data_6MUO
# 
_entry.id   6MUO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6MUO         
WWPDB D_1000237486 
EMDB  EMD-9250     
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
EMDB . EMD-9251 'other EM volume'      
EMDB . EMD-9250 'associated EM volume' 
EMDB . EMD-9252 'other EM volume'      
PDB  . 6mup     unspecified            
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6MUO 
_pdbx_database_status.recvd_initial_deposition_date   2018-10-23 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Allu, P.K.'  1 0000-0001-7547-2254 
'Black, B.E.' 2 0000-0002-3707-9483 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Curr.Biol. 
_citation.journal_id_ASTM           CUBLE2 
_citation.journal_id_CSD            2060 
_citation.journal_id_ISSN           0960-9822 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            29 
_citation.language                  ? 
_citation.page_first                2625 
_citation.page_last                 2639.e5 
_citation.title                     'Structure of the Human Core Centromeric Nucleosome Complex.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.cub.2019.06.062 
_citation.pdbx_database_id_PubMed   31353180 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Allu, P.K.'            1 ? 
primary 'Dawicki-McKenna, J.M.' 2 ? 
primary 'Van Eeuwen, T.'        3 ? 
primary 'Slavin, M.'            4 ? 
primary 'Braitbard, M.'         5 ? 
primary 'Xu, C.'                6 ? 
primary 'Kalisman, N.'          7 ? 
primary 'Murakami, K.'          8 ? 
primary 'Black, B.E.'           9 ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Histone H3-like centromeric protein A' 11993.037 2 ? ? ? ? 
2 polymer man 'Histone H4'                            10604.521 2 ? ? ? ? 
3 polymer man 'Histone H2A type 1-C'                  11494.393 2 ? ? ? ? 
4 polymer man 'Histone H2B type 2-F'                  10249.723 2 ? ? ? ? 
5 polymer syn 'DNA/RNA (147-MER)'                     45141.918 1 ? ? ? ? 
6 polymer syn 'DNA/RNA (147-MER)'                     45582.188 1 ? ? ? ? 
7 polymer syn 'Centromere protein C'                  2508.834  2 ? ? ? ? 
8 polymer man 'Centromere protein N'                  25052.885 1 ? ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Centromere autoantigen A,Centromere protein A,CENP-A'                                                    
3 'Histone H2A/l'                                                                                           
7 'CENP-C,Centromere autoantigen C,Centromere protein C 1,CENP-C 1,Interphase centromere complex protein 7' 
8 'CENP-N,Interphase centromere complex protein 32'                                                         
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;HQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAG
RVTLFPKDVQLARRIRGLEEGL
;
;HQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAG
RVTLFPKDVQLARRIRGLEEGL
;
A,E ? 
2 'polypeptide(L)'        no no 
;KGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVV
YALKRQGRTLYGFG
;
;KGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVV
YALKRQGRTLYGFG
;
B,F ? 
3 'polypeptide(L)'        no no 
;KAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEE
LNKLLGRVTIAQGGVLPNIQSVLLP
;
;KAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEE
LNKLLGRVTIAQGGVLPNIQSVLLP
;
C,G ? 
4 'polypeptide(L)'        no no 
;RKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVS
EGTKAVTKYTSS
;
;RKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVS
EGTKAVTKYTSS
;
D,H ? 
5 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DA)(DA)(DA)(DT)(DA)(DT)(DC)(DC)(DA)(DC)(DC)(DT)(DG)(DC)(DA)(DG)(DA)
(DT)(DT)(DC)(DT)(DA)(DC)(DC)(DA)(DA)(DA)(DA)(DG)(DT)(DG)(DT)(DA)(DT)(DT)(DT)(DG)
(DG)(DA)(DA)(DA)(DC)(DT)(DG)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DA)(DA)(DA)(DG)(DG)
(DC)(DA)(DT)(DG)(DT)(DT)(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DG)(DT)(DG)(DA)(DG)(DT)(DG)
(DA)(DA)(DA)(DC)(DT)(DC)(DC)(DA)(DT)(DC)(DA)(DT)(DC)(DA)(DC)(DA)(DA)(DA)(DG)(DA)
(DA)(DT)(DA)(DT)(DT)(DC)(DT)(DG)(DA)(DG)(DA)(DA)(DT)(DG)(DC)(DT)(DT)(DC)(DC)(DG)
(DT)(DT)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DA)(DT)(DA)(DT)(DG)(DA)(DA)(DC)(DT)(DT)
(DC)(DC)(DT)(DC)(DG)(DA)(DT)
;
;ATCAAATATCCACCTGCAGATTCTACCAAAAGTGTATTTGGAAACTGCTCCATCAAAAGGCATGTTCAGCTCTGTGAGTG
AAACTCCATCATCACAAAGAATATTCTGAGAATGCTTCCGTTTGCCTTTTATATGAACTTCCTCGAT
;
I   ? 
6 polydeoxyribonucleotide no no 
;(DA)(DT)(DC)(DG)(DA)(DG)(DG)(DA)(DA)(DG)(DT)(DT)(DC)(DA)(DT)(DA)(DT)(DA)(DA)(DA)
(DA)(DG)(DG)(DC)(DA)(DA)(DA)(DC)(DG)(DG)(DA)(DA)(DG)(DC)(DA)(DT)(DT)(DC)(DT)(DC)
(DA)(DG)(DA)(DA)(DT)(DA)(DT)(DT)(DC)(DT)(DT)(DT)(DG)(DT)(DG)(DA)(DT)(DG)(DA)(DT)
(DG)(DG)(DA)(DG)(DT)(DT)(DT)(DC)(DA)(DC)(DT)(DC)(DA)(DC)(DA)(DG)(DA)(DG)(DC)(DT)
(DG)(DA)(DA)(DC)(DA)(DT)(DG)(DC)(DC)(DT)(DT)(DT)(DT)(DG)(DA)(DT)(DG)(DG)(DA)(DG)
(DC)(DA)(DG)(DT)(DT)(DT)(DC)(DC)(DA)(DA)(DA)(DT)(DA)(DC)(DA)(DC)(DT)(DT)(DT)(DT)
(DG)(DG)(DT)(DA)(DG)(DA)(DA)(DT)(DC)(DT)(DG)(DC)(DA)(DG)(DG)(DT)(DG)(DG)(DA)(DT)
(DA)(DT)(DT)(DT)(DG)(DA)(DT)
;
;ATCGAGGAAGTTCATATAAAAGGCAAACGGAAGCATTCTCAGAATATTCTTTGTGATGATGGAGTTTCACTCACAGAGCT
GAACATGCCTTTTGATGGAGCAGTTTCCAAATACACTTTTGGTAGAATCTGCAGGTGGATATTTGAT
;
J   ? 
7 'polypeptide(L)'        no no TKSRRISRRPSDWWVVKSEE TKSRRISRRPSDWWVVKSEE K,L ? 
