.248  1.00 97.45  ? 158 TYR A C   1 
ATOM   1113 O O   . TYR A 1 159 ? 26.188  20.887 39.417  1.00 100.65 ? 158 TYR A O   1 
ATOM   1114 C CB  . TYR A 1 159 ? 24.347  23.322 39.243  1.00 100.08 ? 158 TYR A CB  1 
ATOM   1115 C CG  . TYR A 1 159 ? 23.230  23.775 40.157  1.00 105.61 ? 158 TYR A CG  1 
ATOM   1116 C CD1 . TYR A 1 159 ? 23.017  25.124 40.412  1.00 107.86 ? 158 TYR A CD1 1 
ATOM   1117 C CD2 . TYR A 1 159 ? 22.386  22.853 40.763  1.00 109.05 ? 158 TYR A CD2 1 
ATOM   1118 C CE1 . TYR A 1 159 ? 21.996  25.543 41.244  1.00 112.52 ? 158 TYR A CE1 1 
ATOM   1119 C CE2 . TYR A 1 159 ? 21.361  23.262 41.597  1.00 113.52 ? 158 TYR A CE2 1 
ATOM   1120 C CZ  . TYR A 1 159 ? 21.171  24.609 41.834  1.00 117.09 ? 158 TYR A CZ  1 
ATOM   1121 O OH  . TYR A 1 159 ? 20.154  25.025 42.663  1.00 121.15 ? 158 TYR A OH  1 
ATOM   1122 N N   . GLY A 1 160 ? 27.522  22.434 38.473  1.00 106.08 ? 159 GLY A N   1 
ATOM   1123 C CA  . GLY A 1 160 ? 28.376  21.445 37.846  1.00 102.91 ? 159 GLY A CA  1 
ATOM   1124 C C   . GLY A 1 160 ? 28.452  21.556 36.338  1.00 100.50 ? 159 GLY A C   1 
ATOM   1125 O O   . GLY A 1 160 ? 28.487  20.540 35.638  1.00 99.48  ? 159 GLY A O   1 
ATOM   1126 N N   . ALA A 1 161 ? 28.483  22.781 35.822  1.00 102.00 ? 160 ALA A N   1 
ATOM   1127 C CA  . ALA A 1 161 ? 28.593  22.976 34.384  1.00 98.26  ? 160 ALA A CA  1 
ATOM   1128 C C   . ALA A 1 161 ? 29.990  22.605 33.898  1.00 96.15  ? 160 ALA A C   1 
ATOM   1129 O O   . ALA A 1 161 ? 30.967  22.642 34.651  1.00 95.98  ? 160 ALA A O   1 
ATOM   1130 C CB  . ALA A 1 161 ? 28.276  24.425 34.013  1.00 97.91  ? 160 ALA A CB  1 
ATOM   1131 N N   . ASP A 1 162 ? 30.075  22.238 32.621  1.00 99.69  ? 161 ASP A N   1 
ATOM   1132 C CA  . ASP A 1 162 ? 31.343  21.876 31.994  1.00 97.10  ? 161 ASP A CA  1 
ATOM   1133 C C   . ASP A 1 162 ? 31.986  23.147 31.448  1.00 95.12  ? 161 ASP A C   1 
ATOM   1134 O O   . ASP A 1 162 ? 31.490  23.737 30.483  1.00 94.17  ? 161 ASP A O   1 
ATOM   1135 C CB  . ASP A 1 162 ? 31.125  20.842 30.892  1.00 98.60  ? 161 ASP A CB  1 
ATOM   1136 C CG  . ASP A 1 162 ? 32.409  20.135 30.486  1.00 100.81 ? 161 ASP A CG  1 
ATOM   1137 O OD1 . ASP A 1 162 ? 33.412  20.822 30.198  1.00 98.50  ? 161 ASP A OD1 1 
ATOM   1138 O OD2 . ASP A 1 162 ? 32.416  18.885 30.462  1.00 105.54 ? 161 ASP A OD2 1 
ATOM   1139 N N   . VAL A 1 163 ? 33.092  23.565 32.068  1.00 95.06  ? 162 VAL A N   1 
ATOM   1140 C CA  . VAL A 1 163 ? 33.737  24.814 31.676  1.00 91.98  ? 162 VAL A CA  1 
ATOM   1141 C C   . VAL A 1 163 ? 34.398  24.683 30.310  1.00 90.98  ? 162 VAL A C   1 
ATOM   1142 O O   . VAL A 1 163 ? 34.535  25.673 29.581  1.00 88.61  ? 162 VAL A O   1 
ATOM   1143 C CB  . VAL A 1 163 ? 34.751  25.248 32.752  1.00 92.87  ? 162 VAL A CB  1 
ATOM   1144 C CG1 . VAL A 1 163 ? 35.091  26.725 32.603  1.00 90.99  ? 162 VAL A CG1 1 
ATOM   1145 C CG2 . VAL A 1 163 ? 34.211  24.952 34.143  1.00 96.18  ? 162 VAL A CG2 1 
ATOM   1146 N N   . ASN A 1 164 ? 34.817  23.476 29.938  1.00 91.76  ? 163 ASN A N   1 
ATOM   1147 C CA  . ASN A 1 164 ? 35.484  23.221 28.666  1.00 91.17  ? 163 ASN A CA  1 
ATOM   1148 C C   . ASN A 1 164 ? 34.598  22.408 27.725  1.00 95.26  ? 163 ASN A C   1 
ATOM   1149 O O   . ASN A 1 164 ? 35.065  21.495 27.041  1.00 97.10  ? 163 ASN A O   1 
ATOM   1150 C CB  . ASN A 1 164 ? 36.819  22.514 28.889  1.00 91.67  ? 163 ASN A CB  1 
ATOM   1151 C CG  . ASN A 1 164 ? 37.793  23.348 29.702  1.00 97.86  ? 163 ASN A CG  1 
ATOM   1152 O OD1 . ASN A 1 164 ? 37.872  24.566 29.542  1.00 92.66  ? 163 ASN A OD1 1 
ATOM   1153 N ND2 . ASN A 1 164 ? 38.541  22.692 30.583  1.00 98.26  ? 163 ASN A ND2 1 
ATOM   1154 N N   . ALA A 1 165 ? 33.308  22.730 27.684  1.00 87.54  ? 164 ALA A N   1 
ATOM   1155 C CA  . ALA A 1 165 ? 32.391  22.034 26.794  1.00 90.72  ? 164 ALA A CA  1 
ATOM   1156 C C   . ALA A 1 165 ? 32.648  22.437 25.347  1.00 92.49  ? 164 ALA A C   1 
ATOM   1157 O O   . ALA A 1 165 ? 32.902  23.606 25.045  1.00 89.97  ? 164 ALA A O   1 
ATOM   1158 C CB  . ALA A 1 165 ? 30.945  22.336 27.178  1.00 92.24  ? 164 ALA A CB  1 
ATOM   1159 N N   . VAL A 1 166 ? 32.576  21.458 24.449  1.00 86.95  ? 165 VAL A N   1 
ATOM   1160 C CA  . VAL A 1 166 ? 32.880  21.648 23.036  1.00 89.32  ? 165 VAL A CA  1 
ATOM   1161 C C   . VAL A 1 166 ? 31.636  21.324 22.222  1.00 95.21  ? 165 VAL A C   1 
ATOM   1162 O O   . VAL A 1 166 ? 31.037  20.256 22.397  1.00 97.29  ? 165 VAL A O   1 
ATOM   1163 C CB  . VAL A 1 166 ? 34.067  20.771 22.593  1.00 91.77  ? 165 VAL A CB  1 
ATOM   1164 C CG1 . VAL A 1 166 ? 34.319  20.923 21.104  1.00 95.26  ? 165 VAL A CG1 1 
ATOM   1165 C CG2 . VAL A 1 166 ? 35.314  21.123 23.392  1.00 87.81  ? 165 VAL A CG2 1 
ATOM   1166 N N   . ASP A 1 167 ? 31.251  22.240 21.338  1.00 93.32  ? 166 ASP A N   1 
ATOM   1167 C CA  . ASP A 1 167 ? 30.122  22.040 20.446  1.00 98.28  ? 166 ASP A CA  1 
ATOM   1168 C C   . ASP A 1 167 ? 30.611  21.489 19.107  1.00 102.89 ? 166 ASP A C   1 
ATOM   1169 O O   . ASP A 1 167 ? 31.766  21.074 18.964  1.00 101.77 ? 166 ASP A O   1 
ATOM   1170 C CB  . ASP A 1 167 ? 29.340  23.345 20.276  1.00 98.60  ? 166 ASP A CB  1 
ATOM   1171 C CG  . ASP A 1 167 ? 30.219  24.509 19.857  1.00 99.39  ? 166 ASP A CG  1 
ATOM   1172 O OD1 . ASP A 1 167 ? 30.807  24.454 18.756  1.00 102.46 ? 166 ASP A OD1 1 
ATOM   1173 O OD2 . ASP A 1 167 ? 30.314  25.487 20.631  1.00 95.69  ? 166 ASP A OD2 1 
ATOM   1174 N N   . ALA A 1 168 ? 29.722  21.486 18.108  1.00 98.35  ? 167 ALA A N   1 
ATOM   1175 C CA  . ALA A 1 168 ? 30.069  20.929 16.804  1.00 98.34  ? 167 ALA A CA  1 
ATOM   1176 C C   . ALA A 1 168 ? 31.158  21.746 16.119  1.00 98.02  ? 167 ALA A C   1 
ATOM   1177 O O   . ALA A 1 168 ? 32.082  21.181 15.521  1.00 96.38  ? 167 ALA A O   1 
ATOM   1178 C CB  . ALA A 1 168 ? 28.827  20.848 15.920  1.00 98.76  ? 167 ALA A CB  1 
ATOM   1179 N N   . ALA A 1 169 ? 31.072  23.072 16.196  1.00 97.38  ? 168 ALA A N   1 
ATOM   1180 C CA  . ALA A 1 169 ? 32.083  23.937 15.604  1.00 94.77  ? 168 ALA A CA  1 
ATOM   1181 C C   . ALA A 1 169 ? 33.368  23.993 16.420  1.00 94.56  ? 168 ALA A C   1 
ATOM   1182 O O   . ALA A 1 169 ? 34.313  24.678 16.012  1.00 91.78  ? 168 ALA A O   1 
ATOM   1183 C CB  . ALA A 1 169 ? 31.526  25.352 15.423  1.00 92.71  ? 168 ALA A CB  1 
ATOM   1184 N N   . GLY A 1 170 ? 33.427  23.297 17.552  1.00 97.14  ? 169 GLY A N   1 
ATOM   1185 C CA  . GLY A 1 170 ? 34.604  23.299 18.394  1.00 93.81  ? 169 GLY A CA  1 
ATOM   1186 C C   . GLY A 1 170 ? 34.689  24.437 19.385  1.00 88.84  ? 169 GLY A C   1 
ATOM   1187 O O   . GLY A 1 170 ? 35.712  24.564 20.069  1.00 84.24  ? 169 GLY A O   1 
ATOM   1188 N N   . GLY A 1 171 ? 33.651  25.264 19.491  1.00 93.36  ? 170 GLY A N   1 
ATOM   1189 C CA  . GLY A 1 171 ? 33.709  26.415 20.370  1.00 85.91  ? 170 GLY A CA  1 
ATOM   1190 C C   . GLY A 1 171 ? 33.459  26.055 21.823  1.00 84.10  ? 170 GLY A C   1 
ATOM   1191 O O   . GLY A 1 171 ? 32.696  25.147 22.149  1.00 87.05  ? 170 GLY A O   1 
ATOM   1192 N N   . THR A 1 172 ? 34.123  26.789 22.705  1.00 84.19  ? 171 THR A N   1 
ATOM   1193 C CA  . THR A 1 172 ? 33.988  26.647 24.144  1.00 82.14  ? 171 THR A CA  1 
ATOM   1194 C C   . THR A 1 172 ? 33.219  27.831 24.717  1.00 81.08  ? 171 THR A C   1 
ATOM   1195 O O   . THR A 1 172 ? 33.076  28.864 24.055  1.00 79.36  ? 171 THR A O   1 
ATOM   1196 C CB  . THR A 1 172 ? 35.370  26.557 24.809  1.00 82.15  ? 171 THR A CB  1 
ATOM   1197 O OG1 . THR A 1 172 ? 36.143  27.715 24.470  1.00 78.34  ? 171 THR A OG1 1 
ATOM   1198 C CG2 . THR A 1 172 ? 36.105  25.308 24.346  1.00 84.60  ? 171 THR A CG2 1 
ATOM   1199 N N   . PRO A 1 173 ? 32.688  27.714 25.939  1.00 80.14  ? 172 PRO A N   1 
ATOM   1200 C CA  . PRO A 1 173 ? 32.042  28.884 26.555  1.00 79.43  ? 172 PRO A CA  1 
ATOM   1201 C C   . PRO A 1 173 ? 32.944  30.104 26.614  1.00 77.09  ? 172 PRO A C   1 
ATOM   1202 O O   . PRO A 1 173 ? 32.447  31.236 26.554  1.00 76.85  ? 172 PRO A O   1 
ATOM   1203 C CB  . PRO A 1 173 ? 31.673  28.381 27.956  1.00 82.01  ? 172 PRO A CB  1 
ATOM   1204 C CG  . PRO A 1 173 ? 31.493  26.916 27.782  1.00 85.34  ? 172 PRO A CG  1 
ATOM   1205 C CD  . PRO A 1 173 ? 32.516  26.500 26.759  1.00 82.57  ? 172 PRO A CD  1 
ATOM   1206 N N   . LEU A 1 174 ? 34.260  29.907 26.717  1.00 79.97  ? 173 LEU A N   1 
ATOM   1207 C CA  . LEU A 1 174 ? 35.177  31.041 26.696  1.00 76.81  ? 173 LEU A CA  1 
ATOM   1208 C C   . LEU A 1 174 ? 35.238  31.683 25.316  1.00 76.15  ? 173 LEU A C   1 
ATOM   1209 O O   . LEU A 1 174 ? 35.504  32.885 25.205  1.00 74.33  ? 173 LEU A O   1 
ATOM   1210 C CB  . LEU A 1 174 ? 36.570  30.597 27.139  1.00 75.47  ? 173 LEU A CB  1 
ATOM   1211 C CG  . LEU A 1 174 ? 37.533  31.711 27.545  1.00 74.95  ? 173 LEU A CG  1 
ATOM   1212 C CD1 . LEU A 1 174 ? 37.029  32.419 28.792  1.00 77.51  ? 173 LEU A CD1 1 
ATOM   1213 C CD2 . LEU A 1 174 ? 38.929  31.153 27.767  1.00 74.71  ? 173 LEU A CD2 1 
ATOM   1214 N N   . HIS A 1 175 ? 34.999  30.902 24.257  1.00 77.10  ? 174 HIS A N   1 
ATOM   1215 C CA  . HIS A 1 175 ? 34.965  31.468 22.912  1.00 76.71  ? 174 HIS A CA  1 
ATOM   1216 C C   . HIS A 1 175 ? 33.770  32.396 22.732  1.00 78.67  ? 174 HIS A C   1 
ATOM   1217 O O   . HIS A 1 175 ? 33.904  33.483 22.159  1.00 76.92  ? 174 HIS A O   1 
ATOM   1218 C CB  . HIS A 1 175 ? 34.929  30.352 21.866  1.00 80.74  ? 174 HIS A CB  1 
ATOM   1219 C CG  . HIS A 1 175 ? 36.282  29.895 21.416  1.00 82.04  ? 174 HIS A CG  1 
ATOM   1220 N ND1 . HIS A 1 175 ? 36.833  28.696 21.812  1.00 85.13  ? 174 HIS A ND1 1 
ATOM   1221 C CD2 . HIS A 1 175 ? 37.192  30.475 20.597  1.00 81.26  ? 174 HIS A CD2 1 
ATOM   1222 C CE1 . HIS A 1 175 ? 38.025  28.557 21.258  1.00 85.52  ? 174 HIS A CE1 1 
ATOM   1223 N NE2 . HIS A 1 175 ? 38.267  29.624 20.517  1.00 83.34  ? 174 HIS A NE2 1 
ATOM   1224 N N   . GLU A 1 176 ? 32.593  31.983 23.208  1.00 74.11  ? 175 GLU A N   1 
ATOM   1225 C CA  . GLU A 1 176 ? 31.405  32.818 23.066  1.00 75.55  ? 175 GLU A CA  1 
ATOM   1226 C C   . GLU A 1 176 ? 31.525  34.096 23.888  1.00 75.62  ? 175 GLU A C   1 
ATOM   1227 O O   . GLU A 1 176 ? 31.071  35.163 23.459  1.00 75.70  ? 175 GLU A O   1 
ATOM   1228 C CB  . GLU A 1 176 ? 30.159  32.033 23.476  1.00 80.02  ? 175 GLU A CB  1 
ATOM   1229 C CG  . GLU A 1 176 ? 29.892  30.792 22.635  1.00 86.29  ? 175 GLU A CG  1 
ATOM   1230 C CD  . GLU A 1 176 ? 29.379  31.121 21.245  1.00 94.47  ? 175 GLU A CD  1 
ATOM   1231 O OE1 . GLU A 1 176 ? 28.906  32.258 21.035  1.00 90.90  ? 175 GLU A OE1 1 
ATOM   1232 O OE2 . GLU A 1 176 ? 29.449  30.239 20.362  1.00 96.31  ? 175 GLU A OE2 1 
ATOM   1233 N N   . ALA A 1 177 ? 32.136  34.008 25.072  1.00 76.76  ? 176 ALA A N   1 
ATOM   1234 C CA  . ALA A 1 177 ? 32.281  35.187 25.918  1.00 77.85  ? 176 ALA A CA  1 
ATOM   1235 C C   . ALA A 1 177 ? 33.328  36.143 25.362  1.00 76.22  ? 176 ALA A C   1 
ATOM   1236 O O   . ALA A 1 177 ? 33.155  37.366 25.423  1.00 77.69  ? 176 ALA A O   1 
ATOM   1237 C CB  . ALA A 1 177 ? 32.636  34.767 27.343  1.00 80.04  ? 176 ALA A CB  1 
ATOM   1238 N N   . ALA A 1 178 ? 34.424  35.606 24.820  1.00 77.85  ? 177 ALA A N   1 
ATOM   1239 C CA  . ALA A 1 178 ? 35.455  36.463 24.246  1.00 75.38  ? 177 ALA A CA  1 
ATOM   1240 C C   . ALA A 1 178 ? 35.011  37.066 22.921  1.00 76.22  ? 177 ALA A C   1 
ATOM   1241 O O   . ALA A 1 178 ? 35.467  38.154 22.553  1.00 75.48  ? 177 ALA A O   1 
ATOM   1242 C CB  . ALA A 1 178 ? 36.753  35.677 24.062  1.00 73.00  ? 177 ALA A CB  1 
ATOM   1243 N N   . ARG A 1 179 ? 34.128  36.380 22.194  1.00 77.07  ? 178 ARG A N   1 
ATOM   1244 C CA  . ARG A 1 179 ? 33.658  36.900 20.916  1.00 77.27  ? 178 ARG A CA  1 
ATOM   1245 C C   . ARG A 1 179 ? 32.580  37.959 21.109  1.00 80.53  ? 178 ARG A C   1 
ATOM   1246 O O   . ARG A 1 179 ? 32.516  38.930 20.347  1.00 80.00  ? 178 ARG A O   1 
ATOM   1247 C CB  . ARG A 1 179 ? 33.141  35.754 20.049  1.00 79.14  ? 178 ARG A CB  1 
ATOM   1248 C CG  . ARG A 1 179 ? 32.796  36.142 18.627  1.00 83.04  ? 178 ARG A CG  1 
ATOM   1249 C CD  . ARG A 1 179 ? 32.742  34.905 17.753  1.00 88.82  ? 178 ARG A CD  1 
ATOM   1250 N NE  . ARG A 1 179 ? 31.857  33.887 18.312  1.00 94.82  ? 178 ARG A NE  1 
ATOM   1251 C CZ  . ARG A 1 179 ? 31.886  32.603 17.968  1.00 103.02 ? 178 ARG A CZ  1 
ATOM   1252 N NH1 . ARG A 1 179 ? 32.765  32.176 17.072  1.00 100.13 ? 178 ARG A NH1 1 
ATOM   1253 N NH2 . ARG A 1 179 ? 31.043  31.745 18.526  1.00 102.47 ? 178 ARG A NH2 1 
ATOM   1254 N N   . ALA A 1 180 ? 31.732  37.794 22.126  1.00 80.50  ? 179 ALA A N   1 
ATOM   1255 C CA  . ALA A 1 180 ? 30.695  38.781 22.408  1.00 83.27  ? 179 ALA A CA  1 
ATOM   1256 C C   . ALA A 1 180 ? 31.281  40.021 23.076  1.00 85.32  ? 179 ALA A C   1 
ATOM   1257 O O   . ALA A 1 180 ? 31.145  41.138 22.565  1.00 85.50  ? 179 ALA A O   1 
ATOM   1258 C CB  . ALA A 1 180 ? 29.601  38.161 23.282  1.00 87.04  ? 179 ALA A CB  1 
ATOM   1259 N N   . GLY A 1 181 ? 31.934  39.842 24.222  1.00 78.09  ? 180 GLY A N   1 
ATOM   1260 C CA  . GLY A 1 181 ? 32.559  40.952 24.913  1.00 80.32  ? 180 GLY A CA  1 
ATOM   1261 C C   . GLY A 1 181 ? 32.085  41.144 26.339  1.00 87.52  ? 180 GLY A C   1 
ATOM   1262 O O   . GLY A 1 181 ? 31.730  42.258 26.736  1.00 91.26  ? 180 GLY A O   1 
ATOM   1263 N N   . HIS A 1 182 ? 32.077  40.067 27.121  1.00 83.03  ? 181 HIS A N   1 
ATOM   1264 C CA  . HIS A 1 182 ? 31.674  40.102 28.526  1.00 89.79  ? 181 HIS A CA  1 
ATOM   1265 C C   . HIS A 1 182 ? 32.850  39.617 29.367  1.00 91.40  ? 181 HIS A C   1 
ATOM   1266 O O   . HIS A 1 182 ? 33.035  38.410 29.548  1.00 88.56  ? 181 HIS A O   1 
ATOM   1267 C CB  . HIS A 1 182 ? 30.435  39.244 28.766  1.00 92.20  ? 181 HIS A CB  1 
ATOM   1268 C CG  . HIS A 1 182 ? 29.343  39.462 27.767  1.00 91.43  ? 181 HIS A CG  1 
ATOM   1269 N ND1 . HIS A 1 182 ? 28.504  40.554 27.807  1.00 94.83  ? 181 HIS A ND1 1 
ATOM   1270 C CD2 . HIS A 1 182 ? 28.950  38.723 26.702  1.00 87.74  ? 181 HIS A CD2 1 
ATOM   1271 C CE1 . HIS A 1 182 ? 27.642  40.480 26.808  1.00 92.17  ? 181 HIS A CE1 1 
ATOM   1272 N NE2 . HIS A 1 182 ? 27.891  39.379 26.123  1.00 88.48  ? 181 HIS A NE2 1 
ATOM   1273 N N   . LEU A 1 183 ? 33.647  40.556 29.883  1.00 88.13  ? 182 LEU A N   1 
ATOM   1274 C CA  . LEU A 1 183 ? 34.792  40.176 30.701  1.00 88.94  ? 182 LEU A CA  1 
ATOM   1275 C C   . LEU A 1 183 ? 34.373  39.655 32.068  1.00 96.03  ? 182 LEU A C   1 
ATOM   1276 O O   . LEU A 1 183 ? 35.135  38.908 32.692  1.00 93.64  ? 182 LEU A O   1 
ATOM   1277 C CB  . LEU A 1 183 ? 35.749  41.361 30.860  1.00 92.05  ? 182 LEU A CB  1 
ATOM   1278 C CG  . LEU A 1 183 ? 35.346  42.503 31.799  1.00 101.26 ? 182 LEU A CG  1 
ATOM   1279 C CD1 . LEU A 1 183 ? 36.029  42.371 33.155  1.00 105.43 ? 182 LEU A CD1 1 
ATOM   1280 C CD2 . LEU A 1 183 ? 35.656  43.851 31.172  1.00 100.99 ? 182 LEU A CD2 1 
ATOM   1281 N N   . GLU A 1 184 ? 33.180  40.027 32.541  1.00 90.97  ? 183 GLU A N   1 
ATOM   1282 C CA  . GLU A 1 184 ? 32.728  39.566 33.850  1.00 97.77  ? 183 GLU A CA  1 
ATOM   1283 C C   . GLU A 1 184 ? 32.615  38.049 33.894  1.00 93.49  ? 183 GLU A C   1 
ATOM   1284 O O   . GLU A 1 184 ? 32.933  37.426 34.913  1.00 93.61  ? 183 GLU A O   1 
ATOM   1285 C CB  . GLU A 1 184 ? 31.390  40.215 34.207  1.00 102.63 ? 183 GLU A CB  1 
ATOM   1286 C CG  . GLU A 1 184 ? 31.503  41.605 34.819  1.00 107.94 ? 183 GLU A CG  1 
ATOM   1287 C CD  . GLU A 1 184 ? 31.698  42.701 33.787  1.00 110.58 ? 183 GLU A CD  1 
ATOM   1288 O OE1 . GLU A 1 184 ? 31.900  42.380 32.596  1.00 103.47 ? 183 GLU A OE1 1 
ATOM   1289 O OE2 . GLU A 1 184 ? 31.642  43.889 34.170  1.00 109.39 ? 183 GLU A OE2 1 
ATOM   1290 N N   . ILE A 1 185 ? 32.170  37.433 32.798  1.00 96.83  ? 184 ILE A N   1 
ATOM   1291 C CA  . ILE A 1 185 ? 32.073  35.980 32.756  1.00 92.14  ? 184 ILE A CA  1 
ATOM   1292 C C   . ILE A 1 185 ? 33.357  35.320 32.265  1.00 85.59  ? 184 ILE A C   1 
ATOM   1293 O O   . ILE A 1 185 ? 33.573  34.132 32.541  1.00 83.21  ? 184 ILE A O   1 
ATOM   1294 C CB  . ILE A 1 185 ? 30.888  35.526 31.885  1.00 91.61  ? 184 ILE A CB  1 
ATOM   1295 C CG1 . ILE A 1 185 ? 31.035  36.051 30.459  1.00 86.56  ? 184 ILE A CG1 1 
ATOM   1296 C CG2 . ILE A 1 185 ? 29.574  35.993 32.490  1.00 99.71  ? 184 ILE A CG2 1 
ATOM   1297 C CD1 . ILE A 1 185 ? 29.872  35.697 29.566  1.00 87.83  ? 184 ILE A CD1 1 
ATOM   1298 N N   . VAL A 1 186 ? 34.215  36.052 31.551  1.00 90.81  ? 185 VAL A N   1 
ATOM   1299 C CA  . VAL A 1 186 ? 35.496  35.489 31.132  1.00 84.61  ? 185 VAL A CA  1 
ATOM   1300 C C   . VAL A 1 186 ? 36.356  35.178 32.350  1.00 87.46  ? 185 VAL A C   1 
ATOM   1301 O O   . VAL A 1 186 ? 36.942  34.095 32.462  1.00 85.01  ? 185 VAL A O   1 
ATOM   1302 C CB  . VAL A 1 186 ? 36.215  36.442 30.161  1.00 82.72  ? 185 VAL A CB  1 
ATOM   1303 C CG1 . VAL A 1 186 ? 37.665  36.020 29.979  1.00 78.56  ? 185 VAL A CG1 1 
ATOM   1304 C CG2 . VAL A 1 186 ? 35.502  36.468 28.822  1.00 79.36  ? 185 VAL A CG2 1 
ATOM   1305 N N   . GLU A 1 187 ? 36.437  36.126 33.287  1.00 89.28  ? 186 GLU A N   1 
ATOM   1306 C CA  . GLU A 1 187 ? 37.209  35.899 34.504  1.00 90.89  ? 186 GLU A CA  1 
ATOM   1307 C C   . GLU A 1 187 ? 36.604  34.778 35.339  1.00 93.74  ? 186 GLU A C   1 
ATOM   1308 O O   . GLU A 1 187 ? 37.333  33.982 35.943  1.00 92.16  ? 186 GLU A O   1 
ATOM   1309 C CB  . GLU A 1 187 ? 37.292  37.189 35.318  1.00 97.34  ? 186 GLU A CB  1 
ATOM   1310 C CG  . GLU A 1 187 ? 38.070  38.298 34.635  1.00 100.08 ? 186 GLU A CG  1 
ATOM   1311 C CD  . GLU A 1 187 ? 37.913  39.629 35.337  1.00 114.06 ? 186 GLU A CD  1 
ATOM   1312 O OE1 . GLU A 1 187 ? 36.783  39.941 35.770  1.00 118.58 ? 186 GLU A OE1 1 
ATOM   1313 O OE2 . GLU A 1 187 ? 38.918  40.360 35.463  1.00 111.68 ? 186 GLU A OE2 1 
ATOM   1314 N N   . VAL A 1 188 ? 35.273  34.699 35.384  1.00 89.74  ? 187 VAL A N   1 
ATOM   1315 C CA  . VAL A 1 188 ? 34.614  33.636 36.136  1.00 91.77  ? 187 VAL A CA  1 
ATOM   1316 C C   . VAL A 1 188 ? 34.879  32.281 35.490  1.00 87.64  ? 187 VAL A C   1 
ATOM   1317 O O   . VAL A 1 188 ? 35.177  31.298 36.180  1.00 87.74  ? 187 VAL A O   1 
ATOM   1318 C CB  . VAL A 1 188 ? 33.108  33.927 36.260  1.00 98.35  ? 187 VAL A CB  1 
ATOM   1319 C CG1 . VAL A 1 188 ? 32.368  32.706 36.784  1.00 99.52  ? 187 VAL A CG1 1 
ATOM   1320 C CG2 . VAL A 1 188 ? 32.878  35.121 37.174  1.00 104.80 ? 187 VAL A CG2 1 
ATOM   1321 N N   . LEU A 1 189 ? 34.777  32.205 34.161  1.00 92.32  ? 188 LEU A N   1 
ATOM   1322 C CA  . LEU A 1 189 ? 35.096  30.959 33.471  1.00 88.15  ? 188 LEU A CA  1 
ATOM   1323 C C   . LEU A 1 189 ? 36.550  30.567 33.691  1.00 86.89  ? 188 LEU A C   1 
ATOM   1324 O O   . LEU A 1 189 ? 36.857  29.393 33.929  1.00 86.78  ? 188 LEU A O   1 
ATOM   1325 C CB  . LEU A 1 189 ? 34.798  31.091 31.979  1.00 84.58  ? 188 LEU A CB  1 
ATOM   1326 C CG  . LEU A 1 189 ? 33.323  31.069 31.583  1.00 88.24  ? 188 LEU A CG  1 
ATOM   1327 C CD1 . LEU A 1 189 ? 33.161  31.564 30.159  1.00 85.42  ? 188 LEU A CD1 1 
ATOM   1328 C CD2 . LEU A 1 189 ? 32.754  29.669 31.734  1.00 90.20  ? 188 LEU A CD2 1 
ATOM   1329 N N   . LEU A 1 190 ? 37.462  31.540 33.618  1.00 87.75  ? 189 LEU A N   1 
ATOM   1330 C CA  . LEU A 1 190 ? 38.866  31.248 33.882  1.00 85.92  ? 189 LEU A CA  1 
ATOM   1331 C C   . LEU A 1 190 ? 39.104  30.931 35.353  1.00 90.78  ? 189 LEU A C   1 
ATOM   1332 O O   . LEU A 1 190 ? 40.002  30.146 35.677  1.00 90.04  ? 189 LEU A O   1 
ATOM   1333 C CB  . LEU A 1 190 ? 39.737  32.422 33.434  1.00 83.81  ? 189 LEU A CB  1 
ATOM   1334 C CG  . LEU A 1 190 ? 39.831  32.644 31.922  1.00 80.93  ? 189 LEU A CG  1 
ATOM   1335 C CD1 . LEU A 1 190 ? 40.465  33.989 31.611  1.00 80.30  ? 189 LEU A CD1 1 
ATOM   1336 C CD2 . LEU A 1 190 ? 40.611  31.519 31.260  1.00 78.86  ? 189 LEU A CD2 1 
ATOM   1337 N N   . LYS A 1 191 ? 38.311  31.520 36.253  1.00 86.61  ? 190 LYS A N   1 
ATOM   1338 C CA  . LYS A 1 191 ? 38.442  31.194 37.670  1.00 90.36  ? 190 LYS A CA  1 
ATOM   1339 C C   . LYS A 1 191 ? 38.042  29.749 37.941  1.00 92.09  ? 190 LYS A C   1 
ATOM   1340 O O   . LYS A 1 191 ? 38.740  29.032 38.667  1.00 92.74  ? 190 LYS A O   1 
ATOM   1341 C CB  . LYS A 1 191 ? 37.599  32.151 38.513  1.00 96.35  ? 190 LYS A CB  1 
ATOM   1342 N N   . TYR A 1 192 ? 36.923  29.303 37.366  1.00 88.89  ? 191 TYR A N   1 
ATOM   1343 C CA  . TYR A 1 192 ? 36.512  27.914 37.526  1.00 89.60  ? 191 TYR A CA  1 
ATOM   1344 C C   . TYR A 1 192 ? 37.432  26.950 36.789  1.00 88.14  ? 191 TYR A C   1 
ATOM   1345 O O   . TYR A 1 192 ? 37.478  25.765 37.141  1.00 90.96  ? 191 TYR A O   1 
ATOM   1346 C CB  . TYR A 1 192 ? 35.071  27.731 37.048  1.00 91.31  ? 191 TYR A CB  1 
ATOM   1347 C CG  . TYR A 1 192 ? 34.032  27.990 38.116  1.00 97.13  ? 191 TYR A CG  1 
ATOM   1348 C CD1 . TYR A 1 192 ? 33.631  29.283 38.426  1.00 100.58 ? 191 TYR A CD1 1 
ATOM   1349 C CD2 . TYR A 1 192 ? 33.450  26.938 38.813  1.00 100.06 ? 191 TYR A CD2 1 
ATOM   1350 C CE1 . TYR A 1 192 ? 32.680  29.522 39.402  1.00 106.27 ? 191 TYR A CE1 1 
ATOM   1351 C CE2 . TYR A 1 192 ? 32.499  27.167 39.790  1.00 105.33 ? 191 TYR A CE2 1 
ATOM   1352 C CZ  . TYR A 1 192 ? 32.117  28.460 40.081  1.00 110.48 ? 191 TYR A CZ  1 
ATOM   1353 O OH  . TYR A 1 192 ? 31.170  28.690 41.053  1.00 116.06 ? 191 TYR A OH  1 
ATOM   1354 N N   . GLY A 1 193 ? 38.163  27.425 35.783  1.00 93.93  ? 192 GLY A N   1 
ATOM   1355 C CA  . GLY A 1 193 ? 39.091  26.580 35.060  1.00 92.99  ? 192 GLY A CA  1 
ATOM   1356 C C   . GLY A 1 193 ? 38.722  26.377 33.606  1.00 90.97  ? 192 GLY A C   1 
ATOM   1357 O O   . GLY A 1 193 ? 38.147  25.347 33.241  1.00 92.14  ? 192 GLY A O   1 
ATOM   1358 N N   . ALA A 1 194 ? 39.046  27.353 32.765  1.00 89.88  ? 193 ALA A N   1 
ATOM   1359 C CA  . ALA A 1 194 ? 38.792  27.271 31.336  1.00 87.16  ? 193 ALA A CA  1 
ATOM   1360 C C   . ALA A 1 194 ? 40.109  27.188 30.577  1.00 86.81  ? 193 ALA A C   1 
ATOM   1361 O O   . ALA A 1 194 ? 41.127  27.742 31.002  1.00 86.26  ? 193 ALA A O   1 
ATOM   1362 C CB  . ALA A 1 194 ? 37.982  28.475 30.847  1.00 85.89  ? 193 ALA A CB  1 
ATOM   1363 N N   . ASP A 1 195 ? 40.081  26.484 29.448  1.00 87.86  ? 194 ASP A N   1 
ATOM   1364 C CA  . ASP A 1 195 ? 41.253  26.358 28.586  1.00 86.82  ? 194 ASP A CA  1 
ATOM   1365 C C   . ASP A 1 195 ? 41.401  27.660 27.808  1.00 84.34  ? 194 ASP A C   1 
ATOM   1366 O O   . ASP A 1 195 ? 40.656  27.921 26.860  1.00 83.81  ? 194 ASP A O   1 
ATOM   1367 C CB  . ASP A 1 195 ? 41.111  25.153 27.662  1.00 89.74  ? 194 ASP A CB  1 
ATOM   1368 C CG  . ASP A 1 195 ? 42.423  24.756 27.007  1.00 93.65  ? 194 ASP A CG  1 
ATOM   1369 O OD1 . ASP A 1 195 ? 43.069  25.625 26.384  1.00 92.47  ? 194 ASP A OD1 1 
ATOM   1370 O OD2 . ASP A 1 195 ? 42.810  23.573 27.121  1.00 98.15  ? 194 ASP A OD2 1 
ATOM   1371 N N   . VAL A 1 196 ? 42.369  28.487 28.215  1.00 83.50  ? 195 VAL A N   1 
ATOM   1372 C CA  . VAL A 1 196 ? 42.527  29.810 27.623  1.00 80.19  ? 195 VAL A CA  1 
ATOM   1373 C C   . VAL A 1 196 ? 43.011  29.734 26.180  1.00 80.52  ? 195 VAL A C   1 
ATOM   1374 O O   . VAL A 1 196 ? 42.877  30.709 25.432  1.00 78.40  ? 195 VAL A O   1 
ATOM   1375 C CB  . VAL A 1 196 ? 43.485  30.663 28.480  1.00 80.96  ? 195 VAL A CB  1 
ATOM   1376 C CG1 . VAL A 1 196 ? 44.933  30.239 28.261  1.00 81.14  ? 195 VAL A CG1 1 
ATOM   1377 C CG2 . VAL A 1 196 ? 43.297  32.148 28.191  1.00 78.53  ? 195 VAL A CG2 1 
ATOM   1378 N N   . ASN A 1 197 ? 43.564  28.599 25.763  1.00 77.86  ? 196 ASN A N   1 
ATOM   1379 C CA  . ASN A 1 197 ? 44.050  28.407 24.403  1.00 79.31  ? 196 ASN A CA  1 
ATOM   1380 C C   . ASN A 1 197 ? 43.274  27.302 23.697  1.00 84.48  ? 196 ASN A C   1 
ATOM   1381 O O   . ASN A 1 197 ? 43.837  26.498 22.951  1.00 88.19  ? 196 ASN A O   1 
ATOM   1382 C CB  . ASN A 1 197 ? 45.549  28.112 24.399  1.00 80.67  ? 196 ASN A CB  1 
ATOM   1383 C CG  . ASN A 1 197 ? 46.388  29.351 24.666  1.00 85.11  ? 196 ASN A CG  1 
ATOM   1384 O OD1 . ASN A 1 197 ? 46.096  30.434 24.157  1.00 81.40  ? 196 ASN A OD1 1 
ATOM   1385 N ND2 . ASN A 1 197 ? 47.434  29.196 25.470  1.00 82.52  ? 196 ASN A ND2 1 
ATOM   1386 N N   . ALA A 1 198 ? 41.964  27.252 23.929  1.00 76.61  ? 197 ALA A N   1 
ATOM   1387 C CA  . ALA A 1 198 ? 41.117  26.290 23.240  1.00 80.88  ? 197 ALA A CA  1 
ATOM   1388 C C   . ALA A 1 198 ? 41.065  26.598 21.749  1.00 84.76  ? 197 ALA A C   1 
ATOM   1389 O O   . ALA A 1 198 ? 41.124  27.756 21.326  1.00 81.76  ? 197 ALA A O   1 
ATOM   1390 C CB  . ALA A 1 198 ? 39.706  26.299 23.828  1.00 80.49  ? 197 ALA A CB  1 
ATOM   1391 N N   . VAL A 1 199 ? 40.951  25.545 20.947  1.00 78.35  ? 198 VAL A N   1 
ATOM   1392 C CA  . VAL A 1 199 ? 40.988  25.649 19.494  1.00 83.03  ? 198 VAL A CA  1 
ATOM   1393 C C   . VAL A 1 199 ? 39.690  25.087 18.933  1.00 88.99  ? 198 VAL A C   1 
ATOM   1394 O O   . VAL A 1 199 ? 39.322  23.945 19.233  1.00 91.01  ? 198 VAL A O   1 
ATOM   1395 C CB  . VAL A 1 199 ? 42.207  24.910 18.911  1.00 87.86  ? 198 VAL A CB  1 
ATOM   1396 C CG1 . VAL A 1 199 ? 42.127  24.857 17.398  1.00 90.33  ? 198 VAL A CG1 1 
ATOM   1397 C CG2 . VAL A 1 199 ? 43.496  25.586 19.358  1.00 83.64  ? 198 VAL A CG2 1 
ATOM   1398 N N   . ASP A 1 200 ? 38.996  25.890 18.128  1.00 87.85  ? 199 ASP A N   1 
ATOM   1399 C CA  . ASP A 1 200 ? 37.789  25.438 17.456  1.00 91.90  ? 199 ASP A CA  1 
ATOM   1400 C C   . ASP A 1 200 ? 38.146  24.802 16.113  1.00 94.63  ? 199 ASP A C   1 
ATOM   1401 O O   . ASP A 1 200 ? 39.317  24.658 15.754  1.00 92.90  ? 199 ASP A O   1 
ATOM   1402 C CB  . ASP A 1 200 ? 36.796  26.590 17.282  1.00 90.63  ? 199 ASP A CB  1 
ATOM   1403 C CG  . ASP A 1 200 ? 37.421  27.822 16.645  1.00 90.03  ? 199 ASP A CG  1 
ATOM   1404 O OD1 . ASP A 1 200 ? 37.979  27.712 15.533  1.00 88.91  ? 199 ASP A OD1 1 
ATOM   1405 O OD2 . ASP A 1 200 ? 37.335  28.910 17.254  1.00 85.36  ? 199 ASP A OD2 1 
ATOM   1406 N N   . ALA A 1 201 ? 37.114  24.415 15.357  1.00 93.37  ? 200 ALA A N   1 
ATOM   1407 C CA  . ALA A 1 201 ? 37.341  23.777 14.063  1.00 92.03  ? 200 ALA A CA  1 
ATOM   1408 C C   . ALA A 1 201 ? 38.057  24.706 13.094  1.00 89.02  ? 200 ALA A C   1 
ATOM   1409 O O   . ALA A 1 201 ? 38.809  24.242 12.229  1.00 86.54  ? 200 ALA A O   1 
ATOM   1410 C CB  . ALA A 1 201 ? 36.012  23.310 13.469  1.00 93.45  ? 200 ALA A CB  1 
ATOM   1411 N N   . ALA A 1 202 ? 37.840  26.014 13.218  1.00 90.52  ? 201 ALA A N   1 
ATOM   1412 C CA  . ALA A 1 202 ? 38.528  26.991 12.386  1.00 85.47  ? 201 ALA A CA  1 
ATOM   1413 C C   . ALA A 1 202 ? 39.923  27.321 12.896  1.00 84.86  ? 201 ALA A C   1 
ATOM   1414 O O   . ALA A 1 202 ? 40.605  28.155 12.290  1.00 80.42  ? 201 ALA A O   1 
ATOM   1415 C CB  . ALA A 1 202 ? 37.700  28.275 12.285  1.00 83.32  ? 201 ALA A CB  1 
ATOM   1416 N N   . GLY A 1 203 ? 40.360  26.695 13.987  1.00 83.93  ? 202 GLY A N   1 
ATOM   1417 C CA  . GLY A 1 203 ? 41.669  26.949 14.545  1.00 82.03  ? 202 GLY A CA  1 
ATOM   1418 C C   . GLY A 1 203 ? 41.778  28.192 15.399  1.00 80.08  ? 202 GLY A C   1 
ATOM   1419 O O   . GLY A 1 203 ? 42.878  28.499 15.876  1.00 78.00  ? 202 GLY A O   1 
ATOM   1420 N N   . GLY A 1 204 ? 40.681  28.915 15.612  1.00 87.14  ? 203 GLY A N   1 
ATOM   1421 C CA  . GLY A 1 204 ? 40.745  30.159 16.360  1.00 82.29  ? 203 GLY A CA  1 
ATOM   1422 C C   . GLY A 1 204 ? 40.719  29.926 17.864  1.00 81.95  ? 203 GLY A C   1 
ATOM   1423 O O   . GLY A 1 204 ? 39.957  29.109 18.379  1.00 84.33  ? 203 GLY A O   1 
ATOM   1424 N N   . THR A 1 205 ? 41.576  30.658 18.565  1.00 83.45  ? 204 THR A N   1 
ATOM   1425 C CA  . THR A 1 205 ? 41.615  30.656 20.017  1.00 79.64  ? 204 THR A CA  1 
ATOM   1426 C C   . THR A 1 205 ? 40.741  31.776 20.564  1.00 76.41  ? 204 THR A C   1 
ATOM   1427 O O   . THR A 1 205 ? 40.342  32.680 19.824  1.00 75.16  ? 204 THR A O   1 
ATOM   1428 C CB  . THR A 1 205 ? 43.054  30.827 20.504  1.00 80.25  ? 204 THR A CB  1 
ATOM   1429 O OG1 . THR A 1 205 ? 43.596  32.049 19.988  1.00 77.23  ? 204 THR A OG1 1 
ATOM   1430 C CG2 . THR A 1 205 ? 43.916  29.659 20.046  1.00 85.13  ? 204 THR A CG2 1 
ATOM   1431 N N   . PRO A 1 206 ? 40.399  31.738 21.857  1.00 75.86  ? 205 PRO A N   1 
ATOM   1432 C CA  . PRO A 1 206 ? 39.680  32.881 22.441  1.00 73.36  ? 205 PRO A CA  1 
ATOM   1433 C C   . PRO A 1 206 ? 40.407  34.200 22.257  1.00 72.13  ? 205 PRO A C   1 
ATOM   1434 O O   . PRO A 1 206 ? 39.757  35.249 22.157  1.00 71.56  ? 205 PRO A O   1 
ATOM   1435 C CB  . PRO A 1 206 ? 39.563  32.496 23.921  1.00 74.03  ? 205 PRO A CB  1 
ATOM   1436 C CG  . PRO A 1 206 ? 39.540  31.012 23.902  1.00 78.02  ? 205 PRO A CG  1 
ATOM   1437 C CD  . PRO A 1 206 ? 40.482  30.609 22.800  1.00 77.80  ? 205 PRO A CD  1 
ATOM   1438 N N   . LEU A 1 207 ? 41.740  34.178 22.196  1.00 72.28  ? 206 LEU A N   1 
ATOM   1439 C CA  . LEU A 1 207 ? 42.482  35.401 21.918  1.00 70.54  ? 206 LEU A CA  1 
ATOM   1440 C C   . LEU A 1 207 ? 42.262  35.875 20.487  1.00 72.09  ? 206 LEU A C   1 
ATOM   1441 O O   . LEU A 1 207 ? 42.337  37.079 20.218  1.00 71.23  ? 206 LEU A O   1 
ATOM   1442 C CB  . LEU A 1 207 ? 43.970  35.182 22.188  1.00 70.11  ? 206 LEU A CB  1 
ATOM   1443 C CG  . LEU A 1 207 ? 44.850  36.432 22.223  1.00 70.35  ? 206 LEU A CG  1 
ATOM   1444 C CD1 . LEU A 1 207 ? 44.407  37.371 23.335  1.00 70.81  ? 206 LEU A CD1 1 
ATOM   1445 C CD2 . LEU A 1 207 ? 46.308  36.043 22.396  1.00 71.07  ? 206 LEU A CD2 1 
ATOM   1446 N N   . HIS A 1 208 ? 41.992  34.953 19.560  1.00 69.42  ? 207 HIS A N   1 
ATOM   1447 C CA  . HIS A 1 208 ? 41.679  35.351 18.190  1.00 70.34  ? 207 HIS A CA  1 
ATOM   1448 C C   . HIS A 1 208 ? 40.350  36.091 18.125  1.00 71.13  ? 207 HIS A C   1 
ATOM   1449 O O   . HIS A 1 208 ? 40.259  37.174 17.536  1.00 70.30  ? 207 HIS A O   1 
ATOM   1450 C CB  . HIS A 1 208 ? 41.647  34.129 17.271  1.00 74.61  ? 207 HIS A CB  1 
ATOM   1451 C CG  . HIS A 1 208 ? 42.989  33.728 16.746  1.00 76.97  ? 207 HIS A CG  1 
ATOM   1452 N ND1 . HIS A 1 208 ? 43.615  32.559 17.119  1.00 81.05  ? 207 HIS A ND1 1 
ATOM   1453 C CD2 . HIS A 1 208 ? 43.822  34.338 15.870  1.00 76.06  ? 207 HIS A CD2 1 
ATOM   1454 C CE1 . HIS A 1 208 ? 44.777  32.467 16.498  1.00 80.95  ? 207 HIS A CE1 1 
ATOM   1455 N NE2 . HIS A 1 208 ? 44.927  33.534 15.734  1.00 77.60  ? 207 HIS A NE2 1 
ATOM   1456 N N   . GLU A 1 209 ? 39.302  35.516 18.719  1.00 76.12  ? 208 GLU A N   1 
ATOM   1457 C CA  . GLU A 1 209 ? 37.987  36.141 18.649  1.00 76.53  ? 208 GLU A CA  1 
ATOM   1458 C C   . GLU A 1 209 ? 37.943  37.446 19.432  1.00 76.24  ? 208 GLU A C   1 
ATOM   1459 O O   . GLU A 1 209 ? 37.212  38.369 19.053  1.00 76.72  ? 208 GLU A O   1 
ATOM   1460 C CB  . GLU A 1 209 ? 36.917  35.172 19.156  1.00 79.11  ? 208 GLU A CB  1 
ATOM   1461 C CG  . GLU A 1 209 ? 36.912  33.822 18.445  1.00 86.08  ? 208 GLU A CG  1 
ATOM   1462 C CD  . GLU A 1 209 ? 36.645  33.938 16.954  1.00 94.69  ? 208 GLU A CD  1 
ATOM   1463 O OE1 . GLU A 1 209 ? 35.779  34.748 16.559  1.00 91.62  ? 208 GLU A OE1 1 
ATOM   1464 O OE2 . GLU A 1 209 ? 37.308  33.220 16.174  1.00 95.39  ? 208 GLU A OE2 1 
ATOM   1465 N N   . ALA A 1 210 ? 38.719  37.549 20.513  1.00 69.38  ? 209 ALA A N   1 
ATOM   1466 C CA  . ALA A 1 210 ? 38.725  38.776 21.304  1.00 69.62  ? 209 ALA A CA  1 
ATOM   1467 C C   . ALA A 1 210 ? 39.382  39.919 20.541  1.00 69.57  ? 209 ALA A C   1 
ATOM   1468 O O   . ALA A 1 210 ? 38.817  41.014 20.436  1.00 70.76  ? 209 ALA A O   1 
ATOM   1469 C CB  . ALA A 1 210 ? 39.433  38.539 22.637  1.00 69.72  ? 209 ALA A CB  1 
ATOM   1470 N N   . ALA A 1 211 ? 40.578  39.684 19.999  1.00 69.20  ? 210 ALA A N   1 
ATOM   1471 C CA  . ALA A 1 211 ? 41.253  40.712 19.216  1.00 69.42  ? 210 ALA A CA  1 
ATOM   1472 C C   . ALA A 1 211 ? 40.529  41.014 17.912  1.00 70.83  ? 210 ALA A C   1 
ATOM   1473 O O   . ALA A 1 211 ? 40.762  42.073 17.318  1.00 71.84  ? 210 ALA A O   1 
ATOM   1474 C CB  . ALA A 1 211 ? 42.695  40.293 18.927  1.00 68.25  ? 210 ALA A CB  1 
ATOM   1475 N N   . ARG A 1 212 ? 39.660  40.111 17.453  1.00 78.22  ? 211 ARG A N   1 
ATOM   1476 C CA  . ARG A 1 212 ? 38.906  40.352 16.229  1.00 79.36  ? 211 ARG A CA  1 
ATOM   1477 C C   . ARG A 1 212 ? 37.769  41.340 16.463  1.00 82.76  ? 211 ARG A C   1 
ATOM   1478 O O   . ARG A 1 212 ? 37.460  42.155 15.586  1.00 84.30  ? 211 ARG A O   1 
ATOM   1479 C CB  . ARG A 1 212 ? 38.365  39.030 15.681  1.00 79.87  ? 211 ARG A CB  1 
ATOM   1480 C CG  . ARG A 1 212 ? 37.852  39.095 14.252  1.00 84.44  ? 211 ARG A CG  1 
ATOM   1481 C CD  . ARG A 1 212 ? 37.426  37.717 13.767  1.00 89.46  ? 211 ARG A CD  1 
ATOM   1482 N NE  . ARG A 1 212 ? 37.155  37.695 12.332  1.00 93.92  ? 211 ARG A NE  1 
ATOM   1483 C CZ  . ARG A 1 212 ? 36.818  36.604 11.652  1.00 101.25 ? 211 ARG A CZ  1 
ATOM   1484 N NH1 . ARG A 1 212 ? 36.708  35.437 12.275  1.00 99.25  ? 211 ARG A NH1 1 
ATOM   1485 N NH2 . ARG A 1 212 ? 36.591  36.678 10.347  1.00 98.29  ? 211 ARG A NH2 1 
ATOM   1486 N N   . ALA A 1 213 ? 37.145  41.286 17.640  1.00 77.14  ? 212 ALA A N   1 
ATOM   1487 C CA  . ALA A 1 213 ? 36.041  42.175 17.977  1.00 79.42  ? 212 ALA A CA  1 
ATOM   1488 C C   . ALA A 1 213 ? 36.517  43.499 18.561  1.00 81.65  ? 212 ALA A C   1 
ATOM   1489 O O   . ALA A 1 213 ? 35.910  44.543 18.299  1.00 83.91  ? 212 ALA A O   1 
ATOM   1490 C CB  . ALA A 1 213 ? 35.091  41.486 18.959  1.00 80.11  ? 212 ALA A CB  1 
ATOM   1491 N N   . GLY A 1 214 ? 37.586  43.479 19.354  1.00 73.25  ? 213 GLY A N   1 
ATOM   1492 C CA  . GLY A 1 214 ? 38.149  44.703 19.888  1.00 75.69  ? 213 GLY A CA  1 
ATOM   1493 C C   . GLY A 1 214 ? 37.924  44.898 21.373  1.00 79.92  ? 213 GLY A C   1 
ATOM   1494 O O   . GLY A 1 214 ? 37.715  46.026 21.831  1.00 83.39  ? 213 GLY A O   1 
ATOM   1495 N N   . HIS A 1 215 ? 37.970  43.811 22.139  1.00 76.17  ? 214 HIS A N   1 
ATOM   1496 C CA  . HIS A 1 215 ? 37.776  43.858 23.588  1.00 79.85  ? 214 HIS A CA  1 
ATOM   1497 C C   . HIS A 1 215 ? 39.152  43.846 24.246  1.00 81.70  ? 214 HIS A C   1 
ATOM   1498 O O   . HIS A 1 215 ? 39.698  42.791 24.570  1.00 79.17  ? 214 HIS A O   1 
ATOM   1499 C CB  . HIS A 1 215 ? 36.912  42.694 24.054  1.00 79.60  ? 214 HIS A CB  1 
ATOM   1500 C CG  . HIS A 1 215 ? 35.647  42.538 23.273  1.00 79.61  ? 214 HIS A CG  1 
ATOM   1501 N ND1 . HIS A 1 215 ? 34.687  43.524 23.210  1.00 82.89  ? 214 HIS A ND1 1 
ATOM   1502 C CD2 . HIS A 1 215 ? 35.186  41.515 22.515  1.00 77.20  ? 214 HIS A CD2 1 
ATOM   1503 C CE1 . HIS A 1 215 ? 33.688  43.116 22.449  1.00 81.17  ? 214 HIS A CE1 1 
ATOM   1504 N NE2 . HIS A 1 215 ? 33.965  41.899 22.016  1.00 78.28  ? 214 HIS A NE2 1 
ATOM   1505 N N   . LEU A 1 216 ? 39.711  45.044 24.441  1.00 77.00  ? 215 LEU A N   1 
ATOM   1506 C CA  . LEU A 1 216 ? 41.032  45.163 25.053  1.00 78.79  ? 215 LEU A CA  1 
ATOM   1507 C C   . LEU A 1 216 ? 41.046  44.585 26.462  1.00 83.31  ? 215 LEU A C   1 
ATOM   1508 O O   . LEU A 1 216 ? 42.037  43.976 26.884  1.00 81.61  ? 215 LEU A O   1 
ATOM   1509 C CB  . LEU A 1 216 ? 41.464  46.628 25.076  1.00 83.04  ? 215 LEU A CB  1 
ATOM   1510 C CG  . LEU A 1 216 ? 42.739  46.936 25.860  1.00 88.06  ? 215 LEU A CG  1 
ATOM   1511 C CD1 . LEU A 1 216 ? 43.964  46.469 25.091  1.00 84.30  ? 215 LEU A CD1 1 
ATOM   1512 C CD2 . LEU A 1 216 ? 42.831  48.415 26.199  1.00 92.05  ? 215 LEU A CD2 1 
ATOM   1513 N N   . GLU A 1 217 ? 39.953  44.766 27.204  1.00 80.37  ? 216 GLU A N   1 
ATOM   1514 C CA  . GLU A 1 217 ? 39.899  44.279 28.577  1.00 84.98  ? 216 GLU A CA  1 
ATOM   1515 C C   . GLU A 1 217 ? 39.995  42.760 28.625  1.00 80.56  ? 216 GLU A C   1 
ATOM   1516 O O   . GLU A 1 217 ? 40.656  42.200 29.507  1.00 80.88  ? 216 GLU A O   1 
ATOM   1517 C CB  . GLU A 1 217 ? 38.614  44.761 29.251  1.00 90.11  ? 216 GLU A CB  1 
ATOM   1518 C CG  . GLU A 1 217 ? 38.308  46.242 29.039  1.00 95.14  ? 216 GLU A CG  1 
ATOM   1519 C CD  . GLU A 1 217 ? 37.590  46.517 27.725  1.00 98.13  ? 216 GLU A CD  1 
ATOM   1520 O OE1 . GLU A 1 217 ? 36.894  45.607 27.221  1.00 94.08  ? 216 GLU A OE1 1 
ATOM   1521 O OE2 . GLU A 1 217 ? 37.729  47.640 27.194  1.00 95.78  ? 216 GLU A OE2 1 
ATOM   1522 N N   . ILE A 1 218 ? 39.353  42.077 27.676  1.00 83.66  ? 217 ILE A N   1 
ATOM   1523 C CA  . ILE A 1 218 ? 39.403  40.619 27.650  1.00 78.30  ? 217 ILE A CA  1 
ATOM   1524 C C   . ILE A 1 218 ? 40.767  40.137 27.174  1.00 74.21  ? 217 ILE A C   1 
ATOM   1525 O O   . ILE A 1 218 ? 41.295  39.136 27.675  1.00 72.13  ? 217 ILE A O   1 
ATOM   1526 C CB  . ILE A 1 218 ? 38.267  40.063 26.773  1.00 76.16  ? 217 ILE A CB  1 
ATOM   1527 C CG1 . ILE A 1 218 ? 36.913  40.547 27.291  1.00 81.59  ? 217 ILE A CG1 1 
ATOM   1528 C CG2 . ILE A 1 218 ? 38.308  38.543 26.737  1.00 72.57  ? 217 ILE A CG2 1 
ATOM   1529 C CD1 . ILE A 1 218 ? 35.739  40.000 26.519  1.00 81.78  ? 217 ILE A CD1 1 
ATOM   1530 N N   . VAL A 1 219 ? 41.362  40.839 26.207  1.00 76.52  ? 218 VAL A N   1 
ATOM   1531 C CA  . VAL A 1 219 ? 42.655  40.422 25.669  1.00 72.44  ? 218 VAL A CA  1 
ATOM   1532 C C   . VAL A 1 219 ? 43.715  40.423 26.763  1.00 74.96  ? 218 VAL A C   1 
ATOM   1533 O O   . VAL A 1 219 ? 44.541  39.505 26.849  1.00 71.65  ? 218 VAL A O   1 
ATOM   1534 C CB  . VAL A 1 219 ? 43.057  41.322 24.485  1.00 73.08  ? 218 VAL A CB  1 
ATOM   1535 C CG1 . VAL A 1 219 ? 44.502  41.070 24.088  1.00 70.65  ? 218 VAL A CG1 1 
ATOM   1536 C CG2 . VAL A 1 219 ? 42.133  41.078 23.304  1.00 70.64  ? 218 VAL A CG2 1 
ATOM   1537 N N   . GLU A 1 220 ? 43.700  41.440 27.627  1.00 72.99  ? 219 GLU A N   1 
ATOM   1538 C CA  . GLU A 1 220 ? 44.668  41.493 28.718  1.00 74.24  ? 219 GLU A CA  1 
ATOM   1539 C C   . GLU A 1 220 ? 44.418  40.388 29.737  1.00 74.58  ? 219 GLU A C   1 
ATOM   1540 O O   . GLU A 1 220 ? 45.367  39.830 30.300  1.00 72.30  ? 219 GLU A O   1 
ATOM   1541 C CB  . GLU A 1 220 ? 44.625  42.864 29.389  1.00 81.51  ? 219 GLU A CB  1 
ATOM   1542 C CG  . GLU A 1 220 ? 45.215  43.976 28.544  1.00 86.11  ? 219 GLU A CG  1 
ATOM   1543 C CD  . GLU A 1 220 ? 45.087  45.331 29.202  1.00 97.35  ? 219 GLU A CD  1 
ATOM   1544 O OE1 . GLU A 1 220 ? 44.052  45.577 29.857  1.00 99.49  ? 219 GLU A OE1 1 
ATOM   1545 O OE2 . GLU A 1 220 ? 46.022  46.147 29.069  1.00 94.11  ? 219 GLU A OE2 1 
ATOM   1546 N N   . VAL A 1 221 ? 43.149  40.058 29.987  1.00 74.89  ? 220 VAL A N   1 
ATOM   1547 C CA  . VAL A 1 221 ? 42.833  38.999 30.940  1.00 75.05  ? 220 VAL A CA  1 
ATOM   1548 C C   . VAL A 1 221 ? 43.240  37.640 30.384  1.00 70.53  ? 220 VAL A C   1 
ATOM   1549 O O   . VAL A 1 221 ? 43.791  36.799 31.106  1.00 70.06  ? 220 VAL A O   1 
ATOM   1550 C CB  . VAL A 1 221 ? 41.339  39.045 31.311  1.00 80.81  ? 220 VAL A CB  1 
ATOM   1551 C CG1 . VAL A 1 221 ? 40.954  37.826 32.133  1.00 80.64  ? 220 VAL A CG1 1 
ATOM   1552 C CG2 . VAL A 1 221 ? 41.027  40.319 32.078  1.00 88.01  ? 220 VAL A CG2 1 
ATOM   1553 N N   . LEU A 1 222 ? 42.986  37.402 29.093  1.00 74.32  ? 221 LEU A N   1 
ATOM   1554 C CA  . LEU A 1 222 ? 43.395  36.141 28.481  1.00 71.52  ? 221 LEU A CA  1 
ATOM   1555 C C   . LEU A 1 222 ? 44.910  35.982 28.510  1.00 70.91  ? 221 LEU A C   1 
ATOM   1556 O O   . LEU A 1 222 ? 45.423  34.890 28.785  1.00 71.11  ? 221 LEU A O   1 
ATOM   1557 C CB  . LEU A 1 222 ? 42.876  36.056 27.045  1.00 68.97  ? 221 LEU A CB  1 
ATOM   1558 C CG  . LEU A 1 222 ? 41.361  36.010 26.838  1.00 69.37  ? 221 LEU A CG  1 
ATOM   1559 C CD1 . LEU A 1 222 ? 41.025  36.031 25.357  1.00 67.40  ? 221 LEU A CD1 1 
ATOM   1560 C CD2 . LEU A 1 222 ? 40.760  34.784 27.507  1.00 71.17  ? 221 LEU A CD2 1 
ATOM   1561 N N   . LEU A 1 223 ? 45.644  37.063 28.237  1.00 74.71  ? 222 LEU A N   1 
ATOM   1562 C CA  . LEU A 1 223 ? 47.101  36.993 28.258  1.00 74.38  ? 222 LEU A CA  1 
ATOM   1563 C C   . LEU A 1 223 ? 47.638  36.791 29.669  1.00 76.94  ? 222 LEU A C   1 
ATOM   1564 O O   . LEU A 1 223 ? 48.688  36.162 29.846  1.00 77.03  ? 222 LEU A O   1 
ATOM   1565 C CB  . LEU A 1 223 ? 47.693  38.256 27.633  1.00 73.96  ? 222 LEU A CB  1 
ATOM   1566 C CG  . LEU A 1 223 ? 47.520  38.369 26.118  1.00 71.73  ? 222 LEU A CG  1 
ATOM   1567 C CD1 . LEU A 1 223 ? 47.922  39.750 25.631  1.00 72.34  ? 222 LEU A CD1 1 
ATOM   1568 C CD2 . LEU A 1 223 ? 48.330  37.292 25.411  1.00 70.59  ? 222 LEU A CD2 1 
ATOM   1569 N N   . LYS A 1 224 ? 46.941  37.311 30.682  1.00 73.79  ? 223 LYS A N   1 
ATOM   1570 C CA  . LYS A 1 224 ? 47.361  37.080 32.059  1.00 76.80  ? 223 LYS A CA  1 
ATOM   1571 C C   . LYS A 1 224 ? 47.131  35.641 32.496  1.00 77.34  ? 223 LYS A C   1 
ATOM   1572 O O   . LYS A 1 224 ? 47.816  35.168 33.409  1.00 79.48  ? 223 LYS A O   1 
ATOM   1573 C CB  . LYS A 1 224 ? 46.636  38.032 33.012  1.00 80.56  ? 223 LYS A CB  1 
ATOM   1574 C CG  . LYS A 1 224 ? 47.481  39.216 33.454  1.00 84.77  ? 223 LYS A CG  1 
ATOM   1575 C CD  . LYS A 1 224 ? 46.964  39.812 34.753  1.00 92.56  ? 223 LYS A CD  1 
ATOM   1576 C CE  . LYS A 1 224 ? 47.930  40.850 35.300  1.00 96.99  ? 223 LYS A CE  1 
ATOM   1577 N NZ  . LYS A 1 224 ? 47.514  41.342 36.642  1.00 103.84 ? 223 LYS A NZ  1 
ATOM   1578 N N   . TYR A 1 225 ? 46.193  34.936 31.869  1.00 75.16  ? 224 TYR A N   1 
ATOM   1579 C CA  . TYR A 1 225 ? 45.942  33.535 32.172  1.00 75.03  ? 224 TYR A CA  1 
ATOM   1580 C C   . TYR A 1 225 ? 46.729  32.586 31.275  1.00 72.95  ? 224 TYR A C   1 
ATOM   1581 O O   . TYR A 1 225 ? 46.531  31.370 31.356  1.00 72.95  ? 224 TYR A O   1 
ATOM   1582 C CB  . TYR A 1 225 ? 44.443  33.233 32.077  1.00 74.79  ? 224 TYR A CB  1 
ATOM   1583 C CG  . TYR A 1 225 ? 43.674  33.566 33.338  1.00 77.89  ? 224 TYR A CG  1 
ATOM   1584 C CD1 . TYR A 1 225 ? 43.272  34.867 33.609  1.00 79.46  ? 224 TYR A CD1 1 
ATOM   1585 C CD2 . TYR A 1 225 ? 43.350  32.577 34.259  1.00 79.59  ? 224 TYR A CD2 1 
ATOM   1586 C CE1 . TYR A 1 225 ? 42.570  35.174 34.762  1.00 82.84  ? 224 TYR A CE1 1 
ATOM   1587 C CE2 . TYR A 1 225 ? 42.648  32.875 35.414  1.00 82.87  ? 224 TYR A CE2 1 
ATOM   1588 C CZ  . TYR A 1 225 ? 42.260  34.174 35.660  1.00 84.58  ? 224 TYR A CZ  1 
ATOM   1589 O OH  . TYR A 1 225 ? 41.562  34.472 36.808  1.00 88.37  ? 224 TYR A OH  1 
ATOM   1590 N N   . GLY A 1 226 ? 47.609  33.112 30.424  1.00 76.45  ? 225 GLY A N   1 
ATOM   1591 C CA  . GLY A 1 226 ? 48.518  32.278 29.662  1.00 75.26  ? 225 GLY A CA  1 
ATOM   1592 C C   . GLY A 1 226 ? 48.123  32.034 28.220  1.00 72.80  ? 225 GLY A C   1 
ATOM   1593 O O   . GLY A 1 226 ? 48.346  30.942 27.690  1.00 72.09  ? 225 GLY A O   1 
ATOM   1594 N N   . ALA A 1 227 ? 47.547  33.039 27.569  1.00 75.29  ? 226 ALA A N   1 
ATOM   1595 C CA  . ALA A 1 227 ? 47.153  32.902 26.175  1.00 73.33  ? 226 ALA A CA  1 
ATOM   1596 C C   . ALA A 1 227 ? 48.374  32.954 25.267  1.00 72.76  ? 226 ALA A C   1 
ATOM   1597 O O   . ALA A 1 227 ? 49.309  33.727 25.501  1.00 73.62  ? 226 ALA A O   1 
ATOM   1598 C CB  . ALA A 1 227 ? 46.166  34.001 25.784  1.00 72.83  ? 226 ALA A CB  1 
ATOM   1599 N N   . ASP A 1 228 ? 48.364  32.121 24.229  1.00 72.10  ? 227 ASP A N   1 
ATOM   1600 C CA  . ASP A 1 228 ? 49.425  32.135 23.227  1.00 73.38  ? 227 ASP A CA  1 
ATOM   1601 C C   . ASP A 1 228 ? 49.252  33.365 22.344  1.00 73.82  ? 227 ASP A C   1 
ATOM   1602 O O   . ASP A 1 228 ? 48.293  33.456 21.571  1.00 73.65  ? 227 ASP A O   1 
ATOM   1603 C CB  . ASP A 1 228 ? 49.393  30.852 22.400  1.00 76.50  ? 227 ASP A CB  1 
ATOM   1604 C CG  . ASP A 1 228 ? 50.604  30.708 21.490  1.00 82.27  ? 227 ASP A CG  1 
ATOM   1605 O OD1 . ASP A 1 228 ? 51.567  31.491 21.637  1.00 81.95  ? 227 ASP A OD1 1 
ATOM   1606 O OD2 . ASP A 1 228 ? 50.591  29.809 20.624  1.00 86.68  ? 227 ASP A OD2 1 
ATOM   1607 N N   . VAL A 1 229 ? 50.178  34.320 22.465  1.00 69.31  ? 228 VAL A N   1 
ATOM   1608 C CA  . VAL A 1 229 ? 50.079  35.556 21.699  1.00 68.55  ? 228 VAL A CA  1 
ATOM   1609 C C   . VAL A 1 229 ? 50.302  35.321 20.210  1.00 71.81  ? 228 VAL A C   1 
ATOM   1610 O O   . VAL A 1 229 ? 49.853  36.126 19.386  1.00 71.16  ? 228 VAL A O   1 
ATOM   1611 C CB  . VAL A 1 229 ? 51.068  36.603 22.249  1.00 69.25  ? 228 VAL A CB  1 
ATOM   1612 C CG1 . VAL A 1 229 ? 52.495  36.264 21.841  1.00 71.08  ? 228 VAL A CG1 1 
ATOM   1613 C CG2 . VAL A 1 229 ? 50.682  38.004 21.790  1.00 68.20  ? 228 VAL A CG2 1 
ATOM   1614 N N   . ASN A 1 230 ? 50.977  34.235 19.836  1.00 68.59  ? 229 ASN A N   1 
ATOM   1615 C CA  . ASN A 1 230 ? 51.194  33.940 18.425  1.00 71.49  ? 229 ASN A CA  1 
ATOM   1616 C C   . ASN A 1 230 ? 50.501  32.646 18.017  1.00 74.44  ? 229 ASN A C   1 
ATOM   1617 O O   . ASN A 1 230 ? 51.100  31.795 17.350  1.00 77.92  ? 229 ASN A O   1 
ATOM   1618 C CB  . ASN A 1 230 ? 52.689  33.871 18.110  1.00 74.00  ? 229 ASN A CB  1 
ATOM   1619 C CG  . ASN A 1 230 ? 53.304  35.242 17.896  1.00 80.17  ? 229 ASN A CG  1 
ATOM   1620 O OD1 . ASN A 1 230 ? 52.755  36.080 17.184  1.00 78.09  ? 229 ASN A OD1 1 
ATOM   1621 N ND2 . ASN A 1 230 ? 54.453  35.479 18.528  1.00 77.17  ? 229 ASN A ND2 1 
ATOM   1622 N N   . ALA A 1 231 ? 49.241  32.490 18.414  1.00 72.25  ? 230 ALA A N   1 
ATOM   1623 C CA  . ALA A 1 231 ? 48.465  31.337 17.987  1.00 73.81  ? 230 ALA A CA  1 
ATOM   1624 C C   . ALA A 1 231 ? 48.121  31.448 16.506  1.00 76.70  ? 230 ALA A C   1 
ATOM   1625 O O   . ALA A 1 231 ? 47.924  32.540 15.970  1.00 74.83  ? 230 ALA A O   1 
ATOM   1626 C CB  . ALA A 1 231 ? 47.190  31.216 18.817  1.00 71.35  ? 230 ALA A CB  1 
ATOM   1627 N N   . VAL A 1 232 ? 48.049  30.298 15.842  1.00 71.39  ? 231 VAL A N   1 
ATOM   1628 C CA  . VAL A 1 232 ? 47.797  30.226 14.408  1.00 73.06  ? 231 VAL A CA  1 
ATOM   1629 C C   . VAL A 1 232 ? 46.547  29.389 14.176  1.00 74.66  ? 231 VAL A C   1 
ATOM   1630 O O   . VAL A 1 232 ? 46.418  28.290 14.729  1.00 76.25  ? 231 VAL A O   1 
ATOM   1631 C CB  . VAL A 1 232 ? 49.007  29.641 13.655  1.00 78.69  ? 231 VAL A CB  1 
ATOM   1632 C CG1 . VAL A 1 232 ? 48.640  29.317 12.218  1.00 80.96  ? 231 VAL A CG1 1 
ATOM   1633 C CG2 . VAL A 1 232 ? 50.175  30.618 13.701  1.00 78.60  ? 231 VAL A CG2 1 
ATOM   1634 N N   . ASP A 1 233 ? 45.630  29.910 13.364  1.00 75.35  ? 232 ASP A N   1 
ATOM   1635 C CA  . ASP A 1 233 ? 44.385  29.236 13.039  1.00 76.19  ? 232 ASP A CA  1 
ATOM   1636 C C   . ASP A 1 233 ? 44.509  28.541 11.683  1.00 80.85  ? 232 ASP A C   1 
ATOM   1637 O O   . ASP A 1 233 ? 45.598  28.433 11.110  1.00 82.81  ? 232 ASP A O   1 
ATOM   1638 C CB  . ASP A 1 233 ? 43.225  30.234 13.064  1.00 73.61  ? 232 ASP A CB  1 
ATOM   1639 C CG  . ASP A 1 233 ? 43.369  31.325 12.020  1.00 75.77  ? 232 ASP A CG  1 
ATOM   1640 O OD1 . ASP A 1 233 ? 44.517  31.635 11.636  1.00 76.41  ? 232 ASP A OD1 1 
ATOM   1641 O OD2 . ASP A 1 233 ? 42.334  31.874 11.585  1.00 76.60  ? 232 ASP A OD2 1 
ATOM   1642 N N   . ALA A 1 234 ? 43.377  28.063 11.158  1.00 71.94  ? 233 ALA A N   1 
ATOM   1643 C CA  . ALA A 1 234 ? 43.392  27.376 9.870   1.00 75.01  ? 233 ALA A CA  1 
ATOM   1644 C C   . ALA A 1 234 ? 43.816  28.306 8.742   1.00 75.33  ? 233 ALA A C   1 
ATOM   1645 O O   . ALA A 1 234 ? 44.465  27.866 7.787   1.00 77.93  ? 233 ALA A O   1 
ATOM   1646 C CB  . ALA A 1 234 ? 42.016  26.776 9.577   1.00 76.32  ? 233 ALA A CB  1 
ATOM   1647 N N   . ALA A 1 235 ? 43.464  29.588 8.832   1.00 77.56  ? 234 ALA A N   1 
ATOM   1648 C CA  . ALA A 1 235 ? 43.877  30.557 7.827   1.00 76.58  ? 234 ALA A CA  1 
ATOM   1649 C C   . ALA A 1 235 ? 45.308  31.037 8.022   1.00 77.87  ? 234 ALA A C   1 
ATOM   1650 O O   . ALA A 1 235 ? 45.818  31.773 7.170   1.00 77.65  ? 234 ALA A O   1 
ATOM   1651 C CB  . ALA A 1 235 ? 42.928  31.758 7.830   1.00 73.50  ? 234 ALA A CB  1 
ATOM   1652 N N   . GLY A 1 236 ? 45.964  30.645 9.112   1.00 76.36  ? 235 GLY A N   1 
ATOM   1653 C CA  . GLY A 1 236 ? 47.327  31.058 9.370   1.00 77.25  ? 235 GLY A CA  1 
ATOM   1654 C C   . GLY A 1 236 ? 47.482  32.416 10.013  1.00 74.91  ? 235 GLY A C   1 
ATOM   1655 O O   . GLY A 1 236 ? 48.603  32.935 10.061  1.00 75.94  ? 235 GLY A O   1 
ATOM   1656 N N   . GLY A 1 237 ? 46.402  33.006 10.517  1.00 77.33  ? 236 GLY A N   1 
ATOM   1657 C CA  . GLY A 1 237 ? 46.440  34.346 11.081  1.00 73.74  ? 236 GLY A CA  1 
ATOM   1658 C C   . GLY A 1 237 ? 46.577  34.325 12.591  1.00 73.15  ? 236 GLY A C   1 
ATOM   1659 O O   . GLY A 1 237 ? 45.897  33.564 13.282  1.00 72.66  ? 236 GLY A O   1 
ATOM   1660 N N   . THR A 1 238 ? 47.468  35.172 13.096  1.00 69.98  ? 237 THR A N   1 
ATOM   1661 C CA  . THR A 1 238 ? 47.657  35.348 14.527  1.00 69.39  ? 237 THR A CA  1 
ATOM   1662 C C   . THR A 1 238 ? 46.637  36.345 15.062  1.00 68.73  ? 237 THR A C   1 
ATOM   1663 O O   . THR A 1 238 ? 45.944  37.013 14.293  1.00 68.68  ? 237 THR A O   1 
ATOM   1664 C CB  . THR A 1 238 ? 49.084  35.818 14.802  1.00 69.92  ? 237 THR A CB  1 
ATOM   1665 O OG1 . THR A 1 238 ? 49.305  37.086 14.173  1.00 69.97  ? 237 THR A OG1 1 
ATOM   1666 C CG2 . THR A 1 238 ? 50.090  34.807 14.270  1.00 72.53  ? 237 THR A CG2 1 
ATOM   1667 N N   . PRO A 1 239 ? 46.495  36.454 16.387  1.00 68.51  ? 238 PRO A N   1 
ATOM   1668 C CA  . PRO A 1 239 ? 45.644  37.525 16.930  1.00 66.03  ? 238 PRO A CA  1 
ATOM   1669 C C   . PRO A 1 239 ? 46.076  38.910 16.485  1.00 66.64  ? 238 PRO A C   1 
ATOM   1670 O O   . PRO A 1 239 ? 45.237  39.815 16.398  1.00 65.18  ? 238 PRO A O   1 
ATOM   1671 C CB  . PRO A 1 239 ? 45.782  37.345 18.447  1.00 65.94  ? 238 PRO A CB  1 
ATOM   1672 C CG  . PRO A 1 239 ? 46.066  35.899 18.614  1.00 68.95  ? 238 PRO A CG  1 
ATOM   1673 C CD  . PRO A 1 239 ? 46.927  35.517 17.441  1.00 69.75  ? 238 PRO A CD  1 
ATOM   1674 N N   . LEU A 1 240 ? 47.365  39.101 16.193  1.00 67.41  ? 239 LEU A N   1 
ATOM   1675 C CA  . LEU A 1 240 ? 47.815  40.373 15.642  1.00 67.33  ? 239 LEU A CA  1 
ATOM   1676 C C   . LEU A 1 240 ? 47.253  40.605 14.246  1.00 68.69  ? 239 LEU A C   1 
ATOM   1677 O O   . LEU A 1 240 ? 46.994  41.754 13.869  1.00 67.63  ? 239 LEU A O   1 
ATOM   1678 C CB  . LEU A 1 240 ? 49.342  40.427 15.622  1.00 69.78  ? 239 LEU A CB  1 
ATOM   1679 C CG  . LEU A 1 240 ? 49.962  41.793 15.330  1.00 71.64  ? 239 LEU A CG  1 
ATOM   1680 C CD1 . LEU A 1 240 ? 49.533  42.810 16.375  1.00 69.54  ? 239 LEU A CD1 1 
ATOM   1681 C CD2 . LEU A 1 240 ? 51.476  41.684 15.272  1.00 75.22  ? 239 LEU A CD2 1 
ATOM   1682 N N   . HIS A 1 241 ? 47.063  39.537 13.464  1.00 66.73  ? 240 HIS A N   1 
ATOM   1683 C CA  . HIS A 1 241 ? 46.392  39.681 12.176  1.00 67.00  ? 240 HIS A CA  1 
ATOM   1684 C C   . HIS A 1 241 ? 44.985  40.229 12.360  1.00 66.86  ? 240 HIS A C   1 
ATOM   1685 O O   . HIS A 1 241 ? 44.603  41.215 11.721  1.00 67.20  ? 240 HIS A O   1 
ATOM   1686 C CB  . HIS A 1 241 ? 46.344  38.340 11.441  1.00 67.48  ? 240 HIS A CB  1 
ATOM   1687 C CG  . HIS A 1 241 ? 47.602  38.000 10.705  1.00 68.48  ? 240 HIS A CG  1 
ATOM   1688 N ND1 . HIS A 1 241 ? 48.535  37.114 11.199  1.00 70.25  ? 240 HIS A ND1 1 
ATOM   1689 C CD2 . HIS A 1 241 ? 48.076  38.418 9.508   1.00 70.09  ? 240 HIS A CD2 1 
ATOM   1690 C CE1 . HIS A 1 241 ? 49.532  37.004 10.339  1.00 73.55  ? 240 HIS A CE1 1 
ATOM   1691 N NE2 . HIS A 1 241 ? 49.279  37.786 9.305   1.00 73.08  ? 240 HIS A NE2 1 
ATOM   1692 N N   . GLU A 1 242 ? 44.205  39.608 13.248  1.00 73.42  ? 241 GLU A N   1 
ATOM   1693 C CA  . GLU A 1 242 ? 42.826  40.036 13.460  1.00 72.54  ? 241 GLU A CA  1 
ATOM   1694 C C   . GLU A 1 242 ? 42.751  41.440 14.045  1.00 73.04  ? 241 GLU A C   1 
ATOM   1695 O O   . GLU A 1 242 ? 41.785  42.166 13.785  1.00 73.37  ? 241 GLU A O   1 
ATOM   1696 C CB  . GLU A 1 242 ? 42.104  39.045 14.373  1.00 73.40  ? 241 GLU A CB  1 
ATOM   1697 C CG  . GLU A 1 242 ? 42.059  37.614 13.851  1.00 78.90  ? 241 GLU A CG  1 
ATOM   1698 C CD  . GLU A 1 242 ? 40.922  37.375 12.873  1.00 87.95  ? 241 GLU A CD  1 
ATOM   1699 O OE1 . GLU A 1 242 ? 40.469  38.343 12.226  1.00 87.11  ? 241 GLU A OE1 1 
ATOM   1700 O OE2 . GLU A 1 242 ? 40.474  36.214 12.757  1.00 88.12  ? 241 GLU A OE2 1 
ATOM   1701 N N   . ALA A 1 243 ? 43.750  41.839 14.833  1.00 70.87  ? 242 ALA A N   1 
ATOM   1702 C CA  . ALA A 1 243 ? 43.725  43.167 15.437  1.00 70.90  ? 242 ALA A CA  1 
ATOM   1703 C C   . ALA A 1 243 ? 43.969  44.250 14.393  1.00 72.35  ? 242 ALA A C   1 
ATOM   1704 O O   . ALA A 1 243 ? 43.198  45.211 14.290  1.00 72.66  ? 242 ALA A O   1 
ATOM   1705 C CB  . ALA A 1 243 ? 44.756  43.251 16.562  1.00 71.14  ? 242 ALA A CB  1 
ATOM   1706 N N   . ALA A 1 244 ? 45.038  44.112 13.604  1.00 75.07  ? 243 ALA A N   1 
ATOM   1707 C CA  . ALA A 1 244 ? 45.297  45.069 12.534  1.00 75.39  ? 243 ALA A CA  1 
ATOM   1708 C C   . ALA A 1 244 ? 44.274  44.967 11.410  1.00 76.71  ? 243 ALA A C   1 
ATOM   1709 O O   . ALA A 1 244 ? 44.093  45.934 10.663  1.00 76.96  ? 243 ALA A O   1 
ATOM   1710 C CB  . ALA A 1 244 ? 46.706  44.871 11.974  1.00 77.33  ? 243 ALA A CB  1 
ATOM   1711 N N   . ARG A 1 245 ? 43.609  43.817 11.275  1.00 79.57  ? 244 ARG A N   1 
ATOM   1712 C CA  . ARG A 1 245 ? 42.568  43.668 10.263  1.00 80.18  ? 244 ARG A CA  1 
ATOM   1713 C C   . ARG A 1 245 ? 41.388  44.587 10.552  1.00 81.67  ? 244 ARG A C   1 
ATOM   1714 O O   . ARG A 1 245 ? 40.818  45.185 9.632   1.00 82.28  ? 244 ARG A O   1 
ATOM   1715 C CB  . ARG A 1 245 ? 42.124  42.206 10.203  1.00 80.87  ? 244 ARG A CB  1 
ATOM   1716 C CG  . ARG A 1 245 ? 41.230  41.819 9.040   1.00 86.13  ? 244 ARG A CG  1 
ATOM   1717 C CD  . ARG A 1 245 ? 41.118  40.298 8.971   1.00 91.16  ? 244 ARG A CD  1 
ATOM   1718 N NE  . ARG A 1 245 ? 39.950  39.844 8.221   1.00 96.71  ? 244 ARG A NE  1 
ATOM   1719 C CZ  . ARG A 1 245 ? 39.565  38.574 8.138   1.00 103.37 ? 244 ARG A CZ  1 
ATOM   1720 N NH1 . ARG A 1 245 ? 40.256  37.627 8.760   1.00 100.10 ? 244 ARG A NH1 1 
ATOM   1721 N NH2 . ARG A 1 245 ? 38.488  38.248 7.435   1.00 100.87 ? 244 ARG A NH2 1 
ATOM   1722 N N   . ALA A 1 246 ? 41.020  44.723 11.826  1.00 74.32  ? 245 ALA A N   1 
ATOM   1723 C CA  . ALA A 1 246 ? 39.913  45.579 12.234  1.00 75.19  ? 245 ALA A CA  1 
ATOM   1724 C C   . ALA A 1 246 ? 40.355  46.958 12.699  1.00 76.17  ? 245 ALA A C   1 
ATOM   1725 O O   . ALA A 1 246 ? 39.580  47.913 12.588  1.00 77.20  ? 245 ALA A O   1 
ATOM   1726 C CB  . ALA A 1 246 ? 39.108  44.909 13.353  1.00 76.04  ? 245 ALA A CB  1 
ATOM   1727 N N   . GLY A 1 247 ? 41.572  47.088 13.220  1.00 70.14  ? 246 GLY A N   1 
ATOM   1728 C CA  . GLY A 1 247 ? 42.079  48.383 13.631  1.00 70.43  ? 246 GLY A CA  1 
ATOM   1729 C C   . GLY A 1 247 ? 41.796  48.730 15.078  1.00 72.15  ? 246 GLY A C   1 
ATOM   1730 O O   . GLY A 1 247 ? 41.169  49.754 15.366  1.00 73.38  ? 246 GLY A O   1 
ATOM   1731 N N   . HIS A 1 248 ? 42.253  47.886 15.997  1.00 66.89  ? 247 HIS A N   1 
ATOM   1732 C CA  . HIS A 1 248 ? 42.132  48.122 17.434  1.00 68.16  ? 247 HIS A CA  1 
ATOM   1733 C C   . HIS A 1 248 ? 43.530  48.436 17.957  1.00 68.47  ? 247 HIS A C   1 
ATOM   1734 O O   . HIS A 1 248 ? 44.270  47.540 18.368  1.00 67.59  ? 247 HIS A O   1 
ATOM   1735 C CB  . HIS A 1 248 ? 41.524  46.921 18.139  1.00 67.93  ? 247 HIS A CB  1 
ATOM   1736 C CG  . HIS A 1 248 ? 40.217  46.487 17.559  1.00 69.14  ? 247 HIS A CG  1 
ATOM   1737 N ND1 . HIS A 1 248 ? 39.092  47.282 17.589  1.00 71.39  ? 247 HIS A ND1 1 
ATOM   1738 C CD2 . HIS A 1 248 ? 39.856  45.347 16.926  1.00 69.08  ? 247 HIS A CD2 1 
ATOM   1739 C CE1 . HIS A 1 248 ? 38.093  46.649 17.002  1.00 71.64  ? 247 HIS A CE1 1 
ATOM   1740 N NE2 . HIS A 1 248 ? 38.530  45.472 16.592  1.00 70.39  ? 247 HIS A NE2 1 
ATOM   1741 N N   . LEU A 1 249 ? 43.881  49.724 17.938  1.00 69.35  ? 248 LEU A N   1 
ATOM   1742 C CA  . LEU A 1 249 ? 45.235  50.140 18.295  1.00 69.93  ? 248 LEU A CA  1 
ATOM   1743 C C   . LEU A 1 249 ? 45.614  49.674 19.694  1.00 70.85  ? 248 LEU A C   1 
ATOM   1744 O O   . LEU A 1 249 ? 46.768  49.304 19.941  1.00 70.76  ? 248 LEU A O   1 
ATOM   1745 C CB  . LEU A 1 249 ? 45.355  51.660 18.189  1.00 71.78  ? 248 LEU A CB  1 
ATOM   1746 C CG  . LEU A 1 249 ? 46.714  52.265 18.536  1.00 73.06  ? 248 LEU A CG  1 
ATOM   1747 C CD1 . LEU A 1 249 ? 47.733  51.952 17.453  1.00 71.72  ? 248 LEU A CD1 1 
ATOM   1748 C CD2 . LEU A 1 249 ? 46.591  53.765 18.752  1.00 75.55  ? 248 LEU A CD2 1 
ATOM   1749 N N   . GLU A 1 250 ? 44.655  49.676 20.622  1.00 70.17  ? 249 GLU A N   1 
ATOM   1750 C CA  . GLU A 1 250 ? 44.958  49.285 21.993  1.00 71.51  ? 249 GLU A CA  1 
ATOM   1751 C C   . GLU A 1 250 ? 45.371  47.822 22.068  1.00 69.69  ? 249 GLU A C   1 
ATOM   1752 O O   . GLU A 1 250 ? 46.290  47.465 22.814  1.00 70.35  ? 249 GLU A O   1 
ATOM   1753 C CB  . GLU A 1 250 ? 43.754  49.557 22.895  1.00 73.58  ? 249 GLU A CB  1 
ATOM   1754 C CG  . GLU A 1 250 ? 43.389  51.032 23.027  1.00 76.26  ? 249 GLU A CG  1 
ATOM   1755 C CD  . GLU A 1 250 ? 42.649  51.573 21.814  1.00 83.30  ? 249 GLU A CD  1 
ATOM   1756 O OE1 . GLU A 1 250 ? 42.185  50.757 20.988  1.00 80.03  ? 249 GLU A OE1 1 
ATOM   1757 O OE2 . GLU A 1 250 ? 42.535  52.811 21.686  1.00 83.59  ? 249 GLU A OE2 1 
ATOM   1758 N N   . ILE A 1 251 ? 44.713  46.962 21.291  1.00 68.74  ? 250 ILE A N   1 
ATOM   1759 C CA  . ILE A 1 251 ? 45.064  45.546 21.284  1.00 67.21  ? 250 ILE A CA  1 
ATOM   1760 C C   . ILE A 1 251 ? 46.369  45.314 20.534  1.00 66.15  ? 250 ILE A C   1 
ATOM   1761 O O   . ILE A 1 251 ? 47.182  44.471 20.930  1.00 65.98  ? 250 ILE A O   1 
ATOM   1762 C CB  . ILE A 1 251 ? 43.906  44.724 20.691  1.00 66.01  ? 250 ILE A CB  1 
ATOM   1763 C CG1 . ILE A 1 251 ? 42.678  44.823 21.595  1.00 67.60  ? 250 ILE A CG1 1 
ATOM   1764 C CG2 . ILE A 1 251 ? 44.309  43.272 20.506  1.00 64.54  ? 250 ILE A CG2 1 
ATOM   1765 C CD1 . ILE A 1 251 ? 41.509  44.000 21.117  1.00 67.00  ? 250 ILE A CD1 1 
ATOM   1766 N N   . VAL A 1 252 ? 46.598  46.059 19.449  1.00 67.30  ? 251 VAL A N   1 
ATOM   1767 C CA  . VAL A 1 252 ? 47.831  45.893 18.684  1.00 66.79  ? 251 VAL A CA  1 
ATOM   1768 C C   . VAL A 1 252 ? 49.043  46.212 19.549  1.00 68.40  ? 251 VAL A C   1 
ATOM   1769 O O   . VAL A 1 252 ? 50.059  45.507 19.504  1.00 68.37  ? 251 VAL A O   1 
ATOM   1770 C CB  . VAL A 1 252 ? 47.798  46.764 17.414  1.00 66.57  ? 251 VAL A CB  1 
ATOM   1771 C CG1 . VAL A 1 252 ? 49.124  46.672 16.672  1.00 66.64  ? 251 VAL A CG1 1 
ATOM   1772 C CG2 . VAL A 1 252 ? 46.655  46.339 16.509  1.00 65.36  ? 251 VAL A CG2 1 
ATOM   1773 N N   . GLU A 1 253 ? 48.954  47.268 20.362  1.00 69.95  ? 252 GLU A N   1 
ATOM   1774 C CA  . GLU A 1 253 ? 50.081  47.636 21.213  1.00 72.07  ? 252 GLU A CA  1 
ATOM   1775 C C   . GLU A 1 253 ? 50.285  46.637 22.344  1.00 72.59  ? 252 GLU A C   1 
ATOM   1776 O O   . GLU A 1 253 ? 51.425  46.400 22.758  1.00 73.85  ? 252 GLU A O   1 
ATOM   1777 C CB  . GLU A 1 253 ? 49.882  49.045 21.772  1.00 74.39  ? 252 GLU A CB  1 
ATOM   1778 C CG  . GLU A 1 253 ? 49.887  50.134 20.706  1.00 75.14  ? 252 GLU A CG  1 
ATOM   1779 C CD  . GLU A 1 253 ? 49.701  51.526 21.282  1.00 84.55  ? 252 GLU A CD  1 
ATOM   1780 O OE1 . GLU A 1 253 ? 49.595  51.650 22.520  1.00 85.40  ? 252 GLU A OE1 1 
ATOM   1781 O OE2 . GLU A 1 253 ? 49.661  52.496 20.495  1.00 83.05  ? 252 GLU A OE2 1 
ATOM   1782 N N   . VAL A 1 254 ? 49.204  46.039 22.849  1.00 70.21  ? 253 VAL A N   1 
ATOM   1783 C CA  . VAL A 1 254 ? 49.331  45.067 23.931  1.00 70.83  ? 253 VAL A CA  1 
ATOM   1784 C C   . VAL A 1 254 ? 49.915  43.758 23.414  1.00 69.17  ? 253 VAL A C   1 
ATOM   1785 O O   . VAL A 1 254 ? 50.799  43.166 24.045  1.00 70.20  ? 253 VAL A O   1 
ATOM   1786 C CB  . VAL A 1 254 ? 47.968  44.855 24.617  1.00 71.03  ? 253 VAL A CB  1 
ATOM   1787 C CG1 . VAL A 1 254 ? 47.991  43.607 25.483  1.00 71.14  ? 253 VAL A CG1 1 
ATOM   1788 C CG2 . VAL A 1 254 ? 47.608  46.072 25.455  1.00 73.74  ? 253 VAL A CG2 1 
ATOM   1789 N N   . LEU A 1 255 ? 49.438  43.286 22.259  1.00 70.16  ? 254 LEU A N   1 
ATOM   1790 C CA  . LEU A 1 255 ? 49.957  42.040 21.702  1.00 68.96  ? 254 LEU A CA  1 
ATOM   1791 C C   . LEU A 1 255 ? 51.433  42.165 21.342  1.00 69.91  ? 254 LEU A C   1 
ATOM   1792 O O   . LEU A 1 255 ? 52.213  41.230 21.558  1.00 70.34  ? 254 LEU A O   1 
ATOM   1793 C CB  . LEU A 1 255 ? 49.138  41.628 20.477  1.00 67.01  ? 254 LEU A CB  1 
ATOM   1794 C CG  . LEU A 1 255 ? 47.676  41.246 20.718  1.00 66.33  ? 254 LEU A CG  1 
ATOM   1795 C CD1 . LEU A 1 255 ? 46.982  40.897 19.408  1.00 64.94  ? 254 LEU A CD1 1 
ATOM   1796 C CD2 . LEU A 1 255 ? 47.579  40.093 21.705  1.00 66.57  ? 254 LEU A CD2 1 
ATOM   1797 N N   . LEU A 1 256 ? 51.837  43.316 20.799  1.00 70.59  ? 255 LEU A N   1 
ATOM   1798 C CA  . LEU A 1 256 ? 53.231  43.494 20.406  1.00 71.93  ? 255 LEU A CA  1 
ATOM   1799 C C   . LEU A 1 256 ? 54.154  43.505 21.619  1.00 74.38  ? 255 LEU A C   1 
ATOM   1800 O O   . LEU A 1 256 ? 55.221  42.879 21.599  1.00 75.47  ? 255 LEU A O   1 
ATOM   1801 C CB  . LEU A 1 256 ? 53.386  44.779 19.594  1.00 72.36  ? 255 LEU A CB  1 
ATOM   1802 C CG  . LEU A 1 256 ? 52.893  44.712 18.147  1.00 70.59  ? 255 LEU A CG  1 
ATOM   1803 C CD1 . LEU A 1 256 ? 52.887  46.093 17.514  1.00 71.20  ? 255 LEU A CD1 1 
ATOM   1804 C CD2 . LEU A 1 256 ? 53.751  43.754 17.333  1.00 72.86  ? 255 LEU A CD2 1 
ATOM   1805 N N   . LYS A 1 257 ? 53.761  44.208 22.686  1.00 73.95  ? 256 LYS A N   1 
ATOM   1806 C CA  . LYS A 1 257 ? 54.576  44.224 23.897  1.00 76.74  ? 256 LYS A CA  1 
ATOM   1807 C C   . LYS A 1 257 ? 54.659  42.840 24.529  1.00 76.52  ? 256 LYS A C   1 
ATOM   1808 O O   . LYS A 1 257 ? 55.699  42.480 25.094  1.00 78.67  ? 256 LYS A O   1 
ATOM   1809 C CB  . LYS A 1 257 ? 54.018  45.239 24.898  1.00 78.55  ? 256 LYS A CB  1 
ATOM   1810 C CG  . LYS A 1 257 ? 54.121  46.685 24.433  1.00 80.01  ? 256 LYS A CG  1 
ATOM   1811 C CD  . LYS A 1 257 ? 53.351  47.624 25.353  1.00 84.25  ? 256 LYS A CD  1 
ATOM   1812 C CE  . LYS A 1 257 ? 53.330  49.043 24.807  1.00 87.60  ? 256 LYS A CE  1 
ATOM   1813 N NZ  . LYS A 1 257 ? 52.538  49.964 25.668  1.00 91.90  ? 256 LYS A NZ  1 
ATOM   1814 N N   . TYR A 1 258 ? 53.584  42.051 24.441  1.00 73.10  ? 257 TYR A N   1 
ATOM   1815 C CA  . TYR A 1 258 ? 53.619  40.693 24.971  1.00 72.87  ? 257 TYR A CA  1 
ATOM   1816 C C   . TYR A 1 258 ? 54.466  39.760 24.117  1.00 72.31  ? 257 TYR A C   1 
ATOM   1817 O O   . TYR A 1 258 ? 54.830  38.674 24.582  1.00 72.85  ? 257 TYR A O   1 
ATOM   1818 C CB  . TYR A 1 258 ? 52.202  40.136 25.103  1.00 70.99  ? 257 TYR A CB  1 
ATOM   1819 C CG  . TYR A 1 258 ? 51.680  40.121 26.522  1.00 72.59  ? 257 TYR A CG  1 
ATOM   1820 C CD1 . TYR A 1 258 ? 51.050  41.233 27.063  1.00 73.81  ? 257 TYR A CD1 1 
ATOM   1821 C CD2 . TYR A 1 258 ? 51.819  38.993 27.322  1.00 73.23  ? 257 TYR A CD2 1 
ATOM   1822 C CE1 . TYR A 1 258 ? 50.571  41.223 28.360  1.00 75.79  ? 257 TYR A CE1 1 
ATOM   1823 C CE2 . TYR A 1 258 ? 51.343  38.972 28.620  1.00 75.04  ? 257 TYR A CE2 1 
ATOM   1824 C CZ  . TYR A 1 258 ? 50.720  40.091 29.134  1.00 76.39  ? 257 TYR A CZ  1 
ATOM   1825 O OH  . TYR A 1 258 ? 50.245  40.076 30.426  1.00 78.69  ? 257 TYR A OH  1 
ATOM   1826 N N   . GLY A 1 259 ? 54.786  40.152 22.887  1.00 75.19  ? 258 GLY A N   1 
ATOM   1827 C CA  . GLY A 1 259 ? 55.692  39.375 22.066  1.00 75.42  ? 258 GLY A CA  1 
ATOM   1828 C C   . GLY A 1 259 ? 55.059  38.744 20.844  1.00 75.98  ? 258 GLY A C   1 
ATOM   1829 O O   . GLY A 1 259 ? 55.479  37.666 20.414  1.00 77.64  ? 258 GLY A O   1 
ATOM   1830 N N   . ALA A 1 260 ? 54.049  39.396 20.275  1.00 73.92  ? 259 ALA A N   1 
ATOM   1831 C CA  . ALA A 1 260 ? 53.459  38.901 19.041  1.00 75.15  ? 259 ALA A CA  1 
ATOM   1832 C C   . ALA A 1 260 ? 54.432  39.090 17.884  1.00 79.39  ? 259 ALA A C   1 
ATOM   1833 O O   . ALA A 1 260 ? 55.276  39.990 17.892  1.00 79.68  ? 259 ALA A O   1 
ATOM   1834 C CB  . ALA A 1 260 ? 52.142  39.618 18.746  1.00 73.43  ? 259 ALA A CB  1 
ATOM   1835 N N   . ASP A 1 261 ? 54.314  38.224 16.881  1.00 76.74  ? 260 ASP A N   1 
ATOM   1836 C CA  . ASP A 1 261 ? 55.201  38.257 15.723  1.00 79.96  ? 260 ASP A CA  1 
ATOM   1837 C C   . ASP A 1 261 ? 54.622  39.215 14.688  1.00 81.09  ? 260 ASP A C   1 
ATOM   1838 O O   . ASP A 1 261 ? 53.611  38.911 14.045  1.00 80.64  ? 260 ASP A O   1 
ATOM   1839 C CB  . ASP A 1 261 ? 55.387  36.857 15.144  1.00 83.62  ? 260 ASP A CB  1 
ATOM   1840 C CG  . ASP A 1 261 ? 56.492  36.798 14.106  1.00 90.58  ? 260 ASP A CG  1 
ATOM   1841 O OD1 . ASP A 1 261 ? 57.623  37.230 14.415  1.00 91.09  ? 260 ASP A OD1 1 
ATOM   1842 O OD2 . ASP A 1 261 ? 56.235  36.314 12.985  1.00 95.28  ? 260 ASP A OD2 1 
ATOM   1843 N N   . VAL A 1 262 ? 55.264  40.376 14.528  1.00 74.90  ? 261 VAL A N   1 
ATOM   1844 C CA  . VAL A 1 262 ? 54.814  41.372 13.563  1.00 74.65  ? 261 VAL A CA  1 
ATOM   1845 C C   . VAL A 1 262 ? 55.049  40.938 12.125  1.00 79.24  ? 261 VAL A C   1 
ATOM   1846 O O   . VAL A 1 262 ? 54.512  41.560 11.201  1.00 78.94  ? 261 VAL A O   1 
ATOM   1847 C CB  . VAL A 1 262 ? 55.512  42.722 13.830  1.00 75.27  ? 261 VAL A CB  1 
ATOM   1848 C CG1 . VAL A 1 262 ? 56.933  42.705 13.287  1.00 78.42  ? 261 VAL A CG1 1 
ATOM   1849 C CG2 . VAL A 1 262 ? 54.713  43.877 13.241  1.00 73.83  ? 261 VAL A CG2 1 
ATOM   1850 N N   . ASN A 1 263 ? 55.832  39.882 11.910  1.00 75.37  ? 262 ASN A N   1 
ATOM   1851 C CA  . ASN A 1 263 ? 56.113  39.365 10.578  1.00 79.39  ? 262 ASN A CA  1 
ATOM   1852 C C   . ASN A 1 263 ? 55.499  37.983 10.362  1.00 81.72  ? 262 ASN A C   1 
ATOM   1853 O O   . ASN A 1 263 ? 55.990  37.202 9.544   1.00 85.49  ? 262 ASN A O   1 
ATOM   1854 C CB  . ASN A 1 263 ? 57.620  39.322 10.330  1.00 82.96  ? 262 ASN A CB  1 
ATOM   1855 C CG  . ASN A 1 263 ? 58.263  40.693 10.397  1.00 88.63  ? 262 ASN A CG  1 
ATOM   1856 O OD1 . ASN A 1 263 ? 57.711  41.676 9.901   1.00 85.36  ? 262 ASN A OD1 1 
ATOM   1857 N ND2 . ASN A 1 263 ? 59.436  40.767 11.016  1.00 86.46  ? 262 ASN A ND2 1 
ATOM   1858 N N   . ALA A 1 264 ? 54.431  37.669 11.090  1.00 75.98  ? 263 ALA A N   1 
ATOM   1859 C CA  . ALA A 1 264 ? 53.773  36.379 10.932  1.00 75.59  ? 263 ALA A CA  1 
ATOM   1860 C C   . ALA A 1 264 ? 53.031  36.332 9.603   1.00 75.78  ? 263 ALA A C   1 
ATOM   1861 O O   . ALA A 1 264 ? 52.325  37.276 9.243   1.00 74.85  ? 263 ALA A O   1 
ATOM   1862 C CB  . ALA A 1 264 ? 52.810  36.129 12.090  1.00 73.59  ? 263 ALA A CB  1 
ATOM   1863 N N   . VAL A 1 265 ? 53.189  35.232 8.874   1.00 76.38  ? 264 VAL A N   1 
ATOM   1864 C CA  . VAL A 1 265 ? 52.598  35.068 7.551   1.00 77.36  ? 264 VAL A CA  1 
ATOM   1865 C C   . VAL A 1 265 ? 51.448  34.075 7.643   1.00 76.66  ? 264 VAL A C   1 
ATOM   1866 O O   . VAL A 1 265 ? 51.563  33.036 8.304   1.00 76.73  ? 264 VAL A O   1 
ATOM   1867 C CB  . VAL A 1 265 ? 53.653  34.607 6.526   1.00 80.54  ? 264 VAL A CB  1 
ATOM   1868 C CG1 . VAL A 1 265 ? 53.028  34.428 5.156   1.00 82.03  ? 264 VAL A CG1 1 
ATOM   1869 C CG2 . VAL A 1 265 ? 54.796  35.607 6.462   1.00 81.59  ? 264 VAL A CG2 1 
ATOM   1870 N N   . ASP A 1 266 ? 50.335  34.399 6.985   1.00 83.27  ? 265 ASP A N   1 
ATOM   1871 C CA  . ASP A 1 266 ? 49.165  33.538 6.955   1.00 82.17  ? 265 ASP A CA  1 
ATOM   1872 C C   . ASP A 1 266 ? 49.171  32.697 5.678   1.00 86.33  ? 265 ASP A C   1 
ATOM   1873 O O   . ASP A 1 266 ? 50.144  32.686 4.917   1.00 88.80  ? 265 ASP A O   1 
ATOM   1874 C CB  . ASP A 1 266 ? 47.886  34.373 7.087   1.00 78.23  ? 265 ASP A CB  1 
ATOM   1875 C CG  . ASP A 1 266 ? 47.562  35.162 5.827   1.00 80.52  ? 265 ASP A CG  1 
ATOM   1876 O OD1 . ASP A 1 266 ? 48.503  35.569 5.113   1.00 82.43  ? 265 ASP A OD1 1 
ATOM   1877 O OD2 . ASP A 1 266 ? 46.361  35.377 5.554   1.00 80.15  ? 265 ASP A OD2 1 
ATOM   1878 N N   . ALA A 1 267 ? 48.068  31.982 5.436   1.00 81.37  ? 266 ALA A N   1 
ATOM   1879 C CA  . ALA A 1 267 ? 47.992  31.099 4.276   1.00 84.03  ? 266 ALA A CA  1 
ATOM   1880 C C   . ALA A 1 267 ? 48.039  31.886 2.972   1.00 84.69  ? 266 ALA A C   1 
ATOM   1881 O O   . ALA A 1 267 ? 48.623  31.425 1.984   1.00 87.13  ? 266 ALA A O   1 
ATOM   1882 C CB  . ALA A 1 267 ? 46.723  30.251 4.344   1.00 84.11  ? 266 ALA A CB  1 
ATOM   1883 N N   . ALA A 1 268 ? 47.428  33.072 2.947   1.00 87.02  ? 267 ALA A N   1 
ATOM   1884 C CA  . ALA A 1 268 ? 47.474  33.895 1.744   1.00 86.55  ? 267 ALA A CA  1 
ATOM   1885 C C   . ALA A 1 268 ? 48.862  34.485 1.535   1.00 89.01  ? 267 ALA A C   1 
ATOM   1886 O O   . ALA A 1 268 ? 49.319  34.625 0.394   1.00 90.34  ? 267 ALA A O   1 
ATOM   1887 C CB  . ALA A 1 268 ? 46.423  35.002 1.823   1.00 83.31  ? 267 ALA A CB  1 
ATOM   1888 N N   . GLY A 1 269 ? 49.549  34.828 2.621   1.00 84.29  ? 268 GLY A N   1 
ATOM   1889 C CA  . GLY A 1 269 ? 50.873  35.406 2.527   1.00 86.15  ? 268 GLY A CA  1 
ATOM   1890 C C   . GLY A 1 269 ? 50.930  36.822 3.061   1.00 84.87  ? 268 GLY A C   1 
ATOM   1891 O O   . GLY A 1 269 ? 51.708  37.647 2.574   1.00 86.15  ? 268 GLY A O   1 
ATOM   1892 N N   . GLY A 1 270 ? 50.113  37.113 4.070   1.00 83.65  ? 269 GLY A N   1 
ATOM   1893 C CA  . GLY A 1 270 ? 50.008  38.465 4.580   1.00 80.85  ? 269 GLY A CA  1 
ATOM   1894 C C   . GLY A 1 270 ? 50.312  38.619 6.056   1.00 79.40  ? 269 GLY A C   1 
ATOM   1895 O O   . GLY A 1 270 ? 49.689  37.971 6.903   1.00 78.25  ? 269 GLY A O   1 
ATOM   1896 N N   . THR A 1 271 ? 51.279  39.474 6.368   1.00 81.26  ? 270 THR A N   1 
ATOM   1897 C CA  . THR A 1 271 ? 51.569  39.880 7.734   1.00 80.21  ? 270 THR A CA  1 
ATOM   1898 C C   . THR A 1 271 ? 50.564  40.938 8.171   1.00 76.67  ? 270 THR A C   1 
ATOM   1899 O O   . THR A 1 271 ? 49.792  41.448 7.357   1.00 74.70  ? 270 THR A O   1 
ATOM   1900 C CB  . THR A 1 271 ? 52.998  40.415 7.824   1.00 86.00  ? 270 THR A CB  1 
ATOM   1901 O OG1 . THR A 1 271 ? 53.076  41.685 7.162   1.00 84.88  ? 270 THR A OG1 1 
ATOM   1902 C CG2 . THR A 1 271 ? 53.975  39.446 7.179   1.00 90.63  ? 270 THR A CG2 1 
ATOM   1903 N N   . PRO A 1 272 ? 50.537  41.286 9.463   1.00 77.81  ? 271 PRO A N   1 
ATOM   1904 C CA  . PRO A 1 272 ? 49.618  42.349 9.908   1.00 73.76  ? 271 PRO A CA  1 
ATOM   1905 C C   . PRO A 1 272 ? 49.763  43.664 9.156   1.00 74.44  ? 271 PRO A C   1 
ATOM   1906 O O   . PRO A 1 272 ? 48.792  44.429 9.082   1.00 71.65  ? 271 PRO A O   1 
ATOM   1907 C CB  . PRO A 1 272 ? 49.973  42.505 11.392  1.00 73.58  ? 271 PRO A CB  1 
ATOM   1908 C CG  . PRO A 1 272 ? 50.406  41.140 11.795  1.00 77.13  ? 271 PRO A CG  1 
ATOM   1909 C CD  . PRO A 1 272 ? 51.140  40.578 10.610  1.00 79.54  ? 271 PRO A CD  1 
ATOM   1910 N N   . LEU A 1 273 ? 50.938  43.951 8.590   1.00 73.08  ? 272 LEU A N   1 
ATOM   1911 C CA  . LEU A 1 273 ? 51.127  45.225 7.901   1.00 72.99  ? 272 LEU A CA  1 
ATOM   1912 C C   . LEU A 1 273 ? 50.336  45.280 6.599   1.00 73.60  ? 272 LEU A C   1 
ATOM   1913 O O   . LEU A 1 273 ? 49.771  46.326 6.255   1.00 72.94  ? 272 LEU A O   1 
ATOM   1914 C CB  . LEU A 1 273 ? 52.611  45.465 7.633   1.00 76.83  ? 272 LEU A CB  1 
ATOM   1915 C CG  . LEU A 1 273 ? 52.947  46.857 7.100   1.00 78.58  ? 272 LEU A CG  1 
ATOM   1916 C CD1 . LEU A 1 273 ? 52.551  47.919 8.112   1.00 75.89  ? 272 LEU A CD1 1 
ATOM   1917 C CD2 . LEU A 1 273 ? 54.422  46.951 6.770   1.00 83.69  ? 272 LEU A CD2 1 
ATOM   1918 N N   . HIS A 1 274 ? 50.291  44.169 5.855   1.00 79.32  ? 273 HIS A N   1 
ATOM   1919 C CA  . HIS A 1 274 ? 49.511  44.144 4.622   1.00 78.91  ? 273 HIS A CA  1 
ATOM   1920 C C   . HIS A 1 274 ? 48.023  44.289 4.909   1.00 76.16  ? 273 HIS A C   1 
ATOM   1921 O O   . HIS A 1 274 ? 47.281  44.825 4.078   1.00 75.12  ? 273 HIS A O   1 
ATOM   1922 C CB  . HIS A 1 274 ? 49.773  42.852 3.842   1.00 82.26  ? 273 HIS A CB  1 
ATOM   1923 C CG  . HIS A 1 274 ? 51.220  42.475 3.739   1.00 87.06  ? 273 HIS A CG  1 
ATOM   1924 N ND1 . HIS A 1 274 ? 51.722  41.311 4.279   1.00 90.26  ? 273 HIS A ND1 1 
ATOM   1925 C CD2 . HIS A 1 274 ? 52.270  43.097 3.151   1.00 89.29  ? 273 HIS A CD2 1 
ATOM   1926 C CE1 . HIS A 1 274 ? 53.017  41.234 4.036   1.00 93.22  ? 273 HIS A CE1 1 
ATOM   1927 N NE2 . HIS A 1 274 ? 53.376  42.306 3.353   1.00 92.71  ? 273 HIS A NE2 1 
ATOM   1928 N N   . GLU A 1 275 ? 47.570  43.824 6.077   1.00 81.01  ? 274 GLU A N   1 
ATOM   1929 C CA  . GLU A 1 275 ? 46.172  43.987 6.458   1.00 78.04  ? 274 GLU A CA  1 
ATOM   1930 C C   . GLU A 1 275 ? 45.888  45.398 6.959   1.00 77.20  ? 274 GLU A C   1 
ATOM   1931 O O   . GLU A 1 275 ? 44.857  45.986 6.614   1.00 76.28  ? 274 GLU A O   1 
ATOM   1932 C CB  . GLU A 1 275 ? 45.796  42.958 7.526   1.00 77.79  ? 274 GLU A CB  1 
ATOM   1933 C CG  . GLU A 1 275 ? 45.730  41.519 7.027   1.00 82.91  ? 274 GLU A CG  1 
ATOM   1934 C CD  . GLU A 1 275 ? 44.333  41.108 6.597   1.00 88.65  ? 274 GLU A CD  1 
ATOM   1935 O OE1 . GLU A 1 275 ? 43.582  41.967 6.089   1.00 85.75  ? 274 GLU A OE1 1 
ATOM   1936 O OE2 . GLU A 1 275 ? 43.980  39.923 6.777   1.00 87.76  ? 274 GLU A OE2 1 
ATOM   1937 N N   . ALA A 1 276 ? 46.794  45.958 7.766   1.00 73.79  ? 275 ALA A N   1 
ATOM   1938 C CA  . ALA A 1 276 ? 46.579  47.297 8.304   1.00 73.15  ? 275 ALA A CA  1 
ATOM   1939 C C   . ALA A 1 276 ? 46.661  48.356 7.211   1.00 74.03  ? 275 ALA A C   1 
ATOM   1940 O O   . ALA A 1 276 ? 45.845  49.284 7.178   1.00 74.44  ? 275 ALA A O   1 
ATOM   1941 C CB  . ALA A 1 276 ? 47.592  47.587 9.410   1.00 73.66  ? 275 ALA A CB  1 
ATOM   1942 N N   . ALA A 1 277 ? 47.638  48.236 6.308   1.00 71.77  ? 276 ALA A N   1 
ATOM   1943 C CA  . ALA A 1 277 ? 47.764  49.214 5.232   1.00 73.16  ? 276 ALA A CA  1 
ATOM   1944 C C   . ALA A 1 277 ? 46.613  49.112 4.240   1.00 73.75  ? 276 ALA A C   1 
ATOM   1945 O O   . ALA A 1 277 ? 46.181  50.132 3.689   1.00 74.71  ? 276 ALA A O   1 
ATOM   1946 C CB  . ALA A 1 277 ? 49.100  49.039 4.513   1.00 74.43  ? 276 ALA A CB  1 
ATOM   1947 N N   . ARG A 1 278 ? 46.106  47.901 3.997   1.00 74.40  ? 277 ARG A N   1 
ATOM   1948 C CA  . ARG A 1 278 ? 44.973  47.750 3.091   1.00 75.42  ? 277 ARG A CA  1 
ATOM   1949 C C   . ARG A 1 278 ? 43.699  48.310 3.709   1.00 75.04  ? 277 ARG A C   1 
ATOM   1950 O O   . ARG A 1 278 ? 42.934  49.014 3.040   1.00 76.33  ? 277 ARG A O   1 
ATOM   1951 C CB  . ARG A 1 278 ? 44.787  46.280 2.716   1.00 75.70  ? 277 ARG A CB  1 
ATOM   1952 N N   . ALA A 1 279 ? 43.459  48.012 4.988   1.00 75.34  ? 278 ALA A N   1 
ATOM   1953 C CA  . ALA A 1 279 ? 42.271  48.519 5.663   1.00 75.43  ? 278 ALA A CA  1 
ATOM   1954 C C   . ALA A 1 279 ? 42.342  50.018 5.912   1.00 75.96  ? 278 ALA A C   1 
ATOM   1955 O O   . ALA A 1 279 ? 41.300  50.648 6.122   1.00 76.84  ? 278 ALA A O   1 
ATOM   1956 C CB  . ALA A 1 279 ? 42.060  47.780 6.985   1.00 74.18  ? 278 ALA A CB  1 
ATOM   1957 N N   . GLY A 1 280 ? 43.539  50.600 5.897   1.00 73.19  ? 279 GLY A N   1 
ATOM   1958 C CA  . GLY A 1 280 ? 43.692  52.027 6.095   1.00 74.02  ? 279 GLY A CA  1 
ATOM   1959 C C   . GLY A 1 280 ? 43.699  52.441 7.551   1.00 73.63  ? 279 GLY A C   1 
ATOM   1960 O O   . GLY A 1 280 ? 42.777  53.121 8.013   1.00 74.46  ? 279 GLY A O   1 
ATOM   1961 N N   . HIS A 1 281 ? 44.734  52.041 8.289   1.00 73.66  ? 280 HIS A N   1 
ATOM   1962 C CA  . HIS A 1 281 ? 44.889  52.388 9.703   1.00 73.68  ? 280 HIS A CA  1 
ATOM   1963 C C   . HIS A 1 281 ? 46.271  53.010 9.879   1.00 74.65  ? 280 HIS A C   1 
ATOM   1964 O O   . HIS A 1 281 ? 47.248  52.303 10.139  1.00 74.38  ? 280 HIS A O   1 
ATOM   1965 C CB  . HIS A 1 281 ? 44.696  51.167 10.595  1.00 72.48  ? 280 HIS A CB  1 
ATOM   1966 C CG  . HIS A 1 281 ? 43.362  50.508 10.434  1.00 72.72  ? 280 HIS A CG  1 
ATOM   1967 N ND1 . HIS A 1 281 ? 42.175  51.170 10.660  1.00 74.18  ? 280 HIS A ND1 1 
ATOM   1968 C CD2 . HIS A 1 281 ? 43.028  49.249 10.068  1.00 72.64  ? 280 HIS A CD2 1 
ATOM   1969 C CE1 . HIS A 1 281 ? 41.166  50.346 10.440  1.00 73.98  ? 280 HIS A CE1 1 
ATOM   1970 N NE2 . HIS A 1 281 ? 41.656  49.174 10.079  1.00 73.12  ? 280 HIS A NE2 1 
ATOM   1971 N N   . LEU A 1 282 ? 46.345  54.336 9.733   1.00 73.98  ? 281 LEU A N   1 
ATOM   1972 C CA  . LEU A 1 282 ? 47.621  55.031 9.876   1.00 75.07  ? 281 LEU A CA  1 
ATOM   1973 C C   . LEU A 1 282 ? 48.214  54.836 11.264  1.00 75.64  ? 281 LEU A C   1 
ATOM   1974 O O   . LEU A 1 282 ? 49.439  54.761 11.413  1.00 76.99  ? 281 LEU A O   1 
ATOM   1975 C CB  . LEU A 1 282 ? 47.438  56.520 9.584   1.00 76.90  ? 281 LEU A CB  1 
ATOM   1976 C CG  . LEU A 1 282 ? 48.642  57.423 9.854   1.00 78.99  ? 281 LEU A CG  1 
ATOM   1977 C CD1 . LEU A 1 282 ? 49.772  57.122 8.882   1.00 79.37  ? 281 LEU A CD1 1 
ATOM   1978 C CD2 . LEU A 1 282 ? 48.240  58.888 9.790   1.00 81.50  ? 281 LEU A CD2 1 
ATOM   1979 N N   . GLU A 1 283 ? 47.363  54.740 12.287  1.00 78.06  ? 282 GLU A N   1 
ATOM   1980 C CA  . GLU A 1 283 ? 47.854  54.577 13.650  1.00 78.63  ? 282 GLU A CA  1 
ATOM   1981 C C   . GLU A 1 283 ? 48.506  53.214 13.845  1.00 77.21  ? 282 GLU A C   1 
ATOM   1982 O O   . GLU A 1 283 ? 49.567  53.111 14.472  1.00 78.00  ? 282 GLU A O   1 
ATOM   1983 C CB  . GLU A 1 283 ? 46.707  54.768 14.645  1.00 79.26  ? 282 GLU A CB  1 
ATOM   1984 C CG  . GLU A 1 283 ? 45.673  55.811 14.225  1.00 83.28  ? 282 GLU A CG  1 
ATOM   1985 C CD  . GLU A 1 283 ? 44.585  55.241 13.325  1.00 89.30  ? 282 GLU A CD  1 
ATOM   1986 O OE1 . GLU A 1 283 ? 44.265  54.039 13.460  1.00 85.71  ? 282 GLU A OE1 1 
ATOM   1987 O OE2 . GLU A 1 283 ? 44.058  55.996 12.478  1.00 88.39  ? 282 GLU A OE2 1 
ATOM   1988 N N   . ILE A 1 284 ? 47.892  52.159 13.308  1.00 72.35  ? 283 ILE A N   1 
ATOM   1989 C CA  . ILE A 1 284 ? 48.421  50.812 13.500  1.00 71.17  ? 283 ILE A CA  1 
ATOM   1990 C C   . ILE A 1 284 ? 49.665  50.597 12.645  1.00 71.41  ? 283 ILE A C   1 
ATOM   1991 O O   . ILE A 1 284 ? 50.632  49.960 13.083  1.00 71.62  ? 283 ILE A O   1 
ATOM   1992 C CB  . ILE A 1 284 ? 47.331  49.763 13.203  1.00 69.67  ? 283 ILE A CB  1 
ATOM   1993 C CG1 . ILE A 1 284 ? 46.296  49.720 14.332  1.00 69.81  ? 283 ILE A CG1 1 
ATOM   1994 C CG2 . ILE A 1 284 ? 47.941  48.385 13.000  1.00 68.65  ? 283 ILE A CG2 1 
ATOM   1995 C CD1 . ILE A 1 284 ? 45.196  50.761 14.219  1.00 70.82  ? 283 ILE A CD1 1 
ATOM   1996 N N   . VAL A 1 285 ? 49.670  51.134 11.422  1.00 69.36  ? 284 VAL A N   1 
ATOM   1997 C CA  . VAL A 1 285 ? 50.806  50.939 10.524  1.00 70.64  ? 284 VAL A CA  1 
ATOM   1998 C C   . VAL A 1 285 ? 52.073  51.539 11.122  1.00 72.61  ? 284 VAL A C   1 
ATOM   1999 O O   . VAL A 1 285 ? 53.160  50.955 11.025  1.00 73.93  ? 284 VAL A O   1 
ATOM   2000 C CB  . VAL A 1 285 ? 50.495  51.529 9.135   1.00 70.76  ? 284 VAL A CB  1 
ATOM   2001 C CG1 . VAL A 1 285 ? 51.761  51.633 8.299   1.00 72.96  ? 284 VAL A CG1 1 
ATOM   2002 C CG2 . VAL A 1 285 ? 49.462  50.674 8.420   1.00 69.20  ? 284 VAL A CG2 1 
ATOM   2003 N N   . GLU A 1 286 ? 51.954  52.706 11.761  1.00 75.19  ? 285 GLU A N   1 
ATOM   2004 C CA  . GLU A 1 286 ? 53.122  53.332 12.376  1.00 76.67  ? 285 GLU A CA  1 
ATOM   2005 C C   . GLU A 1 286 ? 53.666  52.488 13.523  1.00 77.49  ? 285 GLU A C   1 
ATOM   2006 O O   . GLU A 1 286 ? 54.885  52.392 13.707  1.00 79.03  ? 285 GLU A O   1 
ATOM   2007 C CB  . GLU A 1 286 ? 52.771  54.740 12.862  1.00 77.38  ? 285 GLU A CB  1 
ATOM   2008 C CG  . GLU A 1 286 ? 52.767  55.798 11.765  1.00 81.50  ? 285 GLU A CG  1 
ATOM   2009 C CD  . GLU A 1 286 ? 52.299  57.158 12.258  1.00 88.68  ? 285 GLU A CD  1 
ATOM   2010 O OE1 . GLU A 1 286 ? 51.204  57.233 12.856  1.00 85.67  ? 285 GLU A OE1 1 
ATOM   2011 O OE2 . GLU A 1 286 ? 53.030  58.152 12.053  1.00 89.06  ? 285 GLU A OE2 1 
ATOM   2012 N N   . VAL A 1 287 ? 52.781  51.860 14.299  1.00 70.49  ? 286 VAL A N   1 
ATOM   2013 C CA  . VAL A 1 287 ? 53.232  51.066 15.439  1.00 70.77  ? 286 VAL A CA  1 
ATOM   2014 C C   . VAL A 1 287 ? 53.860  49.759 14.970  1.00 69.94  ? 286 VAL A C   1 
ATOM   2015 O O   . VAL A 1 287 ? 54.876  49.313 15.518  1.00 71.22  ? 286 VAL A O   1 
ATOM   2016 C CB  . VAL A 1 287 ? 52.066  50.819 16.415  1.00 69.82  ? 286 VAL A CB  1 
ATOM   2017 C CG1 . VAL A 1 287 ? 52.520  49.954 17.579  1.00 70.25  ? 286 VAL A CG1 1 
ATOM   2018 C CG2 . VAL A 1 287 ? 51.514  52.140 16.921  1.00 71.32  ? 286 VAL A CG2 1 
ATOM   2019 N N   . LEU A 1 288 ? 53.273  49.125 13.950  1.00 70.97  ? 287 LEU A N   1 
ATOM   2020 C CA  . LEU A 1 288 ? 53.815  47.865 13.451  1.00 72.47  ? 287 LEU A CA  1 
ATOM   2021 C C   . LEU A 1 288 ? 55.218  48.049 12.886  1.00 76.72  ? 287 LEU A C   1 
ATOM   2022 O O   . LEU A 1 288 ? 56.080  47.177 13.045  1.00 78.10  ? 287 LEU A O   1 
ATOM   2023 C CB  . LEU A 1 288 ? 52.888  47.275 12.389  1.00 72.27  ? 287 LEU A CB  1 
ATOM   2024 C CG  . LEU A 1 288 ? 51.497  46.832 12.842  1.00 70.97  ? 287 LEU A CG  1 
ATOM   2025 C CD1 . LEU A 1 288 ? 50.702  46.296 11.663  1.00 70.29  ? 287 LEU A CD1 1 
ATOM   2026 C CD2 . LEU A 1 288 ? 51.599  45.790 13.943  1.00 71.54  ? 287 LEU A CD2 1 
ATOM   2027 N N   . LEU A 1 289 ? 55.466  49.181 12.225  1.00 71.94  ? 288 LEU A N   1 
ATOM   2028 C CA  . LEU A 1 289 ? 56.778  49.432 11.641  1.00 74.39  ? 288 LEU A CA  1 
ATOM   2029 C C   . LEU A 1 289 ? 57.817  49.799 12.692  1.00 76.75  ? 288 LEU A C   1 
ATOM   2030 O O   . LEU A 1 289 ? 59.007  49.528 12.497  1.00 79.00  ? 288 LEU A O   1 
ATOM   2031 C CB  . LEU A 1 289 ? 56.677  50.535 10.589  1.00 75.15  ? 288 LEU A CB  1 
ATOM   2032 C CG  . LEU A 1 289 ? 55.985  50.118 9.293   1.00 73.88  ? 288 LEU A CG  1 
ATOM   2033 C CD1 . LEU A 1 289 ? 55.695  51.329 8.429   1.00 74.58  ? 288 LEU A CD1 1 
ATOM   2034 C CD2 . LEU A 1 289 ? 56.850  49.119 8.543   1.00 75.07  ? 288 LEU A CD2 1 
ATOM   2035 N N   . LYS A 1 290 ? 57.397  50.411 13.802  1.00 79.14  ? 289 LYS A N   1 
ATOM   2036 C CA  . LYS A 1 290 ? 58.344  50.740 14.863  1.00 79.71  ? 289 LYS A CA  1 
ATOM   2037 C C   . LYS A 1 290 ? 58.920  49.483 15.502  1.00 81.64  ? 289 LYS A C   1 
ATOM   2038 O O   . LYS A 1 290 ? 60.129  49.404 15.749  1.00 83.23  ? 289 LYS A O   1 
ATOM   2039 C CB  . LYS A 1 290 ? 57.674  51.617 15.921  1.00 78.87  ? 289 LYS A CB  1 
ATOM   2040 C CG  . LYS A 1 290 ? 57.460  53.060 15.496  1.00 84.46  ? 289 LYS A CG  1 
ATOM   2041 C CD  . LYS A 1 290 ? 56.787  53.871 16.594  1.00 88.16  ? 289 LYS A CD  1 
ATOM   2042 C CE  . LYS A 1 290 ? 56.549  55.308 16.150  1.00 92.83  ? 289 LYS A CE  1 
ATOM   2043 N NZ  . LYS A 1 290 ? 55.850  56.115 17.188  1.00 96.39  ? 289 LYS A NZ  1 
ATOM   2044 N N   . TYR A 1 291 ? 58.074  48.488 15.776  1.00 83.77  ? 290 TYR A N   1 
ATOM   2045 C CA  . TYR A 1 291 ? 58.560  47.259 16.392  1.00 84.17  ? 290 TYR A CA  1 
ATOM   2046 C C   . TYR A 1 291 ? 59.380  46.412 15.429  1.00 88.44  ? 290 TYR A C   1 
ATOM   2047 O O   . TYR A 1 291 ? 60.209  45.614 15.881  1.00 89.40  ? 290 TYR A O   1 
ATOM   2048 C CB  . TYR A 1 291 ? 57.391  46.445 16.946  1.00 82.25  ? 290 TYR A CB  1 
ATOM   2049 C CG  . TYR A 1 291 ? 56.875  46.953 18.274  1.00 80.94  ? 290 TYR A CG  1 
ATOM   2050 C CD1 . TYR A 1 291 ? 56.064  48.080 18.342  1.00 80.82  ? 290 TYR A CD1 1 
ATOM   2051 C CD2 . TYR A 1 291 ? 57.197  46.306 19.462  1.00 81.71  ? 290 TYR A CD2 1 
ATOM   2052 C CE1 . TYR A 1 291 ? 55.590  48.548 19.553  1.00 81.05  ? 290 TYR A CE1 1 
ATOM   2053 C CE2 . TYR A 1 291 ? 56.727  46.767 20.678  1.00 81.87  ? 290 TYR A CE2 1 
ATOM   2054 C CZ  . TYR A 1 291 ? 55.924  47.888 20.717  1.00 83.70  ? 290 TYR A CZ  1 
ATOM   2055 O OH  . TYR A 1 291 ? 55.453  48.351 21.924  1.00 84.51  ? 290 TYR A OH  1 
ATOM   2056 N N   . GLY A 1 292 ? 59.171  46.560 14.122  1.00 83.93  ? 291 GLY A N   1 
ATOM   2057 C CA  . GLY A 1 292 ? 60.023  45.892 13.158  1.00 87.41  ? 291 GLY A CA  1 
ATOM   2058 C C   . GLY A 1 292 ? 59.295  45.097 12.095  1.00 89.98  ? 291 GLY A C   1 
ATOM   2059 O O   . GLY A 1 292 ? 59.660  43.952 11.815  1.00 92.02  ? 291 GLY A O   1 
ATOM   2060 N N   . ALA A 1 293 ? 58.271  45.688 11.489  1.00 80.78  ? 292 ALA A N   1 
ATOM   2061 C CA  . ALA A 1 293 ? 57.577  45.021 10.397  1.00 82.07  ? 292 ALA A CA  1 
ATOM   2062 C C   . ALA A 1 293 ? 58.420  45.068 9.128   1.00 87.71  ? 292 ALA A C   1 
ATOM   2063 O O   . ALA A 1 293 ? 59.128  46.045 8.869   1.00 88.63  ? 292 ALA A O   1 
ATOM   2064 C CB  . ALA A 1 293 ? 56.216  45.671 10.151  1.00 79.28  ? 292 ALA A CB  1 
ATOM   2065 N N   . ASP A 1 294 ? 58.349  43.998 8.339   1.00 86.33  ? 293 ASP A N   1 
ATOM   2066 C CA  . ASP A 1 294 ? 59.058  43.934 7.065   1.00 90.61  ? 293 ASP A CA  1 
ATOM   2067 C C   . ASP A 1 294 ? 58.298  44.780 6.051   1.00 91.02  ? 293 ASP A C   1 
ATOM   2068 O O   . ASP A 1 294 ? 57.235  44.379 5.567   1.00 89.35  ? 293 ASP A O   1 
ATOM   2069 C CB  . ASP A 1 294 ? 59.195  42.487 6.600   1.00 94.15  ? 293 ASP A CB  1 
ATOM   2070 C CG  . ASP A 1 294 ? 60.164  42.335 5.441   1.00 101.50 ? 293 ASP A CG  1 
ATOM   2071 O OD1 . ASP A 1 294 ? 61.303  42.838 5.547   1.00 103.29 ? 293 ASP A OD1 1 
ATOM   2072 O OD2 . ASP A 1 294 ? 59.794  41.703 4.429   1.00 104.37 ? 293 ASP A OD2 1 
ATOM   2073 N N   . VAL A 1 295 ? 58.845  45.956 5.731   1.00 89.20  ? 294 VAL A N   1 
ATOM   2074 C CA  . VAL A 1 295 ? 58.110  46.929 4.928   1.00 87.90  ? 294 VAL A CA  1 
ATOM   2075 C C   . VAL A 1 295 ? 58.010  46.486 3.472   1.00 90.83  ? 294 VAL A C   1 
ATOM   2076 O O   . VAL A 1 295 ? 57.070  46.870 2.765   1.00 88.51  ? 294 VAL A O   1 
ATOM   2077 C CB  . VAL A 1 295 ? 58.761  48.320 5.059   1.00 89.51  ? 294 VAL A CB  1 
ATOM   2078 C CG1 . VAL A 1 295 ? 60.116  48.351 4.367   1.00 93.37  ? 294 VAL A CG1 1 
ATOM   2079 C CG2 . VAL A 1 295 ? 57.839  49.400 4.510   1.00 88.51  ? 294 VAL A CG2 1 
ATOM   2080 N N   . ASN A 1 296 ? 58.953  45.676 2.996   1.00 98.99  ? 295 ASN A N   1 
ATOM   2081 C CA  . ASN A 1 296 ? 58.935  45.162 1.627   1.00 100.14 ? 295 ASN A CA  1 
ATOM   2082 C C   . ASN A 1 296 ? 58.911  43.636 1.699   1.00 102.62 ? 295 ASN A C   1 
ATOM   2083 O O   . ASN A 1 296 ? 59.954  42.976 1.699   1.00 105.47 ? 295 ASN A O   1 
ATOM   2084 C CB  . ASN A 1 296 ? 60.131  45.694 0.810   1.00 103.27 ? 295 ASN A CB  1 
ATOM   2085 C CG  . ASN A 1 296 ? 61.469  45.464 1.497   1.00 113.62 ? 295 ASN A CG  1 
ATOM   2086 O OD1 . ASN A 1 296 ? 61.535  45.286 2.713   1.00 111.37 ? 295 ASN A OD1 1 
ATOM   2087 N ND2 . ASN A 1 296 ? 62.542  45.466 0.715   1.00 113.92 ? 295 ASN A ND2 1 
ATOM   2088 N N   . ALA A 1 297 ? 57.708  43.079 1.763   1.00 104.40 ? 296 ALA A N   1 
ATOM   2089 C CA  . ALA A 1 297 ? 57.484  41.642 1.780   1.00 105.07 ? 296 ALA A CA  1 
ATOM   2090 C C   . ALA A 1 297 ? 56.561  41.264 0.625   1.00 104.78 ? 296 ALA A C   1 
ATOM   2091 O O   . ALA A 1 297 ? 56.053  42.123 -0.102  1.00 102.99 ? 296 ALA A O   1 
ATOM   2092 C CB  . ALA A 1 297 ? 56.896  41.194 3.122   1.00 104.00 ? 296 ALA A CB  1 
ATOM   2093 N N   . VAL A 1 298 ? 56.338  39.960 0.465   1.00 109.16 ? 297 VAL A N   1 
ATOM   2094 C CA  . VAL A 1 298 ? 55.430  39.478 -0.569  1.00 107.81 ? 297 VAL A CA  1 
ATOM   2095 C C   . VAL A 1 298 ? 54.009  39.910 -0.231  1.00 105.26 ? 297 VAL A C   1 
ATOM   2096 O O   . VAL A 1 298 ? 53.507  39.653 0.872   1.00 103.67 ? 297 VAL A O   1 
ATOM   2097 C CB  . VAL A 1 298 ? 55.543  37.953 -0.722  1.00 110.77 ? 297 VAL A CB  1 
ATOM   2098 C CG1 . VAL A 1 298 ? 55.498  37.263 0.637   1.00 110.86 ? 297 VAL A CG1 1 
ATOM   2099 C CG2 . VAL A 1 298 ? 54.446  37.424 -1.637  1.00 109.17 ? 297 VAL A CG2 1 
ATOM   2100 N N   . GLY A 1 299 ? 53.360  40.586 -1.175  1.00 97.99  ? 298 GLY A N   1 
ATOM   2101 C CA  . GLY A 1 299 ? 52.028  41.112 -0.953  1.00 94.19  ? 298 GLY A CA  1 
ATOM   2102 C C   . GLY A 1 299 ? 51.885  42.532 -1.457  1.00 93.98  ? 298 GLY A C   1 
ATOM   2103 O O   . GLY A 1 299 ? 50.780  42.975 -1.785  1.00 91.32  ? 298 GLY A O   1 
ATOM   2104 N N   . THR A 1 300 ? 53.011  43.249 -1.523  1.00 89.39  ? 299 THR A N   1 
ATOM   2105 C CA  . THR A 1 300 ? 53.105  44.618 -2.022  1.00 88.83  ? 299 THR A CA  1 
ATOM   2106 C C   . THR A 1 300 ? 52.095  45.527 -1.330  1.00 86.37  ? 299 THR A C   1 
ATOM   2107 O O   . THR A 1 300 ? 51.061  45.870 -1.918  1.00 84.20  ? 299 THR A O   1 
ATOM   2108 C CB  . THR A 1 300 ? 52.901  44.657 -3.540  1.00 92.23  ? 299 THR A CB  1 
ATOM   2109 O OG1 . THR A 1 300 ? 51.552  44.290 -3.860  1.00 89.73  ? 299 THR A OG1 1 
ATOM   2110 C CG2 . THR A 1 300 ? 53.863  43.700 -4.235  1.00 95.19  ? 299 THR A CG2 1 
ATOM   2111 N N   . PRO A 1 301 ? 52.353  45.938 -0.084  1.00 78.36  ? 300 PRO A N   1 
ATOM   2112 C CA  . PRO A 1 301 ? 51.403  46.833 0.591   1.00 73.72  ? 300 PRO A CA  1 
ATOM   2113 C C   . PRO A 1 301 ? 51.427  48.247 0.044   1.00 74.78  ? 300 PRO A C   1 
ATOM   2114 O O   . PRO A 1 301 ? 50.411  48.947 0.126   1.00 71.32  ? 300 PRO A O   1 
ATOM   2115 C CB  . PRO A 1 301 ? 51.859  46.784 2.054   1.00 75.45  ? 300 PRO A CB  1 
ATOM   2116 C CG  . PRO A 1 301 ? 53.320  46.510 1.966   1.00 82.45  ? 300 PRO A CG  1 
ATOM   2117 C CD  . PRO A 1 301 ? 53.502  45.602 0.774   1.00 83.35  ? 300 PRO A CD  1 
ATOM   2118 N N   . LEU A 1 302 ? 52.558  48.690 -0.510  1.00 70.93  ? 301 LEU A N   1 
ATOM   2119 C CA  . LEU A 1 302 ? 52.610  50.017 -1.110  1.00 71.20  ? 301 LEU A CA  1 
ATOM   2120 C C   . LEU A 1 302 ? 51.719  50.109 -2.343  1.00 69.86  ? 301 LEU A C   1 
ATOM   2121 O O   . LEU A 1 302 ? 51.198  51.187 -2.649  1.00 68.16  ? 301 LEU A O   1 
ATOM   2122 C CB  . LEU A 1 302 ? 54.053  50.377 -1.465  1.00 77.54  ? 301 LEU A CB  1 
ATOM   2123 C CG  . LEU A 1 302 ? 54.321  51.834 -1.844  1.00 80.25  ? 301 LEU A CG  1 
ATOM   2124 C CD1 . LEU A 1 302 ? 54.091  52.748 -0.652  1.00 79.31  ? 301 LEU A CD1 1 
ATOM   2125 C CD2 . LEU A 1 302 ? 55.732  51.990 -2.379  1.00 87.98  ? 301 LEU A CD2 1 
ATOM   2126 N N   . HIS A 1 303 ? 51.531  48.997 -3.060  1.00 77.52  ? 302 HIS A N   1 
ATOM   2127 C CA  . HIS A 1 303 ? 50.617  48.998 -4.198  1.00 75.06  ? 302 HIS A CA  1 
ATOM   2128 C C   . HIS A 1 303 ? 49.183  49.240 -3.747  1.00 71.28  ? 302 HIS A C   1 
ATOM   2129 O O   . HIS A 1 303 ? 48.513  50.159 -4.232  1.00 69.92  ? 302 HIS A O   1 
ATOM   2130 C CB  . HIS A 1 303 ? 50.716  47.677 -4.964  1.00 77.33  ? 302 HIS A CB  1 
ATOM   2131 C CG  . HIS A 1 303 ? 51.865  47.611 -5.919  1.00 84.16  ? 302 HIS A CG  1 
ATOM   2132 N ND1 . HIS A 1 303 ? 53.141  47.268 -5.528  1.00 90.82  ? 302 HIS A ND1 1 
ATOM   2133 C CD2 . HIS A 1 303 ? 51.929  47.837 -7.253  1.00 86.02  ? 302 HIS A CD2 1 
ATOM   2134 C CE1 . HIS A 1 303 ? 53.942  47.286 -6.578  1.00 95.54  ? 302 HIS A CE1 1 
ATOM   2135 N NE2 . HIS A 1 303 ? 53.231  47.631 -7.637  1.00 92.41  ? 302 HIS A NE2 1 
ATOM   2136 N N   . LYS A 1 304 ? 48.694  48.421 -2.812  1.00 74.56  ? 303 LYS A N   1 
ATOM   2137 C CA  . LYS A 1 304 ? 47.308  48.548 -2.376  1.00 72.15  ? 303 LYS A CA  1 
ATOM   2138 C C   . LYS A 1 304 ? 47.069  49.846 -1.616  1.00 73.35  ? 303 LYS A C   1 
ATOM   2139 O O   . LYS A 1 304 ? 45.951  50.371 -1.631  1.00 72.86  ? 303 LYS A O   1 
ATOM   2140 C CB  . LYS A 1 304 ? 46.913  47.347 -1.517  1.00 72.45  ? 303 LYS A CB  1 
ATOM   2141 C CG  . LYS A 1 304 ? 46.980  46.016 -2.249  1.00 76.71  ? 303 LYS A CG  1 
ATOM   2142 C CD  . LYS A 1 304 ? 46.324  44.913 -1.438  1.00 79.29  ? 303 LYS A CD  1 
ATOM   2143 C CE  . LYS A 1 304 ? 46.348  43.589 -2.182  1.00 82.97  ? 303 LYS A CE  1 
ATOM   2144 N NZ  . LYS A 1 304 ? 47.734  43.075 -2.351  1.00 87.73  ? 303 LYS A NZ  1 
ATOM   2145 N N   . ALA A 1 305 ? 48.096  50.378 -0.951  1.00 66.75  ? 304 ALA A N   1 
ATOM   2146 C CA  . ALA A 1 305 ? 47.934  51.641 -0.241  1.00 67.72  ? 304 ALA A CA  1 
ATOM   2147 C C   . ALA A 1 305 ? 47.794  52.802 -1.218  1.00 69.69  ? 304 ALA A C   1 
ATOM   2148 O O   . ALA A 1 305 ? 46.903  53.647 -1.069  1.00 70.25  ? 304 ALA A O   1 
ATOM   2149 C CB  . ALA A 1 305 ? 49.110  51.869 0.708   1.00 70.36  ? 304 ALA A CB  1 
ATOM   2150 N N   . ALA A 1 306 ? 48.666  52.860 -2.229  1.00 68.19  ? 305 ALA A N   1 
ATOM   2151 C CA  . ALA A 1 306 ? 48.555  53.902 -3.243  1.00 69.26  ? 305 ALA A CA  1 
ATOM   2152 C C   . ALA A 1 306 ? 47.330  53.711 -4.126  1.00 69.00  ? 305 ALA A C   1 
ATOM   2153 O O   . ALA A 1 306 ? 46.845  54.686 -4.712  1.00 70.35  ? 305 ALA A O   1 
ATOM   2154 C CB  . ALA A 1 306 ? 49.818  53.943 -4.104  1.00 71.88  ? 305 ALA A CB  1 
ATOM   2155 N N   . ARG A 1 307 ? 46.821  52.482 -4.231  1.00 70.49  ? 306 ARG A N   1 
ATOM   2156 C CA  . ARG A 1 307 ? 45.606  52.238 -4.999  1.00 70.02  ? 306 ARG A CA  1 
ATOM   2157 C C   . ARG A 1 307 ? 44.372  52.742 -4.260  1.00 71.67  ? 306 ARG A C   1 
ATOM   2158 O O   . ARG A 1 307 ? 43.468  53.322 -4.874  1.00 72.73  ? 306 ARG A O   1 
ATOM   2159 C CB  . ARG A 1 307 ? 45.476  50.745 -5.304  1.00 68.40  ? 306 ARG A CB  1 
ATOM   2160 C CG  . ARG A 1 307 ? 44.330  50.398 -6.233  1.00 70.56  ? 306 ARG A CG  1 
ATOM   2161 C CD  . ARG A 1 307 ? 44.335  48.918 -6.565  1.00 71.36  ? 306 ARG A CD  1 
ATOM   2162 N NE  . ARG A 1 307 ? 44.144  48.091 -5.378  1.00 71.31  ? 306 ARG A NE  1 
ATOM   2163 C CZ  . ARG A 1 307 ? 44.186  46.763 -5.381  1.00 74.47  ? 306 ARG A CZ  1 
ATOM   2164 N NH1 . ARG A 1 307 ? 44.416  46.109 -6.511  1.00 71.06  ? 306 ARG A NH1 1 
ATOM   2165 N NH2 . ARG A 1 307 ? 43.999  46.088 -4.255  1.00 69.24  ? 306 ARG A NH2 1 
ATOM   2166 N N   . ALA A 1 308 ? 44.319  52.531 -2.942  1.00 70.92  ? 307 ALA A N   1 
ATOM   2167 C CA  . ALA A 1 308 ? 43.174  52.992 -2.163  1.00 72.65  ? 307 ALA A CA  1 
ATOM   2168 C C   . ALA A 1 308 ? 43.190  54.505 -1.996  1.00 77.50  ? 307 ALA A C   1 
ATOM   2169 O O   . ALA A 1 308 ? 42.144  55.158 -2.095  1.00 80.62  ? 307 ALA A O   1 
ATOM   2170 C CB  . ALA A 1 308 ? 43.156  52.303 -0.799  1.00 72.66  ? 307 ALA A CB  1 
ATOM   2171 N N   . GLY A 1 309 ? 44.362  55.079 -1.738  1.00 73.50  ? 308 GLY A N   1 
ATOM   2172 C CA  . GLY A 1 309 ? 44.483  56.515 -1.581  1.00 77.10  ? 308 GLY A CA  1 
ATOM   2173 C C   . GLY A 1 309 ? 44.829  56.950 -0.172  1.00 80.91  ? 308 GLY A C   1 
ATOM   2174 O O   . GLY A 1 309 ? 44.491  58.065 0.238   1.00 85.04  ? 308 GLY A O   1 
ATOM   2175 N N   . HIS A 1 310 ? 45.501  56.080 0.584   1.00 73.82  ? 309 HIS A N   1 
ATOM   2176 C CA  . HIS A 1 310 ? 45.933  56.409 1.943   1.00 76.15  ? 309 HIS A CA  1 
ATOM   2177 C C   . HIS A 1 310 ? 47.277  57.123 1.855   1.00 78.36  ? 309 HIS A C   1 
ATOM   2178 O O   . HIS A 1 310 ? 48.346  56.541 2.048   1.00 77.14  ? 309 HIS A O   1 
ATOM   2179 C CB  . HIS A 1 310 ? 46.010  55.155 2.805   1.00 74.33  ? 309 HIS A CB  1 
ATOM   2180 C CG  . HIS A 1 310 ? 44.719  54.402 2.891   1.00 74.91  ? 309 HIS A CG  1 
ATOM   2181 N ND1 . HIS A 1 310 ? 43.582  54.936 3.460   1.00 79.82  ? 309 HIS A ND1 1 
ATOM   2182 C CD2 . HIS A 1 310 ? 44.386  53.155 2.484   1.00 72.17  ? 309 HIS A CD2 1 
ATOM   2183 C CE1 . HIS A 1 310 ? 42.604  54.051 3.396   1.00 79.05  ? 309 HIS A CE1 1 
ATOM   2184 N NE2 . HIS A 1 310 ? 43.065  52.961 2.809   1.00 74.18  ? 309 HIS A NE2 1 
ATOM   2185 N N   . LEU A 1 311 ? 47.205  58.423 1.551   1.00 74.16  ? 310 LEU A N   1 
ATOM   2186 C CA  . LEU A 1 311 ? 48.414  59.223 1.374   1.00 75.94  ? 310 LEU A CA  1 
ATOM   2187 C C   . LEU A 1 311 ? 49.299  59.182 2.612   1.00 78.84  ? 310 LEU A C   1 
ATOM   2188 O O   . LEU A 1 311 ? 50.530  59.126 2.505   1.00 79.27  ? 310 LEU A O   1 
ATOM   2189 C CB  . LEU A 1 311 ? 48.038  60.664 1.038   1.00 79.52  ? 310 LEU A CB  1 
ATOM   2190 C CG  . LEU A 1 311 ? 49.180  61.680 1.070   1.00 83.86  ? 310 LEU A CG  1 
ATOM   2191 C CD1 . LEU A 1 311 ? 50.170  61.412 -0.051  1.00 82.43  ? 310 LEU A CD1 1 
ATOM   2192 C CD2 . LEU A 1 311 ? 48.636  63.096 0.994   1.00 88.46  ? 310 LEU A CD2 1 
ATOM   2193 N N   . GLU A 1 312 ? 48.690  59.210 3.798   1.00 77.23  ? 311 GLU A N   1 
ATOM   2194 C CA  . GLU A 1 312 ? 49.473  59.165 5.027   1.00 79.04  ? 311 GLU A CA  1 
ATOM   2195 C C   . GLU A 1 312 ? 50.185  57.826 5.177   1.00 77.13  ? 311 GLU A C   1 
ATOM   2196 O O   . GLU A 1 312 ? 51.316  57.771 5.673   1.00 78.48  ? 311 GLU A O   1 
ATOM   2197 C CB  . GLU A 1 312 ? 48.572  59.439 6.233   1.00 82.45  ? 311 GLU A CB  1 
ATOM   2198 C CG  . GLU A 1 312 ? 47.780  60.742 6.156   1.00 90.57  ? 311 GLU A CG  1 
ATOM   2199 C CD  . GLU A 1 312 ? 46.526  60.626 5.302   1.00 97.42  ? 311 GLU A CD  1 
ATOM   2200 O OE1 . GLU A 1 312 ? 46.251  59.518 4.791   1.00 91.45  ? 311 GLU A OE1 1 
ATOM   2201 O OE2 . GLU A 1 312 ? 45.817  61.642 5.140   1.00 100.29 ? 311 GLU A OE2 1 
ATOM   2202 N N   . ILE A 1 313 ? 49.545  56.739 4.742   1.00 76.43  ? 312 ILE A N   1 
ATOM   2203 C CA  . ILE A 1 313 ? 50.162  55.420 4.856   1.00 74.05  ? 312 ILE A CA  1 
ATOM   2204 C C   . ILE A 1 313 ? 51.268  55.253 3.822   1.00 75.31  ? 312 ILE A C   1 
ATOM   2205 O O   . ILE A 1 313 ? 52.327  54.683 4.114   1.00 76.70  ? 312 ILE A O   1 
ATOM   2206 C CB  . ILE A 1 313 ? 49.094  54.319 4.731   1.00 71.67  ? 312 ILE A CB  1 
ATOM   2207 C CG1 . ILE A 1 313 ? 48.111  54.403 5.900   1.00 73.27  ? 312 ILE A CG1 1 
ATOM   2208 C CG2 . ILE A 1 313 ? 49.742  52.943 4.669   1.00 69.98  ? 312 ILE A CG2 1 
ATOM   2209 C CD1 . ILE A 1 313 ? 47.063  53.315 5.895   1.00 73.47  ? 312 ILE A CD1 1 
ATOM   2210 N N   . VAL A 1 314 ? 51.046  55.743 2.600   1.00 71.20  ? 313 VAL A N   1 
ATOM   2211 C CA  . VAL A 1 314 ? 52.076  55.654 1.568   1.00 72.51  ? 313 VAL A CA  1 
ATOM   2212 C C   . VAL A 1 314 ? 53.318  56.427 1.993   1.00 78.47  ? 313 VAL A C   1 
ATOM   2213 O O   . VAL A 1 314 ? 54.451  56.021 1.705   1.00 81.41  ? 313 VAL A O   1 
ATOM   2214 C CB  . VAL A 1 314 ? 51.526  56.152 0.217   1.00 72.61  ? 313 VAL A CB  1 
ATOM   2215 C CG1 . VAL A 1 314 ? 52.604  56.104 -0.855  1.00 74.93  ? 313 VAL A CG1 1 
ATOM   2216 C CG2 . VAL A 1 314 ? 50.325  55.320 -0.203  1.00 68.50  ? 313 VAL A CG2 1 
ATOM   2217 N N   . GLU A 1 315 ? 53.127  57.545 2.698   1.00 71.16  ? 314 GLU A N   1 
ATOM   2218 C CA  . GLU A 1 315 ? 54.269  58.296 3.206   1.00 75.78  ? 314 GLU A CA  1 
ATOM   2219 C C   . GLU A 1 315 ? 55.019  57.509 4.274   1.00 78.36  ? 314 GLU A C   1 
ATOM   2220 O O   . GLU A 1 315 ? 56.254  57.462 4.264   1.00 82.37  ? 314 GLU A O   1 
ATOM   2221 C CB  . GLU A 1 315 ? 53.809  59.650 3.751   1.00 77.96  ? 314 GLU A CB  1 
ATOM   2222 C CG  . GLU A 1 315 ? 53.616  60.713 2.677   1.00 81.86  ? 314 GLU A CG  1 
ATOM   2223 C CD  . GLU A 1 315 ? 53.213  62.062 3.245   1.00 90.08  ? 314 GLU A CD  1 
ATOM   2224 O OE1 . GLU A 1 315 ? 51.998  62.351 3.294   1.00 86.52  ? 314 GLU A OE1 1 
ATOM   2225 O OE2 . GLU A 1 315 ? 54.111  62.833 3.645   1.00 91.79  ? 314 GLU A OE2 1 
ATOM   2226 N N   . VAL A 1 316 ? 54.291  56.870 5.194   1.00 75.67  ? 315 VAL A N   1 
ATOM   2227 C CA  . VAL A 1 316 ? 54.940  56.128 6.272   1.00 76.72  ? 315 VAL A CA  1 
ATOM   2228 C C   . VAL A 1 316 ? 55.660  54.900 5.724   1.00 78.00  ? 315 VAL A C   1 
ATOM   2229 O O   . VAL A 1 316 ? 56.775  54.578 6.152   1.00 81.32  ? 315 VAL A O   1 
ATOM   2230 C CB  . VAL A 1 316 ? 53.911  55.755 7.355   1.00 75.60  ? 315 VAL A CB  1 
ATOM   2231 C CG1 . VAL A 1 316 ? 54.524  54.815 8.382   1.00 76.19  ? 315 VAL A CG1 1 
ATOM   2232 C CG2 . VAL A 1 316 ? 53.389  57.011 8.036   1.00 77.49  ? 315 VAL A CG2 1 
ATOM   2233 N N   . LEU A 1 317 ? 55.041  54.200 4.769   1.00 73.86  ? 316 LEU A N   1 
ATOM   2234 C CA  . LEU A 1 317 ? 55.675  53.025 4.177   1.00 74.91  ? 316 LEU A CA  1 
ATOM   2235 C C   . LEU A 1 317 ? 57.006  53.385 3.529   1.00 82.08  ? 316 LEU A C   1 
ATOM   2236 O O   . LEU A 1 317 ? 58.012  52.694 3.725   1.00 85.71  ? 316 LEU A O   1 
ATOM   2237 C CB  . LEU A 1 317 ? 54.737  52.379 3.157   1.00 70.94  ? 316 LEU A CB  1 
ATOM   2238 C CG  . LEU A 1 317 ? 53.584  51.546 3.718   1.00 67.74  ? 316 LEU A CG  1 
ATOM   2239 C CD1 . LEU A 1 317 ? 52.639  51.111 2.607   1.00 64.10  ? 316 LEU A CD1 1 
ATOM   2240 C CD2 . LEU A 1 317 ? 54.126  50.338 4.464   1.00 69.89  ? 316 LEU A CD2 1 
ATOM   2241 N N   . LEU A 1 318 ? 57.032  54.474 2.757   1.00 71.78  ? 317 LEU A N   1 
ATOM   2242 C CA  . LEU A 1 318 ? 58.269  54.876 2.096   1.00 78.14  ? 317 LEU A CA  1 
ATOM   2243 C C   . LEU A 1 318 ? 59.302  55.386 3.092   1.00 83.53  ? 317 LEU A C   1 
ATOM   2244 O O   . LEU A 1 318 ? 60.505  55.186 2.889   1.00 88.10  ? 317 LEU A O   1 
ATOM   2245 C CB  . LEU A 1 318 ? 57.976  55.939 1.039   1.00 78.29  ? 317 LEU A CB  1 
ATOM   2246 C CG  . LEU A 1 318 ? 57.257  55.439 -0.214  1.00 76.14  ? 317 LEU A CG  1 
ATOM   2247 C CD1 . LEU A 1 318 ? 56.735  56.605 -1.035  1.00 73.81  ? 317 LEU A CD1 1 
ATOM   2248 C CD2 . LEU A 1 318 ? 58.188  54.570 -1.047  1.00 81.74  ? 317 LEU A CD2 1 
ATOM   2249 N N   . LYS A 1 319 ? 58.859  56.037 4.170   1.00 77.21  ? 318 LYS A N   1 
ATOM   2250 C CA  . LYS A 1 319 ? 59.796  56.549 5.164   1.00 80.91  ? 318 LYS A CA  1 
ATOM   2251 C C   . LYS A 1 319 ? 60.464  55.437 5.958   1.00 81.17  ? 318 LYS A C   1 
ATOM   2252 O O   . LYS A 1 319 ? 61.515  55.673 6.563   1.00 84.79  ? 318 LYS A O   1 
ATOM   2253 C CB  . LYS A 1 319 ? 59.084  57.518 6.110   1.00 79.59  ? 318 LYS A CB  1 
ATOM   2254 C CG  . LYS A 1 319 ? 58.800  58.877 5.489   1.00 83.00  ? 318 LYS A CG  1 
ATOM   2255 C CD  . LYS A 1 319 ? 57.799  59.671 6.311   1.00 83.60  ? 318 LYS A CD  1 
ATOM   2256 C CE  . LYS A 1 319 ? 57.413  60.960 5.605   1.00 88.08  ? 318 LYS A CE  1 
ATOM   2257 N NZ  . LYS A 1 319 ? 56.370  61.713 6.351   1.00 89.51  ? 318 LYS A NZ  1 
ATOM   2258 N N   . TYR A 1 320 ? 59.888  54.236 5.971   1.00 78.94  ? 319 TYR A N   1 
ATOM   2259 C CA  . TYR A 1 320 ? 60.502  53.092 6.631   1.00 79.62  ? 319 TYR A CA  1 
ATOM   2260 C C   . TYR A 1 320 ? 61.275  52.198 5.672   1.00 81.92  ? 319 TYR A C   1 
ATOM   2261 O O   . TYR A 1 320 ? 61.759  51.140 6.088   1.00 82.69  ? 319 TYR A O   1 
ATOM   2262 C CB  . TYR A 1 320 ? 59.444  52.267 7.367   1.00 75.16  ? 319 TYR A CB  1 
ATOM   2263 C CG  . TYR A 1 320 ? 59.172  52.757 8.770   1.00 74.91  ? 319 TYR A CG  1 
ATOM   2264 C CD1 . TYR A 1 320 ? 58.261  53.777 9.005   1.00 73.22  ? 319 TYR A CD1 1 
ATOM   2265 C CD2 . TYR A 1 320 ? 59.834  52.204 9.858   1.00 77.82  ? 319 TYR A CD2 1 
ATOM   2266 C CE1 . TYR A 1 320 ? 58.011  54.228 10.287  1.00 73.85  ? 319 TYR A CE1 1 
ATOM   2267 C CE2 . TYR A 1 320 ? 59.591  52.649 11.143  1.00 79.35  ? 319 TYR A CE2 1 
ATOM   2268 C CZ  . TYR A 1 320 ? 58.679  53.661 11.350  1.00 77.31  ? 319 TYR A CZ  1 
ATOM   2269 O OH  . TYR A 1 320 ? 58.432  54.109 12.624  1.00 79.28  ? 319 TYR A OH  1 
ATOM   2270 N N   . GLY A 1 321 ? 61.399  52.587 4.409   1.00 80.21  ? 320 GLY A N   1 
ATOM   2271 C CA  . GLY A 1 321 ? 62.224  51.872 3.465   1.00 83.27  ? 320 GLY A CA  1 
ATOM   2272 C C   . GLY A 1 321 ? 61.506  50.958 2.498   1.00 81.02  ? 320 GLY A C   1 
ATOM   2273 O O   . GLY A 1 321 ? 62.101  49.968 2.058   1.00 82.87  ? 320 GLY A O   1 
ATOM   2274 N N   . ALA A 1 322 ? 60.254  51.246 2.156   1.00 82.38  ? 321 ALA A N   1 
ATOM   2275 C CA  . ALA A 1 322 ? 59.566  50.447 1.154   1.00 80.49  ? 321 ALA A CA  1 
ATOM   2276 C C   . ALA A 1 322 ? 60.171  50.693 -0.223  1.00 85.71  ? 321 ALA A C   1 
ATOM   2277 O O   . ALA A 1 322 ? 60.666  51.782 -0.524  1.00 88.06  ? 321 ALA A O   1 
ATOM   2278 C CB  . ALA A 1 322 ? 58.073  50.774 1.133   1.00 74.86  ? 321 ALA A CB  1 
ATOM   2279 N N   . ASP A 1 323 ? 60.131  49.663 -1.065  1.00 84.89  ? 322 ASP A N   1 
ATOM   2280 C CA  . ASP A 1 323 ? 60.668  49.768 -2.417  1.00 87.73  ? 322 ASP A CA  1 
ATOM   2281 C C   . ASP A 1 323 ? 59.694  50.571 -3.271  1.00 86.63  ? 322 ASP A C   1 
ATOM   2282 O O   . ASP A 1 323 ? 58.573  50.125 -3.533  1.00 83.78  ? 322 ASP A O   1 
ATOM   2283 C CB  . ASP A 1 323 ? 60.917  48.386 -3.012  1.00 89.68  ? 322 ASP A CB  1 
ATOM   2284 C CG  . ASP A 1 323 ? 61.623  48.452 -4.352  1.00 95.74  ? 322 ASP A CG  1 
ATOM   2285 O OD1 . ASP A 1 323 ? 62.678  49.116 -4.437  1.00 98.18  ? 322 ASP A OD1 1 
ATOM   2286 O OD2 . ASP A 1 323 ? 61.127  47.840 -5.320  1.00 97.47  ? 322 ASP A OD2 1 
ATOM   2287 N N   . VAL A 1 324 ? 60.124  51.758 -3.705  1.00 87.91  ? 323 VAL A N   1 
ATOM   2288 C CA  . VAL A 1 324 ? 59.249  52.633 -4.478  1.00 83.78  ? 323 VAL A CA  1 
ATOM   2289 C C   . VAL A 1 324 ? 58.978  52.051 -5.861  1.00 83.02  ? 323 VAL A C   1 
ATOM   2290 O O   . VAL A 1 324 ? 57.925  52.310 -6.455  1.00 80.16  ? 323 VAL A O   1 
ATOM   2291 C CB  . VAL A 1 324 ? 59.859  54.046 -4.557  1.00 86.05  ? 323 VAL A CB  1 
ATOM   2292 C CG1 . VAL A 1 324 ? 61.211  54.010 -5.255  1.00 90.10  ? 323 VAL A CG1 1 
ATOM   2293 C CG2 . VAL A 1 324 ? 58.908  55.012 -5.252  1.00 83.24  ? 323 VAL A CG2 1 
ATOM   2294 N N   . ASN A 1 325 ? 59.901  51.251 -6.392  1.00 85.72  ? 324 ASN A N   1 
ATOM   2295 C CA  . ASN A 1 325 ? 59.700  50.636 -7.698  1.00 85.24  ? 324 ASN A CA  1 
ATOM   2296 C C   . ASN A 1 325 ? 59.432  49.142 -7.567  1.00 87.30  ? 324 ASN A C   1 
ATOM   2297 O O   . ASN A 1 325 ? 60.025  48.334 -8.290  1.00 90.25  ? 324 ASN A O   1 
ATOM   2298 C CB  . ASN A 1 325 ? 60.911  50.879 -8.603  1.00 89.46  ? 324 ASN A CB  1 
ATOM   2299 C CG  . ASN A 1 325 ? 60.934  52.282 -9.184  1.00 96.27  ? 324 ASN A CG  1 
ATOM   2300 O OD1 . ASN A 1 325 ? 59.887  52.890 -9.410  1.00 90.49  ? 324 ASN A OD1 1 
ATOM   2301 N ND2 . ASN A 1 325 ? 62.133  52.800 -9.436  1.00 97.54  ? 324 ASN A ND2 1 
ATOM   2302 N N   . ALA A 1 326 ? 58.545  48.768 -6.649  1.00 86.05  ? 325 ALA A N   1 
ATOM   2303 C CA  . ALA A 1 326 ? 58.176  47.372 -6.493  1.00 86.98  ? 325 ALA A CA  1 
ATOM   2304 C C   . ALA A 1 326 ? 57.348  46.901 -7.685  1.00 85.71  ? 325 ALA A C   1 
ATOM   2305 O O   . ALA A 1 326 ? 56.706  47.689 -8.385  1.00 80.98  ? 325 ALA A O   1 
ATOM   2306 C CB  . ALA A 1 326 ? 57.398  47.161 -5.195  1.00 85.75  ? 325 ALA A CB  1 
ATOM   2307 N N   . THR A 1 327 ? 57.376  45.593 -7.915  1.00 90.78  ? 326 THR A N   1 
ATOM   2308 C CA  . THR A 1 327 ? 56.671  44.973 -9.027  1.00 89.68  ? 326 THR A CA  1 
ATOM   2309 C C   . THR A 1 327 ? 55.625  43.999 -8.498  1.00 89.96  ? 326 THR A C   1 
ATOM   2310 O O   . THR A 1 327 ? 55.859  43.295 -7.512  1.00 93.68  ? 326 THR A O   1 
ATOM   2311 C CB  . THR A 1 327 ? 57.643  44.245 -9.967  1.00 97.23  ? 326 THR A CB  1 
ATOM   2312 O OG1 . THR A 1 327 ? 56.914  43.389 -10.860 1.00 97.03  ? 326 THR A OG1 1 
ATOM   2313 C CG2 . THR A 1 327 ? 58.650  43.427 -9.173  1.00 101.78 ? 326 THR A CG2 1 
ATOM   2314 N N   . ASP A 1 328 ? 54.468  43.963 -9.159  1.00 95.86  ? 327 ASP A N   1 
ATOM   2315 C CA  . ASP A 1 328 ? 53.403  43.041 -8.777  1.00 92.58  ? 327 ASP A CA  1 
ATOM   2316 C C   . ASP A 1 328 ? 53.318  41.867 -9.744  1.00 98.76  ? 327 ASP A C   1 
ATOM   2317 O O   . ASP A 1 328 ? 54.315  41.498 -10.372 1.00 105.63 ? 327 ASP A O   1 
ATOM   2318 C CB  . ASP A 1 328 ? 52.055  43.762 -8.710  1.00 83.53  ? 327 ASP A CB  1 
ATOM   2319 C CG  . ASP A 1 328 ? 51.602  44.282 -10.064 1.00 85.15  ? 327 ASP A CG  1 
ATOM   2320 O OD1 . ASP A 1 328 ? 52.466  44.466 -10.945 1.00 89.82  ? 327 ASP A OD1 1 
ATOM   2321 O OD2 . ASP A 1 328 ? 50.390  44.518 -10.246 1.00 81.43  ? 327 ASP A OD2 1 
ATOM   2322 N N   . ILE A 1 329 ? 52.132  41.266 -9.855  1.00 90.85  ? 328 ILE A N   1 
ATOM   2323 C CA  . ILE A 1 329 ? 51.945  40.157 -10.783 1.00 95.30  ? 328 ILE A CA  1 
ATOM   2324 C C   . ILE A 1 329 ? 52.059  40.638 -12.225 1.00 97.02  ? 328 ILE A C   1 
ATOM   2325 O O   . ILE A 1 329 ? 52.624  39.948 -13.081 1.00 102.86 ? 328 ILE A O   1 
ATOM   2326 C CB  . ILE A 1 329 ? 50.597  39.466 -10.508 1.00 90.65  ? 328 ILE A CB  1 
ATOM   2327 C CG1 . ILE A 1 329 ? 50.657  38.707 -9.181  1.00 88.07  ? 328 ILE A CG1 1 
ATOM   2328 C CG2 . ILE A 1 329 ? 50.234  38.534 -11.636 1.00 94.63  ? 328 ILE A CG2 1 
ATOM   2329 C CD1 . ILE A 1 329 ? 49.380  37.973 -8.836  1.00 84.88  ? 328 ILE A CD1 1 
ATOM   2330 N N   . TRP A 1 330 ? 51.540  41.828 -12.514 1.00 94.73  ? 329 TRP A N   1 
ATOM   2331 C CA  . TRP A 1 330 ? 51.551  42.378 -13.862 1.00 94.47  ? 329 TRP A CA  1 
ATOM   2332 C C   . TRP A 1 330 ? 52.782  43.229 -14.152 1.00 98.65  ? 329 TRP A C   1 
ATOM   2333 O O   . TRP A 1 330 ? 52.805  43.924 -15.174 1.00 97.79  ? 329 TRP A O   1 
ATOM   2334 C CB  . TRP A 1 330 ? 50.289  43.210 -14.102 1.00 86.95  ? 329 TRP A CB  1 
ATOM   2335 C CG  . TRP A 1 330 ? 49.014  42.422 -14.078 1.00 84.19  ? 329 TRP A CG  1 
ATOM   2336 C CD1 . TRP A 1 330 ? 48.232  42.159 -12.991 1.00 80.86  ? 329 TRP A CD1 1 
ATOM   2337 C CD2 . TRP A 1 330 ? 48.366  41.805 -15.197 1.00 84.94  ? 329 TRP A CD2 1 
ATOM   2338 N NE1 . TRP A 1 330 ? 47.139  41.413 -13.363 1.00 78.95  ? 329 TRP A NE1 1 
ATOM   2339 C CE2 . TRP A 1 330 ? 47.198  41.183 -14.712 1.00 82.48  ? 329 TRP A CE2 1 
ATOM   2340 C CE3 . TRP A 1 330 ? 48.661  41.716 -16.562 1.00 88.63  ? 329 TRP A CE3 1 
ATOM   2341 C CZ2 . TRP A 1 330 ? 46.326  40.481 -15.543 1.00 82.05  ? 329 TRP A CZ2 1 
ATOM   2342 C CZ3 . TRP A 1 330 ? 47.793  41.020 -17.385 1.00 88.72  ? 329 TRP A CZ3 1 
ATOM   2343 C CH2 . TRP A 1 330 ? 46.640  40.411 -16.873 1.00 85.48  ? 329 TRP A CH2 1 
ATOM   2344 N N   . ASP A 1 331 ? 53.798  43.187 -13.287 1.00 94.14  ? 330 ASP A N   1 
ATOM   2345 C CA  . ASP A 1 331 ? 55.005  44.007 -13.438 1.00 96.50  ? 330 ASP A CA  1 
ATOM   2346 C C   . ASP A 1 331 ? 54.663  45.494 -13.530 1.00 92.70  ? 330 ASP A C   1 
ATOM   2347 O O   . ASP A 1 331 ? 55.204  46.223 -14.363 1.00 93.76  ? 330 ASP A O   1 
ATOM   2348 C CB  . ASP A 1 331 ? 55.837  43.570 -14.649 1.00 102.01 ? 330 ASP A CB  1 
ATOM   2349 C CG  . ASP A 1 331 ? 57.108  42.837 -14.254 1.00 111.52 ? 330 ASP A CG  1 
ATOM   2350 O OD1 . ASP A 1 331 ? 57.998  43.473 -13.649 1.00 115.05 ? 330 ASP A OD1 1 
ATOM   2351 O OD2 . ASP A 1 331 ? 57.217  41.625 -14.540 1.00 114.78 ? 330 ASP A OD2 1 
ATOM   2352 N N   . ALA A 1 332 ? 53.762  45.950 -12.663 1.00 91.42  ? 331 ALA A N   1 
ATOM   2353 C CA  . ALA A 1 332 ? 53.342  47.345 -12.619 1.00 87.72  ? 331 ALA A CA  1 
ATOM   2354 C C   . ALA A 1 332 ? 53.798  47.976 -11.310 1.00 86.72  ? 331 ALA A C   1 
ATOM   2355 O O   . ALA A 1 332 ? 53.599  47.397 -10.237 1.00 85.53  ? 331 ALA A O   1 
ATOM   2356 C CB  . ALA A 1 332 ? 51.824  47.464 -12.767 1.00 82.69  ? 331 ALA A CB  1 
ATOM   2357 N N   . THR A 1 333 ? 54.407  49.157 -11.401 1.00 85.55  ? 332 THR A N   1 
ATOM   2358 C CA  . THR A 1 333 ? 54.888  49.872 -10.229 1.00 85.58  ? 332 THR A CA  1 
ATOM   2359 C C   . THR A 1 333 ? 53.729  50.546 -9.500  1.00 80.71  ? 332 THR A C   1 
ATOM   2360 O O   . THR A 1 333 ? 52.662  50.760 -10.079 1.00 76.99  ? 332 THR A O   1 
ATOM   2361 C CB  . THR A 1 333 ? 55.925  50.919 -10.635 1.00 91.90  ? 332 THR A CB  1 
ATOM   2362 O OG1 . THR A 1 333 ? 55.298  51.944 -11.415 1.00 88.95  ? 332 THR A OG1 1 
ATOM   2363 C CG2 . THR A 1 333 ? 57.047  50.283 -11.447 1.00 97.14  ? 332 THR A CG2 1 
ATOM   2364 N N   . PRO A 1 334 ? 53.908  50.886 -8.218  1.00 79.80  ? 333 PRO A N   1 
ATOM   2365 C CA  . PRO A 1 334 ? 52.866  51.657 -7.519  1.00 75.13  ? 333 PRO A CA  1 
ATOM   2366 C C   . PRO A 1 334 ? 52.597  53.007 -8.151  1.00 75.06  ? 333 PRO A C   1 
ATOM   2367 O O   . PRO A 1 334 ? 51.526  53.584 -7.921  1.00 73.63  ? 333 PRO A O   1 
ATOM   2368 C CB  . PRO A 1 334 ? 53.429  51.808 -6.099  1.00 75.92  ? 333 PRO A CB  1 
ATOM   2369 C CG  . PRO A 1 334 ? 54.382  50.681 -5.949  1.00 81.16  ? 333 PRO A CG  1 
ATOM   2370 C CD  . PRO A 1 334 ? 54.993  50.484 -7.306  1.00 83.63  ? 333 PRO A CD  1 
ATOM   2371 N N   . LEU A 1 335 ? 53.538  53.531 -8.938  1.00 78.21  ? 334 LEU A N   1 
ATOM   2372 C CA  . LEU A 1 335 ? 53.297  54.770 -9.665  1.00 78.50  ? 334 LEU A CA  1 
ATOM   2373 C C   . LEU A 1 335 ? 52.223  54.592 -10.732 1.00 76.59  ? 334 LEU A C   1 
ATOM   2374 O O   . LEU A 1 335 ? 51.511  55.549 -11.057 1.00 76.13  ? 334 LEU A O   1 
ATOM   2375 C CB  . LEU A 1 335 ? 54.599  55.261 -10.294 1.00 83.25  ? 334 LEU A CB  1 
ATOM   2376 C CG  . LEU A 1 335 ? 54.592  56.671 -10.875 1.00 84.49  ? 334 LEU A CG  1 
ATOM   2377 C CD1 . LEU A 1 335 ? 54.366  57.693 -9.773  1.00 83.68  ? 334 LEU A CD1 1 
ATOM   2378 C CD2 . LEU A 1 335 ? 55.896  56.936 -11.604 1.00 89.22  ? 334 LEU A CD2 1 
ATOM   2379 N N   . HIS A 1 336 ? 52.093  53.384 -11.286 1.00 81.20  ? 335 HIS A N   1 
ATOM   2380 C CA  . HIS A 1 336 ? 51.039  53.126 -12.262 1.00 79.06  ? 335 HIS A CA  1 
ATOM   2381 C C   . HIS A 1 336 ? 49.661  53.295 -11.634 1.00 77.16  ? 335 HIS A C   1 