8 'polypeptide(L)'        no no 
;MDETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKRASISDAALLDIIYMQFHQHQ
KVWDVFQMSKGPGEDVDLFDMKQFKNSFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYSQTPY
AFTSSSMLRRNTPLLGQALTIASKHHQIVKMDLRSRYLDSLKAIVFKQYNQT
;
;MDETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKRASISDAALLDIIYMQFHQHQ
KVWDVFQMSKGPGEDVDLFDMKQFKNSFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYSQTPY
AFTSSSMLRRNTPLLGQALTIASKHHQIVKMDLRSRYLDSLKAIVFKQYNQT
;
M   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   HIS n 
1 2   GLN n 
1 3   HIS n 
1 4   SER n 
1 5   ARG n 
1 6   ARG n 
1 7   ARG n 
1 8   GLN n 
1 9   GLY n 
1 10  TRP n 
1 11  LEU n 
1 12  LYS n 
1 13  GLU n 
1 14  ILE n 
1 15  ARG n 
1 16  LYS n 
1 17  LEU n 
1 18  GLN n 
1 19  LYS n 
1 20  SER n 
1 21  THR n 
1 22  HIS n 
1 23  LEU n 
1 24  LEU n 
1 25  ILE n 
1 26  ARG n 
1 27  LYS n 
1 28  LEU n 
1 29  PRO n 
1 30  PHE n 
1 31  SER n 
1 32  ARG n 
1 33  LEU n 
1 34  ALA n 
1 35  ARG n 
1 36  GLU n 
1 37  ILE n 
1 38  CYS n 
1 39  VAL n 
1 40  LYS n 
1 41  PHE n 
1 42  THR n 
1 43  ARG n 
1 44  GLY n 
1 45  VAL n 
1 46  ASP n 
1 47  PHE n 
1 48  ASN n 
1 49  TRP n 
1 50  GLN n 
1 51  ALA n 
1 52  GLN n 
1 53  ALA n 
1 54  LEU n 
1 55  LEU n 
1 56  ALA n 
1 57  LEU n 
1 58  GLN n 
1 59  GLU n 
1 60  ALA n 
1 61  ALA n 
1 62  GLU n 
1 63  ALA n 
1 64  PHE n 
1 65  LEU n 
1 66  VAL n 
1 67  HIS n 
1 68  LEU n 
1 69  PHE n 
1 70  GLU n 
1 71  ASP n 
1 72  ALA n 
1 73  TYR n 
1 74  LEU n 
1 75  LEU n 
1 76  THR n 
1 77  LEU n 
1 78  HIS n 
1 79  ALA n 
1 80  GLY n 
1 81  ARG n 
1 82  VAL n 
1 83  THR n 
1 84  LEU n 
1 85  PHE n 
1 86  PRO n 
1 87  LYS n 
1 88  ASP n 
1 89  VAL n 
1 90  GLN n 
1 91  LEU n 
1 92  ALA n 
1 93  ARG n 
1 94  ARG n 
1 95  ILE n 
1 96  ARG n 
1 97  GLY n 
1 98  LEU n 
1 99  GLU n 
1 100 GLU n 
1 101 GLY n 
1 102 LEU n 
2 1   LYS n 
2 2   GLY n 
2 3   LEU n 
2 4   GLY n 
2 5   LYS n 
2 6   GLY n 
2 7   GLY n 
2 8   ALA n 
2 9   LYS n 
2 10  ARG n 
2 11  HIS n 
2 12  ARG n 
2 13  LYS n 
2 14  VAL n 
2 15  LEU n 
2 16  ARG n 
2 17  ASP n 
2 18  ASN n 
2 19  ILE n 
2 20  GLN n 
2 21  GLY n 
2 22  ILE n 
2 23  THR n 
2 24  LYS n 
2 25  PRO n 
2 26  ALA n 
2 27  ILE n 
2 28  ARG n 
2 29  ARG n 
2 30  LEU n 
2 31  ALA n 
2 32  ARG n 
2 33  ARG n 
2 34  GLY n 
2 35  GLY n 
2 36  VAL n 
2 37  LYS n 
2 38  ARG n 
2 39  ILE n 
2 40  SER n 
2 41  GLY n 
2 42  LEU n 
2 43  ILE n 
2 44  TYR n 
2 45  GLU n 
2 46  GLU n 
2 47  THR n 
2 48  ARG n 
2 49  GLY n 
2 50  VAL n 
2 51  LEU n 
2 52  LYS n 
2 53  VAL n 
2 54  PHE n 
2 55  LEU n 
2 56  GLU n 
2 57  ASN n 
2 58  VAL n 
2 59  ILE n 
2 60  ARG n 
2 61  ASP n 
2 62  ALA n 
2 63  VAL n 
2 64  THR n 
2 65  TYR n 
2 66  THR n 
2 67  GLU n 
2 68  HIS n 
2 69  ALA n 
2 70  LYS n 
2 71  ARG n 
2 72  LYS n 
2 73  THR n 
2 74  VAL n 
2 75  THR n 
2 76  ALA n 
2 77  MET n 
2 78  ASP n 
2 79  VAL n 
2 80  VAL n 
2 81  TYR n 
2 82  ALA n 
2 83  LEU n 
2 84  LYS n 
2 85  ARG n 
2 86  GLN n 
2 87  GLY n 
2 88  ARG n 
2 89  THR n 
2 90  LEU n 
2 91  TYR n 
2 92  GLY n 
2 93  PHE n 
2 94  GLY n 
3 1   LYS n 
3 2   ALA n 
3 3   LYS n 
3 4   SER n 
3 5   ARG n 
3 6   SER n 
3 7   SER n 
3 8   ARG n 
3 9   ALA n 
3 10  GLY n 
3 11  LEU n 
3 12  GLN n 
3 13  PHE n 
3 14  PRO n 
3 15  VAL n 
3 16  GLY n 
3 17  ARG n 
3 18  VAL n 
3 19  HIS n 
3 20  ARG n 
3 21  LEU n 
3 22  LEU n 
3 23  ARG n 
3 24  LYS n 
3 25  GLY n 
3 26  ASN n 
3 27  TYR n 
3 28  ALA n 
3 29  GLU n 
3 30  ARG n 
3 31  VAL n 
3 32  GLY n 
3 33  ALA n 
3 34  GLY n 
3 35  ALA n 
3 36  PRO n 
3 37  VAL n 
3 38  TYR n 
3 39  LEU n 
3 40  ALA n 
3 41  ALA n 
3 42  VAL n 
3 43  LEU n 
3 44  GLU n 
3 45  TYR n 
3 46  LEU n 
3 47  THR n 
3 48  ALA n 
3 49  GLU n 
3 50  ILE n 
3 51  LEU n 
3 52  GLU n 
3 53  LEU n 
3 54  ALA n 
3 55  GLY n 
3 56  ASN n 
3 57  ALA n 
3 58  ALA n 
3 59  ARG n 
3 60  ASP n 
3 61  ASN n 
3 62  LYS n 
3 63  LYS n 
3 64  THR n 
3 65  ARG n 
3 66  ILE n 
3 67  ILE n 
3 68  PRO n 
3 69  ARG n 
3 70  HIS n 
3 71  LEU n 
3 72  GLN n 
3 73  LEU n 
3 74  ALA n 
3 75  ILE n 
3 76  ARG n 
3 77  ASN n 
3 78  ASP n 
3 79  GLU n 
3 80  GLU n 
3 81  LEU n 
3 82  ASN n 
3 83  LYS n 
3 84  LEU n 
3 85  LEU n 
3 86  GLY n 
3 87  ARG n 
3 88  VAL n 
3 89  THR n 
3 90  ILE n 
3 91  ALA n 
3 92  GLN n 
3 93  GLY n 
3 94  GLY n 
3 95  VAL n 
3 96  LEU n 
3 97  PRO n 
3 98  ASN n 
3 99  ILE n 
3 100 GLN n 
3 101 SER n 
3 102 VAL n 
3 103 LEU n 
3 104 LEU n 
3 105 PRO n 
4 1   ARG n 
4 2   LYS n 
4 3   GLU n 