ATOM   2382 O O   . HIS A 1 336 ? 48.817  54.037 -12.150 1.00 77.48  ? 335 HIS A O   1 
ATOM   2383 C CB  . HIS A 1 336 ? 51.191  51.718 -12.847 1.00 80.77  ? 335 HIS A CB  1 
ATOM   2384 C CG  . HIS A 1 336 ? 52.370  51.556 -13.757 1.00 86.27  ? 335 HIS A CG  1 
ATOM   2385 N ND1 . HIS A 1 336 ? 53.661  51.433 -13.291 1.00 90.64  ? 335 HIS A ND1 1 
ATOM   2386 C CD2 . HIS A 1 336 ? 52.449  51.484 -15.108 1.00 88.33  ? 335 HIS A CD2 1 
ATOM   2387 C CE1 . HIS A 1 336 ? 54.486  51.298 -14.315 1.00 94.06  ? 335 HIS A CE1 1 
ATOM   2388 N NE2 . HIS A 1 336 ? 53.776  51.326 -15.429 1.00 92.70  ? 335 HIS A NE2 1 
ATOM   2389 N N   . LEU A 1 337 ? 49.420  52.615 -10.510 1.00 76.59  ? 336 LEU A N   1 
ATOM   2390 C CA  . LEU A 1 337 ? 48.114  52.686 -9.861  1.00 74.27  ? 336 LEU A CA  1 
ATOM   2391 C C   . LEU A 1 337 ? 47.813  54.096 -9.369  1.00 76.07  ? 336 LEU A C   1 
ATOM   2392 O O   . LEU A 1 337 ? 46.669  54.558 -9.456  1.00 75.86  ? 336 LEU A O   1 
ATOM   2393 C CB  . LEU A 1 337 ? 48.051  51.690 -8.704  1.00 71.96  ? 336 LEU A CB  1 
ATOM   2394 C CG  . LEU A 1 337 ? 48.148  50.214 -9.089  1.00 73.10  ? 336 LEU A CG  1 
ATOM   2395 C CD1 . LEU A 1 337 ? 48.342  49.349 -7.854  1.00 72.51  ? 336 LEU A CD1 1 
ATOM   2396 C CD2 . LEU A 1 337 ? 46.909  49.783 -9.859  1.00 73.20  ? 336 LEU A CD2 1 
ATOM   2397 N N   . ALA A 1 338 ? 48.824  54.796 -8.848  1.00 75.05  ? 337 ALA A N   1 
ATOM   2398 C CA  . ALA A 1 338 ? 48.601  56.152 -8.360  1.00 76.12  ? 337 ALA A CA  1 
ATOM   2399 C C   . ALA A 1 338 ? 48.191  57.083 -9.493  1.00 79.63  ? 337 ALA A C   1 
ATOM   2400 O O   . ALA A 1 338 ? 47.304  57.928 -9.323  1.00 80.29  ? 337 ALA A O   1 
ATOM   2401 C CB  . ALA A 1 338 ? 49.855  56.673 -7.659  1.00 77.54  ? 337 ALA A CB  1 
ATOM   2402 N N   . ALA A 1 339 ? 48.820  56.940 -10.662 1.00 75.84  ? 338 ALA A N   1 
ATOM   2403 C CA  . ALA A 1 339 ? 48.433  57.744 -11.815 1.00 78.71  ? 338 ALA A CA  1 
ATOM   2404 C C   . ALA A 1 339 ? 47.105  57.295 -12.408 1.00 78.95  ? 338 ALA A C   1 
ATOM   2405 O O   . ALA A 1 339 ? 46.437  58.093 -13.076 1.00 81.21  ? 338 ALA A O   1 
ATOM   2406 C CB  . ALA A 1 339 ? 49.524  57.695 -12.885 1.00 81.90  ? 338 ALA A CB  1 
ATOM   2407 N N   . LEU A 1 340 ? 46.708  56.043 -12.178 1.00 78.27  ? 339 LEU A N   1 
ATOM   2408 C CA  . LEU A 1 340 ? 45.429  55.558 -12.684 1.00 77.62  ? 339 LEU A CA  1 
ATOM   2409 C C   . LEU A 1 340 ? 44.272  56.032 -11.813 1.00 78.08  ? 339 LEU A C   1 
ATOM   2410 O O   . LEU A 1 340 ? 43.258  56.519 -12.324 1.00 79.65  ? 339 LEU A O   1 
ATOM   2411 C CB  . LEU A 1 340 ? 45.444  54.032 -12.767 1.00 75.44  ? 339 LEU A CB  1 
ATOM   2412 C CG  . LEU A 1 340 ? 44.130  53.389 -13.208 1.00 76.07  ? 339 LEU A CG  1 
ATOM   2413 C CD1 . LEU A 1 340 ? 43.867  53.658 -14.679 1.00 79.08  ? 339 LEU A CD1 1 
ATOM   2414 C CD2 . LEU A 1 340 ? 44.151  51.903 -12.925 1.00 74.69  ? 339 LEU A CD2 1 
ATOM   2415 N N   . ILE A 1 341 ? 44.408  55.893 -10.491 1.00 75.05  ? 340 ILE A N   1 
ATOM   2416 C CA  . ILE A 1 341 ? 43.362  56.337 -9.580  1.00 74.48  ? 340 ILE A CA  1 
ATOM   2417 C C   . ILE A 1 341 ? 43.241  57.857 -9.567  1.00 77.38  ? 340 ILE A C   1 
ATOM   2418 O O   . ILE A 1 341 ? 42.202  58.391 -9.161  1.00 78.36  ? 340 ILE A O   1 
ATOM   2419 C CB  . ILE A 1 341 ? 43.627  55.779 -8.167  1.00 71.41  ? 340 ILE A CB  1 
ATOM   2420 C CG1 . ILE A 1 341 ? 42.384  55.907 -7.283  1.00 71.01  ? 340 ILE A CG1 1 
ATOM   2421 C CG2 . ILE A 1 341 ? 44.819  56.477 -7.527  1.00 71.56  ? 340 ILE A CG2 1 
ATOM   2422 C CD1 . ILE A 1 341 ? 41.188  55.128 -7.789  1.00 71.07  ? 340 ILE A CD1 1 
ATOM   2423 N N   . GLY A 1 342 ? 44.270  58.569 -10.015 1.00 77.53  ? 341 GLY A N   1 
ATOM   2424 C CA  . GLY A 1 342 ? 44.204  60.016 -10.092 1.00 80.62  ? 341 GLY A CA  1 
ATOM   2425 C C   . GLY A 1 342 ? 44.491  60.730 -8.791  1.00 81.88  ? 341 GLY A C   1 
ATOM   2426 O O   . GLY A 1 342 ? 43.792  61.692 -8.447  1.00 84.01  ? 341 GLY A O   1 
ATOM   2427 N N   . HIS A 1 343 ? 45.506  60.290 -8.053  1.00 79.31  ? 342 HIS A N   1 
ATOM   2428 C CA  . HIS A 1 343 ? 45.873  60.892 -6.775  1.00 79.41  ? 342 HIS A CA  1 
ATOM   2429 C C   . HIS A 1 343 ? 47.111  61.752 -7.005  1.00 82.70  ? 342 HIS A C   1 
ATOM   2430 O O   . HIS A 1 343 ? 48.224  61.237 -7.133  1.00 81.95  ? 342 HIS A O   1 
ATOM   2431 C CB  . HIS A 1 343 ? 46.121  59.818 -5.721  1.00 76.66  ? 342 HIS A CB  1 
ATOM   2432 C CG  . HIS A 1 343 ? 45.950  60.300 -4.315  1.00 79.75  ? 342 HIS A CG  1 
ATOM   2433 N ND1 . HIS A 1 343 ? 46.787  61.233 -3.741  1.00 82.74  ? 342 HIS A ND1 1 
ATOM   2434 C CD2 . HIS A 1 343 ? 45.040  59.976 -3.366  1.00 80.85  ? 342 HIS A CD2 1 
ATOM   2435 C CE1 . HIS A 1 343 ? 46.398  61.464 -2.499  1.00 84.47  ? 342 HIS A CE1 1 
ATOM   2436 N NE2 . HIS A 1 343 ? 45.341  60.714 -2.247  1.00 83.61  ? 342 HIS A NE2 1 
ATOM   2437 N N   . LEU A 1 344 ? 46.912  63.071 -7.058  1.00 80.72  ? 343 LEU A N   1 
ATOM   2438 C CA  . LEU A 1 344 ? 48.021  63.976 -7.339  1.00 83.71  ? 343 LEU A CA  1 
ATOM   2439 C C   . LEU A 1 344 ? 49.075  63.929 -6.239  1.00 83.48  ? 343 LEU A C   1 
ATOM   2440 O O   . LEU A 1 344 ? 50.279  63.941 -6.523  1.00 84.36  ? 343 LEU A O   1 
ATOM   2441 C CB  . LEU A 1 344 ? 47.499  65.399 -7.518  1.00 87.95  ? 343 LEU A CB  1 
ATOM   2442 C CG  . LEU A 1 344 ? 48.567  66.477 -7.700  1.00 91.81  ? 343 LEU A CG  1 
ATOM   2443 C CD1 . LEU A 1 344 ? 49.339  66.249 -8.991  1.00 93.79  ? 343 LEU A CD1 1 
ATOM   2444 C CD2 . LEU A 1 344 ? 47.941  67.861 -7.673  1.00 96.52  ? 343 LEU A CD2 1 
ATOM   2445 N N   . GLU A 1 345 ? 48.644  63.875 -4.976  1.00 82.67  ? 344 GLU A N   1 
ATOM   2446 C CA  . GLU A 1 345 ? 49.593  63.920 -3.866  1.00 84.01  ? 344 GLU A CA  1 
ATOM   2447 C C   . GLU A 1 345 ? 50.458  62.666 -3.814  1.00 83.06  ? 344 GLU A C   1 
ATOM   2448 O O   . GLU A 1 345 ? 51.673  62.756 -3.605  1.00 84.92  ? 344 GLU A O   1 
ATOM   2449 C CB  . GLU A 1 345 ? 48.850  64.115 -2.543  1.00 85.63  ? 344 GLU A CB  1 
ATOM   2450 C CG  . GLU A 1 345 ? 48.512  65.565 -2.212  1.00 93.08  ? 344 GLU A CG  1 
ATOM   2451 C CD  . GLU A 1 345 ? 47.439  66.146 -3.115  1.00 101.01 ? 344 GLU A CD  1 
ATOM   2452 O OE1 . GLU A 1 345 ? 46.722  65.363 -3.773  1.00 97.02  ? 344 GLU A OE1 1 
ATOM   2453 O OE2 . GLU A 1 345 ? 47.312  67.389 -3.166  1.00 102.73 ? 344 GLU A OE2 1 
ATOM   2454 N N   . ILE A 1 346 ? 49.855  61.489 -3.998  1.00 83.09  ? 345 ILE A N   1 
ATOM   2455 C CA  . ILE A 1 346 ? 50.625  60.250 -3.939  1.00 81.40  ? 345 ILE A CA  1 
ATOM   2456 C C   . ILE A 1 346 ? 51.598  60.167 -5.110  1.00 83.72  ? 345 ILE A C   1 
ATOM   2457 O O   . ILE A 1 346 ? 52.731  59.692 -4.959  1.00 85.33  ? 345 ILE A O   1 
ATOM   2458 C CB  . ILE A 1 346 ? 49.679  59.034 -3.887  1.00 78.69  ? 345 ILE A CB  1 
ATOM   2459 C CG1 . ILE A 1 346 ? 48.925  59.007 -2.555  1.00 78.57  ? 345 ILE A CG1 1 
ATOM   2460 C CG2 . ILE A 1 346 ? 50.449  57.735 -4.079  1.00 77.50  ? 345 ILE A CG2 1 
ATOM   2461 C CD1 . ILE A 1 346 ? 48.005  57.814 -2.389  1.00 77.77  ? 345 ILE A CD1 1 
ATOM   2462 N N   . VAL A 1 347 ? 51.184  60.638 -6.290  1.00 76.43  ? 346 VAL A N   1 
ATOM   2463 C CA  . VAL A 1 347 ? 52.086  60.658 -7.440  1.00 79.14  ? 346 VAL A CA  1 
ATOM   2464 C C   . VAL A 1 347 ? 53.284  61.557 -7.160  1.00 82.21  ? 346 VAL A C   1 
ATOM   2465 O O   . VAL A 1 347 ? 54.425  61.222 -7.502  1.00 83.83  ? 346 VAL A O   1 
ATOM   2466 C CB  . VAL A 1 347 ? 51.329  61.096 -8.709  1.00 81.27  ? 346 VAL A CB  1 
ATOM   2467 C CG1 . VAL A 1 347 ? 52.304  61.389 -9.838  1.00 85.21  ? 346 VAL A CG1 1 
ATOM   2468 C CG2 . VAL A 1 347 ? 50.345  60.019 -9.133  1.00 78.70  ? 346 VAL A CG2 1 
ATOM   2469 N N   . GLU A 1 348 ? 53.046  62.707 -6.526  1.00 78.63  ? 347 GLU A N   1 
ATOM   2470 C CA  . GLU A 1 348 ? 54.151  63.586 -6.158  1.00 82.53  ? 347 GLU A CA  1 
ATOM   2471 C C   . GLU A 1 348 ? 55.056  62.949 -5.110  1.00 85.25  ? 347 GLU A C   1 
ATOM   2472 O O   . GLU A 1 348 ? 56.267  63.189 -5.117  1.00 88.67  ? 347 GLU A O   1 
ATOM   2473 C CB  . GLU A 1 348 ? 53.615  64.926 -5.652  1.00 84.51  ? 347 GLU A CB  1 
ATOM   2474 C CG  . GLU A 1 348 ? 53.238  65.900 -6.758  1.00 88.62  ? 347 GLU A CG  1 
ATOM   2475 C CD  . GLU A 1 348 ? 52.692  67.212 -6.223  1.00 97.39  ? 347 GLU A CD  1 
ATOM   2476 O OE1 . GLU A 1 348 ? 51.552  67.219 -5.711  1.00 93.64  ? 347 GLU A OE1 1 
ATOM   2477 O OE2 . GLU A 1 348 ? 53.405  68.235 -6.310  1.00 99.51  ? 347 GLU A OE2 1 
ATOM   2478 N N   . VAL A 1 349 ? 54.498  62.134 -4.213  1.00 79.94  ? 348 VAL A N   1 
ATOM   2479 C CA  . VAL A 1 349 ? 55.314  61.516 -3.171  1.00 81.73  ? 348 VAL A CA  1 
ATOM   2480 C C   . VAL A 1 349 ? 56.146  60.375 -3.743  1.00 83.83  ? 348 VAL A C   1 
ATOM   2481 O O   . VAL A 1 349 ? 57.328  60.224 -3.409  1.00 87.78  ? 348 VAL A O   1 
ATOM   2482 C CB  . VAL A 1 349 ? 54.428  61.045 -2.004  1.00 80.25  ? 348 VAL A CB  1 
ATOM   2483 C CG1 . VAL A 1 349 ? 55.223  60.165 -1.054  1.00 81.66  ? 348 VAL A CG1 1 
ATOM   2484 C CG2 . VAL A 1 349 ? 53.855  62.241 -1.261  1.00 81.38  ? 348 VAL A CG2 1 
ATOM   2485 N N   . LEU A 1 350 ? 55.549  59.558 -4.613  1.00 80.07  ? 349 LEU A N   1 
ATOM   2486 C CA  . LEU A 1 350 ? 56.284  58.446 -5.209  1.00 81.33  ? 349 LEU A CA  1 
ATOM   2487 C C   . LEU A 1 350 ? 57.429  58.943 -6.083  1.00 86.74  ? 349 LEU A C   1 
ATOM   2488 O O   . LEU A 1 350 ? 58.542  58.406 -6.027  1.00 90.33  ? 349 LEU A O   1 
ATOM   2489 C CB  . LEU A 1 350 ? 55.336  57.562 -6.020  1.00 77.29  ? 349 LEU A CB  1 
ATOM   2490 C CG  . LEU A 1 350 ? 54.351  56.702 -5.225  1.00 74.87  ? 349 LEU A CG  1 
ATOM   2491 C CD1 . LEU A 1 350 ? 53.404  55.960 -6.156  1.00 71.22  ? 349 LEU A CD1 1 
ATOM   2492 C CD2 . LEU A 1 350 ? 55.105  55.726 -4.337  1.00 77.85  ? 349 LEU A CD2 1 
ATOM   2493 N N   . LEU A 1 351 ? 57.179  59.974 -6.895  1.00 85.00  ? 350 LEU A N   1 
ATOM   2494 C CA  . LEU A 1 351 ? 58.224  60.494 -7.772  1.00 88.49  ? 350 LEU A CA  1 
ATOM   2495 C C   . LEU A 1 351 ? 59.340  61.173 -6.988  1.00 94.16  ? 350 LEU A C   1 
ATOM   2496 O O   . LEU A 1 351 ? 60.505  61.117 -7.399  1.00 97.50  ? 350 LEU A O   1 
ATOM   2497 C CB  . LEU A 1 351 ? 57.620  61.463 -8.790  1.00 87.40  ? 350 LEU A CB  1 
ATOM   2498 C CG  . LEU A 1 351 ? 56.859  60.825 -9.954  1.00 85.84  ? 350 LEU A CG  1 
ATOM   2499 C CD1 . LEU A 1 351 ? 56.075  61.873 -10.728 1.00 87.11  ? 350 LEU A CD1 1 
ATOM   2500 C CD2 . LEU A 1 351 ? 57.821  60.089 -10.876 1.00 88.68  ? 350 LEU A CD2 1 
ATOM   2501 N N   . LYS A 1 352 ? 59.012  61.816 -5.865  1.00 87.74  ? 351 LYS A N   1 
ATOM   2502 C CA  . LYS A 1 352 ? 60.040  62.451 -5.050  1.00 92.02  ? 351 LYS A CA  1 
ATOM   2503 C C   . LYS A 1 352 ? 60.881  61.438 -4.285  1.00 95.84  ? 351 LYS A C   1 
ATOM   2504 O O   . LYS A 1 352 ? 62.011  61.757 -3.898  1.00 99.64  ? 351 LYS A O   1 
ATOM   2505 C CB  . LYS A 1 352 ? 59.406  63.450 -4.079  1.00 92.51  ? 351 LYS A CB  1 
ATOM   2506 C CG  . LYS A 1 352 ? 58.989  64.755 -4.736  1.00 97.58  ? 351 LYS A CG  1 
ATOM   2507 C CD  . LYS A 1 352 ? 58.337  65.712 -3.751  1.00 101.38 ? 351 LYS A CD  1 
ATOM   2508 C CE  . LYS A 1 352 ? 57.967  67.024 -4.436  1.00 105.87 ? 351 LYS A CE  1 
ATOM   2509 N NZ  . LYS A 1 352 ? 57.324  67.998 -3.509  1.00 109.56 ? 351 LYS A NZ  1 
ATOM   2510 N N   . ASN A 1 353 ? 60.365  60.230 -4.062  1.00 85.28  ? 352 ASN A N   1 
ATOM   2511 C CA  . ASN A 1 353 ? 61.121  59.173 -3.403  1.00 87.87  ? 352 ASN A CA  1 
ATOM   2512 C C   . ASN A 1 353 ? 61.917  58.314 -4.379  1.00 90.81  ? 352 ASN A C   1 
ATOM   2513 O O   . ASN A 1 353 ? 62.664  57.433 -3.938  1.00 93.15  ? 352 ASN A O   1 
ATOM   2514 C CB  . ASN A 1 353 ? 60.183  58.286 -2.579  1.00 85.24  ? 352 ASN A CB  1 
ATOM   2515 C CG  . ASN A 1 353 ? 59.797  58.918 -1.256  1.00 91.19  ? 352 ASN A CG  1 
ATOM   2516 O OD1 . ASN A 1 353 ? 60.416  58.654 -0.224  1.00 92.66  ? 352 ASN A OD1 1 
ATOM   2517 N ND2 . ASN A 1 353 ? 58.773  59.761 -1.280  1.00 84.57  ? 352 ASN A ND2 1 
ATOM   2518 N N   . GLY A 1 354 ? 61.776  58.542 -5.682  1.00 91.28  ? 353 GLY A N   1 
ATOM   2519 C CA  . GLY A 1 354 ? 62.590  57.844 -6.658  1.00 94.22  ? 353 GLY A CA  1 
ATOM   2520 C C   . GLY A 1 354 ? 61.847  56.809 -7.475  1.00 93.58  ? 353 GLY A C   1 
ATOM   2521 O O   . GLY A 1 354 ? 62.383  55.734 -7.756  1.00 92.82  ? 353 GLY A O   1 
ATOM   2522 N N   . ALA A 1 355 ? 60.615  57.119 -7.868  1.00 91.84  ? 354 ALA A N   1 
ATOM   2523 C CA  . ALA A 1 355 ? 59.841  56.205 -8.692  1.00 89.84  ? 354 ALA A CA  1 
ATOM   2524 C C   . ALA A 1 355 ? 60.311  56.260 -10.140 1.00 97.19  ? 354 ALA A C   1 
ATOM   2525 O O   . ALA A 1 355 ? 60.742  57.305 -10.639 1.00 101.82 ? 354 ALA A O   1 
ATOM   2526 C CB  . ALA A 1 355 ? 58.351  56.536 -8.616  1.00 85.17  ? 354 ALA A CB  1 
ATOM   2527 N N   . ASP A 1 356 ? 60.227  55.116 -10.815 1.00 98.22  ? 355 ASP A N   1 
ATOM   2528 C CA  . ASP A 1 356 ? 60.612  55.018 -12.219 1.00 102.04 ? 355 ASP A CA  1 
ATOM   2529 C C   . ASP A 1 356 ? 59.475  55.569 -13.072 1.00 102.84 ? 355 ASP A C   1 
ATOM   2530 O O   . ASP A 1 356 ? 58.386  54.988 -13.121 1.00 99.37  ? 355 ASP A O   1 
ATOM   2531 C CB  . ASP A 1 356 ? 60.933  53.571 -12.585 1.00 101.61 ? 355 ASP A CB  1 
ATOM   2532 C CG  . ASP A 1 356 ? 61.836  53.460 -13.801 1.00 108.45 ? 355 ASP A CG  1 
ATOM   2533 O OD1 . ASP A 1 356 ? 63.055  53.696 -13.662 1.00 110.73 ? 355 ASP A OD1 1 
ATOM   2534 O OD2 . ASP A 1 356 ? 61.329  53.135 -14.895 1.00 110.66 ? 355 ASP A OD2 1 
ATOM   2535 N N   . VAL A 1 357 ? 59.723  56.697 -13.741 1.00 101.49 ? 356 VAL A N   1 
ATOM   2536 C CA  . VAL A 1 357 ? 58.674  57.353 -14.512 1.00 98.48  ? 356 VAL A CA  1 
ATOM   2537 C C   . VAL A 1 357 ? 58.460  56.698 -15.874 1.00 98.82  ? 356 VAL A C   1 
ATOM   2538 O O   . VAL A 1 357 ? 57.382  56.848 -16.462 1.00 94.95  ? 356 VAL A O   1 
ATOM   2539 C CB  . VAL A 1 357 ? 58.995  58.851 -14.666 1.00 101.81 ? 356 VAL A CB  1 
ATOM   2540 C CG1 . VAL A 1 357 ? 60.155  59.060 -15.628 1.00 105.67 ? 356 VAL A CG1 1 
ATOM   2541 C CG2 . VAL A 1 357 ? 57.764  59.633 -15.107 1.00 97.96  ? 356 VAL A CG2 1 
ATOM   2542 N N   . ASN A 1 358 ? 59.446  55.960 -16.386 1.00 101.43 ? 357 ASN A N   1 
ATOM   2543 C CA  . ASN A 1 358 ? 59.333  55.295 -17.679 1.00 101.52 ? 357 ASN A CA  1 
ATOM   2544 C C   . ASN A 1 358 ? 59.139  53.789 -17.541 1.00 101.98 ? 357 ASN A C   1 
ATOM   2545 O O   . ASN A 1 358 ? 59.388  53.045 -18.495 1.00 103.53 ? 357 ASN A O   1 
ATOM   2546 C CB  . ASN A 1 358 ? 60.561  55.590 -18.540 1.00 106.22 ? 357 ASN A CB  1 
ATOM   2547 C CG  . ASN A 1 358 ? 60.820  57.072 -18.693 1.00 115.02 ? 357 ASN A CG  1 
ATOM   2548 O OD1 . ASN A 1 358 ? 60.070  57.778 -19.367 1.00 111.52 ? 357 ASN A OD1 1 
ATOM   2549 N ND2 . ASN A 1 358 ? 61.890  57.553 -18.070 1.00 115.51 ? 357 ASN A ND2 1 
ATOM   2550 N N   . ALA A 1 359 ? 58.699  53.325 -16.375 1.00 102.02 ? 358 ALA A N   1 
ATOM   2551 C CA  . ALA A 1 359 ? 58.503  51.899 -16.163 1.00 101.32 ? 358 ALA A CA  1 
ATOM   2552 C C   . ALA A 1 359 ? 57.282  51.405 -16.928 1.00 99.35  ? 358 ALA A C   1 
ATOM   2553 O O   . ALA A 1 359 ? 56.224  52.039 -16.921 1.00 94.50  ? 358 ALA A O   1 
ATOM   2554 C CB  . ALA A 1 359 ? 58.347  51.599 -14.673 1.00 99.49  ? 358 ALA A CB  1 
ATOM   2555 N N   . SER A 1 360 ? 57.434  50.263 -17.593 1.00 103.21 ? 359 SER A N   1 
ATOM   2556 C CA  . SER A 1 360 ? 56.356  49.642 -18.346 1.00 100.64 ? 359 SER A CA  1 
ATOM   2557 C C   . SER A 1 360 ? 56.032  48.278 -17.753 1.00 101.04 ? 359 SER A C   1 
ATOM   2558 O O   . SER A 1 360 ? 56.883  47.635 -17.131 1.00 103.12 ? 359 SER A O   1 
ATOM   2559 C CB  . SER A 1 360 ? 56.721  49.496 -19.830 1.00 105.22 ? 359 SER A CB  1 
ATOM   2560 O OG  . SER A 1 360 ? 57.884  48.703 -19.997 1.00 113.40 ? 359 SER A OG  1 
ATOM   2561 N N   . ASP A 1 361 ? 54.791  47.843 -17.948 1.00 104.65 ? 360 ASP A N   1 
ATOM   2562 C CA  . ASP A 1 361 ? 54.336  46.559 -17.435 1.00 102.08 ? 360 ASP A CA  1 
ATOM   2563 C C   . ASP A 1 361 ? 54.525  45.492 -18.515 1.00 107.68 ? 360 ASP A C   1 
ATOM   2564 O O   . ASP A 1 361 ? 55.244  45.703 -19.495 1.00 113.01 ? 360 ASP A O   1 
ATOM   2565 C CB  . ASP A 1 361 ? 52.884  46.674 -16.959 1.00 93.31  ? 360 ASP A CB  1 
ATOM   2566 C CG  . ASP A 1 361 ? 51.919  46.963 -18.092 1.00 94.17  ? 360 ASP A CG  1 
ATOM   2567 O OD1 . ASP A 1 361 ? 52.361  47.489 -19.135 1.00 99.09  ? 360 ASP A OD1 1 
ATOM   2568 O OD2 . ASP A 1 361 ? 50.714  46.669 -17.937 1.00 89.39  ? 360 ASP A OD2 1 
ATOM   2569 N N   . ILE A 1 362 ? 53.883  44.333 -18.347 1.00 95.20  ? 361 ILE A N   1 
ATOM   2570 C CA  . ILE A 1 362 ? 53.996  43.277 -19.347 1.00 99.75  ? 361 ILE A CA  1 
ATOM   2571 C C   . ILE A 1 362 ? 53.327  43.698 -20.650 1.00 101.07 ? 361 ILE A C   1 
ATOM   2572 O O   . ILE A 1 362 ? 53.787  43.332 -21.739 1.00 106.66 ? 361 ILE A O   1 
ATOM   2573 C CB  . ILE A 1 362 ? 53.412  41.961 -18.795 1.00 95.94  ? 361 ILE A CB  1 
ATOM   2574 C CG1 . ILE A 1 362 ? 53.480  40.852 -19.848 1.00 101.82 ? 361 ILE A CG1 1 
ATOM   2575 C CG2 . ILE A 1 362 ? 51.987  42.167 -18.297 1.00 86.02  ? 361 ILE A CG2 1 
ATOM   2576 C CD1 . ILE A 1 362 ? 54.889  40.513 -20.290 1.00 110.83 ? 361 ILE A CD1 1 
ATOM   2577 N N   . THR A 1 363 ? 52.252  44.485 -20.570 1.00 103.32 ? 362 THR A N   1 
ATOM   2578 C CA  . THR A 1 363 ? 51.596  44.968 -21.779 1.00 102.74 ? 362 THR A CA  1 
ATOM   2579 C C   . THR A 1 363 ? 52.354  46.127 -22.415 1.00 107.93 ? 362 THR A C   1 
ATOM   2580 O O   . THR A 1 363 ? 52.240  46.346 -23.626 1.00 109.57 ? 362 THR A O   1 
ATOM   2581 C CB  . THR A 1 363 ? 50.159  45.393 -21.470 1.00 96.60  ? 362 THR A CB  1 
ATOM   2582 O OG1 . THR A 1 363 ? 50.169  46.524 -20.590 1.00 92.92  ? 362 THR A OG1 1 
ATOM   2583 C CG2 . THR A 1 363 ? 49.395  44.254 -20.811 1.00 91.51  ? 362 THR A CG2 1 
ATOM   2584 N N   . GLY A 1 364 ? 53.122  46.874 -21.626 1.00 104.37 ? 363 GLY A N   1 
ATOM   2585 C CA  . GLY A 1 364 ? 53.910  47.976 -22.134 1.00 107.16 ? 363 GLY A CA  1 
ATOM   2586 C C   . GLY A 1 364 ? 53.387  49.361 -21.818 1.00 103.21 ? 363 GLY A C   1 
ATOM   2587 O O   . GLY A 1 364 ? 53.880  50.334 -22.401 1.00 104.69 ? 363 GLY A O   1 
ATOM   2588 N N   . THR A 1 365 ? 52.413  49.487 -20.920 1.00 100.90 ? 364 THR A N   1 
ATOM   2589 C CA  . THR A 1 365 ? 51.849  50.782 -20.567 1.00 96.59  ? 364 THR A CA  1 
ATOM   2590 C C   . THR A 1 365 ? 52.684  51.439 -19.474 1.00 99.00  ? 364 THR A C   1 
ATOM   2591 O O   . THR A 1 365 ? 52.983  50.817 -18.449 1.00 98.74  ? 364 THR A O   1 
ATOM   2592 C CB  . THR A 1 365 ? 50.399  50.639 -20.099 1.00 92.54  ? 364 THR A CB  1 
ATOM   2593 O OG1 . THR A 1 365 ? 50.311  49.609 -19.105 1.00 90.84  ? 364 THR A OG1 1 
ATOM   2594 C CG2 . THR A 1 365 ? 49.488  50.298 -21.270 1.00 90.55  ? 364 THR A CG2 1 
ATOM   2595 N N   . THR A 1 366 ? 53.056  52.694 -19.701 1.00 95.58  ? 365 THR A N   1 
ATOM   2596 C CA  . THR A 1 366 ? 53.766  53.527 -18.745 1.00 96.96  ? 365 THR A CA  1 
ATOM   2597 C C   . THR A 1 366 ? 52.775  54.328 -17.908 1.00 93.29  ? 365 THR A C   1 
ATOM   2598 O O   . THR A 1 366 ? 51.597  54.438 -18.262 1.00 89.26  ? 365 THR A O   1 
ATOM   2599 C CB  . THR A 1 366 ? 54.718  54.470 -19.480 1.00 104.06 ? 365 THR A CB  1 
ATOM   2600 O OG1 . THR A 1 366 ? 53.964  55.369 -20.303 1.00 101.96 ? 365 THR A OG1 1 
ATOM   2601 C CG2 . THR A 1 366 ? 55.679  53.678 -20.354 1.00 108.67 ? 365 THR A CG2 1 
ATOM   2602 N N   . PRO A 1 367 ? 53.211  54.883 -16.772 1.00 89.83  ? 366 PRO A N   1 
ATOM   2603 C CA  . PRO A 1 367 ? 52.300  55.739 -15.995 1.00 85.89  ? 366 PRO A CA  1 
ATOM   2604 C C   . PRO A 1 367 ? 51.742  56.905 -16.791 1.00 87.26  ? 366 PRO A C   1 
ATOM   2605 O O   . PRO A 1 367 ? 50.611  57.335 -16.531 1.00 83.80  ? 366 PRO A O   1 
ATOM   2606 C CB  . PRO A 1 367 ? 53.179  56.212 -14.831 1.00 88.81  ? 366 PRO A CB  1 
ATOM   2607 C CG  . PRO A 1 367 ? 54.164  55.112 -14.653 1.00 93.30  ? 366 PRO A CG  1 
ATOM   2608 C CD  . PRO A 1 367 ? 54.462  54.613 -16.041 1.00 94.52  ? 366 PRO A CD  1 
ATOM   2609 N N   . LEU A 1 368 ? 52.496  57.426 -17.763 1.00 94.70  ? 367 LEU A N   1 
ATOM   2610 C CA  . LEU A 1 368 ? 51.963  58.486 -18.611 1.00 95.08  ? 367 LEU A CA  1 
ATOM   2611 C C   . LEU A 1 368 ? 50.902  57.955 -19.568 1.00 93.48  ? 367 LEU A C   1 
ATOM   2612 O O   . LEU A 1 368 ? 49.972  58.687 -19.927 1.00 93.45  ? 367 LEU A O   1 
ATOM   2613 C CB  . LEU A 1 368 ? 53.095  59.159 -19.387 1.00 100.15 ? 367 LEU A CB  1 
ATOM   2614 C CG  . LEU A 1 368 ? 52.748  60.496 -20.043 1.00 103.01 ? 367 LEU A CG  1 
ATOM   2615 C CD1 . LEU A 1 368 ? 52.461  61.555 -18.986 1.00 103.26 ? 367 LEU A CD1 1 
ATOM   2616 C CD2 . LEU A 1 368 ? 53.863  60.947 -20.972 1.00 108.35 ? 367 LEU A CD2 1 
ATOM   2617 N N   . HIS A 1 369 ? 51.026  56.693 -19.993 1.00 96.48  ? 368 HIS A N   1 
ATOM   2618 C CA  . HIS A 1 369 ? 49.987  56.075 -20.813 1.00 95.79  ? 368 HIS A CA  1 
ATOM   2619 C C   . HIS A 1 369 ? 48.662  56.020 -20.064 1.00 93.85  ? 368 HIS A C   1 
ATOM   2620 O O   . HIS A 1 369 ? 47.612  56.392 -20.601 1.00 94.10  ? 368 HIS A O   1 
ATOM   2621 C CB  . HIS A 1 369 ? 50.416  54.666 -21.236 1.00 96.36  ? 368 HIS A CB  1 
ATOM   2622 C CG  . HIS A 1 369 ? 51.263  54.626 -22.471 1.00 101.45 ? 368 HIS A CG  1 
ATOM   2623 N ND1 . HIS A 1 369 ? 52.255  53.688 -22.660 1.00 105.05 ? 368 HIS A ND1 1 
ATOM   2624 C CD2 . HIS A 1 369 ? 51.253  55.392 -23.587 1.00 104.83 ? 368 HIS A CD2 1 
ATOM   2625 C CE1 . HIS A 1 369 ? 52.828  53.885 -23.834 1.00 108.48 ? 368 HIS A CE1 1 
ATOM   2626 N NE2 . HIS A 1 369 ? 52.238  54.912 -24.417 1.00 108.08 ? 368 HIS A NE2 1 
ATOM   2627 N N   . LEU A 1 370 ? 48.693  55.556 -18.812 1.00 93.09  ? 369 LEU A N   1 
ATOM   2628 C CA  . LEU A 1 370 ? 47.466  55.449 -18.030 1.00 90.44  ? 369 LEU A CA  1 
ATOM   2629 C C   . LEU A 1 370 ? 46.914  56.818 -17.657 1.00 92.46  ? 369 LEU A C   1 
ATOM   2630 O O   . LEU A 1 370 ? 45.692  56.996 -17.598 1.00 92.05  ? 369 LEU A O   1 
ATOM   2631 C CB  . LEU A 1 370 ? 47.721  54.618 -16.772 1.00 87.74  ? 369 LEU A CB  1 
ATOM   2632 C CG  . LEU A 1 370 ? 48.315  53.225 -16.997 1.00 88.75  ? 369 LEU A CG  1 
ATOM   2633 C CD1 . LEU A 1 370 ? 48.823  52.643 -15.689 1.00 86.93  ? 369 LEU A CD1 1 
ATOM   2634 C CD2 . LEU A 1 370 ? 47.292  52.298 -17.636 1.00 88.64  ? 369 LEU A CD2 1 
ATOM   2635 N N   . ALA A 1 371 ? 47.790  57.794 -17.409 1.00 88.74  ? 370 ALA A N   1 
ATOM   2636 C CA  . ALA A 1 371 ? 47.321  59.117 -17.013 1.00 89.93  ? 370 ALA A CA  1 
ATOM   2637 C C   . ALA A 1 371 ? 46.641  59.845 -18.165 1.00 93.76  ? 370 ALA A C   1 
ATOM   2638 O O   . ALA A 1 371 ? 45.679  60.590 -17.944 1.00 94.49  ? 370 ALA A O   1 
ATOM   2639 C CB  . ALA A 1 371 ? 48.484  59.946 -16.470 1.00 91.31  ? 370 ALA A CB  1 
ATOM   2640 N N   . ALA A 1 372 ? 47.116  59.643 -19.395 1.00 91.11  ? 371 ALA A N   1 
ATOM   2641 C CA  . ALA A 1 372 ? 46.501  60.297 -20.543 1.00 93.80  ? 371 ALA A CA  1 
ATOM   2642 C C   . ALA A 1 372 ? 45.179  59.648 -20.933 1.00 93.02  ? 371 ALA A C   1 
ATOM   2643 O O   . ALA A 1 372 ? 44.287  60.333 -21.446 1.00 94.70  ? 371 ALA A O   1 
ATOM   2644 C CB  . ALA A 1 372 ? 47.461  60.287 -21.734 1.00 96.72  ? 371 ALA A CB  1 
ATOM   2645 N N   . THR A 1 373 ? 45.035  58.340 -20.703 1.00 98.19  ? 372 THR A N   1 
ATOM   2646 C CA  . THR A 1 373 ? 43.792  57.660 -21.056 1.00 97.35  ? 372 THR A CA  1 
ATOM   2647 C C   . THR A 1 373 ? 42.653  58.082 -20.136 1.00 97.93  ? 372 THR A C   1 
ATOM   2648 O O   . THR A 1 373 ? 41.523  58.293 -20.593 1.00 99.06  ? 372 THR A O   1 
ATOM   2649 C CB  . THR A 1 373 ? 43.986  56.144 -21.003 1.00 97.65  ? 372 THR A CB  1 
ATOM   2650 O OG1 . THR A 1 373 ? 45.083  55.770 -21.846 1.00 98.93  ? 372 THR A OG1 1 
ATOM   2651 C CG2 . THR A 1 373 ? 42.728  55.427 -21.474 1.00 96.71  ? 372 THR A CG2 1 
ATOM   2652 N N   . MET A 1 374 ? 42.930  58.210 -18.837 1.00 93.92  ? 373 MET A N   1 
ATOM   2653 C CA  . MET A 1 374 ? 41.900  58.628 -17.894 1.00 93.96  ? 373 MET A CA  1 
ATOM   2654 C C   . MET A 1 374 ? 41.610  60.119 -18.009 1.00 98.41  ? 373 MET A C   1 
ATOM   2655 O O   . MET A 1 374 ? 40.445  60.531 -17.973 1.00 100.07 ? 373 MET A O   1 
ATOM   2656 C CB  . MET A 1 374 ? 42.323  58.270 -16.469 1.00 92.30  ? 373 MET A CB  1 
ATOM   2657 C CG  . MET A 1 374 ? 42.655  56.801 -16.283 1.00 90.44  ? 373 MET A CG  1 
ATOM   2658 S SD  . MET A 1 374 ? 41.267  55.728 -16.694 1.00 91.02  ? 373 MET A SD  1 
ATOM   2659 C CE  . MET A 1 374 ? 40.117  56.158 -15.391 1.00 90.26  ? 373 MET A CE  1 
ATOM   2660 N N   . GLY A 1 375 ? 42.648  60.938 -18.150 1.00 93.99  ? 374 GLY A N   1 
ATOM   2661 C CA  . GLY A 1 375 ? 42.460  62.364 -18.325 1.00 97.16  ? 374 GLY A CA  1 
ATOM   2662 C C   . GLY A 1 375 ? 42.855  63.206 -17.128 1.00 98.73  ? 374 GLY A C   1 
ATOM   2663 O O   . GLY A 1 375 ? 42.301  64.290 -16.924 1.00 101.30 ? 374 GLY A O   1 
ATOM   2664 N N   . HIS A 1 376 ? 43.813  62.730 -16.333 1.00 95.00  ? 375 HIS A N   1 
ATOM   2665 C CA  . HIS A 1 376 ? 44.270  63.454 -15.146 1.00 95.11  ? 375 HIS A CA  1 
ATOM   2666 C C   . HIS A 1 376 ? 45.302  64.488 -15.582 1.00 98.31  ? 375 HIS A C   1 
ATOM   2667 O O   . HIS A 1 376 ? 46.492  64.197 -15.711 1.00 97.75  ? 375 HIS A O   1 
ATOM   2668 C CB  . HIS A 1 376 ? 44.840  62.493 -14.111 1.00 92.04  ? 375 HIS A CB  1 
ATOM   2669 C CG  . HIS A 1 376 ? 43.895  61.401 -13.715 1.00 91.01  ? 375 HIS A CG  1 
ATOM   2670 N ND1 . HIS A 1 376 ? 42.680  61.651 -13.113 1.00 92.61  ? 375 HIS A ND1 1 
ATOM   2671 C CD2 . HIS A 1 376 ? 43.986  60.054 -13.831 1.00 88.81  ? 375 HIS A CD2 1 
ATOM   2672 C CE1 . HIS A 1 376 ? 42.063  60.507 -12.878 1.00 90.27  ? 375 HIS A CE1 1 
ATOM   2673 N NE2 . HIS A 1 376 ? 42.834  59.522 -13.303 1.00 87.94  ? 375 HIS A NE2 1 
ATOM   2674 N N   . LEU A 1 377 ? 44.830  65.717 -15.811 1.00 93.16  ? 376 LEU A N   1 
ATOM   2675 C CA  . LEU A 1 377 ? 45.704  66.774 -16.313 1.00 96.86  ? 376 LEU A CA  1 
ATOM   2676 C C   . LEU A 1 377 ? 46.829  67.083 -15.333 1.00 99.66  ? 376 LEU A C   1 
ATOM   2677 O O   . LEU A 1 377 ? 47.977  67.292 -15.742 1.00 101.10 ? 376 LEU A O   1 
ATOM   2678 C CB  . LEU A 1 377 ? 44.887  68.034 -16.596 1.00 100.70 ? 376 LEU A CB  1 
ATOM   2679 C CG  . LEU A 1 377 ? 45.677  69.277 -17.008 1.00 106.67 ? 376 LEU A CG  1 
ATOM   2680 C CD1 . LEU A 1 377 ? 46.251  69.109 -18.405 1.00 106.38 ? 376 LEU A CD1 1 
ATOM   2681 C CD2 . LEU A 1 377 ? 44.811  70.526 -16.919 1.00 111.68 ? 376 LEU A CD2 1 
ATOM   2682 N N   . GLU A 1 378 ? 46.518  67.114 -14.036 1.00 98.07  ? 377 GLU A N   1 
ATOM   2683 C CA  . GLU A 1 378 ? 47.525  67.467 -13.040 1.00 99.98  ? 377 GLU A CA  1 
ATOM   2684 C C   . GLU A 1 378 ? 48.639  66.427 -12.978 1.00 98.78  ? 377 GLU A C   1 
ATOM   2685 O O   . GLU A 1 378 ? 49.811  66.778 -12.796 1.00 101.28 ? 377 GLU A O   1 
ATOM   2686 C CB  . GLU A 1 378 ? 46.868  67.634 -11.670 1.00 100.62 ? 377 GLU A CB  1 
ATOM   2687 N N   . ILE A 1 379 ? 48.297  65.146 -13.133 1.00 98.20  ? 378 ILE A N   1 
ATOM   2688 C CA  . ILE A 1 379 ? 49.302  64.092 -13.021 1.00 96.29  ? 378 ILE A CA  1 
ATOM   2689 C C   . ILE A 1 379 ? 50.185  64.054 -14.263 1.00 99.08  ? 378 ILE A C   1 
ATOM   2690 O O   . ILE A 1 379 ? 51.402  63.846 -14.169 1.00 100.87 ? 378 ILE A O   1 
ATOM   2691 C CB  . ILE A 1 379 ? 48.630  62.730 -12.756 1.00 92.43  ? 378 ILE A CB  1 
ATOM   2692 C CG1 . ILE A 1 379 ? 48.157  62.629 -11.302 1.00 91.07  ? 378 ILE A CG1 1 
ATOM   2693 C CG2 . ILE A 1 379 ? 49.582  61.586 -13.075 1.00 91.32  ? 378 ILE A CG2 1 
ATOM   2694 C CD1 . ILE A 1 379 ? 46.797  63.244 -11.036 1.00 93.71  ? 378 ILE A CD1 1 
ATOM   2695 N N   . VAL A 1 380 ? 49.594  64.260 -15.444 1.00 94.87  ? 379 VAL A N   1 
ATOM   2696 C CA  . VAL A 1 380 ? 50.377  64.282 -16.678 1.00 96.74  ? 379 VAL A CA  1 
ATOM   2697 C C   . VAL A 1 380 ? 51.416  65.394 -16.631 1.00 102.35 ? 379 VAL A C   1 
ATOM   2698 O O   . VAL A 1 380 ? 52.536  65.242 -17.136 1.00 104.43 ? 379 VAL A O   1 
ATOM   2699 C CB  . VAL A 1 380 ? 49.450  64.426 -17.899 1.00 97.20  ? 379 VAL A CB  1 
ATOM   2700 C CG1 . VAL A 1 380 ? 50.262  64.564 -19.178 1.00 99.53  ? 379 VAL A CG1 1 
ATOM   2701 C CG2 . VAL A 1 380 ? 48.512  63.237 -17.995 1.00 92.82  ? 379 VAL A CG2 1 
ATOM   2702 N N   . GLU A 1 381 ? 51.064  66.527 -16.022 1.00 97.20  ? 380 GLU A N   1 
ATOM   2703 C CA  . GLU A 1 381 ? 52.019  67.622 -15.889 1.00 101.84 ? 380 GLU A CA  1 
ATOM   2704 C C   . GLU A 1 381 ? 53.203  67.213 -15.020 1.00 103.96 ? 380 GLU A C   1 
ATOM   2705 O O   . GLU A 1 381 ? 54.361  67.463 -15.372 1.00 107.07 ? 380 GLU A O   1 
ATOM   2706 C CB  . GLU A 1 381 ? 51.324  68.856 -15.312 1.00 104.58 ? 380 GLU A CB  1 
ATOM   2707 C CG  . GLU A 1 381 ? 50.304  69.492 -16.244 1.00 109.24 ? 380 GLU A CG  1 
ATOM   2708 C CD  . GLU A 1 381 ? 49.587  70.666 -15.604 1.00 118.79 ? 380 GLU A CD  1 
ATOM   2709 O OE1 . GLU A 1 381 ? 49.779  70.885 -14.389 1.00 114.95 ? 380 GLU A OE1 1 
ATOM   2710 O OE2 . GLU A 1 381 ? 48.835  71.368 -16.313 1.00 121.56 ? 380 GLU A OE2 1 
ATOM   2711 N N   . VAL A 1 382 ? 52.930  66.562 -13.888 1.00 96.55  ? 381 VAL A N   1 
ATOM   2712 C CA  . VAL A 1 382 ? 53.997  66.209 -12.955 1.00 98.01  ? 381 VAL A CA  1 
ATOM   2713 C C   . VAL A 1 382 ? 54.882  65.110 -13.532 1.00 98.80  ? 381 VAL A C   1 
ATOM   2714 O O   . VAL A 1 382 ? 56.107  65.130 -13.361 1.00 102.43 ? 381 VAL A O   1 
ATOM   2715 C CB  . VAL A 1 382 ? 53.400  65.800 -11.596 1.00 96.31  ? 381 VAL A CB  1 
ATOM   2716 C CG1 . VAL A 1 382 ? 54.502  65.401 -10.627 1.00 97.64  ? 381 VAL A CG1 1 
ATOM   2717 C CG2 . VAL A 1 382 ? 52.566  66.935 -11.024 1.00 97.54  ? 381 VAL A CG2 1 
ATOM   2718 N N   . LEU A 1 383 ? 54.282  64.136 -14.221 1.00 95.96  ? 382 LEU A N   1 
ATOM   2719 C CA  . LEU A 1 383 ? 55.059  63.033 -14.781 1.00 96.48  ? 382 LEU A CA  1 
ATOM   2720 C C   . LEU A 1 383 ? 56.071  63.534 -15.803 1.00 101.18 ? 382 LEU A C   1 
ATOM   2721 O O   . LEU A 1 383 ? 57.238  63.125 -15.794 1.00 104.25 ? 382 LEU A O   1 
ATOM   2722 C CB  . LEU A 1 383 ? 54.126  62.001 -15.415 1.00 91.75  ? 382 LEU A CB  1 
ATOM   2723 C CG  . LEU A 1 383 ? 53.292  61.144 -14.466 1.00 87.22  ? 382 LEU A CG  1 
ATOM   2724 C CD1 . LEU A 1 383 ? 52.332  60.272 -15.255 1.00 85.61  ? 382 LEU A CD1 1 
ATOM   2725 C CD2 . LEU A 1 383 ? 54.197  60.293 -13.590 1.00 88.87  ? 382 LEU A CD2 1 
ATOM   2726 N N   . LEU A 1 384 ? 55.639  64.425 -16.697 1.00 96.01  ? 383 LEU A N   1 
ATOM   2727 C CA  . LEU A 1 384 ? 56.546  64.943 -17.714 1.00 100.15 ? 383 LEU A CA  1 
ATOM   2728 C C   . LEU A 1 384 ? 57.626  65.830 -17.108 1.00 105.15 ? 383 LEU A C   1 
ATOM   2729 O O   . LEU A 1 384 ? 58.711  65.962 -17.686 1.00 108.49 ? 383 LEU A O   1 
ATOM   2730 C CB  . LEU A 1 384 ? 55.754  65.701 -18.777 1.00 99.74  ? 383 LEU A CB  1 
ATOM   2731 C CG  . LEU A 1 384 ? 54.895  64.812 -19.677 1.00 98.11  ? 383 LEU A CG  1 
ATOM   2732 C CD1 . LEU A 1 384 ? 53.781  65.615 -20.320 1.00 99.05  ? 383 LEU A CD1 1 
ATOM   2733 C CD2 . LEU A 1 384 ? 55.758  64.147 -20.739 1.00 100.75 ? 383 LEU A CD2 1 
ATOM   2734 N N   . LYS A 1 385 ? 57.357  66.438 -15.949 1.00 100.14 ? 384 LYS A N   1 
ATOM   2735 C CA  . LYS A 1 385 ? 58.380  67.242 -15.287 1.00 104.32 ? 384 LYS A CA  1 
ATOM   2736 C C   . LYS A 1 385 ? 59.514  66.379 -14.750 1.00 107.50 ? 384 LYS A C   1 
ATOM   2737 O O   . LYS A 1 385 ? 60.643  66.861 -14.608 1.00 111.20 ? 384 LYS A O   1 
ATOM   2738 C CB  . LYS A 1 385 ? 57.763  68.061 -14.153 1.00 104.79 ? 384 LYS A CB  1 
ATOM   2739 C CG  . LYS A 1 385 ? 56.862  69.194 -14.613 1.00 109.05 ? 384 LYS A CG  1 
ATOM   2740 C CD  . LYS A 1 385 ? 56.035  69.743 -13.458 1.00 111.43 ? 384 LYS A CD  1 
ATOM   2741 C CE  . LYS A 1 385 ? 54.993  70.738 -13.949 1.00 114.73 ? 384 LYS A CE  1 
ATOM   2742 N NZ  . LYS A 1 385 ? 54.105  71.216 -12.853 1.00 117.07 ? 384 LYS A NZ  1 
ATOM   2743 N N   . TYR A 1 386 ? 59.238  65.113 -14.445 1.00 96.42  ? 385 TYR A N   1 
ATOM   2744 C CA  . TYR A 1 386 ? 60.254  64.201 -13.939 1.00 97.98  ? 385 TYR A CA  1 
ATOM   2745 C C   . TYR A 1 386 ? 60.900  63.363 -15.033 1.00 98.20  ? 385 TYR A C   1 
ATOM   2746 O O   . TYR A 1 386 ? 61.776  62.545 -14.731 1.00 99.13  ? 385 TYR A O   1 
ATOM   2747 C CB  . TYR A 1 386 ? 59.655  63.289 -12.864 1.00 94.78  ? 385 TYR A CB  1 
ATOM   2748 C CG  . TYR A 1 386 ? 59.517  63.962 -11.517 1.00 95.46  ? 385 TYR A CG  1 
ATOM   2749 C CD1 . TYR A 1 386 ? 58.416  64.754 -11.224 1.00 92.71  ? 385 TYR A CD1 1 
ATOM   2750 C CD2 . TYR A 1 386 ? 60.493  63.810 -10.540 1.00 98.68  ? 385 TYR A CD2 1 
ATOM   2751 C CE1 . TYR A 1 386 ? 58.288  65.374 -9.994  1.00 92.87  ? 385 TYR A CE1 1 
ATOM   2752 C CE2 . TYR A 1 386 ? 60.374  64.425 -9.308  1.00 98.82  ? 385 TYR A CE2 1 
ATOM   2753 C CZ  . TYR A 1 386 ? 59.270  65.206 -9.041  1.00 95.70  ? 385 TYR A CZ  1 
ATOM   2754 O OH  . TYR A 1 386 ? 59.147  65.821 -7.816  1.00 95.54  ? 385 TYR A OH  1 
ATOM   2755 N N   . GLY A 1 387 ? 60.497  63.544 -16.288 1.00 105.46 ? 386 GLY A N   1 
ATOM   2756 C CA  . GLY A 1 387 ? 61.169  62.892 -17.395 1.00 106.76 ? 386 GLY A CA  1 
ATOM   2757 C C   . GLY A 1 387 ? 60.420  61.720 -17.992 1.00 104.81 ? 386 GLY A C   1 
ATOM   2758 O O   . GLY A 1 387 ? 61.029  60.701 -18.333 1.00 105.67 ? 386 GLY A O   1 
ATOM   2759 N N   . ALA A 1 388 ? 59.104  61.846 -18.128 1.00 106.93 ? 387 ALA A N   1 
ATOM   2760 C CA  . ALA A 1 388 ? 58.318  60.791 -18.751 1.00 103.56 ? 387 ALA A CA  1 
ATOM   2761 C C   . ALA A 1 388 ? 58.572  60.759 -20.253 1.00 106.37 ? 387 ALA A C   1 
ATOM   2762 O O   . ALA A 1 388 ? 58.726  61.802 -20.897 1.00 108.03 ? 387 ALA A O   1 
ATOM   2763 C CB  . ALA A 1 388 ? 56.830  60.999 -18.471 1.00 98.98  ? 387 ALA A CB  1 
ATOM   2764 N N   . ASP A 1 389 ? 58.622  59.551 -20.812 1.00 107.15 ? 388 ASP A N   1 
ATOM   2765 C CA  . ASP A 1 389 ? 58.857  59.386 -22.244 1.00 108.68 ? 388 ASP A CA  1 
ATOM   2766 C C   . ASP A 1 389 ? 57.587  59.752 -23.003 1.00 106.71 ? 388 ASP A C   1 
ATOM   2767 O O   . ASP A 1 389 ? 56.594  59.018 -22.960 1.00 102.93 ? 388 ASP A O   1 
ATOM   2768 C CB  . ASP A 1 389 ? 59.289  57.956 -22.554 1.00 110.30 ? 388 ASP A CB  1 
ATOM   2769 C CG  . ASP A 1 389 ? 59.791  57.794 -23.976 1.00 115.96 ? 388 ASP A CG  1 
ATOM   2770 O OD1 . ASP A 1 389 ? 59.922  58.813 -24.683 1.00 117.41 ? 388 ASP A OD1 1 
ATOM   2771 O OD2 . ASP A 1 389 ? 60.056  56.645 -24.388 1.00 118.91 ? 388 ASP A OD2 1 
ATOM   2772 N N   . VAL A 1 390 ? 57.618  60.885 -23.708 1.00 106.08 ? 389 VAL A N   1 
ATOM   2773 C CA  . VAL A 1 390 ? 56.428  61.363 -24.399 1.00 106.12 ? 389 VAL A CA  1 
ATOM   2774 C C   . VAL A 1 390 ? 56.134  60.541 -25.650 1.00 107.50 ? 389 VAL A C   1 
ATOM   2775 O O   . VAL A 1 390 ? 55.015  60.591 -26.174 1.00 106.82 ? 389 VAL A O   1 
ATOM   2776 C CB  . VAL A 1 390 ? 56.587  62.862 -24.725 1.00 109.84 ? 389 VAL A CB  1 
ATOM   2777 C CG1 . VAL A 1 390 ? 57.660  63.072 -25.781 1.00 115.42 ? 389 VAL A CG1 1 
ATOM   2778 C CG2 . VAL A 1 390 ? 55.258  63.481 -25.148 1.00 109.39 ? 389 VAL A CG2 1 
ATOM   2779 N N   . ASN A 1 391 ? 57.104  59.760 -26.133 1.00 111.25 ? 390 ASN A N   1 
ATOM   2780 C CA  . ASN A 1 391 ? 56.931  58.960 -27.342 1.00 112.85 ? 390 ASN A CA  1 
ATOM   2781 C C   . ASN A 1 391 ? 57.027  57.461 -27.069 1.00 112.60 ? 390 ASN A C   1 
ATOM   2782 O O   . ASN A 1 391 ? 57.318  56.686 -27.986 1.00 114.81 ? 390 ASN A O   1 
ATOM   2783 C CB  . ASN A 1 391 ? 57.955  59.369 -28.405 1.00 118.70 ? 390 ASN A CB  1 
ATOM   2784 C CG  . ASN A 1 391 ? 57.862  60.840 -28.773 1.00 128.59 ? 390 ASN A CG  1 
ATOM   2785 O OD1 . ASN A 1 391 ? 56.871  61.287 -29.350 1.00 126.50 ? 390 ASN A OD1 1 
ATOM   2786 N ND2 . ASN A 1 391 ? 58.906  61.598 -28.452 1.00 128.71 ? 390 ASN A ND2 1 
ATOM   2787 N N   . ALA A 1 392 ? 56.789  57.033 -25.831 1.00 113.88 ? 391 ALA A N   1 
ATOM   2788 C CA  . ALA A 1 392 ? 56.820  55.611 -25.516 1.00 113.72 ? 391 ALA A CA  1 
ATOM   2789 C C   . ALA A 1 392 ? 55.593  54.910 -26.088 1.00 111.94 ? 391 ALA A C   1 
ATOM   2790 O O   . ALA A 1 392 ? 54.518  55.500 -26.223 1.00 108.59 ? 391 ALA A O   1 
ATOM   2791 C CB  . ALA A 1 392 ? 56.890  55.396 -24.005 1.00 112.47 ? 391 ALA A CB  1 
ATOM   2792 N N   . TYR A 1 393 ? 55.761  53.634 -26.424 1.00 110.67 ? 392 TYR A N   1 
ATOM   2793 C CA  . TYR A 1 393 ? 54.699  52.854 -27.040 1.00 108.67 ? 392 TYR A CA  1 
ATOM   2794 C C   . TYR A 1 393 ? 54.529  51.533 -26.304 1.00 108.99 ? 392 TYR A C   1 
ATOM   2795 O O   . TYR A 1 393 ? 55.463  51.025 -25.677 1.00 111.86 ? 392 TYR A O   1 
ATOM   2796 C CB  . TYR A 1 393 ? 54.982  52.600 -28.530 1.00 112.40 ? 392 TYR A CB  1 
ATOM   2797 C CG  . TYR A 1 393 ? 56.201  51.745 -28.798 1.00 117.04 ? 392 TYR A CG  1 
ATOM   2798 C CD1 . TYR A 1 393 ? 57.475  52.299 -28.811 1.00 121.10 ? 392 TYR A CD1 1 
ATOM   2799 C CD2 . TYR A 1 393 ? 56.075  50.386 -29.051 1.00 118.73 ? 392 TYR A CD2 1 
ATOM   2800 C CE1 . TYR A 1 393 ? 58.589  51.520 -29.059 1.00 125.71 ? 392 TYR A CE1 1 
ATOM   2801 C CE2 . TYR A 1 393 ? 57.182  49.600 -29.299 1.00 123.70 ? 392 TYR A CE2 1 
ATOM   2802 C CZ  . TYR A 1 393 ? 58.436  50.171 -29.303 1.00 128.94 ? 392 TYR A CZ  1 
ATOM   2803 O OH  . TYR A 1 393 ? 59.539  49.388 -29.552 1.00 133.07 ? 392 TYR A OH  1 
ATOM   2804 N N   . ASP A 1 394 ? 53.323  50.985 -26.388 1.00 109.70 ? 393 ASP A N   1 
ATOM   2805 C CA  . ASP A 1 394 ? 52.971  49.722 -25.764 1.00 109.16 ? 393 ASP A CA  1 
ATOM   2806 C C   . ASP A 1 394 ? 52.945  48.617 -26.824 1.00 113.95 ? 393 ASP A C   1 
ATOM   2807 O O   . ASP A 1 394 ? 53.483  48.782 -27.926 1.00 117.07 ? 393 ASP A O   1 
ATOM   2808 C CB  . ASP A 1 394 ? 51.631  49.878 -25.034 1.00 103.34 ? 393 ASP A CB  1 
ATOM   2809 C CG  . ASP A 1 394 ? 50.571  50.537 -25.896 1.00 103.46 ? 393 ASP A CG  1 
ATOM   2810 O OD1 . ASP A 1 394 ? 50.172  49.938 -26.917 1.00 104.85 ? 393 ASP A OD1 1 
ATOM   2811 O OD2 . ASP A 1 394 ? 50.135  51.656 -25.552 1.00 103.88 ? 393 ASP A OD2 1 
ATOM   2812 N N   . LEU A 1 395 ? 52.317  47.483 -26.500 1.00 99.98  ? 394 LEU A N   1 
ATOM   2813 C CA  . LEU A 1 395 ? 52.250  46.373 -27.445 1.00 103.68 ? 394 LEU A CA  1 
ATOM   2814 C C   . LEU A 1 395 ? 51.311  46.653 -28.610 1.00 103.15 ? 394 LEU A C   1 
ATOM   2815 O O   . LEU A 1 395 ? 51.412  45.982 -29.643 1.00 106.73 ? 394 LEU A O   1 
ATOM   2816 C CB  . LEU A 1 395 ? 51.830  45.092 -26.724 1.00 103.78 ? 394 LEU A CB  1 
ATOM   2817 C CG  . LEU A 1 395 ? 52.975  44.307 -26.082 1.00 110.95 ? 394 LEU A CG  1 
ATOM   2818 C CD1 . LEU A 1 395 ? 52.445  43.156 -25.245 1.00 109.63 ? 394 LEU A CD1 1 
ATOM   2819 C CD2 . LEU A 1 395 ? 53.927  43.797 -27.151 1.00 118.41 ? 394 LEU A CD2 1 
ATOM   2820 N N   . ASN A 1 396 ? 50.402  47.615 -28.471 1.00 111.74 ? 395 ASN A N   1 
ATOM   2821 C CA  . ASN A 1 396 ? 49.572  48.060 -29.582 1.00 110.40 ? 395 ASN A CA  1 
ATOM   2822 C C   . ASN A 1 396 ? 50.221  49.176 -30.386 1.00 114.94 ? 395 ASN A C   1 
ATOM   2823 O O   . ASN A 1 396 ? 49.624  49.645 -31.361 1.00 116.12 ? 395 ASN A O   1 
ATOM   2824 C CB  . ASN A 1 396 ? 48.205  48.526 -29.074 1.00 106.48 ? 395 ASN A CB  1 
ATOM   2825 C CG  . ASN A 1 396 ? 47.321  47.378 -28.645 1.00 110.30 ? 395 ASN A CG  1 
ATOM   2826 O OD1 . ASN A 1 396 ? 46.939  47.277 -27.480 1.00 105.26 ? 395 ASN A OD1 1 
ATOM   2827 N ND2 . ASN A 1 396 ? 46.989  46.503 -29.588 1.00 108.74 ? 395 ASN A ND2 1 
ATOM   2828 N N   . GLY A 1 397 ? 51.420  49.609 -30.004 1.00 114.67 ? 396 GLY A N   1 
ATOM   2829 C CA  . GLY A 1 397 ? 52.079  50.698 -30.694 1.00 117.78 ? 396 GLY A CA  1 
ATOM   2830 C C   . GLY A 1 397 ? 51.497  52.063 -30.415 1.00 117.46 ? 396 GLY A C   1 
ATOM   2831 O O   . GLY A 1 397 ? 51.699  52.986 -31.208 1.00 119.98 ? 396 GLY A O   1 
ATOM   2832 N N   . ALA A 1 398 ? 50.785  52.223 -29.303 1.00 113.47 ? 397 ALA A N   1 
ATOM   2833 C CA  . ALA A 1 398 ? 50.105  53.469 -28.981 1.00 113.08 ? 397 ALA A CA  1 
ATOM   2834 C C   . ALA A 1 398 ? 50.980  54.328 -28.079 1.00 112.65 ? 397 ALA A C   1 
ATOM   2835 O O   . ALA A 1 398 ? 51.504  53.847 -27.068 1.00 110.02 ? 397 ALA A O   1 
ATOM   2836 C CB  . ALA A 1 398 ? 48.761  53.196 -28.305 1.00 109.41 ? 397 ALA A CB  1 
ATOM   2837 N N   . THR A 1 399 ? 51.136  55.589 -28.451 1.00 112.45 ? 398 THR A N   1 
ATOM   2838 C CA  . THR A 1 399 ? 51.813  56.581 -27.628 1.00 112.37 ? 398 THR A CA  1 
ATOM   2839 C C   . THR A 1 399 ? 50.804  57.274 -26.727 1.00 110.59 ? 398 THR A C   1 
ATOM   2840 O O   . THR A 1 399 ? 49.591  57.128 -26.903 1.00 108.97 ? 398 THR A O   1 
ATOM   2841 C CB  . THR A 1 399 ? 52.535  57.584 -28.527 1.00 118.94 ? 398 THR A CB  1 
ATOM   2842 O OG1 . THR A 1 399 ? 51.593  58.199 -29.415 1.00 119.73 ? 398 THR A OG1 1 
ATOM   2843 C CG2 . THR A 1 399 ? 53.613  56.886 -29.342 1.00 122.04 ? 398 THR A CG2 1 
ATOM   2844 N N   . PRO A 1 400 ? 51.265  58.028 -25.721 1.00 108.62 ? 399 PRO A N   1 
ATOM   2845 C CA  . PRO A 1 400 ? 50.310  58.801 -24.910 1.00 106.32 ? 399 PRO A CA  1 
ATOM   2846 C C   . PRO A 1 400 ? 49.459  59.749 -25.734 1.00 109.48 ? 399 PRO A C   1 
ATOM   2847 O O   . PRO A 1 400 ? 48.326  60.055 -25.342 1.00 107.75 ? 399 PRO A O   1 
ATOM   2848 C CB  . PRO A 1 400 ? 51.218  59.557 -23.930 1.00 106.90 ? 399 PRO A CB  1 
ATOM   2849 C CG  . PRO A 1 400 ? 52.417  58.693 -23.804 1.00 108.84 ? 399 PRO A CG  1 
ATOM   2850 C CD  . PRO A 1 400 ? 52.631  58.102 -25.169 1.00 110.05 ? 399 PRO A CD  1 
ATOM   2851 N N   . LEU A 1 401 ? 49.971  60.219 -26.873 1.00 112.21 ? 400 LEU A N   1 
ATOM   2852 C CA  . LEU A 1 401 ? 49.162  61.043 -27.761 1.00 114.30 ? 400 LEU A CA  1 
ATOM   2853 C C   . LEU A 1 401 ? 48.105  60.214 -28.481 1.00 115.03 ? 400 LEU A C   1 
ATOM   2854 O O   . LEU A 1 401 ? 47.014  60.721 -28.771 1.00 115.25 ? 400 LEU A O   1 
ATOM   2855 C CB  . LEU A 1 401 ? 50.060  61.762 -28.768 1.00 118.73 ? 400 LEU A CB  1 
ATOM   2856 C CG  . LEU A 1 401 ? 49.496  63.022 -29.425 1.00 122.82 ? 400 LEU A CG  1 
ATOM   2857 C CD1 . LEU A 1 401 ? 49.328  64.130 -28.396 1.00 121.91 ? 400 LEU A CD1 1 
ATOM   2858 C CD2 . LEU A 1 401 ? 50.390  63.475 -30.566 1.00 128.18 ? 400 LEU A CD2 1 
ATOM   2859 N N   . HIS A 1 402 ? 48.405  58.945 -28.776 1.00 119.55 ? 401 HIS A N   1 
ATOM   2860 C CA  . HIS A 1 402 ? 47.416  58.076 -29.409 1.00 118.91 ? 401 HIS A CA  1 
ATOM   2861 C C   . HIS A 1 402 ? 46.235  57.814 -28.484 1.00 116.52 ? 401 HIS A C   1 
ATOM   2862 O O   . HIS A 1 402 ? 45.079  57.818 -28.925 1.00 116.34 ? 401 HIS A O   1 
ATOM   2863 C CB  . HIS A 1 402 ? 48.061  56.753 -29.827 1.00 119.62 ? 401 HIS A CB  1 
ATOM   2864 C CG  . HIS A 1 402 ? 48.711  56.791 -31.175 1.00 124.95 ? 401 HIS A CG  1 
ATOM   2865 N ND1 . HIS A 1 402 ? 49.990  57.266 -31.373 1.00 128.39 ? 401 HIS A ND1 1 
ATOM   2866 C CD2 . HIS A 1 402 ? 48.260  56.407 -32.392 1.00 127.65 ? 401 HIS A CD2 1 
ATOM   2867 C CE1 . HIS A 1 402 ? 50.297  57.176 -32.655 1.00 131.95 ? 401 HIS A CE1 1 
ATOM   2868 N NE2 . HIS A 1 402 ? 49.265  56.658 -33.295 1.00 131.66 ? 401 HIS A NE2 1 
ATOM   2869 N N   . LEU A 1 403 ? 46.506  57.580 -27.199 1.00 115.06 ? 402 LEU A N   1 
ATOM   2870 C CA  . LEU A 1 403 ? 45.435  57.272 -26.259 1.00 111.85 ? 402 LEU A CA  1 
ATOM   2871 C C   . LEU A 1 403 ? 44.623  58.511 -25.903 1.00 113.55 ? 402 LEU A C   1 
ATOM   2872 O O   . LEU A 1 403 ? 43.399  58.430 -25.754 1.00 112.48 ? 402 LEU A O   1 
ATOM   2873 C CB  . LEU A 1 403 ? 46.016  56.633 -24.999 1.00 109.05 ? 402 LEU A CB  1 
ATOM   2874 C CG  . LEU A 1 403 ? 46.764  55.318 -25.220 1.00 110.33 ? 402 LEU A CG  1 
ATOM   2875 C CD1 . LEU A 1 403 ? 47.455  54.877 -23.942 1.00 108.10 ? 402 LEU A CD1 1 
ATOM   2876 C CD2 . LEU A 1 403 ? 45.814  54.239 -25.720 1.00 110.41 ? 402 LEU A CD2 1 
ATOM   2877 N N   . ALA A 1 404 ? 45.285  59.663 -25.762 1.00 109.67 ? 403 ALA A N   1 
ATOM   2878 C CA  . ALA A 1 404 ? 44.566  60.886 -25.422 1.00 110.64 ? 403 ALA A CA  1 
ATOM   2879 C C   . ALA A 1 404 ? 43.620  61.310 -26.536 1.00 114.29 ? 403 ALA A C   1 
ATOM   2880 O O   . ALA A 1 404 ? 42.562  61.890 -26.266 1.00 114.55 ? 403 ALA A O   1 
ATOM   2881 C CB  . ALA A 1 404 ? 45.556  62.008 -25.108 1.00 112.48 ? 403 ALA A CB  1 
ATOM   2882 N N   . ALA A 1 405 ? 43.978  61.028 -27.789 1.00 116.31 ? 404 ALA A N   1 
ATOM   2883 C CA  . ALA A 1 405 ? 43.107  61.365 -28.907 1.00 118.64 ? 404 ALA A CA  1 
ATOM   2884 C C   . ALA A 1 405 ? 41.935  60.400 -29.030 1.00 118.20 ? 404 ALA A C   1 
ATOM   2885 O O   . ALA A 1 405 ? 40.845  60.809 -29.445 1.00 119.40 ? 404 ALA A O   1 
ATOM   2886 C CB  . ALA A 1 405 ? 43.907  61.388 -30.210 1.00 121.99 ? 404 ALA A CB  1 
ATOM   2887 N N   . ARG A 1 406 ? 42.134  59.127 -28.679 1.00 121.24 ? 405 ARG A N   1 
ATOM   2888 C CA  . ARG A 1 406 ? 41.044  58.162 -28.779 1.00 119.70 ? 405 ARG A CA  1 
ATOM   2889 C C   . ARG A 1 406 ? 40.003  58.393 -27.691 1.00 119.14 ? 405 ARG A C   1 
ATOM   2890 O O   . ARG A 1 406 ? 38.801  58.220 -27.926 1.00 119.19 ? 405 ARG A O   1 
ATOM   2891 C CB  . ARG A 1 406 ? 41.590  56.737 -28.707 1.00 117.87 ? 405 ARG A CB  1 
ATOM   2892 C CG  . ARG A 1 406 ? 40.626  55.687 -29.236 1.00 120.69 ? 405 ARG A CG  1 
ATOM   2893 C CD  . ARG A 1 406 ? 41.139  54.281 -28.982 1.00 122.17 ? 405 ARG A CD  1 
ATOM   2894 N NE  . ARG A 1 406 ? 41.052  53.914 -27.571 1.00 121.86 ? 405 ARG A NE  1 
ATOM   2895 C CZ  . ARG A 1 406 ? 40.008  53.300 -27.022 1.00 124.14 ? 405 ARG A CZ  1 
ATOM   2896 N NH1 . ARG A 1 406 ? 38.958  52.981 -27.766 1.00 121.01 ? 405 ARG A NH1 1 
ATOM   2897 N NH2 . ARG A 1 406 ? 40.014  53.002 -25.728 1.00 116.93 ? 405 ARG A NH2 1 
ATOM   2898 N N   . MET A 1 407 ? 40.445  58.780 -26.493 1.00 113.44 ? 406 MET A N   1 
ATOM   2899 C CA  . MET A 1 407 ? 39.511  59.113 -25.425 1.00 112.48 ? 406 MET A CA  1 
ATOM   2900 C C   . MET A 1 407 ? 38.999  60.542 -25.544 1.00 116.51 ? 406 MET A C   1 
ATOM   2901 O O   . MET A 1 407 ? 37.896  60.841 -25.074 1.00 116.96 ? 406 MET A O   1 
ATOM   2902 C CB  . MET A 1 407 ? 40.170  58.904 -24.060 1.00 110.72 ? 406 MET A CB  1 
ATOM   2903 C CG  . MET A 1 407 ? 40.529  57.457 -23.751 1.00 108.75 ? 406 MET A CG  1 
ATOM   2904 S SD  . MET A 1 407 ? 39.096  56.434 -23.358 1.00 108.13 ? 406 MET A SD  1 
ATOM   2905 C CE  . MET A 1 407 ? 38.537  57.198 -21.836 1.00 106.74 ? 406 MET A CE  1 
ATOM   2906 N N   . GLY A 1 408 ? 39.776  61.431 -26.159 1.00 107.81 ? 407 GLY A N   1 
ATOM   2907 C CA  . GLY A 1 408 ? 39.338  62.795 -26.377 1.00 110.58 ? 407 GLY A CA  1 
ATOM   2908 C C   . GLY A 1 408 ? 39.648  63.736 -25.231 1.00 111.42 ? 407 GLY A C   1 
ATOM   2909 O O   . GLY A 1 408 ? 38.738  64.203 -24.539 1.00 111.85 ? 407 GLY A O   1 
ATOM   2910 N N   . HIS A 1 409 ? 40.930  64.023 -25.020 1.00 108.56 ? 408 HIS A N   1 
ATOM   2911 C CA  . HIS A 1 409 ? 41.374  64.965 -23.997 1.00 108.89 ? 408 HIS A CA  1 
ATOM   2912 C C   . HIS A 1 409 ? 42.227  66.028 -24.674 1.00 112.73 ? 408 HIS A C   1 
ATOM   2913 O O   . HIS A 1 409 ? 43.376  65.766 -25.044 1.00 112.39 ? 408 HIS A O   1 
ATOM   2914 C CB  . HIS A 1 409 ? 42.149  64.254 -22.890 1.00 106.07 ? 408 HIS A CB  1 
ATOM   2915 C CG  . HIS A 1 409 ? 41.322  63.283 -22.107 1.00 104.61 ? 408 HIS A CG  1 
ATOM   2916 N ND1 . HIS A 1 409 ? 41.435  61.918 -22.257 1.00 102.69 ? 408 HIS A ND1 1 
ATOM   2917 C CD2 . HIS A 1 409 ? 40.361  63.482 -21.175 1.00 104.84 ? 408 HIS A CD2 1 
ATOM   2918 C CE1 . HIS A 1 409 ? 40.583  61.317 -21.445 1.00 100.51 ? 408 HIS A CE1 1 
ATOM   2919 N NE2 . HIS A 1 409 ? 39.918  62.243 -20.778 1.00 102.00 ? 408 HIS A NE2 1 
ATOM   2920 N N   . VAL A 1 410 ? 41.665  67.228 -24.829 1.00 109.28 ? 409 VAL A N   1 
ATOM   2921 C CA  . VAL A 1 410 ? 42.350  68.278 -25.575 1.00 113.14 ? 409 VAL A CA  1 
ATOM   2922 C C   . VAL A 1 410 ? 43.444  68.930 -24.736 1.00 112.65 ? 409 VAL A C   1 
ATOM   2923 O O   . VAL A 1 410 ? 44.518  69.258 -25.252 1.00 114.97 ? 409 VAL A O   1 
ATOM   2924 C CB  . VAL A 1 410 ? 41.330  69.312 -26.088 1.00 116.37 ? 409 VAL A CB  1 
ATOM   2925 C CG1 . VAL A 1 410 ? 40.551  68.747 -27.263 1.00 118.22 ? 409 VAL A CG1 1 
ATOM   2926 C CG2 . VAL A 1 410 ? 40.377  69.719 -24.976 1.00 114.56 ? 409 VAL A CG2 1 
ATOM   2927 N N   . GLU A 1 411 ? 43.201  69.125 -23.437 1.00 113.08 ? 410 GLU A N   1 
ATOM   2928 C CA  . GLU A 1 411 ? 44.176  69.823 -22.603 1.00 113.33 ? 410 GLU A CA  1 
ATOM   2929 C C   . GLU A 1 411 ? 45.458  69.014 -22.446 1.00 112.53 ? 410 GLU A C   1 
ATOM   2930 O O   . GLU A 1 411 ? 46.556  69.582 -22.417 1.00 113.63 ? 410 GLU A O   1 
ATOM   2931 C CB  . GLU A 1 411 ? 43.575  70.143 -21.233 1.00 113.10 ? 410 GLU A CB  1 
ATOM   2932 C CG  . GLU A 1 411 ? 42.604  71.316 -21.228 1.00 119.22 ? 410 GLU A CG  1 
ATOM   2933 C CD  . GLU A 1 411 ? 41.245  70.957 -21.794 1.00 126.12 ? 410 GLU A CD  1 
ATOM   2934 O OE1 . GLU A 1 411 ? 40.878  69.764 -21.748 1.00 121.94 ? 410 GLU A OE1 1 
ATOM   2935 O OE2 . GLU A 1 411 ? 40.544  71.867 -22.287 1.00 126.89 ? 410 GLU A OE2 1 
ATOM   2936 N N   . ILE A 1 412 ? 45.341  67.690 -22.346 1.00 111.43 ? 411 ILE A N   1 
ATOM   2937 C CA  . ILE A 1 412 ? 46.520  66.848 -22.167 1.00 109.40 ? 411 ILE A CA  1 
ATOM   2938 C C   . ILE A 1 412 ? 47.310  66.738 -23.466 1.00 112.62 ? 411 ILE A C   1 
ATOM   2939 O O   . ILE A 1 412 ? 48.546  66.691 -23.450 1.00 112.98 ? 411 ILE A O   1 
ATOM   2940 C CB  . ILE A 1 412 ? 46.101  65.469 -21.627 1.00 106.71 ? 411 ILE A CB  1 
ATOM   2941 C CG1 . ILE A 1 412 ? 45.455  65.628 -20.249 1.00 105.21 ? 411 ILE A CG1 1 
ATOM   2942 C CG2 . ILE A 1 412 ? 47.294  64.526 -21.557 1.00 105.03 ? 411 ILE A CG2 1 
ATOM   2943 C CD1 . ILE A 1 412 ? 45.208  64.324 -19.538 1.00 105.09 ? 411 ILE A CD1 1 
ATOM   2944 N N   . VAL A 1 413 ? 46.617  66.699 -24.608 1.00 108.24 ? 412 VAL A N   1 
ATOM   2945 C CA  . VAL A 1 413 ? 47.307  66.739 -25.896 1.00 110.84 ? 412 VAL A CA  1 
ATOM   2946 C C   . VAL A 1 413 ? 48.108  68.026 -26.029 1.00 115.32 ? 412 VAL A C   1 
ATOM   2947 O O   . VAL A 1 413 ? 49.187  68.040 -26.636 1.00 117.21 ? 412 VAL A O   1 
ATOM   2948 C CB  . VAL A 1 413 ? 46.294  66.570 -27.047 1.00 113.37 ? 412 VAL A CB  1 
ATOM   2949 C CG1 . VAL A 1 413 ? 46.930  66.907 -28.388 1.00 117.56 ? 412 VAL A CG1 1 
ATOM   2950 C CG2 . VAL A 1 413 ? 45.754  65.150 -27.066 1.00 110.37 ? 412 VAL A CG2 1 
ATOM   2951 N N   . GLU A 1 414 ? 47.611  69.121 -25.448 1.00 111.13 ? 413 GLU A N   1 
ATOM   2952 C CA  . GLU A 1 414 ? 48.370  70.366 -25.441 1.00 114.21 ? 413 GLU A CA  1 
ATOM   2953 C C   . GLU A 1 414 ? 49.650  70.230 -24.624 1.00 114.46 ? 413 GLU A C   1 
ATOM   2954 O O   . GLU A 1 414 ? 50.694  70.775 -25.003 1.00 116.97 ? 413 GLU A O   1 
ATOM   2955 C CB  . GLU A 1 414 ? 47.503  71.504 -24.900 1.00 115.87 ? 413 GLU A CB  1 
ATOM   2956 C CG  . GLU A 1 414 ? 46.366  71.917 -25.826 1.00 121.38 ? 413 GLU A CG  1 
ATOM   2957 C CD  . GLU A 1 414 ? 45.469  72.981 -25.217 1.00 128.87 ? 413 GLU A CD  1 
ATOM   2958 O OE1 . GLU A 1 414 ? 45.302  72.983 -23.979 1.00 125.72 ? 413 GLU A OE1 1 
ATOM   2959 O OE2 . GLU A 1 414 ? 44.935  73.817 -25.978 1.00 129.36 ? 413 GLU A OE2 1 
ATOM   2960 N N   . VAL A 1 415 ? 49.594  69.503 -23.506 1.00 112.20 ? 414 VAL A N   1 
ATOM   2961 C CA  . VAL A 1 415 ? 50.781  69.336 -22.673 1.00 111.21 ? 414 VAL A CA  1 
ATOM   2962 C C   . VAL A 1 415 ? 51.761  68.366 -23.323 1.00 112.45 ? 414 VAL A C   1 
ATOM   2963 O O   . VAL A 1 415 ? 52.978  68.587 -23.302 1.00 114.09 ? 414 VAL A O   1 
ATOM   2964 C CB  . VAL A 1 415 ? 50.379  68.881 -21.258 1.00 109.80 ? 414 VAL A CB  1 
ATOM   2965 C CG1 . VAL A 1 415 ? 51.607  68.747 -20.370 1.00 111.19 ? 414 VAL A CG1 1 
ATOM   2966 C CG2 . VAL A 1 415 ? 49.384  69.857 -20.651 1.00 110.72 ? 414 VAL A CG2 1 
ATOM   2967 N N   . LEU A 1 416 ? 51.249  67.279 -23.911 1.00 109.18 ? 415 LEU A N   1 
ATOM   2968 C CA  . LEU A 1 416 ? 52.117  66.312 -24.577 1.00 109.81 ? 415 LEU A CA  1 
ATOM   2969 C C   . LEU A 1 416 ? 52.887  66.954 -25.724 1.00 115.40 ? 415 LEU A C   1 
ATOM   2970 O O   . LEU A 1 416 ? 54.085  66.702 -25.897 1.00 117.30 ? 415 LEU A O   1 
ATOM   2971 C CB  . LEU A 1 416 ? 51.292  65.131 -25.088 1.00 107.72 ? 415 LEU A CB  1 
ATOM   2972 C CG  . LEU A 1 416 ? 50.709  64.190 -24.037 1.00 104.72 ? 415 LEU A CG  1 
ATOM   2973 C CD1 . LEU A 1 416 ? 49.692  63.252 -24.667 1.00 103.54 ? 415 LEU A CD1 1 
ATOM   2974 C CD2 . LEU A 1 416 ? 51.821  63.402 -23.366 1.00 104.11 ? 415 LEU A CD2 1 
ATOM   2975 N N   . LEU A 1 417 ? 52.212  67.785 -26.522 1.00 109.24 ? 416 LEU A N   1 
ATOM   2976 C CA  . LEU A 1 417 ? 52.890  68.465 -27.619 1.00 114.89 ? 416 LEU A CA  1 
ATOM   2977 C C   . LEU A 1 417 ? 53.907  69.478 -27.109 1.00 117.34 ? 416 LEU A C   1 
ATOM   2978 O O   . LEU A 1 417 ? 54.925  69.717 -27.770 1.00 121.77 ? 416 LEU A O   1 
ATOM   2979 C CB  . LEU A 1 417 ? 51.865  69.141 -28.527 1.00 117.35 ? 416 LEU A CB  1 
ATOM   2980 C CG  . LEU A 1 417 ? 50.981  68.194 -29.341 1.00 116.50 ? 416 LEU A CG  1 
ATOM   2981 C CD1 . LEU A 1 417 ? 49.842  68.955 -29.998 1.00 118.55 ? 416 LEU A CD1 1 
ATOM   2982 C CD2 . LEU A 1 417 ? 51.807  67.460 -30.385 1.00 119.54 ? 416 LEU A CD2 1 
ATOM   2983 N N   . LYS A 1 418 ? 53.657  70.080 -25.943 1.00 112.92 ? 417 LYS A N   1 
ATOM   2984 C CA  . LYS A 1 418 ? 54.634  70.990 -25.357 1.00 115.11 ? 417 LYS A CA  1 
ATOM   2985 C C   . LYS A 1 418 ? 55.897  70.267 -24.913 1.00 114.78 ? 417 LYS A C   1 
ATOM   2986 O O   . LYS A 1 418 ? 56.959  70.894 -24.831 1.00 118.22 ? 417 LYS A O   1 
ATOM   2987 C CB  . LYS A 1 418 ? 54.022  71.743 -24.174 1.00 112.49 ? 417 LYS A CB  1 
ATOM   2988 C CG  . LYS A 1 418 ? 53.081  72.870 -24.571 1.00 114.49 ? 417 LYS A CG  1 
ATOM   2989 C CD  . LYS A 1 418 ? 52.583  73.632 -23.354 1.00 112.33 ? 417 LYS A CD  1 
ATOM   2990 C CE  . LYS A 1 418 ? 51.707  74.807 -23.766 1.00 114.84 ? 417 LYS A CE  1 
ATOM   2991 N NZ  . LYS A 1 418 ? 51.231  75.591 -22.592 1.00 113.16 ? 417 LYS A NZ  1 
ATOM   2992 N N   . TYR A 1 419 ? 55.808  68.969 -24.630 1.00 106.68 ? 418 TYR A N   1 
ATOM   2993 C CA  . TYR A 1 419 ? 56.961  68.167 -24.251 1.00 107.12 ? 418 TYR A CA  1 
ATOM   2994 C C   . TYR A 1 419 ? 57.510  67.344 -25.409 1.00 110.99 ? 418 TYR A C   1 
ATOM   2995 O O   . TYR A 1 419 ? 58.368  66.483 -25.192 1.00 111.91 ? 418 TYR A O   1 
ATOM   2996 C CB  . TYR A 1 419 ? 56.606  67.253 -23.076 1.00 107.08 ? 418 TYR A CB  1 
ATOM   2997 C CG  . TYR A 1 419 ? 56.618  67.951 -21.732 1.00 105.14 ? 418 TYR A CG  1 
ATOM   2998 C CD1 . TYR A 1 419 ? 55.488  68.599 -21.250 1.00 105.14 ? 418 TYR A CD1 1 
ATOM   2999 C CD2 . TYR A 1 419 ? 57.763  67.962 -20.945 1.00 104.66 ? 418 TYR A CD2 1 
ATOM   3000 C CE1 . TYR A 1 419 ? 55.497  69.236 -20.020 1.00 105.11 ? 418 TYR A CE1 1 
ATOM   3001 C CE2 . TYR A 1 419 ? 57.782  68.597 -19.715 1.00 103.82 ? 418 TYR A CE2 1 
ATOM   3002 C CZ  . TYR A 1 419 ? 56.646  69.232 -19.258 1.00 104.43 ? 418 TYR A CZ  1 
ATOM   3003 O OH  . TYR A 1 419 ? 56.663  69.863 -18.035 1.00 104.44 ? 418 TYR A OH  1 
ATOM   3004 N N   . GLY A 1 420 ? 57.035  67.585 -26.629 1.00 109.32 ? 419 GLY A N   1 
ATOM   3005 C CA  . GLY A 1 420 ? 57.611  66.950 -27.798 1.00 109.38 ? 419 GLY A CA  1 
ATOM   3006 C C   . GLY A 1 420 ? 56.900  65.696 -28.263 1.00 109.55 ? 419 GLY A C   1 
ATOM   3007 O O   . GLY A 1 420 ? 57.547  64.689 -28.565 1.00 109.39 ? 419 GLY A O   1 
ATOM   3008 N N   . ALA A 1 421 ? 55.573  65.743 -28.333 1.00 115.68 ? 420 ALA A N   1 
ATOM   3009 C CA  . ALA A 1 421 ? 54.807  64.622 -28.856 1.00 117.17 ? 420 ALA A CA  1 
ATOM   3010 C C   . ALA A 1 421 ? 54.929  64.563 -30.373 1.00 119.63 ? 420 ALA A C   1 
ATOM   3011 O O   . ALA A 1 421 ? 54.931  65.594 -31.051 1.00 118.91 ? 420 ALA A O   1 
ATOM   3012 C CB  . ALA A 1 421 ? 53.339  64.738 -28.449 1.00 117.09 ? 420 ALA A CB  1 
ATOM   3013 N N   . ASP A 1 422 ? 55.031  63.346 -30.905 1.00 124.26 ? 421 ASP A N   1 
ATOM   3014 C CA  . ASP A 1 422 ? 55.218  63.121 -32.335 1.00 125.15 ? 421 ASP A CA  1 
ATOM   3015 C C   . ASP A 1 422 ? 53.874  62.758 -32.959 1.00 126.78 ? 421 ASP A C   1 
ATOM   3016 O O   . ASP A 1 422 ? 53.350  61.663 -32.728 1.00 127.23 ? 421 ASP A O   1 
ATOM   3017 C CB  . ASP A 1 422 ? 56.253  62.024 -32.577 1.00 127.21 ? 421 ASP A CB  1 
ATOM   3018 C CG  . ASP A 1 422 ? 56.580  61.844 -34.047 1.00 130.99 ? 421 ASP A CG  1 
ATOM   3019 O OD1 . ASP A 1 422 ? 57.134  62.785 -34.655 1.00 130.60 ? 421 ASP A OD1 1 
ATOM   3020 O OD2 . ASP A 1 422 ? 56.289  60.759 -34.594 1.00 133.79 ? 421 ASP A OD2 1 
ATOM   3021 N N   . VAL A 1 423 ? 53.320  63.679 -33.753 1.00 127.03 ? 422 VAL A N   1 
ATOM   3022 C CA  . VAL A 1 423 ? 52.044  63.422 -34.415 1.00 127.38 ? 422 VAL A CA  1 
ATOM   3023 C C   . VAL A 1 423 ? 52.221  62.439 -35.565 1.00 129.78 ? 422 VAL A C   1 
ATOM   3024 O O   . VAL A 1 423 ? 51.298  61.685 -35.897 1.00 130.17 ? 422 VAL A O   1 
ATOM   3025 C CB  . VAL A 1 423 ? 51.417  64.744 -34.899 1.00 128.10 ? 422 VAL A CB  1 
ATOM   3026 C CG1 . VAL A 1 423 ? 50.005  64.512 -35.425 1.00 128.65 ? 422 VAL A CG1 1 
ATOM   3027 C CG2 . VAL A 1 423 ? 51.412  65.774 -33.780 1.00 127.02 ? 422 VAL A CG2 1 
ATOM   3028 N N   . ASN A 1 424 ? 53.403  62.418 -36.183 1.00 129.55 ? 423 ASN A N   1 
ATOM   3029 C CA  . ASN A 1 424 ? 53.670  61.550 -37.325 1.00 130.54 ? 423 ASN A CA  1 
ATOM   3030 C C   . ASN A 1 424 ? 53.857  60.088 -36.938 1.00 132.80 ? 423 ASN A C   1 
ATOM   3031 O O   . ASN A 1 424 ? 54.088  59.260 -37.827 1.00 133.33 ? 423 ASN A O   1 
ATOM   3032 C CB  . ASN A 1 424 ? 54.909  62.047 -38.073 1.00 131.08 ? 423 ASN A CB  1 
ATOM   3033 C CG  . ASN A 1 424 ? 54.868  63.540 -38.347 1.00 137.14 ? 423 ASN A CG  1 
ATOM   3034 O OD1 . ASN A 1 424 ? 54.297  63.986 -39.341 1.00 135.22 ? 423 ASN A OD1 1 
ATOM   3035 N ND2 . ASN A 1 424 ? 55.481  64.319 -37.463 1.00 133.78 ? 423 ASN A ND2 1 
ATOM   3036 N N   . ALA A 1 425 ? 53.765  59.747 -35.655 1.00 130.78 ? 424 ALA A N   1 
ATOM   3037 C CA  . ALA A 1 425 ? 53.967  58.369 -35.230 1.00 131.60 ? 424 ALA A CA  1 
ATOM   3038 C C   . ALA A 1 425 ? 52.782  57.498 -35.631 1.00 133.10 ? 424 ALA A C   1 
ATOM   3039 O O   . ALA A 1 425 ? 51.627  57.932 -35.589 1.00 132.35 ? 424 ALA A O   1 
ATOM   3040 C CB  . ALA A 1 425 ? 54.176  58.305 -33.717 1.00 131.54 ? 424 ALA A CB  1 
ATOM   3041 N N   . GLN A 1 426 ? 53.078  56.260 -36.020 1.00 133.86 ? 425 GLN A N   1 
ATOM   3042 C CA  . GLN A 1 426 ? 52.066  55.288 -36.402 1.00 133.97 ? 425 GLN A CA  1 
ATOM   3043 C C   . GLN A 1 426 ? 52.094  54.106 -35.442 1.00 135.68 ? 425 GLN A C   1 
ATOM   3044 O O   . GLN A 1 426 ? 53.148  53.741 -34.911 1.00 136.03 ? 425 GLN A O   1 
ATOM   3045 C CB  . GLN A 1 426 ? 52.277  54.797 -37.841 1.00 134.98 ? 425 GLN A CB  1 
ATOM   3046 C CG  . GLN A 1 426 ? 52.116  55.879 -38.896 1.00 139.49 ? 425 GLN A CG  1 
ATOM   3047 C CD  . GLN A 1 426 ? 52.287  55.353 -40.308 1.00 145.87 ? 425 GLN A CD  1 
ATOM   3048 O OE1 . GLN A 1 426 ? 53.203  54.580 -40.589 1.00 145.28 ? 425 GLN A OE1 1 
ATOM   3049 N NE2 . GLN A 1 426 ? 51.399  55.768 -41.206 1.00 142.82 ? 425 GLN A NE2 1 
ATOM   3050 N N   . ASP A 1 427 ? 50.924  53.512 -35.224 1.00 134.94 ? 426 ASP A N   1 
ATOM   3051 C CA  . ASP A 1 427 ? 50.787  52.373 -34.327 1.00 134.98 ? 426 ASP A CA  1 
ATOM   3052 C C   . ASP A 1 427 ? 50.914  51.077 -35.131 1.00 136.89 ? 426 ASP A C   1 
ATOM   3053 O O   . ASP A 1 427 ? 51.401  51.080 -36.265 1.00 137.25 ? 426 ASP A O   1 
ATOM   3054 C CB  . ASP A 1 427 ? 49.464  52.470 -33.558 1.00 135.02 ? 426 ASP A CB  1 
ATOM   3055 C CG  . ASP A 1 427 ? 48.272  52.706 -34.468 1.00 137.79 ? 426 ASP A CG  1 
ATOM   3056 O OD1 . ASP A 1 427 ? 47.984  51.839 -35.319 1.00 138.08 ? 426 ASP A OD1 1 
ATOM   3057 O OD2 . ASP A 1 427 ? 47.617  53.760 -34.325 1.00 139.43 ? 426 ASP A OD2 1 
ATOM   3058 N N   . LYS A 1 428 ? 50.477  49.955 -34.554 1.00 136.67 ? 427 LYS A N   1 
ATOM   3059 C CA  . LYS A 1 428 ? 50.554  48.677 -35.253 1.00 136.84 ? 427 LYS A CA  1 
ATOM   3060 C C   . LYS A 1 428 ? 49.557  48.584 -36.402 1.00 138.20 ? 427 LYS A C   1 
ATOM   3061 O O   . LYS A 1 428 ? 49.786  47.815 -37.342 1.00 138.04 ? 427 LYS A O   1 
ATOM   3062 C CB  . LYS A 1 428 ? 50.328  47.526 -34.272 1.00 137.24 ? 427 LYS A CB  1 
ATOM   3063 N N   . PHE A 1 429 ? 48.461  49.343 -36.348 1.00 137.57 ? 428 PHE A N   1 
ATOM   3064 C CA  . PHE A 1 429 ? 47.491  49.346 -37.435 1.00 137.52 ? 428 PHE A CA  1 
ATOM   3065 C C   . PHE A 1 429 ? 47.874  50.302 -38.556 1.00 139.18 ? 428 PHE A C   1 
ATOM   3066 O O   . PHE A 1 429 ? 47.394  50.139 -39.683 1.00 139.04 ? 428 PHE A O   1 
ATOM   3067 C CB  . PHE A 1 429 ? 46.103  49.716 -36.907 1.00 137.86 ? 428 PHE A CB  1 
ATOM   3068 C CG  . PHE A 1 429 ? 45.715  48.980 -35.658 1.00 138.16 ? 428 PHE A CG  1 
ATOM   3069 C CD1 . PHE A 1 429 ? 45.205  47.695 -35.726 1.00 138.94 ? 428 PHE A CD1 1 
ATOM   3070 C CD2 . PHE A 1 429 ? 45.858  49.575 -34.416 1.00 138.78 ? 428 PHE A CD2 1 
ATOM   3071 C CE1 . PHE A 1 429 ? 44.847  47.015 -34.578 1.00 138.94 ? 428 PHE A CE1 1 
ATOM   3072 C CE2 . PHE A 1 429 ? 45.502  48.901 -33.264 1.00 139.48 ? 428 PHE A CE2 1 
ATOM   3073 C CZ  . PHE A 1 429 ? 44.996  47.619 -33.345 1.00 138.66 ? 428 PHE A CZ  1 
ATOM   3074 N N   . GLY A 1 430 ? 48.723  51.289 -38.272 1.00 140.93 ? 429 GLY A N   1 
ATOM   3075 C CA  . GLY A 1 430 ? 49.112  52.289 -39.246 1.00 141.13 ? 429 GLY A CA  1 
ATOM   3076 C C   . GLY A 1 430 ? 48.491  53.651 -39.034 1.00 142.17 ? 429 GLY A C   1 
ATOM   3077 O O   . GLY A 1 430 ? 48.795  54.575 -39.799 1.00 142.14 ? 429 GLY A O   1 
ATOM   3078 N N   . LYS A 1 431 ? 47.638  53.811 -38.027 1.00 135.52 ? 430 LYS A N   1 
ATOM   3079 C CA  . LYS A 1 431 ? 46.976  55.083 -37.786 1.00 135.30 ? 430 LYS A CA  1 
ATOM   3080 C C   . LYS A 1 431 ? 47.863  56.011 -36.966 1.00 136.20 ? 430 LYS A C   1 
ATOM   3081 O O   . LYS A 1 431 ? 48.731  55.570 -36.207 1.00 136.02 ? 430 LYS A O   1 
ATOM   3082 C CB  . LYS A 1 431 ? 45.644  54.864 -37.068 1.00 136.27 ? 430 LYS A CB  1 
ATOM   3083 C CG  . LYS A 1 431 ? 44.640  54.048 -37.864 1.00 141.57 ? 430 LYS A CG  1 
ATOM   3084 C CD  . LYS A 1 431 ? 43.363  53.824 -37.074 1.00 145.39 ? 430 LYS A CD  1 
ATOM   3085 C CE  . LYS A 1 431 ? 42.318  53.106 -37.911 1.00 149.56 ? 430 LYS A CE  1 
ATOM   3086 N NZ  . LYS A 1 431 ? 41.939  53.895 -39.116 1.00 152.97 ? 430 LYS A NZ  1 
ATOM   3087 N N   . THR A 1 432 ? 47.639  57.310 -37.132 1.00 133.99 ? 431 THR A N   1 
ATOM   3088 C CA  . THR A 1 432 ? 48.357  58.345 -36.405 1.00 133.48 ? 431 THR A CA  1 
ATOM   3089 C C   . THR A 1 432 ? 47.410  59.037 -35.430 1.00 134.64 ? 431 THR A C   1 
ATOM   3090 O O   . THR A 1 432 ? 46.218  58.729 -35.359 1.00 134.99 ? 431 THR A O   1 
ATOM   3091 C CB  . THR A 1 432 ? 48.973  59.360 -37.371 1.00 135.86 ? 431 THR A CB  1 
ATOM   3092 O OG1 . THR A 1 432 ? 47.928  60.056 -38.062 1.00 135.90 ? 431 THR A OG1 1 
ATOM   3093 C CG2 . THR A 1 432 ? 49.862  58.659 -38.384 1.00 135.96 ? 431 THR A CG2 1 
ATOM   3094 N N   . ALA A 1 433 ? 47.960  59.990 -34.673 1.00 132.33 ? 432 ALA A N   1 
ATOM   3095 C CA  . ALA A 1 433 ? 47.137  60.752 -33.740 1.00 132.46 ? 432 ALA A CA  1 
ATOM   3096 C C   . ALA A 1 433 ? 46.042  61.522 -34.463 1.00 134.18 ? 432 ALA A C   1 
ATOM   3097 O O   . ALA A 1 433 ? 44.937  61.678 -33.932 1.00 134.75 ? 432 ALA A O   1 
ATOM   3098 C CB  . ALA A 1 433 ? 48.012  61.704 -32.924 1.00 131.56 ? 432 ALA A CB  1 
ATOM   3099 N N   . PHE A 1 434 ? 46.324  61.997 -35.676 1.00 138.11 ? 433 PHE A N   1 
ATOM   3100 C CA  . PHE A 1 434 ? 45.326  62.713 -36.458 1.00 138.82 ? 433 PHE A CA  1 
ATOM   3101 C C   . PHE A 1 434 ? 44.279  61.785 -37.061 1.00 141.00 ? 433 PHE A C   1 
ATOM   3102 O O   . PHE A 1 434 ? 43.178  62.243 -37.386 1.00 141.87 ? 433 PHE A O   1 
ATOM   3103 C CB  . PHE A 1 434 ? 46.019  63.515 -37.565 1.00 138.97 ? 433 PHE A CB  1 
ATOM   3104 C CG  . PHE A 1 434 ? 45.131  64.522 -38.242 1.00 140.16 ? 433 PHE A CG  1 
ATOM   3105 C CD1 . PHE A 1 434 ? 44.958  65.787 -37.703 1.00 141.00 ? 433 PHE A CD1 1 
ATOM   3106 C CD2 . PHE A 1 434 ? 44.482  64.210 -39.426 1.00 141.65 ? 433 PHE A CD2 1 
ATOM   3107 C CE1 . PHE A 1 434 ? 44.147  66.718 -38.327 1.00 142.01 ? 433 PHE A CE1 1 
ATOM   3108 C CE2 . PHE A 1 434 ? 43.669  65.136 -40.054 1.00 143.30 ? 433 PHE A CE2 1 
ATOM   3109 C CZ  . PHE A 1 434 ? 43.501  66.391 -39.504 1.00 142.63 ? 433 PHE A CZ  1 
ATOM   3110 N N   . ASP A 1 435 ? 44.587  60.493 -37.203 1.00 136.50 ? 434 ASP A N   1 
ATOM   3111 C CA  . ASP A 1 435 ? 43.656  59.578 -37.856 1.00 137.17 ? 434 ASP A CA  1 
ATOM   3112 C C   . ASP A 1 435 ? 42.467  59.252 -36.961 1.00 139.17 ? 434 ASP A C   1 
ATOM   3113 O O   . ASP A 1 435 ? 41.322  59.230 -37.427 1.00 140.03 ? 434 ASP A O   1 
ATOM   3114 C CB  . ASP A 1 435 ? 44.381  58.299 -38.271 1.00 137.38 ? 434 ASP A CB  1 
ATOM   3115 C CG  . ASP A 1 435 ? 45.406  58.541 -39.359 1.00 139.92 ? 434 ASP A CG  1 
ATOM   3116 O OD1 . ASP A 1 435 ? 45.222  59.493 -40.146 1.00 140.51 ? 434 ASP A OD1 1 
ATOM   3117 O OD2 . ASP A 1 435 ? 46.393  57.782 -39.431 1.00 140.89 ? 434 ASP A OD2 1 
ATOM   3118 N N   . ILE A 1 436 ? 42.716  58.990 -35.675 1.00 138.33 ? 435 ILE A N   1 
ATOM   3119 C CA  . ILE A 1 436 ? 41.622  58.662 -34.767 1.00 139.15 ? 435 ILE A CA  1 
ATOM   3120 C C   . ILE A 1 436 ? 40.722  59.874 -34.543 1.00 141.34 ? 435 ILE A C   1 
ATOM   3121 O O   . ILE A 1 436 ? 39.514  59.726 -34.315 1.00 142.41 ? 435 ILE A O   1 
ATOM   3122 C CB  . ILE A 1 436 ? 42.183  58.101 -33.444 1.00 139.58 ? 435 ILE A CB  1 
ATOM   3123 C CG1 . ILE A 1 436 ? 42.796  56.715 -33.666 1.00 139.56 ? 435 ILE A CG1 1 
ATOM   3124 C CG2 . ILE A 1 436 ? 41.103  58.012 -32.381 1.00 140.34 ? 435 ILE A CG2 1 
ATOM   3125 C CD1 . ILE A 1 436 ? 44.291  56.722 -33.862 1.00 140.94 ? 435 ILE A CD1 1 
ATOM   3126 N N   . SER A 1 437 ? 41.280  61.086 -34.627 1.00 139.24 ? 436 SER A N   1 
ATOM   3127 C CA  . SER A 1 437 ? 40.465  62.290 -34.480 1.00 140.30 ? 436 SER A CA  1 
ATOM   3128 C C   . SER A 1 437 ? 39.376  62.358 -35.543 1.00 142.82 ? 436 SER A C   1 
ATOM   3129 O O   . SER A 1 437 ? 38.272  62.848 -35.282 1.00 144.13 ? 436 SER A O   1 
ATOM   3130 C CB  . SER A 1 437 ? 41.348  63.537 -34.545 1.00 140.42 ? 436 SER A CB  1 
ATOM   3131 O OG  . SER A 1 437 ? 42.303  63.543 -33.500 1.00 141.77 ? 436 SER A OG  1 
ATOM   3132 N N   . ILE A 1 438 ? 39.668  61.875 -36.749 1.00 140.17 ? 437 ILE A N   1 
ATOM   3133 C CA  . ILE A 1 438 ? 38.657  61.867 -37.798 1.00 141.32 ? 437 ILE A CA  1 
ATOM   3134 C C   . ILE A 1 438 ? 37.793  60.613 -37.712 1.00 143.02 ? 437 ILE A C   1 
ATOM   3135 O O   . ILE A 1 438 ? 36.603  60.651 -38.046 1.00 144.41 ? 437 ILE A O   1 
ATOM   3136 C CB  . ILE A 1 438 ? 39.323  62.004 -39.177 1.00 141.52 ? 437 ILE A CB  1 
ATOM   3137 C CG1 . ILE A 1 438 ? 40.328  63.156 -39.173 1.00 140.56 ? 437 ILE A CG1 1 
ATOM   3138 C CG2 . ILE A 1 438 ? 38.276  62.221 -40.261 1.00 143.15 ? 437 ILE A CG2 1 
ATOM   3139 C CD1 . ILE A 1 438 ? 39.707  64.510 -38.884 1.00 143.70 ? 437 ILE A CD1 1 
ATOM   3140 N N   . ASP A 1 439 ? 38.363  59.496 -37.252 1.00 141.00 ? 438 ASP A N   1 
ATOM   3141 C CA  . ASP A 1 439 ? 37.588  58.266 -37.124 1.00 141.27 ? 438 ASP A CA  1 
ATOM   3142 C C   . ASP A 1 439 ? 36.520  58.392 -36.044 1.00 143.56 ? 438 ASP A C   1 
ATOM   3143 O O   . ASP A 1 439 ? 35.389  57.925 -36.227 1.00 144.45 ? 438 ASP A O   1 
ATOM   3144 C CB  . ASP A 1 439 ? 38.521  57.089 -36.833 1.00 140.52 ? 438 ASP A CB  1 
ATOM   3145 C CG  . ASP A 1 439 ? 39.428  56.758 -38.006 1.00 142.61 ? 438 ASP A CG  1 
ATOM   3146 O OD1 . ASP A 1 439 ? 38.966  56.862 -39.163 1.00 143.06 ? 438 ASP A OD1 1 
ATOM   3147 O OD2 . ASP A 1 439 ? 40.601  56.395 -37.773 1.00 143.41 ? 438 ASP A OD2 1 
ATOM   3148 N N   . ASN A 1 440 ? 36.857  59.015 -34.912 1.00 138.83 ? 439 ASN A N   1 
ATOM   3149 C CA  . ASN A 1 440 ? 35.867  59.235 -33.863 1.00 139.98 ? 439 ASN A CA  1 
ATOM   3150 C C   . ASN A 1 440 ? 34.927  60.384 -34.211 1.00 142.70 ? 439 ASN A C   1 
ATOM   3151 O O   . ASN A 1 440 ? 33.712  60.280 -34.006 1.00 144.06 ? 439 ASN A O   1 
ATOM   3152 C CB  . ASN A 1 440 ? 36.562  59.500 -32.526 1.00 139.47 ? 439 ASN A CB  1 
ATOM   3153 C CG  . ASN A 1 440 ? 36.937  58.223 -31.798 1.00 145.41 ? 439 ASN A CG  1 
ATOM   3154 O OD1 . ASN A 1 440 ? 37.901  57.548 -32.159 1.00 142.43 ? 439 ASN A OD1 1 
ATOM   3155 N ND2 . ASN A 1 440 ? 36.177  57.888 -30.761 1.00 143.25 ? 439 ASN A ND2 1 
ATOM   3156 N N   . GLY A 1 441 ? 35.467  61.481 -34.736 1.00 141.57 ? 440 GLY A N   1 
ATOM   3157 C CA  . GLY A 1 441 ? 34.650  62.615 -35.120 1.00 142.94 ? 440 GLY A CA  1 
ATOM   3158 C C   . GLY A 1 441 ? 34.812  63.810 -34.205 1.00 144.06 ? 440 GLY A C   1 
ATOM   3159 O O   . GLY A 1 441 ? 33.823  64.354 -33.702 1.00 145.39 ? 440 GLY A O   1 
ATOM   3160 N N   . ASN A 1 442 ? 36.055  64.229 -33.980 1.00 137.14 ? 441 ASN A N   1 
ATOM   3161 C CA  . ASN A 1 442 ? 36.370  65.374 -33.126 1.00 136.66 ? 441 ASN A CA  1 
ATOM   3162 C C   . ASN A 1 442 ? 37.182  66.371 -33.944 1.00 136.58 ? 441 ASN A C   1 
ATOM   3163 O O   . ASN A 1 442 ? 38.379  66.167 -34.173 1.00 134.81 ? 441 ASN A O   1 
ATOM   3164 C CB  . ASN A 1 442 ? 37.129  64.938 -31.875 1.00 135.79 ? 441 ASN A CB  1 
ATOM   3165 C CG  . ASN A 1 442 ? 36.310  64.029 -30.981 1.00 143.51 ? 441 ASN A CG  1 
ATOM   3166 O OD1 . ASN A 1 442 ? 35.470  64.492 -30.210 1.00 142.92 ? 441 ASN A OD1 1 
ATOM   3167 N ND2 . ASN A 1 442 ? 36.558  62.728 -31.073 1.00 140.16 ? 441 ASN A ND2 1 
ATOM   3168 N N   . GLU A 1 443 ? 36.533  67.451 -34.386 1.00 135.98 ? 442 GLU A N   1 
ATOM   3169 C CA  . GLU A 1 443 ? 37.241  68.506 -35.098 1.00 134.67 ? 442 GLU A CA  1 
ATOM   3170 C C   . GLU A 1 443 ? 38.075  69.378 -34.170 1.00 134.23 ? 442 GLU A C   1 
ATOM   3171 O O   . GLU A 1 443 ? 38.977  70.077 -34.644 1.00 132.58 ? 442 GLU A O   1 
ATOM   3172 C CB  . GLU A 1 443 ? 36.255  69.384 -35.875 1.00 136.36 ? 442 GLU A CB  1 
ATOM   3173 C CG  . GLU A 1 443 ? 35.494  68.656 -36.974 1.00 140.61 ? 442 GLU A CG  1 
ATOM   3174 C CD  . GLU A 1 443 ? 34.872  69.607 -37.980 1.00 146.70 ? 442 GLU A CD  1 
ATOM   3175 O OE1 . GLU A 1 443 ? 35.524  70.612 -38.334 1.00 142.92 ? 442 GLU A OE1 1 
ATOM   3176 O OE2 . GLU A 1 443 ? 33.729  69.352 -38.416 1.00 146.19 ? 442 GLU A OE2 1 
ATOM   3177 N N   . ASP A 1 444 ? 37.796  69.356 -32.865 1.00 132.69 ? 443 ASP A N   1 
ATOM   3178 C CA  . ASP A 1 444 ? 38.596  70.138 -31.929 1.00 131.13 ? 443 ASP A CA  1 
ATOM   3179 C C   . ASP A 1 444 ? 39.995  69.554 -31.782 1.00 130.34 ? 443 ASP A C   1 
ATOM   3180 O O   . ASP A 1 444 ? 40.981  70.297 -31.712 1.00 128.63 ? 443 ASP A O   1 
ATOM   3181 C CB  . ASP A 1 444 ? 37.896  70.207 -30.572 1.00 132.66 ? 443 ASP A CB  1 
ATOM   3182 C CG  . ASP A 1 444 ? 36.469  70.705 -30.679 1.00 137.63 ? 443 ASP A CG  1 
ATOM   3183 O OD1 . ASP A 1 444 ? 35.601  69.931 -31.135 1.00 139.42 ? 443 ASP A OD1 1 
ATOM   3184 O OD2 . ASP A 1 444 ? 36.215  71.871 -30.309 1.00 139.31 ? 443 ASP A OD2 1 
ATOM   3185 N N   . LEU A 1 445 ? 40.100  68.223 -31.737 1.00 134.57 ? 444 LEU A N   1 
ATOM   3186 C CA  . LEU A 1 445 ? 41.408  67.582 -31.649 1.00 132.86 ? 444 LEU A CA  1 
ATOM   3187 C C   . LEU A 1 445 ? 42.184  67.726 -32.952 1.00 133.13 ? 444 LEU A C   1 
ATOM   3188 O O   . LEU A 1 445 ? 43.410  67.890 -32.937 1.00 131.32 ? 444 LEU A O   1 
ATOM   3189 C CB  . LEU A 1 445 ? 41.243  66.106 -31.284 1.00 133.53 ? 444 LEU A CB  1 
ATOM   3190 C CG  . LEU A 1 445 ? 40.859  65.792 -29.837 1.00 135.54 ? 444 LEU A CG  1 
ATOM   3191 C CD1 . LEU A 1 445 ? 40.254  64.401 -29.735 1.00 136.85 ? 444 LEU A CD1 1 
ATOM   3192 C CD2 . LEU A 1 445 ? 42.075  65.910 -28.933 1.00 134.41 ? 444 LEU A CD2 1 
ATOM   3193 N N   . ALA A 1 446 ? 41.489  67.668 -34.090 1.00 134.89 ? 445 ALA A N   1 
ATOM   3194 C CA  . ALA A 1 446 ? 42.154  67.819 -35.378 1.00 134.14 ? 445 ALA A CA  1 
ATOM   3195 C C   . ALA A 1 446 ? 42.682  69.231 -35.598 1.00 134.31 ? 445 ALA A C   1 
ATOM   3196 O O   . ALA A 1 446 ? 43.569  69.423 -36.436 1.00 133.26 ? 445 ALA A O   1 
ATOM   3197 C CB  . ALA A 1 446 ? 41.199  67.437 -36.510 1.00 135.88 ? 445 ALA A CB  1 
ATOM   3198 N N   . GLU A 1 447 ? 42.159  70.219 -34.865 1.00 135.89 ? 446 GLU A N   1 
ATOM   3199 C CA  . GLU A 1 447 ? 42.632  71.591 -35.023 1.00 134.62 ? 446 GLU A CA  1 
ATOM   3200 C C   . GLU A 1 447 ? 44.054  71.750 -34.501 1.00 133.76 ? 446 GLU A C   1 
ATOM   3201 O O   . GLU A 1 447 ? 44.871  72.454 -35.108 1.00 132.47 ? 446 GLU A O   1 
ATOM   3202 C CB  . GLU A 1 447 ? 41.687  72.556 -34.304 1.00 135.71 ? 446 GLU A CB  1 
ATOM   3203 C CG  . GLU A 1 447 ? 41.993  74.030 -34.540 1.00 137.72 ? 446 GLU A CG  1 
ATOM   3204 C CD  . GLU A 1 447 ? 41.277  74.592 -35.755 1.00 144.45 ? 446 GLU A CD  1 
ATOM   3205 O OE1 . GLU A 1 447 ? 40.029  74.537 -35.790 1.00 143.69 ? 446 GLU A OE1 1 
ATOM   3206 O OE2 . GLU A 1 447 ? 41.961  75.083 -36.677 1.00 141.57 ? 446 GLU A OE2 1 
ATOM   3207 N N   . ILE A 1 448 ? 44.370  71.102 -33.380 1.00 130.65 ? 447 ILE A N   1 
ATOM   3208 C CA  . ILE A 1 448 ? 45.694  71.245 -32.783 1.00 128.79 ? 447 ILE A CA  1 
ATOM   3209 C C   . ILE A 1 448 ? 46.699  70.325 -33.466 1.00 129.57 ? 447 ILE A C   1 
ATOM   3210 O O   . ILE A 1 448 ? 47.863  70.695 -33.660 1.00 128.09 ? 447 ILE A O   1 
ATOM   3211 C CB  . ILE A 1 448 ? 45.616  70.980 -31.268 1.00 129.52 ? 447 ILE A CB  1 
ATOM   3212 C CG1 . ILE A 1 448 ? 44.549  71.870 -30.627 1.00 130.73 ? 447 ILE A CG1 1 
ATOM   3213 C CG2 . ILE A 1 448 ? 46.965  71.220 -30.611 1.00 127.52 ? 447 ILE A CG2 1 
ATOM   3214 C CD1 . ILE A 1 448 ? 44.844  73.350 -30.730 1.00 134.71 ? 447 ILE A CD1 1 
ATOM   3215 N N   . LEU A 1 449 ? 46.268  69.121 -33.851 1.00 131.94 ? 448 LEU A N   1 
ATOM   3216 C CA  . LEU A 1 449 ? 47.189  68.157 -34.445 1.00 131.67 ? 448 LEU A CA  1 
ATOM   3217 C C   . LEU A 1 449 ? 47.689  68.621 -35.808 1.00 132.81 ? 448 LEU A C   1 
ATOM   3218 O O   . LEU A 1 449 ? 48.862  68.421 -36.145 1.00 132.05 ? 448 LEU A O   1 
ATOM   3219 C CB  . LEU A 1 449 ? 46.511  66.792 -34.564 1.00 132.84 ? 448 LEU A CB  1 
ATOM   3220 C CG  . LEU A 1 449 ? 46.247  66.053 -33.252 1.00 134.45 ? 448 LEU A CG  1 
ATOM   3221 C CD1 . LEU A 1 449 ? 45.305  64.885 -33.477 1.00 135.77 ? 448 LEU A CD1 1 
ATOM   3222 C CD2 . LEU A 1 449 ? 47.555  65.576 -32.642 1.00 134.24 ? 448 LEU A CD2 1 
ATOM   3223 N N   . GLN A 1 450 ? 46.820  69.245 -36.605 1.00 131.89 ? 449 GLN A N   1 
ATOM   3224 C CA  . GLN A 1 450 ? 47.197  69.604 -37.966 1.00 131.73 ? 449 GLN A CA  1 
ATOM   3225 C C   . GLN A 1 450 ? 48.182  70.766 -38.005 1.00 131.69 ? 449 GLN A C   1 
ATOM   3226 O O   . GLN A 1 450 ? 48.931  70.896 -38.980 1.00 131.38 ? 449 GLN A O   1 
ATOM   3227 C CB  . GLN A 1 450 ? 45.945  69.936 -38.776 1.00 133.26 ? 449 GLN A CB  1 
ATOM   3228 C CG  . GLN A 1 450 ? 46.094  69.695 -40.267 1.00 138.25 ? 449 GLN A CG  1 
ATOM   3229 C CD  . GLN A 1 450 ? 44.759  69.646 -40.980 1.00 145.61 ? 449 GLN A CD  1 
ATOM   3230 O OE1 . GLN A 1 450 ? 43.776  70.228 -40.523 1.00 144.84 ? 449 GLN A OE1 1 
ATOM   3231 N NE2 . GLN A 1 450 ? 44.714  68.938 -42.102 1.00 143.58 ? 449 GLN A NE2 1 
ATOM   3232 N N   . ALA A 1 451 ? 48.207  71.599 -36.963 1.00 131.34 ? 450 ALA A N   1 
ATOM   3233 C CA  . ALA A 1 451 ? 49.144  72.711 -36.863 1.00 129.89 ? 450 ALA A CA  1 
ATOM   3234 C C   . ALA A 1 451 ? 50.501  72.292 -36.315 1.00 130.15 ? 450 ALA A C   1 
ATOM   3235 O O   . ALA A 1 451 ? 51.511  72.935 -36.626 1.00 129.22 ? 450 ALA A O   1 
ATOM   3236 C CB  . ALA A 1 451 ? 48.560  73.813 -35.973 1.00 129.51 ? 450 ALA A CB  1 
ATOM   3237 N N   . ALA A 1 452 ? 50.550  71.244 -35.496 1.00 129.49 ? 451 ALA A N   1 
ATOM   3238 C CA  . ALA A 1 452 ? 51.801  70.797 -34.900 1.00 128.49 ? 451 ALA A CA  1 
ATOM   3239 C C   . ALA A 1 452 ? 52.489  69.702 -35.706 1.00 128.06 ? 451 ALA A C   1 
ATOM   3240 O O   . ALA A 1 452 ? 53.644  69.373 -35.413 1.00 127.40 ? 451 ALA A O   1 
ATOM   3241 C CB  . ALA A 1 452 ? 51.557  70.302 -33.472 1.00 127.87 ? 451 ALA A CB  1 
ATOM   3242 N N   . ALA A 1 453 ? 51.814  69.140 -36.711 1.00 130.17 ? 452 ALA A N   1 
ATOM   3243 C CA  . ALA A 1 453 ? 52.394  68.054 -37.495 1.00 130.80 ? 452 ALA A CA  1 
ATOM   3244 C C   . ALA A 1 453 ? 53.458  68.562 -38.461 1.00 131.81 ? 452 ALA A C   1 
ATOM   3245 O O   . ALA A 1 453 ? 54.491  67.909 -38.647 1.00 132.07 ? 452 ALA A O   1 
ATOM   3246 C CB  . ALA A 1 453 ? 51.294  67.312 -38.256 1.00 132.00 ? 452 ALA A CB  1 
ATOM   3247 N N   . LEU A 1 454 ? 53.222  69.715 -39.086 1.00 130.71 ? 453 LEU A N   1 
ATOM   3248 C CA  . LEU A 1 454 ? 54.159  70.264 -40.059 1.00 130.46 ? 453 LEU A CA  1 
ATOM   3249 C C   . LEU A 1 454 ? 55.260  71.091 -39.400 1.00 130.66 ? 453 LEU A C   1 
ATOM   3250 O O   . LEU A 1 454 ? 56.439  70.936 -39.734 1.00 130.80 ? 453 LEU A O   1 
ATOM   3251 C CB  . LEU A 1 454 ? 53.407  71.112 -41.089 1.00 130.57 ? 453 LEU A CB  1 
ATOM   3252 C CG  . LEU A 1 454 ? 52.403  70.355 -41.959 1.00 132.97 ? 453 LEU A CG  1 
ATOM   3253 C CD1 . LEU A 1 454 ? 51.660  71.312 -42.876 1.00 134.80 ? 453 LEU A CD1 1 
ATOM   3254 C CD2 . LEU A 1 454 ? 53.105  69.272 -42.763 1.00 134.31 ? 453 LEU A CD2 1 
ATOM   3255 N N   . GLU A 1 455 ? 54.895  71.971 -38.473 1.00 123.40 ? 454 GLU A N   1 
ATOM   3256 C CA  . GLU A 1 455 ? 55.876  72.813 -37.796 1.00 125.39 ? 454 GLU A CA  1 
ATOM   3257 C C   . GLU A 1 455 ? 55.822  72.618 -36.285 1.00 131.08 ? 454 GLU A C   1 
ATOM   3258 O O   . GLU A 1 455 ? 56.830  72.295 -35.656 1.00 121.82 ? 454 GLU A O   1 
ATOM   3259 C CB  . GLU A 1 455 ? 55.651  74.286 -38.146 1.00 124.90 ? 454 GLU A CB  1 
ATOM   3260 N N   . ASP B 2 6   ? 18.470  39.976 -17.640 1.00 116.30 ? 8   ASP B N   1 
ATOM   3261 C CA  . ASP B 2 6   ? 18.988  40.056 -19.004 1.00 124.36 ? 8   ASP B CA  1 
ATOM   3262 C C   . ASP B 2 6   ? 18.164  40.998 -19.907 1.00 132.65 ? 8   ASP B C   1 
ATOM   3263 O O   . ASP B 2 6   ? 18.750  41.810 -20.623 1.00 134.81 ? 8   ASP B O   1 
ATOM   3264 C CB  . ASP B 2 6   ? 19.074  38.654 -19.625 1.00 131.99 ? 8   ASP B CB  1 
ATOM   3265 C CG  . ASP B 2 6   ? 20.099  38.570 -20.743 1.00 140.07 ? 8   ASP B CG  1 
ATOM   3266 O OD1 . ASP B 2 6   ? 21.311  38.652 -20.450 1.00 135.00 ? 8   ASP B OD1 1 
ATOM   3267 O OD2 . ASP B 2 6   ? 19.693  38.416 -21.914 1.00 150.86 ? 8   ASP B OD2 1 
ATOM   3268 N N   . PRO B 2 7   ? 16.823  40.905 -19.890 1.00 130.90 ? 9   PRO B N   1 
ATOM   3269 C CA  . PRO B 2 7   ? 16.045  41.879 -20.678 1.00 137.82 ? 9   PRO B CA  1 
ATOM   3270 C C   . PRO B 2 7   ? 16.201  43.307 -20.183 1.00 130.21 ? 9   PRO B C   1 
ATOM   3271 O O   . PRO B 2 7   ? 16.253  44.239 -20.996 1.00 134.54 ? 9   PRO B O   1 
ATOM   3272 C CB  . PRO B 2 7   ? 14.600  41.376 -20.534 1.00 143.50 ? 9   PRO B CB  1 
ATOM   3273 C CG  . PRO B 2 7   ? 14.599  40.581 -19.285 1.00 135.47 ? 9   PRO B CG  1 
ATOM   3274 C CD  . PRO B 2 7   ? 15.936  39.910 -19.257 1.00 131.37 ? 9   PRO B CD  1 
ATOM   3275 N N   . LYS B 2 8   ? 16.276  43.506 -18.865 1.00 132.70 ? 10  LYS B N   1 
ATOM   3276 C CA  . LYS B 2 8   ? 16.524  44.838 -18.327 1.00 125.53 ? 10  LYS B CA  1 
ATOM   3277 C C   . LYS B 2 8   ? 18.001  45.203 -18.382 1.00 122.08 ? 10  LYS B C   1 
ATOM   3278 O O   . LYS B 2 8   ? 18.340  46.391 -18.435 1.00 119.57 ? 10  LYS B O   1 
ATOM   3279 C CB  . LYS B 2 8   ? 16.014  44.932 -16.888 1.00 124.08 ? 10  LYS B CB  1 
ATOM   3280 N N   . PHE B 2 9   ? 18.887  44.203 -18.366 1.00 115.97 ? 11  PHE B N   1 
ATOM   3281 C CA  . PHE B 2 9   ? 20.316  44.476 -18.471 1.00 113.93 ? 11  PHE B CA  1 
ATOM   3282 C C   . PHE B 2 9   ? 20.661  45.082 -19.826 1.00 124.12 ? 11  PHE B C   1 
ATOM   3283 O O   . PHE B 2 9   ? 21.544  45.943 -19.923 1.00 121.74 ? 11  PHE B O   1 
ATOM   3284 C CB  . PHE B 2 9   ? 21.109  43.189 -18.225 1.00 114.02 ? 11  PHE B CB  1 
ATOM   3285 C CG  . PHE B 2 9   ? 22.356  43.067 -19.060 1.00 119.21 ? 11  PHE B CG  1 
ATOM   3286 C CD1 . PHE B 2 9   ? 23.510  43.749 -18.711 1.00 114.90 ? 11  PHE B CD1 1 
ATOM   3287 C CD2 . PHE B 2 9   ? 22.377  42.255 -20.183 1.00 129.64 ? 11  PHE B CD2 1 
ATOM   3288 C CE1 . PHE B 2 9   ? 24.658  43.634 -19.474 1.00 119.82 ? 11  PHE B CE1 1 
ATOM   3289 C CE2 . PHE B 2 9   ? 23.522  42.136 -20.950 1.00 134.48 ? 11  PHE B CE2 1 
ATOM   3290 C CZ  . PHE B 2 9   ? 24.664  42.826 -20.594 1.00 128.85 ? 11  PHE B CZ  1 
ATOM   3291 N N   . GLU B 2 10  ? 19.973  44.646 -20.884 1.00 115.79 ? 12  GLU B N   1 
ATOM   3292 C CA  . GLU B 2 10  ? 20.220  45.201 -22.211 1.00 124.69 ? 12  GLU B CA  1 
ATOM   3293 C C   . GLU B 2 10  ? 19.842  46.677 -22.266 1.00 124.11 ? 12  GLU B C   1 
ATOM   3294 O O   . GLU B 2 10  ? 20.603  47.508 -22.777 1.00 124.81 ? 12  GLU B O   1 
ATOM   3295 C CB  . GLU B 2 10  ? 19.447  44.402 -23.263 1.00 135.30 ? 12  GLU B CB  1 
ATOM   3296 C CG  . GLU B 2 10  ? 19.573  44.946 -24.677 1.00 145.76 ? 12  GLU B CG  1 
ATOM   3297 C CD  . GLU B 2 10  ? 20.908  44.613 -25.312 1.00 153.58 ? 12  GLU B CD  1 
ATOM   3298 O OE1 . GLU B 2 10  ? 21.496  43.573 -24.946 1.00 149.69 ? 12  GLU B OE1 1 
ATOM   3299 O OE2 . GLU B 2 10  ? 21.366  45.389 -26.179 1.00 154.43 ? 12  GLU B OE2 1 
ATOM   3300 N N   . SER B 2 11  ? 18.660  47.020 -21.747 1.00 130.74 ? 13  SER B N   1 
ATOM   3301 C CA  . SER B 2 11  ? 18.216  48.411 -21.747 1.00 126.31 ? 13  SER B CA  1 
ATOM   3302 C C   . SER B 2 11  ? 19.121  49.295 -20.900 1.00 116.63 ? 13  SER B C   1 
ATOM   3303 O O   . SER B 2 11  ? 19.332  50.467 -21.234 1.00 115.18 ? 13  SER B O   1 
ATOM   3304 C CB  . SER B 2 11  ? 16.775  48.502 -21.245 1.00 124.30 ? 13  SER B CB  1 
ATOM   3305 O OG  . SER B 2 11  ? 16.651  47.920 -19.958 1.00 118.88 ? 13  SER B OG  1 
ATOM   3306 N N   . LYS B 2 12  ? 19.660  48.758 -19.803 1.00 117.86 ? 14  LYS B N   1 
ATOM   3307 C CA  . LYS B 2 12  ? 20.546  49.548 -18.954 1.00 108.82 ? 14  LYS B CA  1 
ATOM   3308 C C   . LYS B 2 12  ? 21.894  49.778 -19.626 1.00 113.50 ? 14  LYS B C   1 
ATOM   3309 O O   . LYS B 2 12  ? 22.463  50.872 -19.530 1.00 110.01 ? 14  LYS B O   1 
ATOM   3310 C CB  . LYS B 2 12  ? 20.725  48.866 -17.598 1.00 105.09 ? 14  LYS B CB  1 
ATOM   3311 C CG  . LYS B 2 12  ? 19.553  49.073 -16.652 1.00 109.13 ? 14  LYS B CG  1 
ATOM   3312 C CD  . LYS B 2 12  ? 19.888  48.626 -15.239 1.00 108.42 ? 14  LYS B CD  1 
ATOM   3313 C CE  . LYS B 2 12  ? 18.769  48.980 -14.273 1.00 111.63 ? 14  LYS B CE  1 
ATOM   3314 N NZ  . LYS B 2 12  ? 19.136  48.680 -12.861 1.00 110.93 ? 14  LYS B NZ  1 
ATOM   3315 N N   . ALA B 2 13  ? 22.425  48.757 -20.304 1.00 107.19 ? 15  ALA B N   1 
ATOM   3316 C CA  . ALA B 2 13  ? 23.709  48.910 -20.979 1.00 110.44 ? 15  ALA B CA  1 
ATOM   3317 C C   . ALA B 2 13  ? 23.627  49.923 -22.113 1.00 116.56 ? 15  ALA B C   1 
ATOM   3318 O O   . ALA B 2 13  ? 24.611  50.615 -22.400 1.00 116.39 ? 15  ALA B O   1 
ATOM   3319 C CB  . ALA B 2 13  ? 24.193  47.558 -21.503 1.00 116.68 ? 15  ALA B CB  1 
ATOM   3320 N N   . ALA B 2 14  ? 22.470  50.020 -22.775 1.00 110.25 ? 16  ALA B N   1 
ATOM   3321 C CA  . ALA B 2 14  ? 22.314  50.989 -23.854 1.00 113.23 ? 16  ALA B CA  1 
ATOM   3322 C C   . ALA B 2 14  ? 22.387  52.421 -23.340 1.00 110.46 ? 16  ALA B C   1 
ATOM   3323 O O   . ALA B 2 14  ? 22.888  53.305 -24.043 1.00 111.08 ? 16  ALA B O   1 
ATOM   3324 C CB  . ALA B 2 14  ? 20.994  50.755 -24.588 1.00 119.28 ? 16  ALA B CB  1 
ATOM   3325 N N   . LEU B 2 15  ? 21.889  52.669 -22.127 1.00 119.46 ? 17  LEU B N   1 
ATOM   3326 C CA  . LEU B 2 15  ? 21.960  54.011 -21.558 1.00 111.68 ? 17  LEU B CA  1 
ATOM   3327 C C   . LEU B 2 15  ? 23.400  54.428 -21.288 1.00 109.08 ? 17  LEU B C   1 
ATOM   3328 O O   . LEU B 2 15  ? 23.787  55.567 -21.576 1.00 106.64 ? 17  LEU B O   1 
ATOM   3329 C CB  . LEU B 2 15  ? 21.140  54.077 -20.270 1.00 104.94 ? 17  LEU B CB  1 
ATOM   3330 C CG  . LEU B 2 15  ? 21.152  55.412 -19.521 1.00 103.40 ? 17  LEU B CG  1 
ATOM   3331 C CD1 . LEU B 2 15  ? 20.481  56.506 -20.337 1.00 107.88 ? 17  LEU B CD1 1 
ATOM   3332 C CD2 . LEU B 2 15  ? 20.493  55.264 -18.158 1.00 102.44 ? 17  LEU B CD2 1 
ATOM   3333 N N   . LEU B 2 16  ? 24.207  53.521 -20.733 1.00 107.78 ? 18  LEU B N   1 
ATOM   3334 C CA  . LEU B 2 16  ? 25.591  53.854 -20.414 1.00 105.16 ? 18  LEU B CA  1 
ATOM   3335 C C   . LEU B 2 16  ? 26.438  53.995 -21.672 1.00 113.25 ? 18  LEU B C   1 
ATOM   3336 O O   . LEU B 2 16  ? 27.321  54.859 -21.739 1.00 110.03 ? 18  LEU B O   1 
ATOM   3337 C CB  . LEU B 2 16  ? 26.184  52.793 -19.489 1.00 103.02 ? 18  LEU B CB  1 
ATOM   3338 C CG  . LEU B 2 16  ? 25.631  52.762 -18.065 1.00 95.95  ? 18  LEU B CG  1 
ATOM   3339 C CD1 . LEU B 2 16  ? 26.042  51.476 -17.371 1.00 94.26  ? 18  LEU B CD1 1 
ATOM   3340 C CD2 . LEU B 2 16  ? 26.102  53.976 -17.281 1.00 92.54  ? 18  LEU B CD2 1 
ATOM   3341 N N   . ALA B 2 17  ? 26.193  53.147 -22.675 1.00 109.98 ? 19  ALA B N   1 
ATOM   3342 C CA  . ALA B 2 17  ? 26.977  53.206 -23.905 1.00 117.50 ? 19  ALA B CA  1 
ATOM   3343 C C   . ALA B 2 17  ? 26.758  54.518 -24.647 1.00 115.73 ? 19  ALA B C   1 
ATOM   3344 O O   . ALA B 2 17  ? 27.697  55.074 -25.229 1.00 114.39 ? 19  ALA B O   1 
ATOM   3345 C CB  . ALA B 2 17  ? 26.631  52.018 -24.802 1.00 129.48 ? 19  ALA B CB  1 
ATOM   3346 N N   . ALA B 2 18  ? 25.524  55.029 -24.641 1.00 123.27 ? 20  ALA B N   1 
ATOM   3347 C CA  . ALA B 2 18  ? 25.260  56.309 -25.288 1.00 119.47 ? 20  ALA B CA  1 
ATOM   3348 C C   . ALA B 2 18  ? 25.941  57.460 -24.560 1.00 110.42 ? 20  ALA B C   1 
ATOM   3349 O O   . ALA B 2 18  ? 26.342  58.443 -25.194 1.00 107.35 ? 20  ALA B O   1 
ATOM   3350 C CB  . ALA B 2 18  ? 23.753  56.556 -25.375 1.00 120.21 ? 20  ALA B CB  1 
ATOM   3351 N N   . ARG B 2 19  ? 26.079  57.359 -23.238 1.00 123.82 ? 21  ARG B N   1 
ATOM   3352 C CA  . ARG B 2 19  ? 26.733  58.419 -22.478 1.00 115.81 ? 21  ARG B CA  1 
ATOM   3353 C C   . ARG B 2 19  ? 28.239  58.427 -22.719 1.00 115.34 ? 21  ARG B C   1 
ATOM   3354 O O   . ARG B 2 19  ? 28.822  59.476 -23.016 1.00 114.97 ? 21  ARG B O   1 
ATOM   3355 C CB  . ARG B 2 19  ? 26.416  58.268 -20.990 1.00 112.35 ? 21  ARG B CB  1 
ATOM   3356 C CG  . ARG B 2 19  ? 25.099  58.913 -20.584 1.00 117.04 ? 21  ARG B CG  1 
ATOM   3357 C CD  . ARG B 2 19  ? 25.330  60.145 -19.725 1.00 117.71 ? 21  ARG B CD  1 
ATOM   3358 N NE  . ARG B 2 19  ? 24.083  60.828 -19.393 1.00 122.40 ? 21  ARG B NE  1 
ATOM   3359 C CZ  . ARG B 2 19  ? 23.598  61.867 -20.066 1.00 129.99 ? 21  ARG B CZ  1 
ATOM   3360 N NH1 . ARG B 2 19  ? 24.254  62.348 -21.112 1.00 127.26 ? 21  ARG B NH1 1 
ATOM   3361 N NH2 . ARG B 2 19  ? 22.455  62.428 -19.691 1.00 128.18 ? 21  ARG B NH2 1 
ATOM   3362 N N   . GLY B 2 20  ? 28.886  57.270 -22.600 1.00 112.91 ? 22  GLY B N   1 
ATOM   3363 C CA  . GLY B 2 20  ? 30.321  57.193 -22.730 1.00 113.91 ? 22  GLY B CA  1 
ATOM   3364 C C   . GLY B 2 20  ? 30.799  55.964 -23.477 1.00 117.03 ? 22  GLY B C   1 
ATOM   3365 O O   . GLY B 2 20  ? 31.099  54.921 -22.886 1.00 115.67 ? 22  GLY B O   1 
ATOM   3366 N N   . PRO B 2 21  ? 30.878  56.067 -24.799 1.00 108.85 ? 23  PRO B N   1 
ATOM   3367 C CA  . PRO B 2 21  ? 31.397  54.962 -25.608 1.00 116.06 ? 23  PRO B CA  1 
ATOM   3368 C C   . PRO B 2 21  ? 32.919  54.896 -25.554 1.00 113.98 ? 23  PRO B C   1 
ATOM   3369 O O   . PRO B 2 21  ? 33.591  55.755 -24.982 1.00 109.66 ? 23  PRO B O   1 
ATOM   3370 C CB  . PRO B 2 21  ? 30.906  55.294 -27.020 1.00 126.04 ? 23  PRO B CB  1 
ATOM   3371 C CG  . PRO B 2 21  ? 30.762  56.777 -27.031 1.00 124.35 ? 23  PRO B CG  1 
ATOM   3372 C CD  . PRO B 2 21  ? 30.477  57.224 -25.620 1.00 112.57 ? 23  PRO B CD  1 
ATOM   3373 N N   . GLU B 2 22  ? 33.449  53.831 -26.153 1.00 116.72 ? 24  GLU B N   1 
ATOM   3374 C CA  . GLU B 2 22  ? 34.880  53.559 -26.285 1.00 114.87 ? 24  GLU B CA  1 
ATOM   3375 C C   . GLU B 2 22  ? 35.581  53.337 -24.949 1.00 110.15 ? 24  GLU B C   1 
ATOM   3376 O O   . GLU B 2 22  ? 36.814  53.253 -24.913 1.00 111.32 ? 24  GLU B O   1 
ATOM   3377 C CB  . GLU B 2 22  ? 35.597  54.682 -27.049 1.00 116.13 ? 24  GLU B CB  1 
ATOM   3378 C CG  . GLU B 2 22  ? 35.015  54.999 -28.418 1.00 127.22 ? 24  GLU B CG  1 
ATOM   3379 C CD  . GLU B 2 22  ? 35.559  54.099 -29.509 1.00 139.50 ? 24  GLU B CD  1 
ATOM   3380 O OE1 . GLU B 2 22  ? 34.786  53.271 -30.038 1.00 143.41 ? 24  GLU B OE1 1 
ATOM   3381 O OE2 . GLU B 2 22  ? 36.762  54.208 -29.829 1.00 135.91 ? 24  GLU B OE2 1 
ATOM   3382 N N   . GLU B 2 23  ? 34.838  53.232 -23.850 1.00 113.72 ? 25  GLU B N   1 
ATOM   3383 C CA  . GLU B 2 23  ? 35.429  53.058 -22.532 1.00 109.14 ? 25  GLU B CA  1 
ATOM   3384 C C   . GLU B 2 23  ? 34.736  51.918 -21.801 1.00 106.09 ? 25  GLU B C   1 
ATOM   3385 O O   . GLU B 2 23  ? 33.556  51.637 -22.028 1.00 107.44 ? 25  GLU B O   1 
ATOM   3386 C CB  . GLU B 2 23  ? 35.354  54.342 -21.690 1.00 107.03 ? 25  GLU B CB  1 
ATOM   3387 C CG  . GLU B 2 23  ? 33.951  54.768 -21.303 1.00 106.85 ? 25  GLU B CG  1 
ATOM   3388 C CD  . GLU B 2 23  ? 33.942  55.703 -20.110 1.00 109.54 ? 25  GLU B CD  1 
ATOM   3389 O OE1 . GLU B 2 23  ? 34.710  55.455 -19.155 1.00 105.34 ? 25  GLU B OE1 1 
ATOM   3390 O OE2 . GLU B 2 23  ? 33.173  56.688 -20.129 1.00 107.50 ? 25  GLU B OE2 1 
ATOM   3391 N N   . LEU B 2 24  ? 35.490  51.260 -20.924 1.00 99.30  ? 26  LEU B N   1 
ATOM   3392 C CA  . LEU B 2 24  ? 34.935  50.182 -20.119 1.00 96.48  ? 26  LEU B CA  1 
ATOM   3393 C C   . LEU B 2 24  ? 33.920  50.739 -19.129 1.00 92.97  ? 26  LEU B C   1 
ATOM   3394 O O   . LEU B 2 24  ? 34.223  51.657 -18.361 1.00 90.81  ? 26  LEU B O   1 
ATOM   3395 C CB  . LEU B 2 24  ? 36.050  49.447 -19.379 1.00 96.95  ? 26  LEU B CB  1 
ATOM   3396 C CG  . LEU B 2 24  ? 35.612  48.311 -18.454 1.00 96.86  ? 26  LEU B CG  1 
ATOM   3397 C CD1 . LEU B 2 24  ? 35.180  47.097 -19.264 1.00 104.59 ? 26  LEU B CD1 1 
ATOM   3398 C CD2 . LEU B 2 24  ? 36.727  47.941 -17.487 1.00 97.97  ? 26  LEU B CD2 1 
ATOM   3399 N N   . LEU B 2 25  ? 32.709  50.189 -19.154 1.00 95.87  ? 27  LEU B N   1 
ATOM   3400 C CA  . LEU B 2 25  ? 31.616  50.643 -18.307 1.00 92.03  ? 27  LEU B CA  1 
ATOM   3401 C C   . LEU B 2 25  ? 31.201  49.516 -17.373 1.00 95.40  ? 27  LEU B C   1 
ATOM   3402 O O   . LEU B 2 25  ? 30.955  48.392 -17.822 1.00 103.49 ? 27  LEU B O   1 
ATOM   3403 C CB  . LEU B 2 25  ? 30.422  51.098 -19.150 1.00 96.38  ? 27  LEU B CB  1 
ATOM   3404 C CG  . LEU B 2 25  ? 30.659  52.288 -20.081 1.00 96.45  ? 27  LEU B CG  1 
ATOM   3405 C CD1 . LEU B 2 25  ? 29.675  52.267 -21.243 1.00 104.93 ? 27  LEU B CD1 1 
ATOM   3406 C CD2 . LEU B 2 25  ? 30.566  53.598 -19.313 1.00 91.05  ? 27  LEU B CD2 1 
ATOM   3407 N N   . CYS B 2 26  ? 31.121  49.821 -16.079 1.00 87.74  ? 28  CYS B N   1 
ATOM   3408 C CA  . CYS B 2 26  ? 30.700  48.868 -15.062 1.00 90.37  ? 28  CYS B CA  1 
ATOM   3409 C C   . CYS B 2 26  ? 29.547  49.458 -14.266 1.00 87.67  ? 28  CYS B C   1 
ATOM   3410 O O   . CYS B 2 26  ? 29.586  50.630 -13.881 1.00 81.15  ? 28  CYS B O   1 
ATOM   3411 C CB  . CYS B 2 26  ? 31.852  48.515 -14.117 1.00 87.19  ? 28  CYS B CB  1 
ATOM   3412 S SG  . CYS B 2 26  ? 33.310  47.810 -14.920 1.00 91.42  ? 28  CYS B SG  1 
ATOM   3413 N N   . PHE B 2 27  ? 28.526  48.640 -14.010 1.00 84.10  ? 29  PHE B N   1 
ATOM   3414 C CA  . PHE B 2 27  ? 27.339  49.088 -13.296 1.00 80.89  ? 29  PHE B CA  1 
ATOM   3415 C C   . PHE B 2 27  ? 26.832  47.967 -12.401 1.00 88.09  ? 29  PHE B C   1 
ATOM   3416 O O   . PHE B 2 27  ? 27.143  46.791 -12.606 1.00 96.36  ? 29  PHE B O   1 
ATOM   3417 C CB  . PHE B 2 27  ? 26.235  49.537 -14.265 1.00 82.23  ? 29  PHE B CB  1 
ATOM   3418 C CG  . PHE B 2 27  ? 25.618  48.411 -15.049 1.00 92.95  ? 29  PHE B CG  1 
ATOM   3419 C CD1 . PHE B 2 27  ? 26.251  47.901 -16.171 1.00 100.55 ? 29  PHE B CD1 1 
ATOM   3420 C CD2 . PHE B 2 27  ? 24.402  47.869 -14.668 1.00 95.78  ? 29  PHE B CD2 1 
ATOM   3421 C CE1 . PHE B 2 27  ? 25.686  46.867 -16.893 1.00 109.97 ? 29  PHE B CE1 1 
ATOM   3422 C CE2 . PHE B 2 27  ? 23.831  46.835 -15.386 1.00 104.22 ? 29  PHE B CE2 1 
ATOM   3423 C CZ  . PHE B 2 27  ? 24.473  46.333 -16.500 1.00 110.38 ? 29  PHE B CZ  1 
ATOM   3424 N N   . THR B 2 28  ? 26.036  48.346 -11.401 1.00 90.11  ? 30  THR B N   1 
ATOM   3425 C CA  . THR B 2 28  ? 25.462  47.395 -10.453 1.00 94.46  ? 30  THR B CA  1 
ATOM   3426 C C   . THR B 2 28  ? 24.027  47.797 -10.151 1.00 91.71  ? 30  THR B C   1 
ATOM   3427 O O   . THR B 2 28  ? 23.782  48.928 -9.719  1.00 84.82  ? 30  THR B O   1 
ATOM   3428 C CB  . THR B 2 28  ? 26.262  47.346 -9.143  1.00 95.27  ? 30  THR B CB  1 
ATOM   3429 O OG1 . THR B 2 28  ? 26.074  48.570 -8.422  1.00 85.30  ? 30  THR B OG1 1 
ATOM   3430 C CG2 . THR B 2 28  ? 27.748  47.149 -9.400  1.00 96.14  ? 30  THR B CG2 1 
ATOM   3431 N N   . GLU B 2 29  ? 23.080  46.883 -10.377 1.00 97.67  ? 31  GLU B N   1 
ATOM   3432 C CA  . GLU B 2 29  ? 21.716  47.148 -9.932  1.00 93.81  ? 31  GLU B CA  1 
ATOM   3433 C C   . GLU B 2 29  ? 21.629  47.076 -8.414  1.00 93.02  ? 31  GLU B C   1 
ATOM   3434 O O   . GLU B 2 29  ? 20.964  47.904 -7.781  1.00 92.03  ? 31  GLU B O   1 
ATOM   3435 C CB  . GLU B 2 29  ? 20.729  46.174 -10.579 1.00 99.93  ? 31  GLU B CB  1 
ATOM   3436 C CG  . GLU B 2 29  ? 20.955  45.923 -12.059 1.00 106.14 ? 31  GLU B CG  1 
ATOM   3437 C CD  . GLU B 2 29  ? 19.902  45.008 -12.652 1.00 118.14 ? 31  GLU B CD  1 
ATOM   3438 O OE1 . GLU B 2 29  ? 19.093  44.451 -11.879 1.00 123.79 ? 31  GLU B OE1 1 
ATOM   3439 O OE2 . GLU B 2 29  ? 19.888  44.839 -13.890 1.00 114.58 ? 31  GLU B OE2 1 
ATOM   3440 N N   . ARG B 2 30  ? 22.300  46.095 -7.815  1.00 92.53  ? 32  ARG B N   1 
ATOM   3441 C CA  . ARG B 2 30  ? 22.432  45.987 -6.372  1.00 92.43  ? 32  ARG B CA  1 
ATOM   3442 C C   . ARG B 2 30  ? 23.898  45.772 -6.023  1.00 97.92  ? 32  ARG B C   1 
ATOM   3443 O O   . ARG B 2 30  ? 24.717  45.421 -6.877  1.00 101.47 ? 32  ARG B O   1 
ATOM   3444 C CB  . ARG B 2 30  ? 21.580  44.842 -5.806  1.00 96.77  ? 32  ARG B CB  1 
ATOM   3445 C CG  . ARG B 2 30  ? 20.083  45.056 -5.949  1.00 97.10  ? 32  ARG B CG  1 
ATOM   3446 C CD  . ARG B 2 30  ? 19.293  43.835 -5.505  1.00 104.96 ? 32  ARG B CD  1 
ATOM   3447 N NE  . ARG B 2 30  ? 17.857  44.046 -5.658  1.00 110.33 ? 32  ARG B NE  1 
ATOM   3448 C CZ  . ARG B 2 30  ? 17.196  43.877 -6.798  1.00 117.46 ? 32  ARG B CZ  1 
ATOM   3449 N NH1 . ARG B 2 30  ? 17.842  43.492 -7.891  1.00 112.19 ? 32  ARG B NH1 1 
ATOM   3450 N NH2 . ARG B 2 30  ? 15.890  44.096 -6.847  1.00 117.63 ? 32  ARG B NH2 1 
ATOM   3451 N N   . LEU B 2 31  ? 24.223  46.008 -4.749  1.00 94.51  ? 33  LEU B N   1 
ATOM   3452 C CA  . LEU B 2 31  ? 25.604  45.874 -4.293  1.00 98.04  ? 33  LEU B CA  1 
ATOM   3453 C C   . LEU B 2 31  ? 26.141  44.464 -4.505  1.00 108.52 ? 33  LEU B C   1 
ATOM   3454 O O   . LEU B 2 31  ? 27.357  44.275 -4.623  1.00 111.38 ? 33  LEU B O   1 
ATOM   3455 C CB  . LEU B 2 31  ? 25.707  46.269 -2.820  1.00 97.28  ? 33  LEU B CB  1 
ATOM   3456 C CG  . LEU B 2 31  ? 25.270  47.699 -2.503  1.00 87.96  ? 33  LEU B CG  1 
ATOM   3457 C CD1 . LEU B 2 31  ? 25.334  47.967 -1.007  1.00 88.37  ? 33  LEU B CD1 1 
ATOM   3458 C CD2 . LEU B 2 31  ? 26.127  48.694 -3.270  1.00 80.60  ? 33  LEU B CD2 1 
ATOM   3459 N N   . GLU B 2 32  ? 25.256  43.463 -4.539  1.00 97.42  ? 34  GLU B N   1 
ATOM   3460 C CA  . GLU B 2 32  ? 25.702  42.076 -4.636  1.00 103.63 ? 34  GLU B CA  1 
ATOM   3461 C C   . GLU B 2 32  ? 26.330  41.782 -5.994  1.00 105.58 ? 34  GLU B C   1 
ATOM   3462 O O   . GLU B 2 32  ? 27.328  41.057 -6.076  1.00 107.82 ? 34  GLU B O   1 
ATOM   3463 C CB  . GLU B 2 32  ? 24.532  41.126 -4.373  1.00 105.57 ? 34  GLU B CB  1 
ATOM   3464 C CG  . GLU B 2 32  ? 24.950  39.686 -4.101  1.00 114.05 ? 34  GLU B CG  1 
ATOM   3465 C CD  . GLU B 2 32  ? 23.771  38.728 -4.057  1.00 122.01 ? 34  GLU B CD  1 
ATOM   3466 O OE1 . GLU B 2 32  ? 23.053  38.618 -5.074  1.00 119.36 ? 34  GLU B OE1 1 
ATOM   3467 O OE2 . GLU B 2 32  ? 23.560  38.087 -3.005  1.00 122.35 ? 34  GLU B OE2 1 
ATOM   3468 N N   . ASP B 2 33  ? 25.760  42.319 -7.067  1.00 103.02 ? 35  ASP B N   1 
ATOM   3469 C CA  . ASP B 2 33  ? 26.190  41.994 -8.418  1.00 104.53 ? 35  ASP B CA  1 
ATOM   3470 C C   . ASP B 2 33  ? 27.071  43.102 -8.985  1.00 103.03 ? 35  ASP B C   1 
ATOM   3471 O O   . ASP B 2 33  ? 27.220  44.177 -8.399  1.00 98.85  ? 35  ASP B O   1 
ATOM   3472 C CB  . ASP B 2 33  ? 24.977  41.769 -9.323  1.00 105.21 ? 35  ASP B CB  1 
ATOM   3473 C CG  . ASP B 2 33  ? 24.268  43.062 -9.672  1.00 102.19 ? 35  ASP B CG  1 
ATOM   3474 O OD1 . ASP B 2 33  ? 23.515  43.573 -8.816  1.00 99.85  ? 35  ASP B OD1 1 
ATOM   3475 O OD2 . ASP B 2 33  ? 24.485  43.582 -10.787 1.00 101.43 ? 35  ASP B OD2 1 
ATOM   3476 N N   . LEU B 2 34  ? 27.649  42.825 -10.157 1.00 97.33  ? 36  LEU B N   1 
ATOM   3477 C CA  . LEU B 2 34  ? 28.468  43.790 -10.885 1.00 94.57  ? 36  LEU B CA  1 
ATOM   3478 C C   . LEU B 2 34  ? 28.721  43.297 -12.306 1.00 97.96  ? 36  LEU B C   1 
ATOM   3479 O O   . LEU B 2 34  ? 29.166  42.162 -12.502 1.00 100.18 ? 36  LEU B O   1 
ATOM   3480 C CB  . LEU B 2 34  ? 29.797  44.040 -10.166 1.00 88.72  ? 36  LEU B CB  1 
ATOM   3481 C CG  . LEU B 2 34  ? 30.701  45.105 -10.794 1.00 81.90  ? 36  LEU B CG  1 
ATOM   3482 C CD1 . LEU B 2 34  ? 31.150  46.127 -9.760  1.00 75.87  ? 36  LEU B CD1 1 
ATOM   3483 C CD2 . LEU B 2 34  ? 31.900  44.470 -11.468 1.00 82.90  ? 36  LEU B CD2 1 
ATOM   3484 N N   . VAL B 2 35  ? 28.440  44.137 -13.301 1.00 93.05  ? 37  VAL B N   1 
ATOM   3485 C CA  . VAL B 2 35  ? 28.589  43.782 -14.708 1.00 96.07  ? 37  VAL B CA  1 
ATOM   3486 C C   . VAL B 2 35  ? 29.447  44.840 -15.385 1.00 90.23  ? 37  VAL B C   1 
ATOM   3487 O O   . VAL B 2 35  ? 29.194  46.040 -15.233 1.00 84.25  ? 37  VAL B O   1 
ATOM   3488 C CB  . VAL B 2 35  ? 27.226  43.665 -15.419 1.00 100.19 ? 37  VAL B CB  1 
ATOM   3489 C CG1 . VAL B 2 35  ? 27.414  43.196 -16.852 1.00 103.68 ? 37  VAL B CG1 1 
ATOM   3490 C CG2 . VAL B 2 35  ? 26.303  42.721 -14.663 1.00 100.34 ? 37  VAL B CG2 1 
ATOM   3491 N N   . CYS B 2 36  ? 30.462  44.398 -16.126 1.00 100.83 ? 38  CYS B N   1 
ATOM   3492 C CA  . CYS B 2 36  ? 31.332  45.282 -16.891 1.00 96.13  ? 38  CYS B CA  1 
ATOM   3493 C C   . CYS B 2 36  ? 31.242  44.918 -18.367 1.00 103.47 ? 38  CYS B C   1 
ATOM   3494 O O   . CYS B 2 36  ? 31.280  43.734 -18.719 1.00 108.70 ? 38  CYS B O   1 
ATOM   3495 C CB  . CYS B 2 36  ? 32.782  45.188 -16.409 1.00 91.30  ? 38  CYS B CB  1 
ATOM   3496 S SG  . CYS B 2 36  ? 33.084  45.798 -14.726 1.00 84.33  ? 38  CYS B SG  1 
ATOM   3497 N N   . PHE B 2 37  ? 31.111  45.932 -19.222 1.00 100.08 ? 39  PHE B N   1 
ATOM   3498 C CA  . PHE B 2 37  ? 30.995  45.713 -20.658 1.00 106.12 ? 39  PHE B CA  1 
ATOM   3499 C C   . PHE B 2 37  ? 31.682  46.844 -21.409 1.00 103.75 ? 39  PHE B C   1 
ATOM   3500 O O   . PHE B 2 37  ? 31.968  47.906 -20.851 1.00 96.35  ? 39  PHE B O   1 
ATOM   3501 C CB  . PHE B 2 37  ? 29.528  45.598 -21.095 1.00 112.85 ? 39  PHE B CB  1 
ATOM   3502 C CG  . PHE B 2 37  ? 28.763  46.886 -21.000 1.00 109.95 ? 39  PHE B CG  1 
ATOM   3503 C CD1 . PHE B 2 37  ? 28.265  47.320 -19.783 1.00 105.14 ? 39  PHE B CD1 1 
ATOM   3504 C CD2 . PHE B 2 37  ? 28.533  47.658 -22.127 1.00 112.63 ? 39  PHE B CD2 1 
ATOM   3505 C CE1 . PHE B 2 37  ? 27.559  48.501 -19.690 1.00 100.17 ? 39  PHE B CE1 1 
ATOM   3506 C CE2 . PHE B 2 37  ? 27.827  48.842 -22.040 1.00 109.30 ? 39  PHE B CE2 1 
ATOM   3507 C CZ  . PHE B 2 37  ? 27.339  49.264 -20.819 1.00 101.59 ? 39  PHE B CZ  1 
ATOM   3508 N N   . TRP B 2 38  ? 31.938  46.601 -22.694 1.00 97.78  ? 40  TRP B N   1 
ATOM   3509 C CA  . TRP B 2 38  ? 32.477  47.623 -23.582 1.00 96.63  ? 40  TRP B CA  1 
ATOM   3510 C C   . TRP B 2 38  ? 32.091  47.266 -25.010 1.00 105.13 ? 40  TRP B C   1 
ATOM   3511 O O   . TRP B 2 38  ? 32.067  46.087 -25.372 1.00 109.70 ? 40  TRP B O   1 
ATOM   3512 C CB  . TRP B 2 38  ? 34.001  47.751 -23.453 1.00 91.60  ? 40  TRP B CB  1 
ATOM   3513 C CG  . TRP B 2 38  ? 34.784  46.684 -24.164 1.00 95.94  ? 40  TRP B CG  1 
ATOM   3514 C CD1 . TRP B 2 38  ? 35.238  46.724 -25.452 1.00 100.15 ? 40  TRP B CD1 1 
ATOM   3515 C CD2 . TRP B 2 38  ? 35.218  45.428 -23.627 1.00 96.70  ? 40  TRP B CD2 1 
ATOM   3516 N NE1 . TRP B 2 38  ? 35.921  45.571 -25.750 1.00 103.44 ? 40  TRP B NE1 1 
ATOM   3517 C CE2 . TRP B 2 38  ? 35.924  44.759 -24.647 1.00 101.56 ? 40  TRP B CE2 1 
ATOM   3518 C CE3 . TRP B 2 38  ? 35.077  44.804 -22.384 1.00 94.51  ? 40  TRP B CE3 1 
ATOM   3519 C CZ2 . TRP B 2 38  ? 36.487  43.498 -24.463 1.00 104.28 ? 40  TRP B CZ2 1 
ATOM   3520 C CZ3 . TRP B 2 38  ? 35.637  43.550 -22.203 1.00 97.35  ? 40  TRP B CZ3 1 
ATOM   3521 C CH2 . TRP B 2 38  ? 36.333  42.912 -23.237 1.00 102.17 ? 40  TRP B CH2 1 
ATOM   3522 N N   . GLU B 2 39  ? 31.786  48.284 -25.810 1.00 100.25 ? 41  GLU B N   1 
ATOM   3523 C CA  . GLU B 2 39  ? 31.380  48.089 -27.196 1.00 108.67 ? 41  GLU B CA  1 
ATOM   3524 C C   . GLU B 2 39  ? 32.582  48.289 -28.110 1.00 109.08 ? 41  GLU B C   1 
ATOM   3525 O O   . GLU B 2 39  ? 33.200  49.359 -28.112 1.00 106.26 ? 41  GLU B O   1 
ATOM   3526 C CB  . GLU B 2 39  ? 30.253  49.050 -27.570 1.00 112.31 ? 41  GLU B CB  1 
ATOM   3527 C CG  . GLU B 2 39  ? 28.932  48.739 -26.896 1.00 114.21 ? 41  GLU B CG  1 
ATOM   3528 C CD  . GLU B 2 39  ? 27.803  49.603 -27.414 1.00 117.40 ? 41  GLU B CD  1 
ATOM   3529 O OE1 . GLU B 2 39  ? 28.019  50.333 -28.404 1.00 119.70 ? 41  GLU B OE1 1 
ATOM   3530 O OE2 . GLU B 2 39  ? 26.698  49.549 -26.835 1.00 114.74 ? 41  GLU B OE2 1 
ATOM   3531 N N   . GLU B 2 40  ? 32.904  47.255 -28.881 1.00 118.84 ? 42  GLU B N   1 
ATOM   3532 C CA  . GLU B 2 40  ? 34.027  47.250 -29.806 1.00 120.11 ? 42  GLU B CA  1 
ATOM   3533 C C   . GLU B 2 40  ? 33.527  46.894 -31.199 1.00 127.09 ? 42  GLU B C   1 
ATOM   3534 O O   . GLU B 2 40  ? 32.558  46.146 -31.351 1.00 129.92 ? 42  GLU B O   1 
ATOM   3535 C CB  . GLU B 2 40  ? 35.116  46.262 -29.364 1.00 117.65 ? 42  GLU B CB  1 
ATOM   3536 C CG  . GLU B 2 40  ? 36.360  46.271 -30.235 1.00 118.57 ? 42  GLU B CG  1 
ATOM   3537 C CD  . GLU B 2 40  ? 37.437  45.342 -29.719 1.00 118.25 ? 42  GLU B CD  1 
ATOM   3538 O OE1 . GLU B 2 40  ? 37.199  44.670 -28.693 1.00 111.10 ? 42  GLU B OE1 1 
ATOM   3539 O OE2 . GLU B 2 40  ? 38.520  45.280 -30.339 1.00 122.01 ? 42  GLU B OE2 1 
ATOM   3540 N N   . ALA B 2 41  ? 34.184  47.448 -32.216 1.00 132.38 ? 43  ALA B N   1 
ATOM   3541 C CA  . ALA B 2 41  ? 33.793  47.165 -33.589 1.00 134.77 ? 43  ALA B CA  1 
ATOM   3542 C C   . ALA B 2 41  ? 34.022  45.691 -33.915 1.00 134.60 ? 43  ALA B C   1 
ATOM   3543 O O   . ALA B 2 41  ? 34.950  45.054 -33.409 1.00 133.47 ? 43  ALA B O   1 
ATOM   3544 C CB  . ALA B 2 41  ? 34.574  48.048 -34.562 1.00 140.38 ? 43  ALA B CB  1 
ATOM   3545 N N   . ALA B 2 42  ? 33.158  45.154 -34.774 1.00 133.49 ? 44  ALA B N   1 
ATOM   3546 C CA  . ALA B 2 42  ? 33.138  43.720 -35.038 1.00 131.72 ? 44  ALA B CA  1 
ATOM   3547 C C   . ALA B 2 42  ? 34.397  43.270 -35.770 1.00 135.61 ? 44  ALA B C   1 
ATOM   3548 O O   . ALA B 2 42  ? 34.778  43.848 -36.793 1.00 139.39 ? 44  ALA B O   1 
ATOM   3549 C CB  . ALA B 2 42  ? 31.898  43.353 -35.851 1.00 132.18 ? 44  ALA B CB  1 
ATOM   3550 N N   . SER B 2 43  ? 35.043  42.234 -35.236 1.00 132.64 ? 45  SER B N   1 
ATOM   3551 C CA  . SER B 2 43  ? 36.202  41.605 -35.855 1.00 134.65 ? 45  SER B CA  1 
ATOM   3552 C C   . SER B 2 43  ? 35.859  40.157 -36.174 1.00 133.85 ? 45  SER B C   1 
ATOM   3553 O O   . SER B 2 43  ? 35.387  39.421 -35.301 1.00 129.74 ? 45  SER B O   1 
ATOM   3554 C CB  . SER B 2 43  ? 37.429  41.675 -34.939 1.00 135.23 ? 45  SER B CB  1 
ATOM   3555 O OG  . SER B 2 43  ? 37.794  43.017 -34.673 1.00 139.88 ? 45  SER B OG  1 
ATOM   3556 N N   . ALA B 2 44  ? 36.096  39.752 -37.426 1.00 131.64 ? 46  ALA B N   1 
ATOM   3557 C CA  . ALA B 2 44  ? 35.749  38.398 -37.849 1.00 130.02 ? 46  ALA B CA  1 
ATOM   3558 C C   . ALA B 2 44  ? 36.596  37.343 -37.148 1.00 128.45 ? 46  ALA B C   1 
ATOM   3559 O O   . ALA B 2 44  ? 36.151  36.199 -36.991 1.00 125.56 ? 46  ALA B O   1 
ATOM   3560 C CB  . ALA B 2 44  ? 35.891  38.268 -39.365 1.00 134.29 ? 46  ALA B CB  1 
ATOM   3561 N N   . GLY B 2 45  ? 37.806  37.697 -36.724 1.00 127.97 ? 47  GLY B N   1 
ATOM   3562 C CA  . GLY B 2 45  ? 38.687  36.753 -36.060 1.00 124.75 ? 47  GLY B CA  1 
ATOM   3563 C C   . GLY B 2 45  ? 38.173  36.283 -34.713 1.00 118.18 ? 47  GLY B C   1 
ATOM   3564 O O   . GLY B 2 45  ? 37.868  37.093 -33.837 1.00 115.13 ? 47  GLY B O   1 
ATOM   3565 N N   . GLY B 2 49  ? 37.108  34.602 -27.181 1.00 97.07  ? 51  GLY B N   1 
ATOM   3566 C CA  . GLY B 2 49  ? 38.345  34.342 -26.467 1.00 96.77  ? 51  GLY B CA  1 
ATOM   3567 C C   . GLY B 2 49  ? 39.468  35.283 -26.855 1.00 101.80 ? 51  GLY B C   1 
ATOM   3568 O O   . GLY B 2 49  ? 40.637  35.022 -26.571 1.00 102.39 ? 51  GLY B O   1 
ATOM   3569 N N   . GLN B 2 50  ? 39.110  36.389 -27.510 1.00 94.27  ? 52  GLN B N   1 
ATOM   3570 C CA  . GLN B 2 50  ? 40.123  37.348 -27.936 1.00 98.27  ? 52  GLN B CA  1 
ATOM   3571 C C   . GLN B 2 50  ? 40.679  38.139 -26.759 1.00 99.12  ? 52  GLN B C   1 
ATOM   3572 O O   . GLN B 2 50  ? 41.827  38.594 -26.808 1.00 101.86 ? 52  GLN B O   1 
ATOM   3573 C CB  . GLN B 2 50  ? 39.543  38.295 -28.986 1.00 101.77 ? 52  GLN B CB  1 
ATOM   3574 N N   . TYR B 2 51  ? 39.888  38.317 -25.704 1.00 93.22  ? 53  TYR B N   1 
ATOM   3575 C CA  . TYR B 2 51  ? 40.285  39.118 -24.557 1.00 92.67  ? 53  TYR B CA  1 
ATOM   3576 C C   . TYR B 2 51  ? 40.131  38.306 -23.278 1.00 89.49  ? 53  TYR B C   1 
ATOM   3577 O O   . TYR B 2 51  ? 39.376  37.331 -23.221 1.00 86.48  ? 53  TYR B O   1 
ATOM   3578 C CB  . TYR B 2 51  ? 39.459  40.409 -24.470 1.00 93.59  ? 53  TYR B CB  1 
ATOM   3579 C CG  . TYR B 2 51  ? 39.570  41.281 -25.700 1.00 98.72  ? 53  TYR B CG  1 
ATOM   3580 C CD1 . TYR B 2 51  ? 40.567  42.239 -25.807 1.00 103.41 ? 53  TYR B CD1 1 
ATOM   3581 C CD2 . TYR B 2 51  ? 38.678  41.143 -26.757 1.00 99.46  ? 53  TYR B CD2 1 
ATOM   3582 C CE1 . TYR B 2 51  ? 40.674  43.037 -26.928 1.00 108.20 ? 53  TYR B CE1 1 
ATOM   3583 C CE2 . TYR B 2 51  ? 38.777  41.937 -27.883 1.00 103.95 ? 53  TYR B CE2 1 
ATOM   3584 C CZ  . TYR B 2 51  ? 39.778  42.882 -27.962 1.00 110.27 ? 53  TYR B CZ  1 
ATOM   3585 O OH  . TYR B 2 51  ? 39.888  43.678 -29.078 1.00 114.70 ? 53  TYR B OH  1 
ATOM   3586 N N   . SER B 2 52  ? 40.860  38.725 -22.243 1.00 89.44  ? 54  SER B N   1 
ATOM   3587 C CA  . SER B 2 52  ? 40.834  38.072 -20.939 1.00 85.95  ? 54  SER B CA  1 
ATOM   3588 C C   . SER B 2 52  ? 40.549  39.118 -19.873 1.00 85.63  ? 54  SER B C   1 
ATOM   3589 O O   . SER B 2 52  ? 41.264  40.121 -19.776 1.00 87.96  ? 54  SER B O   1 
ATOM   3590 C CB  . SER B 2 52  ? 42.157  37.358 -20.646 1.00 88.25  ? 54  SER B CB  1 
ATOM   3591 O OG  . SER B 2 52  ? 43.230  38.280 -20.573 1.00 94.18  ? 54  SER B OG  1 
ATOM   3592 N N   . PHE B 2 53  ? 39.511  38.882 -19.076 1.00 82.77  ? 55  PHE B N   1 
ATOM   3593 C CA  . PHE B 2 53  ? 39.094  39.798 -18.023 1.00 80.86  ? 55  PHE B CA  1 
ATOM   3594 C C   . PHE B 2 53  ? 39.711  39.348 -16.704 1.00 80.47  ? 55  PHE B C   1 
ATOM   3595 O O   . PHE B 2 53  ? 39.529  38.198 -16.291 1.00 78.52  ? 55  PHE B O   1 
ATOM   3596 C CB  . PHE B 2 53  ? 37.569  39.838 -17.926 1.00 78.47  ? 55  PHE B CB  1 
ATOM   3597 C CG  . PHE B 2 53  ? 37.035  41.050 -17.221 1.00 77.78  ? 55  PHE B CG  1 
ATOM   3598 C CD1 . PHE B 2 53  ? 36.741  42.202 -17.931 1.00 80.32  ? 55  PHE B CD1 1 
ATOM   3599 C CD2 . PHE B 2 53  ? 36.808  41.033 -15.856 1.00 76.05  ? 55  PHE B CD2 1 
ATOM   3600 C CE1 . PHE B 2 53  ? 36.242  43.322 -17.291 1.00 80.26  ? 55  PHE B CE1 1 
ATOM   3601 C CE2 . PHE B 2 53  ? 36.308  42.150 -15.209 1.00 75.20  ? 55  PHE B CE2 1 
ATOM   3602 C CZ  . PHE B 2 53  ? 36.025  43.295 -15.929 1.00 76.92  ? 55  PHE B CZ  1 
ATOM   3603 N N   . SER B 2 54  ? 40.438  40.251 -16.048 1.00 79.17  ? 56  SER B N   1 
ATOM   3604 C CA  . SER B 2 54  ? 41.096  39.968 -14.778 1.00 78.21  ? 56  SER B CA  1 
ATOM   3605 C C   . SER B 2 54  ? 40.654  40.991 -13.742 1.00 77.64  ? 56  SER B C   1 
ATOM   3606 O O   . SER B 2 54  ? 40.640  42.194 -14.020 1.00 78.95  ? 56  SER B O   1 
ATOM   3607 C CB  . SER B 2 54  ? 42.619  39.987 -14.930 1.00 82.84  ? 56  SER B CB  1 
ATOM   3608 O OG  . SER B 2 54  ? 43.041  39.076 -15.929 1.00 87.11  ? 56  SER B OG  1 
ATOM   3609 N N   . TYR B 2 55  ? 40.299  40.510 -12.552 1.00 79.27  ? 57  TYR B N   1 
ATOM   3610 C CA  . TYR B 2 55  ? 39.845  41.365 -11.466 1.00 77.26  ? 57  TYR B CA  1 
ATOM   3611 C C   . TYR B 2 55  ? 40.497  40.922 -10.165 1.00 77.60  ? 57  TYR B C   1 
ATOM   3612 O O   . TYR B 2 55  ? 40.832  39.747 -9.991  1.00 77.19  ? 57  TYR B O   1 
ATOM   3613 C CB  . TYR B 2 55  ? 38.315  41.335 -11.327 1.00 74.53  ? 57  TYR B CB  1 
ATOM   3614 C CG  . TYR B 2 55  ? 37.754  40.004 -10.867 1.00 73.10  ? 57  TYR B CG  1 
ATOM   3615 C CD1 . TYR B 2 55  ? 37.468  38.996 -11.778 1.00 74.13  ? 57  TYR B CD1 1 
ATOM   3616 C CD2 . TYR B 2 55  ? 37.503  39.760 -9.522  1.00 71.50  ? 57  TYR B CD2 1 
ATOM   3617 C CE1 . TYR B 2 55  ? 36.954  37.780 -11.362 1.00 73.16  ? 57  TYR B CE1 1 
ATOM   3618 C CE2 . TYR B 2 55  ? 36.992  38.548 -9.098  1.00 70.64  ? 57  TYR B CE2 1 
ATOM   3619 C CZ  . TYR B 2 55  ? 36.719  37.563 -10.022 1.00 73.52  ? 57  TYR B CZ  1 
ATOM   3620 O OH  . TYR B 2 55  ? 36.208  36.358 -9.602  1.00 72.81  ? 57  TYR B OH  1 
ATOM   3621 N N   . GLN B 2 56  ? 40.681  41.875 -9.253  1.00 72.39  ? 58  GLN B N   1 
ATOM   3622 C CA  . GLN B 2 56  ? 41.305  41.593 -7.967  1.00 72.24  ? 58  GLN B CA  1 
ATOM   3623 C C   . GLN B 2 56  ? 40.623  42.410 -6.880  1.00 70.72  ? 58  GLN B C   1 
ATOM   3624 O O   . GLN B 2 56  ? 40.423  43.617 -7.040  1.00 71.56  ? 58  GLN B O   1 
ATOM   3625 C CB  . GLN B 2 56  ? 42.806  41.902 -8.008  1.00 75.92  ? 58  GLN B CB  1 
ATOM   3626 C CG  . GLN B 2 56  ? 43.588  41.352 -6.832  1.00 80.07  ? 58  GLN B CG  1 
ATOM   3627 C CD  . GLN B 2 56  ? 43.944  42.419 -5.817  1.00 86.22  ? 58  GLN B CD  1 
ATOM   3628 O OE1 . GLN B 2 56  ? 43.835  43.615 -6.091  1.00 85.73  ? 58  GLN B OE1 1 
ATOM   3629 N NE2 . GLN B 2 56  ? 44.361  41.992 -4.630  1.00 83.08  ? 58  GLN B NE2 1 
ATOM   3630 N N   . LEU B 2 57  ? 40.283  41.752 -5.774  1.00 82.43  ? 59  LEU B N   1 
ATOM   3631 C CA  . LEU B 2 57  ? 39.633  42.380 -4.636  1.00 81.27  ? 59  LEU B CA  1 
ATOM   3632 C C   . LEU B 2 57  ? 40.689  42.754 -3.596  1.00 83.30  ? 59  LEU B C   1 
ATOM   3633 O O   . LEU B 2 57  ? 41.886  42.526 -3.780  1.00 85.55  ? 59  LEU B O   1 
ATOM   3634 C CB  . LEU B 2 57  ? 38.567  41.444 -4.056  1.00 78.72  ? 59  LEU B CB  1 
ATOM   3635 C CG  . LEU B 2 57  ? 37.463  42.000 -3.145  1.00 78.62  ? 59  LEU B CG  1 
ATOM   3636 C CD1 . LEU B 2 57  ? 36.514  42.916 -3.908  1.00 80.37  ? 59  LEU B CD1 1 
ATOM   3637 C CD2 . LEU B 2 57  ? 36.702  40.865 -2.469  1.00 75.66  ? 59  LEU B CD2 1 
ATOM   3638 N N   . GLU B 2 58  ? 40.241  43.316 -2.477  1.00 79.85  ? 60  GLU B N   1 
ATOM   3639 C CA  . GLU B 2 58  ? 41.162  43.706 -1.420  1.00 81.32  ? 60  GLU B CA  1 
ATOM   3640 C C   . GLU B 2 58  ? 41.593  42.475 -0.635  1.00 82.16  ? 60  GLU B C   1 
ATOM   3641 O O   . GLU B 2 58  ? 40.753  41.676 -0.206  1.00 79.80  ? 60  GLU B O   1 
ATOM   3642 C CB  . GLU B 2 58  ? 40.515  44.725 -0.482  1.00 94.46  ? 60  GLU B CB  1 
ATOM   3643 C CG  . GLU B 2 58  ? 41.497  45.648 0.237   1.00 98.54  ? 60  GLU B CG  1 
ATOM   3644 C CD  . GLU B 2 58  ? 42.010  46.779 -0.643  1.00 100.90 ? 60  GLU B CD  1 
ATOM   3645 O OE1 . GLU B 2 58  ? 41.642  46.831 -1.837  1.00 99.39  ? 60  GLU B OE1 1 
ATOM   3646 O OE2 . GLU B 2 58  ? 42.782  47.624 -0.136  1.00 104.67 ? 60  GLU B OE2 1 
ATOM   3647 N N   . ASP B 2 59  ? 42.907  42.322 -0.468  1.00 85.24  ? 61  ASP B N   1 
ATOM   3648 C CA  . ASP B 2 59  ? 43.497  41.212 0.281   1.00 85.17  ? 61  ASP B CA  1 
ATOM   3649 C C   . ASP B 2 59  ? 43.089  39.857 -0.305  1.00 84.93  ? 61  ASP B C   1 
ATOM   3650 O O   . ASP B 2 59  ? 42.819  38.901 0.424   1.00 83.39  ? 61  ASP B O   1 
ATOM   3651 C CB  . ASP B 2 59  ? 43.138  41.306 1.769   1.00 84.45  ? 61  ASP B CB  1 
ATOM   3652 C CG  . ASP B 2 59  ? 43.464  42.674 2.369   1.00 88.38  ? 61  ASP B CG  1 
ATOM   3653 O OD1 . ASP B 2 59  ? 44.624  42.888 2.784   1.00 92.18  ? 61  ASP B OD1 1 
ATOM   3654 O OD2 . ASP B 2 59  ? 42.564  43.542 2.420   1.00 87.52  ? 61  ASP B OD2 1 
ATOM   3655 N N   . GLU B 2 60  ? 43.052  39.772 -1.629  1.00 78.02  ? 62  GLU B N   1 
ATOM   3656 C CA  . GLU B 2 60  ? 42.627  38.576 -2.342  1.00 77.03  ? 62  GLU B CA  1 
ATOM   3657 C C   . GLU B 2 60  ? 43.450  38.419 -3.609  1.00 80.61  ? 62  GLU B C   1 
ATOM   3658 O O   . GLU B 2 60  ? 43.985  39.400 -4.138  1.00 82.48  ? 62  GLU B O   1 
ATOM   3659 C CB  . GLU B 2 60  ? 41.132  38.628 -2.685  1.00 85.47  ? 62  GLU B CB  1 
ATOM   3660 C CG  . GLU B 2 60  ? 40.249  37.888 -1.689  1.00 84.22  ? 62  GLU B CG  1 
ATOM   3661 C CD  . GLU B 2 60  ? 39.477  36.743 -2.325  1.00 81.81  ? 62  GLU B CD  1 
ATOM   3662 O OE1 . GLU B 2 60  ? 38.929  36.934 -3.432  1.00 80.48  ? 62  GLU B OE1 1 
ATOM   3663 O OE2 . GLU B 2 60  ? 39.424  35.649 -1.720  1.00 81.62  ? 62  GLU B OE2 1 
ATOM   3664 N N   . PRO B 2 61  ? 43.569  37.196 -4.126  1.00 74.40  ? 63  PRO B N   1 
ATOM   3665 C CA  . PRO B 2 61  ? 44.386  36.967 -5.321  1.00 76.58  ? 63  PRO B CA  1 
ATOM   3666 C C   . PRO B 2 61  ? 43.661  37.344 -6.605  1.00 78.11  ? 63  PRO B C   1 
ATOM   3667 O O   . PRO B 2 61  ? 42.444  37.538 -6.641  1.00 75.96  ? 63  PRO B O   1 
ATOM   3668 C CB  . PRO B 2 61  ? 44.659  35.460 -5.275  1.00 76.50  ? 63  PRO B CB  1 
ATOM   3669 C CG  . PRO B 2 61  ? 43.474  34.904 -4.580  1.00 74.96  ? 63  PRO B CG  1 
ATOM   3670 C CD  . PRO B 2 61  ? 43.080  35.930 -3.548  1.00 72.88  ? 63  PRO B CD  1 
ATOM   3671 N N   . TRP B 2 62  ? 44.451  37.449 -7.673  1.00 73.27  ? 64  TRP B N   1 
ATOM   3672 C CA  . TRP B 2 62  ? 43.912  37.780 -8.985  1.00 73.97  ? 64  TRP B CA  1 
ATOM   3673 C C   . TRP B 2 62  ? 43.097  36.619 -9.539  1.00 73.68  ? 64  TRP B C   1 
ATOM   3674 O O   . TRP B 2 62  ? 43.528  35.463 -9.494  1.00 73.83  ? 64  TRP B O   1 
ATOM   3675 C CB  . TRP B 2 62  ? 45.042  38.138 -9.951  1.00 77.54  ? 64  TRP B CB  1 
ATOM   3676 C CG  . TRP B 2 62  ? 45.543  39.545 -9.815  1.00 80.06  ? 64  TRP B CG  1 
ATOM   3677 C CD1 . TRP B 2 62  ? 46.472  40.008 -8.928  1.00 82.49  ? 64  TRP B CD1 1 
ATOM   3678 C CD2 . TRP B 2 62  ? 45.141  40.675 -10.599 1.00 81.22  ? 64  TRP B CD2 1 
ATOM   3679 N NE1 . TRP B 2 62  ? 46.672  41.356 -9.111  1.00 84.47  ? 64  TRP B NE1 1 
ATOM   3680 C CE2 . TRP B 2 62  ? 45.866  41.789 -10.131 1.00 84.78  ? 64  TRP B CE2 1 
ATOM   3681 C CE3 . TRP B 2 62  ? 44.236  40.852 -11.651 1.00 81.13  ? 64  TRP B CE3 1 
ATOM   3682 C CZ2 . TRP B 2 62  ? 45.715  43.062 -10.679 1.00 86.44  ? 64  TRP B CZ2 1 
ATOM   3683 C CZ3 . TRP B 2 62  ? 44.087  42.115 -12.193 1.00 83.41  ? 64  TRP B CZ3 1 
ATOM   3684 C CH2 . TRP B 2 62  ? 44.823  43.204 -11.707 1.00 85.91  ? 64  TRP B CH2 1 
ATOM   3685 N N   . LYS B 2 63  ? 41.912  36.932 -10.057 1.00 78.67  ? 65  LYS B N   1 
ATOM   3686 C CA  . LYS B 2 63  ? 41.015  35.949 -10.643 1.00 77.70  ? 65  LYS B CA  1 
ATOM   3687 C C   . LYS B 2 63  ? 40.596  36.409 -12.033 1.00 80.55  ? 65  LYS B C   1 
ATOM   3688 O O   . LYS B 2 63  ? 40.784  37.569 -12.408 1.00 81.44  ? 65  LYS B O   1 
ATOM   3689 C CB  . LYS B 2 63  ? 39.786  35.730 -9.753  1.00 75.61  ? 65  LYS B CB  1 
ATOM   3690 C CG  . LYS B 2 63  ? 40.131  35.130 -8.399  1.00 78.20  ? 65  LYS B CG  1 
ATOM   3691 C CD  . LYS B 2 63  ? 39.006  35.303 -7.395  1.00 78.60  ? 65  LYS B CD  1 
ATOM   3692 C CE  . LYS B 2 63  ? 39.436  34.831 -6.013  1.00 80.60  ? 65  LYS B CE  1 
ATOM   3693 N NZ  . LYS B 2 63  ? 38.390  35.073 -4.980  1.00 81.59  ? 65  LYS B NZ  1 
ATOM   3694 N N   . LEU B 2 64  ? 40.036  35.480 -12.804 1.00 83.93  ? 66  LEU B N   1 
ATOM   3695 C CA  . LEU B 2 64  ? 39.591  35.750 -14.165 1.00 84.85  ? 66  LEU B CA  1 
ATOM   3696 C C   . LEU B 2 64  ? 38.096  35.493 -14.288 1.00 84.04  ? 66  LEU B C   1 
ATOM   3697 O O   . LEU B 2 64  ? 37.568  34.544 -13.700 1.00 81.83  ? 66  LEU B O   1 
ATOM   3698 C CB  . LEU B 2 64  ? 40.348  34.898 -15.189 1.00 86.60  ? 66  LEU B CB  1 
ATOM   3699 C CG  . LEU B 2 64  ? 41.661  35.481 -15.709 1.00 91.11  ? 66  LEU B CG  1 
ATOM   3700 C CD1 . LEU B 2 64  ? 42.717  35.513 -14.619 1.00 92.05  ? 66  LEU B CD1 1 
ATOM   3701 C CD2 . LEU B 2 64  ? 42.148  34.705 -16.919 1.00 93.20  ? 66  LEU B CD2 1 
ATOM   3702 N N   . CYS B 2 65  ? 37.421  36.348 -15.049 1.00 93.33  ? 67  CYS B N   1 
ATOM   3703 C CA  . CYS B 2 65  ? 35.983  36.271 -15.256 1.00 90.61  ? 67  CYS B CA  1 
ATOM   3704 C C   . CYS B 2 65  ? 35.667  35.727 -16.645 1.00 91.85  ? 67  CYS B C   1 
ATOM   3705 O O   . CYS B 2 65  ? 36.461  35.859 -17.579 1.00 94.34  ? 67  CYS B O   1 
ATOM   3706 C CB  . CYS B 2 65  ? 35.342  37.649 -15.078 1.00 90.41  ? 67  CYS B CB  1 
ATOM   3707 S SG  . CYS B 2 65  ? 33.574  37.736 -15.450 1.00 88.59  ? 67  CYS B SG  1 
ATOM   3708 N N   . ARG B 2 66  ? 34.492  35.112 -16.771 1.00 91.02  ? 68  ARG B N   1 
ATOM   3709 C CA  . ARG B 2 66  ? 34.037  34.576 -18.050 1.00 91.12  ? 68  ARG B CA  1 
ATOM   3710 C C   . ARG B 2 66  ? 33.568  35.709 -18.954 1.00 93.86  ? 68  ARG B C   1 
ATOM   3711 O O   . ARG B 2 66  ? 32.681  36.484 -18.580 1.00 92.35  ? 68  ARG B O   1 
ATOM   3712 C CB  . ARG B 2 66  ? 32.912  33.565 -17.849 1.00 88.34  ? 68  ARG B CB  1 
ATOM   3713 C CG  . ARG B 2 66  ? 32.565  32.796 -19.116 1.00 91.76  ? 68  ARG B CG  1 
ATOM   3714 C CD  . ARG B 2 66  ? 31.216  32.106 -19.007 1.00 92.25  ? 68  ARG B CD  1 
ATOM   3715 N NE  . ARG B 2 66  ? 30.770  31.593 -20.300 1.00 95.72  ? 68  ARG B NE  1 
ATOM   3716 C CZ  . ARG B 2 66  ? 29.573  31.060 -20.523 1.00 99.62  ? 68  ARG B CZ  1 
ATOM   3717 N NH1 . ARG B 2 66  ? 28.689  30.969 -19.537 1.00 94.06  ? 68  ARG B NH1 1 
ATOM   3718 N NH2 . ARG B 2 66  ? 29.257  30.621 -21.733 1.00 96.98  ? 68  ARG B NH2 1 
ATOM   3719 N N   . LEU B 2 67  ? 34.150  35.794 -20.146 1.00 87.74  ? 69  LEU B N   1 
ATOM   3720 C CA  . LEU B 2 67  ? 33.796  36.824 -21.110 1.00 89.97  ? 69  LEU B CA  1 
ATOM   3721 C C   . LEU B 2 67  ? 32.701  36.321 -22.042 1.00 90.68  ? 69  LEU B C   1 
ATOM   3722 O O   . LEU B 2 67  ? 32.749  35.184 -22.520 1.00 90.32  ? 69  LEU B O   1 
ATOM   3723 C CB  . LEU B 2 67  ? 35.024  37.243 -21.920 1.00 94.21  ? 69  LEU B CB  1 
ATOM   3724 C CG  . LEU B 2 67  ? 35.014  38.652 -22.511 1.00 98.82  ? 69  LEU B CG  1 
ATOM   3725 C CD1 . LEU B 2 67  ? 35.285  39.680 -21.428 1.00 98.71  ? 69  LEU B CD1 1 
ATOM   3726 C CD2 . LEU B 2 67  ? 36.040  38.764 -23.626 1.00 103.79 ? 69  LEU B CD2 1 
ATOM   3727 N N   . HIS B 2 68  ? 31.714  37.178 -22.298 1.00 96.42  ? 70  HIS B N   1 
ATOM   3728 C CA  . HIS B 2 68  ? 30.592  36.857 -23.170 1.00 96.21  ? 70  HIS B CA  1 
ATOM   3729 C C   . HIS B 2 68  ? 30.600  37.799 -24.365 1.00 101.22 ? 70  HIS B C   1 
ATOM   3730 O O   . HIS B 2 68  ? 30.748  39.014 -24.201 1.00 102.48 ? 70  HIS B O   1 
ATOM   3731 C CB  . HIS B 2 68  ? 29.257  36.977 -22.426 1.00 93.28  ? 70  HIS B CB  1 
ATOM   3732 C CG  . HIS B 2 68  ? 29.088  35.994 -21.309 1.00 91.09  ? 70  HIS B CG  1 
ATOM   3733 N ND1 . HIS B 2 68  ? 28.281  34.882 -21.413 1.00 90.30  ? 70  HIS B ND1 1 
ATOM   3734 C CD2 . HIS B 2 68  ? 29.613  35.962 -20.061 1.00 90.00  ? 70  HIS B CD2 1 
ATOM   3735 C CE1 . HIS B 2 68  ? 28.320  34.204 -20.279 1.00 87.94  ? 70  HIS B CE1 1 
ATOM   3736 N NE2 . HIS B 2 68  ? 29.121  34.838 -19.443 1.00 87.73  ? 70  HIS B NE2 1 
ATOM   3737 N N   . GLN B 2 69  ? 30.435  37.240 -25.560 1.00 99.20  ? 71  GLN B N   1 
ATOM   3738 C CA  . GLN B 2 69  ? 30.378  38.018 -26.790 1.00 103.08 ? 71  GLN B CA  1 
ATOM   3739 C C   . GLN B 2 69  ? 28.935  38.108 -27.267 1.00 103.89 ? 71  GLN B C   1 
ATOM   3740 O O   . GLN B 2 69  ? 28.251  37.087 -27.388 1.00 102.10 ? 71  GLN B O   1 
ATOM   3741 C CB  . GLN B 2 69  ? 31.254  37.397 -27.879 1.00 106.65 ? 71  GLN B CB  1 
ATOM   3742 C CG  . GLN B 2 69  ? 31.392  38.263 -29.121 1.00 116.02 ? 71  GLN B CG  1 
ATOM   3743 C CD  . GLN B 2 69  ? 32.200  37.593 -30.213 1.00 125.08 ? 71  GLN B CD  1 
ATOM   3744 O OE1 . GLN B 2 69  ? 33.430  37.629 -30.200 1.00 125.20 ? 71  GLN B OE1 1 
ATOM   3745 N NE2 . GLN B 2 69  ? 31.511  36.980 -31.168 1.00 123.69 ? 71  GLN B NE2 1 
ATOM   3746 N N   . ALA B 2 70  ? 28.479  39.331 -27.541 1.00 111.04 ? 72  ALA B N   1 
ATOM   3747 C CA  . ALA B 2 70  ? 27.126  39.556 -28.011 1.00 111.11 ? 72  ALA B CA  1 
ATOM   3748 C C   . ALA B 2 70  ? 27.139  40.697 -29.023 1.00 116.73 ? 72  ALA B C   1 
ATOM   3749 O O   . ALA B 2 70  ? 27.665  41.784 -28.721 1.00 117.96 ? 72  ALA B O   1 
ATOM   3750 C CB  . ALA B 2 70  ? 26.180  39.880 -26.852 1.00 107.92 ? 72  ALA B CB  1 
ATOM   3751 N N   . PRO B 2 71  ? 26.581  40.495 -30.215 1.00 116.69 ? 73  PRO B N   1 
ATOM   3752 C CA  . PRO B 2 71  ? 26.534  41.580 -31.200 1.00 120.98 ? 73  PRO B CA  1 
ATOM   3753 C C   . PRO B 2 71  ? 25.367  42.518 -30.934 1.00 122.02 ? 73  PRO B C   1 
ATOM   3754 O O   . PRO B 2 71  ? 24.262  42.089 -30.589 1.00 120.05 ? 73  PRO B O   1 
ATOM   3755 C CB  . PRO B 2 71  ? 26.365  40.843 -32.538 1.00 124.25 ? 73  PRO B CB  1 
ATOM   3756 C CG  . PRO B 2 71  ? 26.259  39.358 -32.198 1.00 122.53 ? 73  PRO B CG  1 
ATOM   3757 C CD  . PRO B 2 71  ? 25.979  39.259 -30.735 1.00 116.47 ? 73  PRO B CD  1 
ATOM   3758 N N   . THR B 2 72  ? 25.624  43.814 -31.098 1.00 127.61 ? 74  THR B N   1 
ATOM   3759 C CA  . THR B 2 72  ? 24.620  44.835 -30.835 1.00 128.81 ? 74  THR B CA  1 
ATOM   3760 C C   . THR B 2 72  ? 24.901  46.053 -31.705 1.00 135.27 ? 74  THR B C   1 
ATOM   3761 O O   . THR B 2 72  ? 25.942  46.149 -32.360 1.00 137.18 ? 74  THR B O   1 
ATOM   3762 C CB  . THR B 2 72  ? 24.590  45.227 -29.352 1.00 127.76 ? 74  THR B CB  1 
ATOM   3763 O OG1 . THR B 2 72  ? 23.417  46.006 -29.084 1.00 129.45 ? 74  THR B OG1 1 
ATOM   3764 C CG2 . THR B 2 72  ? 25.828  46.035 -28.986 1.00 128.51 ? 74  THR B CG2 1 
ATOM   3765 N N   . ALA B 2 73  ? 23.951  46.982 -31.700 1.00 131.77 ? 75  ALA B N   1 
ATOM   3766 C CA  . ALA B 2 73  ? 24.031  48.252 -32.442 1.00 137.45 ? 75  ALA B CA  1 
ATOM   3767 C C   . ALA B 2 73  ? 24.201  47.911 -33.926 1.00 142.98 ? 75  ALA B C   1 
ATOM   3768 O O   . ALA B 2 73  ? 23.560  46.969 -34.418 1.00 143.38 ? 75  ALA B O   1 
ATOM   3769 C CB  . ALA B 2 73  ? 25.120  49.128 -31.853 1.00 136.70 ? 75  ALA B CB  1 
ATOM   3770 N N   . ARG B 2 74  ? 25.041  48.640 -34.658 1.00 145.72 ? 76  ARG B N   1 
ATOM   3771 C CA  . ARG B 2 74  ? 25.269  48.406 -36.080 1.00 150.61 ? 76  ARG B CA  1 
ATOM   3772 C C   . ARG B 2 74  ? 26.702  47.918 -36.266 1.00 150.92 ? 76  ARG B C   1 
ATOM   3773 O O   . ARG B 2 74  ? 27.654  48.680 -36.066 1.00 151.48 ? 76  ARG B O   1 
ATOM   3774 C CB  . ARG B 2 74  ? 25.009  49.674 -36.891 1.00 157.33 ? 76  ARG B CB  1 
ATOM   3775 N N   . GLY B 2 75  ? 26.846  46.660 -36.671 1.00 145.98 ? 77  GLY B N   1 
ATOM   3776 C CA  . GLY B 2 75  ? 28.168  46.082 -36.898 1.00 145.20 ? 77  GLY B CA  1 
ATOM   3777 C C   . GLY B 2 75  ? 29.112  46.203 -35.722 1.00 141.68 ? 77  GLY B C   1 
ATOM   3778 O O   . GLY B 2 75  ? 30.309  46.459 -35.907 1.00 143.27 ? 77  GLY B O   1 
ATOM   3779 N N   . ALA B 2 76  ? 28.601  46.014 -34.509 1.00 138.76 ? 78  ALA B N   1 
ATOM   3780 C CA  . ALA B 2 76  ? 29.409  46.106 -33.303 1.00 132.45 ? 78  ALA B CA  1 
ATOM   3781 C C   . ALA B 2 76  ? 29.177  44.875 -32.439 1.00 129.55 ? 78  ALA B C   1 
ATOM   3782 O O   . ALA B 2 76  ? 28.137  44.217 -32.522 1.00 132.28 ? 78  ALA B O   1 
ATOM   3783 C CB  . ALA B 2 76  ? 29.091  47.378 -32.505 1.00 130.92 ? 78  ALA B CB  1 
ATOM   3784 N N   . VAL B 2 77  ? 30.168  44.567 -31.606 1.00 125.48 ? 79  VAL B N   1 
ATOM   3785 C CA  . VAL B 2 77  ? 30.103  43.445 -30.679 1.00 123.50 ? 79  VAL B CA  1 
ATOM   3786 C C   . VAL B 2 77  ? 30.372  43.971 -29.277 1.00 120.69 ? 79  VAL B C   1 
ATOM   3787 O O   . VAL B 2 77  ? 31.304  44.756 -29.070 1.00 118.21 ? 79  VAL B O   1 
ATOM   3788 C CB  . VAL B 2 77  ? 31.100  42.329 -31.049 1.00 123.75 ? 79  VAL B CB  1 
ATOM   3789 C CG1 . VAL B 2 77  ? 30.569  41.512 -32.219 1.00 127.83 ? 79  VAL B CG1 1 
ATOM   3790 C CG2 . VAL B 2 77  ? 32.464  42.912 -31.381 1.00 121.66 ? 79  VAL B CG2 1 
ATOM   3791 N N   . ARG B 2 78  ? 29.548  43.551 -28.320 1.00 115.96 ? 80  ARG B N   1 
ATOM   3792 C CA  . ARG B 2 78  ? 29.645  43.991 -26.933 1.00 112.53 ? 80  ARG B CA  1 
ATOM   3793 C C   . ARG B 2 78  ? 30.130  42.827 -26.076 1.00 111.35 ? 80  ARG B C   1 
ATOM   3794 O O   . ARG B 2 78  ? 29.390  41.863 -25.853 1.00 112.70 ? 80  ARG B O   1 
ATOM   3795 C CB  . ARG B 2 78  ? 28.300  44.520 -26.440 1.00 114.05 ? 80  ARG B CB  1 
ATOM   3796 C CG  . ARG B 2 78  ? 28.333  45.085 -25.032 1.00 113.85 ? 80  ARG B CG  1 
ATOM   3797 C CD  . ARG B 2 78  ? 26.937  45.439 -24.562 1.00 118.52 ? 80  ARG B CD  1 
ATOM   3798 N NE  . ARG B 2 78  ? 26.467  46.673 -25.182 1.00 122.89 ? 80  ARG B NE  1 
ATOM   3799 C CZ  . ARG B 2 78  ? 25.202  47.079 -25.178 1.00 129.73 ? 80  ARG B CZ  1 
ATOM   3800 N NH1 . ARG B 2 78  ? 24.270  46.346 -24.584 1.00 126.58 ? 80  ARG B NH1 1 
ATOM   3801 N NH2 . ARG B 2 78  ? 24.869  48.218 -25.770 1.00 127.30 ? 80  ARG B NH2 1 
ATOM   3802 N N   . PHE B 2 79  ? 31.368  42.922 -25.601 1.00 105.95 ? 81  PHE B N   1 
ATOM   3803 C CA  . PHE B 2 79  ? 31.934  41.936 -24.690 1.00 103.49 ? 81  PHE B CA  1 
ATOM   3804 C C   . PHE B 2 79  ? 31.607  42.343 -23.258 1.00 102.32 ? 81  PHE B C   1 
ATOM   3805 O O   . PHE B 2 79  ? 31.954  43.449 -22.830 1.00 100.52 ? 81  PHE B O   1 
ATOM   3806 C CB  . PHE B 2 79  ? 33.446  41.820 -24.881 1.00 102.25 ? 81  PHE B CB  1 
ATOM   3807 C CG  . PHE B 2 79  ? 33.856  41.345 -26.248 1.00 104.85 ? 81  PHE B CG  1 
ATOM   3808 C CD1 . PHE B 2 79  ? 34.060  42.249 -27.279 1.00 106.97 ? 81  PHE B CD1 1 
ATOM   3809 C CD2 . PHE B 2 79  ? 34.052  39.996 -26.498 1.00 106.47 ? 81  PHE B CD2 1 
ATOM   3810 C CE1 . PHE B 2 79  ? 34.442  41.816 -28.535 1.00 109.87 ? 81  PHE B CE1 1 
ATOM   3811 C CE2 . PHE B 2 79  ? 34.435  39.557 -27.752 1.00 108.70 ? 81  PHE B CE2 1 
ATOM   3812 C CZ  . PHE B 2 79  ? 34.630  40.468 -28.771 1.00 109.79 ? 81  PHE B CZ  1 
ATOM   3813 N N   . TRP B 2 80  ? 30.933  41.460 -22.523 1.00 95.93  ? 82  TRP B N   1 
ATOM   3814 C CA  . TRP B 2 80  ? 30.528  41.746 -21.156 1.00 93.98  ? 82  TRP B CA  1 
ATOM   3815 C C   . TRP B 2 80  ? 30.837  40.560 -20.254 1.00 92.21  ? 82  TRP B C   1 
ATOM   3816 O O   . TRP B 2 80  ? 30.843  39.407 -20.692 1.00 93.53  ? 82  TRP B O   1 
ATOM   3817 C CB  . TRP B 2 80  ? 29.032  42.092 -21.069 1.00 96.69  ? 82  TRP B CB  1 
ATOM   3818 C CG  . TRP B 2 80  ? 28.115  41.004 -21.535 1.00 100.06 ? 82  TRP B CG  1 
ATOM   3819 C CD1 . TRP B 2 80  ? 27.760  40.727 -22.823 1.00 103.72 ? 82  TRP B CD1 1 
ATOM   3820 C CD2 . TRP B 2 80  ? 27.413  40.064 -20.714 1.00 100.69 ? 82  TRP B CD2 1 
ATOM   3821 N NE1 . TRP B 2 80  ? 26.892  39.663 -22.856 1.00 106.67 ? 82  TRP B NE1 1 
ATOM   3822 C CE2 . TRP B 2 80  ? 26.662  39.238 -21.574 1.00 104.90 ? 82  TRP B CE2 1 
ATOM   3823 C CE3 . TRP B 2 80  ? 27.353  39.835 -19.336 1.00 98.53  ? 82  TRP B CE3 1 
ATOM   3824 C CZ2 . TRP B 2 80  ? 25.860  38.201 -21.100 1.00 107.09 ? 82  TRP B CZ2 1 
ATOM   3825 C CZ3 . TRP B 2 80  ? 26.556  38.805 -18.868 1.00 100.58 ? 82  TRP B CZ3 1 
ATOM   3826 C CH2 . TRP B 2 80  ? 25.820  38.001 -19.748 1.00 104.86 ? 82  TRP B CH2 1 
ATOM   3827 N N   . CYS B 2 81  ? 31.098  40.863 -18.984 1.00 93.20  ? 83  CYS B N   1 
ATOM   3828 C CA  . CYS B 2 81  ? 31.379  39.860 -17.968 1.00 95.93  ? 83  CYS B CA  1 
ATOM   3829 C C   . CYS B 2 81  ? 30.608  40.213 -16.706 1.00 97.79  ? 83  CYS B C   1 
ATOM   3830 O O   . CYS B 2 81  ? 30.486  41.389 -16.354 1.00 94.24  ? 83  CYS B O   1 
ATOM   3831 C CB  . CYS B 2 81  ? 32.880  39.771 -17.654 1.00 92.74  ? 83  CYS B CB  1 
ATOM   3832 S SG  . CYS B 2 81  ? 33.247  39.703 -15.876 1.00 92.62  ? 83  CYS B SG  1 
ATOM   3833 N N   . SER B 2 82  ? 30.081  39.192 -16.036 1.00 83.23  ? 84  SER B N   1 
ATOM   3834 C CA  . SER B 2 82  ? 29.338  39.356 -14.790 1.00 84.66  ? 84  SER B CA  1 
ATOM   3835 C C   . SER B 2 82  ? 30.151  38.725 -13.667 1.00 87.16  ? 84  SER B C   1 
ATOM   3836 O O   . SER B 2 82  ? 30.306  37.500 -13.618 1.00 87.49  ? 84  SER B O   1 
ATOM   3837 C CB  . SER B 2 82  ? 27.953  38.722 -14.896 1.00 88.97  ? 84  SER B CB  1 
ATOM   3838 O OG  . SER B 2 82  ? 27.175  39.001 -13.746 1.00 93.54  ? 84  SER B OG  1 
ATOM   3839 N N   . LEU B 2 83  ? 30.670  39.559 -12.769 1.00 80.82  ? 85  LEU B N   1 
ATOM   3840 C CA  . LEU B 2 83  ? 31.496  39.060 -11.683 1.00 79.18  ? 85  LEU B CA  1 
ATOM   3841 C C   . LEU B 2 83  ? 30.663  38.219 -10.717 1.00 80.77  ? 85  LEU B C   1 
ATOM   3842 O O   . LEU B 2 83  ? 29.462  38.449 -10.557 1.00 82.63  ? 85  LEU B O   1 
ATOM   3843 C CB  . LEU B 2 83  ? 32.152  40.213 -10.930 1.00 77.20  ? 85  LEU B CB  1 
ATOM   3844 C CG  . LEU B 2 83  ? 33.497  40.709 -11.463 1.00 75.48  ? 85  LEU B CG  1 
ATOM   3845 C CD1 . LEU B 2 83  ? 33.337  41.420 -12.793 1.00 76.14  ? 85  LEU B CD1 1 
ATOM   3846 C CD2 . LEU B 2 83  ? 34.160  41.621 -10.447 1.00 74.18  ? 85  LEU B CD2 1 
ATOM   3847 N N   . PRO B 2 84  ? 31.278  37.227 -10.072 1.00 88.63  ? 86  PRO B N   1 
ATOM   3848 C CA  . PRO B 2 84  ? 30.533  36.390 -9.124  1.00 90.50  ? 86  PRO B CA  1 
ATOM   3849 C C   . PRO B 2 84  ? 30.023  37.203 -7.944  1.00 94.34  ? 86  PRO B C   1 
ATOM   3850 O O   . PRO B 2 84  ? 30.689  38.123 -7.465  1.00 92.39  ? 86  PRO B O   1 
ATOM   3851 C CB  . PRO B 2 84  ? 31.567  35.347 -8.680  1.00 85.38  ? 86  PRO B CB  1 
ATOM   3852 C CG  . PRO B 2 84  ? 32.591  35.336 -9.766  1.00 83.34  ? 86  PRO B CG  1 
ATOM   3853 C CD  . PRO B 2 84  ? 32.657  36.747 -10.265 1.00 82.99  ? 86  PRO B CD  1 
ATOM   3854 N N   . THR B 2 85  ? 28.820  36.854 -7.481  1.00 95.11  ? 87  THR B N   1 
ATOM   3855 C CA  . THR B 2 85  ? 28.226  37.562 -6.352  1.00 98.35  ? 87  THR B CA  1 
ATOM   3856 C C   . THR B 2 85  ? 29.068  37.416 -5.092  1.00 95.67  ? 87  THR B C   1 
ATOM   3857 O O   . THR B 2 85  ? 29.118  38.337 -4.269  1.00 96.72  ? 87  THR B O   1 
ATOM   3858 C CB  . THR B 2 85  ? 26.805  37.057 -6.099  1.00 104.69 ? 87  THR B CB  1 
ATOM   3859 O OG1 . THR B 2 85  ? 26.818  35.631 -5.972  1.00 101.54 ? 87  THR B OG1 1 
ATOM   3860 C CG2 . THR B 2 85  ? 25.892  37.447 -7.251  1.00 107.65 ? 87  THR B CG2 1 
ATOM   3861 N N   . ALA B 2 86  ? 29.731  36.270 -4.921  1.00 100.59 ? 88  ALA B N   1 
ATOM   3862 C CA  . ALA B 2 86  ? 30.529  36.051 -3.720  1.00 96.17  ? 88  ALA B CA  1 
ATOM   3863 C C   . ALA B 2 86  ? 31.798  36.894 -3.718  1.00 93.71  ? 88  ALA B C   1 
ATOM   3864 O O   . ALA B 2 86  ? 32.251  37.322 -2.650  1.00 91.79  ? 88  ALA B O   1 
ATOM   3865 C CB  . ALA B 2 86  ? 30.877  34.569 -3.584  1.00 91.95  ? 88  ALA B CB  1 
ATOM   3866 N N   . ASP B 2 87  ? 32.385  37.142 -4.891  1.00 94.68  ? 89  ASP B N   1 
ATOM   3867 C CA  . ASP B 2 87  ? 33.602  37.939 -4.965  1.00 90.44  ? 89  ASP B CA  1 
ATOM   3868 C C   . ASP B 2 87  ? 33.344  39.433 -4.815  1.00 93.84  ? 89  ASP B C   1 
ATOM   3869 O O   . ASP B 2 87  ? 34.274  40.178 -4.488  1.00 89.59  ? 89  ASP B O   1 
ATOM   3870 C CB  . ASP B 2 87  ? 34.311  37.682 -6.297  1.00 88.12  ? 89  ASP B CB  1 
ATOM   3871 C CG  . ASP B 2 87  ? 35.090  36.383 -6.302  1.00 85.85  ? 89  ASP B CG  1 
ATOM   3872 O OD1 . ASP B 2 87  ? 35.803  36.110 -5.314  1.00 85.24  ? 89  ASP B OD1 1 
ATOM   3873 O OD2 . ASP B 2 87  ? 34.991  35.634 -7.298  1.00 87.23  ? 89  ASP B OD2 1 
ATOM   3874 N N   . THR B 2 88  ? 32.113  39.885 -5.042  1.00 92.66  ? 90  THR B N   1 
ATOM   3875 C CA  . THR B 2 88  ? 31.775  41.298 -4.926  1.00 92.72  ? 90  THR B CA  1 
ATOM   3876 C C   . THR B 2 88  ? 31.693  41.717 -3.464  1.00 94.47  ? 90  THR B C   1 
ATOM   3877 O O   . THR B 2 88  ? 31.038  41.054 -2.652  1.00 97.92  ? 90  THR B O   1 
ATOM   3878 C CB  . THR B 2 88  ? 30.452  41.595 -5.631  1.00 100.84 ? 90  THR B CB  1 
ATOM   3879 O OG1 . THR B 2 88  ? 29.448  40.680 -5.173  1.00 106.94 ? 90  THR B OG1 1 
ATOM   3880 C CG2 . THR B 2 88  ? 30.609  41.470 -7.140  1.00 99.38  ? 90  THR B CG2 1 
ATOM   3881 N N   . SER B 2 89  ? 32.365  42.818 -3.132  1.00 93.65  ? 91  SER B N   1 
ATOM   3882 C CA  . SER B 2 89  ? 32.309  43.401 -1.798  1.00 93.24  ? 91  SER B CA  1 
ATOM   3883 C C   . SER B 2 89  ? 32.458  44.907 -1.946  1.00 90.02  ? 91  SER B C   1 
ATOM   3884 O O   . SER B 2 89  ? 33.431  45.376 -2.540  1.00 85.13  ? 91  SER B O   1 
ATOM   3885 C CB  . SER B 2 89  ? 33.404  42.831 -0.888  1.00 90.77  ? 91  SER B CB  1 
ATOM   3886 O OG  . SER B 2 89  ? 33.127  41.485 -0.542  1.00 95.57  ? 91  SER B OG  1 
ATOM   3887 N N   . SER B 2 90  ? 31.514  45.656 -1.385  1.00 90.68  ? 92  SER B N   1 
ATOM   3888 C CA  . SER B 2 90  ? 31.475  47.097 -1.579  1.00 87.02  ? 92  SER B CA  1 
ATOM   3889 C C   . SER B 2 90  ? 32.450  47.807 -0.641  1.00 87.27  ? 92  SER B C   1 
ATOM   3890 O O   . SER B 2 90  ? 32.968  47.226 0.318   1.00 87.41  ? 92  SER B O   1 
ATOM   3891 C CB  . SER B 2 90  ? 30.058  47.627 -1.366  1.00 90.40  ? 92  SER B CB  1 
ATOM   3892 O OG  . SER B 2 90  ? 29.117  46.870 -2.109  1.00 98.22  ? 92  SER B OG  1 
ATOM   3893 N N   . PHE B 2 91  ? 32.719  49.078 -0.960  1.00 82.96  ? 93  PHE B N   1 
ATOM   3894 C CA  . PHE B 2 91  ? 33.636  49.927 -0.199  1.00 82.58  ? 93  PHE B CA  1 
ATOM   3895 C C   . PHE B 2 91  ? 35.069  49.413 -0.277  1.00 82.12  ? 93  PHE B C   1 
ATOM   3896 O O   . PHE B 2 91  ? 35.865  49.608 0.645   1.00 82.29  ? 93  PHE B O   1 
ATOM   3897 C CB  . PHE B 2 91  ? 33.193  50.071 1.261   1.00 84.77  ? 93  PHE B CB  1 
ATOM   3898 C CG  . PHE B 2 91  ? 31.801  50.611 1.416   1.00 86.86  ? 93  PHE B CG  1 
ATOM   3899 C CD1 . PHE B 2 91  ? 31.574  51.977 1.428   1.00 88.48  ? 93  PHE B CD1 1 
ATOM   3900 C CD2 . PHE B 2 91  ? 30.718  49.756 1.546   1.00 88.67  ? 93  PHE B CD2 1 
ATOM   3901 C CE1 . PHE B 2 91  ? 30.298  52.482 1.567   1.00 90.35  ? 93  PHE B CE1 1 
ATOM   3902 C CE2 . PHE B 2 91  ? 29.439  50.253 1.686   1.00 91.28  ? 93  PHE B CE2 1 
ATOM   3903 C CZ  . PHE B 2 91  ? 29.227  51.618 1.696   1.00 91.16  ? 93  PHE B CZ  1 
ATOM   3904 N N   . VAL B 2 92  ? 35.398  48.760 -1.387  1.00 80.51  ? 94  VAL B N   1 
ATOM   3905 C CA  . VAL B 2 92  ? 36.709  48.158 -1.608  1.00 79.22  ? 94  VAL B CA  1 
ATOM   3906 C C   . VAL B 2 92  ? 37.175  48.481 -3.023  1.00 78.98  ? 94  VAL B C   1 
ATOM   3907 O O   . VAL B 2 92  ? 36.387  48.367 -3.974  1.00 78.61  ? 94  VAL B O   1 
ATOM   3908 C CB  . VAL B 2 92  ? 36.658  46.641 -1.373  1.00 80.51  ? 94  VAL B CB  1 
ATOM   3909 C CG1 . VAL B 2 92  ? 37.751  45.939 -2.153  1.00 79.15  ? 94  VAL B CG1 1 
ATOM   3910 C CG2 . VAL B 2 92  ? 36.779  46.334 0.112   1.00 81.76  ? 94  VAL B CG2 1 
ATOM   3911 N N   . PRO B 2 93  ? 38.431  48.882 -3.212  1.00 76.48  ? 95  PRO B N   1 
ATOM   3912 C CA  . PRO B 2 93  ? 38.922  49.149 -4.571  1.00 75.38  ? 95  PRO B CA  1 
ATOM   3913 C C   . PRO B 2 93  ? 39.051  47.856 -5.361  1.00 73.58  ? 95  PRO B C   1 
ATOM   3914 O O   . PRO B 2 93  ? 39.697  46.902 -4.922  1.00 72.52  ? 95  PRO B O   1 
ATOM   3915 C CB  . PRO B 2 93  ? 40.288  49.810 -4.341  1.00 76.80  ? 95  PRO B CB  1 
ATOM   3916 C CG  . PRO B 2 93  ? 40.343  50.148 -2.883  1.00 80.58  ? 95  PRO B CG  1 
ATOM   3917 C CD  . PRO B 2 93  ? 39.433  49.197 -2.182  1.00 78.44  ? 95  PRO B CD  1 
ATOM   3918 N N   . LEU B 2 94  ? 38.424  47.831 -6.533  1.00 68.29  ? 96  LEU B N   1 
ATOM   3919 C CA  . LEU B 2 94  ? 38.426  46.673 -7.418  1.00 66.87  ? 96  LEU B CA  1 
ATOM   3920 C C   . LEU B 2 94  ? 39.258  47.020 -8.646  1.00 66.99  ? 96  LEU B C   1 
ATOM   3921 O O   . LEU B 2 94  ? 38.874  47.887 -9.437  1.00 67.06  ? 96  LEU B O   1 
ATOM   3922 C CB  . LEU B 2 94  ? 36.999  46.291 -7.807  1.00 67.59  ? 96  LEU B CB  1 
ATOM   3923 C CG  . LEU B 2 94  ? 36.822  45.133 -8.788  1.00 67.45  ? 96  LEU B CG  1 
ATOM   3924 C CD1 . LEU B 2 94  ? 37.346  43.841 -8.184  1.00 67.62  ? 96  LEU B CD1 1 
ATOM   3925 C CD2 . LEU B 2 94  ? 35.363  44.992 -9.195  1.00 70.14  ? 96  LEU B CD2 1 
ATOM   3926 N N   . GLU B 2 95  ? 40.395  46.348 -8.803  1.00 70.33  ? 97  GLU B N   1 
ATOM   3927 C CA  . GLU B 2 95  ? 41.284  46.584 -9.933  1.00 69.57  ? 97  GLU B CA  1 
ATOM   3928 C C   . GLU B 2 95  ? 40.895  45.663 -11.082 1.00 71.75  ? 97  GLU B C   1 
ATOM   3929 O O   . GLU B 2 95  ? 40.928  44.436 -10.940 1.00 72.71  ? 97  GLU B O   1 
ATOM   3930 C CB  . GLU B 2 95  ? 42.744  46.365 -9.534  1.00 68.72  ? 97  GLU B CB  1 
ATOM   3931 C CG  . GLU B 2 95  ? 43.748  46.978 -10.501 1.00 70.88  ? 97  GLU B CG  1 
ATOM   3932 C CD  . GLU B 2 95  ? 45.174  46.539 -10.229 1.00 75.78  ? 97  GLU B CD  1 
ATOM   3933 O OE1 . GLU B 2 95  ? 45.516  46.331 -9.046  1.00 73.22  ? 97  GLU B OE1 1 
ATOM   3934 O OE2 . GLU B 2 95  ? 45.952  46.400 -11.197 1.00 73.82  ? 97  GLU B OE2 1 
ATOM   3935 N N   . LEU B 2 96  ? 40.524  46.254 -12.213 1.00 68.91  ? 98  LEU B N   1 
ATOM   3936 C CA  . LEU B 2 96  ? 40.132  45.518 -13.405 1.00 70.30  ? 98  LEU B CA  1 
ATOM   3937 C C   . LEU B 2 96  ? 41.173  45.715 -14.498 1.00 71.51  ? 98  LEU B C   1 
ATOM   3938 O O   . LEU B 2 96  ? 41.737  46.805 -14.640 1.00 70.23  ? 98  LEU B O   1 
ATOM   3939 C CB  . LEU B 2 96  ? 38.762  45.978 -13.906 1.00 71.13  ? 98  LEU B CB  1 
ATOM   3940 C CG  . LEU B 2 96  ? 37.652  46.012 -12.857 1.00 71.21  ? 98  LEU B CG  1 
ATOM   3941 C CD1 . LEU B 2 96  ? 36.483  46.860 -13.338 1.00 72.15  ? 98  LEU B CD1 1 
ATOM   3942 C CD2 . LEU B 2 96  ? 37.198  44.603 -12.519 1.00 71.88  ? 98  LEU B CD2 1 
ATOM   3943 N N   . ARG B 2 97  ? 41.426  44.658 -15.269 1.00 74.26  ? 99  ARG B N   1 
ATOM   3944 C CA  . ARG B 2 97  ? 42.376  44.730 -16.376 1.00 75.59  ? 99  ARG B CA  1 
ATOM   3945 C C   . ARG B 2 97  ? 41.907  43.816 -17.495 1.00 79.71  ? 99  ARG B C   1 
ATOM   3946 O O   . ARG B 2 97  ? 41.751  42.609 -17.287 1.00 81.70  ? 99  ARG B O   1 
ATOM   3947 C CB  . ARG B 2 97  ? 43.787  44.341 -15.928 1.00 75.72  ? 99  ARG B CB  1 
ATOM   3948 C CG  . ARG B 2 97  ? 44.875  44.791 -16.893 1.00 78.89  ? 99  ARG B CG  1 
ATOM   3949 C CD  . ARG B 2 97  ? 46.206  44.132 -16.584 1.00 81.47  ? 99  ARG B CD  1 
ATOM   3950 N NE  . ARG B 2 97  ? 46.840  44.676 -15.387 1.00 79.62  ? 99  ARG B NE  1 
ATOM   3951 C CZ  . ARG B 2 97  ? 47.918  45.453 -15.401 1.00 82.21  ? 99  ARG B CZ  1 
ATOM   3952 N NH1 . ARG B 2 97  ? 48.483  45.783 -16.554 1.00 80.50  ? 99  ARG B NH1 1 
ATOM   3953 N NH2 . ARG B 2 97  ? 48.430  45.903 -14.263 1.00 74.49  ? 99  ARG B NH2 1 
ATOM   3954 N N   . VAL B 2 98  ? 41.692  44.387 -18.674 1.00 82.17  ? 100 VAL B N   1 
ATOM   3955 C CA  . VAL B 2 98  ? 41.336  43.629 -19.867 1.00 84.38  ? 100 VAL B CA  1 
ATOM   3956 C C   . VAL B 2 98  ? 42.582  43.505 -20.732 1.00 87.73  ? 100 VAL B C   1 
ATOM   3957 O O   . VAL B 2 98  ? 43.158  44.515 -21.154 1.00 86.91  ? 100 VAL B O   1 
ATOM   3958 C CB  . VAL B 2 98  ? 40.189  44.299 -20.638 1.00 84.86  ? 100 VAL B CB  1 
ATOM   3959 C CG1 . VAL B 2 98  ? 39.837  43.487 -21.874 1.00 87.24  ? 100 VAL B CG1 1 
ATOM   3960 C CG2 . VAL B 2 98  ? 38.977  44.466 -19.736 1.00 82.86  ? 100 VAL B CG2 1 
ATOM   3961 N N   . THR B 2 99  ? 43.008  42.272 -20.985 1.00 87.43  ? 101 THR B N   1 
ATOM   3962 C CA  . THR B 2 99  ? 44.218  42.001 -21.748 1.00 89.52  ? 101 THR B CA  1 
ATOM   3963 C C   . THR B 2 99  ? 43.860  41.280 -23.040 1.00 92.96  ? 101 THR B C   1 
ATOM   3964 O O   . THR B 2 99  ? 42.946  40.449 -23.067 1.00 93.83  ? 101 THR B O   1 
ATOM   3965 C CB  . THR B 2 99  ? 45.209  41.163 -20.933 1.00 94.05  ? 101 THR B CB  1 
ATOM   3966 O OG1 . THR B 2 99  ? 45.219  41.623 -19.575 1.00 91.55  ? 101 THR B OG1 1 
ATOM   3967 C CG2 . THR B 2 99  ? 46.613  41.290 -21.508 1.00 93.94  ? 101 THR B CG2 1 
ATOM   3968 N N   . ALA B 2 100 ? 44.573  41.615 -24.113 1.00 94.51  ? 102 ALA B N   1 
ATOM   3969 C CA  . ALA B 2 100 ? 44.329  41.017 -25.414 1.00 96.50  ? 102 ALA B CA  1 
ATOM   3970 C C   . ALA B 2 100 ? 44.907  39.604 -25.481 1.00 99.73  ? 102 ALA B C   1 
ATOM   3971 O O   . ALA B 2 100 ? 45.624  39.149 -24.585 1.00 99.75  ? 102 ALA B O   1 
ATOM   3972 C CB  . ALA B 2 100 ? 44.921  41.885 -26.521 1.00 97.88  ? 102 ALA B CB  1 
ATOM   3973 N N   . ALA B 2 101 ? 44.579  38.904 -26.572 1.00 100.46 ? 103 ALA B N   1 
ATOM   3974 C CA  . ALA B 2 101 ? 45.065  37.540 -26.758 1.00 102.36 ? 103 ALA B CA  1 
ATOM   3975 C C   . ALA B 2 101 ? 46.587  37.492 -26.803 1.00 103.63 ? 103 ALA B C   1 
ATOM   3976 O O   . ALA B 2 101 ? 47.206  36.605 -26.203 1.00 104.05 ? 103 ALA B O   1 
ATOM   3977 C CB  . ALA B 2 101 ? 44.471  36.942 -28.033 1.00 104.30 ? 103 ALA B CB  1 
ATOM   3978 N N   . SER B 2 102 ? 47.209  38.436 -27.509 1.00 103.41 ? 104 SER B N   1 
ATOM   3979 C CA  . SER B 2 102 ? 48.663  38.485 -27.574 1.00 103.12 ? 104 SER B CA  1 
ATOM   3980 C C   . SER B 2 102 ? 49.284  39.031 -26.298 1.00 102.27 ? 104 SER B C   1 
ATOM   3981 O O   . SER B 2 102 ? 50.452  38.738 -26.017 1.00 101.52 ? 104 SER B O   1 
ATOM   3982 C CB  . SER B 2 102 ? 49.110  39.337 -28.765 1.00 105.07 ? 104 SER B CB  1 
ATOM   3983 O OG  . SER B 2 102 ? 48.633  40.667 -28.646 1.00 107.18 ? 104 SER B OG  1 
ATOM   3984 N N   . GLY B 2 103 ? 48.536  39.813 -25.526 1.00 104.02 ? 105 GLY B N   1 
ATOM   3985 C CA  . GLY B 2 103 ? 49.057  40.409 -24.313 1.00 102.08 ? 105 GLY B CA  1 
ATOM   3986 C C   . GLY B 2 103 ? 49.041  41.921 -24.381 1.00 101.74 ? 105 GLY B C   1 
ATOM   3987 O O   . GLY B 2 103 ? 49.712  42.595 -23.595 1.00 99.92  ? 105 GLY B O   1 
ATOM   3988 N N   . ALA B 2 104 ? 48.269  42.463 -25.323 1.00 100.14 ? 106 ALA B N   1 
ATOM   3989 C CA  . ALA B 2 104 ? 48.199  43.899 -25.530 1.00 99.04  ? 106 ALA B CA  1 
ATOM   3990 C C   . ALA B 2 104 ? 47.239  44.539 -24.529 1.00 98.02  ? 106 ALA B C   1 
ATOM   3991 O O   . ALA B 2 104 ? 46.279  43.904 -24.085 1.00 97.60  ? 106 ALA B O   1 
ATOM   3992 C CB  . ALA B 2 104 ? 47.745  44.208 -26.953 1.00 101.26 ? 106 ALA B CB  1 
ATOM   3993 N N   . PRO B 2 105 ? 47.479  45.797 -24.155 1.00 96.25  ? 107 PRO B N   1 
ATOM   3994 C CA  . PRO B 2 105 ? 46.605  46.459 -23.177 1.00 93.77  ? 107 PRO B CA  1 
ATOM   3995 C C   . PRO B 2 105 ? 45.314  46.939 -23.827 1.00 95.47  ? 107 PRO B C   1 
ATOM   3996 O O   . PRO B 2 105 ? 45.336  47.633 -24.846 1.00 97.05  ? 107 PRO B O   1 
ATOM   3997 C CB  . PRO B 2 105 ? 47.453  47.636 -22.683 1.00 92.93  ? 107 PRO B CB  1 
ATOM   3998 C CG  . PRO B 2 105 ? 48.336  47.954 -23.844 1.00 96.75  ? 107 PRO B CG  1 
ATOM   3999 C CD  . PRO B 2 105 ? 48.634  46.638 -24.520 1.00 97.13  ? 107 PRO B CD  1 
ATOM   4000 N N   . ARG B 2 106 ? 44.182  46.555 -23.236 1.00 90.09  ? 108 ARG B N   1 
ATOM   4001 C CA  . ARG B 2 106 ? 42.872  46.984 -23.710 1.00 90.14  ? 108 ARG B CA  1 
ATOM   4002 C C   . ARG B 2 106 ? 42.211  47.961 -22.747 1.00 89.02  ? 108 ARG B C   1 
ATOM   4003 O O   . ARG B 2 106 ? 41.828  49.064 -23.149 1.00 89.36  ? 108 ARG B O   1 
ATOM   4004 C CB  . ARG B 2 106 ? 41.970  45.763 -23.943 1.00 90.85  ? 108 ARG B CB  1 
ATOM   4005 C CG  . ARG B 2 106 ? 40.635  46.089 -24.598 1.00 94.58  ? 108 ARG B CG  1 
ATOM   4006 C CD  . ARG B 2 106 ? 40.814  46.543 -26.039 1.00 100.41 ? 108 ARG B CD  1 
ATOM   4007 N NE  . ARG B 2 106 ? 40.639  47.985 -26.187 1.00 103.60 ? 108 ARG B NE  1 
ATOM   4008 C CZ  . ARG B 2 106 ? 39.485  48.570 -26.493 1.00 108.99 ? 108 ARG B CZ  1 
ATOM   4009 N NH1 . ARG B 2 106 ? 38.397  47.835 -26.685 1.00 105.44 ? 108 ARG B NH1 1 
ATOM   4010 N NH2 . ARG B 2 106 ? 39.418  49.889 -26.607 1.00 105.71 ? 108 ARG B NH2 1 
ATOM   4011 N N   . TYR B 2 107 ? 42.061  47.585 -21.478 1.00 90.20  ? 109 TYR B N   1 
ATOM   4012 C CA  . TYR B 2 107 ? 41.462  48.463 -20.483 1.00 87.86  ? 109 TYR B CA  1 
ATOM   4013 C C   . TYR B 2 107 ? 42.138  48.237 -19.139 1.00 86.88  ? 109 TYR B C   1 
ATOM   4014 O O   . TYR B 2 107 ? 42.655  47.153 -18.859 1.00 87.24  ? 109 TYR B O   1 
ATOM   4015 C CB  . TYR B 2 107 ? 39.948  48.240 -20.356 1.00 88.05  ? 109 TYR B CB  1 
ATOM   4016 C CG  . TYR B 2 107 ? 39.137  48.756 -21.526 1.00 90.62  ? 109 TYR B CG  1 
ATOM   4017 C CD1 . TYR B 2 107 ? 38.968  50.120 -21.733 1.00 91.68  ? 109 TYR B CD1 1 
ATOM   4018 C CD2 . TYR B 2 107 ? 38.531  47.880 -22.416 1.00 92.66  ? 109 TYR B CD2 1 
ATOM   4019 C CE1 . TYR B 2 107 ? 38.224  50.596 -22.799 1.00 94.38  ? 109 TYR B CE1 1 
ATOM   4020 C CE2 . TYR B 2 107 ? 37.786  48.346 -23.485 1.00 95.14  ? 109 TYR B CE2 1 
ATOM   4021 C CZ  . TYR B 2 107 ? 37.635  49.704 -23.672 1.00 98.19  ? 109 TYR B CZ  1 
ATOM   4022 O OH  . TYR B 2 107 ? 36.894  50.170 -24.734 1.00 102.10 ? 109 TYR B OH  1 
ATOM   4023 N N   . HIS B 2 108 ? 42.131  49.282 -18.313 1.00 79.51  ? 110 HIS B N   1 
ATOM   4024 C CA  . HIS B 2 108 ? 42.700  49.214 -16.969 1.00 77.42  ? 110 HIS B CA  1 
ATOM   4025 C C   . HIS B 2 108 ? 41.990  50.262 -16.124 1.00 77.11  ? 110 HIS B C   1 
ATOM   4026 O O   . HIS B 2 108 ? 42.140  51.462 -16.376 1.00 76.94  ? 110 HIS B O   1 
ATOM   4027 C CB  . HIS B 2 108 ? 44.205  49.459 -16.998 1.00 77.26  ? 110 HIS B CB  1 
ATOM   4028 C CG  . HIS B 2 108 ? 44.930  48.922 -15.804 1.00 76.73  ? 110 HIS B CG  1 
ATOM   4029 N ND1 . HIS B 2 108 ? 44.516  49.160 -14.512 1.00 75.69  ? 110 HIS B ND1 1 
ATOM   4030 C CD2 . HIS B 2 108 ? 46.058  48.178 -15.706 1.00 77.39  ? 110 HIS B CD2 1 
ATOM   4031 C CE1 . HIS B 2 108 ? 45.348  48.576 -13.669 1.00 74.39  ? 110 HIS B CE1 1 
ATOM   4032 N NE2 . HIS B 2 108 ? 46.293  47.973 -14.368 1.00 75.30  ? 110 HIS B NE2 1 
ATOM   4033 N N   . ARG B 2 109 ? 41.226  49.818 -15.128 1.00 69.93  ? 111 ARG B N   1 
ATOM   4034 C CA  . ARG B 2 109 ? 40.451  50.730 -14.300 1.00 69.78  ? 111 ARG B CA  1 
ATOM   4035 C C   . ARG B 2 109 ? 40.407  50.207 -12.873 1.00 70.52  ? 111 ARG B C   1 
ATOM   4036 O O   . ARG B 2 109 ? 40.488  48.999 -12.635 1.00 70.26  ? 111 ARG B O   1 
ATOM   4037 C CB  . ARG B 2 109 ? 39.026  50.916 -14.837 1.00 71.16  ? 111 ARG B CB  1 
ATOM   4038 C CG  . ARG B 2 109 ? 38.918  51.915 -15.980 1.00 75.70  ? 111 ARG B CG  1 
ATOM   4039 C CD  . ARG B 2 109 ? 37.542  51.884 -16.629 1.00 80.88  ? 111 ARG B CD  1 
ATOM   4040 N NE  . ARG B 2 109 ? 36.617  52.842 -16.028 1.00 84.97  ? 111 ARG B NE  1 
ATOM   4041 C CZ  . ARG B 2 109 ? 35.535  52.502 -15.336 1.00 90.13  ? 111 ARG B CZ  1 
ATOM   4042 N NH1 . ARG B 2 109 ? 35.240  51.222 -15.149 1.00 85.33  ? 111 ARG B NH1 1 
ATOM   4043 N NH2 . ARG B 2 109 ? 34.748  53.440 -14.827 1.00 87.59  ? 111 ARG B NH2 1 
ATOM   4044 N N   . VAL B 2 110 ? 40.294  51.134 -11.927 1.00 65.71  ? 112 VAL B N   1 
ATOM   4045 C CA  . VAL B 2 110 ? 40.113  50.821 -10.515 1.00 65.08  ? 112 VAL B CA  1 
ATOM   4046 C C   . VAL B 2 110 ? 38.826  51.498 -10.070 1.00 66.90  ? 112 VAL B C   1 
ATOM   4047 O O   . VAL B 2 110 ? 38.765  52.731 -9.978  1.00 68.12  ? 112 VAL B O   1 
ATOM   4048 C CB  . VAL B 2 110 ? 41.304  51.277 -9.662  1.00 64.34  ? 112 VAL B CB  1 
ATOM   4049 C CG1 . VAL B 2 110 ? 40.984  51.126 -8.183  1.00 64.77  ? 112 VAL B CG1 1 
ATOM   4050 C CG2 . VAL B 2 110 ? 42.542  50.475 -10.018 1.00 62.86  ? 112 VAL B CG2 1 
ATOM   4051 N N   . ILE B 2 111 ? 37.792  50.699 -9.804  1.00 68.72  ? 113 ILE B N   1 
ATOM   4052 C CA  . ILE B 2 111 ? 36.481  51.216 -9.442  1.00 70.86  ? 113 ILE B CA  1 
ATOM   4053 C C   . ILE B 2 111 ? 36.042  50.601 -8.120  1.00 72.47  ? 113 ILE B C   1 
ATOM   4054 O O   . ILE B 2 111 ? 36.534  49.553 -7.697  1.00 70.61  ? 113 ILE B O   1 
ATOM   4055 C CB  . ILE B 2 111 ? 35.426  50.948 -10.539 1.00 71.65  ? 113 ILE B CB  1 
ATOM   4056 C CG1 . ILE B 2 111 ? 35.296  49.447 -10.813 1.00 69.64  ? 113 ILE B CG1 1 
ATOM   4057 C CG2 . ILE B 2 111 ? 35.784  51.695 -11.815 1.00 71.72  ? 113 ILE B CG2 1 
ATOM   4058 C CD1 . ILE B 2 111 ? 34.040  48.821 -10.241 1.00 72.19  ? 113 ILE B CD1 1 
ATOM   4059 N N   . HIS B 2 112 ? 35.103  51.278 -7.468  1.00 74.00  ? 114 HIS B N   1 
ATOM   4060 C CA  . HIS B 2 112 ? 34.478  50.797 -6.244  1.00 74.19  ? 114 HIS B CA  1 
ATOM   4061 C C   . HIS B 2 112 ? 33.034  50.423 -6.545  1.00 75.49  ? 114 HIS B C   1 
ATOM   4062 O O   . HIS B 2 112 ? 32.325  51.172 -7.227  1.00 77.84  ? 114 HIS B O   1 
ATOM   4063 C CB  . HIS B 2 112 ? 34.547  51.854 -5.140  1.00 77.83  ? 114 HIS B CB  1 
ATOM   4064 C CG  . HIS B 2 112 ? 35.943  52.192 -4.717  1.00 79.46  ? 114 HIS B CG  1 
ATOM   4065 N ND1 . HIS B 2 112 ? 36.801  52.930 -5.504  1.00 80.93  ? 114 HIS B ND1 1 
ATOM   4066 C CD2 . HIS B 2 112 ? 36.633  51.887 -3.593  1.00 80.09  ? 114 HIS B CD2 1 
ATOM   4067 C CE1 . HIS B 2 112 ? 37.958  53.068 -4.881  1.00 81.26  ? 114 HIS B CE1 1 
ATOM   4068 N NE2 . HIS B 2 112 ? 37.883  52.444 -3.720  1.00 81.17  ? 114 HIS B NE2 1 
ATOM   4069 N N   . ILE B 2 113 ? 32.612  49.255 -6.057  1.00 79.30  ? 115 ILE B N   1 
ATOM   4070 C CA  . ILE B 2 113 ? 31.278  48.748 -6.371  1.00 80.25  ? 115 ILE B CA  1 
ATOM   4071 C C   . ILE B 2 113 ? 30.204  49.724 -5.904  1.00 83.28  ? 115 ILE B C   1 
ATOM   4072 O O   . ILE B 2 113 ? 29.199  49.941 -6.592  1.00 85.11  ? 115 ILE B O   1 
ATOM   4073 C CB  . ILE B 2 113 ? 31.075  47.348 -5.758  1.00 79.49  ? 115 ILE B CB  1 
ATOM   4074 C CG1 . ILE B 2 113 ? 32.100  46.352 -6.310  1.00 77.28  ? 115 ILE B CG1 1 
ATOM   4075 C CG2 . ILE B 2 113 ? 29.667  46.845 -6.024  1.00 81.28  ? 115 ILE B CG2 1 
ATOM   4076 C CD1 . ILE B 2 113 ? 33.397  46.282 -5.533  1.00 76.05  ? 115 ILE B CD1 1 
ATOM   4077 N N   . ASN B 2 114 ? 30.403  50.338 -4.737  1.00 81.38  ? 116 ASN B N   1 
ATOM   4078 C CA  . ASN B 2 114 ? 29.420  51.273 -4.204  1.00 84.57  ? 116 ASN B CA  1 
ATOM   4079 C C   . ASN B 2 114 ? 29.359  52.583 -4.980  1.00 85.90  ? 116 ASN B C   1 
ATOM   4080 O O   . ASN B 2 114 ? 28.434  53.371 -4.752  1.00 87.90  ? 116 ASN B O   1 
ATOM   4081 C CB  . ASN B 2 114 ? 29.715  51.561 -2.731  1.00 85.86  ? 116 ASN B CB  1 
ATOM   4082 C CG  . ASN B 2 114 ? 31.128  52.050 -2.508  1.00 84.22  ? 116 ASN B CG  1 
ATOM   4083 O OD1 . ASN B 2 114 ? 32.091  51.308 -2.698  1.00 82.08  ? 116 ASN B OD1 1 
ATOM   4084 N ND2 . ASN B 2 114 ? 31.261  53.306 -2.101  1.00 86.58  ? 116 ASN B ND2 1 
ATOM   4085 N N   . GLU B 2 115 ? 30.314  52.841 -5.873  1.00 84.31  ? 117 GLU B N   1 
ATOM   4086 C CA  . GLU B 2 115 ? 30.355  54.077 -6.645  1.00 86.80  ? 117 GLU B CA  1 
ATOM   4087 C C   . GLU B 2 115 ? 29.833  53.918 -8.068  1.00 88.00  ? 117 GLU B C   1 
ATOM   4088 O O   . GLU B 2 115 ? 29.828  54.897 -8.821  1.00 88.18  ? 117 GLU B O   1 
ATOM   4089 C CB  . GLU B 2 115 ? 31.783  54.637 -6.682  1.00 87.91  ? 117 GLU B CB  1 
ATOM   4090 C CG  . GLU B 2 115 ? 32.330  55.047 -5.322  1.00 91.54  ? 117 GLU B CG  1 
ATOM   4091 C CD  . GLU B 2 115 ? 33.486  56.027 -5.426  1.00 100.17 ? 117 GLU B CD  1 
ATOM   4092 O OE1 . GLU B 2 115 ? 33.327  57.065 -6.101  1.00 98.00  ? 117 GLU B OE1 1 
ATOM   4093 O OE2 . GLU B 2 115 ? 34.556  55.755 -4.838  1.00 98.21  ? 117 GLU B OE2 1 
ATOM   4094 N N   . VAL B 2 116 ? 29.409  52.717 -8.460  1.00 82.78  ? 118 VAL B N   1 
ATOM   4095 C CA  . VAL B 2 116 ? 28.933  52.474 -9.818  1.00 82.38  ? 118 VAL B CA  1 
ATOM   4096 C C   . VAL B 2 116 ? 27.516  51.913 -9.788  1.00 83.46  ? 118 VAL B C   1 
ATOM   4097 O O   . VAL B 2 116 ? 27.179  50.998 -10.549 1.00 85.18  ? 118 VAL B O   1 
ATOM   4098 C CB  . VAL B 2 116 ? 29.887  51.531 -10.574 1.00 83.54  ? 118 VAL B CB  1 
ATOM   4099 C CG1 . VAL B 2 116 ? 31.168  52.261 -10.935 1.00 84.90  ? 118 VAL B CG1 1 
ATOM   4100 C CG2 . VAL B 2 116 ? 30.199  50.308 -9.728  1.00 84.63  ? 118 VAL B CG2 1 
ATOM   4101 N N   . VAL B 2 117 ? 26.675  52.459 -8.914  1.00 84.30  ? 119 VAL B N   1 
ATOM   4102 C CA  . VAL B 2 117 ? 25.303  51.985 -8.767  1.00 85.40  ? 119 VAL B CA  1 
ATOM   4103 C C   . VAL B 2 117 ? 24.441  52.590 -9.865  1.00 85.06  ? 119 VAL B C   1 
ATOM   4104 O O   . VAL B 2 117 ? 24.459  53.807 -10.088 1.00 83.35  ? 119 VAL B O   1 
ATOM   4105 C CB  . VAL B 2 117 ? 24.751  52.334 -7.376  1.00 85.22  ? 119 VAL B CB  1 
ATOM   4106 C CG1 . VAL B 2 117 ? 23.374  51.721 -7.184  1.00 86.57  ? 119 VAL B CG1 1 
ATOM   4107 C CG2 . VAL B 2 117 ? 25.705  51.860 -6.292  1.00 85.79  ? 119 VAL B CG2 1 
ATOM   4108 N N   . LEU B 2 118 ? 23.680  51.743 -10.552 1.00 84.41  ? 120 LEU B N   1 
ATOM   4109 C CA  . LEU B 2 118 ? 22.737  52.170 -11.584 1.00 84.76  ? 120 LEU B CA  1 
ATOM   4110 C C   . LEU B 2 118 ? 21.359  51.629 -11.216 1.00 86.27  ? 120 LEU B C   1 
ATOM   4111 O O   . LEU B 2 118 ? 21.063  50.454 -11.449 1.00 89.26  ? 120 LEU B O   1 
ATOM   4112 C CB  . LEU B 2 118 ? 23.172  51.689 -12.964 1.00 86.77  ? 120 LEU B CB  1 
ATOM   4113 C CG  . LEU B 2 118 ? 22.260  52.116 -14.115 1.00 87.75  ? 120 LEU B CG  1 
ATOM   4114 C CD1 . LEU B 2 118 ? 22.425  53.600 -14.405 1.00 84.80  ? 120 LEU B CD1 1 
ATOM   4115 C CD2 . LEU B 2 118 ? 22.536  51.289 -15.360 1.00 91.46  ? 120 LEU B CD2 1 
ATOM   4116 N N   . LEU B 2 119 ? 20.523  52.486 -10.637 1.00 92.49  ? 121 LEU B N   1 
ATOM   4117 C CA  . LEU B 2 119 ? 19.215  52.070 -10.159 1.00 93.32  ? 121 LEU B CA  1 
ATOM   4118 C C   . LEU B 2 119 ? 18.243  51.897 -11.324 1.00 97.19  ? 121 LEU B C   1 
ATOM   4119 O O   . LEU B 2 119 ? 18.537  52.228 -12.475 1.00 97.55  ? 121 LEU B O   1 
ATOM   4120 C CB  . LEU B 2 119 ? 18.659  53.086 -9.163  1.00 89.08  ? 121 LEU B CB  1 
ATOM   4121 C CG  . LEU B 2 119 ? 19.478  53.308 -7.893  1.00 88.90  ? 121 LEU B CG  1 
ATOM   4122 C CD1 . LEU B 2 119 ? 18.936  54.495 -7.109  1.00 85.70  ? 121 LEU B CD1 1 
ATOM   4123 C CD2 . LEU B 2 119 ? 19.482  52.048 -7.045  1.00 91.80  ? 121 LEU B CD2 1 
ATOM   4124 N N   . ASP B 2 120 ? 17.070  51.360 -11.010 1.00 93.99  ? 122 ASP B N   1 
ATOM   4125 C CA  . ASP B 2 120 ? 16.005  51.221 -11.988 1.00 95.15  ? 122 ASP B CA  1 
ATOM   4126 C C   . ASP B 2 120 ? 15.163  52.494 -12.034 1.00 91.48  ? 122 ASP B C   1 
ATOM   4127 O O   . ASP B 2 120 ? 15.234  53.354 -11.153 1.00 87.69  ? 122 ASP B O   1 
ATOM   4128 C CB  . ASP B 2 120 ? 15.133  50.010 -11.660 1.00 98.28  ? 122 ASP B CB  1 
ATOM   4129 C CG  . ASP B 2 120 ? 15.928  48.722 -11.597 1.00 107.24 ? 122 ASP B CG  1 
ATOM   4130 O OD1 . ASP B 2 120 ? 16.621  48.500 -10.582 1.00 107.04 ? 122 ASP B OD1 1 
ATOM   4131 O OD2 . ASP B 2 120 ? 15.860  47.930 -12.561 1.00 113.63 ? 122 ASP B OD2 1 
ATOM   4132 N N   . ALA B 2 121 ? 14.351  52.605 -13.078 1.00 95.20  ? 123 ALA B N   1 
ATOM   4133 C CA  . ALA B 2 121 ? 13.512  53.782 -13.237 1.00 90.52  ? 123 ALA B CA  1 
ATOM   4134 C C   . ALA B 2 121 ? 12.399  53.781 -12.191 1.00 89.17  ? 123 ALA B C   1 
ATOM   4135 O O   . ALA B 2 121 ? 11.847  52.723 -11.871 1.00 91.00  ? 123 ALA B O   1 
ATOM   4136 C CB  . ALA B 2 121 ? 12.911  53.827 -14.641 1.00 91.32  ? 123 ALA B CB  1 
ATOM   4137 N N   . PRO B 2 122 ? 12.060  54.940 -11.629 1.00 81.23  ? 124 PRO B N   1 
ATOM   4138 C CA  . PRO B 2 122 ? 10.958  54.996 -10.663 1.00 79.09  ? 124 PRO B CA  1 
ATOM   4139 C C   . PRO B 2 122 ? 9.622   54.698 -11.326 1.00 79.43  ? 124 PRO B C   1 
ATOM   4140 O O   . PRO B 2 122 ? 9.461   54.785 -12.545 1.00 79.32  ? 124 PRO B O   1 
ATOM   4141 C CB  . PRO B 2 122 ? 11.007  56.437 -10.141 1.00 76.91  ? 124 PRO B CB  1 
ATOM   4142 C CG  . PRO B 2 122 ? 12.374  56.937 -10.496 1.00 79.01  ? 124 PRO B CG  1 
ATOM   4143 C CD  . PRO B 2 122 ? 12.743  56.237 -11.765 1.00 79.83  ? 124 PRO B CD  1 
ATOM   4144 N N   . VAL B 2 123 ? 8.649   54.333 -10.492 1.00 83.07  ? 125 VAL B N   1 
ATOM   4145 C CA  . VAL B 2 123 ? 7.322   53.951 -10.950 1.00 82.09  ? 125 VAL B CA  1 
ATOM   4146 C C   . VAL B 2 123 ? 6.276   54.709 -10.141 1.00 80.39  ? 125 VAL B C   1 
ATOM   4147 O O   . VAL B 2 123 ? 6.584   55.392 -9.164  1.00 79.56  ? 125 VAL B O   1 
ATOM   4148 C CB  . VAL B 2 123 ? 7.090   52.430 -10.847 1.00 86.56  ? 125 VAL B CB  1 
ATOM   4149 C CG1 . VAL B 2 123 ? 7.984   51.691 -11.834 1.00 90.18  ? 125 VAL B CG1 1 
ATOM   4150 C CG2 . VAL B 2 123 ? 7.345   51.953 -9.425  1.00 87.99  ? 125 VAL B CG2 1 
ATOM   4151 N N   . GLY B 2 124 ? 5.024   54.573 -10.565 1.00 85.70  ? 126 GLY B N   1 
ATOM   4152 C CA  . GLY B 2 124 ? 3.912   55.194 -9.865  1.00 83.80  ? 126 GLY B CA  1 
ATOM   4153 C C   . GLY B 2 124 ? 3.867   56.702 -9.973  1.00 83.66  ? 126 GLY B C   1 
ATOM   4154 O O   . GLY B 2 124 ? 3.469   57.378 -9.015  1.00 83.17  ? 126 GLY B O   1 
ATOM   4155 N N   . LEU B 2 125 ? 4.254   57.247 -11.122 1.00 80.28  ? 127 LEU B N   1 
ATOM   4156 C CA  . LEU B 2 125 ? 4.260   58.690 -11.322 1.00 80.12  ? 127 LEU B CA  1 
ATOM   4157 C C   . LEU B 2 125 ? 2.830   59.178 -11.519 1.00 80.78  ? 127 LEU B C   1 
ATOM   4158 O O   . LEU B 2 125 ? 2.120   58.697 -12.409 1.00 80.17  ? 127 LEU B O   1 
ATOM   4159 C CB  . LEU B 2 125 ? 5.132   59.051 -12.521 1.00 80.84  ? 127 LEU B CB  1 
ATOM   4160 C CG  . LEU B 2 125 ? 5.447   60.533 -12.718 1.00 83.32  ? 127 LEU B CG  1 
ATOM   4161 C CD1 . LEU B 2 125 ? 6.267   61.054 -11.551 1.00 84.14  ? 127 LEU B CD1 1 
ATOM   4162 C CD2 . LEU B 2 125 ? 6.182   60.749 -14.031 1.00 84.85  ? 127 LEU B CD2 1 
ATOM   4163 N N   . VAL B 2 126 ? 2.404   60.123 -10.684 1.00 81.56  ? 128 VAL B N   1 
ATOM   4164 C CA  . VAL B 2 126 ? 1.054   60.672 -10.733 1.00 82.12  ? 128 VAL B CA  1 
ATOM   4165 C C   . VAL B 2 126 ? 1.157   62.188 -10.681 1.00 85.64  ? 128 VAL B C   1 
ATOM   4166 O O   . VAL B 2 126 ? 1.759   62.742 -9.753  1.00 86.75  ? 128 VAL B O   1 
ATOM   4167 C CB  . VAL B 2 126 ? 0.174   60.152 -9.583  1.00 83.08  ? 128 VAL B CB  1 
ATOM   4168 C CG1 . VAL B 2 126 ? -1.170  60.862 -9.581  1.00 84.57  ? 128 VAL B CG1 1 
ATOM   4169 C CG2 . VAL B 2 126 ? -0.017  58.648 -9.700  1.00 81.58  ? 128 VAL B CG2 1 
ATOM   4170 N N   . ALA B 2 127 ? 0.576   62.854 -11.671 1.00 77.58  ? 129 ALA B N   1 
ATOM   4171 C CA  . ALA B 2 127 ? 0.543   64.306 -11.736 1.00 79.33  ? 129 ALA B CA  1 
ATOM   4172 C C   . ALA B 2 127 ? -0.872  64.796 -11.458 1.00 81.64  ? 129 ALA B C   1 
ATOM   4173 O O   . ALA B 2 127 ? -1.846  64.216 -11.947 1.00 81.67  ? 129 ALA B O   1 
ATOM   4174 C CB  . ALA B 2 127 ? 1.024   64.804 -13.101 1.00 78.85  ? 129 ALA B CB  1 
ATOM   4175 N N   . ARG B 2 128 ? -0.980  65.857 -10.661 1.00 80.98  ? 130 ARG B N   1 
ATOM   4176 C CA  . ARG B 2 128 ? -2.268  66.413 -10.270 1.00 84.38  ? 130 ARG B CA  1 
ATOM   4177 C C   . ARG B 2 128 ? -2.215  67.930 -10.353 1.00 91.04  ? 130 ARG B C   1 
ATOM   4178 O O   . ARG B 2 128 ? -1.185  68.541 -10.058 1.00 92.43  ? 130 ARG B O   1 
ATOM   4179 C CB  . ARG B 2 128 ? -2.662  65.995 -8.846  1.00 84.42  ? 130 ARG B CB  1 
ATOM   4180 C CG  . ARG B 2 128 ? -3.151  64.563 -8.705  1.00 82.25  ? 130 ARG B CG  1 
ATOM   4181 C CD  . ARG B 2 128 ? -4.456  64.342 -9.450  1.00 83.72  ? 130 ARG B CD  1 
ATOM   4182 N NE  . ARG B 2 128 ? -4.245  63.612 -10.695 1.00 81.63  ? 130 ARG B NE  1 
ATOM   4183 C CZ  . ARG B 2 128 ? -4.344  62.292 -10.811 1.00 81.60  ? 130 ARG B CZ  1 
ATOM   4184 N NH1 . ARG B 2 128 ? -4.657  61.554 -9.754  1.00 76.34  ? 130 ARG B NH1 1 
ATOM   4185 N NH2 . ARG B 2 128 ? -4.132  61.707 -11.983 1.00 74.86  ? 130 ARG B NH2 1 
ATOM   4186 N N   . LEU B 2 129 ? -3.331  68.530 -10.758 1.00 86.12  ? 131 LEU B N   1 
ATOM   4187 C CA  . LEU B 2 129 ? -3.439  69.981 -10.828 1.00 90.03  ? 131 LEU B CA  1 
ATOM   4188 C C   . LEU B 2 129 ? -3.826  70.533 -9.461  1.00 94.83  ? 131 LEU B C   1 
ATOM   4189 O O   . LEU B 2 129 ? -4.849  70.138 -8.891  1.00 96.06  ? 131 LEU B O   1 
ATOM   4190 C CB  . LEU B 2 129 ? -4.464  70.392 -11.881 1.00 90.86  ? 131 LEU B CB  1 
ATOM   4191 C CG  . LEU B 2 129 ? -4.057  70.197 -13.339 1.00 88.69  ? 131 LEU B CG  1 
ATOM   4192 C CD1 . LEU B 2 129 ? -5.248  70.429 -14.253 1.00 90.36  ? 131 LEU B CD1 1 
ATOM   4193 C CD2 . LEU B 2 129 ? -2.907  71.123 -13.703 1.00 89.27  ? 131 LEU B CD2 1 
ATOM   4194 N N   . ALA B 2 130 ? -3.015  71.450 -8.944  1.00 98.17  ? 132 ALA B N   1 
ATOM   4195 C CA  . ALA B 2 130 ? -3.268  72.081 -7.657  1.00 103.86 ? 132 ALA B CA  1 
ATOM   4196 C C   . ALA B 2 130 ? -4.205  73.268 -7.834  1.00 108.69 ? 132 ALA B C   1 
ATOM   4197 O O   . ALA B 2 130 ? -4.084  74.032 -8.797  1.00 108.46 ? 132 ALA B O   1 
ATOM   4198 C CB  . ALA B 2 130 ? -1.959  72.536 -7.010  1.00 105.62 ? 132 ALA B CB  1 
ATOM   4199 N N   . ASP B 2 131 ? -5.143  73.420 -6.897  1.00 114.85 ? 133 ASP B N   1 
ATOM   4200 C CA  . ASP B 2 131 ? -6.119  74.499 -6.985  1.00 117.82 ? 133 ASP B CA  1 
ATOM   4201 C C   . ASP B 2 131 ? -5.514  75.870 -6.717  1.00 123.02 ? 133 ASP B C   1 
ATOM   4202 O O   . ASP B 2 131 ? -6.195  76.879 -6.931  1.00 124.40 ? 133 ASP B O   1 
ATOM   4203 C CB  . ASP B 2 131 ? -7.268  74.251 -6.005  1.00 120.79 ? 133 ASP B CB  1 
ATOM   4204 C CG  . ASP B 2 131 ? -7.997  72.950 -6.277  1.00 120.31 ? 133 ASP B CG  1 
ATOM   4205 O OD1 . ASP B 2 131 ? -7.382  71.876 -6.103  1.00 117.70 ? 133 ASP B OD1 1 
ATOM   4206 O OD2 . ASP B 2 131 ? -9.184  73.001 -6.661  1.00 121.44 ? 133 ASP B OD2 1 
ATOM   4207 N N   . GLU B 2 132 ? -4.266  75.934 -6.258  1.00 122.90 ? 134 GLU B N   1 
ATOM   4208 C CA  . GLU B 2 132 ? -3.617  77.191 -5.901  1.00 126.63 ? 134 GLU B CA  1 
ATOM   4209 C C   . GLU B 2 132 ? -2.784  77.674 -7.084  1.00 125.82 ? 134 GLU B C   1 
ATOM   4210 O O   . GLU B 2 132 ? -1.794  77.035 -7.455  1.00 122.97 ? 134 GLU B O   1 
ATOM   4211 C CB  . GLU B 2 132 ? -2.752  77.018 -4.655  1.00 129.49 ? 134 GLU B CB  1 
ATOM   4212 N N   . SER B 2 133 ? -3.209  78.788 -7.689  1.00 134.89 ? 135 SER B N   1 
ATOM   4213 C CA  . SER B 2 133 ? -2.482  79.473 -8.757  1.00 133.27 ? 135 SER B CA  1 
ATOM   4214 C C   . SER B 2 133 ? -2.378  78.663 -10.046 1.00 128.48 ? 135 SER B C   1 
ATOM   4215 O O   . SER B 2 133 ? -2.134  79.229 -11.117 1.00 126.75 ? 135 SER B O   1 
ATOM   4216 C CB  . SER B 2 133 ? -1.079  79.863 -8.277  1.00 136.69 ? 135 SER B CB  1 
ATOM   4217 O OG  . SER B 2 133 ? -0.337  80.491 -9.308  1.00 137.61 ? 135 SER B OG  1 
ATOM   4218 N N   . GLY B 2 134 ? -2.563  77.349 -9.965  1.00 125.72 ? 136 GLY B N   1 
ATOM   4219 C CA  . GLY B 2 134 ? -2.540  76.514 -11.148 1.00 119.95 ? 136 GLY B CA  1 
ATOM   4220 C C   . GLY B 2 134 ? -1.239  75.754 -11.300 1.00 117.69 ? 136 GLY B C   1 
ATOM   4221 O O   . GLY B 2 134 ? -0.718  75.620 -12.411 1.00 113.79 ? 136 GLY B O   1 
ATOM   4222 N N   . HIS B 2 135 ? -0.698  75.266 -10.186 1.00 112.34 ? 137 HIS B N   1 
ATOM   4223 C CA  . HIS B 2 135 ? 0.547   74.515 -10.183 1.00 108.89 ? 137 HIS B CA  1 
ATOM   4224 C C   . HIS B 2 135 ? 0.261   73.016 -10.295 1.00 104.56 ? 137 HIS B C   1 
ATOM   4225 O O   . HIS B 2 135 ? -0.891  72.575 -10.288 1.00 104.19 ? 137 HIS B O   1 
ATOM   4226 C CB  . HIS B 2 135 ? 1.359   74.848 -8.933  1.00 113.81 ? 137 HIS B CB  1 
ATOM   4227 C CG  . HIS B 2 135 ? 1.737   76.293 -8.831  1.00 120.13 ? 137 HIS B CG  1 
ATOM   4228 N ND1 . HIS B 2 135 ? 2.479   76.936 -9.798  1.00 118.71 ? 137 HIS B ND1 1 
ATOM   4229 C CD2 . HIS B 2 135 ? 1.479   77.219 -7.878  1.00 127.56 ? 137 HIS B CD2 1 
ATOM   4230 C CE1 . HIS B 2 135 ? 2.661   78.197 -9.446  1.00 123.73 ? 137 HIS B CE1 1 
ATOM   4231 N NE2 . HIS B 2 135 ? 2.064   78.394 -8.285  1.00 129.10 ? 137 HIS B NE2 1 
ATOM   4232 N N   . VAL B 2 136 ? 1.323   72.216 -10.388 1.00 95.33  ? 138 VAL B N   1 
ATOM   4233 C CA  . VAL B 2 136 ? 1.207   70.771 -10.547 1.00 91.24  ? 138 VAL B CA  1 
ATOM   4234 C C   . VAL B 2 136 ? 1.918   70.079 -9.393  1.00 90.28  ? 138 VAL B C   1 
ATOM   4235 O O   . VAL B 2 136 ? 3.031   70.462 -9.015  1.00 91.08  ? 138 VAL B O   1 
ATOM   4236 C CB  . VAL B 2 136 ? 1.787   70.306 -11.899 1.00 88.34  ? 138 VAL B CB  1 
ATOM   4237 C CG1 . VAL B 2 136 ? 1.744   68.789 -12.010 1.00 84.71  ? 138 VAL B CG1 1 
ATOM   4238 C CG2 . VAL B 2 136 ? 1.030   70.947 -13.050 1.00 89.65  ? 138 VAL B CG2 1 
ATOM   4239 N N   . VAL B 2 137 ? 1.270   69.057 -8.839  1.00 86.08  ? 139 VAL B N   1 
ATOM   4240 C CA  . VAL B 2 137 ? 1.808   68.261 -7.742  1.00 85.35  ? 139 VAL B CA  1 
ATOM   4241 C C   . VAL B 2 137 ? 2.175   66.886 -8.285  1.00 81.38  ? 139 VAL B C   1 
ATOM   4242 O O   . VAL B 2 137 ? 1.307   66.152 -8.774  1.00 80.04  ? 139 VAL B O   1 
ATOM   4243 C CB  . VAL B 2 137 ? 0.807   68.147 -6.583  1.00 87.72  ? 139 VAL B CB  1 
ATOM   4244 C CG1 . VAL B 2 137 ? 1.349   67.222 -5.506  1.00 87.11  ? 139 VAL B CG1 1 
ATOM   4245 C CG2 . VAL B 2 137 ? 0.504   69.524 -6.012  1.00 92.29  ? 139 VAL B CG2 1 
ATOM   4246 N N   . LEU B 2 138 ? 3.456   66.536 -8.200  1.00 90.84  ? 140 LEU B N   1 
ATOM   4247 C CA  . LEU B 2 138 ? 3.957   65.248 -8.664  1.00 86.34  ? 140 LEU B CA  1 
ATOM   4248 C C   . LEU B 2 138 ? 4.251   64.340 -7.479  1.00 85.80  ? 140 LEU B C   1 
ATOM   4249 O O   . LEU B 2 138 ? 4.861   64.771 -6.494  1.00 87.24  ? 140 LEU B O   1 
ATOM   4250 C CB  . LEU B 2 138 ? 5.220   65.415 -9.509  1.00 85.87  ? 140 LEU B CB  1 
ATOM   4251 C CG  . LEU B 2 138 ? 5.020   65.590 -11.011 1.00 86.98  ? 140 LEU B CG  1 
ATOM   4252 C CD1 . LEU B 2 138 ? 6.350   65.899 -11.672 1.00 86.91  ? 140 LEU B CD1 1 
ATOM   4253 C CD2 . LEU B 2 138 ? 4.391   64.342 -11.611 1.00 84.79  ? 140 LEU B CD2 1 
ATOM   4254 N N   . ARG B 2 139 ? 3.818   63.085 -7.583  1.00 88.02  ? 141 ARG B N   1 
ATOM   4255 C CA  . ARG B 2 139 ? 4.089   62.064 -6.581  1.00 86.49  ? 141 ARG B CA  1 
ATOM   4256 C C   . ARG B 2 139 ? 4.532   60.791 -7.284  1.00 85.61  ? 141 ARG B C   1 
ATOM   4257 O O   . ARG B 2 139 ? 3.871   60.334 -8.223  1.00 84.45  ? 141 ARG B O   1 
ATOM   4258 C CB  . ARG B 2 139 ? 2.859   61.785 -5.708  1.00 86.82  ? 141 ARG B CB  1 
ATOM   4259 C CG  . ARG B 2 139 ? 2.507   62.901 -4.739  1.00 93.70  ? 141 ARG B CG  1 
ATOM   4260 C CD  . ARG B 2 139 ? 1.587   62.391 -3.640  1.00 98.88  ? 141 ARG B CD  1 
ATOM   4261 N NE  . ARG B 2 139 ? 0.943   63.474 -2.902  1.00 106.06 ? 141 ARG B NE  1 
ATOM   4262 C CZ  . ARG B 2 139 ? 0.156   63.292 -1.847  1.00 112.97 ? 141 ARG B CZ  1 
ATOM   4263 N NH1 . ARG B 2 139 ? -0.087  62.066 -1.401  1.00 107.85 ? 141 ARG B NH1 1 
ATOM   4264 N NH2 . ARG B 2 139 ? -0.387  64.335 -1.234  1.00 112.74 ? 141 ARG B NH2 1 
ATOM   4265 N N   . TRP B 2 140 ? 5.652   60.226 -6.836  1.00 82.04  ? 142 TRP B N   1 
ATOM   4266 C CA  . TRP B 2 140 ? 6.202   59.018 -7.432  1.00 81.35  ? 142 TRP B CA  1 
ATOM   4267 C C   . TRP B 2 140 ? 6.707   58.098 -6.329  1.00 83.23  ? 142 TRP B C   1 
ATOM   4268 O O   . TRP B 2 140 ? 6.798   58.481 -5.159  1.00 83.66  ? 142 TRP B O   1 
ATOM   4269 C CB  . TRP B 2 140 ? 7.326   59.341 -8.425  1.00 81.39  ? 142 TRP B CB  1 
ATOM   4270 C CG  . TRP B 2 140 ? 8.485   60.049 -7.803  1.00 82.81  ? 142 TRP B CG  1 
ATOM   4271 C CD1 . TRP B 2 140 ? 9.618   59.480 -7.300  1.00 84.44  ? 142 TRP B CD1 1 
ATOM   4272 C CD2 . TRP B 2 140 ? 8.626   61.461 -7.615  1.00 83.90  ? 142 TRP B CD2 1 
ATOM   4273 N NE1 . TRP B 2 140 ? 10.456  60.451 -6.809  1.00 85.20  ? 142 TRP B NE1 1 
ATOM   4274 C CE2 . TRP B 2 140 ? 9.871   61.676 -6.991  1.00 86.17  ? 142 TRP B CE2 1 
ATOM   4275 C CE3 . TRP B 2 140 ? 7.822   62.565 -7.913  1.00 85.26  ? 142 TRP B CE3 1 
ATOM   4276 C CZ2 . TRP B 2 140 ? 10.330  62.949 -6.659  1.00 87.92  ? 142 TRP B CZ2 1 
ATOM   4277 C CZ3 . TRP B 2 140 ? 8.279   63.829 -7.583  1.00 88.17  ? 142 TRP B CZ3 1 
ATOM   4278 C CH2 . TRP B 2 140 ? 9.521   64.010 -6.963  1.00 89.36  ? 142 TRP B CH2 1 
ATOM   4279 N N   . LEU B 2 141 ? 7.032   56.867 -6.716  1.00 76.27  ? 143 LEU B N   1 
ATOM   4280 C CA  . LEU B 2 141 ? 7.537   55.846 -5.814  1.00 77.95  ? 143 LEU B CA  1 
ATOM   4281 C C   . LEU B 2 141 ? 8.938   55.409 -6.232  1.00 80.82  ? 143 LEU B C   1 
ATOM   4282 O O   . LEU B 2 141 ? 9.302   55.522 -7.407  1.00 80.61  ? 143 LEU B O   1 
ATOM   4283 C CB  . LEU B 2 141 ? 6.606   54.626 -5.783  1.00 78.94  ? 143 LEU B CB  1 
ATOM   4284 C CG  . LEU B 2 141 ? 5.320   54.771 -4.964  1.00 79.08  ? 143 LEU B CG  1 
ATOM   4285 C CD1 . LEU B 2 141 ? 4.187   55.299 -5.826  1.00 77.66  ? 143 LEU B CD1 1 
ATOM   4286 C CD2 . LEU B 2 141 ? 4.930   53.446 -4.327  1.00 81.29  ? 143 LEU B CD2 1 
ATOM   4287 N N   . PRO B 2 142 ? 9.750   54.927 -5.293  1.00 78.65  ? 144 PRO B N   1 
ATOM   4288 C CA  . PRO B 2 142 ? 11.109  54.479 -5.634  1.00 80.17  ? 144 PRO B CA  1 
ATOM   4289 C C   . PRO B 2 142 ? 11.074  53.271 -6.554  1.00 83.93  ? 144 PRO B C   1 
ATOM   4290 O O   . PRO B 2 142 ? 10.027  52.622 -6.698  1.00 84.32  ? 144 PRO B O   1 
ATOM   4291 C CB  . PRO B 2 142 ? 11.714  54.122 -4.266  1.00 81.79  ? 144 PRO B CB  1 
ATOM   4292 C CG  . PRO B 2 142 ? 10.903  54.894 -3.279  1.00 82.00  ? 144 PRO B CG  1 
ATOM   4293 C CD  . PRO B 2 142 ? 9.516   54.915 -3.839  1.00 79.54  ? 144 PRO B CD  1 
ATOM   4294 N N   . PRO B 2 143 ? 12.192  52.944 -7.202  1.00 82.69  ? 145 PRO B N   1 
ATOM   4295 C CA  . PRO B 2 143 ? 12.229  51.772 -8.089  1.00 85.92  ? 145 PRO B CA  1 
ATOM   4296 C C   . PRO B 2 143 ? 11.891  50.495 -7.340  1.00 90.19  ? 145 PRO B C   1 
ATOM   4297 O O   . PRO B 2 143 ? 12.246  50.340 -6.162  1.00 90.02  ? 145 PRO B O   1 
ATOM   4298 C CB  . PRO B 2 143 ? 13.681  51.756 -8.597  1.00 88.50  ? 145 PRO B CB  1 
ATOM   4299 C CG  . PRO B 2 143 ? 14.438  52.643 -7.657  1.00 87.29  ? 145 PRO B CG  1 
ATOM   4300 C CD  . PRO B 2 143 ? 13.461  53.688 -7.232  1.00 82.26  ? 145 PRO B CD  1 
ATOM   4301 N N   . PRO B 2 144 ? 11.205  49.557 -7.994  1.00 90.36  ? 146 PRO B N   1 
ATOM   4302 C CA  . PRO B 2 144 ? 10.748  48.349 -7.296  1.00 93.16  ? 146 PRO B CA  1 
ATOM   4303 C C   . PRO B 2 144 ? 11.912  47.481 -6.841  1.00 98.39  ? 146 PRO B C   1 
ATOM   4304 O O   . PRO B 2 144 ? 12.918  47.340 -7.541  1.00 100.49 ? 146 PRO B O   1 
ATOM   4305 C CB  . PRO B 2 144 ? 9.895   47.628 -8.349  1.00 95.76  ? 146 PRO B CB  1 
ATOM   4306 C CG  . PRO B 2 144 ? 9.549   48.679 -9.357  1.00 94.04  ? 146 PRO B CG  1 
ATOM   4307 C CD  . PRO B 2 144 ? 10.725  49.604 -9.385  1.00 91.26  ? 146 PRO B CD  1 
ATOM   4308 N N   . GLU B 2 145 ? 11.758  46.902 -5.650  1.00 102.79 ? 147 GLU B N   1 
ATOM   4309 C CA  . GLU B 2 145 ? 12.729  45.983 -5.055  1.00 106.18 ? 147 GLU B CA  1 
ATOM   4310 C C   . GLU B 2 145 ? 14.135  46.583 -5.062  1.00 106.84 ? 147 GLU B C   1 
ATOM   4311 O O   . GLU B 2 145 ? 15.062  46.077 -5.699  1.00 109.69 ? 147 GLU B O   1 
ATOM   4312 C CB  . GLU B 2 145 ? 12.706  44.631 -5.775  1.00 111.25 ? 147 GLU B CB  1 
ATOM   4313 C CG  . GLU B 2 145 ? 11.385  43.885 -5.662  1.00 115.22 ? 147 GLU B CG  1 
ATOM   4314 C CD  . GLU B 2 145 ? 11.172  43.276 -4.290  1.00 122.12 ? 147 GLU B CD  1 
ATOM   4315 O OE1 . GLU B 2 145 ? 12.172  43.031 -3.583  1.00 120.32 ? 147 GLU B OE1 1 
ATOM   4316 O OE2 . GLU B 2 145 ? 10.002  43.039 -3.918  1.00 120.56 ? 147 GLU B OE2 1 
ATOM   4317 N N   . THR B 2 146 ? 14.276  47.693 -4.336  1.00 107.23 ? 148 THR B N   1 
ATOM   4318 C CA  . THR B 2 146 ? 15.548  48.380 -4.222  1.00 105.73 ? 148 THR B CA  1 
ATOM   4319 C C   . THR B 2 146 ? 15.774  48.764 -2.763  1.00 104.93 ? 148 THR B C   1 
ATOM   4320 O O   . THR B 2 146 ? 14.914  49.431 -2.159  1.00 102.24 ? 148 THR B O   1 
ATOM   4321 C CB  . THR B 2 146 ? 15.592  49.622 -5.117  1.00 105.47 ? 148 THR B CB  1 
ATOM   4322 O OG1 . THR B 2 146 ? 15.395  49.234 -6.483  1.00 107.85 ? 148 THR B OG1 1 
ATOM   4323 C CG2 . THR B 2 146 ? 16.933  50.326 -4.987  1.00 103.47 ? 148 THR B CG2 1 
ATOM   4324 N N   . PRO B 2 147 ? 16.893  48.366 -2.172  1.00 112.16 ? 149 PRO B N   1 
ATOM   4325 C CA  . PRO B 2 147 ? 17.177  48.714 -0.778  1.00 110.55 ? 149 PRO B CA  1 
ATOM   4326 C C   . PRO B 2 147 ? 17.651  50.161 -0.683  1.00 108.93 ? 149 PRO B C   1 
ATOM   4327 O O   . PRO B 2 147 ? 17.818  50.854 -1.685  1.00 107.78 ? 149 PRO B O   1 
ATOM   4328 C CB  . PRO B 2 147 ? 18.282  47.732 -0.387  1.00 113.31 ? 149 PRO B CB  1 
ATOM   4329 C CG  . PRO B 2 147 ? 18.970  47.407 -1.666  1.00 116.14 ? 149 PRO B CG  1 
ATOM   4330 C CD  . PRO B 2 147 ? 17.959  47.546 -2.774  1.00 115.40 ? 149 PRO B CD  1 
ATOM   4331 N N   . MET B 2 148 ? 17.868  50.608 0.555   1.00 113.75 ? 150 MET B N   1 
ATOM   4332 C CA  . MET B 2 148 ? 18.325  51.967 0.848   1.00 111.80 ? 150 MET B CA  1 
ATOM   4333 C C   . MET B 2 148 ? 17.361  53.007 0.273   1.00 111.15 ? 150 MET B C   1 
ATOM   4334 O O   . MET B 2 148 ? 17.740  53.897 -0.493  1.00 109.84 ? 150 MET B O   1 
ATOM   4335 C CB  . MET B 2 148 ? 19.749  52.190 0.325   1.00 112.46 ? 150 MET B CB  1 
ATOM   4336 C CG  . MET B 2 148 ? 20.734  51.086 0.682   1.00 115.43 ? 150 MET B CG  1 
ATOM   4337 S SD  . MET B 2 148 ? 21.219  51.100 2.415   1.00 117.24 ? 150 MET B SD  1 
ATOM   4338 C CE  . MET B 2 148 ? 22.357  49.717 2.464   1.00 118.03 ? 150 MET B CE  1 
ATOM   4339 N N   . THR B 2 149 ? 16.090  52.878 0.663   1.00 104.29 ? 151 THR B N   1 
ATOM   4340 C CA  . THR B 2 149 ? 15.061  53.779 0.151   1.00 105.94 ? 151 THR B CA  1 
ATOM   4341 C C   . THR B 2 149 ? 15.323  55.223 0.568   1.00 110.01 ? 151 THR B C   1 
ATOM   4342 O O   . THR B 2 149 ? 15.114  56.152 -0.221  1.00 110.09 ? 151 THR B O   1 
ATOM   4343 C CB  . THR B 2 149 ? 13.682  53.328 0.634   1.00 110.26 ? 151 THR B CB  1 
ATOM   4344 O OG1 . THR B 2 149 ? 13.482  51.951 0.291   1.00 107.62 ? 151 THR B OG1 1 
ATOM   4345 C CG2 . THR B 2 149 ? 12.586  54.169 -0.002  1.00 111.51 ? 151 THR B CG2 1 
ATOM   4346 N N   . SER B 2 150 ? 15.784  55.431 1.801   1.00 110.99 ? 152 SER B N   1 
ATOM   4347 C CA  . SER B 2 150 ? 15.970  56.775 2.337   1.00 114.26 ? 152 SER B CA  1 
ATOM   4348 C C   . SER B 2 150 ? 17.169  57.508 1.745   1.00 113.86 ? 152 SER B C   1 
ATOM   4349 O O   . SER B 2 150 ? 17.374  58.680 2.081   1.00 116.46 ? 152 SER B O   1 
ATOM   4350 C CB  . SER B 2 150 ? 16.105  56.707 3.859   1.00 118.39 ? 152 SER B CB  1 
ATOM   4351 O OG  . SER B 2 150 ? 17.167  55.847 4.238   1.00 118.70 ? 152 SER B OG  1 
ATOM   4352 N N   . HIS B 2 151 ? 17.959  56.870 0.880   1.00 115.87 ? 153 HIS B N   1 
ATOM   4353 C CA  . HIS B 2 151 ? 19.168  57.482 0.338   1.00 114.87 ? 153 HIS B CA  1 
ATOM   4354 C C   . HIS B 2 151 ? 19.085  57.704 -1.168  1.00 113.80 ? 153 HIS B C   1 
ATOM   4355 O O   . HIS B 2 151 ? 20.114  57.938 -1.809  1.00 112.93 ? 153 HIS B O   1 
ATOM   4356 C CB  . HIS B 2 151 ? 20.393  56.630 0.675   1.00 113.80 ? 153 HIS B CB  1 
ATOM   4357 C CG  . HIS B 2 151 ? 20.528  56.319 2.132   1.00 116.82 ? 153 HIS B CG  1 
ATOM   4358 N ND1 . HIS B 2 151 ? 20.078  55.139 2.684   1.00 116.42 ? 153 HIS B ND1 1 
ATOM   4359 C CD2 . HIS B 2 151 ? 21.066  57.031 3.151   1.00 120.53 ? 153 HIS B CD2 1 
ATOM   4360 C CE1 . HIS B 2 151 ? 20.330  55.138 3.980   1.00 118.50 ? 153 HIS B CE1 1 
ATOM   4361 N NE2 . HIS B 2 151 ? 20.930  56.274 4.289   1.00 121.21 ? 153 HIS B NE2 1 
ATOM   4362 N N   . ILE B 2 152 ? 17.891  57.634 -1.746  1.00 101.12 ? 154 ILE B N   1 
ATOM   4363 C CA  . ILE B 2 152 ? 17.715  57.804 -3.183  1.00 99.99  ? 154 ILE B CA  1 
ATOM   4364 C C   . ILE B 2 152 ? 17.409  59.266 -3.485  1.00 101.73 ? 154 ILE B C   1 
ATOM   4365 O O   . ILE B 2 152 ? 16.525  59.869 -2.865  1.00 103.95 ? 154 ILE B O   1 
ATOM   4366 C CB  . ILE B 2 152 ? 16.602  56.885 -3.713  1.00 98.88  ? 154 ILE B CB  1 
ATOM   4367 C CG1 . ILE B 2 152 ? 16.900  55.429 -3.353  1.00 97.90  ? 154 ILE B CG1 1 
ATOM   4368 C CG2 . ILE B 2 152 ? 16.458  57.032 -5.221  1.00 100.67 ? 154 ILE B CG2 1 
ATOM   4369 C CD1 . ILE B 2 152 ? 15.706  54.511 -3.492  1.00 99.54  ? 154 ILE B CD1 1 
ATOM   4370 N N   . ARG B 2 153 ? 18.142  59.833 -4.439  1.00 96.27  ? 155 ARG B N   1 
ATOM   4371 C CA  . ARG B 2 153 ? 17.929  61.194 -4.907  1.00 97.68  ? 155 ARG B CA  1 
ATOM   4372 C C   . ARG B 2 153 ? 17.235  61.170 -6.264  1.00 98.63  ? 155 ARG B C   1 
ATOM   4373 O O   . ARG B 2 153 ? 17.465  60.274 -7.080  1.00 99.82  ? 155 ARG B O   1 
ATOM   4374 C CB  . ARG B 2 153 ? 19.259  61.947 -5.005  1.00 99.19  ? 155 ARG B CB  1 
ATOM   4375 C CG  . ARG B 2 153 ? 19.133  63.460 -4.938  1.00 105.55 ? 155 ARG B CG  1 
ATOM   4376 C CD  . ARG B 2 153 ? 20.501  64.126 -4.899  1.00 110.92 ? 155 ARG B CD  1 
ATOM   4377 N NE  . ARG B 2 153 ? 21.184  64.054 -6.187  1.00 112.82 ? 155 ARG B NE  1 
ATOM   4378 C CZ  . ARG B 2 153 ? 22.494  64.204 -6.348  1.00 118.44 ? 155 ARG B CZ  1 
ATOM   4379 N NH1 . ARG B 2 153 ? 23.271  64.440 -5.299  1.00 116.08 ? 155 ARG B NH1 1 
ATOM   4380 N NH2 . ARG B 2 153 ? 23.029  64.121 -7.559  1.00 114.32 ? 155 ARG B NH2 1 
ATOM   4381 N N   . TYR B 2 154 ? 16.382  62.162 -6.502  1.00 91.25  ? 156 TYR B N   1 
ATOM   4382 C CA  . TYR B 2 154 ? 15.546  62.197 -7.694  1.00 91.85  ? 156 TYR B CA  1 
ATOM   4383 C C   . TYR B 2 154 ? 15.763  63.492 -8.470  1.00 94.36  ? 156 TYR B C   1 
ATOM   4384 O O   . TYR B 2 154 ? 16.407  64.433 -7.999  1.00 94.57  ? 156 TYR B O   1 
ATOM   4385 C CB  . TYR B 2 154 ? 14.065  62.036 -7.327  1.00 90.81  ? 156 TYR B CB  1 
ATOM   4386 C CG  . TYR B 2 154 ? 13.750  60.742 -6.608  1.00 90.58  ? 156 TYR B CG  1 
ATOM   4387 C CD1 . TYR B 2 154 ? 13.526  59.567 -7.314  1.00 91.47  ? 156 TYR B CD1 1 
ATOM   4388 C CD2 . TYR B 2 154 ? 13.679  60.697 -5.222  1.00 92.83  ? 156 TYR B CD2 1 
ATOM   4389 C CE1 . TYR B 2 154 ? 13.239  58.383 -6.660  1.00 90.91  ? 156 TYR B CE1 1 
ATOM   4390 C CE2 . TYR B 2 154 ? 13.393  59.518 -4.560  1.00 93.03  ? 156 TYR B CE2 1 
ATOM   4391 C CZ  . TYR B 2 154 ? 13.174  58.365 -5.283  1.00 92.82  ? 156 TYR B CZ  1 
ATOM   4392 O OH  . TYR B 2 154 ? 12.890  57.192 -4.622  1.00 93.16  ? 156 TYR B OH  1 
ATOM   4393 N N   . GLU B 2 155 ? 15.207  63.519 -9.681  1.00 86.33  ? 157 GLU B N   1 
ATOM   4394 C CA  . GLU B 2 155 ? 15.303  64.677 -10.569 1.00 88.32  ? 157 GLU B CA  1 
ATOM   4395 C C   . GLU B 2 155 ? 14.171  64.590 -11.582 1.00 87.96  ? 157 GLU B C   1 
ATOM   4396 O O   . GLU B 2 155 ? 14.103  63.622 -12.346 1.00 86.38  ? 157 GLU B O   1 
ATOM   4397 C CB  . GLU B 2 155 ? 16.661  64.711 -11.273 1.00 88.84  ? 157 GLU B CB  1 
ATOM   4398 C CG  . GLU B 2 155 ? 16.915  65.961 -12.097 1.00 91.41  ? 157 GLU B CG  1 
ATOM   4399 C CD  . GLU B 2 155 ? 18.222  65.894 -12.864 1.00 98.10  ? 157 GLU B CD  1 
ATOM   4400 O OE1 . GLU B 2 155 ? 19.223  66.476 -12.394 1.00 95.39  ? 157 GLU B OE1 1 
ATOM   4401 O OE2 . GLU B 2 155 ? 18.252  65.239 -13.927 1.00 96.18  ? 157 GLU B OE2 1 
ATOM   4402 N N   . VAL B 2 156 ? 13.291  65.591 -11.596 1.00 86.42  ? 158 VAL B N   1 
ATOM   4403 C CA  . VAL B 2 156 ? 12.138  65.599 -12.490 1.00 86.70  ? 158 VAL B CA  1 
ATOM   4404 C C   . VAL B 2 156 ? 12.439  66.478 -13.697 1.00 88.41  ? 158 VAL B C   1 
ATOM   4405 O O   . VAL B 2 156 ? 13.187  67.459 -13.611 1.00 90.26  ? 158 VAL B O   1 
ATOM   4406 C CB  . VAL B 2 156 ? 10.867  66.075 -11.755 1.00 88.33  ? 158 VAL B CB  1 
ATOM   4407 C CG1 . VAL B 2 156 ? 10.457  65.062 -10.697 1.00 86.85  ? 158 VAL B CG1 1 
ATOM   4408 C CG2 . VAL B 2 156 ? 11.090  67.442 -11.131 1.00 91.29  ? 158 VAL B CG2 1 
ATOM   4409 N N   . ASP B 2 157 ? 11.855  66.118 -14.841 1.00 91.88  ? 159 ASP B N   1 
ATOM   4410 C CA  . ASP B 2 157 ? 12.030  66.851 -16.092 1.00 93.72  ? 159 ASP B CA  1 
ATOM   4411 C C   . ASP B 2 157 ? 10.669  67.325 -16.585 1.00 95.39  ? 159 ASP B C   1 
ATOM   4412 O O   . ASP B 2 157 ? 9.819   66.508 -16.957 1.00 94.60  ? 159 ASP B O   1 
ATOM   4413 C CB  . ASP B 2 157 ? 12.713  65.987 -17.149 1.00 94.85  ? 159 ASP B CB  1 
ATOM   4414 C CG  . ASP B 2 157 ? 12.813  66.685 -18.493 1.00 101.87 ? 159 ASP B CG  1 
ATOM   4415 O OD1 . ASP B 2 157 ? 13.682  67.571 -18.643 1.00 104.49 ? 159 ASP B OD1 1 
ATOM   4416 O OD2 . ASP B 2 157 ? 11.983  66.385 -19.383 1.00 103.74 ? 159 ASP B OD2 1 
ATOM   4417 N N   . VAL B 2 158 ? 10.467  68.638 -16.603 1.00 95.96  ? 160 VAL B N   1 
ATOM   4418 C CA  . VAL B 2 158 ? 9.231   69.233 -17.098 1.00 95.68  ? 160 VAL B CA  1 
ATOM   4419 C C   . VAL B 2 158 ? 9.445   69.600 -18.563 1.00 102.59 ? 160 VAL B C   1 
ATOM   4420 O O   . VAL B 2 158 ? 10.156  70.559 -18.875 1.00 105.28 ? 160 VAL B O   1 
ATOM   4421 C CB  . VAL B 2 158 ? 8.821   70.456 -16.270 1.00 98.58  ? 160 VAL B CB  1 
ATOM   4422 C CG1 . VAL B 2 158 ? 7.391   70.858 -16.595 1.00 101.11 ? 160 VAL B CG1 1 
ATOM   4423 C CG2 . VAL B 2 158 ? 8.978   70.166 -14.788 1.00 97.60  ? 160 VAL B CG2 1 
ATOM   4424 N N   . SER B 2 159 ? 8.840   68.831 -19.462 1.00 103.15 ? 161 SER B N   1 
ATOM   4425 C CA  . SER B 2 159 ? 8.998   69.025 -20.896 1.00 107.57 ? 161 SER B CA  1 
ATOM   4426 C C   . SER B 2 159 ? 7.775   69.717 -21.483 1.00 108.29 ? 161 SER B C   1 
ATOM   4427 O O   . SER B 2 159 ? 6.636   69.402 -21.124 1.00 105.07 ? 161 SER B O   1 
ATOM   4428 C CB  . SER B 2 159 ? 9.228   67.687 -21.601 1.00 110.19 ? 161 SER B CB  1 
ATOM   4429 O OG  . SER B 2 159 ? 9.378   67.867 -22.999 1.00 115.53 ? 161 SER B OG  1 
ATOM   4430 N N   . ALA B 2 160 ? 8.019   70.659 -22.391 1.00 119.01 ? 162 ALA B N   1 
ATOM   4431 C CA  . ALA B 2 160 ? 6.941   71.351 -23.081 1.00 118.99 ? 162 ALA B CA  1 
ATOM   4432 C C   . ALA B 2 160 ? 6.425   70.507 -24.239 1.00 122.02 ? 162 ALA B C   1 
ATOM   4433 O O   . ALA B 2 160 ? 7.202   69.875 -24.961 1.00 124.15 ? 162 ALA B O   1 
ATOM   4434 C CB  . ALA B 2 160 ? 7.417   72.711 -23.593 1.00 121.83 ? 162 ALA B CB  1 
ATOM   4435 N N   . GLY B 2 161 ? 5.103   70.501 -24.412 1.00 132.24 ? 163 GLY B N   1 
ATOM   4436 C CA  . GLY B 2 161 ? 4.504   69.665 -25.442 1.00 133.54 ? 163 GLY B CA  1 
ATOM   4437 C C   . GLY B 2 161 ? 4.851   70.117 -26.849 1.00 139.47 ? 163 GLY B C   1 
ATOM   4438 O O   . GLY B 2 161 ? 5.312   69.322 -27.674 1.00 140.15 ? 163 GLY B O   1 
ATOM   4439 N N   . GLN B 2 162 ? 4.635   71.397 -27.143 1.00 140.58 ? 164 GLN B N   1 
ATOM   4440 C CA  . GLN B 2 162 ? 4.839   71.914 -28.489 1.00 143.11 ? 164 GLN B CA  1 
ATOM   4441 C C   . GLN B 2 162 ? 6.314   72.216 -28.727 1.00 144.12 ? 164 GLN B C   1 
ATOM   4442 O O   . GLN B 2 162 ? 6.981   72.817 -27.878 1.00 143.66 ? 164 GLN B O   1 
ATOM   4443 C CB  . GLN B 2 162 ? 3.999   73.172 -28.709 1.00 144.14 ? 164 GLN B CB  1 
ATOM   4444 N N   . GLY B 2 163 ? 6.819   71.794 -29.889 1.00 145.39 ? 165 GLY B N   1 
ATOM   4445 C CA  . GLY B 2 163 ? 8.193   72.067 -30.262 1.00 144.93 ? 165 GLY B CA  1 
ATOM   4446 C C   . GLY B 2 163 ? 9.188   71.371 -29.349 1.00 145.26 ? 165 GLY B C   1 
ATOM   4447 O O   . GLY B 2 163 ? 8.912   70.323 -28.756 1.00 144.49 ? 165 GLY B O   1 
ATOM   4448 N N   . ALA B 2 164 ? 10.374  71.967 -29.240 1.00 140.93 ? 166 ALA B N   1 
ATOM   4449 C CA  . ALA B 2 164 ? 11.433  71.425 -28.397 1.00 140.09 ? 166 ALA B CA  1 
ATOM   4450 C C   . ALA B 2 164 ? 11.093  71.712 -26.939 1.00 140.74 ? 166 ALA B C   1 
ATOM   4451 O O   . ALA B 2 164 ? 11.135  72.865 -26.498 1.00 140.85 ? 166 ALA B O   1 
ATOM   4452 C CB  . ALA B 2 164 ? 12.783  72.023 -28.781 1.00 142.24 ? 166 ALA B CB  1 
ATOM   4453 N N   . GLY B 2 165 ? 10.750  70.667 -26.190 1.00 129.12 ? 167 GLY B N   1 
ATOM   4454 C CA  . GLY B 2 165 ? 10.348  70.835 -24.808 1.00 128.57 ? 167 GLY B CA  1 
ATOM   4455 C C   . GLY B 2 165 ? 11.355  70.325 -23.797 1.00 128.83 ? 167 GLY B C   1 
ATOM   4456 O O   . GLY B 2 165 ? 11.477  69.116 -23.581 1.00 128.13 ? 167 GLY B O   1 
ATOM   4457 N N   . SER B 2 166 ? 12.087  71.247 -23.174 1.00 119.37 ? 168 SER B N   1 
ATOM   4458 C CA  . SER B 2 166 ? 13.018  70.905 -22.105 1.00 118.13 ? 168 SER B CA  1 
ATOM   4459 C C   . SER B 2 166 ? 13.181  72.096 -21.167 1.00 118.98 ? 168 SER B C   1 
ATOM   4460 O O   . SER B 2 166 ? 14.296  72.444 -20.763 1.00 117.97 ? 168 SER B O   1 
ATOM   4461 C CB  . SER B 2 166 ? 14.370  70.456 -22.663 1.00 118.91 ? 168 SER B CB  1 
ATOM   4462 O OG  . SER B 2 166 ? 14.229  69.286 -23.452 1.00 122.39 ? 168 SER B OG  1 
ATOM   4463 N N   . VAL B 2 167 ? 12.062  72.737 -20.819 1.00 120.97 ? 169 VAL B N   1 
ATOM   4464 C CA  . VAL B 2 167 ? 12.107  74.037 -20.155 1.00 120.40 ? 169 VAL B CA  1 
ATOM   4465 C C   . VAL B 2 167 ? 12.631  73.916 -18.728 1.00 118.53 ? 169 VAL B C   1 
ATOM   4466 O O   . VAL B 2 167 ? 13.431  74.747 -18.279 1.00 119.15 ? 169 VAL B O   1 
ATOM   4467 C CB  . VAL B 2 167 ? 10.722  74.708 -20.196 1.00 120.19 ? 169 VAL B CB  1 
ATOM   4468 C CG1 . VAL B 2 167 ? 10.519  75.414 -21.528 1.00 123.40 ? 169 VAL B CG1 1 
ATOM   4469 C CG2 . VAL B 2 167 ? 9.626   73.682 -19.961 1.00 117.28 ? 169 VAL B CG2 1 
ATOM   4470 N N   . GLN B 2 168 ? 12.200  72.894 -17.991 1.00 107.73 ? 170 GLN B N   1 
ATOM   4471 C CA  . GLN B 2 168 ? 12.441  72.842 -16.556 1.00 106.82 ? 170 GLN B CA  1 
ATOM   4472 C C   . GLN B 2 168 ? 12.961  71.471 -16.148 1.00 103.97 ? 170 GLN B C   1 
ATOM   4473 O O   . GLN B 2 168 ? 12.493  70.442 -16.645 1.00 104.64 ? 170 GLN B O   1 
ATOM   4474 C CB  . GLN B 2 168 ? 11.150  73.162 -15.791 1.00 108.03 ? 170 GLN B CB  1 
ATOM   4475 C CG  . GLN B 2 168 ? 11.341  73.634 -14.364 1.00 109.48 ? 170 GLN B CG  1 
ATOM   4476 C CD  . GLN B 2 168 ? 10.061  74.194 -13.771 1.00 113.90 ? 170 GLN B CD  1 
ATOM   4477 O OE1 . GLN B 2 168 ? 9.099   74.470 -14.489 1.00 113.58 ? 170 GLN B OE1 1 
ATOM   4478 N NE2 . GLN B 2 168 ? 10.041  74.361 -12.454 1.00 113.41 ? 170 GLN B NE2 1 
ATOM   4479 N N   . ARG B 2 169 ? 13.945  71.472 -15.246 1.00 99.55  ? 171 ARG B N   1 
ATOM   4480 C CA  . ARG B 2 169 ? 14.484  70.250 -14.650 1.00 96.42  ? 171 ARG B CA  1 
ATOM   4481 C C   . ARG B 2 169 ? 14.839  70.545 -13.198 1.00 97.21  ? 171 ARG B C   1 
ATOM   4482 O O   . ARG B 2 169 ? 15.797  71.278 -12.932 1.00 99.49  ? 171 ARG B O   1 
ATOM   4483 C CB  . ARG B 2 169 ? 15.703  69.753 -15.426 1.00 96.78  ? 171 ARG B CB  1 
ATOM   4484 C CG  . ARG B 2 169 ? 16.311  68.471 -14.894 1.00 98.19  ? 171 ARG B CG  1 
ATOM   4485 C CD  . ARG B 2 169 ? 17.203  67.843 -15.946 1.00 102.39 ? 171 ARG B CD  1 
ATOM   4486 N NE  . ARG B 2 169 ? 16.449  67.530 -17.157 1.00 107.70 ? 171 ARG B NE  1 
ATOM   4487 C CZ  . ARG B 2 169 ? 17.000  67.278 -18.339 1.00 113.49 ? 171 ARG B CZ  1 
ATOM   4488 N NH1 . ARG B 2 169 ? 18.318  67.305 -18.479 1.00 108.04 ? 171 ARG B NH1 1 
ATOM   4489 N NH2 . ARG B 2 169 ? 16.231  67.003 -19.384 1.00 111.76 ? 171 ARG B NH2 1 
ATOM   4490 N N   . VAL B 2 170 ? 14.080  69.976 -12.264 1.00 97.94  ? 172 VAL B N   1 
ATOM   4491 C CA  . VAL B 2 170 ? 14.210  70.273 -10.841 1.00 98.35  ? 172 VAL B CA  1 
ATOM   4492 C C   . VAL B 2 170 ? 14.838  69.077 -10.137 1.00 97.28  ? 172 VAL B C   1 
ATOM   4493 O O   . VAL B 2 170 ? 14.408  67.934 -10.339 1.00 94.52  ? 172 VAL B O   1 
ATOM   4494 C CB  . VAL B 2 170 ? 12.850  70.621 -10.212 1.00 100.25 ? 172 VAL B CB  1 
ATOM   4495 C CG1 . VAL B 2 170 ? 13.006  70.895 -8.723  1.00 101.63 ? 172 VAL B CG1 1 
ATOM   4496 C CG2 . VAL B 2 170 ? 12.224  71.815 -10.921 1.00 102.91 ? 172 VAL B CG2 1 
ATOM   4497 N N   . GLU B 2 171 ? 15.850  69.341 -9.310  1.00 102.13 ? 173 GLU B N   1 
ATOM   4498 C CA  . GLU B 2 171 ? 16.478  68.310 -8.491  1.00 100.43 ? 173 GLU B CA  1 
ATOM   4499 C C   . GLU B 2 171 ? 15.745  68.193 -7.160  1.00 102.21 ? 173 GLU B C   1 
ATOM   4500 O O   . GLU B 2 171 ? 15.533  69.195 -6.470  1.00 105.09 ? 173 GLU B O   1 
ATOM   4501 C CB  . GLU B 2 171 ? 17.955  68.626 -8.249  1.00 102.45 ? 173 GLU B CB  1 
ATOM   4502 C CG  . GLU B 2 171 ? 18.888  68.229 -9.383  1.00 105.63 ? 173 GLU B CG  1 
ATOM   4503 C CD  . GLU B 2 171 ? 20.331  68.086 -8.924  1.00 113.73 ? 173 GLU B CD  1 
ATOM   4504 O OE1 . GLU B 2 171 ? 21.085  69.080 -9.011  1.00 115.00 ? 173 GLU B OE1 1 
ATOM   4505 O OE2 . GLU B 2 171 ? 20.706  66.991 -8.452  1.00 110.08 ? 173 GLU B OE2 1 
ATOM   4506 N N   . ILE B 2 172 ? 15.362  66.970 -6.803  1.00 100.25 ? 174 ILE B N   1 
ATOM   4507 C CA  . ILE B 2 172 ? 14.642  66.697 -5.565  1.00 101.40 ? 174 ILE B CA  1 
ATOM   4508 C C   . ILE B 2 172 ? 15.638  66.250 -4.507  1.00 103.59 ? 174 ILE B C   1 
ATOM   4509 O O   . ILE B 2 172 ? 16.537  65.447 -4.786  1.00 101.33 ? 174 ILE B O   1 
ATOM   4510 C CB  . ILE B 2 172 ? 13.556  65.627 -5.785  1.00 100.15 ? 174 ILE B CB  1 
ATOM   4511 C CG1 . ILE B 2 172 ? 12.784  65.913 -7.073  1.00 99.21  ? 174 ILE B CG1 1 
ATOM   4512 C CG2 . ILE B 2 172 ? 12.611  65.569 -4.596  1.00 102.72 ? 174 ILE B CG2 1 
ATOM   4513 C CD1 . ILE B 2 172 ? 11.928  67.151 -7.007  1.00 104.12 ? 174 ILE B CD1 1 
ATOM   4514 N N   . LEU B 2 173 ? 15.484  66.767 -3.289  1.00 108.42 ? 175 LEU B N   1 
ATOM   4515 C CA  . LEU B 2 173 ? 16.358  66.365 -2.195  1.00 110.84 ? 175 LEU B CA  1 
ATOM   4516 C C   . LEU B 2 173 ? 16.108  64.906 -1.819  1.00 111.01 ? 175 LEU B C   1 
ATOM   4517 O O   . LEU B 2 173 ? 15.006  64.377 -1.984  1.00 109.37 ? 175 LEU B O   1 
ATOM   4518 C CB  . LEU B 2 173 ? 16.163  67.279 -0.982  1.00 115.04 ? 175 LEU B CB  1 
ATOM   4519 C CG  . LEU B 2 173 ? 14.813  67.324 -0.262  1.00 117.53 ? 175 LEU B CG  1 
ATOM   4520 C CD1 . LEU B 2 173 ? 14.747  66.337 0.900   1.00 120.44 ? 175 LEU B CD1 1 
ATOM   4521 C CD2 . LEU B 2 173 ? 14.498  68.737 0.213   1.00 121.02 ? 175 LEU B CD2 1 
ATOM   4522 N N   . GLU B 2 174 ? 17.157  64.254 -1.321  1.00 113.41 ? 176 GLU B N   1 
ATOM   4523 C CA  . GLU B 2 174 ? 17.071  62.840 -0.979  1.00 113.03 ? 176 GLU B CA  1 
ATOM   4524 C C   . GLU B 2 174 ? 16.076  62.605 0.153   1.00 116.17 ? 176 GLU B C   1 
ATOM   4525 O O   . GLU B 2 174 ? 15.988  63.386 1.104   1.00 118.85 ? 176 GLU B O   1 
ATOM   4526 C CB  . GLU B 2 174 ? 18.452  62.294 -0.601  1.00 115.33 ? 176 GLU B CB  1 
ATOM   4527 C CG  . GLU B 2 174 ? 18.919  62.641 0.804   1.00 123.60 ? 176 GLU B CG  1 
ATOM   4528 C CD  . GLU B 2 174 ? 20.300  62.102 1.111   1.00 131.88 ? 176 GLU B CD  1 
ATOM   4529 O OE1 . GLU B 2 174 ? 21.243  62.426 0.361   1.00 129.41 ? 176 GLU B OE1 1 
ATOM   4530 O OE2 . GLU B 2 174 ? 20.439  61.351 2.100   1.00 132.09 ? 176 GLU B OE2 1 
ATOM   4531 N N   . GLY B 2 175 ? 15.298  61.531 0.023   1.00 111.85 ? 177 GLY B N   1 
ATOM   4532 C CA  . GLY B 2 175 ? 14.384  61.073 1.040   1.00 114.01 ? 177 GLY B CA  1 
ATOM   4533 C C   . GLY B 2 175 ? 12.924  61.399 0.793   1.00 114.32 ? 177 GLY B C   1 
ATOM   4534 O O   . GLY B 2 175 ? 12.053  60.673 1.283   1.00 115.44 ? 177 GLY B O   1 
ATOM   4535 N N   . ARG B 2 176 ? 12.630  62.453 0.038   1.00 105.16 ? 178 ARG B N   1 
ATOM   4536 C CA  . ARG B 2 176 ? 11.250  62.805 -0.271  1.00 104.66 ? 178 ARG B CA  1 
ATOM   4537 C C   . ARG B 2 176 ? 10.903  62.333 -1.677  1.00 102.11 ? 178 ARG B C   1 
ATOM   4538 O O   . ARG B 2 176 ? 11.738  62.382 -2.585  1.00 99.72  ? 178 ARG B O   1 
ATOM   4539 C CB  . ARG B 2 176 ? 11.007  64.312 -0.132  1.00 106.50 ? 178 ARG B CB  1 
ATOM   4540 C CG  . ARG B 2 176 ? 11.706  65.181 -1.157  1.00 107.46 ? 178 ARG B CG  1 
ATOM   4541 C CD  . ARG B 2 176 ? 11.477  66.659 -0.878  1.00 112.54 ? 178 ARG B CD  1 
ATOM   4542 N NE  . ARG B 2 176 ? 10.109  67.091 -1.140  1.00 113.79 ? 178 ARG B NE  1 
ATOM   4543 C CZ  . ARG B 2 176 ? 9.682   68.338 -0.971  1.00 120.07 ? 178 ARG B CZ  1 
ATOM   4544 N NH1 . ARG B 2 176 ? 10.522  69.271 -0.540  1.00 119.07 ? 178 ARG B NH1 1 
ATOM   4545 N NH2 . ARG B 2 176 ? 8.421   68.655 -1.232  1.00 115.11 ? 178 ARG B NH2 1 
ATOM   4546 N N   . THR B 2 177 ? 9.669   61.856 -1.845  1.00 93.78  ? 179 THR B N   1 
ATOM   4547 C CA  . THR B 2 177 ? 9.217   61.282 -3.106  1.00 90.99  ? 179 THR B CA  1 
ATOM   4548 C C   . THR B 2 177 ? 8.113   62.103 -3.765  1.00 91.99  ? 179 THR B C   1 
ATOM   4549 O O   . THR B 2 177 ? 7.361   61.571 -4.588  1.00 90.75  ? 179 THR B O   1 
ATOM   4550 C CB  . THR B 2 177 ? 8.742   59.846 -2.886  1.00 94.30  ? 179 THR B CB  1 
ATOM   4551 O OG1 . THR B 2 177 ? 7.773   59.821 -1.832  1.00 97.39  ? 179 THR B OG1 1 
ATOM   4552 C CG2 . THR B 2 177 ? 9.912   58.955 -2.503  1.00 94.18  ? 179 THR B CG2 1 
ATOM   4553 N N   . GLU B 2 178 ? 7.996   63.384 -3.423  1.00 93.34  ? 180 GLU B N   1 
ATOM   4554 C CA  . GLU B 2 178 ? 6.978   64.234 -4.022  1.00 93.99  ? 180 GLU B CA  1 
ATOM   4555 C C   . GLU B 2 178 ? 7.470   65.673 -4.040  1.00 95.92  ? 180 GLU B C   1 
ATOM   4556 O O   . GLU B 2 178 ? 8.303   66.070 -3.221  1.00 97.18  ? 180 GLU B O   1 
ATOM   4557 C CB  . GLU B 2 178 ? 5.647   64.132 -3.268  1.00 98.26  ? 180 GLU B CB  1 
ATOM   4558 C CG  . GLU B 2 178 ? 5.735   64.489 -1.796  1.00 105.66 ? 180 GLU B CG  1 
ATOM   4559 C CD  . GLU B 2 178 ? 4.466   64.151 -1.039  1.00 117.07 ? 180 GLU B CD  1 
ATOM   4560 O OE1 . GLU B 2 178 ? 3.914   63.053 -1.263  1.00 114.86 ? 180 GLU B OE1 1 
ATOM   4561 O OE2 . GLU B 2 178 ? 4.017   64.986 -0.224  1.00 119.99 ? 180 GLU B OE2 1 
ATOM   4562 N N   . CYS B 2 179 ? 6.945   66.451 -4.984  1.00 95.99  ? 181 CYS B N   1 
ATOM   4563 C CA  . CYS B 2 179 ? 7.334   67.846 -5.133  1.00 97.27  ? 181 CYS B CA  1 
ATOM   4564 C C   . CYS B 2 179 ? 6.166   68.626 -5.716  1.00 100.16 ? 181 CYS B C   1 
ATOM   4565 O O   . CYS B 2 179 ? 5.252   68.058 -6.320  1.00 99.36  ? 181 CYS B O   1 
ATOM   4566 C CB  . CYS B 2 179 ? 8.579   68.002 -6.014  1.00 94.12  ? 181 CYS B CB  1 
ATOM   4567 S SG  . CYS B 2 179 ? 8.329   67.617 -7.763  1.00 91.42  ? 181 CYS B SG  1 
ATOM   4568 N N   . VAL B 2 180 ? 6.206   69.942 -5.524  1.00 89.09  ? 182 VAL B N   1 
ATOM   4569 C CA  . VAL B 2 180 ? 5.203   70.853 -6.063  1.00 90.78  ? 182 VAL B CA  1 
ATOM   4570 C C   . VAL B 2 180 ? 5.899   71.777 -7.051  1.00 90.42  ? 182 VAL B C   1 
ATOM   4571 O O   . VAL B 2 180 ? 6.747   72.591 -6.661  1.00 92.99  ? 182 VAL B O   1 
ATOM   4572 C CB  . VAL B 2 180 ? 4.500   71.657 -4.960  1.00 96.49  ? 182 VAL B CB  1 
ATOM   4573 C CG1 . VAL B 2 180 ? 3.533   72.663 -5.571  1.00 100.11 ? 182 VAL B CG1 1 
ATOM   4574 C CG2 . VAL B 2 180 ? 3.771   70.723 -4.005  1.00 97.96  ? 182 VAL B CG2 1 
ATOM   4575 N N   . LEU B 2 181 ? 5.541   71.657 -8.326  1.00 96.08  ? 183 LEU B N   1 
ATOM   4576 C CA  . LEU B 2 181 ? 6.167   72.429 -9.386  1.00 95.10  ? 183 LEU B CA  1 
ATOM   4577 C C   . LEU B 2 181 ? 5.466   73.772 -9.527  1.00 101.15 ? 183 LEU B C   1 
ATOM   4578 O O   . LEU B 2 181 ? 4.268   73.897 -9.266  1.00 104.26 ? 183 LEU B O   1 
ATOM   4579 C CB  . LEU B 2 181 ? 6.108   71.668 -10.709 1.00 90.78  ? 183 LEU B CB  1 
ATOM   4580 C CG  . LEU B 2 181 ? 7.022   70.450 -10.807 1.00 87.47  ? 183 LEU B CG  1 
ATOM   4581 C CD1 . LEU B 2 181 ? 6.654   69.617 -12.018 1.00 84.20  ? 183 LEU B CD1 1 
ATOM   4582 C CD2 . LEU B 2 181 ? 8.475   70.888 -10.872 1.00 88.00  ? 183 LEU B CD2 1 
ATOM   4583 N N   . SER B 2 182 ? 6.222   74.780 -9.953  1.00 104.39 ? 184 SER B N   1 
ATOM   4584 C CA  . SER B 2 182 ? 5.698   76.128 -10.108 1.00 109.20 ? 184 SER B CA  1 
ATOM   4585 C C   . SER B 2 182 ? 6.123   76.709 -11.450 1.00 109.58 ? 184 SER B C   1 
ATOM   4586 O O   . SER B 2 182 ? 6.945   76.138 -12.172 1.00 105.71 ? 184 SER B O   1 
ATOM   4587 C CB  . SER B 2 182 ? 6.164   77.041 -8.964  1.00 114.44 ? 184 SER B CB  1 
ATOM   4588 O OG  . SER B 2 182 ? 7.576   77.043 -8.861  1.00 115.45 ? 184 SER B OG  1 
ATOM   4589 N N   . ASN B 2 183 ? 5.529   77.859 -11.777 1.00 107.00 ? 185 ASN B N   1 
ATOM   4590 C CA  . ASN B 2 183 ? 5.879   78.641 -12.963 1.00 107.93 ? 185 ASN B CA  1 
ATOM   4591 C C   . ASN B 2 183 ? 5.651   77.836 -14.244 1.00 105.49 ? 185 ASN B C   1 
ATOM   4592 O O   . ASN B 2 183 ? 6.579   77.509 -14.987 1.00 103.10 ? 185 ASN B O   1 
ATOM   4593 C CB  . ASN B 2 183 ? 7.322   79.153 -12.875 1.00 108.26 ? 185 ASN B CB  1 
ATOM   4594 C CG  . ASN B 2 183 ? 7.568   80.356 -13.765 1.00 118.81 ? 185 ASN B CG  1 
ATOM   4595 O OD1 . ASN B 2 183 ? 7.814   80.217 -14.963 1.00 116.12 ? 185 ASN B OD1 1 
ATOM   4596 N ND2 . ASN B 2 183 ? 7.504   81.547 -13.180 1.00 120.68 ? 185 ASN B ND2 1 
ATOM   4597 N N   . LEU B 2 184 ? 4.382   77.516 -14.488 1.00 105.91 ? 186 LEU B N   1 
ATOM   4598 C CA  . LEU B 2 184 ? 3.959   76.835 -15.703 1.00 103.29 ? 186 LEU B CA  1 
ATOM   4599 C C   . LEU B 2 184 ? 2.889   77.664 -16.395 1.00 108.85 ? 186 LEU B C   1 
ATOM   4600 O O   . LEU B 2 184 ? 1.952   78.142 -15.747 1.00 112.46 ? 186 LEU B O   1 
ATOM   4601 C CB  . LEU B 2 184 ? 3.421   75.438 -15.384 1.00 98.76  ? 186 LEU B CB  1 
ATOM   4602 C CG  . LEU B 2 184 ? 4.357   74.530 -14.588 1.00 96.59  ? 186 LEU B CG  1 
ATOM   4603 C CD1 . LEU B 2 184 ? 3.619   73.299 -14.092 1.00 94.68  ? 186 LEU B CD1 1 
ATOM   4604 C CD2 . LEU B 2 184 ? 5.553   74.134 -15.438 1.00 93.94  ? 186 LEU B CD2 1 
ATOM   4605 N N   . ARG B 2 185 ? 3.026   77.824 -17.709 1.00 107.99 ? 187 ARG B N   1 
ATOM   4606 C CA  . ARG B 2 185 ? 2.081   78.614 -18.485 1.00 110.71 ? 187 ARG B CA  1 
ATOM   4607 C C   . ARG B 2 185 ? 0.798   77.830 -18.721 1.00 109.54 ? 187 ARG B C   1 
ATOM   4608 O O   . ARG B 2 185 ? 0.822   76.612 -18.916 1.00 104.44 ? 187 ARG B O   1 
ATOM   4609 C CB  . ARG B 2 185 ? 2.700   79.030 -19.819 1.00 111.01 ? 187 ARG B CB  1 
ATOM   4610 C CG  . ARG B 2 185 ? 3.869   79.996 -19.684 1.00 116.05 ? 187 ARG B CG  1 
ATOM   4611 C CD  . ARG B 2 185 ? 4.438   80.374 -21.042 1.00 121.09 ? 187 ARG B CD  1 
ATOM   4612 N NE  . ARG B 2 185 ? 3.445   81.020 -21.896 1.00 126.19 ? 187 ARG B NE  1 
ATOM   4613 C CZ  . ARG B 2 185 ? 3.663   81.374 -23.158 1.00 133.02 ? 187 ARG B CZ  1 
ATOM   4614 N NH1 . ARG B 2 185 ? 4.843   81.143 -23.719 1.00 129.26 ? 187 ARG B NH1 1 
ATOM   4615 N NH2 . ARG B 2 185 ? 2.702   81.957 -23.862 1.00 131.41 ? 187 ARG B NH2 1 
ATOM   4616 N N   . GLY B 2 186 ? -0.328  78.540 -18.707 1.00 107.48 ? 188 GLY B N   1 
ATOM   4617 C CA  . GLY B 2 186 ? -1.603  77.890 -18.906 1.00 105.88 ? 188 GLY B CA  1 
ATOM   4618 C C   . GLY B 2 186 ? -1.838  77.498 -20.351 1.00 103.89 ? 188 GLY B C   1 
ATOM   4619 O O   . GLY B 2 186 ? -1.187  77.984 -21.277 1.00 104.25 ? 188 GLY B O   1 
ATOM   4620 N N   . ARG B 2 187 ? -2.795  76.584 -20.533 1.00 101.08 ? 189 ARG B N   1 
ATOM   4621 C CA  . ARG B 2 187 ? -3.169  76.076 -21.855 1.00 101.57 ? 189 ARG B CA  1 
ATOM   4622 C C   . ARG B 2 187 ? -1.967  75.468 -22.576 1.00 98.16  ? 189 ARG B C   1 
ATOM   4623 O O   . ARG B 2 187 ? -1.790  75.642 -23.784 1.00 99.98  ? 189 ARG B O   1 
ATOM   4624 C CB  . ARG B 2 187 ? -3.825  77.167 -22.706 1.00 107.20 ? 189 ARG B CB  1 
ATOM   4625 N N   . THR B 2 188 ? -1.128  74.756 -21.825 1.00 99.62  ? 190 THR B N   1 
ATOM   4626 C CA  . THR B 2 188 ? 0.056   74.106 -22.371 1.00 96.84  ? 190 THR B CA  1 
ATOM   4627 C C   . THR B 2 188 ? 0.186   72.722 -21.755 1.00 93.52  ? 190 THR B C   1 
ATOM   4628 O O   . THR B 2 188 ? 0.044   72.569 -20.539 1.00 92.73  ? 190 THR B O   1 
ATOM   4629 C CB  . THR B 2 188 ? 1.321   74.930 -22.095 1.00 101.21 ? 190 THR B CB  1 
ATOM   4630 O OG1 . THR B 2 188 ? 1.107   76.287 -22.503 1.00 105.70 ? 190 THR B OG1 1 
ATOM   4631 C CG2 . THR B 2 188 ? 2.511   74.357 -22.852 1.00 99.37  ? 190 THR B CG2 1 
ATOM   4632 N N   . ARG B 2 189 ? 0.456   71.719 -22.590 1.00 96.06  ? 191 ARG B N   1 
ATOM   4633 C CA  . ARG B 2 189 ? 0.591   70.340 -22.128 1.00 92.34  ? 191 ARG B CA  1 
ATOM   4634 C C   . ARG B 2 189 ? 2.024   70.105 -21.668 1.00 92.17  ? 191 ARG B C   1 
ATOM   4635 O O   . ARG B 2 189 ? 2.957   70.142 -22.477 1.00 93.41  ? 191 ARG B O   1 
ATOM   4636 C CB  . ARG B 2 189 ? 0.218   69.345 -23.223 1.00 91.76  ? 191 ARG B CB  1 
ATOM   4637 C CG  . ARG B 2 189 ? 0.067   67.928 -22.690 1.00 91.89  ? 191 ARG B CG  1 
ATOM   4638 C CD  . ARG B 2 189 ? 0.027   66.888 -23.792 1.00 94.54  ? 191 ARG B CD  1 
ATOM   4639 N NE  . ARG B 2 189 ? 1.369   66.408 -24.111 1.00 96.77  ? 191 ARG B NE  1 
ATOM   4640 C CZ  . ARG B 2 189 ? 1.622   65.308 -24.811 1.00 101.57 ? 191 ARG B CZ  1 
ATOM   4641 N NH1 . ARG B 2 189 ? 0.620   64.568 -25.267 1.00 97.50  ? 191 ARG B NH1 1 
ATOM   4642 N NH2 . ARG B 2 189 ? 2.875   64.946 -25.052 1.00 98.15  ? 191 ARG B NH2 1 
ATOM   4643 N N   . TYR B 2 190 ? 2.202   69.862 -20.376 1.00 87.92  ? 192 TYR B N   1 
ATOM   4644 C CA  . TYR B 2 190 ? 3.515   69.583 -19.813 1.00 86.47  ? 192 TYR B CA  1 
ATOM   4645 C C   . TYR B 2 190 ? 3.636   68.085 -19.562 1.00 84.15  ? 192 TYR B C   1 
ATOM   4646 O O   . TYR B 2 190 ? 2.719   67.467 -19.012 1.00 82.93  ? 192 TYR B O   1 
ATOM   4647 C CB  . TYR B 2 190 ? 3.735   70.369 -18.520 1.00 87.92  ? 192 TYR B CB  1 
ATOM   4648 C CG  . TYR B 2 190 ? 4.037   71.838 -18.734 1.00 92.49  ? 192 TYR B CG  1 
ATOM   4649 C CD1 . TYR B 2 190 ? 5.302   72.259 -19.124 1.00 94.50  ? 192 TYR B CD1 1 
ATOM   4650 C CD2 . TYR B 2 190 ? 3.058   72.804 -18.541 1.00 96.02  ? 192 TYR B CD2 1 
ATOM   4651 C CE1 . TYR B 2 190 ? 5.584   73.602 -19.317 1.00 98.99  ? 192 TYR B CE1 1 
ATOM   4652 C CE2 . TYR B 2 190 ? 3.329   74.149 -18.732 1.00 100.62 ? 192 TYR B CE2 1 
ATOM   4653 C CZ  . TYR B 2 190 ? 4.593   74.542 -19.120 1.00 104.00 ? 192 TYR B CZ  1 
ATOM   4654 O OH  . TYR B 2 190 ? 4.867   75.878 -19.312 1.00 109.02 ? 192 TYR B OH  1 
ATOM   4655 N N   . THR B 2 191 ? 4.763   67.508 -19.967 1.00 86.76  ? 193 THR B N   1 
ATOM   4656 C CA  . THR B 2 191 ? 5.043   66.091 -19.772 1.00 84.24  ? 193 THR B CA  1 
ATOM   4657 C C   . THR B 2 191 ? 6.135   65.936 -18.722 1.00 84.02  ? 193 THR B C   1 
ATOM   4658 O O   . THR B 2 191 ? 7.190   66.573 -18.818 1.00 85.16  ? 193 THR B O   1 
ATOM   4659 C CB  . THR B 2 191 ? 5.465   65.430 -21.086 1.00 88.29  ? 193 THR B CB  1 
ATOM   4660 O OG1 . THR B 2 191 ? 4.545   65.798 -22.122 1.00 90.12  ? 193 THR B OG1 1 
ATOM   4661 C CG2 . THR B 2 191 ? 5.471   63.918 -20.942 1.00 86.21  ? 193 THR B CG2 1 
ATOM   4662 N N   . PHE B 2 192 ? 5.884   65.086 -17.730 1.00 77.20  ? 194 PHE B N   1 
ATOM   4663 C CA  . PHE B 2 192 ? 6.768   64.937 -16.585 1.00 76.27  ? 194 PHE B CA  1 
ATOM   4664 C C   . PHE B 2 192 ? 7.387   63.547 -16.553 1.00 76.53  ? 194 PHE B C   1 
ATOM   4665 O O   . PHE B 2 192 ? 6.754   62.555 -16.926 1.00 76.09  ? 194 PHE B O   1 
ATOM   4666 C CB  . PHE B 2 192 ? 6.012   65.189 -15.279 1.00 77.11  ? 194 PHE B CB  1 
ATOM   4667 C CG  . PHE B 2 192 ? 5.157   66.419 -15.306 1.00 79.65  ? 194 PHE B CG  1 
ATOM   4668 C CD1 . PHE B 2 192 ? 5.713   67.671 -15.111 1.00 82.48  ? 194 PHE B CD1 1 
ATOM   4669 C CD2 . PHE B 2 192 ? 3.795   66.324 -15.529 1.00 81.24  ? 194 PHE B CD2 1 
ATOM   4670 C CE1 . PHE B 2 192 ? 4.925   68.804 -15.137 1.00 85.65  ? 194 PHE B CE1 1 
ATOM   4671 C CE2 . PHE B 2 192 ? 3.002   67.453 -15.556 1.00 84.82  ? 194 PHE B CE2 1 
ATOM   4672 C CZ  . PHE B 2 192 ? 3.567   68.694 -15.359 1.00 86.22  ? 194 PHE B CZ  1 
ATOM   4673 N N   . ALA B 2 193 ? 8.634   63.490 -16.087 1.00 78.45  ? 195 ALA B N   1 
ATOM   4674 C CA  . ALA B 2 193 ? 9.347   62.240 -15.877 1.00 78.45  ? 195 ALA B CA  1 
ATOM   4675 C C   . ALA B 2 193 ? 10.390  62.460 -14.791 1.00 79.62  ? 195 ALA B C   1 
ATOM   4676 O O   . ALA B 2 193 ? 10.953  63.551 -14.669 1.00 79.88  ? 195 ALA B O   1 
ATOM   4677 C CB  . ALA B 2 193 ? 10.006  61.735 -17.166 1.00 80.41  ? 195 ALA B CB  1 
ATOM   4678 N N   . VAL B 2 194 ? 10.642  61.417 -14.001 1.00 77.64  ? 196 VAL B N   1 
ATOM   4679 C CA  . VAL B 2 194 ? 11.495  61.512 -12.823 1.00 78.34  ? 196 VAL B CA  1 
ATOM   4680 C C   . VAL B 2 194 ? 12.694  60.583 -12.986 1.00 80.13  ? 196 VAL B C   1 
ATOM   4681 O O   . VAL B 2 194 ? 12.574  59.483 -13.537 1.00 81.08  ? 196 VAL B O   1 
ATOM   4682 C CB  . VAL B 2 194 ? 10.707  61.192 -11.533 1.00 78.42  ? 196 VAL B CB  1 
ATOM   4683 C CG1 . VAL B 2 194 ? 10.189  59.765 -11.552 1.00 78.90  ? 196 VAL B CG1 1 
ATOM   4684 C CG2 . VAL B 2 194 ? 11.556  61.450 -10.296 1.00 79.80  ? 196 VAL B CG2 1 
ATOM   4685 N N   . ARG B 2 195 ? 13.852  61.044 -12.519 1.00 78.97  ? 197 ARG B N   1 
ATOM   4686 C CA  . ARG B 2 195 ? 15.097  60.290 -12.525 1.00 80.98  ? 197 ARG B CA  1 
ATOM   4687 C C   . ARG B 2 195 ? 15.396  59.752 -11.126 1.00 82.94  ? 197 ARG B C   1 
ATOM   4688 O O   . ARG B 2 195 ? 14.738  60.104 -10.145 1.00 81.97  ? 197 ARG B O   1 
ATOM   4689 C CB  . ARG B 2 195 ? 16.246  61.175 -13.010 1.00 82.21  ? 197 ARG B CB  1 
ATOM   4690 C CG  . ARG B 2 195 ? 16.870  60.750 -14.322 1.00 87.71  ? 197 ARG B CG  1 
ATOM   4691 C CD  . ARG B 2 195 ? 18.011  61.684 -14.688 1.00 92.89  ? 197 ARG B CD  1 
ATOM   4692 N NE  . ARG B 2 195 ? 18.572  61.381 -16.000 1.00 99.31  ? 197 ARG B NE  1 
ATOM   4693 C CZ  . ARG B 2 195 ? 19.550  62.075 -16.571 1.00 107.50 ? 197 ARG B CZ  1 
ATOM   4694 N NH1 . ARG B 2 195 ? 20.078  63.118 -15.944 1.00 103.97 ? 197 ARG B NH1 1 
ATOM   4695 N NH2 . ARG B 2 195 ? 20.000  61.728 -17.769 1.00 107.15 ? 197 ARG B NH2 1 
ATOM   4696 N N   . ALA B 2 196 ? 16.412  58.893 -11.037 1.00 80.86  ? 198 ALA B N   1 
ATOM   4697 C CA  . ALA B 2 196 ? 16.791  58.311 -9.755  1.00 82.07  ? 198 ALA B CA  1 
ATOM   4698 C C   . ALA B 2 196 ? 18.277  57.978 -9.742  1.00 85.03  ? 198 ALA B C   1 
ATOM   4699 O O   . ALA B 2 196 ? 18.829  57.532 -10.751 1.00 85.76  ? 198 ALA B O   1 
ATOM   4700 C CB  . ALA B 2 196 ? 15.971  57.052 -9.451  1.00 80.69  ? 198 ALA B CB  1 
ATOM   4701 N N   . ARG B 2 197 ? 18.914  58.196 -8.591  1.00 89.28  ? 199 ARG B N   1 
ATOM   4702 C CA  . ARG B 2 197 ? 20.307  57.818 -8.386  1.00 91.80  ? 199 ARG B CA  1 
ATOM   4703 C C   . ARG B 2 197 ? 20.586  57.754 -6.890  1.00 94.40  ? 199 ARG B C   1 
ATOM   4704 O O   . ARG B 2 197 ? 19.849  58.320 -6.078  1.00 93.21  ? 199 ARG B O   1 
ATOM   4705 C CB  . ARG B 2 197 ? 21.272  58.795 -9.070  1.00 92.28  ? 199 ARG B CB  1 
ATOM   4706 C CG  . ARG B 2 197 ? 21.436  60.122 -8.342  1.00 95.24  ? 199 ARG B CG  1 
ATOM   4707 C CD  . ARG B 2 197 ? 22.514  60.982 -8.987  1.00 99.54  ? 199 ARG B CD  1 
ATOM   4708 N NE  . ARG B 2 197 ? 23.853  60.439 -8.774  1.00 104.78 ? 199 ARG B NE  1 
ATOM   4709 C CZ  . ARG B 2 197 ? 24.963  60.967 -9.280  1.00 111.49 ? 199 ARG B CZ  1 
ATOM   4710 N NH1 . ARG B 2 197 ? 24.898  62.059 -10.030 1.00 107.21 ? 199 ARG B NH1 1 
ATOM   4711 N NH2 . ARG B 2 197 ? 26.139  60.405 -9.035  1.00 110.31 ? 199 ARG B NH2 1 
ATOM   4712 N N   . MET B 2 198 ? 21.661  57.051 -6.538  1.00 93.40  ? 200 MET B N   1 
ATOM   4713 C CA  . MET B 2 198 ? 22.074  56.936 -5.144  1.00 96.05  ? 200 MET B CA  1 
ATOM   4714 C C   . MET B 2 198 ? 22.856  58.173 -4.722  1.00 98.37  ? 200 MET B C   1 
ATOM   4715 O O   . MET B 2 198 ? 23.839  58.550 -5.368  1.00 100.75 ? 200 MET B O   1 
ATOM   4716 C CB  . MET B 2 198 ? 22.916  55.678 -4.932  1.00 99.43  ? 200 MET B CB  1 
ATOM   4717 C CG  . MET B 2 198 ? 22.112  54.388 -4.883  1.00 99.55  ? 200 MET B CG  1 
ATOM   4718 S SD  . MET B 2 198 ? 20.996  54.341 -3.466  1.00 99.91  ? 200 MET B SD  1 
ATOM   4719 C CE  . MET B 2 198 ? 20.405  52.653 -3.547  1.00 100.96 ? 200 MET B CE  1 
ATOM   4720 N N   . ALA B 2 199 ? 22.415  58.801 -3.636  1.00 107.73 ? 201 ALA B N   1 
ATOM   4721 C CA  . ALA B 2 199 ? 22.988  60.069 -3.211  1.00 107.20 ? 201 ALA B CA  1 
ATOM   4722 C C   . ALA B 2 199 ? 24.359  59.879 -2.572  1.00 110.95 ? 201 ALA B C   1 
ATOM   4723 O O   . ALA B 2 199 ? 24.668  58.831 -1.999  1.00 111.79 ? 201 ALA B O   1 
ATOM   4724 C CB  . ALA B 2 199 ? 22.050  60.774 -2.231  1.00 103.41 ? 201 ALA B CB  1 
ATOM   4725 N N   . GLU B 2 200 ? 25.182  60.921 -2.680  1.00 111.47 ? 202 GLU B N   1 
ATOM   4726 C CA  . GLU B 2 200 ? 26.494  60.963 -2.059  1.00 114.01 ? 202 GLU B CA  1 
ATOM   4727 C C   . GLU B 2 200 ? 26.338  61.079 -0.542  1.00 113.38 ? 202 GLU B C   1 
ATOM   4728 O O   . GLU B 2 200 ? 25.254  61.392 -0.043  1.00 111.28 ? 202 GLU B O   1 
ATOM   4729 C CB  . GLU B 2 200 ? 27.294  62.133 -2.632  1.00 115.11 ? 202 GLU B CB  1 
ATOM   4730 C CG  . GLU B 2 200 ? 27.878  61.872 -4.012  1.00 118.85 ? 202 GLU B CG  1 
ATOM   4731 C CD  . GLU B 2 200 ? 26.836  61.933 -5.114  1.00 125.44 ? 202 GLU B CD  1 
ATOM   4732 O OE1 . GLU B 2 200 ? 26.117  62.951 -5.202  1.00 122.04 ? 202 GLU B OE1 1 
ATOM   4733 O OE2 . GLU B 2 200 ? 26.739  60.962 -5.894  1.00 125.24 ? 202 GLU B OE2 1 
ATOM   4734 N N   . PRO B 2 201 ? 27.413  60.836 0.234   1.00 117.01 ? 203 PRO B N   1 
ATOM   4735 C CA  . PRO B 2 201 ? 28.785  60.481 -0.148  1.00 119.88 ? 203 PRO B CA  1 
ATOM   4736 C C   . PRO B 2 201 ? 29.106  58.984 -0.131  1.00 121.46 ? 203 PRO B C   1 
ATOM   4737 O O   . PRO B 2 201 ? 30.011  58.558 -0.851  1.00 123.41 ? 203 PRO B O   1 
ATOM   4738 C CB  . PRO B 2 201 ? 29.626  61.217 0.899   1.00 123.92 ? 203 PRO B CB  1 
ATOM   4739 C CG  . PRO B 2 201 ? 28.724  61.332 2.112   1.00 124.20 ? 203 PRO B CG  1 
ATOM   4740 C CD  . PRO B 2 201 ? 27.302  61.031 1.689   1.00 119.56 ? 203 PRO B CD  1 
ATOM   4741 N N   . SER B 2 202 ? 28.388  58.202 0.679   1.00 119.52 ? 204 SER B N   1 
ATOM   4742 C CA  . SER B 2 202 ? 28.698  56.780 0.786   1.00 120.38 ? 204 SER B CA  1 
ATOM   4743 C C   . SER B 2 202 ? 28.415  56.034 -0.512  1.00 117.00 ? 204 SER B C   1 
ATOM   4744 O O   . SER B 2 202 ? 29.063  55.020 -0.792  1.00 118.10 ? 204 SER B O   1 
ATOM   4745 C CB  . SER B 2 202 ? 27.914  56.154 1.939   1.00 120.79 ? 204 SER B CB  1 
ATOM   4746 O OG  . SER B 2 202 ? 28.282  56.735 3.179   1.00 124.53 ? 204 SER B OG  1 
ATOM   4747 N N   . PHE B 2 203 ? 27.462  56.507 -1.308  1.00 113.11 ? 205 PHE B N   1 
ATOM   4748 C CA  . PHE B 2 203 ? 27.080  55.842 -2.544  1.00 109.92 ? 205 PHE B CA  1 
ATOM   4749 C C   . PHE B 2 203 ? 27.219  56.797 -3.722  1.00 109.69 ? 205 PHE B C   1 
ATOM   4750 O O   . PHE B 2 203 ? 26.957  57.997 -3.600  1.00 108.48 ? 205 PHE B O   1 
ATOM   4751 C CB  . PHE B 2 203 ? 25.649  55.309 -2.456  1.00 107.62 ? 205 PHE B CB  1 
ATOM   4752 C CG  . PHE B 2 203 ? 25.494  54.164 -1.497  1.00 108.18 ? 205 PHE B CG  1 
ATOM   4753 C CD1 . PHE B 2 203 ? 25.825  52.875 -1.879  1.00 109.69 ? 205 PHE B CD1 1 
ATOM   4754 C CD2 . PHE B 2 203 ? 25.032  54.380 -0.209  1.00 109.43 ? 205 PHE B CD2 1 
ATOM   4755 C CE1 . PHE B 2 203 ? 25.689  51.820 -0.997  1.00 110.33 ? 205 PHE B CE1 1 
ATOM   4756 C CE2 . PHE B 2 203 ? 24.894  53.330 0.678   1.00 110.94 ? 205 PHE B CE2 1 
ATOM   4757 C CZ  . PHE B 2 203 ? 25.223  52.048 0.282   1.00 111.14 ? 205 PHE B CZ  1 
ATOM   4758 N N   . GLY B 2 204 ? 27.638  56.248 -4.865  1.00 107.40 ? 206 GLY B N   1 
ATOM   4759 C CA  . GLY B 2 204 ? 27.723  57.009 -6.093  1.00 105.80 ? 206 GLY B CA  1 
ATOM   4760 C C   . GLY B 2 204 ? 27.309  56.159 -7.276  1.00 103.12 ? 206 GLY B C   1 
ATOM   4761 O O   . GLY B 2 204 ? 27.048  54.962 -7.143  1.00 102.68 ? 206 GLY B O   1 
ATOM   4762 N N   . GLY B 2 205 ? 27.251  56.796 -8.438  1.00 101.53 ? 207 GLY B N   1 
ATOM   4763 C CA  . GLY B 2 205 ? 26.889  56.074 -9.646  1.00 100.57 ? 207 GLY B CA  1 
ATOM   4764 C C   . GLY B 2 205 ? 26.411  57.025 -10.731 1.00 100.38 ? 207 GLY B C   1 
ATOM   4765 O O   . GLY B 2 205 ? 26.888  58.156 -10.836 1.00 101.31 ? 207 GLY B O   1 
ATOM   4766 N N   . PHE B 2 206 ? 25.460  56.537 -11.526 1.00 96.58  ? 208 PHE B N   1 
ATOM   4767 C CA  . PHE B 2 206 ? 24.937  57.264 -12.670 1.00 96.21  ? 208 PHE B CA  1 
ATOM   4768 C C   . PHE B 2 206 ? 23.428  57.420 -12.545 1.00 94.20  ? 208 PHE B C   1 
ATOM   4769 O O   . PHE B 2 206 ? 22.766  56.703 -11.790 1.00 92.88  ? 208 PHE B O   1 
ATOM   4770 C CB  . PHE B 2 206 ? 25.276  56.556 -13.987 1.00 95.41  ? 208 PHE B CB  1 
ATOM   4771 C CG  . PHE B 2 206 ? 26.573  55.804 -13.955 1.00 96.78  ? 208 PHE B CG  1 
ATOM   4772 C CD1 . PHE B 2 206 ? 27.772  56.459 -14.181 1.00 98.92  ? 208 PHE B CD1 1 
ATOM   4773 C CD2 . PHE B 2 206 ? 26.595  54.440 -13.710 1.00 95.83  ? 208 PHE B CD2 1 
ATOM   4774 C CE1 . PHE B 2 206 ? 28.969  55.770 -14.157 1.00 99.96  ? 208 PHE B CE1 1 
ATOM   4775 C CE2 . PHE B 2 206 ? 27.790  53.745 -13.685 1.00 97.27  ? 208 PHE B CE2 1 
ATOM   4776 C CZ  . PHE B 2 206 ? 28.978  54.412 -13.909 1.00 99.64  ? 208 PHE B CZ  1 
ATOM   4777 N N   . TRP B 2 207 ? 22.890  58.366 -13.308 1.00 102.21 ? 209 TRP B N   1 
ATOM   4778 C CA  . TRP B 2 207 ? 21.451  58.578 -13.329 1.00 96.74  ? 209 TRP B CA  1 
ATOM   4779 C C   . TRP B 2 207 ? 20.749  57.402 -13.995 1.00 92.69  ? 209 TRP B C   1 
ATOM   4780 O O   . TRP B 2 207 ? 21.233  56.845 -14.984 1.00 93.08  ? 209 TRP B O   1 
ATOM   4781 C CB  . TRP B 2 207 ? 21.112  59.875 -14.063 1.00 95.40  ? 209 TRP B CB  1 
ATOM   4782 C CG  . TRP B 2 207 ? 21.253  61.109 -13.221 1.00 95.75  ? 209 TRP B CG  1 
ATOM   4783 C CD1 . TRP B 2 207 ? 22.172  62.105 -13.375 1.00 99.92  ? 209 TRP B CD1 1 
ATOM   4784 C CD2 . TRP B 2 207 ? 20.446  61.479 -12.094 1.00 91.46  ? 209 TRP B CD2 1 
ATOM   4785 N NE1 . TRP B 2 207 ? 21.989  63.072 -12.416 1.00 97.73  ? 209 TRP B NE1 1 
ATOM   4786 C CE2 . TRP B 2 207 ? 20.936  62.711 -11.617 1.00 92.37  ? 209 TRP B CE2 1 
ATOM   4787 C CE3 . TRP B 2 207 ? 19.361  60.887 -11.443 1.00 87.14  ? 209 TRP B CE3 1 
ATOM   4788 C CZ2 . TRP B 2 207 ? 20.377  63.363 -10.519 1.00 89.16  ? 209 TRP B CZ2 1 
ATOM   4789 C CZ3 . TRP B 2 207 ? 18.806  61.537 -10.353 1.00 84.64  ? 209 TRP B CZ3 1 
ATOM   4790 C CH2 . TRP B 2 207 ? 19.316  62.761 -9.901  1.00 86.39  ? 209 TRP B CH2 1 
ATOM   4791 N N   . SER B 2 208 ? 19.598  57.029 -13.444 1.00 94.33  ? 210 SER B N   1 
ATOM   4792 C CA  . SER B 2 208 ? 18.806  55.942 -13.991 1.00 90.67  ? 210 SER B CA  1 
ATOM   4793 C C   . SER B 2 208 ? 17.987  56.427 -15.183 1.00 87.05  ? 210 SER B C   1 
ATOM   4794 O O   . SER B 2 208 ? 17.950  57.616 -15.510 1.00 87.12  ? 210 SER B O   1 
ATOM   4795 C CB  . SER B 2 208 ? 17.881  55.362 -12.923 1.00 88.26  ? 210 SER B CB  1 
ATOM   4796 O OG  . SER B 2 208 ? 16.868  56.290 -12.574 1.00 84.95  ? 210 SER B OG  1 
ATOM   4797 N N   . ALA B 2 209 ? 17.320  55.482 -15.838 1.00 87.66  ? 211 ALA B N   1 
ATOM   4798 C CA  . ALA B 2 209 ? 16.457  55.829 -16.953 1.00 84.47  ? 211 ALA B CA  1 
ATOM   4799 C C   . ALA B 2 209 ? 15.234  56.596 -16.458 1.00 81.33  ? 211 ALA B C   1 
ATOM   4800 O O   . ALA B 2 209 ? 14.825  56.491 -15.298 1.00 80.67  ? 211 ALA B O   1 
ATOM   4801 C CB  . ALA B 2 209 ? 16.024  54.573 -17.710 1.00 82.51  ? 211 ALA B CB  1 
ATOM   4802 N N   . TRP B 2 210 ? 14.654  57.385 -17.358 1.00 84.11  ? 212 TRP B N   1 
ATOM   4803 C CA  . TRP B 2 210 ? 13.486  58.181 -17.010 1.00 80.83  ? 212 TRP B CA  1 
ATOM   4804 C C   . TRP B 2 210 ? 12.270  57.288 -16.806 1.00 79.18  ? 212 TRP B C   1 
ATOM   4805 O O   . TRP B 2 210 ? 12.101  56.273 -17.487 1.00 78.45  ? 212 TRP B O   1 
ATOM   4806 C CB  . TRP B 2 210 ? 13.199  59.215 -18.097 1.00 80.38  ? 212 TRP B CB  1 
ATOM   4807 C CG  . TRP B 2 210 ? 14.238  60.287 -18.195 1.00 83.69  ? 212 TRP B CG  1 
ATOM   4808 C CD1 . TRP B 2 210 ? 15.211  60.401 -19.144 1.00 86.99  ? 212 TRP B CD1 1 
ATOM   4809 C CD2 . TRP B 2 210 ? 14.410  61.400 -17.309 1.00 84.69  ? 212 TRP B CD2 1 
ATOM   4810 N NE1 . TRP B 2 210 ? 15.977  61.516 -18.905 1.00 90.65  ? 212 TRP B NE1 1 
ATOM   4811 C CE2 . TRP B 2 210 ? 15.505  62.147 -17.784 1.00 90.00  ? 212 TRP B CE2 1 
ATOM   4812 C CE3 . TRP B 2 210 ? 13.743  61.837 -16.160 1.00 82.80  ? 212 TRP B CE3 1 
ATOM   4813 C CZ2 . TRP B 2 210 ? 15.949  63.306 -17.151 1.00 92.58  ? 212 TRP B CZ2 1 
ATOM   4814 C CZ3 . TRP B 2 210 ? 14.185  62.989 -15.534 1.00 85.22  ? 212 TRP B CZ3 1 
ATOM   4815 C CH2 . TRP B 2 210 ? 15.277  63.710 -16.030 1.00 90.04  ? 212 TRP B CH2 1 
ATOM   4816 N N   . SER B 2 211 ? 11.419  57.675 -15.860 1.00 80.85  ? 213 SER B N   1 
ATOM   4817 C CA  . SER B 2 211 ? 10.195  56.937 -15.604 1.00 79.33  ? 213 SER B CA  1 
ATOM   4818 C C   . SER B 2 211 ? 9.233   57.080 -16.780 1.00 77.90  ? 213 SER B C   1 
ATOM   4819 O O   . SER B 2 211 ? 9.458   57.848 -17.720 1.00 76.87  ? 213 SER B O   1 
ATOM   4820 C CB  . SER B 2 211 ? 9.530   57.429 -14.321 1.00 80.23  ? 213 SER B CB  1 
ATOM   4821 O OG  . SER B 2 211 ? 9.065   58.760 -14.469 1.00 81.23  ? 213 SER B OG  1 
ATOM   4822 N N   . GLU B 2 212 ? 8.152   56.316 -16.723 1.00 80.20  ? 214 GLU B N   1 
ATOM   4823 C CA  . GLU B 2 212 ? 7.113   56.425 -17.731 1.00 78.12  ? 214 GLU B CA  1 
ATOM   4824 C C   . GLU B 2 212 ? 6.521   57.829 -17.694 1.00 77.94  ? 214 GLU B C   1 
ATOM   4825 O O   . GLU B 2 212 ? 6.055   58.269 -16.632 1.00 78.46  ? 214 GLU B O   1 
ATOM   4826 C CB  . GLU B 2 212 ? 6.032   55.376 -17.503 1.00 79.22  ? 214 GLU B CB  1 
ATOM   4827 C CG  . GLU B 2 212 ? 6.436   53.988 -17.969 1.00 82.84  ? 214 GLU B CG  1 
ATOM   4828 C CD  . GLU B 2 212 ? 6.728   53.938 -19.457 1.00 86.33  ? 214 GLU B CD  1 
ATOM   4829 O OE1 . GLU B 2 212 ? 5.793   54.150 -20.257 1.00 83.36  ? 214 GLU B OE1 1 
ATOM   4830 O OE2 . GLU B 2 212 ? 7.895   53.688 -19.828 1.00 83.85  ? 214 GLU B OE2 1 
ATOM   4831 N N   . PRO B 2 213 ? 6.537   58.565 -18.803 1.00 76.23  ? 215 PRO B N   1 
ATOM   4832 C CA  . PRO B 2 213 ? 6.072   59.955 -18.772 1.00 76.12  ? 215 PRO B CA  1 
ATOM   4833 C C   . PRO B 2 213 ? 4.589   60.047 -18.453 1.00 75.47  ? 215 PRO B C   1 
ATOM   4834 O O   . PRO B 2 213 ? 3.796   59.171 -18.807 1.00 74.95  ? 215 PRO B O   1 
ATOM   4835 C CB  . PRO B 2 213 ? 6.370   60.462 -20.188 1.00 76.21  ? 215 PRO B CB  1 
ATOM   4836 C CG  . PRO B 2 213 ? 7.404   59.525 -20.725 1.00 76.86  ? 215 PRO B CG  1 
ATOM   4837 C CD  . PRO B 2 213 ? 7.083   58.195 -20.118 1.00 76.25  ? 215 PRO B CD  1 
ATOM   4838 N N   . VAL B 2 214 ? 4.223   61.125 -17.764 1.00 76.20  ? 216 VAL B N   1 
ATOM   4839 C CA  . VAL B 2 214 ? 2.836   61.426 -17.429 1.00 76.39  ? 216 VAL B CA  1 
ATOM   4840 C C   . VAL B 2 214 ? 2.552   62.850 -17.884 1.00 76.60  ? 216 VAL B C   1 
ATOM   4841 O O   . VAL B 2 214 ? 3.223   63.790 -17.441 1.00 77.15  ? 216 VAL B O   1 
ATOM   4842 C CB  . VAL B 2 214 ? 2.552   61.271 -15.925 1.00 77.49  ? 216 VAL B CB  1 
ATOM   4843 C CG1 . VAL B 2 214 ? 1.142   61.736 -15.605 1.00 78.55  ? 216 VAL B CG1 1 
ATOM   4844 C CG2 . VAL B 2 214 ? 2.752   59.828 -15.494 1.00 77.75  ? 216 VAL B CG2 1 
ATOM   4845 N N   . SER B 2 215 ? 1.568   63.006 -18.767 1.00 80.96  ? 217 SER B N   1 
ATOM   4846 C CA  . SER B 2 215 ? 1.222   64.295 -19.350 1.00 81.58  ? 217 SER B CA  1 
ATOM   4847 C C   . SER B 2 215 ? -0.055  64.838 -18.712 1.00 84.65  ? 217 SER B C   1 
ATOM   4848 O O   . SER B 2 215 ? -0.964  64.081 -18.364 1.00 85.27  ? 217 SER B O   1 
ATOM   4849 C CB  . SER B 2 215 ? 1.037   64.179 -20.869 1.00 81.64  ? 217 SER B CB  1 
ATOM   4850 O OG  . SER B 2 215 ? 2.199   63.658 -21.498 1.00 83.44  ? 217 SER B OG  1 
ATOM   4851 N N   . LEU B 2 216 ? -0.128  66.165 -18.602 1.00 76.58  ? 218 LEU B N   1 
ATOM   4852 C CA  . LEU B 2 216 ? -1.259  66.871 -18.011 1.00 78.22  ? 218 LEU B CA  1 
ATOM   4853 C C   . LEU B 2 216 ? -1.392  68.226 -18.702 1.00 80.16  ? 218 LEU B C   1 
ATOM   4854 O O   . LEU B 2 216 ? -0.389  68.853 -19.058 1.00 79.95  ? 218 LEU B O   1 
ATOM   4855 C CB  . LEU B 2 216 ? -1.097  67.068 -16.492 1.00 79.27  ? 218 LEU B CB  1 
ATOM   4856 C CG  . LEU B 2 216 ? -2.016  66.410 -15.455 1.00 82.82  ? 218 LEU B CG  1 
ATOM   4857 C CD1 . LEU B 2 216 ? -1.959  64.941 -15.613 1.00 81.88  ? 218 LEU B CD1 1 
ATOM   4858 C CD2 . LEU B 2 216 ? -1.692  66.819 -14.035 1.00 85.52  ? 218 LEU B CD2 1 
ATOM   4859 N N   . LEU B 2 217 ? -2.637  68.641 -18.930 1.00 83.43  ? 219 LEU B N   1 
ATOM   4860 C CA  . LEU B 2 217 ? -2.955  69.900 -19.593 1.00 85.19  ? 219 LEU B CA  1 
ATOM   4861 C C   . LEU B 2 217 ? -3.330  70.916 -18.525 1.00 89.88  ? 219 LEU B C   1 
ATOM   4862 O O   . LEU B 2 217 ? -4.154  70.624 -17.653 1.00 91.31  ? 219 LEU B O   1 
ATOM   4863 C CB  . LEU B 2 217 ? -4.108  69.713 -20.589 1.00 84.90  ? 219 LEU B CB  1 
ATOM   4864 C CG  . LEU B 2 217 ? -4.367  70.803 -21.630 1.00 87.57  ? 219 LEU B CG  1 
ATOM   4865 C CD1 . LEU B 2 217 ? -5.255  71.904 -21.068 1.00 91.17  ? 219 LEU B CD1 1 
ATOM   4866 C CD2 . LEU B 2 217 ? -3.036  71.367 -22.101 1.00 87.78  ? 219 LEU B CD2 1 
ATOM   4867 N N   . THR B 2 218 ? -2.722  72.100 -18.593 1.00 88.68  ? 220 THR B N   1 
ATOM   4868 C CA  . THR B 2 218 ? -2.935  73.142 -17.594 1.00 91.82  ? 220 THR B CA  1 
ATOM   4869 C C   . THR B 2 218 ? -4.088  74.051 -18.007 1.00 95.96  ? 220 THR B C   1 
ATOM   4870 O O   . THR B 2 218 ? -4.242  74.354 -19.192 1.00 95.68  ? 220 THR B O   1 
ATOM   4871 C CB  . THR B 2 218 ? -1.674  73.981 -17.408 1.00 94.84  ? 220 THR B CB  1 
ATOM   4872 O OG1 . THR B 2 218 ? -1.375  74.668 -18.629 1.00 95.33  ? 220 THR B OG1 1 
ATOM   4873 C CG2 . THR B 2 218 ? -0.497  73.099 -17.026 1.00 91.75  ? 220 THR B CG2 1 
ATOM   4874 N N   . PRO B 2 219 ? -4.916  74.489 -17.051 1.00 99.22  ? 221 PRO B N   1 
ATOM   4875 C CA  . PRO B 2 219 ? -6.020  75.396 -17.393 1.00 101.85 ? 221 PRO B CA  1 
ATOM   4876 C C   . PRO B 2 219 ? -5.516  76.796 -17.700 1.00 105.30 ? 221 PRO B C   1 
ATOM   4877 O O   . PRO B 2 219 ? -4.309  77.050 -17.651 1.00 104.98 ? 221 PRO B O   1 
ATOM   4878 C CB  . PRO B 2 219 ? -6.899  75.379 -16.134 1.00 104.31 ? 221 PRO B CB  1 
ATOM   4879 C CG  . PRO B 2 219 ? -6.442  74.191 -15.342 1.00 104.22 ? 221 PRO B CG  1 
ATOM   4880 C CD  . PRO B 2 219 ? -4.989  74.045 -15.650 1.00 100.31 ? 221 PRO B CD  1 
ATOM   4881 N N   . SER B 2 220 ? -6.428  77.712 -18.014 1.00 109.31 ? 222 SER B N   1 
ATOM   4882 C CA  . SER B 2 220 ? -6.064  79.095 -18.284 1.00 111.43 ? 222 SER B CA  1 
ATOM   4883 C C   . SER B 2 220 ? -6.120  79.915 -17.001 1.00 114.72 ? 222 SER B C   1 
ATOM   4884 O O   . SER B 2 220 ? -7.049  79.773 -16.200 1.00 115.51 ? 222 SER B O   1 
ATOM   4885 C CB  . SER B 2 220 ? -6.987  79.699 -19.343 1.00 114.28 ? 222 SER B CB  1 
ATOM   4886 O OG  . SER B 2 220 ? -6.450  80.912 -19.844 1.00 120.18 ? 222 SER B OG  1 
ATOM   4887 N N   . ASP B 2 221 ? -5.126  80.779 -16.816 1.00 106.67 ? 223 ASP B N   1 
ATOM   4888 C CA  . ASP B 2 221 ? -5.045  81.625 -15.627 1.00 116.80 ? 223 ASP B CA  1 
ATOM   4889 C C   . ASP B 2 221 ? -6.267  82.534 -15.513 1.00 127.15 ? 223 ASP B C   1 
ATOM   4890 O O   . ASP B 2 221 ? -6.457  83.212 -14.503 1.00 115.91 ? 223 ASP B O   1 
ATOM   4891 C CB  . ASP B 2 221 ? -3.770  82.473 -15.653 1.00 120.79 ? 223 ASP B CB  1 
ATOM   4892 C CG  . ASP B 2 221 ? -2.795  82.025 -16.722 1.00 120.15 ? 223 ASP B CG  1 
ATOM   4893 O OD1 . ASP B 2 221 ? -3.203  81.965 -17.901 1.00 120.61 ? 223 ASP B OD1 1 
ATOM   4894 O OD2 . ASP B 2 221 ? -1.631  81.717 -16.385 1.00 119.36 ? 223 ASP B OD2 1 
ATOM   4895 N N   . LYS C 2 8   ? 15.258  56.910 10.695  1.00 139.36 ? 10  LYS C N   1 
ATOM   4896 C CA  . LYS C 2 8   ? 13.822  56.741 10.890  1.00 133.01 ? 10  LYS C CA  1 
ATOM   4897 C C   . LYS C 2 8   ? 13.512  55.430 11.613  1.00 124.42 ? 10  LYS C C   1 
ATOM   4898 O O   . LYS C 2 8   ? 13.598  55.352 12.838  1.00 119.20 ? 10  LYS C O   1 
ATOM   4899 C CB  . LYS C 2 8   ? 13.092  56.789 9.546   1.00 136.56 ? 10  LYS C CB  1 
ATOM   4900 N N   . PHE C 2 9   ? 13.146  54.405 10.838  1.00 134.27 ? 11  PHE C N   1 
ATOM   4901 C CA  . PHE C 2 9   ? 12.875  53.088 11.409  1.00 126.06 ? 11  PHE C CA  1 
ATOM   4902 C C   . PHE C 2 9   ? 14.127  52.468 12.019  1.00 127.30 ? 11  PHE C C   1 
ATOM   4903 O O   . PHE C 2 9   ? 14.038  51.753 13.024  1.00 120.77 ? 11  PHE C O   1 
ATOM   4904 C CB  . PHE C 2 9   ? 12.278  52.171 10.335  1.00 123.87 ? 11  PHE C CB  1 
ATOM   4905 C CG  . PHE C 2 9   ? 12.723  50.732 10.430  1.00 120.55 ? 11  PHE C CG  1 
ATOM   4906 C CD1 . PHE C 2 9   ? 12.156  49.869 11.355  1.00 112.53 ? 11  PHE C CD1 1 
ATOM   4907 C CD2 . PHE C 2 9   ? 13.696  50.238 9.574   1.00 125.41 ? 11  PHE C CD2 1 
ATOM   4908 C CE1 . PHE C 2 9   ? 12.564  48.547 11.434  1.00 109.79 ? 11  PHE C CE1 1 
ATOM   4909 C CE2 . PHE C 2 9   ? 14.106  48.918 9.647   1.00 122.26 ? 11  PHE C CE2 1 
ATOM   4910 C CZ  . PHE C 2 9   ? 13.539  48.072 10.578  1.00 114.23 ? 11  PHE C CZ  1 
ATOM   4911 N N   . GLU C 2 10  ? 15.296  52.726 11.428  1.00 127.10 ? 12  GLU C N   1 
ATOM   4912 C CA  . GLU C 2 10  ? 16.541  52.168 11.949  1.00 128.50 ? 12  GLU C CA  1 
ATOM   4913 C C   . GLU C 2 10  ? 16.847  52.687 13.350  1.00 126.90 ? 12  GLU C C   1 
ATOM   4914 O O   . GLU C 2 10  ? 17.226  51.915 14.239  1.00 122.92 ? 12  GLU C O   1 
ATOM   4915 C CB  . GLU C 2 10  ? 17.694  52.482 10.995  1.00 135.22 ? 12  GLU C CB  1 
ATOM   4916 C CG  . GLU C 2 10  ? 19.048  52.018 11.499  1.00 132.18 ? 12  GLU C CG  1 
ATOM   4917 C CD  . GLU C 2 10  ? 19.230  50.521 11.367  1.00 131.94 ? 12  GLU C CD  1 
ATOM   4918 O OE1 . GLU C 2 10  ? 18.614  49.928 10.457  1.00 130.12 ? 12  GLU C OE1 1 