4 4   SER n 
4 5   TYR n 
4 6   SER n 
4 7   VAL n 
4 8   TYR n 
4 9   VAL n 
4 10  TYR n 
4 11  LYS n 
4 12  VAL n 
4 13  LEU n 
4 14  LYS n 
4 15  GLN n 
4 16  VAL n 
4 17  HIS n 
4 18  PRO n 
4 19  ASP n 
4 20  THR n 
4 21  GLY n 
4 22  ILE n 
4 23  SER n 
4 24  SER n 
4 25  LYS n 
4 26  ALA n 
4 27  MET n 
4 28  GLY n 
4 29  ILE n 
4 30  MET n 
4 31  ASN n 
4 32  SER n 
4 33  PHE n 
4 34  VAL n 
4 35  ASN n 
4 36  ASP n 
4 37  ILE n 
4 38  PHE n 
4 39  GLU n 
4 40  ARG n 
4 41  ILE n 
4 42  ALA n 
4 43  GLY n 
4 44  GLU n 
4 45  ALA n 
4 46  SER n 
4 47  ARG n 
4 48  LEU n 
4 49  ALA n 
4 50  HIS n 
4 51  TYR n 
4 52  ASN n 
4 53  LYS n 
4 54  ARG n 
4 55  SER n 
4 56  THR n 
4 57  ILE n 
4 58  THR n 
4 59  SER n 
4 60  ARG n 
4 61  GLU n 
4 62  ILE n 
4 63  GLN n 
4 64  THR n 
4 65  ALA n 
4 66  VAL n 
4 67  ARG n 
4 68  LEU n 
4 69  LEU n 
4 70  LEU n 
4 71  PRO n 
4 72  GLY n 
4 73  GLU n 
4 74  LEU n 
4 75  ALA n 
4 76  LYS n 
4 77  HIS n 
4 78  ALA n 
4 79  VAL n 
4 80  SER n 
4 81  GLU n 
4 82  GLY n 
4 83  THR n 
4 84  LYS n 
4 85  ALA n 
4 86  VAL n 
4 87  THR n 
4 88  LYS n 
4 89  TYR n 
4 90  THR n 
4 91  SER n 
4 92  SER n 
5 1   DA  n 
5 2   DT  n 
5 3   DC  n 
5 4   DA  n 
5 5   DA  n 
5 6   DA  n 
5 7   DT  n 
5 8   DA  n 
5 9   DT  n 
5 10  DC  n 
5 11  DC  n 
5 12  DA  n 
5 13  DC  n 
5 14  DC  n 
5 15  DT  n 
5 16  DG  n 
5 17  DC  n 
5 18  DA  n 
5 19  DG  n 
5 20  DA  n 
5 21  DT  n 
5 22  DT  n 
5 23  DC  n 
5 24  DT  n 
5 25  DA  n 
5 26  DC  n 
5 27  DC  n 
5 28  DA  n 
5 29  DA  n 
5 30  DA  n 
5 31  DA  n 
5 32  DG  n 
5 33  DT  n 
5 34  DG  n 
5 35  DT  n 
5 36  DA  n 
5 37  DT  n 
5 38  DT  n 
5 39  DT  n 
5 40  DG  n 
5 41  DG  n 
5 42  DA  n 
5 43  DA  n 
5 44  DA  n 
5 45  DC  n 
5 46  DT  n 
5 47  DG  n 
5 48  DC  n 
5 49  DT  n 
5 50  DC  n 
5 51  DC  n 
5 52  DA  n 
5 53  DT  n 
5 54  DC  n 
5 55  DA  n 
5 56  DA  n 
5 57  DA  n 
5 58  DA  n 
5 59  DG  n 
5 60  DG  n 
5 61  DC  n 
5 62  DA  n 
5 63  DT  n 
5 64  DG  n 
5 65  DT  n 
5 66  DT  n 
5 67  DC  n 
5 68  DA  n 
5 69  DG  n 
5 70  DC  n 
5 71  DT  n 
5 72  DC  n 
5 73  DT  n 
5 74  DG  n 
5 75  DT  n 
5 76  DG  n 
5 77  DA  n 
5 78  DG  n 
5 79  DT  n 
5 80  DG  n 
5 81  DA  n 
5 82  DA  n 
5 83  DA  n 
5 84  DC  n 
5 85  DT  n 
5 86  DC  n 
5 87  DC  n 
5 88  DA  n 
5 89  DT  n 
5 90  DC  n 
5 91  DA  n 
5 92  DT  n 
5 93  DC  n 
5 94  DA  n 
5 95  DC  n 
5 96  DA  n 
5 97  DA  n 
5 98  DA  n 
5 99  DG  n 
5 100 DA  n 
5 101 DA  n 
5 102 DT  n 
5 103 DA  n 
5 104 DT  n 
5 105 DT  n 
5 106 DC  n 
5 107 DT  n 
5 108 DG  n 
5 109 DA  n 
5 110 DG  n 
5 111 DA  n 
5 112 DA  n 
5 113 DT  n 
5 114 DG  n 
5 115 DC  n 
5 116 DT  n 
5 117 DT  n 
5 118 DC  n 
5 119 DC  n 
5 120 DG  n 
5 121 DT  n 
5 122 DT  n 
5 123 DT  n 
5 124 DG  n 
5 125 DC  n 
5 126 DC  n 
5 127 DT  n 
5 128 DT  n 
5 129 DT  n 
5 130 DT  n 
5 131 DA  n 
5 132 DT  n 
5 133 DA  n 
5 134 DT  n 
5 135 DG  n 
5 136 DA  n 
5 137 DA  n 
5 138 DC  n 
5 139 DT  n 
5 140 DT  n 
5 141 DC  n 
5 142 DC  n 
5 143 DT  n 
5 144 DC  n 
5 145 DG  n 
5 146 DA  n 
5 147 DT  n 
6 1   DA  n 
6 2   DT  n 
6 3   DC  n 
6 4   DG  n 
6 5   DA  n 
6 6   DG  n 
6 7   DG  n 
6 8   DA  n 
6 9   DA  n 
6 10  DG  n 
6 11  DT  n 
6 12  DT  n 
6 13  DC  n 
6 14  DA  n 
6 15  DT  n 
6 16  DA  n 
6 17  DT  n 
6 18  DA  n 
6 19  DA  n 
6 20  DA  n 
6 21  DA  n 
6 22  DG  n 
6 23  DG  n 
6 24  DC  n 
6 25  DA  n 
6 26  DA  n 
6 27  DA  n 
6 28  DC  n 
6 29  DG  n 
6 30  DG  n 
6 31  DA  n 
6 32  DA  n 
6 33  DG  n 
6 34  DC  n 
6 35  DA  n 
6 36  DT  n 
6 37  DT  n 
6 38  DC  n 
6 39  DT  n 
6 40  DC  n 
6 41  DA  n 
6 42  DG  n 
6 43  DA  n 
6 44  DA  n 
6 45  DT  n 
6 46  DA  n 
6 47  DT  n 
6 48  DT  n 
6 49  DC  n 
6 50  DT  n 
6 51  DT  n 
6 52  DT  n 
6 53  DG  n 
6 54  DT  n 
6 55  DG  n 
6 56  DA  n 
6 57  DT  n 
6 58  DG  n 
6 59  DA  n 
6 60  DT  n 
6 61  DG  n 
6 62  DG  n 
6 63  DA  n 
6 64  DG  n 
6 65  DT  n 
6 66  DT  n 
6 67  DT  n 
6 68  DC  n 
6 69  DA  n 
6 70  DC  n 
6 71  DT  n 
6 72  DC  n 
6 73  DA  n 
6 74  DC  n 
6 75  DA  n 
6 76  DG  n 
6 77  DA  n 
6 78  DG  n 
6 79  DC  n 
6 80  DT  n 
6 81  DG  n 
6 82  DA  n 
6 83  DA  n 
6 84  DC  n 
6 85  DA  n 
6 86  DT  n 
6 87  DG  n 
6 88  DC  n 
6 89  DC  n 
6 90  DT  n 
6 91  DT  n 
6 92  DT  n 
6 93  DT  n 
6 94  DG  n 
6 95  DA  n 
6 96  DT  n 
6 97  DG  n 
6 98  DG  n 
6 99  DA  n 
6 100 DG  n 
6 101 DC  n 
6 102 DA  n 
6 103 DG  n 
6 104 DT  n 
6 105 DT  n 
6 106 DT  n 
6 107 DC  n 
6 108 DC  n 
6 109 DA  n 
6 110 DA  n 