ATOM   4919 O OE2 . GLU C 2 10  ? 19.990  49.940 12.170  1.00 125.70 ? 12  GLU C OE2 1 
ATOM   4920 N N   . SER C 2 11  ? 16.704  53.998 13.561  1.00 127.43 ? 13  SER C N   1 
ATOM   4921 C CA  . SER C 2 11  ? 16.990  54.568 14.875  1.00 122.57 ? 13  SER C CA  1 
ATOM   4922 C C   . SER C 2 11  ? 16.062  54.012 15.950  1.00 114.41 ? 13  SER C C   1 
ATOM   4923 O O   . SER C 2 11  ? 16.485  53.833 17.098  1.00 110.60 ? 13  SER C O   1 
ATOM   4924 C CB  . SER C 2 11  ? 16.893  56.095 14.817  1.00 124.65 ? 13  SER C CB  1 
ATOM   4925 O OG  . SER C 2 11  ? 15.628  56.514 14.333  1.00 124.30 ? 13  SER C OG  1 
ATOM   4926 N N   . LYS C 2 12  ? 14.805  53.723 15.602  1.00 118.93 ? 14  LYS C N   1 
ATOM   4927 C CA  . LYS C 2 12  ? 13.879  53.163 16.583  1.00 110.43 ? 14  LYS C CA  1 
ATOM   4928 C C   . LYS C 2 12  ? 14.226  51.716 16.910  1.00 107.31 ? 14  LYS C C   1 
ATOM   4929 O O   . LYS C 2 12  ? 14.176  51.307 18.077  1.00 102.42 ? 14  LYS C O   1 
ATOM   4930 C CB  . LYS C 2 12  ? 12.441  53.252 16.071  1.00 107.07 ? 14  LYS C CB  1 
ATOM   4931 C CG  . LYS C 2 12  ? 11.795  54.618 16.208  1.00 107.54 ? 14  LYS C CG  1 
ATOM   4932 C CD  . LYS C 2 12  ? 10.302  54.534 15.935  1.00 103.20 ? 14  LYS C CD  1 
ATOM   4933 C CE  . LYS C 2 12  ? 9.611   55.856 16.217  1.00 103.33 ? 14  LYS C CE  1 
ATOM   4934 N NZ  . LYS C 2 12  ? 8.132   55.745 16.087  1.00 101.16 ? 14  LYS C NZ  1 
ATOM   4935 N N   . ALA C 2 13  ? 14.580  50.927 15.894  1.00 114.24 ? 15  ALA C N   1 
ATOM   4936 C CA  . ALA C 2 13  ? 14.906  49.525 16.126  1.00 110.94 ? 15  ALA C CA  1 
ATOM   4937 C C   . ALA C 2 13  ? 16.165  49.368 16.969  1.00 112.96 ? 15  ALA C C   1 
ATOM   4938 O O   . ALA C 2 13  ? 16.271  48.413 17.747  1.00 110.59 ? 15  ALA C O   1 
ATOM   4939 C CB  . ALA C 2 13  ? 15.062  48.794 14.792  1.00 112.42 ? 15  ALA C CB  1 
ATOM   4940 N N   . ALA C 2 14  ? 17.123  50.289 16.835  1.00 120.41 ? 16  ALA C N   1 
ATOM   4941 C CA  . ALA C 2 14  ? 18.352  50.191 17.615  1.00 119.80 ? 16  ALA C CA  1 
ATOM   4942 C C   . ALA C 2 14  ? 18.090  50.359 19.106  1.00 115.45 ? 16  ALA C C   1 
ATOM   4943 O O   . ALA C 2 14  ? 18.767  49.727 19.926  1.00 113.23 ? 16  ALA C O   1 
ATOM   4944 C CB  . ALA C 2 14  ? 19.366  51.229 17.133  1.00 123.85 ? 16  ALA C CB  1 
ATOM   4945 N N   . LEU C 2 15  ? 17.123  51.202 19.477  1.00 118.72 ? 17  LEU C N   1 
ATOM   4946 C CA  . LEU C 2 15  ? 16.791  51.373 20.888  1.00 113.62 ? 17  LEU C CA  1 
ATOM   4947 C C   . LEU C 2 15  ? 16.193  50.098 21.472  1.00 110.05 ? 17  LEU C C   1 
ATOM   4948 O O   . LEU C 2 15  ? 16.523  49.710 22.599  1.00 108.24 ? 17  LEU C O   1 
ATOM   4949 C CB  . LEU C 2 15  ? 15.834  52.555 21.063  1.00 111.62 ? 17  LEU C CB  1 
ATOM   4950 C CG  . LEU C 2 15  ? 15.337  52.906 22.471  1.00 108.96 ? 17  LEU C CG  1 
ATOM   4951 C CD1 . LEU C 2 15  ? 15.182  54.412 22.604  1.00 110.47 ? 17  LEU C CD1 1 
ATOM   4952 C CD2 . LEU C 2 15  ? 14.018  52.215 22.803  1.00 105.03 ? 17  LEU C CD2 1 
ATOM   4953 N N   . LEU C 2 16  ? 15.306  49.438 20.724  1.00 116.24 ? 18  LEU C N   1 
ATOM   4954 C CA  . LEU C 2 16  ? 14.668  48.227 21.232  1.00 110.52 ? 18  LEU C CA  1 
ATOM   4955 C C   . LEU C 2 16  ? 15.659  47.073 21.325  1.00 113.00 ? 18  LEU C C   1 
ATOM   4956 O O   . LEU C 2 16  ? 15.594  46.267 22.261  1.00 109.70 ? 18  LEU C O   1 
ATOM   4957 C CB  . LEU C 2 16  ? 13.480  47.848 20.347  1.00 106.90 ? 18  LEU C CB  1 
ATOM   4958 C CG  . LEU C 2 16  ? 12.265  48.776 20.419  1.00 105.80 ? 18  LEU C CG  1 
ATOM   4959 C CD1 . LEU C 2 16  ? 11.305  48.499 19.271  1.00 104.52 ? 18  LEU C CD1 1 
ATOM   4960 C CD2 . LEU C 2 16  ? 11.560  48.639 21.762  1.00 101.97 ? 18  LEU C CD2 1 
ATOM   4961 N N   . ALA C 2 17  ? 16.578  46.971 20.361  1.00 109.34 ? 19  ALA C N   1 
ATOM   4962 C CA  . ALA C 2 17  ? 17.567  45.899 20.397  1.00 109.12 ? 19  ALA C CA  1 
ATOM   4963 C C   . ALA C 2 17  ? 18.477  46.034 21.611  1.00 112.25 ? 19  ALA C C   1 
ATOM   4964 O O   . ALA C 2 17  ? 18.880  45.030 22.210  1.00 109.73 ? 19  ALA C O   1 
ATOM   4965 C CB  . ALA C 2 17  ? 18.386  45.892 19.106  1.00 112.58 ? 19  ALA C CB  1 
ATOM   4966 N N   . ALA C 2 18  ? 18.815  47.271 21.985  1.00 118.14 ? 20  ALA C N   1 
ATOM   4967 C CA  . ALA C 2 18  ? 19.620  47.491 23.181  1.00 117.70 ? 20  ALA C CA  1 
ATOM   4968 C C   . ALA C 2 18  ? 18.860  47.113 24.447  1.00 116.41 ? 20  ALA C C   1 
ATOM   4969 O O   . ALA C 2 18  ? 19.474  46.691 25.434  1.00 116.13 ? 20  ALA C O   1 
ATOM   4970 C CB  . ALA C 2 18  ? 20.079  48.949 23.249  1.00 119.36 ? 20  ALA C CB  1 
ATOM   4971 N N   . ARG C 2 19  ? 17.532  47.259 24.439  1.00 119.01 ? 21  ARG C N   1 
ATOM   4972 C CA  . ARG C 2 19  ? 16.737  46.893 25.607  1.00 114.56 ? 21  ARG C CA  1 
ATOM   4973 C C   . ARG C 2 19  ? 16.700  45.382 25.796  1.00 113.63 ? 21  ARG C C   1 
ATOM   4974 O O   . ARG C 2 19  ? 16.973  44.875 26.891  1.00 113.49 ? 21  ARG C O   1 
ATOM   4975 C CB  . ARG C 2 19  ? 15.316  47.444 25.467  1.00 110.46 ? 21  ARG C CB  1 
ATOM   4976 C CG  . ARG C 2 19  ? 15.121  48.866 25.963  1.00 114.56 ? 21  ARG C CG  1 
ATOM   4977 C CD  . ARG C 2 19  ? 14.251  48.873 27.211  1.00 116.03 ? 21  ARG C CD  1 
ATOM   4978 N NE  . ARG C 2 19  ? 14.089  50.210 27.774  1.00 120.88 ? 21  ARG C NE  1 
ATOM   4979 C CZ  . ARG C 2 19  ? 14.827  50.694 28.768  1.00 128.75 ? 21  ARG C CZ  1 
ATOM   4980 N NH1 . ARG C 2 19  ? 15.780  49.948 29.310  1.00 126.18 ? 21  ARG C NH1 1 
ATOM   4981 N NH2 . ARG C 2 19  ? 14.610  51.921 29.222  1.00 126.86 ? 21  ARG C NH2 1 
ATOM   4982 N N   . GLY C 2 20  ? 16.364  44.648 24.740  1.00 105.01 ? 22  GLY C N   1 
ATOM   4983 C CA  . GLY C 2 20  ? 16.231  43.214 24.819  1.00 105.23 ? 22  GLY C CA  1 
ATOM   4984 C C   . GLY C 2 20  ? 16.743  42.518 23.576  1.00 105.99 ? 22  GLY C C   1 
ATOM   4985 O O   . GLY C 2 20  ? 15.991  42.257 22.631  1.00 104.93 ? 22  GLY C O   1 
ATOM   4986 N N   . PRO C 2 21  ? 18.032  42.197 23.551  1.00 102.51 ? 23  PRO C N   1 
ATOM   4987 C CA  . PRO C 2 21  ? 18.591  41.472 22.408  1.00 101.49 ? 23  PRO C CA  1 
ATOM   4988 C C   . PRO C 2 21  ? 18.203  40.002 22.471  1.00 102.17 ? 23  PRO C C   1 
ATOM   4989 O O   . PRO C 2 21  ? 17.664  39.513 23.464  1.00 102.85 ? 23  PRO C O   1 
ATOM   4990 C CB  . PRO C 2 21  ? 20.101  41.657 22.571  1.00 103.00 ? 23  PRO C CB  1 
ATOM   4991 C CG  . PRO C 2 21  ? 20.300  41.847 24.038  1.00 106.23 ? 23  PRO C CG  1 
ATOM   4992 C CD  . PRO C 2 21  ? 19.035  42.448 24.601  1.00 104.40 ? 23  PRO C CD  1 
ATOM   4993 N N   . GLU C 2 22  ? 18.483  39.299 21.375  1.00 99.18  ? 24  GLU C N   1 
ATOM   4994 C CA  . GLU C 2 22  ? 18.211  37.871 21.232  1.00 98.47  ? 24  GLU C CA  1 
ATOM   4995 C C   . GLU C 2 22  ? 16.723  37.545 21.319  1.00 99.01  ? 24  GLU C C   1 
ATOM   4996 O O   . GLU C 2 22  ? 16.357  36.369 21.433  1.00 98.55  ? 24  GLU C O   1 
ATOM   4997 C CB  . GLU C 2 22  ? 18.988  37.039 22.264  1.00 100.66 ? 24  GLU C CB  1 
ATOM   4998 C CG  . GLU C 2 22  ? 20.491  37.280 22.258  1.00 105.07 ? 24  GLU C CG  1 
ATOM   4999 C CD  . GLU C 2 22  ? 21.214  36.452 21.214  1.00 110.77 ? 24  GLU C CD  1 
ATOM   5000 O OE1 . GLU C 2 22  ? 21.717  37.042 20.234  1.00 107.41 ? 24  GLU C OE1 1 
ATOM   5001 O OE2 . GLU C 2 22  ? 21.263  35.212 21.363  1.00 109.63 ? 24  GLU C OE2 1 
ATOM   5002 N N   . GLU C 2 23  ? 15.854  38.554 21.272  1.00 97.14  ? 25  GLU C N   1 
ATOM   5003 C CA  . GLU C 2 23  ? 14.420  38.368 21.435  1.00 97.04  ? 25  GLU C CA  1 
ATOM   5004 C C   . GLU C 2 23  ? 13.671  39.055 20.303  1.00 97.12  ? 25  GLU C C   1 
ATOM   5005 O O   . GLU C 2 23  ? 14.102  40.091 19.788  1.00 96.70  ? 25  GLU C O   1 
ATOM   5006 C CB  . GLU C 2 23  ? 13.956  38.927 22.792  1.00 99.51  ? 25  GLU C CB  1 
ATOM   5007 C CG  . GLU C 2 23  ? 12.469  38.805 23.074  1.00 104.65 ? 25  GLU C CG  1 
ATOM   5008 C CD  . GLU C 2 23  ? 12.072  39.492 24.365  1.00 113.09 ? 25  GLU C CD  1 
ATOM   5009 O OE1 . GLU C 2 23  ? 12.949  40.111 25.003  1.00 111.77 ? 25  GLU C OE1 1 
ATOM   5010 O OE2 . GLU C 2 23  ? 10.884  39.414 24.740  1.00 111.95 ? 25  GLU C OE2 1 
ATOM   5011 N N   . LEU C 2 24  ? 12.536  38.469 19.926  1.00 93.04  ? 26  LEU C N   1 
ATOM   5012 C CA  . LEU C 2 24  ? 11.700  39.043 18.881  1.00 91.79  ? 26  LEU C CA  1 
ATOM   5013 C C   . LEU C 2 24  ? 11.061  40.337 19.371  1.00 91.97  ? 26  LEU C C   1 
ATOM   5014 O O   . LEU C 2 24  ? 10.409  40.361 20.419  1.00 93.70  ? 26  LEU C O   1 
ATOM   5015 C CB  . LEU C 2 24  ? 10.627  38.042 18.455  1.00 92.58  ? 26  LEU C CB  1 
ATOM   5016 C CG  . LEU C 2 24  ? 9.637   38.490 17.378  1.00 91.99  ? 26  LEU C CG  1 
ATOM   5017 C CD1 . LEU C 2 24  ? 10.305  38.519 16.012  1.00 90.57  ? 26  LEU C CD1 1 
ATOM   5018 C CD2 . LEU C 2 24  ? 8.426   37.573 17.356  1.00 93.81  ? 26  LEU C CD2 1 
ATOM   5019 N N   . LEU C 2 25  ? 11.262  41.417 18.620  1.00 94.71  ? 27  LEU C N   1 
ATOM   5020 C CA  . LEU C 2 25  ? 10.753  42.734 18.977  1.00 96.23  ? 27  LEU C CA  1 
ATOM   5021 C C   . LEU C 2 25  ? 9.788   43.222 17.907  1.00 98.18  ? 27  LEU C C   1 
ATOM   5022 O O   . LEU C 2 25  ? 10.119  43.211 16.716  1.00 96.86  ? 27  LEU C O   1 
ATOM   5023 C CB  . LEU C 2 25  ? 11.895  43.736 19.150  1.00 96.10  ? 27  LEU C CB  1 
ATOM   5024 C CG  . LEU C 2 25  ? 12.882  43.419 20.273  1.00 97.83  ? 27  LEU C CG  1 
ATOM   5025 C CD1 . LEU C 2 25  ? 14.230  44.069 20.003  1.00 97.40  ? 27  LEU C CD1 1 
ATOM   5026 C CD2 . LEU C 2 25  ? 12.318  43.863 21.615  1.00 99.70  ? 27  LEU C CD2 1 
ATOM   5027 N N   . CYS C 2 26  ? 8.603   43.654 18.332  1.00 98.74  ? 28  CYS C N   1 
ATOM   5028 C CA  . CYS C 2 26  ? 7.597   44.208 17.438  1.00 100.14 ? 28  CYS C CA  1 
ATOM   5029 C C   . CYS C 2 26  ? 7.169   45.578 17.941  1.00 102.32 ? 28  CYS C C   1 
ATOM   5030 O O   . CYS C 2 26  ? 6.931   45.763 19.139  1.00 101.85 ? 28  CYS C O   1 
ATOM   5031 C CB  . CYS C 2 26  ? 6.376   43.293 17.328  1.00 100.79 ? 28  CYS C CB  1 
ATOM   5032 S SG  . CYS C 2 26  ? 6.711   41.628 16.701  1.00 99.76  ? 28  CYS C SG  1 
ATOM   5033 N N   . PHE C 2 27  ? 7.069   46.534 17.021  1.00 97.71  ? 29  PHE C N   1 
ATOM   5034 C CA  . PHE C 2 27  ? 6.708   47.900 17.369  1.00 98.55  ? 29  PHE C CA  1 
ATOM   5035 C C   . PHE C 2 27  ? 5.871   48.495 16.249  1.00 101.26 ? 29  PHE C C   1 
ATOM   5036 O O   . PHE C 2 27  ? 5.854   47.992 15.123  1.00 101.30 ? 29  PHE C O   1 
ATOM   5037 C CB  . PHE C 2 27  ? 7.946   48.771 17.617  1.00 98.44  ? 29  PHE C CB  1 
ATOM   5038 C CG  . PHE C 2 27  ? 8.725   49.081 16.371  1.00 99.03  ? 29  PHE C CG  1 
ATOM   5039 C CD1 . PHE C 2 27  ? 9.609   48.157 15.840  1.00 98.32  ? 29  PHE C CD1 1 
ATOM   5040 C CD2 . PHE C 2 27  ? 8.575   50.301 15.731  1.00 101.02 ? 29  PHE C CD2 1 
ATOM   5041 C CE1 . PHE C 2 27  ? 10.325  48.442 14.695  1.00 96.77  ? 29  PHE C CE1 1 
ATOM   5042 C CE2 . PHE C 2 27  ? 9.287   50.592 14.586  1.00 101.39 ? 29  PHE C CE2 1 
ATOM   5043 C CZ  . PHE C 2 27  ? 10.163  49.661 14.068  1.00 97.62  ? 29  PHE C CZ  1 
ATOM   5044 N N   . THR C 2 28  ? 5.176   49.583 16.572  1.00 95.99  ? 30  THR C N   1 
ATOM   5045 C CA  . THR C 2 28  ? 4.367   50.300 15.595  1.00 97.38  ? 30  THR C CA  1 
ATOM   5046 C C   . THR C 2 28  ? 4.544   51.794 15.828  1.00 99.97  ? 30  THR C C   1 
ATOM   5047 O O   . THR C 2 28  ? 4.320   52.285 16.939  1.00 100.53 ? 30  THR C O   1 
ATOM   5048 C CB  . THR C 2 28  ? 2.891   49.887 15.677  1.00 99.59  ? 30  THR C CB  1 
ATOM   5049 O OG1 . THR C 2 28  ? 2.276   50.511 16.809  1.00 100.21 ? 30  THR C OG1 1 
ATOM   5050 C CG2 . THR C 2 28  ? 2.732   48.373 15.770  1.00 99.46  ? 30  THR C CG2 1 
ATOM   5051 N N   . GLU C 2 29  ? 4.975   52.510 14.785  1.00 101.49 ? 31  GLU C N   1 
ATOM   5052 C CA  . GLU C 2 29  ? 5.108   53.961 14.875  1.00 101.54 ? 31  GLU C CA  1 
ATOM   5053 C C   . GLU C 2 29  ? 3.744   54.637 14.928  1.00 103.79 ? 31  GLU C C   1 
ATOM   5054 O O   . GLU C 2 29  ? 3.533   55.571 15.711  1.00 103.50 ? 31  GLU C O   1 
ATOM   5055 C CB  . GLU C 2 29  ? 5.915   54.477 13.683  1.00 101.45 ? 31  GLU C CB  1 
ATOM   5056 C CG  . GLU C 2 29  ? 7.111   53.609 13.319  1.00 102.99 ? 31  GLU C CG  1 
ATOM   5057 C CD  . GLU C 2 29  ? 7.909   54.176 12.162  1.00 108.34 ? 31  GLU C CD  1 
ATOM   5058 O OE1 . GLU C 2 29  ? 7.444   55.154 11.540  1.00 105.87 ? 31  GLU C OE1 1 
ATOM   5059 O OE2 . GLU C 2 29  ? 9.006   53.651 11.879  1.00 105.05 ? 31  GLU C OE2 1 
ATOM   5060 N N   . ARG C 2 30  ? 2.810   54.175 14.104  1.00 107.16 ? 32  ARG C N   1 
ATOM   5061 C CA  . ARG C 2 30  ? 1.428   54.623 14.128  1.00 108.39 ? 32  ARG C CA  1 
ATOM   5062 C C   . ARG C 2 30  ? 0.534   53.392 14.160  1.00 110.22 ? 32  ARG C C   1 
ATOM   5063 O O   . ARG C 2 30  ? 0.978   52.277 13.876  1.00 108.65 ? 32  ARG C O   1 
ATOM   5064 C CB  . ARG C 2 30  ? 1.091   55.507 12.918  1.00 99.76  ? 32  ARG C CB  1 
ATOM   5065 N N   . LEU C 2 31  ? -0.738  53.601 14.493  1.00 105.12 ? 33  LEU C N   1 
ATOM   5066 C CA  . LEU C 2 31  ? -1.690  52.473 14.673  1.00 105.15 ? 33  LEU C CA  1 
ATOM   5067 C C   . LEU C 2 31  ? -1.836  51.681 13.371  1.00 104.52 ? 33  LEU C C   1 
ATOM   5068 O O   . LEU C 2 31  ? -2.195  50.489 13.450  1.00 103.21 ? 33  LEU C O   1 
ATOM   5069 C CB  . LEU C 2 31  ? -3.042  53.034 15.128  1.00 107.82 ? 33  LEU C CB  1 
ATOM   5070 C CG  . LEU C 2 31  ? -4.189  52.025 15.176  1.00 110.80 ? 33  LEU C CG  1 
ATOM   5071 C CD1 . LEU C 2 31  ? -5.337  52.549 16.024  1.00 114.57 ? 33  LEU C CD1 1 
ATOM   5072 C CD2 . LEU C 2 31  ? -4.673  51.689 13.773  1.00 109.28 ? 33  LEU C CD2 1 
ATOM   5073 N N   . GLU C 2 32  ? -1.571  52.312 12.225  1.00 110.42 ? 34  GLU C N   1 
ATOM   5074 C CA  . GLU C 2 32  ? -1.804  51.636 10.950  1.00 108.48 ? 34  GLU C CA  1 
ATOM   5075 C C   . GLU C 2 32  ? -0.810  50.502 10.700  1.00 107.14 ? 34  GLU C C   1 
ATOM   5076 O O   . GLU C 2 32  ? -1.190  49.444 10.186  1.00 105.10 ? 34  GLU C O   1 
ATOM   5077 C CB  . GLU C 2 32  ? -1.750  52.651 9.809   1.00 108.98 ? 34  GLU C CB  1 
ATOM   5078 N N   . ASP C 2 33  ? 0.462   50.700 11.040  1.00 107.05 ? 35  ASP C N   1 
ATOM   5079 C CA  . ASP C 2 33  ? 1.515   49.768 10.664  1.00 104.82 ? 35  ASP C CA  1 
ATOM   5080 C C   . ASP C 2 33  ? 1.928   48.875 11.835  1.00 105.88 ? 35  ASP C C   1 
ATOM   5081 O O   . ASP C 2 33  ? 1.459   49.016 12.968  1.00 107.18 ? 35  ASP C O   1 
ATOM   5082 C CB  . ASP C 2 33  ? 2.728   50.523 10.118  1.00 105.49 ? 35  ASP C CB  1 
ATOM   5083 C CG  . ASP C 2 33  ? 3.526   51.208 11.209  1.00 110.74 ? 35  ASP C CG  1 
ATOM   5084 O OD1 . ASP C 2 33  ? 3.082   52.267 11.700  1.00 112.34 ? 35  ASP C OD1 1 
ATOM   5085 O OD2 . ASP C 2 33  ? 4.599   50.682 11.576  1.00 112.16 ? 35  ASP C OD2 1 
ATOM   5086 N N   . LEU C 2 34  ? 2.824   47.931 11.535  1.00 100.02 ? 36  LEU C N   1 
ATOM   5087 C CA  . LEU C 2 34  ? 3.421   47.032 12.516  1.00 99.81  ? 36  LEU C CA  1 
ATOM   5088 C C   . LEU C 2 34  ? 4.639   46.344 11.916  1.00 97.65  ? 36  LEU C C   1 
ATOM   5089 O O   . LEU C 2 34  ? 4.551   45.735 10.845  1.00 93.99  ? 36  LEU C O   1 
ATOM   5090 C CB  . LEU C 2 34  ? 2.416   45.985 12.999  1.00 99.71  ? 36  LEU C CB  1 
ATOM   5091 C CG  . LEU C 2 34  ? 2.970   45.047 14.075  1.00 101.06 ? 36  LEU C CG  1 
ATOM   5092 C CD1 . LEU C 2 34  ? 2.049   45.004 15.278  1.00 102.22 ? 36  LEU C CD1 1 
ATOM   5093 C CD2 . LEU C 2 34  ? 3.181   43.650 13.513  1.00 99.44  ? 36  LEU C CD2 1 
ATOM   5094 N N   . VAL C 2 35  ? 5.776   46.430 12.603  1.00 103.34 ? 37  VAL C N   1 
ATOM   5095 C CA  . VAL C 2 35  ? 7.038   45.873 12.128  1.00 100.11 ? 37  VAL C CA  1 
ATOM   5096 C C   . VAL C 2 35  ? 7.620   44.984 13.217  1.00 101.36 ? 37  VAL C C   1 
ATOM   5097 O O   . VAL C 2 35  ? 7.707   45.395 14.380  1.00 103.37 ? 37  VAL C O   1 
ATOM   5098 C CB  . VAL C 2 35  ? 8.043   46.977 11.744  1.00 102.19 ? 37  VAL C CB  1 
ATOM   5099 C CG1 . VAL C 2 35  ? 9.303   46.366 11.157  1.00 96.70  ? 37  VAL C CG1 1 
ATOM   5100 C CG2 . VAL C 2 35  ? 7.415   47.958 10.764  1.00 102.43 ? 37  VAL C CG2 1 
ATOM   5101 N N   . CYS C 2 36  ? 8.017   43.771 12.840  1.00 105.89 ? 38  CYS C N   1 
ATOM   5102 C CA  . CYS C 2 36  ? 8.669   42.829 13.740  1.00 105.72 ? 38  CYS C CA  1 
ATOM   5103 C C   . CYS C 2 36  ? 10.056  42.516 13.202  1.00 104.44 ? 38  CYS C C   1 
ATOM   5104 O O   . CYS C 2 36  ? 10.215  42.249 12.006  1.00 100.01 ? 38  CYS C O   1 
ATOM   5105 C CB  . CYS C 2 36  ? 7.862   41.539 13.883  1.00 105.02 ? 38  CYS C CB  1 
ATOM   5106 S SG  . CYS C 2 36  ? 6.271   41.714 14.715  1.00 110.01 ? 38  CYS C SG  1 
ATOM   5107 N N   . PHE C 2 37  ? 11.054  42.543 14.081  1.00 101.01 ? 39  PHE C N   1 
ATOM   5108 C CA  . PHE C 2 37  ? 12.426  42.285 13.679  1.00 96.74  ? 39  PHE C CA  1 
ATOM   5109 C C   . PHE C 2 37  ? 13.150  41.546 14.793  1.00 99.03  ? 39  PHE C C   1 
ATOM   5110 O O   . PHE C 2 37  ? 12.701  41.514 15.942  1.00 101.31 ? 39  PHE C O   1 
ATOM   5111 C CB  . PHE C 2 37  ? 13.173  43.585 13.346  1.00 95.94  ? 39  PHE C CB  1 
ATOM   5112 C CG  . PHE C 2 37  ? 13.473  44.437 14.547  1.00 98.99  ? 39  PHE C CG  1 
ATOM   5113 C CD1 . PHE C 2 37  ? 12.499  45.249 15.101  1.00 103.08 ? 39  PHE C CD1 1 
ATOM   5114 C CD2 . PHE C 2 37  ? 14.736  44.430 15.116  1.00 99.09  ? 39  PHE C CD2 1 
ATOM   5115 C CE1 . PHE C 2 37  ? 12.777  46.033 16.205  1.00 105.02 ? 39  PHE C CE1 1 
ATOM   5116 C CE2 . PHE C 2 37  ? 15.020  45.211 16.218  1.00 102.21 ? 39  PHE C CE2 1 
ATOM   5117 C CZ  . PHE C 2 37  ? 14.040  46.013 16.764  1.00 103.93 ? 39  PHE C CZ  1 
ATOM   5118 N N   . TRP C 2 38  ? 14.285  40.948 14.436  1.00 102.20 ? 40  TRP C N   1 
ATOM   5119 C CA  . TRP C 2 38  ? 15.161  40.328 15.417  1.00 103.25 ? 40  TRP C CA  1 
ATOM   5120 C C   . TRP C 2 38  ? 16.571  40.267 14.849  1.00 102.51 ? 40  TRP C C   1 
ATOM   5121 O O   . TRP C 2 38  ? 16.758  39.993 13.660  1.00 99.61  ? 40  TRP C O   1 
ATOM   5122 C CB  . TRP C 2 38  ? 14.668  38.928 15.811  1.00 104.08 ? 40  TRP C CB  1 
ATOM   5123 C CG  . TRP C 2 38  ? 14.927  37.853 14.791  1.00 101.81 ? 40  TRP C CG  1 
ATOM   5124 C CD1 . TRP C 2 38  ? 16.034  37.060 14.696  1.00 101.72 ? 40  TRP C CD1 1 
ATOM   5125 C CD2 . TRP C 2 38  ? 14.047  37.440 13.737  1.00 99.86  ? 40  TRP C CD2 1 
ATOM   5126 N NE1 . TRP C 2 38  ? 15.904  36.189 13.641  1.00 99.33  ? 40  TRP C NE1 1 
ATOM   5127 C CE2 . TRP C 2 38  ? 14.692  36.402 13.037  1.00 98.97  ? 40  TRP C CE2 1 
ATOM   5128 C CE3 . TRP C 2 38  ? 12.781  37.853 13.313  1.00 100.40 ? 40  TRP C CE3 1 
ATOM   5129 C CZ2 . TRP C 2 38  ? 14.113  35.769 11.939  1.00 96.87  ? 40  TRP C CZ2 1 
ATOM   5130 C CZ3 . TRP C 2 38  ? 12.208  37.223 12.222  1.00 98.52  ? 40  TRP C CZ3 1 
ATOM   5131 C CH2 . TRP C 2 38  ? 12.874  36.194 11.548  1.00 96.78  ? 40  TRP C CH2 1 
ATOM   5132 N N   . GLU C 2 39  ? 17.553  40.535 15.704  1.00 104.92 ? 41  GLU C N   1 
ATOM   5133 C CA  . GLU C 2 39  ? 18.962  40.503 15.336  1.00 104.06 ? 41  GLU C CA  1 
ATOM   5134 C C   . GLU C 2 39  ? 19.559  39.183 15.802  1.00 106.18 ? 41  GLU C C   1 
ATOM   5135 O O   . GLU C 2 39  ? 19.478  38.847 16.989  1.00 108.41 ? 41  GLU C O   1 
ATOM   5136 C CB  . GLU C 2 39  ? 19.722  41.680 15.945  1.00 106.38 ? 41  GLU C CB  1 
ATOM   5137 C CG  . GLU C 2 39  ? 19.364  43.025 15.347  1.00 109.21 ? 41  GLU C CG  1 
ATOM   5138 C CD  . GLU C 2 39  ? 20.261  44.137 15.847  1.00 118.46 ? 41  GLU C CD  1 
ATOM   5139 O OE1 . GLU C 2 39  ? 21.262  43.834 16.531  1.00 118.47 ? 41  GLU C OE1 1 
ATOM   5140 O OE2 . GLU C 2 39  ? 19.964  45.315 15.558  1.00 117.20 ? 41  GLU C OE2 1 
ATOM   5141 N N   . GLU C 2 40  ? 20.159  38.441 14.879  1.00 114.11 ? 42  GLU C N   1 
ATOM   5142 C CA  . GLU C 2 40  ? 20.738  37.146 15.196  1.00 115.04 ? 42  GLU C CA  1 
ATOM   5143 C C   . GLU C 2 40  ? 22.223  37.155 14.863  1.00 117.52 ? 42  GLU C C   1 
ATOM   5144 O O   . GLU C 2 40  ? 22.642  37.725 13.851  1.00 115.84 ? 42  GLU C O   1 
ATOM   5145 C CB  . GLU C 2 40  ? 20.018  36.034 14.425  1.00 113.35 ? 42  GLU C CB  1 
ATOM   5146 C CG  . GLU C 2 40  ? 20.486  34.629 14.748  1.00 117.95 ? 42  GLU C CG  1 
ATOM   5147 C CD  . GLU C 2 40  ? 19.672  33.573 14.029  1.00 125.07 ? 42  GLU C CD  1 
ATOM   5148 O OE1 . GLU C 2 40  ? 18.762  33.945 13.257  1.00 122.79 ? 42  GLU C OE1 1 
ATOM   5149 O OE2 . GLU C 2 40  ? 19.941  32.371 14.238  1.00 124.35 ? 42  GLU C OE2 1 
ATOM   5150 N N   . ALA C 2 41  ? 23.012  36.510 15.725  1.00 127.82 ? 43  ALA C N   1 
ATOM   5151 C CA  . ALA C 2 41  ? 24.457  36.463 15.530  1.00 129.45 ? 43  ALA C CA  1 
ATOM   5152 C C   . ALA C 2 41  ? 24.828  35.607 14.327  1.00 129.71 ? 43  ALA C C   1 
ATOM   5153 O O   . ALA C 2 41  ? 25.643  36.013 13.490  1.00 129.23 ? 43  ALA C O   1 
ATOM   5154 C CB  . ALA C 2 41  ? 25.139  35.942 16.795  1.00 133.45 ? 43  ALA C CB  1 
ATOM   5155 N N   . ALA C 2 42  ? 24.237  34.419 14.224  1.00 141.81 ? 44  ALA C N   1 
ATOM   5156 C CA  . ALA C 2 42  ? 24.646  33.460 13.207  1.00 141.75 ? 44  ALA C CA  1 
ATOM   5157 C C   . ALA C 2 42  ? 24.290  33.968 11.817  1.00 140.72 ? 44  ALA C C   1 
ATOM   5158 O O   . ALA C 2 42  ? 23.146  34.349 11.554  1.00 138.34 ? 44  ALA C O   1 
ATOM   5159 C CB  . ALA C 2 42  ? 23.986  32.106 13.461  1.00 142.86 ? 44  ALA C CB  1 
ATOM   5160 N N   . SER C 2 43  ? 25.283  33.977 10.927  1.00 149.27 ? 45  SER C N   1 
ATOM   5161 C CA  . SER C 2 43  ? 25.082  34.346 9.535   1.00 149.18 ? 45  SER C CA  1 
ATOM   5162 C C   . SER C 2 43  ? 25.405  33.232 8.552   1.00 153.19 ? 45  SER C C   1 
ATOM   5163 O O   . SER C 2 43  ? 24.902  33.269 7.424   1.00 152.92 ? 45  SER C O   1 
ATOM   5164 C CB  . SER C 2 43  ? 25.927  35.581 9.180   1.00 151.12 ? 45  SER C CB  1 
ATOM   5165 O OG  . SER C 2 43  ? 25.547  36.697 9.968   1.00 151.57 ? 45  SER C OG  1 
ATOM   5166 N N   . ALA C 2 44  ? 26.217  32.252 8.940   1.00 154.56 ? 46  ALA C N   1 
ATOM   5167 C CA  . ALA C 2 44  ? 26.584  31.175 8.034   1.00 157.75 ? 46  ALA C CA  1 
ATOM   5168 C C   . ALA C 2 44  ? 25.370  30.314 7.701   1.00 158.08 ? 46  ALA C C   1 
ATOM   5169 O O   . ALA C 2 44  ? 24.439  30.176 8.499   1.00 155.46 ? 46  ALA C O   1 
ATOM   5170 C CB  . ALA C 2 44  ? 27.687  30.311 8.647   1.00 161.48 ? 46  ALA C CB  1 
ATOM   5171 N N   . GLY C 2 45  ? 25.388  29.736 6.504   1.00 151.58 ? 47  GLY C N   1 
ATOM   5172 C CA  . GLY C 2 45  ? 24.294  28.901 6.045   1.00 161.29 ? 47  GLY C CA  1 
ATOM   5173 C C   . GLY C 2 45  ? 23.112  29.695 5.525   1.00 167.14 ? 47  GLY C C   1 
ATOM   5174 O O   . GLY C 2 45  ? 21.958  29.345 5.774   1.00 152.93 ? 47  GLY C O   1 
ATOM   5175 N N   . PRO C 2 48  ? 18.296  34.798 3.412   1.00 130.74 ? 50  PRO C N   1 
ATOM   5176 C CA  . PRO C 2 48  ? 16.983  35.427 3.596   1.00 130.88 ? 50  PRO C CA  1 
ATOM   5177 C C   . PRO C 2 48  ? 15.846  34.409 3.684   1.00 127.34 ? 50  PRO C C   1 
ATOM   5178 O O   . PRO C 2 48  ? 14.885  34.626 4.422   1.00 124.84 ? 50  PRO C O   1 
ATOM   5179 C CB  . PRO C 2 48  ? 16.836  36.303 2.347   1.00 135.35 ? 50  PRO C CB  1 
ATOM   5180 C CG  . PRO C 2 48  ? 17.725  35.669 1.331   1.00 136.74 ? 50  PRO C CG  1 
ATOM   5181 C CD  . PRO C 2 48  ? 18.888  35.121 2.103   1.00 133.93 ? 50  PRO C CD  1 
ATOM   5182 N N   . GLY C 2 49  ? 15.962  33.313 2.938   1.00 130.30 ? 51  GLY C N   1 
ATOM   5183 C CA  . GLY C 2 49  ? 14.945  32.278 2.945   1.00 126.72 ? 51  GLY C CA  1 
ATOM   5184 C C   . GLY C 2 49  ? 15.174  31.224 4.008   1.00 124.46 ? 51  GLY C C   1 
ATOM   5185 O O   . GLY C 2 49  ? 14.588  30.137 3.956   1.00 121.86 ? 51  GLY C O   1 
ATOM   5186 N N   . GLN C 2 50  ? 16.032  31.535 4.982   1.00 123.68 ? 52  GLN C N   1 
ATOM   5187 C CA  . GLN C 2 50  ? 16.328  30.581 6.044   1.00 121.36 ? 52  GLN C CA  1 
ATOM   5188 C C   . GLN C 2 50  ? 15.172  30.452 7.029   1.00 119.21 ? 52  GLN C C   1 
ATOM   5189 O O   . GLN C 2 50  ? 15.002  29.393 7.645   1.00 116.95 ? 52  GLN C O   1 
ATOM   5190 C CB  . GLN C 2 50  ? 17.605  30.998 6.775   1.00 123.91 ? 52  GLN C CB  1 
ATOM   5191 C CG  . GLN C 2 50  ? 18.791  31.241 5.855   1.00 131.65 ? 52  GLN C CG  1 
ATOM   5192 C CD  . GLN C 2 50  ? 19.953  31.912 6.562   1.00 140.48 ? 52  GLN C CD  1 
ATOM   5193 O OE1 . GLN C 2 50  ? 20.536  32.869 6.051   1.00 141.52 ? 52  GLN C OE1 1 
ATOM   5194 N NE2 . GLN C 2 50  ? 20.298  31.411 7.742   1.00 137.91 ? 52  GLN C NE2 1 
ATOM   5195 N N   . TYR C 2 51  ? 14.369  31.503 7.187   1.00 110.85 ? 53  TYR C N   1 
ATOM   5196 C CA  . TYR C 2 51  ? 13.282  31.521 8.152   1.00 107.54 ? 53  TYR C CA  1 
ATOM   5197 C C   . TYR C 2 51  ? 11.975  31.880 7.458   1.00 108.44 ? 53  TYR C C   1 
ATOM   5198 O O   . TYR C 2 51  ? 11.962  32.488 6.385   1.00 111.17 ? 53  TYR C O   1 
ATOM   5199 C CB  . TYR C 2 51  ? 13.559  32.515 9.291   1.00 107.73 ? 53  TYR C CB  1 
ATOM   5200 C CG  . TYR C 2 51  ? 14.829  32.229 10.058  1.00 109.76 ? 53  TYR C CG  1 
ATOM   5201 C CD1 . TYR C 2 51  ? 14.821  31.388 11.163  1.00 108.85 ? 53  TYR C CD1 1 
ATOM   5202 C CD2 . TYR C 2 51  ? 16.037  32.797 9.677   1.00 113.66 ? 53  TYR C CD2 1 
ATOM   5203 C CE1 . TYR C 2 51  ? 15.979  31.123 11.867  1.00 111.77 ? 53  TYR C CE1 1 
ATOM   5204 C CE2 . TYR C 2 51  ? 17.200  32.537 10.374  1.00 115.13 ? 53  TYR C CE2 1 
ATOM   5205 C CZ  . TYR C 2 51  ? 17.165  31.700 11.468  1.00 116.78 ? 53  TYR C CZ  1 
ATOM   5206 O OH  . TYR C 2 51  ? 18.321  31.438 12.166  1.00 119.45 ? 53  TYR C OH  1 
ATOM   5207 N N   . SER C 2 52  ? 10.868  31.493 8.092   1.00 105.31 ? 54  SER C N   1 
ATOM   5208 C CA  . SER C 2 52  ? 9.528   31.757 7.581   1.00 106.14 ? 54  SER C CA  1 
ATOM   5209 C C   . SER C 2 52  ? 8.706   32.421 8.676   1.00 105.89 ? 54  SER C C   1 
ATOM   5210 O O   . SER C 2 52  ? 8.582   31.877 9.778   1.00 102.40 ? 54  SER C O   1 
ATOM   5211 C CB  . SER C 2 52  ? 8.853   30.466 7.108   1.00 106.36 ? 54  SER C CB  1 
ATOM   5212 O OG  . SER C 2 52  ? 8.677   29.562 8.184   1.00 105.85 ? 54  SER C OG  1 
ATOM   5213 N N   . PHE C 2 53  ? 8.147   33.590 8.371   1.00 97.59  ? 55  PHE C N   1 
ATOM   5214 C CA  . PHE C 2 53  ? 7.349   34.360 9.316   1.00 97.61  ? 55  PHE C CA  1 
ATOM   5215 C C   . PHE C 2 53  ? 5.874   34.041 9.101   1.00 100.31 ? 55  PHE C C   1 
ATOM   5216 O O   . PHE C 2 53  ? 5.369   34.158 7.980   1.00 104.21 ? 55  PHE C O   1 
ATOM   5217 C CB  . PHE C 2 53  ? 7.609   35.858 9.150   1.00 102.51 ? 55  PHE C CB  1 
ATOM   5218 C CG  . PHE C 2 53  ? 7.190   36.684 10.333  1.00 102.81 ? 55  PHE C CG  1 
ATOM   5219 C CD1 . PHE C 2 53  ? 8.074   36.934 11.369  1.00 99.83  ? 55  PHE C CD1 1 
ATOM   5220 C CD2 . PHE C 2 53  ? 5.913   37.217 10.405  1.00 107.68 ? 55  PHE C CD2 1 
ATOM   5221 C CE1 . PHE C 2 53  ? 7.691   37.695 12.458  1.00 99.85  ? 55  PHE C CE1 1 
ATOM   5222 C CE2 . PHE C 2 53  ? 5.525   37.979 11.491  1.00 107.97 ? 55  PHE C CE2 1 
ATOM   5223 C CZ  . PHE C 2 53  ? 6.415   38.218 12.518  1.00 102.71 ? 55  PHE C CZ  1 
ATOM   5224 N N   . SER C 2 54  ? 5.193   33.626 10.169  1.00 101.14 ? 56  SER C N   1 
ATOM   5225 C CA  . SER C 2 54  ? 3.778   33.278 10.117  1.00 102.82 ? 56  SER C CA  1 
ATOM   5226 C C   . SER C 2 54  ? 3.011   34.068 11.166  1.00 104.82 ? 56  SER C C   1 
ATOM   5227 O O   . SER C 2 54  ? 3.442   34.150 12.321  1.00 100.24 ? 56  SER C O   1 
ATOM   5228 C CB  . SER C 2 54  ? 3.571   31.776 10.339  1.00 99.95  ? 56  SER C CB  1 
ATOM   5229 O OG  . SER C 2 54  ? 4.315   31.019 9.403   1.00 102.29 ? 56  SER C OG  1 
ATOM   5230 N N   . TYR C 2 55  ? 1.876   34.641 10.768  1.00 94.22  ? 57  TYR C N   1 
ATOM   5231 C CA  . TYR C 2 55  ? 1.031   35.400 11.679  1.00 96.52  ? 57  TYR C CA  1 
ATOM   5232 C C   . TYR C 2 55  ? -0.419  35.004 11.449  1.00 101.56 ? 57  TYR C C   1 
ATOM   5233 O O   . TYR C 2 55  ? -0.809  34.633 10.340  1.00 104.31 ? 57  TYR C O   1 
ATOM   5234 C CB  . TYR C 2 55  ? 1.211   36.915 11.504  1.00 102.96 ? 57  TYR C CB  1 
ATOM   5235 C CG  . TYR C 2 55  ? 0.707   37.471 10.190  1.00 110.86 ? 57  TYR C CG  1 
ATOM   5236 C CD1 . TYR C 2 55  ? 1.513   37.469 9.059   1.00 111.77 ? 57  TYR C CD1 1 
ATOM   5237 C CD2 . TYR C 2 55  ? -0.565  38.021 10.086  1.00 116.98 ? 57  TYR C CD2 1 
ATOM   5238 C CE1 . TYR C 2 55  ? 1.061   37.982 7.859   1.00 117.54 ? 57  TYR C CE1 1 
ATOM   5239 C CE2 . TYR C 2 55  ? -1.025  38.536 8.891   1.00 122.65 ? 57  TYR C CE2 1 
ATOM   5240 C CZ  . TYR C 2 55  ? -0.208  38.514 7.781   1.00 124.89 ? 57  TYR C CZ  1 
ATOM   5241 O OH  . TYR C 2 55  ? -0.663  39.027 6.588   1.00 130.27 ? 57  TYR C OH  1 
ATOM   5242 N N   . GLN C 2 56  ? -1.214  35.076 12.515  1.00 104.58 ? 58  GLN C N   1 
ATOM   5243 C CA  . GLN C 2 56  ? -2.614  34.681 12.456  1.00 108.14 ? 58  GLN C CA  1 
ATOM   5244 C C   . GLN C 2 56  ? -3.444  35.591 13.350  1.00 112.92 ? 58  GLN C C   1 
ATOM   5245 O O   . GLN C 2 56  ? -3.060  35.875 14.488  1.00 108.05 ? 58  GLN C O   1 
ATOM   5246 C CB  . GLN C 2 56  ? -2.775  33.209 12.869  1.00 102.60 ? 58  GLN C CB  1 
ATOM   5247 C CG  . GLN C 2 56  ? -4.122  32.586 12.538  1.00 111.21 ? 58  GLN C CG  1 
ATOM   5248 C CD  . GLN C 2 56  ? -5.015  32.435 13.752  1.00 115.63 ? 58  GLN C CD  1 
ATOM   5249 O OE1 . GLN C 2 56  ? -4.563  32.561 14.889  1.00 107.29 ? 58  GLN C OE1 1 
ATOM   5250 N NE2 . GLN C 2 56  ? -6.292  32.158 13.517  1.00 118.43 ? 58  GLN C NE2 1 
ATOM   5251 N N   . LEU C 2 57  ? -4.582  36.046 12.828  1.00 113.53 ? 59  LEU C N   1 
ATOM   5252 C CA  . LEU C 2 57  ? -5.496  36.912 13.555  1.00 116.20 ? 59  LEU C CA  1 
ATOM   5253 C C   . LEU C 2 57  ? -6.589  36.074 14.215  1.00 115.53 ? 59  LEU C C   1 
ATOM   5254 O O   . LEU C 2 57  ? -6.645  34.851 14.072  1.00 113.52 ? 59  LEU C O   1 
ATOM   5255 C CB  . LEU C 2 57  ? -6.110  37.951 12.613  1.00 122.61 ? 59  LEU C CB  1 
ATOM   5256 C CG  . LEU C 2 57  ? -5.159  38.883 11.866  1.00 126.77 ? 59  LEU C CG  1 
ATOM   5257 C CD1 . LEU C 2 57  ? -5.909  39.650 10.789  1.00 133.73 ? 59  LEU C CD1 1 
ATOM   5258 C CD2 . LEU C 2 57  ? -4.502  39.837 12.840  1.00 125.66 ? 59  LEU C CD2 1 
ATOM   5259 N N   . GLU C 2 58  ? -7.497  36.745 14.917  1.00 118.76 ? 60  GLU C N   1 
ATOM   5260 C CA  . GLU C 2 58  ? -8.595  36.050 15.573  1.00 118.05 ? 60  GLU C CA  1 
ATOM   5261 C C   . GLU C 2 58  ? -9.660  35.698 14.543  1.00 124.52 ? 60  GLU C C   1 
ATOM   5262 O O   . GLU C 2 58  ? -10.073 36.553 13.751  1.00 129.97 ? 60  GLU C O   1 
ATOM   5263 C CB  . GLU C 2 58  ? -9.193  36.903 16.692  1.00 118.10 ? 60  GLU C CB  1 
ATOM   5264 C CG  . GLU C 2 58  ? -9.866  36.087 17.795  1.00 117.37 ? 60  GLU C CG  1 
ATOM   5265 C CD  . GLU C 2 58  ? -10.566 36.951 18.831  1.00 121.15 ? 60  GLU C CD  1 
ATOM   5266 O OE1 . GLU C 2 58  ? -10.822 38.139 18.543  1.00 123.03 ? 60  GLU C OE1 1 
ATOM   5267 O OE2 . GLU C 2 58  ? -10.861 36.443 19.934  1.00 112.66 ? 60  GLU C OE2 1 
ATOM   5268 N N   . ASP C 2 59  ? -10.088 34.432 14.546  1.00 130.29 ? 61  ASP C N   1 
ATOM   5269 C CA  . ASP C 2 59  ? -11.097 33.930 13.610  1.00 133.61 ? 61  ASP C CA  1 
ATOM   5270 C C   . ASP C 2 59  ? -10.644 34.129 12.165  1.00 136.97 ? 61  ASP C C   1 
ATOM   5271 O O   . ASP C 2 59  ? -11.437 34.478 11.287  1.00 141.14 ? 61  ASP C O   1 
ATOM   5272 C CB  . ASP C 2 59  ? -12.462 34.586 13.851  1.00 138.58 ? 61  ASP C CB  1 
ATOM   5273 C CG  . ASP C 2 59  ? -12.922 34.480 15.296  1.00 137.85 ? 61  ASP C CG  1 
ATOM   5274 O OD1 . ASP C 2 59  ? -12.178 33.910 16.122  1.00 132.95 ? 61  ASP C OD1 1 
ATOM   5275 O OD2 . ASP C 2 59  ? -14.031 34.967 15.606  1.00 141.79 ? 61  ASP C OD2 1 
ATOM   5276 N N   . GLU C 2 60  ? -9.359  33.898 11.918  1.00 126.71 ? 62  GLU C N   1 
ATOM   5277 C CA  . GLU C 2 60  ? -8.739  34.120 10.622  1.00 127.88 ? 62  GLU C CA  1 
ATOM   5278 C C   . GLU C 2 60  ? -7.693  33.041 10.371  1.00 123.81 ? 62  GLU C C   1 
ATOM   5279 O O   . GLU C 2 60  ? -7.139  32.483 11.324  1.00 118.90 ? 62  GLU C O   1 
ATOM   5280 C CB  . GLU C 2 60  ? -8.074  35.504 10.562  1.00 130.58 ? 62  GLU C CB  1 
ATOM   5281 C CG  . GLU C 2 60  ? -8.744  36.487 9.624   1.00 139.89 ? 62  GLU C CG  1 
ATOM   5282 C CD  . GLU C 2 60  ? -7.890  36.794 8.413   1.00 147.01 ? 62  GLU C CD  1 
ATOM   5283 O OE1 . GLU C 2 60  ? -6.823  36.161 8.267   1.00 139.73 ? 62  GLU C OE1 1 
ATOM   5284 O OE2 . GLU C 2 60  ? -8.281  37.668 7.611   1.00 150.94 ? 62  GLU C OE2 1 
ATOM   5285 N N   . PRO C 2 61  ? -7.399  32.740 9.110   1.00 128.80 ? 63  PRO C N   1 
ATOM   5286 C CA  . PRO C 2 61  ? -6.414  31.695 8.816   1.00 124.02 ? 63  PRO C CA  1 
ATOM   5287 C C   . PRO C 2 61  ? -4.987  32.206 8.946   1.00 121.91 ? 63  PRO C C   1 
ATOM   5288 O O   . PRO C 2 61  ? -4.719  33.409 8.971   1.00 124.12 ? 63  PRO C O   1 
ATOM   5289 C CB  . PRO C 2 61  ? -6.731  31.311 7.367   1.00 127.38 ? 63  PRO C CB  1 
ATOM   5290 C CG  . PRO C 2 61  ? -7.293  32.553 6.780   1.00 134.16 ? 63  PRO C CG  1 
ATOM   5291 C CD  . PRO C 2 61  ? -8.073  33.216 7.889   1.00 134.49 ? 63  PRO C CD  1 
ATOM   5292 N N   . TRP C 2 62  ? -4.065  31.251 9.034   1.00 125.11 ? 64  TRP C N   1 
ATOM   5293 C CA  . TRP C 2 62  ? -2.649  31.573 9.145   1.00 121.36 ? 64  TRP C CA  1 
ATOM   5294 C C   . TRP C 2 62  ? -2.117  32.113 7.824   1.00 125.37 ? 64  TRP C C   1 
ATOM   5295 O O   . TRP C 2 62  ? -2.392  31.556 6.757   1.00 126.88 ? 64  TRP C O   1 
ATOM   5296 C CB  . TRP C 2 62  ? -1.860  30.334 9.565   1.00 114.46 ? 64  TRP C CB  1 
ATOM   5297 C CG  . TRP C 2 62  ? -1.935  30.038 11.032  1.00 110.24 ? 64  TRP C CG  1 
ATOM   5298 C CD1 . TRP C 2 62  ? -2.924  29.357 11.680  1.00 111.31 ? 64  TRP C CD1 1 
ATOM   5299 C CD2 . TRP C 2 62  ? -0.977  30.402 12.034  1.00 104.96 ? 64  TRP C CD2 1 
ATOM   5300 N NE1 . TRP C 2 62  ? -2.645  29.280 13.024  1.00 107.38 ? 64  TRP C NE1 1 
ATOM   5301 C CE2 . TRP C 2 62  ? -1.454  29.913 13.266  1.00 103.86 ? 64  TRP C CE2 1 
ATOM   5302 C CE3 . TRP C 2 62  ? 0.237   31.096 12.009  1.00 103.65 ? 64  TRP C CE3 1 
ATOM   5303 C CZ2 . TRP C 2 62  ? -0.762  30.095 14.460  1.00 99.80  ? 64  TRP C CZ2 1 
ATOM   5304 C CZ3 . TRP C 2 62  ? 0.923   31.276 13.197  1.00 98.59  ? 64  TRP C CZ3 1 
ATOM   5305 C CH2 . TRP C 2 62  ? 0.422   30.778 14.405  1.00 97.25  ? 64  TRP C CH2 1 
ATOM   5306 N N   . LYS C 2 63  ? -1.353  33.201 7.897   1.00 109.27 ? 65  LYS C N   1 
ATOM   5307 C CA  . LYS C 2 63  ? -0.732  33.805 6.728   1.00 110.24 ? 65  LYS C CA  1 
ATOM   5308 C C   . LYS C 2 63  ? 0.763   33.960 6.972   1.00 105.63 ? 65  LYS C C   1 
ATOM   5309 O O   . LYS C 2 63  ? 1.243   33.871 8.105   1.00 101.63 ? 65  LYS C O   1 
ATOM   5310 C CB  . LYS C 2 63  ? -1.352  35.169 6.388   1.00 115.26 ? 65  LYS C CB  1 
ATOM   5311 C CG  . LYS C 2 63  ? -2.806  35.107 5.953   1.00 123.86 ? 65  LYS C CG  1 
ATOM   5312 C CD  . LYS C 2 63  ? -3.453  36.481 6.011   1.00 132.76 ? 65  LYS C CD  1 
ATOM   5313 C CE  . LYS C 2 63  ? -4.941  36.409 5.709   1.00 140.09 ? 65  LYS C CE  1 
ATOM   5314 N NZ  . LYS C 2 63  ? -5.607  37.734 5.852   1.00 148.51 ? 65  LYS C NZ  1 
ATOM   5315 N N   . LEU C 2 64  ? 1.499   34.190 5.887   1.00 112.23 ? 66  LEU C N   1 
ATOM   5316 C CA  . LEU C 2 64  ? 2.948   34.329 5.930   1.00 109.32 ? 66  LEU C CA  1 
ATOM   5317 C C   . LEU C 2 64  ? 3.359   35.703 5.420   1.00 115.23 ? 66  LEU C C   1 
ATOM   5318 O O   . LEU C 2 64  ? 2.777   36.222 4.463   1.00 119.98 ? 66  LEU C O   1 
ATOM   5319 C CB  . LEU C 2 64  ? 3.637   33.235 5.104   1.00 106.68 ? 66  LEU C CB  1 
ATOM   5320 C CG  . LEU C 2 64  ? 3.930   31.904 5.806   1.00 103.11 ? 66  LEU C CG  1 
ATOM   5321 C CD1 . LEU C 2 64  ? 2.650   31.139 6.131   1.00 103.31 ? 66  LEU C CD1 1 
ATOM   5322 C CD2 . LEU C 2 64  ? 4.874   31.050 4.973   1.00 102.41 ? 66  LEU C CD2 1 
ATOM   5323 N N   . CYS C 2 65  ? 4.364   36.288 6.066   1.00 110.57 ? 67  CYS C N   1 
ATOM   5324 C CA  . CYS C 2 65  ? 4.862   37.614 5.732   1.00 115.42 ? 67  CYS C CA  1 
ATOM   5325 C C   . CYS C 2 65  ? 6.187   37.516 4.984   1.00 115.48 ? 67  CYS C C   1 
ATOM   5326 O O   . CYS C 2 65  ? 6.938   36.551 5.140   1.00 110.23 ? 67  CYS C O   1 
ATOM   5327 C CB  . CYS C 2 65  ? 5.038   38.455 7.000   1.00 116.08 ? 67  CYS C CB  1 
ATOM   5328 S SG  . CYS C 2 65  ? 5.809   40.078 6.770   1.00 123.91 ? 67  CYS C SG  1 
ATOM   5329 N N   . ARG C 2 66  ? 6.468   38.532 4.170   1.00 112.32 ? 68  ARG C N   1 
ATOM   5330 C CA  . ARG C 2 66  ? 7.715   38.582 3.416   1.00 112.16 ? 68  ARG C CA  1 
ATOM   5331 C C   . ARG C 2 66  ? 8.857   38.962 4.351   1.00 111.41 ? 68  ARG C C   1 
ATOM   5332 O O   . ARG C 2 66  ? 8.814   40.013 4.999   1.00 114.46 ? 68  ARG C O   1 
ATOM   5333 C CB  . ARG C 2 66  ? 7.606   39.576 2.261   1.00 118.30 ? 68  ARG C CB  1 
ATOM   5334 C CG  . ARG C 2 66  ? 8.760   39.509 1.265   1.00 121.30 ? 68  ARG C CG  1 
ATOM   5335 C CD  . ARG C 2 66  ? 8.807   40.739 0.365   1.00 130.01 ? 68  ARG C CD  1 
ATOM   5336 N NE  . ARG C 2 66  ? 7.642   40.829 -0.512  1.00 135.77 ? 68  ARG C NE  1 
ATOM   5337 C CZ  . ARG C 2 66  ? 6.599   41.623 -0.294  1.00 143.87 ? 68  ARG C CZ  1 
ATOM   5338 N NH1 . ARG C 2 66  ? 6.570   42.406 0.776   1.00 140.85 ? 68  ARG C NH1 1 
ATOM   5339 N NH2 . ARG C 2 66  ? 5.583   41.637 -1.147  1.00 142.56 ? 68  ARG C NH2 1 
ATOM   5340 N N   . LEU C 2 67  ? 9.874   38.111 4.417   1.00 111.61 ? 69  LEU C N   1 
ATOM   5341 C CA  . LEU C 2 67  ? 11.022  38.346 5.277   1.00 109.48 ? 69  LEU C CA  1 
ATOM   5342 C C   . LEU C 2 67  ? 12.119  39.071 4.510   1.00 114.92 ? 69  LEU C C   1 
ATOM   5343 O O   . LEU C 2 67  ? 12.419  38.729 3.363   1.00 116.00 ? 69  LEU C O   1 
ATOM   5344 C CB  . LEU C 2 67  ? 11.548  37.021 5.831   1.00 103.06 ? 69  LEU C CB  1 
ATOM   5345 C CG  . LEU C 2 67  ? 12.295  37.076 7.161   1.00 100.81 ? 69  LEU C CG  1 
ATOM   5346 C CD1 . LEU C 2 67  ? 11.315  37.254 8.310   1.00 98.24  ? 69  LEU C CD1 1 
ATOM   5347 C CD2 . LEU C 2 67  ? 13.117  35.812 7.352   1.00 98.33  ? 69  LEU C CD2 1 
ATOM   5348 N N   . HIS C 2 68  ? 12.709  40.078 5.148   1.00 108.66 ? 70  HIS C N   1 
ATOM   5349 C CA  . HIS C 2 68  ? 13.786  40.865 4.562   1.00 113.03 ? 70  HIS C CA  1 
ATOM   5350 C C   . HIS C 2 68  ? 15.038  40.724 5.415   1.00 110.28 ? 70  HIS C C   1 
ATOM   5351 O O   . HIS C 2 68  ? 14.969  40.808 6.645   1.00 105.06 ? 70  HIS C O   1 
ATOM   5352 C CB  . HIS C 2 68  ? 13.393  42.339 4.429   1.00 117.42 ? 70  HIS C CB  1 
ATOM   5353 C CG  . HIS C 2 68  ? 12.269  42.580 3.471   1.00 121.67 ? 70  HIS C CG  1 
ATOM   5354 N ND1 . HIS C 2 68  ? 10.946  42.568 3.857   1.00 122.91 ? 70  HIS C ND1 1 
ATOM   5355 C CD2 . HIS C 2 68  ? 12.270  42.835 2.141   1.00 125.03 ? 70  HIS C CD2 1 
ATOM   5356 C CE1 . HIS C 2 68  ? 10.181  42.808 2.807   1.00 125.89 ? 70  HIS C CE1 1 
ATOM   5357 N NE2 . HIS C 2 68  ? 10.960  42.973 1.753   1.00 127.27 ? 70  HIS C NE2 1 
ATOM   5358 N N   . GLN C 2 69  ? 16.174  40.505 4.758   1.00 118.81 ? 71  GLN C N   1 
ATOM   5359 C CA  . GLN C 2 69  ? 17.462  40.369 5.424   1.00 114.59 ? 71  GLN C CA  1 
ATOM   5360 C C   . GLN C 2 69  ? 18.265  41.651 5.254   1.00 117.57 ? 71  GLN C C   1 
ATOM   5361 O O   . GLN C 2 69  ? 18.407  42.157 4.136   1.00 121.32 ? 71  GLN C O   1 
ATOM   5362 C CB  . GLN C 2 69  ? 18.241  39.178 4.862   1.00 114.62 ? 71  GLN C CB  1 
ATOM   5363 C CG  . GLN C 2 69  ? 19.510  38.846 5.632   1.00 116.13 ? 71  GLN C CG  1 
ATOM   5364 C CD  . GLN C 2 69  ? 20.293  37.709 5.004   1.00 122.72 ? 71  GLN C CD  1 
ATOM   5365 O OE1 . GLN C 2 69  ? 19.996  36.536 5.229   1.00 119.80 ? 71  GLN C OE1 1 
ATOM   5366 N NE2 . GLN C 2 69  ? 21.302  38.053 4.211   1.00 121.71 ? 71  GLN C NE2 1 
ATOM   5367 N N   . ALA C 2 70  ? 18.785  42.176 6.366   1.00 120.07 ? 72  ALA C N   1 
ATOM   5368 C CA  . ALA C 2 70  ? 19.583  43.393 6.355   1.00 121.24 ? 72  ALA C CA  1 
ATOM   5369 C C   . ALA C 2 70  ? 20.696  43.261 7.391   1.00 118.67 ? 72  ALA C C   1 
ATOM   5370 O O   . ALA C 2 70  ? 20.415  42.942 8.561   1.00 115.16 ? 72  ALA C O   1 
ATOM   5371 C CB  . ALA C 2 70  ? 18.728  44.630 6.644   1.00 123.39 ? 72  ALA C CB  1 
ATOM   5372 N N   . PRO C 2 71  ? 21.951  43.491 7.008   1.00 117.82 ? 73  PRO C N   1 
ATOM   5373 C CA  . PRO C 2 71  ? 23.045  43.411 7.981   1.00 115.62 ? 73  PRO C CA  1 
ATOM   5374 C C   . PRO C 2 71  ? 23.173  44.695 8.785   1.00 117.14 ? 73  PRO C C   1 
ATOM   5375 O O   . PRO C 2 71  ? 23.045  45.802 8.256   1.00 119.73 ? 73  PRO C O   1 
ATOM   5376 C CB  . PRO C 2 71  ? 24.287  43.176 7.107   1.00 117.43 ? 73  PRO C CB  1 
ATOM   5377 C CG  . PRO C 2 71  ? 23.803  43.209 5.659   1.00 121.32 ? 73  PRO C CG  1 
ATOM   5378 C CD  . PRO C 2 71  ? 22.442  43.821 5.662   1.00 121.36 ? 73  PRO C CD  1 
ATOM   5379 N N   . THR C 2 72  ? 23.431  44.535 10.082  1.00 128.09 ? 74  THR C N   1 
ATOM   5380 C CA  . THR C 2 72  ? 23.541  45.667 10.990  1.00 128.28 ? 74  THR C CA  1 
ATOM   5381 C C   . THR C 2 72  ? 24.461  45.300 12.145  1.00 128.41 ? 74  THR C C   1 
ATOM   5382 O O   . THR C 2 72  ? 24.854  44.142 12.312  1.00 127.41 ? 74  THR C O   1 
ATOM   5383 C CB  . THR C 2 72  ? 22.168  46.105 11.515  1.00 130.07 ? 74  THR C CB  1 
ATOM   5384 O OG1 . THR C 2 72  ? 22.285  47.379 12.163  1.00 131.23 ? 74  THR C OG1 1 
ATOM   5385 C CG2 . THR C 2 72  ? 21.624  45.082 12.502  1.00 126.33 ? 74  THR C CG2 1 
ATOM   5386 N N   . ALA C 2 73  ? 24.793  46.308 12.945  1.00 132.22 ? 75  ALA C N   1 
ATOM   5387 C CA  . ALA C 2 73  ? 25.646  46.177 14.140  1.00 132.42 ? 75  ALA C CA  1 
ATOM   5388 C C   . ALA C 2 73  ? 27.001  45.625 13.687  1.00 135.19 ? 75  ALA C C   1 
ATOM   5389 O O   . ALA C 2 73  ? 27.513  46.037 12.635  1.00 136.73 ? 75  ALA C O   1 
ATOM   5390 C CB  . ALA C 2 73  ? 24.932  45.355 15.195  1.00 130.28 ? 75  ALA C CB  1 
ATOM   5391 N N   . ARG C 2 74  ? 27.605  44.708 14.441  1.00 128.52 ? 76  ARG C N   1 
ATOM   5392 C CA  . ARG C 2 74  ? 28.905  44.135 14.107  1.00 130.76 ? 76  ARG C CA  1 
ATOM   5393 C C   . ARG C 2 74  ? 28.716  42.662 13.765  1.00 129.70 ? 76  ARG C C   1 
ATOM   5394 O O   . ARG C 2 74  ? 28.401  41.851 14.642  1.00 129.62 ? 76  ARG C O   1 
ATOM   5395 C CB  . ARG C 2 74  ? 29.888  44.311 15.262  1.00 134.73 ? 76  ARG C CB  1 
ATOM   5396 N N   . GLY C 2 75  ? 28.931  42.321 12.499  1.00 129.04 ? 77  GLY C N   1 
ATOM   5397 C CA  . GLY C 2 75  ? 28.799  40.936 12.054  1.00 128.94 ? 77  GLY C CA  1 
ATOM   5398 C C   . GLY C 2 75  ? 27.474  40.300 12.404  1.00 128.42 ? 77  GLY C C   1 
ATOM   5399 O O   . GLY C 2 75  ? 27.426  39.121 12.776  1.00 129.10 ? 77  GLY C O   1 
ATOM   5400 N N   . ALA C 2 76  ? 26.386  41.057 12.285  1.00 126.68 ? 78  ALA C N   1 
ATOM   5401 C CA  . ALA C 2 76  ? 25.054  40.568 12.604  1.00 124.59 ? 78  ALA C CA  1 
ATOM   5402 C C   . ALA C 2 76  ? 24.107  40.872 11.452  1.00 125.08 ? 78  ALA C C   1 
ATOM   5403 O O   . ALA C 2 76  ? 24.331  41.789 10.658  1.00 126.26 ? 78  ALA C O   1 
ATOM   5404 C CB  . ALA C 2 76  ? 24.518  41.188 13.902  1.00 123.61 ? 78  ALA C CB  1 
ATOM   5405 N N   . VAL C 2 77  ? 23.037  40.087 11.374  1.00 117.63 ? 79  VAL C N   1 
ATOM   5406 C CA  . VAL C 2 77  ? 22.009  40.242 10.353  1.00 117.51 ? 79  VAL C CA  1 
ATOM   5407 C C   . VAL C 2 77  ? 20.667  40.400 11.052  1.00 116.38 ? 79  VAL C C   1 
ATOM   5408 O O   . VAL C 2 77  ? 20.362  39.664 11.998  1.00 114.26 ? 79  VAL C O   1 
ATOM   5409 C CB  . VAL C 2 77  ? 21.991  39.052 9.376   1.00 119.71 ? 79  VAL C CB  1 
ATOM   5410 C CG1 . VAL C 2 77  ? 23.132  39.172 8.378   1.00 122.17 ? 79  VAL C CG1 1 
ATOM   5411 C CG2 . VAL C 2 77  ? 22.083  37.737 10.135  1.00 118.90 ? 79  VAL C CG2 1 
ATOM   5412 N N   . ARG C 2 78  ? 19.879  41.371 10.599  1.00 107.21 ? 80  ARG C N   1 
ATOM   5413 C CA  . ARG C 2 78  ? 18.574  41.676 11.175  1.00 105.49 ? 80  ARG C CA  1 
ATOM   5414 C C   . ARG C 2 78  ? 17.495  41.255 10.186  1.00 108.03 ? 80  ARG C C   1 
ATOM   5415 O O   . ARG C 2 78  ? 17.334  41.881 9.133   1.00 111.90 ? 80  ARG C O   1 
ATOM   5416 C CB  . ARG C 2 78  ? 18.452  43.163 11.504  1.00 106.84 ? 80  ARG C CB  1 
ATOM   5417 C CG  . ARG C 2 78  ? 17.149  43.531 12.198  1.00 108.14 ? 80  ARG C CG  1 
ATOM   5418 C CD  . ARG C 2 78  ? 16.984  45.037 12.319  1.00 113.27 ? 80  ARG C CD  1 
ATOM   5419 N NE  . ARG C 2 78  ? 17.827  45.610 13.363  1.00 114.40 ? 80  ARG C NE  1 
ATOM   5420 C CZ  . ARG C 2 78  ? 18.071  46.910 13.490  1.00 121.29 ? 80  ARG C CZ  1 
ATOM   5421 N NH1 . ARG C 2 78  ? 17.535  47.773 12.638  1.00 120.99 ? 80  ARG C NH1 1 
ATOM   5422 N NH2 . ARG C 2 78  ? 18.852  47.347 14.468  1.00 116.70 ? 80  ARG C NH2 1 
ATOM   5423 N N   . PHE C 2 79  ? 16.764  40.197 10.521  1.00 105.56 ? 81  PHE C N   1 
ATOM   5424 C CA  . PHE C 2 79  ? 15.627  39.760 9.723   1.00 106.73 ? 81  PHE C CA  1 
ATOM   5425 C C   . PHE C 2 79  ? 14.383  40.489 10.214  1.00 108.30 ? 81  PHE C C   1 
ATOM   5426 O O   . PHE C 2 79  ? 14.023  40.385 11.392  1.00 104.31 ? 81  PHE C O   1 
ATOM   5427 C CB  . PHE C 2 79  ? 15.437  38.246 9.819   1.00 104.35 ? 81  PHE C CB  1 
ATOM   5428 C CG  . PHE C 2 79  ? 16.590  37.451 9.278   1.00 106.03 ? 81  PHE C CG  1 
ATOM   5429 C CD1 . PHE C 2 79  ? 16.634  37.091 7.941   1.00 109.74 ? 81  PHE C CD1 1 
ATOM   5430 C CD2 . PHE C 2 79  ? 17.626  37.054 10.108  1.00 106.08 ? 81  PHE C CD2 1 
ATOM   5431 C CE1 . PHE C 2 79  ? 17.690  36.356 7.440   1.00 112.30 ? 81  PHE C CE1 1 
ATOM   5432 C CE2 . PHE C 2 79  ? 18.686  36.319 9.613   1.00 108.53 ? 81  PHE C CE2 1 
ATOM   5433 C CZ  . PHE C 2 79  ? 18.717  35.970 8.276   1.00 110.73 ? 81  PHE C CZ  1 
ATOM   5434 N N   . TRP C 2 80  ? 13.731  41.229 9.319   1.00 101.39 ? 82  TRP C N   1 
ATOM   5435 C CA  . TRP C 2 80  ? 12.552  42.003 9.675   1.00 103.55 ? 82  TRP C CA  1 
ATOM   5436 C C   . TRP C 2 80  ? 11.459  41.812 8.633   1.00 110.81 ? 82  TRP C C   1 
ATOM   5437 O O   . TRP C 2 80  ? 11.732  41.575 7.452   1.00 114.73 ? 82  TRP C O   1 
ATOM   5438 C CB  . TRP C 2 80  ? 12.882  43.497 9.829   1.00 105.80 ? 82  TRP C CB  1 
ATOM   5439 C CG  . TRP C 2 80  ? 13.441  44.142 8.600   1.00 111.84 ? 82  TRP C CG  1 
ATOM   5440 C CD1 . TRP C 2 80  ? 14.741  44.127 8.187   1.00 112.40 ? 82  TRP C CD1 1 
ATOM   5441 C CD2 . TRP C 2 80  ? 12.721  44.912 7.632   1.00 118.51 ? 82  TRP C CD2 1 
ATOM   5442 N NE1 . TRP C 2 80  ? 14.874  44.835 7.018   1.00 117.75 ? 82  TRP C NE1 1 
ATOM   5443 C CE2 . TRP C 2 80  ? 13.648  45.327 6.656   1.00 122.38 ? 82  TRP C CE2 1 
ATOM   5444 C CE3 . TRP C 2 80  ? 11.382  45.289 7.493   1.00 122.84 ? 82  TRP C CE3 1 
ATOM   5445 C CZ2 . TRP C 2 80  ? 13.280  46.100 5.556   1.00 127.80 ? 82  TRP C CZ2 1 
ATOM   5446 C CZ3 . TRP C 2 80  ? 11.018  46.055 6.401   1.00 129.22 ? 82  TRP C CZ3 1 
ATOM   5447 C CH2 . TRP C 2 80  ? 11.963  46.453 5.447   1.00 131.26 ? 82  TRP C CH2 1 
ATOM   5448 N N   . CYS C 2 81  ? 10.214  41.914 9.094   1.00 110.56 ? 83  CYS C N   1 
ATOM   5449 C CA  . CYS C 2 81  ? 9.033   41.788 8.255   1.00 116.89 ? 83  CYS C CA  1 
ATOM   5450 C C   . CYS C 2 81  ? 8.044   42.882 8.621   1.00 124.05 ? 83  CYS C C   1 
ATOM   5451 O O   . CYS C 2 81  ? 7.875   43.206 9.800   1.00 118.63 ? 83  CYS C O   1 
ATOM   5452 C CB  . CYS C 2 81  ? 8.364   40.418 8.423   1.00 111.07 ? 83  CYS C CB  1 
ATOM   5453 S SG  . CYS C 2 81  ? 6.562   40.516 8.608   1.00 116.30 ? 83  CYS C SG  1 
ATOM   5454 N N   . SER C 2 82  ? 7.388   43.443 7.610   1.00 107.21 ? 84  SER C N   1 
ATOM   5455 C CA  . SER C 2 82  ? 6.384   44.484 7.798   1.00 110.46 ? 84  SER C CA  1 
ATOM   5456 C C   . SER C 2 82  ? 5.027   43.910 7.411   1.00 113.74 ? 84  SER C C   1 
ATOM   5457 O O   . SER C 2 82  ? 4.779   43.630 6.233   1.00 114.97 ? 84  SER C O   1 
ATOM   5458 C CB  . SER C 2 82  ? 6.718   45.724 6.971   1.00 115.04 ? 84  SER C CB  1 
ATOM   5459 O OG  . SER C 2 82  ? 5.824   46.782 7.265   1.00 120.40 ? 84  SER C OG  1 
ATOM   5460 N N   . LEU C 2 83  ? 4.154   43.734 8.401   1.00 107.88 ? 85  LEU C N   1 
ATOM   5461 C CA  . LEU C 2 83  ? 2.845   43.156 8.149   1.00 109.17 ? 85  LEU C CA  1 
ATOM   5462 C C   . LEU C 2 83  ? 1.997   44.100 7.297   1.00 109.76 ? 85  LEU C C   1 
ATOM   5463 O O   . LEU C 2 83  ? 2.164   45.321 7.357   1.00 107.99 ? 85  LEU C O   1 
ATOM   5464 C CB  . LEU C 2 83  ? 2.123   42.856 9.462   1.00 109.64 ? 85  LEU C CB  1 
ATOM   5465 C CG  . LEU C 2 83  ? 2.379   41.492 10.113  1.00 112.47 ? 85  LEU C CG  1 
ATOM   5466 C CD1 . LEU C 2 83  ? 3.792   41.391 10.668  1.00 112.27 ? 85  LEU C CD1 1 
ATOM   5467 C CD2 . LEU C 2 83  ? 1.350   41.212 11.199  1.00 113.73 ? 85  LEU C CD2 1 
ATOM   5468 N N   . PRO C 2 84  ? 1.088   43.556 6.487   1.00 112.79 ? 86  PRO C N   1 
ATOM   5469 C CA  . PRO C 2 84  ? 0.245   44.414 5.647   1.00 112.20 ? 86  PRO C CA  1 
ATOM   5470 C C   . PRO C 2 84  ? -0.626  45.330 6.493   1.00 112.15 ? 86  PRO C C   1 
ATOM   5471 O O   . PRO C 2 84  ? -1.109  44.949 7.561   1.00 112.23 ? 86  PRO C O   1 
ATOM   5472 C CB  . PRO C 2 84  ? -0.598  43.413 4.848   1.00 114.62 ? 86  PRO C CB  1 
ATOM   5473 C CG  . PRO C 2 84  ? 0.184   42.139 4.886   1.00 117.51 ? 86  PRO C CG  1 
ATOM   5474 C CD  . PRO C 2 84  ? 0.856   42.126 6.224   1.00 115.24 ? 86  PRO C CD  1 
ATOM   5475 N N   . THR C 2 85  ? -0.818  46.555 5.999   1.00 115.08 ? 87  THR C N   1 
ATOM   5476 C CA  . THR C 2 85  ? -1.611  47.539 6.727   1.00 114.13 ? 87  THR C CA  1 
ATOM   5477 C C   . THR C 2 85  ? -3.054  47.086 6.916   1.00 116.33 ? 87  THR C C   1 
ATOM   5478 O O   . THR C 2 85  ? -3.677  47.419 7.930   1.00 116.15 ? 87  THR C O   1 
ATOM   5479 C CB  . THR C 2 85  ? -1.565  48.885 6.003   1.00 115.75 ? 87  THR C CB  1 
ATOM   5480 O OG1 . THR C 2 85  ? -1.933  48.705 4.630   1.00 116.72 ? 87  THR C OG1 1 
ATOM   5481 C CG2 . THR C 2 85  ? -0.164  49.476 6.071   1.00 114.00 ? 87  THR C CG2 1 
ATOM   5482 N N   . ALA C 2 86  ? -3.604  46.334 5.958   1.00 115.48 ? 88  ALA C N   1 
ATOM   5483 C CA  . ALA C 2 86  ? -4.994  45.903 6.071   1.00 116.44 ? 88  ALA C CA  1 
ATOM   5484 C C   . ALA C 2 86  ? -5.175  44.848 7.154   1.00 118.19 ? 88  ALA C C   1 
ATOM   5485 O O   . ALA C 2 86  ? -6.222  44.808 7.811   1.00 118.46 ? 88  ALA C O   1 
ATOM   5486 C CB  . ALA C 2 86  ? -5.491  45.373 4.727   1.00 117.98 ? 88  ALA C CB  1 
ATOM   5487 N N   . ASP C 2 87  ? -4.176  43.989 7.353   1.00 117.03 ? 89  ASP C N   1 
ATOM   5488 C CA  . ASP C 2 87  ? -4.243  42.964 8.384   1.00 117.85 ? 89  ASP C CA  1 
ATOM   5489 C C   . ASP C 2 87  ? -4.009  43.519 9.782   1.00 118.45 ? 89  ASP C C   1 
ATOM   5490 O O   . ASP C 2 87  ? -4.288  42.820 10.761  1.00 119.69 ? 89  ASP C O   1 
ATOM   5491 C CB  . ASP C 2 87  ? -3.240  41.846 8.093   1.00 119.07 ? 89  ASP C CB  1 
ATOM   5492 C CG  . ASP C 2 87  ? -3.750  40.866 7.052   1.00 123.80 ? 89  ASP C CG  1 
ATOM   5493 O OD1 . ASP C 2 87  ? -4.927  40.454 7.147   1.00 124.85 ? 89  ASP C OD1 1 
ATOM   5494 O OD2 . ASP C 2 87  ? -2.974  40.502 6.144   1.00 126.10 ? 89  ASP C OD2 1 
ATOM   5495 N N   . THR C 2 88  ? -3.496  44.741 9.899   1.00 113.34 ? 90  THR C N   1 
ATOM   5496 C CA  . THR C 2 88  ? -3.243  45.323 11.209  1.00 113.01 ? 90  THR C CA  1 
ATOM   5497 C C   . THR C 2 88  ? -4.566  45.649 11.890  1.00 114.80 ? 90  THR C C   1 
ATOM   5498 O O   . THR C 2 88  ? -5.426  46.321 11.311  1.00 115.20 ? 90  THR C O   1 
ATOM   5499 C CB  . THR C 2 88  ? -2.400  46.588 11.068  1.00 114.39 ? 90  THR C CB  1 
ATOM   5500 O OG1 . THR C 2 88  ? -1.349  46.361 10.121  1.00 112.91 ? 90  THR C OG1 1 
ATOM   5501 C CG2 . THR C 2 88  ? -1.789  46.977 12.401  1.00 114.16 ? 90  THR C CG2 1 
ATOM   5502 N N   . SER C 2 89  ? -4.728  45.174 13.123  1.00 109.67 ? 91  SER C N   1 
ATOM   5503 C CA  . SER C 2 89  ? -5.937  45.450 13.889  1.00 110.39 ? 91  SER C CA  1 
ATOM   5504 C C   . SER C 2 89  ? -5.608  45.483 15.374  1.00 111.95 ? 91  SER C C   1 
ATOM   5505 O O   . SER C 2 89  ? -5.040  44.526 15.907  1.00 111.99 ? 91  SER C O   1 
ATOM   5506 C CB  . SER C 2 89  ? -7.015  44.397 13.608  1.00 112.38 ? 91  SER C CB  1 
ATOM   5507 O OG  . SER C 2 89  ? -7.545  44.544 12.300  1.00 114.68 ? 91  SER C OG  1 
ATOM   5508 N N   . SER C 2 90  ? -5.979  46.575 16.035  1.00 102.93 ? 92  SER C N   1 
ATOM   5509 C CA  . SER C 2 90  ? -5.663  46.742 17.442  1.00 103.65 ? 92  SER C CA  1 
ATOM   5510 C C   . SER C 2 90  ? -6.693  46.019 18.307  1.00 106.20 ? 92  SER C C   1 
ATOM   5511 O O   . SER C 2 90  ? -7.781  45.657 17.849  1.00 106.48 ? 92  SER C O   1 
ATOM   5512 C CB  . SER C 2 90  ? -5.615  48.225 17.812  1.00 104.74 ? 92  SER C CB  1 
ATOM   5513 O OG  . SER C 2 90  ? -4.804  48.957 16.909  1.00 106.03 ? 92  SER C OG  1 
ATOM   5514 N N   . PHE C 2 91  ? -6.316  45.781 19.566  1.00 99.90  ? 93  PHE C N   1 
ATOM   5515 C CA  . PHE C 2 91  ? -7.174  45.116 20.552  1.00 101.59 ? 93  PHE C CA  1 
ATOM   5516 C C   . PHE C 2 91  ? -7.495  43.678 20.151  1.00 102.97 ? 93  PHE C C   1 
ATOM   5517 O O   . PHE C 2 91  ? -8.559  43.152 20.491  1.00 104.17 ? 93  PHE C O   1 
ATOM   5518 C CB  . PHE C 2 91  ? -8.467  45.898 20.801  1.00 103.05 ? 93  PHE C CB  1 
ATOM   5519 C CG  . PHE C 2 91  ? -8.245  47.311 21.246  1.00 103.57 ? 93  PHE C CG  1 
ATOM   5520 C CD1 . PHE C 2 91  ? -8.064  47.615 22.585  1.00 106.21 ? 93  PHE C CD1 1 
ATOM   5521 C CD2 . PHE C 2 91  ? -8.217  48.340 20.320  1.00 102.73 ? 93  PHE C CD2 1 
ATOM   5522 C CE1 . PHE C 2 91  ? -7.861  48.920 22.992  1.00 106.84 ? 93  PHE C CE1 1 
ATOM   5523 C CE2 . PHE C 2 91  ? -8.014  49.644 20.719  1.00 103.80 ? 93  PHE C CE2 1 
ATOM   5524 C CZ  . PHE C 2 91  ? -7.836  49.937 22.056  1.00 105.02 ? 93  PHE C CZ  1 
ATOM   5525 N N   . VAL C 2 92  ? -6.590  43.031 19.424  1.00 104.61 ? 94  VAL C N   1 
ATOM   5526 C CA  . VAL C 2 92  ? -6.815  41.666 18.952  1.00 105.01 ? 94  VAL C CA  1 
ATOM   5527 C C   . VAL C 2 92  ? -5.552  40.845 19.184  1.00 106.11 ? 94  VAL C C   1 
ATOM   5528 O O   . VAL C 2 92  ? -4.444  41.327 18.904  1.00 104.82 ? 94  VAL C O   1 
ATOM   5529 C CB  . VAL C 2 92  ? -7.232  41.654 17.472  1.00 105.23 ? 94  VAL C CB  1 
ATOM   5530 C CG1 . VAL C 2 92  ? -6.903  40.316 16.823  1.00 105.53 ? 94  VAL C CG1 1 
ATOM   5531 C CG2 . VAL C 2 92  ? -8.719  41.956 17.339  1.00 105.80 ? 94  VAL C CG2 1 
ATOM   5532 N N   . PRO C 2 93  ? -5.660  39.618 19.699  1.00 101.14 ? 95  PRO C N   1 
ATOM   5533 C CA  . PRO C 2 93  ? -4.459  38.794 19.894  1.00 99.50  ? 95  PRO C CA  1 
ATOM   5534 C C   . PRO C 2 93  ? -3.882  38.342 18.560  1.00 98.58  ? 95  PRO C C   1 
ATOM   5535 O O   . PRO C 2 93  ? -4.580  37.755 17.730  1.00 98.84  ? 95  PRO C O   1 
ATOM   5536 C CB  . PRO C 2 93  ? -4.965  37.604 20.723  1.00 103.32 ? 95  PRO C CB  1 
ATOM   5537 C CG  . PRO C 2 93  ? -6.331  37.983 21.199  1.00 106.88 ? 95  PRO C CG  1 
ATOM   5538 C CD  . PRO C 2 93  ? -6.874  38.969 20.220  1.00 105.67 ? 95  PRO C CD  1 
ATOM   5539 N N   . LEU C 2 94  ? -2.599  38.632 18.359  1.00 96.63  ? 96  LEU C N   1 
ATOM   5540 C CA  . LEU C 2 94  ? -1.877  38.281 17.141  1.00 94.56  ? 96  LEU C CA  1 
ATOM   5541 C C   . LEU C 2 94  ? -0.836  37.221 17.484  1.00 94.13  ? 96  LEU C C   1 
ATOM   5542 O O   . LEU C 2 94  ? 0.118   37.496 18.221  1.00 92.74  ? 96  LEU C O   1 
ATOM   5543 C CB  . LEU C 2 94  ? -1.226  39.517 16.524  1.00 91.50  ? 96  LEU C CB  1 
ATOM   5544 C CG  . LEU C 2 94  ? -0.372  39.294 15.277  1.00 89.57  ? 96  LEU C CG  1 
ATOM   5545 C CD1 . LEU C 2 94  ? -1.222  38.748 14.143  1.00 91.35  ? 96  LEU C CD1 1 
ATOM   5546 C CD2 . LEU C 2 94  ? 0.311   40.589 14.865  1.00 86.97  ? 96  LEU C CD2 1 
ATOM   5547 N N   . GLU C 2 95  ? -1.019  36.015 16.955  1.00 97.55  ? 97  GLU C N   1 
ATOM   5548 C CA  . GLU C 2 95  ? -0.088  34.918 17.191  1.00 98.28  ? 97  GLU C CA  1 
ATOM   5549 C C   . GLU C 2 95  ? 0.983   34.925 16.108  1.00 98.93  ? 97  GLU C C   1 
ATOM   5550 O O   . GLU C 2 95  ? 0.672   34.801 14.919  1.00 99.04  ? 97  GLU C O   1 
ATOM   5551 C CB  . GLU C 2 95  ? -0.814  33.573 17.222  1.00 100.32 ? 97  GLU C CB  1 
ATOM   5552 C CG  . GLU C 2 95  ? 0.005   32.460 17.860  1.00 104.61 ? 97  GLU C CG  1 
ATOM   5553 C CD  . GLU C 2 95  ? -0.610  31.091 17.669  1.00 113.16 ? 97  GLU C CD  1 
ATOM   5554 O OE1 . GLU C 2 95  ? -1.855  30.998 17.648  1.00 113.06 ? 97  GLU C OE1 1 
ATOM   5555 O OE2 . GLU C 2 95  ? 0.149   30.108 17.540  1.00 112.04 ? 97  GLU C OE2 1 
ATOM   5556 N N   . LEU C 2 96  ? 2.237   35.077 16.520  1.00 96.19  ? 98  LEU C N   1 
ATOM   5557 C CA  . LEU C 2 96  ? 3.372   35.088 15.611  1.00 94.03  ? 98  LEU C CA  1 
ATOM   5558 C C   . LEU C 2 96  ? 4.214   33.839 15.831  1.00 94.79  ? 98  LEU C C   1 
ATOM   5559 O O   . LEU C 2 96  ? 4.370   33.376 16.965  1.00 96.10  ? 98  LEU C O   1 
ATOM   5560 C CB  . LEU C 2 96  ? 4.230   36.340 15.818  1.00 91.49  ? 98  LEU C CB  1 
ATOM   5561 C CG  . LEU C 2 96  ? 3.501   37.685 15.803  1.00 90.79  ? 98  LEU C CG  1 
ATOM   5562 C CD1 . LEU C 2 96  ? 4.364   38.772 16.426  1.00 88.90  ? 98  LEU C CD1 1 
ATOM   5563 C CD2 . LEU C 2 96  ? 3.103   38.065 14.387  1.00 90.83  ? 98  LEU C CD2 1 
ATOM   5564 N N   . ARG C 2 97  ? 4.752   33.295 14.741  1.00 95.50  ? 99  ARG C N   1 
ATOM   5565 C CA  . ARG C 2 97  ? 5.609   32.116 14.817  1.00 96.49  ? 99  ARG C CA  1 
ATOM   5566 C C   . ARG C 2 97  ? 6.669   32.202 13.732  1.00 97.70  ? 99  ARG C C   1 
ATOM   5567 O O   . ARG C 2 97  ? 6.339   32.284 12.545  1.00 98.54  ? 99  ARG C O   1 
ATOM   5568 C CB  . ARG C 2 97  ? 4.797   30.826 14.671  1.00 98.70  ? 99  ARG C CB  1 
ATOM   5569 C CG  . ARG C 2 97  ? 5.543   29.584 15.140  1.00 103.03 ? 99  ARG C CG  1 
ATOM   5570 C CD  . ARG C 2 97  ? 4.841   28.305 14.718  1.00 108.30 ? 99  ARG C CD  1 
ATOM   5571 N NE  . ARG C 2 97  ? 3.641   28.048 15.507  1.00 111.23 ? 99  ARG C NE  1 
ATOM   5572 C CZ  . ARG C 2 97  ? 3.547   27.095 16.428  1.00 116.67 ? 99  ARG C CZ  1 
ATOM   5573 N NH1 . ARG C 2 97  ? 4.587   26.312 16.680  1.00 113.36 ? 99  ARG C NH1 1 
ATOM   5574 N NH2 . ARG C 2 97  ? 2.417   26.926 17.101  1.00 112.92 ? 99  ARG C NH2 1 
ATOM   5575 N N   . VAL C 2 98  ? 7.934   32.181 14.139  1.00 98.40  ? 100 VAL C N   1 
ATOM   5576 C CA  . VAL C 2 98  ? 9.062   32.150 13.217  1.00 97.43  ? 100 VAL C CA  1 
ATOM   5577 C C   . VAL C 2 98  ? 9.587   30.723 13.176  1.00 99.19  ? 100 VAL C C   1 
ATOM   5578 O O   . VAL C 2 98  ? 10.004  30.176 14.204  1.00 100.17 ? 100 VAL C O   1 
ATOM   5579 C CB  . VAL C 2 98  ? 10.164  33.132 13.640  1.00 95.66  ? 100 VAL C CB  1 
ATOM   5580 C CG1 . VAL C 2 98  ? 11.323  33.076 12.659  1.00 95.17  ? 100 VAL C CG1 1 
ATOM   5581 C CG2 . VAL C 2 98  ? 9.607   34.541 13.741  1.00 94.13  ? 100 VAL C CG2 1 
ATOM   5582 N N   . THR C 2 99  ? 9.560   30.114 11.995  1.00 100.67 ? 101 THR C N   1 
ATOM   5583 C CA  . THR C 2 99  ? 9.970   28.730 11.817  1.00 102.60 ? 101 THR C CA  1 
ATOM   5584 C C   . THR C 2 99  ? 11.201  28.669 10.924  1.00 104.31 ? 101 THR C C   1 
ATOM   5585 O O   . THR C 2 99  ? 11.326  29.440 9.968   1.00 103.47 ? 101 THR C O   1 
ATOM   5586 C CB  . THR C 2 99  ? 8.837   27.890 11.213  1.00 107.37 ? 101 THR C CB  1 
ATOM   5587 O OG1 . THR C 2 99  ? 7.590   28.267 11.812  1.00 106.38 ? 101 THR C OG1 1 
ATOM   5588 C CG2 . THR C 2 99  ? 9.080   26.408 11.461  1.00 108.70 ? 101 THR C CG2 1 
ATOM   5589 N N   . ALA C 2 100 ? 12.108  27.752 11.247  1.00 108.28 ? 102 ALA C N   1 
ATOM   5590 C CA  . ALA C 2 100 ? 13.336  27.591 10.488  1.00 108.92 ? 102 ALA C CA  1 
ATOM   5591 C C   . ALA C 2 100 ? 13.061  26.874 9.168   1.00 112.01 ? 102 ALA C C   1 
ATOM   5592 O O   . ALA C 2 100 ? 11.953  26.399 8.903   1.00 113.60 ? 102 ALA C O   1 
ATOM   5593 C CB  . ALA C 2 100 ? 14.374  26.826 11.305  1.00 107.86 ? 102 ALA C CB  1 
ATOM   5594 N N   . ALA C 2 101 ? 14.094  26.813 8.323   1.00 110.93 ? 103 ALA C N   1 
ATOM   5595 C CA  . ALA C 2 101 ? 13.959  26.151 7.029   1.00 112.58 ? 103 ALA C CA  1 
ATOM   5596 C C   . ALA C 2 101 ? 13.591  24.681 7.191   1.00 116.45 ? 103 ALA C C   1 
ATOM   5597 O O   . ALA C 2 101 ? 12.740  24.163 6.459   1.00 118.15 ? 103 ALA C O   1 
ATOM   5598 C CB  . ALA C 2 101 ? 15.254  26.297 6.228   1.00 111.81 ? 103 ALA C CB  1 
ATOM   5599 N N   . SER C 2 102 ? 14.221  23.993 8.144   1.00 108.37 ? 104 SER C N   1 
ATOM   5600 C CA  . SER C 2 102 ? 13.908  22.591 8.391   1.00 110.65 ? 104 SER C CA  1 
ATOM   5601 C C   . SER C 2 102 ? 12.597  22.404 9.141   1.00 112.48 ? 104 SER C C   1 
ATOM   5602 O O   . SER C 2 102 ? 11.989  21.332 9.040   1.00 113.94 ? 104 SER C O   1 
ATOM   5603 C CB  . SER C 2 102 ? 15.043  21.927 9.174   1.00 110.87 ? 104 SER C CB  1 
ATOM   5604 O OG  . SER C 2 102 ? 15.233  22.562 10.427  1.00 111.36 ? 104 SER C OG  1 
ATOM   5605 N N   . GLY C 2 103 ? 12.154  23.411 9.888   1.00 107.07 ? 105 GLY C N   1 
ATOM   5606 C CA  . GLY C 2 103 ? 10.934  23.308 10.663  1.00 106.65 ? 105 GLY C CA  1 
ATOM   5607 C C   . GLY C 2 103 ? 11.187  23.458 12.148  1.00 105.79 ? 105 GLY C C   1 
ATOM   5608 O O   . GLY C 2 103 ? 10.339  23.107 12.972  1.00 105.86 ? 105 GLY C O   1 
ATOM   5609 N N   . ALA C 2 104 ? 12.356  23.990 12.495  1.00 107.30 ? 106 ALA C N   1 
ATOM   5610 C CA  . ALA C 2 104 ? 12.765  24.145 13.880  1.00 105.83 ? 106 ALA C CA  1 
ATOM   5611 C C   . ALA C 2 104 ? 12.144  25.398 14.496  1.00 105.25 ? 106 ALA C C   1 
ATOM   5612 O O   . ALA C 2 104 ? 11.871  26.375 13.793  1.00 104.12 ? 106 ALA C O   1 
ATOM   5613 C CB  . ALA C 2 104 ? 14.284  24.222 13.976  1.00 104.83 ? 106 ALA C CB  1 
ATOM   5614 N N   . PRO C 2 105 ? 11.908  25.393 15.810  1.00 104.47 ? 107 PRO C N   1 
ATOM   5615 C CA  . PRO C 2 105 ? 11.290  26.559 16.457  1.00 102.77 ? 107 PRO C CA  1 
ATOM   5616 C C   . PRO C 2 105 ? 12.307  27.671 16.679  1.00 101.73 ? 107 PRO C C   1 
ATOM   5617 O O   . PRO C 2 105 ? 13.376  27.450 17.254  1.00 101.57 ? 107 PRO C O   1 
ATOM   5618 C CB  . PRO C 2 105 ? 10.779  25.995 17.788  1.00 104.60 ? 107 PRO C CB  1 
ATOM   5619 C CG  . PRO C 2 105 ? 11.713  24.870 18.085  1.00 107.75 ? 107 PRO C CG  1 
ATOM   5620 C CD  . PRO C 2 105 ? 12.090  24.272 16.751  1.00 107.02 ? 107 PRO C CD  1 
ATOM   5621 N N   . ARG C 2 106 ? 11.970  28.872 16.209  1.00 100.71 ? 108 ARG C N   1 
ATOM   5622 C CA  . ARG C 2 106 ? 12.804  30.054 16.392  1.00 98.22  ? 108 ARG C CA  1 
ATOM   5623 C C   . ARG C 2 106 ? 12.175  31.046 17.362  1.00 98.51  ? 108 ARG C C   1 
ATOM   5624 O O   . ARG C 2 106 ? 12.807  31.435 18.348  1.00 97.67  ? 108 ARG C O   1 
ATOM   5625 C CB  . ARG C 2 106 ? 13.072  30.720 15.034  1.00 97.26  ? 108 ARG C CB  1 
ATOM   5626 C CG  . ARG C 2 106 ? 14.066  31.876 15.070  1.00 97.25  ? 108 ARG C CG  1 
ATOM   5627 C CD  . ARG C 2 106 ? 15.477  31.403 15.384  1.00 98.82  ? 108 ARG C CD  1 
ATOM   5628 N NE  . ARG C 2 106 ? 15.872  31.729 16.751  1.00 100.08 ? 108 ARG C NE  1 
ATOM   5629 C CZ  . ARG C 2 106 ? 16.523  32.836 17.097  1.00 101.36 ? 108 ARG C CZ  1 
ATOM   5630 N NH1 . ARG C 2 106 ? 16.858  33.729 16.175  1.00 94.61  ? 108 ARG C NH1 1 
ATOM   5631 N NH2 . ARG C 2 106 ? 16.840  33.049 18.367  1.00 97.14  ? 108 ARG C NH2 1 
ATOM   5632 N N   . TYR C 2 107 ? 10.940  31.472 17.103  1.00 100.77 ? 109 TYR C N   1 
ATOM   5633 C CA  . TYR C 2 107 ? 10.241  32.396 17.984  1.00 100.03 ? 109 TYR C CA  1 
ATOM   5634 C C   . TYR C 2 107 ? 8.757   32.062 17.987  1.00 102.60 ? 109 TYR C C   1 
ATOM   5635 O O   . TYR C 2 107 ? 8.221   31.534 17.009  1.00 103.37 ? 109 TYR C O   1 
ATOM   5636 C CB  . TYR C 2 107 ? 10.446  33.857 17.565  1.00 98.31  ? 109 TYR C CB  1 
ATOM   5637 C CG  . TYR C 2 107 ? 11.839  34.380 17.823  1.00 96.85  ? 109 TYR C CG  1 
ATOM   5638 C CD1 . TYR C 2 107 ? 12.284  34.615 19.118  1.00 97.28  ? 109 TYR C CD1 1 
ATOM   5639 C CD2 . TYR C 2 107 ? 12.704  34.653 16.773  1.00 95.69  ? 109 TYR C CD2 1 
ATOM   5640 C CE1 . TYR C 2 107 ? 13.556  35.095 19.359  1.00 96.00  ? 109 TYR C CE1 1 
ATOM   5641 C CE2 . TYR C 2 107 ? 13.978  35.135 17.004  1.00 93.73  ? 109 TYR C CE2 1 
ATOM   5642 C CZ  . TYR C 2 107 ? 14.398  35.354 18.298  1.00 95.95  ? 109 TYR C CZ  1 
ATOM   5643 O OH  . TYR C 2 107 ? 15.666  35.834 18.532  1.00 94.34  ? 109 TYR C OH  1 
ATOM   5644 N N   . HIS C 2 108 ? 8.099   32.378 19.101  1.00 92.94  ? 110 HIS C N   1 
ATOM   5645 C CA  . HIS C 2 108 ? 6.660   32.164 19.237  1.00 94.01  ? 110 HIS C CA  1 
ATOM   5646 C C   . HIS C 2 108 ? 6.145   33.156 20.269  1.00 94.96  ? 110 HIS C C   1 
ATOM   5647 O O   . HIS C 2 108 ? 6.496   33.056 21.449  1.00 95.52  ? 110 HIS C O   1 
ATOM   5648 C CB  . HIS C 2 108 ? 6.354   30.729 19.658  1.00 96.26  ? 110 HIS C CB  1 
ATOM   5649 C CG  . HIS C 2 108 ? 4.960   30.288 19.338  1.00 98.36  ? 110 HIS C CG  1 
ATOM   5650 N ND1 . HIS C 2 108 ? 3.849   31.036 19.663  1.00 98.58  ? 110 HIS C ND1 1 
ATOM   5651 C CD2 . HIS C 2 108 ? 4.495   29.168 18.736  1.00 100.38 ? 110 HIS C CD2 1 
ATOM   5652 C CE1 . HIS C 2 108 ? 2.760   30.401 19.266  1.00 99.45  ? 110 HIS C CE1 1 
ATOM   5653 N NE2 . HIS C 2 108 ? 3.125   29.265 18.701  1.00 100.70 ? 110 HIS C NE2 1 
ATOM   5654 N N   . ARG C 2 109 ? 5.314   34.102 19.836  1.00 93.66  ? 111 ARG C N   1 
ATOM   5655 C CA  . ARG C 2 109 ? 4.806   35.136 20.724  1.00 93.45  ? 111 ARG C CA  1 
ATOM   5656 C C   . ARG C 2 109 ? 3.376   35.487 20.342  1.00 95.08  ? 111 ARG C C   1 
ATOM   5657 O O   . ARG C 2 109 ? 2.987   35.402 19.175  1.00 94.63  ? 111 ARG C O   1 
ATOM   5658 C CB  . ARG C 2 109 ? 5.680   36.399 20.680  1.00 91.59  ? 111 ARG C CB  1 
ATOM   5659 C CG  . ARG C 2 109 ? 6.941   36.315 21.532  1.00 94.08  ? 111 ARG C CG  1 
ATOM   5660 C CD  . ARG C 2 109 ? 7.881   37.486 21.270  1.00 94.01  ? 111 ARG C CD  1 
ATOM   5661 N NE  . ARG C 2 109 ? 7.646   38.607 22.177  1.00 95.56  ? 111 ARG C NE  1 
ATOM   5662 C CZ  . ARG C 2 109 ? 7.178   39.791 21.797  1.00 98.32  ? 111 ARG C CZ  1 
ATOM   5663 N NH1 . ARG C 2 109 ? 6.883   40.015 20.523  1.00 92.90  ? 111 ARG C NH1 1 
ATOM   5664 N NH2 . ARG C 2 109 ? 6.999   40.753 22.692  1.00 94.28  ? 111 ARG C NH2 1 
ATOM   5665 N N   . VAL C 2 110 ? 2.600   35.883 21.347  1.00 93.19  ? 112 VAL C N   1 
ATOM   5666 C CA  . VAL C 2 110 ? 1.239   36.374 21.170  1.00 93.29  ? 112 VAL C CA  1 
ATOM   5667 C C   . VAL C 2 110 ? 1.192   37.766 21.780  1.00 94.07  ? 112 VAL C C   1 
ATOM   5668 O O   . VAL C 2 110 ? 1.250   37.915 23.008  1.00 94.99  ? 112 VAL C O   1 
ATOM   5669 C CB  . VAL C 2 110 ? 0.198   35.452 21.817  1.00 96.26  ? 112 VAL C CB  1 
ATOM   5670 C CG1 . VAL C 2 110 ? -1.178  36.101 21.784  1.00 96.35  ? 112 VAL C CG1 1 
ATOM   5671 C CG2 . VAL C 2 110 ? 0.175   34.103 21.117  1.00 96.75  ? 112 VAL C CG2 1 
ATOM   5672 N N   . ILE C 2 111 ? 1.087   38.786 20.931  1.00 94.18  ? 113 ILE C N   1 
ATOM   5673 C CA  . ILE C 2 111 ? 1.118   40.172 21.373  1.00 93.73  ? 113 ILE C CA  1 
ATOM   5674 C C   . ILE C 2 111 ? -0.123  40.892 20.867  1.00 94.69  ? 113 ILE C C   1 
ATOM   5675 O O   . ILE C 2 111 ? -0.789  40.457 19.925  1.00 94.23  ? 113 ILE C O   1 
ATOM   5676 C CB  . ILE C 2 111 ? 2.392   40.905 20.900  1.00 93.20  ? 113 ILE C CB  1 
ATOM   5677 C CG1 . ILE C 2 111 ? 2.493   40.875 19.372  1.00 91.92  ? 113 ILE C CG1 1 
ATOM   5678 C CG2 . ILE C 2 111 ? 3.628   40.285 21.534  1.00 93.50  ? 113 ILE C CG2 1 
ATOM   5679 C CD1 . ILE C 2 111 ? 2.156   42.191 18.701  1.00 92.78  ? 113 ILE C CD1 1 
ATOM   5680 N N   . HIS C 2 112 ? -0.428  42.011 21.516  1.00 97.34  ? 114 HIS C N   1 
ATOM   5681 C CA  . HIS C 2 112 ? -1.499  42.903 21.099  1.00 96.88  ? 114 HIS C CA  1 
ATOM   5682 C C   . HIS C 2 112 ? -0.875  44.173 20.543  1.00 96.58  ? 114 HIS C C   1 
ATOM   5683 O O   . HIS C 2 112 ? 0.026   44.748 21.163  1.00 96.58  ? 114 HIS C O   1 
ATOM   5684 C CB  . HIS C 2 112 ? -2.436  43.225 22.264  1.00 98.83  ? 114 HIS C CB  1 
ATOM   5685 C CG  . HIS C 2 112 ? -3.167  42.031 22.794  1.00 101.37 ? 114 HIS C CG  1 
ATOM   5686 N ND1 . HIS C 2 112 ? -4.461  41.728 22.429  1.00 102.36 ? 114 HIS C ND1 1 
ATOM   5687 C CD2 . HIS C 2 112 ? -2.783  41.061 23.657  1.00 103.17 ? 114 HIS C CD2 1 
ATOM   5688 C CE1 . HIS C 2 112 ? -4.844  40.625 23.046  1.00 103.67 ? 114 HIS C CE1 1 
ATOM   5689 N NE2 . HIS C 2 112 ? -3.844  40.200 23.797  1.00 104.26 ? 114 HIS C NE2 1 
ATOM   5690 N N   . ILE C 2 113 ? -1.354  44.601 19.374  1.00 94.45  ? 115 ILE C N   1 
ATOM   5691 C CA  . ILE C 2 113 ? -0.753  45.739 18.683  1.00 92.73  ? 115 ILE C CA  1 
ATOM   5692 C C   . ILE C 2 113 ? -0.812  46.992 19.548  1.00 94.17  ? 115 ILE C C   1 
ATOM   5693 O O   . ILE C 2 113 ? 0.124   47.801 19.560  1.00 93.34  ? 115 ILE C O   1 
ATOM   5694 C CB  . ILE C 2 113 ? -1.437  45.947 17.321  1.00 92.50  ? 115 ILE C CB  1 
ATOM   5695 C CG1 . ILE C 2 113 ? -1.297  44.679 16.480  1.00 92.48  ? 115 ILE C CG1 1 
ATOM   5696 C CG2 . ILE C 2 113 ? -0.819  47.127 16.590  1.00 91.10  ? 115 ILE C CG2 1 
ATOM   5697 C CD1 . ILE C 2 113 ? -1.940  44.764 15.126  1.00 93.77  ? 115 ILE C CD1 1 
ATOM   5698 N N   . ASN C 2 114 ? -1.903  47.167 20.293  1.00 90.34  ? 116 ASN C N   1 
ATOM   5699 C CA  . ASN C 2 114 ? -2.061  48.344 21.137  1.00 91.09  ? 116 ASN C CA  1 
ATOM   5700 C C   . ASN C 2 114 ? -1.114  48.356 22.332  1.00 93.47  ? 116 ASN C C   1 
ATOM   5701 O O   . ASN C 2 114 ? -1.017  49.386 23.008  1.00 94.29  ? 116 ASN C O   1 
ATOM   5702 C CB  . ASN C 2 114 ? -3.508  48.443 21.623  1.00 92.62  ? 116 ASN C CB  1 
ATOM   5703 C CG  . ASN C 2 114 ? -3.979  47.176 22.305  1.00 101.17 ? 116 ASN C CG  1 
ATOM   5704 O OD1 . ASN C 2 114 ? -4.119  46.133 21.668  1.00 98.99  ? 116 ASN C OD1 1 
ATOM   5705 N ND2 . ASN C 2 114 ? -4.225  47.260 23.607  1.00 100.47 ? 116 ASN C ND2 1 
ATOM   5706 N N   . GLU C 2 115 ? -0.425  47.250 22.613  1.00 93.07  ? 117 GLU C N   1 
ATOM   5707 C CA  . GLU C 2 115 ? 0.484   47.159 23.749  1.00 94.14  ? 117 GLU C CA  1 
ATOM   5708 C C   . GLU C 2 115 ? 1.952   47.316 23.367  1.00 93.90  ? 117 GLU C C   1 
ATOM   5709 O O   . GLU C 2 115 ? 2.810   47.307 24.255  1.00 94.24  ? 117 GLU C O   1 
ATOM   5710 C CB  . GLU C 2 115 ? 0.287   45.820 24.472  1.00 95.71  ? 117 GLU C CB  1 
ATOM   5711 C CG  . GLU C 2 115 ? -1.089  45.641 25.099  1.00 100.33 ? 117 GLU C CG  1 
ATOM   5712 C CD  . GLU C 2 115 ? -1.104  44.571 26.176  1.00 107.65 ? 117 GLU C CD  1 
ATOM   5713 O OE1 . GLU C 2 115 ? -0.240  43.670 26.129  1.00 104.81 ? 117 GLU C OE1 1 
ATOM   5714 O OE2 . GLU C 2 115 ? -1.977  44.631 27.068  1.00 107.38 ? 117 GLU C OE2 1 
ATOM   5715 N N   . VAL C 2 116 ? 2.265   47.461 22.080  1.00 92.40  ? 118 VAL C N   1 
ATOM   5716 C CA  . VAL C 2 116 ? 3.652   47.578 21.639  1.00 90.02  ? 118 VAL C CA  1 
ATOM   5717 C C   . VAL C 2 116 ? 3.829   48.854 20.826  1.00 88.15  ? 118 VAL C C   1 
ATOM   5718 O O   . VAL C 2 116 ? 4.531   48.865 19.808  1.00 86.39  ? 118 VAL C O   1 
ATOM   5719 C CB  . VAL C 2 116 ? 4.087   46.342 20.830  1.00 89.36  ? 118 VAL C CB  1 
ATOM   5720 C CG1 . VAL C 2 116 ? 4.267   45.146 21.750  1.00 91.18  ? 118 VAL C CG1 1 
ATOM   5721 C CG2 . VAL C 2 116 ? 3.071   46.033 19.741  1.00 89.62  ? 118 VAL C CG2 1 
ATOM   5722 N N   . VAL C 2 117 ? 3.201   49.935 21.271  1.00 92.12  ? 119 VAL C N   1 
ATOM   5723 C CA  . VAL C 2 117 ? 3.261   51.202 20.551  1.00 90.44  ? 119 VAL C CA  1 
ATOM   5724 C C   . VAL C 2 117 ? 4.558   51.918 20.897  1.00 90.91  ? 119 VAL C C   1 
ATOM   5725 O O   . VAL C 2 117 ? 4.900   52.080 22.074  1.00 92.91  ? 119 VAL C O   1 
ATOM   5726 C CB  . VAL C 2 117 ? 2.041   52.074 20.884  1.00 93.49  ? 119 VAL C CB  1 
ATOM   5727 C CG1 . VAL C 2 117 ? 2.037   53.325 20.023  1.00 91.55  ? 119 VAL C CG1 1 
ATOM   5728 C CG2 . VAL C 2 117 ? 0.757   51.284 20.695  1.00 94.28  ? 119 VAL C CG2 1 
ATOM   5729 N N   . LEU C 2 118 ? 5.284   52.350 19.870  1.00 97.04  ? 120 LEU C N   1 
ATOM   5730 C CA  . LEU C 2 118 ? 6.500   53.144 20.024  1.00 95.46  ? 120 LEU C CA  1 
ATOM   5731 C C   . LEU C 2 118 ? 6.306   54.415 19.204  1.00 94.45  ? 120 LEU C C   1 
ATOM   5732 O O   . LEU C 2 118 ? 6.510   54.414 17.986  1.00 91.48  ? 120 LEU C O   1 
ATOM   5733 C CB  . LEU C 2 118 ? 7.730   52.361 19.575  1.00 92.84  ? 120 LEU C CB  1 
ATOM   5734 C CG  . LEU C 2 118 ? 9.074   53.074 19.717  1.00 91.31  ? 120 LEU C CG  1 
ATOM   5735 C CD1 . LEU C 2 118 ? 9.477   53.162 21.180  1.00 93.42  ? 120 LEU C CD1 1 
ATOM   5736 C CD2 . LEU C 2 118 ? 10.144  52.358 18.907  1.00 88.70  ? 120 LEU C CD2 1 
ATOM   5737 N N   . LEU C 2 119 ? 5.921   55.499 19.872  1.00 92.84  ? 121 LEU C N   1 
ATOM   5738 C CA  . LEU C 2 119 ? 5.588   56.734 19.182  1.00 91.48  ? 121 LEU C CA  1 
ATOM   5739 C C   . LEU C 2 119 ? 6.846   57.470 18.726  1.00 89.65  ? 121 LEU C C   1 
ATOM   5740 O O   . LEU C 2 119 ? 7.975   57.116 19.072  1.00 88.31  ? 121 LEU C O   1 
ATOM   5741 C CB  . LEU C 2 119 ? 4.748   57.637 20.084  1.00 94.87  ? 121 LEU C CB  1 
ATOM   5742 C CG  . LEU C 2 119 ? 3.403   57.067 20.531  1.00 99.56  ? 121 LEU C CG  1 
ATOM   5743 C CD1 . LEU C 2 119 ? 2.776   57.950 21.599  1.00 103.32 ? 121 LEU C CD1 1 
ATOM   5744 C CD2 . LEU C 2 119 ? 2.475   56.918 19.337  1.00 99.07  ? 121 LEU C CD2 1 
ATOM   5745 N N   . ASP C 2 120 ? 6.630   58.513 17.930  1.00 95.21  ? 122 ASP C N   1 
ATOM   5746 C CA  . ASP C 2 120 ? 7.701   59.383 17.476  1.00 92.91  ? 122 ASP C CA  1 
ATOM   5747 C C   . ASP C 2 120 ? 7.940   60.497 18.492  1.00 95.49  ? 122 ASP C C   1 
ATOM   5748 O O   . ASP C 2 120 ? 7.143   60.726 19.404  1.00 98.45  ? 122 ASP C O   1 
ATOM   5749 C CB  . ASP C 2 120 ? 7.374   59.971 16.103  1.00 92.62  ? 122 ASP C CB  1 
ATOM   5750 C CG  . ASP C 2 120 ? 7.133   58.903 15.052  1.00 95.50  ? 122 ASP C CG  1 
ATOM   5751 O OD1 . ASP C 2 120 ? 6.037   58.302 15.053  1.00 97.13  ? 122 ASP C OD1 1 
ATOM   5752 O OD2 . ASP C 2 120 ? 8.039   58.664 14.225  1.00 95.83  ? 122 ASP C OD2 1 
ATOM   5753 N N   . ALA C 2 121 ? 9.062   61.189 18.329  1.00 86.43  ? 123 ALA C N   1 
ATOM   5754 C CA  . ALA C 2 121 ? 9.400   62.264 19.246  1.00 87.82  ? 123 ALA C CA  1 
ATOM   5755 C C   . ALA C 2 121 ? 8.468   63.456 19.032  1.00 90.42  ? 123 ALA C C   1 
ATOM   5756 O O   . ALA C 2 121 ? 8.142   63.795 17.890  1.00 89.07  ? 123 ALA C O   1 
ATOM   5757 C CB  . ALA C 2 121 ? 10.853  62.697 19.052  1.00 85.86  ? 123 ALA C CB  1 
ATOM   5758 N N   . PRO C 2 122 ? 8.022   64.106 20.105  1.00 80.04  ? 124 PRO C N   1 
ATOM   5759 C CA  . PRO C 2 122 ? 7.177   65.294 19.951  1.00 81.53  ? 124 PRO C CA  1 
ATOM   5760 C C   . PRO C 2 122 ? 7.949   66.451 19.334  1.00 81.05  ? 124 PRO C C   1 
ATOM   5761 O O   . PRO C 2 122 ? 9.181   66.477 19.308  1.00 79.23  ? 124 PRO C O   1 
ATOM   5762 C CB  . PRO C 2 122 ? 6.744   65.618 21.387  1.00 86.21  ? 124 PRO C CB  1 
ATOM   5763 C CG  . PRO C 2 122 ? 6.986   64.359 22.163  1.00 88.69  ? 124 PRO C CG  1 
ATOM   5764 C CD  . PRO C 2 122 ? 8.164   63.706 21.514  1.00 83.31  ? 124 PRO C CD  1 
ATOM   5765 N N   . VAL C 2 123 ? 7.192   67.419 18.815  1.00 85.95  ? 125 VAL C N   1 
ATOM   5766 C CA  . VAL C 2 123 ? 7.754   68.580 18.141  1.00 85.01  ? 125 VAL C CA  1 
ATOM   5767 C C   . VAL C 2 123 ? 7.120   69.840 18.719  1.00 88.60  ? 125 VAL C C   1 
ATOM   5768 O O   . VAL C 2 123 ? 6.175   69.786 19.506  1.00 90.83  ? 125 VAL C O   1 
ATOM   5769 C CB  . VAL C 2 123 ? 7.548   68.530 16.613  1.00 84.89  ? 125 VAL C CB  1 
ATOM   5770 C CG1 . VAL C 2 123 ? 8.365   67.401 16.001  1.00 82.40  ? 125 VAL C CG1 1 
ATOM   5771 C CG2 . VAL C 2 123 ? 6.071   68.378 16.279  1.00 86.34  ? 125 VAL C CG2 1 
ATOM   5772 N N   . GLY C 2 124 ? 7.657   70.983 18.307  1.00 89.54  ? 126 GLY C N   1 
ATOM   5773 C CA  . GLY C 2 124 ? 7.123   72.268 18.726  1.00 91.57  ? 126 GLY C CA  1 
ATOM   5774 C C   . GLY C 2 124 ? 7.351   72.610 20.183  1.00 94.78  ? 126 GLY C C   1 
ATOM   5775 O O   . GLY C 2 124 ? 6.484   73.231 20.812  1.00 97.27  ? 126 GLY C O   1 
ATOM   5776 N N   . LEU C 2 125 ? 8.500   72.230 20.735  1.00 84.66  ? 127 LEU C N   1 
ATOM   5777 C CA  . LEU C 2 125 ? 8.805   72.515 22.131  1.00 85.61  ? 127 LEU C CA  1 
ATOM   5778 C C   . LEU C 2 125 ? 9.161   73.989 22.278  1.00 87.35  ? 127 LEU C C   1 
ATOM   5779 O O   . LEU C 2 125 ? 10.076  74.482 21.611  1.00 87.50  ? 127 LEU C O   1 
ATOM   5780 C CB  . LEU C 2 125 ? 9.948   71.628 22.615  1.00 84.78  ? 127 LEU C CB  1 
ATOM   5781 C CG  . LEU C 2 125 ? 10.227  71.643 24.116  1.00 86.06  ? 127 LEU C CG  1 
ATOM   5782 C CD1 . LEU C 2 125 ? 9.039   71.097 24.883  1.00 86.51  ? 127 LEU C CD1 1 
ATOM   5783 C CD2 . LEU C 2 125 ? 11.477  70.838 24.419  1.00 85.60  ? 127 LEU C CD2 1 
ATOM   5784 N N   . VAL C 2 126 ? 8.431   74.694 23.140  1.00 93.15  ? 128 VAL C N   1 
ATOM   5785 C CA  . VAL C 2 126 ? 8.634   76.120 23.371  1.00 94.28  ? 128 VAL C CA  1 
ATOM   5786 C C   . VAL C 2 126 ? 8.663   76.367 24.873  1.00 98.53  ? 128 VAL C C   1 
ATOM   5787 O O   . VAL C 2 126 ? 7.724   75.993 25.585  1.00 100.68 ? 128 VAL C O   1 
ATOM   5788 C CB  . VAL C 2 126 ? 7.539   76.977 22.706  1.00 95.93  ? 128 VAL C CB  1 
ATOM   5789 C CG1 . VAL C 2 126 ? 7.706   78.439 23.092  1.00 97.66  ? 128 VAL C CG1 1 
ATOM   5790 C CG2 . VAL C 2 126 ? 7.575   76.815 21.193  1.00 92.72  ? 128 VAL C CG2 1 
ATOM   5791 N N   . ALA C 2 127 ? 9.734   76.995 25.349  1.00 99.70  ? 129 ALA C N   1 
ATOM   5792 C CA  . ALA C 2 127 ? 9.885   77.347 26.753  1.00 102.24 ? 129 ALA C CA  1 
ATOM   5793 C C   . ALA C 2 127 ? 9.723   78.851 26.926  1.00 104.70 ? 129 ALA C C   1 
ATOM   5794 O O   . ALA C 2 127 ? 10.276  79.638 26.150  1.00 103.13 ? 129 ALA C O   1 
ATOM   5795 C CB  . ALA C 2 127 ? 11.248  76.903 27.288  1.00 101.57 ? 129 ALA C CB  1 
ATOM   5796 N N   . ARG C 2 128 ? 8.963   79.246 27.945  1.00 106.28 ? 130 ARG C N   1 
ATOM   5797 C CA  . ARG C 2 128 ? 8.677   80.648 28.210  1.00 107.70 ? 130 ARG C CA  1 
ATOM   5798 C C   . ARG C 2 128 ? 8.756   80.908 29.708  1.00 111.54 ? 130 ARG C C   1 
ATOM   5799 O O   . ARG C 2 128 ? 8.347   80.064 30.511  1.00 113.05 ? 130 ARG C O   1 
ATOM   5800 C CB  . ARG C 2 128 ? 7.291   81.029 27.670  1.00 108.64 ? 130 ARG C CB  1 
ATOM   5801 C CG  . ARG C 2 128 ? 6.891   82.479 27.873  1.00 113.48 ? 130 ARG C CG  1 
ATOM   5802 C CD  . ARG C 2 128 ? 5.494   82.722 27.327  1.00 117.70 ? 130 ARG C CD  1 
ATOM   5803 N NE  . ARG C 2 128 ? 4.996   84.058 27.637  1.00 122.92 ? 130 ARG C NE  1 
ATOM   5804 C CZ  . ARG C 2 128 ? 3.761   84.472 27.370  1.00 129.45 ? 130 ARG C CZ  1 
ATOM   5805 N NH1 . ARG C 2 128 ? 2.896   83.651 26.791  1.00 125.74 ? 130 ARG C NH1 1 
ATOM   5806 N NH2 . ARG C 2 128 ? 3.389   85.705 27.686  1.00 126.83 ? 130 ARG C NH2 1 
ATOM   5807 N N   . LEU C 2 129 ? 9.281   82.074 30.080  1.00 112.12 ? 131 LEU C N   1 
ATOM   5808 C CA  . LEU C 2 129 ? 9.370   82.475 31.480  1.00 114.88 ? 131 LEU C CA  1 
ATOM   5809 C C   . LEU C 2 129 ? 8.059   83.129 31.903  1.00 117.43 ? 131 LEU C C   1 
ATOM   5810 O O   . LEU C 2 129 ? 7.629   84.116 31.295  1.00 116.97 ? 131 LEU C O   1 
ATOM   5811 C CB  . LEU C 2 129 ? 10.541  83.432 31.700  1.00 115.46 ? 131 LEU C CB  1 
ATOM   5812 C CG  . LEU C 2 129 ? 11.952  82.846 31.637  1.00 114.18 ? 131 LEU C CG  1 
ATOM   5813 C CD1 . LEU C 2 129 ? 13.003  83.950 31.641  1.00 114.79 ? 131 LEU C CD1 1 
ATOM   5814 C CD2 . LEU C 2 129 ? 12.181  81.878 32.788  1.00 115.49 ? 131 LEU C CD2 1 
ATOM   5815 N N   . ALA C 2 130 ? 7.427   82.581 32.938  1.00 132.51 ? 132 ALA C N   1 
ATOM   5816 C CA  . ALA C 2 130 ? 6.184   83.134 33.458  1.00 134.68 ? 132 ALA C CA  1 
ATOM   5817 C C   . ALA C 2 130 ? 6.469   84.209 34.499  1.00 137.87 ? 132 ALA C C   1 
ATOM   5818 O O   . ALA C 2 130 ? 7.323   84.037 35.373  1.00 138.78 ? 132 ALA C O   1 
ATOM   5819 C CB  . ALA C 2 130 ? 5.318   82.032 34.069  1.00 136.75 ? 132 ALA C CB  1 
ATOM   5820 N N   . ASP C 2 131 ? 5.740   85.321 34.398  1.00 145.03 ? 133 ASP C N   1 
ATOM   5821 C CA  . ASP C 2 131 ? 5.897   86.439 35.321  1.00 146.98 ? 133 ASP C CA  1 
ATOM   5822 C C   . ASP C 2 131 ? 5.258   86.192 36.682  1.00 151.53 ? 133 ASP C C   1 
ATOM   5823 O O   . ASP C 2 131 ? 5.494   86.977 37.607  1.00 153.30 ? 133 ASP C O   1 
ATOM   5824 C CB  . ASP C 2 131 ? 5.309   87.711 34.703  1.00 147.21 ? 133 ASP C CB  1 
ATOM   5825 C CG  . ASP C 2 131 ? 3.818   87.599 34.442  1.00 151.32 ? 133 ASP C CG  1 
ATOM   5826 O OD1 . ASP C 2 131 ? 3.029   87.863 35.374  1.00 153.68 ? 133 ASP C OD1 1 
ATOM   5827 O OD2 . ASP C 2 131 ? 3.435   87.240 33.308  1.00 151.63 ? 133 ASP C OD2 1 
ATOM   5828 N N   . GLU C 2 132 ? 4.470   85.131 36.834  1.00 147.14 ? 134 GLU C N   1 
ATOM   5829 C CA  . GLU C 2 132 ? 3.731   84.876 38.060  1.00 150.16 ? 134 GLU C CA  1 
ATOM   5830 C C   . GLU C 2 132 ? 4.523   83.926 38.964  1.00 153.28 ? 134 GLU C C   1 
ATOM   5831 O O   . GLU C 2 132 ? 5.740   83.769 38.810  1.00 152.16 ? 134 GLU C O   1 
ATOM   5832 C CB  . GLU C 2 132 ? 2.335   84.337 37.711  1.00 150.43 ? 134 GLU C CB  1 
ATOM   5833 C CG  . GLU C 2 132 ? 2.319   83.005 36.962  1.00 151.71 ? 134 GLU C CG  1 
ATOM   5834 C CD  . GLU C 2 132 ? 2.256   83.172 35.453  1.00 153.57 ? 134 GLU C CD  1 
ATOM   5835 O OE1 . GLU C 2 132 ? 2.707   84.221 34.947  1.00 150.56 ? 134 GLU C OE1 1 
ATOM   5836 O OE2 . GLU C 2 132 ? 1.747   82.254 34.773  1.00 150.17 ? 134 GLU C OE2 1 
ATOM   5837 N N   . SER C 2 133 ? 3.836   83.294 39.922  1.00 153.53 ? 135 SER C N   1 
ATOM   5838 C CA  . SER C 2 133 ? 4.476   82.301 40.779  1.00 154.82 ? 135 SER C CA  1 
ATOM   5839 C C   . SER C 2 133 ? 4.997   81.108 39.991  1.00 154.18 ? 135 SER C C   1 
ATOM   5840 O O   . SER C 2 133 ? 5.860   80.378 40.493  1.00 154.55 ? 135 SER C O   1 
ATOM   5841 C CB  . SER C 2 133 ? 3.503   81.827 41.860  1.00 158.19 ? 135 SER C CB  1 
ATOM   5842 O OG  . SER C 2 133 ? 3.183   82.875 42.758  1.00 163.67 ? 135 SER C OG  1 
ATOM   5843 N N   . GLY C 2 134 ? 4.491   80.889 38.780  1.00 143.56 ? 136 GLY C N   1 
ATOM   5844 C CA  . GLY C 2 134 ? 5.041   79.840 37.945  1.00 139.26 ? 136 GLY C CA  1 
ATOM   5845 C C   . GLY C 2 134 ? 6.480   80.137 37.572  1.00 137.59 ? 136 GLY C C   1 
ATOM   5846 O O   . GLY C 2 134 ? 6.902   81.292 37.492  1.00 138.57 ? 136 GLY C O   1 
ATOM   5847 N N   . HIS C 2 135 ? 7.241   79.074 37.334  1.00 133.00 ? 137 HIS C N   1 
ATOM   5848 C CA  . HIS C 2 135 ? 8.650   79.231 37.004  1.00 130.69 ? 137 HIS C CA  1 
ATOM   5849 C C   . HIS C 2 135 ? 8.816   79.338 35.494  1.00 128.18 ? 137 HIS C C   1 
ATOM   5850 O O   . HIS C 2 135 ? 8.960   80.440 34.955  1.00 126.44 ? 137 HIS C O   1 
ATOM   5851 C CB  . HIS C 2 135 ? 9.462   78.060 37.562  1.00 131.00 ? 137 HIS C CB  1 
ATOM   5852 C CG  . HIS C 2 135 ? 9.369   77.911 39.050  1.00 135.39 ? 137 HIS C CG  1 
ATOM   5853 N ND1 . HIS C 2 135 ? 8.176   77.686 39.704  1.00 138.18 ? 137 HIS C ND1 1 
ATOM   5854 C CD2 . HIS C 2 135 ? 10.322  77.947 40.012  1.00 136.51 ? 137 HIS C CD2 1 
ATOM   5855 C CE1 . HIS C 2 135 ? 8.398   77.596 41.003  1.00 140.05 ? 137 HIS C CE1 1 
ATOM   5856 N NE2 . HIS C 2 135 ? 9.692   77.750 41.216  1.00 139.39 ? 137 HIS C NE2 1 
ATOM   5857 N N   . VAL C 2 136 ? 8.796   78.200 34.808  1.00 110.89 ? 138 VAL C N   1 
ATOM   5858 C CA  . VAL C 2 136 ? 8.926   78.140 33.359  1.00 111.61 ? 138 VAL C CA  1 
ATOM   5859 C C   . VAL C 2 136 ? 7.695   77.437 32.803  1.00 114.58 ? 138 VAL C C   1 
ATOM   5860 O O   . VAL C 2 136 ? 7.217   76.453 33.378  1.00 115.59 ? 138 VAL C O   1 
ATOM   5861 C CB  . VAL C 2 136 ? 10.227  77.430 32.923  1.00 112.54 ? 138 VAL C CB  1 
ATOM   5862 C CG1 . VAL C 2 136 ? 10.275  76.003 33.450  1.00 113.92 ? 138 VAL C CG1 1 
ATOM   5863 C CG2 . VAL C 2 136 ? 10.377  77.460 31.408  1.00 114.23 ? 138 VAL C CG2 1 
ATOM   5864 N N   . VAL C 2 137 ? 7.165   77.962 31.703  1.00 103.60 ? 139 VAL C N   1 
ATOM   5865 C CA  . VAL C 2 137 ? 5.992   77.399 31.045  1.00 104.52 ? 139 VAL C CA  1 
ATOM   5866 C C   . VAL C 2 137 ? 6.459   76.702 29.776  1.00 105.41 ? 139 VAL C C   1 
ATOM   5867 O O   . VAL C 2 137 ? 7.001   77.343 28.867  1.00 105.16 ? 139 VAL C O   1 
ATOM   5868 C CB  . VAL C 2 137 ? 4.944   78.479 30.734  1.00 103.65 ? 139 VAL C CB  1 
ATOM   5869 C CG1 . VAL C 2 137 ? 3.785   77.886 29.947  1.00 104.01 ? 139 VAL C CG1 1 
ATOM   5870 C CG2 . VAL C 2 137 ? 4.446   79.117 32.020  1.00 102.98 ? 139 VAL C CG2 1 
ATOM   5871 N N   . LEU C 2 138 ? 6.252   75.389 29.718  1.00 97.18  ? 140 LEU C N   1 
ATOM   5872 C CA  . LEU C 2 138 ? 6.632   74.576 28.573  1.00 98.29  ? 140 LEU C CA  1 
ATOM   5873 C C   . LEU C 2 138 ? 5.386   74.216 27.777  1.00 100.38 ? 140 LEU C C   1 
ATOM   5874 O O   . LEU C 2 138 ? 4.377   73.796 28.353  1.00 100.59 ? 140 LEU C O   1 
ATOM   5875 C CB  . LEU C 2 138 ? 7.353   73.304 29.022  1.00 99.65  ? 140 LEU C CB  1 
ATOM   5876 C CG  . LEU C 2 138 ? 8.872   73.387 29.177  1.00 100.41 ? 140 LEU C CG  1 
ATOM   5877 C CD1 . LEU C 2 138 ? 9.421   72.104 29.787  1.00 101.63 ? 140 LEU C CD1 1 
ATOM   5878 C CD2 . LEU C 2 138 ? 9.525   73.673 27.837  1.00 102.15 ? 140 LEU C CD2 1 
ATOM   5879 N N   . ARG C 2 139 ? 5.462   74.372 26.458  1.00 97.93  ? 141 ARG C N   1 
ATOM   5880 C CA  . ARG C 2 139 ? 4.372   74.015 25.562  1.00 98.03  ? 141 ARG C CA  1 
ATOM   5881 C C   . ARG C 2 139 ? 4.944   73.247 24.382  1.00 99.71  ? 141 ARG C C   1 
ATOM   5882 O O   . ARG C 2 139 ? 5.909   73.695 23.754  1.00 99.40  ? 141 ARG C O   1 
ATOM   5883 C CB  . ARG C 2 139 ? 3.614   75.261 25.087  1.00 97.04  ? 141 ARG C CB  1 
ATOM   5884 C CG  . ARG C 2 139 ? 2.796   75.930 26.185  1.00 100.76 ? 141 ARG C CG  1 
ATOM   5885 C CD  . ARG C 2 139 ? 1.758   76.892 25.631  1.00 103.08 ? 141 ARG C CD  1 
ATOM   5886 N NE  . ARG C 2 139 ? 1.254   77.785 26.672  1.00 107.21 ? 141 ARG C NE  1 
ATOM   5887 C CZ  . ARG C 2 139 ? 0.291   78.684 26.491  1.00 109.73 ? 141 ARG C CZ  1 
ATOM   5888 N NH1 . ARG C 2 139 ? -0.283  78.817 25.303  1.00 102.24 ? 141 ARG C NH1 1 
ATOM   5889 N NH2 . ARG C 2 139 ? -0.098  79.451 27.501  1.00 105.32 ? 141 ARG C NH2 1 
ATOM   5890 N N   . TRP C 2 140 ? 4.357   72.089 24.092  1.00 87.78  ? 142 TRP C N   1 
ATOM   5891 C CA  . TRP C 2 140 ? 4.825   71.229 23.017  1.00 88.45  ? 142 TRP C CA  1 
ATOM   5892 C C   . TRP C 2 140 ? 3.627   70.663 22.269  1.00 89.53  ? 142 TRP C C   1 
ATOM   5893 O O   . TRP C 2 140 ? 2.478   70.788 22.700  1.00 88.36  ? 142 TRP C O   1 
ATOM   5894 C CB  . TRP C 2 140 ? 5.709   70.095 23.551  1.00 90.18  ? 142 TRP C CB  1 
ATOM   5895 C CG  . TRP C 2 140 ? 5.004   69.192 24.516  1.00 91.76  ? 142 TRP C CG  1 
ATOM   5896 C CD1 . TRP C 2 140 ? 4.351   68.031 24.224  1.00 94.02  ? 142 TRP C CD1 1 
ATOM   5897 C CD2 . TRP C 2 140 ? 4.881   69.375 25.933  1.00 91.44  ? 142 TRP C CD2 1 
ATOM   5898 N NE1 . TRP C 2 140 ? 3.827   67.481 25.368  1.00 93.02  ? 142 TRP C NE1 1 
ATOM   5899 C CE2 . TRP C 2 140 ? 4.139   68.286 26.431  1.00 92.93  ? 142 TRP C CE2 1 
ATOM   5900 C CE3 . TRP C 2 140 ? 5.325   70.354 26.827  1.00 90.80  ? 142 TRP C CE3 1 
ATOM   5901 C CZ2 . TRP C 2 140 ? 3.832   68.149 27.784  1.00 91.45  ? 142 TRP C CZ2 1 
ATOM   5902 C CZ3 . TRP C 2 140 ? 5.019   70.215 28.170  1.00 91.03  ? 142 TRP C CZ3 1 
ATOM   5903 C CH2 . TRP C 2 140 ? 4.280   69.121 28.634  1.00 91.31  ? 142 TRP C CH2 1 
ATOM   5904 N N   . LEU C 2 141 ? 3.911   70.034 21.131  1.00 88.94  ? 143 LEU C N   1 
ATOM   5905 C CA  . LEU C 2 141 ? 2.888   69.420 20.305  1.00 88.74  ? 143 LEU C CA  1 
ATOM   5906 C C   . LEU C 2 141 ? 3.129   67.918 20.197  1.00 93.23  ? 143 LEU C C   1 
ATOM   5907 O O   . LEU C 2 141 ? 4.270   67.459 20.302  1.00 94.66  ? 143 LEU C O   1 
ATOM   5908 C CB  . LEU C 2 141 ? 2.865   70.039 18.899  1.00 86.85  ? 143 LEU C CB  1 
ATOM   5909 C CG  . LEU C 2 141 ? 2.204   71.414 18.756  1.00 84.71  ? 143 LEU C CG  1 
ATOM   5910 C CD1 . LEU C 2 141 ? 3.215   72.536 18.947  1.00 84.67  ? 143 LEU C CD1 1 
ATOM   5911 C CD2 . LEU C 2 141 ? 1.514   71.543 17.405  1.00 84.18  ? 143 LEU C CD2 1 
ATOM   5912 N N   . PRO C 2 142 ? 2.076   67.130 19.998  1.00 90.02  ? 144 PRO C N   1 
ATOM   5913 C CA  . PRO C 2 142 ? 2.240   65.675 19.867  1.00 93.19  ? 144 PRO C CA  1 
ATOM   5914 C C   . PRO C 2 142 ? 3.024   65.329 18.615  1.00 95.59  ? 144 PRO C C   1 
ATOM   5915 O O   . PRO C 2 142 ? 3.219   66.189 17.742  1.00 93.00  ? 144 PRO C O   1 
ATOM   5916 C CB  . PRO C 2 142 ? 0.792   65.165 19.781  1.00 90.71  ? 144 PRO C CB  1 
ATOM   5917 C CG  . PRO C 2 142 ? -0.032  66.243 20.402  1.00 86.83  ? 144 PRO C CG  1 
ATOM   5918 C CD  . PRO C 2 142 ? 0.657   67.522 20.035  1.00 86.12  ? 144 PRO C CD  1 
ATOM   5919 N N   . PRO C 2 143 ? 3.506   64.092 18.493  1.00 94.67  ? 145 PRO C N   1 
ATOM   5920 C CA  . PRO C 2 143 ? 4.238   63.692 17.281  1.00 94.41  ? 145 PRO C CA  1 
ATOM   5921 C C   . PRO C 2 143 ? 3.381   63.878 16.043  1.00 92.85  ? 145 PRO C C   1 
ATOM   5922 O O   . PRO C 2 143 ? 2.159   63.669 16.087  1.00 92.85  ? 145 PRO C O   1 
ATOM   5923 C CB  . PRO C 2 143 ? 4.554   62.207 17.528  1.00 97.69  ? 145 PRO C CB  1 
ATOM   5924 C CG  . PRO C 2 143 ? 3.633   61.787 18.636  1.00 99.88  ? 145 PRO C CG  1 
ATOM   5925 C CD  . PRO C 2 143 ? 3.461   63.004 19.484  1.00 97.58  ? 145 PRO C CD  1 
ATOM   5926 N N   . PRO C 2 144 ? 3.982   64.270 14.919  1.00 100.72 ? 146 PRO C N   1 
ATOM   5927 C CA  . PRO C 2 144 ? 3.179   64.624 13.741  1.00 98.68  ? 146 PRO C CA  1 
ATOM   5928 C C   . PRO C 2 144 ? 2.428   63.433 13.166  1.00 99.79  ? 146 PRO C C   1 
ATOM   5929 O O   . PRO C 2 144 ? 2.971   62.333 13.039  1.00 102.03 ? 146 PRO C O   1 
ATOM   5930 C CB  . PRO C 2 144 ? 4.221   65.153 12.746  1.00 97.18  ? 146 PRO C CB  1 
ATOM   5931 C CG  . PRO C 2 144 ? 5.420   65.497 13.577  1.00 97.52  ? 146 PRO C CG  1 
ATOM   5932 C CD  . PRO C 2 144 ? 5.418   64.506 14.700  1.00 100.21 ? 146 PRO C CD  1 
ATOM   5933 N N   . GLU C 2 145 ? 1.174   63.683 12.794  1.00 110.23 ? 147 GLU C N   1 
ATOM   5934 C CA  . GLU C 2 145 ? 0.302   62.705 12.143  1.00 109.81 ? 147 GLU C CA  1 
ATOM   5935 C C   . GLU C 2 145 ? 0.297   61.373 12.896  1.00 113.53 ? 147 GLU C C   1 
ATOM   5936 O O   . GLU C 2 145 ? 0.739   60.336 12.400  1.00 114.64 ? 147 GLU C O   1 
ATOM   5937 C CB  . GLU C 2 145 ? 0.695   62.526 10.675  1.00 108.73 ? 147 GLU C CB  1 
ATOM   5938 C CG  . GLU C 2 145 ? 0.519   63.798 9.856   1.00 108.64 ? 147 GLU C CG  1 
ATOM   5939 C CD  . GLU C 2 145 ? 0.489   63.542 8.362   1.00 113.09 ? 147 GLU C CD  1 
ATOM   5940 O OE1 . GLU C 2 145 ? 0.860   62.427 7.939   1.00 112.12 ? 147 GLU C OE1 1 
ATOM   5941 O OE2 . GLU C 2 145 ? 0.088   64.457 7.610   1.00 108.65 ? 147 GLU C OE2 1 
ATOM   5942 N N   . THR C 2 146 ? -0.216  61.429 14.125  1.00 103.92 ? 148 THR C N   1 
ATOM   5943 C CA  . THR C 2 146 ? -0.320  60.271 14.999  1.00 106.85 ? 148 THR C CA  1 
ATOM   5944 C C   . THR C 2 146 ? -1.718  60.259 15.606  1.00 106.77 ? 148 THR C C   1 
ATOM   5945 O O   . THR C 2 146 ? -2.140  61.263 16.207  1.00 104.17 ? 148 THR C O   1 
ATOM   5946 C CB  . THR C 2 146 ? 0.745   60.302 16.104  1.00 113.07 ? 148 THR C CB  1 
ATOM   5947 O OG1 . THR C 2 146 ? 2.050   60.318 15.512  1.00 114.11 ? 148 THR C OG1 1 
ATOM   5948 C CG2 . THR C 2 146 ? 0.617   59.083 17.004  1.00 115.98 ? 148 THR C CG2 1 
ATOM   5949 N N   . PRO C 2 147 ? -2.457  59.164 15.486  1.00 106.95 ? 149 PRO C N   1 
ATOM   5950 C CA  . PRO C 2 147 ? -3.826  59.118 16.007  1.00 103.10 ? 149 PRO C CA  1 
ATOM   5951 C C   . PRO C 2 147 ? -3.833  58.964 17.525  1.00 100.20 ? 149 PRO C C   1 
ATOM   5952 O O   . PRO C 2 147 ? -2.795  58.801 18.165  1.00 103.11 ? 149 PRO C O   1 
ATOM   5953 C CB  . PRO C 2 147 ? -4.423  57.891 15.316  1.00 103.26 ? 149 PRO C CB  1 
ATOM   5954 C CG  . PRO C 2 147 ? -3.257  57.010 15.030  1.00 107.83 ? 149 PRO C CG  1 
ATOM   5955 C CD  . PRO C 2 147 ? -2.052  57.894 14.858  1.00 108.42 ? 149 PRO C CD  1 
ATOM   5956 N N   . MET C 2 148 ? -5.041  59.011 18.090  1.00 108.81 ? 150 MET C N   1 
ATOM   5957 C CA  . MET C 2 148 ? -5.266  58.910 19.533  1.00 104.57 ? 150 MET C CA  1 
ATOM   5958 C C   . MET C 2 148 ? -4.495  59.999 20.283  1.00 105.31 ? 150 MET C C   1 
ATOM   5959 O O   . MET C 2 148 ? -3.695  59.733 21.183  1.00 106.74 ? 150 MET C O   1 
ATOM   5960 C CB  . MET C 2 148 ? -4.903  57.514 20.051  1.00 108.35 ? 150 MET C CB  1 
ATOM   5961 C CG  . MET C 2 148 ? -5.492  56.374 19.234  1.00 111.34 ? 150 MET C CG  1 
ATOM   5962 S SD  . MET C 2 148 ? -7.268  56.176 19.480  1.00 105.25 ? 150 MET C SD  1 
ATOM   5963 C CE  . MET C 2 148 ? -7.607  54.785 18.403  1.00 107.42 ? 150 MET C CE  1 
ATOM   5964 N N   . THR C 2 149 ? -4.754  61.248 19.883  1.00 102.36 ? 151 THR C N   1 
ATOM   5965 C CA  . THR C 2 149 ? -4.056  62.383 20.481  1.00 99.04  ? 151 THR C CA  1 
ATOM   5966 C C   . THR C 2 149 ? -4.369  62.511 21.967  1.00 99.75  ? 151 THR C C   1 
ATOM   5967 O O   . THR C 2 149 ? -3.483  62.818 22.773  1.00 99.00  ? 151 THR C O   1 
ATOM   5968 C CB  . THR C 2 149 ? -4.426  63.672 19.748  1.00 98.91  ? 151 THR C CB  1 
ATOM   5969 O OG1 . THR C 2 149 ? -4.193  63.511 18.343  1.00 99.51  ? 151 THR C OG1 1 
ATOM   5970 C CG2 . THR C 2 149 ? -3.599  64.840 20.266  1.00 95.24  ? 151 THR C CG2 1 
ATOM   5971 N N   . SER C 2 150 ? -5.622  62.271 22.351  1.00 102.13 ? 152 SER C N   1 
ATOM   5972 C CA  . SER C 2 150 ? -6.048  62.464 23.732  1.00 99.81  ? 152 SER C CA  1 
ATOM   5973 C C   . SER C 2 150 ? -5.530  61.391 24.681  1.00 101.71 ? 152 SER C C   1 
ATOM   5974 O O   . SER C 2 150 ? -5.767  61.501 25.888  1.00 99.84  ? 152 SER C O   1 
ATOM   5975 C CB  . SER C 2 150 ? -7.575  62.510 23.801  1.00 100.31 ? 152 SER C CB  1 
ATOM   5976 O OG  . SER C 2 150 ? -8.141  61.331 23.254  1.00 105.46 ? 152 SER C OG  1 
ATOM   5977 N N   . HIS C 2 151 ? -4.831  60.369 24.188  1.00 98.16  ? 153 HIS C N   1 
ATOM   5978 C CA  . HIS C 2 151 ? -4.385  59.266 25.031  1.00 98.92  ? 153 HIS C CA  1 
ATOM   5979 C C   . HIS C 2 151 ? -2.866  59.185 25.129  1.00 101.42 ? 153 HIS C C   1 
ATOM   5980 O O   . HIS C 2 151 ? -2.332  58.153 25.547  1.00 102.54 ? 153 HIS C O   1 
ATOM   5981 C CB  . HIS C 2 151 ? -4.959  57.943 24.524  1.00 101.29 ? 153 HIS C CB  1 
ATOM   5982 C CG  . HIS C 2 151 ? -6.447  57.958 24.363  1.00 101.64 ? 153 HIS C CG  1 
ATOM   5983 N ND1 . HIS C 2 151 ? -7.062  58.197 23.154  1.00 104.09 ? 153 HIS C ND1 1 
ATOM   5984 C CD2 . HIS C 2 151 ? -7.442  57.772 25.262  1.00 100.30 ? 153 HIS C CD2 1 
ATOM   5985 C CE1 . HIS C 2 151 ? -8.373  58.154 23.313  1.00 103.21 ? 153 HIS C CE1 1 
ATOM   5986 N NE2 . HIS C 2 151 ? -8.630  57.900 24.583  1.00 100.78 ? 153 HIS C NE2 1 
ATOM   5987 N N   . ILE C 2 152 ? -2.160  60.242 24.749  1.00 91.63  ? 154 ILE C N   1 
ATOM   5988 C CA  . ILE C 2 152 ? -0.703  60.258 24.798  1.00 92.25  ? 154 ILE C CA  1 
ATOM   5989 C C   . ILE C 2 152 ? -0.259  60.845 26.131  1.00 93.38  ? 154 ILE C C   1 
ATOM   5990 O O   . ILE C 2 152 ? -0.739  61.907 26.547  1.00 91.40  ? 154 ILE C O   1 
ATOM   5991 C CB  . ILE C 2 152 ? -0.118  61.055 23.620  1.00 92.67  ? 154 ILE C CB  1 
ATOM   5992 C CG1 . ILE C 2 152 ? -0.625  60.493 22.292  1.00 92.87  ? 154 ILE C CG1 1 
ATOM   5993 C CG2 . ILE C 2 152 ? 1.400   61.021 23.655  1.00 91.96  ? 154 ILE C CG2 1 
ATOM   5994 C CD1 . ILE C 2 152 ? -0.413  61.425 21.121  1.00 93.22  ? 154 ILE C CD1 1 
ATOM   5995 N N   . ARG C 2 153 ? 0.649   60.148 26.805  1.00 89.04  ? 155 ARG C N   1 
ATOM   5996 C CA  . ARG C 2 153 ? 1.234   60.612 28.053  1.00 89.77  ? 155 ARG C CA  1 
ATOM   5997 C C   . ARG C 2 153 ? 2.646   61.123 27.791  1.00 90.63  ? 155 ARG C C   1 
ATOM   5998 O O   . ARG C 2 153 ? 3.360   60.609 26.927  1.00 88.76  ? 155 ARG C O   1 
ATOM   5999 C CB  . ARG C 2 153 ? 1.258   59.490 29.095  1.00 90.35  ? 155 ARG C CB  1 
ATOM   6000 C CG  . ARG C 2 153 ? 1.316   59.969 30.537  1.00 95.14  ? 155 ARG C CG  1 
ATOM   6001 C CD  . ARG C 2 153 ? 1.198   58.803 31.507  1.00 98.64  ? 155 ARG C CD  1 
ATOM   6002 N NE  . ARG C 2 153 ? 2.409   57.986 31.525  1.00 99.33  ? 155 ARG C NE  1 
ATOM   6003 C CZ  . ARG C 2 153 ? 2.463   56.735 31.970  1.00 106.64 ? 155 ARG C CZ  1 
ATOM   6004 N NH1 . ARG C 2 153 ? 1.371   56.147 32.441  1.00 103.65 ? 155 ARG C NH1 1 
ATOM   6005 N NH2 . ARG C 2 153 ? 3.610   56.070 31.945  1.00 104.38 ? 155 ARG C NH2 1 
ATOM   6006 N N   . TYR C 2 154 ? 3.042   62.147 28.541  1.00 87.14  ? 156 TYR C N   1 
ATOM   6007 C CA  . TYR C 2 154 ? 4.306   62.831 28.315  1.00 87.16  ? 156 TYR C CA  1 
ATOM   6008 C C   . TYR C 2 154 ? 5.162   62.817 29.575  1.00 88.69  ? 156 TYR C C   1 
ATOM   6009 O O   . TYR C 2 154 ? 4.715   62.445 30.663  1.00 89.20  ? 156 TYR C O   1 
ATOM   6010 C CB  . TYR C 2 154 ? 4.073   64.273 27.849  1.00 87.36  ? 156 TYR C CB  1 
ATOM   6011 C CG  . TYR C 2 154 ? 3.286   64.373 26.563  1.00 85.95  ? 156 TYR C CG  1 
ATOM   6012 C CD1 . TYR C 2 154 ? 3.915   64.245 25.333  1.00 86.52  ? 156 TYR C CD1 1 
ATOM   6013 C CD2 . TYR C 2 154 ? 1.915   64.596 26.579  1.00 83.67  ? 156 TYR C CD2 1 
ATOM   6014 C CE1 . TYR C 2 154 ? 3.203   64.334 24.154  1.00 84.82  ? 156 TYR C CE1 1 
ATOM   6015 C CE2 . TYR C 2 154 ? 1.195   64.688 25.404  1.00 82.41  ? 156 TYR C CE2 1 
ATOM   6016 C CZ  . TYR C 2 154 ? 1.845   64.555 24.195  1.00 85.24  ? 156 TYR C CZ  1 
ATOM   6017 O OH  . TYR C 2 154 ? 1.137   64.644 23.020  1.00 83.36  ? 156 TYR C OH  1 
ATOM   6018 N N   . GLU C 2 155 ? 6.417   63.230 29.400  1.00 86.75  ? 157 GLU C N   1 
ATOM   6019 C CA  . GLU C 2 155 ? 7.390   63.297 30.488  1.00 86.02  ? 157 GLU C CA  1 
ATOM   6020 C C   . GLU C 2 155 ? 8.486   64.265 30.073  1.00 87.58  ? 157 GLU C C   1 
ATOM   6021 O O   . GLU C 2 155 ? 9.145   64.047 29.052  1.00 86.06  ? 157 GLU C O   1 
ATOM   6022 C CB  . GLU C 2 155 ? 7.973   61.918 30.796  1.00 83.74  ? 157 GLU C CB  1 
ATOM   6023 C CG  . GLU C 2 155 ? 8.878   61.881 32.019  1.00 89.53  ? 157 GLU C CG  1 
ATOM   6024 C CD  . GLU C 2 155 ? 9.523   60.523 32.230  1.00 98.50  ? 157 GLU C CD  1 
ATOM   6025 O OE1 . GLU C 2 155 ? 9.015   59.745 33.067  1.00 99.83  ? 157 GLU C OE1 1 
ATOM   6026 O OE2 . GLU C 2 155 ? 10.524  60.224 31.545  1.00 95.56  ? 157 GLU C OE2 1 
ATOM   6027 N N   . VAL C 2 156 ? 8.684   65.322 30.852  1.00 88.28  ? 158 VAL C N   1 
ATOM   6028 C CA  . VAL C 2 156 ? 9.679   66.339 30.537  1.00 89.98  ? 158 VAL C CA  1 
ATOM   6029 C C   . VAL C 2 156 ? 10.942  66.054 31.335  1.00 89.19  ? 158 VAL C C   1 
ATOM   6030 O O   . VAL C 2 156 ? 10.897  65.489 32.435  1.00 89.86  ? 158 VAL C O   1 
ATOM   6031 C CB  . VAL C 2 156 ? 9.151   67.763 30.817  1.00 92.54  ? 158 VAL C CB  1 
ATOM   6032 C CG1 . VAL C 2 156 ? 8.028   68.111 29.852  1.00 91.10  ? 158 VAL C CG1 1 
ATOM   6033 C CG2 . VAL C 2 156 ? 8.685   67.885 32.257  1.00 93.14  ? 158 VAL C CG2 1 
ATOM   6034 N N   . ASP C 2 157 ? 12.084  66.447 30.775  1.00 101.47 ? 159 ASP C N   1 
ATOM   6035 C CA  . ASP C 2 157 ? 13.388  66.236 31.396  1.00 99.79  ? 159 ASP C CA  1 
ATOM   6036 C C   . ASP C 2 157 ? 14.021  67.594 31.665  1.00 103.00 ? 159 ASP C C   1 
ATOM   6037 O O   . ASP C 2 157 ? 14.351  68.331 30.728  1.00 103.81 ? 159 ASP C O   1 
ATOM   6038 C CB  . ASP C 2 157 ? 14.292  65.385 30.507  1.00 97.09  ? 159 ASP C CB  1 
ATOM   6039 C CG  . ASP C 2 157 ? 15.692  65.230 31.079  1.00 102.27 ? 159 ASP C CG  1 
ATOM   6040 O OD1 . ASP C 2 157 ? 15.868  64.434 32.026  1.00 107.58 ? 159 ASP C OD1 1 
ATOM   6041 O OD2 . ASP C 2 157 ? 16.608  65.949 30.618  1.00 101.61 ? 159 ASP C OD2 1 
ATOM   6042 N N   . VAL C 2 158 ? 14.186  67.920 32.943  1.00 109.69 ? 160 VAL C N   1 
ATOM   6043 C CA  . VAL C 2 158 ? 14.811  69.168 33.363  1.00 111.25 ? 160 VAL C CA  1 
ATOM   6044 C C   . VAL C 2 158 ? 16.290  68.882 33.595  1.00 110.56 ? 160 VAL C C   1 
ATOM   6045 O O   . VAL C 2 158 ? 16.663  68.261 34.594  1.00 110.26 ? 160 VAL C O   1 
ATOM   6046 C CB  . VAL C 2 158 ? 14.149  69.727 34.627  1.00 113.82 ? 160 VAL C CB  1 
ATOM   6047 C CG1 . VAL C 2 158 ? 14.572  71.167 34.863  1.00 115.85 ? 160 VAL C CG1 1 
ATOM   6048 C CG2 . VAL C 2 158 ? 12.637  69.607 34.538  1.00 114.88 ? 160 VAL C CG2 1 
ATOM   6049 N N   . SER C 2 159 ? 17.133  69.327 32.670  1.00 121.30 ? 161 SER C N   1 
ATOM   6050 C CA  . SER C 2 159 ? 18.565  69.075 32.736  1.00 119.01 ? 161 SER C CA  1 
ATOM   6051 C C   . SER C 2 159 ? 19.304  70.318 33.217  1.00 122.39 ? 161 SER C C   1 
ATOM   6052 O O   . SER C 2 159 ? 18.993  71.438 32.803  1.00 125.42 ? 161 SER C O   1 
ATOM   6053 C CB  . SER C 2 159 ? 19.101  68.646 31.368  1.00 118.20 ? 161 SER C CB  1 
ATOM   6054 O OG  . SER C 2 159 ? 20.495  68.401 31.415  1.00 123.43 ? 161 SER C OG  1 
ATOM   6055 N N   . ALA C 2 160 ? 20.281  70.112 34.096  1.00 132.38 ? 162 ALA C N   1 
ATOM   6056 C CA  . ALA C 2 160 ? 21.114  71.206 34.572  1.00 134.39 ? 162 ALA C CA  1 
ATOM   6057 C C   . ALA C 2 160 ? 22.220  71.496 33.566  1.00 136.78 ? 162 ALA C C   1 
ATOM   6058 O O   . ALA C 2 160 ? 22.810  70.579 32.988  1.00 136.29 ? 162 ALA C O   1 
ATOM   6059 C CB  . ALA C 2 160 ? 21.717  70.868 35.935  1.00 134.38 ? 162 ALA C CB  1 
ATOM   6060 N N   . GLY C 2 161 ? 22.494  72.784 33.355  1.00 145.72 ? 163 GLY C N   1 
ATOM   6061 C CA  . GLY C 2 161 ? 23.486  73.163 32.361  1.00 145.87 ? 163 GLY C CA  1 
ATOM   6062 C C   . GLY C 2 161 ? 24.895  72.752 32.748  1.00 148.01 ? 163 GLY C C   1 
ATOM   6063 O O   . GLY C 2 161 ? 25.602  72.104 31.970  1.00 147.68 ? 163 GLY C O   1 
ATOM   6064 N N   . GLN C 2 162 ? 25.322  73.123 33.952  1.00 150.74 ? 164 GLN C N   1 
ATOM   6065 C CA  . GLN C 2 162 ? 26.684  72.855 34.393  1.00 151.48 ? 164 GLN C CA  1 
ATOM   6066 C C   . GLN C 2 162 ? 26.803  71.431 34.924  1.00 152.20 ? 164 GLN C C   1 
ATOM   6067 O O   . GLN C 2 162 ? 25.954  70.972 35.696  1.00 151.31 ? 164 GLN C O   1 
ATOM   6068 C CB  . GLN C 2 162 ? 27.099  73.857 35.469  1.00 153.57 ? 164 GLN C CB  1 
ATOM   6069 N N   . GLY C 2 163 ? 27.861  70.734 34.504  1.00 155.09 ? 165 GLY C N   1 
ATOM   6070 C CA  . GLY C 2 163 ? 28.135  69.395 34.992  1.00 155.18 ? 165 GLY C CA  1 
ATOM   6071 C C   . GLY C 2 163 ? 27.082  68.374 34.591  1.00 154.98 ? 165 GLY C C   1 
ATOM   6072 O O   . GLY C 2 163 ? 26.399  68.500 33.569  1.00 154.17 ? 165 GLY C O   1 
ATOM   6073 N N   . ALA C 2 164 ? 26.954  67.340 35.421  1.00 154.92 ? 166 ALA C N   1 
ATOM   6074 C CA  . ALA C 2 164 ? 25.999  66.262 35.181  1.00 153.59 ? 166 ALA C CA  1 
ATOM   6075 C C   . ALA C 2 164 ? 24.589  66.747 35.498  1.00 152.56 ? 166 ALA C C   1 
ATOM   6076 O O   . ALA C 2 164 ? 24.251  66.987 36.662  1.00 151.64 ? 166 ALA C O   1 
ATOM   6077 C CB  . ALA C 2 164 ? 26.360  65.041 36.021  1.00 154.48 ? 166 ALA C CB  1 
ATOM   6078 N N   . GLY C 2 165 ? 23.762  66.889 34.464  1.00 146.88 ? 167 GLY C N   1 
ATOM   6079 C CA  . GLY C 2 165 ? 22.418  67.404 34.637  1.00 144.97 ? 167 GLY C CA  1 
ATOM   6080 C C   . GLY C 2 165 ? 21.336  66.355 34.485  1.00 144.32 ? 167 GLY C C   1 
ATOM   6081 O O   . GLY C 2 165 ? 21.015  65.931 33.371  1.00 144.46 ? 167 GLY C O   1 
ATOM   6082 N N   . SER C 2 166 ? 20.766  65.929 35.613  1.00 136.49 ? 168 SER C N   1 
ATOM   6083 C CA  . SER C 2 166 ? 19.652  64.987 35.613  1.00 134.55 ? 168 SER C CA  1 
ATOM   6084 C C   . SER C 2 166 ? 18.784  65.221 36.844  1.00 134.00 ? 168 SER C C   1 
ATOM   6085 O O   . SER C 2 166 ? 18.367  64.273 37.520  1.00 134.42 ? 168 SER C O   1 
ATOM   6086 C CB  . SER C 2 166 ? 20.145  63.539 35.567  1.00 137.56 ? 168 SER C CB  1 
ATOM   6087 O OG  . SER C 2 166 ? 20.877  63.285 34.380  1.00 142.22 ? 168 SER C OG  1 
ATOM   6088 N N   . VAL C 2 167 ? 18.512  66.490 37.151  1.00 126.45 ? 169 VAL C N   1 
ATOM   6089 C CA  . VAL C 2 167 ? 17.921  66.839 38.440  1.00 126.06 ? 169 VAL C CA  1 
ATOM   6090 C C   . VAL C 2 167 ? 16.467  66.386 38.518  1.00 125.09 ? 169 VAL C C   1 
ATOM   6091 O O   . VAL C 2 167 ? 16.039  65.802 39.520  1.00 125.62 ? 169 VAL C O   1 
ATOM   6092 C CB  . VAL C 2 167 ? 18.056  68.351 38.697  1.00 128.48 ? 169 VAL C CB  1 
ATOM   6093 C CG1 . VAL C 2 167 ? 19.205  68.625 39.654  1.00 130.72 ? 169 VAL C CG1 1 
ATOM   6094 C CG2 . VAL C 2 167 ? 18.265  69.095 37.386  1.00 129.04 ? 169 VAL C CG2 1 
ATOM   6095 N N   . GLN C 2 168 ? 15.684  66.649 37.473  1.00 111.11 ? 170 GLN C N   1 
ATOM   6096 C CA  . GLN C 2 168 ? 14.242  66.465 37.564  1.00 110.05 ? 170 GLN C CA  1 
ATOM   6097 C C   . GLN C 2 168 ? 13.687  65.815 36.305  1.00 109.77 ? 170 GLN C C   1 
ATOM   6098 O O   . GLN C 2 168 ? 14.154  66.082 35.194  1.00 109.21 ? 170 GLN C O   1 
ATOM   6099 C CB  . GLN C 2 168 ? 13.525  67.796 37.825  1.00 110.97 ? 170 GLN C CB  1 
ATOM   6100 C CG  . GLN C 2 168 ? 12.142  67.629 38.439  1.00 115.86 ? 170 GLN C CG  1 
ATOM   6101 C CD  . GLN C 2 168 ? 11.572  68.930 38.967  1.00 123.39 ? 170 GLN C CD  1 
ATOM   6102 O OE1 . GLN C 2 168 ? 12.289  69.920 39.112  1.00 123.36 ? 170 GLN C OE1 1 
ATOM   6103 N NE2 . GLN C 2 168 ? 10.279  68.932 39.268  1.00 121.46 ? 170 GLN C NE2 1 
ATOM   6104 N N   . ARG C 2 169 ? 12.691  64.952 36.500  1.00 98.99  ? 171 ARG C N   1 
ATOM   6105 C CA  . ARG C 2 169 ? 11.931  64.338 35.414  1.00 97.82  ? 171 ARG C CA  1 
ATOM   6106 C C   . ARG C 2 169 ? 10.476  64.311 35.860  1.00 99.32  ? 171 ARG C C   1 
ATOM   6107 O O   . ARG C 2 169 ? 10.121  63.564 36.777  1.00 102.15 ? 171 ARG C O   1 
ATOM   6108 C CB  . ARG C 2 169 ? 12.432  62.929 35.091  1.00 99.01  ? 171 ARG C CB  1 
ATOM   6109 C CG  . ARG C 2 169 ? 13.492  62.867 34.002  1.00 97.22  ? 171 ARG C CG  1 
ATOM   6110 C CD  . ARG C 2 169 ? 13.823  61.424 33.645  1.00 99.12  ? 171 ARG C CD  1 
ATOM   6111 N NE  . ARG C 2 169 ? 14.790  61.327 32.555  1.00 97.91  ? 171 ARG C NE  1 
ATOM   6112 C CZ  . ARG C 2 169 ? 15.274  60.181 32.085  1.00 99.74  ? 171 ARG C CZ  1 
ATOM   6113 N NH1 . ARG C 2 169 ? 14.884  59.028 32.612  1.00 102.95 ? 171 ARG C NH1 1 
ATOM   6114 N NH2 . ARG C 2 169 ? 16.151  60.186 31.091  1.00 98.93  ? 171 ARG C NH2 1 
ATOM   6115 N N   . VAL C 2 170 ? 9.640   65.121 35.215  1.00 94.11  ? 172 VAL C N   1 
ATOM   6116 C CA  . VAL C 2 170 ? 8.255   65.329 35.625  1.00 95.87  ? 172 VAL C CA  1 
ATOM   6117 C C   . VAL C 2 170 ? 7.341   64.601 34.652  1.00 96.38  ? 172 VAL C C   1 
ATOM   6118 O O   . VAL C 2 170 ? 7.482   64.742 33.431  1.00 94.76  ? 172 VAL C O   1 
ATOM   6119 C CB  . VAL C 2 170 ? 7.907   66.827 35.683  1.00 95.28  ? 172 VAL C CB  1 
ATOM   6120 C CG1 . VAL C 2 170 ? 6.450   67.022 36.077  1.00 97.70  ? 172 VAL C CG1 1 
ATOM   6121 C CG2 . VAL C 2 170 ? 8.832   67.552 36.645  1.00 95.54  ? 172 VAL C CG2 1 
ATOM   6122 N N   . GLU C 2 171 ? 6.399   63.830 35.193  1.00 97.83  ? 173 GLU C N   1 
ATOM   6123 C CA  . GLU C 2 171 ? 5.402   63.139 34.389  1.00 99.42  ? 173 GLU C CA  1 
ATOM   6124 C C   . GLU C 2 171 ? 4.198   64.047 34.178  1.00 100.34 ? 173 GLU C C   1 
ATOM   6125 O O   . GLU C 2 171 ? 3.656   64.606 35.137  1.00 101.79 ? 173 GLU C O   1 
ATOM   6126 C CB  . GLU C 2 171 ? 4.976   61.830 35.056  1.00 102.91 ? 173 GLU C CB  1 
ATOM   6127 C CG  . GLU C 2 171 ? 5.937   60.672 34.815  1.00 103.13 ? 173 GLU C CG  1 
ATOM   6128 C CD  . GLU C 2 171 ? 5.292   59.316 35.034  1.00 107.34 ? 173 GLU C CD  1 
ATOM   6129 O OE1 . GLU C 2 171 ? 5.384   58.789 36.164  1.00 109.99 ? 173 GLU C OE1 1 
ATOM   6130 O OE2 . GLU C 2 171 ? 4.678   58.787 34.084  1.00 108.65 ? 173 GLU C OE2 1 
ATOM   6131 N N   . ILE C 2 172 ? 3.787   64.191 32.924  1.00 100.16 ? 174 ILE C N   1 
ATOM   6132 C CA  . ILE C 2 172 ? 2.665   65.043 32.549  1.00 101.76 ? 174 ILE C CA  1 
ATOM   6133 C C   . ILE C 2 172 ? 1.415   64.185 32.467  1.00 105.79 ? 174 ILE C C   1 
ATOM   6134 O O   . ILE C 2 172 ? 1.457   63.051 31.971  1.00 106.94 ? 174 ILE C O   1 
ATOM   6135 C CB  . ILE C 2 172 ? 2.932   65.762 31.214  1.00 100.30 ? 174 ILE C CB  1 
ATOM   6136 C CG1 . ILE C 2 172 ? 4.351   66.328 31.198  1.00 96.61  ? 174 ILE C CG1 1 
ATOM   6137 C CG2 . ILE C 2 172 ? 1.910   66.870 30.987  1.00 102.37 ? 174 ILE C CG2 1 
ATOM   6138 C CD1 . ILE C 2 172 ? 4.557   67.464 32.165  1.00 95.88  ? 174 ILE C CD1 1 
ATOM   6139 N N   . LEU C 2 173 ? 0.302   64.718 32.961  1.00 108.52 ? 175 LEU C N   1 
ATOM   6140 C CA  . LEU C 2 173 ? -0.953  63.985 32.911  1.00 113.06 ? 175 LEU C CA  1 
ATOM   6141 C C   . LEU C 2 173 ? -1.397  63.787 31.466  1.00 114.70 ? 175 LEU C C   1 
ATOM   6142 O O   . LEU C 2 173 ? -1.116  64.605 30.585  1.00 113.18 ? 175 LEU C O   1 
ATOM   6143 C CB  . LEU C 2 173 ? -2.029  64.725 33.707  1.00 116.04 ? 175 LEU C CB  1 
ATOM   6144 C CG  . LEU C 2 173 ? -2.457  66.117 33.232  1.00 116.33 ? 175 LEU C CG  1 
ATOM   6145 C CD1 . LEU C 2 173 ? -3.663  66.056 32.298  1.00 120.72 ? 175 LEU C CD1 1 
ATOM   6146 C CD2 . LEU C 2 173 ? -2.738  67.025 34.421  1.00 117.26 ? 175 LEU C CD2 1 
ATOM   6147 N N   . GLU C 2 174 ? -2.097  62.680 31.232  1.00 118.53 ? 176 GLU C N   1 
ATOM   6148 C CA  . GLU C 2 174 ? -2.535  62.340 29.886  1.00 121.20 ? 176 GLU C CA  1 
ATOM   6149 C C   . GLU C 2 174 ? -3.513  63.382 29.359  1.00 123.94 ? 176 GLU C C   1 
ATOM   6150 O O   . GLU C 2 174 ? -4.419  63.823 30.069  1.00 126.50 ? 176 GLU C O   1 
ATOM   6151 C CB  . GLU C 2 174 ? -3.182  60.951 29.889  1.00 125.82 ? 176 GLU C CB  1 
ATOM   6152 C CG  . GLU C 2 174 ? -4.062  60.651 28.686  1.00 130.84 ? 176 GLU C CG  1 
ATOM   6153 C CD  . GLU C 2 174 ? -4.901  59.402 28.882  1.00 136.54 ? 176 GLU C CD  1 
ATOM   6154 O OE1 . GLU C 2 174 ? -4.646  58.664 29.857  1.00 136.24 ? 176 GLU C OE1 1 
ATOM   6155 O OE2 . GLU C 2 174 ? -5.818  59.160 28.066  1.00 141.96 ? 176 GLU C OE2 1 
ATOM   6156 N N   . GLY C 2 175 ? -3.321  63.779 28.099  1.00 124.02 ? 177 GLY C N   1 
ATOM   6157 C CA  . GLY C 2 175 ? -4.224  64.672 27.410  1.00 127.76 ? 177 GLY C CA  1 
ATOM   6158 C C   . GLY C 2 175 ? -3.769  66.115 27.306  1.00 125.05 ? 177 GLY C C   1 
ATOM   6159 O O   . GLY C 2 175 ? -4.203  66.816 26.385  1.00 128.03 ? 177 GLY C O   1 
ATOM   6160 N N   . ARG C 2 176 ? -2.913  66.579 28.211  1.00 120.23 ? 178 ARG C N   1 
ATOM   6161 C CA  . ARG C 2 176 ? -2.428  67.952 28.173  1.00 118.07 ? 178 ARG C CA  1 
ATOM   6162 C C   . ARG C 2 176 ? -1.030  68.006 27.570  1.00 113.61 ? 178 ARG C C   1 
ATOM   6163 O O   . ARG C 2 176 ? -0.208  67.113 27.793  1.00 110.67 ? 178 ARG C O   1 
ATOM   6164 C CB  . ARG C 2 176 ? -2.421  68.581 29.570  1.00 116.69 ? 178 ARG C CB  1 
ATOM   6165 C CG  . ARG C 2 176 ? -2.030  70.054 29.567  1.00 115.58 ? 178 ARG C CG  1 
ATOM   6166 C CD  . ARG C 2 176 ? -2.754  70.850 30.638  1.00 117.94 ? 178 ARG C CD  1 
ATOM   6167 N NE  . ARG C 2 176 ? -4.192  70.598 30.635  1.00 123.41 ? 178 ARG C NE  1 
ATOM   6168 C CZ  . ARG C 2 176 ? -4.879  70.195 31.699  1.00 125.44 ? 178 ARG C CZ  1 
ATOM   6169 N NH1 . ARG C 2 176 ? -4.257  70.005 32.855  1.00 122.58 ? 178 ARG C NH1 1 
ATOM   6170 N NH2 . ARG C 2 176 ? -6.187  69.986 31.610  1.00 130.95 ? 178 ARG C NH2 1 
ATOM   6171 N N   . THR C 2 177 ? -0.772  69.061 26.794  1.00 113.76 ? 179 THR C N   1 
ATOM   6172 C CA  . THR C 2 177 ? 0.484   69.237 26.078  1.00 110.47 ? 179 THR C CA  1 
ATOM   6173 C C   . THR C 2 177 ? 1.287   70.428 26.594  1.00 107.54 ? 179 THR C C   1 
ATOM   6174 O O   . THR C 2 177 ? 2.125   70.969 25.866  1.00 106.24 ? 179 THR C O   1 
ATOM   6175 C CB  . THR C 2 177 ? 0.217   69.391 24.581  1.00 113.98 ? 179 THR C CB  1 
ATOM   6176 O OG1 . THR C 2 177 ? -0.743  70.434 24.373  1.00 118.30 ? 179 THR C OG1 1 
ATOM   6177 C CG2 . THR C 2 177 ? -0.330  68.096 24.007  1.00 116.93 ? 179 THR C CG2 1 
ATOM   6178 N N   . GLU C 2 178 ? 1.044   70.852 27.832  1.00 107.07 ? 180 GLU C N   1 
ATOM   6179 C CA  . GLU C 2 178 ? 1.766   71.973 28.415  1.00 105.10 ? 180 GLU C CA  1 
ATOM   6180 C C   . GLU C 2 178 ? 1.854   71.778 29.921  1.00 103.70 ? 180 GLU C C   1 
ATOM   6181 O O   . GLU C 2 178 ? 1.032   71.086 30.526  1.00 105.39 ? 180 GLU C O   1 
ATOM   6182 C CB  . GLU C 2 178 ? 1.096   73.313 28.085  1.00 108.79 ? 180 GLU C CB  1 
ATOM   6183 C CG  . GLU C 2 178 ? -0.355  73.414 28.526  1.00 113.25 ? 180 GLU C CG  1 
ATOM   6184 C CD  . GLU C 2 178 ? -1.041  74.658 27.993  1.00 117.91 ? 180 GLU C CD  1 
ATOM   6185 O OE1 . GLU C 2 178 ? -0.367  75.703 27.871  1.00 117.36 ? 180 GLU C OE1 1 
ATOM   6186 O OE2 . GLU C 2 178 ? -2.252  74.589 27.691  1.00 122.72 ? 180 GLU C OE2 1 
ATOM   6187 N N   . CYS C 2 179 ? 2.870   72.394 30.522  1.00 112.08 ? 181 CYS C N   1 
ATOM   6188 C CA  . CYS C 2 179 ? 3.083   72.254 31.954  1.00 111.52 ? 181 CYS C CA  1 
ATOM   6189 C C   . CYS C 2 179 ? 3.748   73.505 32.511  1.00 112.79 ? 181 CYS C C   1 
ATOM   6190 O O   . CYS C 2 179 ? 4.407   74.262 31.793  1.00 112.57 ? 181 CYS C O   1 
ATOM   6191 C CB  . CYS C 2 179 ? 3.934   71.016 32.263  1.00 109.45 ? 181 CYS C CB  1 
ATOM   6192 S SG  . CYS C 2 179 ? 4.536   70.916 33.961  1.00 111.60 ? 181 CYS C SG  1 
ATOM   6193 N N   . VAL C 2 180 ? 3.564   73.703 33.815  1.00 112.87 ? 182 VAL C N   1 
ATOM   6194 C CA  . VAL C 2 180 ? 4.185   74.787 34.567  1.00 112.18 ? 182 VAL C CA  1 
ATOM   6195 C C   . VAL C 2 180 ? 5.075   74.133 35.615  1.00 110.73 ? 182 VAL C C   1 
ATOM   6196 O O   . VAL C 2 180 ? 4.578   73.462 36.529  1.00 111.10 ? 182 VAL C O   1 
ATOM   6197 C CB  . VAL C 2 180 ? 3.147   75.714 35.213  1.00 117.42 ? 182 VAL C CB  1 
ATOM   6198 C CG1 . VAL C 2 180 ? 3.832   76.767 36.070  1.00 118.59 ? 182 VAL C CG1 1 
ATOM   6199 C CG2 . VAL C 2 180 ? 2.291   76.374 34.141  1.00 120.27 ? 182 VAL C CG2 1 
ATOM   6200 N N   . LEU C 2 181 ? 6.383   74.327 35.486  1.00 117.05 ? 183 LEU C N   1 
ATOM   6201 C CA  . LEU C 2 181 ? 7.363   73.661 36.330  1.00 114.96 ? 183 LEU C CA  1 
ATOM   6202 C C   . LEU C 2 181 ? 7.611   74.439 37.617  1.00 117.62 ? 183 LEU C C   1 
ATOM   6203 O O   . LEU C 2 181 ? 7.439   75.659 37.675  1.00 119.76 ? 183 LEU C O   1 
ATOM   6204 C CB  . LEU C 2 181 ? 8.684   73.474 35.582  1.00 112.75 ? 183 LEU C CB  1 
ATOM   6205 C CG  . LEU C 2 181 ? 8.775   72.429 34.464  1.00 112.23 ? 183 LEU C CG  1 
ATOM   6206 C CD1 . LEU C 2 181 ? 7.959   72.811 33.236  1.00 113.49 ? 183 LEU C CD1 1 
ATOM   6207 C CD2 . LEU C 2 181 ? 10.226  72.209 34.084  1.00 110.63 ? 183 LEU C CD2 1 
ATOM   6208 N N   . SER C 2 182 ? 8.001   73.708 38.659  1.00 122.47 ? 184 SER C N   1 
ATOM   6209 C CA  . SER C 2 182 ? 8.304   74.283 39.960  1.00 124.04 ? 184 SER C CA  1 
ATOM   6210 C C   . SER C 2 182 ? 9.627   73.722 40.470  1.00 123.85 ? 184 SER C C   1 
ATOM   6211 O O   . SER C 2 182 ? 10.171  72.758 39.924  1.00 121.44 ? 184 SER C O   1 
ATOM   6212 C CB  . SER C 2 182 ? 7.179   74.007 40.967  1.00 127.05 ? 184 SER C CB  1 
ATOM   6213 O OG  . SER C 2 182 ? 6.912   72.619 41.062  1.00 128.62 ? 184 SER C OG  1 
ATOM   6214 N N   . ASN C 2 183 ? 10.141  74.349 41.529  1.00 124.04 ? 185 ASN C N   1 
ATOM   6215 C CA  . ASN C 2 183 ? 11.352  73.907 42.225  1.00 123.82 ? 185 ASN C CA  1 
ATOM   6216 C C   . ASN C 2 183 ? 12.561  73.877 41.286  1.00 123.69 ? 185 ASN C C   1 
ATOM   6217 O O   . ASN C 2 183 ? 13.179  72.837 41.052  1.00 121.32 ? 185 ASN C O   1 
ATOM   6218 C CB  . ASN C 2 183 ? 11.139  72.541 42.889  1.00 122.77 ? 185 ASN C CB  1 
ATOM   6219 C CG  . ASN C 2 183 ? 10.670  72.657 44.327  1.00 133.11 ? 185 ASN C CG  1 
ATOM   6220 O OD1 . ASN C 2 183 ? 11.479  72.767 45.249  1.00 132.91 ? 185 ASN C OD1 1 
ATOM   6221 N ND2 . ASN C 2 183 ? 9.357   72.627 44.526  1.00 131.70 ? 185 ASN C ND2 1 
ATOM   6222 N N   . LEU C 2 184 ? 12.888  75.048 40.745  1.00 121.12 ? 186 LEU C N   1 
ATOM   6223 C CA  . LEU C 2 184 ? 14.090  75.234 39.945  1.00 121.46 ? 186 LEU C CA  1 
ATOM   6224 C C   . LEU C 2 184 ? 14.873  76.418 40.492  1.00 125.86 ? 186 LEU C C   1 
ATOM   6225 O O   . LEU C 2 184 ? 14.290  77.444 40.857  1.00 127.36 ? 186 LEU C O   1 
ATOM   6226 C CB  . LEU C 2 184 ? 13.771  75.425 38.450  1.00 120.07 ? 186 LEU C CB  1 
ATOM   6227 C CG  . LEU C 2 184 ? 12.673  76.373 37.965  1.00 120.41 ? 186 LEU C CG  1 
ATOM   6228 C CD1 . LEU C 2 184 ? 13.124  77.826 37.975  1.00 120.95 ? 186 LEU C CD1 1 
ATOM   6229 C CD2 . LEU C 2 184 ? 12.236  75.964 36.570  1.00 120.04 ? 186 LEU C CD2 1 
ATOM   6230 N N   . ARG C 2 185 ? 16.192  76.264 40.571  1.00 113.99 ? 187 ARG C N   1 
ATOM   6231 C CA  . ARG C 2 185 ? 17.044  77.319 41.098  1.00 118.23 ? 187 ARG C CA  1 
ATOM   6232 C C   . ARG C 2 185 ? 17.213  78.434 40.072  1.00 117.26 ? 187 ARG C C   1 
ATOM   6233 O O   . ARG C 2 185 ? 17.274  78.186 38.864  1.00 113.24 ? 187 ARG C O   1 
ATOM   6234 C CB  . ARG C 2 185 ? 18.410  76.756 41.494  1.00 120.12 ? 187 ARG C CB  1 
ATOM   6235 C CG  . ARG C 2 185 ? 19.135  76.042 40.365  1.00 116.05 ? 187 ARG C CG  1 
ATOM   6236 C CD  . ARG C 2 185 ? 20.474  75.470 40.805  1.00 118.75 ? 187 ARG C CD  1 
ATOM   6237 N NE  . ARG C 2 185 ? 21.441  76.512 41.138  1.00 123.17 ? 187 ARG C NE  1 
ATOM   6238 C CZ  . ARG C 2 185 ? 22.716  76.278 41.434  1.00 126.48 ? 187 ARG C CZ  1 
ATOM   6239 N NH1 . ARG C 2 185 ? 23.180  75.036 41.435  1.00 125.82 ? 187 ARG C NH1 1 
ATOM   6240 N NH2 . ARG C 2 185 ? 23.528  77.284 41.726  1.00 131.06 ? 187 ARG C NH2 1 
ATOM   6241 N N   . GLY C 2 186 ? 17.260  79.674 40.567  1.00 115.99 ? 188 GLY C N   1 
ATOM   6242 C CA  . GLY C 2 186 ? 17.426  80.818 39.697  1.00 116.33 ? 188 GLY C CA  1 
ATOM   6243 C C   . GLY C 2 186 ? 18.853  80.984 39.206  1.00 116.78 ? 188 GLY C C   1 
ATOM   6244 O O   . GLY C 2 186 ? 19.795  80.401 39.742  1.00 118.10 ? 188 GLY C O   1 
ATOM   6245 N N   . ARG C 2 187 ? 18.997  81.796 38.155  1.00 116.26 ? 189 ARG C N   1 
ATOM   6246 C CA  . ARG C 2 187 ? 20.300  82.085 37.550  1.00 117.10 ? 189 ARG C CA  1 
ATOM   6247 C C   . ARG C 2 187 ? 20.987  80.807 37.077  1.00 113.25 ? 189 ARG C C   1 
ATOM   6248 O O   . ARG C 2 187 ? 22.194  80.626 37.250  1.00 115.15 ? 189 ARG C O   1 
ATOM   6249 C CB  . ARG C 2 187 ? 21.201  82.866 38.512  1.00 123.44 ? 189 ARG C CB  1 
ATOM   6250 N N   . THR C 2 188 ? 20.208  79.907 36.481  1.00 108.07 ? 190 THR C N   1 
ATOM   6251 C CA  . THR C 2 188 ? 20.716  78.639 35.982  1.00 109.36 ? 190 THR C CA  1 
ATOM   6252 C C   . THR C 2 188 ? 20.109  78.356 34.616  1.00 103.73 ? 190 THR C C   1 
ATOM   6253 O O   . THR C 2 188 ? 18.907  78.543 34.413  1.00 99.82  ? 190 THR C O   1 
ATOM   6254 C CB  . THR C 2 188 ? 20.399  77.488 36.948  1.00 115.90 ? 190 THR C CB  1 
ATOM   6255 O OG1 . THR C 2 188 ? 20.817  77.847 38.271  1.00 121.38 ? 190 THR C OG1 1 
ATOM   6256 C CG2 . THR C 2 188 ? 21.113  76.213 36.520  1.00 118.81 ? 190 THR C CG2 1 
ATOM   6257 N N   . ARG C 2 189 ? 20.950  77.913 33.683  1.00 104.52 ? 191 ARG C N   1 
ATOM   6258 C CA  . ARG C 2 189 ? 20.516  77.610 32.323  1.00 100.23 ? 191 ARG C CA  1 
ATOM   6259 C C   . ARG C 2 189 ? 19.967  76.188 32.288  1.00 100.33 ? 191 ARG C C   1 
ATOM   6260 O O   . ARG C 2 189 ? 20.716  75.219 32.453  1.00 104.75 ? 191 ARG C O   1 
ATOM   6261 C CB  . ARG C 2 189 ? 21.679  77.787 31.351  1.00 102.91 ? 191 ARG C CB  1 
ATOM   6262 C CG  . ARG C 2 189 ? 21.296  77.759 29.881  1.00 99.44  ? 191 ARG C CG  1 
ATOM   6263 C CD  . ARG C 2 189 ? 22.541  77.660 29.013  1.00 103.46 ? 191 ARG C CD  1 
ATOM   6264 N NE  . ARG C 2 189 ? 22.225  77.431 27.607  1.00 101.12 ? 191 ARG C NE  1 
ATOM   6265 C CZ  . ARG C 2 189 ? 22.249  76.237 27.024  1.00 100.94 ? 191 ARG C CZ  1 
ATOM   6266 N NH1 . ARG C 2 189 ? 22.575  75.160 27.726  1.00 102.94 ? 191 ARG C NH1 1 
ATOM   6267 N NH2 . ARG C 2 189 ? 21.949  76.120 25.738  1.00 99.32  ? 191 ARG C NH2 1 
ATOM   6268 N N   . TYR C 2 190 ? 18.661  76.063 32.065  1.00 97.92  ? 192 TYR C N   1 
ATOM   6269 C CA  . TYR C 2 190 ? 17.981  74.776 32.021  1.00 98.33  ? 192 TYR C CA  1 
ATOM   6270 C C   . TYR C 2 190 ? 17.679  74.362 30.587  1.00 94.72  ? 192 TYR C C   1 
ATOM   6271 O O   . TYR C 2 190 ? 17.228  75.176 29.776  1.00 89.74  ? 192 TYR C O   1 
ATOM   6272 C CB  . TYR C 2 190 ? 16.676  74.814 32.819  1.00 97.97  ? 192 TYR C CB  1 
ATOM   6273 C CG  . TYR C 2 190 ? 16.850  74.732 34.316  1.00 105.23 ? 192 TYR C CG  1 
ATOM   6274 C CD1 . TYR C 2 190 ? 17.118  73.517 34.932  1.00 112.54 ? 192 TYR C CD1 1 
ATOM   6275 C CD2 . TYR C 2 190 ? 16.721  75.858 35.117  1.00 105.72 ? 192 TYR C CD2 1 
ATOM   6276 C CE1 . TYR C 2 190 ? 17.269  73.426 36.298  1.00 119.50 ? 192 TYR C CE1 1 
ATOM   6277 C CE2 . TYR C 2 190 ? 16.870  75.777 36.490  1.00 112.70 ? 192 TYR C CE2 1 
ATOM   6278 C CZ  . TYR C 2 190 ? 17.144  74.557 37.073  1.00 121.76 ? 192 TYR C CZ  1 
ATOM   6279 O OH  . TYR C 2 190 ? 17.293  74.460 38.435  1.00 129.24 ? 192 TYR C OH  1 
ATOM   6280 N N   . THR C 2 191 ? 17.939  73.094 30.282  1.00 95.17  ? 193 THR C N   1 
ATOM   6281 C CA  . THR C 2 191 ? 17.632  72.504 28.987  1.00 92.28  ? 193 THR C CA  1 
ATOM   6282 C C   . THR C 2 191 ? 16.488  71.512 29.154  1.00 92.99  ? 193 THR C C   1 
ATOM   6283 O O   . THR C 2 191 ? 16.549  70.630 30.018  1.00 98.37  ? 193 THR C O   1 
ATOM   6284 C CB  . THR C 2 191 ? 18.860  71.805 28.398  1.00 99.70  ? 193 THR C CB  1 
ATOM   6285 O OG1 . THR C 2 191 ? 19.994  72.678 28.484  1.00 100.59 ? 193 THR C OG1 1 
ATOM   6286 C CG2 . THR C 2 191 ? 18.619  71.431 26.944  1.00 96.57  ? 193 THR C CG2 1 
ATOM   6287 N N   . PHE C 2 192 ? 15.451  71.653 28.330  1.00 94.04  ? 194 PHE C N   1 
ATOM   6288 C CA  . PHE C 2 192 ? 14.243  70.849 28.444  1.00 92.32  ? 194 PHE C CA  1 
ATOM   6289 C C   . PHE C 2 192 ? 14.061  69.963 27.219  1.00 92.15  ? 194 PHE C C   1 
ATOM   6290 O O   . PHE C 2 192 ? 14.422  70.334 26.098  1.00 90.16  ? 194 PHE C O   1 
ATOM   6291 C CB  . PHE C 2 192 ? 12.986  71.717 28.618  1.00 87.22  ? 194 PHE C CB  1 
ATOM   6292 C CG  . PHE C 2 192 ? 13.114  72.778 29.672  1.00 88.61  ? 194 PHE C CG  1 
ATOM   6293 C CD1 . PHE C 2 192 ? 12.956  72.463 31.012  1.00 94.64  ? 194 PHE C CD1 1 
ATOM   6294 C CD2 . PHE C 2 192 ? 13.369  74.092 29.323  1.00 85.90  ? 194 PHE C CD2 1 
ATOM   6295 C CE1 . PHE C 2 192 ? 13.066  73.439 31.984  1.00 96.54  ? 194 PHE C CE1 1 
ATOM   6296 C CE2 . PHE C 2 192 ? 13.479  75.072 30.291  1.00 88.06  ? 194 PHE C CE2 1 
ATOM   6297 C CZ  . PHE C 2 192 ? 13.327  74.745 31.623  1.00 92.43  ? 194 PHE C CZ  1 
ATOM   6298 N N   . ALA C 2 193 ? 13.490  68.783 27.453  1.00 84.51  ? 195 ALA C N   1 
ATOM   6299 C CA  . ALA C 2 193 ? 13.112  67.857 26.397  1.00 83.74  ? 195 ALA C CA  1 
ATOM   6300 C C   . ALA C 2 193 ? 11.958  67.011 26.912  1.00 83.74  ? 195 ALA C C   1 
ATOM   6301 O O   . ALA C 2 193 ? 11.889  66.696 28.103  1.00 87.18  ? 195 ALA C O   1 
ATOM   6302 C CB  . ALA C 2 193 ? 14.283  66.971 25.961  1.00 90.85  ? 195 ALA C CB  1 
ATOM   6303 N N   . VAL C 2 194 ? 11.053  66.643 26.010  1.00 86.25  ? 196 VAL C N   1 
ATOM   6304 C CA  . VAL C 2 194 ? 9.809   65.982 26.383  1.00 84.41  ? 196 VAL C CA  1 
ATOM   6305 C C   . VAL C 2 194 ? 9.762   64.595 25.756  1.00 87.12  ? 196 VAL C C   1 
ATOM   6306 O O   . VAL C 2 194 ? 10.207  64.394 24.620  1.00 87.21  ? 196 VAL C O   1 
ATOM   6307 C CB  . VAL C 2 194 ? 8.580   66.824 25.972  1.00 78.45  ? 196 VAL C CB  1 
ATOM   6308 C CG1 . VAL C 2 194 ? 8.516   66.997 24.463  1.00 76.25  ? 196 VAL C CG1 1 
ATOM   6309 C CG2 . VAL C 2 194 ? 7.294   66.205 26.506  1.00 77.40  ? 196 VAL C CG2 1 
ATOM   6310 N N   . ARG C 2 195 ? 9.234   63.639 26.513  1.00 76.22  ? 197 ARG C N   1 
ATOM   6311 C CA  . ARG C 2 195 ? 9.039   62.265 26.078  1.00 77.95  ? 197 ARG C CA  1 
ATOM   6312 C C   . ARG C 2 195 ? 7.571   62.038 25.729  1.00 74.66  ? 197 ARG C C   1 
ATOM   6313 O O   . ARG C 2 195 ? 6.709   62.882 25.981  1.00 70.76  ? 197 ARG C O   1 
ATOM   6314 C CB  . ARG C 2 195 ? 9.483   61.293 27.173  1.00 83.94  ? 197 ARG C CB  1 
ATOM   6315 C CG  . ARG C 2 195 ? 10.671  60.421 26.818  1.00 92.54  ? 197 ARG C CG  1 
ATOM   6316 C CD  . ARG C 2 195 ? 10.994  59.484 27.972  1.00 101.75 ? 197 ARG C CD  1 
ATOM   6317 N NE  . ARG C 2 195 ? 12.195  58.691 27.733  1.00 110.68 ? 197 ARG C NE  1 
ATOM   6318 C CZ  . ARG C 2 195 ? 12.708  57.834 28.609  1.00 122.00 ? 197 ARG C CZ  1 
ATOM   6319 N NH1 . ARG C 2 195 ? 12.125  57.658 29.787  1.00 119.55 ? 197 ARG C NH1 1 
ATOM   6320 N NH2 . ARG C 2 195 ? 13.804  57.151 28.309  1.00 123.50 ? 197 ARG C NH2 1 
ATOM   6321 N N   . ALA C 2 196 ? 7.288   60.876 25.145  1.00 84.41  ? 198 ALA C N   1 
ATOM   6322 C CA  . ALA C 2 196 ? 5.920   60.549 24.768  1.00 81.79  ? 198 ALA C CA  1 
ATOM   6323 C C   . ALA C 2 196 ? 5.717   59.043 24.806  1.00 84.05  ? 198 ALA C C   1 
ATOM   6324 O O   . ALA C 2 196 ? 6.608   58.277 24.429  1.00 87.19  ? 198 ALA C O   1 
ATOM   6325 C CB  . ALA C 2 196 ? 5.581   61.088 23.373  1.00 78.64  ? 198 ALA C CB  1 
ATOM   6326 N N   . ARG C 2 197 ? 4.538   58.630 25.264  1.00 85.30  ? 199 ARG C N   1 
ATOM   6327 C CA  . ARG C 2 197 ? 4.149   57.227 25.245  1.00 87.07  ? 199 ARG C CA  1 
ATOM   6328 C C   . ARG C 2 197 ? 2.636   57.148 25.372  1.00 84.33  ? 199 ARG C C   1 
ATOM   6329 O O   . ARG C 2 197 ? 1.981   58.095 25.814  1.00 81.56  ? 199 ARG C O   1 
ATOM   6330 C CB  . ARG C 2 197 ? 4.823   56.427 26.364  1.00 91.01  ? 199 ARG C CB  1 
ATOM   6331 C CG  . ARG C 2 197 ? 4.221   56.653 27.740  1.00 90.97  ? 199 ARG C CG  1 
ATOM   6332 C CD  . ARG C 2 197 ? 4.838   55.717 28.762  1.00 98.90  ? 199 ARG C CD  1 
ATOM   6333 N NE  . ARG C 2 197 ? 4.432   54.332 28.547  1.00 103.30 ? 199 ARG C NE  1 
ATOM   6334 C CZ  . ARG C 2 197 ? 4.879   53.304 29.260  1.00 114.57 ? 199 ARG C CZ  1 
ATOM   6335 N NH1 . ARG C 2 197 ? 5.751   53.503 30.240  1.00 114.74 ? 199 ARG C NH1 1 
ATOM   6336 N NH2 . ARG C 2 197 ? 4.454   52.077 28.993  1.00 113.54 ? 199 ARG C NH2 1 
ATOM   6337 N N   . MET C 2 198 ? 2.092   56.003 24.975  1.00 91.65  ? 200 MET C N   1 
ATOM   6338 C CA  . MET C 2 198 ? 0.659   55.775 25.067  1.00 89.91  ? 200 MET C CA  1 
ATOM   6339 C C   . MET C 2 198 ? 0.292   55.363 26.489  1.00 92.28  ? 200 MET C C   1 
ATOM   6340 O O   . MET C 2 198 ? 0.865   54.416 27.037  1.00 97.06  ? 200 MET C O   1 
ATOM   6341 C CB  . MET C 2 198 ? 0.229   54.708 24.063  1.00 91.19  ? 200 MET C CB  1 
ATOM   6342 C CG  . MET C 2 198 ? 0.180   55.199 22.623  1.00 90.24  ? 200 MET C CG  1 
ATOM   6343 S SD  . MET C 2 198 ? -1.055  56.487 22.369  1.00 86.38  ? 200 MET C SD  1 
ATOM   6344 C CE  . MET C 2 198 ? -1.021  56.649 20.585  1.00 87.46  ? 200 MET C CE  1 
ATOM   6345 N N   . ALA C 2 199 ? -0.656  56.081 27.084  1.00 92.32  ? 201 ALA C N   1 
ATOM   6346 C CA  . ALA C 2 199 ? -0.991  55.877 28.486  1.00 93.69  ? 201 ALA C CA  1 
ATOM   6347 C C   . ALA C 2 199 ? -1.796  54.597 28.690  1.00 96.58  ? 201 ALA C C   1 
ATOM   6348 O O   . ALA C 2 199 ? -2.528  54.144 27.806  1.00 96.98  ? 201 ALA C O   1 
ATOM   6349 C CB  . ALA C 2 199 ? -1.773  57.073 29.027  1.00 92.85  ? 201 ALA C CB  1 
ATOM   6350 N N   . GLU C 2 200 ? -1.649  54.018 29.881  1.00 94.05  ? 202 GLU C N   1 
ATOM   6351 C CA  . GLU C 2 200 ? -2.415  52.847 30.271  1.00 97.86  ? 202 GLU C CA  1 
ATOM   6352 C C   . GLU C 2 200 ? -3.876  53.233 30.505  1.00 98.35  ? 202 GLU C C   1 
ATOM   6353 O O   . GLU C 2 200 ? -4.198  54.416 30.640  1.00 95.29  ? 202 GLU C O   1 
ATOM   6354 C CB  . GLU C 2 200 ? -1.810  52.229 31.531  1.00 101.63 ? 202 GLU C CB  1 
ATOM   6355 C CG  . GLU C 2 200 ? -0.551  51.409 31.285  1.00 108.06 ? 202 GLU C CG  1 
ATOM   6356 C CD  . GLU C 2 200 ? 0.671   52.271 31.027  1.00 112.83 ? 202 GLU C CD  1 
ATOM   6357 O OE1 . GLU C 2 200 ? 0.960   53.158 31.859  1.00 109.71 ? 202 GLU C OE1 1 
ATOM   6358 O OE2 . GLU C 2 200 ? 1.342   52.060 29.994  1.00 111.28 ? 202 GLU C OE2 1 
ATOM   6359 N N   . PRO C 2 201 ? -4.794  52.248 30.562  1.00 89.39  ? 203 PRO C N   1 
ATOM   6360 C CA  . PRO C 2 201 ? -4.647  50.791 30.445  1.00 94.07  ? 203 PRO C CA  1 
ATOM   6361 C C   . PRO C 2 201 ? -4.908  50.235 29.043  1.00 95.04  ? 203 PRO C C   1 
ATOM   6362 O O   . PRO C 2 201 ? -4.401  49.160 28.716  1.00 98.77  ? 203 PRO C O   1 
ATOM   6363 C CB  . PRO C 2 201 ? -5.688  50.266 31.435  1.00 98.05  ? 203 PRO C CB  1 
ATOM   6364 C CG  . PRO C 2 201 ? -6.743  51.351 31.503  1.00 96.10  ? 203 PRO C CG  1 
ATOM   6365 C CD  . PRO C 2 201 ? -6.182  52.614 30.890  1.00 89.43  ? 203 PRO C CD  1 
ATOM   6366 N N   . SER C 2 202 ? -5.696  50.950 28.235  1.00 95.78  ? 204 SER C N   1 
ATOM   6367 C CA  . SER C 2 202 ? -6.040  50.456 26.906  1.00 94.60  ? 204 SER C CA  1 
ATOM   6368 C C   . SER C 2 202 ? -4.822  50.378 25.995  1.00 95.01  ? 204 SER C C   1 
ATOM   6369 O O   . SER C 2 202 ? -4.794  49.556 25.072  1.00 95.92  ? 204 SER C O   1 
ATOM   6370 C CB  . SER C 2 202 ? -7.114  51.344 26.277  1.00 91.61  ? 204 SER C CB  1 
ATOM   6371 O OG  . SER C 2 202 ? -8.309  51.319 27.040  1.00 95.68  ? 204 SER C OG  1 
ATOM   6372 N N   . PHE C 2 203 ? -3.816  51.215 26.231  1.00 94.56  ? 205 PHE C N   1 
ATOM   6373 C CA  . PHE C 2 203 ? -2.622  51.271 25.400  1.00 93.78  ? 205 PHE C CA  1 
ATOM   6374 C C   . PHE C 2 203 ? -1.378  51.009 26.235  1.00 98.14  ? 205 PHE C C   1 
ATOM   6375 O O   . PHE C 2 203 ? -1.307  51.400 27.404  1.00 98.32  ? 205 PHE C O   1 
ATOM   6376 C CB  . PHE C 2 203 ? -2.484  52.630 24.712  1.00 89.57  ? 205 PHE C CB  1 
ATOM   6377 C CG  . PHE C 2 203 ? -3.500  52.876 23.644  1.00 87.91  ? 205 PHE C CG  1 
ATOM   6378 C CD1 . PHE C 2 203 ? -3.332  52.343 22.379  1.00 88.98  ? 205 PHE C CD1 1 
ATOM   6379 C CD2 . PHE C 2 203 ? -4.613  53.659 23.896  1.00 87.13  ? 205 PHE C CD2 1 
ATOM   6380 C CE1 . PHE C 2 203 ? -4.262  52.571 21.387  1.00 87.99  ? 205 PHE C CE1 1 
ATOM   6381 C CE2 . PHE C 2 203 ? -5.546  53.894 22.909  1.00 87.13  ? 205 PHE C CE2 1 
ATOM   6382 C CZ  . PHE C 2 203 ? -5.372  53.349 21.652  1.00 86.73  ? 205 PHE C CZ  1 
ATOM   6383 N N   . GLY C 2 204 ? -0.400  50.336 25.623  1.00 89.40  ? 206 GLY C N   1 
ATOM   6384 C CA  . GLY C 2 204 ? 0.888   50.133 26.249  1.00 92.87  ? 206 GLY C CA  1 
ATOM   6385 C C   . GLY C 2 204 ? 1.994   50.250 25.220  1.00 93.61  ? 206 GLY C C   1 
ATOM   6386 O O   . GLY C 2 204 ? 1.741   50.348 24.017  1.00 90.36  ? 206 GLY C O   1 
ATOM   6387 N N   . GLY C 2 205 ? 3.226   50.231 25.708  1.00 92.35  ? 207 GLY C N   1 
ATOM   6388 C CA  . GLY C 2 205 ? 4.356   50.319 24.796  1.00 92.70  ? 207 GLY C CA  1 
ATOM   6389 C C   . GLY C 2 205 ? 5.608   50.791 25.518  1.00 95.73  ? 207 GLY C C   1 
ATOM   6390 O O   . GLY C 2 205 ? 5.820   50.476 26.689  1.00 99.47  ? 207 GLY C O   1 
ATOM   6391 N N   . PHE C 2 206 ? 6.422   51.548 24.787  1.00 93.49  ? 208 PHE C N   1 
ATOM   6392 C CA  . PHE C 2 206 ? 7.707   52.023 25.271  1.00 95.18  ? 208 PHE C CA  1 
ATOM   6393 C C   . PHE C 2 206 ? 7.772   53.541 25.167  1.00 89.34  ? 208 PHE C C   1 
ATOM   6394 O O   . PHE C 2 206 ? 6.991   54.171 24.447  1.00 84.12  ? 208 PHE C O   1 
ATOM   6395 C CB  . PHE C 2 206 ? 8.862   51.406 24.473  1.00 100.42 ? 208 PHE C CB  1 
ATOM   6396 C CG  . PHE C 2 206 ? 8.563   50.037 23.931  1.00 104.69 ? 208 PHE C CG  1 
ATOM   6397 C CD1 . PHE C 2 206 ? 8.717   48.910 24.720  1.00 112.84 ? 208 PHE C CD1 1 
ATOM   6398 C CD2 . PHE C 2 206 ? 8.126   49.881 22.625  1.00 101.75 ? 208 PHE C CD2 1 
ATOM   6399 C CE1 . PHE C 2 206 ? 8.440   47.652 24.216  1.00 115.54 ? 208 PHE C CE1 1 
ATOM   6400 C CE2 . PHE C 2 206 ? 7.849   48.627 22.116  1.00 104.72 ? 208 PHE C CE2 1 
ATOM   6401 C CZ  . PHE C 2 206 ? 8.006   47.511 22.913  1.00 110.65 ? 208 PHE C CZ  1 
ATOM   6402 N N   . TRP C 2 207 ? 8.713   54.127 25.903  1.00 99.27  ? 209 TRP C N   1 
ATOM   6403 C CA  . TRP C 2 207 ? 8.940   55.562 25.812  1.00 93.95  ? 209 TRP C CA  1 
ATOM   6404 C C   . TRP C 2 207 ? 9.550   55.916 24.461  1.00 93.90  ? 209 TRP C C   1 
ATOM   6405 O O   . TRP C 2 207 ? 10.398  55.191 23.934  1.00 97.79  ? 209 TRP C O   1 
ATOM   6406 C CB  . TRP C 2 207 ? 9.860   56.038 26.937  1.00 95.35  ? 209 TRP C CB  1 
ATOM   6407 C CG  . TRP C 2 207 ? 9.163   56.284 28.240  1.00 94.40  ? 209 TRP C CG  1 
ATOM   6408 C CD1 . TRP C 2 207 ? 9.314   55.579 29.398  1.00 99.67  ? 209 TRP C CD1 1 
ATOM   6409 C CD2 . TRP C 2 207 ? 8.205   57.313 28.519  1.00 89.33  ? 209 TRP C CD2 1 
ATOM   6410 N NE1 . TRP C 2 207 ? 8.511   56.106 30.382  1.00 96.64  ? 209 TRP C NE1 1 
ATOM   6411 C CE2 . TRP C 2 207 ? 7.819   57.171 29.867  1.00 91.63  ? 209 TRP C CE2 1 
ATOM   6412 C CE3 . TRP C 2 207 ? 7.635   58.340 27.760  1.00 85.63  ? 209 TRP C CE3 1 
ATOM   6413 C CZ2 . TRP C 2 207 ? 6.890   58.017 30.471  1.00 87.89  ? 209 TRP C CZ2 1 
ATOM   6414 C CZ3 . TRP C 2 207 ? 6.715   59.179 28.361  1.00 83.49  ? 209 TRP C CZ3 1 
ATOM   6415 C CH2 . TRP C 2 207 ? 6.350   59.011 29.703  1.00 84.37  ? 209 TRP C CH2 1 
ATOM   6416 N N   . SER C 2 208 ? 9.107   57.036 23.899  1.00 90.13  ? 210 SER C N   1 
ATOM   6417 C CA  . SER C 2 208 ? 9.641   57.502 22.631  1.00 89.46  ? 210 SER C CA  1 
ATOM   6418 C C   . SER C 2 208 ? 10.956  58.246 22.845  1.00 91.89  ? 210 SER C C   1 
ATOM   6419 O O   . SER C 2 208 ? 11.386  58.503 23.972  1.00 92.66  ? 210 SER C O   1 
ATOM   6420 C CB  . SER C 2 208 ? 8.639   58.412 21.925  1.00 87.17  ? 210 SER C CB  1 
ATOM   6421 O OG  . SER C 2 208 ? 8.497   59.638 22.621  1.00 88.45  ? 210 SER C OG  1 
ATOM   6422 N N   . ALA C 2 209 ? 11.595  58.599 21.734  1.00 90.03  ? 211 ALA C N   1 
ATOM   6423 C CA  . ALA C 2 209 ? 12.821  59.376 21.793  1.00 91.17  ? 211 ALA C CA  1 
ATOM   6424 C C   . ALA C 2 209 ? 12.531  60.797 22.267  1.00 89.47  ? 211 ALA C C   1 
ATOM   6425 O O   . ALA C 2 209 ? 11.413  61.308 22.149  1.00 86.83  ? 211 ALA C O   1 
ATOM   6426 C CB  . ALA C 2 209 ? 13.508  59.404 20.428  1.00 92.72  ? 211 ALA C CB  1 
ATOM   6427 N N   . TRP C 2 210 ? 13.558  61.432 22.825  1.00 88.43  ? 212 TRP C N   1 
ATOM   6428 C CA  . TRP C 2 210 ? 13.416  62.790 23.330  1.00 86.74  ? 212 TRP C CA  1 
ATOM   6429 C C   . TRP C 2 210 ? 13.272  63.786 22.186  1.00 87.38  ? 212 TRP C C   1 
ATOM   6430 O O   . TRP C 2 210 ? 13.871  63.626 21.118  1.00 89.40  ? 212 TRP C O   1 
ATOM   6431 C CB  . TRP C 2 210 ? 14.616  63.160 24.201  1.00 87.82  ? 212 TRP C CB  1 
ATOM   6432 C CG  . TRP C 2 210 ? 14.686  62.393 25.484  1.00 87.85  ? 212 TRP C CG  1 
ATOM   6433 C CD1 . TRP C 2 210 ? 15.522  61.355 25.775  1.00 92.34  ? 212 TRP C CD1 1 
ATOM   6434 C CD2 . TRP C 2 210 ? 13.883  62.601 26.652  1.00 85.65  ? 212 TRP C CD2 1 
ATOM   6435 N NE1 . TRP C 2 210 ? 15.292  60.906 27.053  1.00 93.33  ? 212 TRP C NE1 1 
ATOM   6436 C CE2 . TRP C 2 210 ? 14.290  61.654 27.613  1.00 89.73  ? 212 TRP C CE2 1 
ATOM   6437 C CE3 . TRP C 2 210 ? 12.860  63.496 26.979  1.00 83.30  ? 212 TRP C CE3 1 
ATOM   6438 C CZ2 . TRP C 2 210 ? 13.710  61.577 28.878  1.00 89.03  ? 212 TRP C CZ2 1 
ATOM   6439 C CZ3 . TRP C 2 210 ? 12.286  63.418 28.235  1.00 83.02  ? 212 TRP C CZ3 1 
ATOM   6440 C CH2 . TRP C 2 210 ? 12.711  62.465 29.169  1.00 85.35  ? 212 TRP C CH2 1 
ATOM   6441 N N   . SER C 2 211 ? 12.461  64.816 22.416  1.00 86.64  ? 213 SER C N   1 
ATOM   6442 C CA  . SER C 2 211 ? 12.269  65.885 21.449  1.00 88.14  ? 213 SER C CA  1 
ATOM   6443 C C   . SER C 2 211 ? 13.533  66.733 21.324  1.00 91.49  ? 213 SER C C   1 
ATOM   6444 O O   . SER C 2 211 ? 14.496  66.586 22.081  1.00 91.54  ? 213 SER C O   1 
ATOM   6445 C CB  . SER C 2 211 ? 11.098  66.773 21.860  1.00 89.74  ? 213 SER C CB  1 
ATOM   6446 O OG  . SER C 2 211 ? 11.402  67.479 23.052  1.00 93.17  ? 213 SER C OG  1 
ATOM   6447 N N   . GLU C 2 212 ? 13.515  67.637 20.353  1.00 86.72  ? 214 GLU C N   1 
ATOM   6448 C CA  . GLU C 2 212 ? 14.608  68.582 20.181  1.00 89.39  ? 214 GLU C CA  1 
ATOM   6449 C C   . GLU C 2 212 ? 14.730  69.463 21.420  1.00 91.25  ? 214 GLU C C   1 
ATOM   6450 O O   . GLU C 2 212 ? 13.743  70.101 21.817  1.00 91.80  ? 214 GLU C O   1 
ATOM   6451 C CB  . GLU C 2 212 ? 14.388  69.435 18.936  1.00 93.02  ? 214 GLU C CB  1 
ATOM   6452 C CG  . GLU C 2 212 ? 14.738  68.727 17.635  1.00 96.42  ? 214 GLU C CG  1 
ATOM   6453 C CD  . GLU C 2 212 ? 16.204  68.332 17.558  1.00 103.59 ? 214 GLU C CD  1 
ATOM   6454 O OE1 . GLU C 2 212 ? 17.065  69.238 17.530  1.00 103.83 ? 214 GLU C OE1 1 
ATOM   6455 O OE2 . GLU C 2 212 ? 16.496  67.118 17.522  1.00 100.39 ? 214 GLU C OE2 1 
ATOM   6456 N N   . PRO C 2 213 ? 15.894  69.513 22.066  1.00 88.99  ? 215 PRO C N   1 
ATOM   6457 C CA  . PRO C 2 213 ? 16.014  70.267 23.318  1.00 89.46  ? 215 PRO C CA  1 
ATOM   6458 C C   . PRO C 2 213 ? 15.814  71.760 23.115  1.00 94.38  ? 215 PRO C C   1 
ATOM   6459 O O   . PRO C 2 213 ? 16.164  72.327 22.077  1.00 97.37  ? 215 PRO C O   1 
ATOM   6460 C CB  . PRO C 2 213 ? 17.444  69.961 23.781  1.00 90.26  ? 215 PRO C CB  1 
ATOM   6461 C CG  . PRO C 2 213 ? 17.823  68.703 23.065  1.00 90.62  ? 215 PRO C CG  1 
ATOM   6462 C CD  . PRO C 2 213 ? 17.128  68.781 21.741  1.00 89.58  ? 215 PRO C CD  1 
ATOM   6463 N N   . VAL C 2 214 ? 15.231  72.393 24.130  1.00 89.59  ? 216 VAL C N   1 
ATOM   6464 C CA  . VAL C 2 214 ? 15.023  73.836 24.165  1.00 93.04  ? 216 VAL C CA  1 
ATOM   6465 C C   . VAL C 2 214 ? 15.561  74.352 25.493  1.00 92.26  ? 216 VAL C C   1 
ATOM   6466 O O   . VAL C 2 214 ? 15.110  73.915 26.558  1.00 88.79  ? 216 VAL C O   1 
ATOM   6467 C CB  . VAL C 2 214 ? 13.543  74.212 23.995  1.00 92.64  ? 216 VAL C CB  1 
ATOM   6468 C CG1 . VAL C 2 214 ? 13.351  75.707 24.182  1.00 95.32  ? 216 VAL C CG1 1 
ATOM   6469 C CG2 . VAL C 2 214 ? 13.047  73.775 22.627  1.00 93.92  ? 216 VAL C CG2 1 
ATOM   6470 N N   . SER C 2 215 ? 16.518  75.273 25.433  1.00 92.27  ? 217 SER C N   1 
ATOM   6471 C CA  . SER C 2 215 ? 17.172  75.785 26.628  1.00 91.74  ? 217 SER C CA  1 
ATOM   6472 C C   . SER C 2 215 ? 16.665  77.179 26.979  1.00 92.94  ? 217 SER C C   1 
ATOM   6473 O O   . SER C 2 215 ? 16.342  77.983 26.102  1.00 95.59  ? 217 SER C O   1 
ATOM   6474 C CB  . SER C 2 215 ? 18.690  75.822 26.439  1.00 94.80  ? 217 SER C CB  1 
ATOM   6475 O OG  . SER C 2 215 ? 19.196  74.536 26.126  1.00 93.66  ? 217 SER C OG  1 
ATOM   6476 N N   . LEU C 2 216 ? 16.597  77.452 28.281  1.00 97.88  ? 218 LEU C N   1 
ATOM   6477 C CA  . LEU C 2 216 ? 16.147  78.740 28.790  1.00 98.24  ? 218 LEU C CA  1 
ATOM   6478 C C   . LEU C 2 216 ? 16.768  78.974 30.160  1.00 97.35  ? 218 LEU C C   1 
ATOM   6479 O O   . LEU C 2 216 ? 16.853  78.048 30.972  1.00 94.70  ? 218 LEU C O   1 
ATOM   6480 C CB  . LEU C 2 216 ? 14.616  78.800 28.879  1.00 97.01  ? 218 LEU C CB  1 
ATOM   6481 C CG  . LEU C 2 216 ? 13.993  80.073 29.453  1.00 99.02  ? 218 LEU C CG  1 
ATOM   6482 C CD1 . LEU C 2 216 ? 14.464  81.297 28.682  1.00 104.04 ? 218 LEU C CD1 1 
ATOM   6483 C CD2 . LEU C 2 216 ? 12.475  79.974 29.433  1.00 98.39  ? 218 LEU C CD2 1 
ATOM   6484 N N   . LEU C 2 217 ? 17.193  80.210 30.414  1.00 100.28 ? 219 LEU C N   1 
ATOM   6485 C CA  . LEU C 2 217 ? 17.798  80.586 31.686  1.00 99.38  ? 219 LEU C CA  1 
ATOM   6486 C C   . LEU C 2 217 ? 16.776  81.336 32.532  1.00 98.31  ? 219 LEU C C   1 
ATOM   6487 O O   . LEU C 2 217 ? 16.080  82.226 32.032  1.00 100.20 ? 219 LEU C O   1 
ATOM   6488 C CB  . LEU C 2 217 ? 19.060  81.427 31.474  1.00 102.66 ? 219 LEU C CB  1 
ATOM   6489 C CG  . LEU C 2 217 ? 18.969  82.831 30.873  1.00 106.31 ? 219 LEU C CG  1 
ATOM   6490 C CD1 . LEU C 2 217 ? 18.966  83.892 31.966  1.00 106.46 ? 219 LEU C CD1 1 
ATOM   6491 C CD2 . LEU C 2 217 ? 20.111  83.068 29.896  1.00 110.15 ? 219 LEU C CD2 1 
ATOM   6492 N N   . THR C 2 218 ? 16.672  80.958 33.805  1.00 106.21 ? 220 THR C N   1 
ATOM   6493 C CA  . THR C 2 218 ? 15.714  81.502 34.762  1.00 104.46 ? 220 THR C CA  1 
ATOM   6494 C C   . THR C 2 218 ? 16.302  82.710 35.488  1.00 106.66 ? 220 THR C C   1 
ATOM   6495 O O   . THR C 2 218 ? 17.495  82.726 35.801  1.00 107.58 ? 220 THR C O   1 
ATOM   6496 C CB  . THR C 2 218 ? 15.311  80.444 35.785  1.00 104.24 ? 220 THR C CB  1 
ATOM   6497 O OG1 . THR C 2 218 ? 16.450  80.085 36.578  1.00 104.51 ? 220 THR C OG1 1 
ATOM   6498 C CG2 . THR C 2 218 ? 14.786  79.207 35.076  1.00 102.71 ? 220 THR C CG2 1 
ATOM   6499 N N   . PRO C 2 219 ? 15.476  83.724 35.769  1.00 108.30 ? 221 PRO C N   1 
ATOM   6500 C CA  . PRO C 2 219 ? 15.974  84.913 36.476  1.00 109.33 ? 221 PRO C CA  1 
ATOM   6501 C C   . PRO C 2 219 ? 16.289  84.635 37.937  1.00 110.04 ? 221 PRO C C   1 
ATOM   6502 O O   . PRO C 2 219 ? 16.114  83.511 38.420  1.00 107.66 ? 221 PRO C O   1 
ATOM   6503 C CB  . PRO C 2 219 ? 14.820  85.918 36.336  1.00 111.67 ? 221 PRO C CB  1 
ATOM   6504 C CG  . PRO C 2 219 ? 13.952  85.375 35.233  1.00 112.39 ? 221 PRO C CG  1 
ATOM   6505 C CD  . PRO C 2 219 ? 14.089  83.893 35.313  1.00 108.51 ? 221 PRO C CD  1 
ATOM   6506 N N   . SER C 2 220 ? 16.738  85.662 38.651  1.00 108.15 ? 222 SER C N   1 
ATOM   6507 C CA  . SER C 2 220 ? 17.077  85.521 40.059  1.00 110.40 ? 222 SER C CA  1 
ATOM   6508 C C   . SER C 2 220 ? 15.850  85.761 40.934  1.00 113.06 ? 222 SER C C   1 
ATOM   6509 O O   . SER C 2 220 ? 15.309  86.863 40.975  1.00 117.06 ? 222 SER C O   1 
ATOM   6510 C CB  . SER C 2 220 ? 18.194  86.494 40.445  1.00 114.67 ? 222 SER C CB  1 
ATOM   6511 O OG  . SER C 2 220 ? 17.787  87.836 40.241  1.00 118.81 ? 222 SER C OG  1 
HETATM 6512 C C1  . GOL D 3 .   ? 48.530  45.398 -7.494  1.00 92.37  ? 501 GOL A C1  1 
HETATM 6513 O O1  . GOL D 3 .   ? 48.226  45.419 -8.854  1.00 92.03  ? 501 GOL A O1  1 
HETATM 6514 C C2  . GOL D 3 .   ? 48.033  44.043 -6.938  1.00 92.87  ? 501 GOL A C2  1 
HETATM 6515 O O2  . GOL D 3 .   ? 48.525  42.967 -7.669  1.00 93.08  ? 501 GOL A O2  1 
HETATM 6516 C C3  . GOL D 3 .   ? 48.515  44.024 -5.464  1.00 93.06  ? 501 GOL A C3  1 
HETATM 6517 O O3  . GOL D 3 .   ? 48.113  42.804 -4.919  1.00 93.13  ? 501 GOL A O3  1 
HETATM 6518 O O   . HOH E 4 .   ? 29.706  40.795 -0.465  1.00 80.19  ? 301 HOH B O   1 
HETATM 6519 O O   . HOH E 4 .   ? 7.929   76.918 -17.635 1.00 88.15  ? 302 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . ASP A 4   ? 1.2613 1.2601 2.9115 -0.2427 0.3023  -0.3815 3   ASP A N   
2    C CA  . ASP A 4   ? 1.2541 1.2846 2.9157 -0.2389 0.2945  -0.4033 3   ASP A CA  
3    C C   . ASP A 4   ? 1.2937 1.3221 2.9222 -0.2516 0.3283  -0.3738 3   ASP A C   
4    O O   . ASP A 4   ? 1.2981 1.3351 2.8921 -0.2463 0.3156  -0.3722 3   ASP A O   
5    C CB  . ASP A 4   ? 1.2627 1.3240 3.0004 -0.2381 0.2967  -0.4418 3   ASP A CB  
6    C CG  . ASP A 4   ? 1.2805 1.3535 3.0528 -0.2227 0.2601  -0.4764 3   ASP A CG  
7    O OD1 . ASP A 4   ? 1.2567 1.3324 2.9973 -0.2076 0.2207  -0.4849 3   ASP A OD1 
8    O OD2 . ASP A 4   ? 1.3147 1.3953 3.1455 -0.2256 0.2711  -0.4952 3   ASP A OD2 
9    N N   . LEU A 5   ? 1.1991 1.2178 2.8385 -0.2678 0.3716  -0.3505 4   LEU A N   
10   C CA  . LEU A 5   ? 1.2253 1.2464 2.8311 -0.2798 0.4069  -0.3209 4   LEU A CA  
11   C C   . LEU A 5   ? 1.2531 1.2436 2.7853 -0.2803 0.4114  -0.2787 4   LEU A C   
12   O O   . LEU A 5   ? 1.2682 1.2674 2.7610 -0.2831 0.4255  -0.2612 4   LEU A O   
13   C CB  . LEU A 5   ? 1.2565 1.2783 2.8943 -0.2966 0.4514  -0.3084 4   LEU A CB  
14   C CG  . LEU A 5   ? 1.2830 1.3367 2.9922 -0.2994 0.4569  -0.3476 4   LEU A CG  
15   C CD1 . LEU A 5   ? 1.2797 1.3282 3.0451 -0.2939 0.4396  -0.3748 4   LEU A CD1 
16   C CD2 . LEU A 5   ? 1.3358 1.3972 3.0530 -0.3178 0.5055  -0.3287 4   LEU A CD2 
17   N N   . GLY A 6   ? 1.2798 1.2369 2.7939 -0.2764 0.3996  -0.2641 5   GLY A N   
18   C CA  . GLY A 6   ? 1.2782 1.2043 2.7223 -0.2750 0.4015  -0.2260 5   GLY A CA  
19   C C   . GLY A 6   ? 1.2418 1.1727 2.6344 -0.2584 0.3662  -0.2346 5   GLY A C   
20   O O   . GLY A 6   ? 1.2430 1.1676 2.5596 -0.2503 0.3715  -0.2065 5   GLY A O   
21   N N   . LYS A 7   ? 1.2148 1.1586 2.6335 -0.2468 0.3262  -0.2719 6   LYS A N   
22   C CA  . LYS A 7   ? 1.2144 1.1644 2.5733 -0.2247 0.2886  -0.2788 6   LYS A CA  
23   C C   . LYS A 7   ? 1.2430 1.2220 2.5888 -0.2206 0.2951  -0.2835 6   LYS A C   
24   O O   . LYS A 7   ? 1.2509 1.2293 2.5333 -0.2045 0.2755  -0.2762 6   LYS A O   
25   C CB  . LYS A 7   ? 1.1991 1.1592 2.5927 -0.2136 0.2454  -0.3170 6   LYS A CB  
26   N N   . LYS A 8   ? 1.1938 1.1989 2.6013 -0.2351 0.3227  -0.2973 7   LYS A N   
27   C CA  . LYS A 8   ? 1.2065 1.2422 2.6069 -0.2324 0.3321  -0.3037 7   LYS A CA  
28   C C   . LYS A 8   ? 1.2499 1.2784 2.5835 -0.2356 0.3639  -0.2644 7   LYS A C   
29   O O   . LYS A 8   ? 1.2619 1.3113 2.5657 -0.2276 0.3639  -0.2662 7   LYS A O   
30   C CB  . LYS A 8   ? 1.2051 1.2745 2.6961 -0.2477 0.3526  -0.3337 7   LYS A CB  
31   C CG  . LYS A 8   ? 1.2614 1.3692 2.7666 -0.2403 0.3459  -0.3588 7   LYS A CG  
32   C CD  . LYS A 8   ? 1.2727 1.4047 2.8531 -0.2346 0.3155  -0.4063 7   LYS A CD  
33   C CE  . LYS A 8   ? 1.3135 1.4831 2.9146 -0.2266 0.3081  -0.4325 7   LYS A CE  
34   N NZ  . LYS A 8   ? 1.3253 1.5179 2.9957 -0.2177 0.2763  -0.4779 7   LYS A NZ  
35   N N   . LEU A 9   ? 1.2110 1.2114 2.5222 -0.2462 0.3897  -0.2300 8   LEU A N   
36   C CA  . LEU A 9   ? 1.2400 1.2345 2.4851 -0.2479 0.4191  -0.1909 8   LEU A CA  
37   C C   . LEU A 9   ? 1.2613 1.2353 2.4192 -0.2280 0.3929  -0.1731 8   LEU A C   
38   O O   . LEU A 9   ? 1.2795 1.2667 2.3851 -0.2201 0.3983  -0.1624 8   LEU A O   
39   C CB  . LEU A 9   ? 1.2520 1.2235 2.5083 -0.2662 0.4567  -0.1586 8   LEU A CB  
40   C CG  . LEU A 9   ? 1.3061 1.2718 2.4942 -0.2682 0.4890  -0.1147 8   LEU A CG  
41   C CD1 . LEU A 9   ? 1.3229 1.3315 2.5191 -0.2754 0.5181  -0.1202 8   LEU A CD1 
42   C CD2 . LEU A 9   ? 1.3279 1.2611 2.5228 -0.2827 0.5180  -0.0791 8   LEU A CD2 
43   N N   . LEU A 10  ? 1.2795 1.2234 2.4231 -0.2202 0.3648  -0.1717 9   LEU A N   
44   C CA  . LEU A 10  ? 1.2802 1.2050 2.3440 -0.2023 0.3401  -0.1565 9   LEU A CA  
45   C C   . LEU A 10  ? 1.2883 1.2339 2.3346 -0.1862 0.3097  -0.1799 9   LEU A C   
46   O O   . LEU A 10  ? 1.2964 1.2377 2.2764 -0.1737 0.3011  -0.1661 9   LEU A O   
47   C CB  . LEU A 10  ? 1.2601 1.1522 2.3192 -0.1986 0.3171  -0.1540 9   LEU A CB  
48   C CG  . LEU A 10  ? 1.2500 1.1463 2.3727 -0.1987 0.2895  -0.1896 9   LEU A CG  
49   C CD1 . LEU A 10  ? 1.2389 1.1441 2.3363 -0.1799 0.2459  -0.2115 9   LEU A CD1 
50   C CD2 . LEU A 10  ? 1.2468 1.1135 2.3865 -0.2047 0.2889  -0.1817 9   LEU A CD2 
51   N N   . LYS A 11  ? 1.1605 1.1286 2.2676 -0.1859 0.2928  -0.2153 10  LYS A N   
52   C CA  . LYS A 11  ? 1.1537 1.1415 2.2506 -0.1706 0.2653  -0.2363 10  LYS A CA  
53   C C   . LYS A 11  ? 1.1852 1.1995 2.2703 -0.1720 0.2894  -0.2330 10  LYS A C   
54   O O   . LYS A 11  ? 1.1902 1.2112 2.2365 -0.1580 0.2732  -0.2351 10  LYS A O   
55   C CB  . LYS A 11  ? 1.1433 1.1496 2.3112 -0.1689 0.2405  -0.2750 10  LYS A CB  
56   N N   . ALA A 12  ? 1.1385 1.1694 2.2578 -0.1889 0.3288  -0.2284 11  ALA A N   
57   C CA  . ALA A 12  ? 1.1575 1.2183 2.2646 -0.1914 0.3552  -0.2256 11  ALA A CA  
58   C C   . ALA A 12  ? 1.1950 1.2424 2.2217 -0.1878 0.3724  -0.1889 11  ALA A C   
59   O O   . ALA A 12  ? 1.2060 1.2728 2.1976 -0.1793 0.3749  -0.1891 11  ALA A O   
60   C CB  . ALA A 12  ? 1.1622 1.2490 2.3344 -0.2118 0.3928  -0.2340 11  ALA A CB  
61   N N   . ALA A 13  ? 1.1574 1.1729 2.1569 -0.1934 0.3836  -0.1587 12  ALA A N   
62   C CA  . ALA A 13  ? 1.1718 1.1735 2.0938 -0.1879 0.3966  -0.1239 12  ALA A CA  
63   C C   . ALA A 13  ? 1.1476 1.1381 2.0119 -0.1678 0.3623  -0.1259 12  ALA A C   
64   O O   . ALA A 13  ? 1.1515 1.1468 1.9570 -0.1599 0.3699  -0.1097 12  ALA A O   
65   C CB  . ALA A 13  ? 1.1983 1.1651 2.1092 -0.1968 0.4118  -0.0924 12  ALA A CB  
66   N N   . ARG A 14  ? 1.1198 1.0972 2.0002 -0.1593 0.3249  -0.1459 13  ARG A N   
67   C CA  . ARG A 14  ? 1.1121 1.0795 1.9416 -0.1414 0.2930  -0.1482 13  ARG A CA  
68   C C   . ARG A 14  ? 1.1417 1.1400 1.9753 -0.1331 0.2868  -0.1684 13  ARG A C   
69   O O   . ARG A 14  ? 1.1456 1.1426 1.9279 -0.1209 0.2772  -0.1625 13  ARG A O   
70   C CB  . ARG A 14  ? 1.0815 1.0279 1.9256 -0.1353 0.2559  -0.1619 13  ARG A CB  
71   C CG  . ARG A 14  ? 1.0962 1.0274 1.8838 -0.1187 0.2245  -0.1591 13  ARG A CG  
72   C CD  . ARG A 14  ? 1.0928 1.0061 1.8923 -0.1139 0.1906  -0.1708 13  ARG A CD  
73   N NE  . ARG A 14  ? 1.1087 1.0411 1.9719 -0.1141 0.1742  -0.2008 13  ARG A NE  
74   C CZ  . ARG A 14  ? 1.1421 1.0682 2.0302 -0.1110 0.1463  -0.2166 13  ARG A CZ  
75   N NH1 . ARG A 14  ? 1.0712 0.9729 1.9267 -0.1084 0.1327  -0.2059 13  ARG A NH1 
76   N NH2 . ARG A 14  ? 1.0901 1.0370 2.0366 -0.1098 0.1313  -0.2447 13  ARG A NH2 
77   N N   . ALA A 15  ? 1.1777 1.2045 2.0755 -0.1394 0.2923  -0.1941 14  ALA A N   
78   C CA  . ALA A 15  ? 1.1835 1.2422 2.0950 -0.1322 0.2884  -0.2161 14  ALA A CA  
79   C C   . ALA A 15  ? 1.2222 1.3099 2.1177 -0.1382 0.3259  -0.2075 14  ALA A C   
80   O O   . ALA A 15  ? 1.2214 1.3364 2.1186 -0.1309 0.3241  -0.2243 14  ALA A O   
81   C CB  . ALA A 15  ? 1.1695 1.2492 2.1598 -0.1350 0.2764  -0.2502 14  ALA A CB  
82   N N   . GLY A 16  ? 1.2342 1.3179 2.1156 -0.1511 0.3595  -0.1822 15  GLY A N   
83   C CA  . GLY A 16  ? 1.2558 1.3667 2.1089 -0.1553 0.3947  -0.1689 15  GLY A CA  
84   C C   . GLY A 16  ? 1.2704 1.4277 2.1776 -0.1651 0.4185  -0.1925 15  GLY A C   
85   O O   . GLY A 16  ? 1.2787 1.4691 2.1650 -0.1622 0.4354  -0.1957 15  GLY A O   
86   N N   . GLN A 17  ? 1.2350 1.3989 2.2136 -0.1766 0.4204  -0.2117 16  GLN A N   
87   C CA  . GLN A 17  ? 1.2311 1.4406 2.2674 -0.1883 0.4463  -0.2351 16  GLN A CA  
88   C C   . GLN A 17  ? 1.2706 1.4866 2.3019 -0.2074 0.4930  -0.2075 16  GLN A C   
89   O O   . GLN A 17  ? 1.2647 1.4668 2.3373 -0.2223 0.5054  -0.2019 16  GLN A O   
90   C CB  . GLN A 17  ? 1.2096 1.4250 2.3270 -0.1913 0.4265  -0.2701 16  GLN A CB  
91   C CG  . GLN A 17  ? 1.2521 1.4569 2.3744 -0.1719 0.3783  -0.2932 16  GLN A CG  
92   C CD  . GLN A 17  ? 1.3347 1.5045 2.4761 -0.1698 0.3486  -0.2946 16  GLN A CD  
93   O OE1 . GLN A 17  ? 1.3409 1.4792 2.4547 -0.1753 0.3542  -0.2681 16  GLN A OE1 
94   N NE2 . GLN A 17  ? 1.2778 1.4549 2.4682 -0.1611 0.3163  -0.3264 16  GLN A NE2 
95   N N   . ASP A 18  ? 1.3393 1.5782 2.3205 -0.2068 0.5195  -0.1901 17  ASP A N   
96   C CA  . ASP A 18  ? 1.3669 1.6110 2.3300 -0.2230 0.5642  -0.1569 17  ASP A CA  
97   C C   . ASP A 18  ? 1.3789 1.6517 2.4173 -0.2445 0.5947  -0.1723 17  ASP A C   
98   O O   . ASP A 18  ? 1.3881 1.6430 2.4442 -0.2612 0.6192  -0.1491 17  ASP A O   
99   C CB  . ASP A 18  ? 1.3972 1.6709 2.2949 -0.2161 0.5844  -0.1418 17  ASP A CB  
100  C CG  . ASP A 18  ? 1.4658 1.7677 2.3601 -0.2341 0.6353  -0.1190 17  ASP A CG  
101  O OD1 . ASP A 18  ? 1.4927 1.7643 2.3781 -0.2456 0.6543  -0.0834 17  ASP A OD1 
102  O OD2 . ASP A 18  ? 1.4880 1.8432 2.3888 -0.2366 0.6567  -0.1365 17  ASP A OD2 
103  N N   . ASP A 19  ? 1.3726 1.6902 2.4597 -0.2446 0.5939  -0.2125 18  ASP A N   
104  C CA  . ASP A 19  ? 1.3654 1.7152 2.5277 -0.2652 0.6235  -0.2315 18  ASP A CA  
105  C C   . ASP A 19  ? 1.3603 1.6813 2.5893 -0.2729 0.6067  -0.2446 18  ASP A C   
106  O O   . ASP A 19  ? 1.3602 1.6858 2.6384 -0.2938 0.6366  -0.2410 18  ASP A O   
107  C CB  . ASP A 19  ? 1.3552 1.7613 2.5563 -0.2615 0.6233  -0.2753 18  ASP A CB  
108  C CG  . ASP A 19  ? 1.4190 1.8685 2.5722 -0.2618 0.6552  -0.2657 18  ASP A CG  
109  O OD1 . ASP A 19  ? 1.4475 1.8829 2.5341 -0.2640 0.6766  -0.2231 18  ASP A OD1 
110  O OD2 . ASP A 19  ? 1.4342 1.9339 2.6176 -0.2591 0.6583  -0.3019 18  ASP A OD2 
111  N N   . GLU A 20  ? 1.3496 1.6421 2.5816 -0.2563 0.5595  -0.2603 19  GLU A N   
112  C CA  . GLU A 20  ? 1.3270 1.5946 2.6185 -0.2612 0.5398  -0.2747 19  GLU A CA  
113  C C   . GLU A 20  ? 1.3546 1.5783 2.6263 -0.2714 0.5528  -0.2366 19  GLU A C   
114  O O   . GLU A 20  ? 1.3412 1.5575 2.6742 -0.2871 0.5642  -0.2421 19  GLU A O   
115  C CB  . GLU A 20  ? 1.3115 1.5628 2.6030 -0.2394 0.4857  -0.2986 19  GLU A CB  
116  C CG  . GLU A 20  ? 1.3336 1.5429 2.6398 -0.2374 0.4582  -0.2956 19  GLU A CG  
117  C CD  . GLU A 20  ? 1.3916 1.6139 2.7909 -0.2499 0.4591  -0.3266 19  GLU A CD  
118  O OE1 . GLU A 20  ? 1.3557 1.6061 2.8059 -0.2433 0.4392  -0.3659 19  GLU A OE1 
119  O OE2 . GLU A 20  ? 1.3625 1.5672 2.7871 -0.2661 0.4794  -0.3126 19  GLU A OE2 
120  N N   . VAL A 21  ? 1.3548 1.5496 2.5454 -0.2624 0.5510  -0.1993 20  VAL A N   
121  C CA  . VAL A 21  ? 1.3632 1.5133 2.5339 -0.2694 0.5591  -0.1632 20  VAL A CA  
122  C C   . VAL A 21  ? 1.3992 1.5577 2.5978 -0.2937 0.6097  -0.1411 20  VAL A C   
123  O O   . VAL A 21  ? 1.3896 1.5231 2.6320 -0.3074 0.6186  -0.1334 20  VAL A O   
124  C CB  . VAL A 21  ? 1.3986 1.5206 2.4757 -0.2535 0.5472  -0.1295 20  VAL A CB  
125  C CG1 . VAL A 21  ? 1.4144 1.4972 2.4685 -0.2627 0.5666  -0.0870 20  VAL A CG1 
126  C CG2 . VAL A 21  ? 1.3778 1.4791 2.4358 -0.2330 0.4965  -0.1474 20  VAL A CG2 
127  N N   . ARG A 22  ? 1.3610 1.5565 2.5367 -0.2997 0.6442  -0.1312 21  ARG A N   
128  C CA  . ARG A 22  ? 1.3834 1.5905 2.5799 -0.3234 0.6956  -0.1067 21  ARG A CA  
129  C C   . ARG A 22  ? 1.3852 1.5999 2.6655 -0.3376 0.6997  -0.1354 21  ARG A C   
130  O O   . ARG A 22  ? 1.4053 1.6048 2.6936 -0.3514 0.7247  -0.1128 21  ARG A O   
131  C CB  . ARG A 22  ? 1.4120 1.6670 2.5684 -0.3249 0.7274  -0.0990 21  ARG A CB  
132  C CG  . ARG A 22  ? 1.4778 1.7213 2.5339 -0.3091 0.7258  -0.0623 21  ARG A CG  
133  C CD  . ARG A 22  ? 1.5384 1.8371 2.5594 -0.3097 0.7560  -0.0608 21  ARG A CD  
134  N NE  . ARG A 22  ? 1.5994 1.8898 2.5257 -0.2950 0.7567  -0.0252 21  ARG A NE  
135  C CZ  . ARG A 22  ? 1.6780 2.0145 2.5575 -0.2903 0.7769  -0.0217 21  ARG A CZ  
136  N NH1 . ARG A 22  ? 1.6240 2.0181 2.5430 -0.2997 0.7988  -0.0518 21  ARG A NH1 
137  N NH2 . ARG A 22  ? 1.6484 1.9760 2.4433 -0.2755 0.7746  0.0096  21  ARG A NH2 
138  N N   . ILE A 23  ? 1.3707 1.6060 2.7074 -0.3316 0.6717  -0.1845 22  ILE A N   
139  C CA  . ILE A 23  ? 1.3579 1.5971 2.7682 -0.3402 0.6683  -0.2153 22  ILE A CA  
140  C C   . ILE A 23  ? 1.3568 1.5488 2.7947 -0.3410 0.6493  -0.2106 22  ILE A C   
141  O O   . ILE A 23  ? 1.3596 1.5398 2.8376 -0.3524 0.6626  -0.2113 22  ILE A O   
142  C CB  . ILE A 23  ? 1.3432 1.6201 2.8015 -0.3304 0.6417  -0.2692 22  ILE A CB  
143  C CG1 . ILE A 23  ? 1.3579 1.6832 2.7910 -0.3291 0.6610  -0.2764 22  ILE A CG1 
144  C CG2 . ILE A 23  ? 1.3334 1.6139 2.8675 -0.3370 0.6361  -0.3035 22  ILE A CG2 
145  C CD1 . ILE A 23  ? 1.3654 1.7263 2.8422 -0.3172 0.6332  -0.3282 22  ILE A CD1 
146  N N   . LEU A 24  ? 1.3560 1.5217 2.7735 -0.3288 0.6178  -0.2069 23  LEU A N   
147  C CA  . LEU A 24  ? 1.3374 1.4609 2.7775 -0.3277 0.5966  -0.2050 23  LEU A CA  
148  C C   . LEU A 24  ? 1.3804 1.4667 2.7903 -0.3378 0.6243  -0.1579 23  LEU A C   
149  O O   . LEU A 24  ? 1.3722 1.4337 2.8201 -0.3431 0.6230  -0.1592 23  LEU A O   
150  C CB  . LEU A 24  ? 1.3133 1.4192 2.7301 -0.3114 0.5544  -0.2121 23  LEU A CB  
151  C CG  . LEU A 24  ? 1.3046 1.4318 2.7572 -0.2965 0.5119  -0.2604 23  LEU A CG  
152  C CD1 . LEU A 24  ? 1.3089 1.4134 2.6932 -0.2717 0.4677  -0.2560 23  LEU A CD1 
153  C CD2 . LEU A 24  ? 1.2926 1.4154 2.8204 -0.3002 0.4968  -0.2913 23  LEU A CD2 
154  N N   . MET A 25  ? 1.4078 1.4908 2.7499 -0.3390 0.6487  -0.1165 24  MET A N   
155  C CA  . MET A 25  ? 1.4369 1.4828 2.7445 -0.3459 0.6721  -0.0681 24  MET A CA  
156  C C   . MET A 25  ? 1.4836 1.5360 2.8253 -0.3624 0.7051  -0.0607 24  MET A C   
157  O O   . MET A 25  ? 1.5171 1.5344 2.8585 -0.3688 0.7174  -0.0310 24  MET A O   
158  C CB  . MET A 25  ? 1.4768 1.5227 2.7002 -0.3408 0.6892  -0.0269 24  MET A CB  
159  N N   . ALA A 26  ? 1.3770 1.4735 2.7499 -0.3693 0.7192  -0.0878 25  ALA A N   
160  C CA  . ALA A 26  ? 1.4233 1.5292 2.8307 -0.3863 0.7515  -0.0834 25  ALA A CA  
161  C C   . ALA A 26  ? 1.4247 1.5290 2.9177 -0.3901 0.7370  -0.1256 25  ALA A C   
162  O O   . ALA A 26  ? 1.4616 1.5565 2.9891 -0.4036 0.7595  -0.1178 25  ALA A O   
163  C CB  . ALA A 26  ? 1.4450 1.6026 2.8357 -0.3927 0.7785  -0.0880 25  ALA A CB  
164  N N   . ASN A 27  ? 1.3968 1.5111 2.9246 -0.3777 0.6994  -0.1702 26  ASN A N   
165  C CA  . ASN A 27  ? 1.3835 1.4987 2.9899 -0.3780 0.6825  -0.2126 26  ASN A CA  
166  C C   . ASN A 27  ? 1.4036 1.4739 3.0283 -0.3773 0.6721  -0.2005 26  ASN A C   
167  O O   . ASN A 27  ? 1.4172 1.4831 3.1022 -0.3839 0.6774  -0.2183 26  ASN A O   
168  C CB  . ASN A 27  ? 1.3334 1.4726 2.9662 -0.3624 0.6421  -0.2612 26  ASN A CB  
169  C CG  . ASN A 27  ? 1.4198 1.6077 3.0687 -0.3642 0.6511  -0.2898 26  ASN A CG  
170  O OD1 . ASN A 27  ? 1.4317 1.6390 3.0569 -0.3759 0.6870  -0.2701 26  ASN A OD1 
171  N ND2 . ASN A 27  ? 1.3458 1.5551 3.0343 -0.3514 0.6170  -0.3369 26  ASN A ND2 
172  N N   . GLY A 28  ? 1.3785 1.4166 2.9541 -0.3685 0.6571  -0.1724 27  GLY A N   
173  C CA  . GLY A 28  ? 1.3824 1.3790 2.9721 -0.3665 0.6463  -0.1608 27  GLY A CA  
174  C C   . GLY A 28  ? 1.3527 1.3296 2.9200 -0.3497 0.6051  -0.1678 27  GLY A C   
175  O O   . GLY A 28  ? 1.3366 1.2956 2.9395 -0.3437 0.5821  -0.1852 27  GLY A O   
176  N N   . ALA A 29  ? 1.3427 1.3250 2.8517 -0.3420 0.5955  -0.1556 28  ALA A N   
177  C CA  . ALA A 29  ? 1.3039 1.2664 2.7839 -0.3274 0.5581  -0.1585 28  ALA A CA  
178  C C   . ALA A 29  ? 1.3282 1.2482 2.7545 -0.3269 0.5669  -0.1110 28  ALA A C   
179  O O   . ALA A 29  ? 1.3620 1.2763 2.7455 -0.3342 0.5996  -0.0706 28  ALA A O   
180  C CB  . ALA A 29  ? 1.2605 1.2490 2.7079 -0.3188 0.5421  -0.1708 28  ALA A CB  
181  N N   . ASP A 30  ? 1.3498 1.2421 2.7776 -0.3171 0.5363  -0.1168 29  ASP A N   
182  C CA  . ASP A 30  ? 1.3676 1.2182 2.7495 -0.3144 0.5395  -0.0764 29  ASP A CA  
183  C C   . ASP A 30  ? 1.3748 1.2202 2.6791 -0.3081 0.5393  -0.0488 29  ASP A C   
184  O O   . ASP A 30  ? 1.3506 1.2077 2.6397 -0.2991 0.5124  -0.0700 29  ASP A O   
185  C CB  . ASP A 30  ? 1.3495 1.1785 2.7560 -0.3044 0.5044  -0.0965 29  ASP A CB  
186  C CG  . ASP A 30  ? 1.4064 1.1930 2.7729 -0.3008 0.5060  -0.0584 29  ASP A CG  
187  O OD1 . ASP A 30  ? 1.4559 1.2257 2.8200 -0.3095 0.5370  -0.0245 29  ASP A OD1 
188  O OD2 . ASP A 30  ? 1.3981 1.1687 2.7358 -0.2887 0.4754  -0.0628 29  ASP A OD2 
189  N N   . VAL A 31  ? 1.3786 1.2067 2.6333 -0.3121 0.5689  -0.0013 30  VAL A N   
190  C CA  . VAL A 31  ? 1.3889 1.2175 2.5689 -0.3057 0.5742  0.0258  30  VAL A CA  
191  C C   . VAL A 31  ? 1.3873 1.1850 2.5227 -0.2885 0.5380  0.0288  30  VAL A C   
192  O O   . VAL A 31  ? 1.3917 1.1974 2.4556 -0.2705 0.5180  0.0303  30  VAL A O   
193  C CB  . VAL A 31  ? 1.4525 1.2745 2.5870 -0.3116 0.6139  0.0759  30  VAL A CB  
194  C CG1 . VAL A 31  ? 1.4749 1.3116 2.5280 -0.3011 0.6192  0.0969  30  VAL A CG1 
195  C CG2 . VAL A 31  ? 1.4810 1.3302 2.6576 -0.3266 0.6451  0.0713  30  VAL A CG2 
196  N N   . ASN A 32  ? 1.3858 1.1515 2.5533 -0.2890 0.5242  0.0266  31  ASN A N   
197  C CA  . ASN A 32  ? 1.3697 1.1044 2.5012 -0.2750 0.4928  0.0300  31  ASN A CA  
198  C C   . ASN A 32  ? 1.3415 1.0801 2.5267 -0.2708 0.4560  -0.0166 31  ASN A C   
199  O O   . ASN A 32  ? 1.3298 1.0475 2.5377 -0.2671 0.4421  -0.0211 31  ASN A O   
200  C CB  . ASN A 32  ? 1.3988 1.0944 2.5087 -0.2744 0.5064  0.0713  31  ASN A CB  
201  C CG  . ASN A 32  ? 1.5315 1.2246 2.5829 -0.2767 0.5412  0.1196  31  ASN A CG  
202  O OD1 . ASN A 32  ? 1.5253 1.2396 2.5184 -0.2682 0.5413  0.1245  31  ASN A OD1 
203  N ND2 . ASN A 32  ? 1.5451 1.2189 2.5993 -0.2816 0.5635  0.1522  31  ASN A ND2 
204  N N   . ALA A 33  ? 1.3559 1.1276 2.5516 -0.2656 0.4360  -0.0526 32  ALA A N   
205  C CA  . ALA A 33  ? 1.3180 1.0986 2.5606 -0.2605 0.3997  -0.0972 32  ALA A CA  
206  C C   . ALA A 33  ? 1.3210 1.0879 2.5018 -0.2401 0.3601  -0.1008 32  ALA A C   
207  O O   . ALA A 33  ? 1.3347 1.1016 2.4374 -0.2272 0.3539  -0.0829 32  ALA A O   
208  C CB  . ALA A 33  ? 1.3114 1.1338 2.5874 -0.2604 0.3920  -0.1329 32  ALA A CB  
209  N N   . THR A 34  ? 1.3589 1.1169 2.5773 -0.2377 0.3338  -0.1261 33  THR A N   
210  C CA  . THR A 34  ? 1.3457 1.0915 2.5121 -0.2204 0.2976  -0.1313 33  THR A CA  
211  C C   . THR A 34  ? 1.3467 1.1217 2.4940 -0.2065 0.2630  -0.1622 33  THR A C   
212  O O   . THR A 34  ? 1.3299 1.1297 2.5362 -0.2094 0.2517  -0.1967 33  THR A O   
213  C CB  . THR A 34  ? 1.3583 1.0881 2.5687 -0.2216 0.2833  -0.1464 33  THR A CB  
214  O OG1 . THR A 34  ? 1.3353 1.0968 2.6040 -0.2192 0.2626  -0.1896 33  THR A OG1 
215  C CG2 . THR A 34  ? 1.3673 1.0776 2.5997 -0.2304 0.3149  -0.1181 33  THR A CG2 
216  N N   . ASP A 35  ? 1.3236 1.0953 2.3901 -0.1911 0.2462  -0.1495 34  ASP A N   
217  C CA  . ASP A 35  ? 1.3140 1.1071 2.3546 -0.1765 0.2116  -0.1735 34  ASP A CA  
218  C C   . ASP A 35  ? 1.3060 1.0946 2.3509 -0.1683 0.1762  -0.1961 34  ASP A C   
219  O O   . ASP A 35  ? 1.2959 1.0650 2.3622 -0.1733 0.1784  -0.1944 34  ASP A O   
220  C CB  . ASP A 35  ? 1.3388 1.1300 2.2949 -0.1647 0.2105  -0.1504 34  ASP A CB  
221  C CG  . ASP A 35  ? 1.3784 1.1931 2.3155 -0.1521 0.1823  -0.1713 34  ASP A CG  
222  O OD1 . ASP A 35  ? 1.3742 1.2071 2.3595 -0.1511 0.1617  -0.2026 34  ASP A OD1 
223  O OD2 . ASP A 35  ? 1.4063 1.2214 2.2816 -0.1426 0.1802  -0.1566 34  ASP A OD2 
224  N N   . ILE A 36  ? 1.1827 0.9909 2.2086 -0.1554 0.1432  -0.2180 35  ILE A N   
225  C CA  . ILE A 36  ? 1.1758 0.9838 2.1910 -0.1458 0.1086  -0.2372 35  ILE A CA  
226  C C   . ILE A 36  ? 1.1827 0.9633 2.1338 -0.1406 0.1079  -0.2125 35  ILE A C   
227  O O   . ILE A 36  ? 1.1790 0.9506 2.1380 -0.1395 0.0942  -0.2224 35  ILE A O   
228  C CB  . ILE A 36  ? 1.1777 1.0105 2.1732 -0.1320 0.0750  -0.2579 35  ILE A CB  
229  C CG1 . ILE A 36  ? 1.1756 1.0373 2.2449 -0.1356 0.0697  -0.2892 35  ILE A CG1 
230  C CG2 . ILE A 36  ? 1.1740 1.0068 2.1385 -0.1210 0.0409  -0.2707 35  ILE A CG2 
231  C CD1 . ILE A 36  ? 1.2207 1.0948 2.3007 -0.1393 0.0899  -0.2826 35  ILE A CD1 
232  N N   . TRP A 37  ? 1.2893 1.0588 2.1791 -0.1370 0.1226  -0.1824 36  TRP A N   
233  C CA  . TRP A 37  ? 1.2938 1.0376 2.1251 -0.1325 0.1266  -0.1569 36  TRP A CA  
234  C C   . TRP A 37  ? 1.3189 1.0403 2.1629 -0.1432 0.1620  -0.1287 36  TRP A C   
235  O O   . TRP A 37  ? 1.3286 1.0300 2.1201 -0.1387 0.1703  -0.1021 36  TRP A O   
236  C CB  . TRP A 37  ? 1.2995 1.0459 2.0544 -0.1205 0.1191  -0.1425 36  TRP A CB  
237  C CG  . TRP A 37  ? 1.2983 1.0631 2.0355 -0.1098 0.0853  -0.1645 36  TRP A CG  
238  C CD1 . TRP A 37  ? 1.3124 1.1011 2.0771 -0.1078 0.0741  -0.1834 36  TRP A CD1 
239  C CD2 . TRP A 37  ? 1.2946 1.0554 1.9821 -0.0992 0.0587  -0.1682 36  TRP A CD2 
240  N NE1 . TRP A 37  ? 1.3111 1.1092 2.0450 -0.0962 0.0416  -0.1961 36  TRP A NE1 
241  C CE2 . TRP A 37  ? 1.3133 1.0954 1.9990 -0.0916 0.0327  -0.1869 36  TRP A CE2 
242  C CE3 . TRP A 37  ? 1.2970 1.0394 1.9427 -0.0956 0.0544  -0.1578 36  TRP A CE3 
243  C CZ2 . TRP A 37  ? 1.3133 1.0982 1.9543 -0.0814 0.0045  -0.1930 36  TRP A CZ2 
244  C CZ3 . TRP A 37  ? 1.3023 1.0497 1.9058 -0.0860 0.0267  -0.1671 36  TRP A CZ3 
245  C CH2 . TRP A 37  ? 1.3100 1.0784 1.9103 -0.0795 0.0029  -0.1834 36  TRP A CH2 
246  N N   . ASP A 38  ? 1.2952 1.0204 2.2082 -0.1570 0.1830  -0.1335 37  ASP A N   
247  C CA  . ASP A 38  ? 1.3085 1.0116 2.2431 -0.1691 0.2178  -0.1059 37  ASP A CA  
248  C C   . ASP A 38  ? 1.3496 1.0491 2.2276 -0.1675 0.2434  -0.0704 37  ASP A C   
249  O O   . ASP A 38  ? 1.3653 1.0408 2.2194 -0.1691 0.2628  -0.0388 37  ASP A O   
250  C CB  . ASP A 38  ? 1.3099 0.9840 2.2481 -0.1686 0.2125  -0.0994 37  ASP A CB  
251  C CG  . ASP A 38  ? 1.3238 1.0035 2.3337 -0.1733 0.1944  -0.1353 37  ASP A CG  
252  O OD1 . ASP A 38  ? 1.3165 1.0092 2.3974 -0.1851 0.2055  -0.1520 37  ASP A OD1 
253  O OD2 . ASP A 38  ? 1.3362 1.0101 2.3330 -0.1653 0.1692  -0.1492 37  ASP A OD2 
254  N N   . ALA A 39  ? 1.3062 1.0312 2.1648 -0.1638 0.2429  -0.0764 38  ALA A N   
255  C CA  . ALA A 39  ? 1.3317 1.0619 2.1421 -0.1621 0.2666  -0.0491 38  ALA A CA  
256  C C   . ALA A 39  ? 1.3608 1.1076 2.2217 -0.1771 0.2987  -0.0467 38  ALA A C   
257  O O   . ALA A 39  ? 1.3479 1.1194 2.2545 -0.1809 0.2927  -0.0745 38  ALA A O   
258  C CB  . ALA A 39  ? 1.3326 1.0811 2.0893 -0.1480 0.2460  -0.0584 38  ALA A CB  
259  N N   . THR A 40  ? 1.3038 1.0380 2.1564 -0.1852 0.3328  -0.0133 39  THR A N   
260  C CA  . THR A 40  ? 1.3201 1.0706 2.2167 -0.2009 0.3676  -0.0073 39  THR A CA  
261  C C   . THR A 40  ? 1.3479 1.1327 2.2155 -0.1964 0.3740  -0.0123 39  THR A C   
262  O O   . THR A 40  ? 1.3497 1.1393 2.1539 -0.1815 0.3583  -0.0095 39  THR A O   
263  C CB  . THR A 40  ? 1.3827 1.1097 2.2719 -0.2102 0.4025  0.0342  39  THR A CB  
264  O OG1 . THR A 40  ? 1.4064 1.1263 2.2118 -0.1971 0.4047  0.0636  39  THR A OG1 
265  C CG2 . THR A 40  ? 1.3627 1.0554 2.2940 -0.2160 0.3976  0.0368  39  THR A CG2 
266  N N   . PRO A 41  ? 1.2557 1.0663 2.1732 -0.2095 0.3973  -0.0221 40  PRO A N   
267  C CA  . PRO A 41  ? 1.2714 1.1171 2.1655 -0.2058 0.4062  -0.0277 40  PRO A CA  
268  C C   . PRO A 41  ? 1.3192 1.1654 2.1390 -0.1995 0.4258  0.0067  40  PRO A C   
269  O O   . PRO A 41  ? 1.3289 1.2020 2.1149 -0.1909 0.4238  -0.0006 40  PRO A O   
270  C CB  . PRO A 41  ? 1.2821 1.1518 2.2496 -0.2244 0.4344  -0.0401 40  PRO A CB  
271  C CG  . PRO A 41  ? 1.2709 1.1246 2.3076 -0.2326 0.4221  -0.0596 40  PRO A CG  
272  C CD  . PRO A 41  ? 1.2498 1.0627 2.2545 -0.2273 0.4116  -0.0369 40  PRO A CD  
273  N N   . LEU A 42  ? 1.2702 1.0887 2.0656 -0.2027 0.4439  0.0429  41  LEU A N   
274  C CA  . LEU A 42  ? 1.3030 1.1225 2.0229 -0.1938 0.4584  0.0754  41  LEU A CA  
275  C C   . LEU A 42  ? 1.3064 1.1187 1.9629 -0.1733 0.4251  0.0697  41  LEU A C   
276  O O   . LEU A 42  ? 1.3273 1.1570 1.9266 -0.1629 0.4293  0.0789  41  LEU A O   
277  C CB  . LEU A 42  ? 1.3275 1.1164 2.0391 -0.2010 0.4836  0.1169  41  LEU A CB  
278  C CG  . LEU A 42  ? 1.3884 1.1804 2.0245 -0.1923 0.5025  0.1545  41  LEU A CG  
279  C CD1 . LEU A 42  ? 1.4144 1.2506 2.0441 -0.1982 0.5320  0.1557  41  LEU A CD1 
280  C CD2 . LEU A 42  ? 1.4203 1.1756 2.0516 -0.1975 0.5216  0.1964  41  LEU A CD2 
281  N N   . HIS A 43  ? 1.3603 1.1498 2.0274 -0.1676 0.3927  0.0533  42  HIS A N   
282  C CA  . HIS A 43  ? 1.3438 1.1283 1.9557 -0.1497 0.3611  0.0451  42  HIS A CA  
283  C C   . HIS A 43  ? 1.3507 1.1682 1.9533 -0.1426 0.3492  0.0201  42  HIS A C   
284  O O   . HIS A 43  ? 1.3611 1.1890 1.9075 -0.1306 0.3458  0.0255  42  HIS A O   
285  C CB  . HIS A 43  ? 1.3105 1.0701 1.9428 -0.1470 0.3297  0.0286  42  HIS A CB  
286  C CG  . HIS A 43  ? 1.3283 1.0528 1.9556 -0.1486 0.3338  0.0519  42  HIS A CG  
287  N ND1 . HIS A 43  ? 1.3234 1.0303 2.0133 -0.1611 0.3393  0.0492  42  HIS A ND1 
288  C CD2 . HIS A 43  ? 1.3514 1.0551 1.9222 -0.1386 0.3323  0.0765  42  HIS A CD2 
289  C CE1 . HIS A 43  ? 1.3296 1.0051 2.0029 -0.1588 0.3410  0.0720  42  HIS A CE1 
290  N NE2 . HIS A 43  ? 1.3484 1.0215 1.9488 -0.1449 0.3364  0.0892  42  HIS A NE2 
291  N N   . LEU A 44  ? 1.2143 1.0491 1.8755 -0.1492 0.3421  -0.0088 43  LEU A N   
292  C CA  . LEU A 44  ? 1.2068 1.0704 1.8674 -0.1417 0.3275  -0.0344 43  LEU A CA  
293  C C   . LEU A 44  ? 1.2541 1.1483 1.8935 -0.1420 0.3546  -0.0264 43  LEU A C   
294  O O   . LEU A 44  ? 1.2542 1.1676 1.8673 -0.1312 0.3433  -0.0390 43  LEU A O   
295  C CB  . LEU A 44  ? 1.1859 1.0624 1.9189 -0.1487 0.3155  -0.0661 43  LEU A CB  
296  C CG  . LEU A 44  ? 1.1743 1.0277 1.9341 -0.1482 0.2879  -0.0792 43  LEU A CG  
297  C CD1 . LEU A 44  ? 1.1585 1.0276 1.9984 -0.1581 0.2855  -0.1072 43  LEU A CD1 
298  C CD2 . LEU A 44  ? 1.1686 1.0148 1.8869 -0.1321 0.2507  -0.0897 43  LEU A CD2 
299  N N   . ALA A 45  ? 1.2092 1.1096 1.8604 -0.1544 0.3908  -0.0058 44  ALA A N   
300  C CA  . ALA A 45  ? 1.2410 1.1752 1.8693 -0.1550 0.4184  0.0020  44  ALA A CA  
301  C C   . ALA A 45  ? 1.2769 1.2073 1.8258 -0.1408 0.4182  0.0241  44  ALA A C   
302  O O   . ALA A 45  ? 1.2895 1.2503 1.8100 -0.1327 0.4213  0.0160  44  ALA A O   
303  C CB  . ALA A 45  ? 1.2650 1.2078 1.9265 -0.1731 0.4586  0.0201  44  ALA A CB  
304  N N   . ALA A 46  ? 1.2598 1.1548 1.7756 -0.1372 0.4138  0.0498  45  ALA A N   
305  C CA  . ALA A 46  ? 1.2796 1.1705 1.7217 -0.1228 0.4117  0.0696  45  ALA A CA  
306  C C   . ALA A 46  ? 1.2729 1.1641 1.6855 -0.1073 0.3779  0.0476  45  ALA A C   
307  O O   . ALA A 46  ? 1.2905 1.1919 1.6480 -0.0948 0.3769  0.0540  45  ALA A O   
308  C CB  . ALA A 46  ? 1.2896 1.1415 1.7102 -0.1228 0.4149  0.1018  45  ALA A CB  
309  N N   . LEU A 47  ? 1.2381 1.1195 1.6863 -0.1077 0.3506  0.0221  46  LEU A N   
310  C CA  . LEU A 47  ? 1.2121 1.0925 1.6344 -0.0942 0.3194  0.0033  46  LEU A CA  
311  C C   . LEU A 47  ? 1.2353 1.1526 1.6620 -0.0897 0.3208  -0.0179 46  LEU A C   
312  O O   . LEU A 47  ? 1.2389 1.1660 1.6225 -0.0777 0.3138  -0.0204 46  LEU A O   
313  C CB  . LEU A 47  ? 1.1710 1.0300 1.6275 -0.0957 0.2898  -0.0145 46  LEU A CB  
314  C CG  . LEU A 47  ? 1.1582 1.0080 1.5855 -0.0830 0.2562  -0.0284 46  LEU A CG  
315  C CD1 . LEU A 47  ? 1.1330 0.9542 1.5730 -0.0844 0.2334  -0.0317 46  LEU A CD1 
316  C CD2 . LEU A 47  ? 1.1564 1.0298 1.6075 -0.0794 0.2429  -0.0547 46  LEU A CD2 
317  N N   . ILE A 48  ? 1.1794 1.1187 1.6621 -0.0990 0.3295  -0.0355 47  ILE A N   
318  C CA  . ILE A 48  ? 1.1645 1.1399 1.6606 -0.0949 0.3298  -0.0591 47  ILE A CA  
319  C C   . ILE A 48  ? 1.1835 1.1900 1.6458 -0.0928 0.3585  -0.0486 47  ILE A C   
320  O O   . ILE A 48  ? 1.1709 1.2074 1.6296 -0.0856 0.3568  -0.0675 47  ILE A O   
321  C CB  . ILE A 48  ? 1.1575 1.1501 1.7264 -0.1053 0.3318  -0.0824 47  ILE A CB  
322  C CG1 . ILE A 48  ? 1.1863 1.1876 1.7832 -0.1215 0.3669  -0.0680 47  ILE A CG1 
323  C CG2 . ILE A 48  ? 1.1385 1.1058 1.7386 -0.1045 0.2996  -0.0963 47  ILE A CG2 
324  C CD1 . ILE A 48  ? 1.1812 1.2049 1.8525 -0.1327 0.3730  -0.0929 47  ILE A CD1 
325  N N   . GLY A 49  ? 1.2674 1.2688 1.7058 -0.0986 0.3846  -0.0190 48  GLY A N   
326  C CA  . GLY A 49  ? 1.3012 1.3340 1.7011 -0.0955 0.4117  -0.0062 48  GLY A CA  
327  C C   . GLY A 49  ? 1.3252 1.3983 1.7619 -0.1074 0.4426  -0.0133 48  GLY A C   
328  O O   . GLY A 49  ? 1.3340 1.4466 1.7474 -0.1027 0.4594  -0.0174 48  GLY A O   
329  N N   . HIS A 50  ? 1.3510 1.4184 1.8463 -0.1227 0.4512  -0.0172 49  HIS A N   
330  C CA  . HIS A 50  ? 1.3560 1.4626 1.8921 -0.1361 0.4824  -0.0253 49  HIS A CA  
331  C C   . HIS A 50  ? 1.4028 1.5100 1.9114 -0.1452 0.5192  0.0133  49  HIS A C   
332  O O   . HIS A 50  ? 1.4043 1.4833 1.9368 -0.1577 0.5299  0.0332  49  HIS A O   
333  C CB  . HIS A 50  ? 1.3364 1.4380 1.9503 -0.1485 0.4755  -0.0479 49  HIS A CB  
334  C CG  . HIS A 50  ? 1.3458 1.4949 2.0093 -0.1581 0.4966  -0.0725 49  HIS A CG  
335  N ND1 . HIS A 50  ? 1.3771 1.5590 2.0351 -0.1689 0.5375  -0.0581 49  HIS A ND1 
336  C CD2 . HIS A 50  ? 1.3264 1.4974 2.0467 -0.1582 0.4822  -0.1111 49  HIS A CD2 
337  C CE1 . HIS A 50  ? 1.3617 1.5853 2.0722 -0.1760 0.5483  -0.0889 49  HIS A CE1 
338  N NE2 . HIS A 50  ? 1.3320 1.5491 2.0825 -0.1693 0.5145  -0.1218 49  HIS A NE2 
339  N N   . LEU A 51  ? 1.3784 1.5189 1.8375 -0.1386 0.5386  0.0238  50  LEU A N   
340  C CA  . LEU A 51  ? 1.4115 1.5539 1.8347 -0.1447 0.5727  0.0646  50  LEU A CA  
341  C C   . LEU A 51  ? 1.4349 1.5919 1.9107 -0.1667 0.6072  0.0708  50  LEU A C   
342  O O   . LEU A 51  ? 1.4555 1.5912 1.9241 -0.1768 0.6302  0.1081  50  LEU A O   
343  C CB  . LEU A 51  ? 1.4305 1.6150 1.7921 -0.1320 0.5855  0.0691  50  LEU A CB  
344  C CG  . LEU A 51  ? 1.4878 1.6801 1.7999 -0.1344 0.6193  0.1133  50  LEU A CG  
345  C CD1 . LEU A 51  ? 1.5020 1.6382 1.7785 -0.1289 0.6080  0.1506  50  LEU A CD1 
346  C CD2 . LEU A 51  ? 1.5102 1.7550 1.7672 -0.1207 0.6298  0.1087  50  LEU A CD2 
347  N N   . GLU A 52  ? 1.4036 1.5962 1.9359 -0.1747 0.6113  0.0347  51  GLU A N   
348  C CA  . GLU A 52  ? 1.4093 1.6214 1.9952 -0.1966 0.6459  0.0368  51  GLU A CA  
349  C C   . GLU A 52  ? 1.4110 1.5776 2.0517 -0.2100 0.6400  0.0428  51  GLU A C   
350  O O   . GLU A 52  ? 1.4242 1.5862 2.0911 -0.2281 0.6718  0.0651  51  GLU A O   
351  C CB  . GLU A 52  ? 1.3964 1.6617 2.0302 -0.2000 0.6498  -0.0078 51  GLU A CB  
352  C CG  . GLU A 52  ? 1.4470 1.7629 2.0345 -0.1873 0.6567  -0.0191 51  GLU A CG  
353  C CD  . GLU A 52  ? 1.4996 1.8369 2.1146 -0.1751 0.6260  -0.0674 51  GLU A CD  
354  O OE1 . GLU A 52  ? 1.4567 1.8220 2.1376 -0.1840 0.6296  -0.1010 51  GLU A OE1 
355  O OE2 . GLU A 52  ? 1.4697 1.7950 2.0428 -0.1566 0.5982  -0.0719 51  GLU A OE2 
356  N N   . ILE A 53  ? 1.3817 1.5160 2.0417 -0.2016 0.6003  0.0227  52  ILE A N   
357  C CA  . ILE A 53  ? 1.3640 1.4577 2.0753 -0.2125 0.5917  0.0250  52  ILE A CA  
358  C C   . ILE A 53  ? 1.3961 1.4432 2.0679 -0.2118 0.5953  0.0682  52  ILE A C   
359  O O   . ILE A 53  ? 1.3932 1.4145 2.1047 -0.2266 0.6093  0.0839  52  ILE A O   
360  C CB  . ILE A 53  ? 1.3399 1.4196 2.0838 -0.2031 0.5476  -0.0121 52  ILE A CB  
361  C CG1 . ILE A 53  ? 1.3246 1.4484 2.1183 -0.2047 0.5448  -0.0544 52  ILE A CG1 
362  C CG2 . ILE A 53  ? 1.3219 1.3618 2.1143 -0.2122 0.5359  -0.0115 52  ILE A CG2 
363  C CD1 . ILE A 53  ? 1.3235 1.4352 2.1540 -0.1958 0.5023  -0.0891 52  ILE A CD1 
364  N N   . VAL A 54  ? 1.4117 1.4481 2.0094 -0.1945 0.5830  0.0869  53  VAL A N   
365  C CA  . VAL A 54  ? 1.4277 1.4202 1.9872 -0.1915 0.5838  0.1268  53  VAL A CA  
366  C C   . VAL A 54  ? 1.4787 1.4743 2.0337 -0.2056 0.6278  0.1668  53  VAL A C   
367  O O   . VAL A 54  ? 1.4835 1.4396 2.0535 -0.2141 0.6362  0.1948  53  VAL A O   
368  C CB  . VAL A 54  ? 1.4530 1.4396 1.9346 -0.1691 0.5617  0.1347  53  VAL A CB  
369  C CG1 . VAL A 54  ? 1.4772 1.4259 1.9148 -0.1651 0.5679  0.1788  53  VAL A CG1 
370  C CG2 . VAL A 54  ? 1.4166 1.3882 1.9056 -0.1573 0.5181  0.1019  53  VAL A CG2 
371  N N   . GLU A 55  ? 1.4179 1.4611 1.9541 -0.2088 0.6570  0.1699  54  GLU A N   
372  C CA  . GLU A 55  ? 1.4542 1.5036 1.9772 -0.2215 0.7006  0.2117  54  GLU A CA  
373  C C   . GLU A 55  ? 1.4608 1.5036 2.0643 -0.2470 0.7255  0.2113  54  GLU A C   
374  O O   . GLU A 55  ? 1.4806 1.4960 2.0902 -0.2589 0.7505  0.2507  54  GLU A O   
375  C CB  . GLU A 55  ? 1.4834 1.5919 1.9623 -0.2175 0.7248  0.2124  54  GLU A CB  
376  C CG  . GLU A 55  ? 1.5321 1.6506 1.9300 -0.1926 0.7050  0.2159  54  GLU A CG  
377  C CD  . GLU A 55  ? 1.6327 1.8104 1.9840 -0.1890 0.7333  0.2225  54  GLU A CD  
378  O OE1 . GLU A 55  ? 1.6386 1.8259 1.9742 -0.1997 0.7709  0.2601  54  GLU A OE1 
379  O OE2 . GLU A 55  ? 1.5919 1.8078 1.9233 -0.1755 0.7184  0.1898  54  GLU A OE2 
380  N N   . VAL A 56  ? 1.4398 1.5070 2.1084 -0.2554 0.7191  0.1668  55  VAL A N   
381  C CA  . VAL A 56  ? 1.4305 1.4966 2.1806 -0.2798 0.7432  0.1613  55  VAL A CA  
382  C C   . VAL A 56  ? 1.4232 1.4337 2.2182 -0.2848 0.7247  0.1646  55  VAL A C   
383  O O   . VAL A 56  ? 1.4217 1.4189 2.2759 -0.3054 0.7492  0.1746  55  VAL A O   
384  C CB  . VAL A 56  ? 1.4195 1.5318 2.2284 -0.2860 0.7407  0.1099  55  VAL A CB  
385  C CG1 . VAL A 56  ? 1.4384 1.6099 2.2100 -0.2830 0.7631  0.1049  55  VAL A CG1 
386  C CG2 . VAL A 56  ? 1.3801 1.4809 2.2057 -0.2706 0.6909  0.0687  55  VAL A CG2 
387  N N   . LEU A 57  ? 1.4256 1.4049 2.1964 -0.2670 0.6826  0.1550  56  LEU A N   
388  C CA  . LEU A 57  ? 1.4219 1.3507 2.2303 -0.2704 0.6646  0.1583  56  LEU A CA  
389  C C   . LEU A 57  ? 1.4738 1.3639 2.2535 -0.2739 0.6852  0.2111  56  LEU A C   
390  O O   . LEU A 57  ? 1.4967 1.3568 2.3316 -0.2893 0.6981  0.2231  56  LEU A O   
391  C CB  . LEU A 57  ? 1.3730 1.2839 2.1605 -0.2504 0.6147  0.1326  56  LEU A CB  
392  C CG  . LEU A 57  ? 1.3224 1.2581 2.1530 -0.2471 0.5871  0.0805  56  LEU A CG  
393  C CD1 . LEU A 57  ? 1.2827 1.2020 2.0739 -0.2259 0.5415  0.0644  56  LEU A CD1 
394  C CD2 . LEU A 57  ? 1.3178 1.2466 2.2406 -0.2641 0.5888  0.0578  56  LEU A CD2 
395  N N   . LEU A 58  ? 1.5169 1.4076 2.2131 -0.2591 0.6882  0.2425  57  LEU A N   
396  C CA  . LEU A 58  ? 1.5492 1.4029 2.2125 -0.2593 0.7053  0.2951  57  LEU A CA  
397  C C   . LEU A 58  ? 1.5977 1.4634 2.2786 -0.2787 0.7518  0.3267  57  LEU A C   
398  O O   . LEU A 58  ? 1.6145 1.4440 2.3040 -0.2832 0.7558  0.3558  57  LEU A O   
399  C CB  . LEU A 58  ? 1.5757 1.4318 2.1432 -0.2359 0.6925  0.3163  57  LEU A CB  
400  C CG  . LEU A 58  ? 1.5662 1.4075 2.1053 -0.2149 0.6447  0.2894  57  LEU A CG  
401  C CD1 . LEU A 58  ? 1.5947 1.4531 2.0437 -0.1933 0.6370  0.3030  57  LEU A CD1 
402  C CD2 . LEU A 58  ? 1.5595 1.3451 2.1231 -0.2141 0.6244  0.2981  57  LEU A CD2 
403  N N   . LYS A 59  ? 1.4844 1.4035 2.1609 -0.2851 0.7748  0.3150  58  LYS A N   
404  C CA  . LYS A 59  ? 1.5467 1.4834 2.2253 -0.2991 0.8065  0.3382  58  LYS A CA  
405  C C   . LYS A 59  ? 1.5553 1.4765 2.3206 -0.3182 0.8100  0.3209  58  LYS A C   
406  O O   . LYS A 59  ? 1.6155 1.5255 2.3887 -0.3297 0.8308  0.3496  58  LYS A O   
407  C CB  . LYS A 59  ? 1.5469 1.5495 2.2003 -0.3007 0.8282  0.3247  58  LYS A CB  
408  N N   . ASN A 60  ? 1.5183 1.4399 2.3492 -0.3214 0.7893  0.2739  59  ASN A N   
409  C CA  . ASN A 60  ? 1.5215 1.4310 2.4372 -0.3367 0.7884  0.2507  59  ASN A CA  
410  C C   . ASN A 60  ? 1.5142 1.3685 2.4597 -0.3325 0.7623  0.2523  59  ASN A C   
411  O O   . ASN A 60  ? 1.4972 1.3432 2.5164 -0.3401 0.7504  0.2201  59  ASN A O   
412  C CB  . ASN A 60  ? 1.4684 1.4170 2.4419 -0.3417 0.7796  0.1947  59  ASN A CB  
413  C CG  . ASN A 60  ? 1.5343 1.4915 2.5850 -0.3594 0.7923  0.1735  59  ASN A CG  
414  O OD1 . ASN A 60  ? 1.5681 1.5247 2.6178 -0.3714 0.8210  0.2014  59  ASN A OD1 
415  N ND2 . ASN A 60  ? 1.4543 1.4200 2.5720 -0.3606 0.7703  0.1238  59  ASN A ND2 
416  N N   . GLY A 61  ? 1.5928 1.4119 2.4826 -0.3193 0.7519  0.2866  60  GLY A N   
417  C CA  . GLY A 61  ? 1.5803 1.3493 2.4951 -0.3142 0.7266  0.2881  60  GLY A CA  
418  C C   . GLY A 61  ? 1.5248 1.2872 2.4574 -0.3045 0.6899  0.2494  60  GLY A C   
419  O O   . GLY A 61  ? 1.4814 1.2641 2.4721 -0.3104 0.6785  0.2048  60  GLY A O   
420  N N   . ALA A 62  ? 1.5729 1.3076 2.4551 -0.2891 0.6700  0.2658  61  ALA A N   
421  C CA  . ALA A 62  ? 1.5133 1.2382 2.4058 -0.2798 0.6340  0.2328  61  ALA A CA  
422  C C   . ALA A 62  ? 1.5229 1.2031 2.3749 -0.2657 0.6143  0.2575  61  ALA A C   
423  O O   . ALA A 62  ? 1.5694 1.2331 2.3715 -0.2601 0.6287  0.3011  61  ALA A O   
424  C CB  . ALA A 62  ? 1.4883 1.2544 2.3325 -0.2661 0.6177  0.2075  61  ALA A CB  
425  N N   . ASP A 63  ? 1.5867 1.2523 2.4539 -0.2563 0.5751  0.2255  62  ASP A N   
426  C CA  . ASP A 63  ? 1.5823 1.2091 2.4161 -0.2418 0.5510  0.2397  62  ASP A CA  
427  C C   . ASP A 63  ? 1.6119 1.2517 2.3512 -0.2198 0.5338  0.2468  62  ASP A C   
428  O O   . ASP A 63  ? 1.5835 1.2428 2.3032 -0.2086 0.5043  0.2129  62  ASP A O   
429  C CB  . ASP A 63  ? 1.5399 1.1523 2.4271 -0.2407 0.5165  0.1995  62  ASP A CB  
430  C CG  . ASP A 63  ? 1.5737 1.1444 2.4447 -0.2300 0.4966  0.2133  62  ASP A CG  
431  O OD1 . ASP A 63  ? 1.6158 1.1653 2.4394 -0.2239 0.5102  0.2559  62  ASP A OD1 
432  O OD2 . ASP A 63  ? 1.5588 1.1203 2.4644 -0.2269 0.4664  0.1802  62  ASP A OD2 
433  N N   . VAL A 64  ? 1.5371 1.1664 2.2183 -0.2134 0.5524  0.2915  63  VAL A N   
434  C CA  . VAL A 64  ? 1.5537 1.1980 2.1466 -0.1924 0.5383  0.2984  63  VAL A CA  
435  C C   . VAL A 64  ? 1.5474 1.1620 2.1124 -0.1754 0.5017  0.2917  63  VAL A C   
436  O O   . VAL A 64  ? 1.5404 1.1699 2.0498 -0.1586 0.4784  0.2772  63  VAL A O   
437  C CB  . VAL A 64  ? 1.6260 1.2764 2.1655 -0.1906 0.5715  0.3469  63  VAL A CB  
438  C CG1 . VAL A 64  ? 1.6499 1.2532 2.1930 -0.1915 0.5819  0.3901  63  VAL A CG1 
439  C CG2 . VAL A 64  ? 1.6448 1.3217 2.0980 -0.1696 0.5591  0.3472  63  VAL A CG2 
440  N N   . ASN A 65  ? 1.5521 1.1262 2.1582 -0.1797 0.4963  0.3000  64  ASN A N   
441  C CA  . ASN A 65  ? 1.5310 1.0781 2.1197 -0.1651 0.4622  0.2903  64  ASN A CA  
442  C C   . ASN A 65  ? 1.4905 1.0352 2.1396 -0.1703 0.4350  0.2446  64  ASN A C   
443  O O   . ASN A 65  ? 1.4704 0.9848 2.1487 -0.1690 0.4186  0.2391  64  ASN A O   
444  C CB  . ASN A 65  ? 1.5619 1.0660 2.1509 -0.1633 0.4719  0.3306  64  ASN A CB  
445  C CG  . ASN A 65  ? 1.7047 1.2117 2.2253 -0.1545 0.4947  0.3776  64  ASN A CG  
446  O OD1 . ASN A 65  ? 1.6942 1.2340 2.1527 -0.1438 0.4935  0.3753  64  ASN A OD1 
447  N ND2 . ASN A 65  ? 1.7045 1.1777 2.2373 -0.1585 0.5151  0.4204  64  ASN A ND2 
448  N N   . ALA A 66  ? 1.4678 1.0457 2.1370 -0.1753 0.4289  0.2104  65  ALA A N   
449  C CA  . ALA A 66  ? 1.4196 1.0005 2.1446 -0.1794 0.4030  0.1668  65  ALA A CA  
450  C C   . ALA A 66  ? 1.4102 0.9884 2.0926 -0.1620 0.3641  0.1454  65  ALA A C   
451  O O   . ALA A 66  ? 1.4197 1.0102 2.0324 -0.1481 0.3557  0.1508  65  ALA A O   
452  C CB  . ALA A 66  ? 1.4082 1.0263 2.1660 -0.1884 0.4076  0.1385  65  ALA A CB  
453  N N   . SER A 67  ? 1.4651 1.0295 2.1918 -0.1634 0.3410  0.1196  66  SER A N   
454  C CA  . SER A 67  ? 1.4398 1.0023 2.1341 -0.1491 0.3046  0.0970  66  SER A CA  
455  C C   . SER A 67  ? 1.4140 0.9982 2.1511 -0.1525 0.2811  0.0524  66  SER A C   
456  O O   . SER A 67  ? 1.3955 0.9763 2.2058 -0.1642 0.2825  0.0351  66  SER A O   
457  C CB  . SER A 67  ? 1.4567 0.9839 2.1598 -0.1453 0.2965  0.1072  66  SER A CB  
458  O OG  . SER A 67  ? 1.4701 0.9988 2.1452 -0.1328 0.2623  0.0827  66  SER A OG  
459  N N   . ASP A 68  ? 1.3599 0.9666 2.0530 -0.1420 0.2593  0.0339  67  ASP A N   
460  C CA  . ASP A 68  ? 1.3271 0.9561 2.0518 -0.1426 0.2347  -0.0056 67  ASP A CA  
461  C C   . ASP A 68  ? 1.3186 0.9386 2.0402 -0.1350 0.2030  -0.0269 67  ASP A C   
462  O O   . ASP A 68  ? 1.3250 0.9206 2.0328 -0.1312 0.2019  -0.0136 67  ASP A O   
463  C CB  . ASP A 68  ? 1.3349 0.9919 2.0189 -0.1357 0.2281  -0.0132 67  ASP A CB  
464  C CG  . ASP A 68  ? 1.3813 1.0360 1.9874 -0.1203 0.2117  -0.0062 67  ASP A CG  
465  O OD1 . ASP A 68  ? 1.3988 1.0319 1.9711 -0.1151 0.2166  0.0157  67  ASP A OD1 
466  O OD2 . ASP A 68  ? 1.3942 1.0686 1.9752 -0.1131 0.1937  -0.0228 67  ASP A OD2 
467  N N   . ILE A 69  ? 1.3026 0.9443 2.0369 -0.1321 0.1764  -0.0608 68  ILE A N   
468  C CA  . ILE A 69  ? 1.2884 0.9283 2.0228 -0.1258 0.1464  -0.0847 68  ILE A CA  
469  C C   . ILE A 69  ? 1.3033 0.9347 1.9610 -0.1126 0.1335  -0.0733 68  ILE A C   
470  O O   . ILE A 69  ? 1.2929 0.9174 1.9457 -0.1079 0.1145  -0.0859 68  ILE A O   
471  C CB  . ILE A 69  ? 1.2761 0.9450 2.0376 -0.1250 0.1212  -0.1215 68  ILE A CB  
472  C CG1 . ILE A 69  ? 1.2633 0.9342 2.0469 -0.1222 0.0945  -0.1500 68  ILE A CG1 
473  C CG2 . ILE A 69  ? 1.2810 0.9677 1.9831 -0.1148 0.1079  -0.1216 68  ILE A CG2 
474  C CD1 . ILE A 69  ? 1.2756 0.9773 2.0878 -0.1205 0.0688  -0.1863 68  ILE A CD1 
475  N N   . THR A 70  ? 1.3162 0.9506 1.9168 -0.1066 0.1436  -0.0519 69  THR A N   
476  C CA  . THR A 70  ? 1.3227 0.9502 1.8527 -0.0945 0.1342  -0.0409 69  THR A CA  
477  C C   . THR A 70  ? 1.3646 0.9684 1.8699 -0.0921 0.1552  -0.0080 69  THR A C   
478  O O   . THR A 70  ? 1.3706 0.9673 1.8217 -0.0816 0.1476  0.0004  69  THR A O   
479  C CB  . THR A 70  ? 1.3516 0.9992 1.8334 -0.0876 0.1292  -0.0413 69  THR A CB  
480  O OG1 . THR A 70  ? 1.3642 1.0182 1.8491 -0.0919 0.1554  -0.0231 69  THR A OG1 
481  C CG2 . THR A 70  ? 1.3266 0.9958 1.8271 -0.0875 0.1052  -0.0712 69  THR A CG2 
482  N N   . GLY A 71  ? 1.3348 0.9267 1.8785 -0.1015 0.1812  0.0111  70  GLY A N   
483  C CA  . GLY A 71  ? 1.3657 0.9353 1.8859 -0.0989 0.2022  0.0463  70  GLY A CA  
484  C C   . GLY A 71  ? 1.4098 0.9908 1.8842 -0.0956 0.2235  0.0715  70  GLY A C   
485  O O   . GLY A 71  ? 1.4401 1.0058 1.8881 -0.0919 0.2409  0.1030  70  GLY A O   
486  N N   . THR A 72  ? 1.3768 0.9853 1.8421 -0.0962 0.2220  0.0581  71  THR A N   
487  C CA  . THR A 72  ? 1.4023 1.0274 1.8265 -0.0927 0.2409  0.0764  71  THR A CA  
488  C C   . THR A 72  ? 1.4433 1.0697 1.9033 -0.1050 0.2740  0.0968  71  THR A C   
489  O O   . THR A 72  ? 1.4269 1.0569 1.9491 -0.1178 0.2794  0.0837  71  THR A O   
490  C CB  . THR A 72  ? 1.4166 1.0703 1.8267 -0.0892 0.2270  0.0526  71  THR A CB  
491  O OG1 . THR A 72  ? 1.3932 1.0447 1.7754 -0.0799 0.1969  0.0340  71  THR A OG1 
492  C CG2 . THR A 72  ? 1.4366 1.1096 1.8014 -0.0834 0.2437  0.0674  71  THR A CG2 
493  N N   . THR A 73  ? 1.3680 0.9935 1.7885 -0.1010 0.2965  0.1285  72  THR A N   
494  C CA  . THR A 73  ? 1.3985 1.0269 1.8405 -0.1119 0.3312  0.1538  72  THR A CA  
495  C C   . THR A 73  ? 1.4312 1.0963 1.8499 -0.1115 0.3455  0.1516  72  THR A C   
496  O O   . THR A 73  ? 1.4229 1.1064 1.7995 -0.1001 0.3297  0.1370  72  THR A O   
497  C CB  . THR A 73  ? 1.4688 1.0724 1.8804 -0.1068 0.3471  0.1938  72  THR A CB  
498  O OG1 . THR A 73  ? 1.4903 1.1033 1.8272 -0.0896 0.3397  0.2027  72  THR A OG1 
499  C CG2 . THR A 73  ? 1.4467 1.0135 1.8894 -0.1074 0.3332  0.1943  72  THR A CG2 
500  N N   . PRO A 74  ? 1.3347 1.0128 1.7836 -0.1243 0.3761  0.1641  73  PRO A N   
501  C CA  . PRO A 74  ? 1.3524 1.0694 1.7811 -0.1237 0.3906  0.1596  73  PRO A CA  
502  C C   . PRO A 74  ? 1.4041 1.1332 1.7567 -0.1084 0.3947  0.1782  73  PRO A C   
503  O O   . PRO A 74  ? 1.4044 1.1649 1.7312 -0.1016 0.3906  0.1618  73  PRO A O   
504  C CB  . PRO A 74  ? 1.3799 1.1043 1.8548 -0.1415 0.4263  0.1752  73  PRO A CB  
505  C CG  . PRO A 74  ? 1.3729 1.0670 1.9118 -0.1532 0.4222  0.1710  73  PRO A CG  
506  C CD  . PRO A 74  ? 1.3469 1.0077 1.8567 -0.1412 0.3985  0.1782  73  PRO A CD  
507  N N   . LEU A 75  ? 1.3711 1.0767 1.6894 -0.1019 0.4017  0.2109  74  LEU A N   
508  C CA  . LEU A 75  ? 1.4053 1.1233 1.6503 -0.0852 0.4022  0.2264  74  LEU A CA  
509  C C   . LEU A 75  ? 1.3984 1.1165 1.6099 -0.0704 0.3683  0.2009  74  LEU A C   
510  O O   . LEU A 75  ? 1.4149 1.1574 1.5769 -0.0580 0.3655  0.1968  74  LEU A O   
511  C CB  . LEU A 75  ? 1.4428 1.1338 1.6622 -0.0807 0.4157  0.2683  74  LEU A CB  
512  C CG  . LEU A 75  ? 1.5047 1.2114 1.6486 -0.0630 0.4203  0.2891  74  LEU A CG  
513  C CD1 . LEU A 75  ? 1.5300 1.2813 1.6559 -0.0656 0.4471  0.2940  74  LEU A CD1 
514  C CD2 . LEU A 75  ? 1.5468 1.2203 1.6705 -0.0570 0.4277  0.3299  74  LEU A CD2 
515  N N   . HIS A 76  ? 1.4565 1.1499 1.6956 -0.0719 0.3432  0.1827  75  HIS A N   
516  C CA  . HIS A 76  ? 1.4284 1.1226 1.6385 -0.0601 0.3122  0.1582  75  HIS A CA  
517  C C   . HIS A 76  ? 1.4235 1.1502 1.6352 -0.0598 0.3052  0.1300  75  HIS A C   
518  O O   . HIS A 76  ? 1.4229 1.1640 1.5919 -0.0478 0.2933  0.1198  75  HIS A O   
519  C CB  . HIS A 76  ? 1.3915 1.0571 1.6348 -0.0634 0.2886  0.1434  75  HIS A CB  
520  C CG  . HIS A 76  ? 1.4196 1.0544 1.6439 -0.0562 0.2830  0.1623  75  HIS A CG  
521  N ND1 . HIS A 76  ? 1.4089 1.0147 1.6776 -0.0632 0.2767  0.1621  75  HIS A ND1 
522  C CD2 . HIS A 76  ? 1.4587 1.0884 1.6277 -0.0416 0.2814  0.1795  75  HIS A CD2 
523  C CE1 . HIS A 76  ? 1.4265 1.0093 1.6691 -0.0535 0.2716  0.1792  75  HIS A CE1 
524  N NE2 . HIS A 76  ? 1.4587 1.0553 1.6397 -0.0400 0.2740  0.1905  75  HIS A NE2 
525  N N   . LEU A 77  ? 1.2987 1.0371 1.5633 -0.0727 0.3120  0.1161  76  LEU A N   
526  C CA  . LEU A 77  ? 1.2798 1.0477 1.5527 -0.0721 0.3041  0.0889  76  LEU A CA  
527  C C   . LEU A 77  ? 1.3310 1.1314 1.5674 -0.0657 0.3224  0.0951  76  LEU A C   
528  O O   . LEU A 77  ? 1.3208 1.1404 1.5349 -0.0568 0.3099  0.0766  76  LEU A O   
529  C CB  . LEU A 77  ? 1.2604 1.0354 1.6008 -0.0867 0.3086  0.0730  76  LEU A CB  
530  C CG  . LEU A 77  ? 1.2384 0.9926 1.6190 -0.0911 0.2840  0.0544  76  LEU A CG  
531  C CD1 . LEU A 77  ? 1.2274 0.9913 1.6774 -0.1056 0.2930  0.0410  76  LEU A CD1 
532  C CD2 . LEU A 77  ? 1.2205 0.9786 1.5800 -0.0810 0.2523  0.0308  76  LEU A CD2 
533  N N   . ALA A 78  ? 1.3076 1.1159 1.5386 -0.0702 0.3526  0.1208  77  ALA A N   
534  C CA  . ALA A 78  ? 1.3451 1.1898 1.5406 -0.0640 0.3713  0.1259  77  ALA A CA  
535  C C   . ALA A 78  ? 1.3803 1.2264 1.5105 -0.0460 0.3601  0.1314  77  ALA A C   
536  O O   . ALA A 78  ? 1.3931 1.2723 1.4962 -0.0373 0.3623  0.1195  77  ALA A O   
537  C CB  . ALA A 78  ? 1.3855 1.2386 1.5870 -0.0733 0.4071  0.1552  77  ALA A CB  
538  N N   . ALA A 79  ? 1.3290 1.1414 1.4370 -0.0399 0.3477  0.1467  78  ALA A N   
539  C CA  . ALA A 79  ? 1.3284 1.1420 1.3778 -0.0225 0.3352  0.1492  78  ALA A CA  
540  C C   . ALA A 79  ? 1.2858 1.1012 1.3304 -0.0161 0.3066  0.1172  78  ALA A C   
541  O O   . ALA A 79  ? 1.2779 1.1106 1.2816 -0.0032 0.2999  0.1089  78  ALA A O   
542  C CB  . ALA A 79  ? 1.3548 1.1324 1.3852 -0.0176 0.3315  0.1755  78  ALA A CB  
543  N N   . THR A 80  ? 1.3366 1.1354 1.4228 -0.0249 0.2896  0.0993  79  THR A N   
544  C CA  . THR A 80  ? 1.2966 1.0963 1.3787 -0.0199 0.2631  0.0721  79  THR A CA  
545  C C   . THR A 80  ? 1.3104 1.1446 1.3991 -0.0186 0.2661  0.0515  79  THR A C   
546  O O   . THR A 80  ? 1.3039 1.1499 1.3655 -0.0088 0.2545  0.0371  79  THR A O   
547  C CB  . THR A 80  ? 1.2823 1.0577 1.4054 -0.0289 0.2442  0.0600  79  THR A CB  
548  O OG1 . THR A 80  ? 1.2849 1.0299 1.4066 -0.0300 0.2415  0.0763  79  THR A OG1 
549  C CG2 . THR A 80  ? 1.2376 1.0128 1.3514 -0.0237 0.2172  0.0360  79  THR A CG2 
550  N N   . MET A 81  ? 1.2966 1.1480 1.4252 -0.0288 0.2820  0.0483  80  MET A N   
551  C CA  . MET A 81  ? 1.2946 1.1799 1.4374 -0.0277 0.2846  0.0263  80  MET A CA  
552  C C   . MET A 81  ? 1.3502 1.2680 1.4532 -0.0180 0.3018  0.0304  80  MET A C   
553  O O   . MET A 81  ? 1.3403 1.2802 1.4331 -0.0100 0.2942  0.0099  80  MET A O   
554  C CB  . MET A 81  ? 1.2988 1.1955 1.4985 -0.0412 0.2970  0.0196  80  MET A CB  
555  C CG  . MET A 81  ? 1.2720 1.1425 1.5148 -0.0497 0.2783  0.0108  80  MET A CG  
556  S SD  . MET A 81  ? 1.2417 1.1052 1.4848 -0.0422 0.2421  -0.0157 80  MET A SD  
557  C CE  . MET A 81  ? 1.1982 1.0213 1.4417 -0.0449 0.2214  -0.0086 80  MET A CE  
558  N N   . GLY A 82  ? 1.2872 1.2092 1.3683 -0.0182 0.3247  0.0567  81  GLY A N   
559  C CA  . GLY A 82  ? 1.3181 1.2744 1.3576 -0.0079 0.3412  0.0621  81  GLY A CA  
560  C C   . GLY A 82  ? 1.3435 1.3381 1.4031 -0.0152 0.3692  0.0619  81  GLY A C   
561  O O   . GLY A 82  ? 1.3358 1.3713 1.3861 -0.0088 0.3757  0.0440  81  GLY A O   
562  N N   . HIS A 83  ? 1.3472 1.3309 1.4374 -0.0292 0.3868  0.0799  82  HIS A N   
563  C CA  . HIS A 83  ? 1.3561 1.3756 1.4684 -0.0389 0.4167  0.0819  82  HIS A CA  
564  C C   . HIS A 83  ? 1.4043 1.4284 1.4756 -0.0371 0.4429  0.1197  82  HIS A C   
565  O O   . HIS A 83  ? 1.4163 1.4133 1.5011 -0.0473 0.4555  0.1474  82  HIS A O   
566  C CB  . HIS A 83  ? 1.3463 1.3536 1.5249 -0.0566 0.4202  0.0747  82  HIS A CB  
567  C CG  . HIS A 83  ? 1.3289 1.3353 1.5476 -0.0571 0.3947  0.0391  82  HIS A CG  
568  N ND1 . HIS A 83  ? 1.3030 1.2713 1.5465 -0.0601 0.3697  0.0333  82  HIS A ND1 
569  C CD2 . HIS A 83  ? 1.3162 1.3559 1.5550 -0.0542 0.3898  0.0079  82  HIS A CD2 
570  C CE1 . HIS A 83  ? 1.2694 1.2467 1.5431 -0.0588 0.3505  0.0028  82  HIS A CE1 
571  N NE2 . HIS A 83  ? 1.2795 1.2981 1.5530 -0.0552 0.3619  -0.0129 82  HIS A NE2 
572  N N   . LEU A 84  ? 1.3905 1.4502 1.4125 -0.0236 0.4508  0.1207  83  LEU A N   
573  C CA  . LEU A 84  ? 1.4225 1.4904 1.3977 -0.0189 0.4739  0.1579  83  LEU A CA  
574  C C   . LEU A 84  ? 1.4561 1.5401 1.4573 -0.0355 0.5086  0.1771  83  LEU A C   
575  O O   . LEU A 84  ? 1.4833 1.5505 1.4655 -0.0387 0.5269  0.2170  83  LEU A O   
576  C CB  . LEU A 84  ? 1.4252 1.5379 1.3464 -0.0007 0.4753  0.1488  83  LEU A CB  
577  C CG  . LEU A 84  ? 1.4779 1.6061 1.3420 0.0081  0.4969  0.1864  83  LEU A CG  
578  C CD1 . LEU A 84  ? 1.4960 1.5734 1.3303 0.0158  0.4832  0.2179  83  LEU A CD1 
579  C CD2 . LEU A 84  ? 1.4814 1.6661 1.3009 0.0253  0.4993  0.1684  83  LEU A CD2 
580  N N   . GLU A 85  ? 1.4211 1.5375 1.4677 -0.0464 0.5184  0.1497  84  GLU A N   
581  C CA  . GLU A 85  ? 1.4361 1.5707 1.5125 -0.0639 0.5527  0.1645  84  GLU A CA  
582  C C   . GLU A 85  ? 1.4539 1.5384 1.5739 -0.0800 0.5550  0.1849  84  GLU A C   
583  O O   . GLU A 85  ? 1.4767 1.5572 1.6014 -0.0918 0.5841  0.2173  84  GLU A O   
584  C CB  . GLU A 85  ? 1.4206 1.6019 1.5416 -0.0712 0.5597  0.1250  84  GLU A CB  
585  N N   . ILE A 86  ? 1.4642 1.5111 1.6171 -0.0809 0.5251  0.1663  85  ILE A N   
586  C CA  . ILE A 86  ? 1.4585 1.4604 1.6569 -0.0953 0.5246  0.1802  85  ILE A CA  
587  C C   . ILE A 86  ? 1.4932 1.4513 1.6550 -0.0887 0.5200  0.2175  85  ILE A C   
588  O O   . ILE A 86  ? 1.5018 1.4308 1.6887 -0.1008 0.5350  0.2443  85  ILE A O   
589  C CB  . ILE A 86  ? 1.4323 1.4168 1.6816 -0.0985 0.4943  0.1438  85  ILE A CB  
590  C CG1 . ILE A 86  ? 1.4182 1.4401 1.7209 -0.1092 0.5035  0.1122  85  ILE A CG1 
591  C CG2 . ILE A 86  ? 1.4217 1.3566 1.7075 -0.1080 0.4853  0.1556  85  ILE A CG2 
592  C CD1 . ILE A 86  ? 1.4388 1.5033 1.7239 -0.0975 0.4951  0.0819  85  ILE A CD1 
593  N N   . VAL A 87  ? 1.4716 1.4248 1.5774 -0.0695 0.5000  0.2189  86  VAL A N   
594  C CA  . VAL A 87  ? 1.4896 1.4032 1.5605 -0.0611 0.4935  0.2519  86  VAL A CA  
595  C C   . VAL A 87  ? 1.5437 1.4622 1.5893 -0.0640 0.5271  0.2966  86  VAL A C   
596  O O   . VAL A 87  ? 1.5563 1.4352 1.6130 -0.0699 0.5341  0.3286  86  VAL A O   
597  C CB  . VAL A 87  ? 1.5032 1.4188 1.5186 -0.0393 0.4672  0.2412  86  VAL A CB  
598  C CG1 . VAL A 87  ? 1.5296 1.4149 1.5011 -0.0282 0.4656  0.2779  86  VAL A CG1 
599  C CG2 . VAL A 87  ? 1.4667 1.3634 1.5077 -0.0380 0.4333  0.2059  86  VAL A CG2 
600  N N   . GLU A 88  ? 1.5428 1.5111 1.5549 -0.0599 0.5486  0.2994  87  GLU A N   
601  C CA  . GLU A 88  ? 1.5814 1.5600 1.5625 -0.0618 0.5818  0.3438  87  GLU A CA  
602  C C   . GLU A 88  ? 1.6025 1.5698 1.6402 -0.0862 0.6110  0.3615  87  GLU A C   
603  O O   . GLU A 88  ? 1.6337 1.5840 1.6591 -0.0911 0.6347  0.4065  87  GLU A O   
604  C CB  . GLU A 88  ? 1.5985 1.6407 1.5320 -0.0517 0.5974  0.3373  87  GLU A CB  
605  C CG  . GLU A 88  ? 1.6381 1.6938 1.5095 -0.0263 0.5734  0.3269  87  GLU A CG  
606  C CD  . GLU A 88  ? 1.7228 1.8465 1.5533 -0.0163 0.5882  0.3145  87  GLU A CD  
607  O OE1 . GLU A 88  ? 1.6902 1.8538 1.5522 -0.0286 0.6069  0.2940  87  GLU A OE1 
608  O OE2 . GLU A 88  ? 1.7057 1.8453 1.4745 0.0044  0.5806  0.3230  87  GLU A OE2 
609  N N   . VAL A 89  ? 1.5417 1.5178 1.6431 -0.1015 0.6100  0.3271  88  VAL A N   
610  C CA  . VAL A 89  ? 1.5426 1.5090 1.7053 -0.1254 0.6368  0.3386  88  VAL A CA  
611  C C   . VAL A 89  ? 1.5488 1.4527 1.7483 -0.1323 0.6255  0.3555  88  VAL A C   
612  O O   . VAL A 89  ? 1.5666 1.4488 1.7907 -0.1466 0.6512  0.3892  88  VAL A O   
613  C CB  . VAL A 89  ? 1.5272 1.5263 1.7482 -0.1378 0.6372  0.2931  88  VAL A CB  
614  C CG1 . VAL A 89  ? 1.5203 1.5014 1.8163 -0.1623 0.6568  0.2972  88  VAL A CG1 
615  C CG2 . VAL A 89  ? 1.5366 1.6008 1.7306 -0.1352 0.6584  0.2817  88  VAL A CG2 
616  N N   . LEU A 90  ? 1.5358 1.4110 1.7413 -0.1227 0.5876  0.3319  89  LEU A N   
617  C CA  . LEU A 90  ? 1.5209 1.3405 1.7629 -0.1280 0.5742  0.3423  89  LEU A CA  
618  C C   . LEU A 90  ? 1.5700 1.3576 1.7720 -0.1205 0.5833  0.3917  89  LEU A C   
619  O O   . LEU A 90  ? 1.5754 1.3271 1.8151 -0.1328 0.5972  0.4181  89  LEU A O   
620  C CB  . LEU A 90  ? 1.4825 1.2849 1.7304 -0.1177 0.5318  0.3061  89  LEU A CB  
621  C CG  . LEU A 90  ? 1.4590 1.2787 1.7613 -0.1266 0.5183  0.2601  89  LEU A CG  
622  C CD1 . LEU A 90  ? 1.4303 1.2386 1.7203 -0.1131 0.4773  0.2295  89  LEU A CD1 
623  C CD2 . LEU A 90  ? 1.4485 1.2474 1.8288 -0.1474 0.5293  0.2584  89  LEU A CD2 
624  N N   . LEU A 91  ? 1.5286 1.3286 1.6567 -0.0996 0.5749  0.4039  90  LEU A N   
625  C CA  . LEU A 91  ? 1.5812 1.3523 1.6671 -0.0891 0.5803  0.4507  90  LEU A CA  
626  C C   . LEU A 91  ? 1.6474 1.4236 1.7335 -0.1014 0.6224  0.4962  90  LEU A C   
627  O O   . LEU A 91  ? 1.6948 1.4304 1.7840 -0.1030 0.6314  0.5373  90  LEU A O   
628  C CB  . LEU A 91  ? 1.5786 1.3707 1.5854 -0.0635 0.5632  0.4502  90  LEU A CB  
629  C CG  . LEU A 91  ? 1.5497 1.3296 1.5495 -0.0499 0.5220  0.4130  90  LEU A CG  
630  C CD1 . LEU A 91  ? 1.5636 1.3744 1.4901 -0.0266 0.5099  0.4079  90  LEU A CD1 
631  C CD2 . LEU A 91  ? 1.5545 1.2769 1.5771 -0.0488 0.5031  0.4249  90  LEU A CD2 
632  N N   . LYS A 92  ? 1.6001 1.4259 1.6846 -0.1106 0.6491  0.4898  91  LYS A N   
633  C CA  . LYS A 92  ? 1.6358 1.4708 1.7215 -0.1245 0.6921  0.5325  91  LYS A CA  
634  C C   . LYS A 92  ? 1.6410 1.4395 1.8093 -0.1498 0.7085  0.5408  91  LYS A C   
635  O O   . LYS A 92  ? 1.6721 1.4573 1.8432 -0.1583 0.7259  0.5764  91  LYS A O   
636  C CB  . LYS A 92  ? 1.6523 1.5550 1.7187 -0.1285 0.7162  0.5177  91  LYS A CB  
637  N N   . TYR A 93  ? 1.5933 1.3805 1.8259 -0.1592 0.6884  0.4971  92  TYR A N   
638  C CA  . TYR A 93  ? 1.5982 1.3537 1.9158 -0.1823 0.7002  0.4967  92  TYR A CA  
639  C C   . TYR A 93  ? 1.5965 1.2909 1.9402 -0.1784 0.6757  0.5046  92  TYR A C   
640  O O   . TYR A 93  ? 1.5722 1.2438 1.9902 -0.1923 0.6676  0.4812  92  TYR A O   
641  C CB  . TYR A 93  ? 1.5424 1.3259 1.9203 -0.1951 0.6938  0.4433  92  TYR A CB  
642  C CG  . TYR A 93  ? 1.5607 1.3926 1.9551 -0.2116 0.7317  0.4419  92  TYR A CG  
643  C CD1 . TYR A 93  ? 1.5956 1.4207 2.0480 -0.2337 0.7556  0.4517  92  TYR A CD1 
644  C CD2 . TYR A 93  ? 1.5451 1.4332 1.8947 -0.2026 0.7346  0.4231  92  TYR A CD2 
645  C CE1 . TYR A 93  ? 1.6146 1.4872 2.0789 -0.2475 0.7836  0.4448  92  TYR A CE1 
646  C CE2 . TYR A 93  ? 1.5620 1.4980 1.9288 -0.2178 0.7695  0.4190  92  TYR A CE2 
647  C CZ  . TYR A 93  ? 1.5970 1.5251 2.0199 -0.2404 0.7934  0.4299  92  TYR A CZ  
648  O OH  . TYR A 93  ? 1.6163 1.5946 2.0526 -0.2541 0.8201  0.4202  92  TYR A OH  
649  N N   . GLY A 94  ? 1.7385 1.4085 2.0248 -0.1593 0.6629  0.5345  93  GLY A N   
650  C CA  . GLY A 94  ? 1.7289 1.3427 2.0397 -0.1550 0.6412  0.5443  93  GLY A CA  
651  C C   . GLY A 94  ? 1.6963 1.2959 2.0262 -0.1468 0.6000  0.4992  93  GLY A C   
652  O O   . GLY A 94  ? 1.6663 1.2280 2.0557 -0.1544 0.5876  0.4897  93  GLY A O   
653  N N   . ALA A 95  ? 1.7209 1.3525 2.0026 -0.1311 0.5771  0.4690  94  ALA A N   
654  C CA  . ALA A 95  ? 1.6769 1.2975 1.9678 -0.1219 0.5365  0.4278  94  ALA A CA  
655  C C   . ALA A 95  ? 1.7036 1.2863 1.9624 -0.1046 0.5143  0.4455  94  ALA A C   
656  O O   . ALA A 95  ? 1.7453 1.3241 1.9490 -0.0918 0.5233  0.4829  94  ALA A O   
657  C CB  . ALA A 95  ? 1.6666 1.3320 1.9184 -0.1114 0.5208  0.3919  94  ALA A CB  
658  N N   . ASP A 96  ? 1.7244 1.2811 2.0186 -0.1037 0.4847  0.4172  95  ASP A N   
659  C CA  . ASP A 96  ? 1.7267 1.2497 1.9975 -0.0875 0.4602  0.4256  95  ASP A CA  
660  C C   . ASP A 96  ? 1.7473 1.2955 1.9447 -0.0662 0.4382  0.4102  95  ASP A C   
661  O O   . ASP A 96  ? 1.7083 1.2737 1.9066 -0.0638 0.4151  0.3690  95  ASP A O   
662  C CB  . ASP A 96  ? 1.6851 1.1788 2.0199 -0.0944 0.4366  0.3960  95  ASP A CB  
663  C CG  . ASP A 96  ? 1.7316 1.1858 2.0578 -0.0812 0.4172  0.4090  95  ASP A CG  
664  O OD1 . ASP A 96  ? 1.7763 1.2214 2.0516 -0.0674 0.4238  0.4457  95  ASP A OD1 
665  O OD2 . ASP A 96  ? 1.7185 1.1529 2.0895 -0.0838 0.3945  0.3813  95  ASP A OD2 
666  N N   . VAL A 97  ? 1.6433 1.1946 1.7778 -0.0504 0.4455  0.4437  96  VAL A N   
667  C CA  . VAL A 97  ? 1.6520 1.2319 1.7177 -0.0302 0.4279  0.4293  96  VAL A CA  
668  C C   . VAL A 97  ? 1.6413 1.2000 1.7021 -0.0179 0.3912  0.4040  96  VAL A C   
669  O O   . VAL A 97  ? 1.6272 1.2096 1.6530 -0.0069 0.3714  0.3749  96  VAL A O   
670  C CB  . VAL A 97  ? 1.7221 1.3138 1.7233 -0.0157 0.4454  0.4715  96  VAL A CB  
671  C CG1 . VAL A 97  ? 1.7481 1.2938 1.7482 -0.0078 0.4433  0.5100  96  VAL A CG1 
672  C CG2 . VAL A 97  ? 1.7270 1.3557 1.6608 0.0046  0.4295  0.4526  96  VAL A CG2 
673  N N   . ASN A 98  ? 1.6414 1.1568 1.7402 -0.0203 0.3821  0.4128  97  ASN A N   
674  C CA  . ASN A 98  ? 1.6155 1.1126 1.7131 -0.0095 0.3484  0.3876  97  ASN A CA  
675  C C   . ASN A 98  ? 1.5777 1.0547 1.7476 -0.0249 0.3359  0.3587  97  ASN A C   
676  O O   . ASN A 98  ? 1.5673 1.0102 1.7671 -0.0232 0.3229  0.3599  97  ASN A O   
677  C CB  . ASN A 98  ? 1.6562 1.1229 1.7282 0.0068  0.3425  0.4193  97  ASN A CB  
678  C CG  . ASN A 98  ? 1.7921 1.2831 1.7854 0.0269  0.3458  0.4391  97  ASN A CG  
679  O OD1 . ASN A 98  ? 1.7642 1.2788 1.7160 0.0400  0.3266  0.4128  97  ASN A OD1 
680  N ND2 . ASN A 98  ? 1.8029 1.2894 1.7762 0.0297  0.3705  0.4857  97  ASN A ND2 
681  N N   . ALA A 99  ? 1.5856 1.0854 1.7858 -0.0389 0.3387  0.3311  98  ALA A N   
682  C CA  . ALA A 99  ? 1.5331 1.0219 1.7974 -0.0515 0.3239  0.2984  98  ALA A CA  
683  C C   . ALA A 99  ? 1.5134 1.0130 1.7564 -0.0421 0.2906  0.2595  98  ALA A C   
684  O O   . ALA A 99  ? 1.5220 1.0441 1.7075 -0.0297 0.2825  0.2529  98  ALA A O   
685  C CB  . ALA A 99  ? 1.5175 1.0264 1.8266 -0.0701 0.3411  0.2864  98  ALA A CB  
686  N N   . TYR A 100 ? 1.5241 1.0090 1.8157 -0.0485 0.2717  0.2328  99  TYR A N   
687  C CA  . TYR A 100 ? 1.4899 0.9848 1.7652 -0.0414 0.2409  0.1964  99  TYR A CA  
688  C C   . TYR A 100 ? 1.4561 0.9582 1.7884 -0.0550 0.2297  0.1622  99  TYR A C   
689  O O   . TYR A 100 ? 1.4444 0.9327 1.8388 -0.0679 0.2394  0.1635  99  TYR A O   
690  C CB  . TYR A 100 ? 1.5050 0.9756 1.7679 -0.0292 0.2222  0.1970  99  TYR A CB  
691  C CG  . TYR A 100 ? 1.4967 0.9386 1.8261 -0.0372 0.2164  0.1907  99  TYR A CG  
692  C CD1 . TYR A 100 ? 1.5276 0.9420 1.8955 -0.0435 0.2373  0.2220  99  TYR A CD1 
693  C CD2 . TYR A 100 ? 1.4643 0.9076 1.8190 -0.0384 0.1903  0.1529  99  TYR A CD2 
694  C CE1 . TYR A 100 ? 1.5156 0.9035 1.9508 -0.0509 0.2319  0.2140  99  TYR A CE1 
695  C CE2 . TYR A 100 ? 1.4543 0.8752 1.8734 -0.0451 0.1842  0.1429  99  TYR A CE2 
696  C CZ  . TYR A 100 ? 1.5043 0.8968 1.9658 -0.0514 0.2048  0.1726  99  TYR A CZ  
697  O OH  . TYR A 100 ? 1.4940 0.8639 2.0258 -0.0583 0.1988  0.1604  99  TYR A OH  
698  N N   . ASP A 101 ? 1.4527 0.9773 1.7639 -0.0517 0.2093  0.1317  100 ASP A N   
699  C CA  . ASP A 101 ? 1.4094 0.9465 1.7637 -0.0615 0.1950  0.0981  100 ASP A CA  
700  C C   . ASP A 101 ? 1.4009 0.9287 1.7662 -0.0578 0.1674  0.0726  100 ASP A C   
701  O O   . ASP A 101 ? 1.4162 0.9218 1.7786 -0.0516 0.1637  0.0821  100 ASP A O   
702  C CB  . ASP A 101 ? 1.4030 0.9713 1.7277 -0.0601 0.1910  0.0837  100 ASP A CB  
703  C CG  . ASP A 101 ? 1.4513 1.0286 1.7077 -0.0457 0.1788  0.0823  100 ASP A CG  
704  O OD1 . ASP A 101 ? 1.4736 1.0349 1.7029 -0.0362 0.1750  0.0938  100 ASP A OD1 
705  O OD2 . ASP A 101 ? 1.4622 1.0626 1.6953 -0.0437 0.1730  0.0690  100 ASP A OD2 
706  N N   . LEU A 102 ? 1.3753 0.9217 1.7533 -0.0610 0.1476  0.0398  101 LEU A N   
707  C CA  . LEU A 102 ? 1.3556 0.8999 1.7399 -0.0577 0.1215  0.0132  101 LEU A CA  
708  C C   . LEU A 102 ? 1.3780 0.9252 1.6967 -0.0443 0.1086  0.0128  101 LEU A C   
709  O O   . LEU A 102 ? 1.3784 0.9154 1.6950 -0.0390 0.0945  0.0030  101 LEU A O   
710  C CB  . LEU A 102 ? 1.3230 0.8893 1.7366 -0.0644 0.1043  -0.0199 101 LEU A CB  
711  C CG  . LEU A 102 ? 1.3283 0.8920 1.8194 -0.0769 0.1093  -0.0312 101 LEU A CG  
712  C CD1 . LEU A 102 ? 1.3038 0.8942 1.8162 -0.0810 0.0913  -0.0631 101 LEU A CD1 
713  C CD2 . LEU A 102 ? 1.3402 0.8828 1.8709 -0.0778 0.1038  -0.0375 101 LEU A CD2 
714  N N   . ASN A 103 ? 1.3052 0.8678 1.5737 -0.0389 0.1134  0.0209  102 ASN A N   
715  C CA  . ASN A 103 ? 1.3094 0.8756 1.5179 -0.0265 0.1040  0.0211  102 ASN A CA  
716  C C   . ASN A 103 ? 1.3382 0.8856 1.5238 -0.0171 0.1159  0.0481  102 ASN A C   
717  O O   . ASN A 103 ? 1.3463 0.8933 1.4911 -0.0060 0.1059  0.0456  102 ASN A O   
718  C CB  . ASN A 103 ? 1.3002 0.8893 1.4685 -0.0238 0.1058  0.0196  102 ASN A CB  
719  C CG  . ASN A 103 ? 1.3295 0.9360 1.5023 -0.0280 0.0865  -0.0080 102 ASN A CG  
720  O OD1 . ASN A 103 ? 1.2962 0.9030 1.4676 -0.0271 0.0672  -0.0274 102 ASN A OD1 
721  N ND2 . ASN A 103 ? 1.2820 0.9046 1.4607 -0.0323 0.0914  -0.0099 102 ASN A ND2 
722  N N   . GLY A 104 ? 1.3547 0.8873 1.5660 -0.0211 0.1370  0.0741  103 GLY A N   
723  C CA  . GLY A 104 ? 1.3963 0.9119 1.5830 -0.0114 0.1495  0.1049  103 GLY A CA  
724  C C   . GLY A 104 ? 1.4394 0.9712 1.5750 -0.0040 0.1653  0.1253  103 GLY A C   
725  O O   . GLY A 104 ? 1.4781 1.0007 1.5827 0.0070  0.1732  0.1500  103 GLY A O   
726  N N   . ALA A 105 ? 1.3969 0.9541 1.5243 -0.0090 0.1693  0.1149  104 ALA A N   
727  C CA  . ALA A 105 ? 1.4224 1.0003 1.5046 -0.0020 0.1833  0.1285  104 ALA A CA  
728  C C   . ALA A 105 ? 1.4676 1.0429 1.5629 -0.0069 0.2117  0.1598  104 ALA A C   
729  O O   . ALA A 105 ? 1.4481 1.0212 1.5915 -0.0209 0.2227  0.1603  104 ALA A O   
730  C CB  . ALA A 105 ? 1.3939 0.9992 1.4695 -0.0057 0.1769  0.1047  104 ALA A CB  
731  N N   . THR A 106 ? 1.4034 0.9809 1.4559 0.0048  0.2237  0.1854  105 THR A N   
732  C CA  . THR A 106 ? 1.4400 1.0200 1.4926 0.0018  0.2523  0.2182  105 THR A CA  
733  C C   . THR A 106 ? 1.4616 1.0791 1.4915 0.0011  0.2651  0.2126  105 THR A C   
734  O O   . THR A 106 ? 1.4424 1.0809 1.4500 0.0061  0.2509  0.1869  105 THR A O   
735  C CB  . THR A 106 ? 1.5253 1.0906 1.5404 0.0166  0.2574  0.2498  105 THR A CB  
736  O OG1 . THR A 106 ? 1.5463 1.1317 1.5033 0.0335  0.2452  0.2399  105 THR A OG1 
737  C CG2 . THR A 106 ? 1.5121 1.0390 1.5575 0.0172  0.2446  0.2542  105 THR A CG2 
738  N N   . PRO A 107 ? 1.3876 1.0156 1.4257 -0.0057 0.2927  0.2355  106 PRO A N   
739  C CA  . PRO A 107 ? 1.3981 1.0661 1.4144 -0.0052 0.3054  0.2284  106 PRO A CA  
740  C C   . PRO A 107 ? 1.4426 1.1329 1.3953 0.0134  0.2990  0.2262  106 PRO A C   
741  O O   . PRO A 107 ? 1.4355 1.1585 1.3735 0.0157  0.2984  0.2057  106 PRO A O   
742  C CB  . PRO A 107 ? 1.4365 1.1088 1.4681 -0.0146 0.3381  0.2593  106 PRO A CB  
743  C CG  . PRO A 107 ? 1.4374 1.0724 1.5229 -0.0270 0.3401  0.2702  106 PRO A CG  
744  C CD  . PRO A 107 ? 1.4107 1.0164 1.4858 -0.0166 0.3142  0.2654  106 PRO A CD  
745  N N   . LEU A 108 ? 1.3853 1.0596 1.3032 0.0274  0.2934  0.2450  107 LEU A N   
746  C CA  . LEU A 108 ? 1.3999 1.0962 1.2601 0.0461  0.2846  0.2388  107 LEU A CA  
747  C C   . LEU A 108 ? 1.3838 1.0810 1.2402 0.0498  0.2570  0.2023  107 LEU A C   
748  O O   . LEU A 108 ? 1.3779 1.1033 1.2016 0.0594  0.2515  0.1844  107 LEU A O   
749  C CB  . LEU A 108 ? 1.4343 1.1131 1.2605 0.0610  0.2855  0.2699  107 LEU A CB  
750  C CG  . LEU A 108 ? 1.4689 1.1752 1.2330 0.0823  0.2811  0.2697  107 LEU A CG  
751  C CD1 . LEU A 108 ? 1.4779 1.2273 1.2184 0.0836  0.3037  0.2758  107 LEU A CD1 
752  C CD2 . LEU A 108 ? 1.5103 1.1934 1.2473 0.0977  0.2772  0.2995  107 LEU A CD2 
753  N N   . HIS A 109 ? 1.4317 1.1002 1.3224 0.0421  0.2403  0.1901  108 HIS A N   
754  C CA  . HIS A 109 ? 1.3913 1.0613 1.2787 0.0438  0.2156  0.1569  108 HIS A CA  
755  C C   . HIS A 109 ? 1.3744 1.0710 1.2723 0.0365  0.2155  0.1328  108 HIS A C   
756  O O   . HIS A 109 ? 1.3673 1.0825 1.2391 0.0438  0.2051  0.1126  108 HIS A O   
757  C CB  . HIS A 109 ? 1.3544 0.9930 1.2796 0.0357  0.1996  0.1484  108 HIS A CB  
758  C CG  . HIS A 109 ? 1.3885 1.0043 1.2980 0.0468  0.1879  0.1566  108 HIS A CG  
759  N ND1 . HIS A 109 ? 1.4107 0.9981 1.3419 0.0458  0.1948  0.1817  108 HIS A ND1 
760  C CD2 . HIS A 109 ? 1.4026 1.0197 1.2804 0.0590  0.1697  0.1418  108 HIS A CD2 
761  C CE1 . HIS A 109 ? 1.4249 0.9970 1.3386 0.0580  0.1800  0.1818  108 HIS A CE1 
762  N NE2 . HIS A 109 ? 1.4223 1.0132 1.3031 0.0660  0.1648  0.1570  108 HIS A NE2 
763  N N   . LEU A 110 ? 1.3694 1.0675 1.3088 0.0221  0.2269  0.1341  109 LEU A N   
764  C CA  . LEU A 110 ? 1.3358 1.0564 1.2925 0.0153  0.2247  0.1106  109 LEU A CA  
765  C C   . LEU A 110 ? 1.3856 1.1418 1.3129 0.0228  0.2384  0.1095  109 LEU A C   
766  O O   . LEU A 110 ? 1.3642 1.1400 1.2867 0.0249  0.2296  0.0860  109 LEU A O   
767  C CB  . LEU A 110 ? 1.3099 1.0244 1.3218 -0.0010 0.2332  0.1111  109 LEU A CB  
768  C CG  . LEU A 110 ? 1.2920 0.9766 1.3409 -0.0092 0.2184  0.1056  109 LEU A CG  
769  C CD1 . LEU A 110 ? 1.2839 0.9635 1.3881 -0.0243 0.2323  0.1111  109 LEU A CD1 
770  C CD2 . LEU A 110 ? 1.2547 0.9402 1.3052 -0.0091 0.1923  0.0765  109 LEU A CD2 
771  N N   . ALA A 111 ? 1.3463 1.1127 1.2549 0.0271  0.2600  0.1346  110 ALA A N   
772  C CA  . ALA A 111 ? 1.3689 1.1746 1.2485 0.0352  0.2735  0.1319  110 ALA A CA  
773  C C   . ALA A 111 ? 1.3844 1.2028 1.2193 0.0516  0.2589  0.1175  110 ALA A C   
774  O O   . ALA A 111 ? 1.3748 1.2259 1.1985 0.0566  0.2601  0.0981  110 ALA A O   
775  C CB  . ALA A 111 ? 1.4058 1.2206 1.2705 0.0368  0.3000  0.1646  110 ALA A CB  
776  N N   . ALA A 112 ? 1.3684 1.1627 1.1815 0.0600  0.2451  0.1245  111 ALA A N   
777  C CA  . ALA A 112 ? 1.3653 1.1719 1.1396 0.0751  0.2308  0.1084  111 ALA A CA  
778  C C   . ALA A 112 ? 1.3465 1.1524 1.1359 0.0703  0.2117  0.0761  111 ALA A C   
779  O O   . ALA A 112 ? 1.3334 1.1620 1.1023 0.0787  0.2059  0.0558  111 ALA A O   
780  C CB  . ALA A 112 ? 1.3866 1.1684 1.1364 0.0858  0.2215  0.1243  111 ALA A CB  
781  N N   . ARG A 113 ? 1.3928 1.1737 1.2186 0.0571  0.2019  0.0710  112 ARG A N   
782  C CA  . ARG A 113 ? 1.3446 1.1238 1.1829 0.0522  0.1838  0.0441  112 ARG A CA  
783  C C   . ARG A 113 ? 1.3434 1.1494 1.1981 0.0482  0.1898  0.0284  112 ARG A C   
784  O O   . ARG A 113 ? 1.3236 1.1415 1.1710 0.0515  0.1798  0.0072  112 ARG A O   
785  C CB  . ARG A 113 ? 1.2994 1.0490 1.1710 0.0403  0.1714  0.0430  112 ARG A CB  
786  C CG  . ARG A 113 ? 1.2842 1.0310 1.1635 0.0359  0.1515  0.0187  112 ARG A CG  
787  C CD  . ARG A 113 ? 1.2829 1.0035 1.1853 0.0274  0.1370  0.0166  112 ARG A CD  
788  N NE  . ARG A 113 ? 1.2939 1.0084 1.2395 0.0158  0.1430  0.0225  112 ARG A NE  
789  C CZ  . ARG A 113 ? 1.3234 1.0201 1.2980 0.0075  0.1316  0.0182  112 ARG A CZ  
790  N NH1 . ARG A 113 ? 1.2603 0.9445 1.2237 0.0091  0.1141  0.0084  112 ARG A NH1 
791  N NH2 . ARG A 113 ? 1.2599 0.9542 1.2766 -0.0026 0.1380  0.0213  112 ARG A NH2 
792  N N   . MET A 114 ? 1.2911 1.1069 1.1713 0.0409  0.2065  0.0377  113 MET A N   
793  C CA  . MET A 114 ? 1.2789 1.1227 1.1785 0.0378  0.2129  0.0215  113 MET A CA  
794  C C   . MET A 114 ? 1.3234 1.2035 1.1934 0.0496  0.2258  0.0173  113 MET A C   
795  O O   . MET A 114 ? 1.3024 1.2075 1.1836 0.0506  0.2258  -0.0039 113 MET A O   
796  C CB  . MET A 114 ? 1.2794 1.1236 1.2208 0.0251  0.2262  0.0296  113 MET A CB  
797  C CG  . MET A 114 ? 1.2485 1.0615 1.2239 0.0138  0.2131  0.0301  113 MET A CG  
798  S SD  . MET A 114 ? 1.2056 1.0079 1.1871 0.0132  0.1842  0.0048  113 MET A SD  
799  C CE  . MET A 114 ? 1.1558 0.9273 1.1733 0.0014  0.1721  0.0085  113 MET A CE  
800  N N   . GLY A 115 ? 1.3131 1.1979 1.1475 0.0594  0.2359  0.0362  114 GLY A N   
801  C CA  . GLY A 115 ? 1.3149 1.2369 1.1156 0.0732  0.2451  0.0305  114 GLY A CA  
802  C C   . GLY A 115 ? 1.3397 1.2965 1.1460 0.0718  0.2692  0.0368  114 GLY A C   
803  O O   . GLY A 115 ? 1.3214 1.3160 1.1273 0.0768  0.2741  0.0156  114 GLY A O   
804  N N   . HIS A 116 ? 1.3005 1.2466 1.1142 0.0646  0.2853  0.0646  115 HIS A N   
805  C CA  . HIS A 116 ? 1.3121 1.2917 1.1283 0.0620  0.3114  0.0746  115 HIS A CA  
806  C C   . HIS A 116 ? 1.3509 1.3387 1.1187 0.0742  0.3242  0.1038  115 HIS A C   
807  O O   . HIS A 116 ? 1.3735 1.3325 1.1392 0.0702  0.3311  0.1353  115 HIS A O   
808  C CB  . HIS A 116 ? 1.3220 1.2861 1.1855 0.0437  0.3226  0.0849  115 HIS A CB  
809  C CG  . HIS A 116 ? 1.3081 1.2615 1.2183 0.0333  0.3071  0.0587  115 HIS A CG  
810  N ND1 . HIS A 116 ? 1.2921 1.2761 1.2210 0.0337  0.3049  0.0291  115 HIS A ND1 
811  C CD2 . HIS A 116 ? 1.2996 1.2162 1.2420 0.0231  0.2922  0.0577  115 HIS A CD2 
812  C CE1 . HIS A 116 ? 1.2640 1.2283 1.2329 0.0247  0.2890  0.0137  115 HIS A CE1 
813  N NE2 . HIS A 116 ? 1.2647 1.1899 1.2409 0.0182  0.2810  0.0301  115 HIS A NE2 
814  N N   . VAL A 117 ? 1.3529 1.3808 1.0835 0.0897  0.3270  0.0928  116 VAL A N   
815  C CA  . VAL A 117 ? 1.3716 1.4097 1.0502 0.1051  0.3347  0.1185  116 VAL A CA  
816  C C   . VAL A 117 ? 1.4163 1.4675 1.0904 0.0993  0.3633  0.1512  116 VAL A C   
817  O O   . VAL A 117 ? 1.4454 1.4804 1.0905 0.1051  0.3703  0.1872  116 VAL A O   
818  C CB  . VAL A 117 ? 1.3621 1.4452 1.0048 0.1239  0.3292  0.0936  116 VAL A CB  
819  C CG1 . VAL A 117 ? 1.3364 1.4702 0.9981 0.1207  0.3425  0.0668  116 VAL A CG1 
820  C CG2 . VAL A 117 ? 1.3890 1.4865 0.9755 0.1420  0.3357  0.1201  116 VAL A CG2 
821  N N   . GLU A 118 ? 1.3532 1.4337 1.0575 0.0876  0.3808  0.1398  117 GLU A N   
822  C CA  . GLU A 118 ? 1.3805 1.4752 1.0837 0.0795  0.4105  0.1699  117 GLU A CA  
823  C C   . GLU A 118 ? 1.4174 1.4591 1.1461 0.0655  0.4147  0.2026  117 GLU A C   
824  O O   . GLU A 118 ? 1.4479 1.4819 1.1558 0.0656  0.4327  0.2418  117 GLU A O   
825  C CB  . GLU A 118 ? 1.3712 1.5081 1.1095 0.0684  0.4272  0.1459  117 GLU A CB  
826  C CG  . GLU A 118 ? 1.3932 1.5930 1.1056 0.0821  0.4317  0.1186  117 GLU A CG  
827  C CD  . GLU A 118 ? 1.4329 1.6387 1.1653 0.0871  0.4073  0.0736  117 GLU A CD  
828  O OE1 . GLU A 118 ? 1.4002 1.5604 1.1546 0.0825  0.3854  0.0676  117 GLU A OE1 
829  O OE2 . GLU A 118 ? 1.3839 1.6413 1.1117 0.0955  0.4106  0.0439  117 GLU A OE2 
830  N N   . ILE A 119 ? 1.3705 1.3756 1.1450 0.0535  0.3980  0.1872  118 ILE A N   
831  C CA  . ILE A 119 ? 1.3823 1.3386 1.1873 0.0404  0.3997  0.2125  118 ILE A CA  
832  C C   . ILE A 119 ? 1.4156 1.3355 1.1876 0.0523  0.3866  0.2370  118 ILE A C   
833  O O   . ILE A 119 ? 1.4369 1.3254 1.2163 0.0467  0.3966  0.2710  118 ILE A O   
834  C CB  . ILE A 119 ? 1.3652 1.2987 1.2275 0.0260  0.3837  0.1855  118 ILE A CB  
835  C CG1 . ILE A 119 ? 1.3556 1.3191 1.2598 0.0118  0.4008  0.1694  118 ILE A CG1 
836  C CG2 . ILE A 119 ? 1.3713 1.2527 1.2623 0.0162  0.3773  0.2044  118 ILE A CG2 
837  C CD1 . ILE A 119 ? 1.3639 1.3709 1.2650 0.0185  0.3952  0.1330  118 ILE A CD1 
838  N N   . VAL A 120 ? 1.4196 1.3436 1.1577 0.0689  0.3648  0.2199  119 VAL A N   
839  C CA  . VAL A 120 ? 1.4346 1.3276 1.1417 0.0819  0.3508  0.2395  119 VAL A CA  
840  C C   . VAL A 120 ? 1.4849 1.3891 1.1491 0.0928  0.3699  0.2792  119 VAL A C   
841  O O   . VAL A 120 ? 1.5076 1.3753 1.1694 0.0936  0.3717  0.3129  119 VAL A O   
842  C CB  . VAL A 120 ? 1.4288 1.3301 1.1103 0.0970  0.3249  0.2089  119 VAL A CB  
843  C CG1 . VAL A 120 ? 1.4470 1.3313 1.0866 0.1150  0.3140  0.2287  119 VAL A CG1 
844  C CG2 . VAL A 120 ? 1.3999 1.2756 1.1215 0.0862  0.3038  0.1802  119 VAL A CG2 
845  N N   . GLU A 121 ? 1.5088 1.4646 1.1395 0.1017  0.3844  0.2757  120 GLU A N   
846  C CA  . GLU A 121 ? 1.5399 1.5127 1.1233 0.1137  0.4025  0.3138  120 GLU A CA  
847  C C   . GLU A 121 ? 1.5819 1.5370 1.1877 0.0972  0.4301  0.3534  120 GLU A C   
848  O O   . GLU A 121 ? 1.6128 1.5519 1.1910 0.1041  0.4399  0.3962  120 GLU A O   
849  C CB  . GLU A 121 ? 1.5354 1.5744 1.0810 0.1260  0.4122  0.2963  120 GLU A CB  
850  C CG  . GLU A 121 ? 1.5521 1.6111 1.0626 0.1476  0.3879  0.2672  120 GLU A CG  
851  C CD  . GLU A 121 ? 1.6175 1.7456 1.0957 0.1599  0.3980  0.2467  120 GLU A CD  
852  O OE1 . GLU A 121 ? 1.5851 1.7455 1.0897 0.1476  0.4138  0.2285  120 GLU A OE1 
853  O OE2 . GLU A 121 ? 1.5859 1.7381 1.0144 0.1824  0.3895  0.2468  120 GLU A OE2 
854  N N   . VAL A 122 ? 1.5159 1.4734 1.1734 0.0756  0.4430  0.3402  121 VAL A N   
855  C CA  . VAL A 122 ? 1.5381 1.4808 1.2235 0.0579  0.4711  0.3745  121 VAL A CA  
856  C C   . VAL A 122 ? 1.5612 1.4397 1.2757 0.0512  0.4625  0.3993  121 VAL A C   
857  O O   . VAL A 122 ? 1.5909 1.4482 1.3030 0.0473  0.4814  0.4431  121 VAL A O   
858  C CB  . VAL A 122 ? 1.5332 1.4987 1.2705 0.0373  0.4853  0.3482  121 VAL A CB  
859  C CG1 . VAL A 122 ? 1.5511 1.4915 1.3319 0.0159  0.5103  0.3780  121 VAL A CG1 
860  C CG2 . VAL A 122 ? 1.5286 1.5609 1.2383 0.0431  0.5011  0.3317  121 VAL A CG2 
861  N N   . LEU A 123 ? 1.5135 1.3611 1.2570 0.0497  0.4344  0.3717  122 LEU A N   
862  C CA  . LEU A 123 ? 1.5218 1.3119 1.2970 0.0439  0.4242  0.3891  122 LEU A CA  
863  C C   . LEU A 123 ? 1.5654 1.3337 1.2957 0.0629  0.4168  0.4218  122 LEU A C   
864  O O   . LEU A 123 ? 1.6052 1.3344 1.3522 0.0586  0.4247  0.4573  122 LEU A O   
865  C CB  . LEU A 123 ? 1.4625 1.2320 1.2737 0.0393  0.3952  0.3491  122 LEU A CB  
866  C CG  . LEU A 123 ? 1.4240 1.2014 1.2920 0.0190  0.3993  0.3213  122 LEU A CG  
867  C CD1 . LEU A 123 ? 1.3887 1.1531 1.2775 0.0189  0.3682  0.2823  122 LEU A CD1 
868  C CD2 . LEU A 123 ? 1.4494 1.1987 1.3696 -0.0002 0.4184  0.3446  122 LEU A CD2 
869  N N   . LEU A 124 ? 1.5869 1.3799 1.2635 0.0846  0.4013  0.4097  123 LEU A N   
870  C CA  . LEU A 124 ? 1.6120 1.3885 1.2441 0.1053  0.3924  0.4387  123 LEU A CA  
871  C C   . LEU A 124 ? 1.6647 1.4516 1.2652 0.1090  0.4208  0.4887  123 LEU A C   
872  O O   . LEU A 124 ? 1.6931 1.4453 1.2831 0.1166  0.4209  0.5280  123 LEU A O   
873  C CB  . LEU A 124 ? 1.5970 1.4036 1.1813 0.1275  0.3699  0.4098  123 LEU A CB  
874  C CG  . LEU A 124 ? 1.5849 1.3706 1.1908 0.1283  0.3386  0.3706  123 LEU A CG  
875  C CD1 . LEU A 124 ? 1.5663 1.3922 1.1332 0.1452  0.3229  0.3358  123 LEU A CD1 
876  C CD2 . LEU A 124 ? 1.6072 1.3427 1.2202 0.1350  0.3221  0.3895  123 LEU A CD2 
877  N N   . LYS A 125 ? 1.6422 1.4772 1.2278 0.1039  0.4451  0.4883  124 LYS A N   
878  C CA  . LYS A 125 ? 1.6780 1.5273 1.2335 0.1049  0.4755  0.5364  124 LYS A CA  
879  C C   . LYS A 125 ? 1.7088 1.5168 1.3154 0.0822  0.4979  0.5706  124 LYS A C   
880  O O   . LYS A 125 ? 1.7464 1.5453 1.3321 0.0839  0.5192  0.6209  124 LYS A O   
881  C CB  . LYS A 125 ? 1.6813 1.5987 1.2104 0.1045  0.4960  0.5214  124 LYS A CB  
882  N N   . TYR A 126 ? 1.5930 1.3692 1.4659 -0.1534 0.4543  0.3177  125 TYR A N   
883  C CA  . TYR A 126 ? 1.5793 1.3291 1.5202 -0.1581 0.4825  0.3208  125 TYR A CA  
884  C C   . TYR A 126 ? 1.5614 1.2674 1.5539 -0.1405 0.4702  0.3678  125 TYR A C   
885  O O   . TYR A 126 ? 1.5560 1.2408 1.6028 -0.1491 0.4975  0.3857  125 TYR A O   
886  C CB  . TYR A 126 ? 1.5550 1.3013 1.5598 -0.1489 0.4905  0.2481  125 TYR A CB  
887  C CG  . TYR A 126 ? 1.5805 1.3507 1.5945 -0.1760 0.5329  0.2162  125 TYR A CG  
888  C CD1 . TYR A 126 ? 1.5820 1.3355 1.6480 -0.1880 0.5648  0.2240  125 TYR A CD1 
889  C CD2 . TYR A 126 ? 1.6029 1.4136 1.5814 -0.1914 0.5443  0.1740  125 TYR A CD2 
890  C CE1 . TYR A 126 ? 1.5966 1.3731 1.6728 -0.2140 0.6050  0.1928  125 TYR A CE1 
891  C CE2 . TYR A 126 ? 1.6157 1.4506 1.6093 -0.2182 0.5860  0.1395  125 TYR A CE2 
892  C CZ  . TYR A 126 ? 1.6378 1.4554 1.6771 -0.2291 0.6153  0.1502  125 TYR A CZ  
893  O OH  . TYR A 126 ? 1.6465 1.4893 1.7023 -0.2568 0.6581  0.1141  125 TYR A OH  
894  N N   . GLY A 127 ? 1.6646 1.3571 1.6494 -0.1174 0.4330  0.3845  126 GLY A N   
895  C CA  . GLY A 127 ? 1.6308 1.2842 1.6733 -0.1021 0.4237  0.4251  126 GLY A CA  
896  C C   . GLY A 127 ? 1.5904 1.2221 1.6874 -0.0766 0.4000  0.3814  126 GLY A C   
897  O O   . GLY A 127 ? 1.5603 1.1645 1.7381 -0.0717 0.4110  0.3752  126 GLY A O   
898  N N   . ALA A 128 ? 1.6540 1.3022 1.7101 -0.0632 0.3694  0.3495  127 ALA A N   
899  C CA  . ALA A 128 ? 1.6062 1.2432 1.7030 -0.0425 0.3436  0.3123  127 ALA A CA  
900  C C   . ALA A 128 ? 1.5895 1.2093 1.6801 -0.0271 0.3157  0.3496  127 ALA A C   
901  O O   . ALA A 128 ? 1.6014 1.2320 1.6289 -0.0268 0.3008  0.3877  127 ALA A O   
902  C CB  . ALA A 128 ? 1.6100 1.2739 1.6784 -0.0360 0.3256  0.2611  127 ALA A CB  
903  N N   . ASP A 129 ? 1.5561 1.1548 1.7158 -0.0169 0.3101  0.3352  128 ASP A N   
904  C CA  . ASP A 129 ? 1.5208 1.1026 1.6911 -0.0023 0.2860  0.3618  128 ASP A CA  
905  C C   . ASP A 129 ? 1.5125 1.1127 1.6258 0.0110  0.2490  0.3377  128 ASP A C   
906  O O   . ASP A 129 ? 1.4939 1.1067 1.6212 0.0150  0.2378  0.2873  128 ASP A O   
907  C CB  . ASP A 129 ? 1.4961 1.0560 1.7652 -0.0006 0.2972  0.3409  128 ASP A CB  
908  C CG  . ASP A 129 ? 1.4994 1.0422 1.7940 0.0132  0.2763  0.3617  128 ASP A CG  
909  O OD1 . ASP A 129 ? 1.5072 1.0370 1.7909 0.0178  0.2723  0.4237  128 ASP A OD1 
910  O OD2 . ASP A 129 ? 1.4901 1.0376 1.8181 0.0174  0.2640  0.3172  128 ASP A OD2 
911  N N   . VAL A 130 ? 1.4849 1.0913 1.5363 0.0163  0.2294  0.3764  129 VAL A N   
912  C CA  . VAL A 130 ? 1.4622 1.0860 1.4590 0.0274  0.1972  0.3546  129 VAL A CA  
913  C C   . VAL A 130 ? 1.4198 1.0301 1.4565 0.0421  0.1743  0.3365  129 VAL A C   
914  O O   . VAL A 130 ? 1.3949 1.0189 1.4085 0.0499  0.1510  0.3032  129 VAL A O   
915  C CB  . VAL A 130 ? 1.4985 1.1404 1.4192 0.0248  0.1850  0.3981  129 VAL A CB  
916  C CG1 . VAL A 130 ? 1.4796 1.1049 1.4225 0.0305  0.1771  0.4593  129 VAL A CG1 
917  C CG2 . VAL A 130 ? 1.4833 1.1452 1.3497 0.0334  0.1573  0.3686  129 VAL A CG2 
918  N N   . ASN A 131 ? 1.4588 1.0445 1.5621 0.0440  0.1828  0.3562  130 ASN A N   
919  C CA  . ASN A 131 ? 1.4149 0.9916 1.5647 0.0529  0.1670  0.3340  130 ASN A CA  
920  C C   . ASN A 131 ? 1.4236 1.0020 1.6479 0.0431  0.1852  0.2843  130 ASN A C   
921  O O   . ASN A 131 ? 1.4044 0.9705 1.7008 0.0415  0.1923  0.2732  130 ASN A O   
922  C CB  . ASN A 131 ? 1.4027 0.9558 1.5905 0.0606  0.1646  0.3837  130 ASN A CB  
923  C CG  . ASN A 131 ? 1.4866 1.0504 1.6002 0.0702  0.1370  0.4259  130 ASN A CG  
924  O OD1 . ASN A 131 ? 1.4755 1.0632 1.5077 0.0677  0.1267  0.4206  130 ASN A OD1 
925  N ND2 . ASN A 131 ? 1.4358 0.9854 1.5849 0.0800  0.1262  0.4656  130 ASN A ND2 
926  N N   . ALA A 132 ? 1.3250 0.9241 1.5395 0.0341  0.1941  0.2508  131 ALA A N   
927  C CA  . ALA A 132 ? 1.3236 0.9379 1.6037 0.0215  0.2084  0.2020  131 ALA A CA  
928  C C   . ALA A 132 ? 1.3144 0.9556 1.5939 0.0223  0.1808  0.1631  131 ALA A C   
929  O O   . ALA A 132 ? 1.3011 0.9548 1.5203 0.0325  0.1511  0.1652  131 ALA A O   
930  C CB  . ALA A 132 ? 1.3540 0.9884 1.6265 0.0121  0.2232  0.1816  131 ALA A CB  
931  N N   . GLN A 133 ? 1.2024 0.8569 1.5525 0.0081  0.1930  0.1257  132 GLN A N   
932  C CA  . GLN A 133 ? 1.1908 0.8811 1.5447 0.0012  0.1705  0.0867  132 GLN A CA  
933  C C   . GLN A 133 ? 1.2161 0.9549 1.6123 -0.0217 0.1806  0.0372  132 GLN A C   
934  O O   . GLN A 133 ? 1.2148 0.9509 1.6761 -0.0361 0.2140  0.0200  132 GLN A O   
935  C CB  . GLN A 133 ? 1.1756 0.8487 1.5769 0.0000  0.1744  0.0827  132 GLN A CB  
936  C CG  . GLN A 133 ? 1.2087 0.8409 1.5761 0.0221  0.1614  0.1350  132 GLN A CG  
937  C CD  . GLN A 133 ? 1.2453 0.8614 1.6751 0.0220  0.1658  0.1305  132 GLN A CD  
938  O OE1 . GLN A 133 ? 1.2220 0.8618 1.7117 0.0036  0.1768  0.0800  132 GLN A OE1 
939  N NE2 . GLN A 133 ? 1.1895 0.7712 1.6100 0.0404  0.1581  0.1818  132 GLN A NE2 
940  N N   . ASP A 134 ? 1.1439 0.9310 1.5070 -0.0263 0.1512  0.0169  133 ASP A N   
941  C CA  . ASP A 134 ? 1.1368 0.9855 1.5321 -0.0493 0.1520  -0.0237 133 ASP A CA  
942  C C   . ASP A 134 ? 1.1226 1.0146 1.5581 -0.0746 0.1519  -0.0677 133 ASP A C   
943  O O   . ASP A 134 ? 1.1165 0.9798 1.5770 -0.0745 0.1629  -0.0715 133 ASP A O   
944  C CB  . ASP A 134 ? 1.1542 1.0373 1.5005 -0.0412 0.1193  -0.0126 133 ASP A CB  
945  C CG  . ASP A 134 ? 1.1974 1.0890 1.4932 -0.0314 0.0826  0.0002  133 ASP A CG  
946  O OD1 . ASP A 134 ? 1.1949 1.0468 1.4722 -0.0207 0.0817  0.0142  133 ASP A OD1 
947  O OD2 . ASP A 134 ? 1.2196 1.1594 1.4998 -0.0346 0.0543  -0.0008 133 ASP A OD2 
948  N N   . ALA A 135 ? 1.0620 1.0298 1.5081 -0.0989 0.1398  -0.1016 134 ALA A N   
949  C CA  . ALA A 135 ? 1.0211 1.0472 1.4982 -0.1307 0.1395  -0.1488 134 ALA A CA  
950  C C   . ALA A 135 ? 1.0456 1.0726 1.4743 -0.1237 0.1090  -0.1372 134 ALA A C   
951  O O   . ALA A 135 ? 1.0188 1.0626 1.4765 -0.1434 0.1182  -0.1715 134 ALA A O   
952  C CB  . ALA A 135 ? 0.9855 1.1066 1.4761 -0.1614 0.1288  -0.1807 134 ALA A CB  
953  N N   . ALA A 136 ? 1.0656 1.0761 1.4273 -0.0980 0.0756  -0.0937 135 ALA A N   
954  C CA  . ALA A 136 ? 1.0656 1.0709 1.3814 -0.0894 0.0481  -0.0804 135 ALA A CA  
955  C C   . ALA A 136 ? 1.0764 1.0055 1.3917 -0.0673 0.0613  -0.0619 135 ALA A C   
956  O O   . ALA A 136 ? 1.0698 0.9950 1.3658 -0.0654 0.0467  -0.0628 135 ALA A O   
957  C CB  . ALA A 136 ? 1.0739 1.0872 1.3304 -0.0701 0.0111  -0.0420 135 ALA A CB  
958  N N   . GLY A 137 ? 1.1770 1.0506 1.5155 -0.0520 0.0876  -0.0424 136 GLY A N   
959  C CA  . GLY A 137 ? 1.1714 0.9800 1.5153 -0.0318 0.0981  -0.0145 136 GLY A CA  
960  C C   . GLY A 137 ? 1.1738 0.9429 1.4461 -0.0015 0.0765  0.0360  136 GLY A C   
961  O O   . GLY A 137 ? 1.1472 0.8745 1.4147 0.0141  0.0768  0.0629  136 GLY A O   
962  N N   . GLY A 138 ? 1.2174 1.0030 1.4415 0.0056  0.0591  0.0482  137 GLY A N   
963  C CA  . GLY A 138 ? 1.1854 0.9424 1.3459 0.0294  0.0421  0.0857  137 GLY A CA  
964  C C   . GLY A 138 ? 1.2042 0.9314 1.3585 0.0380  0.0637  0.1108  137 GLY A C   
965  O O   . GLY A 138 ? 1.2286 0.9678 1.4158 0.0276  0.0834  0.0979  137 GLY A O   
966  N N   . THR A 139 ? 1.1839 0.8785 1.2945 0.0543  0.0600  0.1456  138 THR A N   
967  C CA  . THR A 139 ? 1.1988 0.8733 1.2907 0.0585  0.0791  0.1722  138 THR A CA  
968  C C   . THR A 139 ? 1.2214 0.9155 1.2773 0.0613  0.0716  0.1647  138 THR A C   
969  O O   . THR A 139 ? 1.1988 0.9155 1.2427 0.0645  0.0480  0.1492  138 THR A O   
970  C CB  . THR A 139 ? 1.2162 0.8620 1.2754 0.0696  0.0765  0.2137  138 THR A CB  