6 111 DA  n 
6 112 DT  n 
6 113 DA  n 
6 114 DC  n 
6 115 DA  n 
6 116 DC  n 
6 117 DT  n 
6 118 DT  n 
6 119 DT  n 
6 120 DT  n 
6 121 DG  n 
6 122 DG  n 
6 123 DT  n 
6 124 DA  n 
6 125 DG  n 
6 126 DA  n 
6 127 DA  n 
6 128 DT  n 
6 129 DC  n 
6 130 DT  n 
6 131 DG  n 
6 132 DC  n 
6 133 DA  n 
6 134 DG  n 
6 135 DG  n 
6 136 DT  n 
6 137 DG  n 
6 138 DG  n 
6 139 DA  n 
6 140 DT  n 
6 141 DA  n 
6 142 DT  n 
6 143 DT  n 
6 144 DT  n 
6 145 DG  n 
6 146 DA  n 
6 147 DT  n 
7 1   THR n 
7 2   LYS n 
7 3   SER n 
7 4   ARG n 
7 5   ARG n 
7 6   ILE n 
7 7   SER n 
7 8   ARG n 
7 9   ARG n 
7 10  PRO n 
7 11  SER n 
7 12  ASP n 
7 13  TRP n 
7 14  TRP n 
7 15  VAL n 
7 16  VAL n 
7 17  LYS n 
7 18  SER n 
7 19  GLU n 
7 20  GLU n 
8 1   MET n 
8 2   ASP n 
8 3   GLU n 
8 4   THR n 
8 5   VAL n 
8 6   ALA n 
8 7   GLU n 
8 8   PHE n 
8 9   ILE n 
8 10  LYS n 
8 11  ARG n 
8 12  THR n 
8 13  ILE n 
8 14  LEU n 
8 15  LYS n 
8 16  ILE n 
8 17  PRO n 
8 18  MET n 
8 19  ASN n 
8 20  GLU n 
8 21  LEU n 
8 22  THR n 
8 23  THR n 
8 24  ILE n 
8 25  LEU n 
8 26  LYS n 
8 27  ALA n 
8 28  TRP n 
8 29  ASP n 
8 30  PHE n 
8 31  LEU n 
8 32  SER n 
8 33  GLU n 
8 34  ASN n 
8 35  GLN n 
8 36  LEU n 
8 37  GLN n 
8 38  THR n 
8 39  VAL n 
8 40  ASN n 
8 41  PHE n 
8 42  ARG n 
8 43  GLN n 
8 44  ARG n 
8 45  LYS n 
8 46  GLU n 
8 47  SER n 
8 48  VAL n 
8 49  VAL n 
8 50  GLN n 
8 51  HIS n 
8 52  LEU n 
8 53  ILE n 
8 54  HIS n 
8 55  LEU n 
8 56  CYS n 
8 57  GLU n 
8 58  GLU n 
8 59  LYS n 
8 60  ARG n 
8 61  ALA n 
8 62  SER n 
8 63  ILE n 
8 64  SER n 
8 65  ASP n 
8 66  ALA n 
8 67  ALA n 
8 68  LEU n 
8 69  LEU n 
8 70  ASP n 
8 71  ILE n 
8 72  ILE n 
8 73  TYR n 
8 74  MET n 
8 75  GLN n 
8 76  PHE n 
8 77  HIS n 
8 78  GLN n 
8 79  HIS n 
8 80  GLN n 
8 81  LYS n 
8 82  VAL n 
8 83  TRP n 
8 84  ASP n 
8 85  VAL n 
8 86  PHE n 
8 87  GLN n 
8 88  MET n 
8 89  SER n 
8 90  LYS n 
8 91  GLY n 
8 92  PRO n 
8 93  GLY n 
8 94  GLU n 
8 95  ASP n 
8 96  VAL n 
8 97  ASP n 
8 98  LEU n 
8 99  PHE n 
8 100 ASP n 
8 101 MET n 
8 102 LYS n 
8 103 GLN n 
8 104 PHE n 
8 105 LYS n 
8 106 ASN n 
8 107 SER n 
8 108 PHE n 
8 109 LYS n 
8 110 LYS n 
8 111 ILE n 
8 112 LEU n 
8 113 GLN n 
8 114 ARG n 
8 115 ALA n 
8 116 LEU n 
8 117 LYS n 
8 118 ASN n 
8 119 VAL n 
8 120 THR n 
8 121 VAL n 
8 122 SER n 
8 123 PHE n 
8 124 ARG n 
8 125 GLU n 
8 126 THR n 
8 127 GLU n 
8 128 GLU n 
8 129 ASN n 
8 130 ALA n 
8 131 VAL n 
8 132 TRP n 
8 133 ILE n 
8 134 ARG n 
8 135 ILE n 
8 136 ALA n 
8 137 TRP n 
8 138 GLY n 
8 139 THR n 
8 140 GLN n 
8 141 TYR n 
8 142 THR n 
8 143 LYS n 
8 144 PRO n 
8 145 ASN n 
8 146 GLN n 
8 147 TYR n 
8 148 LYS n 
8 149 PRO n 
8 150 THR n 
8 151 TYR n 
8 152 VAL n 
8 153 VAL n 
8 154 TYR n 
8 155 TYR n 
8 156 SER n 
8 157 GLN n 
8 158 THR n 
8 159 PRO n 
8 160 TYR n 
8 161 ALA n 
8 162 PHE n 
8 163 THR n 
8 164 SER n 
8 165 SER n 
8 166 SER n 
8 167 MET n 
8 168 LEU n 
8 169 ARG n 
8 170 ARG n 
8 171 ASN n 
8 172 THR n 
8 173 PRO n 
8 174 LEU n 
8 175 LEU n 
8 176 GLY n 
8 177 GLN n 
8 178 ALA n 
8 179 LEU n 
8 180 THR n 
8 181 ILE n 
8 182 ALA n 
8 183 SER n 
8 184 LYS n 
8 185 HIS n 
8 186 HIS n 
8 187 GLN n 
8 188 ILE n 
8 189 VAL n 
8 190 LYS n 
8 191 MET n 
8 192 ASP n 
8 193 LEU n 
8 194 ARG n 
8 195 SER n 
8 196 ARG n 
8 197 TYR n 
8 198 LEU n 
8 199 ASP n 
8 200 SER n 
8 201 LEU n 
8 202 LYS n 
8 203 ALA n 
8 204 ILE n 
8 205 VAL n 
8 206 PHE n 
8 207 LYS n 
8 208 GLN n 
8 209 TYR n 
8 210 ASN n 
8 211 GLN n 
8 212 THR n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 102 Human ? CENPA ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 94  Human ? 
;HIST1H4A, H4/A, H4FA, HIST1H4B, H4/I, H4FI, HIST1H4C, H4/G, H4FG, HIST1H4D, H4/B, H4FB, HIST1H4E, H4/J, H4FJ, HIST1H4F, H4/C, H4FC, HIST1H4H, H4/H, H4FH, HIST1H4I, H4/M, H4FM, HIST1H4J, H4/E, H4FE, HIST1H4K, H4/D, H4FD, HIST1H4L, H4/K, H4FK, HIST2H4A, H4/N, H4F2, H4FN, HIST2H4, HIST2H4B, H4/O, H4FO, HIST4H4
;
? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 105 Human ? 'HIST1H2AC, H2AFL' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 92  Human ? HIST2H2BF ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8 1 sample 'Biological sequence' 1 212 Human ? 'CENPN, C16orf60, ICEN32, BM-309' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 
;Escherichia coli 'BL21-Gold(DE3)pLysS AG'
;
866768 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
5 1 sample 1 147 'Homo sapiens' Human 9606 ? 
6 1 sample 1 147 'Homo sapiens' Human 9606 ? 