971  O OG1 . THR A 139 ? 1.1790 0.8317 1.1864 0.0803  0.0472  0.2157  138 THR A OG1 
972  C CG2 . THR A 139 ? 1.2066 0.8306 1.3241 0.0681  0.0875  0.2251  138 THR A CG2 
973  N N   . PRO A 140 ? 1.2013 0.8889 1.2473 0.0587  0.0934  0.1753  139 PRO A N   
974  C CA  . PRO A 140 ? 1.2124 0.9171 1.2324 0.0613  0.0901  0.1652  139 PRO A CA  
975  C C   . PRO A 140 ? 1.2065 0.9110 1.1739 0.0722  0.0683  0.1730  139 PRO A C   
976  O O   . PRO A 140 ? 1.2099 0.9312 1.1737 0.0755  0.0606  0.1569  139 PRO A O   
977  C CB  . PRO A 140 ? 1.2684 0.9645 1.2825 0.0528  0.1222  0.1767  139 PRO A CB  
978  C CG  . PRO A 140 ? 1.2875 0.9696 1.3483 0.0443  0.1421  0.1828  139 PRO A CG  
979  C CD  . PRO A 140 ? 1.2340 0.9031 1.3050 0.0502  0.1253  0.1920  139 PRO A CD  
980  N N   . LEU A 141 ? 1.2282 0.9158 1.1635 0.0776  0.0591  0.1969  140 LEU A N   
981  C CA  . LEU A 141 ? 1.2025 0.8938 1.0911 0.0867  0.0370  0.2001  140 LEU A CA  
982  C C   . LEU A 141 ? 1.1688 0.8717 1.0736 0.0926  0.0107  0.1798  140 LEU A C   
983  O O   . LEU A 141 ? 1.1524 0.8643 1.0351 0.0988  -0.0040 0.1721  140 LEU A O   
984  C CB  . LEU A 141 ? 1.2218 0.8978 1.0789 0.0904  0.0314  0.2334  140 LEU A CB  
985  C CG  . LEU A 141 ? 1.2314 0.9169 1.0309 0.0958  0.0149  0.2397  140 LEU A CG  
986  C CD1 . LEU A 141 ? 1.2670 0.9714 1.0306 0.0859  0.0328  0.2344  140 LEU A CD1 
987  C CD2 . LEU A 141 ? 1.2540 0.9300 1.0354 0.1004  0.0040  0.2759  140 LEU A CD2 
988  N N   . HIS A 142 ? 1.2081 0.9157 1.1539 0.0878  0.0064  0.1699  141 HIS A N   
989  C CA  . HIS A 142 ? 1.1754 0.9065 1.1355 0.0871  -0.0180 0.1524  141 HIS A CA  
990  C C   . HIS A 142 ? 1.1994 0.9564 1.1788 0.0865  -0.0222 0.1407  141 HIS A C   
991  O O   . HIS A 142 ? 1.1669 0.9366 1.1395 0.0924  -0.0427 0.1396  141 HIS A O   
992  C CB  . HIS A 142 ? 1.1880 0.9315 1.1902 0.0744  -0.0165 0.1378  141 HIS A CB  
993  C CG  . HIS A 142 ? 1.1884 0.9124 1.1880 0.0759  -0.0197 0.1436  141 HIS A CG  
994  N ND1 . HIS A 142 ? 1.2148 0.9120 1.2383 0.0753  0.0017  0.1566  141 HIS A ND1 
995  C CD2 . HIS A 142 ? 1.1662 0.8946 1.1513 0.0780  -0.0408 0.1392  141 HIS A CD2 
996  C CE1 . HIS A 142 ? 1.1970 0.8826 1.2271 0.0783  -0.0065 0.1599  141 HIS A CE1 
997  N NE2 . HIS A 142 ? 1.1719 0.8764 1.1756 0.0793  -0.0318 0.1468  141 HIS A NE2 
998  N N   . GLU A 143 ? 1.1266 0.8921 1.1390 0.0795  -0.0022 0.1335  142 GLU A N   
999  C CA  . GLU A 143 ? 1.1383 0.9297 1.1833 0.0800  -0.0050 0.1245  142 GLU A CA  
1000 C C   . GLU A 143 ? 1.1599 0.9399 1.1847 0.0902  -0.0011 0.1260  142 GLU A C   
1001 O O   . GLU A 143 ? 1.1462 0.9447 1.2022 0.0951  -0.0121 0.1215  142 GLU A O   
1002 C CB  . GLU A 143 ? 1.1915 0.9935 1.2778 0.0700  0.0188  0.1144  142 GLU A CB  
1003 C CG  . GLU A 143 ? 1.2440 1.0671 1.3630 0.0554  0.0191  0.1036  142 GLU A CG  
1004 C CD  . GLU A 143 ? 1.3213 1.1979 1.4761 0.0474  -0.0065 0.0959  142 GLU A CD  
1005 O OE1 . GLU A 143 ? 1.2596 1.1496 1.3999 0.0527  -0.0341 0.1053  142 GLU A OE1 
1006 O OE2 . GLU A 143 ? 1.3298 1.2402 1.5287 0.0340  0.0007  0.0825  142 GLU A OE2 
1007 N N   . ALA A 144 ? 1.1725 0.9275 1.1514 0.0913  0.0153  0.1324  143 ALA A N   
1008 C CA  . ALA A 144 ? 1.2011 0.9545 1.1591 0.0949  0.0227  0.1254  143 ALA A CA  
1009 C C   . ALA A 144 ? 1.1742 0.9261 1.1091 0.1042  -0.0021 0.1275  143 ALA A C   
1010 O O   . ALA A 144 ? 1.1858 0.9453 1.1365 0.1083  -0.0027 0.1145  143 ALA A O   
1011 C CB  . ALA A 144 ? 1.2588 1.0006 1.1702 0.0868  0.0479  0.1327  143 ALA A CB  
1012 N N   . ALA A 145 ? 1.1799 0.9220 1.0863 0.1069  -0.0204 0.1413  144 ALA A N   
1013 C CA  . ALA A 145 ? 1.1503 0.8914 1.0355 0.1145  -0.0441 0.1426  144 ALA A CA  
1014 C C   . ALA A 145 ? 1.1094 0.8702 1.0379 0.1169  -0.0657 0.1394  144 ALA A C   
1015 O O   . ALA A 145 ? 1.0902 0.8534 1.0190 0.1232  -0.0792 0.1377  144 ALA A O   
1016 C CB  . ALA A 145 ? 1.1348 0.8617 0.9851 0.1156  -0.0555 0.1569  144 ALA A CB  
1017 N N   . ARG A 146 ? 1.0933 0.8735 1.0605 0.1100  -0.0697 0.1405  145 ARG A N   
1018 C CA  . ARG A 146 ? 1.0550 0.8668 1.0630 0.1085  -0.0932 0.1453  145 ARG A CA  
1019 C C   . ARG A 146 ? 1.0828 0.9044 1.1412 0.1153  -0.0886 0.1443  145 ARG A C   
1020 O O   . ARG A 146 ? 1.0431 0.8792 1.1310 0.1201  -0.1078 0.1546  145 ARG A O   
1021 C CB  . ARG A 146 ? 1.0616 0.9046 1.0968 0.0942  -0.0984 0.1445  145 ARG A CB  
1022 N N   . ALA A 147 ? 1.1365 0.9507 1.2128 0.1149  -0.0615 0.1324  146 ALA A N   
1023 C CA  . ALA A 147 ? 1.1524 0.9756 1.2907 0.1204  -0.0516 0.1251  146 ALA A CA  
1024 C C   . ALA A 147 ? 1.1920 0.9953 1.3157 0.1266  -0.0397 0.1106  146 ALA A C   
1025 O O   . ALA A 147 ? 1.1764 0.9869 1.3595 0.1333  -0.0418 0.1079  146 ALA A O   
1026 C CB  . ALA A 147 ? 1.2108 1.0382 1.3786 0.1144  -0.0238 0.1117  146 ALA A CB  
1027 N N   . GLY A 148 ? 1.1345 0.9173 1.1867 0.1230  -0.0266 0.1019  147 GLY A N   
1028 C CA  . GLY A 148 ? 1.1723 0.9464 1.2020 0.1240  -0.0157 0.0843  147 GLY A CA  
1029 C C   . GLY A 148 ? 1.2784 1.0570 1.3167 0.1144  0.0216  0.0553  147 GLY A C   
1030 O O   . GLY A 148 ? 1.2931 1.0781 1.3769 0.1141  0.0363  0.0303  147 GLY A O   
1031 N N   . HIS A 149 ? 1.2359 1.0136 1.2361 0.1039  0.0398  0.0567  148 HIS A N   
1032 C CA  . HIS A 149 ? 1.3222 1.1111 1.3180 0.0887  0.0774  0.0298  148 HIS A CA  
1033 C C   . HIS A 149 ? 1.3963 1.1883 1.3008 0.0766  0.0841  0.0345  148 HIS A C   
1034 O O   . HIS A 149 ? 1.3808 1.1637 1.2371 0.0752  0.0763  0.0642  148 HIS A O   
1035 C CB  . HIS A 149 ? 1.3374 1.1295 1.3631 0.0826  0.0947  0.0314  148 HIS A CB  
1036 C CG  . HIS A 149 ? 1.2891 1.0878 1.4054 0.0931  0.0843  0.0322  148 HIS A CG  
1037 N ND1 . HIS A 149 ? 1.2780 1.0885 1.4778 0.0961  0.0962  0.0087  148 HIS A ND1 
1038 C CD2 . HIS A 149 ? 1.2477 1.0493 1.3898 0.0991  0.0632  0.0547  148 HIS A CD2 
1039 C CE1 . HIS A 149 ? 1.2184 1.0395 1.4911 0.1056  0.0790  0.0240  148 HIS A CE1 
1040 N NE2 . HIS A 149 ? 1.2071 1.0267 1.4410 0.1057  0.0586  0.0502  148 HIS A NE2 
1041 N N   . LEU A 150 ? 1.2656 1.0752 1.1538 0.0663  0.0991  0.0057  149 LEU A N   
1042 C CA  . LEU A 150 ? 1.3261 1.1514 1.1267 0.0526  0.1007  0.0127  149 LEU A CA  
1043 C C   . LEU A 150 ? 1.3861 1.2294 1.1430 0.0315  0.1256  0.0215  149 LEU A C   
1044 O O   . LEU A 150 ? 1.3524 1.1955 1.0479 0.0282  0.1146  0.0596  149 LEU A O   
1045 C CB  . LEU A 150 ? 1.3505 1.2006 1.1491 0.0419  0.1136  -0.0278 149 LEU A CB  
1046 C CG  . LEU A 150 ? 1.3875 1.2695 1.0954 0.0230  0.1147  -0.0243 149 LEU A CG  
1047 C CD1 . LEU A 150 ? 1.3475 1.2114 1.0138 0.0403  0.0754  0.0132  149 LEU A CD1 
1048 C CD2 . LEU A 150 ? 1.4066 1.3276 1.1219 0.0016  0.1422  -0.0807 149 LEU A CD2 
1049 N N   . GLU A 151 ? 1.3772 1.2375 1.1718 0.0161  0.1603  -0.0116 150 GLU A N   
1050 C CA  . GLU A 151 ? 1.3985 1.2838 1.1474 -0.0098 0.1882  -0.0068 150 GLU A CA  
1051 C C   . GLU A 151 ? 1.3957 1.2550 1.1381 -0.0019 0.1791  0.0393  150 GLU A C   
1052 O O   . GLU A 151 ? 1.3978 1.2708 1.0836 -0.0183 0.1878  0.0687  150 GLU A O   
1053 C CB  . GLU A 151 ? 1.4150 1.3256 1.2149 -0.0298 0.2306  -0.0598 150 GLU A CB  
1054 C CG  . GLU A 151 ? 1.4823 1.4469 1.2176 -0.0690 0.2636  -0.0819 150 GLU A CG  
1055 C CD  . GLU A 151 ? 1.5611 1.5524 1.3502 -0.0928 0.3108  -0.1373 150 GLU A CD  
1056 O OE1 . GLU A 151 ? 1.5122 1.4843 1.4010 -0.0774 0.3182  -0.1703 150 GLU A OE1 
1057 O OE2 . GLU A 151 ? 1.5577 1.5929 1.2931 -0.1284 0.3407  -0.1459 150 GLU A OE2 
1058 N N   . ILE A 152 ? 1.4161 1.2432 1.2191 0.0205  0.1624  0.0471  151 ILE A N   
1059 C CA  . ILE A 152 ? 1.3789 1.1836 1.1840 0.0261  0.1560  0.0835  151 ILE A CA  
1060 C C   . ILE A 152 ? 1.3396 1.1302 1.0930 0.0339  0.1297  0.1269  151 ILE A C   
1061 O O   . ILE A 152 ? 1.3381 1.1215 1.0700 0.0280  0.1346  0.1619  151 ILE A O   
1062 C CB  . ILE A 152 ? 1.3192 1.1065 1.2026 0.0431  0.1448  0.0757  151 ILE A CB  
1063 C CG1 . ILE A 152 ? 1.3516 1.1531 1.2942 0.0337  0.1749  0.0430  151 ILE A CG1 
1064 C CG2 . ILE A 152 ? 1.2694 1.0352 1.1553 0.0497  0.1320  0.1085  151 ILE A CG2 
1065 C CD1 . ILE A 152 ? 1.3673 1.1848 1.3576 0.0347  0.1832  0.0031  151 ILE A CD1 
1066 N N   . VAL A 153 ? 1.4581 1.2447 1.1987 0.0469  0.1029  0.1260  152 VAL A N   
1067 C CA  . VAL A 153 ? 1.3987 1.1742 1.0985 0.0547  0.0779  0.1637  152 VAL A CA  
1068 C C   . VAL A 153 ? 1.4509 1.2529 1.0838 0.0364  0.0875  0.1890  152 VAL A C   
1069 O O   . VAL A 153 ? 1.4215 1.2151 1.0368 0.0369  0.0802  0.2342  152 VAL A O   
1070 C CB  . VAL A 153 ? 1.3673 1.1368 1.0685 0.0701  0.0494  0.1527  152 VAL A CB  
1071 C CG1 . VAL A 153 ? 1.3202 1.0857 0.9768 0.0753  0.0267  0.1866  152 VAL A CG1 
1072 C CG2 . VAL A 153 ? 1.2998 1.0496 1.0621 0.0855  0.0342  0.1435  152 VAL A CG2 
1073 N N   . GLU A 154 ? 1.4006 1.2404 1.0012 0.0174  0.1049  0.1608  153 GLU A N   
1074 C CA  . GLU A 154 ? 1.4316 1.3133 0.9619 -0.0067 0.1134  0.1848  153 GLU A CA  
1075 C C   . GLU A 154 ? 1.4660 1.3515 0.9900 -0.0221 0.1348  0.2177  153 GLU A C   
1076 O O   . GLU A 154 ? 1.4629 1.3672 0.9422 -0.0330 0.1295  0.2688  153 GLU A O   
1077 C CB  . GLU A 154 ? 1.4960 1.4271 0.9995 -0.0307 0.1342  0.1354  153 GLU A CB  
1078 C CG  . GLU A 154 ? 1.5205 1.4622 1.0079 -0.0232 0.1132  0.1156  153 GLU A CG  
1079 C CD  . GLU A 154 ? 1.6445 1.6405 1.1129 -0.0517 0.1398  0.0598  153 GLU A CD  
1080 O OE1 . GLU A 154 ? 1.6532 1.6497 1.1742 -0.0587 0.1693  0.0100  153 GLU A OE1 
1081 O OE2 . GLU A 154 ? 1.6133 1.6556 1.0201 -0.0688 0.1326  0.0636  153 GLU A OE2 
1082 N N   . VAL A 155 ? 1.4418 1.3114 1.0152 -0.0235 0.1586  0.1927  154 VAL A N   
1083 C CA  . VAL A 155 ? 1.4619 1.3333 1.0349 -0.0393 0.1824  0.2203  154 VAL A CA  
1084 C C   . VAL A 155 ? 1.4224 1.2519 1.0231 -0.0207 0.1654  0.2716  154 VAL A C   
1085 O O   . VAL A 155 ? 1.4282 1.2638 1.0082 -0.0320 0.1713  0.3227  154 VAL A O   
1086 C CB  . VAL A 155 ? 1.5075 1.3768 1.1318 -0.0467 0.2140  0.1732  154 VAL A CB  
1087 C CG1 . VAL A 155 ? 1.5155 1.3747 1.1539 -0.0574 0.2361  0.2017  154 VAL A CG1 
1088 C CG2 . VAL A 155 ? 1.5511 1.4696 1.1521 -0.0735 0.2410  0.1237  154 VAL A CG2 
1089 N N   . LEU A 156 ? 1.4186 1.2095 1.0718 0.0054  0.1456  0.2592  155 LEU A N   
1090 C CA  . LEU A 156 ? 1.3703 1.1249 1.0620 0.0196  0.1346  0.2954  155 LEU A CA  
1091 C C   . LEU A 156 ? 1.3817 1.1382 1.0413 0.0235  0.1135  0.3478  155 LEU A C   
1092 O O   . LEU A 156 ? 1.4084 1.1508 1.0880 0.0224  0.1180  0.3951  155 LEU A O   
1093 C CB  . LEU A 156 ? 1.3098 1.0375 1.0572 0.0405  0.1173  0.2651  155 LEU A CB  
1094 C CG  . LEU A 156 ? 1.3448 1.0713 1.1432 0.0388  0.1340  0.2251  155 LEU A CG  
1095 C CD1 . LEU A 156 ? 1.2888 1.0037 1.1323 0.0556  0.1105  0.2028  155 LEU A CD1 
1096 C CD2 . LEU A 156 ? 1.3734 1.0897 1.2031 0.0281  0.1610  0.2397  155 LEU A CD2 
1097 N N   . LEU A 157 ? 1.4525 1.2272 1.0708 0.0282  0.0908  0.3414  156 LEU A N   
1098 C CA  . LEU A 157 ? 1.4272 1.2103 1.0177 0.0320  0.0680  0.3916  156 LEU A CA  
1099 C C   . LEU A 157 ? 1.4941 1.3179 1.0357 0.0077  0.0799  0.4406  156 LEU A C   
1100 O O   . LEU A 157 ? 1.4878 1.3141 1.0306 0.0103  0.0657  0.5020  156 LEU A O   
1101 C CB  . LEU A 157 ? 1.4047 1.2037 0.9612 0.0399  0.0428  0.3680  156 LEU A CB  
1102 C CG  . LEU A 157 ? 1.3582 1.1218 0.9591 0.0631  0.0245  0.3342  156 LEU A CG  
1103 C CD1 . LEU A 157 ? 1.3521 1.1346 0.9174 0.0670  0.0051  0.3084  156 LEU A CD1 
1104 C CD2 . LEU A 157 ? 1.3087 1.0384 0.9574 0.0787  0.0105  0.3667  156 LEU A CD2 
1105 N N   . LYS A 158 ? 1.3936 1.2541 0.8972 -0.0178 0.1061  0.4163  157 LYS A N   
1106 C CA  . LYS A 158 ? 1.4669 1.3769 0.9181 -0.0476 0.1194  0.4628  157 LYS A CA  
1107 C C   . LYS A 158 ? 1.4926 1.3768 0.9864 -0.0505 0.1374  0.5102  157 LYS A C   
1108 O O   . LYS A 158 ? 1.5519 1.4635 1.0228 -0.0658 0.1365  0.5785  157 LYS A O   
1109 C CB  . LYS A 158 ? 1.4937 1.4573 0.8938 -0.0792 0.1464  0.4129  157 LYS A CB  
1110 N N   . TYR A 159 ? 1.4374 1.2733 0.9968 -0.0376 0.1537  0.4778  158 TYR A N   
1111 C CA  . TYR A 159 ? 1.4424 1.2502 1.0534 -0.0401 0.1740  0.5153  158 TYR A CA  
1112 C C   . TYR A 159 ? 1.4209 1.1859 1.0957 -0.0167 0.1554  0.5616  158 TYR A C   
1113 O O   . TYR A 159 ? 1.4522 1.1988 1.1733 -0.0205 0.1709  0.6087  158 TYR A O   
1114 C CB  . TYR A 159 ? 1.4538 1.2349 1.1138 -0.0388 0.2003  0.4584  158 TYR A CB  
1115 C CG  . TYR A 159 ? 1.5234 1.3419 1.1474 -0.0685 0.2335  0.4330  158 TYR A CG  
1116 C CD1 . TYR A 159 ? 1.5531 1.4044 1.1406 -0.0780 0.2381  0.3749  158 TYR A CD1 
1117 C CD2 . TYR A 159 ? 1.5624 1.3838 1.1972 -0.0886 0.2634  0.4646  158 TYR A CD2 
1118 C CE1 . TYR A 159 ? 1.6075 1.4956 1.1720 -0.1076 0.2726  0.3442  158 TYR A CE1 
1119 C CE2 . TYR A 159 ? 1.6171 1.4761 1.2201 -0.1189 0.2964  0.4372  158 TYR A CE2 
1120 C CZ  . TYR A 159 ? 1.6623 1.5556 1.2311 -0.1287 0.3015  0.3745  158 TYR A CZ  
1121 O OH  . TYR A 159 ? 1.7078 1.6409 1.2544 -0.1611 0.3383  0.3400  158 TYR A OH  
1122 N N   . GLY A 160 ? 1.5318 1.2809 1.2179 0.0059  0.1257  0.5473  159 GLY A N   
1123 C CA  . GLY A 160 ? 1.4814 1.1950 1.2339 0.0260  0.1100  0.5852  159 GLY A CA  
1124 C C   . GLY A 160 ? 1.4441 1.1172 1.2574 0.0469  0.1029  0.5323  159 GLY A C   
1125 O O   . GLY A 160 ? 1.4158 1.0534 1.3106 0.0560  0.1100  0.5422  159 GLY A O   
1126 N N   . ALA A 161 ? 1.4713 1.1536 1.2506 0.0520  0.0905  0.4758  160 ALA A N   
1127 C CA  . ALA A 161 ? 1.4165 1.0725 1.2444 0.0676  0.0805  0.4294  160 ALA A CA  
1128 C C   . ALA A 161 ? 1.3861 1.0281 1.2393 0.0833  0.0552  0.4492  160 ALA A C   
1129 O O   . ALA A 161 ? 1.3902 1.0489 1.2078 0.0855  0.0377  0.4892  160 ALA A O   
1130 C CB  . ALA A 161 ? 1.4190 1.0919 1.2093 0.0684  0.0725  0.3737  160 ALA A CB  
1131 N N   . ASP A 162 ? 1.4175 1.0349 1.3355 0.0918  0.0542  0.4187  161 ASP A N   
1132 C CA  . ASP A 162 ? 1.3768 0.9808 1.3319 0.1046  0.0347  0.4253  161 ASP A CA  
1133 C C   . ASP A 162 ? 1.3629 0.9816 1.2697 0.1114  0.0083  0.3878  161 ASP A C   
1134 O O   . ASP A 162 ? 1.3480 0.9693 1.2608 0.1096  0.0078  0.3395  161 ASP A O   
1135 C CB  . ASP A 162 ? 1.3719 0.9503 1.4241 0.1040  0.0516  0.4034  161 ASP A CB  
1136 C CG  . ASP A 162 ? 1.3850 0.9500 1.4954 0.1133  0.0402  0.4157  161 ASP A CG  
1137 O OD1 . ASP A 162 ? 1.3631 0.9383 1.4412 0.1212  0.0139  0.4030  161 ASP A OD1 
1138 O OD2 . ASP A 162 ? 1.4225 0.9762 1.6114 0.1093  0.0574  0.4255  161 ASP A OD2 
1139 N N   . VAL A 163 ? 1.3724 1.0050 1.2346 0.1179  -0.0142 0.4131  162 VAL A N   
1140 C CA  . VAL A 163 ? 1.3442 0.9908 1.1599 0.1234  -0.0373 0.3799  162 VAL A CA  
1141 C C   . VAL A 163 ? 1.3205 0.9517 1.1847 0.1309  -0.0488 0.3497  162 VAL A C   
1142 O O   . VAL A 163 ? 1.2949 0.9347 1.1373 0.1319  -0.0618 0.3118  162 VAL A O   
1143 C CB  . VAL A 163 ? 1.3665 1.0387 1.1233 0.1243  -0.0568 0.4099  162 VAL A CB  
1144 C CG1 . VAL A 163 ? 1.3550 1.0454 1.0567 0.1263  -0.0719 0.3732  162 VAL A CG1 
1145 C CG2 . VAL A 163 ? 1.4127 1.1081 1.1334 0.1100  -0.0434 0.4474  162 VAL A CG2 
1146 N N   . ASN A 164 ? 1.3130 0.9245 1.2489 0.1338  -0.0423 0.3653  163 ASN A N   
1147 C CA  . ASN A 164 ? 1.2906 0.8933 1.2801 0.1355  -0.0480 0.3320  163 ASN A CA  
1148 C C   . ASN A 164 ? 1.3216 0.9151 1.3828 0.1239  -0.0227 0.3007  163 ASN A C   
1149 O O   . ASN A 164 ? 1.3228 0.9051 1.4616 0.1213  -0.0132 0.2886  163 ASN A O   
1150 C CB  . ASN A 164 ? 1.2871 0.8857 1.3103 0.1425  -0.0584 0.3520  163 ASN A CB  
1151 C CG  . ASN A 164 ? 1.3839 1.0038 1.3306 0.1478  -0.0841 0.3620  163 ASN A CG  
1152 O OD1 . ASN A 164 ? 1.3337 0.9651 1.2218 0.1495  -0.0985 0.3422  163 ASN A OD1 
1153 N ND2 . ASN A 164 ? 1.3838 1.0119 1.3377 0.1496  -0.0889 0.3924  163 ASN A ND2 
1154 N N   . ALA A 165 ? 1.2272 0.8295 1.2692 0.1148  -0.0097 0.2835  164 ALA A N   
1155 C CA  . ALA A 165 ? 1.2461 0.8492 1.3515 0.1008  0.0137  0.2502  164 ALA A CA  
1156 C C   . ALA A 165 ? 1.2566 0.8826 1.3752 0.0908  0.0031  0.1986  164 ALA A C   
1157 O O   . ALA A 165 ? 1.2372 0.8818 1.2996 0.0933  -0.0203 0.1861  164 ALA A O   
1158 C CB  . ALA A 165 ? 1.2706 0.8821 1.3518 0.0939  0.0282  0.2471  164 ALA A CB  
1159 N N   . VAL A 166 ? 1.1592 0.7883 1.3563 0.0766  0.0225  0.1679  165 VAL A N   
1160 C CA  . VAL A 166 ? 1.1722 0.8336 1.3879 0.0596  0.0163  0.1167  165 VAL A CA  
1161 C C   . VAL A 166 ? 1.2249 0.9169 1.4757 0.0365  0.0356  0.0782  165 VAL A C   
1162 O O   . VAL A 166 ? 1.2345 0.9130 1.5493 0.0296  0.0658  0.0753  165 VAL A O   
1163 C CB  . VAL A 166 ? 1.1836 0.8342 1.4692 0.0566  0.0241  0.1028  165 VAL A CB  
1164 C CG1 . VAL A 166 ? 1.2073 0.9013 1.5110 0.0315  0.0222  0.0434  165 VAL A CG1 
1165 C CG2 . VAL A 166 ? 1.1524 0.7792 1.4048 0.0796  0.0017  0.1431  165 VAL A CG2 
1166 N N   . ASP A 167 ? 1.1986 0.9352 1.4119 0.0236  0.0180  0.0514  166 ASP A N   
1167 C CA  . ASP A 167 ? 1.2367 1.0181 1.4794 -0.0015 0.0302  0.0147  166 ASP A CA  
1168 C C   . ASP A 167 ? 1.2645 1.0882 1.5565 -0.0312 0.0381  -0.0378 166 ASP A C   
1169 O O   . ASP A 167 ? 1.2465 1.0549 1.5652 -0.0306 0.0410  -0.0469 166 ASP A O   
1170 C CB  . ASP A 167 ? 1.2496 1.0638 1.4331 -0.0002 0.0054  0.0228  166 ASP A CB  
1171 C CG  . ASP A 167 ? 1.2720 1.1029 1.4016 0.0046  -0.0282 0.0287  166 ASP A CG  
1172 O OD1 . ASP A 167 ? 1.2944 1.1631 1.4354 -0.0160 -0.0354 -0.0011 166 ASP A OD1 
1173 O OD2 . ASP A 167 ? 1.2494 1.0586 1.3279 0.0263  -0.0452 0.0603  166 ASP A OD2 
1174 N N   . ALA A 168 ? 1.1816 1.0662 1.4889 -0.0604 0.0422  -0.0751 167 ALA A N   
1175 C CA  . ALA A 168 ? 1.1475 1.0879 1.5012 -0.0975 0.0538  -0.1330 167 ALA A CA  
1176 C C   . ALA A 168 ? 1.1494 1.1177 1.4570 -0.1036 0.0252  -0.1388 167 ALA A C   
1177 O O   . ALA A 168 ? 1.1115 1.0917 1.4589 -0.1215 0.0377  -0.1759 167 ALA A O   
1178 C CB  . ALA A 168 ? 1.1229 1.1363 1.4932 -0.1306 0.0604  -0.1677 167 ALA A CB  
1179 N N   . ALA A 169 ? 1.1629 1.1421 1.3948 -0.0902 -0.0106 -0.1043 168 ALA A N   
1180 C CA  . ALA A 169 ? 1.1373 1.1400 1.3236 -0.0948 -0.0384 -0.1035 168 ALA A CA  
1181 C C   . ALA A 169 ? 1.1608 1.0984 1.3337 -0.0654 -0.0429 -0.0808 168 ALA A C   
1182 O O   . ALA A 169 ? 1.1331 1.0832 1.2709 -0.0673 -0.0638 -0.0810 168 ALA A O   
1183 C CB  . ALA A 169 ? 1.1211 1.1558 1.2457 -0.0897 -0.0733 -0.0706 168 ALA A CB  
1184 N N   . GLY A 170 ? 1.2054 1.0793 1.4062 -0.0403 -0.0250 -0.0586 169 GLY A N   
1185 C CA  . GLY A 170 ? 1.1842 1.0044 1.3758 -0.0132 -0.0313 -0.0311 169 GLY A CA  
1186 C C   . GLY A 170 ? 1.1560 0.9470 1.2725 0.0168  -0.0572 0.0173  169 GLY A C   
1187 O O   . GLY A 170 ? 1.1146 0.8714 1.2150 0.0369  -0.0665 0.0400  169 GLY A O   
1188 N N   . GLY A 171 ? 1.2208 1.0281 1.2984 0.0189  -0.0677 0.0312  170 GLY A N   
1189 C CA  . GLY A 171 ? 1.1541 0.9395 1.1705 0.0431  -0.0879 0.0672  170 GLY A CA  
1190 C C   . GLY A 171 ? 1.1484 0.8879 1.1591 0.0647  -0.0748 0.1001  170 GLY A C   
1191 O O   . GLY A 171 ? 1.1769 0.9055 1.2252 0.0614  -0.0513 0.1017  170 GLY A O   
1192 N N   . THR A 172 ? 1.1729 0.8905 1.1356 0.0841  -0.0895 0.1261  171 THR A N   
1193 C CA  . THR A 172 ? 1.1639 0.8513 1.1057 0.1003  -0.0812 0.1599  171 THR A CA  
1194 C C   . THR A 172 ? 1.1631 0.8577 1.0599 0.1062  -0.0867 0.1675  171 THR A C   
1195 O O   . THR A 172 ? 1.1384 0.8547 1.0220 0.1032  -0.1018 0.1537  171 THR A O   
1196 C CB  . THR A 172 ? 1.1766 0.8443 1.1006 0.1139  -0.0924 0.1815  171 THR A CB  
1197 O OG1 . THR A 172 ? 1.1380 0.8180 1.0207 0.1174  -0.1161 0.1716  171 THR A OG1 
1198 C CG2 . THR A 172 ? 1.1898 0.8468 1.1777 0.1098  -0.0829 0.1755  171 THR A CG2 
1199 N N   . PRO A 173 ? 1.1617 0.8420 1.0413 0.1124  -0.0729 0.1895  172 PRO A N   
1200 C CA  . PRO A 173 ? 1.1615 0.8507 1.0058 0.1159  -0.0739 0.1893  172 PRO A CA  
1201 C C   . PRO A 173 ? 1.1427 0.8375 0.9488 0.1235  -0.0948 0.1855  172 PRO A C   
1202 O O   . PRO A 173 ? 1.1373 0.8444 0.9381 0.1242  -0.0984 0.1741  172 PRO A O   
1203 C CB  . PRO A 173 ? 1.2042 0.8813 1.0304 0.1170  -0.0546 0.2139  172 PRO A CB  
1204 C CG  . PRO A 173 ? 1.2360 0.8989 1.1076 0.1123  -0.0389 0.2251  172 PRO A CG  
1205 C CD  . PRO A 173 ? 1.1923 0.8525 1.0927 0.1129  -0.0525 0.2142  172 PRO A CD  
1206 N N   . LEU A 174 ? 1.1877 0.8744 0.9763 0.1291  -0.1077 0.1942  173 LEU A N   
1207 C CA  . LEU A 174 ? 1.1565 0.8494 0.9126 0.1349  -0.1267 0.1871  173 LEU A CA  
1208 C C   . LEU A 174 ? 1.1370 0.8441 0.9122 0.1300  -0.1417 0.1670  173 LEU A C   
1209 O O   . LEU A 174 ? 1.1165 0.8312 0.8766 0.1330  -0.1533 0.1601  173 LEU A O   
1210 C CB  . LEU A 174 ? 1.1484 0.8330 0.8859 0.1414  -0.1374 0.2023  173 LEU A CB  
1211 C CG  . LEU A 174 ? 1.1453 0.8497 0.8529 0.1426  -0.1481 0.1934  173 LEU A CG  
1212 C CD1 . LEU A 174 ? 1.1935 0.8975 0.8541 0.1455  -0.1417 0.1991  173 LEU A CD1 
1213 C CD2 . LEU A 174 ? 1.1332 0.8528 0.8524 0.1415  -0.1529 0.2018  173 LEU A CD2 
1214 N N   . HIS A 175 ? 1.1341 0.8498 0.9455 0.1195  -0.1404 0.1575  174 HIS A N   
1215 C CA  . HIS A 175 ? 1.1152 0.8583 0.9412 0.1084  -0.1551 0.1420  174 HIS A CA  
1216 C C   . HIS A 175 ? 1.1297 0.8916 0.9678 0.1068  -0.1562 0.1438  174 HIS A C   
1217 O O   . HIS A 175 ? 1.1018 0.8809 0.9398 0.1058  -0.1728 0.1449  174 HIS A O   
1218 C CB  . HIS A 175 ? 1.1483 0.9081 1.0113 0.0911  -0.1496 0.1252  174 HIS A CB  
1219 C CG  . HIS A 175 ? 1.1650 0.9217 1.0305 0.0874  -0.1560 0.1138  174 HIS A CG  
1220 N ND1 . HIS A 175 ? 1.2030 0.9369 1.0946 0.0906  -0.1425 0.1144  174 HIS A ND1 
1221 C CD2 . HIS A 175 ? 1.1533 0.9280 1.0063 0.0799  -0.1734 0.1019  174 HIS A CD2 
1222 C CE1 . HIS A 175 ? 1.2043 0.9419 1.1031 0.0861  -0.1508 0.1001  174 HIS A CE1 
1223 N NE2 . HIS A 175 ? 1.1777 0.9405 1.0486 0.0785  -0.1691 0.0906  174 HIS A NE2 
1224 N N   . GLU A 176 ? 1.0666 0.8261 0.9230 0.1063  -0.1383 0.1463  175 GLU A N   
1225 C CA  . GLU A 176 ? 1.0704 0.8489 0.9514 0.1056  -0.1380 0.1479  175 GLU A CA  
1226 C C   . GLU A 176 ? 1.0797 0.8463 0.9472 0.1184  -0.1390 0.1518  175 GLU A C   
1227 O O   . GLU A 176 ? 1.0653 0.8492 0.9617 0.1195  -0.1482 0.1548  175 GLU A O   
1228 C CB  . GLU A 176 ? 1.1192 0.8967 1.0246 0.1017  -0.1155 0.1461  175 GLU A CB  
1229 C CG  . GLU A 176 ? 1.1843 0.9778 1.1165 0.0860  -0.1096 0.1355  175 GLU A CG  
1230 C CD  . GLU A 176 ? 1.2612 1.1051 1.2231 0.0698  -0.1259 0.1282  175 GLU A CD  
1231 O OE1 . GLU A 176 ? 1.2058 1.0692 1.1789 0.0736  -0.1398 0.1393  175 GLU A OE1 
1232 O OE2 . GLU A 176 ? 1.2703 1.1390 1.2498 0.0512  -0.1240 0.1117  175 GLU A OE2 
1233 N N   . ALA A 177 ? 1.1145 0.8570 0.9450 0.1262  -0.1289 0.1522  176 ALA A N   
1234 C CA  . ALA A 177 ? 1.1337 0.8715 0.9528 0.1334  -0.1248 0.1464  176 ALA A CA  
1235 C C   . ALA A 177 ? 1.1141 0.8548 0.9270 0.1371  -0.1453 0.1445  176 ALA A C   
1236 O O   . ALA A 177 ? 1.1233 0.8685 0.9603 0.1407  -0.1455 0.1388  176 ALA A O   
1237 C CB  . ALA A 177 ? 1.1800 0.9054 0.9557 0.1345  -0.1086 0.1473  176 ALA A CB  
1238 N N   . ALA A 178 ? 1.1437 0.8815 0.9328 0.1355  -0.1605 0.1478  177 ALA A N   
1239 C CA  . ALA A 178 ? 1.1135 0.8550 0.8955 0.1369  -0.1792 0.1454  177 ALA A CA  
1240 C C   . ALA A 178 ? 1.1024 0.8696 0.9239 0.1291  -0.1936 0.1524  177 ALA A C   
1241 O O   . ALA A 178 ? 1.0829 0.8642 0.9208 0.1273  -0.1982 0.1521  177 ALA A O   
1242 C CB  . ALA A 178 ? 1.0877 0.8352 0.8508 0.1304  -0.1807 0.1398  177 ALA A CB  
1243 N N   . ARG A 179 ? 1.0992 0.8854 0.9440 0.1196  -0.1947 0.1577  178 ARG A N   
1244 C CA  . ARG A 179 ? 1.0775 0.9013 0.9571 0.1083  -0.2123 0.1704  178 ARG A CA  
1245 C C   . ARG A 179 ? 1.0996 0.9310 1.0291 0.1155  -0.2098 0.1834  178 ARG A C   
1246 O O   . ARG A 179 ? 1.0730 0.9304 1.0363 0.1120  -0.2233 0.2000  178 ARG A O   
1247 C CB  . ARG A 179 ? 1.0882 0.9419 0.9767 0.0903  -0.2129 0.1662  178 ARG A CB  
1248 C CG  . ARG A 179 ? 1.1107 1.0200 1.0246 0.0710  -0.2344 0.1799  178 ARG A CG  
1249 C CD  . ARG A 179 ? 1.1735 1.1173 1.0841 0.0468  -0.2325 0.1622  178 ARG A CD  
1250 N NE  . ARG A 179 ? 1.2487 1.1796 1.1744 0.0486  -0.2100 0.1492  178 ARG A NE  
1251 C CZ  . ARG A 179 ? 1.3478 1.2890 1.2774 0.0326  -0.1969 0.1255  178 ARG A CZ  
1252 N NH1 . ARG A 179 ? 1.3060 1.2727 1.2259 0.0124  -0.2029 0.1075  178 ARG A NH1 
1253 N NH2 . ARG A 179 ? 1.3392 1.2657 1.2885 0.0351  -0.1748 0.1170  178 ARG A NH2 
1254 N N   . ALA A 180 ? 1.1011 0.9150 1.0426 0.1237  -0.1876 0.1748  179 ALA A N   
1255 C CA  . ALA A 180 ? 1.1144 0.9338 1.1156 0.1307  -0.1802 0.1807  179 ALA A CA  
1256 C C   . ALA A 180 ? 1.1434 0.9423 1.1559 0.1414  -0.1743 0.1731  179 ALA A C   
1257 O O   . ALA A 180 ? 1.1233 0.9339 1.1916 0.1445  -0.1846 0.1887  179 ALA A O   
1258 C CB  . ALA A 180 ? 1.1617 0.9724 1.1728 0.1321  -0.1545 0.1678  179 ALA A CB  
1259 N N   . GLY A 181 ? 1.0763 0.8491 1.0415 0.1454  -0.1573 0.1505  180 GLY A N   
1260 C CA  . GLY A 181 ? 1.1067 0.8662 1.0789 0.1512  -0.1484 0.1344  180 GLY A CA  
1261 C C   . GLY A 181 ? 1.2002 0.9514 1.1740 0.1512  -0.1163 0.1058  180 GLY A C   
1262 O O   . GLY A 181 ? 1.2282 0.9799 1.2594 0.1534  -0.1004 0.0895  180 GLY A O   
1263 N N   . HIS A 182 ? 1.1636 0.9108 1.0804 0.1464  -0.1048 0.0991  181 HIS A N   
1264 C CA  . HIS A 182 ? 1.2530 1.0025 1.1561 0.1400  -0.0741 0.0735  181 HIS A CA  
1265 C C   . HIS A 182 ? 1.3000 1.0493 1.1234 0.1353  -0.0748 0.0684  181 HIS A C   
1266 O O   . HIS A 182 ? 1.2807 1.0273 1.0569 0.1332  -0.0792 0.0860  181 HIS A O   
1267 C CB  . HIS A 182 ? 1.2791 1.0323 1.1919 0.1353  -0.0587 0.0777  181 HIS A CB  
1268 C CG  . HIS A 182 ? 1.2426 1.0025 1.2289 0.1397  -0.0655 0.0905  181 HIS A CG  
1269 N ND1 . HIS A 182 ? 1.2560 1.0233 1.3238 0.1424  -0.0524 0.0782  181 HIS A ND1 
1270 C CD2 . HIS A 182 ? 1.1902 0.9570 1.1865 0.1400  -0.0838 0.1142  181 HIS A CD2 
1271 C CE1 . HIS A 182 ? 1.1998 0.9794 1.3229 0.1458  -0.0663 0.1004  181 HIS A CE1 
1272 N NE2 . HIS A 182 ? 1.1675 0.9502 1.2439 0.1427  -0.0853 0.1204  181 HIS A NE2 
1273 N N   . LEU A 183 ? 1.2590 1.0144 1.0751 0.1330  -0.0701 0.0457  182 LEU A N   
1274 C CA  . LEU A 183 ? 1.2904 1.0556 1.0335 0.1270  -0.0733 0.0422  182 LEU A CA  
1275 C C   . LEU A 183 ? 1.3862 1.1739 1.0885 0.1118  -0.0494 0.0327  182 LEU A C   
1276 O O   . LEU A 183 ? 1.3730 1.1734 1.0115 0.1065  -0.0568 0.0477  182 LEU A O   
1277 C CB  . LEU A 183 ? 1.3254 1.0973 1.0746 0.1259  -0.0737 0.0162  182 LEU A CB  
1278 C CG  . LEU A 183 ? 1.4236 1.2152 1.2085 0.1133  -0.0408 -0.0294 182 LEU A CG  
1279 C CD1 . LEU A 183 ? 1.4874 1.3147 1.2037 0.0949  -0.0278 -0.0524 182 LEU A CD1 
1280 C CD2 . LEU A 183 ? 1.4010 1.1815 1.2549 0.1200  -0.0412 -0.0461 182 LEU A CD2 
1281 N N   . GLU A 184 ? 1.3061 1.1030 1.0473 0.1032  -0.0210 0.0107  183 GLU A N   
1282 C CA  . GLU A 184 ? 1.3964 1.2216 1.0969 0.0834  0.0047  -0.0001 183 GLU A CA  
1283 C C   . GLU A 184 ? 1.3595 1.1780 1.0147 0.0845  -0.0056 0.0426  183 GLU A C   
1284 O O   . GLU A 184 ? 1.3725 1.2168 0.9675 0.0701  0.0000  0.0542  183 GLU A O   
1285 C CB  . GLU A 184 ? 1.4340 1.2682 1.1971 0.0738  0.0390  -0.0345 183 GLU A CB  
1286 C CG  . GLU A 184 ? 1.4810 1.3379 1.2824 0.0611  0.0649  -0.0885 183 GLU A CG  
1287 C CD  . GLU A 184 ? 1.4960 1.3275 1.3778 0.0792  0.0536  -0.0949 183 GLU A CD  
1288 O OE1 . GLU A 184 ? 1.4122 1.2152 1.3039 0.0992  0.0216  -0.0555 183 GLU A OE1 
1289 O OE2 . GLU A 184 ? 1.4574 1.3013 1.3974 0.0708  0.0788  -0.1401 183 GLU A OE2 
1290 N N   . ILE A 185 ? 1.4008 1.1897 1.0886 0.0993  -0.0202 0.0676  184 ILE A N   
1291 C CA  . ILE A 185 ? 1.3536 1.1326 1.0146 0.1004  -0.0266 0.1043  184 ILE A CA  
1292 C C   . ILE A 185 ? 1.2845 1.0513 0.9164 0.1106  -0.0556 0.1324  184 ILE A C   
1293 O O   . ILE A 185 ? 1.2632 1.0269 0.8716 0.1096  -0.0589 0.1639  184 ILE A O   
1294 C CB  . ILE A 185 ? 1.3350 1.0960 1.0497 0.1061  -0.0228 0.1108  184 ILE A CB  
1295 C CG1 . ILE A 185 ? 1.2603 1.0075 1.0209 0.1197  -0.0454 0.1098  184 ILE A CG1 
1296 C CG2 . ILE A 185 ? 1.4223 1.1967 1.1694 0.0953  0.0081  0.0855  184 ILE A CG2 
1297 C CD1 . ILE A 185 ? 1.2599 1.0031 1.0740 0.1219  -0.0443 0.1151  184 ILE A CD1 
1298 N N   . VAL A 186 ? 1.3499 1.1099 0.9906 0.1199  -0.0750 0.1225  185 VAL A N   
1299 C CA  . VAL A 186 ? 1.2822 1.0337 0.8988 0.1279  -0.1003 0.1433  185 VAL A CA  
1300 C C   . VAL A 186 ? 1.3291 1.1044 0.8895 0.1204  -0.1013 0.1561  185 VAL A C   
1301 O O   . VAL A 186 ? 1.3044 1.0766 0.8492 0.1237  -0.1130 0.1894  185 VAL A O   
1302 C CB  . VAL A 186 ? 1.2544 0.9981 0.8906 0.1361  -0.1184 0.1276  185 VAL A CB  
1303 C CG1 . VAL A 186 ? 1.2121 0.9534 0.8193 0.1415  -0.1407 0.1409  185 VAL A CG1 
1304 C CG2 . VAL A 186 ? 1.1994 0.9293 0.8867 0.1410  -0.1248 0.1293  185 VAL A CG2 
1305 N N   . GLU A 187 ? 1.3503 1.1555 0.8864 0.1082  -0.0884 0.1299  186 GLU A N   
1306 C CA  . GLU A 187 ? 1.3772 1.2212 0.8549 0.0953  -0.0900 0.1415  186 GLU A CA  
1307 C C   . GLU A 187 ? 1.4163 1.2754 0.8701 0.0842  -0.0787 0.1761  186 GLU A C   
1308 O O   . GLU A 187 ? 1.4012 1.2809 0.8197 0.0808  -0.0919 0.2148  186 GLU A O   
1309 C CB  . GLU A 187 ? 1.4516 1.3333 0.9134 0.0782  -0.0726 0.0959  186 GLU A CB  
1310 C CG  . GLU A 187 ? 1.4823 1.3523 0.9679 0.0876  -0.0834 0.0659  186 GLU A CG  
1311 C CD  . GLU A 187 ? 1.6457 1.5472 1.1407 0.0701  -0.0577 0.0121  186 GLU A CD  
1312 O OE1 . GLU A 187 ? 1.6918 1.6025 1.2114 0.0580  -0.0284 -0.0116 186 GLU A OE1 
1313 O OE2 . GLU A 187 ? 1.6137 1.5321 1.0976 0.0670  -0.0643 -0.0101 186 GLU A OE2 
1314 N N   . VAL A 188 ? 1.3601 1.2112 0.8382 0.0781  -0.0546 0.1661  187 VAL A N   
1315 C CA  . VAL A 188 ? 1.3880 1.2513 0.8477 0.0661  -0.0409 0.1992  187 VAL A CA  
1316 C C   . VAL A 188 ? 1.3394 1.1688 0.8216 0.0820  -0.0579 0.2470  187 VAL A C   
1317 O O   . VAL A 188 ? 1.3432 1.1874 0.8032 0.0762  -0.0615 0.2929  187 VAL A O   
1318 C CB  . VAL A 188 ? 1.4625 1.3237 0.9508 0.0559  -0.0094 0.1712  187 VAL A CB  
1319 C CG1 . VAL A 188 ? 1.4795 1.3428 0.9592 0.0462  0.0045  0.2084  187 VAL A CG1 
1320 C CG2 . VAL A 188 ? 1.5358 1.4401 1.0060 0.0339  0.0143  0.1232  187 VAL A CG2 
1321 N N   . LEU A 189 ? 1.3956 1.1840 0.9282 0.0998  -0.0673 0.2375  188 LEU A N   
1322 C CA  . LEU A 189 ? 1.3418 1.1011 0.9066 0.1118  -0.0793 0.2711  188 LEU A CA  
1323 C C   . LEU A 189 ? 1.3292 1.0967 0.8755 0.1183  -0.1032 0.3005  188 LEU A C   
1324 O O   . LEU A 189 ? 1.3246 1.0869 0.8859 0.1209  -0.1071 0.3442  188 LEU A O   
1325 C CB  . LEU A 189 ? 1.2895 1.0183 0.9060 0.1231  -0.0849 0.2469  188 LEU A CB  
1326 C CG  . LEU A 189 ? 1.3269 1.0470 0.9791 0.1186  -0.0647 0.2302  188 LEU A CG  
1327 C CD1 . LEU A 189 ? 1.2813 0.9900 0.9741 0.1257  -0.0760 0.2053  188 LEU A CD1 
1328 C CD2 . LEU A 189 ? 1.3480 1.0555 1.0237 0.1151  -0.0506 0.2585  188 LEU A CD2 
1329 N N   . LEU A 190 ? 1.3437 1.1246 0.8660 0.1211  -0.1187 0.2782  189 LEU A N   
1330 C CA  . LEU A 190 ? 1.3101 1.1174 0.8371 0.1185  -0.1393 0.2972  189 LEU A CA  
1331 C C   . LEU A 190 ? 1.3746 1.2207 0.8540 0.0997  -0.1413 0.3287  189 LEU A C   
1332 O O   . LEU A 190 ? 1.3677 1.2015 0.8517 0.0989  -0.1574 0.3484  189 LEU A O   
1333 C CB  . LEU A 190 ? 1.2818 1.0989 0.8037 0.1215  -0.1509 0.2595  189 LEU A CB  
1334 C CG  . LEU A 190 ? 1.2381 1.0252 0.8118 0.1318  -0.1548 0.2327  189 LEU A CG  
1335 C CD1 . LEU A 190 ? 1.2332 1.0256 0.7923 0.1332  -0.1627 0.1976  189 LEU A CD1 
1336 C CD2 . LEU A 190 ? 1.1906 0.9799 0.8260 0.1337  -0.1601 0.2497  189 LEU A CD2 
1337 N N   . LYS A 191 ? 1.3327 1.2079 0.7502 0.0918  -0.1213 0.3230  190 LYS A N   
1338 C CA  . LYS A 191 ? 1.3786 1.3019 0.7527 0.0676  -0.1178 0.3472  190 LYS A CA  
1339 C C   . LYS A 191 ? 1.3970 1.3006 0.8013 0.0672  -0.1125 0.3929  190 LYS A C   
1340 O O   . LYS A 191 ? 1.4004 1.3191 0.8043 0.0633  -0.1221 0.4216  190 LYS A O   
1341 C CB  . LYS A 191 ? 1.4543 1.4283 0.7783 0.0439  -0.0915 0.3160  190 LYS A CB  
1342 N N   . TYR A 192 ? 1.3557 1.2292 0.7924 0.0732  -0.0953 0.4015  191 TYR A N   
1343 C CA  . TYR A 192 ? 1.3589 1.2105 0.8351 0.0725  -0.0875 0.4415  191 TYR A CA  
1344 C C   . TYR A 192 ? 1.3324 1.1432 0.8732 0.0905  -0.1053 0.4511  191 TYR A C   
1345 O O   . TYR A 192 ? 1.3586 1.1630 0.9343 0.0901  -0.1021 0.4873  191 TYR A O   
1346 C CB  . TYR A 192 ? 1.3801 1.2098 0.8796 0.0751  -0.0606 0.4427  191 TYR A CB  
1347 C CG  . TYR A 192 ? 1.4560 1.3233 0.9112 0.0488  -0.0338 0.4382  191 TYR A CG  
1348 C CD1 . TYR A 192 ? 1.5028 1.3979 0.9208 0.0348  -0.0207 0.3819  191 TYR A CD1 
1349 C CD2 . TYR A 192 ? 1.4890 1.3651 0.9476 0.0360  -0.0189 0.4882  191 TYR A CD2 
1350 C CE1 . TYR A 192 ? 1.5735 1.5068 0.9574 0.0072  0.0079  0.3696  191 TYR A CE1 
1351 C CE2 . TYR A 192 ? 1.5569 1.4718 0.9733 0.0080  0.0077  0.4812  191 TYR A CE2 
1352 C CZ  . TYR A 192 ? 1.6248 1.5696 1.0033 -0.0071 0.0217  0.4188  191 TYR A CZ  
1353 O OH  . TYR A 192 ? 1.6934 1.6806 1.0358 -0.0383 0.0522  0.4044  191 TYR A OH  
1354 N N   . GLY A 193 ? 1.4067 1.1948 0.9673 0.1046  -0.1214 0.4192  192 GLY A N   
1355 C CA  . GLY A 193 ? 1.3854 1.1436 1.0044 0.1200  -0.1335 0.4215  192 GLY A CA  
1356 C C   . GLY A 193 ? 1.3543 1.0727 1.0296 0.1307  -0.1286 0.3968  192 GLY A C   
1357 O O   . GLY A 193 ? 1.3580 1.0545 1.0884 0.1329  -0.1135 0.4108  192 GLY A O   
1358 N N   . ALA A 194 ? 1.3441 1.0586 1.0125 0.1331  -0.1417 0.3605  193 ALA A N   
1359 C CA  . ALA A 194 ? 1.2940 0.9934 1.0243 0.1367  -0.1388 0.3370  193 ALA A CA  
1360 C C   . ALA A 194 ? 1.2669 0.9917 1.0397 0.1581  -0.1305 0.3266  193 ALA A C   
1361 O O   . ALA A 194 ? 1.2504 1.0145 1.0125 0.1553  -0.1422 0.3282  193 ALA A O   
1362 C CB  . ALA A 194 ? 1.2813 0.9931 0.9890 0.1400  -0.1278 0.3079  193 ALA A CB  
1363 N N   . ASP A 195 ? 1.2808 0.9627 1.0949 0.1641  -0.1289 0.3120  194 ASP A N   
1364 C CA  . ASP A 195 ? 1.2539 0.9377 1.1073 0.1679  -0.1378 0.2958  194 ASP A CA  
1365 C C   . ASP A 195 ? 1.2228 0.9265 1.0552 0.1569  -0.1514 0.2588  194 ASP A C   
1366 O O   . ASP A 195 ? 1.2229 0.9075 1.0541 0.1516  -0.1529 0.2331  194 ASP A O   
1367 C CB  . ASP A 195 ? 1.2790 0.9240 1.2066 0.1650  -0.1326 0.2885  194 ASP A CB  
1368 C CG  . ASP A 195 ? 1.3121 0.9556 1.2907 0.1680  -0.1404 0.2758  194 ASP A CG  
1369 O OD1 . ASP A 195 ? 1.2995 0.9565 1.2573 0.1658  -0.1547 0.2500  194 ASP A OD1 
1370 O OD2 . ASP A 195 ? 1.3505 0.9817 1.3971 0.1698  -0.1319 0.2904  194 ASP A OD2 
1371 N N   . VAL A 196 ? 1.2096 0.9462 1.0169 0.1553  -0.1611 0.2538  195 VAL A N   
1372 C CA  . VAL A 196 ? 1.1743 0.9211 0.9514 0.1474  -0.1696 0.2171  195 VAL A CA  
1373 C C   . VAL A 196 ? 1.1771 0.9059 0.9765 0.1462  -0.1777 0.1890  195 VAL A C   
1374 O O   . VAL A 196 ? 1.1551 0.8886 0.9353 0.1392  -0.1830 0.1625  195 VAL A O   
1375 C CB  . VAL A 196 ? 1.1822 0.9632 0.9309 0.1447  -0.1766 0.2178  195 VAL A CB  
1376 C CG1 . VAL A 196 ? 1.1730 0.9620 0.9481 0.1499  -0.1845 0.2206  195 VAL A CG1 
1377 C CG2 . VAL A 196 ? 1.1607 0.9462 0.8770 0.1380  -0.1789 0.1852  195 VAL A CG2 
1378 N N   . ASN A 197 ? 1.1357 0.8431 0.9795 0.1519  -0.1799 0.1954  196 ASN A N   
1379 C CA  . ASN A 197 ? 1.1530 0.8389 1.0215 0.1485  -0.1929 0.1667  196 ASN A CA  
1380 C C   . ASN A 197 ? 1.2066 0.8714 1.1319 0.1419  -0.1805 0.1581  196 ASN A C   
1381 O O   . ASN A 197 ? 1.2324 0.8970 1.2216 0.1338  -0.1719 0.1362  196 ASN A O   
1382 C CB  . ASN A 197 ? 1.1598 0.8491 1.0562 0.1537  -0.2012 0.1655  196 ASN A CB  
1383 C CG  . ASN A 197 ? 1.2208 0.9416 1.0714 0.1502  -0.2079 0.1544  196 ASN A CG  
1384 O OD1 . ASN A 197 ? 1.1828 0.9130 0.9970 0.1410  -0.2107 0.1320  196 ASN A OD1 
1385 N ND2 . ASN A 197 ? 1.1788 0.9176 1.0391 0.1571  -0.2092 0.1717  196 ASN A ND2 
1386 N N   . ALA A 198 ? 1.1109 0.7743 1.0255 0.1385  -0.1680 0.1660  197 ALA A N   
1387 C CA  . ALA A 198 ? 1.1452 0.8092 1.1185 0.1243  -0.1452 0.1480  197 ALA A CA  
1388 C C   . ALA A 198 ? 1.1819 0.8744 1.1641 0.1015  -0.1450 0.1008  197 ALA A C   
1389 O O   . ALA A 198 ? 1.1548 0.8661 1.0857 0.0972  -0.1619 0.0913  197 ALA A O   
1390 C CB  . ALA A 198 ? 1.1478 0.8080 1.1025 0.1250  -0.1333 0.1655  197 ALA A CB  
1391 N N   . VAL A 199 ? 1.0745 0.7753 1.1272 0.0840  -0.1244 0.0713  198 VAL A N   
1392 C CA  . VAL A 199 ? 1.1157 0.8566 1.1825 0.0548  -0.1213 0.0224  198 VAL A CA  
1393 C C   . VAL A 199 ? 1.1732 0.9368 1.2713 0.0340  -0.1007 0.0018  198 VAL A C   
1394 O O   . VAL A 199 ? 1.1834 0.9288 1.3458 0.0344  -0.0760 0.0011  198 VAL A O   
1395 C CB  . VAL A 199 ? 1.1546 0.8984 1.2852 0.0446  -0.1118 -0.0096 198 VAL A CB  
1396 C CG1 . VAL A 199 ? 1.1623 0.9586 1.3113 0.0059  -0.1022 -0.0664 198 VAL A CG1 
1397 C CG2 . VAL A 199 ? 1.1176 0.8467 1.2135 0.0630  -0.1350 0.0076  198 VAL A CG2 
1398 N N   . ASP A 200 ? 1.1579 0.9639 1.2161 0.0156  -0.1112 -0.0121 199 ASP A N   
1399 C CA  . ASP A 200 ? 1.1881 1.0299 1.2739 -0.0086 -0.0951 -0.0351 199 ASP A CA  
1400 C C   . ASP A 200 ? 1.1899 1.0823 1.3235 -0.0473 -0.0801 -0.0920 199 ASP A C   
1401 O O   . ASP A 200 ? 1.1618 1.0556 1.3125 -0.0536 -0.0797 -0.1137 199 ASP A O   
1402 C CB  . ASP A 200 ? 1.1813 1.0516 1.2107 -0.0102 -0.1150 -0.0164 199 ASP A CB  
1403 C CG  . ASP A 200 ? 1.1808 1.0802 1.1595 -0.0165 -0.1431 -0.0132 199 ASP A CG  
1404 O OD1 . ASP A 200 ? 1.1487 1.0926 1.1370 -0.0455 -0.1440 -0.0462 199 ASP A OD1 
1405 O OD2 . ASP A 200 ? 1.1431 1.0238 1.0762 0.0050  -0.1621 0.0207  199 ASP A OD2 
1406 N N   . ALA A 201 ? 1.1499 1.0905 1.3074 -0.0764 -0.0661 -0.1205 200 ALA A N   
1407 C CA  . ALA A 201 ? 1.0969 1.0995 1.3005 -0.1211 -0.0477 -0.1826 200 ALA A CA  
1408 C C   . ALA A 201 ? 1.0581 1.1140 1.2103 -0.1439 -0.0714 -0.1954 200 ALA A C   
1409 O O   . ALA A 201 ? 1.0027 1.0966 1.1888 -0.1758 -0.0570 -0.2460 200 ALA A O   
1410 C CB  . ALA A 201 ? 1.0885 1.1440 1.3182 -0.1506 -0.0314 -0.2087 200 ALA A CB  
1411 N N   . ALA A 202 ? 1.1002 1.1612 1.1778 -0.1300 -0.1053 -0.1516 201 ALA A N   
1412 C CA  . ALA A 202 ? 1.0374 1.1438 1.0662 -0.1486 -0.1296 -0.1524 201 ALA A CA  
1413 C C   . ALA A 202 ? 1.0516 1.1074 1.0654 -0.1246 -0.1381 -0.1428 201 ALA A C   
1414 O O   . ALA A 202 ? 0.9987 1.0843 0.9728 -0.1376 -0.1570 -0.1421 201 ALA A O   
1415 C CB  . ALA A 202 ? 1.0203 1.1533 0.9923 -0.1435 -0.1610 -0.1060 201 ALA A CB  
1416 N N   . GLY A 203 ? 1.0526 1.0377 1.0986 -0.0916 -0.1254 -0.1323 202 GLY A N   
1417 C CA  . GLY A 203 ? 1.0461 0.9877 1.0829 -0.0681 -0.1345 -0.1211 202 GLY A CA  
1418 C C   . GLY A 203 ? 1.0554 0.9627 1.0247 -0.0351 -0.1627 -0.0704 202 GLY A C   
1419 O O   . GLY A 203 ? 1.0434 0.9205 0.9999 -0.0168 -0.1723 -0.0614 202 GLY A O   
1420 N N   . GLY A 204 ? 1.1545 1.0683 1.0880 -0.0281 -0.1745 -0.0404 203 GLY A N   
1421 C CA  . GLY A 204 ? 1.1198 1.0065 1.0005 -0.0011 -0.1966 -0.0004 203 GLY A CA  
1422 C C   . GLY A 204 ? 1.1357 0.9633 1.0148 0.0341  -0.1912 0.0272  203 GLY A C   
1423 O O   . GLY A 204 ? 1.1619 0.9735 1.0688 0.0399  -0.1744 0.0327  203 GLY A O   
1424 N N   . THR A 205 ? 1.1747 0.9757 1.0202 0.0548  -0.2051 0.0446  204 THR A N   
1425 C CA  . THR A 205 ? 1.1452 0.9048 0.9759 0.0835  -0.2039 0.0730  204 THR A CA  
1426 C C   . THR A 205 ? 1.1173 0.8747 0.9112 0.0939  -0.2109 0.0946  204 THR A C   
1427 O O   . THR A 205 ? 1.0965 0.8792 0.8801 0.0834  -0.2211 0.0929  204 THR A O   
1428 C CB  . THR A 205 ? 1.1631 0.9050 0.9810 0.0968  -0.2143 0.0755  204 THR A CB  
1429 O OG1 . THR A 205 ? 1.1314 0.8887 0.9145 0.0917  -0.2313 0.0686  204 THR A OG1 
1430 C CG2 . THR A 205 ? 1.2072 0.9485 1.0788 0.0885  -0.2045 0.0540  204 THR A CG2 
1431 N N   . PRO A 206 ? 1.1236 0.8554 0.9034 0.1124  -0.2046 0.1160  205 PRO A N   
1432 C CA  . PRO A 206 ? 1.0921 0.8377 0.8576 0.1149  -0.1967 0.1229  205 PRO A CA  
1433 C C   . PRO A 206 ? 1.0707 0.8394 0.8304 0.1098  -0.1979 0.1125  205 PRO A C   
1434 O O   . PRO A 206 ? 1.0577 0.8389 0.8223 0.1082  -0.1967 0.1148  205 PRO A O   
1435 C CB  . PRO A 206 ? 1.1073 0.8405 0.8651 0.1258  -0.1818 0.1383  205 PRO A CB  
1436 C CG  . PRO A 206 ? 1.1604 0.8676 0.9365 0.1299  -0.1807 0.1491  205 PRO A CG  
1437 C CD  . PRO A 206 ? 1.1503 0.8590 0.9469 0.1226  -0.1917 0.1310  205 PRO A CD  
1438 N N   . LEU A 207 ? 1.0736 0.8440 0.8289 0.1085  -0.2011 0.1027  206 LEU A N   
1439 C CA  . LEU A 207 ? 1.0469 0.8340 0.7991 0.1029  -0.2022 0.0926  206 LEU A CA  
1440 C C   . LEU A 207 ? 1.0567 0.8642 0.8181 0.0888  -0.2119 0.0891  206 LEU A C   
1441 O O   . LEU A 207 ? 1.0387 0.8615 0.8064 0.0851  -0.2107 0.0908  206 LEU A O   
1442 C CB  . LEU A 207 ? 1.0449 0.8282 0.7908 0.1048  -0.2043 0.0834  206 LEU A CB  
1443 C CG  . LEU A 207 ? 1.0463 0.8399 0.7866 0.1019  -0.2036 0.0732  206 LEU A CG  
1444 C CD1 . LEU A 207 ? 1.0565 0.8480 0.7861 0.1094  -0.1973 0.0775  206 LEU A CD1 
1445 C CD2 . LEU A 207 ? 1.0578 0.8481 0.7943 0.1038  -0.2080 0.0641  206 LEU A CD2 
1446 N N   . HIS A 208 ? 1.0216 0.8319 0.7842 0.0795  -0.2245 0.0861  207 HIS A N   
1447 C CA  . HIS A 208 ? 1.0193 0.8658 0.7875 0.0593  -0.2359 0.0855  207 HIS A CA  
1448 C C   . HIS A 208 ? 1.0176 0.8828 0.8021 0.0596  -0.2328 0.1045  207 HIS A C   
1449 O O   . HIS A 208 ? 0.9936 0.8870 0.7906 0.0532  -0.2332 0.1141  207 HIS A O   
1450 C CB  . HIS A 208 ? 1.0710 0.9274 0.8366 0.0412  -0.2532 0.0705  207 HIS A CB  
1451 C CG  . HIS A 208 ? 1.0985 0.9613 0.8649 0.0290  -0.2537 0.0442  207 HIS A CG  
1452 N ND1 . HIS A 208 ? 1.1487 0.9902 0.9406 0.0340  -0.2398 0.0251  207 HIS A ND1 
1453 C CD2 . HIS A 208 ? 1.0816 0.9725 0.8359 0.0111  -0.2630 0.0341  207 HIS A CD2 
1454 C CE1 . HIS A 208 ? 1.1416 0.9960 0.9383 0.0205  -0.2420 0.0006  207 HIS A CE1 
1455 N NE2 . HIS A 208 ? 1.0987 0.9831 0.8666 0.0053  -0.2569 0.0042  207 HIS A NE2 
1456 N N   . GLU A 209 ? 1.0854 0.9331 0.8736 0.0688  -0.2309 0.1124  208 GLU A N   
1457 C CA  . GLU A 209 ? 1.0783 0.9421 0.8876 0.0700  -0.2309 0.1301  208 GLU A CA  
1458 C C   . GLU A 209 ? 1.0736 0.9284 0.8949 0.0841  -0.2193 0.1376  208 GLU A C   
1459 O O   . GLU A 209 ? 1.0645 0.9379 0.9128 0.0838  -0.2229 0.1533  208 GLU A O   
1460 C CB  . GLU A 209 ? 1.1175 0.9598 0.9283 0.0766  -0.2316 0.1353  208 GLU A CB  
1461 C CG  . GLU A 209 ? 1.1964 1.0570 1.0172 0.0577  -0.2268 0.1165  208 GLU A CG  
1462 C CD  . GLU A 209 ? 1.2806 1.2029 1.1143 0.0278  -0.2397 0.1124  208 GLU A CD  
1463 O OE1 . GLU A 209 ? 1.2271 1.1795 1.0744 0.0238  -0.2518 0.1346  208 GLU A OE1 
1464 O OE2 . GLU A 209 ? 1.2813 1.2274 1.1158 0.0062  -0.2374 0.0873  208 GLU A OE2 
1465 N N   . ALA A 210 ? 1.0012 0.8291 0.8057 0.0953  -0.2088 0.1274  209 ALA A N   
1466 C CA  . ALA A 210 ? 1.0062 0.8216 0.8174 0.1062  -0.2040 0.1297  209 ALA A CA  
1467 C C   . ALA A 210 ? 0.9948 0.8276 0.8209 0.0999  -0.2095 0.1325  209 ALA A C   
1468 O O   . ALA A 210 ? 0.9993 0.8339 0.8555 0.1048  -0.2124 0.1462  209 ALA A O   
1469 C CB  . ALA A 210 ? 1.0263 0.8158 0.8069 0.1160  -0.1965 0.1172  209 ALA A CB  
1470 N N   . ALA A 211 ? 0.9921 0.8347 0.8025 0.0900  -0.2113 0.1212  210 ALA A N   
1471 C CA  . ALA A 211 ? 0.9859 0.8447 0.8069 0.0830  -0.2163 0.1253  210 ALA A CA  
1472 C C   . ALA A 211 ? 0.9845 0.8794 0.8273 0.0718  -0.2245 0.1450  210 ALA A C   
1473 O O   . ALA A 211 ? 0.9878 0.8950 0.8470 0.0687  -0.2291 0.1576  210 ALA A O   
1474 C CB  . ALA A 211 ? 0.9782 0.8383 0.7768 0.0745  -0.2166 0.1071  210 ALA A CB  
1475 N N   . ARG A 212 ? 1.0723 0.9845 0.9152 0.0648  -0.2288 0.1489  211 ARG A N   
1476 C CA  . ARG A 212 ? 1.0673 1.0199 0.9281 0.0509  -0.2399 0.1670  211 ARG A CA  
1477 C C   . ARG A 212 ? 1.0978 1.0479 0.9989 0.0617  -0.2413 0.1912  211 ARG A C   
1478 O O   . ARG A 212 ? 1.0997 1.0763 1.0268 0.0525  -0.2501 0.2126  211 ARG A O   
1479 C CB  . ARG A 212 ? 1.0701 1.0451 0.9193 0.0355  -0.2477 0.1602  211 ARG A CB  
1480 C CG  . ARG A 212 ? 1.1059 1.1370 0.9656 0.0104  -0.2608 0.1726  211 ARG A CG  
1481 C CD  . ARG A 212 ? 1.1638 1.2234 1.0120 -0.0110 -0.2686 0.1589  211 ARG A CD  
1482 N NE  . ARG A 212 ? 1.1965 1.3226 1.0496 -0.0435 -0.2775 0.1633  211 ARG A NE  
1483 C CZ  . ARG A 212 ? 1.2758 1.4479 1.1234 -0.0727 -0.2819 0.1457  211 ARG A CZ  
1484 N NH1 . ARG A 212 ? 1.2591 1.4128 1.0991 -0.0734 -0.2823 0.1245  211 ARG A NH1 
1485 N NH2 . ARG A 212 ? 1.2148 1.4533 1.0665 -0.1048 -0.2848 0.1487  211 ARG A NH2 
1486 N N   . ALA A 213 ? 1.0338 0.9519 0.9452 0.0791  -0.2333 0.1893  212 ALA A N   
1487 C CA  . ALA A 213 ? 1.0487 0.9601 1.0090 0.0901  -0.2337 0.2088  212 ALA A CA  
1488 C C   . ALA A 213 ? 1.0768 0.9619 1.0637 0.1024  -0.2289 0.2112  212 ALA A C   
1489 O O   . ALA A 213 ? 1.0845 0.9759 1.1276 0.1046  -0.2320 0.2323  212 ALA A O   
1490 C CB  . ALA A 213 ? 1.0636 0.9524 1.0277 0.1016  -0.2277 0.2037  212 ALA A CB  
1491 N N   . GLY A 214 ? 0.9904 0.8473 0.9455 0.1088  -0.2225 0.1904  213 GLY A N   
1492 C CA  . GLY A 214 ? 1.0217 0.8526 1.0018 0.1185  -0.2210 0.1887  213 GLY A CA  
1493 C C   . GLY A 214 ? 1.0876 0.8740 1.0751 0.1368  -0.2151 0.1711  213 GLY A C   
1494 O O   . GLY A 214 ? 1.1194 0.8839 1.1651 0.1479  -0.2117 0.1714  213 GLY A O   
1495 N N   . HIS A 215 ? 1.0627 0.8346 0.9969 0.1399  -0.2126 0.1530  214 HIS A N   
1496 C CA  . HIS A 215 ? 1.1246 0.8632 1.0463 0.1537  -0.2006 0.1286  214 HIS A CA  
1497 C C   . HIS A 215 ? 1.1699 0.8983 1.0360 0.1538  -0.1987 0.1033  214 HIS A C   
1498 O O   . HIS A 215 ? 1.1587 0.8861 0.9635 0.1526  -0.2030 0.0980  214 HIS A O   
1499 C CB  . HIS A 215 ? 1.1289 0.8697 1.0259 0.1532  -0.1916 0.1269  214 HIS A CB  
1500 C CG  . HIS A 215 ? 1.1075 0.8646 1.0528 0.1511  -0.1974 0.1516  214 HIS A CG  
1501 N ND1 . HIS A 215 ? 1.1202 0.8830 1.1462 0.1553  -0.1898 0.1604  214 HIS A ND1 
1502 C CD2 . HIS A 215 ? 1.0742 0.8523 1.0068 0.1421  -0.2056 0.1660  214 HIS A CD2 
1503 C CE1 . HIS A 215 ? 1.0814 0.8661 1.1366 0.1515  -0.2003 0.1853  214 HIS A CE1 
1504 N NE2 . HIS A 215 ? 1.0607 0.8574 1.0561 0.1418  -0.2079 0.1855  214 HIS A NE2 
1505 N N   . LEU A 216 ? 1.1020 0.8248 0.9989 0.1551  -0.1917 0.0887  215 LEU A N   
1506 C CA  . LEU A 216 ? 1.1413 0.8607 0.9914 0.1536  -0.1901 0.0623  215 LEU A CA  
1507 C C   . LEU A 216 ? 1.2125 0.9381 1.0148 0.1521  -0.1730 0.0358  215 LEU A C   
1508 O O   . LEU A 216 ? 1.2093 0.9404 0.9511 0.1506  -0.1811 0.0285  215 LEU A O   
1509 C CB  . LEU A 216 ? 1.1786 0.8927 1.0839 0.1533  -0.1797 0.0465  215 LEU A CB  
1510 C CG  . LEU A 216 ? 1.2541 0.9708 1.1209 0.1497  -0.1728 0.0106  215 LEU A CG  
1511 C CD1 . LEU A 216 ? 1.2231 0.9390 1.0410 0.1485  -0.1988 0.0235  215 LEU A CD1 
1512 C CD2 . LEU A 216 ? 1.2821 0.9949 1.2205 0.1474  -0.1498 -0.0171 215 LEU A CD2 
1513 N N   . GLU A 217 ? 1.1640 0.8939 0.9957 0.1506  -0.1497 0.0232  216 GLU A N   
1514 C CA  . GLU A 217 ? 1.2328 0.9784 1.0176 0.1436  -0.1318 -0.0003 216 GLU A CA  
1515 C C   . GLU A 217 ? 1.1976 0.9446 0.9187 0.1450  -0.1468 0.0250  216 GLU A C   
1516 O O   . GLU A 217 ? 1.2154 0.9779 0.8797 0.1402  -0.1471 0.0195  216 GLU A O   
1517 C CB  . GLU A 217 ? 1.2786 1.0309 1.1143 0.1386  -0.1013 -0.0205 216 GLU A CB  
1518 C CG  . GLU A 217 ? 1.3130 1.0591 1.2427 0.1394  -0.0840 -0.0408 216 GLU A CG  
1519 C CD  . GLU A 217 ? 1.3328 1.0625 1.3330 0.1504  -0.0996 -0.0022 216 GLU A CD  
1520 O OE1 . GLU A 217 ? 1.2866 1.0159 1.2719 0.1539  -0.1131 0.0279  216 GLU A OE1 
1521 O OE2 . GLU A 217 ? 1.2813 1.0030 1.3548 0.1539  -0.0984 -0.0001 216 GLU A OE2 
1522 N N   . ILE A 218 ? 1.2356 0.9710 0.9720 0.1500  -0.1591 0.0539  217 ILE A N   
1523 C CA  . ILE A 218 ? 1.1825 0.9165 0.8760 0.1507  -0.1691 0.0752  217 ILE A CA  
1524 C C   . ILE A 218 ? 1.1429 0.8741 0.8028 0.1530  -0.1913 0.0829  217 ILE A C   
1525 O O   . ILE A 218 ? 1.1227 0.8637 0.7542 0.1497  -0.1910 0.0899  217 ILE A O   
1526 C CB  . ILE A 218 ? 1.1461 0.8746 0.8732 0.1517  -0.1717 0.0955  217 ILE A CB  
1527 C CG1 . ILE A 218 ? 1.1999 0.9324 0.9677 0.1501  -0.1489 0.0865  217 ILE A CG1 
1528 C CG2 . ILE A 218 ? 1.1119 0.8373 0.8082 0.1510  -0.1770 0.1126  217 ILE A CG2 
1529 C CD1 . ILE A 218 ? 1.1905 0.9238 0.9930 0.1501  -0.1511 0.1053  217 ILE A CD1 
1530 N N   . VAL A 219 ? 1.1647 0.8947 0.8479 0.1518  -0.2022 0.0801  218 VAL A N   
1531 C CA  . VAL A 219 ? 1.1041 0.8561 0.7920 0.1383  -0.2013 0.0745  218 VAL A CA  
1532 C C   . VAL A 219 ? 1.1479 0.9044 0.7958 0.1412  -0.2030 0.0625  218 VAL A C   
1533 O O   . VAL A 219 ? 1.0992 0.8743 0.7490 0.1336  -0.1994 0.0660  218 VAL A O   
1534 C CB  . VAL A 219 ? 1.1002 0.8570 0.8197 0.1319  -0.2070 0.0728  218 VAL A CB  
1535 C CG1 . VAL A 219 ? 1.0664 0.8371 0.7807 0.1222  -0.2070 0.0623  218 VAL A CG1 
1536 C CG2 . VAL A 219 ? 1.0513 0.8240 0.8085 0.1226  -0.2052 0.0895  218 VAL A CG2 
1537 N N   . GLU A 220 ? 1.1378 0.8826 0.7528 0.1521  -0.2086 0.0471  219 GLU A N   
1538 C CA  . GLU A 220 ? 1.1599 0.9266 0.7341 0.1486  -0.2081 0.0316  219 GLU A CA  
1539 C C   . GLU A 220 ? 1.1677 0.9549 0.7111 0.1442  -0.2023 0.0479  219 GLU A C   
1540 O O   . GLU A 220 ? 1.1297 0.9490 0.6684 0.1347  -0.2015 0.0540  219 GLU A O   
1541 C CB  . GLU A 220 ? 1.2415 1.0224 0.8330 0.1406  -0.1879 -0.0051 219 GLU A CB  
1542 C CG  . GLU A 220 ? 1.2917 1.0588 0.9211 0.1422  -0.1915 -0.0193 219 GLU A CG  
1543 C CD  . GLU A 220 ? 1.4183 1.1967 1.0838 0.1337  -0.1658 -0.0590 219 GLU A CD  
1544 O OE1 . GLU A 220 ? 1.4351 1.2216 1.1234 0.1282  -0.1423 -0.0728 219 GLU A OE1 
1545 O OE2 . GLU A 220 ? 1.3727 1.1531 1.0498 0.1311  -0.1663 -0.0801 219 GLU A OE2 
1546 N N   . VAL A 221 ? 1.1727 0.9531 0.7196 0.1444  -0.1903 0.0571  220 VAL A N   
1547 C CA  . VAL A 221 ? 1.1803 0.9774 0.6939 0.1404  -0.1862 0.0786  220 VAL A CA  
1548 C C   . VAL A 221 ? 1.1067 0.9107 0.6626 0.1359  -0.1878 0.1063  220 VAL A C   
1549 O O   . VAL A 221 ? 1.0928 0.9253 0.6439 0.1290  -0.1884 0.1264  220 VAL A O   
1550 C CB  . VAL A 221 ? 1.2478 1.0445 0.7783 0.1342  -0.1621 0.0746  220 VAL A CB  
1551 C CG1 . VAL A 221 ? 1.2514 1.0616 0.7511 0.1295  -0.1583 0.1042  220 VAL A CG1 
1552 C CG2 . VAL A 221 ? 1.3287 1.1482 0.8672 0.1217  -0.1386 0.0338  220 VAL A CG2 
1553 N N   . LEU A 222 ? 1.1450 0.9310 0.7476 0.1372  -0.1870 0.1066  221 LEU A N   
1554 C CA  . LEU A 222 ? 1.0944 0.8880 0.7352 0.1326  -0.1855 0.1217  221 LEU A CA  
1555 C C   . LEU A 222 ? 1.0774 0.8903 0.7264 0.1294  -0.1917 0.1196  221 LEU A C   
1556 O O   . LEU A 222 ? 1.0711 0.8961 0.7348 0.1297  -0.1934 0.1402  221 LEU A O   
1557 C CB  . LEU A 222 ? 1.0549 0.8345 0.7311 0.1307  -0.1841 0.1148  221 LEU A CB  
1558 C CG  . LEU A 222 ? 1.0636 0.8280 0.7443 0.1335  -0.1793 0.1211  221 LEU A CG  
1559 C CD1 . LEU A 222 ? 1.0272 0.7927 0.7410 0.1274  -0.1819 0.1152  221 LEU A CD1 
1560 C CD2 . LEU A 222 ? 1.0896 0.8489 0.7656 0.1359  -0.1727 0.1428  221 LEU A CD2 
1561 N N   . LEU A 223 ? 1.1273 0.9412 0.7702 0.1281  -0.1960 0.0975  222 LEU A N   
1562 C CA  . LEU A 223 ? 1.1154 0.9461 0.7647 0.1255  -0.2019 0.0934  222 LEU A CA  
1563 C C   . LEU A 223 ? 1.1456 1.0086 0.7691 0.1234  -0.2066 0.1079  222 LEU A C   
1564 O O   . LEU A 223 ? 1.1352 1.0184 0.7733 0.1225  -0.2130 0.1208  222 LEU A O   
1565 C CB  . LEU A 223 ? 1.1133 0.9356 0.7615 0.1242  -0.2046 0.0670  222 LEU A CB  
1566 C CG  . LEU A 223 ? 1.0811 0.8866 0.7576 0.1207  -0.2031 0.0591  222 LEU A CG  
1567 C CD1 . LEU A 223 ? 1.0922 0.8898 0.7665 0.1197  -0.2066 0.0409  222 LEU A CD1 
1568 C CD2 . LEU A 223 ? 1.0586 0.8668 0.7567 0.1178  -0.2057 0.0619  222 LEU A CD2 
1569 N N   . LYS A 224 ? 1.1162 0.9888 0.6987 0.1213  -0.2048 0.1067  223 LYS A N   
1570 C CA  . LYS A 224 ? 1.1501 1.0671 0.7009 0.1119  -0.2097 0.1230  223 LYS A CA  
1571 C C   . LYS A 224 ? 1.1462 1.0789 0.7134 0.1107  -0.2112 0.1667  223 LYS A C   
1572 O O   . LYS A 224 ? 1.1614 1.1374 0.7211 0.1013  -0.2207 0.1934  223 LYS A O   
1573 C CB  . LYS A 224 ? 1.2134 1.1414 0.7061 0.1060  -0.2044 0.1026  223 LYS A CB  
1574 C CG  . LYS A 224 ? 1.2675 1.2202 0.7333 0.0979  -0.2066 0.0679  223 LYS A CG  
1575 C CD  . LYS A 224 ? 1.3743 1.3642 0.7785 0.0828  -0.1972 0.0468  223 LYS A CD  
1576 C CE  . LYS A 224 ? 1.4246 1.4514 0.8090 0.0673  -0.1959 0.0083  223 LYS A CE  
1577 N NZ  . LYS A 224 ? 1.5130 1.5892 0.8433 0.0436  -0.1797 -0.0201 223 LYS A NZ  
1578 N N   . TYR A 225 ? 1.3221 0.8893 0.6445 0.0807  -0.1530 0.2083  224 TYR A N   
1579 C CA  . TYR A 225 ? 1.3093 0.8961 0.6456 0.0772  -0.1463 0.2189  224 TYR A CA  
1580 C C   . TYR A 225 ? 1.2439 0.8749 0.6530 0.0681  -0.1627 0.2277  224 TYR A C   
1581 O O   . TYR A 225 ? 1.2333 0.8801 0.6584 0.0655  -0.1575 0.2369  224 TYR A O   
1582 C CB  . TYR A 225 ? 1.3029 0.9101 0.6289 0.0906  -0.1057 0.2245  224 TYR A CB  
1583 C CG  . TYR A 225 ? 1.3830 0.9419 0.6345 0.1006  -0.0841 0.2218  224 TYR A CG  
1584 C CD1 . TYR A 225 ? 1.4327 0.9523 0.6341 0.1148  -0.0696 0.2111  224 TYR A CD1 
1585 C CD2 . TYR A 225 ? 1.4163 0.9637 0.6441 0.0976  -0.0760 0.2306  224 TYR A CD2 
1586 C CE1 . TYR A 225 ? 1.5179 0.9849 0.6448 0.1278  -0.0450 0.2082  224 TYR A CE1 
1587 C CE2 . TYR A 225 ? 1.4974 0.9975 0.6538 0.1086  -0.0524 0.2289  224 TYR A CE2 
1588 C CZ  . TYR A 225 ? 1.5501 1.0085 0.6549 0.1247  -0.0356 0.2172  224 TYR A CZ  
1589 O OH  . TYR A 225 ? 1.6419 1.0454 0.6702 0.1393  -0.0076 0.2150  224 TYR A OH  
1590 N N   . GLY A 226 ? 1.2686 0.9158 0.7202 0.0644  -0.1806 0.2260  225 GLY A N   
1591 C CA  . GLY A 226 ? 1.2213 0.9003 0.7380 0.0582  -0.1952 0.2350  225 GLY A CA  
1592 C C   . GLY A 226 ? 1.1618 0.8831 0.7211 0.0645  -0.1782 0.2371  225 GLY A C   
1593 O O   . GLY A 226 ? 1.1349 0.8747 0.7296 0.0625  -0.1780 0.2449  225 GLY A O   
1594 N N   . ALA A 227 ? 1.1924 0.9237 0.7447 0.0717  -0.1648 0.2306  226 ALA A N   
1595 C CA  . ALA A 227 ? 1.1448 0.9117 0.7297 0.0764  -0.1509 0.2323  226 ALA A CA  
1596 C C   . ALA A 227 ? 1.1115 0.8988 0.7543 0.0717  -0.1647 0.2346  226 ALA A C   
1597 O O   . ALA A 227 ? 1.1252 0.8975 0.7743 0.0682  -0.1862 0.2375  226 ALA A O   
1598 C CB  . ALA A 227 ? 1.1414 0.9174 0.7082 0.0863  -0.1310 0.2257  226 ALA A CB  
1599 N N   . ASP A 228 ? 1.0768 0.8984 0.7642 0.0712  -0.1493 0.2330  227 ASP A N   
1600 C CA  . ASP A 228 ? 1.0681 0.9103 0.8097 0.0711  -0.1513 0.2360  227 ASP A CA  
1601 C C   . ASP A 228 ? 1.0663 0.9252 0.8133 0.0745  -0.1435 0.2305  227 ASP A C   
1602 O O   . ASP A 228 ? 1.0598 0.9384 0.8001 0.0769  -0.1235 0.2226  227 ASP A O   
1603 C CB  . ASP A 228 ? 1.0922 0.9518 0.8626 0.0715  -0.1331 0.2338  227 ASP A CB  
1604 C CG  . ASP A 228 ? 1.1430 1.0163 0.9666 0.0755  -0.1292 0.2396  227 ASP A CG  
1605 O OD1 . ASP A 228 ? 1.1297 1.0044 0.9794 0.0757  -0.1451 0.2501  227 ASP A OD1 
1606 O OD2 . ASP A 228 ? 1.1919 1.0714 1.0301 0.0784  -0.1095 0.2351  227 ASP A OD2 
1607 N N   . VAL A 229 ? 1.0075 0.8578 0.7682 0.0728  -0.1625 0.2374  228 VAL A N   
1608 C CA  . VAL A 229 ? 0.9925 0.8543 0.7577 0.0753  -0.1575 0.2342  228 VAL A CA  
1609 C C   . VAL A 229 ? 1.0080 0.9050 0.8156 0.0781  -0.1362 0.2336  228 VAL A C   
1610 O O   . VAL A 229 ? 0.9961 0.9071 0.8005 0.0807  -0.1251 0.2292  228 VAL A O   
1611 C CB  . VAL A 229 ? 1.0079 0.8462 0.7769 0.0693  -0.1873 0.2440  228 VAL A CB  
1612 C CG1 . VAL A 229 ? 1.0022 0.8596 0.8391 0.0647  -0.1979 0.2610  228 VAL A CG1 
1613 C CG2 . VAL A 229 ? 1.0007 0.8366 0.7539 0.0721  -0.1842 0.2391  228 VAL A CG2 
1614 N N   . ASN A 230 ? 0.9523 0.8591 0.7948 0.0789  -0.1286 0.2385  229 ASN A N   
1615 C CA  . ASN A 230 ? 0.9731 0.9012 0.8418 0.0835  -0.1038 0.2366  229 ASN A CA  
1616 C C   . ASN A 230 ? 1.0176 0.9429 0.8681 0.0839  -0.0854 0.2262  229 ASN A C   
1617 O O   . ASN A 230 ? 1.0550 0.9791 0.9267 0.0887  -0.0693 0.2276  229 ASN A O   
1618 C CB  . ASN A 230 ? 0.9822 0.9197 0.9098 0.0874  -0.1037 0.2535  229 ASN A CB  
1619 C CG  . ASN A 230 ? 1.0488 0.9965 1.0006 0.0850  -0.1149 0.2645  229 ASN A CG  
1620 O OD1 . ASN A 230 ? 1.0263 0.9814 0.9596 0.0853  -0.1057 0.2575  229 ASN A OD1 
1621 N ND2 . ASN A 230 ? 0.9964 0.9436 0.9921 0.0808  -0.1381 0.2845  229 ASN A ND2 
1622 N N   . ALA A 231 ? 1.0042 0.9255 0.8156 0.0792  -0.0866 0.2176  230 ALA A N   
1623 C CA  . ALA A 231 ? 1.0310 0.9488 0.8245 0.0749  -0.0738 0.2095  230 ALA A CA  
1624 C C   . ALA A 231 ? 1.0677 0.9939 0.8528 0.0733  -0.0574 0.2023  230 ALA A C   
1625 O O   . ALA A 231 ? 1.0396 0.9804 0.8232 0.0743  -0.0567 0.2027  230 ALA A O   
1626 C CB  . ALA A 231 ? 1.0102 0.9273 0.7736 0.0692  -0.0796 0.2081  230 ALA A CB  
1627 N N   . VAL A 232 ? 1.0096 0.9199 0.7830 0.0703  -0.0455 0.1957  231 VAL A N   
1628 C CA  . VAL A 232 ? 1.0403 0.9442 0.7913 0.0671  -0.0311 0.1878  231 VAL A CA  
1629 C C   . VAL A 232 ? 1.0763 0.9688 0.7918 0.0518  -0.0361 0.1809  231 VAL A C   
1630 O O   . VAL A 232 ? 1.1038 0.9785 0.8148 0.0476  -0.0388 0.1796  231 VAL A O   
1631 C CB  . VAL A 232 ? 1.1156 0.9978 0.8765 0.0782  -0.0095 0.1867  231 VAL A CB  
1632 C CG1 . VAL A 232 ? 1.1675 1.0254 0.8832 0.0735  0.0064  0.1757  231 VAL A CG1 
1633 C CG2 . VAL A 232 ? 1.0930 0.9950 0.8983 0.0904  -0.0054 0.1992  231 VAL A CG2 
1634 N N   . ASP A 233 ? 1.0887 0.9918 0.7824 0.0420  -0.0399 0.1794  232 ASP A N   
1635 C CA  . ASP A 233 ? 1.1106 1.0073 0.7767 0.0232  -0.0504 0.1779  232 ASP A CA  
1636 C C   . ASP A 233 ? 1.1979 1.0543 0.8196 0.0149  -0.0433 0.1667  232 ASP A C   
1637 O O   . ASP A 233 ? 1.2337 1.0654 0.8472 0.0276  -0.0237 0.1600  232 ASP A O   
1638 C CB  . ASP A 233 ? 1.0627 0.9971 0.7370 0.0166  -0.0628 0.1882  232 ASP A CB  
1639 C CG  . ASP A 233 ? 1.0893 1.0331 0.7565 0.0197  -0.0598 0.1885  232 ASP A CG  
1640 O OD1 . ASP A 233 ? 1.1009 1.0327 0.7696 0.0319  -0.0460 0.1835  232 ASP A OD1 
1641 O OD2 . ASP A 233 ? 1.0934 1.0588 0.7582 0.0101  -0.0711 0.1969  232 ASP A OD2 
1642 N N   . ALA A 234 ? 1.0987 0.9449 0.6896 -0.0070 -0.0590 0.1666  233 ALA A N   
1643 C CA  . ALA A 234 ? 1.1749 0.9691 0.7063 -0.0187 -0.0569 0.1547  233 ALA A CA  
1644 C C   . ALA A 234 ? 1.1877 0.9783 0.6962 -0.0121 -0.0459 0.1521  233 ALA A C   
1645 O O   . ALA A 234 ? 1.2536 0.9936 0.7136 -0.0082 -0.0283 0.1402  233 ALA A O   
1646 C CB  . ALA A 234 ? 1.2029 0.9885 0.7083 -0.0490 -0.0849 0.1593  233 ALA A CB  
1647 N N   . ALA A 235 ? 1.1894 1.0287 0.7288 -0.0093 -0.0534 0.1638  234 ALA A N   
1648 C CA  . ALA A 235 ? 1.1825 1.0221 0.7052 -0.0028 -0.0435 0.1643  234 ALA A CA  
1649 C C   . ALA A 235 ? 1.1874 1.0315 0.7398 0.0225  -0.0163 0.1635  234 ALA A C   
1650 O O   . ALA A 235 ? 1.1896 1.0309 0.7300 0.0295  -0.0030 0.1653  234 ALA A O   
1651 C CB  . ALA A 235 ? 1.1193 1.0071 0.6663 -0.0092 -0.0629 0.1794  234 ALA A CB  
1652 N N   . GLY A 236 ? 1.1523 1.0039 0.7452 0.0349  -0.0097 0.1641  235 GLY A N   
1653 C CA  . GLY A 236 ? 1.1479 1.0077 0.7797 0.0558  0.0104  0.1688  235 GLY A CA  
1654 C C   . GLY A 236 ? 1.0879 0.9920 0.7664 0.0623  0.0008  0.1809  235 GLY A C   
1655 O O   . GLY A 236 ? 1.0868 0.9994 0.7991 0.0758  0.0133  0.1884  235 GLY A O   
1656 N N   . GLY A 237 ? 1.1085 1.0385 0.7911 0.0535  -0.0202 0.1850  236 GLY A N   
1657 C CA  . GLY A 237 ? 1.0423 1.0029 0.7566 0.0602  -0.0285 0.1946  236 GLY A CA  
1658 C C   . GLY A 237 ? 1.0231 0.9913 0.7649 0.0655  -0.0386 0.1977  236 GLY A C   
1659 O O   . GLY A 237 ? 1.0204 0.9858 0.7547 0.0599  -0.0456 0.1955  236 GLY A O   
1660 N N   . THR A 238 ? 0.9712 0.9458 0.7417 0.0746  -0.0410 0.2045  237 THR A N   
1661 C CA  . THR A 238 ? 0.9595 0.9324 0.7447 0.0781  -0.0549 0.2081  237 THR A CA  
1662 C C   . THR A 238 ? 0.9524 0.9344 0.7246 0.0788  -0.0645 0.2101  237 THR A C   
1663 O O   . THR A 238 ? 0.9498 0.9455 0.7142 0.0777  -0.0617 0.2117  237 THR A O   
1664 C CB  . THR A 238 ? 0.9554 0.9256 0.7755 0.0840  -0.0584 0.2170  237 THR A CB  
1665 O OG1 . THR A 238 ? 0.9497 0.9304 0.7787 0.0856  -0.0579 0.2229  237 THR A OG1 
1666 C CG2 . THR A 238 ? 0.9836 0.9474 0.8249 0.0879  -0.0425 0.2190  237 THR A CG2 
1667 N N   . PRO A 239 ? 0.9553 0.9264 0.7215 0.0820  -0.0746 0.2113  238 PRO A N   
1668 C CA  . PRO A 239 ? 0.9292 0.9004 0.6793 0.0879  -0.0779 0.2139  238 PRO A CA  
1669 C C   . PRO A 239 ? 0.9347 0.9054 0.6921 0.0922  -0.0817 0.2175  238 PRO A C   
1670 O O   . PRO A 239 ? 0.9178 0.8936 0.6651 0.0980  -0.0789 0.2202  238 PRO A O   
1671 C CB  . PRO A 239 ? 0.9428 0.8877 0.6750 0.0911  -0.0868 0.2137  238 PRO A CB  
1672 C CG  . PRO A 239 ? 0.9791 0.9226 0.7182 0.0846  -0.0862 0.2119  238 PRO A CG  
1673 C CD  . PRO A 239 ? 0.9768 0.9307 0.7426 0.0810  -0.0811 0.2109  238 PRO A CD  
1674 N N   . LEU A 240 ? 0.9386 0.9043 0.7183 0.0899  -0.0871 0.2206  239 LEU A N   
1675 C CA  . LEU A 240 ? 0.9332 0.9003 0.7245 0.0914  -0.0907 0.2267  239 LEU A CA  
1676 C C   . LEU A 240 ? 0.9425 0.9329 0.7346 0.0907  -0.0769 0.2280  239 LEU A C   
1677 O O   . LEU A 240 ? 0.9288 0.9217 0.7193 0.0937  -0.0786 0.2329  239 LEU A O   
1678 C CB  . LEU A 240 ? 0.9542 0.9169 0.7800 0.0875  -0.0989 0.2353  239 LEU A CB  
1679 C CG  . LEU A 240 ? 0.9736 0.9325 0.8158 0.0861  -0.1083 0.2453  239 LEU A CG  
1680 C CD1 . LEU A 240 ? 0.9685 0.8951 0.7785 0.0879  -0.1267 0.2425  239 LEU A CD1 
1681 C CD2 . LEU A 240 ? 1.0014 0.9648 0.8917 0.0807  -0.1155 0.2598  239 LEU A CD2 
1682 N N   . HIS A 241 ? 0.9151 0.9163 0.7039 0.0860  -0.0650 0.2240  240 HIS A N   
1683 C CA  . HIS A 241 ? 0.9180 0.9334 0.6941 0.0821  -0.0568 0.2252  240 HIS A CA  
1684 C C   . HIS A 241 ? 0.9159 0.9436 0.6807 0.0835  -0.0625 0.2285  240 HIS A C   
1685 O O   . HIS A 241 ? 0.9169 0.9544 0.6820 0.0853  -0.0636 0.2359  240 HIS A O   
1686 C CB  . HIS A 241 ? 0.9310 0.9419 0.6912 0.0748  -0.0466 0.2183  240 HIS A CB  
1687 C CG  . HIS A 241 ? 0.9444 0.9447 0.7128 0.0772  -0.0312 0.2187  240 HIS A CG  
1688 N ND1 . HIS A 241 ? 0.9646 0.9537 0.7510 0.0812  -0.0247 0.2170  240 HIS A ND1 
1689 C CD2 . HIS A 241 ? 0.9670 0.9663 0.7298 0.0779  -0.0177 0.2234  240 HIS A CD2 
1690 C CE1 . HIS A 241 ? 1.0049 0.9886 0.8013 0.0863  -0.0053 0.2215  240 HIS A CE1 
1691 N NE2 . HIS A 241 ? 1.0031 0.9914 0.7822 0.0843  0.0005  0.2249  240 HIS A NE2 
1692 N N   . GLU A 242 ? 1.0008 1.0294 0.7596 0.0839  -0.0647 0.2262  241 GLU A N   
1693 C CA  . GLU A 242 ? 0.9842 1.0298 0.7421 0.0876  -0.0653 0.2343  241 GLU A CA  
1694 C C   . GLU A 242 ? 0.9931 1.0298 0.7522 0.1021  -0.0655 0.2392  241 GLU A C   
1695 O O   . GLU A 242 ? 0.9900 1.0426 0.7551 0.1084  -0.0630 0.2497  241 GLU A O   
1696 C CB  . GLU A 242 ? 0.9953 1.0432 0.7502 0.0860  -0.0635 0.2340  241 GLU A CB  
1697 C CG  . GLU A 242 ? 1.0661 1.1157 0.8159 0.0704  -0.0652 0.2293  241 GLU A CG  
1698 C CD  . GLU A 242 ? 1.1728 1.2451 0.9237 0.0576  -0.0711 0.2387  241 GLU A CD  
1699 O OE1 . GLU A 242 ? 1.1544 1.2430 0.9123 0.0599  -0.0739 0.2484  241 GLU A OE1 
1700 O OE2 . GLU A 242 ? 1.1772 1.2489 0.9220 0.0436  -0.0757 0.2382  241 GLU A OE2 
1701 N N   . ALA A 243 ? 0.9771 0.9854 0.7302 0.1070  -0.0701 0.2335  242 ALA A N   
1702 C CA  . ALA A 243 ? 0.9887 0.9741 0.7311 0.1192  -0.0728 0.2360  242 ALA A CA  
1703 C C   . ALA A 243 ? 1.0005 0.9931 0.7553 0.1191  -0.0752 0.2430  242 ALA A C   
1704 O O   . ALA A 243 ? 1.0047 0.9986 0.7576 0.1295  -0.0715 0.2503  242 ALA A O   
1705 C CB  . ALA A 243 ? 1.0103 0.9560 0.7369 0.1192  -0.0844 0.2292  242 ALA A CB  
1706 N N   . ALA A 244 ? 1.0285 1.0257 0.7980 0.1089  -0.0789 0.2431  243 ALA A N   
1707 C CA  . ALA A 244 ? 1.0264 1.0313 0.8066 0.1075  -0.0791 0.2520  243 ALA A CA  
1708 C C   . ALA A 244 ? 1.0340 1.0677 0.8131 0.1051  -0.0729 0.2588  243 ALA A C   
1709 O O   . ALA A 244 ? 1.0340 1.0733 0.8168 0.1068  -0.0741 0.2688  243 ALA A O   
1710 C CB  . ALA A 244 ? 1.0449 1.0493 0.8439 0.0987  -0.0792 0.2541  243 ALA A CB  
1711 N N   . ARG A 245 ? 1.0669 1.1163 0.8401 0.0989  -0.0697 0.2554  244 ARG A N   
1712 C CA  . ARG A 245 ? 1.0675 1.1411 0.8377 0.0921  -0.0713 0.2644  244 ARG A CA  
1713 C C   . ARG A 245 ? 1.0775 1.1635 0.8620 0.1025  -0.0726 0.2750  244 ARG A C   
1714 O O   . ARG A 245 ? 1.0781 1.1777 0.8703 0.0990  -0.0767 0.2842  244 ARG A O   
1715 C CB  . ARG A 245 ? 1.0772 1.1578 0.8378 0.0803  -0.0719 0.2586  244 ARG A CB  
1716 C CG  . ARG A 245 ? 1.1420 1.2389 0.8917 0.0657  -0.0803 0.2674  244 ARG A CG  
1717 C CD  . ARG A 245 ? 1.2143 1.3032 0.9461 0.0512  -0.0824 0.2581  244 ARG A CD  
1718 N NE  . ARG A 245 ? 1.2825 1.3859 1.0062 0.0340  -0.0981 0.2693  244 ARG A NE  
1719 C CZ  . ARG A 245 ? 1.3749 1.4702 1.0827 0.0177  -0.1057 0.2650  244 ARG A CZ  
1720 N NH1 . ARG A 245 ? 1.3436 1.4173 1.0424 0.0192  -0.0958 0.2491  244 ARG A NH1 
1721 N NH2 . ARG A 245 ? 1.3412 1.4483 1.0432 -0.0017 -0.1263 0.2786  244 ARG A NH2 
1722 N N   . ALA A 246 ? 0.9866 1.0639 0.7734 0.1162  -0.0671 0.2739  245 ALA A N   
1723 C CA  . ALA A 246 ? 0.9905 1.0753 0.7912 0.1317  -0.0607 0.2852  245 ALA A CA  
1724 C C   . ALA A 246 ? 1.0169 1.0690 0.8081 0.1478  -0.0581 0.2845  245 ALA A C   
1725 O O   . ALA A 246 ? 1.0244 1.0808 0.8280 0.1608  -0.0528 0.2962  245 ALA A O   
1726 C CB  . ALA A 246 ? 0.9987 1.0896 0.8008 0.1411  -0.0503 0.2887  245 ALA A CB  
1727 N N   . GLY A 247 ? 0.9589 0.9764 0.7296 0.1469  -0.0635 0.2734  246 GLY A N   
1728 C CA  . GLY A 247 ? 0.9806 0.9586 0.7367 0.1577  -0.0670 0.2734  246 GLY A CA  
1729 C C   . GLY A 247 ? 1.0275 0.9617 0.7522 0.1749  -0.0597 0.2665  246 GLY A C   
1730 O O   . GLY A 247 ? 1.0538 0.9662 0.7680 0.1937  -0.0505 0.2724  246 GLY A O   
1731 N N   . HIS A 248 ? 0.9736 0.8893 0.6785 0.1698  -0.0625 0.2544  247 HIS A N   
1732 C CA  . HIS A 248 ? 1.0224 0.8850 0.6823 0.1835  -0.0572 0.2460  247 HIS A CA  
1733 C C   . HIS A 248 ? 1.0514 0.8644 0.6859 0.1711  -0.0811 0.2357  247 HIS A C   
1734 O O   . HIS A 248 ? 1.0415 0.8523 0.6743 0.1576  -0.0929 0.2294  247 HIS A O   
1735 C CB  . HIS A 248 ? 1.0166 0.8936 0.6707 0.1855  -0.0445 0.2439  247 HIS A CB  
1736 C CG  . HIS A 248 ? 1.0012 0.9340 0.6919 0.1915  -0.0269 0.2588  247 HIS A CG  
1737 N ND1 . HIS A 248 ? 1.0249 0.9636 0.7239 0.2134  -0.0073 0.2728  247 HIS A ND1 
1738 C CD2 . HIS A 248 ? 0.9726 0.9561 0.6961 0.1772  -0.0282 0.2643  247 HIS A CD2 
1739 C CE1 . HIS A 248 ? 0.9941 0.9911 0.7366 0.2107  0.0001  0.2892  247 HIS A CE1 
1740 N NE2 . HIS A 248 ? 0.9666 0.9881 0.7200 0.1873  -0.0140 0.2831  247 HIS A NE2 
1741 N N   . LEU A 249 ? 1.0815 0.8541 0.6996 0.1748  -0.0905 0.2366  248 LEU A N   
1742 C CA  . LEU A 249 ? 1.1082 0.8371 0.7119 0.1584  -0.1194 0.2323  248 LEU A CA  
1743 C C   . LEU A 249 ? 1.1538 0.8304 0.7078 0.1552  -0.1313 0.2211  248 LEU A C   
1744 O O   . LEU A 249 ? 1.1530 0.8202 0.7152 0.1354  -0.1575 0.2211  248 LEU A O   
1745 C CB  . LEU A 249 ? 1.1533 0.8361 0.7380 0.1638  -0.1276 0.2354  248 LEU A CB  
1746 C CG  . LEU A 249 ? 1.1901 0.8233 0.7625 0.1438  -0.1627 0.2352  248 LEU A CG  
1747 C CD1 . LEU A 249 ? 1.1322 0.8208 0.7721 0.1227  -0.1748 0.2481  248 LEU A CD1 
1748 C CD2 . LEU A 249 ? 1.2574 0.8236 0.7894 0.1523  -0.1694 0.2347  248 LEU A CD2 
1749 N N   . GLU A 250 ? 1.1735 0.8159 0.6768 0.1749  -0.1117 0.2144  249 GLU A N   
1750 C CA  . GLU A 250 ? 1.2296 0.8140 0.6735 0.1720  -0.1217 0.2035  249 GLU A CA  
1751 C C   . GLU A 250 ? 1.1815 0.8097 0.6568 0.1566  -0.1280 0.2039  249 GLU A C   
1752 O O   . GLU A 250 ? 1.2040 0.8041 0.6648 0.1392  -0.1524 0.1984  249 GLU A O   
1753 C CB  . GLU A 250 ? 1.2911 0.8315 0.6731 0.2003  -0.0902 0.1986  249 GLU A CB  
1754 C CG  . GLU A 250 ? 1.3614 0.8385 0.6977 0.2196  -0.0820 0.1967  249 GLU A CG  
1755 C CD  . GLU A 250 ? 1.4105 0.9464 0.8081 0.2325  -0.0619 0.2098  249 GLU A CD  
1756 O OE1 . GLU A 250 ? 1.3188 0.9395 0.7825 0.2296  -0.0502 0.2201  249 GLU A OE1 
1757 O OE2 . GLU A 250 ? 1.4357 0.9283 0.8120 0.2444  -0.0603 0.2105  249 GLU A OE2 
1758 N N   . ILE A 251 ? 1.1303 0.8283 0.6533 0.1605  -0.1073 0.2105  250 ILE A N   
1759 C CA  . ILE A 251 ? 1.0893 0.8243 0.6401 0.1472  -0.1114 0.2109  250 ILE A CA  
1760 C C   . ILE A 251 ? 1.0515 0.8113 0.6507 0.1268  -0.1345 0.2154  250 ILE A C   
1761 O O   . ILE A 251 ? 1.0466 0.8052 0.6549 0.1143  -0.1500 0.2158  250 ILE A O   
1762 C CB  . ILE A 251 ? 1.0432 0.8383 0.6265 0.1547  -0.0839 0.2161  250 ILE A CB  
1763 C CG1 . ILE A 251 ? 1.0836 0.8574 0.6274 0.1756  -0.0582 0.2169  250 ILE A CG1 
1764 C CG2 . ILE A 251 ? 1.0032 0.8329 0.6160 0.1398  -0.0888 0.2158  250 ILE A CG2 
1765 C CD1 . ILE A 251 ? 1.0429 0.8772 0.6256 0.1801  -0.0351 0.2274  250 ILE A CD1 
1766 N N   . VAL A 252 ? 1.0470 0.8298 0.6803 0.1246  -0.1351 0.2216  251 VAL A N   
1767 C CA  . VAL A 252 ? 1.0157 0.8236 0.6983 0.1081  -0.1502 0.2296  251 VAL A CA  
1768 C C   . VAL A 252 ? 1.0547 0.8172 0.7270 0.0945  -0.1832 0.2327  251 VAL A C   
1769 O O   . VAL A 252 ? 1.0357 0.8158 0.7462 0.0816  -0.1964 0.2405  251 VAL A O   
1770 C CB  . VAL A 252 ? 0.9944 0.8283 0.7069 0.1090  -0.1431 0.2376  251 VAL A CB  
1771 C CG1 . VAL A 252 ? 0.9710 0.8274 0.7337 0.0940  -0.1538 0.2491  251 VAL A CG1 
1772 C CG2 . VAL A 252 ? 0.9600 0.8395 0.6841 0.1177  -0.1174 0.2377  251 VAL A CG2 
1773 N N   . GLU A 253 ? 1.1110 0.8133 0.7334 0.0965  -0.1966 0.2273  252 GLU A N   
1774 C CA  . GLU A 253 ? 1.1540 0.8148 0.7696 0.0778  -0.2291 0.2268  252 GLU A CA  
1775 C C   . GLU A 253 ? 1.1735 0.8176 0.7669 0.0718  -0.2378 0.2199  252 GLU A C   
1776 O O   . GLU A 253 ? 1.1830 0.8219 0.8010 0.0528  -0.2650 0.2258  252 GLU A O   
1777 C CB  . GLU A 253 ? 1.2252 0.8172 0.7843 0.0798  -0.2401 0.2189  252 GLU A CB  
1778 C CG  . GLU A 253 ? 1.2219 0.8254 0.8075 0.0821  -0.2374 0.2282  252 GLU A CG  
1779 C CD  . GLU A 253 ? 1.3871 0.9131 0.9122 0.0848  -0.2490 0.2201  252 GLU A CD  
1780 O OE1 . GLU A 253 ? 1.4441 0.9016 0.8993 0.0847  -0.2594 0.2061  252 GLU A OE1 
1781 O OE2 . GLU A 253 ? 1.3620 0.8899 0.9038 0.0872  -0.2475 0.2277  252 GLU A OE2 
1782 N N   . VAL A 254 ? 1.1592 0.7975 0.7111 0.0870  -0.2150 0.2101  253 VAL A N   
1783 C CA  . VAL A 254 ? 1.1806 0.8022 0.7086 0.0816  -0.2213 0.2047  253 VAL A CA  
1784 C C   . VAL A 254 ? 1.1193 0.7982 0.7108 0.0741  -0.2219 0.2151  253 VAL A C   
1785 O O   . VAL A 254 ? 1.1301 0.8022 0.7349 0.0603  -0.2430 0.2185  253 VAL A O   
1786 C CB  . VAL A 254 ? 1.2111 0.8095 0.6781 0.1011  -0.1927 0.1941  253 VAL A CB  
1787 C CG1 . VAL A 254 ? 1.2164 0.8149 0.6717 0.0963  -0.1930 0.1921  253 VAL A CG1 
1788 C CG2 . VAL A 254 ? 1.2975 0.8174 0.6867 0.1093  -0.1942 0.1829  253 VAL A CG2 
1789 N N   . LEU A 255 ? 1.1023 0.8330 0.7303 0.0833  -0.1998 0.2208  254 LEU A N   
1790 C CA  . LEU A 255 ? 1.0558 0.8298 0.7346 0.0783  -0.1982 0.2301  254 LEU A CA  
1791 C C   . LEU A 255 ? 1.0433 0.8316 0.7814 0.0642  -0.2194 0.2442  254 LEU A C   
1792 O O   . LEU A 255 ? 1.0327 0.8345 0.8054 0.0574  -0.2280 0.2521  254 LEU A O   
1793 C CB  . LEU A 255 ? 1.0049 0.8306 0.7107 0.0874  -0.1656 0.2271  254 LEU A CB  
1794 C CG  . LEU A 255 ? 1.0063 0.8364 0.6774 0.0992  -0.1419 0.2183  254 LEU A CG  
1795 C CD1 . LEU A 255 ? 0.9615 0.8419 0.6640 0.1020  -0.1185 0.2184  254 LEU A CD1 
1796 C CD2 . LEU A 255 ? 1.0206 0.8373 0.6715 0.0972  -0.1440 0.2164  254 LEU A CD2 
1797 N N   . LEU A 256 ? 1.0468 0.8335 0.8019 0.0601  -0.2269 0.2498  255 LEU A N   
1798 C CA  . LEU A 256 ? 1.0355 0.8414 0.8561 0.0465  -0.2439 0.2673  255 LEU A CA  
1799 C C   . LEU A 256 ? 1.0775 0.8515 0.8971 0.0296  -0.2767 0.2689  255 LEU A C   
1800 O O   . LEU A 256 ? 1.0633 0.8620 0.9424 0.0202  -0.2875 0.2845  255 LEU A O   
1801 C CB  . LEU A 256 ? 1.0347 0.8437 0.8710 0.0444  -0.2446 0.2741  255 LEU A CB  
1802 C CG  . LEU A 256 ? 0.9889 0.8430 0.8500 0.0557  -0.2130 0.2784  255 LEU A CG  
1803 C CD1 . LEU A 256 ? 0.9981 0.8458 0.8615 0.0541  -0.2153 0.2841  255 LEU A CD1 
1804 C CD2 . LEU A 256 ? 0.9792 0.8814 0.9077 0.0550  -0.1971 0.2922  255 LEU A CD2 
1805 N N   . LYS A 257 ? 1.1138 0.8304 0.8654 0.0252  -0.2926 0.2545  256 LYS A N   
1806 C CA  . LYS A 257 ? 1.1670 0.8439 0.9049 0.0057  -0.3279 0.2553  256 LYS A CA  
1807 C C   . LYS A 257 ? 1.1594 0.8470 0.9012 0.0064  -0.3266 0.2556  256 LYS A C   
1808 O O   . LYS A 257 ? 1.1766 0.8622 0.9504 -0.0109 -0.3540 0.2669  256 LYS A O   
1809 C CB  . LYS A 257 ? 1.2457 0.8458 0.8931 0.0029  -0.3421 0.2378  256 LYS A CB  
1810 C CG  . LYS A 257 ? 1.2739 0.8507 0.9153 -0.0017 -0.3518 0.2390  256 LYS A CG  
1811 C CD  . LYS A 257 ? 1.3901 0.8820 0.9290 0.0029  -0.3571 0.2191  256 LYS A CD  
1812 C CE  . LYS A 257 ? 1.4440 0.9102 0.9743 0.0019  -0.3631 0.2201  256 LYS A CE  
1813 N NZ  . LYS A 257 ? 1.5647 0.9390 0.9881 0.0110  -0.3638 0.2003  256 LYS A NZ  
1814 N N   . TYR A 258 ? 1.1214 0.8211 0.8348 0.0246  -0.2965 0.2455  257 TYR A N   
1815 C CA  . TYR A 258 ? 1.1135 0.8235 0.8319 0.0256  -0.2938 0.2470  257 TYR A CA  
1816 C C   . TYR A 258 ? 1.0600 0.8244 0.8632 0.0257  -0.2890 0.2654  257 TYR A C   
1817 O O   . TYR A 258 ? 1.0588 0.8298 0.8795 0.0235  -0.2936 0.2712  257 TYR A O   
1818 C CB  . TYR A 258 ? 1.1077 0.8149 0.7746 0.0428  -0.2636 0.2336  257 TYR A CB  
1819 C CG  . TYR A 258 ? 1.1710 0.8245 0.7625 0.0413  -0.2692 0.2212  257 TYR A CG  
1820 C CD1 . TYR A 258 ? 1.2264 0.8285 0.7493 0.0453  -0.2679 0.2084  257 TYR A CD1 
1821 C CD2 . TYR A 258 ? 1.1827 0.8317 0.7681 0.0372  -0.2743 0.2233  257 TYR A CD2 
1822 C CE1 . TYR A 258 ? 1.2962 0.8411 0.7423 0.0460  -0.2693 0.1973  257 TYR A CE1 
1823 C CE2 . TYR A 258 ? 1.2474 0.8442 0.7596 0.0359  -0.2776 0.2133  257 TYR A CE2 
1824 C CZ  . TYR A 258 ? 1.3060 0.8496 0.7469 0.0407  -0.2740 0.2000  257 TYR A CZ  
1825 O OH  . TYR A 258 ? 1.3819 0.8657 0.7423 0.0417  -0.2736 0.1900  257 TYR A OH  
1826 N N   . GLY A 259 ? 1.0672 0.8675 0.9220 0.0293  -0.2779 0.2760  258 GLY A N   
1827 C CA  . GLY A 259 ? 1.0273 0.8741 0.9640 0.0311  -0.2697 0.2964  258 GLY A CA  
1828 C C   . GLY A 259 ? 1.0189 0.8993 0.9688 0.0481  -0.2346 0.2980  258 GLY A C   
1829 O O   . GLY A 259 ? 1.0161 0.9229 1.0108 0.0548  -0.2196 0.3088  258 GLY A O   
1830 N N   . ALA A 260 ? 1.0064 0.8853 0.9169 0.0549  -0.2173 0.2844  259 ALA A N   
1831 C CA  . ALA A 260 ? 1.0075 0.9204 0.9273 0.0665  -0.1776 0.2748  259 ALA A CA  
1832 C C   . ALA A 260 ? 1.0284 0.9748 1.0131 0.0681  -0.1632 0.2911  259 ALA A C   
1833 O O   . ALA A 260 ? 1.0202 0.9678 1.0394 0.0603  -0.1818 0.3085  259 ALA A O   
1834 C CB  . ALA A 260 ? 1.0053 0.9117 0.8728 0.0718  -0.1644 0.2575  259 ALA A CB  
1835 N N   . ASP A 261 ? 0.9829 0.9520 0.9808 0.0780  -0.1291 0.2868  260 ASP A N   
1836 C CA  . ASP A 261 ? 0.9970 0.9932 1.0482 0.0837  -0.1055 0.3021  260 ASP A CA  
1837 C C   . ASP A 261 ? 1.0166 1.0199 1.0444 0.0848  -0.0902 0.2955  260 ASP A C   
1838 O O   . ASP A 261 ? 1.0263 1.0281 1.0097 0.0892  -0.0707 0.2779  260 ASP A O   
1839 C CB  . ASP A 261 ? 1.0367 1.0401 1.1003 0.0954  -0.0740 0.2996  260 ASP A CB  
1840 C CG  . ASP A 261 ? 1.0979 1.1238 1.2199 0.1053  -0.0452 0.3198  260 ASP A CG  
1841 O OD1 . ASP A 261 ? 1.0764 1.1192 1.2654 0.1023  -0.0592 0.3470  260 ASP A OD1 
1842 O OD2 . ASP A 261 ? 1.1655 1.1896 1.2650 0.1156  -0.0085 0.3103  260 ASP A OD2 
1843 N N   . VAL A 262 ? 0.9255 0.9358 0.9847 0.0789  -0.1023 0.3122  261 VAL A N   
1844 C CA  . VAL A 262 ? 0.9261 0.9425 0.9676 0.0795  -0.0901 0.3099  261 VAL A CA  
1845 C C   . VAL A 262 ? 0.9738 1.0099 1.0269 0.0892  -0.0498 0.3138  261 VAL A C   
1846 O O   . VAL A 262 ? 0.9783 1.0168 1.0043 0.0901  -0.0366 0.3097  261 VAL A O   
1847 C CB  . VAL A 262 ? 0.9244 0.9379 0.9975 0.0687  -0.1162 0.3290  261 VAL A CB  
1848 C CG1 . VAL A 262 ? 0.9282 0.9702 1.0811 0.0681  -0.1061 0.3594  261 VAL A CG1 
1849 C CG2 . VAL A 262 ? 0.9206 0.9273 0.9571 0.0682  -0.1138 0.3217  261 VAL A CG2 
1850 N N   . ASN A 263 ? 0.9102 0.9553 0.9981 0.0976  -0.0288 0.3224  262 ASN A N   
1851 C CA  . ASN A 263 ? 0.9590 1.0106 1.0467 0.1098  0.0149  0.3250  262 ASN A CA  
1852 C C   . ASN A 263 ? 1.0109 1.0424 1.0518 0.1174  0.0348  0.3035  262 ASN A C   
1853 O O   . ASN A 263 ? 1.0597 1.0852 1.1033 0.1302  0.0711  0.3064  262 ASN A O   
1854 C CB  . ASN A 263 ? 0.9691 1.0439 1.1390 0.1174  0.0322  0.3569  262 ASN A CB  
1855 C CG  . ASN A 263 ? 1.0178 1.1122 1.2374 0.1067  0.0124  0.3819  262 ASN A CG  
1856 O OD1 . ASN A 263 ? 0.9886 1.0792 1.1755 0.1007  0.0091  0.3767  262 ASN A OD1 
1857 N ND2 . ASN A 263 ? 0.9564 1.0708 1.2579 0.1028  -0.0036 0.4117  262 ASN A ND2 
1858 N N   . ALA A 264 ? 0.9578 0.9750 0.9541 0.1102  0.0129  0.2831  263 ALA A N   
1859 C CA  . ALA A 264 ? 0.9746 0.9709 0.9267 0.1132  0.0263  0.2641  263 ALA A CA  
1860 C C   . ALA A 264 ? 1.0011 0.9834 0.8948 0.1130  0.0482  0.2513  263 ALA A C   
1861 O O   . ALA A 264 ? 0.9951 0.9841 0.8645 0.1056  0.0381  0.2489  263 ALA A O   
1862 C CB  . ALA A 264 ? 0.9607 0.9492 0.8863 0.1043  -0.0027 0.2506  263 ALA A CB  
1863 N N   . VAL A 265 ? 1.0259 0.9833 0.8929 0.1208  0.0770  0.2439  264 VAL A N   
1864 C CA  . VAL A 265 ? 1.0694 1.0007 0.8693 0.1189  0.0970  0.2320  264 VAL A CA  
1865 C C   . VAL A 265 ? 1.0892 0.9929 0.8307 0.1082  0.0850  0.2109  264 VAL A C   
1866 O O   . VAL A 265 ? 1.0919 0.9825 0.8410 0.1108  0.0842  0.2054  264 VAL A O   
1867 C CB  . VAL A 265 ? 1.1169 1.0274 0.9160 0.1361  0.1423  0.2396  264 VAL A CB  
1868 C CG1 . VAL A 265 ? 1.1782 1.0486 0.8899 0.1325  0.1609  0.2258  264 VAL A CG1 
1869 C CG2 . VAL A 265 ? 1.0951 1.0403 0.9648 0.1450  0.1535  0.2665  264 VAL A CG2 
1870 N N   . ASP A 266 ? 1.1935 1.0895 0.8809 0.0946  0.0733  0.2021  265 ASP A N   
1871 C CA  . ASP A 266 ? 1.2048 1.0773 0.8401 0.0799  0.0577  0.1867  265 ASP A CA  
1872 C C   . ASP A 266 ? 1.2999 1.1177 0.8626 0.0784  0.0800  0.1751  265 ASP A C   
1873 O O   . ASP A 266 ? 1.3409 1.1381 0.8949 0.0932  0.1138  0.1785  265 ASP A O   
1874 C CB  . ASP A 266 ? 1.1487 1.0476 0.7762 0.0645  0.0273  0.1889  265 ASP A CB  
1875 C CG  . ASP A 266 ? 1.1919 1.0860 0.7813 0.0586  0.0296  0.1927  265 ASP A CG  
1876 O OD1 . ASP A 266 ? 1.2189 1.1051 0.8080 0.0694  0.0542  0.1984  265 ASP A OD1 
1877 O OD2 . ASP A 266 ? 1.1942 1.0939 0.7573 0.0429  0.0066  0.1929  265 ASP A OD2 
1878 N N   . ALA A 267 ? 1.2649 1.0549 0.7719 0.0598  0.0614  0.1629  266 ALA A N   
1879 C CA  . ALA A 267 ? 1.3493 1.0722 0.7712 0.0546  0.0767  0.1493  266 ALA A CA  
1880 C C   . ALA A 267 ? 1.3795 1.0862 0.7521 0.0531  0.0880  0.1527  266 ALA A C   
1881 O O   . ALA A 267 ? 1.4497 1.0998 0.7611 0.0618  0.1198  0.1455  266 ALA A O   
1882 C CB  . ALA A 267 ? 1.3737 1.0720 0.7503 0.0290  0.0448  0.1391  266 ALA A CB  
1883 N N   . ALA A 268 ? 1.3869 1.1382 0.7813 0.0436  0.0646  0.1644  267 ALA A N   
1884 C CA  . ALA A 268 ? 1.3996 1.1384 0.7505 0.0417  0.0732  0.1707  267 ALA A CA  
1885 C C   . ALA A 268 ? 1.4149 1.1647 0.8022 0.0664  0.1130  0.1815  267 ALA A C   
1886 O O   . ALA A 268 ? 1.4618 1.1752 0.7954 0.0722  0.1407  0.1830  267 ALA A O   
1887 C CB  . ALA A 268 ? 1.3362 1.1211 0.7080 0.0262  0.0366  0.1832  267 ALA A CB  
1888 N N   . GLY A 269 ? 1.3095 1.1069 0.7863 0.0801  0.1158  0.1914  268 GLY A N   
1889 C CA  . GLY A 269 ? 1.3098 1.1257 0.8377 0.1005  0.1480  0.2075  268 GLY A CA  
1890 C C   . GLY A 269 ? 1.2526 1.1251 0.8471 0.0988  0.1282  0.2249  268 GLY A C   
1891 O O   . GLY A 269 ? 1.2562 1.1421 0.8749 0.1074  0.1476  0.2414  268 GLY A O   
1892 N N   . GLY A 270 ? 1.2180 1.1200 0.8405 0.0882  0.0913  0.2223  269 GLY A N   
1893 C CA  . GLY A 270 ? 1.1529 1.0958 0.8234 0.0863  0.0707  0.2357  269 GLY A CA  
1894 C C   . GLY A 270 ? 1.1041 1.0740 0.8389 0.0900  0.0532  0.2392  269 GLY A C   
1895 O O   . GLY A 270 ? 1.0908 1.0596 0.8227 0.0855  0.0364  0.2287  269 GLY A O   
1896 N N   . THR A 271 ? 1.1023 1.0929 0.8924 0.0966  0.0555  0.2557  270 THR A N   
1897 C CA  . THR A 271 ? 1.0657 1.0745 0.9074 0.0965  0.0320  0.2611  270 THR A CA  
1898 C C   . THR A 271 ? 1.0213 1.0392 0.8526 0.0895  0.0046  0.2595  270 THR A C   
1899 O O   . THR A 271 ? 1.0070 1.0253 0.8058 0.0854  0.0043  0.2591  270 THR A O   
1900 C CB  . THR A 271 ? 1.1131 1.1368 1.0179 0.1026  0.0406  0.2829  270 THR A CB  
1901 O OG1 . THR A 271 ? 1.0940 1.1275 1.0036 0.0997  0.0407  0.2959  270 THR A OG1 
1902 C CG2 . THR A 271 ? 1.1697 1.1860 1.0879 0.1144  0.0772  0.2891  270 THR A CG2 
1903 N N   . PRO A 272 ? 1.0268 1.0480 0.8817 0.0888  -0.0184 0.2596  271 PRO A N   
1904 C CA  . PRO A 272 ? 0.9792 1.0018 0.8214 0.0867  -0.0385 0.2588  271 PRO A CA  
1905 C C   . PRO A 272 ? 0.9837 1.0120 0.8326 0.0861  -0.0384 0.2716  271 PRO A C   
1906 O O   . PRO A 272 ? 0.9545 0.9837 0.7843 0.0863  -0.0477 0.2711  271 PRO A O   
1907 C CB  . PRO A 272 ? 0.9740 0.9863 0.8354 0.0872  -0.0589 0.2586  271 PRO A CB  
1908 C CG  . PRO A 272 ? 1.0172 1.0267 0.8866 0.0878  -0.0529 0.2532  271 PRO A CG  
1909 C CD  . PRO A 272 ? 1.0414 1.0579 0.9227 0.0904  -0.0269 0.2586  271 PRO A CD  
1910 N N   . LEU A 273 ? 0.9546 0.9879 0.8341 0.0863  -0.0265 0.2859  272 LEU A N   
1911 C CA  . LEU A 273 ? 0.9491 0.9868 0.8374 0.0845  -0.0267 0.3007  272 LEU A CA  
1912 C C   . LEU A 273 ? 0.9703 1.0098 0.8163 0.0838  -0.0130 0.2994  272 LEU A C   
1913 O O   . LEU A 273 ? 0.9648 1.0057 0.8010 0.0822  -0.0223 0.3061  272 LEU A O   
1914 C CB  . LEU A 273 ? 0.9778 1.0244 0.9171 0.0841  -0.0157 0.3211  272 LEU A CB  
1915 C CG  . LEU A 273 ? 0.9926 1.0430 0.9502 0.0800  -0.0195 0.3403  272 LEU A CG  
1916 C CD1 . LEU A 273 ? 0.9636 0.9981 0.9219 0.0753  -0.0532 0.3385  272 LEU A CD1 
1917 C CD2 . LEU A 273 ? 1.0325 1.0980 1.0494 0.0791  -0.0047 0.3654  272 LEU A CD2 
1918 N N   . HIS A 274 ? 1.0544 1.0884 0.8709 0.0842  0.0075  0.2917  273 HIS A N   
1919 C CA  . HIS A 274 ? 1.0691 1.0957 0.8335 0.0798  0.0149  0.2903  273 HIS A CA  
1920 C C   . HIS A 274 ? 1.0406 1.0719 0.7811 0.0744  -0.0092 0.2829  273 HIS A C   
1921 O O   . HIS A 274 ? 1.0360 1.0686 0.7495 0.0693  -0.0153 0.2896  273 HIS A O   
1922 C CB  . HIS A 274 ? 1.1315 1.1372 0.8566 0.0804  0.0401  0.2812  273 HIS A CB  
1923 C CG  . HIS A 274 ? 1.1822 1.1854 0.9402 0.0906  0.0695  0.2895  273 HIS A CG  
1924 N ND1 . HIS A 274 ? 1.2208 1.2163 0.9923 0.0969  0.0806  0.2811  273 HIS A ND1 
1925 C CD2 . HIS A 274 ? 1.1987 1.2088 0.9851 0.0964  0.0915  0.3094  273 HIS A CD2 
1926 C CE1 . HIS A 274 ? 1.2439 1.2435 1.0547 0.1076  0.1087  0.2963  273 HIS A CE1 
1927 N NE2 . HIS A 274 ? 1.2302 1.2402 1.0522 0.1071  0.1165  0.3143  273 HIS A NE2 
1928 N N   . GLU A 275 ? 1.0967 1.1317 0.8497 0.0759  -0.0224 0.2725  274 GLU A N   
1929 C CA  . GLU A 275 ? 1.0594 1.1039 0.8018 0.0738  -0.0408 0.2703  274 GLU A CA  
1930 C C   . GLU A 275 ? 1.0389 1.0904 0.8041 0.0808  -0.0530 0.2804  274 GLU A C   
1931 O O   . GLU A 275 ? 1.0263 1.0879 0.7841 0.0809  -0.0620 0.2885  274 GLU A O   
1932 C CB  . GLU A 275 ? 1.0555 1.0993 0.8008 0.0742  -0.0457 0.2578  274 GLU A CB  
1933 C CG  . GLU A 275 ? 1.1343 1.1661 0.8498 0.0659  -0.0376 0.2473  274 GLU A CG  
1934 C CD  . GLU A 275 ? 1.2142 1.2518 0.9022 0.0543  -0.0512 0.2480  274 GLU A CD  
1935 O OE1 . GLU A 275 ? 1.1733 1.2249 0.8598 0.0517  -0.0620 0.2601  274 GLU A OE1 
1936 O OE2 . GLU A 275 ? 1.2112 1.2398 0.8833 0.0467  -0.0533 0.2389  274 GLU A OE2 
1937 N N   . ALA A 276 ? 0.9895 1.0321 0.7820 0.0863  -0.0551 0.2817  275 ALA A N   
1938 C CA  . ALA A 276 ? 0.9800 1.0153 0.7843 0.0929  -0.0673 0.2889  275 ALA A CA  
1939 C C   . ALA A 276 ? 0.9895 1.0285 0.7947 0.0912  -0.0659 0.3044  275 ALA A C   
1940 O O   . ALA A 276 ? 0.9956 1.0340 0.7986 0.0964  -0.0737 0.3106  275 ALA A O   
1941 C CB  . ALA A 276 ? 0.9861 1.0015 0.8110 0.0943  -0.0757 0.2869  275 ALA A CB  
1942 N N   . ALA A 277 ? 0.9586 0.9999 0.7685 0.0851  -0.0532 0.3117  276 ALA A N   
1943 C CA  . ALA A 277 ? 0.9764 1.0196 0.7838 0.0826  -0.0499 0.3285  276 ALA A CA  
1944 C C   . ALA A 277 ? 0.9929 1.0445 0.7648 0.0793  -0.0513 0.3318  276 ALA A C   
1945 O O   . ALA A 277 ? 1.0053 1.0556 0.7776 0.0782  -0.0577 0.3391  276 ALA A O   
1946 C CB  . ALA A 277 ? 0.9877 1.0315 0.8087 0.0786  -0.0302 0.3383  276 ALA A CB  
1947 N N   . ARG A 278 ? 1.0095 1.0637 0.7535 0.0743  -0.0479 0.3206  277 ARG A N   
1948 C CA  . ARG A 278 ? 1.0322 1.0885 0.7448 0.0652  -0.0565 0.3201  277 ARG A CA  
1949 C C   . ARG A 278 ? 1.0158 1.0839 0.7516 0.0691  -0.0740 0.3179  277 ARG A C   
1950 O O   . ARG A 278 ? 1.0310 1.1032 0.7659 0.0663  -0.0834 0.3260  277 ARG A O   
1951 C CB  . ARG A 278 ? 1.0516 1.1007 0.7241 0.0563  -0.0520 0.3109  277 ARG A CB  
1952 N N   . ALA A 279 ? 1.0113 1.0839 0.7676 0.0774  -0.0761 0.3094  278 ALA A N   
1953 C CA  . ALA A 279 ? 1.0016 1.0845 0.7799 0.0857  -0.0848 0.3107  278 ALA A CA  
1954 C C   . ALA A 279 ? 1.0056 1.0783 0.8024 0.0975  -0.0861 0.3186  278 ALA A C   
1955 O O   . ALA A 279 ? 1.0088 1.0892 0.8216 0.1062  -0.0901 0.3255  278 ALA A O   
1956 C CB  . ALA A 279 ? 0.9826 1.0668 0.7691 0.0927  -0.0823 0.3008  278 ALA A CB  
1957 N N   . GLY A 280 ? 0.9760 1.0313 0.7737 0.0982  -0.0827 0.3207  279 GLY A N   
1958 C CA  . GLY A 280 ? 0.9881 1.0259 0.7984 0.1067  -0.0868 0.3286  279 GLY A CA  
1959 C C   . GLY A 280 ? 0.9899 1.0032 0.8044 0.1206  -0.0894 0.3223  279 GLY A C   
1960 O O   . GLY A 280 ? 1.0020 1.0076 0.8196 0.1342  -0.0897 0.3251  279 GLY A O   
1961 N N   . HIS A 281 ? 0.9963 0.9938 0.8086 0.1182  -0.0908 0.3160  280 HIS A N   
1962 C CA  . HIS A 281 ? 1.0113 0.9736 0.8143 0.1287  -0.0971 0.3097  280 HIS A CA  
1963 C C   . HIS A 281 ? 1.0301 0.9656 0.8406 0.1205  -0.1091 0.3163  280 HIS A C   
1964 O O   . HIS A 281 ? 1.0224 0.9601 0.8435 0.1101  -0.1121 0.3126  280 HIS A O   
1965 C CB  . HIS A 281 ? 0.9980 0.9651 0.7910 0.1308  -0.0935 0.2974  280 HIS A CB  
1966 C CG  . HIS A 281 ? 0.9909 0.9872 0.7848 0.1352  -0.0839 0.2951  280 HIS A CG  
1967 N ND1 . HIS A 281 ? 1.0085 1.0050 0.8051 0.1500  -0.0787 0.3009  280 HIS A ND1 
1968 C CD2 . HIS A 281 ? 0.9794 1.0053 0.7754 0.1262  -0.0797 0.2910  280 HIS A CD2 
1969 C CE1 . HIS A 281 ? 0.9907 1.0216 0.7984 0.1485  -0.0731 0.3031  280 HIS A CE1 
1970 N NE2 . HIS A 281 ? 0.9761 1.0221 0.7800 0.1327  -0.0755 0.2959  280 HIS A NE2 
1971 N N   . LEU A 282 ? 1.0303 0.9398 0.8409 0.1232  -0.1165 0.3253  281 LEU A N   
1972 C CA  . LEU A 282 ? 1.0489 0.9312 0.8723 0.1112  -0.1320 0.3343  281 LEU A CA  
1973 C C   . LEU A 282 ? 1.0744 0.9163 0.8834 0.1075  -0.1482 0.3218  281 LEU A C   
1974 O O   . LEU A 282 ? 1.0854 0.9221 0.9175 0.0910  -0.1622 0.3278  281 LEU A O   
1975 C CB  . LEU A 282 ? 1.0832 0.9359 0.9026 0.1154  -0.1386 0.3439  281 LEU A CB  
1976 C CG  . LEU A 282 ? 1.1186 0.9335 0.9493 0.1009  -0.1588 0.3522  281 LEU A CG  
1977 C CD1 . LEU A 282 ? 1.0956 0.9498 0.9701 0.0823  -0.1544 0.3668  281 LEU A CD1 
1978 C CD2 . LEU A 282 ? 1.1695 0.9426 0.9845 0.1089  -0.1652 0.3585  281 LEU A CD2 
1979 N N   . GLU A 283 ? 1.1271 0.9399 0.8988 0.1222  -0.1462 0.3066  282 GLU A N   
1980 C CA  . GLU A 283 ? 1.1601 0.9243 0.9032 0.1184  -0.1628 0.2937  282 GLU A CA  
1981 C C   . GLU A 283 ? 1.1249 0.9202 0.8884 0.1066  -0.1639 0.2893  282 GLU A C   
1982 O O   . GLU A 283 ? 1.1405 0.9130 0.9100 0.0917  -0.1858 0.2905  282 GLU A O   
1983 C CB  . GLU A 283 ? 1.1989 0.9224 0.8903 0.1406  -0.1527 0.2798  282 GLU A CB  
1984 C CG  . GLU A 283 ? 1.2560 0.9697 0.9386 0.1608  -0.1384 0.2867  282 GLU A CG  
1985 C CD  . GLU A 283 ? 1.2999 1.0809 1.0123 0.1715  -0.1152 0.2949  282 GLU A CD  
1986 O OE1 . GLU A 283 ? 1.2403 1.0571 0.9593 0.1704  -0.1058 0.2888  282 GLU A OE1 
1987 O OE2 . GLU A 283 ? 1.2779 1.0738 1.0069 0.1791  -0.1095 0.3092  282 GLU A OE2 
1988 N N   . ILE A 284 ? 1.0427 0.8880 0.8182 0.1120  -0.1428 0.2861  283 ILE A N   
1989 C CA  . ILE A 284 ? 1.0145 0.8844 0.8055 0.1036  -0.1410 0.2809  283 ILE A CA  
1990 C C   . ILE A 284 ? 0.9922 0.8908 0.8303 0.0887  -0.1423 0.2951  283 ILE A C   
1991 O O   . ILE A 284 ? 0.9873 0.8870 0.8471 0.0790  -0.1515 0.2973  283 ILE A O   
1992 C CB  . ILE A 284 ? 0.9856 0.8916 0.7698 0.1125  -0.1198 0.2733  283 ILE A CB  
1993 C CG1 . ILE A 284 ? 1.0088 0.8885 0.7550 0.1271  -0.1162 0.2622  283 ILE A CG1 
1994 C CG2 . ILE A 284 ? 0.9564 0.8908 0.7611 0.1032  -0.1144 0.2705  283 ILE A CG2 
1995 C CD1 . ILE A 284 ? 1.0304 0.8991 0.7613 0.1440  -0.1071 0.2667  283 ILE A CD1 
1996 N N   . VAL A 285 ? 0.9527 0.8742 0.8086 0.0877  -0.1316 0.3078  284 VAL A N   
1997 C CA  . VAL A 285 ? 0.9454 0.8944 0.8443 0.0769  -0.1245 0.3241  284 VAL A CA  
1998 C C   . VAL A 285 ? 0.9667 0.8942 0.8978 0.0635  -0.1484 0.3377  284 VAL A C   
1999 O O   . VAL A 285 ? 0.9620 0.9101 0.9369 0.0551  -0.1469 0.3497  284 VAL A O   
2000 C CB  . VAL A 285 ? 0.9395 0.9089 0.8403 0.0785  -0.1089 0.3364  284 VAL A CB  
2001 C CG1 . VAL A 285 ? 0.9465 0.9352 0.8905 0.0687  -0.0997 0.3576  284 VAL A CG1 
2002 C CG2 . VAL A 285 ? 0.9201 0.9144 0.7948 0.0856  -0.0895 0.3269  284 VAL A CG2 
2003 N N   . GLU A 286 ? 1.0210 0.9041 0.9318 0.0611  -0.1718 0.3379  285 GLU A N   
2004 C CA  . GLU A 286 ? 1.0406 0.8957 0.9769 0.0435  -0.2014 0.3501  285 GLU A CA  
2005 C C   . GLU A 286 ? 1.0547 0.8971 0.9924 0.0362  -0.2190 0.3422  285 GLU A C   
2006 O O   . GLU A 286 ? 1.0548 0.9063 1.0418 0.0196  -0.2346 0.3569  285 GLU A O   
2007 C CB  . GLU A 286 ? 1.0811 0.8792 0.9798 0.0428  -0.2205 0.3437  285 GLU A CB  
2008 C CG  . GLU A 286 ? 1.1240 0.9316 1.0409 0.0417  -0.2125 0.3592  285 GLU A CG  
2009 C CD  . GLU A 286 ? 1.2498 0.9953 1.1245 0.0446  -0.2288 0.3522  285 GLU A CD  
2010 O OE1 . GLU A 286 ? 1.2407 0.9533 1.0611 0.0628  -0.2242 0.3353  285 GLU A OE1 
2011 O OE2 . GLU A 286 ? 1.2529 0.9810 1.1498 0.0293  -0.2448 0.3655  285 GLU A OE2 
2012 N N   . VAL A 287 ? 0.9887 0.8127 0.8770 0.0480  -0.2164 0.3218  286 VAL A N   
2013 C CA  . VAL A 287 ? 0.9998 0.8073 0.8817 0.0412  -0.2332 0.3134  286 VAL A CA  
2014 C C   . VAL A 287 ? 0.9539 0.8146 0.8887 0.0398  -0.2193 0.3250  286 VAL A C   
2015 O O   . VAL A 287 ? 0.9576 0.8210 0.9276 0.0273  -0.2361 0.3328  286 VAL A O   
2016 C CB  . VAL A 287 ? 1.0246 0.7938 0.8346 0.0555  -0.2307 0.2901  286 VAL A CB  
2017 C CG1 . VAL A 287 ? 1.0393 0.7912 0.8386 0.0478  -0.2467 0.2819  286 VAL A CG1 
2018 C CG2 . VAL A 287 ? 1.0818 0.7903 0.8379 0.0603  -0.2406 0.2808  286 VAL A CG2 
2019 N N   . LEU A 288 ? 0.9512 0.8541 0.8913 0.0524  -0.1840 0.3205  287 LEU A N   
2020 C CA  . LEU A 288 ? 0.9429 0.8876 0.9228 0.0540  -0.1633 0.3260  287 LEU A CA  
2021 C C   . LEU A 288 ? 0.9643 0.9346 1.0161 0.0441  -0.1636 0.3547  287 LEU A C   
2022 O O   . LEU A 288 ? 0.9601 0.9505 1.0570 0.0421  -0.1612 0.3661  287 LEU A O   
2023 C CB  . LEU A 288 ? 0.9382 0.9105 0.8970 0.0666  -0.1282 0.3147  287 LEU A CB  
2024 C CG  . LEU A 288 ? 0.9437 0.9047 0.8481 0.0761  -0.1238 0.2920  287 LEU A CG  
2025 C CD1 . LEU A 288 ? 0.9306 0.9192 0.8209 0.0826  -0.0963 0.2866  287 LEU A CD1 
2026 C CD2 . LEU A 288 ? 0.9570 0.9071 0.8541 0.0756  -0.1326 0.2827  287 LEU A CD2 
2027 N N   . LEU A 289 ? 0.8980 0.8694 0.9662 0.0387  -0.1652 0.3699  288 LEU A N   
2028 C CA  . LEU A 289 ? 0.8946 0.8943 1.0376 0.0293  -0.1623 0.4023  288 LEU A CA  
2029 C C   . LEU A 289 ? 0.9167 0.8992 1.1003 0.0095  -0.2035 0.4172  288 LEU A C   
2030 O O   . LEU A 289 ? 0.9086 0.9240 1.1690 0.0019  -0.2014 0.4442  288 LEU A O   
2031 C CB  . LEU A 289 ? 0.9013 0.9068 1.0470 0.0283  -0.1505 0.4145  288 LEU A CB  
2032 C CG  . LEU A 289 ? 0.8862 0.9160 1.0047 0.0436  -0.1075 0.4060  288 LEU A CG  
2033 C CD1 . LEU A 289 ? 0.9001 0.9260 1.0077 0.0416  -0.1036 0.4162  288 LEU A CD1 
2034 C CD2 . LEU A 289 ? 0.8739 0.9407 1.0376 0.0500  -0.0725 0.4211  288 LEU A CD2 
2035 N N   . LYS A 290 ? 0.9817 0.9124 1.1128 0.0004  -0.2369 0.3959  289 LYS A N   
2036 C CA  . LYS A 290 ? 0.9890 0.8957 1.1438 -0.0227 -0.2775 0.4019  289 LYS A CA  
2037 C C   . LYS A 290 ? 0.9969 0.9222 1.1827 -0.0243 -0.2821 0.4051  289 LYS A C   
2038 O O   . LYS A 290 ? 0.9870 0.9322 1.2430 -0.0418 -0.3007 0.4286  289 LYS A O   
2039 C CB  . LYS A 290 ? 1.0291 0.8644 1.1031 -0.0289 -0.3077 0.3768  289 LYS A CB  
2040 C CG  . LYS A 290 ? 1.1148 0.9229 1.1716 -0.0337 -0.3144 0.3794  289 LYS A CG  
2041 C CD  . LYS A 290 ? 1.2169 0.9452 1.1875 -0.0360 -0.3403 0.3548  289 LYS A CD  
2042 C CE  . LYS A 290 ? 1.2925 0.9893 1.2452 -0.0386 -0.3455 0.3577  289 LYS A CE  
2043 N NZ  . LYS A 290 ? 1.3965 1.0071 1.2588 -0.0365 -0.3656 0.3340  289 LYS A NZ  
2044 N N   . TYR A 291 ? 1.0409 0.9619 1.1801 -0.0072 -0.2661 0.3843  290 TYR A N   
2045 C CA  . TYR A 291 ? 1.0326 0.9679 1.1975 -0.0075 -0.2697 0.3867  290 TYR A CA  
2046 C C   . TYR A 291 ? 1.0385 1.0341 1.2877 0.0014  -0.2392 0.4145  290 TYR A C   
2047 O O   . TYR A 291 ? 1.0278 1.0415 1.3275 -0.0031 -0.2462 0.4274  290 TYR A O   
2048 C CB  . TYR A 291 ? 1.0404 0.9529 1.1318 0.0077  -0.2603 0.3583  290 TYR A CB  
2049 C CG  . TYR A 291 ? 1.0694 0.9199 1.0862 -0.0005 -0.2903 0.3353  290 TYR A CG  
2050 C CD1 . TYR A 291 ? 1.1012 0.9114 1.0580 0.0022  -0.2938 0.3209  290 TYR A CD1 
2051 C CD2 . TYR A 291 ? 1.0907 0.9194 1.0944 -0.0095 -0.3127 0.3296  290 TYR A CD2 
2052 C CE1 . TYR A 291 ? 1.1500 0.8965 1.0330 -0.0019 -0.3157 0.3013  290 TYR A CE1 
2053 C CE2 . TYR A 291 ? 1.1394 0.9049 1.0665 -0.0162 -0.3366 0.3097  290 TYR A CE2 
2054 C CZ  . TYR A 291 ? 1.1974 0.9202 1.0627 -0.0115 -0.3365 0.2955  290 TYR A CZ  
2055 O OH  . TYR A 291 ? 1.2585 0.9109 1.0415 -0.0153 -0.3558 0.2764  290 TYR A OH  
2056 N N   . GLY A 292 ? 0.9673 0.9913 1.2304 0.0152  -0.2034 0.4254  291 GLY A N   
2057 C CA  . GLY A 292 ? 0.9694 1.0431 1.3086 0.0265  -0.1678 0.4548  291 GLY A CA  
2058 C C   . GLY A 292 ? 1.0100 1.0978 1.3111 0.0486  -0.1148 0.4340  291 GLY A C   
2059 O O   . GLY A 292 ? 1.0205 1.1281 1.3475 0.0619  -0.0859 0.4375  291 GLY A O   
2060 N N   . ALA A 293 ? 0.9190 0.9928 1.1573 0.0523  -0.1032 0.4138  292 ALA A N   
2061 C CA  . ALA A 293 ? 0.9463 1.0285 1.1435 0.0686  -0.0591 0.3968  292 ALA A CA  
2062 C C   . ALA A 293 ? 0.9930 1.1038 1.2358 0.0762  -0.0197 0.4218  292 ALA A C   
2063 O O   . ALA A 293 ? 0.9842 1.1084 1.2749 0.0676  -0.0261 0.4487  292 ALA A O   
2064 C CB  . ALA A 293 ? 0.9429 1.0039 1.0653 0.0686  -0.0634 0.3727  292 ALA A CB  
2065 N N   . ASP A 294 ? 0.9803 1.0954 1.2045 0.0923  0.0225  0.4138  293 ASP A N   
2066 C CA  . ASP A 294 ? 1.0202 1.1528 1.2699 0.1040  0.0694  0.4346  293 ASP A CA  
2067 C C   . ASP A 294 ? 1.0484 1.1700 1.2397 0.1017  0.0797  0.4269  293 ASP A C   
2068 O O   . ASP A 294 ? 1.0608 1.1605 1.1734 0.1056  0.0894  0.3999  293 ASP A O   
2069 C CB  . ASP A 294 ? 1.0727 1.1984 1.3062 0.1232  0.1115  0.4255  293 ASP A CB  
2070 C CG  . ASP A 294 ? 1.1494 1.2893 1.4177 0.1395  0.1657  0.4520  293 ASP A CG  
2071 O OD1 . ASP A 294 ? 1.1303 1.3036 1.4906 0.1382  0.1674  0.4898  293 ASP A OD1 
2072 O OD2 . ASP A 294 ? 1.2162 1.3309 1.4186 0.1532  0.2067  0.4367  293 ASP A OD2 
2073 N N   . VAL A 295 ? 1.0067 1.1433 1.2390 0.0935  0.0747  0.4534  294 VAL A N   
2074 C CA  . VAL A 295 ? 1.0110 1.1364 1.1926 0.0888  0.0753  0.4490  294 VAL A CA  
2075 C C   . VAL A 295 ? 1.0658 1.1847 1.2005 0.1021  0.1258  0.4484  294 VAL A C   
2076 O O   . VAL A 295 ? 1.0654 1.1664 1.1311 0.0998  0.1265  0.4350  294 VAL A O   
2077 C CB  . VAL A 295 ? 1.0078 1.1462 1.2471 0.0746  0.0528  0.4790  294 VAL A CB  
2078 C CG1 . VAL A 295 ? 1.0207 1.1905 1.3366 0.0793  0.0876  0.5191  294 VAL A CG1 
2079 C CG2 . VAL A 295 ? 1.0191 1.1403 1.2036 0.0687  0.0425  0.4713  294 VAL A CG2 
2080 N N   . ASN A 296 ? 1.1551 1.2840 1.3220 0.1168  0.1686  0.4639  295 ASN A N   
2081 C CA  . ASN A 296 ? 1.1951 1.3049 1.3048 0.1317  0.2216  0.4623  295 ASN A CA  
2082 C C   . ASN A 296 ? 1.2434 1.3323 1.3235 0.1470  0.2464  0.4421  295 ASN A C   
2083 O O   . ASN A 296 ? 1.2568 1.3580 1.3927 0.1627  0.2798  0.4608  295 ASN A O   
2084 C CB  . ASN A 296 ? 1.2075 1.3402 1.3759 0.1395  0.2621  0.5036  295 ASN A CB  
2085 C CG  . ASN A 296 ? 1.2863 1.4581 1.5729 0.1447  0.2679  0.5365  295 ASN A CG  
2086 O OD1 . ASN A 296 ? 1.2389 1.4227 1.5701 0.1358  0.2272  0.5321  295 ASN A OD1 
2087 N ND2 . ASN A 296 ? 1.2661 1.4576 1.6048 0.1593  0.3189  0.5727  295 ASN A ND2 
2088 N N   . ALA A 297 ? 1.3043 1.3617 1.3006 0.1424  0.2295  0.4064  296 ALA A N   
2089 C CA  . ALA A 297 ? 1.3374 1.3651 1.2897 0.1532  0.2478  0.3834  296 ALA A CA  
2090 C C   . ALA A 297 ? 1.3883 1.3681 1.2249 0.1527  0.2652  0.3608  296 ALA A C   
2091 O O   . ALA A 297 ? 1.3813 1.3556 1.1762 0.1435  0.2591  0.3636  296 ALA A O   
2092 C CB  . ALA A 297 ? 1.3181 1.3508 1.2825 0.1440  0.2039  0.3635  296 ALA A CB  
2093 N N   . VAL A 298 ? 1.4749 1.4157 1.2570 0.1611  0.2836  0.3394  297 VAL A N   
2094 C CA  . VAL A 298 ? 1.5159 1.4010 1.1794 0.1564  0.2928  0.3165  297 VAL A CA  
2095 C C   . VAL A 298 ? 1.4941 1.3839 1.1213 0.1328  0.2386  0.2992  297 VAL A C   
2096 O O   . VAL A 298 ? 1.4580 1.3660 1.1151 0.1253  0.2041  0.2879  297 VAL A O   
2097 C CB  . VAL A 298 ? 1.5866 1.4217 1.2005 0.1692  0.3215  0.2973  297 VAL A CB  
2098 C CG1 . VAL A 298 ? 1.5613 1.4179 1.2328 0.1682  0.2947  0.2883  297 VAL A CG1 
2099 C CG2 . VAL A 298 ? 1.6311 1.4016 1.1152 0.1569  0.3162  0.2710  297 VAL A CG2 
2100 N N   . GLY A 299 ? 1.4280 1.3021 0.9931 0.1221  0.2323  0.3003  298 GLY A N   
2101 C CA  . GLY A 299 ? 1.3845 1.2686 0.9255 0.1019  0.1837  0.2910  298 GLY A CA  
2102 C C   . GLY A 299 ? 1.3722 1.2770 0.9215 0.0954  0.1732  0.3104  298 GLY A C   
2103 O O   . GLY A 299 ? 1.3540 1.2547 0.8611 0.0807  0.1432  0.3069  298 GLY A O   
2104 N N   . THR A 300 ? 1.2864 1.2147 0.8955 0.1059  0.1970  0.3340  299 THR A N   
2105 C CA  . THR A 300 ? 1.2680 1.2144 0.8928 0.1012  0.1926  0.3566  299 THR A CA  
2106 C C   . THR A 300 ? 1.2213 1.1927 0.8678 0.0878  0.1423  0.3544  299 THR A C   
2107 O O   . THR A 300 ? 1.2163 1.1753 0.8075 0.0771  0.1227  0.3514  299 THR A O   
2108 C CB  . THR A 300 ? 1.3559 1.2608 0.8876 0.0993  0.2166  0.3603  299 THR A CB  
2109 O OG1 . THR A 300 ? 1.3606 1.2370 0.8115 0.0840  0.1859  0.3405  299 THR A OG1 
2110 C CG2 . THR A 300 ? 1.4168 1.2854 0.9144 0.1166  0.2735  0.3606  299 THR A CG2 
2111 N N   . PRO A 301 ? 0.9692 1.0918 0.9162 0.0809  -0.0914 0.3317  300 PRO A N   
2112 C CA  . PRO A 301 ? 0.9346 1.0342 0.8321 0.0662  -0.0941 0.3379  300 PRO A CA  
2113 C C   . PRO A 301 ? 0.9453 1.0546 0.8414 0.0529  -0.0796 0.3347  300 PRO A C   
2114 O O   . PRO A 301 ? 0.9206 1.0091 0.7800 0.0467  -0.0748 0.3350  300 PRO A O   
2115 C CB  . PRO A 301 ? 0.9620 1.0523 0.8526 0.0625  -0.1247 0.3453  300 PRO A CB  
2116 C CG  . PRO A 301 ? 1.0188 1.1424 0.9716 0.0721  -0.1386 0.3424  300 PRO A CG  
2117 C CD  . PRO A 301 ? 1.0140 1.1519 1.0011 0.0887  -0.1198 0.3337  300 PRO A CD  
2118 N N   . LEU A 302 ? 0.8730 1.0123 0.8097 0.0475  -0.0726 0.3304  301 LEU A N   
2119 C CA  . LEU A 302 ? 0.8802 1.0180 0.8070 0.0300  -0.0586 0.3303  301 LEU A CA  
2120 C C   . LEU A 302 ? 0.8801 0.9998 0.7746 0.0303  -0.0379 0.3311  301 LEU A C   
2121 O O   . LEU A 302 ? 0.8769 0.9722 0.7406 0.0203  -0.0352 0.3355  301 LEU A O   
2122 C CB  . LEU A 302 ? 0.9303 1.1079 0.9082 0.0178  -0.0517 0.3242  301 LEU A CB  
2123 C CG  . LEU A 302 ? 0.9715 1.1410 0.9366 -0.0084 -0.0414 0.3265  301 LEU A CG  
2124 C CD1 . LEU A 302 ? 0.9752 1.1193 0.9188 -0.0168 -0.0640 0.3300  301 LEU A CD1 
2125 C CD2 . LEU A 302 ? 1.0349 1.2529 1.0552 -0.0252 -0.0262 0.3174  301 LEU A CD2 
2126 N N   . HIS A 303 ? 0.9733 1.0999 0.8722 0.0422  -0.0269 0.3266  302 HIS A N   
2127 C CA  . HIS A 303 ? 0.9605 1.0685 0.8229 0.0417  -0.0125 0.3270  302 HIS A CA  
2128 C C   . HIS A 303 ? 0.9342 1.0136 0.7606 0.0472  -0.0250 0.3311  302 HIS A C   
2129 O O   . HIS A 303 ? 0.9331 0.9884 0.7349 0.0414  -0.0252 0.3260  302 HIS A O   
2130 C CB  . HIS A 303 ? 0.9815 1.1013 0.8554 0.0522  0.0008  0.3173  302 HIS A CB  
2131 C CG  . HIS A 303 ? 1.0489 1.1982 0.9506 0.0442  0.0243  0.3070  302 HIS A CG  
2132 N ND1 . HIS A 303 ? 1.1004 1.2876 1.0626 0.0486  0.0252  0.2972  302 HIS A ND1 
2133 C CD2 . HIS A 303 ? 1.0809 1.2297 0.9580 0.0303  0.0488  0.3026  302 HIS A CD2 
2134 C CE1 . HIS A 303 ? 1.1444 1.3600 1.1258 0.0377  0.0540  0.2837  302 HIS A CE1 
2135 N NE2 . HIS A 303 ? 1.1326 1.3223 1.0562 0.0241  0.0702  0.2877  302 HIS A NE2 
2136 N N   . LYS A 304 ? 0.9763 1.0505 0.8059 0.0551  -0.0351 0.3227  303 LYS A N   
2137 C CA  . LYS A 304 ? 0.9603 1.0125 0.7685 0.0552  -0.0398 0.3080  303 LYS A CA  
2138 C C   . LYS A 304 ? 0.9821 1.0231 0.7816 0.0503  -0.0477 0.3064  303 LYS A C   
2139 O O   . LYS A 304 ? 0.9841 1.0143 0.7701 0.0536  -0.0495 0.3003  303 LYS A O   
2140 C CB  . LYS A 304 ? 0.9665 1.0144 0.7719 0.0576  -0.0447 0.3039  303 LYS A CB  
2141 C CG  . LYS A 304 ? 1.0182 1.0688 0.8277 0.0645  -0.0388 0.3068  303 LYS A CG  
2142 C CD  . LYS A 304 ? 1.0616 1.0946 0.8564 0.0621  -0.0444 0.3043  303 LYS A CD  
2143 C CE  . LYS A 304 ? 1.1098 1.1376 0.9049 0.0697  -0.0400 0.3094  303 LYS A CE  
2144 N NZ  . LYS A 304 ? 1.1579 1.1943 0.9810 0.0843  -0.0441 0.3203  303 LYS A NZ  
2145 N N   . ALA A 305 ? 0.8932 0.9404 0.7026 0.0440  -0.0546 0.3151  304 ALA A N   
2146 C CA  . ALA A 305 ? 0.9144 0.9475 0.7111 0.0382  -0.0626 0.3159  304 ALA A CA  
2147 C C   . ALA A 305 ? 0.9488 0.9634 0.7356 0.0358  -0.0599 0.3207  304 ALA A C   
2148 O O   . ALA A 305 ? 0.9681 0.9616 0.7395 0.0413  -0.0659 0.3182  304 ALA A O   
2149 C CB  . ALA A 305 ? 0.9404 0.9851 0.7479 0.0282  -0.0749 0.3259  304 ALA A CB  
2150 N N   . ALA A 306 ? 0.9255 0.9468 0.7186 0.0274  -0.0515 0.3311  305 ALA A N   
2151 C CA  . ALA A 306 ? 0.9565 0.9485 0.7267 0.0198  -0.0494 0.3377  305 ALA A CA  
2152 C C   . ALA A 306 ? 0.9666 0.9388 0.7162 0.0322  -0.0506 0.3284  305 ALA A C   
2153 O O   . ALA A 306 ? 1.0044 0.9400 0.7285 0.0325  -0.0594 0.3326  305 ALA A O   
2154 C CB  . ALA A 306 ? 0.9825 0.9902 0.7583 0.0002  -0.0346 0.3515  305 ALA A CB  
2155 N N   . ARG A 307 ? 0.9755 0.9683 0.7345 0.0416  -0.0459 0.3184  306 ARG A N   
2156 C CA  . ARG A 307 ? 0.9783 0.9601 0.7221 0.0512  -0.0510 0.3116  306 ARG A CA  
2157 C C   . ARG A 307 ? 0.9993 0.9767 0.7470 0.0653  -0.0653 0.3066  306 ARG A C   
2158 O O   . ARG A 307 ? 1.0225 0.9824 0.7586 0.0753  -0.0791 0.3084  306 ARG A O   
2159 C CB  . ARG A 307 ? 0.9470 0.9526 0.6994 0.0537  -0.0412 0.3053  306 ARG A CB  
2160 C CG  . ARG A 307 ? 0.9819 0.9813 0.7177 0.0595  -0.0471 0.3009  306 ARG A CG  
2161 C CD  . ARG A 307 ? 0.9844 1.0029 0.7239 0.0593  -0.0363 0.2972  306 ARG A CD  
2162 N NE  . ARG A 307 ? 0.9713 1.0060 0.7322 0.0629  -0.0347 0.2924  306 ARG A NE  
2163 C CZ  . ARG A 307 ? 1.0076 1.0507 0.7712 0.0634  -0.0279 0.2915  306 ARG A CZ  
2164 N NH1 . ARG A 307 ? 0.9686 1.0122 0.7190 0.0632  -0.0198 0.2942  306 ARG A NH1 
2165 N NH2 . ARG A 307 ? 0.9375 0.9835 0.7097 0.0629  -0.0292 0.2900  306 ARG A NH2 
2166 N N   . ALA A 308 ? 0.9788 0.9743 0.7415 0.0672  -0.0636 0.3030  307 ALA A N   
2167 C CA  . ALA A 308 ? 0.9966 1.0002 0.7634 0.0812  -0.0716 0.3018  307 ALA A CA  
2168 C C   . ALA A 308 ? 1.0701 1.0412 0.8333 0.0854  -0.0834 0.2996  307 ALA A C   
2169 O O   . ALA A 308 ? 1.1097 1.0714 0.8821 0.1020  -0.0947 0.2879  307 ALA A O   
2170 C CB  . ALA A 308 ? 0.9882 1.0121 0.7605 0.0741  -0.0623 0.2913  307 ALA A CB  
2171 N N   . GLY A 309 ? 1.0283 0.9818 0.7827 0.0712  -0.0827 0.3086  308 GLY A N   
2172 C CA  . GLY A 309 ? 1.0899 1.0033 0.8362 0.0710  -0.0941 0.3072  308 GLY A CA  
2173 C C   . GLY A 309 ? 1.1369 1.0496 0.8876 0.0633  -0.0923 0.2927  308 GLY A C   
2174 O O   . GLY A 309 ? 1.2004 1.0816 0.9489 0.0692  -0.1010 0.2803  308 GLY A O   
2175 N N   . HIS A 310 ? 1.0361 0.9785 0.7901 0.0508  -0.0839 0.2932  309 HIS A N   
2176 C CA  . HIS A 310 ? 1.0682 1.0087 0.8164 0.0390  -0.0856 0.2814  309 HIS A CA  
2177 C C   . HIS A 310 ? 1.1020 1.0263 0.8492 0.0201  -0.0925 0.2925  309 HIS A C   
2178 O O   . HIS A 310 ? 1.0752 1.0233 0.8324 0.0067  -0.0932 0.3016  309 HIS A O   
2179 C CB  . HIS A 310 ? 1.0360 1.0077 0.7807 0.0330  -0.0803 0.2800  309 HIS A CB  
2180 C CG  . HIS A 310 ? 1.0374 1.0267 0.7821 0.0438  -0.0699 0.2689  309 HIS A CG  
2181 N ND1 . HIS A 310 ? 1.1001 1.0880 0.8446 0.0509  -0.0635 0.2443  309 HIS A ND1 
2182 C CD2 . HIS A 310 ? 0.9945 1.0050 0.7429 0.0465  -0.0635 0.2761  309 HIS A CD2 
2183 C CE1 . HIS A 310 ? 1.0796 1.0932 0.8306 0.0552  -0.0525 0.2371  309 HIS A CE1 
2184 N NE2 . HIS A 310 ? 1.0151 1.0386 0.7649 0.0516  -0.0534 0.2575  309 HIS A NE2 
2185 N N   . LEU A 311 ? 1.0659 0.9477 0.8042 0.0190  -0.0994 0.2903  310 LEU A N   
2186 C CA  . LEU A 311 ? 1.0963 0.9576 0.8316 -0.0047 -0.1042 0.3003  310 LEU A CA  
2187 C C   . LEU A 311 ? 1.1255 1.0045 0.8656 -0.0230 -0.1093 0.2916  310 LEU A C   
2188 O O   . LEU A 311 ? 1.1196 1.0171 0.8753 -0.0437 -0.1110 0.3012  310 LEU A O   
2189 C CB  . LEU A 311 ? 1.1688 0.9672 0.8855 -0.0032 -0.1141 0.2977  310 LEU A CB  
2190 C CG  . LEU A 311 ? 1.2376 1.0035 0.9451 -0.0335 -0.1193 0.3038  310 LEU A CG  
2191 C CD1 . LEU A 311 ? 1.2135 0.9942 0.9241 -0.0558 -0.1093 0.3274  310 LEU A CD1 
2192 C CD2 . LEU A 311 ? 1.3286 1.0193 1.0132 -0.0284 -0.1329 0.2973  310 LEU A CD2 
2193 N N   . GLU A 312 ? 1.1104 0.9867 0.8374 -0.0174 -0.1121 0.2716  311 GLU A N   
2194 C CA  . GLU A 312 ? 1.1321 1.0196 0.8516 -0.0366 -0.1217 0.2637  311 GLU A CA  
2195 C C   . GLU A 312 ? 1.0870 1.0213 0.8223 -0.0401 -0.1254 0.2778  311 GLU A C   
2196 O O   . GLU A 312 ? 1.0949 1.0457 0.8411 -0.0575 -0.1396 0.2814  311 GLU A O   
2197 C CB  . GLU A 312 ? 1.1901 1.0618 0.8810 -0.0325 -0.1198 0.2371  311 GLU A CB  
2198 C CG  . GLU A 312 ? 1.3109 1.1356 0.9947 -0.0221 -0.1173 0.2165  311 GLU A CG  
2199 C CD  . GLU A 312 ? 1.3928 1.2166 1.0921 0.0074  -0.1081 0.2144  311 GLU A CD  
2200 O OE1 . GLU A 312 ? 1.3013 1.1613 1.0122 0.0160  -0.1011 0.2281  311 GLU A OE1 
2201 O OE2 . GLU A 312 ? 1.4412 1.2264 1.1429 0.0228  -0.1107 0.1979  311 GLU A OE2 
2202 N N   . ILE A 313 ? 1.0698 1.0246 0.8097 -0.0229 -0.1156 0.2848  312 ILE A N   
2203 C CA  . ILE A 313 ? 1.0233 1.0125 0.7778 -0.0223 -0.1213 0.2975  312 ILE A CA  
2204 C C   . ILE A 313 ? 1.0172 1.0312 0.8128 -0.0255 -0.1200 0.3109  312 ILE A C   
2205 O O   . ILE A 313 ? 1.0161 1.0593 0.8387 -0.0310 -0.1327 0.3161  312 ILE A O   
2206 C CB  . ILE A 313 ? 0.9945 0.9909 0.7377 -0.0063 -0.1103 0.2985  312 ILE A CB  
2207 C CG1 . ILE A 313 ? 1.0327 1.0141 0.7370 -0.0101 -0.1073 0.2818  312 ILE A CG1 
2208 C CG2 . ILE A 313 ? 0.9596 0.9803 0.7189 -0.0027 -0.1178 0.3129  312 ILE A CG2 
2209 C CD1 . ILE A 313 ? 1.0361 1.0268 0.7285 -0.0022 -0.0945 0.2811  312 ILE A CD1 
2210 N N   . VAL A 314 ? 0.9669 0.9704 0.7678 -0.0229 -0.1053 0.3154  313 VAL A N   
2211 C CA  . VAL A 314 ? 0.9649 0.9922 0.7981 -0.0323 -0.0968 0.3248  313 VAL A CA  
2212 C C   . VAL A 314 ? 1.0298 1.0672 0.8847 -0.0572 -0.1064 0.3221  313 VAL A C   
2213 O O   . VAL A 314 ? 1.0380 1.1181 0.9371 -0.0660 -0.1048 0.3237  313 VAL A O   
2214 C CB  . VAL A 314 ? 0.9804 0.9823 0.7962 -0.0308 -0.0808 0.3318  313 VAL A CB  
2215 C CG1 . VAL A 314 ? 0.9938 1.0196 0.8336 -0.0477 -0.0655 0.3391  313 VAL A CG1 
2216 C CG2 . VAL A 314 ? 0.9339 0.9337 0.7349 -0.0073 -0.0750 0.3323  313 VAL A CG2 
2217 N N   . GLU A 315 ? 0.9579 0.9589 0.7871 -0.0692 -0.1164 0.3144  314 GLU A N   
2218 C CA  . GLU A 315 ? 1.0078 1.0162 0.8552 -0.0966 -0.1284 0.3095  314 GLU A CA  
2219 C C   . GLU A 315 ? 1.0183 1.0682 0.8909 -0.0971 -0.1506 0.3056  314 GLU A C   
2220 O O   . GLU A 315 ? 1.0396 1.1309 0.9594 -0.1127 -0.1588 0.3050  314 GLU A O   
2221 C CB  . GLU A 315 ? 1.0675 1.0185 0.8761 -0.1082 -0.1352 0.2991  314 GLU A CB  
2222 C CG  . GLU A 315 ? 1.1381 1.0424 0.9298 -0.1184 -0.1229 0.3062  314 GLU A CG  
2223 C CD  . GLU A 315 ? 1.2753 1.1149 1.0325 -0.1270 -0.1332 0.2937  314 GLU A CD  
2224 O OE1 . GLU A 315 ? 1.2526 1.0521 0.9825 -0.1034 -0.1331 0.2864  314 GLU A OE1 
2225 O OE2 . GLU A 315 ? 1.2985 1.1286 1.0605 -0.1573 -0.1418 0.2883  314 GLU A OE2 
2226 N N   . VAL A 316 ? 0.9979 1.0377 0.8396 -0.0815 -0.1617 0.3029  315 VAL A N   
2227 C CA  . VAL A 316 ? 0.9999 1.0649 0.8501 -0.0830 -0.1896 0.3031  315 VAL A CA  
2228 C C   . VAL A 316 ? 0.9821 1.0955 0.8862 -0.0681 -0.1929 0.3131  315 VAL A C   
2229 O O   . VAL A 316 ? 0.9977 1.1479 0.9442 -0.0728 -0.2175 0.3129  315 VAL A O   
2230 C CB  . VAL A 316 ? 1.0165 1.0499 0.8060 -0.0760 -0.1967 0.2990  315 VAL A CB  
2231 C CG1 . VAL A 316 ? 1.0204 1.0693 0.8053 -0.0771 -0.2291 0.3058  315 VAL A CG1 
2232 C CG2 . VAL A 316 ? 1.0692 1.0610 0.8142 -0.0913 -0.1946 0.2814  315 VAL A CG2 
2233 N N   . LEU A 317 ? 0.9282 1.0429 0.8354 -0.0488 -0.1702 0.3193  316 LEU A N   
2234 C CA  . LEU A 317 ? 0.9106 1.0664 0.8692 -0.0324 -0.1698 0.3240  316 LEU A CA  
2235 C C   . LEU A 317 ? 0.9619 1.1674 0.9892 -0.0456 -0.1645 0.3178  316 LEU A C   
2236 O O   . LEU A 317 ? 0.9731 1.2242 1.0593 -0.0381 -0.1824 0.3145  316 LEU A O   
2237 C CB  . LEU A 317 ? 0.8691 1.0131 0.8130 -0.0146 -0.1430 0.3281  316 LEU A CB  
2238 C CG  . LEU A 317 ? 0.8549 0.9678 0.7513 0.0000  -0.1476 0.3329  316 LEU A CG  
2239 C CD1 . LEU A 317 ? 0.8155 0.9194 0.7007 0.0127  -0.1212 0.3341  316 LEU A CD1 
2240 C CD2 . LEU A 317 ? 0.8742 0.9967 0.7846 0.0113  -0.1750 0.3393  316 LEU A CD2 
2241 N N   . LEU A 318 ? 0.8362 1.0328 0.8583 -0.0665 -0.1407 0.3152  317 LEU A N   
2242 C CA  . LEU A 318 ? 0.8805 1.1251 0.9633 -0.0876 -0.1286 0.3079  317 LEU A CA  
2243 C C   . LEU A 318 ? 0.9279 1.2000 1.0461 -0.1074 -0.1580 0.2999  317 LEU A C   
2244 O O   . LEU A 318 ? 0.9387 1.2750 1.1335 -0.1155 -0.1600 0.2900  317 LEU A O   
2245 C CB  . LEU A 318 ? 0.9032 1.1167 0.9545 -0.1108 -0.0974 0.3113  317 LEU A CB  
2246 C CG  . LEU A 318 ? 0.8884 1.0884 0.9162 -0.0970 -0.0681 0.3178  317 LEU A CG  
2247 C CD1 . LEU A 318 ? 0.8947 1.0412 0.8686 -0.1184 -0.0500 0.3265  317 LEU A CD1 
2248 C CD2 . LEU A 318 ? 0.9168 1.1810 1.0082 -0.0948 -0.0476 0.3085  317 LEU A CD2 
2249 N N   . LYS A 319 ? 0.8793 1.1078 0.9465 -0.1161 -0.1808 0.3006  318 LYS A N   
2250 C CA  . LYS A 319 ? 0.9109 1.1605 1.0027 -0.1377 -0.2126 0.2919  318 LYS A CA  
2251 C C   . LYS A 319 ? 0.8854 1.1784 1.0202 -0.1185 -0.2506 0.2919  318 LYS A C   
2252 O O   . LYS A 319 ? 0.9027 1.2352 1.0839 -0.1341 -0.2801 0.2834  318 LYS A O   
2253 C CB  . LYS A 319 ? 0.9406 1.1260 0.9576 -0.1520 -0.2251 0.2891  318 LYS A CB  
2254 C CG  . LYS A 319 ? 1.0076 1.1496 0.9964 -0.1767 -0.2002 0.2860  318 LYS A CG  
2255 C CD  . LYS A 319 ? 1.0638 1.1352 0.9775 -0.1786 -0.2072 0.2795  318 LYS A CD  
2256 C CE  . LYS A 319 ? 1.1483 1.1647 1.0337 -0.1956 -0.1859 0.2782  318 LYS A CE  
2257 N NZ  . LYS A 319 ? 1.2103 1.1588 1.0319 -0.1905 -0.1909 0.2664  318 LYS A NZ  
2258 N N   . TYR A 320 ? 0.8651 1.1487 0.9857 -0.0859 -0.2542 0.3014  319 TYR A N   
2259 C CA  . TYR A 320 ? 0.8511 1.1644 1.0097 -0.0640 -0.2937 0.3047  319 TYR A CA  
2260 C C   . TYR A 320 ? 0.8289 1.2043 1.0793 -0.0424 -0.2824 0.2981  319 TYR A C   
2261 O O   . TYR A 320 ? 0.8185 1.2150 1.1083 -0.0167 -0.3160 0.3003  319 TYR A O   
2262 C CB  . TYR A 320 ? 0.8397 1.0955 0.9206 -0.0450 -0.3088 0.3194  319 TYR A CB  
2263 C CG  . TYR A 320 ? 0.8744 1.0882 0.8836 -0.0635 -0.3404 0.3219  319 TYR A CG  
2264 C CD1 . TYR A 320 ? 0.8919 1.0591 0.8311 -0.0831 -0.3188 0.3161  319 TYR A CD1 
2265 C CD2 . TYR A 320 ? 0.9095 1.1281 0.9193 -0.0610 -0.3936 0.3282  319 TYR A CD2 
2266 C CE1 . TYR A 320 ? 0.9352 1.0647 0.8059 -0.1017 -0.3429 0.3129  319 TYR A CE1 
2267 C CE2 . TYR A 320 ? 0.9686 1.1454 0.9010 -0.0823 -0.4216 0.3294  319 TYR A CE2 
2268 C CZ  . TYR A 320 ? 0.9803 1.1142 0.8429 -0.1038 -0.3929 0.3198  319 TYR A CZ  
2269 O OH  . TYR A 320 ? 1.0454 1.1384 0.8283 -0.1266 -0.4160 0.3156  319 TYR A OH  
2270 N N   . GLY A 321 ? 0.7883 1.1893 1.0701 -0.0524 -0.2368 0.2893  320 GLY A N   
2271 C CA  . GLY A 321 ? 0.7747 1.2422 1.1470 -0.0379 -0.2188 0.2755  320 GLY A CA  
2272 C C   . GLY A 321 ? 0.7576 1.2075 1.1133 -0.0125 -0.1873 0.2782  320 GLY A C   
2273 O O   . GLY A 321 ? 0.7425 1.2374 1.1686 0.0122  -0.1858 0.2661  320 GLY A O   
2274 N N   . ALA A 322 ? 0.8243 1.2119 1.0939 -0.0166 -0.1641 0.2907  321 ALA A N   
2275 C CA  . ALA A 322 ? 0.8110 1.1838 1.0635 0.0026  -0.1341 0.2915  321 ALA A CA  
2276 C C   . ALA A 322 ? 0.8473 1.2651 1.1442 -0.0119 -0.0900 0.2760  321 ALA A C   
2277 O O   . ALA A 322 ? 0.8685 1.3034 1.1739 -0.0452 -0.0735 0.2718  321 ALA A O   
2278 C CB  . ALA A 322 ? 0.7951 1.0974 0.9518 0.0002  -0.1236 0.3064  321 ALA A CB  
2279 N N   . ASP A 323 ? 0.8241 1.2573 1.1440 0.0099  -0.0693 0.2666  322 ASP A N   
2280 C CA  . ASP A 323 ? 0.8349 1.3101 1.1884 -0.0053 -0.0224 0.2487  322 ASP A CA  
2281 C C   . ASP A 323 ? 0.8689 1.2899 1.1326 -0.0294 0.0078  0.2623  322 ASP A C   
2282 O O   . ASP A 323 ? 0.8696 1.2412 1.0726 -0.0137 0.0095  0.2729  322 ASP A O   
2283 C CB  . ASP A 323 ? 0.8333 1.3376 1.2365 0.0270  -0.0105 0.2300  322 ASP A CB  
2284 C CG  . ASP A 323 ? 0.8782 1.4364 1.3229 0.0089  0.0416  0.2045  322 ASP A CG  