7 1 sample 1 20  'Homo sapiens' Human 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP CENPA_HUMAN P49450 ?        1 
;HQHSRRRQGWLKEIRKLQKSTHLLIRKLPFSRLAREICVKFTRGVDFNWQAQALLALQEAAEAFLVHLFEDAYLLTLHAG
RVTLFPKDVQLARRIRGLEEGL
;
38  
2 UNP H4_HUMAN    P62805 ?        2 
;KGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVV
YALKRQGRTLYGFG
;
9   
3 UNP H2A1C_HUMAN Q93077 ?        3 
;KAKSRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRIIPRHLQLAIRNDEE
LNKLLGRVTIAQGGVLPNIQAVLLP
;
14  
4 UNP H2B2F_HUMAN Q5QNW6 Q5QNW6-2 4 
;RKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVS
EGTKAVTKYTSS
;
34  
5 PDB 6MUO        6MUO   ?        5 ? 1   
6 PDB 6MUO        6MUO   ?        6 ? 1   
7 UNP CENPC_HUMAN Q03188 ?        7 TKSRRISRRPSDWWVVKSEE 518 
8 UNP CENPN_HUMAN Q96H22 Q96H22-3 8 
;MDETVAEFIKRTILKIPMNELTTILKAWDFLSENQLQTVNFRQRKESVVQHLIHLCEEKRASISDAALLDIIYMQFHQHQ
KVWEVFQMSKGPGEDVDLFDMKQFKNSFKKILQRALKNVTVSFRETEENAVWIRIAWGTQYTKPNQYKPTYVVYYSQTPY
AFTSSSMLRRNTPLLGQALTIASKHHQIVKMDLRSRYLDSLKAIVFKQYNQT
;
1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6MUO A 1 ? 102 ? P49450 38  ? 139 ? 38  139 
2  2 6MUO B 1 ? 94  ? P62805 9   ? 102 ? 8   101 
3  3 6MUO C 1 ? 105 ? Q93077 14  ? 118 ? 13  117 
4  4 6MUO D 1 ? 92  ? Q5QNW6 34  ? 125 ? 33  124 
5  1 6MUO E 1 ? 102 ? P49450 38  ? 139 ? 38  139 
6  2 6MUO F 1 ? 94  ? P62805 9   ? 102 ? 8   101 
7  3 6MUO G 1 ? 105 ? Q93077 14  ? 118 ? 13  117 
8  4 6MUO H 1 ? 92  ? Q5QNW6 34  ? 125 ? 33  124 
9  5 6MUO I 1 ? 147 ? 6MUO   -73 ? 73  ? -73 73  
10 6 6MUO J 1 ? 147 ? 6MUO   -73 ? 73  ? -73 73  
11 7 6MUO K 1 ? 20  ? Q03188 518 ? 537 ? 518 537 
12 7 6MUO L 1 ? 20  ? Q03188 518 ? 537 ? 518 537 
13 8 6MUO M 1 ? 212 ? Q96H22 1   ? 212 ? 1   212 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
3  6MUO SER C 101 ? UNP Q93077 ALA 114 conflict 113 1 
7  6MUO SER G 101 ? UNP Q93077 ALA 114 conflict 113 2 
13 6MUO ASP M 84  ? UNP Q96H22 GLU 84  conflict 84  3 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6MUO 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6MUO 
_struct.title                        'CENP-A nucleosome bound by two copies of CENP-C(CD) and one copy CENP-N(NT)' 
_struct.pdbx_descriptor              
;Histone H3-like centromeric protein A, Histone H4, Histone H2A type 1-C, Histone H2B type 2-F, Centromere protein C, Centromere protein N/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6MUO 
_struct_keywords.text            'centromere, CENP-A, kinetochore, nucleosome, NUCLEAR PROTEIN' 
_struct_keywords.pdbx_keywords   'NUCLEAR PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
J N N 6 ? 
K N N 7 ? 
L N N 7 ? 
M N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 TRP A 10  ? GLN A 18  ? TRP A 47  GLN A 55  1 ? 9  
HELX_P HELX_P2  AA2 ARG A 26  ? PHE A 41  ? ARG A 63  PHE A 78  1 ? 16 
HELX_P HELX_P3  AA3 GLN A 50  ? LEU A 77  ? GLN A 87  LEU A 114 1 ? 28 
HELX_P HELX_P4  AA4 PRO A 86  ? ILE A 95  ? PRO A 123 ILE A 132 1 ? 10 
HELX_P HELX_P5  AA5 THR B 23  ? GLY B 35  ? THR B 30  GLY B 42  1 ? 13 
HELX_P HELX_P6  AA6 LEU B 42  ? GLU B 56  ? LEU B 49  GLU B 63  1 ? 15 
HELX_P HELX_P7  AA7 VAL B 58  ? ALA B 69  ? VAL B 65  ALA B 76  1 ? 12 
HELX_P HELX_P8  AA8 THR B 75  ? GLY B 87  ? THR B 82  GLY B 94  1 ? 13 
HELX_P HELX_P9  AA9 ARG C 5   ? GLY C 10  ? ARG C 17  GLY C 22  1 ? 6  
HELX_P HELX_P10 AB1 PRO C 14  ? GLY C 25  ? PRO C 26  GLY C 37  1 ? 12 
HELX_P HELX_P11 AB2 GLY C 34  ? ALA C 48  ? GLY C 46  ALA C 60  1 ? 15 
HELX_P HELX_P12 AB3 GLU C 49  ? ASN C 61  ? GLU C 61  ASN C 73  1 ? 13 
HELX_P HELX_P13 AB4 PRO C 68  ? ARG C 76  ? PRO C 80  ARG C 88  1 ? 9  
HELX_P HELX_P14 AB5 ASP C 78  ? LEU C 85  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P15 AB6 TYR D 5   ? HIS D 17  ? TYR D 37  HIS D 49  1 ? 13 
HELX_P HELX_P16 AB7 LYS D 25  ? PHE D 33  ? LYS D 57  PHE D 65  1 ? 9  
HELX_P HELX_P17 AB8 PHE D 33  ? ASN D 52  ? PHE D 65  ASN D 84  1 ? 20 
HELX_P HELX_P18 AB9 ILE D 62  ? ARG D 67  ? ILE D 94  ARG D 99  1 ? 6  
HELX_P HELX_P19 AC1 PRO D 71  ? SER D 91  ? PRO D 103 SER D 123 1 ? 21 
HELX_P HELX_P20 AC2 GLY E 9   ? GLN E 18  ? GLY E 46  GLN E 55  1 ? 10 
HELX_P HELX_P21 AC3 ARG E 26  ? PHE E 41  ? ARG E 63  PHE E 78  1 ? 16 
HELX_P HELX_P22 AC4 ALA E 53  ? GLN E 58  ? ALA E 90  GLN E 95  1 ? 6  
HELX_P HELX_P23 AC5 ALA E 60  ? LEU E 74  ? ALA E 97  LEU E 111 1 ? 15 
HELX_P HELX_P24 AC6 LEU E 75  ? GLY E 80  ? LEU E 112 GLY E 117 5 ? 6  
HELX_P HELX_P25 AC7 PHE E 85  ? GLN E 90  ? PHE E 122 GLN E 127 1 ? 6  
HELX_P HELX_P26 AC8 THR F 23  ? GLY F 35  ? THR F 30  GLY F 42  1 ? 13 
HELX_P HELX_P27 AC9 LEU F 42  ? GLU F 56  ? LEU F 49  GLU F 63  1 ? 15 
HELX_P HELX_P28 AD1 VAL F 58  ? ALA F 69  ? VAL F 65  ALA F 76  1 ? 12 
HELX_P HELX_P29 AD2 ALA F 76  ? GLY F 87  ? ALA F 83  GLY F 94  1 ? 12 
HELX_P HELX_P30 AD3 SER G 4   ? GLY G 10  ? SER G 16  GLY G 22  1 ? 7  
HELX_P HELX_P31 AD4 VAL G 15  ? GLY G 25  ? VAL G 27  GLY G 37  1 ? 11 
HELX_P HELX_P32 AD5 GLY G 34  ? ASP G 60  ? GLY G 46  ASP G 72  1 ? 27 
HELX_P HELX_P33 AD6 ILE G 67  ? ARG G 76  ? ILE G 79  ARG G 88  1 ? 10 
HELX_P HELX_P34 AD7 GLU G 79  ? LEU G 85  ? GLU G 91  LEU G 97  1 ? 7  
HELX_P HELX_P35 AD8 TYR H 5   ? HIS H 17  ? TYR H 37  HIS H 49  1 ? 13 
HELX_P HELX_P36 AD9 SER H 23  ? ASN H 52  ? SER H 55  ASN H 84  1 ? 30 
HELX_P HELX_P37 AE1 ILE H 62  ? ARG H 67  ? ILE H 94  ARG H 99  1 ? 6  
HELX_P HELX_P38 AE2 PRO H 71  ? THR H 83  ? PRO H 103 THR H 115 1 ? 13 
HELX_P HELX_P39 AE3 THR H 83  ? SER H 91  ? THR H 115 SER H 123 1 ? 9  
HELX_P HELX_P40 AE4 GLU M 3   ? LEU M 14  ? GLU M 3   LEU M 14  1 ? 12 
HELX_P HELX_P41 AE5 GLU M 20  ? ASP M 29  ? GLU M 20  ASP M 29  1 ? 10 
HELX_P HELX_P42 AE6 SER M 32  ? VAL M 39  ? SER M 32  VAL M 39  1 ? 8  
HELX_P HELX_P43 AE7 ARG M 44  ? GLU M 58  ? ARG M 44  GLU M 58  1 ? 15 
HELX_P HELX_P44 AE8 SER M 62  ? PHE M 76  ? SER M 62  PHE M 76  1 ? 15 
HELX_P HELX_P45 AE9 MET M 101 ? SER M 107 ? MET M 101 SER M 107 1 ? 7  
HELX_P HELX_P46 AF1 ASN M 171 ? ILE M 181 ? ASN M 171 ILE M 181 1 ? 11 
HELX_P HELX_P47 AF2 VAL M 205 ? ASN M 210 ? VAL M 205 ASN M 210 1 ? 6  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1   hydrog ? ? I DT 2   N3 ? ? ? 1_555 J DA 146 N1 ? ? I DT -72 J DA 72  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog2   hydrog ? ? I DT 2   O4 ? ? ? 1_555 J DA 146 N6 ? ? I DT -72 J DA 72  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog3   hydrog ? ? I DC 3   N3 ? ? ? 1_555 J DG 145 N1 ? ? I DC -71 J DG 71  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog4   hydrog ? ? I DC 3   N4 ? ? ? 1_555 J DG 145 O6 ? ? I DC -71 J DG 71  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog5   hydrog ? ? I DC 3   O2 ? ? ? 1_555 J DG 145 N2 ? ? I DC -71 J DG 71  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog6   hydrog ? ? I DA 4   N1 ? ? ? 1_555 J DT 144 N3 ? ? I DA -70 J DT 70  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog7   hydrog ? ? I DA 6   N1 ? ? ? 1_555 J DT 142 N3 ? ? I DA -68 J DT 68  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog8   hydrog ? ? I DA 6   N1 ? ? ? 1_555 J DT 143 N3 ? ? I DA -68 J DT 69  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog9   hydrog ? ? I DT 7   N3 ? ? ? 1_555 J DA 141 N1 ? ? I DT -67 J DA 67  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog10  hydrog ? ? I DT 7   O4 ? ? ? 1_555 J DA 141 N6 ? ? I DT -67 J DA 67  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog11  hydrog ? ? I DA 8   N1 ? ? ? 1_555 J DT 140 N3 ? ? I DA -66 J DT 66  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog12  hydrog ? ? I DA 8   N6 ? ? ? 1_555 J DT 140 O4 ? ? I DA -66 J DT 66  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog13  hydrog ? ? I DT 9   O4 ? ? ? 1_555 J DG 138 N1 ? ? I DT -65 J DG 64  1_555 ? ? ? ? ? ? 'DT-DG MISPAIR' ? ? 
hydrog14  hydrog ? ? I DC 10  N4 ? ? ? 1_555 J DG 137 O6 ? ? I DC -64 J DG 63  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog15  hydrog ? ? I DC 10  O2 ? ? ? 1_555 J DG 138 N2 ? ? I DC -64 J DG 64  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog16  hydrog ? ? I DC 11  O2 ? ? ? 1_555 J DG 137 N2 ? ? I DC -63 J DG 63  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog17  hydrog ? ? I DA 12  N1 ? ? ? 1_555 J DG 135 N1 ? ? I DA -62 J DG 61  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ? ? 
hydrog18  hydrog ? ? I DA 12  N6 ? ? ? 1_555 J DG 135 O6 ? ? I DA -62 J DG 61  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ? ? 
hydrog19  hydrog ? ? I DA 12  N1 ? ? ? 1_555 J DT 136 N3 ? ? I DA -62 J DT 62  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog20  hydrog ? ? I DA 12  N6 ? ? ? 1_555 J DT 136 O4 ? ? I DA -62 J DT 62  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog21  hydrog ? ? I DC 13  N3 ? ? ? 1_555 J DG 135 N1 ? ? I DC -61 J DG 61  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog22  hydrog ? ? I DC 13  N4 ? ? ? 1_555 J DG 135 O6 ? ? I DC -61 J DG 61  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog23  hydrog ? ? I DC 13  O2 ? ? ? 1_555 J DG 135 N2 ? ? I DC -61 J DG 61  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog24  hydrog ? ? I DC 14  N3 ? ? ? 1_555 J DA 133 N6 ? ? I DC -60 J DA 59  1_555 ? ? ? ? ? ? 'DC-DA MISPAIR' ? ? 
hydrog25  hydrog ? ? I DC 14  O2 ? ? ? 1_555 J DG 134 N2 ? ? I DC -60 J DG 60  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog26  hydrog ? ? I DT 15  N3 ? ? ? 1_555 J DA 133 N1 ? ? I DT -59 J DA 59  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog27  hydrog ? ? I DT 15  O4 ? ? ? 1_555 J DA 133 N6 ? ? I DT -59 J DA 59  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog28  hydrog ? ? I DG 16  N2 ? ? ? 1_555 J DC 132 N3 ? ? I DG -58 J DC 58  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog29  hydrog ? ? I DC 17  N3 ? ? ? 1_555 J DG 131 N1 ? ? I DC -57 J DG 57  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog30  hydrog ? ? I DC 17  N4 ? ? ? 1_555 J DG 131 O6 ? ? I DC -57 J DG 57  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog31  hydrog ? ? I DC 17  O2 ? ? ? 1_555 J DG 131 N2 ? ? I DC -57 J DG 57  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog32  hydrog ? ? I DA 18  N1 ? ? ? 1_555 J DT 130 N3 ? ? I DA -56 J DT 56  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog33  hydrog ? ? I DA 18  N6 ? ? ? 1_555 J DT 130 O4 ? ? I DA -56 J DT 56  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog34  hydrog ? ? I DG 19  N1 ? ? ? 1_555 J DC 129 N3 ? ? I DG -55 J DC 55  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog35  hydrog ? ? I DG 19  N2 ? ? ? 1_555 J DC 129 O2 ? ? I DG -55 J DC 55  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog36  hydrog ? ? I DG 19  O6 ? ? ? 1_555 J DC 129 N4 ? ? I DG -55 J DC 55  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog37  hydrog ? ? I DA 20  N1 ? ? ? 1_555 J DT 128 N3 ? ? I DA -54 J DT 54  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog38  hydrog ? ? I DA 20  N6 ? ? ? 1_555 J DT 128 O4 ? ? I DA -54 J DT 54  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog39  hydrog ? ? I DT 21  N3 ? ? ? 1_555 J DA 127 N1 ? ? I DT -53 J DA 53  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog40  hydrog ? ? I DT 21  O4 ? ? ? 1_555 J DA 127 N6 ? ? I DT -53 J DA 53  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog41  hydrog ? ? I DT 22  N3 ? ? ? 1_555 J DA 126 N1 ? ? I DT -52 J DA 52  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog42  hydrog ? ? I DT 22  O4 ? ? ? 1_555 J DA 126 N6 ? ? I DT -52 J DA 52  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog43  hydrog ? ? I DC 23  N3 ? ? ? 1_555 J DG 125 N1 ? ? I DC -51 J DG 51  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog44  hydrog ? ? I DC 23  N4 ? ? ? 1_555 J DG 125 O6 ? ? I DC -51 J DG 51  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog45  hydrog ? ? I DC 23  O2 ? ? ? 1_555 J DG 125 N2 ? ? I DC -51 J DG 51  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog46  hydrog ? ? I DT 24  N3 ? ? ? 1_555 J DA 124 N1 ? ? I DT -50 J DA 50  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog47  hydrog ? ? I DT 24  O4 ? ? ? 1_555 J DA 124 N6 ? ? I DT -50 J DA 50  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog48  hydrog ? ? I DA 25  N1 ? ? ? 1_555 J DT 123 N3 ? ? I DA -49 J DT 49  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog49  hydrog ? ? I DA 25  N6 ? ? ? 1_555 J DT 123 O4 ? ? I DA -49 J DT 49  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog50  hydrog ? ? I DC 26  N3 ? ? ? 1_555 J DG 122 N1 ? ? I DC -48 J DG 48  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog51  hydrog ? ? I DC 26  N4 ? ? ? 1_555 J DG 122 O6 ? ? I DC -48 J DG 48  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog52  hydrog ? ? I DC 26  O2 ? ? ? 1_555 J DG 122 N2 ? ? I DC -48 J DG 48  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog53  hydrog ? ? I DC 27  N4 ? ? ? 1_555 J DG 121 O6 ? ? I DC -47 J DG 47  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog54  hydrog ? ? I DA 28  N1 ? ? ? 1_555 J DT 120 N3 ? ? I DA -46 J DT 46  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog55  hydrog ? ? I DA 28  N6 ? ? ? 1_555 J DT 120 O4 ? ? I DA -46 J DT 46  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog56  hydrog ? ? I DA 29  N1 ? ? ? 1_555 J DT 119 N3 ? ? I DA -45 J DT 45  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog57  hydrog ? ? I DA 29  N6 ? ? ? 