2285 O OD1 . ASP A 323 ? 0.8688 1.4874 1.3744 -0.0168 0.0546  0.1898  322 ASP A OD1 
2286 O OD2 . ASP A 323 ? 0.9160 1.4571 1.3303 0.0169  0.0709  0.1975  322 ASP A OD2 
2287 N N   . VAL A 324 ? 0.8854 1.3136 1.1411 -0.0686 0.0287  0.2625  323 VAL A N   
2288 C CA  . VAL A 324 ? 0.8832 1.2502 1.0500 -0.0919 0.0491  0.2788  323 VAL A CA  
2289 C C   . VAL A 324 ? 0.8817 1.2483 1.0243 -0.0914 0.0866  0.2723  323 VAL A C   
2290 O O   . VAL A 324 ? 0.8919 1.1994 0.9544 -0.0940 0.0921  0.2877  323 VAL A O   
2291 C CB  . VAL A 324 ? 0.9148 1.2798 1.0750 -0.1375 0.0589  0.2824  323 VAL A CB  
2292 C CG1 . VAL A 324 ? 0.9163 1.3583 1.1487 -0.1644 0.0937  0.2596  323 VAL A CG1 
2293 C CG2 . VAL A 324 ? 0.9381 1.2242 1.0004 -0.1582 0.0695  0.3033  323 VAL A CG2 
2294 N N   . ASN A 325 ? 0.8708 1.3033 1.0829 -0.0869 0.1114  0.2469  324 ASN A N   
2295 C CA  . ASN A 325 ? 0.8727 1.3062 1.0600 -0.0878 0.1497  0.2352  324 ASN A CA  
2296 C C   . ASN A 325 ? 0.8849 1.3283 1.1040 -0.0425 0.1393  0.2219  324 ASN A C   
2297 O O   . ASN A 325 ? 0.8919 1.3800 1.1574 -0.0351 0.1684  0.1941  324 ASN A O   
2298 C CB  . ASN A 325 ? 0.8889 1.3870 1.1230 -0.1225 0.1969  0.2103  324 ASN A CB  
2299 C CG  . ASN A 325 ? 1.0090 1.4732 1.1757 -0.1763 0.2180  0.2272  324 ASN A CG  
2300 O OD1 . ASN A 325 ? 0.9949 1.3790 1.0644 -0.1839 0.2063  0.2551  324 ASN A OD1 
2301 N ND2 . ASN A 325 ? 0.9872 1.5114 1.2076 -0.2145 0.2478  0.2096  324 ASN A ND2 
2302 N N   . ALA A 326 ? 0.8924 1.2917 1.0853 -0.0143 0.0997  0.2394  325 ALA A N   
2303 C CA  . ALA A 326 ? 0.9012 1.2935 1.1100 0.0241  0.0872  0.2313  325 ALA A CA  
2304 C C   . ALA A 326 ? 0.9163 1.2762 1.0640 0.0231  0.1144  0.2277  325 ALA A C   
2305 O O   . ALA A 326 ? 0.8923 1.2174 0.9670 -0.0019 0.1287  0.2411  325 ALA A O   
2306 C CB  . ALA A 326 ? 0.9084 1.2573 1.0924 0.0450  0.0414  0.2527  325 ALA A CB  
2307 N N   . THR A 327 ? 0.9685 1.3357 1.1451 0.0511  0.1177  0.2091  326 THR A N   
2308 C CA  . THR A 327 ? 0.9811 1.3208 1.1056 0.0514  0.1420  0.2001  326 THR A CA  
2309 C C   . THR A 327 ? 1.0100 1.3009 1.1070 0.0790  0.1125  0.2099  326 THR A C   
2310 O O   . THR A 327 ? 1.0420 1.3334 1.1839 0.1053  0.0836  0.2104  326 THR A O   
2311 C CB  . THR A 327 ? 1.0417 1.4315 1.2212 0.0548  0.1813  0.1614  326 THR A CB  
2312 O OG1 . THR A 327 ? 1.0667 1.4229 1.1970 0.0614  0.1973  0.1498  326 THR A OG1 
2313 C CG2 . THR A 327 ? 1.0478 1.4837 1.3355 0.0888  0.1635  0.1413  326 THR A CG2 
2314 N N   . ASP A 328 ? 1.1249 1.3718 1.1455 0.0704  0.1180  0.2183  327 ASP A N   
2315 C CA  . ASP A 328 ? 1.1074 1.3107 1.0995 0.0892  0.0954  0.2250  327 ASP A CA  
2316 C C   . ASP A 328 ? 1.1897 1.3854 1.1775 0.0987  0.1163  0.1995  327 ASP A C   
2317 O O   . ASP A 328 ? 1.2498 1.4814 1.2822 0.1023  0.1436  0.1717  327 ASP A O   
2318 C CB  . ASP A 328 ? 1.0302 1.1937 0.9499 0.0752  0.0811  0.2491  327 ASP A CB  
2319 C CG  . ASP A 328 ? 1.0744 1.2262 0.9347 0.0530  0.1034  0.2476  327 ASP A CG  
2320 O OD1 . ASP A 328 ? 1.1229 1.2997 0.9902 0.0388  0.1339  0.2327  327 ASP A OD1 
2321 O OD2 . ASP A 328 ? 1.0564 1.1752 0.8625 0.0483  0.0897  0.2605  327 ASP A OD2 
2322 N N   . ILE A 329 ? 1.1209 1.2725 1.0585 0.1015  0.1049  0.2051  328 ILE A N   
2323 C CA  . ILE A 329 ? 1.1867 1.3229 1.1112 0.1074  0.1227  0.1800  328 ILE A CA  
2324 C C   . ILE A 329 ? 1.2184 1.3672 1.1008 0.0828  0.1587  0.1655  328 ILE A C   
2325 O O   . ILE A 329 ? 1.2837 1.4454 1.1791 0.0850  0.1883  0.1336  328 ILE A O   
2326 C CB  . ILE A 329 ? 1.1591 1.2462 1.0389 0.1102  0.1000  0.1904  328 ILE A CB  
2327 C CG1 . ILE A 329 ? 1.1211 1.1882 1.0369 0.1316  0.0702  0.2000  328 ILE A CG1 
2328 C CG2 . ILE A 329 ? 1.2266 1.2930 1.0758 0.1076  0.1187  0.1651  328 ILE A CG2 
2329 C CD1 . ILE A 329 ? 1.1107 1.1301 0.9841 0.1282  0.0518  0.2092  328 ILE A CD1 
2330 N N   . TRP A 330 ? 1.2100 1.3511 1.0380 0.0583  0.1563  0.1877  329 TRP A N   
2331 C CA  . TRP A 330 ? 1.2272 1.3667 0.9955 0.0295  0.1843  0.1814  329 TRP A CA  
2332 C C   . TRP A 330 ? 1.2591 1.4384 1.0509 0.0099  0.2138  0.1761  329 TRP A C   
2333 O O   . TRP A 330 ? 1.2715 1.4426 1.0014 -0.0218 0.2355  0.1785  329 TRP A O   
2334 C CB  . TRP A 330 ? 1.1705 1.2712 0.8622 0.0137  0.1604  0.2097  329 TRP A CB  
2335 C CG  . TRP A 330 ? 1.1550 1.2245 0.8193 0.0243  0.1371  0.2101  329 TRP A CG  
2336 C CD1 . TRP A 330 ? 1.1091 1.1678 0.7954 0.0411  0.1067  0.2230  329 TRP A CD1 
2337 C CD2 . TRP A 330 ? 1.1911 1.2378 0.7985 0.0139  0.1438  0.1953  329 TRP A CD2 
2338 N NE1 . TRP A 330 ? 1.1040 1.1385 0.7572 0.0408  0.0952  0.2167  329 TRP A NE1 
2339 C CE2 . TRP A 330 ? 1.1675 1.1936 0.7728 0.0254  0.1151  0.1998  329 TRP A CE2 
2340 C CE3 . TRP A 330 ? 1.2574 1.2989 0.8112 -0.0078 0.1724  0.1771  329 TRP A CE3 
2341 C CZ2 . TRP A 330 ? 1.1855 1.1884 0.7436 0.0171  0.1108  0.1867  329 TRP A CZ2 
2342 C CZ3 . TRP A 330 ? 1.2859 1.2998 0.7851 -0.0150 0.1671  0.1645  329 TRP A CZ3 
2343 C CH2 . TRP A 330 ? 1.2490 1.2449 0.7538 -0.0019 0.1349  0.1693  329 TRP A CH2 
2344 N N   . ASP A 331 ? 1.1598 1.3805 1.0366 0.0250  0.2134  0.1693  330 ASP A N   
2345 C CA  . ASP A 331 ? 1.1618 1.4298 1.0751 0.0040  0.2402  0.1623  330 ASP A CA  
2346 C C   . ASP A 331 ? 1.1427 1.3859 0.9937 -0.0283 0.2329  0.1947  330 ASP A C   
2347 O O   . ASP A 331 ? 1.1632 1.4162 0.9832 -0.0637 0.2644  0.1920  330 ASP A O   
2348 C CB  . ASP A 331 ? 1.2174 1.5204 1.1383 -0.0115 0.2924  0.1239  330 ASP A CB  
2349 C CG  . ASP A 331 ? 1.2771 1.6454 1.3147 0.0131  0.3080  0.0883  330 ASP A CG  
2350 O OD1 . ASP A 331 ? 1.2850 1.6996 1.3869 0.0082  0.3070  0.0905  330 ASP A OD1 
2351 O OD2 . ASP A 331 ? 1.3066 1.6792 1.3754 0.0385  0.3184  0.0566  330 ASP A OD2 
2352 N N   . ALA A 332 ? 1.1451 1.3526 0.9758 -0.0176 0.1921  0.2243  331 ALA A N   
2353 C CA  . ALA A 332 ? 1.1267 1.3019 0.9042 -0.0405 0.1778  0.2541  331 ALA A CA  
2354 C C   . ALA A 332 ? 1.0902 1.2824 0.9225 -0.0337 0.1562  0.2657  331 ALA A C   
2355 O O   . ALA A 332 ? 1.0589 1.2571 0.9338 -0.0055 0.1309  0.2659  331 ALA A O   
2356 C CB  . ALA A 332 ? 1.1044 1.2245 0.8128 -0.0339 0.1483  0.2739  331 ALA A CB  
2357 N N   . THR A 333 ? 1.0772 1.2722 0.9011 -0.0632 0.1656  0.2757  332 THR A N   
2358 C CA  . THR A 333 ? 1.0579 1.2666 0.9272 -0.0628 0.1457  0.2849  332 THR A CA  
2359 C C   . THR A 333 ? 1.0280 1.1836 0.8552 -0.0527 0.1080  0.3097  332 THR A C   
2360 O O   . THR A 333 ? 1.0179 1.1274 0.7799 -0.0529 0.0994  0.3221  332 THR A O   
2361 C CB  . THR A 333 ? 1.1308 1.3575 1.0033 -0.1033 0.1709  0.2850  332 THR A CB  
2362 O OG1 . THR A 333 ? 1.1449 1.3097 0.9249 -0.1316 0.1716  0.3079  332 THR A OG1 
2363 C CG2 . THR A 333 ? 1.1618 1.4497 1.0793 -0.1168 0.2157  0.2544  332 THR A CG2 
2364 N N   . PRO A 334 ? 1.0012 1.1644 0.8666 -0.0432 0.0841  0.3145  333 PRO A N   
2365 C CA  . PRO A 334 ? 0.9702 1.0861 0.7981 -0.0364 0.0539  0.3323  333 PRO A CA  
2366 C C   . PRO A 334 ? 1.0048 1.0731 0.7740 -0.0617 0.0541  0.3489  333 PRO A C   
2367 O O   . PRO A 334 ? 1.0143 1.0372 0.7461 -0.0518 0.0306  0.3608  333 PRO A O   
2368 C CB  . PRO A 334 ? 0.9559 1.0941 0.8345 -0.0299 0.0349  0.3297  333 PRO A CB  
2369 C CG  . PRO A 334 ? 0.9827 1.1751 0.9260 -0.0184 0.0435  0.3127  333 PRO A CG  
2370 C CD  . PRO A 334 ? 1.0057 1.2210 0.9509 -0.0349 0.0799  0.3012  333 PRO A CD  
2371 N N   . LEU A 335 ? 1.0449 1.1208 0.8058 -0.0949 0.0797  0.3491  334 LEU A N   
2372 C CA  . LEU A 335 ? 1.0916 1.1085 0.7825 -0.1234 0.0790  0.3688  334 LEU A CA  
2373 C C   . LEU A 335 ? 1.1061 1.0783 0.7255 -0.1180 0.0739  0.3793  334 LEU A C   
2374 O O   . LEU A 335 ? 1.1404 1.0447 0.7076 -0.1184 0.0536  0.3875  334 LEU A O   
2375 C CB  . LEU A 335 ? 1.1436 1.1815 0.8381 -0.1675 0.1131  0.3654  334 LEU A CB  
2376 C CG  . LEU A 335 ? 1.2065 1.1760 0.8278 -0.2062 0.1118  0.3887  334 LEU A CG  
2377 C CD1 . LEU A 335 ? 1.2057 1.1385 0.8354 -0.2006 0.0793  0.3989  334 LEU A CD1 
2378 C CD2 . LEU A 335 ? 1.2553 1.2553 0.8795 -0.2563 0.1549  0.3815  334 LEU A CD2 
2379 N N   . HIS A 336 ? 1.1524 1.1547 0.7780 -0.1059 0.0893  0.3650  335 HIS A N   
2380 C CA  . HIS A 336 ? 1.1602 1.1217 0.7222 -0.0993 0.0803  0.3681  335 HIS A CA  
2381 C C   . HIS A 336 ? 1.1475 1.0725 0.7116 -0.0644 0.0399  0.3639  335 HIS A C   
2382 O O   . HIS A 336 ? 1.1854 1.0539 0.7045 -0.0587 0.0198  0.3662  335 HIS A O   
2383 C CB  . HIS A 336 ? 1.1637 1.1674 0.7376 -0.0932 0.1049  0.3501  335 HIS A CB  
2384 C CG  . HIS A 336 ? 1.2259 1.2577 0.7942 -0.1257 0.1497  0.3361  335 HIS A CG  
2385 N ND1 . HIS A 336 ? 1.2376 1.3272 0.8792 -0.1336 0.1753  0.3186  335 HIS A ND1 
2386 C CD2 . HIS A 336 ? 1.2810 1.2949 0.7803 -0.1538 0.1747  0.3340  335 HIS A CD2 
2387 C CE1 . HIS A 336 ? 1.2788 1.3906 0.9045 -0.1649 0.2182  0.3035  335 HIS A CE1 
2388 N NE2 . HIS A 336 ? 1.3083 1.3720 0.8419 -0.1795 0.2204  0.3129  335 HIS A NE2 
2389 N N   . LEU A 337 ? 1.1096 1.0713 0.7292 -0.0397 0.0300  0.3572  336 LEU A N   
2390 C CA  . LEU A 337 ? 1.0851 1.0244 0.7124 -0.0127 -0.0005 0.3472  336 LEU A CA  
2391 C C   . LEU A 337 ? 1.1255 1.0225 0.7423 -0.0112 -0.0207 0.3525  336 LEU A C   
2392 O O   . LEU A 337 ? 1.1401 1.0031 0.7391 0.0057  -0.0437 0.3489  336 LEU A O   
2393 C CB  . LEU A 337 ? 1.0230 1.0062 0.7049 0.0064  -0.0018 0.3383  336 LEU A CB  
2394 C CG  . LEU A 337 ? 1.0227 1.0396 0.7152 0.0131  0.0138  0.3339  336 LEU A CG  
2395 C CD1 . LEU A 337 ? 0.9885 1.0375 0.7291 0.0297  0.0111  0.3310  336 LEU A CD1 
2396 C CD2 . LEU A 337 ? 1.0420 1.0364 0.7027 0.0195  0.0027  0.3243  336 LEU A CD2 
2397 N N   . ALA A 338 ? 1.1063 1.0084 0.7368 -0.0282 -0.0131 0.3627  337 ALA A N   
2398 C CA  . ALA A 338 ? 1.1386 0.9967 0.7571 -0.0281 -0.0315 0.3690  337 ALA A CA  
2399 C C   . ALA A 338 ? 1.2220 1.0198 0.7839 -0.0336 -0.0390 0.3785  337 ALA A C   
2400 O O   . ALA A 338 ? 1.2461 1.0057 0.7987 -0.0149 -0.0635 0.3805  337 ALA A O   
2401 C CB  . ALA A 338 ? 1.1428 1.0185 0.7847 -0.0526 -0.0220 0.3796  337 ALA A CB  
2402 N N   . ALA A 339 ? 1.1872 0.9806 0.7140 -0.0583 -0.0181 0.3857  338 ALA A N   
2403 C CA  . ALA A 339 ? 1.2588 1.0004 0.7313 -0.0643 -0.0261 0.3973  338 ALA A CA  
2404 C C   . ALA A 339 ? 1.2684 1.0039 0.7275 -0.0351 -0.0465 0.3924  338 ALA A C   
2405 O O   . ALA A 339 ? 1.3202 1.0162 0.7494 -0.0302 -0.0687 0.4035  338 ALA A O   
2406 C CB  . ALA A 339 ? 1.3109 1.0541 0.7469 -0.1048 0.0057  0.4047  338 ALA A CB  
2407 N N   . LEU A 340 ? 1.2395 1.0131 0.7213 -0.0193 -0.0427 0.3768  339 LEU A N   
2408 C CA  . LEU A 340 ? 1.2345 1.0076 0.7073 0.0047  -0.0630 0.3711  339 LEU A CA  
2409 C C   . LEU A 340 ? 1.2304 1.0000 0.7362 0.0361  -0.0940 0.3663  339 LEU A C   
2410 O O   . LEU A 340 ? 1.2577 1.0127 0.7559 0.0520  -0.1208 0.3729  339 LEU A O   
2411 C CB  . LEU A 340 ? 1.1912 1.0014 0.6738 0.0033  -0.0485 0.3558  339 LEU A CB  
2412 C CG  . LEU A 340 ? 1.1999 1.0142 0.6762 0.0232  -0.0700 0.3483  339 LEU A CG  
2413 C CD1 . LEU A 340 ? 1.2620 1.0565 0.6861 0.0157  -0.0755 0.3610  339 LEU A CD1 
2414 C CD2 . LEU A 340 ? 1.1603 1.0154 0.6622 0.0195  -0.0579 0.3336  339 LEU A CD2 
2415 N N   . ILE A 341 ? 1.1719 0.9605 0.7190 0.0419  -0.0929 0.3553  340 ILE A N   
2416 C CA  . ILE A 341 ? 1.1538 0.9434 0.7328 0.0684  -0.1183 0.3494  340 ILE A CA  
2417 C C   . ILE A 341 ? 1.2056 0.9558 0.7789 0.0741  -0.1360 0.3647  340 ILE A C   
2418 O O   . ILE A 341 ? 1.2113 0.9566 0.8094 0.0985  -0.1633 0.3628  340 ILE A O   
2419 C CB  . ILE A 341 ? 1.0861 0.9152 0.7120 0.0663  -0.1093 0.3373  340 ILE A CB  
2420 C CG1 . ILE A 341 ? 1.0631 0.9096 0.7255 0.0917  -0.1308 0.3298  340 ILE A CG1 
2421 C CG2 . ILE A 341 ? 1.0897 0.9101 0.7191 0.0496  -0.0965 0.3452  340 ILE A CG2 
2422 C CD1 . ILE A 341 ? 1.0519 0.9234 0.7252 0.1056  -0.1442 0.3228  340 ILE A CD1 
2423 N N   . GLY A 342 ? 1.2280 0.9465 0.7713 0.0482  -0.1244 0.3789  341 GLY A N   
2424 C CA  . GLY A 342 ? 1.2905 0.9540 0.8187 0.0455  -0.1452 0.3922  341 GLY A CA  
2425 C C   . GLY A 342 ? 1.3029 0.9521 0.8559 0.0469  -0.1503 0.3888  341 GLY A C   
2426 O O   . GLY A 342 ? 1.3409 0.9502 0.9009 0.0648  -0.1788 0.3888  341 GLY A O   
2427 N N   . HIS A 343 ? 1.2565 0.9340 0.8228 0.0284  -0.1265 0.3848  342 HIS A N   
2428 C CA  . HIS A 343 ? 1.2547 0.9217 0.8409 0.0245  -0.1320 0.3824  342 HIS A CA  
2429 C C   . HIS A 343 ? 1.3183 0.9476 0.8764 -0.0134 -0.1223 0.3964  342 HIS A C   
2430 O O   . HIS A 343 ? 1.2973 0.9594 0.8572 -0.0417 -0.0969 0.3998  342 HIS A O   
2431 C CB  . HIS A 343 ? 1.1862 0.9160 0.8106 0.0266  -0.1180 0.3704  342 HIS A CB  
2432 C CG  . HIS A 343 ? 1.2195 0.9445 0.8661 0.0337  -0.1313 0.3642  342 HIS A CG  
2433 N ND1 . HIS A 343 ? 1.2693 0.9640 0.9105 0.0131  -0.1312 0.3639  342 HIS A ND1 
2434 C CD2 . HIS A 343 ? 1.2123 0.9670 0.8927 0.0595  -0.1343 0.3402  342 HIS A CD2 
2435 C CE1 . HIS A 343 ? 1.2799 0.9828 0.9467 0.0275  -0.1353 0.3402  342 HIS A CE1 
2436 N NE2 . HIS A 343 ? 1.2489 0.9889 0.9388 0.0549  -0.1352 0.3253  342 HIS A NE2 
2437 N N   . LEU A 344 ? 1.3245 0.8836 0.8590 -0.0151 -0.1438 0.4038  343 LEU A N   
2438 C CA  . LEU A 344 ? 1.3881 0.9024 0.8899 -0.0559 -0.1358 0.4176  343 LEU A CA  
2439 C C   . LEU A 344 ? 1.3699 0.9080 0.8939 -0.0817 -0.1234 0.4152  343 LEU A C   
2440 O O   . LEU A 344 ? 1.3794 0.9305 0.8954 -0.1225 -0.1013 0.4238  343 LEU A O   
2441 C CB  . LEU A 344 ? 1.4816 0.9067 0.9535 -0.0498 -0.1660 0.4242  343 LEU A CB  
2442 C CG  . LEU A 344 ? 1.5627 0.9288 0.9969 -0.0945 -0.1610 0.4377  343 LEU A CG  
2443 C CD1 . LEU A 344 ? 1.5965 0.9726 0.9946 -0.1305 -0.1354 0.4518  343 LEU A CD1 
2444 C CD2 . LEU A 344 ? 1.6626 0.9333 1.0713 -0.0819 -0.1960 0.4409  343 LEU A CD2 
2445 N N   . GLU A 345 ? 1.3473 0.8940 0.8996 -0.0611 -0.1382 0.4036  344 GLU A N   
2446 C CA  . GLU A 345 ? 1.3441 0.9219 0.9262 -0.0822 -0.1276 0.3916  344 GLU A CA  
2447 C C   . GLU A 345 ? 1.2896 0.9575 0.9086 -0.0951 -0.1009 0.3883  344 GLU A C   
2448 O O   . GLU A 345 ? 1.2988 0.9926 0.9350 -0.1282 -0.0870 0.3877  344 GLU A O   
2449 C CB  . GLU A 345 ? 1.3540 0.9349 0.9649 -0.0520 -0.1410 0.3638  344 GLU A CB  
2450 C CG  . GLU A 345 ? 1.4848 0.9789 1.0731 -0.0491 -0.1634 0.3575  344 GLU A CG  
2451 C CD  . GLU A 345 ? 1.6187 1.0428 1.1766 -0.0228 -0.1885 0.3699  344 GLU A CD  
2452 O OE1 . GLU A 345 ? 1.5567 1.0109 1.1186 -0.0003 -0.1901 0.3763  344 GLU A OE1 
2453 O OE2 . GLU A 345 ? 1.6793 1.0150 1.2092 -0.0244 -0.2101 0.3729  344 GLU A OE2 
2454 N N   . ILE A 346 ? 1.2682 0.9846 0.9043 -0.0690 -0.0953 0.3843  345 ILE A N   
2455 C CA  . ILE A 346 ? 1.2084 1.0026 0.8817 -0.0755 -0.0736 0.3795  345 ILE A CA  
2456 C C   . ILE A 346 ? 1.2396 1.0426 0.8989 -0.1085 -0.0512 0.3937  345 ILE A C   
2457 O O   . ILE A 346 ? 1.2284 1.0872 0.9266 -0.1277 -0.0327 0.3870  345 ILE A O   
2458 C CB  . ILE A 346 ? 1.1565 0.9883 0.8450 -0.0419 -0.0738 0.3718  345 ILE A CB  
2459 C CG1 . ILE A 346 ? 1.1465 0.9847 0.8540 -0.0185 -0.0871 0.3532  345 ILE A CG1 
2460 C CG2 . ILE A 346 ? 1.1089 1.0064 0.8293 -0.0466 -0.0534 0.3691  345 ILE A CG2 
2461 C CD1 . ILE A 346 ? 1.1192 0.9946 0.8412 0.0075  -0.0849 0.3445  345 ILE A CD1 
2462 N N   . VAL A 347 ? 1.1830 0.9328 0.7883 -0.1158 -0.0523 0.4099  346 VAL A N   
2463 C CA  . VAL A 347 ? 1.2242 0.9768 0.8058 -0.1523 -0.0256 0.4185  346 VAL A CA  
2464 C C   . VAL A 347 ? 1.2656 1.0083 0.8495 -0.1987 -0.0165 0.4259  346 VAL A C   
2465 O O   . VAL A 347 ? 1.2603 1.0550 0.8698 -0.2302 0.0137  0.4207  346 VAL A O   
2466 C CB  . VAL A 347 ? 1.2895 0.9836 0.8148 -0.1441 -0.0299 0.4218  346 VAL A CB  
2467 C CG1 . VAL A 347 ? 1.3547 1.0389 0.8440 -0.1890 -0.0019 0.4309  346 VAL A CG1 
2468 C CG2 . VAL A 347 ? 1.2471 0.9668 0.7764 -0.1076 -0.0326 0.4116  346 VAL A CG2 
2469 N N   . GLU A 348 ? 1.2466 0.9273 0.8137 -0.2010 -0.0402 0.4290  347 GLU A N   
2470 C CA  . GLU A 348 ? 1.2963 0.9674 0.8722 -0.2439 -0.0329 0.4277  347 GLU A CA  
2471 C C   . GLU A 348 ? 1.2737 1.0354 0.9300 -0.2450 -0.0239 0.4042  347 GLU A C   
2472 O O   . GLU A 348 ? 1.2967 1.0919 0.9807 -0.2856 -0.0061 0.3997  347 GLU A O   
2473 C CB  . GLU A 348 ? 1.3647 0.9421 0.9041 -0.2421 -0.0634 0.4327  347 GLU A CB  
2474 C CG  . GLU A 348 ? 1.4682 0.9576 0.9416 -0.2514 -0.0697 0.4470  347 GLU A CG  
2475 C CD  . GLU A 348 ? 1.6193 1.0151 1.0659 -0.2431 -0.1021 0.4475  347 GLU A CD  
2476 O OE1 . GLU A 348 ? 1.5764 0.9512 1.0304 -0.1962 -0.1284 0.4391  347 GLU A OE1 
2477 O OE2 . GLU A 348 ? 1.6724 1.0159 1.0927 -0.2844 -0.1005 0.4540  347 GLU A OE2 
2478 N N   . VAL A 349 ? 1.1806 0.9825 0.8742 -0.2032 -0.0373 0.3893  348 VAL A N   
2479 C CA  . VAL A 349 ? 1.1556 1.0332 0.9167 -0.2022 -0.0374 0.3704  348 VAL A CA  
2480 C C   . VAL A 349 ? 1.1389 1.0984 0.9478 -0.2070 -0.0117 0.3651  348 VAL A C   
2481 O O   . VAL A 349 ? 1.1498 1.1695 1.0158 -0.2278 -0.0040 0.3533  348 VAL A O   
2482 C CB  . VAL A 349 ? 1.1316 1.0144 0.9030 -0.1613 -0.0602 0.3582  348 VAL A CB  
2483 C CG1 . VAL A 349 ? 1.1046 1.0624 0.9357 -0.1574 -0.0643 0.3438  348 VAL A CG1 
2484 C CG2 . VAL A 349 ? 1.1799 0.9935 0.9187 -0.1606 -0.0818 0.3536  348 VAL A CG2 
2485 N N   . LEU A 350 ? 1.0955 1.0604 0.8865 -0.1871 0.0007  0.3707  349 LEU A N   
2486 C CA  . LEU A 350 ? 1.0723 1.1099 0.9078 -0.1885 0.0271  0.3611  349 LEU A CA  
2487 C C   . LEU A 350 ? 1.1325 1.1893 0.9738 -0.2372 0.0590  0.3608  349 LEU A C   
2488 O O   . LEU A 350 ? 1.1283 1.2636 1.0402 -0.2484 0.0770  0.3429  349 LEU A O   
2489 C CB  . LEU A 350 ? 1.0348 1.0631 0.8387 -0.1613 0.0338  0.3658  349 LEU A CB  
2490 C CG  . LEU A 350 ? 0.9990 1.0322 0.8135 -0.1166 0.0114  0.3608  349 LEU A CG  
2491 C CD1 . LEU A 350 ? 0.9691 0.9885 0.7484 -0.0974 0.0182  0.3653  349 LEU A CD1 
2492 C CD2 . LEU A 350 ? 0.9906 1.0911 0.8761 -0.1029 0.0077  0.3449  349 LEU A CD2 
2493 N N   . LEU A 351 ? 1.1587 1.1440 0.9270 -0.2678 0.0656  0.3796  350 LEU A N   
2494 C CA  . LEU A 351 ? 1.2022 1.1979 0.9621 -0.3230 0.1003  0.3810  350 LEU A CA  
2495 C C   . LEU A 351 ? 1.2448 1.2732 1.0595 -0.3564 0.0997  0.3696  350 LEU A C   
2496 O O   . LEU A 351 ? 1.2515 1.3424 1.1108 -0.3949 0.1327  0.3562  350 LEU A O   
2497 C CB  . LEU A 351 ? 1.2578 1.1521 0.9110 -0.3499 0.1012  0.4091  350 LEU A CB  
2498 C CG  . LEU A 351 ? 1.2651 1.1375 0.8590 -0.3363 0.1116  0.4194  350 LEU A CG  
2499 C CD1 . LEU A 351 ? 1.3460 1.1110 0.8527 -0.3352 0.0934  0.4333  350 LEU A CD1 
2500 C CD2 . LEU A 351 ? 1.2700 1.2137 0.8860 -0.3658 0.1615  0.4035  350 LEU A CD2 
2501 N N   . LYS A 352 ? 1.1760 1.1671 0.9908 -0.3443 0.0640  0.3713  351 LYS A N   
2502 C CA  . LYS A 352 ? 1.2035 1.2242 1.0685 -0.3764 0.0582  0.3588  351 LYS A CA  
2503 C C   . LYS A 352 ? 1.1802 1.3115 1.1497 -0.3585 0.0553  0.3333  351 LYS A C   
2504 O O   . LYS A 352 ? 1.1905 1.3750 1.2203 -0.3913 0.0586  0.3186  351 LYS A O   
2505 C CB  . LYS A 352 ? 1.2490 1.1904 1.0755 -0.3691 0.0207  0.3649  351 LYS A CB  
2506 C CG  . LYS A 352 ? 1.3799 1.2100 1.1178 -0.4001 0.0198  0.3874  351 LYS A CG  
2507 C CD  . LYS A 352 ? 1.4645 1.2157 1.1718 -0.3870 -0.0170 0.3871  351 LYS A CD  
2508 C CE  . LYS A 352 ? 1.5903 1.2210 1.2113 -0.4159 -0.0224 0.4100  351 LYS A CE  
2509 N NZ  . LYS A 352 ? 1.6731 1.2217 1.2678 -0.4004 -0.0574 0.4049  351 LYS A NZ  
2510 N N   . ASN A 353 ? 1.0277 1.1922 1.0204 -0.3083 0.0463  0.3279  352 ASN A N   
2511 C CA  . ASN A 353 ? 0.9975 1.2565 1.0846 -0.2863 0.0383  0.3066  352 ASN A CA  
2512 C C   . ASN A 353 ? 0.9892 1.3271 1.1339 -0.2921 0.0765  0.2909  352 ASN A C   
2513 O O   . ASN A 353 ? 0.9614 1.3817 1.1961 -0.2729 0.0701  0.2704  352 ASN A O   
2514 C CB  . ASN A 353 ? 0.9711 1.2176 1.0502 -0.2319 0.0071  0.3090  352 ASN A CB  
2515 C CG  . ASN A 353 ? 1.0678 1.2729 1.1241 -0.2266 -0.0311 0.3114  352 ASN A CG  
2516 O OD1 . ASN A 353 ? 1.0553 1.3034 1.1620 -0.2219 -0.0564 0.3000  352 ASN A OD1 
2517 N ND2 . ASN A 353 ? 1.0378 1.1580 1.0175 -0.2268 -0.0371 0.3245  352 ASN A ND2 
2518 N N   . GLY A 354 ? 0.8650 1.2133 1.3900 -0.0218 -0.1407 0.3373  353 GLY A N   
2519 C CA  . GLY A 354 ? 0.8594 1.2751 1.4455 -0.0381 -0.1067 0.3303  353 GLY A CA  
2520 C C   . GLY A 354 ? 0.8558 1.3051 1.3946 -0.0278 -0.0760 0.3320  353 GLY A C   
2521 O O   . GLY A 354 ? 0.8186 1.3134 1.3949 -0.0252 -0.0648 0.3134  353 GLY A O   
2522 N N   . ALA A 355 ? 0.8682 1.2944 1.3269 -0.0209 -0.0647 0.3531  354 ALA A N   
2523 C CA  . ALA A 355 ? 0.8495 1.3027 1.2614 -0.0119 -0.0391 0.3566  354 ALA A CA  
2524 C C   . ALA A 355 ? 0.9233 1.4165 1.3528 -0.0343 0.0057  0.3681  354 ALA A C   
2525 O O   . ALA A 355 ? 0.9787 1.4647 1.4253 -0.0573 0.0214  0.3850  354 ALA A O   
2526 C CB  . ALA A 355 ? 0.8309 1.2466 1.1584 0.0036  -0.0452 0.3740  354 ALA A CB  
2527 N N   . ASP A 356 ? 0.9269 1.4578 1.3473 -0.0276 0.0265  0.3589  355 ASP A N   
2528 C CA  . ASP A 356 ? 0.9626 1.5278 1.3866 -0.0448 0.0717  0.3679  355 ASP A CA  
2529 C C   . ASP A 356 ? 1.0111 1.5462 1.3502 -0.0462 0.0865  0.3959  355 ASP A C   
2530 O O   . ASP A 356 ? 0.9902 1.5149 1.2704 -0.0270 0.0771  0.3974  355 ASP A O   
2531 C CB  . ASP A 356 ? 0.9368 1.5470 1.3771 -0.0335 0.0843  0.3456  355 ASP A CB  
2532 C CG  . ASP A 356 ? 0.9979 1.6506 1.4720 -0.0522 0.1315  0.3460  355 ASP A CG  
2533 O OD1 . ASP A 356 ? 0.9889 1.6707 1.5478 -0.0674 0.1405  0.3349  355 ASP A OD1 
2534 O OD2 . ASP A 356 ? 1.0443 1.6999 1.4603 -0.0514 0.1598  0.3568  355 ASP A OD2 
2535 N N   . VAL A 357 ? 1.0013 1.5198 1.3351 -0.0695 0.1075  0.4181  356 VAL A N   
2536 C CA  . VAL A 357 ? 1.0035 1.4836 1.2547 -0.0706 0.1154  0.4449  356 VAL A CA  
2537 C C   . VAL A 357 ? 1.0174 1.5143 1.2229 -0.0723 0.1506  0.4507  356 VAL A C   
2538 O O   . VAL A 357 ? 1.0039 1.4702 1.1334 -0.0642 0.1486  0.4669  356 VAL A O   
2539 C CB  . VAL A 357 ? 1.0568 1.5012 1.3105 -0.0948 0.1198  0.4673  356 VAL A CB  
2540 C CG1 . VAL A 357 ? 1.0841 1.5547 1.3763 -0.1257 0.1642  0.4733  356 VAL A CG1 
2541 C CG2 . VAL A 357 ? 1.0545 1.4463 1.2214 -0.0892 0.1114  0.4922  356 VAL A CG2 
2542 N N   . ASN A 358 ? 1.0209 1.5633 1.2698 -0.0806 0.1809  0.4364  357 ASN A N   
2543 C CA  . ASN A 358 ? 1.0335 1.5885 1.2354 -0.0806 0.2157  0.4395  357 ASN A CA  
2544 C C   . ASN A 358 ? 1.0281 1.6152 1.2316 -0.0563 0.2064  0.4148  357 ASN A C   
2545 O O   . ASN A 358 ? 1.0470 1.6547 1.2320 -0.0551 0.2359  0.4091  357 ASN A O   
2546 C CB  . ASN A 358 ? 1.0722 1.6520 1.3118 -0.1078 0.2648  0.4430  357 ASN A CB  
2547 C CG  . ASN A 358 ? 1.1952 1.7405 1.4345 -0.1358 0.2748  0.4686  357 ASN A CG  
2548 O OD1 . ASN A 358 ? 1.1941 1.6901 1.3530 -0.1413 0.2789  0.4942  357 ASN A OD1 
2549 N ND2 . ASN A 358 ? 1.1636 1.7316 1.4935 -0.1539 0.2756  0.4616  357 ASN A ND2 
2550 N N   . ALA A 359 ? 1.0232 1.6100 1.2431 -0.0370 0.1663  0.4003  358 ALA A N   
2551 C CA  . ALA A 359 ? 1.0064 1.6175 1.2259 -0.0155 0.1537  0.3776  358 ALA A CA  
2552 C C   . ALA A 359 ? 1.0162 1.6073 1.1516 -0.0024 0.1523  0.3884  358 ALA A C   
2553 O O   . ALA A 359 ? 0.9835 1.5383 1.0688 0.0007  0.1372  0.4075  358 ALA A O   
2554 C CB  . ALA A 359 ? 0.9738 1.5806 1.2256 -0.0006 0.1117  0.3614  358 ALA A CB  
2555 N N   . SER A 360 ? 1.0618 1.6758 1.1841 0.0064  0.1657  0.3746  359 SER A N   
2556 C CA  . SER A 360 ? 1.0606 1.6562 1.1072 0.0195  0.1607  0.3815  359 SER A CA  
2557 C C   . SER A 360 ? 1.0579 1.6695 1.1115 0.0399  0.1339  0.3595  359 SER A C   
2558 O O   . SER A 360 ? 1.0556 1.6964 1.1660 0.0438  0.1296  0.3361  359 SER A O   
2559 C CB  . SER A 360 ? 1.1324 1.7280 1.1373 0.0125  0.2002  0.3872  359 SER A CB  
2560 O OG  . SER A 360 ? 1.2059 1.8437 1.2593 0.0130  0.2234  0.3638  359 SER A OG  
2561 N N   . ASP A 361 ? 1.1297 1.7199 1.1267 0.0523  0.1137  0.3670  360 ASP A N   
2562 C CA  . ASP A 361 ? 1.0947 1.6936 1.0903 0.0690  0.0872  0.3498  360 ASP A CA  
2563 C C   . ASP A 361 ? 1.1732 1.7814 1.1366 0.0764  0.1006  0.3392  360 ASP A C   
2564 O O   . ASP A 361 ? 1.2418 1.8562 1.1961 0.0690  0.1342  0.3406  360 ASP A O   
2565 C CB  . ASP A 361 ? 1.0030 1.5769 0.9656 0.0770  0.0576  0.3631  360 ASP A CB  
2566 C CG  . ASP A 361 ? 1.0433 1.5771 0.9576 0.0757  0.0573  0.3651  360 ASP A CG  
2567 O OD1 . ASP A 361 ? 1.1177 1.6407 1.0066 0.0672  0.0816  0.3739  360 ASP A OD1 
2568 O OD2 . ASP A 361 ? 0.9947 1.5015 0.9001 0.0813  0.0339  0.3533  360 ASP A OD2 
2569 N N   . ILE A 362 ? 1.0226 1.6287 0.9657 0.0907  0.0752  0.3286  361 ILE A N   
2570 C CA  . ILE A 362 ? 1.0917 1.7001 0.9981 0.1002  0.0825  0.3175  361 ILE A CA  
2571 C C   . ILE A 362 ? 1.1424 1.7190 0.9786 0.0978  0.0944  0.3367  361 ILE A C   
2572 O O   . ILE A 362 ? 1.2260 1.7995 1.0273 0.1005  0.1176  0.3321  361 ILE A O   
2573 C CB  . ILE A 362 ? 1.0459 1.6531 0.9464 0.1143  0.0474  0.3027  361 ILE A CB  
2574 C CG1 . ILE A 362 ? 1.1362 1.7394 0.9930 0.1258  0.0503  0.2908  361 ILE A CG1 
2575 C CG2 . ILE A 362 ? 0.9347 1.5109 0.8226 0.1125  0.0192  0.3115  361 ILE A CG2 
2576 C CD1 . ILE A 362 ? 1.2324 1.8623 1.1162 0.1288  0.0803  0.2697  361 ILE A CD1 
2577 N N   . THR A 363 ? 1.1879 1.7219 1.0160 0.0918  0.0748  0.3425  362 THR A N   
2578 C CA  . THR A 363 ? 1.2156 1.6977 0.9903 0.0876  0.0771  0.3461  362 THR A CA  
2579 C C   . THR A 363 ? 1.2892 1.7614 1.0501 0.0737  0.1113  0.3607  362 THR A C   
2580 O O   . THR A 363 ? 1.3427 1.7738 1.0468 0.0702  0.1236  0.3633  362 THR A O   
2581 C CB  . THR A 363 ? 1.1506 1.5949 0.9250 0.0869  0.0461  0.3446  362 THR A CB  
2582 O OG1 . THR A 363 ? 1.0902 1.5405 0.9000 0.0797  0.0466  0.3544  362 THR A OG1 
2583 C CG2 . THR A 363 ? 1.0776 1.5273 0.8719 0.0950  0.0182  0.3280  362 THR A CG2 
2584 N N   . GLY A 364 ? 1.2176 1.7207 1.0272 0.0639  0.1265  0.3700  363 GLY A N   
2585 C CA  . GLY A 364 ? 1.2567 1.7508 1.0643 0.0464  0.1603  0.3824  363 GLY A CA  
2586 C C   . GLY A 364 ? 1.2181 1.6779 1.0255 0.0360  0.1487  0.3967  363 GLY A C   
2587 O O   . GLY A 364 ? 1.2496 1.6870 1.0412 0.0197  0.1733  0.4080  363 GLY A O   
2588 N N   . THR A 365 ? 1.1858 1.6386 1.0094 0.0445  0.1137  0.3952  364 THR A N   
2589 C CA  . THR A 365 ? 1.1420 1.5627 0.9652 0.0385  0.1011  0.4059  364 THR A CA  
2590 C C   . THR A 365 ? 1.1437 1.5954 1.0224 0.0299  0.1085  0.4165  364 THR A C   
2591 O O   . THR A 365 ? 1.1126 1.6041 1.0351 0.0367  0.1003  0.4117  364 THR A O   
2592 C CB  . THR A 365 ? 1.0986 1.4985 0.9190 0.0516  0.0651  0.3956  364 THR A CB  
2593 O OG1 . THR A 365 ? 1.0515 1.4883 0.9117 0.0618  0.0513  0.3828  364 THR A OG1 
2594 C CG2 . THR A 365 ? 1.1058 1.4643 0.8702 0.0562  0.0553  0.3896  364 THR A CG2 
2595 N N   . THR A 366 ? 1.1101 1.5384 0.9832 0.0142  0.1222  0.4319  365 THR A N   
2596 C CA  . THR A 366 ? 1.1052 1.5511 1.0277 0.0031  0.1261  0.4452  365 THR A CA  
2597 C C   . THR A 366 ? 1.0699 1.4851 0.9896 0.0120  0.0932  0.4480  365 THR A C   
2598 O O   . THR A 366 ? 1.0436 1.4228 0.9250 0.0224  0.0744  0.4399  365 THR A O   
2599 C CB  . THR A 366 ? 1.2003 1.6334 1.1202 -0.0215 0.1596  0.4594  365 THR A CB  
2600 O OG1 . THR A 366 ? 1.2163 1.5860 1.0719 -0.0250 0.1533  0.4664  365 THR A OG1 
2601 C CG2 . THR A 366 ? 1.2473 1.7096 1.1720 -0.0292 0.1972  0.4505  365 THR A CG2 
2602 N N   . PRO A 367 ? 1.0077 1.4355 0.9700 0.0087  0.0857  0.4578  366 PRO A N   
2603 C CA  . PRO A 367 ? 0.9718 1.3645 0.9273 0.0186  0.0570  0.4575  366 PRO A CA  
2604 C C   . PRO A 367 ? 1.0220 1.3618 0.9319 0.0123  0.0556  0.4651  366 PRO A C   
2605 O O   . PRO A 367 ? 0.9948 1.3037 0.8856 0.0255  0.0328  0.4565  366 PRO A O   
2606 C CB  . PRO A 367 ? 0.9876 1.3944 0.9922 0.0123  0.0526  0.4686  366 PRO A CB  
2607 C CG  . PRO A 367 ? 1.0143 1.4640 1.0668 0.0096  0.0638  0.4465  366 PRO A CG  
2608 C CD  . PRO A 367 ? 1.0326 1.4981 1.0607 0.0002  0.0949  0.4504  366 PRO A CD  
2609 N N   . LEU A 368 ? 1.1269 1.4534 1.0179 -0.0080 0.0810  0.4797  367 LEU A N   
2610 C CA  . LEU A 368 ? 1.1700 1.4373 1.0053 -0.0142 0.0783  0.4875  367 LEU A CA  
2611 C C   . LEU A 368 ? 1.1763 1.4174 0.9582 -0.0017 0.0697  0.4741  367 LEU A C   
2612 O O   . LEU A 368 ? 1.2066 1.3981 0.9461 0.0039  0.0516  0.4748  367 LEU A O   
2613 C CB  . LEU A 368 ? 1.2414 1.4961 1.0677 -0.0423 0.1110  0.5058  367 LEU A CB  
2614 C CG  . LEU A 368 ? 1.3194 1.5053 1.0892 -0.0528 0.1069  0.5193  367 LEU A CG  
2615 C CD1 . LEU A 368 ? 1.3225 1.4888 1.1121 -0.0487 0.0794  0.5276  367 LEU A CD1 
2616 C CD2 . LEU A 368 ? 1.3966 1.5686 1.1514 -0.0831 0.1462  0.5338  367 LEU A CD2 
2617 N N   . HIS A 369 ? 1.2041 1.4749 0.9870 0.0032  0.0800  0.4623  368 HIS A N   
2618 C CA  . HIS A 369 ? 1.2186 1.4647 0.9562 0.0154  0.0669  0.4499  368 HIS A CA  
2619 C C   . HIS A 369 ? 1.1903 1.4327 0.9427 0.0342  0.0335  0.4371  368 HIS A C   
2620 O O   . HIS A 369 ? 1.2204 1.4209 0.9342 0.0409  0.0155  0.4350  368 HIS A O   
2621 C CB  . HIS A 369 ? 1.2128 1.4939 0.9547 0.0184  0.0814  0.4391  368 HIS A CB  
2622 C CG  . HIS A 369 ? 1.2967 1.5615 0.9964 0.0037  0.1143  0.4460  368 HIS A CG  
2623 N ND1 . HIS A 369 ? 1.3215 1.6285 1.0413 0.0003  0.1412  0.4407  368 HIS A ND1 
2624 C CD2 . HIS A 369 ? 1.3805 1.5877 1.0148 -0.0083 0.1262  0.4564  368 HIS A CD2 
2625 C CE1 . HIS A 369 ? 1.3903 1.6689 1.0623 -0.0134 0.1717  0.4461  368 HIS A CE1 
2626 N NE2 . HIS A 369 ? 1.4251 1.6403 1.0412 -0.0199 0.1630  0.4566  368 HIS A NE2 
2627 N N   . LEU A 370 ? 1.1486 1.4325 0.9560 0.0423  0.0260  0.4283  369 LEU A N   
2628 C CA  . LEU A 370 ? 1.1098 1.3923 0.9343 0.0579  0.0017  0.4142  369 LEU A CA  
2629 C C   . LEU A 370 ? 1.1505 1.3969 0.9656 0.0608  -0.0120 0.4206  369 LEU A C   
2630 O O   . LEU A 370 ? 1.1542 1.3821 0.9610 0.0726  -0.0305 0.4124  369 LEU A O   
2631 C CB  . LEU A 370 ? 1.0439 1.3705 0.9195 0.0640  0.0006  0.4029  369 LEU A CB  
2632 C CG  . LEU A 370 ? 1.0407 1.4038 0.9277 0.0633  0.0109  0.3959  369 LEU A CG  
2633 C CD1 . LEU A 370 ? 0.9912 1.3891 0.9226 0.0672  0.0090  0.3891  369 LEU A CD1 
2634 C CD2 . LEU A 370 ? 1.0482 1.4040 0.9157 0.0706  0.0006  0.3824  369 LEU A CD2 
2635 N N   . ALA A 371 ? 1.1060 1.3419 0.9236 0.0501  -0.0040 0.4360  370 ALA A N   
2636 C CA  . ALA A 371 ? 1.1379 1.3352 0.9438 0.0539  -0.0193 0.4418  370 ALA A CA  
2637 C C   . ALA A 371 ? 1.2238 1.3673 0.9715 0.0533  -0.0281 0.4483  370 ALA A C   
2638 O O   . ALA A 371 ? 1.2476 1.3604 0.9824 0.0654  -0.0492 0.4451  370 ALA A O   
2639 C CB  . ALA A 371 ? 1.1499 1.3458 0.9735 0.0407  -0.0108 0.4585  370 ALA A CB  
2640 N N   . ALA A 372 ? 1.2088 1.3363 0.9168 0.0405  -0.0126 0.4569  371 ALA A N   
2641 C CA  . ALA A 372 ? 1.2857 1.3515 0.9266 0.0400  -0.0224 0.4635  371 ALA A CA  
2642 C C   . ALA A 372 ? 1.2829 1.3416 0.9099 0.0572  -0.0447 0.4489  371 ALA A C   
2643 O O   . ALA A 372 ? 1.3347 1.3435 0.9201 0.0654  -0.0665 0.4509  371 ALA A O   
2644 C CB  . ALA A 372 ? 1.3460 1.3890 0.9401 0.0197  0.0047  0.4770  371 ALA A CB  
2645 N N   . THR A 373 ? 1.3214 1.4268 0.9826 0.0628  -0.0415 0.4350  372 THR A N   
2646 C CA  . THR A 373 ? 1.3144 1.4156 0.9688 0.0767  -0.0628 0.4227  372 THR A CA  
2647 C C   . THR A 373 ? 1.3085 1.4158 0.9965 0.0926  -0.0852 0.4146  372 THR A C   
2648 O O   . THR A 373 ? 1.3390 1.4182 1.0066 0.1040  -0.1091 0.4121  372 THR A O   
2649 C CB  . THR A 373 ? 1.2936 1.4408 0.9759 0.0770  -0.0532 0.4108  372 THR A CB  
2650 O OG1 . THR A 373 ? 1.3214 1.4648 0.9727 0.0640  -0.0302 0.4178  372 THR A OG1 
2651 C CG2 . THR A 373 ? 1.2878 1.4261 0.9608 0.0887  -0.0762 0.4004  372 THR A CG2 
2652 N N   . MET A 374 ? 1.2297 1.3714 0.9674 0.0946  -0.0783 0.4106  373 MET A N   
2653 C CA  . MET A 374 ? 1.2188 1.3657 0.9855 0.1099  -0.0945 0.4029  373 MET A CA  
2654 C C   . MET A 374 ? 1.3021 1.3994 1.0378 0.1151  -0.1103 0.4121  373 MET A C   
2655 O O   . MET A 374 ? 1.3285 1.4104 1.0633 0.1304  -0.1323 0.4080  373 MET A O   
2656 C CB  . MET A 374 ? 1.1669 1.3559 0.9843 0.1109  -0.0820 0.3951  373 MET A CB  
2657 C CG  . MET A 374 ? 1.1196 1.3525 0.9644 0.1064  -0.0687 0.3856  373 MET A CG  
2658 S SD  . MET A 374 ? 1.1195 1.3666 0.9723 0.1153  -0.0816 0.3748  373 MET A SD  
2659 C CE  . MET A 374 ? 1.0934 1.3536 0.9826 0.1308  -0.0898 0.3687  373 MET A CE  
2660 N N   . GLY A 375 ? 1.2626 1.3343 0.9743 0.1027  -0.1005 0.4253  374 GLY A N   
2661 C CA  . GLY A 375 ? 1.3336 1.3499 1.0082 0.1062  -0.1161 0.4353  374 GLY A CA  
2662 C C   . GLY A 375 ? 1.3453 1.3617 1.0443 0.1088  -0.1165 0.4367  374 GLY A C   
2663 O O   . GLY A 375 ? 1.3970 1.3743 1.0777 0.1204  -0.1363 0.4381  374 GLY A O   
2664 N N   . HIS A 376 ? 1.2724 1.3278 1.0095 0.0998  -0.0977 0.4359  375 HIS A N   
2665 C CA  . HIS A 376 ? 1.2681 1.3195 1.0262 0.1026  -0.1003 0.4368  375 HIS A CA  
2666 C C   . HIS A 376 ? 1.3312 1.3439 1.0603 0.0854  -0.0962 0.4576  375 HIS A C   
2667 O O   . HIS A 376 ? 1.3129 1.3456 1.0557 0.0661  -0.0766 0.4692  375 HIS A O   
2668 C CB  . HIS A 376 ? 1.1960 1.2983 1.0029 0.1013  -0.0864 0.4275  375 HIS A CB  
2669 C CG  . HIS A 376 ? 1.1622 1.3007 0.9951 0.1141  -0.0863 0.4094  375 HIS A CG  
2670 N ND1 . HIS A 376 ? 1.1819 1.3152 1.0216 0.1328  -0.0999 0.3987  375 HIS A ND1 
2671 C CD2 . HIS A 376 ? 1.1132 1.2936 0.9676 0.1101  -0.0738 0.4017  375 HIS A CD2 
2672 C CE1 . HIS A 376 ? 1.1307 1.3025 0.9965 0.1378  -0.0937 0.3873  375 HIS A CE1 
2673 N NE2 . HIS A 376 ? 1.0902 1.2879 0.9631 0.1243  -0.0794 0.3879  375 HIS A NE2 
2674 N N   . LEU A 377 ? 1.2977 1.2541 0.9877 0.0924  -0.1150 0.4635  376 LEU A N   
2675 C CA  . LEU A 377 ? 1.3712 1.2820 1.0269 0.0749  -0.1114 0.4851  376 LEU A CA  
2676 C C   . LEU A 377 ? 1.3897 1.3142 1.0826 0.0633  -0.1047 0.4935  376 LEU A C   
2677 O O   . LEU A 377 ? 1.4084 1.3305 1.1022 0.0374  -0.0880 0.5137  376 LEU A O   
2678 C CB  . LEU A 377 ? 1.4585 1.3029 1.0645 0.0902  -0.1366 0.4872  376 LEU A CB  
2679 C CG  . LEU A 377 ? 1.5654 1.3544 1.1330 0.0747  -0.1348 0.5098  376 LEU A CG  
2680 C CD1 . LEU A 377 ? 1.5817 1.3524 1.1078 0.0506  -0.1131 0.5271  376 LEU A CD1 
2681 C CD2 . LEU A 377 ? 1.6612 1.3921 1.1900 0.0999  -0.1617 0.5078  376 LEU A CD2 
2682 N N   . GLU A 378 ? 1.3555 1.2918 1.0791 0.0814  -0.1178 0.4787  377 GLU A N   
2683 C CA  . GLU A 378 ? 1.3686 1.3074 1.1228 0.0738  -0.1187 0.4853  377 GLU A CA  
2684 C C   . GLU A 378 ? 1.3203 1.3139 1.1191 0.0544  -0.0966 0.4925  377 GLU A C   
2685 O O   . GLU A 378 ? 1.3447 1.3378 1.1659 0.0340  -0.0922 0.5111  377 GLU A O   
2686 C CB  . GLU A 378 ? 1.3748 1.3072 1.1412 0.1006  -0.1370 0.4641  377 GLU A CB  
2687 N N   . ILE A 379 ? 1.2916 1.3325 1.1069 0.0600  -0.0841 0.4790  378 ILE A N   
2688 C CA  . ILE A 379 ? 1.2361 1.3298 1.0928 0.0466  -0.0652 0.4835  378 ILE A CA  
2689 C C   . ILE A 379 ? 1.2725 1.3724 1.1197 0.0193  -0.0418 0.5055  378 ILE A C   
2690 O O   . ILE A 379 ? 1.2743 1.4011 1.1572 -0.0005 -0.0268 0.5213  378 ILE A O   
2691 C CB  . ILE A 379 ? 1.1674 1.3038 1.0407 0.0620  -0.0607 0.4606  378 ILE A CB  
2692 C CG1 . ILE A 379 ? 1.1445 1.2801 1.0357 0.0821  -0.0753 0.4410  378 ILE A CG1 
2693 C CG2 . ILE A 379 ? 1.1268 1.3138 1.0293 0.0483  -0.0400 0.4662  378 ILE A CG2 
2694 C CD1 . ILE A 379 ? 1.1976 1.3002 1.0629 0.1023  -0.0910 0.4273  378 ILE A CD1 
2695 N N   . VAL A 380 ? 1.2449 1.3169 1.0430 0.0173  -0.0375 0.5069  379 VAL A N   
2696 C CA  . VAL A 380 ? 1.2780 1.3442 1.0533 -0.0085 -0.0116 0.5247  379 VAL A CA  
2697 C C   . VAL A 380 ? 1.3562 1.3951 1.1376 -0.0341 -0.0055 0.5495  379 VAL A C   
2698 O O   . VAL A 380 ? 1.3704 1.4282 1.1694 -0.0615 0.0234  0.5649  379 VAL A O   
2699 C CB  . VAL A 380 ? 1.3203 1.3437 1.0291 -0.0028 -0.0146 0.5207  379 VAL A CB  
2700 C CG1 . VAL A 380 ? 1.3692 1.3720 1.0406 -0.0295 0.0144  0.5377  379 VAL A CG1 
2701 C CG2 . VAL A 380 ? 1.2535 1.3070 0.9661 0.0173  -0.0205 0.4985  379 VAL A CG2 
2702 N N   . GLU A 381 ? 1.3099 1.3035 1.0797 -0.0264 -0.0316 0.5524  380 GLU A N   
2703 C CA  . GLU A 381 ? 1.3759 1.3384 1.1552 -0.0519 -0.0313 0.5759  380 GLU A CA  
2704 C C   . GLU A 381 ? 1.3620 1.3713 1.2165 -0.0673 -0.0243 0.5852  380 GLU A C   
2705 O O   . GLU A 381 ? 1.3899 1.4057 1.2726 -0.1015 -0.0025 0.6061  380 GLU A O   
2706 C CB  . GLU A 381 ? 1.4401 1.3425 1.1909 -0.0350 -0.0656 0.5727  380 GLU A CB  
2707 C CG  . GLU A 381 ? 1.5423 1.3886 1.2197 -0.0233 -0.0742 0.5696  380 GLU A CG  
2708 C CD  . GLU A 381 ? 1.6893 1.4815 1.3427 -0.0012 -0.1073 0.5636  380 GLU A CD  
2709 O OE1 . GLU A 381 ? 1.6263 1.4251 1.3164 0.0080  -0.1237 0.5572  380 GLU A OE1 
2710 O OE2 . GLU A 381 ? 1.7607 1.5015 1.3564 0.0095  -0.1172 0.5643  380 GLU A OE2 
2711 N N   . VAL A 382 ? 1.2461 1.2866 1.1356 -0.0434 -0.0415 0.5687  381 VAL A N   
2712 C CA  . VAL A 382 ? 1.2305 1.3042 1.1893 -0.0533 -0.0431 0.5715  381 VAL A CA  
2713 C C   . VAL A 382 ? 1.2068 1.3403 1.2070 -0.0711 -0.0073 0.5629  381 VAL A C   
2714 O O   . VAL A 382 ? 1.2259 1.3794 1.2867 -0.0942 0.0041  0.5578  381 VAL A O   
2715 C CB  . VAL A 382 ? 1.2028 1.2823 1.1741 -0.0196 -0.0718 0.5503  381 VAL A CB  
2716 C CG1 . VAL A 382 ? 1.1892 1.2921 1.2285 -0.0263 -0.0773 0.5311  381 VAL A CG1 
2717 C CG2 . VAL A 382 ? 1.2516 1.2702 1.1842 0.0000  -0.1014 0.5410  381 VAL A CG2 
2718 N N   . LEU A 383 ? 1.1705 1.3334 1.1421 -0.0599 0.0092  0.5600  382 LEU A N   
2719 C CA  . LEU A 383 ? 1.1477 1.3654 1.1528 -0.0724 0.0422  0.5498  382 LEU A CA  
2720 C C   . LEU A 383 ? 1.2060 1.4203 1.2179 -0.1086 0.0773  0.5659  382 LEU A C   
2721 O O   . LEU A 383 ? 1.2098 1.4651 1.2860 -0.1269 0.0998  0.5555  382 LEU A O   
2722 C CB  . LEU A 383 ? 1.0956 1.3337 1.0568 -0.0532 0.0495  0.5462  382 LEU A CB  
2723 C CG  . LEU A 383 ? 1.0290 1.2871 0.9980 -0.0216 0.0250  0.5249  382 LEU A CG  
2724 C CD1 . LEU A 383 ? 1.0192 1.2836 0.9501 -0.0065 0.0293  0.5044  382 LEU A CD1 
2725 C CD2 . LEU A 383 ? 1.0133 1.3142 1.0490 -0.0216 0.0256  0.5032  382 LEU A CD2 
2726 N N   . LEU A 384 ? 1.1792 1.3432 1.1254 -0.1195 0.0828  0.5910  383 LEU A N   
2727 C CA  . LEU A 384 ? 1.2373 1.3888 1.1790 -0.1551 0.1193  0.6048  383 LEU A CA  
2728 C C   . LEU A 384 ? 1.2810 1.4267 1.2875 -0.1827 0.1173  0.6125  383 LEU A C   
2729 O O   . LEU A 384 ? 1.3058 1.4687 1.3476 -0.2156 0.1539  0.6194  383 LEU A O   
2730 C CB  . LEU A 384 ? 1.2876 1.3678 1.1343 -0.1534 0.1171  0.6073  383 LEU A CB  
2731 C CG  . LEU A 384 ? 1.2876 1.3659 1.0743 -0.1323 0.1233  0.5894  383 LEU A CG  
2732 C CD1 . LEU A 384 ? 1.3542 1.3556 1.0536 -0.1203 0.1016  0.5902  383 LEU A CD1 
2733 C CD2 . LEU A 384 ? 1.3139 1.4161 1.0980 -0.1526 0.1710  0.5871  383 LEU A CD2 
2734 N N   . LYS A 385 ? 1.2202 1.3400 1.2446 -0.1688 0.0748  0.6072  384 LYS A N   
2735 C CA  . LYS A 385 ? 1.2549 1.3648 1.3441 -0.1921 0.0648  0.6080  384 LYS A CA  
2736 C C   . LYS A 385 ? 1.2398 1.4166 1.4281 -0.1992 0.0767  0.5837  384 LYS A C   
2737 O O   . LYS A 385 ? 1.2614 1.4463 1.5175 -0.2284 0.0843  0.5853  384 LYS A O   
2738 C CB  . LYS A 385 ? 1.2824 1.3416 1.3573 -0.1708 0.0133  0.6060  384 LYS A CB  
2739 C CG  . LYS A 385 ? 1.3892 1.3749 1.3795 -0.1683 -0.0032 0.6305  384 LYS A CG  
2740 C CD  . LYS A 385 ? 1.4394 1.3839 1.4104 -0.1358 -0.0528 0.6225  384 LYS A CD  
2741 C CE  . LYS A 385 ? 1.5322 1.4086 1.4184 -0.1245 -0.0704 0.6359  384 LYS A CE  
2742 N NZ  . LYS A 385 ? 1.5796 1.4215 1.4470 -0.0868 -0.1126 0.6160  384 LYS A NZ  
2743 N N   . TYR A 386 ? 1.0798 1.3032 1.2804 -0.1732 0.0761  0.5608  385 TYR A N   
2744 C CA  . TYR A 386 ? 1.0494 1.3337 1.3396 -0.1755 0.0831  0.5351  385 TYR A CA  
2745 C C   . TYR A 386 ? 1.0272 1.3659 1.3383 -0.1914 0.1341  0.5323  385 TYR A C   
2746 O O   . TYR A 386 ? 0.9949 1.3885 1.3832 -0.1924 0.1427  0.5095  385 TYR A O   
2747 C CB  . TYR A 386 ? 1.0040 1.3018 1.2955 -0.1381 0.0500  0.5101  385 TYR A CB  
2748 C CG  . TYR A 386 ? 1.0229 1.2789 1.3251 -0.1248 0.0022  0.5037  385 TYR A CG  
2749 C CD1 . TYR A 386 ? 1.0303 1.2289 1.2632 -0.1076 -0.0235 0.5167  385 TYR A CD1 
2750 C CD2 . TYR A 386 ? 1.0327 1.3034 1.4132 -0.1276 -0.0188 0.4833  385 TYR A CD2 
2751 C CE1 . TYR A 386 ? 1.0455 1.2015 1.2815 -0.0930 -0.0656 0.5098  385 TYR A CE1 
2752 C CE2 . TYR A 386 ? 1.0500 1.2737 1.4310 -0.1138 -0.0643 0.4769  385 TYR A CE2 
2753 C CZ  . TYR A 386 ? 1.0547 1.2206 1.3607 -0.0963 -0.0859 0.4903  385 TYR A CZ  
2754 O OH  . TYR A 386 ? 1.0717 1.1868 1.3717 -0.0803 -0.1296 0.4829  385 TYR A OH  
2755 N N   . GLY A 387 ? 1.1482 1.4691 1.3898 -0.2020 0.1665  0.5537  386 GLY A N   
2756 C CA  . GLY A 387 ? 1.1467 1.5101 1.3997 -0.2190 0.2193  0.5533  386 GLY A CA  
2757 C C   . GLY A 387 ? 1.1346 1.5169 1.3307 -0.1938 0.2306  0.5446  386 GLY A C   
2758 O O   . GLY A 387 ? 1.1154 1.5514 1.3484 -0.1929 0.2588  0.5273  386 GLY A O   
2759 N N   . ALA A 388 ? 1.2049 1.5434 1.3144 -0.1725 0.2072  0.5554  387 ALA A N   
2760 C CA  . ALA A 388 ? 1.1774 1.5275 1.2299 -0.1500 0.2138  0.5492  387 ALA A CA  
2761 C C   . ALA A 388 ? 1.2383 1.5678 1.2354 -0.1645 0.2547  0.5490  387 ALA A C   
2762 O O   . ALA A 388 ? 1.2890 1.5679 1.2477 -0.1860 0.2676  0.5632  387 ALA A O   
2763 C CB  . ALA A 388 ? 1.1570 1.4626 1.1411 -0.1225 0.1730  0.5536  387 ALA A CB  
2764 N N   . ASP A 389 ? 1.2410 1.6019 1.2284 -0.1519 0.2733  0.5298  388 ASP A N   
2765 C CA  . ASP A 389 ? 1.2890 1.6240 1.2164 -0.1622 0.3112  0.5247  388 ASP A CA  
2766 C C   . ASP A 389 ? 1.3261 1.5847 1.1438 -0.1497 0.2899  0.5301  388 ASP A C   
2767 O O   . ASP A 389 ? 1.2900 1.5455 1.0754 -0.1223 0.2624  0.5190  388 ASP A O   
2768 C CB  . ASP A 389 ? 1.2838 1.6726 1.2344 -0.1500 0.3334  0.5016  388 ASP A CB  
2769 C CG  . ASP A 389 ? 1.3803 1.7466 1.2790 -0.1643 0.3796  0.4960  388 ASP A CG  
2770 O OD1 . ASP A 389 ? 1.4327 1.7449 1.2833 -0.1877 0.3981  0.5107  388 ASP A OD1 
2771 O OD2 . ASP A 389 ? 1.4058 1.8050 1.3073 -0.1524 0.3977  0.4769  388 ASP A OD2 
2772 N N   . VAL A 390 ? 1.3577 1.5527 1.1203 -0.1706 0.3014  0.5461  389 VAL A N   
2773 C CA  . VAL A 390 ? 1.4182 1.5344 1.0794 -0.1594 0.2773  0.5512  389 VAL A CA  
2774 C C   . VAL A 390 ? 1.4693 1.5599 1.0554 -0.1524 0.2944  0.5396  389 VAL A C   
2775 O O   . VAL A 390 ? 1.5051 1.5393 1.0144 -0.1365 0.2671  0.5383  389 VAL A O   
2776 C CB  . VAL A 390 ? 1.5007 1.5502 1.1224 -0.1841 0.2824  0.5730  389 VAL A CB  
2777 C CG1 . VAL A 390 ? 1.5847 1.6173 1.1833 -0.2173 0.3375  0.5783  389 VAL A CG1 
2778 C CG2 . VAL A 390 ? 1.5529 1.5212 1.0821 -0.1671 0.2459  0.5777  389 VAL A CG2 
2779 N N   . ASN A 391 ? 1.4959 1.6265 1.1045 -0.1630 0.3369  0.5295  390 ASN A N   
2780 C CA  . ASN A 391 ? 1.5497 1.6542 1.0841 -0.1580 0.3551  0.5188  390 ASN A CA  
2781 C C   . ASN A 391 ? 1.5094 1.6806 1.0884 -0.1355 0.3547  0.4974  390 ASN A C   
2782 O O   . ASN A 391 ? 1.5509 1.7197 1.0916 -0.1354 0.3814  0.4866  390 ASN A O   
2783 C CB  . ASN A 391 ? 1.6441 1.7232 1.1429 -0.1918 0.4098  0.5245  390 ASN A CB  
2784 C CG  . ASN A 391 ? 1.8136 1.8167 1.2553 -0.2166 0.4109  0.5469  390 ASN A CG  
2785 O OD1 . ASN A 391 ? 1.8450 1.7694 1.1920 -0.2101 0.3841  0.5546  390 ASN A OD1 
2786 N ND2 . ASN A 391 ? 1.7888 1.8126 1.2890 -0.2459 0.4403  0.5568  390 ASN A ND2 
2787 N N   . ALA A 392 ? 1.4822 1.7089 1.1358 -0.1169 0.3245  0.4912  391 ALA A N   
2788 C CA  . ALA A 392 ? 1.4486 1.7329 1.1393 -0.0951 0.3198  0.4718  391 ALA A CA  
2789 C C   . ALA A 392 ? 1.4635 1.7092 1.0806 -0.0718 0.2897  0.4637  391 ALA A C   
2790 O O   . ALA A 392 ? 1.4563 1.6472 1.0224 -0.0658 0.2575  0.4709  391 ALA A O   
2791 C CB  . ALA A 392 ? 1.3814 1.7276 1.1641 -0.0845 0.2945  0.4691  391 ALA A CB  
2792 N N   . TYR A 393 ? 1.4383 1.7130 1.0537 -0.0583 0.2989  0.4475  392 TYR A N   
2793 C CA  . TYR A 393 ? 1.4466 1.6862 0.9962 -0.0383 0.2717  0.4390  392 TYR A CA  
2794 C C   . TYR A 393 ? 1.4146 1.7124 1.0140 -0.0153 0.2518  0.4227  392 TYR A C   
2795 O O   . TYR A 393 ? 1.4066 1.7688 1.0748 -0.0153 0.2706  0.4154  392 TYR A O   
2796 C CB  . TYR A 393 ? 1.5373 1.7308 1.0026 -0.0463 0.3024  0.4369  392 TYR A CB  
2797 C CG  . TYR A 393 ? 1.5688 1.8132 1.0651 -0.0487 0.3474  0.4238  392 TYR A CG  
2798 C CD1 . TYR A 393 ? 1.5964 1.8685 1.1365 -0.0724 0.3949  0.4265  392 TYR A CD1 
2799 C CD2 . TYR A 393 ? 1.5874 1.8519 1.0721 -0.0271 0.3418  0.4070  392 TYR A CD2 
2800 C CE1 . TYR A 393 ? 1.6256 1.9479 1.2031 -0.0735 0.4371  0.4106  392 TYR A CE1 
2801 C CE2 . TYR A 393 ? 1.6252 1.9363 1.1387 -0.0261 0.3826  0.3924  392 TYR A CE2 
2802 C CZ  . TYR A 393 ? 1.6650 2.0065 1.2276 -0.0488 0.4309  0.3930  392 TYR A CZ  
2803 O OH  . TYR A 393 ? 1.6879 2.0795 1.2885 -0.0467 0.4723  0.3745  392 TYR A OH  
2804 N N   . ASP A 394 ? 1.4433 1.7161 1.0087 0.0029  0.2125  0.4165  393 ASP A N   
2805 C CA  . ASP A 394 ? 1.4105 1.7260 1.0109 0.0233  0.1887  0.4016  393 ASP A CA  
2806 C C   . ASP A 394 ? 1.4959 1.7943 1.0395 0.0334  0.1954  0.3902  393 ASP A C   
2807 O O   . ASP A 394 ? 1.5642 1.8310 1.0529 0.0238  0.2275  0.3926  393 ASP A O   
2808 C CB  . ASP A 394 ? 1.3370 1.6391 0.9503 0.0343  0.1412  0.4005  393 ASP A CB  
2809 C CG  . ASP A 394 ? 1.3861 1.6150 0.9300 0.0330  0.1214  0.4063  393 ASP A CG  
2810 O OD1 . ASP A 394 ? 1.4365 1.6281 0.9192 0.0382  0.1158  0.4010  393 ASP A OD1 
2811 O OD2 . ASP A 394 ? 1.3976 1.6037 0.9456 0.0275  0.1094  0.4159  393 ASP A OD2 
2812 N N   . LEU A 395 ? 1.3100 1.6253 0.8634 0.0519  0.1653  0.3774  394 LEU A N   
2813 C CA  . LEU A 395 ? 1.3810 1.6782 0.8803 0.0634  0.1661  0.3660  394 LEU A CA  
2814 C C   . LEU A 395 ? 1.4300 1.6471 0.8420 0.0615  0.1485  0.3703  394 LEU A C   
2815 O O   . LEU A 395 ? 1.5060 1.6936 0.8555 0.0664  0.1562  0.3642  394 LEU A O   
2816 C CB  . LEU A 395 ? 1.3581 1.6918 0.8931 0.0815  0.1355  0.3514  394 LEU A CB  
2817 C CG  . LEU A 395 ? 1.4076 1.8120 0.9959 0.0884  0.1575  0.3420  394 LEU A CG  
2818 C CD1 . LEU A 395 ? 1.3715 1.8031 0.9908 0.1037  0.1210  0.3293  394 LEU A CD1 
2819 C CD2 . LEU A 395 ? 1.5163 1.9199 1.0628 0.0918  0.1970  0.3343  394 LEU A CD2 
2820 N N   . ASN A 396 ? 1.5538 1.7337 0.9582 0.0555  0.1234  0.3799  395 ASN A N   
2821 C CA  . ASN A 396 ? 1.5912 1.6921 0.9115 0.0511  0.1057  0.3861  395 ASN A CA  
2822 C C   . ASN A 396 ? 1.6809 1.7398 0.9466 0.0309  0.1392  0.4007  395 ASN A C   
2823 O O   . ASN A 396 ? 1.7450 1.7345 0.9327 0.0232  0.1249  0.4083  395 ASN A O   
2824 C CB  . ASN A 396 ? 1.5426 1.6226 0.8807 0.0561  0.0602  0.3875  395 ASN A CB  
2825 C CG  . ASN A 396 ? 1.5741 1.6731 0.9436 0.0715  0.0245  0.3727  395 ASN A CG  
2826 O OD1 . ASN A 396 ? 1.4720 1.6140 0.9135 0.0768  0.0099  0.3672  395 ASN A OD1 
2827 N ND2 . ASN A 396 ? 1.5846 1.6488 0.8983 0.0766  0.0102  0.3662  395 ASN A ND2 
2828 N N   . GLY A 397 ? 1.6505 1.7496 0.9568 0.0194  0.1815  0.4053  396 GLY A N   
2829 C CA  . GLY A 397 ? 1.7173 1.7786 0.9793 -0.0043 0.2162  0.4192  396 GLY A CA  
2830 C C   . GLY A 397 ? 1.7283 1.7508 0.9839 -0.0147 0.1968  0.4342  396 GLY A C   
2831 O O   . GLY A 397 ? 1.7992 1.7672 0.9922 -0.0353 0.2127  0.4473  396 GLY A O   
2832 N N   . ALA A 398 ? 1.6483 1.6976 0.9654 -0.0021 0.1628  0.4324  397 ALA A N   
2833 C CA  . ALA A 398 ? 1.6572 1.6701 0.9694 -0.0064 0.1396  0.4440  397 ALA A CA  
2834 C C   . ALA A 398 ? 1.6177 1.6691 0.9933 -0.0192 0.1630  0.4534  397 ALA A C   
2835 O O   . ALA A 398 ? 1.5337 1.6560 0.9905 -0.0143 0.1696  0.4470  397 ALA A O   
2836 C CB  . ALA A 398 ? 1.5983 1.6175 0.9414 0.0142  0.0901  0.4351  397 ALA A CB  
2837 N N   . THR A 399 ? 1.6455 1.6462 0.9809 -0.0369 0.1726  0.4692  398 THR A N   
2838 C CA  . THR A 399 ? 1.6188 1.6428 1.0080 -0.0505 0.1873  0.4807  398 THR A CA  
2839 C C   . THR A 399 ? 1.5901 1.6064 1.0054 -0.0373 0.1448  0.4829  398 THR A C   
2840 O O   . THR A 399 ? 1.5900 1.5752 0.9751 -0.0204 0.1084  0.4764  398 THR A O   
2841 C CB  . THR A 399 ? 1.7405 1.7093 1.0695 -0.0787 0.2214  0.4969  398 THR A CB  
2842 O OG1 . THR A 399 ? 1.8122 1.6920 1.0448 -0.0791 0.1966  0.5043  398 THR A OG1 
2843 C CG2 . THR A 399 ? 1.7792 1.7653 1.0925 -0.0934 0.2696  0.4920  398 THR A CG2 
2844 N N   . PRO A 400 ? 1.5355 1.5809 1.0106 -0.0444 0.1476  0.4911  399 PRO A N   
2845 C CA  . PRO A 400 ? 1.5058 1.5366 0.9973 -0.0319 0.1092  0.4929  399 PRO A CA  
2846 C C   . PRO A 400 ? 1.6022 1.5470 1.0107 -0.0310 0.0894  0.5012  399 PRO A C   
2847 O O   . PRO A 400 ? 1.5855 1.5135 0.9950 -0.0128 0.0520  0.4959  399 PRO A O   
2848 C CB  . PRO A 400 ? 1.4819 1.5449 1.0350 -0.0458 0.1223  0.5044  399 PRO A CB  
2849 C CG  . PRO A 400 ? 1.4692 1.5943 1.0720 -0.0559 0.1568  0.5007  399 PRO A CG  
2850 C CD  . PRO A 400 ? 1.5145 1.6132 1.0539 -0.0620 0.1822  0.4968  399 PRO A CD  
2851 N N   . LEU A 401 ? 1.6805 1.5676 1.0152 -0.0501 0.1142  0.5134  400 LEU A N   
2852 C CA  . LEU A 401 ? 1.7690 1.5632 1.0107 -0.0477 0.0935  0.5214  400 LEU A CA  
2853 C C   . LEU A 401 ? 1.8034 1.5702 0.9970 -0.0304 0.0650  0.5089  400 LEU A C   
2854 O O   . LEU A 401 ? 1.8409 1.5498 0.9882 -0.0159 0.0285  0.5092  400 LEU A O   
2855 C CB  . LEU A 401 ? 1.8694 1.6031 1.0387 -0.0758 0.1310  0.5387  400 LEU A CB  
2856 C CG  . LEU A 401 ? 1.9778 1.6186 1.0703 -0.0713 0.1150  0.5497  400 LEU A CG  
2857 C CD1 . LEU A 401 ? 1.9534 1.5942 1.0845 -0.0630 0.0992  0.5610  400 LEU A CD1 
2858 C CD2 . LEU A 401 ? 2.0820 1.6743 1.1140 -0.0956 0.1564  0.5594  400 LEU A CD2 
2859 N N   . HIS A 402 ? 1.8436 1.6498 1.0487 -0.0303 0.0792  0.4977  401 HIS A N   
2860 C CA  . HIS A 402 ? 1.8555 1.6399 1.0225 -0.0157 0.0488  0.4863  401 HIS A CA  
2861 C C   . HIS A 402 ? 1.7943 1.6112 1.0219 0.0106  0.0076  0.4733  401 HIS A C   
2862 O O   . HIS A 402 ? 1.8192 1.5920 1.0094 0.0234  -0.0305 0.4694  401 HIS A O   
2863 C CB  . HIS A 402 ? 1.8498 1.6735 1.0215 -0.0193 0.0741  0.4768  401 HIS A CB  
2864 C CG  . HIS A 402 ? 1.9624 1.7382 1.0469 -0.0449 0.1003  0.4865  401 HIS A CG  
2865 N ND1 . HIS A 402 ? 2.0052 1.7877 1.0852 -0.0697 0.1491  0.4967  401 HIS A ND1 
2866 C CD2 . HIS A 402 ? 2.0276 1.7727 1.0497 -0.0536 0.0817  0.4876  401 HIS A CD2 
2867 C CE1 . HIS A 402 ? 2.0795 1.8393 1.0947 -0.0923 0.1614  0.5034  401 HIS A CE1 
2868 N NE2 . HIS A 402 ? 2.0878 1.8386 1.0759 -0.0822 0.1190  0.5010  401 HIS A NE2 
2869 N N   . LEU A 403 ? 1.7187 1.6125 1.0404 0.0164  0.0138  0.4666  402 LEU A N   
2870 C CA  . LEU A 403 ? 1.6460 1.5757 1.0280 0.0370  -0.0193 0.4534  402 LEU A CA  
2871 C C   . LEU A 403 ? 1.6815 1.5750 1.0578 0.0451  -0.0462 0.4588  402 LEU A C   
2872 O O   . LEU A 403 ? 1.6673 1.5538 1.0526 0.0629  -0.0800 0.4497  402 LEU A O   
2873 C CB  . LEU A 403 ? 1.5518 1.5664 1.0253 0.0383  -0.0044 0.4451  402 LEU A CB  
2874 C CG  . LEU A 403 ? 1.5497 1.6058 1.0367 0.0354  0.0181  0.4372  402 LEU A CG  
2875 C CD1 . LEU A 403 ? 1.4687 1.5994 1.0395 0.0358  0.0310  0.4318  402 LEU A CD1 
2876 C CD2 . LEU A 403 ? 1.5595 1.6072 1.0283 0.0489  -0.0057 0.4240  402 LEU A CD2 
2877 N N   . ALA A 404 ? 1.6445 1.5149 1.0076 0.0329  -0.0316 0.4733  403 ALA A N   
2878 C CA  . ALA A 404 ? 1.6730 1.5047 1.0262 0.0429  -0.0576 0.4783  403 ALA A CA  
2879 C C   . ALA A 404 ? 1.7754 1.5239 1.0431 0.0542  -0.0855 0.4808  403 ALA A C   
2880 O O   . ALA A 404 ? 1.7848 1.5125 1.0548 0.0747  -0.1186 0.4765  403 ALA A O   
2881 C CB  . ALA A 404 ? 1.7013 1.5196 1.0529 0.0262  -0.0360 0.4948  403 ALA A CB  
2882 N N   . ALA A 405 ? 1.8414 1.5425 1.0354 0.0434  -0.0726 0.4859  404 ALA A N   
2883 C CA  . ALA A 405 ? 1.9132 1.5486 1.0458 0.0583  -0.0961 0.4801  404 ALA A CA  
2884 C C   . ALA A 405 ? 1.8959 1.5467 1.0485 0.0745  -0.1321 0.4632  404 ALA A C   
2885 O O   . ALA A 405 ? 1.9279 1.5476 1.0613 0.1120  -0.1542 0.4549  404 ALA A O   
2886 C CB  . ALA A 405 ? 1.9997 1.5818 1.0536 0.0404  -0.0679 0.4873  404 ALA A CB  
2887 N N   . ARG A 406 ? 1.9025 1.6092 1.0948 0.0681  -0.1258 0.4577  405 ARG A N   
2888 C CA  . ARG A 406 ? 1.8699 1.5927 1.0854 0.0840  -0.1577 0.4427  405 ARG A CA  
2889 C C   . ARG A 406 ? 1.8286 1.5870 1.1112 0.1061  -0.1840 0.4346  405 ARG A C   
2890 O O   . ARG A 406 ? 1.8290 1.5783 1.1212 0.1248  -0.2171 0.4231  405 ARG A O   
2891 C CB  . ARG A 406 ? 1.8252 1.5941 1.0594 0.0767  -0.1399 0.4383  405 ARG A CB  
2892 C CG  . ARG A 406 ? 1.8610 1.6278 1.0967 0.0871  -0.1705 0.4247  405 ARG A CG  
2893 C CD  . ARG A 406 ? 1.8537 1.6712 1.1170 0.0847  -0.1531 0.4178  405 ARG A CD  
2894 N NE  . ARG A 406 ? 1.7887 1.6886 1.1528 0.0934  -0.1440 0.4070  405 ARG A NE  
2895 C CZ  . ARG A 406 ? 1.7893 1.7207 1.2068 0.1074  -0.1686 0.3946  405 ARG A CZ  
2896 N NH1 . ARG A 406 ? 1.7743 1.6641 1.1596 0.1183  -0.2056 0.3903  405 ARG A NH1 
2897 N NH2 . ARG A 406 ? 1.6467 1.6483 1.1479 0.1094  -0.1568 0.3870  405 ARG A NH2 
2898 N N   . MET A 407 ? 1.7214 1.5275 1.0611 0.1032  -0.1673 0.4378  406 MET A N   
2899 C CA  . MET A 407 ? 1.6748 1.5171 1.0820 0.1198  -0.1879 0.4293  406 MET A CA  
2900 C C   . MET A 407 ? 1.7571 1.5423 1.1275 0.1324  -0.2098 0.4361  406 MET A C   
2901 O O   . MET A 407 ? 1.7466 1.5431 1.1541 0.1520  -0.2369 0.4272  406 MET A O   
2902 C CB  . MET A 407 ? 1.6004 1.5183 1.0882 0.1122  -0.1606 0.4256  406 MET A CB  
2903 C CG  . MET A 407 ? 1.5403 1.5190 1.0729 0.1069  -0.1424 0.4154  406 MET A CG  
2904 S SD  . MET A 407 ? 1.5022 1.5185 1.0877 0.1240  -0.1685 0.3990  406 MET A SD  
2905 C CE  . MET A 407 ? 1.4488 1.5037 1.1032 0.1342  -0.1713 0.3955  406 MET A CE  
2906 N N   . GLY A 408 ? 1.6830 1.4182 0.9951 0.1222  -0.1928 0.4477  407 GLY A N   
2907 C CA  . GLY A 408 ? 1.7430 1.4331 1.0255 0.1422  -0.2031 0.4503  407 GLY A CA  
2908 C C   . GLY A 408 ? 1.7372 1.4414 1.0549 0.1388  -0.2003 0.4566  407 GLY A C   
2909 O O   . GLY A 408 ? 1.7256 1.4429 1.0812 0.1584  -0.2243 0.4480  407 GLY A O   
2910 N N   . HIS A 409 ? 1.7052 1.4076 1.0119 0.1157  -0.1702 0.4712  408 HIS A N   
2911 C CA  . HIS A 409 ? 1.6984 1.4074 1.0316 0.1132  -0.1654 0.4789  408 HIS A CA  
2912 C C   . HIS A 409 ? 1.7822 1.4411 1.0598 0.1051  -0.1420 0.4979  408 HIS A C   
2913 O O   . HIS A 409 ? 1.7861 1.4415 1.0429 0.0786  -0.1107 0.5104  408 HIS A O   
2914 C CB  . HIS A 409 ? 1.6096 1.3974 1.0231 0.0954  -0.1429 0.4740  408 HIS A CB  
2915 C CG  . HIS A 409 ? 1.5467 1.3980 1.0298 0.1085  -0.1547 0.4554  408 HIS A CG  
2916 N ND1 . HIS A 409 ? 1.4982 1.3960 1.0076 0.1032  -0.1418 0.4471  408 HIS A ND1 
2917 C CD2 . HIS A 409 ? 1.5265 1.4007 1.0564 0.1274  -0.1757 0.4440  408 HIS A CD2 
2918 C CE1 . HIS A 409 ? 1.4348 1.3805 1.0038 0.1172  -0.1533 0.4325  408 HIS A CE1 
2919 N NE2 . HIS A 409 ? 1.4527 1.3868 1.0361 0.1314  -0.1722 0.4306  408 HIS A NE2 
2920 N N   . VAL A 410 ? 1.7483 1.3883 1.0155 0.1323  -0.1504 0.5062  409 VAL A N   
2921 C CA  . VAL A 410 ? 1.8099 1.4376 1.0513 0.1268  -0.1262 0.5406  409 VAL A CA  
2922 C C   . VAL A 410 ? 1.8099 1.4158 1.0547 0.1017  -0.1132 0.5481  409 VAL A C   
2923 O O   . VAL A 410 ? 1.8553 1.4404 1.0728 0.0764  -0.0841 0.5698  409 VAL A O   
2924 C CB  . VAL A 410 ? 1.8385 1.4863 1.0967 0.1421  -0.1545 0.5661  409 VAL A CB  
2925 C CG1 . VAL A 410 ? 1.8600 1.5249 1.1070 0.1448  -0.1705 0.5742  409 VAL A CG1 
2926 C CG2 . VAL A 410 ? 1.7924 1.4611 1.0992 0.1668  -0.1823 0.5495  409 VAL A CG2 
2927 N N   . GLU A 411 ? 1.7965 1.4166 1.0836 0.1075  -0.1332 0.5342  410 GLU A N   
2928 C CA  . GLU A 411 ? 1.7939 1.4105 1.1015 0.0873  -0.1236 0.5459  410 GLU A CA  
2929 C C   . GLU A 411 ? 1.7632 1.4138 1.0985 0.0488  -0.0940 0.5481  410 GLU A C   
2930 O O   . GLU A 411 ? 1.7798 1.4207 1.1171 0.0228  -0.0729 0.5664  410 GLU A O   
2931 C CB  . GLU A 411 ? 1.7665 1.4058 1.1250 0.1066  -0.1500 0.5294  410 GLU A CB  
2932 C CG  . GLU A 411 ? 1.8514 1.4743 1.2041 0.1401  -0.1715 0.5343  410 GLU A CG  
2933 C CD  . GLU A 411 ? 1.9289 1.5752 1.2879 0.1686  -0.1881 0.5230  410 GLU A CD  
2934 O OE1 . GLU A 411 ? 1.8699 1.5286 1.2348 0.1684  -0.1935 0.4992  410 GLU A OE1 
2935 O OE2 . GLU A 411 ? 1.9345 1.5874 1.2992 0.1807  -0.2043 0.5431  410 GLU A OE2 
2936 N N   . ILE A 412 ? 1.7211 1.4233 1.0894 0.0459  -0.0900 0.5321  411 ILE A N   
2937 C CA  . ILE A 412 ? 1.6628 1.4201 1.0739 0.0187  -0.0578 0.5353  411 ILE A CA  
2938 C C   . ILE A 412 ? 1.7337 1.4582 1.0871 -0.0043 -0.0257 0.5503  411 ILE A C   
2939 O O   . ILE A 412 ? 1.7236 1.4703 1.0988 -0.0321 0.0065  0.5622  411 ILE A O   
2940 C CB  . ILE A 412 ? 1.5858 1.4142 1.0544 0.0298  -0.0612 0.5144  411 ILE A CB  
2941 C CG1 . ILE A 412 ? 1.5376 1.3968 1.0631 0.0501  -0.0846 0.5007  411 ILE A CG1 
2942 C CG2 . ILE A 412 ? 1.5317 1.4180 1.0409 0.0090  -0.0269 0.5170  411 ILE A CG2 
2943 C CD1 . ILE A 412 ? 1.4915 1.4223 1.0792 0.0588  -0.0814 0.4824  411 ILE A CD1 
2944 N N   . VAL A 413 ? 1.7210 1.3914 1.0004 0.0087  -0.0321 0.5499  412 VAL A N   
2945 C CA  . VAL A 413 ? 1.7918 1.4172 1.0024 -0.0076 0.0017  0.5654  412 VAL A CA  
2946 C C   . VAL A 413 ? 1.8665 1.4554 1.0599 -0.0235 0.0226  0.5913  412 VAL A C   
2947 O O   . VAL A 413 ? 1.8996 1.4792 1.0746 -0.0513 0.0633  0.6056  412 VAL A O   
2948 C CB  . VAL A 413 ? 1.8552 1.4440 1.0083 0.0219  -0.0109 0.5599  412 VAL A CB  
2949 C CG1 . VAL A 413 ? 1.9282 1.4998 1.0389 0.0187  0.0281  0.5849  412 VAL A CG1 
2950 C CG2 . VAL A 413 ? 1.8038 1.4217 0.9682 0.0248  -0.0269 0.5367  412 VAL A CG2 
2951 N N   . GLU A 414 ? 1.8146 1.3872 1.0206 -0.0078 -0.0040 0.5978  413 GLU A N   
2952 C CA  . GLU A 414 ? 1.8640 1.4082 1.0671 -0.0280 0.0086  0.6230  413 GLU A CA  
2953 C C   . GLU A 414 ? 1.8359 1.4163 1.0968 -0.0658 0.0296  0.6243  413 GLU A C   
2954 O O   . GLU A 414 ? 1.8764 1.4380 1.1300 -0.0972 0.0604  0.6446  413 GLU A O   
2955 C CB  . GLU A 414 ? 1.8881 1.4142 1.1003 -0.0040 -0.0311 0.6264  413 GLU A CB  
2956 C CG  . GLU A 414 ? 1.9745 1.4854 1.1522 0.0234  -0.0536 0.6359  413 GLU A CG  
2957 C CD  . GLU A 414 ? 2.0671 1.5671 1.2624 0.0432  -0.0959 0.6342  413 GLU A CD  
2958 O OE1 . GLU A 414 ? 2.0063 1.5260 1.2444 0.0556  -0.1100 0.6168  413 GLU A OE1 
2959 O OE2 . GLU A 414 ? 2.0954 1.5617 1.2579 0.0439  -0.1172 0.6478  413 GLU A OE2 
2960 N N   . VAL A 415 ? 1.7625 1.4069 1.0937 -0.0616 0.0151  0.6062  414 VAL A N   
2961 C CA  . VAL A 415 ? 1.7064 1.4061 1.1128 -0.0892 0.0334  0.6118  414 VAL A CA  
2962 C C   . VAL A 415 ? 1.7053 1.4440 1.1233 -0.1142 0.0781  0.6130  414 VAL A C   
2963 O O   . VAL A 415 ? 1.7095 1.4649 1.1605 -0.1466 0.1092  0.6269  414 VAL A O   
2964 C CB  . VAL A 415 ? 1.6442 1.4033 1.1245 -0.0684 0.0058  0.5948  414 VAL A CB  
2965 C CG1 . VAL A 415 ? 1.6173 1.4306 1.1768 -0.0917 0.0215  0.6033  414 VAL A CG1 
2966 C CG2 . VAL A 415 ? 1.6748 1.3925 1.1395 -0.0415 -0.0346 0.5899  414 VAL A CG2 
2967 N N   . LEU A 416 ? 1.6666 1.4207 1.0610 -0.0996 0.0819  0.5973  415 LEU A N   
2968 C CA  . LEU A 416 ? 1.6612 1.4500 1.0609 -0.1188 0.1240  0.5950  415 LEU A CA  
2969 C C   . LEU A 416 ? 1.7727 1.5024 1.1094 -0.1470 0.1633  0.6132  415 LEU A C   
2970 O O   . LEU A 416 ? 1.7745 1.5378 1.1447 -0.1760 0.2057  0.6180  415 LEU A O   
2971 C CB  . LEU A 416 ? 1.6404 1.4401 1.0125 -0.0960 0.1143  0.5754  415 LEU A CB  
2972 C CG  . LEU A 416 ? 1.5552 1.4256 0.9981 -0.0717 0.0884  0.5558  415 LEU A CG  
2973 C CD1 . LEU A 416 ? 1.5560 1.4177 0.9603 -0.0502 0.0719  0.5389  415 LEU A CD1 
2974 C CD2 . LEU A 416 ? 1.4923 1.4452 1.0182 -0.0838 0.1151  0.5531  415 LEU A CD2 
2975 N N   . LEU A 417 ? 1.7524 1.3963 1.0020 -0.1351 0.1532  0.6236  416 LEU A N   
2976 C CA  . LEU A 417 ? 1.8628 1.4491 1.0534 -0.1537 0.1952  0.6458  416 LEU A CA  
2977 C C   . LEU A 417 ? 1.8773 1.4665 1.1145 -0.1871 0.2111  0.6646  416 LEU A C   
2978 O O   . LEU A 417 ? 1.9404 1.5171 1.1691 -0.2162 0.2597  0.6791  416 LEU A O   
2979 C CB  . LEU A 417 ? 1.9320 1.4672 1.0597 -0.1175 0.1764  0.6606  416 LEU A CB  
2980 C CG  . LEU A 417 ? 1.9273 1.4747 1.0245 -0.0842 0.1655  0.6471  416 LEU A CG  
2981 C CD1 . LEU A 417 ? 1.9584 1.5069 1.0391 -0.0583 0.1261  0.6719  416 LEU A CD1 
2982 C CD2 . LEU A 417 ? 1.9617 1.5321 1.0481 -0.0954 0.2142  0.6524  416 LEU A CD2 
2983 N N   . LYS A 418 ? 1.7992 1.4036 1.0878 -0.1830 0.1720  0.6646  417 LYS A N   
2984 C CA  . LYS A 418 ? 1.8086 1.4165 1.1484 -0.2158 0.1807  0.6814  417 LYS A CA  
2985 C C   . LYS A 418 ? 1.7485 1.4359 1.1768 -0.2466 0.2149  0.6768  417 LYS A C   
2986 O O   . LYS A 418 ? 1.7789 1.4674 1.2454 -0.2821 0.2398  0.6915  417 LYS A O   
2987 C CB  . LYS A 418 ? 1.7666 1.3693 1.1381 -0.1987 0.1275  0.6809  417 LYS A CB  
2988 C CG  . LYS A 418 ? 1.8410 1.3664 1.1429 -0.1768 0.0978  0.6910  417 LYS A CG  
2989 C CD  . LYS A 418 ? 1.8039 1.3243 1.1398 -0.1612 0.0487  0.6871  417 LYS A CD  
2990 C CE  . LYS A 418 ? 1.8784 1.3304 1.1547 -0.1408 0.0192  0.6964  417 LYS A CE  
2991 N NZ  . LYS A 418 ? 1.8502 1.2933 1.1562 -0.1237 -0.0265 0.6895  417 LYS A NZ  
2992 N N   . TYR A 419 ? 1.8259 1.4226 0.8050 0.0276  -0.0725 0.2949  418 TYR A N   
2993 C CA  . TYR A 419 ? 1.8332 1.4203 0.8167 0.0218  -0.0688 0.2909  418 TYR A CA  
2994 C C   . TYR A 419 ? 1.8778 1.4760 0.8632 0.0168  -0.0671 0.2905  418 TYR A C   
2995 O O   . TYR A 419 ? 1.8915 1.4833 0.8771 0.0132  -0.0647 0.2857  418 TYR A O   
2996 C CB  . TYR A 419 ? 1.8363 1.4172 0.8150 0.0185  -0.0656 0.2835  418 TYR A CB  
2997 C CG  . TYR A 419 ? 1.8167 1.3833 0.7947 0.0233  -0.0667 0.2827  418 TYR A CG  
2998 C CD1 . TYR A 419 ? 1.8173 1.3887 0.7887 0.0294  -0.0692 0.2833  418 TYR A CD1 
2999 C CD2 . TYR A 419 ? 1.8148 1.3645 0.7972 0.0225  -0.0657 0.2808  418 TYR A CD2 
3000 C CE1 . TYR A 419 ? 1.8223 1.3806 0.7909 0.0352  -0.0708 0.2817  418 TYR A CE1 
3001 C CE2 . TYR A 419 ? 1.8091 1.3455 0.7900 0.0271  -0.0669 0.2796  418 TYR A CE2 
3002 C CZ  . TYR A 419 ? 1.8180 1.3580 0.7917 0.0337  -0.0696 0.2800  418 TYR A CZ  
3003 O OH  . TYR A 419 ? 1.8238 1.3505 0.7940 0.0397  -0.0714 0.2782  418 TYR A OH  
3004 N N   . GLY A 420 ? 1.8513 1.4659 0.8364 0.0177  -0.0687 0.2950  419 GLY A N   
3005 C CA  . GLY A 420 ? 1.8477 1.4745 0.8339 0.0144  -0.0678 0.2951  419 GLY A CA  
3006 C C   . GLY A 420 ? 1.8494 1.4854 0.8276 0.0103  -0.0661 0.2890  419 GLY A C   
3007 O O   . GLY A 420 ? 1.8492 1.4833 0.8238 0.0072  -0.0651 0.2839  419 GLY A O   
3008 N N   . ALA A 421 ? 1.9254 1.5712 0.8988 0.0104  -0.0667 0.2892  420 ALA A N   
3009 C CA  . ALA A 421 ? 1.9438 1.5997 0.9084 0.0051  -0.0658 0.2842  420 ALA A CA  
3010 C C   . ALA A 421 ? 1.9691 1.6421 0.9341 0.0057  -0.0670 0.2869  420 ALA A C   
3011 O O   . ALA A 421 ? 1.9544 1.6384 0.9253 0.0105  -0.0688 0.2945  420 ALA A O   
3012 C CB  . ALA A 421 ? 1.9412 1.6078 0.9000 0.0046  -0.0659 0.2840  420 ALA A CB  
3013 N N   . ASP A 422 ? 2.0302 1.7039 0.9871 0.0010  -0.0667 0.2807  421 ASP A N   
3014 C CA  . ASP A 422 ? 2.0367 1.7267 0.9919 0.0018  -0.0680 0.2818  421 ASP A CA  
3015 C C   . ASP A 422 ? 2.0545 1.7605 1.0021 -0.0012 -0.0686 0.2806  421 ASP A C   
3016 O O   . ASP A 422 ? 2.0661 1.7654 1.0024 -0.0079 -0.0689 0.2735  421 ASP A O   
3017 C CB  . ASP A 422 ? 2.0684 1.7485 1.0166 0.0002  -0.0686 0.2747  421 ASP A CB  
3018 C CG  . ASP A 422 ? 2.1105 1.8099 1.0565 0.0024  -0.0702 0.2755  421 ASP A CG  
3019 O OD1 . ASP A 422 ? 2.0971 1.8119 1.0531 0.0063  -0.0701 0.2833  421 ASP A OD1 
3020 O OD2 . ASP A 422 ? 2.1505 1.8493 1.0837 -0.0004 -0.0722 0.2684  421 ASP A OD2 
3021 N N   . VAL A 423 ? 2.0492 1.7757 1.0018 0.0032  -0.0695 0.2878  422 VAL A N   
3022 C CA  . VAL A 423 ? 2.0494 1.7953 0.9950 0.0014  -0.0702 0.2870  422 VAL A CA  
3023 C C   . VAL A 423 ? 2.0798 1.8336 1.0178 -0.0017 -0.0712 0.2823  422 VAL A C   
3024 O O   . VAL A 423 ? 2.0855 1.8470 1.0133 -0.0069 -0.0719 0.2776  422 VAL A O   
3025 C CB  . VAL A 423 ? 2.0504 1.8146 1.0021 0.0085  -0.0719 0.2960  422 VAL A CB  
3026 C CG1 . VAL A 423 ? 2.0525 1.8393 0.9963 0.0074  -0.0725 0.2946  422 VAL A CG1 
3027 C CG2 . VAL A 423 ? 2.0393 1.7908 0.9961 0.0131  -0.0727 0.3000  422 VAL A CG2 
3028 N N   . ASN A 424 ? 2.0759 1.8290 1.0174 0.0011  -0.0717 0.2831  423 ASN A N   
3029 C CA  . ASN A 424 ? 2.0882 1.8504 1.0213 0.0002  -0.0735 0.2782  423 ASN A CA  
3030 C C   . ASN A 424 ? 2.1292 1.8695 1.0470 -0.0057 -0.0754 0.2668  423 ASN A C   
3031 O O   . ASN A 424 ? 2.1385 1.8819 1.0456 -0.0060 -0.0783 0.2610  423 ASN A O   
3032 C CB  . ASN A 424 ? 2.0890 1.8619 1.0297 0.0055  -0.0738 0.2831  423 ASN A CB  
3033 C CG  . ASN A 424 ? 2.1562 1.9439 1.1105 0.0098  -0.0733 0.2955  423 ASN A CG  
3034 O OD1 . ASN A 424 ? 2.1244 1.9336 1.0799 0.0119  -0.0743 0.3008  423 ASN A OD1 
3035 N ND2 . ASN A 424 ? 2.1154 1.8895 1.0782 0.0110  -0.0725 0.3003  423 ASN A ND2 
3036 N N   . ALA A 425 ? 2.1124 1.8295 1.0272 -0.0102 -0.0748 0.2634  424 ALA A N   
3037 C CA  . ALA A 425 ? 2.1370 1.8282 1.0349 -0.0165 -0.0779 0.2533  424 ALA A CA  
3038 C C   . ALA A 425 ? 2.1604 1.8535 1.0434 -0.0257 -0.0808 0.2485  424 ALA A C   
3039 O O   . ALA A 425 ? 2.1440 1.8541 1.0306 -0.0292 -0.0789 0.2525  424 ALA A O   
3040 C CB  . ALA A 425 ? 2.1440 1.8110 1.0431 -0.0195 -0.0765 0.2522  424 ALA A CB  
3041 N N   . GLN A 426 ? 2.1821 1.8575 1.0465 -0.0295 -0.0862 0.2395  425 GLN A N   
3042 C CA  . GLN A 426 ? 2.1906 1.8622 1.0373 -0.0406 -0.0908 0.2339  425 GLN A CA  
3043 C C   . GLN A 426 ? 2.2314 1.8647 1.0592 -0.0515 -0.0957 0.2268  425 GLN A C   
3044 O O   . GLN A 426 ? 2.2460 1.8538 1.0688 -0.0469 -0.0977 0.2229  425 GLN A O   
3045 C CB  . GLN A 426 ? 2.2035 1.8851 1.0402 -0.0368 -0.0952 0.2290  425 GLN A CB  
3046 C CG  . GLN A 426 ? 2.2420 1.9627 1.0951 -0.0281 -0.0911 0.2366  425 GLN A CG  
3047 C CD  . GLN A 426 ? 2.3222 2.0554 1.1649 -0.0246 -0.0956 0.2314  425 GLN A CD  
3048 O OE1 . GLN A 426 ? 2.3241 2.0416 1.1541 -0.0207 -0.1005 0.2235  425 GLN A OE1 
3049 N NE2 . GLN A 426 ? 2.2723 2.0348 1.1193 -0.0248 -0.0943 0.2351  425 GLN A NE2 
3050 N N   . ASP A 427 ? 2.2269 1.8572 1.0431 -0.0666 -0.0982 0.2253  426 ASP A N   
3051 C CA  . ASP A 427 ? 2.2461 1.8400 1.0424 -0.0806 -0.1040 0.2200  426 ASP A CA  
3052 C C   . ASP A 427 ? 2.2877 1.8569 1.0566 -0.0862 -0.1144 0.2105  426 ASP A C   
3053 O O   . ASP A 427 ? 2.2896 1.8685 1.0568 -0.0755 -0.1163 0.2071  426 ASP A O   
3054 C CB  . ASP A 427 ? 2.2417 1.8480 1.0403 -0.0961 -0.1015 0.2245  426 ASP A CB  
3055 C CG  . ASP A 427 ? 2.2645 1.9057 1.0653 -0.1014 -0.1006 0.2265  426 ASP A CG  
3056 O OD1 . ASP A 427 ? 2.2761 1.9107 1.0594 -0.1096 -0.1073 0.2209  426 ASP A OD1 
3057 O OD2 . ASP A 427 ? 2.2682 1.9429 1.0867 -0.0968 -0.0938 0.2332  426 ASP A OD2 
3058 N N   . LYS A 428 ? 2.3035 1.8400 1.0494 -0.1034 -0.1219 0.2061  427 LYS A N   
3059 C CA  . LYS A 428 ? 2.3258 1.8321 1.0415 -0.1096 -0.1339 0.1966  427 LYS A CA  
3060 C C   . LYS A 428 ? 2.3354 1.8679 1.0475 -0.1173 -0.1358 0.1959  427 LYS A C   
3061 O O   . LYS A 428 ? 2.3449 1.8628 1.0370 -0.1155 -0.1447 0.1876  427 LYS A O   
3062 C CB  . LYS A 428 ? 2.3548 1.8149 1.0447 -0.1282 -0.1428 0.1934  427 LYS A CB  
3063 N N   . PHE A 429 ? 2.3085 1.8800 1.0387 -0.1245 -0.1283 0.2036  428 PHE A N   
3064 C CA  . PHE A 429 ? 2.2983 1.8996 1.0274 -0.1308 -0.1293 0.2032  428 PHE A CA  
3065 C C   . PHE A 429 ? 2.3013 1.9380 1.0488 -0.1103 -0.1235 0.2053  428 PHE A C   
3066 O O   . PHE A 429 ? 2.2951 1.9504 1.0376 -0.1115 -0.1263 0.2025  428 PHE A O   
3067 C CB  . PHE A 429 ? 2.2893 1.9203 1.0284 -0.1467 -0.1244 0.2099  428 PHE A CB  
3068 C CG  . PHE A 429 ? 2.3064 1.9106 1.0325 -0.1675 -0.1282 0.2104  428 PHE A CG  
3069 C CD1 . PHE A 429 ? 2.3347 1.9115 1.0329 -0.1906 -0.1393 0.2054  428 PHE A CD1 
3070 C CD2 . PHE A 429 ? 2.3088 1.9148 1.0496 -0.1648 -0.1213 0.2161  428 PHE A CD2 
3071 C CE1 . PHE A 429 ? 2.3473 1.8994 1.0326 -0.2119 -0.1434 0.2071  428 PHE A CE1 
3072 C CE2 . PHE A 429 ? 2.3289 1.9128 1.0580 -0.1844 -0.1248 0.2171  428 PHE A CE2 
3073 C CZ  . PHE A 429 ? 2.3366 1.8938 1.0381 -0.2085 -0.1358 0.2131  428 PHE A CZ  
3074 N N   . GLY A 430 ? 2.3134 1.9598 1.0814 -0.0930 -0.1161 0.2104  429 GLY A N   
3075 C CA  . GLY A 430 ? 2.2988 1.9788 1.0849 -0.0755 -0.1107 0.2145  429 GLY A CA  
3076 C C   . GLY A 430 ? 2.2916 2.0077 1.1024 -0.0703 -0.1014 0.2250  429 GLY A C   
3077 O O   . GLY A 430 ? 2.2776 2.0199 1.1032 -0.0566 -0.0974 0.2300  429 GLY A O   
3078 N N   . LYS A 431 ? 2.2056 1.9238 1.0198 -0.0805 -0.0987 0.2285  430 LYS A N   
3079 C CA  . LYS A 431 ? 2.1853 1.9363 1.0190 -0.0737 -0.0913 0.2371  430 LYS A CA  
3080 C C   . LYS A 431 ? 2.1937 1.9378 1.0435 -0.0615 -0.0864 0.2427  430 LYS A C   
3081 O O   . LYS A 431 ? 2.2026 1.9168 1.0486 -0.0626 -0.0877 0.2400  430 LYS A O   
3082 C CB  . LYS A 431 ? 2.1954 1.9572 1.0250 -0.0891 -0.0908 0.2375  430 LYS A CB  
3083 C CG  . LYS A 431 ? 2.2633 2.0371 1.0788 -0.1037 -0.0957 0.2328  430 LYS A CG  
3084 C CD  . LYS A 431 ? 2.3077 2.0962 1.1203 -0.1211 -0.0951 0.2335  430 LYS A CD  
3085 C CE  . LYS A 431 ? 2.3585 2.1645 1.1595 -0.1370 -0.0998 0.2293  430 LYS A CE  
3086 N NZ  . LYS A 431 ? 2.3865 2.2282 1.1974 -0.1231 -0.0970 0.2310  430 LYS A NZ  
3087 N N   . THR A 432 ? 2.1513 1.9221 1.0178 -0.0497 -0.0815 0.2506  431 THR A N   
3088 C CA  . THR A 432 ? 2.1410 1.9077 1.0229 -0.0391 -0.0777 0.2568  431 THR A CA  
3089 C C   . THR A 432 ? 2.1497 1.9291 1.0370 -0.0395 -0.0746 0.2610  431 THR A C   
3090 O O   . THR A 432 ? 2.1514 1.9463 1.0313 -0.0477 -0.0749 0.2591  431 THR A O   
3091 C CB  . THR A 432 ? 2.1613 1.9450 1.0560 -0.0253 -0.0764 0.2632  431 THR A CB  
3092 O OG1 . THR A 432 ? 2.1505 1.9649 1.0482 -0.0210 -0.0756 0.2678  431 THR A OG1 
3093 C CG2 . THR A 432 ? 2.1665 1.9445 1.0548 -0.0241 -0.0795 0.2586  431 THR A CG2 
3094 N N   . ALA A 433 ? 2.1182 1.8921 1.0177 -0.0307 -0.0721 0.2662  432 ALA A N   
3095 C CA  . ALA A 433 ? 2.1143 1.9007 1.0177 -0.0282 -0.0701 0.2697  432 ALA A CA  
3096 C C   . ALA A 433 ? 2.1246 1.9449 1.0286 -0.0212 -0.0702 0.2736  432 ALA A C   
3097 O O   . ALA A 433 ? 2.1274 1.9657 1.0267 -0.0224 -0.0695 0.2731  432 ALA A O   
3098 C CB  . ALA A 433 ? 2.1038 1.8760 1.0191 -0.0192 -0.0688 0.2744  432 ALA A CB  
3099 N N   . PHE A 434 ? 2.1693 2.0004 1.0779 -0.0133 -0.0714 0.2773  433 PHE A N   
3100 C CA  . PHE A 434 ? 2.1683 2.0303 1.0761 -0.0054 -0.0722 0.2811  433 PHE A CA  
3101 C C   . PHE A 434 ? 2.1948 2.0727 1.0897 -0.0137 -0.0725 0.2746  433 PHE A C   
3102 O O   . PHE A 434 ? 2.1992 2.1020 1.0893 -0.0080 -0.0728 0.2751  433 PHE A O   
3103 C CB  . PHE A 434 ? 2.1654 2.0327 1.0821 0.0040  -0.0739 0.2881  433 PHE A CB  
3104 C CG  . PHE A 434 ? 2.1707 2.0667 1.0882 0.0138  -0.0762 0.2941  433 PHE A CG  
3105 C CD1 . PHE A 434 ? 2.1785 2.0772 1.1017 0.0201  -0.0796 0.3011  433 PHE A CD1 
3106 C CD2 . PHE A 434 ? 2.1852 2.1016 1.0954 0.0164  -0.0763 0.2921  433 PHE A CD2 
3107 C CE1 . PHE A 434 ? 2.1840 2.1055 1.1062 0.0240  -0.0850 0.3064  433 PHE A CE1 
3108 C CE2 . PHE A 434 ? 2.1974 2.1367 1.1105 0.0261  -0.0787 0.2956  433 PHE A CE2 
3109 C CZ  . PHE A 434 ? 2.1838 2.1289 1.1065 0.0231  -0.0850 0.3033  433 PHE A CZ  
3110 N N   . ASP A 435 ? 2.1458 2.0076 1.0331 -0.0275 -0.0736 0.2678  434 ASP A N   
3111 C CA  . ASP A 435 ? 2.1539 2.0287 1.0292 -0.0391 -0.0755 0.2616  434 ASP A CA  
3112 C C   . ASP A 435 ? 2.1773 2.0642 1.0462 -0.0508 -0.0750 0.2585  434 ASP A C   
3113 O O   . ASP A 435 ? 2.1807 2.0948 1.0450 -0.0545 -0.0756 0.2564  434 ASP A O   
3114 C CB  . ASP A 435 ? 2.1674 2.0184 1.0339 -0.0507 -0.0790 0.2553  434 ASP A CB  
3115 C CG  . ASP A 435 ? 2.1989 2.0473 1.0701 -0.0396 -0.0798 0.2570  434 ASP A CG  
3116 O OD1 . ASP A 435 ? 2.1963 2.0674 1.0750 -0.0271 -0.0784 0.2627  434 ASP A OD1 
3117 O OD2 . ASP A 435 ? 2.2210 2.0451 1.0871 -0.0431 -0.0823 0.2527  434 ASP A OD2 
3118 N N   . ILE A 436 ? 2.1725 2.0420 1.0415 -0.0578 -0.0740 0.2580  435 ILE A N   
3119 C CA  . ILE A 436 ? 2.1796 2.0640 1.0433 -0.0705 -0.0734 0.2555  435 ILE A CA  
3120 C C   . ILE A 436 ? 2.1954 2.1115 1.0632 -0.0562 -0.0712 0.2586  435 ILE A C   
3121 O O   . ILE A 436 ? 2.2009 2.1452 1.0648 -0.0648 -0.0712 0.2556  435 ILE A O   
3122 C CB  . ILE A 436 ? 2.1949 2.0514 1.0570 -0.0807 -0.0731 0.2546  435 ILE A CB  
3123 C CG1 . ILE A 436 ? 2.2091 2.0333 1.0601 -0.0973 -0.0776 0.2497  435 ILE A CG1 
3124 C CG2 . ILE A 436 ? 2.1986 2.0758 1.0580 -0.0914 -0.0717 0.2537  435 ILE A CG2 
3125 C CD1 . ILE A 436 ? 2.2365 2.0278 1.0907 -0.0871 -0.0783 0.2498  435 ILE A CD1 
3126 N N   . SER A 437 ? 2.1676 2.0804 1.0426 -0.0349 -0.0703 0.2644  436 SER A N   
3127 C CA  . SER A 437 ? 2.1741 2.1095 1.0472 -0.0185 -0.0704 0.2666  436 SER A CA  
3128 C C   . SER A 437 ? 2.1995 2.1611 1.0659 -0.0187 -0.0724 0.2634  436 SER A C   
3129 O O   . SER A 437 ? 2.2087 2.1959 1.0715 -0.0167 -0.0737 0.2608  436 SER A O   
3130 C CB  . SER A 437 ? 2.1759 2.1014 1.0579 0.0019  -0.0712 0.2747  436 SER A CB  
3131 O OG  . SER A 437 ? 2.1970 2.1012 1.0884 -0.0016 -0.0702 0.2771  436 SER A OG  
3132 N N   . ILE A 438 ? 2.1666 2.1258 1.0336 -0.0224 -0.0734 0.2630  437 ILE A N   
3133 C CA  . ILE A 438 ? 2.1729 2.1599 1.0366 -0.0249 -0.0754 0.2597  437 ILE A CA  
3134 C C   . ILE A 438 ? 2.1875 2.1965 1.0501 -0.0493 -0.0754 0.2531  437 ILE A C   
3135 O O   . ILE A 438 ? 2.1920 2.2384 1.0563 -0.0542 -0.0762 0.2497  437 ILE A O   
3136 C CB  . ILE A 438 ? 2.1789 2.1555 1.0428 -0.0168 -0.0769 0.2624  437 ILE A CB  
3137 C CG1 . ILE A 438 ? 2.1740 2.1267 1.0398 0.0038  -0.0771 0.2703  437 ILE A CG1 
3138 C CG2 . ILE A 438 ? 2.1897 2.1969 1.0525 -0.0172 -0.0794 0.2599  437 ILE A CG2 
3139 C CD1 . ILE A 438 ? 2.2167 2.1682 1.0749 0.0151  -0.0813 0.2728  437 ILE A CD1 
3140 N N   . ASP A 439 ? 2.1701 2.1569 1.0302 -0.0659 -0.0754 0.2513  438 ASP A N   
3141 C CA  . ASP A 439 ? 2.1708 2.1711 1.0259 -0.0921 -0.0771 0.2459  438 ASP A CA  
3142 C C   . ASP A 439 ? 2.1888 2.2190 1.0467 -0.1003 -0.0754 0.2445  438 ASP A C   
3143 O O   . ASP A 439 ? 2.1880 2.2537 1.0467 -0.1159 -0.0763 0.2409  438 ASP A O   
3144 C CB  . ASP A 439 ? 2.1770 2.1374 1.0245 -0.1076 -0.0796 0.2442  438 ASP A CB  
3145 C CG  . ASP A 439 ? 2.2120 2.1507 1.0557 -0.1024 -0.0824 0.2432  438 ASP A CG  
3146 O OD1 . ASP A 439 ? 2.2107 2.1707 1.0544 -0.0994 -0.0836 0.2418  438 ASP A OD1 
3147 O OD2 . ASP A 439 ? 2.2352 2.1375 1.0763 -0.1011 -0.0835 0.2433  438 ASP A OD2 
3148 N N   . ASN A 440 ? 2.1316 2.1515 0.9920 -0.0904 -0.0730 0.2473  439 ASN A N   
3149 C CA  . ASN A 440 ? 2.1344 2.1865 0.9979 -0.0955 -0.0713 0.2456  439 ASN A CA  
3150 C C   . ASN A 440 ? 2.1533 2.2461 1.0225 -0.0780 -0.0713 0.2445  439 ASN A C   
3151 O O   . ASN A 440 ? 2.1532 2.2926 1.0278 -0.0871 -0.0710 0.2405  439 ASN A O   
3152 C CB  . ASN A 440 ? 2.1363 2.1634 0.9994 -0.0902 -0.0693 0.2483  439 ASN A CB  
3153 C CG  . ASN A 440 ? 2.2211 2.2243 1.0796 -0.1147 -0.0699 0.2476  439 ASN A CG  
3154 O OD1 . ASN A 440 ? 2.1974 2.1627 1.0514 -0.1201 -0.0719 0.2481  439 ASN A OD1 
3155 N ND2 . ASN A 440 ? 2.1861 2.2117 1.0450 -0.1297 -0.0690 0.2462  439 ASN A ND2 
3156 N N   . GLY A 441 ? 2.1445 2.2217 1.0130 -0.0538 -0.0724 0.2480  440 GLY A N   
3157 C CA  . GLY A 441 ? 2.1491 2.2596 1.0222 -0.0366 -0.0745 0.2470  440 GLY A CA  
3158 C C   . GLY A 441 ? 2.1659 2.2697 1.0380 -0.0172 -0.0760 0.2489  440 GLY A C   
3159 O O   . GLY A 441 ? 2.1669 2.3119 1.0453 -0.0108 -0.0769 0.2450  440 GLY A O   
3160 N N   . ASN A 442 ? 2.0970 2.1515 0.9622 -0.0074 -0.0768 0.2546  441 ASN A N   
3161 C CA  . ASN A 442 ? 2.0966 2.1367 0.9592 0.0090  -0.0799 0.2571  441 ASN A CA  
3162 C C   . ASN A 442 ? 2.1065 2.1161 0.9668 0.0229  -0.0854 0.2641  441 ASN A C   
3163 O O   . ASN A 442 ? 2.1011 2.0660 0.9550 0.0201  -0.0848 0.2690  441 ASN A O   
3164 C CB  . ASN A 442 ? 2.0971 2.1073 0.9548 0.0036  -0.0765 0.2582  441 ASN A CB  
3165 C CG  . ASN A 442 ? 2.1824 2.2254 1.0448 -0.0137 -0.0725 0.2527  441 ASN A CG  
3166 O OD1 . ASN A 442 ? 2.1625 2.2393 1.0284 -0.0097 -0.0732 0.2488  441 ASN A OD1 
3167 N ND2 . ASN A 442 ? 2.1421 2.1772 1.0060 -0.0343 -0.0692 0.2523  441 ASN A ND2 
3168 N N   . GLU A 443 ? 2.0871 2.1245 0.9551 0.0393  -0.0906 0.2644  442 GLU A N   
3169 C CA  . GLU A 443 ? 2.0771 2.0919 0.9480 0.0528  -0.0968 0.2723  442 GLU A CA  
3170 C C   . GLU A 443 ? 2.0799 2.0670 0.9535 0.0629  -0.1003 0.2775  442 GLU A C   
3171 O O   . GLU A 443 ? 2.0659 2.0269 0.9445 0.0695  -0.1043 0.2857  442 GLU A O   
3172 C CB  . GLU A 443 ? 2.0841 2.1353 0.9616 0.0721  -0.1016 0.2707  442 GLU A CB  
3173 C CG  . GLU A 443 ? 2.1270 2.2091 1.0065 0.0631  -0.0987 0.2667  442 GLU A CG  
3174 C CD  . GLU A 443 ? 2.1942 2.3004 1.0793 0.0822  -0.1044 0.2678  442 GLU A CD  
3175 O OE1 . GLU A 443 ? 2.1556 2.2348 1.0400 0.0964  -0.1106 0.2755  442 GLU A OE1 
3176 O OE2 . GLU A 443 ? 2.1704 2.3230 1.0611 0.0827  -0.1031 0.2613  442 GLU A OE2 
3177 N N   . ASP A 444 ? 2.0583 2.0528 0.9305 0.0647  -0.0987 0.2729  443 ASP A N   
3178 C CA  . ASP A 444 ? 2.0465 2.0140 0.9219 0.0756  -0.1016 0.2768  443 ASP A CA  
3179 C C   . ASP A 444 ? 2.0467 1.9789 0.9268 0.0586  -0.0981 0.2835  443 ASP A C   
3180 O O   . ASP A 444 ? 2.0321 1.9354 0.9199 0.0683  -0.1007 0.2895  443 ASP A O   
3181 C CB  . ASP A 444 ? 2.0595 2.0485 0.9326 0.0822  -0.1006 0.2691  443 ASP A CB  
3182 C CG  . ASP A 444 ? 2.1052 2.1438 0.9803 0.0996  -0.1033 0.2612  443 ASP A CG  
3183 O OD1 . ASP A 444 ? 2.1156 2.1898 0.9920 0.0877  -0.0993 0.2564  443 ASP A OD1 
3184 O OD2 . ASP A 444 ? 2.1249 2.1674 1.0009 0.1260  -0.1100 0.2591  443 ASP A OD2 
3185 N N   . LEU A 445 ? 2.1003 2.0359 0.9770 0.0343  -0.0924 0.2820  444 LEU A N   
3186 C CA  . LEU A 445 ? 2.0775 2.0002 0.9705 0.0267  -0.0868 0.2880  444 LEU A CA  
3187 C C   . LEU A 445 ? 2.0820 1.9925 0.9837 0.0292  -0.0875 0.2936  444 LEU A C   
3188 O O   . LEU A 445 ? 2.0657 1.9466 0.9772 0.0326  -0.0862 0.2972  444 LEU A O   
3189 C CB  . LEU A 445 ? 2.0798 2.0189 0.9746 0.0201  -0.0769 0.2831  444 LEU A CB  
3190 C CG  . LEU A 445 ? 2.1069 2.0482 0.9949 0.0198  -0.0735 0.2780  444 LEU A CG  
3191 C CD1 . LEU A 445 ? 2.1307 2.0660 1.0029 0.0062  -0.0685 0.2696  444 LEU A CD1 
3192 C CD2 . LEU A 445 ? 2.1024 2.0068 0.9979 0.0158  -0.0735 0.2805  444 LEU A CD2 
3193 N N   . ALA A 446 ? 2.1005 2.0292 0.9954 0.0246  -0.0906 0.2934  445 ALA A N   
3194 C CA  . ALA A 446 ? 2.0904 2.0133 0.9931 0.0266  -0.0915 0.2991  445 ALA A CA  
3195 C C   . ALA A 446 ? 2.0996 1.9980 1.0057 0.0427  -0.0977 0.3053  445 ALA A C   
3196 O O   . ALA A 446 ? 2.0871 1.9747 1.0017 0.0431  -0.0981 0.3116  445 ALA A O   
3197 C CB  . ALA A 446 ? 2.1131 2.0467 1.0032 0.0177  -0.0938 0.2934  445 ALA A CB  
3198 N N   . GLU A 447 ? 2.1235 2.0160 1.0237 0.0580  -0.1026 0.3038  446 GLU A N   
3199 C CA  . GLU A 447 ? 2.1143 1.9837 1.0171 0.0755  -0.1095 0.3104  446 GLU A CA  
3200 C C   . GLU A 447 ? 2.1109 1.9475 1.0237 0.0730  -0.1077 0.3153  446 GLU A C   
3201 O O   . GLU A 447 ? 2.0991 1.9170 1.0172 0.0765  -0.1113 0.3233  446 GLU A O   
3202 C CB  . GLU A 447 ? 2.1295 2.0035 1.0233 0.0964  -0.1157 0.3059  446 GLU A CB  
3203 C CG  . GLU A 447 ? 2.1638 2.0128 1.0561 0.1164  -0.1254 0.3124  446 GLU A CG  
3204 C CD  . GLU A 447 ? 2.2451 2.1099 1.1333 0.1268  -0.1315 0.3148  446 GLU A CD  
3205 O OE1 . GLU A 447 ? 2.2265 2.1238 1.1093 0.1362  -0.1324 0.3072  446 GLU A OE1 
3206 O OE2 . GLU A 447 ? 2.2133 2.0609 1.1047 0.1253  -0.1353 0.3243  446 GLU A OE2 
3207 N N   . ILE A 448 ? 2.0730 1.9030 0.9880 0.0664  -0.1022 0.3107  447 ILE A N   
3208 C CA  . ILE A 448 ? 2.0571 1.8553 0.9809 0.0648  -0.1003 0.3136  447 ILE A CA  
3209 C C   . ILE A 448 ? 2.0642 1.8606 0.9984 0.0515  -0.0943 0.3153  447 ILE A C   
3210 O O   . ILE A 448 ? 2.0496 1.8254 0.9919 0.0513  -0.0947 0.3204  447 ILE A O   
3211 C CB  . ILE A 448 ? 2.0699 1.8603 0.9910 0.0648  -0.0975 0.3073  447 ILE A CB  
3212 C CG1 . ILE A 448 ? 2.0868 1.8842 0.9962 0.0811  -0.1038 0.3039  447 ILE A CG1 
3213 C CG2 . ILE A 448 ? 2.0532 1.8094 0.9825 0.0639  -0.0964 0.3096  447 ILE A CG2 
3214 C CD1 . ILE A 448 ? 2.1467 1.9183 1.0535 0.0990  -0.1130 0.3089  447 ILE A CD1 
3215 N N   . LEU A 449 ? 2.0871 1.9059 1.0200 0.0413  -0.0891 0.3106  448 LEU A N   
3216 C CA  . LEU A 449 ? 2.0828 1.8978 1.0224 0.0321  -0.0840 0.3097  448 LEU A CA  
3217 C C   . LEU A 449 ? 2.0939 1.9136 1.0387 0.0341  -0.0866 0.3168  448 LEU A C   
3218 O O   . LEU A 449 ? 2.0857 1.8938 1.0379 0.0310  -0.0847 0.3187  448 LEU A O   
3219 C CB  . LEU A 449 ? 2.0933 1.9272 1.0267 0.0229  -0.0794 0.3022  448 LEU A CB  
3220 C CG  . LEU A 449 ? 2.1176 1.9448 1.0462 0.0169  -0.0759 0.2955  448 LEU A CG  
3221 C CD1 . LEU A 449 ? 2.1307 1.9782 1.0496 0.0082  -0.0731 0.2891  448 LEU A CD1 
3222 C CD2 . LEU A 449 ? 2.1234 1.9193 1.0579 0.0121  -0.0732 0.2934  448 LEU A CD2 
3223 N N   . GLN A 450 ? 2.0777 1.9157 1.0178 0.0389  -0.0915 0.3206  449 GLN A N   
3224 C CA  . GLN A 450 ? 2.0717 1.9178 1.0157 0.0392  -0.0941 0.3277  449 GLN A CA  
3225 C C   . GLN A 450 ? 2.0767 1.9001 1.0269 0.0446  -0.0984 0.3369  449 GLN A C   
3226 O O   . GLN A 450 ? 2.0694 1.8971 1.0255 0.0421  -0.0986 0.3432  449 GLN A O   
3227 C CB  . GLN A 450 ? 2.0861 1.9555 1.0214 0.0414  -0.0991 0.3286  449 GLN A CB  
3228 C CG  . GLN A 450 ? 2.1426 2.0302 1.0799 0.0364  -0.0996 0.3324  449 GLN A CG  
3229 C CD  . GLN A 450 ? 2.2337 2.1406 1.1581 0.0334  -0.1039 0.3292  449 GLN A CD  
3230 O OE1 . GLN A 450 ? 2.2284 2.1325 1.1424 0.0412  -0.1082 0.3263  449 GLN A OE1 
3231 N NE2 . GLN A 450 ? 2.2033 2.1238 1.1284 0.0247  -0.1023 0.3259  449 GLN A NE2 
3232 N N   . ALA A 451 ? 2.0806 1.8812 1.0286 0.0518  -0.1020 0.3378  450 ALA A N   
3233 C CA  . ALA A 451 ? 2.0690 1.8447 1.0213 0.0562  -0.1066 0.3463  450 ALA A CA  
3234 C C   . ALA A 451 ? 2.0745 1.8343 1.0362 0.0491  -0.1013 0.3454  450 ALA A C   
3235 O O   . ALA A 451 ? 2.0646 1.8132 1.0319 0.0480  -0.1033 0.3533  450 ALA A O   
3236 C CB  . ALA A 451 ? 2.0739 1.8295 1.0172 0.0690  -0.1141 0.3465  450 ALA A CB  
3237 N N   . ALA A 452 ? 2.0663 1.8252 1.0287 0.0441  -0.0949 0.3361  451 ALA A N   
3238 C CA  . ALA A 452 ? 2.0565 1.7994 1.0262 0.0383  -0.0905 0.3339  451 ALA A CA  
3239 C C   . ALA A 452 ? 2.0449 1.8017 1.0189 0.0306  -0.0853 0.3312  451 ALA A C   
3240 O O   . ALA A 452 ? 2.0383 1.7847 1.0176 0.0268  -0.0825 0.3299  451 ALA A O   
3241 C CB  . ALA A 452 ? 2.0539 1.7838 1.0207 0.0377  -0.0876 0.3254  451 ALA A CB  
3242 N N   . ALA A 453 ? 2.0651 1.8454 1.0355 0.0293  -0.0845 0.3298  452 ALA A N   
3243 C CA  . ALA A 453 ? 2.0687 1.8610 1.0398 0.0239  -0.0807 0.3256  452 ALA A CA  
3244 C C   . ALA A 453 ? 2.0770 1.8768 1.0545 0.0242  -0.0818 0.3339  452 ALA A C   
3245 O O   . ALA A 453 ? 2.0792 1.8799 1.0588 0.0210  -0.0791 0.3309  452 ALA A O   
3246 C CB  . ALA A 453 ? 2.0790 1.8937 1.0426 0.0227  -0.0800 0.3211  452 ALA A CB  
3247 N N   . LEU A 454 ? 2.0604 1.8665 1.0396 0.0281  -0.0864 0.3444  453 LEU A N   
3248 C CA  . LEU A 454 ? 2.0521 1.8685 1.0364 0.0278  -0.0875 0.3540  453 LEU A CA  
3249 C C   . LEU A 454 ? 2.0595 1.8557 1.0492 0.0271  -0.0887 0.3602  453 LEU A C   
3250 O O   . LEU A 454 ? 2.0579 1.8603 1.0515 0.0243  -0.0863 0.3624  453 LEU A O   
3251 C CB  . LEU A 454 ? 2.0492 1.8807 1.0313 0.0317  -0.0925 0.3633  453 LEU A CB  
3252 C CG  . LEU A 454 ? 2.0728 1.9298 1.0498 0.0316  -0.0915 0.3584  453 LEU A CG  
3253 C CD1 . LEU A 454 ? 2.0924 1.9624 1.0669 0.0350  -0.0978 0.3682  453 LEU A CD1 
3254 C CD2 . LEU A 454 ? 2.0835 1.9589 1.0610 0.0291  -0.0865 0.3533  453 LEU A CD2 
3255 N N   . GLU A 455 ? 1.9758 1.7486 0.9641 0.0302  -0.0929 0.3626  454 GLU A N   
3256 C CA  . GLU A 455 ? 2.0072 1.7580 0.9991 0.0291  -0.0950 0.3682  454 GLU A CA  
3257 C C   . GLU A 455 ? 2.0875 1.8142 1.0786 0.0297  -0.0939 0.3600  454 GLU A C   
3258 O O   . GLU A 455 ? 1.9718 1.6896 0.9672 0.0257  -0.0906 0.3570  454 GLU A O   
3259 C CB  . GLU A 455 ? 2.0056 1.7457 0.9942 0.0332  -0.1032 0.3804  454 GLU A CB  
3260 N N   . ASP B 6   ? 1.2145 1.1329 2.0716 0.1353  0.0200  -0.1226 8   ASP B N   
3261 C CA  . ASP B 6   ? 1.4072 1.2051 2.1127 0.1255  0.0038  -0.1300 8   ASP B CA  
3262 C C   . ASP B 6   ? 1.5244 1.3125 2.2030 0.0952  -0.1116 -0.1661 8   ASP B C   
3263 O O   . ASP B 6   ? 1.5952 1.3467 2.1803 0.1024  -0.1465 -0.1547 8   ASP B O   
3264 C CB  . ASP B 6   ? 1.5786 1.2405 2.1958 0.0997  0.0706  -0.1472 8   ASP B CB  
3265 C CG  . ASP B 6   ? 1.7776 1.3111 2.2332 0.1016  0.1055  -0.1389 8   ASP B CG  
3266 O OD1 . ASP B 6   ? 1.7126 1.2600 2.1568 0.1475  0.1706  -0.0902 8   ASP B OD1 
3267 O OD2 . ASP B 6   ? 1.9910 1.4108 2.3302 0.0520  0.0689  -0.1800 8   ASP B OD2 
3268 N N   . PRO B 7   ? 1.4624 1.2857 2.2255 0.0604  -0.1730 -0.2049 9   PRO B N   
3269 C CA  . PRO B 7   ? 1.5472 1.3794 2.3100 0.0375  -0.2908 -0.2258 9   PRO B CA  
3270 C C   . PRO B 7   ? 1.3941 1.3237 2.2296 0.0790  -0.3348 -0.2034 9   PRO B C   
3271 O O   . PRO B 7   ? 1.4803 1.3795 2.2519 0.0761  -0.4101 -0.1998 9   PRO B O   
3272 C CB  . PRO B 7   ? 1.5668 1.4433 2.4422 -0.0035 -0.3335 -0.2639 9   PRO B CB  
3273 C CG  . PRO B 7   ? 1.4125 1.3478 2.3869 0.0125  -0.2438 -0.2606 9   PRO B CG  
3274 C CD  . PRO B 7   ? 1.4264 1.2787 2.2862 0.0359  -0.1436 -0.2295 9   PRO B CD  
3275 N N   . LYS B 8   ? 1.3489 1.3864 2.3068 0.1117  -0.2880 -0.1884 10  LYS B N   
3276 C CA  . LYS B 8   ? 1.2147 1.3304 2.2245 0.1457  -0.3131 -0.1686 10  LYS B CA  
3277 C C   . LYS B 8   ? 1.2213 1.3044 2.1128 0.1723  -0.2677 -0.1261 10  LYS B C   
3278 O O   . LYS B 8   ? 1.1894 1.2929 2.0608 0.1898  -0.3049 -0.1114 10  LYS B O   
3279 C CB  . LYS B 8   ? 1.1024 1.3380 2.2743 0.1573  -0.2762 -0.1729 10  LYS B CB  
3280 N N   . PHE B 9   ? 1.1847 1.2180 2.0036 0.1758  -0.1855 -0.1043 11  PHE B N   
3281 C CA  . PHE B 9   ? 1.1997 1.2101 1.9189 0.2006  -0.1393 -0.0598 11  PHE B CA  
3282 C C   . PHE B 9   ? 1.4082 1.3218 1.9858 0.1894  -0.1935 -0.0670 11  PHE B C   
3283 O O   . PHE B 9   ? 1.3967 1.3172 1.9118 0.2065  -0.1957 -0.0385 11  PHE B O   
3284 C CB  . PHE B 9   ? 1.2212 1.1966 1.9144 0.2105  -0.0379 -0.0322 11  PHE B CB  
3285 C CG  . PHE B 9   ? 1.3602 1.2499 1.9191 0.2226  0.0040  -0.0052 11  PHE B CG  
3286 C CD1 . PHE B 9   ? 1.2948 1.2381 1.8328 0.2505  0.0295  0.0448  11  PHE B CD1 
3287 C CD2 . PHE B 9   ? 1.5736 1.3275 2.0248 0.2002  0.0237  -0.0313 11  PHE B CD2 
3288 C CE1 . PHE B 9   ? 1.4177 1.2902 1.8449 0.2615  0.0736  0.0692  11  PHE B CE1 
3289 C CE2 . PHE B 9   ? 1.7031 1.3730 2.0337 0.2096  0.0742  -0.0111 11  PHE B CE2 
3290 C CZ  . PHE B 9   ? 1.6118 1.3458 1.9380 0.2433  0.0996  0.0398  11  PHE B CZ  
3291 N N   . GLU B 10  ? 1.3543 1.1747 1.8704 0.1526  -0.2387 -0.1043 12  GLU B N   
3292 C CA  . GLU B 10  ? 1.5505 1.2691 1.9178 0.1292  -0.2966 -0.1123 12  GLU B CA  
3293 C C   . GLU B 10  ? 1.5163 1.2851 1.9141 0.1377  -0.3923 -0.1086 12  GLU B C   
3294 O O   . GLU B 10  ? 1.5728 1.3032 1.8661 0.1430  -0.4109 -0.0899 12  GLU B O   
3295 C CB  . GLU B 10  ? 1.7453 1.3567 2.0388 0.0740  -0.3310 -0.1522 12  GLU B CB  
3296 C CG  . GLU B 10  ? 1.9713 1.4689 2.0980 0.0341  -0.4007 -0.1618 12  GLU B CG  
3297 C CD  . GLU B 10  ? 2.1621 1.5503 2.1230 0.0326  -0.3194 -0.1497 12  GLU B CD  
3298 O OE1 . GLU B 10  ? 2.1188 1.4853 2.0835 0.0487  -0.2106 -0.1437 12  GLU B OE1 
3299 O OE2 . GLU B 10  ? 2.2380 1.5603 2.0693 0.0156  -0.3618 -0.1447 12  GLU B OE2 
3300 N N   . SER B 11  ? 1.5239 1.3752 2.0685 0.1390  -0.4498 -0.1262 13  SER B N   
3301 C CA  . SER B 11  ? 1.4358 1.3316 2.0318 0.1531  -0.5345 -0.1220 13  SER B CA  
3302 C C   . SER B 11  ? 1.2905 1.2455 1.8954 0.1909  -0.4910 -0.0912 13  SER B C   
3303 O O   . SER B 11  ? 1.2929 1.2320 1.8515 0.1992  -0.5431 -0.0792 13  SER B O   
3304 C CB  . SER B 11  ? 1.3204 1.3025 2.1000 0.1522  -0.5858 -0.1464 13  SER B CB  
3305 O OG  . SER B 11  ? 1.1809 1.2519 2.0842 0.1681  -0.5064 -0.1512 13  SER B OG  
3306 N N   . LYS B 12  ? 1.2664 1.2870 1.9245 0.2083  -0.3987 -0.0752 14  LYS B N   
3307 C CA  . LYS B 12  ? 1.1318 1.2135 1.7894 0.2316  -0.3575 -0.0420 14  LYS B CA  
3308 C C   . LYS B 12  ? 1.2661 1.2836 1.7629 0.2328  -0.3353 -0.0105 14  LYS B C   
3309 O O   . LYS B 12  ? 1.2329 1.2633 1.6837 0.2404  -0.3499 0.0094  14  LYS B O   
3310 C CB  . LYS B 12  ? 1.0221 1.1941 1.7766 0.2396  -0.2725 -0.0268 14  LYS B CB  
3311 C CG  . LYS B 12  ? 0.9918 1.2471 1.9077 0.2382  -0.2847 -0.0549 14  LYS B CG  
3312 C CD  . LYS B 12  ? 0.9312 1.2725 1.9156 0.2372  -0.2015 -0.0335 14  LYS B CD  
3313 C CE  . LYS B 12  ? 0.9084 1.3164 2.0168 0.2246  -0.2006 -0.0646 14  LYS B CE  
3314 N NZ  . LYS B 12  ? 0.8769 1.3463 1.9915 0.2058  -0.1199 -0.0410 14  LYS B NZ  
3315 N N   . ALA B 13  ? 1.2398 1.1838 1.6491 0.2232  -0.2933 -0.0073 15  ALA B N   
3316 C CA  . ALA B 13  ? 1.3498 1.2320 1.6143 0.2236  -0.2616 0.0198  15  ALA B CA  
3317 C C   . ALA B 13  ? 1.4946 1.2933 1.6409 0.2041  -0.3462 0.0062  15  ALA B C   
3318 O O   . ALA B 13  ? 1.5326 1.3110 1.5786 0.2057  -0.3373 0.0305  15  ALA B O   
3319 C CB  . ALA B 13  ? 1.4740 1.2810 1.6782 0.2173  -0.1893 0.0197  15  ALA B CB  
3320 N N   . ALA B 14  ? 1.4272 1.1787 1.5832 0.1817  -0.4314 -0.0283 16  ALA B N   
3321 C CA  . ALA B 14  ? 1.5283 1.1988 1.5750 0.1596  -0.5233 -0.0343 16  ALA B CA  
3322 C C   . ALA B 14  ? 1.4624 1.1888 1.5458 0.1827  -0.5626 -0.0160 16  ALA B C   
3323 O O   . ALA B 14  ? 1.5329 1.1947 1.4928 0.1718  -0.6024 -0.0043 16  ALA B O   
3324 C CB  . ALA B 14  ? 1.6121 1.2377 1.6825 0.1277  -0.6139 -0.0654 16  ALA B CB  
3325 N N   . LEU B 15  ? 1.4870 1.3224 1.7295 0.2096  -0.5475 -0.0157 17  LEU B N   
3326 C CA  . LEU B 15  ? 1.3637 1.2418 1.6378 0.2278  -0.5699 -0.0026 17  LEU B CA  
3327 C C   . LEU B 15  ? 1.3639 1.2488 1.5318 0.2292  -0.5086 0.0314  17  LEU B C   
3328 O O   . LEU B 15  ? 1.3720 1.2216 1.4583 0.2260  -0.5432 0.0433  17  LEU B O   
3329 C CB  . LEU B 15  ? 1.1804 1.1661 1.6409 0.2480  -0.5489 -0.0152 17  LEU B CB  
3330 C CG  . LEU B 15  ? 1.1339 1.1591 1.6358 0.2631  -0.5532 -0.0081 17  LEU B CG  
3331 C CD1 . LEU B 15  ? 1.2251 1.1809 1.6930 0.2543  -0.6224 -0.0175 17  LEU B CD1 
3332 C CD2 . LEU B 15  ? 1.0372 1.1606 1.6943 0.2674  -0.4948 -0.0238 17  LEU B CD2 
3333 N N   . LEU B 16  ? 1.3302 1.2625 1.5023 0.2326  -0.4187 0.0514  18  LEU B N   
3334 C CA  . LEU B 16  ? 1.3142 1.2749 1.4065 0.2320  -0.3602 0.0919  18  LEU B CA  
3335 C C   . LEU B 16  ? 1.5073 1.3670 1.4288 0.2156  -0.3698 0.0997  18  LEU B C   
3336 O O   . LEU B 16  ? 1.4974 1.3543 1.3291 0.2077  -0.3653 0.1238  18  LEU B O   
3337 C CB  . LEU B 16  ? 1.2355 1.2814 1.3973 0.2421  -0.2671 0.1207  18  LEU B CB  
3338 C CG  . LEU B 16  ? 1.0618 1.2157 1.3683 0.2477  -0.2431 0.1223  18  LEU B CG  
3339 C CD1 . LEU B 16  ? 0.9983 1.2136 1.3695 0.2549  -0.1633 0.1505  18  LEU B CD1 
3340 C CD2 . LEU B 16  ? 1.0048 1.2151 1.2960 0.2372  -0.2402 0.1443  18  LEU B CD2 
3341 N N   . ALA B 17  ? 1.5138 1.2852 1.3798 0.2030  -0.3784 0.0776  19  ALA B N   
3342 C CA  . ALA B 17  ? 1.7032 1.3654 1.3957 0.1788  -0.3780 0.0790  19  ALA B CA  
3343 C C   . ALA B 17  ? 1.7387 1.3293 1.3291 0.1584  -0.4709 0.0717  19  ALA B C   
3344 O O   . ALA B 17  ? 1.7855 1.3236 1.2373 0.1409  -0.4630 0.0866  19  ALA B O   
3345 C CB  . ALA B 17  ? 1.9020 1.4700 1.5476 0.1587  -0.3661 0.0500  19  ALA B CB  
3346 N N   . ALA B 18  ? 1.8112 1.3988 1.4736 0.1606  -0.5588 0.0517  20  ALA B N   
3347 C CA  . ALA B 18  ? 1.8123 1.3322 1.3947 0.1471  -0.6514 0.0524  20  ALA B CA  
3348 C C   . ALA B 18  ? 1.6836 1.2532 1.2585 0.1607  -0.6312 0.0773  20  ALA B C   
3349 O O   . ALA B 18  ? 1.6944 1.2111 1.1734 0.1334  -0.6342 0.0793  20  ALA B O   
3350 C CB  . ALA B 18  ? 1.7837 1.3047 1.4791 0.1529  -0.7449 0.0328  20  ALA B CB  
3351 N N   . ARG B 19  ? 1.7736 1.4598 1.4711 0.1850  -0.5689 0.0884  21  ARG B N   
3352 C CA  . ARG B 19  ? 1.6624 1.3952 1.3428 0.1861  -0.5445 0.1112  21  ARG B CA  
3353 C C   . ARG B 19  ? 1.7033 1.4314 1.2479 0.1661  -0.4864 0.1422  21  ARG B C   
3354 O O   . ARG B 19  ? 1.7318 1.4397 1.1967 0.1389  -0.4754 0.1467  21  ARG B O   
3355 C CB  . ARG B 19  ? 1.5254 1.3794 1.3638 0.2046  -0.4943 0.1136  21  ARG B CB  
3356 C CG  . ARG B 19  ? 1.5421 1.4019 1.5030 0.2222  -0.5482 0.0864  21  ARG B CG  
3357 C CD  . ARG B 19  ? 1.5423 1.4274 1.5026 0.2181  -0.5313 0.0949  21  ARG B CD  
3358 N NE  . ARG B 19  ? 1.5632 1.4429 1.6447 0.2358  -0.5657 0.0666  21  ARG B NE  
3359 C CZ  . ARG B 19  ? 1.6970 1.4958 1.7463 0.2338  -0.6130 0.0566  21  ARG B CZ  
3360 N NH1 . ARG B 19  ? 1.7407 1.4575 1.6369 0.2095  -0.6313 0.0687  21  ARG B NH1 
3361 N NH2 . ARG B 19  ? 1.6294 1.4315 1.8093 0.2558  -0.6363 0.0352  21  ARG B NH2 
3362 N N   . GLY B 20  ? 1.2129 1.4721 1.6051 0.3865  0.0811  0.1505  22  GLY B N   
3363 C CA  . GLY B 20  ? 1.2330 1.4492 1.6458 0.3832  0.1414  0.1534  22  GLY B CA  
3364 C C   . GLY B 20  ? 1.3092 1.4847 1.6528 0.3877  0.1428  0.1384  22  GLY B C   
3365 O O   . GLY B 20  ? 1.2723 1.4683 1.6544 0.3641  0.1237  0.1147  22  GLY B O   
3366 N N   . PRO B 21  ? 1.2671 1.3731 1.4955 0.4217  0.1673  0.1526  23  PRO B N   
3367 C CA  . PRO B 21  ? 1.4019 1.4561 1.5519 0.4302  0.1775  0.1378  23  PRO B CA  
3368 C C   . PRO B 21  ? 1.3638 1.3976 1.5693 0.4289  0.2478  0.1369  23  PRO B C   
3369 O O   . PRO B 21  ? 1.2685 1.3281 1.5699 0.4188  0.2898  0.1468  23  PRO B O   
3370 C CB  . PRO B 21  ? 1.6011 1.5868 1.6011 0.4708  0.1812  0.1555  23  PRO B CB  
3371 C CG  . PRO B 21  ? 1.5796 1.5559 1.5892 0.4904  0.2106  0.1892  23  PRO B CG  
3372 C CD  . PRO B 21  ? 1.3554 1.4158 1.5060 0.4588  0.1879  0.1842  23  PRO B CD  
3373 N N   . GLU B 22  ? 1.4321 1.4232 1.5795 0.4386  0.2594  0.1203  24  GLU B N   
3374 C CA  . GLU B 22  ? 1.3997 1.3749 1.5898 0.4459  0.3250  0.1136  24  GLU B CA  
3375 C C   . GLU B 22  ? 1.2635 1.3150 1.6065 0.4221  0.3200  0.0965  24  GLU B C   
3376 O O   . GLU B 22  ? 1.2519 1.3162 1.6615 0.4289  0.3721  0.0882  24  GLU B O   
3377 C CB  . GLU B 22  ? 1.4355 1.3690 1.6081 0.4633  0.4082  0.1392  24  GLU B CB  
3378 C CG  . GLU B 22  ? 1.6625 1.5056 1.6656 0.4958  0.4200  0.1610  24  GLU B CG  
3379 C CD  . GLU B 22  ? 1.8790 1.6490 1.7724 0.5205  0.4531  0.1495  24  GLU B CD  
3380 O OE1 . GLU B 22  ? 1.9774 1.7131 1.7585 0.5314  0.3998  0.1363  24  GLU B OE1 
3381 O OE2 . GLU B 22  ? 1.8303 1.5803 1.7534 0.5269  0.5340  0.1500  24  GLU B OE2 
3382 N N   . GLU B 23  ? 1.2718 1.3775 1.6714 0.3963  0.2588  0.0893  25  GLU B N   
3383 C CA  . GLU B 23  ? 1.1488 1.3210 1.6771 0.3770  0.2472  0.0744  25  GLU B CA  
3384 C C   . GLU B 23  ? 1.1144 1.2913 1.6252 0.3612  0.1803  0.0564  25  GLU B C   
3385 O O   . GLU B 23  ? 1.1631 1.3209 1.5984 0.3502  0.1375  0.0559  25  GLU B O   
3386 C CB  . GLU B 23  ? 1.0698 1.2999 1.6971 0.3558  0.2534  0.0855  25  GLU B CB  
3387 C CG  . GLU B 23  ? 1.0708 1.3156 1.6736 0.3405  0.2026  0.0949  25  GLU B CG  
3388 C CD  . GLU B 23  ? 1.0557 1.3549 1.7513 0.3100  0.1937  0.0929  25  GLU B CD  
3389 O OE1 . GLU B 23  ? 0.9795 1.3051 1.7178 0.2810  0.1792  0.0698  25  GLU B OE1 
3390 O OE2 . GLU B 23  ? 1.0320 1.3328 1.7198 0.3098  0.1923  0.1097  25  GLU B OE2 
3391 N N   . LEU B 24  ? 0.9971 1.1990 1.5769 0.3605  0.1728  0.0401  26  LEU B N   
3392 C CA  . LEU B 24  ? 0.9726 1.1629 1.5302 0.3449  0.1175  0.0255  26  LEU B CA  
3393 C C   . LEU B 24  ? 0.8991 1.1373 1.4962 0.3100  0.0770  0.0305  26  LEU B C   
3394 O O   . LEU B 24  ? 0.8207 1.1176 1.5120 0.3014  0.0852  0.0359  26  LEU B O   
3395 C CB  . LEU B 24  ? 0.9555 1.1562 1.5719 0.3630  0.1197  0.0107  26  LEU B CB  
3396 C CG  . LEU B 24  ? 0.9765 1.1451 1.5587 0.3513  0.0692  -0.0008 26  LEU B CG  
3397 C CD1 . LEU B 24  ? 1.1491 1.2215 1.6034 0.3564  0.0608  -0.0108 26  LEU B CD1 
3398 C CD2 . LEU B 24  ? 0.9551 1.1532 1.6139 0.3758  0.0654  -0.0105 26  LEU B CD2 
3399 N N   . LEU B 25  ? 0.9668 1.1819 1.4939 0.2875  0.0357  0.0251  27  LEU B N   
3400 C CA  . LEU B 25  ? 0.8916 1.1544 1.4509 0.2542  0.0006  0.0268  27  LEU B CA  
3401 C C   . LEU B 25  ? 0.9480 1.1890 1.4877 0.2267  -0.0358 0.0108  27  LEU B C   
3402 O O   . LEU B 25  ? 1.0993 1.2772 1.5556 0.2214  -0.0480 -0.0027 27  LEU B O   
3403 C CB  . LEU B 25  ? 0.9625 1.2328 1.4666 0.2492  -0.0146 0.0320  27  LEU B CB  
3404 C CG  . LEU B 25  ? 0.9640 1.2376 1.4632 0.2795  0.0211  0.0534  27  LEU B CG  
3405 C CD1 . LEU B 25  ? 1.1110 1.3640 1.5120 0.2903  0.0008  0.0543  27  LEU B CD1 
3406 C CD2 . LEU B 25  ? 0.8469 1.1772 1.4351 0.2739  0.0312  0.0679  27  LEU B CD2 
3407 N N   . CYS B 26  ? 0.8151 1.0974 1.4214 0.2079  -0.0497 0.0116  28  CYS B N   
3408 C CA  . CYS B 26  ? 0.8663 1.1199 1.4474 0.1802  -0.0785 0.0005  28  CYS B CA  
3409 C C   . CYS B 26  ? 0.8025 1.1105 1.4180 0.1423  -0.0977 0.0006  28  CYS B C   
3410 O O   . CYS B 26  ? 0.6751 1.0448 1.3634 0.1461  -0.0891 0.0101  28  CYS B O   
3411 C CB  . CYS B 26  ? 0.8187 1.0597 1.4343 0.2011  -0.0768 -0.0002 28  CYS B CB  
3412 S SG  . CYS B 26  ? 0.8950 1.0880 1.4905 0.2538  -0.0515 -0.0041 28  CYS B SG  
3413 N N   . PHE B 27  ? 0.7831 1.0655 1.3470 0.1039  -0.1194 -0.0123 29  PHE B N   
3414 C CA  . PHE B 27  ? 0.7123 1.0513 1.3098 0.0654  -0.1333 -0.0166 29  PHE B CA  
3415 C C   . PHE B 27  ? 0.8374 1.1236 1.3861 0.0231  -0.1447 -0.0297 29  PHE B C   
3416 O O   . PHE B 27  ? 0.9967 1.1952 1.4694 0.0206  -0.1454 -0.0371 29  PHE B O   
3417 C CB  . PHE B 27  ? 0.7128 1.1038 1.3077 0.0567  -0.1438 -0.0227 29  PHE B CB  
3418 C CG  . PHE B 27  ? 0.8899 1.2370 1.4050 0.0324  -0.1598 -0.0439 29  PHE B CG  
3419 C CD1 . PHE B 27  ? 1.0285 1.3146 1.4773 0.0596  -0.1537 -0.0453 29  PHE B CD1 
3420 C CD2 . PHE B 27  ? 0.9217 1.2888 1.4287 -0.0213 -0.1775 -0.0661 29  PHE B CD2 
3421 C CE1 . PHE B 27  ? 1.1903 1.4293 1.5589 0.0345  -0.1691 -0.0694 29  PHE B CE1 
3422 C CE2 . PHE B 27  ? 1.0653 1.3926 1.5021 -0.0518 -0.1919 -0.0919 29  PHE B CE2 
3423 C CZ  . PHE B 27  ? 1.1901 1.4500 1.5539 -0.0234 -0.1898 -0.0940 29  PHE B CZ  
3424 N N   . THR B 28  ? 0.8355 1.1667 1.4216 -0.0100 -0.1484 -0.0323 30  THR B N   
3425 C CA  . THR B 28  ? 0.9242 1.2030 1.4617 -0.0564 -0.1502 -0.0431 30  THR B CA  
3426 C C   . THR B 28  ? 0.8497 1.2061 1.4288 -0.1033 -0.1519 -0.0569 30  THR B C   
3427 O O   . THR B 28  ? 0.7112 1.1478 1.3640 -0.0942 -0.1487 -0.0503 30  THR B O   
3428 C CB  . THR B 28  ? 0.9496 1.1878 1.4823 -0.0428 -0.1466 -0.0307 30  THR B CB  
3429 O OG1 . THR B 28  ? 0.7692 1.0905 1.3813 -0.0412 -0.1436 -0.0251 30  THR B OG1 
3430 C CG2 . THR B 28  ? 0.9792 1.1733 1.5005 0.0126  -0.1476 -0.0198 30  THR B CG2 
3431 N N   . GLU B 29  ? 0.9468 1.2816 1.4826 -0.1542 -0.1546 -0.0793 31  GLU B N   
3432 C CA  . GLU B 29  ? 0.8544 1.2706 1.4394 -0.2043 -0.1522 -0.0977 31  GLU B CA  
3433 C C   . GLU B 29  ? 0.8560 1.2429 1.4355 -0.2309 -0.1318 -0.0918 31  GLU B C   
3434 O O   . GLU B 29  ? 0.7929 1.2637 1.4403 -0.2422 -0.1238 -0.0942 31  GLU B O   
3435 C CB  . GLU B 29  ? 0.9458 1.3556 1.4953 -0.2599 -0.1589 -0.1302 31  GLU B CB  
3436 C CG  . GLU B 29  ? 1.0390 1.4391 1.5548 -0.2355 -0.1801 -0.1385 31  GLU B CG  
3437 C CD  . GLU B 29  ? 1.1992 1.6039 1.6856 -0.2972 -0.1911 -0.1785 31  GLU B CD  
3438 O OE1 . GLU B 29  ? 1.2710 1.6725 1.7602 -0.3637 -0.1755 -0.1989 31  GLU B OE1 
3439 O OE2 . GLU B 29  ? 1.1624 1.5716 1.6196 -0.2822 -0.2131 -0.1920 31  GLU B OE2 
3440 N N   . ARG B 30  ? 0.9212 1.1830 1.4116 -0.2360 -0.1227 -0.0836 32  ARG B N   
3441 C CA  . ARG B 30  ? 0.9478 1.1580 1.4063 -0.2488 -0.1060 -0.0730 32  ARG B CA  
3442 C C   . ARG B 30  ? 1.0634 1.1870 1.4700 -0.1923 -0.1156 -0.0500 32  ARG B C   
3443 O O   . ARG B 30  ? 1.1283 1.2147 1.5124 -0.1545 -0.1276 -0.0455 32  ARG B O   
3444 C CB  . ARG B 30  ? 1.0552 1.1847 1.4369 -0.3196 -0.0818 -0.0885 32  ARG B CB  
3445 C CG  . ARG B 30  ? 1.0018 1.2357 1.4519 -0.3824 -0.0690 -0.1175 32  ARG B CG  
3446 C CD  . ARG B 30  ? 1.1556 1.3025 1.5299 -0.4620 -0.0379 -0.1374 32  ARG B CD  
3447 N NE  . ARG B 30  ? 1.1546 1.4234 1.6140 -0.5250 -0.0254 -0.1718 32  ARG B NE  
3448 C CZ  . ARG B 30  ? 1.2075 1.5470 1.7086 -0.5425 -0.0450 -0.1991 32  ARG B CZ  
3449 N NH1 . ARG B 30  ? 1.1679 1.4649 1.6300 -0.5168 -0.0725 -0.2010 32  ARG B NH1 
3450 N NH2 . ARG B 30  ? 1.1601 1.5904 1.7190 -0.5546 -0.0405 -0.2115 32  ARG B NH2 
3451 N N   . LEU B 31  ? 1.0342 1.1327 1.4242 -0.1842 -0.1110 -0.0380 33  LEU B N   
3452 C CA  . LEU B 31  ? 1.1123 1.1484 1.4642 -0.1269 -0.1272 -0.0204 33  LEU B CA  
3453 C C   . LEU B 31  ? 1.3295 1.2266 1.5672 -0.1153 -0.1293 -0.0157 33  LEU B C   
3454 O O   . LEU B 31  ? 1.3827 1.2448 1.6047 -0.0561 -0.1469 -0.0052 33  LEU B O   
3455 C CB  . LEU B 31  ? 1.1119 1.1374 1.4470 -0.1259 -0.1255 -0.0128 33  LEU B CB  
3456 C CG  . LEU B 31  ? 0.9175 1.0667 1.3578 -0.1317 -0.1210 -0.0185 33  LEU B CG  
3457 C CD1 . LEU B 31  ? 0.9445 1.0663 1.3470 -0.1345 -0.1176 -0.0145 33  LEU B CD1 
3458 C CD2 . LEU B 31  ? 0.7648 0.9975 1.3002 -0.0829 -0.1378 -0.0161 33  LEU B CD2 
3459 N N   . GLU B 32  ? 1.2421 1.0583 1.4012 -0.1713 -0.1089 -0.0256 34  GLU B N   
3460 C CA  . GLU B 32  ? 1.4158 1.0741 1.4477 -0.1632 -0.1050 -0.0210 34  GLU B CA  
3461 C C   . GLU B 32  ? 1.4387 1.0934 1.4796 -0.1265 -0.1176 -0.0265 34  GLU B C   
3462 O O   . GLU B 32  ? 1.5232 1.0797 1.4937 -0.0758 -0.1253 -0.0162 34  GLU B O   
3463 C CB  . GLU B 32  ? 1.4981 1.0672 1.4460 -0.2440 -0.0725 -0.0347 34  GLU B CB  
3464 C CG  . GLU B 32  ? 1.7253 1.0948 1.5132 -0.2389 -0.0599 -0.0253 34  GLU B CG  
3465 C CD  . GLU B 32  ? 1.8830 1.1605 1.5924 -0.3301 -0.0206 -0.0447 34  GLU B CD  
3466 O OE1 . GLU B 32  ? 1.8154 1.1480 1.5717 -0.3771 -0.0168 -0.0734 34  GLU B OE1 
3467 O OE2 . GLU B 32  ? 1.9674 1.1161 1.5653 -0.3564 0.0073  -0.0330 34  GLU B OE2 
3468 N N   . ASP B 33  ? 1.3456 1.1027 1.4658 -0.1467 -0.1195 -0.0430 35  ASP B N   
3469 C CA  . ASP B 33  ? 1.3716 1.1164 1.4837 -0.1203 -0.1264 -0.0511 35  ASP B CA  
3470 C C   . ASP B 33  ? 1.2849 1.1351 1.4947 -0.0587 -0.1400 -0.0406 35  ASP B C   
3471 O O   . ASP B 33  ? 1.1746 1.1149 1.4662 -0.0446 -0.1449 -0.0308 35  ASP B O   
3472 C CB  . ASP B 33  ? 1.3679 1.1451 1.4847 -0.1822 -0.1218 -0.0790 35  ASP B CB  
3473 C CG  . ASP B 33  ? 1.2342 1.1768 1.4719 -0.1922 -0.1315 -0.0854 35  ASP B CG  
3474 O OD1 . ASP B 33  ? 1.1684 1.1723 1.4533 -0.2267 -0.1243 -0.0868 35  ASP B OD1 
3475 O OD2 . ASP B 33  ? 1.1904 1.1948 1.4688 -0.1608 -0.1438 -0.0876 35  ASP B OD2 
3476 N N   . LEU B 34  ? 1.2244 1.0547 1.4191 -0.0253 -0.1411 -0.0448 36  LEU B N   
3477 C CA  . LEU B 34  ? 1.1333 1.0502 1.4099 0.0271  -0.1435 -0.0368 36  LEU B CA  
3478 C C   . LEU B 34  ? 1.2033 1.0822 1.4366 0.0455  -0.1376 -0.0469 36  LEU B C   
3479 O O   . LEU B 34  ? 1.2990 1.0643 1.4430 0.0598  -0.1326 -0.0519 36  LEU B O   
3480 C CB  . LEU B 34  ? 1.0480 0.9664 1.3565 0.0847  -0.1476 -0.0210 36  LEU B CB  
3481 C CG  . LEU B 34  ? 0.8978 0.9103 1.3036 0.1305  -0.1419 -0.0154 36  LEU B CG  
3482 C CD1 . LEU B 34  ? 0.7661 0.8576 1.2589 0.1427  -0.1492 -0.0076 36  LEU B CD1 
3483 C CD2 . LEU B 34  ? 0.9363 0.8977 1.3156 0.1859  -0.1337 -0.0161 36  LEU B CD2 
3484 N N   . VAL B 35  ? 1.0959 1.0589 1.3805 0.0490  -0.1369 -0.0498 37  VAL B N   
3485 C CA  . VAL B 35  ? 1.1613 1.0922 1.3966 0.0657  -0.1312 -0.0603 37  VAL B CA  
3486 C C   . VAL B 35  ? 1.0425 1.0417 1.3442 0.1176  -0.1170 -0.0454 37  VAL B C   
3487 O O   . VAL B 35  ? 0.9084 1.0021 1.2905 0.1166  -0.1175 -0.0348 37  VAL B O   
3488 C CB  . VAL B 35  ? 1.2152 1.1694 1.4221 0.0142  -0.1453 -0.0825 37  VAL B CB  
3489 C CG1 . VAL B 35  ? 1.2998 1.2052 1.4345 0.0327  -0.1424 -0.0964 37  VAL B CG1 
3490 C CG2 . VAL B 35  ? 1.2519 1.1506 1.4098 -0.0502 -0.1515 -0.1006 37  VAL B CG2 
3491 N N   . CYS B 36  ? 1.2069 1.1519 1.4721 0.1621  -0.0990 -0.0454 38  CYS B N   
3492 C CA  . CYS B 36  ? 1.1133 1.1088 1.4305 0.2074  -0.0743 -0.0339 38  CYS B CA  
3493 C C   . CYS B 36  ? 1.2494 1.1969 1.4851 0.2192  -0.0621 -0.0441 38  CYS B C   
3494 O O   . CYS B 36  ? 1.3781 1.2301 1.5217 0.2186  -0.0629 -0.0603 38  CYS B O   
3495 C CB  . CYS B 36  ? 1.0379 1.0292 1.4017 0.2557  -0.0569 -0.0271 38  CYS B CB  
3496 S SG  . CYS B 36  ? 0.8946 0.9533 1.3563 0.2513  -0.0741 -0.0173 38  CYS B SG  
3497 N N   . PHE B 37  ? 1.1809 1.1833 1.4384 0.2311  -0.0499 -0.0349 39  PHE B N   
3498 C CA  . PHE B 37  ? 1.3018 1.2595 1.4708 0.2458  -0.0395 -0.0431 39  PHE B CA  
3499 C C   . PHE B 37  ? 1.2475 1.2435 1.4512 0.2851  -0.0018 -0.0229 39  PHE B C   
3500 O O   . PHE B 37  ? 1.0987 1.1645 1.3978 0.2898  0.0106  -0.0050 39  PHE B O   
3501 C CB  . PHE B 37  ? 1.4016 1.3705 1.5156 0.2046  -0.0773 -0.0593 39  PHE B CB  
3502 C CG  . PHE B 37  ? 1.3098 1.3783 1.4894 0.1971  -0.0916 -0.0449 39  PHE B CG  
3503 C CD1 . PHE B 37  ? 1.1986 1.3327 1.4635 0.1684  -0.1077 -0.0398 39  PHE B CD1 
3504 C CD2 . PHE B 37  ? 1.3491 1.4363 1.4942 0.2234  -0.0873 -0.0359 39  PHE B CD2 
3505 C CE1 . PHE B 37  ? 1.0876 1.3078 1.4106 0.1670  -0.1183 -0.0278 39  PHE B CE1 
3506 C CE2 . PHE B 37  ? 1.2626 1.4307 1.4596 0.2252  -0.1003 -0.0210 39  PHE B CE2 
3507 C CZ  . PHE B 37  ? 1.1110 1.3476 1.4012 0.1975  -0.1154 -0.0179 39  PHE B CZ  
3508 N N   . TRP B 38  ? 1.2198 1.1597 1.3358 0.3107  0.0202  -0.0274 40  TRP B N   
3509 C CA  . TRP B 38  ? 1.1990 1.1539 1.3185 0.3450  0.0627  -0.0078 40  TRP B CA  
3510 C C   . TRP B 38  ? 1.3746 1.2619 1.3579 0.3587  0.0639  -0.0173 40  TRP B C   
3511 O O   . TRP B 38  ? 1.4853 1.2994 1.3836 0.3556  0.0545  -0.0414 40  TRP B O   
3512 C CB  . TRP B 38  ? 1.1125 1.0694 1.2984 0.3791  0.1175  -0.0008 40  TRP B CB  
3513 C CG  . TRP B 38  ? 1.2193 1.0953 1.3309 0.4096  0.1457  -0.0170 40  TRP B CG  
3514 C CD1 . TRP B 38  ? 1.3162 1.1400 1.3490 0.4405  0.1907  -0.0160 40  TRP B CD1 
3515 C CD2 . TRP B 38  ? 1.2485 1.0770 1.3488 0.4168  0.1347  -0.0360 40  TRP B CD2 
3516 N NE1 . TRP B 38  ? 1.3991 1.1521 1.3790 0.4657  0.2091  -0.0359 40  TRP B NE1 
3517 C CE2 . TRP B 38  ? 1.3623 1.1146 1.3821 0.4539  0.1743  -0.0477 40  TRP B CE2 
3518 C CE3 . TRP B 38  ? 1.2065 1.0389 1.3457 0.3989  0.0978  -0.0428 40  TRP B CE3 
3519 C CZ2 . TRP B 38  ? 1.4328 1.1143 1.4152 0.4768  0.1766  -0.0668 40  TRP B CZ2 
3520 C CZ3 . TRP B 38  ? 1.2832 1.0386 1.3769 0.4218  0.0993  -0.0588 40  TRP B CZ3 
3521 C CH2 . TRP B 38  ? 1.3939 1.0756 1.4127 0.4618  0.1378  -0.0709 40  TRP B CH2 
3522 N N   . GLU B 39  ? 1.3178 1.2206 1.2705 0.3756  0.0752  0.0012  41  GLU B N   
3523 C CA  . GLU B 39  ? 1.4922 1.3330 1.3040 0.3942  0.0721  -0.0058 41  GLU B CA  
3524 C C   . GLU B 39  ? 1.5330 1.3131 1.2986 0.4377  0.1444  0.0070  41  GLU B C   
3525 O O   . GLU B 39  ? 1.4695 1.2752 1.2929 0.4557  0.1923  0.0344  41  GLU B O   
3526 C CB  . GLU B 39  ? 1.5316 1.4178 1.3180 0.3951  0.0367  0.0075  41  GLU B CB  
3527 C CG  . GLU B 39  ? 1.5238 1.4737 1.3420 0.3520  -0.0347 -0.0134 41  GLU B CG  
3528 C CD  . GLU B 39  ? 1.5581 1.5582 1.3444 0.3639  -0.0743 -0.0054 41  GLU B CD  
3529 O OE1 . GLU B 39  ? 1.6249 1.5883 1.3350 0.4086  -0.0496 0.0171  41  GLU B OE1 
3530 O OE2 . GLU B 39  ? 1.4834 1.5582 1.3180 0.3313  -0.1283 -0.0218 41  GLU B OE2 
3531 N N   . GLU B 40  ? 1.7197 1.4154 1.3802 0.4516  0.1569  -0.0151 42  GLU B N   
3532 C CA  . GLU B 40  ? 1.7761 1.4068 1.3809 0.4928  0.2298  -0.0093 42  GLU B CA  
3533 C C   . GLU B 40  ? 1.9539 1.4972 1.3776 0.5102  0.2224  -0.0215 42  GLU B C   
3534 O O   . GLU B 40  ? 2.0222 1.5442 1.3701 0.4869  0.1605  -0.0488 42  GLU B O   
3535 C CB  . GLU B 40  ? 1.7374 1.3434 1.3895 0.5038  0.2615  -0.0276 42  GLU B CB  
3536 C CG  . GLU B 40  ? 1.7766 1.3327 1.3959 0.5475  0.3450  -0.0247 42  GLU B CG  
3537 C CD  . GLU B 40  ? 1.7531 1.3024 1.4375 0.5670  0.3721  -0.0438 42  GLU B CD  
3538 O OE1 . GLU B 40  ? 1.6385 1.2067 1.3762 0.5481  0.3238  -0.0565 42  GLU B OE1 
3539 O OE2 . GLU B 40  ? 1.8114 1.3343 1.4900 0.6042  0.4437  -0.0461 42  GLU B OE2 
3540 N N   . ALA B 41  ? 2.2346 1.5906 1.2046 -0.0050 -0.3937 0.3422  43  ALA B N   
3541 C CA  . ALA B 41  ? 2.2940 1.6670 1.1596 0.0079  -0.3967 0.3520  43  ALA B CA  
3542 C C   . ALA B 41  ? 2.2812 1.7203 1.1127 0.0094  -0.3359 0.3081  43  ALA B C   
3543 O O   . ALA B 41  ? 2.2444 1.7138 1.1129 -0.0069 -0.2793 0.3052  43  ALA B O   
3544 C CB  . ALA B 41  ? 2.3966 1.7415 1.1958 -0.0110 -0.3956 0.4432  43  ALA B CB  
3545 N N   . ALA B 42  ? 2.2832 1.7443 1.0446 0.0302  -0.3496 0.2725  44  ALA B N   
3546 C CA  . ALA B 42  ? 2.2515 1.7683 0.9848 0.0347  -0.2986 0.2157  44  ALA B CA  
3547 C C   . ALA B 42  ? 2.3103 1.8572 0.9853 0.0154  -0.2321 0.2588  44  ALA B C   
3548 O O   . ALA B 42  ? 2.3874 1.9255 0.9833 0.0082  -0.2358 0.3197  44  ALA B O   
3549 C CB  . ALA B 42  ? 2.2730 1.8062 0.9430 0.0589  -0.3350 0.1676  44  ALA B CB  
3550 N N   . SER B 43  ? 2.2475 1.8300 0.9621 0.0086  -0.1697 0.2282  45  SER B N   
3551 C CA  . SER B 43  ? 2.2753 1.8955 0.9452 -0.0051 -0.0993 0.2557  45  SER B CA  
3552 C C   . SER B 43  ? 2.2631 1.9229 0.8998 0.0089  -0.0581 0.1840  45  SER B C   
3553 O O   . SER B 43  ? 2.1882 1.8532 0.8882 0.0184  -0.0511 0.1212  45  SER B O   
3554 C CB  . SER B 43  ? 2.2523 1.8812 1.0048 -0.0248 -0.0580 0.2888  45  SER B CB  
3555 O OG  . SER B 43  ? 2.3134 1.9041 1.0973 -0.0422 -0.0940 0.3535  45  SER B OG  
3556 N N   . ALA B 44  ? 2.2605 1.9454 0.7959 0.0092  -0.0293 0.1931  46  ALA B N   
3557 C CA  . ALA B 44  ? 2.2423 1.9604 0.7374 0.0212  0.0089  0.1222  46  ALA B CA  
3558 C C   . ALA B 44  ? 2.1939 1.9366 0.7500 0.0184  0.0819  0.0981  46  ALA B C   
3559 O O   . ALA B 44  ? 2.1505 1.9062 0.7141 0.0296  0.1080  0.0271  46  ALA B O   
3560 C CB  . ALA B 44  ? 2.3322 2.0716 0.6988 0.0214  0.0242  0.1398  46  ALA B CB  
3561 N N   . GLY B 45  ? 2.1701 1.9198 0.7722 0.0039  0.1150  0.1559  47  GLY B N   
3562 C CA  . GLY B 45  ? 2.1001 1.8770 0.7627 0.0044  0.1821  0.1408  47  GLY B CA  
3563 C C   . GLY B 45  ? 1.9900 1.7527 0.7475 0.0140  0.1726  0.0885  47  GLY B C   
3564 O O   . GLY B 45  ? 1.9392 1.6755 0.7598 0.0098  0.1250  0.1015  47  GLY B O   
3565 N N   . GLY B 49  ? 1.5869 1.2918 0.8097 0.0477  0.1678  -0.0709 51  GLY B N   
3566 C CA  . GLY B 49  ? 1.5588 1.2875 0.8305 0.0475  0.2074  -0.0359 51  GLY B CA  
3567 C C   . GLY B 49  ? 1.6155 1.3658 0.8867 0.0304  0.2018  0.0362  51  GLY B C   
3568 O O   . GLY B 49  ? 1.6011 1.3845 0.9047 0.0294  0.2408  0.0698  51  GLY B O   
3569 N N   . GLN B 50  ? 1.5377 1.2697 0.7744 0.0170  0.1530  0.0612  52  GLN B N   
3570 C CA  . GLN B 50  ? 1.5844 1.3307 0.8185 -0.0034 0.1473  0.1319  52  GLN B CA  
3571 C C   . GLN B 50  ? 1.5690 1.3136 0.8835 -0.0166 0.1221  0.1620  52  GLN B C   
3572 O O   . GLN B 50  ? 1.5868 1.3586 0.9248 -0.0339 0.1365  0.2167  52  GLN B O   
3573 C CB  . GLN B 50  ? 1.6593 1.3790 0.8285 -0.0127 0.1024  0.1527  52  GLN B CB  
3574 N N   . TYR B 51  ? 1.4892 1.2054 0.8472 -0.0100 0.0852  0.1254  53  TYR B N   
3575 C CA  . TYR B 51  ? 1.4608 1.1710 0.8893 -0.0224 0.0549  0.1457  53  TYR B CA  
3576 C C   . TYR B 51  ? 1.4009 1.1189 0.8802 -0.0062 0.0714  0.1038  53  TYR B C   
3577 O O   . TYR B 51  ? 1.3710 1.0822 0.8328 0.0134  0.0918  0.0530  53  TYR B O   
3578 C CB  . TYR B 51  ? 1.4885 1.1487 0.9187 -0.0317 -0.0149 0.1476  53  TYR B CB  
3579 C CG  . TYR B 51  ? 1.5765 1.2209 0.9533 -0.0466 -0.0349 0.1945  53  TYR B CG  
3580 C CD1 . TYR B 51  ? 1.6284 1.2753 1.0254 -0.0734 -0.0428 0.2577  53  TYR B CD1 
3581 C CD2 . TYR B 51  ? 1.6152 1.2431 0.9206 -0.0349 -0.0461 0.1763  53  TYR B CD2 
3582 C CE1 . TYR B 51  ? 1.7128 1.3408 1.0574 -0.0878 -0.0581 0.3053  53  TYR B CE1 
3583 C CE2 . TYR B 51  ? 1.6962 1.3085 0.9451 -0.0466 -0.0649 0.2232  53  TYR B CE2 
3584 C CZ  . TYR B 51  ? 1.7709 1.3807 1.0383 -0.0729 -0.0692 0.2895  53  TYR B CZ  
3585 O OH  . TYR B 51  ? 1.8535 1.4433 1.0615 -0.0855 -0.0850 0.3409  53  TYR B OH  
3586 N N   . SER B 52  ? 1.3749 1.1071 0.9164 -0.0159 0.0621  0.1261  54  SER B N   
3587 C CA  . SER B 52  ? 1.3121 1.0534 0.9003 -0.0014 0.0744  0.0953  54  SER B CA  
3588 C C   . SER B 52  ? 1.3014 1.0172 0.9350 -0.0126 0.0189  0.0911  54  SER B C   
3589 O O   . SER B 52  ? 1.3199 1.0408 0.9813 -0.0354 -0.0071 0.1327  54  SER B O   
3590 C CB  . SER B 52  ? 1.3124 1.1086 0.9321 0.0027  0.1245  0.1250  54  SER B CB  
3591 O OG  . SER B 52  ? 1.3661 1.1895 1.0228 -0.0218 0.1086  0.1787  54  SER B OG  
3592 N N   . PHE B 53  ? 1.2715 0.9598 0.9136 0.0021  0.0028  0.0393  55  PHE B N   
3593 C CA  . PHE B 53  ? 1.2434 0.9047 0.9241 -0.0046 -0.0473 0.0247  55  PHE B CA  
3594 C C   . PHE B 53  ? 1.2142 0.9039 0.9393 0.0008  -0.0307 0.0212  55  PHE B C   
3595 O O   . PHE B 53  ? 1.1870 0.8888 0.9076 0.0214  0.0084  -0.0056 55  PHE B O   
3596 C CB  . PHE B 53  ? 1.2323 0.8519 0.8975 0.0090  -0.0739 -0.0309 55  PHE B CB  
3597 C CG  . PHE B 53  ? 1.2256 0.8088 0.9210 0.0013  -0.1324 -0.0427 55  PHE B CG  
3598 C CD1 . PHE B 53  ? 1.2730 0.8222 0.9567 -0.0102 -0.1778 -0.0234 55  PHE B CD1 