1_555 J DT 119 O4 ? ? I DA -45 J DT 45  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog58  hydrog ? ? I DA 30  N1 ? ? ? 1_555 J DT 118 N3 ? ? I DA -44 J DT 44  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog59  hydrog ? ? I DA 30  N6 ? ? ? 1_555 J DT 118 O4 ? ? I DA -44 J DT 44  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog60  hydrog ? ? I DA 31  N1 ? ? ? 1_555 J DT 117 N3 ? ? I DA -43 J DT 43  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog61  hydrog ? ? I DA 31  N6 ? ? ? 1_555 J DT 117 O4 ? ? I DA -43 J DT 43  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog62  hydrog ? ? I DG 32  N1 ? ? ? 1_555 J DC 116 N3 ? ? I DG -42 J DC 42  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog63  hydrog ? ? I DG 32  N2 ? ? ? 1_555 J DC 116 O2 ? ? I DG -42 J DC 42  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog64  hydrog ? ? I DG 32  O6 ? ? ? 1_555 J DC 116 N4 ? ? I DG -42 J DC 42  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog65  hydrog ? ? I DT 33  N3 ? ? ? 1_555 J DA 115 N1 ? ? I DT -41 J DA 41  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog66  hydrog ? ? I DT 33  O4 ? ? ? 1_555 J DA 115 N6 ? ? I DT -41 J DA 41  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog67  hydrog ? ? I DG 34  N1 ? ? ? 1_555 J DC 114 N3 ? ? I DG -40 J DC 40  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog68  hydrog ? ? I DG 34  N2 ? ? ? 1_555 J DC 114 O2 ? ? I DG -40 J DC 40  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog69  hydrog ? ? I DG 34  O6 ? ? ? 1_555 J DC 114 N4 ? ? I DG -40 J DC 40  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog70  hydrog ? ? I DT 35  N3 ? ? ? 1_555 J DA 113 N1 ? ? I DT -39 J DA 39  1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog71  hydrog ? ? I DA 36  N1 ? ? ? 1_555 J DA 111 N6 ? ? I DA -38 J DA 37  1_555 ? ? ? ? ? ? 'DA-DA MISPAIR' ? ? 
hydrog72  hydrog ? ? I DT 37  N3 ? ? ? 1_555 J DA 111 N1 ? ? I DT -37 J DA 37  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog73  hydrog ? ? I DT 37  O4 ? ? ? 1_555 J DA 111 N6 ? ? I DT -37 J DA 37  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog74  hydrog ? ? I DT 38  N3 ? ? ? 1_555 J DA 110 N1 ? ? I DT -36 J DA 36  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog75  hydrog ? ? I DT 38  O4 ? ? ? 1_555 J DA 110 N6 ? ? I DT -36 J DA 36  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog76  hydrog ? ? I DT 39  N3 ? ? ? 1_555 J DA 109 N1 ? ? I DT -35 J DA 35  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog77  hydrog ? ? I DT 39  O4 ? ? ? 1_555 J DA 109 N6 ? ? I DT -35 J DA 35  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog78  hydrog ? ? I DG 40  N1 ? ? ? 1_555 J DC 108 N3 ? ? I DG -34 J DC 34  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog79  hydrog ? ? I DG 40  N2 ? ? ? 1_555 J DC 108 O2 ? ? I DG -34 J DC 34  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog80  hydrog ? ? I DG 40  O6 ? ? ? 1_555 J DC 108 N4 ? ? I DG -34 J DC 34  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog81  hydrog ? ? I DG 41  N2 ? ? ? 1_555 J DC 107 O2 ? ? I DG -33 J DC 33  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog82  hydrog ? ? I DA 42  N1 ? ? ? 1_555 J DT 106 N3 ? ? I DA -32 J DT 32  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog83  hydrog ? ? I DA 42  N6 ? ? ? 1_555 J DT 106 O4 ? ? I DA -32 J DT 32  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog84  hydrog ? ? I DA 43  N1 ? ? ? 1_555 J DT 105 N3 ? ? I DA -31 J DT 31  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog85  hydrog ? ? I DA 43  N6 ? ? ? 1_555 J DT 105 O4 ? ? I DA -31 J DT 31  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog86  hydrog ? ? I DA 44  N1 ? ? ? 1_555 J DG 103 N1 ? ? I DA -30 J DG 29  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ? ? 
hydrog87  hydrog ? ? I DA 44  N6 ? ? ? 1_555 J DG 103 O6 ? ? I DA -30 J DG 29  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ? ? 
hydrog88  hydrog ? ? I DA 44  N1 ? ? ? 1_555 J DT 104 N3 ? ? I DA -30 J DT 30  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog89  hydrog ? ? I DA 44  N6 ? ? ? 1_555 J DT 104 O4 ? ? I DA -30 J DT 30  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog90  hydrog ? ? I DC 45  O2 ? ? ? 1_555 J DG 103 N2 ? ? I DC -29 J DG 29  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog91  hydrog ? ? I DT 46  N3 ? ? ? 1_555 J DA 102 N1 ? ? I DT -28 J DA 28  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog92  hydrog ? ? I DT 46  O4 ? ? ? 1_555 J DA 102 N6 ? ? I DT -28 J DA 28  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog93  hydrog ? ? I DG 47  N2 ? ? ? 1_555 J DC 101 N3 ? ? I DG -27 J DC 27  1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog94  hydrog ? ? I DC 48  N3 ? ? ? 1_555 J DG 100 N2 ? ? I DC -26 J DG 26  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog95  hydrog ? ? I DT 49  N3 ? ? ? 1_555 J DA 99  N1 ? ? I DT -25 J DA 25  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog96  hydrog ? ? I DT 49  O4 ? ? ? 1_555 J DA 99  N6 ? ? I DT -25 J DA 25  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog97  hydrog ? ? I DC 50  N3 ? ? ? 1_555 J DG 98  N1 ? ? I DC -24 J DG 24  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog98  hydrog ? ? I DC 50  N4 ? ? ? 1_555 J DG 98  O6 ? ? I DC -24 J DG 24  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog99  hydrog ? ? I DC 50  O2 ? ? ? 1_555 J DG 98  N2 ? ? I DC -24 J DG 24  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog100 hydrog ? ? I DC 51  N4 ? ? ? 1_555 J DT 96  O4 ? ? I DC -23 J DT 22  1_555 ? ? ? ? ? ? 'DC-DT MISPAIR' ? ? 