3599 C CD2 . PHE B 53  ? 1.1923 0.7724 0.9248 0.0071  -0.1412 -0.0735 55  PHE B CD2 
3600 C CE1 . PHE B 53  ? 1.2753 0.7852 0.9890 -0.0150 -0.2306 -0.0362 55  PHE B CE1 
3601 C CE2 . PHE B 53  ? 1.1843 0.7294 0.9435 0.0011  -0.1932 -0.0890 55  PHE B CE2 
3602 C CZ  . PHE B 53  ? 1.2205 0.7291 0.9730 -0.0095 -0.2378 -0.0714 55  PHE B CZ  
3603 N N   . SER B 54  ? 1.1810 0.8799 0.9473 -0.0180 -0.0608 0.0485  56  SER B N   
3604 C CA  . SER B 54  ? 1.1443 0.8754 0.9518 -0.0145 -0.0536 0.0489  56  SER B CA  
3605 C C   . SER B 54  ? 1.1377 0.8385 0.9736 -0.0248 -0.1075 0.0267  56  SER B C   
3606 O O   . SER B 54  ? 1.1602 0.8335 1.0061 -0.0467 -0.1504 0.0415  56  SER B O   
3607 C CB  . SER B 54  ? 1.1743 0.9620 1.0114 -0.0288 -0.0344 0.1035  56  SER B CB  
3608 O OG  . SER B 54  ? 1.2278 1.0434 1.0385 -0.0180 0.0176  0.1227  56  SER B OG  
3609 N N   . TYR B 55  ? 1.1541 0.8571 1.0005 -0.0087 -0.1035 -0.0084 57  TYR B N   
3610 C CA  . TYR B 55  ? 1.1299 0.8067 0.9989 -0.0150 -0.1494 -0.0369 57  TYR B CA  
3611 C C   . TYR B 55  ? 1.1136 0.8293 1.0056 -0.0083 -0.1393 -0.0382 57  TYR B C   
3612 O O   . TYR B 55  ? 1.1005 0.8489 0.9835 0.0113  -0.0937 -0.0327 57  TYR B O   
3613 C CB  . TYR B 55  ? 1.1182 0.7473 0.9664 0.0011  -0.1611 -0.0926 57  TYR B CB  
3614 C CG  . TYR B 55  ? 1.1031 0.7415 0.9328 0.0272  -0.1162 -0.1263 57  TYR B CG  
3615 C CD1 . TYR B 55  ? 1.1249 0.7668 0.9249 0.0401  -0.0737 -0.1292 57  TYR B CD1 
3616 C CD2 . TYR B 55  ? 1.0788 0.7197 0.9182 0.0377  -0.1152 -0.1558 57  TYR B CD2 
3617 C CE1 . TYR B 55  ? 1.1167 0.7604 0.9026 0.0611  -0.0308 -0.1601 57  TYR B CE1 
3618 C CE2 . TYR B 55  ? 1.0727 0.7169 0.8943 0.0597  -0.0713 -0.1828 57  TYR B CE2 
3619 C CZ  . TYR B 55  ? 1.1175 0.7610 0.9150 0.0705  -0.0289 -0.1846 57  TYR B CZ  
3620 O OH  . TYR B 55  ? 1.1145 0.7550 0.8971 0.0897  0.0165  -0.2116 57  TYR B OH  
3621 N N   . GLN B 56  ? 1.0401 0.7503 0.9602 -0.0239 -0.1830 -0.0455 58  GLN B N   
3622 C CA  . GLN B 56  ? 1.0190 0.7683 0.9576 -0.0191 -0.1824 -0.0475 58  GLN B CA  
3623 C C   . GLN B 56  ? 1.0091 0.7245 0.9536 -0.0235 -0.2259 -0.0913 58  GLN B C   
3624 O O   . GLN B 56  ? 1.0264 0.7058 0.9870 -0.0448 -0.2702 -0.0972 58  GLN B O   
3625 C CB  . GLN B 56  ? 1.0341 0.8395 1.0112 -0.0403 -0.1885 0.0028  58  GLN B CB  
3626 C CG  . GLN B 56  ? 1.0622 0.9238 1.0562 -0.0296 -0.1807 0.0085  58  GLN B CG  
3627 C CD  . GLN B 56  ? 1.1278 0.9958 1.1524 -0.0528 -0.2340 -0.0025 58  GLN B CD  
3628 O OE1 . GLN B 56  ? 1.1271 0.9606 1.1696 -0.0814 -0.2745 -0.0057 58  GLN B OE1 
3629 N NE2 . GLN B 56  ? 1.0729 0.9824 1.1012 -0.0402 -0.2347 -0.0090 58  GLN B NE2 
3630 N N   . LEU B 57  ? 1.1589 0.8838 1.0890 -0.0027 -0.2114 -0.1209 59  LEU B N   
3631 C CA  . LEU B 57  ? 1.1533 0.8520 1.0827 -0.0030 -0.2451 -0.1665 59  LEU B CA  
3632 C C   . LEU B 57  ? 1.1572 0.8989 1.1088 -0.0159 -0.2701 -0.1533 59  LEU B C   
3633 O O   . LEU B 57  ? 1.1612 0.9552 1.1340 -0.0242 -0.2620 -0.1087 59  LEU B O   
3634 C CB  . LEU B 57  ? 1.1372 0.8206 1.0331 0.0260  -0.2119 -0.2078 59  LEU B CB  
3635 C CG  . LEU B 57  ? 1.1513 0.7964 1.0393 0.0307  -0.2364 -0.2654 59  LEU B CG  
3636 C CD1 . LEU B 57  ? 1.1861 0.7817 1.0857 0.0230  -0.2640 -0.2877 59  LEU B CD1 
3637 C CD2 . LEU B 57  ? 1.1240 0.7703 0.9804 0.0575  -0.1923 -0.2947 59  LEU B CD2 
3638 N N   . GLU B 58  ? 1.1208 0.8447 1.0683 -0.0171 -0.3005 -0.1947 60  GLU B N   
3639 C CA  . GLU B 58  ? 1.1202 0.8853 1.0842 -0.0299 -0.3291 -0.1900 60  GLU B CA  
3640 C C   . GLU B 58  ? 1.1211 0.9390 1.0615 -0.0037 -0.2931 -0.1776 60  GLU B C   
3641 O O   . GLU B 58  ? 1.1095 0.9105 1.0120 0.0230  -0.2614 -0.2032 60  GLU B O   
3642 C CB  . GLU B 58  ? 1.3006 1.0264 1.2622 -0.0390 -0.3730 -0.2429 60  GLU B CB  
3643 C CG  . GLU B 58  ? 1.3330 1.0864 1.3248 -0.0677 -0.4205 -0.2397 60  GLU B CG  
3644 C CD  . GLU B 58  ? 1.3548 1.0867 1.3923 -0.1042 -0.4548 -0.2161 60  GLU B CD  
3645 O OE1 . GLU B 58  ? 1.3458 1.0438 1.3866 -0.1051 -0.4415 -0.1976 60  GLU B OE1 
3646 O OE2 . GLU B 58  ? 1.3865 1.1351 1.4555 -0.1333 -0.4953 -0.2161 60  GLU B OE2 
3647 N N   . ASP B 59  ? 1.1301 1.0128 1.0959 -0.0112 -0.2973 -0.1363 61  ASP B N   
3648 C CA  . ASP B 59  ? 1.1162 1.0552 1.0648 0.0153  -0.2686 -0.1161 61  ASP B CA  
3649 C C   . ASP B 59  ? 1.1256 1.0551 1.0463 0.0472  -0.2057 -0.1017 61  ASP B C   
3650 O O   . ASP B 59  ? 1.1163 1.0509 1.0015 0.0762  -0.1749 -0.1081 61  ASP B O   
3651 C CB  . ASP B 59  ? 1.1177 1.0573 1.0338 0.0251  -0.2883 -0.1547 61  ASP B CB  
3652 C CG  . ASP B 59  ? 1.1582 1.1003 1.0994 -0.0076 -0.3514 -0.1781 61  ASP B CG  
3653 O OD1 . ASP B 59  ? 1.1761 1.1807 1.1456 -0.0210 -0.3770 -0.1537 61  ASP B OD1 
3654 O OD2 . ASP B 59  ? 1.1691 1.0513 1.1049 -0.0200 -0.3759 -0.2224 61  ASP B OD2 
3655 N N   . GLU B 60  ? 1.0388 0.9523 0.9733 0.0410  -0.1857 -0.0821 62  GLU B N   
3656 C CA  . GLU B 60  ? 1.0395 0.9378 0.9495 0.0665  -0.1281 -0.0739 62  GLU B CA  
3657 C C   . GLU B 60  ? 1.0668 0.9921 1.0039 0.0585  -0.1094 -0.0288 62  GLU B C   
3658 O O   . GLU B 60  ? 1.0758 1.0115 1.0465 0.0289  -0.1422 -0.0115 62  GLU B O   
3659 C CB  . GLU B 60  ? 1.1789 1.0081 1.0606 0.0698  -0.1199 -0.1201 62  GLU B CB  
3660 C CG  . GLU B 60  ? 1.1828 0.9910 1.0261 0.0943  -0.0950 -0.1555 62  GLU B CG  
3661 C CD  . GLU B 60  ? 1.1701 0.9492 0.9889 0.1145  -0.0392 -0.1644 62  GLU B CD  
3662 O OE1 . GLU B 60  ? 1.1615 0.9115 0.9849 0.1056  -0.0368 -0.1740 62  GLU B OE1 
3663 O OE2 . GLU B 60  ? 1.1744 0.9586 0.9683 0.1388  0.0019  -0.1615 62  GLU B OE2 
3664 N N   . PRO B 61  ? 0.9896 0.9246 0.9125 0.0837  -0.0547 -0.0096 63  PRO B N   
3665 C CA  . PRO B 61  ? 0.9999 0.9648 0.9452 0.0791  -0.0310 0.0319  63  PRO B CA  
3666 C C   . PRO B 61  ? 1.0396 0.9567 0.9717 0.0642  -0.0286 0.0202  63  PRO B C   
3667 O O   . PRO B 61  ? 1.0400 0.9008 0.9454 0.0641  -0.0368 -0.0210 63  PRO B O   
3668 C CB  . PRO B 61  ? 0.9977 0.9819 0.9273 0.1162  0.0284  0.0489  63  PRO B CB  
3669 C CG  . PRO B 61  ? 1.0094 0.9423 0.8963 0.1349  0.0441  0.0069  63  PRO B CG  
3670 C CD  . PRO B 61  ? 0.9867 0.9088 0.8735 0.1183  -0.0094 -0.0222 63  PRO B CD  
3671 N N   . TRP B 62  ? 0.9622 0.9074 0.9142 0.0522  -0.0172 0.0583  64  TRP B N   
3672 C CA  . TRP B 62  ? 0.9897 0.8969 0.9241 0.0389  -0.0139 0.0553  64  TRP B CA  
3673 C C   . TRP B 62  ? 1.0104 0.8863 0.9028 0.0650  0.0357  0.0329  64  TRP B C   
3674 O O   . TRP B 62  ? 1.0054 0.9062 0.8934 0.0898  0.0833  0.0457  64  TRP B O   
3675 C CB  . TRP B 62  ? 1.0112 0.9614 0.9737 0.0193  -0.0090 0.1050  64  TRP B CB  
3676 C CG  . TRP B 62  ? 1.0277 0.9862 1.0279 -0.0178 -0.0624 0.1215  64  TRP B CG  
3677 C CD1 . TRP B 62  ? 1.0270 1.0343 1.0730 -0.0315 -0.0898 0.1382  64  TRP B CD1 
3678 C CD2 . TRP B 62  ? 1.0587 0.9730 1.0544 -0.0465 -0.0953 0.1228  64  TRP B CD2 
3679 N NE1 . TRP B 62  ? 1.0478 1.0411 1.1208 -0.0701 -0.1361 0.1472  64  TRP B NE1 
3680 C CE2 . TRP B 62  ? 1.0821 1.0152 1.1240 -0.0788 -0.1394 0.1403  64  TRP B CE2 
3681 C CE3 . TRP B 62  ? 1.0885 0.9489 1.0451 -0.0476 -0.0932 0.1114  64  TRP B CE3 
3682 C CZ2 . TRP B 62  ? 1.1139 1.0061 1.1642 -0.1118 -0.1780 0.1487  64  TRP B CZ2 
3683 C CZ3 . TRP B 62  ? 1.1277 0.9517 1.0899 -0.0772 -0.1338 0.1222  64  TRP B CZ3 
3684 C CH2 . TRP B 62  ? 1.1397 0.9759 1.1485 -0.1089 -0.1742 0.1417  64  TRP B CH2 
3685 N N   . LYS B 63  ? 1.1010 0.9222 0.9658 0.0595  0.0235  -0.0019 65  LYS B N   
3686 C CA  . LYS B 63  ? 1.1117 0.9013 0.9393 0.0783  0.0640  -0.0305 65  LYS B CA  
3687 C C   . LYS B 63  ? 1.1624 0.9286 0.9696 0.0640  0.0555  -0.0303 65  LYS B C   
3688 O O   . LYS B 63  ? 1.1712 0.9331 0.9902 0.0406  0.0140  -0.0128 65  LYS B O   
3689 C CB  . LYS B 63  ? 1.1034 0.8533 0.9161 0.0897  0.0590  -0.0823 65  LYS B CB  
3690 C CG  . LYS B 63  ? 1.1271 0.8968 0.9471 0.1072  0.0741  -0.0816 65  LYS B CG  
3691 C CD  . LYS B 63  ? 1.1474 0.8820 0.9568 0.1109  0.0572  -0.1294 65  LYS B CD  
3692 C CE  . LYS B 63  ? 1.1652 0.9220 0.9752 0.1269  0.0673  -0.1231 65  LYS B CE  
3693 N NZ  . LYS B 63  ? 1.1921 0.9186 0.9893 0.1290  0.0516  -0.1689 65  LYS B NZ  
3694 N N   . LEU B 64  ? 1.2217 0.9714 0.9960 0.0780  0.0952  -0.0496 66  LEU B N   
3695 C CA  . LEU B 64  ? 1.2493 0.9801 0.9943 0.0683  0.0907  -0.0522 66  LEU B CA  
3696 C C   . LEU B 64  ? 1.2620 0.9491 0.9821 0.0757  0.0866  -0.1081 66  LEU B C   
3697 O O   . LEU B 64  ? 1.2387 0.9153 0.9550 0.0923  0.1175  -0.1408 66  LEU B O   
3698 C CB  . LEU B 64  ? 1.2688 1.0270 0.9947 0.0757  0.1417  -0.0255 66  LEU B CB  
3699 C CG  . LEU B 64  ? 1.3056 1.1065 1.0499 0.0598  0.1385  0.0318  66  LEU B CG  
3700 C CD1 . LEU B 64  ? 1.2869 1.1309 1.0796 0.0616  0.1374  0.0603  66  LEU B CD1 
3701 C CD2 . LEU B 64  ? 1.3349 1.1559 1.0503 0.0672  0.1887  0.0488  66  LEU B CD2 
3702 N N   . CYS B 65  ? 1.3926 1.0554 1.0980 0.0633  0.0483  -0.1174 67  CYS B N   
3703 C CA  . CYS B 65  ? 1.3749 1.0041 1.0637 0.0690  0.0355  -0.1699 67  CYS B CA  
3704 C C   . CYS B 65  ? 1.4052 1.0328 1.0520 0.0712  0.0575  -0.1771 67  CYS B C   
3705 O O   . CYS B 65  ? 1.4377 1.0825 1.0642 0.0638  0.0661  -0.1375 67  CYS B O   
3706 C CB  . CYS B 65  ? 1.3761 0.9787 1.0802 0.0582  -0.0286 -0.1793 67  CYS B CB  
3707 S SG  . CYS B 65  ? 1.3677 0.9381 1.0602 0.0665  -0.0531 -0.2409 67  CYS B SG  
3708 N N   . ARG B 66  ? 1.4050 1.0144 1.0389 0.0800  0.0674  -0.2298 68  ARG B N   
3709 C CA  . ARG B 66  ? 1.4205 1.0286 1.0129 0.0814  0.0840  -0.2473 68  ARG B CA  
3710 C C   . ARG B 66  ? 1.4652 1.0629 1.0383 0.0720  0.0294  -0.2395 68  ARG B C   
3711 O O   . ARG B 66  ? 1.4457 1.0243 1.0388 0.0719  -0.0168 -0.2632 68  ARG B O   
3712 C CB  . ARG B 66  ? 1.3767 0.9916 0.9883 0.0879  0.1054  -0.3025 68  ARG B CB  
3713 C CG  . ARG B 66  ? 1.4177 1.0584 1.0103 0.0870  0.1225  -0.3160 68  ARG B CG  
3714 C CD  . ARG B 66  ? 1.3824 1.0792 1.0434 0.0947  0.0987  -0.3487 68  ARG B CD  
3715 N NE  . ARG B 66  ? 1.4335 1.1406 1.0630 0.0968  0.1010  -0.3634 68  ARG B NE  
3716 C CZ  . ARG B 66  ? 1.4911 1.1830 1.1108 0.1104  0.0785  -0.3632 68  ARG B CZ  
3717 N NH1 . ARG B 66  ? 1.4349 1.0839 1.0549 0.1089  0.0709  -0.3436 68  ARG B NH1 
3718 N NH2 . ARG B 66  ? 1.4719 1.1611 1.0518 0.1110  0.0834  -0.3770 68  ARG B NH2 
3719 N N   . LEU B 67  ? 1.3972 1.0067 0.9299 0.0661  0.0360  -0.2058 69  LEU B N   
3720 C CA  . LEU B 67  ? 1.4387 1.0368 0.9430 0.0585  -0.0125 -0.1897 69  LEU B CA  
3721 C C   . LEU B 67  ? 1.4618 1.0572 0.9265 0.0657  -0.0145 -0.2351 69  LEU B C   
3722 O O   . LEU B 67  ? 1.4619 1.0707 0.8991 0.0702  0.0328  -0.2562 69  LEU B O   
3723 C CB  . LEU B 67  ? 1.4960 1.1102 0.9733 0.0463  -0.0041 -0.1253 69  LEU B CB  
3724 C CG  . LEU B 67  ? 1.5654 1.1604 1.0288 0.0341  -0.0593 -0.0866 69  LEU B CG  
3725 C CD1 . LEU B 67  ? 1.5512 1.1290 1.0702 0.0249  -0.0962 -0.0677 69  LEU B CD1 
3726 C CD2 . LEU B 67  ? 1.6366 1.2509 1.0561 0.0225  -0.0380 -0.0311 69  LEU B CD2 
3727 N N   . HIS B 68  ? 1.5404 1.1187 1.0043 0.0674  -0.0707 -0.2514 70  HIS B N   
3728 C CA  . HIS B 68  ? 1.5475 1.1291 0.9790 0.0744  -0.0847 -0.2956 70  HIS B CA  
3729 C C   . HIS B 68  ? 1.6291 1.2055 1.0114 0.0717  -0.1279 -0.2584 70  HIS B C   
3730 O O   . HIS B 68  ? 1.6472 1.2024 1.0443 0.0685  -0.1726 -0.2214 70  HIS B O   
3731 C CB  . HIS B 68  ? 1.4981 1.0705 0.9758 0.0832  -0.1149 -0.3535 70  HIS B CB  
3732 C CG  . HIS B 68  ? 1.4366 1.0390 0.9855 0.0746  -0.0611 -0.3727 70  HIS B CG  
3733 N ND1 . HIS B 68  ? 1.4040 1.0416 0.9855 0.0569  -0.0163 -0.3925 70  HIS B ND1 
3734 C CD2 . HIS B 68  ? 1.4091 1.0094 1.0012 0.0723  -0.0420 -0.3595 70  HIS B CD2 
3735 C CE1 . HIS B 68  ? 1.3619 0.9968 0.9827 0.0448  0.0276  -0.3825 70  HIS B CE1 
3736 N NE2 . HIS B 68  ? 1.3538 0.9848 0.9947 0.0542  0.0140  -0.3679 70  HIS B NE2 
3737 N N   . GLN B 69  ? 1.6183 1.2112 0.9398 0.0730  -0.1141 -0.2683 71  GLN B N   
3738 C CA  . GLN B 69  ? 1.6882 1.2784 0.9499 0.0724  -0.1524 -0.2342 71  GLN B CA  
3739 C C   . GLN B 69  ? 1.7009 1.2945 0.9519 0.0848  -0.1981 -0.2844 71  GLN B C   
3740 O O   . GLN B 69  ? 1.6724 1.2860 0.9209 0.0885  -0.1761 -0.3443 71  GLN B O   
3741 C CB  . GLN B 69  ? 1.7498 1.3610 0.9413 0.0657  -0.1071 -0.2071 71  GLN B CB  
3742 C CG  . GLN B 69  ? 1.8930 1.5002 1.0150 0.0631  -0.1415 -0.1589 71  GLN B CG  
3743 C CD  . GLN B 69  ? 2.0243 1.6561 1.0721 0.0571  -0.0925 -0.1381 71  GLN B CD  
3744 O OE1 . GLN B 69  ? 2.0241 1.6630 1.0701 0.0464  -0.0552 -0.0882 71  GLN B OE1 
3745 N NE2 . GLN B 69  ? 2.0212 1.6698 1.0088 0.0639  -0.0923 -0.1786 71  GLN B NE2 
3746 N N   . ALA B 70  ? 1.7991 1.3732 1.0468 0.0914  -0.2619 -0.2600 72  ALA B N   
3747 C CA  . ALA B 70  ? 1.7992 1.3810 1.0415 0.1068  -0.3133 -0.3018 72  ALA B CA  
3748 C C   . ALA B 70  ? 1.8944 1.4591 1.0819 0.1125  -0.3668 -0.2475 72  ALA B C   
3749 O O   . ALA B 70  ? 1.9163 1.4456 1.1199 0.1092  -0.3911 -0.1928 72  ALA B O   
3750 C CB  . ALA B 70  ? 1.7339 1.3062 1.0604 0.1172  -0.3427 -0.3459 72  ALA B CB  
3751 N N   . PRO B 71  ? 1.9084 1.4953 1.0299 0.1205  -0.3866 -0.2601 73  PRO B N   
3752 C CA  . PRO B 71  ? 1.9884 1.5573 1.0510 0.1289  -0.4397 -0.2055 73  PRO B CA  
3753 C C   . PRO B 71  ? 1.9919 1.5449 1.0994 0.1513  -0.5128 -0.2219 73  PRO B C   
3754 O O   . PRO B 71  ? 1.9431 1.5222 1.0960 0.1637  -0.5288 -0.2905 73  PRO B O   
3755 C CB  . PRO B 71  ? 2.0482 1.6540 1.0188 0.1299  -0.4289 -0.2207 73  PRO B CB  
3756 C CG  . PRO B 71  ? 2.0081 1.6480 0.9995 0.1215  -0.3703 -0.2904 73  PRO B CG  
3757 C CD  . PRO B 71  ? 1.9010 1.5293 0.9953 0.1214  -0.3615 -0.3247 73  PRO B CD  
3758 N N   . THR B 72  ? 2.0806 1.5897 1.1783 0.1565  -0.5558 -0.1580 74  THR B N   
3759 C CA  . THR B 72  ? 2.0889 1.5739 1.2313 0.1810  -0.6259 -0.1651 74  THR B CA  
3760 C C   . THR B 72  ? 2.2048 1.6467 1.2881 0.1882  -0.6716 -0.0863 74  THR B C   
3761 O O   . THR B 72  ? 2.2555 1.6849 1.2719 0.1700  -0.6447 -0.0247 74  THR B O   
3762 C CB  . THR B 72  ? 2.0515 1.5083 1.2943 0.1799  -0.6251 -0.1835 74  THR B CB  
3763 O OG1 . THR B 72  ? 2.0604 1.5047 1.3534 0.2080  -0.6887 -0.2096 74  THR B OG1 
3764 C CG2 . THR B 72  ? 2.0771 1.4829 1.3228 0.1605  -0.6124 -0.1123 74  THR B CG2 
3765 N N   . ALA B 73  ? 2.1589 1.5781 1.2697 0.2158  -0.7395 -0.0881 75  ALA B N   
3766 C CA  . ALA B 73  ? 2.2636 1.6316 1.3271 0.2288  -0.7919 -0.0140 75  ALA B CA  
3767 C C   . ALA B 73  ? 2.3635 1.7592 1.3099 0.2283  -0.7904 0.0174  75  ALA B C   
3768 O O   . ALA B 73  ? 2.3576 1.8137 1.2764 0.2359  -0.7866 -0.0381 75  ALA B O   
3769 C CB  . ALA B 73  ? 2.2677 1.5704 1.3560 0.2075  -0.7776 0.0496  75  ALA B CB  
3770 N N   . ARG B 74  ? 2.4359 1.7897 1.3111 0.2182  -0.7920 0.1032  76  ARG B N   
3771 C CA  . ARG B 74  ? 2.5304 1.9069 1.2853 0.2174  -0.7887 0.1401  76  ARG B CA  
3772 C C   . ARG B 74  ? 2.5479 1.9283 1.2581 0.1804  -0.7140 0.1801  76  ARG B C   
3773 O O   . ARG B 74  ? 2.5695 1.9001 1.2859 0.1609  -0.7001 0.2479  76  ARG B O   
3774 C CB  . ARG B 74  ? 2.6330 1.9785 1.3665 0.2326  -0.8301 0.2070  76  ARG B CB  
3775 N N   . GLY B 75  ? 2.4793 1.9196 1.1475 0.1708  -0.6661 0.1371  77  GLY B N   
3776 C CA  . GLY B 75  ? 2.4789 1.9321 1.1061 0.1398  -0.5916 0.1683  77  GLY B CA  
3777 C C   . GLY B 75  ? 2.4137 1.8425 1.1271 0.1159  -0.5503 0.1837  77  GLY B C   
3778 O O   . GLY B 75  ? 2.4468 1.8608 1.1358 0.0915  -0.5117 0.2466  77  GLY B O   
3779 N N   . ALA B 76  ? 1.8580 2.1741 1.2401 0.1197  -0.5984 0.0848  78  ALA B N   
3780 C CA  . ALA B 76  ? 1.7679 2.0862 1.1785 0.0859  -0.5585 0.1233  78  ALA B CA  
3781 C C   . ALA B 76  ? 1.7053 2.0477 1.1695 0.0288  -0.5545 0.0905  78  ALA B C   
3782 O O   . ALA B 76  ? 1.7130 2.1014 1.2115 0.0205  -0.5890 0.0312  78  ALA B O   
3783 C CB  . ALA B 76  ? 1.7359 2.0555 1.1830 0.0910  -0.5551 0.1468  78  ALA B CB  
3784 N N   . VAL B 77  ? 1.6637 1.9652 1.1387 -0.0124 -0.5103 0.1275  79  VAL B N   
3785 C CA  . VAL B 77  ? 1.6224 1.9303 1.1396 -0.0684 -0.4955 0.1074  79  VAL B CA  
3786 C C   . VAL B 77  ? 1.5819 1.8585 1.1452 -0.0980 -0.4691 0.1386  79  VAL B C   
3787 O O   . VAL B 77  ? 1.5699 1.8028 1.1189 -0.0898 -0.4435 0.1857  79  VAL B O   
3788 C CB  . VAL B 77  ? 1.6487 1.9343 1.1190 -0.0858 -0.4678 0.1184  79  VAL B CB  
3789 C CG1 . VAL B 77  ? 1.7002 2.0212 1.1355 -0.0689 -0.5000 0.0690  79  VAL B CG1 
3790 C CG2 . VAL B 77  ? 1.6543 1.8884 1.0799 -0.0629 -0.4332 0.1765  79  VAL B CG2 
3791 N N   . ARG B 78  ? 1.4950 1.7939 1.1171 -0.1311 -0.4759 0.1076  80  ARG B N   
3792 C CA  . ARG B 78  ? 1.4472 1.7177 1.1108 -0.1549 -0.4564 0.1305  80  ARG B CA  
3793 C C   . ARG B 78  ? 1.4355 1.6899 1.1054 -0.2017 -0.4264 0.1324  80  ARG B C   
3794 O O   . ARG B 78  ? 1.4313 1.7180 1.1326 -0.2310 -0.4328 0.0878  80  ARG B O   
3795 C CB  . ARG B 78  ? 1.4344 1.7405 1.1585 -0.1491 -0.4844 0.0967  80  ARG B CB  
3796 C CG  . ARG B 78  ? 1.4303 1.7042 1.1912 -0.1655 -0.4679 0.1197  80  ARG B CG  
3797 C CD  . ARG B 78  ? 1.4549 1.7692 1.2790 -0.1601 -0.4930 0.0818  80  ARG B CD  
3798 N NE  . ARG B 78  ? 1.5092 1.8384 1.3215 -0.1162 -0.5174 0.0860  80  ARG B NE  
3799 C CZ  . ARG B 78  ? 1.5640 1.9448 1.4203 -0.0988 -0.5445 0.0508  80  ARG B CZ  
3800 N NH1 . ARG B 78  ? 1.4872 1.9090 1.4132 -0.1237 -0.5497 0.0050  80  ARG B NH1 
3801 N NH2 . ARG B 78  ? 1.5359 1.9312 1.3696 -0.0570 -0.5632 0.0614  80  ARG B NH2 
3802 N N   . PHE B 79  ? 1.3907 1.5987 1.0361 -0.2086 -0.3909 0.1788  81  PHE B N   
3803 C CA  . PHE B 79  ? 1.3670 1.5566 1.0085 -0.2454 -0.3585 0.1881  81  PHE B CA  
3804 C C   . PHE B 79  ? 1.3416 1.5185 1.0275 -0.2595 -0.3544 0.1941  81  PHE B C   
3805 O O   . PHE B 79  ? 1.3227 1.4741 1.0224 -0.2413 -0.3513 0.2196  81  PHE B O   
3806 C CB  . PHE B 79  ? 1.3758 1.5296 0.9797 -0.2373 -0.3203 0.2273  81  PHE B CB  
3807 C CG  . PHE B 79  ? 1.4223 1.5834 0.9782 -0.2200 -0.3198 0.2241  81  PHE B CG  
3808 C CD1 . PHE B 79  ? 1.4552 1.6151 0.9943 -0.1815 -0.3333 0.2351  81  PHE B CD1 
3809 C CD2 . PHE B 79  ? 1.4536 1.6188 0.9731 -0.2407 -0.3032 0.2103  81  PHE B CD2 
3810 C CE1 . PHE B 79  ? 1.5075 1.6712 0.9959 -0.1593 -0.3331 0.2332  81  PHE B CE1 
3811 C CE2 . PHE B 79  ? 1.4967 1.6655 0.9678 -0.2207 -0.3030 0.2062  81  PHE B CE2 
3812 C CZ  . PHE B 79  ? 1.5156 1.6841 0.9718 -0.1778 -0.3193 0.2183  81  PHE B CZ  
3813 N N   . TRP B 80  ? 1.2463 1.4415 0.9572 -0.2938 -0.3532 0.1649  82  TRP B N   
3814 C CA  . TRP B 80  ? 1.2100 1.3935 0.9673 -0.3019 -0.3451 0.1650  82  TRP B CA  
3815 C C   . TRP B 80  ? 1.1940 1.3463 0.9631 -0.3160 -0.2778 0.1540  82  TRP B C   
3816 O O   . TRP B 80  ? 1.2122 1.3652 0.9762 -0.3293 -0.2460 0.1267  82  TRP B O   
3817 C CB  . TRP B 80  ? 1.2072 1.4290 1.0377 -0.2990 -0.3731 0.1190  82  TRP B CB  
3818 C CG  . TRP B 80  ? 1.2220 1.4792 1.1006 -0.3152 -0.3596 0.0550  82  TRP B CG  
3819 C CD1 . TRP B 80  ? 1.2579 1.5579 1.1252 -0.3144 -0.3912 0.0233  82  TRP B CD1 
3820 C CD2 . TRP B 80  ? 1.2075 1.4608 1.1576 -0.3339 -0.3102 0.0119  82  TRP B CD2 
3821 N NE1 . TRP B 80  ? 1.2650 1.5904 1.1976 -0.3355 -0.3674 -0.0415 82  TRP B NE1 
3822 C CE2 . TRP B 80  ? 1.2345 1.5297 1.2217 -0.3494 -0.3144 -0.0478 82  TRP B CE2 
3823 C CE3 . TRP B 80  ? 1.1804 1.3974 1.1658 -0.3365 -0.2606 0.0179  82  TRP B CE3 
3824 C CZ2 . TRP B 80  ? 1.2340 1.5340 1.3011 -0.3730 -0.2679 -0.1016 82  TRP B CZ2 
3825 C CZ3 . TRP B 80  ? 1.1820 1.4007 1.2389 -0.3548 -0.2113 -0.0301 82  TRP B CZ3 
3826 C CH2 . TRP B 80  ? 1.2079 1.4669 1.3095 -0.3757 -0.2138 -0.0892 82  TRP B CH2 
3827 N N   . CYS B 81  ? 1.2127 1.3347 0.9936 -0.3094 -0.2554 0.1755  83  CYS B N   
3828 C CA  . CYS B 81  ? 1.2566 1.3449 1.0435 -0.3126 -0.1892 0.1710  83  CYS B CA  
3829 C C   . CYS B 81  ? 1.2651 1.3430 1.1075 -0.3029 -0.1771 0.1589  83  CYS B C   
3830 O O   . CYS B 81  ? 1.2170 1.2977 1.0659 -0.2897 -0.2169 0.1768  83  CYS B O   
3831 C CB  . CYS B 81  ? 1.2485 1.3067 0.9683 -0.3042 -0.1668 0.2204  83  CYS B CB  
3832 S SG  . CYS B 81  ? 1.2582 1.2784 0.9827 -0.2851 -0.1212 0.2371  83  CYS B SG  
3833 N N   . SER B 82  ? 1.0731 1.1350 0.9544 -0.3078 -0.1189 0.1292  84  SER B N   
3834 C CA  . SER B 82  ? 1.0789 1.1266 1.0113 -0.2948 -0.0948 0.1183  84  SER B CA  
3835 C C   . SER B 82  ? 1.1391 1.1383 1.0342 -0.2772 -0.0321 0.1432  84  SER B C   
3836 O O   . SER B 82  ? 1.1527 1.1295 1.0420 -0.2839 0.0284  0.1317  84  SER B O   
3837 C CB  . SER B 82  ? 1.0974 1.1680 1.1149 -0.3114 -0.0737 0.0631  84  SER B CB  
3838 O OG  . SER B 82  ? 1.1415 1.2017 1.2110 -0.2961 -0.0531 0.0558  84  SER B OG  
3839 N N   . LEU B 83  ? 1.0736 1.0559 0.9415 -0.2521 -0.0464 0.1756  85  LEU B N   
3840 C CA  . LEU B 83  ? 1.0800 1.0235 0.9050 -0.2270 0.0057  0.1996  85  LEU B CA  
3841 C C   . LEU B 83  ? 1.0957 1.0115 0.9617 -0.2143 0.0747  0.1762  85  LEU B C   
3842 O O   . LEU B 83  ? 1.0927 1.0208 1.0259 -0.2190 0.0702  0.1478  85  LEU B O   
3843 C CB  . LEU B 83  ? 1.0672 1.0049 0.8610 -0.2020 -0.0322 0.2311  85  LEU B CB  
3844 C CG  . LEU B 83  ? 1.0609 1.0089 0.7982 -0.2061 -0.0687 0.2667  85  LEU B CG  
3845 C CD1 . LEU B 83  ? 1.0557 1.0343 0.8028 -0.2320 -0.1283 0.2674  85  LEU B CD1 
3846 C CD2 . LEU B 83  ? 1.0549 0.9929 0.7708 -0.1790 -0.0906 0.2885  85  LEU B CD2 
3847 N N   . PRO B 84  ? 1.2207 1.0989 1.0478 -0.1958 0.1429  0.1890  86  PRO B N   
3848 C CA  . PRO B 84  ? 1.2446 1.0876 1.1064 -0.1794 0.2192  0.1722  86  PRO B CA  
3849 C C   . PRO B 84  ? 1.2901 1.1245 1.1700 -0.1458 0.2117  0.1775  86  PRO B C   
3850 O O   . PRO B 84  ? 1.2791 1.1161 1.1153 -0.1215 0.1701  0.2031  86  PRO B O   
3851 C CB  . PRO B 84  ? 1.2163 1.0185 1.0093 -0.1562 0.2863  0.1965  86  PRO B CB  
3852 C CG  . PRO B 84  ? 1.1997 1.0235 0.9432 -0.1767 0.2502  0.2121  86  PRO B CG  
3853 C CD  . PRO B 84  ? 1.1786 1.0451 0.9295 -0.1883 0.1588  0.2197  86  PRO B CD  
3854 N N   . THR B 85  ? 1.2803 1.1045 1.2288 -0.1449 0.2535  0.1509  87  THR B N   
3855 C CA  . THR B 85  ? 1.3188 1.1322 1.2860 -0.1096 0.2530  0.1549  87  THR B CA  
3856 C C   . THR B 85  ? 1.3242 1.0942 1.2164 -0.0553 0.2934  0.1874  87  THR B C   
3857 O O   . THR B 85  ? 1.3456 1.1122 1.2172 -0.0210 0.2632  0.1999  87  THR B O   
3858 C CB  . THR B 85  ? 1.3694 1.1799 1.4285 -0.1184 0.3027  0.1219  87  THR B CB  
3859 O OG1 . THR B 85  ? 1.3400 1.1126 1.4054 -0.1224 0.3932  0.1149  87  THR B OG1 
3860 C CG2 . THR B 85  ? 1.3619 1.2292 1.4990 -0.1643 0.2472  0.0857  87  THR B CG2 
3861 N N   . ALA B 86  ? 1.4126 1.1492 1.2603 -0.0433 0.3611  0.1998  88  ALA B N   
3862 C CA  . ALA B 86  ? 1.3878 1.0974 1.1689 0.0169  0.3871  0.2197  88  ALA B CA  
3863 C C   . ALA B 86  ? 1.3698 1.1054 1.0852 0.0296  0.3204  0.2426  88  ALA B C   
3864 O O   . ALA B 86  ? 1.3593 1.0899 1.0385 0.0774  0.3097  0.2505  88  ALA B O   
3865 C CB  . ALA B 86  ? 1.3394 1.0329 1.1213 0.0320  0.4262  0.1986  88  ALA B CB  
3866 N N   . ASP B 87  ? 1.3758 1.1412 1.0804 -0.0120 0.2741  0.2498  89  ASP B N   
3867 C CA  . ASP B 87  ? 1.3263 1.1232 0.9866 -0.0070 0.2081  0.2659  89  ASP B CA  
3868 C C   . ASP B 87  ? 1.3647 1.1704 1.0303 -0.0058 0.1429  0.2760  89  ASP B C   
3869 O O   . ASP B 87  ? 1.3197 1.1383 0.9460 0.0108  0.0997  0.2921  89  ASP B O   
3870 C CB  . ASP B 87  ? 1.2874 1.1169 0.9439 -0.0504 0.1781  0.2666  89  ASP B CB  
3871 C CG  . ASP B 87  ? 1.2551 1.0977 0.9091 -0.0424 0.2068  0.2489  89  ASP B CG  
3872 O OD1 . ASP B 87  ? 1.2532 1.0947 0.8908 -0.0045 0.2154  0.2430  89  ASP B OD1 
3873 O OD2 . ASP B 87  ? 1.2642 1.1164 0.9337 -0.0703 0.2191  0.2419  89  ASP B OD2 
3874 N N   . THR B 88  ? 1.3263 1.1373 1.0570 -0.0250 0.1243  0.2536  90  THR B N   
3875 C CA  . THR B 88  ? 1.3151 1.1409 1.0670 -0.0250 0.0535  0.2501  90  THR B CA  
3876 C C   . THR B 88  ? 1.3540 1.1532 1.0824 0.0292  0.0646  0.2531  90  THR B C   
3877 O O   . THR B 88  ? 1.4043 1.1753 1.1411 0.0597  0.1277  0.2466  90  THR B O   
3878 C CB  . THR B 88  ? 1.3868 1.2308 1.2137 -0.0568 0.0327  0.2249  90  THR B CB  
3879 O OG1 . THR B 88  ? 1.4559 1.2818 1.3254 -0.0479 0.1017  0.2058  90  THR B OG1 
3880 C CG2 . THR B 88  ? 1.3528 1.2294 1.1936 -0.1052 0.0018  0.2210  90  THR B CG2 
3881 N N   . SER B 89  ? 1.3508 1.1572 1.0502 0.0423  0.0050  0.2623  91  SER B N   
3882 C CA  . SER B 89  ? 1.3616 1.1455 1.0354 0.0945  0.0010  0.2606  91  SER B CA  
3883 C C   . SER B 89  ? 1.3139 1.1093 0.9970 0.0822  -0.0827 0.2580  91  SER B C   
3884 O O   . SER B 89  ? 1.2498 1.0662 0.9185 0.0572  -0.1278 0.2688  91  SER B O   
3885 C CB  . SER B 89  ? 1.3575 1.1313 0.9600 0.1416  0.0348  0.2743  91  SER B CB  
3886 O OG  . SER B 89  ? 1.4308 1.1801 1.0204 0.1646  0.1219  0.2781  91  SER B OG  
3887 N N   . SER B 90  ? 1.3198 1.0985 1.0272 0.1014  -0.0994 0.2451  92  SER B N   
3888 C CA  . SER B 90  ? 1.2682 1.0491 0.9891 0.0886  -0.1742 0.2414  92  SER B CA  
3889 C C   . SER B 90  ? 1.2915 1.0611 0.9634 0.1221  -0.2070 0.2420  92  SER B C   
3890 O O   . SER B 90  ? 1.3115 1.0726 0.9371 0.1661  -0.1719 0.2427  92  SER B O   
3891 C CB  . SER B 90  ? 1.3005 1.0684 1.0659 0.0982  -0.1790 0.2269  92  SER B CB  
3892 O OG  . SER B 90  ? 1.3763 1.1616 1.1940 0.0713  -0.1446 0.2197  92  SER B OG  
3893 N N   . PHE B 91  ? 1.2226 1.0085 0.9210 0.0990  -0.2606 0.2315  93  PHE B N   
3894 C CA  . PHE B 91  ? 1.2151 1.0165 0.9062 0.1140  -0.2798 0.2145  93  PHE B CA  
3895 C C   . PHE B 91  ? 1.2018 1.0420 0.8764 0.1082  -0.2666 0.2193  93  PHE B C   
3896 O O   . PHE B 91  ? 1.2049 1.0595 0.8622 0.1322  -0.2709 0.2101  93  PHE B O   
3897 C CB  . PHE B 91  ? 1.2619 1.0336 0.9254 0.1693  -0.2707 0.2027  93  PHE B CB  
3898 C CG  . PHE B 91  ? 1.2941 1.0304 0.9756 0.1827  -0.2801 0.1969  93  PHE B CG  
3899 C CD1 . PHE B 91  ? 1.3085 1.0390 1.0142 0.1707  -0.3205 0.1804  93  PHE B CD1 
3900 C CD2 . PHE B 91  ? 1.3304 1.0344 1.0041 0.2105  -0.2430 0.2077  93  PHE B CD2 
3901 C CE1 . PHE B 91  ? 1.3352 1.0386 1.0589 0.1847  -0.3275 0.1759  93  PHE B CE1 
3902 C CE2 . PHE B 91  ? 1.3607 1.0432 1.0643 0.2231  -0.2478 0.2009  93  PHE B CE2 
3903 C CZ  . PHE B 91  ? 1.3517 1.0348 1.0771 0.2117  -0.2950 0.1869  93  PHE B CZ  
3904 N N   . VAL B 92  ? 1.1731 1.0309 0.8551 0.0759  -0.2520 0.2315  94  VAL B N   
3905 C CA  . VAL B 92  ? 1.1502 1.0427 0.8170 0.0732  -0.2339 0.2363  94  VAL B CA  
3906 C C   . VAL B 92  ? 1.1310 1.0371 0.8326 0.0222  -0.2492 0.2356  94  VAL B C   
3907 O O   . VAL B 92  ? 1.1221 1.0192 0.8454 -0.0074 -0.2499 0.2417  94  VAL B O   
3908 C CB  . VAL B 92  ? 1.1791 1.0712 0.8087 0.0957  -0.1798 0.2572  94  VAL B CB  
3909 C CG1 . VAL B 92  ? 1.1629 1.0687 0.7757 0.0836  -0.1594 0.2566  94  VAL B CG1 
3910 C CG2 . VAL B 92  ? 1.2118 1.0841 0.8107 0.1309  -0.1680 0.2511  94  VAL B CG2 
3911 N N   . PRO B 93  ? 1.0110 1.1951 0.6999 0.0485  -0.0712 0.1358  95  PRO B N   
3912 C CA  . PRO B 93  ? 0.9899 1.1543 0.7198 0.0584  -0.0814 0.1437  95  PRO B CA  
3913 C C   . PRO B 93  ? 0.9570 1.1244 0.7143 0.0330  -0.0596 0.1608  95  PRO B C   
3914 O O   . PRO B 93  ? 0.9524 1.0931 0.7098 0.0098  -0.0523 0.1861  95  PRO B O   
3915 C CB  . PRO B 93  ? 1.0272 1.1304 0.7606 0.0680  -0.1106 0.1610  95  PRO B CB  
3916 C CG  . PRO B 93  ? 1.0891 1.1909 0.7818 0.0710  -0.1242 0.1508  95  PRO B CG  
3917 C CD  . PRO B 93  ? 1.0607 1.2020 0.7176 0.0516  -0.0961 0.1493  95  PRO B CD  
3918 N N   . LEU B 94  ? 0.8702 1.0718 0.6528 0.0397  -0.0510 0.1448  96  LEU B N   
3919 C CA  . LEU B 94  ? 0.8367 1.0521 0.6520 0.0178  -0.0303 0.1483  96  LEU B CA  
3920 C C   . LEU B 94  ? 0.8441 1.0281 0.6731 0.0298  -0.0415 0.1609  96  LEU B C   
3921 O O   . LEU B 94  ? 0.8424 1.0418 0.6638 0.0574  -0.0527 0.1491  96  LEU B O   
3922 C CB  . LEU B 94  ? 0.8148 1.1044 0.6490 0.0157  -0.0114 0.1117  96  LEU B CB  
3923 C CG  . LEU B 94  ? 0.7891 1.1069 0.6666 -0.0054 0.0094  0.1008  96  LEU B CG  
3924 C CD1 . LEU B 94  ? 0.7933 1.0835 0.6924 -0.0426 0.0345  0.1238  96  LEU B CD1 
3925 C CD2 . LEU B 94  ? 0.7871 1.1863 0.6914 -0.0008 0.0198  0.0543  96  LEU B CD2 
3926 N N   . GLU B 95  ? 0.8947 1.0335 0.7442 0.0103  -0.0368 0.1865  97  GLU B N   
3927 C CA  . GLU B 95  ? 0.8911 0.9965 0.7560 0.0170  -0.0390 0.1993  97  GLU B CA  
3928 C C   . GLU B 95  ? 0.8986 1.0423 0.7852 0.0043  -0.0176 0.1830  97  GLU B C   
3929 O O   . GLU B 95  ? 0.8967 1.0498 0.8160 -0.0252 0.0016  0.1807  97  GLU B O   
3930 C CB  . GLU B 95  ? 0.8940 0.9347 0.7823 0.0032  -0.0447 0.2284  97  GLU B CB  
3931 C CG  . GLU B 95  ? 0.9304 0.9274 0.8353 0.0143  -0.0458 0.2419  97  GLU B CG  
3932 C CD  . GLU B 95  ? 0.9962 0.9381 0.9449 -0.0037 -0.0474 0.2636  97  GLU B CD  
3933 O OE1 . GLU B 95  ? 0.9680 0.8938 0.9204 -0.0111 -0.0643 0.2722  97  GLU B OE1 
3934 O OE2 . GLU B 95  ? 0.9698 0.8866 0.9486 -0.0090 -0.0322 0.2710  97  GLU B OE2 
3935 N N   . LEU B 96  ? 0.8612 1.0270 0.7301 0.0281  -0.0214 0.1710  98  LEU B N   
3936 C CA  . LEU B 96  ? 0.8604 1.0700 0.7408 0.0221  -0.0066 0.1482  98  LEU B CA  
3937 C C   . LEU B 96  ? 0.8916 1.0604 0.7650 0.0277  0.0001  0.1667  98  LEU B C   
3938 O O   . LEU B 96  ? 0.8989 1.0223 0.7472 0.0507  -0.0098 0.1916  98  LEU B O   
3939 C CB  . LEU B 96  ? 0.8553 1.1343 0.7131 0.0490  -0.0187 0.1155  98  LEU B CB  
3940 C CG  . LEU B 96  ? 0.8390 1.1610 0.7057 0.0480  -0.0224 0.0934  98  LEU B CG  
3941 C CD1 . LEU B 96  ? 0.8387 1.2169 0.6858 0.0851  -0.0428 0.0662  98  LEU B CD1 
3942 C CD2 . LEU B 96  ? 0.8189 1.1785 0.7337 0.0105  0.0036  0.0706  98  LEU B CD2 
3943 N N   . ARG B 97  ? 0.9120 1.0966 0.8129 0.0057  0.0212  0.1524  99  ARG B N   
3944 C CA  . ARG B 97  ? 0.9422 1.0943 0.8355 0.0081  0.0353  0.1647  99  ARG B CA  
3945 C C   . ARG B 97  ? 0.9728 1.1836 0.8722 -0.0007 0.0510  0.1267  99  ARG B C   
3946 O O   . ARG B 97  ? 0.9706 1.2080 0.9255 -0.0320 0.0659  0.1023  99  ARG B O   
3947 C CB  . ARG B 97  ? 0.9504 1.0351 0.8917 -0.0174 0.0483  0.1913  99  ARG B CB  
3948 C CG  . ARG B 97  ? 1.0086 1.0462 0.9425 -0.0106 0.0648  0.2103  99  ARG B CG  
3949 C CD  . ARG B 97  ? 1.0358 1.0214 1.0383 -0.0401 0.0805  0.2242  99  ARG B CD  
3950 N NE  . ARG B 97  ? 1.0215 0.9569 1.0468 -0.0391 0.0598  0.2503  99  ARG B NE  
3951 C CZ  . ARG B 97  ? 1.0678 0.9445 1.1113 -0.0322 0.0610  0.2728  99  ARG B CZ  
3952 N NH1 . ARG B 97  ? 1.0555 0.9107 1.0926 -0.0268 0.0880  0.2787  99  ARG B NH1 
3953 N NH2 . ARG B 97  ? 0.9735 0.8143 1.0423 -0.0306 0.0368  0.2873  99  ARG B NH2 
3954 N N   . VAL B 98  ? 1.0162 1.2466 0.8595 0.0279  0.0479  0.1214  100 VAL B N   
3955 C CA  . VAL B 98  ? 1.0269 1.3154 0.8636 0.0248  0.0595  0.0814  100 VAL B CA  
3956 C C   . VAL B 98  ? 1.0876 1.3290 0.9168 0.0162  0.0879  0.0981  100 VAL B C   
3957 O O   . VAL B 98  ? 1.1109 1.3037 0.8876 0.0404  0.0906  0.1352  100 VAL B O   
3958 C CB  . VAL B 98  ? 1.0346 1.3856 0.8043 0.0667  0.0335  0.0610  100 VAL B CB  
3959 C CG1 . VAL B 98  ? 1.0454 1.4640 0.8054 0.0649  0.0409  0.0123  100 VAL B CG1 
3960 C CG2 . VAL B 98  ? 0.9870 1.3845 0.7769 0.0743  0.0086  0.0414  100 VAL B CG2 
3961 N N   . THR B 99  ? 1.0599 1.3132 0.9489 -0.0189 0.1134  0.0704  101 THR B N   
3962 C CA  . THR B 99  ? 1.0967 1.3090 0.9955 -0.0328 0.1461  0.0786  101 THR B CA  
3963 C C   . THR B 99  ? 1.1246 1.4025 1.0050 -0.0344 0.1612  0.0275  101 THR B C   
3964 O O   . THR B 99  ? 1.1007 1.4495 1.0150 -0.0453 0.1534  -0.0226 101 THR B O   
3965 C CB  . THR B 99  ? 1.1377 1.3015 1.1344 -0.0726 0.1643  0.0887  101 THR B CB  
3966 O OG1 . THR B 99  ? 1.1128 1.2394 1.1265 -0.0714 0.1413  0.1223  101 THR B OG1 
3967 C CG2 . THR B 99  ? 1.1518 1.2554 1.1620 -0.0808 0.1951  0.1096  101 THR B CG2 
3968 N N   . ALA B 100 ? 1.1693 1.4250 0.9967 -0.0232 0.1847  0.0377  102 ALA B N   
3969 C CA  . ALA B 100 ? 1.1852 1.5025 0.9788 -0.0211 0.1998  -0.0117 102 ALA B CA  
3970 C C   . ALA B 100 ? 1.1885 1.5155 1.0852 -0.0673 0.2323  -0.0543 102 ALA B C   
3971 O O   . ALA B 100 ? 1.1751 1.4515 1.1634 -0.0979 0.2442  -0.0361 102 ALA B O   
3972 C CB  . ALA B 100 ? 1.2476 1.5329 0.9386 0.0075  0.2198  0.0188  102 ALA B CB  
3973 N N   . ALA B 101 ? 1.1798 1.5751 1.0621 -0.0698 0.2445  -0.1140 103 ALA B N   
3974 C CA  . ALA B 101 ? 1.1638 1.5749 1.1505 -0.1124 0.2774  -0.1638 103 ALA B CA  
3975 C C   . ALA B 101 ? 1.1933 1.5241 1.2200 -0.1335 0.3187  -0.1318 103 ALA B C   
3976 O O   . ALA B 101 ? 1.1685 1.4711 1.3138 -0.1701 0.3366  -0.1384 103 ALA B O   
3977 C CB  . ALA B 101 ? 1.1691 1.6716 1.1221 -0.1067 0.2825  -0.2393 103 ALA B CB  
3978 N N   . SER B 102 ? 1.2342 1.5261 1.1689 -0.1100 0.3357  -0.0959 104 SER B N   
3979 C CA  . SER B 102 ? 1.2411 1.4572 1.2199 -0.1293 0.3783  -0.0671 104 SER B CA  
3980 C C   . SER B 102 ? 1.2379 1.3742 1.2736 -0.1349 0.3648  -0.0068 104 SER B C   
3981 O O   . SER B 102 ? 1.2181 1.2989 1.3404 -0.1599 0.3916  0.0058  104 SER B O   
3982 C CB  . SER B 102 ? 1.3107 1.5090 1.1724 -0.1031 0.4085  -0.0468 104 SER B CB  
3983 O OG  . SER B 102 ? 1.3796 1.5557 1.1370 -0.0617 0.3807  0.0071  104 SER B OG  
3984 N N   . GLY B 103 ? 1.2754 1.4086 1.2684 -0.1111 0.3227  0.0257  105 GLY B N   
3985 C CA  . GLY B 103 ? 1.2594 1.3241 1.2951 -0.1125 0.3056  0.0771  105 GLY B CA  
3986 C C   . GLY B 103 ? 1.2987 1.3241 1.2431 -0.0755 0.2947  0.1271  105 GLY B C   
3987 O O   . GLY B 103 ? 1.2862 1.2471 1.2630 -0.0748 0.2888  0.1682  105 GLY B O   
3988 N N   . ALA B 104 ? 1.3021 1.3670 1.1357 -0.0429 0.2905  0.1224  106 ALA B N   
3989 C CA  . ALA B 104 ? 1.3310 1.3574 1.0747 -0.0039 0.2837  0.1723  106 ALA B CA  
3990 C C   . ALA B 104 ? 1.3185 1.3559 1.0501 0.0176  0.2335  0.1880  106 ALA B C   
3991 O O   . ALA B 104 ? 1.2858 1.3846 1.0379 0.0118  0.2048  0.1527  106 ALA B O   
3992 C CB  . ALA B 104 ? 1.3871 1.4507 1.0098 0.0274  0.2966  0.1655  106 ALA B CB  
3993 N N   . PRO B 105 ? 1.3242 1.3028 1.0301 0.0414  0.2259  0.2375  107 PRO B N   
3994 C CA  . PRO B 105 ? 1.2918 1.2798 0.9912 0.0619  0.1808  0.2487  107 PRO B CA  
3995 C C   . PRO B 105 ? 1.3256 1.3723 0.9294 0.1033  0.1543  0.2408  107 PRO B C   
3996 O O   . PRO B 105 ? 1.3781 1.4121 0.8972 0.1347  0.1669  0.2650  107 PRO B O   
3997 C CB  . PRO B 105 ? 1.3041 1.2062 1.0206 0.0718  0.1878  0.2987  107 PRO B CB  
3998 C CG  . PRO B 105 ? 1.3788 1.2376 1.0597 0.0764  0.2355  0.3224  107 PRO B CG  
3999 C CD  . PRO B 105 ? 1.3640 1.2616 1.0649 0.0462  0.2628  0.2821  107 PRO B CD  
4000 N N   . ARG B 106 ? 1.2310 1.3422 0.8499 0.1046  0.1183  0.2073  108 ARG B N   
4001 C CA  . ARG B 106 ? 1.2340 1.4094 0.7815 0.1447  0.0852  0.1926  108 ARG B CA  
4002 C C   . ARG B 106 ? 1.2222 1.3873 0.7729 0.1689  0.0508  0.2123  108 ARG B C   
4003 O O   . ARG B 106 ? 1.2519 1.4052 0.7381 0.2127  0.0356  0.2409  108 ARG B O   
4004 C CB  . ARG B 106 ? 1.2034 1.4744 0.7742 0.1288  0.0734  0.1268  108 ARG B CB  
4005 C CG  . ARG B 106 ? 1.2465 1.5967 0.7502 0.1711  0.0369  0.1005  108 ARG B CG  
4006 C CD  . ARG B 106 ? 1.3557 1.7071 0.7524 0.2065  0.0448  0.1162  108 ARG B CD  
4007 N NE  . ARG B 106 ? 1.4351 1.7444 0.7568 0.2564  0.0275  0.1721  108 ARG B NE  
4008 C CZ  . ARG B 106 ? 1.5007 1.8562 0.7841 0.2977  -0.0151 0.1618  108 ARG B CZ  
4009 N NH1 . ARG B 106 ? 1.4170 1.8725 0.7167 0.3000  -0.0453 0.0979  108 ARG B NH1 
4010 N NH2 . ARG B 106 ? 1.4868 1.7816 0.7479 0.3279  -0.0253 0.2072  108 ARG B NH2 
4011 N N   . TYR B 107 ? 1.2118 1.3801 0.8352 0.1428  0.0396  0.1982  109 TYR B N   
4012 C CA  . TYR B 107 ? 1.1822 1.3435 0.8128 0.1622  0.0107  0.2101  109 TYR B CA  
4013 C C   . TYR B 107 ? 1.1609 1.2775 0.8624 0.1287  0.0155  0.2186  109 TYR B C   
4014 O O   . TYR B 107 ? 1.1488 1.2649 0.9011 0.0902  0.0324  0.2046  109 TYR B O   
4015 C CB  . TYR B 107 ? 1.1563 1.4068 0.7825 0.1772  -0.0201 0.1672  109 TYR B CB  
4016 C CG  . TYR B 107 ? 1.1979 1.4951 0.7500 0.2235  -0.0403 0.1611  109 TYR B CG  
4017 C CD1 . TYR B 107 ? 1.2396 1.5032 0.7404 0.2700  -0.0572 0.2000  109 TYR B CD1 
4018 C CD2 . TYR B 107 ? 1.2027 1.5786 0.7394 0.2227  -0.0446 0.1150  109 TYR B CD2 
4019 C CE1 . TYR B 107 ? 1.2820 1.5803 0.7236 0.3109  -0.0776 0.1953  109 TYR B CE1 
4020 C CE2 . TYR B 107 ? 1.2428 1.6668 0.7052 0.2695  -0.0700 0.1078  109 TYR B CE2 
4021 C CZ  . TYR B 107 ? 1.3111 1.6908 0.7287 0.3124  -0.0863 0.1503  109 TYR B CZ  
4022 O OH  . TYR B 107 ? 1.3658 1.7726 0.7409 0.3474  -0.1078 0.1407  109 TYR B OH  
4023 N N   . HIS B 108 ? 1.0788 1.1585 0.7838 0.1459  -0.0011 0.2408  110 HIS B N   
4024 C CA  . HIS B 108 ? 1.0463 1.0888 0.8065 0.1213  -0.0045 0.2467  110 HIS B CA  
4025 C C   . HIS B 108 ? 1.0442 1.0897 0.7960 0.1474  -0.0316 0.2472  110 HIS B C   
4026 O O   . HIS B 108 ? 1.0614 1.0684 0.7936 0.1782  -0.0365 0.2714  110 HIS B O   
4027 C CB  . HIS B 108 ? 1.0606 1.0236 0.8515 0.1080  0.0158  0.2780  110 HIS B CB  
4028 C CG  . HIS B 108 ? 1.0421 0.9788 0.8945 0.0763  0.0120  0.2766  110 HIS B CG  
4029 N ND1 . HIS B 108 ? 1.0228 0.9675 0.8857 0.0769  -0.0131 0.2689  110 HIS B ND1 
4030 C CD2 . HIS B 108 ? 1.0444 0.9471 0.9490 0.0461  0.0284  0.2825  110 HIS B CD2 
4031 C CE1 . HIS B 108 ? 0.9999 0.9171 0.9094 0.0502  -0.0147 0.2729  110 HIS B CE1 
4032 N NE2 . HIS B 108 ? 1.0096 0.9006 0.9506 0.0317  0.0086  0.2813  110 HIS B NE2 
4033 N N   . ARG B 109 ? 0.9327 1.0216 0.7028 0.1350  -0.0448 0.2205  111 ARG B N   
4034 C CA  . ARG B 109 ? 0.9282 1.0302 0.6930 0.1580  -0.0674 0.2119  111 ARG B CA  
4035 C C   . ARG B 109 ? 0.9259 1.0350 0.7186 0.1307  -0.0704 0.1979  111 ARG B C   
4036 O O   . ARG B 109 ? 0.9102 1.0373 0.7219 0.0982  -0.0570 0.1891  111 ARG B O   
4037 C CB  . ARG B 109 ? 0.9304 1.1041 0.6694 0.1862  -0.0819 0.1856  111 ARG B CB  
4038 C CG  . ARG B 109 ? 1.0063 1.1660 0.7039 0.2296  -0.0903 0.2069  111 ARG B CG  
4039 C CD  . ARG B 109 ? 1.0528 1.2931 0.7272 0.2579  -0.1099 0.1770  111 ARG B CD  
4040 N NE  . ARG B 109 ? 1.0943 1.3554 0.7788 0.2886  -0.1340 0.1648  111 ARG B NE  
4041 C CZ  . ARG B 109 ? 1.1273 1.4556 0.8416 0.2826  -0.1435 0.1219  111 ARG B CZ  
4042 N NH1 . ARG B 109 ? 1.0422 1.4199 0.7800 0.2464  -0.1298 0.0903  111 ARG B NH1 
4043 N NH2 . ARG B 109 ? 1.0850 1.4299 0.8132 0.3120  -0.1630 0.1093  111 ARG B NH2 
4044 N N   . VAL B 110 ? 0.8700 0.9626 0.6640 0.1452  -0.0865 0.1967  112 VAL B N   
4045 C CA  . VAL B 110 ? 0.8554 0.9593 0.6579 0.1267  -0.0912 0.1824  112 VAL B CA  
4046 C C   . VAL B 110 ? 0.8660 1.0189 0.6571 0.1500  -0.1027 0.1537  112 VAL B C   
4047 O O   . VAL B 110 ? 0.8880 1.0215 0.6789 0.1796  -0.1177 0.1538  112 VAL B O   
4048 C CB  . VAL B 110 ? 0.8619 0.9027 0.6799 0.1207  -0.1012 0.1995  112 VAL B CB  
4049 C CG1 . VAL B 110 ? 0.8650 0.9230 0.6728 0.1101  -0.1101 0.1830  112 VAL B CG1 
4050 C CG2 . VAL B 110 ? 0.8490 0.8479 0.6915 0.0953  -0.0895 0.2230  112 VAL B CG2 
4051 N N   . ILE B 111 ? 0.8677 1.0838 0.6597 0.1364  -0.0928 0.1269  113 ILE B N   
4052 C CA  . ILE B 111 ? 0.8758 1.1482 0.6684 0.1560  -0.0992 0.0932  113 ILE B CA  
4053 C C   . ILE B 111 ? 0.8879 1.1857 0.6800 0.1299  -0.0841 0.0755  113 ILE B C   
4054 O O   . ILE B 111 ? 0.8695 1.1530 0.6604 0.0969  -0.0676 0.0897  113 ILE B O   
4055 C CB  . ILE B 111 ? 0.8610 1.1986 0.6627 0.1705  -0.0999 0.0698  113 ILE B CB  
4056 C CG1 . ILE B 111 ? 0.8184 1.1900 0.6375 0.1347  -0.0772 0.0592  113 ILE B CG1 
4057 C CG2 . ILE B 111 ? 0.8764 1.1881 0.6607 0.2038  -0.1158 0.0917  113 ILE B CG2 
4058 C CD1 . ILE B 111 ? 0.8172 1.2608 0.6650 0.1200  -0.0617 0.0184  113 ILE B CD1 
4059 N N   . HIS B 112 ? 0.8947 1.2289 0.6879 0.1464  -0.0879 0.0456  114 HIS B N   
4060 C CA  . HIS B 112 ? 0.8887 1.2551 0.6750 0.1252  -0.0674 0.0248  114 HIS B CA  
4061 C C   . HIS B 112 ? 0.8677 1.3144 0.6861 0.1259  -0.0516 -0.0147 114 HIS B C   
4062 O O   . HIS B 112 ? 0.8788 1.3597 0.7190 0.1579  -0.0692 -0.0373 114 HIS B O   
4063 C CB  . HIS B 112 ? 0.9470 1.2964 0.7137 0.1408  -0.0792 0.0131  114 HIS B CB  
4064 C CG  . HIS B 112 ? 0.9985 1.2766 0.7441 0.1388  -0.0966 0.0426  114 HIS B CG  
4065 N ND1 . HIS B 112 ? 1.0281 1.2572 0.7898 0.1582  -0.1178 0.0629  114 HIS B ND1 
4066 C CD2 . HIS B 112 ? 1.0267 1.2763 0.7399 0.1207  -0.0965 0.0538  114 HIS B CD2 
4067 C CE1 . HIS B 112 ? 1.0531 1.2292 0.8054 0.1502  -0.1296 0.0800  114 HIS B CE1 
4068 N NE2 . HIS B 112 ? 1.0581 1.2475 0.7783 0.1293  -0.1211 0.0743  114 HIS B NE2 
4069 N N   . ILE B 113 ? 0.9032 1.3788 0.7310 0.0914  -0.0185 -0.0225 115 ILE B N   
4070 C CA  . ILE B 113 ? 0.8729 1.4276 0.7487 0.0862  0.0012  -0.0647 115 ILE B CA  
4071 C C   . ILE B 113 ? 0.8904 1.4925 0.7815 0.1118  -0.0031 -0.1059 115 ILE B C   
4072 O O   . ILE B 113 ? 0.8770 1.5418 0.8151 0.1315  -0.0118 -0.1437 115 ILE B O   
4073 C CB  . ILE B 113 ? 0.8546 1.4214 0.7442 0.0414  0.0461  -0.0622 115 ILE B CB  
4074 C CG1 . ILE B 113 ? 0.8411 1.3638 0.7314 0.0178  0.0497  -0.0257 115 ILE B CG1 
4075 C CG2 . ILE B 113 ? 0.8269 1.4785 0.7828 0.0334  0.0708  -0.1131 115 ILE B CG2 
4076 C CD1 . ILE B 113 ? 0.8689 1.3131 0.7076 0.0067  0.0452  0.0238  115 ILE B CD1 
4077 N N   . ASN B 114 ? 0.8869 1.4632 0.7421 0.1138  0.0005  -0.1033 116 ASN B N   
4078 C CA  . ASN B 114 ? 0.9062 1.5264 0.7805 0.1365  0.0004  -0.1467 116 ASN B CA  
4079 C C   . ASN B 114 ? 0.9174 1.5343 0.8120 0.1838  -0.0420 -0.1553 116 ASN B C   
4080 O O   . ASN B 114 ? 0.9170 1.5772 0.8456 0.2078  -0.0459 -0.1956 116 ASN B O   
4081 C CB  . ASN B 114 ? 0.9484 1.5421 0.7719 0.1257  0.0162  -0.1448 116 ASN B CB  
4082 C CG  . ASN B 114 ? 0.9701 1.4857 0.7441 0.1325  -0.0126 -0.1059 116 ASN B CG  
4083 O OD1 . ASN B 114 ? 0.9660 1.4365 0.7163 0.1129  -0.0142 -0.0646 116 ASN B OD1 
4084 N ND2 . ASN B 114 ? 1.0065 1.5074 0.7759 0.1602  -0.0350 -0.1230 116 ASN B ND2 
4085 N N   . GLU B 115 ? 0.9202 1.4849 0.7982 0.1982  -0.0703 -0.1175 117 GLU B N   
4086 C CA  . GLU B 115 ? 0.9526 1.5011 0.8442 0.2440  -0.1063 -0.1139 117 GLU B CA  
4087 C C   . GLU B 115 ? 0.9471 1.5336 0.8628 0.2662  -0.1243 -0.1168 117 GLU B C   
4088 O O   . GLU B 115 ? 0.9528 1.5246 0.8732 0.3079  -0.1541 -0.1065 117 GLU B O   
4089 C CB  . GLU B 115 ? 1.0073 1.4677 0.8652 0.2491  -0.1226 -0.0692 117 GLU B CB  
4090 C CG  . GLU B 115 ? 1.0721 1.4975 0.9084 0.2377  -0.1171 -0.0732 117 GLU B CG  
4091 C CD  . GLU B 115 ? 1.2076 1.5580 1.0403 0.2559  -0.1402 -0.0463 117 GLU B CD  
4092 O OE1 . GLU B 115 ? 1.1747 1.5127 1.0361 0.2929  -0.1591 -0.0452 117 GLU B OE1 
4093 O OE2 . GLU B 115 ? 1.2073 1.5105 1.0138 0.2343  -0.1393 -0.0260 117 GLU B OE2 
4094 N N   . VAL B 116 ? 0.7499 1.0334 1.3620 -0.0673 -0.3354 0.4935  118 VAL B N   
4095 C CA  . VAL B 116 ? 0.7565 1.0164 1.3572 -0.0425 -0.3001 0.4794  118 VAL B CA  
4096 C C   . VAL B 116 ? 0.8013 1.0320 1.3378 -0.0419 -0.2840 0.4244  118 VAL B C   
4097 O O   . VAL B 116 ? 0.8345 1.0448 1.3572 -0.0235 -0.2457 0.4138  118 VAL B O   
4098 C CB  . VAL B 116 ? 0.7552 1.0220 1.3969 -0.0159 -0.2599 0.5255  118 VAL B CB  
4099 C CG1 . VAL B 116 ? 0.7505 1.0408 1.4347 -0.0208 -0.2556 0.5552  118 VAL B CG1 
4100 C CG2 . VAL B 116 ? 0.7641 1.0356 1.4159 -0.0159 -0.2474 0.5494  118 VAL B CG2 
4101 N N   . VAL B 117 ? 0.8247 1.0551 1.3233 -0.0618 -0.3138 0.3880  119 VAL B N   
4102 C CA  . VAL B 117 ? 0.8634 1.0753 1.3062 -0.0637 -0.3017 0.3407  119 VAL B CA  
4103 C C   . VAL B 117 ? 0.8746 1.0675 1.2899 -0.0542 -0.2927 0.3017  119 VAL B C   
4104 O O   . VAL B 117 ? 0.8501 1.0459 1.2711 -0.0571 -0.3157 0.2943  119 VAL B O   
4105 C CB  . VAL B 117 ? 0.8657 1.0948 1.2776 -0.0841 -0.3347 0.3205  119 VAL B CB  
4106 C CG1 . VAL B 117 ? 0.9025 1.1214 1.2652 -0.0853 -0.3186 0.2818  119 VAL B CG1 
4107 C CG2 . VAL B 117 ? 0.8526 1.1133 1.2936 -0.0931 -0.3482 0.3644  119 VAL B CG2 
4108 N N   . LEU B 118 ? 0.8813 1.0555 1.2703 -0.0434 -0.2604 0.2775  120 LEU B N   
4109 C CA  . LEU B 118 ? 0.8997 1.0637 1.2572 -0.0344 -0.2507 0.2388  120 LEU B CA  
4110 C C   . LEU B 118 ? 0.9369 1.0919 1.2490 -0.0441 -0.2456 0.1962  120 LEU B C   
4111 O O   . LEU B 118 ? 0.9815 1.1215 1.2884 -0.0411 -0.2194 0.1890  120 LEU B O   
4112 C CB  . LEU B 118 ? 0.9228 1.0810 1.2932 -0.0100 -0.2170 0.2489  120 LEU B CB  
4113 C CG  . LEU B 118 ? 0.9461 1.1049 1.2833 0.0015  -0.2071 0.2127  120 LEU B CG  
4114 C CD1 . LEU B 118 ? 0.8977 1.0747 1.2494 0.0030  -0.2300 0.2236  120 LEU B CD1 
4115 C CD2 . LEU B 118 ? 0.9948 1.1493 1.3309 0.0266  -0.1701 0.2122  120 LEU B CD2 
4116 N N   . LEU B 119 ? 1.0222 1.1863 1.3059 -0.0554 -0.2706 0.1687  121 LEU B N   
4117 C CA  . LEU B 119 ? 1.0449 1.2110 1.2898 -0.0650 -0.2680 0.1342  121 LEU B CA  
4118 C C   . LEU B 119 ? 1.1046 1.2628 1.3256 -0.0567 -0.2481 0.1006  121 LEU B C   
4119 O O   . LEU B 119 ? 1.1077 1.2630 1.3357 -0.0418 -0.2383 0.1016  121 LEU B O   
4120 C CB  . LEU B 119 ? 0.9937 1.1766 1.2144 -0.0746 -0.2997 0.1152  121 LEU B CB  
4121 C CG  . LEU B 119 ? 0.9817 1.1801 1.2161 -0.0846 -0.3253 0.1392  121 LEU B CG  
4122 C CD1 . LEU B 119 ? 0.9464 1.1567 1.1530 -0.0892 -0.3579 0.1097  121 LEU B CD1 
4123 C CD2 . LEU B 119 ? 1.0138 1.2252 1.2491 -0.0924 -0.3126 0.1589  121 LEU B CD2 
4124 N N   . ASP B 120 ? 1.0718 1.2336 1.2659 -0.0667 -0.2426 0.0733  122 ASP B N   
4125 C CA  . ASP B 120 ? 1.0943 1.2564 1.2645 -0.0633 -0.2294 0.0381  122 ASP B CA  
4126 C C   . ASP B 120 ? 1.0494 1.2321 1.1942 -0.0607 -0.2483 0.0147  122 ASP B C   
4127 O O   . ASP B 120 ? 0.9994 1.1910 1.1413 -0.0634 -0.2711 0.0184  122 ASP B O   
4128 C CB  . ASP B 120 ? 1.1376 1.2957 1.3011 -0.0778 -0.2154 0.0233  122 ASP B CB  
4129 C CG  . ASP B 120 ? 1.2492 1.3807 1.4448 -0.0789 -0.1953 0.0470  122 ASP B CG  
4130 O OD1 . ASP B 120 ? 1.2388 1.3730 1.4553 -0.0837 -0.2008 0.0807  122 ASP B OD1 
4131 O OD2 . ASP B 120 ? 1.3361 1.4452 1.5363 -0.0737 -0.1744 0.0312  122 ASP B OD2 
4132 N N   . ALA B 121 ? 1.0997 1.2912 1.2264 -0.0540 -0.2391 -0.0110 123 ALA B N   
4133 C CA  . ALA B 121 ? 1.0396 1.2525 1.1472 -0.0481 -0.2536 -0.0299 123 ALA B CA  
4134 C C   . ALA B 121 ? 1.0242 1.2544 1.1095 -0.0601 -0.2630 -0.0491 123 ALA B C   
4135 O O   . ALA B 121 ? 1.0478 1.2816 1.1282 -0.0735 -0.2520 -0.0560 123 ALA B O   
4136 C CB  . ALA B 121 ? 1.0489 1.2775 1.1433 -0.0370 -0.2407 -0.0485 123 ALA B CB  
4137 N N   . PRO B 122 ? 0.9233 1.1648 0.9983 -0.0545 -0.2827 -0.0568 124 PRO B N   
4138 C CA  . PRO B 122 ? 0.8963 1.1621 0.9465 -0.0602 -0.2890 -0.0756 124 PRO B CA  
4139 C C   . PRO B 122 ? 0.8973 1.1894 0.9314 -0.0614 -0.2766 -0.0981 124 PRO B C   
4140 O O   . PRO B 122 ? 0.8943 1.1892 0.9302 -0.0547 -0.2686 -0.1048 124 PRO B O   
4141 C CB  . PRO B 122 ? 0.8708 1.1361 0.9154 -0.0478 -0.3122 -0.0834 124 PRO B CB  
4142 C CG  . PRO B 122 ? 0.8967 1.1332 0.9721 -0.0437 -0.3218 -0.0605 124 PRO B CG  
4143 C CD  . PRO B 122 ? 0.9039 1.1348 0.9946 -0.0421 -0.3003 -0.0469 124 PRO B CD  
4144 N N   . VAL B 123 ? 0.9394 1.2585 0.9583 -0.0701 -0.2756 -0.1075 125 VAL B N   
4145 C CA  . VAL B 123 ? 0.9193 1.2708 0.9290 -0.0759 -0.2658 -0.1253 125 VAL B CA  
4146 C C   . VAL B 123 ? 0.8921 1.2815 0.8810 -0.0671 -0.2740 -0.1372 125 VAL B C   
4147 O O   . VAL B 123 ? 0.8859 1.2732 0.8639 -0.0573 -0.2864 -0.1357 125 VAL B O   
4148 C CB  . VAL B 123 ? 0.9713 1.3222 0.9953 -0.0988 -0.2511 -0.1197 125 VAL B CB  
4149 C CG1 . VAL B 123 ? 1.0239 1.3367 1.0659 -0.1024 -0.2403 -0.1161 125 VAL B CG1 
4150 C CG2 . VAL B 123 ? 0.9863 1.3419 1.0149 -0.1073 -0.2524 -0.0985 125 VAL B CG2 
4151 N N   . GLY B 124 ? 0.9485 1.3757 0.9320 -0.0697 -0.2673 -0.1507 126 GLY B N   
4152 C CA  . GLY B 124 ? 0.9155 1.3868 0.8817 -0.0588 -0.2706 -0.1601 126 GLY B CA  
4153 C C   . GLY B 124 ? 0.9184 1.3870 0.8731 -0.0313 -0.2821 -0.1720 126 GLY B C   
4154 O O   . GLY B 124 ? 0.9124 1.3978 0.8500 -0.0161 -0.2884 -0.1802 126 GLY B O   
4155 N N   . LEU B 125 ? 0.8784 1.3277 0.8440 -0.0226 -0.2843 -0.1726 127 LEU B N   
4156 C CA  . LEU B 125 ? 0.8785 1.3205 0.8454 0.0031  -0.2948 -0.1783 127 LEU B CA  
4157 C C   . LEU B 125 ? 0.8735 1.3634 0.8322 0.0171  -0.2889 -0.1889 127 LEU B C   
4158 O O   . LEU B 125 ? 0.8544 1.3748 0.8170 0.0093  -0.2778 -0.1868 127 LEU B O   
4159 C CB  . LEU B 125 ? 0.8895 1.3044 0.8775 0.0082  -0.2960 -0.1656 127 LEU B CB  
4160 C CG  . LEU B 125 ? 0.9221 1.3174 0.9264 0.0321  -0.3084 -0.1622 127 LEU B CG  
4161 C CD1 . LEU B 125 ? 0.9453 1.2998 0.9516 0.0336  -0.3257 -0.1658 127 LEU B CD1 
4162 C CD2 . LEU B 125 ? 0.9365 1.3220 0.9655 0.0369  -0.3051 -0.1409 127 LEU B CD2 
4163 N N   . VAL B 126 ? 0.8857 1.3796 0.8337 0.0381  -0.2946 -0.1997 128 VAL B N   
4164 C CA  . VAL B 126 ? 0.8791 1.4193 0.8218 0.0566  -0.2869 -0.2073 128 VAL B CA  
4165 C C   . VAL B 126 ? 0.9273 1.4497 0.8768 0.0893  -0.3010 -0.2190 128 VAL B C   
4166 O O   . VAL B 126 ? 0.9568 1.4410 0.8985 0.0984  -0.3134 -0.2317 128 VAL B O   
4167 C CB  . VAL B 126 ? 0.8855 1.4628 0.8082 0.0538  -0.2766 -0.2112 128 VAL B CB  
4168 C CG1 . VAL B 126 ? 0.8876 1.5187 0.8071 0.0791  -0.2701 -0.2188 128 VAL B CG1 
4169 C CG2 . VAL B 126 ? 0.8580 1.4554 0.7862 0.0210  -0.2655 -0.1975 128 VAL B CG2 
4170 N N   . ALA B 127 ? 0.8121 1.3562 0.7794 0.1060  -0.2970 -0.2122 129 ALA B N   
4171 C CA  . ALA B 127 ? 0.8358 1.3572 0.8210 0.1380  -0.3044 -0.2162 129 ALA B CA  
4172 C C   . ALA B 127 ? 0.8504 1.4236 0.8280 0.1637  -0.2948 -0.2258 129 ALA B C   
4173 O O   . ALA B 127 ? 0.8305 1.4673 0.8053 0.1574  -0.2825 -0.2167 129 ALA B O   
4174 C CB  . ALA B 127 ? 0.8219 1.3322 0.8418 0.1426  -0.3055 -0.1919 129 ALA B CB  
4175 N N   . ARG B 128 ? 0.8516 1.3982 0.8272 0.1930  -0.3011 -0.2455 130 ARG B N   
4176 C CA  . ARG B 128 ? 0.8820 1.4741 0.8501 0.2244  -0.2903 -0.2565 130 ARG B CA  
4177 C C   . ARG B 128 ? 0.9715 1.5205 0.9672 0.2614  -0.2973 -0.2650 130 ARG B C   
4178 O O   . ARG B 128 ? 1.0092 1.4859 1.0169 0.2626  -0.3147 -0.2770 130 ARG B O   
4179 C CB  . ARG B 128 ? 0.8892 1.5026 0.8159 0.2278  -0.2866 -0.2799 130 ARG B CB  
4180 C CG  . ARG B 128 ? 0.8471 1.5215 0.7564 0.1977  -0.2746 -0.2657 130 ARG B CG  
4181 C CD  . ARG B 128 ? 0.8349 1.5868 0.7593 0.2010  -0.2591 -0.2474 130 ARG B CD  
4182 N NE  . ARG B 128 ? 0.7984 1.5599 0.7431 0.1700  -0.2600 -0.2264 130 ARG B NE  
4183 C CZ  . ARG B 128 ? 0.7916 1.5752 0.7336 0.1330  -0.2532 -0.2155 130 ARG B CZ  
4184 N NH1 . ARG B 128 ? 0.7236 1.5278 0.6494 0.1218  -0.2450 -0.2161 130 ARG B NH1 
4185 N NH2 . ARG B 128 ? 0.7032 1.4799 0.6614 0.1078  -0.2505 -0.2013 130 ARG B NH2 
4186 N N   . LEU B 129 ? 0.8887 1.4829 0.9004 0.2909  -0.2844 -0.2569 131 LEU B N   
4187 C CA  . LEU B 129 ? 0.9401 1.4957 0.9849 0.3305  -0.2879 -0.2630 131 LEU B CA  
4188 C C   . LEU B 129 ? 1.0165 1.5542 1.0325 0.3611  -0.2882 -0.3054 131 LEU B C   
4189 O O   . LEU B 129 ? 1.0209 1.6228 1.0062 0.3733  -0.2724 -0.3134 131 LEU B O   
4190 C CB  . LEU B 129 ? 0.9193 1.5360 0.9971 0.3521  -0.2727 -0.2316 131 LEU B CB  
4191 C CG  . LEU B 129 ? 0.8753 1.5083 0.9860 0.3333  -0.2739 -0.1906 131 LEU B CG  
4192 C CD1 . LEU B 129 ? 0.8613 1.5774 0.9944 0.3534  -0.2587 -0.1607 131 LEU B CD1 
4193 C CD2 . LEU B 129 ? 0.8950 1.4482 1.0488 0.3389  -0.2884 -0.1803 131 LEU B CD2 
4194 N N   . ALA B 130 ? 1.0830 1.5368 1.1104 0.3742  -0.3067 -0.3327 132 ALA B N   
4195 C CA  . ALA B 130 ? 1.1736 1.6016 1.1709 0.4063  -0.3106 -0.3817 132 ALA B CA  
4196 C C   . ALA B 130 ? 1.2244 1.6533 1.2522 0.4570  -0.2986 -0.3872 132 ALA B C   
4197 O O   . ALA B 130 ? 1.2111 1.6120 1.2978 0.4666  -0.3004 -0.3611 132 ALA B O   
4198 C CB  . ALA B 130 ? 1.2266 1.5624 1.2242 0.3953  -0.3402 -0.4140 132 ALA B CB  
4199 N N   . ASP B 131 ? 1.3028 1.7683 1.2927 0.4920  -0.2846 -0.4178 133 ASP B N   
4200 C CA  . ASP B 131 ? 1.3293 1.8013 1.3462 0.5455  -0.2693 -0.4239 133 ASP B CA  
4201 C C   . ASP B 131 ? 1.4196 1.7843 1.4702 0.5736  -0.2882 -0.4603 133 ASP B C   
4202 O O   . ASP B 131 ? 1.4282 1.7821 1.5162 0.6188  -0.2767 -0.4617 133 ASP B O   
4203 C CB  . ASP B 131 ? 1.3595 1.9053 1.3248 0.5782  -0.2470 -0.4465 133 ASP B CB  
4204 C CG  . ASP B 131 ? 1.3236 1.9789 1.2686 0.5511  -0.2282 -0.4068 133 ASP B CG  
4205 O OD1 . ASP B 131 ? 1.2969 1.9609 1.2143 0.5058  -0.2373 -0.4005 133 ASP B OD1 
4206 O OD2 . ASP B 131 ? 1.3068 2.0392 1.2682 0.5747  -0.2052 -0.3810 133 ASP B OD2 
4207 N N   . GLU B 132 ? 1.4467 1.7326 1.4904 0.5478  -0.3174 -0.4886 134 GLU B N   
4208 C CA  . GLU B 132 ? 1.5185 1.6968 1.5960 0.5683  -0.3412 -0.5294 134 GLU B CA  
4209 C C   . GLU B 132 ? 1.4993 1.6219 1.6595 0.5460  -0.3554 -0.4851 134 GLU B C   
4210 O O   . GLU B 132 ? 1.4645 1.5775 1.6301 0.4996  -0.3703 -0.4607 134 GLU B O   
4211 C CB  . GLU B 132 ? 1.5881 1.7199 1.6121 0.5529  -0.3682 -0.5871 134 GLU B CB  
4212 N N   . SER B 133 ? 1.6019 1.6942 1.8293 0.5816  -0.3483 -0.4699 135 SER B N   
4213 C CA  . SER B 133 ? 1.5696 1.6073 1.8867 0.5697  -0.3605 -0.4253 135 SER B CA  
4214 C C   . SER B 133 ? 1.4790 1.5880 1.8148 0.5374  -0.3481 -0.3522 135 SER B C   
4215 O O   . SER B 133 ? 1.4362 1.5330 1.8467 0.5390  -0.3474 -0.3013 135 SER B O   
4216 C CB  . SER B 133 ? 1.6402 1.5749 1.9785 0.5422  -0.3988 -0.4562 135 SER B CB  
4217 O OG  . SER B 133 ? 1.6364 1.5246 2.0678 0.5287  -0.4100 -0.4058 135 SER B OG  
4218 N N   . GLY B 134 ? 1.4403 1.6252 1.7112 0.5093  -0.3382 -0.3460 136 GLY B N   
4219 C CA  . GLY B 134 ? 1.3410 1.5955 1.6212 0.4805  -0.3266 -0.2867 136 GLY B CA  
4220 C C   . GLY B 134 ? 1.3236 1.5528 1.5953 0.4310  -0.3448 -0.2763 136 GLY B C   
4221 O O   . GLY B 134 ? 1.2570 1.4984 1.5683 0.4124  -0.3445 -0.2267 136 GLY B O   
4222 N N   . HIS B 135 ? 1.2829 1.4819 1.5035 0.4121  -0.3600 -0.3208 137 HIS B N   
4223 C CA  . HIS B 135 ? 1.2500 1.4260 1.4611 0.3671  -0.3772 -0.3129 137 HIS B CA  
4224 C C   . HIS B 135 ? 1.1876 1.4418 1.3432 0.3395  -0.3613 -0.2990 137 HIS B C   
4225 O O   . HIS B 135 ? 1.1697 1.4944 1.2946 0.3524  -0.3400 -0.2984 137 HIS B O   
4226 C CB  . HIS B 135 ? 1.3432 1.4451 1.5361 0.3612  -0.4053 -0.3653 137 HIS B CB  
4227 C CG  . HIS B 135 ? 1.4318 1.4463 1.6864 0.3827  -0.4257 -0.3830 137 HIS B CG  
4228 N ND1 . HIS B 135 ? 1.4003 1.3731 1.7373 0.3737  -0.4356 -0.3396 137 HIS B ND1 
4229 C CD2 . HIS B 135 ? 1.5456 1.5057 1.7954 0.4134  -0.4382 -0.4397 137 HIS B CD2 
4230 C CE1 . HIS B 135 ? 1.4740 1.3662 1.8611 0.3950  -0.4545 -0.3665 137 HIS B CE1 
4231 N NE2 . HIS B 135 ? 1.5641 1.4437 1.8975 0.4198  -0.4570 -0.4313 137 HIS B NE2 
4232 N N   . VAL B 136 ? 1.0776 1.3191 1.2254 0.3008  -0.3720 -0.2867 138 VAL B N   
4233 C CA  . VAL B 136 ? 1.0197 1.3219 1.1248 0.2718  -0.3588 -0.2726 138 VAL B CA  
4234 C C   . VAL B 136 ? 1.0294 1.3095 1.0914 0.2486  -0.3726 -0.3009 138 VAL B C   
4235 O O   . VAL B 136 ? 1.0546 1.2723 1.1337 0.2375  -0.3958 -0.3107 138 VAL B O   
4236 C CB  . VAL B 136 ? 0.9670 1.2857 1.1037 0.2495  -0.3536 -0.2246 138 VAL B CB  
4237 C CG1 . VAL B 136 ? 0.9184 1.2869 1.0132 0.2188  -0.3422 -0.2176 138 VAL B CG1 
4238 C CG2 . VAL B 136 ? 0.9582 1.3144 1.1338 0.2738  -0.3395 -0.1925 138 VAL B CG2 
4239 N N   . VAL B 137 ? 0.9743 1.3108 0.9854 0.2405  -0.3589 -0.3101 139 VAL B N   
4240 C CA  . VAL B 137 ? 0.9803 1.3137 0.9489 0.2199  -0.3677 -0.3290 139 VAL B CA  
4241 C C   . VAL B 137 ? 0.9215 1.2854 0.8853 0.1835  -0.3578 -0.2972 139 VAL B C   
4242 O O   . VAL B 137 ? 0.8879 1.3106 0.8427 0.1785  -0.3378 -0.2815 139 VAL B O   
4243 C CB  . VAL B 137 ? 1.0125 1.3897 0.9307 0.2413  -0.3583 -0.3602 139 VAL B CB  
4244 C CG1 . VAL B 137 ? 1.0152 1.4033 0.8911 0.2194  -0.3652 -0.3700 139 VAL B CG1 
4245 C CG2 . VAL B 137 ? 1.0821 1.4220 1.0025 0.2812  -0.3681 -0.3990 139 VAL B CG2 
4246 N N   . LEU B 138 ? 1.0517 1.3754 1.0245 0.1583  -0.3727 -0.2884 140 LEU B N   
4247 C CA  . LEU B 138 ? 0.9894 1.3307 0.9605 0.1264  -0.3638 -0.2608 140 LEU B CA  
4248 C C   . LEU B 138 ? 0.9909 1.3438 0.9252 0.1096  -0.3669 -0.2704 140 LEU B C   
4249 O O   . LEU B 138 ? 1.0230 1.3463 0.9453 0.1127  -0.3865 -0.2908 140 LEU B O   
4250 C CB  . LEU B 138 ? 0.9843 1.2811 0.9974 0.1122  -0.3738 -0.2350 140 LEU B CB  
4251 C CG  . LEU B 138 ? 0.9821 1.2945 1.0282 0.1173  -0.3610 -0.2061 140 LEU B CG  
4252 C CD1 . LEU B 138 ? 0.9806 1.2513 1.0702 0.1081  -0.3717 -0.1787 140 LEU B CD1 
4253 C CD2 . LEU B 138 ? 0.9433 1.3102 0.9683 0.1025  -0.3396 -0.1950 140 LEU B CD2 
4254 N N   . ARG B 139 ? 1.0090 1.4066 0.9286 0.0915  -0.3487 -0.2547 141 ARG B N   
4255 C CA  . ARG B 139 ? 0.9945 1.4014 0.8903 0.0717  -0.3410 -0.2463 141 ARG B CA  
4256 C C   . ARG B 139 ? 0.9765 1.3876 0.8885 0.0428  -0.3306 -0.2183 141 ARG B C   
4257 O O   . ARG B 139 ? 0.9496 1.3872 0.8718 0.0376  -0.3166 -0.2099 141 ARG B O   
4258 C CB  . ARG B 139 ? 0.9913 1.4523 0.8553 0.0828  -0.3245 -0.2548 141 ARG B CB  
4259 C CG  . ARG B 139 ? 1.0871 1.5472 0.9256 0.1145  -0.3339 -0.2879 141 ARG B CG  
4260 C CD  . ARG B 139 ? 1.1445 1.6642 0.9485 0.1230  -0.3168 -0.2893 141 ARG B CD  
4261 N NE  . ARG B 139 ? 1.2400 1.7722 1.0174 0.1615  -0.3205 -0.3249 141 ARG B NE  
4262 C CZ  . ARG B 139 ? 1.3203 1.9080 1.0641 0.1788  -0.3066 -0.3313 141 ARG B CZ  
4263 N NH1 . ARG B 139 ? 1.2408 1.8788 0.9784 0.1589  -0.2903 -0.3008 141 ARG B NH1 
4264 N NH2 . ARG B 139 ? 1.3231 1.9190 1.0415 0.2185  -0.3099 -0.3683 141 ARG B NH2 
4265 N N   . TRP B 140 ? 0.9382 1.3255 0.8535 0.0252  -0.3392 -0.2060 142 TRP B N   
4266 C CA  . TRP B 140 ? 0.9233 1.3112 0.8565 0.0017  -0.3319 -0.1833 142 TRP B CA  
4267 C C   . TRP B 140 ? 0.9474 1.3447 0.8702 -0.0136 -0.3328 -0.1701 142 TRP B C   
4268 O O   . TRP B 140 ? 0.9585 1.3620 0.8583 -0.0057 -0.3430 -0.1788 142 TRP B O   
4269 C CB  . TRP B 140 ? 0.9283 1.2706 0.8935 -0.0014 -0.3383 -0.1693 142 TRP B CB  
4270 C CG  . TRP B 140 ? 0.9557 1.2603 0.9305 0.0005  -0.3618 -0.1688 142 TRP B CG  
4271 C CD1 . TRP B 140 ? 0.9786 1.2671 0.9626 -0.0150 -0.3692 -0.1505 142 TRP B CD1 
4272 C CD2 . TRP B 140 ? 0.9757 1.2546 0.9575 0.0178  -0.3828 -0.1871 142 TRP B CD2 
4273 N NE1 . TRP B 140 ? 0.9945 1.2532 0.9894 -0.0108 -0.3958 -0.1570 142 TRP B NE1 
4274 C CE2 . TRP B 140 ? 1.0104 1.2584 1.0053 0.0085  -0.4051 -0.1814 142 TRP B CE2 
4275 C CE3 . TRP B 140 ? 0.9928 1.2709 0.9759 0.0403  -0.3853 -0.2069 142 TRP B CE3 
4276 C CZ2 . TRP B 140 ? 1.0395 1.2517 1.0494 0.0178  -0.4310 -0.1980 142 TRP B CZ2 
4277 C CZ3 . TRP B 140 ? 1.0374 1.2761 1.0366 0.0527  -0.4096 -0.2229 142 TRP B CZ3 
4278 C CH2 . TRP B 140 ? 1.0592 1.2638 1.0722 0.0400  -0.4340 -0.2207 142 TRP B CH2 
4279 N N   . LEU B 141 ? 0.8540 1.2490 0.7948 -0.0346 -0.3186 -0.1466 143 LEU B N   
4280 C CA  . LEU B 141 ? 0.8717 1.2761 0.8137 -0.0499 -0.3156 -0.1245 143 LEU B CA  
4281 C C   . LEU B 141 ? 0.9127 1.2746 0.8835 -0.0615 -0.3178 -0.1018 143 LEU B C   
4282 O O   . LEU B 141 ? 0.9131 1.2459 0.9038 -0.0612 -0.3135 -0.1007 143 LEU B O   
4283 C CB  . LEU B 141 ? 0.8703 1.3112 0.8180 -0.0648 -0.2941 -0.1120 143 LEU B CB  
4284 C CG  . LEU B 141 ? 0.8607 1.3604 0.7835 -0.0557 -0.2895 -0.1208 143 LEU B CG  
4285 C CD1 . LEU B 141 ? 0.8379 1.3547 0.7582 -0.0464 -0.2838 -0.1416 143 LEU B CD1 
4286 C CD2 . LEU B 141 ? 0.8717 1.4088 0.8082 -0.0741 -0.2738 -0.0918 143 LEU B CD2 
4287 N N   . PRO B 142 ? 0.8834 1.2476 0.8573 -0.0693 -0.3239 -0.0807 144 PRO B N   
4288 C CA  . PRO B 142 ? 0.9037 1.2331 0.9092 -0.0785 -0.3247 -0.0542 144 PRO B CA  
4289 C C   . PRO B 142 ? 0.9475 1.2623 0.9790 -0.0901 -0.2993 -0.0389 144 PRO B C   
4290 O O   . PRO B 142 ? 0.9471 1.2820 0.9747 -0.0969 -0.2839 -0.0456 144 PRO B O   
4291 C CB  . PRO B 142 ? 0.9186 1.2707 0.9184 -0.0837 -0.3353 -0.0332 144 PRO B CB  
4292 C CG  . PRO B 142 ? 0.9227 1.3121 0.8809 -0.0715 -0.3490 -0.0594 144 PRO B CG  
4293 C CD  . PRO B 142 ? 0.8900 1.2954 0.8366 -0.0661 -0.3324 -0.0795 144 PRO B CD  
4294 N N   . PRO B 143 ? 0.9335 1.2143 0.9939 -0.0922 -0.2948 -0.0197 145 PRO B N   
4295 C CA  . PRO B 143 ? 0.9733 1.2346 1.0567 -0.1000 -0.2704 -0.0110 145 PRO B CA  
4296 C C   . PRO B 143 ? 1.0188 1.2941 1.1140 -0.1148 -0.2567 0.0074  145 PRO B C   
4297 O O   . PRO B 143 ? 1.0095 1.3053 1.1054 -0.1178 -0.2642 0.0307  145 PRO B O   
4298 C CB  . PRO B 143 ? 1.0072 1.2366 1.1188 -0.0945 -0.2698 0.0122  145 PRO B CB  
4299 C CG  . PRO B 143 ? 0.9896 1.2272 1.0998 -0.0916 -0.2955 0.0246  145 PRO B CG  
4300 C CD  . PRO B 143 ? 0.9302 1.1891 1.0063 -0.0862 -0.3122 -0.0067 145 PRO B CD  
4301 N N   . PRO B 144 ? 1.0194 1.2869 1.1270 -0.1248 -0.2378 -0.0012 146 PRO B N   
4302 C CA  . PRO B 144 ? 1.0433 1.3241 1.1722 -0.1412 -0.2248 0.0188  146 PRO B CA  
4303 C C   . PRO B 144 ? 1.1049 1.3643 1.2690 -0.1440 -0.2165 0.0585  146 PRO B C   
4304 O O   . PRO B 144 ? 1.1385 1.3599 1.3198 -0.1367 -0.2107 0.0642  146 PRO B O   
4305 C CB  . PRO B 144 ? 1.0772 1.3428 1.2183 -0.1524 -0.2101 -0.0055 146 PRO B CB  
4306 C CG  . PRO B 144 ? 1.0647 1.3323 1.1760 -0.1400 -0.2185 -0.0404 146 PRO B CG  
4307 C CD  . PRO B 144 ? 1.0373 1.2893 1.1409 -0.1223 -0.2296 -0.0308 146 PRO B CD  
4308 N N   . GLU B 145 ? 1.1462 1.4370 1.3224 -0.1525 -0.2146 0.0901  147 GLU B N   
4309 C CA  . GLU B 145 ? 1.1791 1.4610 1.3942 -0.1554 -0.2054 0.1364  147 GLU B CA  
4310 C C   . GLU B 145 ? 1.1925 1.4600 1.4069 -0.1420 -0.2174 0.1502  147 GLU B C   
4311 O O   . GLU B 145 ? 1.2313 1.4592 1.4771 -0.1374 -0.2053 0.1640  147 GLU B O   
4312 C CB  . GLU B 145 ? 1.2426 1.4791 1.5054 -0.1658 -0.1804 0.1427  147 GLU B CB  
4313 C CG  . GLU B 145 ? 1.2824 1.5338 1.5615 -0.1847 -0.1704 0.1374  147 GLU B CG  
4314 C CD  . GLU B 145 ? 1.3461 1.6444 1.6495 -0.1933 -0.1664 0.1870  147 GLU B CD  
4315 O OE1 . GLU B 145 ? 1.3154 1.6202 1.6361 -0.1865 -0.1657 0.2290  147 GLU B OE1 
4316 O OE2 . GLU B 145 ? 1.3128 1.6481 1.6199 -0.2062 -0.1638 0.1880  147 GLU B OE2 
4317 N N   . THR B 146 ? 1.1975 1.4995 1.3774 -0.1352 -0.2422 0.1451  148 THR B N   
4318 C CA  . THR B 146 ? 1.1797 1.4753 1.3622 -0.1266 -0.2600 0.1580  148 THR B CA  
4319 C C   . THR B 146 ? 1.1585 1.5068 1.3217 -0.1268 -0.2821 0.1767  148 THR B C   
4320 O O   . THR B 146 ? 1.1265 1.5097 1.2485 -0.1245 -0.2955 0.1515  148 THR B O   
4321 C CB  . THR B 146 ? 1.1909 1.4645 1.3520 -0.1173 -0.2741 0.1210  148 THR B CB  
4322 O OG1 . THR B 146 ? 1.2294 1.4646 1.4037 -0.1148 -0.2532 0.1049  148 THR B OG1 
4323 C CG2 . THR B 146 ? 1.1628 1.4311 1.3376 -0.1119 -0.2943 0.1390  148 THR B CG2 
4324 N N   . PRO B 147 ? 1.2371 1.5974 1.4271 -0.1275 -0.2864 0.2194  149 PRO B N   
4325 C CA  . PRO B 147 ? 1.2043 1.6230 1.3731 -0.1273 -0.3103 0.2370  149 PRO B CA  
4326 C C   . PRO B 147 ? 1.1934 1.6119 1.3335 -0.1227 -0.3458 0.2058  149 PRO B C   
4327 O O   . PRO B 147 ? 1.1920 1.5667 1.3366 -0.1197 -0.3497 0.1799  149 PRO B O   
4328 C CB  . PRO B 147 ? 1.2200 1.6484 1.4369 -0.1296 -0.3011 0.2970  149 PRO B CB  
4329 C CG  . PRO B 147 ? 1.2629 1.6291 1.5209 -0.1266 -0.2833 0.3012  149 PRO B CG  
4330 C CD  . PRO B 147 ? 1.2727 1.5976 1.5145 -0.1261 -0.2686 0.2545  149 PRO B CD  
4331 N N   . MET B 148 ? 1.2463 1.7170 1.3588 -0.1221 -0.3725 0.2093  150 MET B N   
4332 C CA  . MET B 148 ? 1.2295 1.7015 1.3168 -0.1201 -0.4115 0.1769  150 MET B CA  
4333 C C   . MET B 148 ? 1.2422 1.6848 1.2962 -0.1126 -0.4168 0.1187  150 MET B C   
4334 O O   . MET B 148 ? 1.2357 1.6355 1.3021 -0.1118 -0.4303 0.0973  150 MET B O   
4335 C CB  . MET B 148 ? 1.2322 1.6747 1.3660 -0.1257 -0.4245 0.2005  150 MET B CB  
4336 C CG  . MET B 148 ? 1.2474 1.7137 1.4248 -0.1301 -0.4133 0.2636  150 MET B CG  
4337 S SD  . MET B 148 ? 1.2497 1.8007 1.4043 -0.1339 -0.4452 0.2880  150 MET B SD  
4338 C CE  . MET B 148 ? 1.2316 1.7989 1.4542 -0.1362 -0.4227 0.3702  150 MET B CE  
4339 N N   . THR B 149 ? 1.1234 1.5374 1.3016 -0.2255 -0.3481 -0.1528 151 THR B N   
4340 C CA  . THR B 149 ? 1.1484 1.5422 1.3348 -0.2183 -0.3598 -0.1654 151 THR B CA  
4341 C C   . THR B 149 ? 1.1940 1.5801 1.4058 -0.2227 -0.3799 -0.1640 151 THR B C   
4342 O O   . THR B 149 ? 1.1939 1.5785 1.4106 -0.2324 -0.3768 -0.1581 151 THR B O   
4343 C CB  . THR B 149 ? 1.2088 1.6257 1.3548 -0.2202 -0.3478 -0.1723 151 THR B CB  
4344 O OG1 . THR B 149 ? 1.1899 1.6084 1.2906 -0.2319 -0.3269 -0.1557 151 THR B OG1 
4345 C CG2 . THR B 149 ? 1.2230 1.6341 1.3799 -0.2168 -0.3562 -0.1799 151 THR B CG2 
4346 N N   . SER B 150 ? 1.2000 1.6054 1.4116 -0.2261 -0.3901 -0.1711 152 SER B N   
4347 C CA  . SER B 150 ? 1.2339 1.6554 1.4521 -0.2348 -0.4010 -0.1838 152 SER B CA  
4348 C C   . SER B 150 ? 1.2132 1.6485 1.4645 -0.2475 -0.3960 -0.1712 152 SER B C   
4349 O O   . SER B 150 ? 1.2380 1.6766 1.5104 -0.2419 -0.4091 -0.1966 152 SER B O   
4350 C CB  . SER B 150 ? 1.2872 1.7245 1.4868 -0.2318 -0.4114 -0.2028 152 SER B CB  
4351 O OG  . SER B 150 ? 1.2910 1.7183 1.5009 -0.2360 -0.4195 -0.1807 152 SER B OG  
4352 N N   . HIS B 151 ? 1.2254 1.6808 1.4962 -0.2492 -0.3724 -0.1550 153 HIS B N   
4353 C CA  . HIS B 151 ? 1.1880 1.6463 1.5304 -0.2396 -0.3810 -0.1578 153 HIS B CA  
4354 C C   . HIS B 151 ? 1.1806 1.5918 1.5516 -0.2286 -0.3796 -0.1424 153 HIS B C   
4355 O O   . HIS B 151 ? 1.1612 1.5432 1.5865 -0.2259 -0.3892 -0.1098 153 HIS B O   
4356 C CB  . HIS B 151 ? 1.1590 1.6309 1.5342 -0.2381 -0.3820 -0.1370 153 HIS B CB  
4357 C CG  . HIS B 151 ? 1.1908 1.7047 1.5434 -0.2414 -0.3836 -0.1585 153 HIS B CG  
4358 N ND1 . HIS B 151 ? 1.1969 1.6958 1.5308 -0.2200 -0.3804 -0.1734 153 HIS B ND1 
4359 C CD2 . HIS B 151 ? 1.2314 1.7608 1.5876 -0.2515 -0.4016 -0.1656 153 HIS B CD2 
4360 C CE1 . HIS B 151 ? 1.2257 1.7189 1.5580 -0.2132 -0.4006 -0.1857 153 HIS B CE1 
4361 N NE2 . HIS B 151 ? 1.2424 1.7935 1.5693 -0.2416 -0.3935 -0.1868 153 HIS B NE2 
4362 N N   . ILE B 152 ? 1.0350 1.4366 1.3704 -0.2274 -0.3707 -0.1546 154 ILE B N   
4363 C CA  . ILE B 152 ? 1.0313 1.3846 1.3832 -0.2205 -0.3723 -0.1404 154 ILE B CA  
4364 C C   . ILE B 152 ? 1.0521 1.3807 1.4324 -0.2093 -0.3867 -0.1538 154 ILE B C   
4365 O O   . ILE B 152 ? 1.0816 1.4246 1.4436 -0.2046 -0.3906 -0.1814 154 ILE B O   
4366 C CB  . ILE B 152 ? 1.0362 1.3868 1.3339 -0.2255 -0.3592 -0.1459 154 ILE B CB  
4367 C CG1 . ILE B 152 ? 1.0313 1.3897 1.2988 -0.2323 -0.3509 -0.1344 154 ILE B CG1 
4368 C CG2 . ILE B 152 ? 1.0788 1.3663 1.3801 -0.2243 -0.3668 -0.1248 154 ILE B CG2 
4369 C CD1 . ILE B 152 ? 1.0735 1.4231 1.2854 -0.2318 -0.3436 -0.1455 154 ILE B CD1 
4370 N N   . ARG B 153 ? 0.9810 1.2669 1.4101 -0.2052 -0.3987 -0.1286 155 ARG B N   
4371 C CA  . ARG B 153 ? 0.9991 1.2522 1.4601 -0.1945 -0.4159 -0.1370 155 ARG B CA  
4372 C C   . ARG B 153 ? 1.0265 1.2422 1.4788 -0.1925 -0.4151 -0.1266 155 ARG B C   
4373 O O   . ARG B 153 ? 1.0528 1.2478 1.4923 -0.2026 -0.4089 -0.0973 155 ARG B O   
4374 C CB  . ARG B 153 ? 1.0043 1.2359 1.5288 -0.1965 -0.4343 -0.1088 155 ARG B CB  
4375 C CG  . ARG B 153 ? 1.0852 1.2872 1.6378 -0.1869 -0.4592 -0.1264 155 ARG B CG  
4376 C CD  . ARG B 153 ? 1.1390 1.3236 1.7518 -0.1947 -0.4801 -0.0936 155 ARG B CD  
4377 N NE  . ARG B 153 ? 1.1551 1.3158 1.8157 -0.2015 -0.4796 -0.0402 155 ARG B NE  
4378 C CZ  . ARG B 153 ? 1.2055 1.3673 1.9276 -0.2128 -0.4880 0.0103  155 ARG B CZ  
4379 N NH1 . ARG B 153 ? 1.1643 1.3438 1.9025 -0.2192 -0.5013 0.0106  155 ARG B NH1 
4380 N NH2 . ARG B 153 ? 1.1416 1.2903 1.9116 -0.2197 -0.4833 0.0656  155 ARG B NH2 
4381 N N   . TYR B 154 ? 0.9363 1.1370 1.3938 -0.1808 -0.4260 -0.1481 156 TYR B N   
4382 C CA  . TYR B 154 ? 0.9589 1.1279 1.4032 -0.1797 -0.4283 -0.1413 156 TYR B CA  
4383 C C   . TYR B 154 ? 0.9898 1.1126 1.4827 -0.1714 -0.4517 -0.1309 156 TYR B C   
4384 O O   . TYR B 154 ? 0.9810 1.0967 1.5155 -0.1652 -0.4673 -0.1345 156 TYR B O   
4385 C CB  . TYR B 154 ? 0.9469 1.1497 1.3539 -0.1748 -0.4208 -0.1714 156 TYR B CB  
4386 C CG  . TYR B 154 ? 0.9452 1.1941 1.3024 -0.1875 -0.3997 -0.1760 156 TYR B CG  
4387 C CD1 . TYR B 154 ? 0.9757 1.2108 1.2891 -0.2022 -0.3897 -0.1578 156 TYR B CD1 
4388 C CD2 . TYR B 154 ? 0.9607 1.2566 1.3096 -0.1865 -0.3948 -0.1960 156 TYR B CD2 
4389 C CE1 . TYR B 154 ? 0.9706 1.2442 1.2392 -0.2145 -0.3734 -0.1618 156 TYR B CE1 
4390 C CE2 . TYR B 154 ? 0.9656 1.3004 1.2689 -0.2019 -0.3790 -0.1928 156 TYR B CE2 
4391 C CZ  . TYR B 154 ? 0.9774 1.3064 1.2431 -0.2163 -0.3670 -0.1768 156 TYR B CZ  
4392 O OH  . TYR B 154 ? 0.9848 1.3499 1.2049 -0.2336 -0.3542 -0.1727 156 TYR B OH  
4393 N N   . GLU B 155 ? 0.9038 0.9898 1.3867 -0.1742 -0.4576 -0.1155 157 GLU B N   
4394 C CA  . GLU B 155 ? 0.9307 0.9697 1.4553 -0.1692 -0.4814 -0.1003 157 GLU B CA  
4395 C C   . GLU B 155 ? 0.9448 0.9590 1.4384 -0.1707 -0.4867 -0.0976 157 GLU B C   
4396 O O   . GLU B 155 ? 0.9475 0.9389 1.3958 -0.1878 -0.4798 -0.0741 157 GLU B O   
4397 C CB  . GLU B 155 ? 0.9351 0.9420 1.4983 -0.1839 -0.4883 -0.0513 157 GLU B CB  
4398 C CG  . GLU B 155 ? 0.9661 0.9285 1.5788 -0.1825 -0.5143 -0.0291 157 GLU B CG  
4399 C CD  . GLU B 155 ? 1.0423 0.9846 1.7003 -0.2025 -0.5170 0.0313  157 GLU B CD  
4400 O OE1 . GLU B 155 ? 0.9854 0.9396 1.6994 -0.2034 -0.5250 0.0479  157 GLU B OE1 
4401 O OE2 . GLU B 155 ? 1.0348 0.9480 1.6716 -0.2209 -0.5108 0.0668  157 GLU B OE2 
4402 N N   . VAL B 156 ? 0.9186 0.9305 1.4344 -0.1545 -0.5033 -0.1193 158 VAL B N   
4403 C CA  . VAL B 156 ? 0.9347 0.9297 1.4298 -0.1556 -0.5126 -0.1153 158 VAL B CA  
4404 C C   . VAL B 156 ? 0.9679 0.8998 1.4915 -0.1588 -0.5389 -0.0843 158 VAL B C   
4405 O O   . VAL B 156 ? 0.9809 0.8929 1.5558 -0.1518 -0.5547 -0.0788 158 VAL B O   
4406 C CB  . VAL B 156 ? 0.9352 0.9752 1.4455 -0.1359 -0.5172 -0.1545 158 VAL B CB  
4407 C CG1 . VAL B 156 ? 0.9065 1.0119 1.3815 -0.1396 -0.4916 -0.1757 158 VAL B CG1 
4408 C CG2 . VAL B 156 ? 0.9563 0.9875 1.5249 -0.1125 -0.5388 -0.1792 158 VAL B CG2 
4409 N N   . ASP B 157 ? 1.0363 0.9327 1.5220 -0.1728 -0.5469 -0.0604 159 ASP B N   
4410 C CA  . ASP B 157 ? 1.0756 0.9092 1.5762 -0.1809 -0.5735 -0.0256 159 ASP B CA  
4411 C C   . ASP B 157 ? 1.0991 0.9269 1.5986 -0.1732 -0.5937 -0.0334 159 ASP B C   
4412 O O   . ASP B 157 ? 1.1066 0.9366 1.5513 -0.1854 -0.5895 -0.0291 159 ASP B O   
4413 C CB  . ASP B 157 ? 1.1267 0.9049 1.5722 -0.2118 -0.5700 0.0198  159 ASP B CB  
4414 C CG  . ASP B 157 ? 1.2377 0.9475 1.6855 -0.2258 -0.5964 0.0600  159 ASP B CG  
4415 O OD1 . ASP B 157 ? 1.2546 0.9517 1.7640 -0.2248 -0.6068 0.0807  159 ASP B OD1 
4416 O OD2 . ASP B 157 ? 1.2955 0.9643 1.6820 -0.2391 -0.6084 0.0730  159 ASP B OD2 
4417 N N   . VAL B 158 ? 1.0894 0.9061 1.6505 -0.1548 -0.6193 -0.0415 160 VAL B N   
4418 C CA  . VAL B 158 ? 1.0830 0.8923 1.6601 -0.1458 -0.6446 -0.0450 160 VAL B CA  
4419 C C   . VAL B 158 ? 1.1985 0.9363 1.7629 -0.1647 -0.6712 0.0027  160 VAL B C   
4420 O O   . VAL B 158 ? 1.2299 0.9319 1.8382 -0.1619 -0.6908 0.0197  160 VAL B O   
4421 C CB  . VAL B 158 ? 1.0888 0.9178 1.7389 -0.1134 -0.6632 -0.0829 160 VAL B CB  
4422 C CG1 . VAL B 158 ? 1.1098 0.9494 1.7825 -0.1020 -0.6862 -0.0909 160 VAL B CG1 
4423 C CG2 . VAL B 158 ? 1.0551 0.9422 1.7110 -0.0982 -0.6392 -0.1256 160 VAL B CG2 
4424 N N   . SER B 159 ? 1.2357 0.9491 1.7344 -0.1869 -0.6744 0.0273  161 SER B N   
4425 C CA  . SER B 159 ? 1.3282 0.9668 1.7921 -0.2105 -0.7002 0.0752  161 SER B CA  
4426 C C   . SER B 159 ? 1.3342 0.9614 1.8191 -0.2047 -0.7344 0.0809  161 SER B C   
4427 O O   . SER B 159 ? 1.2791 0.9490 1.7639 -0.1976 -0.7325 0.0607  161 SER B O   
4428 C CB  . SER B 159 ? 1.4128 1.0066 1.7673 -0.2445 -0.6863 0.1030  161 SER B CB  
4429 O OG  . SER B 159 ? 1.5261 1.0353 1.8282 -0.2707 -0.7096 0.1494  161 SER B OG  
4430 N N   . ALA B 160 ? 1.4804 1.0533 1.9881 -0.2099 -0.7670 0.1128  162 ALA B N   
4431 C CA  . ALA B 160 ? 1.4802 1.0322 2.0087 -0.2074 -0.8052 0.1263  162 ALA B CA  
4432 C C   . ALA B 160 ? 1.5677 1.0714 1.9970 -0.2421 -0.8169 0.1648  162 ALA B C   
4433 O O   . ALA B 160 ? 1.6411 1.0894 1.9866 -0.2710 -0.8095 0.1957  162 ALA B O   
4434 C CB  . ALA B 160 ? 1.5101 1.0192 2.0997 -0.2006 -0.8396 0.1483  162 ALA B CB  
4435 N N   . GLY B 161 ? 1.6901 1.2098 2.1246 -0.2410 -0.8355 0.1637  163 GLY B N   
4436 C CA  . GLY B 161 ? 1.7566 1.2275 2.0899 -0.2758 -0.8501 0.1999  163 GLY B CA  
4437 C C   . GLY B 161 ? 1.8792 1.2589 2.1611 -0.3013 -0.8869 0.2509  163 GLY B C   
4438 O O   . GLY B 161 ? 1.9506 1.2619 2.1125 -0.3341 -0.8846 0.2802  163 GLY B O   
4439 N N   . GLN B 162 ? 1.8687 1.2408 2.2319 -0.2871 -0.9213 0.2615  164 GLN B N   
4440 C CA  . GLN B 162 ? 1.9406 1.2364 2.2605 -0.3113 -0.9618 0.3130  164 GLN B CA  
4441 C C   . GLN B 162 ? 1.9631 1.2393 2.2735 -0.3171 -0.9457 0.3257  164 GLN B C   
4442 O O   . GLN B 162 ? 1.9141 1.2300 2.3144 -0.2914 -0.9301 0.3020  164 GLN B O   
4443 C CB  . GLN B 162 ? 1.9222 1.2172 2.3374 -0.2948 -1.0055 0.3215  164 GLN B CB  
4444 N N   . GLY B 163 ? 2.0379 1.2535 2.2327 -0.3503 -0.9350 0.3594  165 GLY B N   
4445 C CA  . GLY B 163 ? 2.0439 1.2413 2.2216 -0.3521 -0.8912 0.3770  165 GLY B CA  
4446 C C   . GLY B 163 ? 2.0415 1.2588 2.2190 -0.3400 -0.8353 0.3588  165 GLY B C   
4447 O O   . GLY B 163 ? 2.0448 1.2664 2.1788 -0.3414 -0.8188 0.3359  165 GLY B O   
4448 N N   . ALA B 164 ? 1.9639 1.1968 2.1941 -0.3305 -0.8079 0.3721  166 ALA B N   
4449 C CA  . ALA B 164 ? 1.9405 1.1970 2.1855 -0.3197 -0.7583 0.3629  166 ALA B CA  
4450 C C   . ALA B 164 ? 1.8872 1.2116 2.2488 -0.2999 -0.7842 0.3128  166 ALA B C   
4451 O O   . ALA B 164 ? 1.8400 1.2007 2.3108 -0.2829 -0.8157 0.3014  166 ALA B O   
4452 C CB  . ALA B 164 ? 1.9572 1.2169 2.2303 -0.3176 -0.7248 0.4009  166 ALA B CB  
4453 N N   . GLY B 165 ? 1.7447 1.0872 2.0741 -0.2987 -0.7669 0.2803  167 GLY B N   
4454 C CA  . GLY B 165 ? 1.6819 1.1031 2.1003 -0.2720 -0.7746 0.2264  167 GLY B CA  
4455 C C   . GLY B 165 ? 1.6647 1.1245 2.1056 -0.2656 -0.7356 0.2071  167 GLY B C   
4456 O O   . GLY B 165 ? 1.6805 1.1358 2.0521 -0.2774 -0.7049 0.2004  167 GLY B O   
4457 N N   . SER B 166 ? 1.5028 0.9954 2.0372 -0.2482 -0.7401 0.2004  168 SER B N   
4458 C CA  . SER B 166 ? 1.4608 0.9980 2.0295 -0.2408 -0.7106 0.1819  168 SER B CA  
4459 C C   . SER B 166 ? 1.4276 1.0011 2.0920 -0.2115 -0.7301 0.1539  168 SER B C   
4460 O O   . SER B 166 ? 1.3948 0.9807 2.1069 -0.2129 -0.7245 0.1669  168 SER B O   
4461 C CB  . SER B 166 ? 1.4914 0.9922 2.0344 -0.2649 -0.6768 0.2351  168 SER B CB  
4462 O OG  . SER B 166 ? 1.5936 1.0459 2.0107 -0.2749 -0.6382 0.2588  168 SER B OG  
4463 N N   . VAL B 167 ? 1.4416 1.0239 2.1308 -0.1859 -0.7525 0.1182  169 VAL B N   
4464 C CA  . VAL B 167 ? 1.4089 0.9913 2.1744 -0.1597 -0.7783 0.0956  169 VAL B CA  
4465 C C   . VAL B 167 ? 1.3643 0.9885 2.1508 -0.1436 -0.7564 0.0553  169 VAL B C   
4466 O O   . VAL B 167 ? 1.3594 0.9731 2.1946 -0.1379 -0.7720 0.0575  169 VAL B O   
4467 C CB  . VAL B 167 ? 1.4022 0.9751 2.1895 -0.1370 -0.8072 0.0692  169 VAL B CB  
4468 C CG1 . VAL B 167 ? 1.4580 0.9772 2.2534 -0.1501 -0.8460 0.1159  169 VAL B CG1 
4469 C CG2 . VAL B 167 ? 1.3680 0.9802 2.1078 -0.1348 -0.7843 0.0424  169 VAL B CG2 
4470 N N   . GLN B 168 ? 1.2251 0.8961 1.9720 -0.1386 -0.7237 0.0209  170 GLN B N   
4471 C CA  . GLN B 168 ? 1.1950 0.9074 1.9563 -0.1209 -0.7073 -0.0233 170 GLN B CA  
4472 C C   . GLN B 168 ? 1.1611 0.9143 1.8749 -0.1362 -0.6663 -0.0222 170 GLN B C   
4473 O O   . GLN B 168 ? 1.1846 0.9465 1.8447 -0.1496 -0.6485 -0.0128 170 GLN B O   
4474 C CB  . GLN B 168 ? 1.1975 0.9361 1.9712 -0.0917 -0.7148 -0.0766 170 GLN B CB  
4475 C CG  . GLN B 168 ? 1.1998 0.9596 2.0005 -0.0687 -0.7170 -0.1240 170 GLN B CG  
4476 C CD  . GLN B 168 ? 1.2411 1.0169 2.0699 -0.0364 -0.7358 -0.1735 170 GLN B CD  
4477 O OE1 . GLN B 168 ? 1.2354 1.0004 2.0796 -0.0303 -0.7538 -0.1679 170 GLN B OE1 
4478 N NE2 . GLN B 168 ? 1.2228 1.0251 2.0609 -0.0152 -0.7345 -0.2218 170 GLN B NE2 
4479 N N   . ARG B 169 ? 1.0925 0.8650 1.8251 -0.1356 -0.6560 -0.0296 171 ARG B N   
4480 C CA  . ARG B 169 ? 1.0503 0.8648 1.7484 -0.1464 -0.6206 -0.0322 171 ARG B CA  
4481 C C   . ARG B 169 ? 1.0438 0.8888 1.7608 -0.1319 -0.6180 -0.0694 171 ARG B C   
4482 O O   . ARG B 169 ? 1.0650 0.8916 1.8235 -0.1346 -0.6354 -0.0560 171 ARG B O   
4483 C CB  . ARG B 169 ? 1.0590 0.8565 1.7618 -0.1738 -0.6125 0.0240  171 ARG B CB  
4484 C CG  . ARG B 169 ? 1.0733 0.9088 1.7487 -0.1851 -0.5801 0.0268  171 ARG B CG  
4485 C CD  . ARG B 169 ? 1.1348 0.9452 1.8103 -0.2143 -0.5713 0.0874  171 ARG B CD  
4486 N NE  . ARG B 169 ? 1.2369 0.9976 1.8576 -0.2280 -0.5756 0.1041  171 ARG B NE  
4487 C CZ  . ARG B 169 ? 1.3416 1.0536 1.9171 -0.2356 -0.5462 0.1615  171 ARG B CZ  
4488 N NH1 . ARG B 169 ? 1.2600 0.9787 1.8662 -0.2364 -0.5179 0.2103  171 ARG B NH1 
4489 N NH2 . ARG B 169 ? 1.3649 1.0228 1.8587 -0.2394 -0.5420 0.1731  171 ARG B NH2 
4490 N N   . VAL B 170 ? 1.0484 0.9392 1.7336 -0.1198 -0.5992 -0.1121 172 VAL B N   
4491 C CA  . VAL B 170 ? 1.0422 0.9593 1.7354 -0.1055 -0.6004 -0.1524 172 VAL B CA  
4492 C C   . VAL B 170 ? 1.0250 0.9873 1.6839 -0.1195 -0.5683 -0.1499 172 VAL B C   
4493 O O   . VAL B 170 ? 0.9944 0.9863 1.6105 -0.1281 -0.5420 -0.1459 172 VAL B O   
4494 C CB  . VAL B 170 ? 1.0594 0.9987 1.7511 -0.0795 -0.6079 -0.2026 172 VAL B CB  
4495 C CG1 . VAL B 170 ? 1.0690 1.0302 1.7624 -0.0651 -0.6124 -0.2454 172 VAL B CG1 
4496 C CG2 . VAL B 170 ? 1.0945 0.9870 1.8285 -0.0631 -0.6443 -0.2047 172 VAL B CG2 
4497 N N   . GLU B 171 ? 1.0796 1.0441 1.7570 -0.1233 -0.5746 -0.1503 173 GLU B N   
4498 C CA  . GLU B 171 ? 1.0521 1.0603 1.7036 -0.1351 -0.5496 -0.1493 173 GLU B CA  
4499 C C   . GLU B 171 ? 1.0717 1.1188 1.6931 -0.1213 -0.5438 -0.2000 173 GLU B C   
4500 O O   . GLU B 171 ? 1.1081 1.1382 1.7466 -0.1053 -0.5695 -0.2323 173 GLU B O   
4501 C CB  . GLU B 171 ? 1.0691 1.0646 1.7591 -0.1493 -0.5625 -0.1184 173 GLU B CB  
4502 C CG  . GLU B 171 ? 1.1036 1.0864 1.8233 -0.1684 -0.5565 -0.0578 173 GLU B CG  
4503 C CD  . GLU B 171 ? 1.1884 1.1870 1.9458 -0.1844 -0.5585 -0.0226 173 GLU B CD  
4504 O OE1 . GLU B 171 ? 1.1971 1.1679 2.0043 -0.1907 -0.5864 0.0019  173 GLU B OE1 
4505 O OE2 . GLU B 171 ? 1.1343 1.1739 1.8742 -0.1913 -0.5349 -0.0170 173 GLU B OE2 
4506 N N   . ILE B 172 ? 1.0455 1.1414 1.6223 -0.1279 -0.5135 -0.2057 174 ILE B N   
4507 C CA  . ILE B 172 ? 1.0552 1.1960 1.6016 -0.1186 -0.5054 -0.2463 174 ILE B CA  
4508 C C   . ILE B 172 ? 1.0799 1.2429 1.6132 -0.1315 -0.4997 -0.2441 174 ILE B C   
4509 O O   . ILE B 172 ? 1.0494 1.2204 1.5804 -0.1496 -0.4851 -0.2098 174 ILE B O   
4510 C CB  . ILE B 172 ? 1.0388 1.2216 1.5448 -0.1222 -0.4796 -0.2480 174 ILE B CB  
4511 C CG1 . ILE B 172 ? 1.0317 1.1879 1.5498 -0.1177 -0.4866 -0.2359 174 ILE B CG1 
4512 C CG2 . ILE B 172 ? 1.0615 1.2914 1.5501 -0.1087 -0.4773 -0.2888 174 ILE B CG2 
4513 C CD1 . ILE B 172 ? 1.0861 1.2280 1.6419 -0.0916 -0.5136 -0.2671 174 ILE B CD1 
4514 N N   . LEU B 173 ? 1.3663 1.5966 1.1565 -0.1501 -0.3653 -0.2967 175 LEU B N   
4515 C CA  . LEU B 173 ? 1.4198 1.6342 1.1574 -0.1564 -0.4046 -0.2919 175 LEU B CA  
4516 C C   . LEU B 173 ? 1.4335 1.6672 1.1172 -0.1355 -0.3618 -0.2838 175 LEU B C   
4517 O O   . LEU B 173 ? 1.4230 1.6550 1.0777 -0.1165 -0.3044 -0.2991 175 LEU B O   
4518 C CB  . LEU B 173 ? 1.5345 1.6570 1.1793 -0.1596 -0.4464 -0.3382 175 LEU B CB  
4519 C CG  . LEU B 173 ? 1.6218 1.6829 1.1611 -0.1325 -0.4025 -0.3897 175 LEU B CG  
4520 C CD1 . LEU B 173 ? 1.7039 1.7405 1.1318 -0.1192 -0.3849 -0.3932 175 LEU B CD1 
4521 C CD2 . LEU B 173 ? 1.7037 1.6826 1.2119 -0.1365 -0.4252 -0.4239 175 LEU B CD2 
4522 N N   . GLU B 174 ? 1.4594 1.7119 1.1380 -0.1405 -0.3940 -0.2564 176 GLU B N   
4523 C CA  . GLU B 174 ? 1.4648 1.7314 1.0983 -0.1219 -0.3613 -0.2416 176 GLU B CA  
4524 C C   . GLU B 174 ? 1.5708 1.7691 1.0739 -0.1083 -0.3364 -0.2780 176 GLU B C   
4525 O O   . GLU B 174 ? 1.6526 1.7867 1.0765 -0.1127 -0.3681 -0.3100 176 GLU B O   
4526 C CB  . GLU B 174 ? 1.4758 1.7721 1.1340 -0.1282 -0.4101 -0.2040 176 GLU B CB  
4527 C CG  . GLU B 174 ? 1.6318 1.8654 1.1992 -0.1382 -0.4726 -0.2193 176 GLU B CG  
4528 C CD  . GLU B 174 ? 1.7101 1.9811 1.3197 -0.1445 -0.5276 -0.1777 176 GLU B CD  
4529 O OE1 . GLU B 174 ? 1.6150 1.9519 1.3500 -0.1586 -0.5544 -0.1454 176 GLU B OE1 
4530 O OE2 . GLU B 174 ? 1.7537 1.9907 1.2746 -0.1346 -0.5431 -0.1742 176 GLU B OE2 
4531 N N   . GLY B 175 ? 1.5198 1.7300 0.9999 -0.0915 -0.2773 -0.2728 177 GLY B N   
4532 C CA  . GLY B 175 ? 1.6016 1.7620 0.9684 -0.0791 -0.2422 -0.2943 177 GLY B CA  
4533 C C   . GLY B 175 ? 1.6104 1.7614 0.9720 -0.0691 -0.1836 -0.3261 177 GLY B C   
4534 O O   . GLY B 175 ? 1.6483 1.7860 0.9519 -0.0585 -0.1343 -0.3300 177 GLY B O   
4535 N N   . ARG B 176 ? 1.4691 1.6295 0.8970 -0.0725 -0.1880 -0.3448 178 ARG B N   
4536 C CA  . ARG B 176 ? 1.4592 1.6174 0.9001 -0.0604 -0.1373 -0.3730 178 ARG B CA  
4537 C C   . ARG B 176 ? 1.3727 1.5904 0.9168 -0.0613 -0.1100 -0.3508 178 ARG B C   
4538 O O   . ARG B 176 ? 1.3072 1.5600 0.9216 -0.0711 -0.1372 -0.3250 178 ARG B O   
4539 C CB  . ARG B 176 ? 1.4975 1.6140 0.9350 -0.0589 -0.1615 -0.4119 178 ARG B CB  
4540 C CG  . ARG B 176 ? 1.4709 1.6079 1.0043 -0.0753 -0.2065 -0.3991 178 ARG B CG  
4541 C CD  . ARG B 176 ? 1.5592 1.6379 1.0789 -0.0741 -0.2366 -0.4384 178 ARG B CD  
4542 N NE  . ARG B 176 ? 1.5723 1.6437 1.1077 -0.0530 -0.1910 -0.4689 178 ARG B NE  
4543 C CZ  . ARG B 176 ? 1.6714 1.6901 1.2006 -0.0435 -0.2071 -0.5069 178 ARG B CZ  
4544 N NH1 . ARG B 176 ? 1.6869 1.6474 1.1900 -0.0574 -0.2689 -0.5166 178 ARG B NH1 
4545 N NH2 . ARG B 176 ? 1.5988 1.6198 1.1549 -0.0202 -0.1636 -0.5315 178 ARG B NH2 
4546 N N   . THR B 177 ? 1.2610 1.4901 0.8122 -0.0512 -0.0560 -0.3595 179 THR B N   
4547 C CA  . THR B 177 ? 1.1828 1.4581 0.8164 -0.0520 -0.0327 -0.3416 179 THR B CA  
4548 C C   . THR B 177 ? 1.1734 1.4575 0.8645 -0.0459 -0.0156 -0.3648 179 THR B C   
4549 O O   . THR B 177 ? 1.1298 1.4440 0.8742 -0.0448 0.0099  -0.3571 179 THR B O   
4550 C CB  . THR B 177 ? 1.2293 1.5135 0.8402 -0.0499 0.0067  -0.3243 179 THR B CB  
4551 O OG1 . THR B 177 ? 1.2959 1.5564 0.8479 -0.0433 0.0454  -0.3441 179 THR B OG1 
4552 C CG2 . THR B 177 ? 1.2424 1.5213 0.8146 -0.0532 -0.0160 -0.2947 179 THR B CG2 
4553 N N   . GLU B 178 ? 1.2036 1.4573 0.8857 -0.0413 -0.0339 -0.3936 180 GLU B N   
4554 C CA  . GLU B 178 ? 1.1905 1.4489 0.9318 -0.0316 -0.0226 -0.4151 180 GLU B CA  
4555 C C   . GLU B 178 ? 1.2251 1.4465 0.9729 -0.0333 -0.0683 -0.4325 180 GLU B C   
4556 O O   . GLU B 178 ? 1.2739 1.4559 0.9624 -0.0390 -0.1006 -0.4407 180 GLU B O   
4557 C CB  . GLU B 178 ? 1.2536 1.5070 0.9728 -0.0131 0.0297  -0.4424 180 GLU B CB  
4558 C CG  . GLU B 178 ? 1.3990 1.6012 1.0145 -0.0015 0.0370  -0.4707 180 GLU B CG  
4559 C CD  . GLU B 178 ? 1.5495 1.7588 1.1397 0.0175  0.1026  -0.4886 180 GLU B CD  
4560 O OE1 . GLU B 178 ? 1.4971 1.7487 1.1185 0.0107  0.1403  -0.4643 180 GLU B OE1 
4561 O OE2 . GLU B 178 ? 1.6157 1.7871 1.1564 0.0394  0.1174  -0.5267 180 GLU B OE2 
4562 N N   . CYS B 179 ? 1.1991 1.4286 1.0196 -0.0300 -0.0763 -0.4366 181 CYS B N   
4563 C CA  . CYS B 179 ? 1.2229 1.4123 1.0607 -0.0335 -0.1217 -0.4490 181 CYS B CA  
4564 C C   . CYS B 179 ? 1.2406 1.4265 1.1387 -0.0159 -0.1113 -0.4684 181 CYS B C   
4565 O O   . CYS B 179 ? 1.2006 1.4286 1.1458 -0.0077 -0.0787 -0.4615 181 CYS B O   
4566 C CB  . CYS B 179 ? 1.1631 1.3711 1.0421 -0.0593 -0.1654 -0.4091 181 CYS B CB  
4567 S SG  . CYS B 179 ? 1.0817 1.3472 1.0446 -0.0645 -0.1550 -0.3715 181 CYS B SG  
4568 N N   . VAL B 180 ? 1.1181 1.2494 1.0174 -0.0102 -0.1445 -0.4925 182 VAL B N   
4569 C CA  . VAL B 180 ? 1.1234 1.2416 1.0842 0.0094  -0.1447 -0.5105 182 VAL B CA  
4570 C C   . VAL B 180 ? 1.1081 1.2077 1.1197 -0.0112 -0.2000 -0.4842 182 VAL B C   
4571 O O   . VAL B 180 ? 1.1669 1.2135 1.1530 -0.0248 -0.2441 -0.4894 182 VAL B O   
4572 C CB  . VAL B 180 ? 1.2296 1.2893 1.1472 0.0413  -0.1316 -0.5652 182 VAL B CB  
4573 C CG1 . VAL B 180 ? 1.2553 1.2999 1.2486 0.0649  -0.1379 -0.5817 182 VAL B CG1 
4574 C CG2 . VAL B 180 ? 1.2567 1.3417 1.1237 0.0612  -0.0678 -0.5845 182 VAL B CG2 
4575 N N   . LEU B 181 ? 1.1434 1.2831 1.2241 -0.0154 -0.2002 -0.4542 183 LEU B N   
4576 C CA  . LEU B 181 ? 1.1195 1.2485 1.2455 -0.0364 -0.2455 -0.4195 183 LEU B CA  
4577 C C   . LEU B 181 ? 1.2021 1.2752 1.3660 -0.0191 -0.2718 -0.4417 183 LEU B C   
4578 O O   . LEU B 181 ? 1.2366 1.3059 1.4189 0.0131  -0.2470 -0.4748 183 LEU B O   
4579 C CB  . LEU B 181 ? 1.0320 1.2212 1.1962 -0.0461 -0.2343 -0.3772 183 LEU B CB  
4580 C CG  . LEU B 181 ? 0.9841 1.2214 1.1178 -0.0634 -0.2168 -0.3484 183 LEU B CG  
4581 C CD1 . LEU B 181 ? 0.9191 1.2037 1.0763 -0.0627 -0.1992 -0.3213 183 LEU B CD1 
4582 C CD2 . LEU B 181 ? 0.9943 1.2243 1.1250 -0.0909 -0.2514 -0.3178 183 LEU B CD2 
4583 N N   . SER B 182 ? 1.2507 1.2816 1.4338 -0.0404 -0.3223 -0.4203 184 SER B N   
4584 C CA  . SER B 182 ? 1.3223 1.2862 1.5406 -0.0264 -0.3567 -0.4374 184 SER B CA  
4585 C C   . SER B 182 ? 1.3094 1.2732 1.5811 -0.0518 -0.3949 -0.3831 184 SER B C   
4586 O O   . SER B 182 ? 1.2427 1.2563 1.5174 -0.0806 -0.3933 -0.3346 184 SER B O   
4587 C CB  . SER B 182 ? 1.4324 1.3104 1.6052 -0.0256 -0.3893 -0.4762 184 SER B CB  
4588 O OG  . SER B 182 ? 1.4530 1.3269 1.6066 -0.0671 -0.4236 -0.4459 184 SER B OG  
4589 N N   . ASN B 183 ? 1.2828 1.1881 1.5947 -0.0376 -0.4269 -0.3910 185 ASN B N   
4590 C CA  . ASN B 183 ? 1.2862 1.1715 1.6430 -0.0610 -0.4696 -0.3390 185 ASN B CA  
4591 C C   . ASN B 183 ? 1.2247 1.1833 1.6004 -0.0666 -0.4486 -0.2932 185 ASN B C   
4592 O O   . ASN B 183 ? 1.1846 1.1789 1.5537 -0.0986 -0.4508 -0.2414 185 ASN B O   
4593 C CB  . ASN B 183 ? 1.3027 1.1594 1.6513 -0.1059 -0.5085 -0.3061 185 ASN B CB  
4594 C CG  . ASN B 183 ? 1.4385 1.2415 1.8341 -0.1273 -0.5602 -0.2631 185 ASN B CG  
4595 O OD1 . ASN B 183 ? 1.3837 1.2264 1.8018 -0.1467 -0.5597 -0.2044 185 ASN B OD1 
4596 N ND2 . ASN B 183 ? 1.4921 1.1976 1.8955 -0.1232 -0.6054 -0.2919 185 ASN B ND2 
4597 N N   . LEU B 184 ? 1.2146 1.1952 1.6143 -0.0334 -0.4282 -0.3140 186 LEU B N   
4598 C CA  . LEU B 184 ? 1.1586 1.1934 1.5728 -0.0343 -0.4185 -0.2787 186 LEU B CA  
4599 C C   . LEU B 184 ? 1.2216 1.2235 1.6908 -0.0113 -0.4502 -0.2763 186 LEU B C   
4600 O O   . LEU B 184 ? 1.2642 1.2394 1.7694 0.0229  -0.4497 -0.3207 186 LEU B O   
4601 C CB  . LEU B 184 ? 1.0842 1.1861 1.4820 -0.0201 -0.3683 -0.3018 186 LEU B CB  
4602 C CG  . LEU B 184 ? 1.0647 1.1968 1.4084 -0.0365 -0.3363 -0.3078 186 LEU B CG  
4603 C CD1 . LEU B 184 ? 1.0272 1.2094 1.3609 -0.0188 -0.2892 -0.3361 186 LEU B CD1 
4604 C CD2 . LEU B 184 ? 1.0300 1.1905 1.3487 -0.0687 -0.3412 -0.2545 186 LEU B CD2 
4605 N N   . ARG B 185 ? 1.2084 1.2128 1.6819 -0.0273 -0.4765 -0.2236 187 ARG B N   
4606 C CA  . ARG B 185 ? 1.2379 1.2081 1.7602 -0.0079 -0.5156 -0.2120 187 ARG B CA  
4607 C C   . ARG B 185 ? 1.1951 1.2165 1.7503 0.0213  -0.4986 -0.2336 187 ARG B C   
4608 O O   . ARG B 185 ? 1.1204 1.2021 1.6457 0.0136  -0.4669 -0.2310 187 ARG B O   
4609 C CB  . ARG B 185 ? 1.2547 1.2066 1.7567 -0.0369 -0.5500 -0.1431 187 ARG B CB  
4610 C CG  . ARG B 185 ? 1.3392 1.2374 1.8326 -0.0692 -0.5752 -0.1128 187 ARG B CG  
4611 C CD  . ARG B 185 ? 1.4134 1.3006 1.8869 -0.0985 -0.6011 -0.0374 187 ARG B CD  
4612 N NE  . ARG B 185 ? 1.4824 1.3293 1.9831 -0.0787 -0.6431 -0.0202 187 ARG B NE  
4613 C CZ  . ARG B 185 ? 1.5830 1.4123 2.0589 -0.0969 -0.6699 0.0451  187 ARG B CZ  
4614 N NH1 . ARG B 185 ? 1.5434 1.3977 1.9700 -0.1344 -0.6515 0.0993  187 ARG B NH1 
4615 N NH2 . ARG B 185 ? 1.5679 1.3566 2.0685 -0.0760 -0.7141 0.0585  187 ARG B NH2 
4616 N N   . GLY B 186 ? 1.1547 1.1506 1.7785 0.0550  -0.5227 -0.2541 188 GLY B N   
4617 C CA  . GLY B 186 ? 1.0989 1.1481 1.7761 0.0818  -0.5121 -0.2722 188 GLY B CA  
4618 C C   . GLY B 186 ? 1.0708 1.1390 1.7376 0.0688  -0.5443 -0.2256 188 GLY B C   
4619 O O   . GLY B 186 ? 1.1020 1.1322 1.7270 0.0469  -0.5789 -0.1772 188 GLY B O   
4620 N N   . ARG B 187 ? 1.0039 1.1303 1.7064 0.0814  -0.5330 -0.2395 189 ARG B N   
4621 C CA  . ARG B 187 ? 1.0096 1.1523 1.6972 0.0719  -0.5677 -0.2041 189 ARG B CA  
4622 C C   . ARG B 187 ? 1.0048 1.1443 1.5805 0.0365  -0.5593 -0.1660 189 ARG B C   
4623 O O   . ARG B 187 ? 1.0516 1.1660 1.5811 0.0249  -0.5971 -0.1222 189 ARG B O   
4624 C CB  . ARG B 187 ? 1.0799 1.1770 1.8161 0.0882  -0.6334 -0.1776 189 ARG B CB  
4625 N N   . THR B 188 ? 1.0301 1.1952 1.5598 0.0218  -0.5080 -0.1817 190 THR B N   
4626 C CA  . THR B 188 ? 1.0243 1.1964 1.4587 -0.0061 -0.4901 -0.1500 190 THR B CA  
4627 C C   . THR B 188 ? 0.9734 1.1964 1.3835 -0.0094 -0.4407 -0.1784 190 THR B C   
4628 O O   . THR B 188 ? 0.9462 1.1869 1.3902 -0.0009 -0.4082 -0.2159 190 THR B O   
4629 C CB  . THR B 188 ? 1.1003 1.2394 1.5057 -0.0254 -0.4859 -0.1265 190 THR B CB  
4630 O OG1 . THR B 188 ? 1.1648 1.2473 1.6041 -0.0220 -0.5338 -0.1031 190 THR B OG1 
4631 C CG2 . THR B 188 ? 1.1006 1.2546 1.4206 -0.0510 -0.4680 -0.0843 190 THR B CG2 
4632 N N   . ARG B 189 ? 1.0220 1.2614 1.3663 -0.0200 -0.4354 -0.1607 191 ARG B N   
4633 C CA  . ARG B 189 ? 0.9711 1.2492 1.2881 -0.0233 -0.3940 -0.1839 191 ARG B CA  
4634 C C   . ARG B 189 ? 0.9855 1.2704 1.2462 -0.0378 -0.3560 -0.1732 191 ARG B C   
4635 O O   . ARG B 189 ? 1.0247 1.3009 1.2235 -0.0493 -0.3568 -0.1364 191 ARG B O   
4636 C CB  . ARG B 189 ? 0.9786 1.2604 1.2474 -0.0252 -0.4102 -0.1750 191 ARG B CB  
4637 C CG  . ARG B 189 ? 0.9726 1.2860 1.2326 -0.0268 -0.3757 -0.2036 191 ARG B CG  
4638 C CD  . ARG B 189 ? 1.0346 1.3364 1.2212 -0.0306 -0.3908 -0.1952 191 ARG B CD  
4639 N NE  . ARG B 189 ? 1.0973 1.3924 1.1872 -0.0357 -0.3600 -0.1767 191 ARG B NE  
4640 C CZ  . ARG B 189 ? 1.1888 1.4719 1.1985 -0.0344 -0.3551 -0.1772 191 ARG B CZ  
4641 N NH1 . ARG B 189 ? 1.1408 1.4113 1.1523 -0.0333 -0.3857 -0.1956 191 ARG B NH1 
4642 N NH2 . ARG B 189 ? 1.1714 1.4546 1.1034 -0.0332 -0.3211 -0.1600 191 ARG B NH2 
4643 N N   . TYR B 190 ? 0.9183 1.2214 1.2010 -0.0363 -0.3222 -0.2030 192 TYR B N   
4644 C CA  . TYR B 190 ? 0.9106 1.2241 1.1507 -0.0492 -0.2914 -0.1950 192 TYR B CA  
4645 C C   . TYR B 190 ? 0.8829 1.2274 1.0870 -0.0483 -0.2564 -0.2095 192 TYR B C   
4646 O O   . TYR B 190 ? 0.8532 1.2114 1.0864 -0.0399 -0.2445 -0.2398 192 TYR B O   
4647 C CB  . TYR B 190 ? 0.9221 1.2223 1.1962 -0.0487 -0.2855 -0.2171 192 TYR B CB  
4648 C CG  . TYR B 190 ? 0.9861 1.2447 1.2834 -0.0551 -0.3210 -0.1972 192 TYR B CG  
4649 C CD1 . TYR B 190 ? 1.0227 1.2746 1.2934 -0.0775 -0.3280 -0.1568 192 TYR B CD1 
4650 C CD2 . TYR B 190 ? 1.0229 1.2494 1.3762 -0.0385 -0.3472 -0.2168 192 TYR B CD2 
4651 C CE1 . TYR B 190 ? 1.0854 1.2940 1.3818 -0.0884 -0.3634 -0.1342 192 TYR B CE1 
4652 C CE2 . TYR B 190 ? 1.0906 1.2678 1.4648 -0.0442 -0.3839 -0.1984 192 TYR B CE2 
4653 C CZ  . TYR B 190 ? 1.1472 1.3128 1.4915 -0.0718 -0.3935 -0.1561 192 TYR B CZ  
4654 O OH  . TYR B 190 ? 1.2205 1.3321 1.5897 -0.0824 -0.4329 -0.1335 192 TYR B OH  
4655 N N   . THR B 191 ? 0.9316 1.2872 1.0777 -0.0561 -0.2388 -0.1856 193 THR B N   
4656 C CA  . THR B 191 ? 0.9059 1.2820 1.0127 -0.0529 -0.2076 -0.1963 193 THR B CA  
4657 C C   . THR B 191 ? 0.8995 1.2930 1.0000 -0.0587 -0.1806 -0.1964 193 THR B C   
4658 O O   . THR B 191 ? 0.9136 1.3117 1.0103 -0.0684 -0.1831 -0.1691 193 THR B O   
4659 C CB  . THR B 191 ? 0.9805 1.3532 1.0209 -0.0497 -0.2073 -0.1726 193 THR B CB  
4660 O OG1 . THR B 191 ? 1.0124 1.3611 1.0507 -0.0465 -0.2435 -0.1672 193 THR B OG1 
4661 C CG2 . THR B 191 ? 0.9641 1.3437 0.9678 -0.0421 -0.1828 -0.1912 193 THR B CG2 
4662 N N   . PHE B 192 ? 0.8094 1.2128 0.9111 -0.0547 -0.1576 -0.2233 194 PHE B N   
4663 C CA  . PHE B 192 ? 0.7967 1.2108 0.8904 -0.0591 -0.1388 -0.2268 194 PHE B CA  
4664 C C   . PHE B 192 ? 0.8085 1.2387 0.8604 -0.0542 -0.1128 -0.2221 194 PHE B C   
4665 O O   . PHE B 192 ? 0.8102 1.2357 0.8453 -0.0474 -0.1047 -0.2326 194 PHE B O   
4666 C CB  . PHE B 192 ? 0.8018 1.2067 0.9214 -0.0562 -0.1322 -0.2608 194 PHE B CB  
4667 C CG  . PHE B 192 ? 0.8253 1.2103 0.9907 -0.0523 -0.1547 -0.2735 194 PHE B CG  
4668 C CD1 . PHE B 192 ? 0.8644 1.2272 1.0422 -0.0587 -0.1776 -0.2666 194 PHE B CD1 
4669 C CD2 . PHE B 192 ? 0.8320 1.2192 1.0356 -0.0420 -0.1563 -0.2915 194 PHE B CD2 
4670 C CE1 . PHE B 192 ? 0.8995 1.2352 1.1194 -0.0511 -0.2004 -0.2797 194 PHE B CE1 
4671 C CE2 . PHE B 192 ? 0.8660 1.2368 1.1201 -0.0330 -0.1773 -0.3030 194 PHE B CE2 
4672 C CZ  . PHE B 192 ? 0.8921 1.2332 1.1506 -0.0356 -0.1988 -0.2984 194 PHE B CZ  
4673 N N   . ALA B 193 ? 0.8311 1.2777 0.8719 -0.0579 -0.1041 -0.2058 195 ALA B N   
4674 C CA  . ALA B 193 ? 0.8369 1.2981 0.8456 -0.0496 -0.0809 -0.2005 195 ALA B CA  
4675 C C   . ALA B 193 ? 0.8442 1.3199 0.8613 -0.0566 -0.0817 -0.1928 195 ALA B C   
4676 O O   . ALA B 193 ? 0.8366 1.3176 0.8809 -0.0694 -0.1010 -0.1790 195 ALA B O   
4677 C CB  . ALA B 193 ? 0.8669 1.3411 0.8472 -0.0388 -0.0712 -0.1753 195 ALA B CB  
4678 N N   . VAL B 194 ? 0.8264 1.3037 0.8201 -0.0498 -0.0659 -0.2002 196 VAL B N   
4679 C CA  . VAL B 194 ? 0.8331 1.3172 0.8264 -0.0557 -0.0729 -0.1964 196 VAL B CA  
4680 C C   . VAL B 194 ? 0.8479 1.3612 0.8354 -0.0445 -0.0618 -0.1709 196 VAL B C   
4681 O O   . VAL B 194 ? 0.8684 1.3797 0.8325 -0.0278 -0.0413 -0.1707 196 VAL B O   
4682 C CB  . VAL B 194 ? 0.8523 1.3084 0.8189 -0.0562 -0.0662 -0.2259 196 VAL B CB  
4683 C CG1 . VAL B 194 ? 0.8702 1.3183 0.8092 -0.0454 -0.0410 -0.2319 196 VAL B CG1 
4684 C CG2 . VAL B 194 ? 0.8760 1.3283 0.8276 -0.0632 -0.0821 -0.2241 196 VAL B CG2 
4685 N N   . ARG B 195 ? 0.8161 1.3548 0.8296 -0.0528 -0.0786 -0.1499 197 ARG B N   
4686 C CA  . ARG B 195 ? 0.8247 1.4009 0.8512 -0.0409 -0.0716 -0.1226 197 ARG B CA  
4687 C C   . ARG B 195 ? 0.8613 1.4239 0.8661 -0.0408 -0.0840 -0.1303 197 ARG B C   
4688 O O   . ARG B 195 ? 0.8713 1.3968 0.8463 -0.0521 -0.0968 -0.1552 197 ARG B O   
4689 C CB  . ARG B 195 ? 0.8042 1.4286 0.8909 -0.0527 -0.0849 -0.0860 197 ARG B CB  
4690 C CG  . ARG B 195 ? 0.8538 1.5215 0.9572 -0.0341 -0.0547 -0.0564 197 ARG B CG  
4691 C CD  . ARG B 195 ? 0.8771 1.6006 1.0516 -0.0507 -0.0646 -0.0135 197 ARG B CD  
4692 N NE  . ARG B 195 ? 0.9400 1.7081 1.1251 -0.0314 -0.0270 0.0174  197 ARG B NE  
4693 C CZ  . ARG B 195 ? 1.0028 1.8297 1.2518 -0.0429 -0.0216 0.0629  197 ARG B CZ  
4694 N NH1 . ARG B 195 ? 0.9305 1.7746 1.2453 -0.0776 -0.0592 0.0824  197 ARG B NH1 
4695 N NH2 . ARG B 195 ? 0.9869 1.8527 1.2318 -0.0201 0.0216  0.0896  197 ARG B NH2 
4696 N N   . ALA B 196 ? 0.8213 1.4132 0.8379 -0.0251 -0.0795 -0.1078 198 ALA B N   
4697 C CA  . ALA B 196 ? 0.8494 1.4270 0.8419 -0.0233 -0.0960 -0.1088 198 ALA B CA  
4698 C C   . ALA B 196 ? 0.8518 1.4827 0.8963 -0.0125 -0.1076 -0.0727 198 ALA B C   
4699 O O   . ALA B 196 ? 0.8359 1.5073 0.9152 0.0080  -0.0828 -0.0522 198 ALA B O   
4700 C CB  . ALA B 196 ? 0.8660 1.4008 0.7992 -0.0078 -0.0727 -0.1270 198 ALA B CB  
4701 N N   . ARG B 197 ? 0.9044 1.5350 0.9530 -0.0245 -0.1460 -0.0655 199 ARG B N   
4702 C CA  . ARG B 197 ? 0.8994 1.5825 1.0060 -0.0144 -0.1651 -0.0300 199 ARG B CA  
4703 C C   . ARG B 197 ? 0.9550 1.6066 1.0250 -0.0251 -0.2107 -0.0336 199 ARG B C   
4704 O O   . ARG B 197 ? 0.9795 1.5757 0.9863 -0.0444 -0.2285 -0.0620 199 ARG B O   
4705 C CB  . ARG B 197 ? 0.8502 1.6024 1.0535 -0.0292 -0.1772 0.0022  199 ARG B CB  
4706 C CG  . ARG B 197 ? 0.8863 1.6255 1.1070 -0.0681 -0.2296 -0.0007 199 ARG B CG  
4707 C CD  . ARG B 197 ? 0.8794 1.6919 1.2108 -0.0867 -0.2445 0.0407  199 ARG B CD  
4708 N NE  . ARG B 197 ? 0.8962 1.7783 1.3066 -0.0759 -0.2601 0.0802  199 ARG B NE  
4709 C CZ  . ARG B 197 ? 0.9148 1.8797 1.4417 -0.0889 -0.2689 0.1258  199 ARG B CZ  
4710 N NH1 . ARG B 197 ? 0.8412 1.8223 1.4101 -0.1157 -0.2641 0.1393  199 ARG B NH1 
4711 N NH2 . ARG B 197 ? 0.8500 1.8837 1.4578 -0.0752 -0.2827 0.1615  199 ARG B NH2 
4712 N N   . MET B 198 ? 0.9186 1.6046 1.0255 -0.0092 -0.2293 -0.0045 200 MET B N   
4713 C CA  . MET B 198 ? 0.9737 1.6312 1.0444 -0.0178 -0.2805 -0.0017 200 MET B CA  
4714 C C   . MET B 198 ? 0.9766 1.6593 1.1015 -0.0501 -0.3384 0.0099  200 MET B C   
4715 O O   . MET B 198 ? 0.9447 1.7033 1.1802 -0.0543 -0.3472 0.0432  200 MET B O   
4716 C CB  . MET B 198 ? 1.0007 1.6822 1.0949 0.0137  -0.2847 0.0273  200 MET B CB  
4717 C CG  . MET B 198 ? 1.0469 1.6731 1.0624 0.0398  -0.2465 0.0134  200 MET B CG  
4718 S SD  . MET B 198 ? 1.1305 1.6586 1.0072 0.0199  -0.2610 -0.0165 200 MET B SD  
4719 C CE  . MET B 198 ? 1.1775 1.6588 0.9999 0.0501  -0.2200 -0.0142 200 MET B CE  
4720 N N   . ALA B 199 ? 1.3649 1.4716 1.2567 0.1553  -0.5561 -0.4112 201 ALA B N   
4721 C CA  . ALA B 199 ? 1.3374 1.4664 1.2692 0.1435  -0.5940 -0.4309 201 ALA B CA  
4722 C C   . ALA B 199 ? 1.3564 1.5256 1.3334 0.1572  -0.6288 -0.4297 201 ALA B C   
4723 O O   . ALA B 199 ? 1.3734 1.5467 1.3273 0.1815  -0.6332 -0.4161 201 ALA B O   
4724 C CB  . ALA B 199 ? 1.3188 1.4212 1.1893 0.1423  -0.6119 -0.4510 201 ALA B CB  
4725 N N   . GLU B 200 ? 1.3303 1.5300 1.3750 0.1413  -0.6533 -0.4438 202 GLU B N   
4726 C CA  . GLU B 200 ? 1.3306 1.5741 1.4273 0.1503  -0.6918 -0.4474 202 GLU B CA  
4727 C C   . GLU B 200 ? 1.3441 1.5812 1.3826 0.1636  -0.7229 -0.4565 202 GLU B C   
4728 O O   . GLU B 200 ? 1.3535 1.5504 1.3241 0.1592  -0.7067 -0.4592 202 GLU B O   
4729 C CB  . GLU B 200 ? 1.3056 1.5784 1.4898 0.1256  -0.7031 -0.4616 202 GLU B CB  
4730 C CG  . GLU B 200 ? 1.3251 1.6115 1.5791 0.1155  -0.6693 -0.4443 202 GLU B CG  
4731 C CD  . GLU B 200 ? 1.4300 1.6794 1.6567 0.1006  -0.6241 -0.4364 202 GLU B CD  
4732 O OE1 . GLU B 200 ? 1.3988 1.6285 1.6096 0.0833  -0.6240 -0.4514 202 GLU B OE1 
4733 O OE2 . GLU B 200 ? 1.4319 1.6725 1.6539 0.1061  -0.5886 -0.4153 202 GLU B OE2 
4734 N N   . PRO B 201 ? 1.3693 1.6422 1.4344 0.1776  -0.7550 -0.4534 203 PRO B N   
4735 C CA  . PRO B 201 ? 1.3588 1.6848 1.5112 0.1851  -0.7769 -0.4482 203 PRO B CA  
4736 C C   . PRO B 201 ? 1.3802 1.7121 1.5226 0.2147  -0.7652 -0.4194 203 PRO B C   
4737 O O   . PRO B 201 ? 1.3710 1.7314 1.5867 0.2164  -0.7529 -0.4040 203 PRO B O   
4738 C CB  . PRO B 201 ? 1.3941 1.7462 1.5680 0.1799  -0.8071 -0.4561 203 PRO B CB  
4739 C CG  . PRO B 201 ? 1.4429 1.7568 1.5192 0.1850  -0.8069 -0.4585 203 PRO B CG  
4740 C CD  . PRO B 201 ? 1.4238 1.6866 1.4323 0.1851  -0.7722 -0.4555 203 PRO B CD  
4741 N N   . SER B 202 ? 1.3948 1.6972 1.4492 0.2373  -0.7642 -0.4109 204 SER B N   
4742 C CA  . SER B 202 ? 1.4090 1.7133 1.4517 0.2668  -0.7501 -0.3815 204 SER B CA  
4743 C C   . SER B 202 ? 1.3666 1.6511 1.4276 0.2620  -0.6931 -0.3615 204 SER B C   
4744 O O   . SER B 202 ? 1.3652 1.6640 1.4582 0.2795  -0.6776 -0.3379 204 SER B O   
4745 C CB  . SER B 202 ? 1.4595 1.7309 1.3991 0.2911  -0.7580 -0.3773 204 SER B CB  
4746 O OG  . SER B 202 ? 1.5065 1.7986 1.4265 0.2976  -0.8123 -0.3943 204 SER B OG  
4747 N N   . PHE B 203 ? 1.3347 1.5869 1.3762 0.2388  -0.6613 -0.3704 205 PHE B N   
4748 C CA  . PHE B 203 ? 1.2987 1.5299 1.3480 0.2316  -0.6075 -0.3542 205 PHE B CA  
4749 C C   . PHE B 203 ? 1.2723 1.5125 1.3829 0.2000  -0.5930 -0.3641 205 PHE B C   
4750 O O   . PHE B 203 ? 1.2561 1.4962 1.3696 0.1814  -0.6126 -0.3853 205 PHE B O   
4751 C CB  . PHE B 203 ? 1.3173 1.4971 1.2748 0.2357  -0.5769 -0.3519 205 PHE B CB  
4752 C CG  . PHE B 203 ? 1.3493 1.5139 1.2472 0.2676  -0.5782 -0.3369 205 PHE B CG  
4753 C CD1 . PHE B 203 ? 1.3655 1.5280 1.2740 0.2850  -0.5468 -0.3119 205 PHE B CD1 
4754 C CD2 . PHE B 203 ? 1.3923 1.5426 1.2229 0.2806  -0.6090 -0.3476 205 PHE B CD2 
4755 C CE1 . PHE B 203 ? 1.3972 1.5434 1.2516 0.3157  -0.5457 -0.2963 205 PHE B CE1 
4756 C CE2 . PHE B 203 ? 1.4362 1.5701 1.2089 0.3110  -0.6088 -0.3321 205 PHE B CE2 
4757 C CZ  . PHE B 203 ? 1.4352 1.5670 1.2206 0.3292  -0.5771 -0.3056 205 PHE B CZ  
4758 N N   . GLY B 204 ? 1.2255 1.4714 1.3839 0.1943  -0.5564 -0.3480 206 GLY B N   
4759 C CA  . GLY B 204 ? 1.1872 1.4362 1.3965 0.1656  -0.5352 -0.3532 206 GLY B CA  
4760 C C   . GLY B 204 ? 1.1641 1.3898 1.3640 0.1599  -0.4808 -0.3365 206 GLY B C   
4761 O O   . GLY B 204 ? 1.1767 1.3860 1.3388 0.1781  -0.4591 -0.3215 206 GLY B O   
4762 N N   . GLY B 205 ? 1.1336 1.3569 1.3670 0.1339  -0.4583 -0.3395 207 GLY B N   
4763 C CA  . GLY B 205 ? 1.1312 1.3340 1.3562 0.1248  -0.4071 -0.3258 207 GLY B CA  
4764 C C   . GLY B 205 ? 1.1294 1.3212 1.3632 0.0952  -0.3894 -0.3328 207 GLY B C   
4765 O O   . GLY B 205 ? 1.1193 1.3289 1.4012 0.0811  -0.4097 -0.3433 207 GLY B O   
4766 N N   . PHE B 206 ? 1.1070 1.2695 1.2933 0.0864  -0.3511 -0.3267 208 PHE B N   
4767 C CA  . PHE B 206 ? 1.1059 1.2565 1.2932 0.0600  -0.3297 -0.3290 208 PHE B CA  
4768 C C   . PHE B 206 ? 1.1162 1.2365 1.2266 0.0558  -0.3254 -0.3357 208 PHE B C   
4769 O O   . PHE B 206 ? 1.1236 1.2276 1.1779 0.0720  -0.3267 -0.3363 208 PHE B O   
4770 C CB  . PHE B 206 ? 1.0895 1.2369 1.2989 0.0490  -0.2839 -0.3149 208 PHE B CB  
4771 C CG  . PHE B 206 ? 1.0798 1.2495 1.3479 0.0617  -0.2780 -0.3044 208 PHE B CG  
4772 C CD1 . PHE B 206 ? 1.0699 1.2687 1.4197 0.0551  -0.2903 -0.3051 208 PHE B CD1 
4773 C CD2 . PHE B 206 ? 1.0781 1.2395 1.3235 0.0804  -0.2582 -0.2933 208 PHE B CD2 
4774 C CE1 . PHE B 206 ? 1.0555 1.2772 1.4653 0.0673  -0.2846 -0.2950 208 PHE B CE1 
4775 C CE2 . PHE B 206 ? 1.0699 1.2524 1.3735 0.0936  -0.2516 -0.2818 208 PHE B CE2 
4776 C CZ  . PHE B 206 ? 1.0618 1.2756 1.4487 0.0871  -0.2656 -0.2825 208 PHE B CZ  
4777 N N   . TRP B 207 ? 1.2201 1.3329 1.3304 0.0343  -0.3191 -0.3398 209 TRP B N   
4778 C CA  . TRP B 207 ? 1.1809 1.2680 1.2266 0.0286  -0.3134 -0.3450 209 TRP B CA  
4779 C C   . TRP B 207 ? 1.1511 1.2196 1.1512 0.0276  -0.2741 -0.3357 209 TRP B C   
4780 O O   . TRP B 207 ? 1.1473 1.2196 1.1698 0.0192  -0.2439 -0.3253 209 TRP B O   
4781 C CB  . TRP B 207 ? 1.1587 1.2445 1.2215 0.0068  -0.3151 -0.3485 209 TRP B CB  
4782 C CG  . TRP B 207 ? 1.1537 1.2467 1.2375 0.0070  -0.3530 -0.3628 209 TRP B CG  
4783 C CD1 . TRP B 207 ? 1.1788 1.2905 1.3273 -0.0029 -0.3681 -0.3670 209 TRP B CD1 
4784 C CD2 . TRP B 207 ? 1.1183 1.1981 1.1587 0.0164  -0.3781 -0.3764 209 TRP B CD2 
4785 N NE1 . TRP B 207 ? 1.1512 1.2626 1.2993 -0.0010 -0.4014 -0.3834 209 TRP B NE1 
4786 C CE2 . TRP B 207 ? 1.1124 1.2039 1.1934 0.0109  -0.4081 -0.3893 209 TRP B CE2 
4787 C CE3 . TRP B 207 ? 1.0937 1.1516 1.0656 0.0282  -0.3761 -0.3799 209 TRP B CE3 
4788 C CZ2 . TRP B 207 ? 1.0846 1.1658 1.1375 0.0163  -0.4357 -0.4058 209 TRP B CZ2 
4789 C CZ3 . TRP B 207 ? 1.0747 1.1219 1.0191 0.0344  -0.4032 -0.3952 209 TRP B CZ3 
4790 C CH2 . TRP B 207 ? 1.0801 1.1386 1.0637 0.0284  -0.4327 -0.4081 209 TRP B CH2 
4791 N N   . SER B 208 ? 1.2002 1.2474 1.1366 0.0353  -0.2730 -0.3409 210 SER B N   
4792 C CA  . SER B 208 ? 1.1753 1.2039 1.0657 0.0332  -0.2365 -0.3356 210 SER B CA  
4793 C C   . SER B 208 ? 1.1361 1.1584 1.0130 0.0094  -0.2172 -0.3347 210 SER B C   
4794 O O   . SER B 208 ? 1.1273 1.1566 1.0263 -0.0032 -0.2323 -0.3368 210 SER B O   
4795 C CB  . SER B 208 ? 1.1720 1.1798 1.0017 0.0504  -0.2414 -0.3421 210 SER B CB  
4796 O OG  . SER B 208 ? 1.1429 1.1406 0.9442 0.0450  -0.2595 -0.3531 210 SER B OG  
4797 N N   . ALA B 209 ? 1.1605 1.1696 1.0004 0.0032  -0.1832 -0.3313 211 ALA B N   
4798 C CA  . ALA B 209 ? 1.1282 1.1331 0.9483 -0.0187 -0.1658 -0.3304 211 ALA B CA  
4799 C C   . ALA B 209 ? 1.1028 1.0987 0.8887 -0.0189 -0.1859 -0.3393 211 ALA B C   
4800 O O   . ALA B 209 ? 1.1061 1.0918 0.8672 -0.0026 -0.2025 -0.3475 211 ALA B O   
4801 C CB  . ALA B 209 ? 1.1179 1.1120 0.9051 -0.0260 -0.1252 -0.3276 211 ALA B CB  
4802 N N   . TRP B 210 ? 1.1373 1.1363 0.9222 -0.0372 -0.1834 -0.3367 212 TRP B N   
4803 C CA  . TRP B 210 ? 1.1065 1.0985 0.8660 -0.0383 -0.2004 -0.3433 212 TRP B CA  
4804 C C   . TRP B 210 ? 1.1087 1.0862 0.8135 -0.0353 -0.1842 -0.3497 212 TRP B C   
4805 O O   . TRP B 210 ? 1.1068 1.0821 0.7919 -0.0424 -0.1545 -0.3472 212 TRP B O   
4806 C CB  . TRP B 210 ? 1.0931 1.0933 0.8677 -0.0574 -0.2003 -0.3355 212 TRP B CB  
4807 C CG  . TRP B 210 ? 1.1133 1.1244 0.9423 -0.0606 -0.2174 -0.3310 212 TRP B CG  
4808 C CD1 . TRP B 210 ? 1.1393 1.1607 1.0051 -0.0721 -0.2041 -0.3207 212 TRP B CD1 
4809 C CD2 . TRP B 210 ? 1.1175 1.1289 0.9714 -0.0533 -0.2487 -0.3383 212 TRP B CD2 
4810 N NE1 . TRP B 210 ? 1.1669 1.1958 1.0817 -0.0723 -0.2251 -0.3209 212 TRP B NE1 
4811 C CE2 . TRP B 210 ? 1.1626 1.1859 1.0709 -0.0614 -0.2531 -0.3322 212 TRP B CE2 
4812 C CE3 . TRP B 210 ? 1.1033 1.1044 0.9384 -0.0418 -0.2716 -0.3504 212 TRP B CE3 
4813 C CZ2 . TRP B 210 ? 1.1816 1.2082 1.1277 -0.0589 -0.2799 -0.3389 212 TRP B CZ2 
4814 C CZ3 . TRP B 210 ? 1.1217 1.1251 0.9913 -0.0395 -0.2982 -0.3572 212 TRP B CZ3 
4815 C CH2 . TRP B 210 ? 1.1598 1.1765 1.0850 -0.0484 -0.3025 -0.3519 212 TRP B CH2 
4816 N N   . SER B 211 ? 1.1414 1.1078 0.8226 -0.0255 -0.2020 -0.3592 213 SER B N   
4817 C CA  . SER B 211 ? 1.1432 1.0951 0.7760 -0.0228 -0.1871 -0.3667 213 SER B CA  
4818 C C   . SER B 211 ? 1.1270 1.0861 0.7466 -0.0427 -0.1719 -0.3634 213 SER B C   
4819 O O   . SER B 211 ? 1.1012 1.0744 0.7452 -0.0568 -0.1753 -0.3542 213 SER B O   
4820 C CB  . SER B 211 ? 1.1659 1.1030 0.7794 -0.0084 -0.2093 -0.3778 213 SER B CB  
4821 O OG  . SER B 211 ? 1.1714 1.1136 0.8011 -0.0161 -0.2286 -0.3781 213 SER B OG  
4822 N N   . GLU B 212 ? 1.1724 1.1221 0.7529 -0.0435 -0.1547 -0.3708 214 GLU B N   
4823 C CA  . GLU B 212 ? 1.1476 1.1071 0.7133 -0.0615 -0.1436 -0.3696 214 GLU B CA  
4824 C C   . GLU B 212 ? 1.1383 1.1042 0.7187 -0.0636 -0.1693 -0.3669 214 GLU B C   
4825 O O   . GLU B 212 ? 1.1509 1.1044 0.7259 -0.0505 -0.1858 -0.3750 214 GLU B O   
4826 C CB  . GLU B 212 ? 1.1788 1.1272 0.7040 -0.0609 -0.1223 -0.3810 214 GLU B CB  
4827 C CG  . GLU B 212 ? 1.2307 1.1752 0.7415 -0.0660 -0.0891 -0.3824 214 GLU B CG  
4828 C CD  . GLU B 212 ? 1.2661 1.2286 0.7855 -0.0884 -0.0739 -0.3743 214 GLU B CD  
4829 O OE1 . GLU B 212 ? 1.2288 1.2039 0.7345 -0.1047 -0.0709 -0.3753 214 GLU B OE1 
4830 O OE2 . GLU B 212 ? 1.2272 1.1917 0.7670 -0.0898 -0.0650 -0.3668 214 GLU B OE2 
4831 N N   . PRO B 213 ? 1.1052 1.0878 0.7034 -0.0789 -0.1721 -0.3553 215 PRO B N   
4832 C CA  . PRO B 213 ? 1.0958 1.0831 0.7133 -0.0793 -0.1954 -0.3501 215 PRO B CA  
4833 C C   . PRO B 213 ? 1.0962 1.0806 0.6906 -0.0774 -0.1979 -0.3575 215 PRO B C   
4834 O O   . PRO B 213 ? 1.0980 1.0859 0.6639 -0.0840 -0.1800 -0.3627 215 PRO B O   
4835 C CB  . PRO B 213 ? 1.0855 1.0905 0.7194 -0.0968 -0.1908 -0.3337 215 PRO B CB  
4836 C CG  . PRO B 213 ? 1.0932 1.1000 0.7273 -0.1029 -0.1698 -0.3315 215 PRO B CG  
4837 C CD  . PRO B 213 ? 1.0996 1.0954 0.7021 -0.0959 -0.1531 -0.3451 215 PRO B CD  
4838 N N   . VAL B 214 ? 1.1025 1.0803 0.7123 -0.0688 -0.2192 -0.3591 216 VAL B N   
4839 C CA  . VAL B 214 ? 1.1100 1.0843 0.7082 -0.0663 -0.2221 -0.3629 216 VAL B CA  
4840 C C   . VAL B 214 ? 1.0994 1.0840 0.7269 -0.0701 -0.2401 -0.3521 216 VAL B C   
4841 O O   . VAL B 214 ? 1.0997 1.0766 0.7551 -0.0643 -0.2559 -0.3502 216 VAL B O   
4842 C CB  . VAL B 214 ? 1.1353 1.0822 0.7266 -0.0520 -0.2189 -0.3653 216 VAL B CB  
4843 C CG1 . VAL B 214 ? 1.1509 1.0933 0.7403 -0.0509 -0.2183 -0.3645 216 VAL B CG1 
4844 C CG2 . VAL B 214 ? 1.1522 1.0850 0.7171 -0.0484 -0.1956 -0.3663 216 VAL B CG2 
4845 N N   . SER B 215 ? 1.1502 1.1523 0.7736 -0.0799 -0.2366 -0.3435 217 SER B N   
4846 C CA  . SER B 215 ? 1.1452 1.1583 0.7962 -0.0833 -0.2503 -0.3273 217 SER B CA  
4847 C C   . SER B 215 ? 1.1845 1.1927 0.8391 -0.0748 -0.2584 -0.3328 217 SER B C   
4848 O O   . SER B 215 ? 1.2004 1.2077 0.8316 -0.0730 -0.2494 -0.3450 217 SER B O   
4849 C CB  . SER B 215 ? 1.1394 1.1782 0.7844 -0.0996 -0.2429 -0.3102 217 SER B CB  
4850 O OG  . SER B 215 ? 1.1625 1.2039 0.8040 -0.1084 -0.2318 -0.3056 217 SER B OG  
4851 N N   . LEU B 216 ? 1.0728 1.0773 0.7596 -0.0702 -0.2731 -0.3234 218 LEU B N   
4852 C CA  . LEU B 216 ? 1.0919 1.0898 0.7904 -0.0616 -0.2802 -0.3266 218 LEU B CA  
4853 C C   . LEU B 216 ? 1.1011 1.1087 0.8359 -0.0632 -0.2910 -0.3048 218 LEU B C   
4854 O O   . LEU B 216 ? 1.0923 1.0976 0.8479 -0.0663 -0.2956 -0.2941 218 LEU B O   
4855 C CB  . LEU B 216 ? 1.1155 1.0827 0.8138 -0.0481 -0.2850 -0.3466 218 LEU B CB  
4856 C CG  . LEU B 216 ? 1.1746 1.1256 0.8468 -0.0393 -0.2773 -0.3667 218 LEU B CG  
4857 C CD1 . LEU B 216 ? 1.1721 1.1280 0.8108 -0.0443 -0.2586 -0.3702 218 LEU B CD1 
4858 C CD2 . LEU B 216 ? 1.2192 1.1387 0.8915 -0.0272 -0.2829 -0.3821 218 LEU B CD2 
4859 N N   . LEU B 217 ? 1.1356 1.1546 0.8796 -0.0611 -0.2936 -0.2973 219 LEU B N   
4860 C CA  . LEU B 217 ? 1.1432 1.1721 0.9214 -0.0604 -0.3027 -0.2739 219 LEU B CA  
4861 C C   . LEU B 217 ? 1.2013 1.2058 1.0081 -0.0476 -0.3085 -0.2813 219 LEU B C   
4862 O O   . LEU B 217 ? 1.2256 1.2197 1.0239 -0.0404 -0.3053 -0.2982 219 LEU B O   
4863 C CB  . LEU B 217 ? 1.1305 1.1917 0.9034 -0.0657 -0.3030 -0.2587 219 LEU B CB  
4864 C CG  . LEU B 217 ? 1.1493 1.2285 0.9495 -0.0665 -0.3118 -0.2277 219 LEU B CG  
4865 C CD1 . LEU B 217 ? 1.1853 1.2560 1.0228 -0.0532 -0.3185 -0.2225 219 LEU B CD1 
4866 C CD2 . LEU B 217 ? 1.1515 1.2210 0.9629 -0.0709 -0.3120 -0.2145 219 LEU B CD2 
4867 N N   . THR B 218 ? 1.1785 1.1720 1.0191 -0.0455 -0.3147 -0.2696 220 THR B N   
4868 C CA  . THR B 218 ? 1.2172 1.1844 1.0870 -0.0353 -0.3183 -0.2780 220 THR B CA  
4869 C C   . THR B 218 ? 1.2564 1.2331 1.1565 -0.0295 -0.3199 -0.2587 220 THR B C   
4870 O O   . THR B 218 ? 1.2414 1.2418 1.1520 -0.0335 -0.3223 -0.2318 220 THR B O   
4871 C CB  . THR B 218 ? 1.2530 1.2023 1.1483 -0.0369 -0.3223 -0.2777 220 THR B CB  
4872 O OG1 . THR B 218 ? 1.2463 1.2107 1.1651 -0.0424 -0.3228 -0.2488 220 THR B OG1 
4873 C CG2 . THR B 218 ? 1.2238 1.1677 1.0947 -0.0416 -0.3224 -0.2949 220 THR B CG2 
4874 N N   . PRO B 219 ? 1.2991 1.2576 1.2132 -0.0195 -0.3181 -0.2711 221 PRO B N   
4875 C CA  . PRO B 219 ? 1.3178 1.2848 1.2674 -0.0122 -0.3186 -0.2519 221 PRO B CA  
4876 C C   . PRO B 219 ? 1.3511 1.3064 1.3433 -0.0098 -0.3207 -0.2328 221 PRO B C   
4877 O O   . PRO B 219 ? 1.3509 1.2924 1.3456 -0.0152 -0.3217 -0.2362 221 PRO B O   
4878 C CB  . PRO B 219 ? 1.3561 1.3005 1.3067 -0.0029 -0.3123 -0.2755 221 PRO B CB  
4879 C CG  . PRO B 219 ? 1.3743 1.3062 1.2792 -0.0061 -0.3086 -0.3039 221 PRO B CG  
4880 C CD  . PRO B 219 ? 1.3289 1.2597 1.2229 -0.0141 -0.3138 -0.3026 221 PRO B CD  
4881 N N   . SER B 220 ? 1.3879 1.3486 1.4168 -0.0015 -0.3203 -0.2124 222 SER B N   
4882 C CA  . SER B 220 ? 1.4048 1.3514 1.4777 0.0023  -0.3189 -0.1927 222 SER B CA  
4883 C C   . SER B 220 ? 1.4509 1.3579 1.5500 0.0092  -0.3117 -0.2142 222 SER B C   
4884 O O   . SER B 220 ? 1.4641 1.3618 1.5628 0.0162  -0.3072 -0.2299 222 SER B O   
4885 C CB  . SER B 220 ? 1.4229 1.3957 1.5235 0.0091  -0.3215 -0.1559 222 SER B CB  
4886 O OG  . SER B 220 ? 1.4893 1.4504 1.6265 0.0115  -0.3186 -0.1320 222 SER B OG  
4887 N N   . ASP B 221 ? 1.3493 1.2323 1.4716 0.0062  -0.3092 -0.2158 223 ASP B N   
4888 C CA  . ASP B 221 ? 1.4825 1.3264 1.6291 0.0100  -0.3020 -0.2383 223 ASP B CA  
4889 C C   . ASP B 221 ? 1.6028 1.4387 1.7897 0.0222  -0.2931 -0.2253 223 ASP B C   
4890 O O   . ASP B 221 ? 1.4648 1.2674 1.6718 0.0261  -0.2839 -0.2444 223 ASP B O   
4891 C CB  . ASP B 221 ? 1.5311 1.3556 1.7029 0.0029  -0.3005 -0.2390 223 ASP B CB  
4892 C CG  . ASP B 221 ? 1.5198 1.3676 1.6778 -0.0065 -0.3065 -0.2220 223 ASP B CG  
4893 O OD1 . ASP B 221 ? 1.5163 1.3907 1.6755 -0.0048 -0.3074 -0.1899 223 ASP B OD1 
4894 O OD2 . ASP B 221 ? 1.5164 1.3566 1.6620 -0.0155 -0.3103 -0.2407 223 ASP B OD2 
4895 N N   . LYS C 8   ? 1.6106 1.4648 2.2196 0.0262  -0.0326 -0.1795 10  LYS C N   
4896 C CA  . LYS C 8   ? 1.5643 1.4005 2.0889 0.0378  -0.0398 -0.2517 10  LYS C CA  
4897 C C   . LYS C 8   ? 1.4654 1.3035 1.9585 0.0389  -0.0174 -0.3004 10  LYS C C   
4898 O O   . LYS C 8   ? 1.4021 1.2154 1.9116 0.0289  -0.0470 -0.3175 10  LYS C O   
4899 C CB  . LYS C 8   ? 1.6184 1.4831 2.0874 0.0558  -0.0090 -0.2578 10  LYS C CB  
4900 N N   . PHE C 9   ? 1.5970 1.4621 2.0428 0.0518  0.0316  -0.3216 11  PHE C N   
4901 C CA  . PHE C 9   ? 1.5006 1.3669 1.9224 0.0511  0.0522  -0.3622 11  PHE C CA  
4902 C C   . PHE C 9   ? 1.4936 1.3636 1.9797 0.0413  0.0663  -0.3317 11  PHE C C   
4903 O O   . PHE C 9   ? 1.4118 1.2739 1.9032 0.0330  0.0603  -0.3574 11  PHE C O   
4904 C CB  . PHE C 9   ? 1.4893 1.3716 1.8455 0.0665  0.0940  -0.3886 11  PHE C CB  
4905 C CG  . PHE C 9   ? 1.4469 1.3315 1.8019 0.0691  0.1307  -0.3999 11  PHE C CG  
4906 C CD1 . PHE C 9   ? 1.3521 1.2271 1.6966 0.0589  0.1211  -0.4400 11  PHE C CD1 
4907 C CD2 . PHE C 9   ? 1.5009 1.3994 1.8649 0.0855  0.1756  -0.3676 11  PHE C CD2 
4908 C CE1 . PHE C 9   ? 1.3176 1.1894 1.6645 0.0608  0.1513  -0.4490 11  PHE C CE1 
4909 C CE2 . PHE C 9   ? 1.4643 1.3574 1.8235 0.0929  0.2085  -0.3798 11  PHE C CE2 
4910 C CZ  . PHE C 9   ? 1.3707 1.2466 1.7228 0.0785  0.1942  -0.4216 11  PHE C CZ  
4911 N N   . GLU C 10  ? 1.4668 1.3557 2.0066 0.0431  0.0858  -0.2714 12  GLU C N   
4912 C CA  . GLU C 10