hydrog101 hydrog ? ? I DC 51  N3 ? ? ? 1_555 J DG 97  N2 ? ? I DC -23 J DG 23  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog102 hydrog ? ? I DA 52  N1 ? ? ? 1_555 J DT 96  N3 ? ? I DA -22 J DT 22  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog103 hydrog ? ? I DT 53  N3 ? ? ? 1_555 J DA 95  N1 ? ? I DT -21 J DA 21  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog104 hydrog ? ? I DT 53  O4 ? ? ? 1_555 J DA 95  N6 ? ? I DT -21 J DA 21  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog105 hydrog ? ? I DC 54  O2 ? ? ? 1_555 J DG 94  N2 ? ? I DC -20 J DG 20  1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog106 hydrog ? ? I DA 55  N1 ? ? ? 1_555 J DT 93  N3 ? ? I DA -19 J DT 19  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog107 hydrog ? ? I DA 55  N6 ? ? ? 1_555 J DT 93  O4 ? ? I DA -19 J DT 19  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog108 hydrog ? ? I DA 56  N1 ? ? ? 1_555 J DT 92  N3 ? ? I DA -18 J DT 18  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog109 hydrog ? ? I DA 57  N1 ? ? ? 1_555 J DT 91  N3 ? ? I DA -17 J DT 17  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog110 hydrog ? ? I DA 58  N1 ? ? ? 1_555 J DT 90  N3 ? ? I DA -16 J DT 16  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog111 hydrog ? ? I DA 58  N6 ? ? ? 1_555 J DT 90  O4 ? ? I DA -16 J DT 16  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog112 hydrog ? ? I DG 60  N1 ? ? ? 1_555 J DC 88  N3 ? ? I DG -14 J DC 14  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog113 hydrog ? ? I DG 60  N2 ? ? ? 1_555 J DC 88  O2 ? ? I DG -14 J DC 14  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog114 hydrog ? ? I DG 60  O6 ? ? ? 1_555 J DC 88  N4 ? ? I DG -14 J DC 14  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog115 hydrog ? ? I DC 61  N3 ? ? ? 1_555 J DG 87  N1 ? ? I DC -13 J DG 13  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog116 hydrog ? ? I DC 61  N4 ? ? ? 1_555 J DG 87  O6 ? ? I DC -13 J DG 13  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog117 hydrog ? ? I DC 61  O2 ? ? ? 1_555 J DG 87  N2 ? ? I DC -13 J DG 13  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog118 hydrog ? ? I DA 62  N1 ? ? ? 1_555 J DT 86  N3 ? ? I DA -12 J DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog119 hydrog ? ? I DA 62  N6 ? ? ? 1_555 J DT 86  O4 ? ? I DA -12 J DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog120 hydrog ? ? I DG 64  N1 ? ? ? 1_555 J DC 84  N3 ? ? I DG -10 J DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog121 hydrog ? ? I DG 64  N2 ? ? ? 1_555 J DC 84  O2 ? ? I DG -10 J DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog122 hydrog ? ? I DG 64  O6 ? ? ? 1_555 J DC 84  N4 ? ? I DG -10 J DC 10  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog123 hydrog ? ? I DT 65  N3 ? ? ? 1_555 J DA 83  N1 ? ? I DT -9  J DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog124 hydrog ? ? I DT 65  O4 ? ? ? 1_555 J DA 83  N6 ? ? I DT -9  J DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog125 hydrog ? ? I DT 66  N3 ? ? ? 1_555 J DA 82  N1 ? ? I DT -8  J DA 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog126 hydrog ? ? I DT 66  O4 ? ? ? 1_555 J DA 82  N6 ? ? I DT -8  J DA 8   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog127 hydrog ? ? I DC 67  N3 ? ? ? 1_555 J DG 81  N1 ? ? I DC -7  J DG 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog128 hydrog ? ? I DC 67  N4 ? ? ? 1_555 J DG 81  O6 ? ? I DC -7  J DG 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog129 hydrog ? ? I DC 67  O2 ? ? ? 1_555 J DG 81  N2 ? ? I DC -7  J DG 7   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog130 hydrog ? ? I DA 68  N1 ? ? ? 1_555 J DT 80  N3 ? ? I DA -6  J DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog131 hydrog ? ? I DA 68  N6 ? ? ? 1_555 J DT 80  O4 ? ? I DA -6  J DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog132 hydrog ? ? I DC 70  N3 ? ? ? 1_555 J DG 78  N1 ? ? I DC -4  J DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog133 hydrog ? ? I DC 70  N4 ? ? ? 1_555 J DG 78  O6 ? ? I DC -4  J DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog134 hydrog ? ? I DC 70  O2 ? ? ? 1_555 J DG 78  N2 ? ? I DC -4  J DG 4   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog135 hydrog ? ? I DT 71  N3 ? ? ? 1_555 J DA 77  N1 ? ? I DT -3  J DA 3   1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog136 hydrog ? ? I DC 72  N3 ? ? ? 1_555 J DG 76  N1 ? ? I DC -2  J DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog137 hydrog ? ? I DC 72  N4 ? ? ? 1_555 J DG 76  O6 ? ? I DC -2  J DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog138 hydrog ? ? I DC 72  O2 ? ? ? 1_555 J DG 76  N2 ? ? I DC -2  J DG 2   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog139 hydrog ? ? I DT 73  N3 ? ? ? 1_555 J DA 75  N1 ? ? I DT -1  J DA 1   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog140 hydrog ? ? I DT 73  O4 ? ? ? 1_555 J DA 75  N6 ? ? I DT -1  J DA 1   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog141 hydrog ? ? I DG 74  N1 ? ? ? 1_555 J DA 73  N1 ? ? I DG 0   J DA -1  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ? ? 
hydrog142 hydrog ? ? I DG 74  O6 ? ? ? 1_555 J DA 73  N6 ? ? I DG 0   J DA -1  1_555 ? ? ? ? ? ? TYPE_8_PAIR     ? ? 
hydrog143 hydrog ? ? I DG 74  N1 ? ? ? 1_555 J DC 74  N3 ? ? I DG 0   J DC 0   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog144 hydrog ? ? I DG 74  N2 ? ? ? 1_555 J DC 74  O2 ? ? I DG 0   J DC 0   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog145 hydrog ? ? I DG 74  O6 ? ? ? 1_555 J DC 74  N4 ? ? I DG 0   J DC 0   1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog146 hydrog ? ? I DT 75  N3 ? ? ? 1_555 J DA 73  N1 ? ? I DT 1   J DA -1  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog147 hydrog ? ? I DT 75  O4 ? ? ? 1_555 J DA 73  N6 ? ? I DT 1   J DA -1  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog148 hydrog ? ? I DG 76  N1 ? ? ? 1_555 J DC 72  N3 ? ? I DG 2   J DC -2  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog149 hydrog ? ? I DG 76  N2 ? ? ? 1_555 J DC 72  O2 ? ? I DG 2   J DC -2  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog150 hydrog ? ? I DG 76  O6 ? ? ? 1_555 J DC 72  N4 ? ? I DG 2   J DC -2  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog151 hydrog ? ? I DA 77  N1 ? ? ? 1_555 J DT 71  N3 ? ? I DA 3   J DT -3  1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog152 hydrog ? ? I DG 78  N1 ? ? ? 1_555 J DC 70  N3 ? ? I DG 4   J DC -4  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog153 hydrog ? ? I DG 78  N2 ? ? ? 1_555 J DC 70  O2 ? ? I DG 4   J DC -4  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog154 hydrog ? ? I DG 78  O6 ? ? ? 1_555 J DC 70  N4 ? ? I DG 4   J DC -4  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog155 hydrog ? ? I DT 79  N3 ? ? ? 1_555 J DA 69  N1 ? ? I DT 5   J DA -5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog156 hydrog ? ? I DT 79  O4 ? ? ? 1_555 J DA 69  N6 ? ? I DT 5   J DA -5  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog157 hydrog ? ? I DA 81  N1 ? ? ? 1_555 J DT 67  N3 ? ? I DA 7   J DT -7  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog158 hydrog ? ? I DA 81  N6 ? ? ? 1_555 J DT 67  O4 ? ? I DA 7   J DT -7  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog159 hydrog ? ? I DA 82  N1 ? ? ? 1_555 J DT 66  N3 ? ? I DA 8   J DT -8  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog160 hydrog ? ? I DA 82  N6 ? ? ? 1_555 J DT 66  O4 ? ? I DA 8   J DT -8  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog161 hydrog ? ? I DA 83  N1 ? ? ? 1_555 J DG 64  N1 ? ? I DA 9   J DG -10 1_555 ? ? ? ? ? ? TYPE_8_PAIR     ? ? 
hydrog162 hydrog ? ? I DA 83  N6 ? ? ? 1_555 J DG 64  O6 ? ? I DA 9   J DG -10 1_555 ? ? ? ? ? ? TYPE_8_PAIR     ? ? 
hydrog163 hydrog ? ? I DA 83  N1 ? ? ? 1_555 J DT 65  N3 ? ? I DA 9   J DT -9  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog164 hydrog ? ? I DA 83  N6 ? ? ? 1_555 J DT 65  O4 ? ? I DA 9   J DT -9  1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog165 hydrog ? ? I DC 84  N3 ? ? ? 1_555 J DG 64  N1 ? ? I DC 10  J DG -10 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog166 hydrog ? ? I DC 84  N4 ? ? ? 1_555 J DG 64  O6 ? ? I DC 10  J DG -10 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog167 hydrog ? ? I DC 84  O2 ? ? ? 1_555 J DG 64  N2 ? ? I DC 10  J DG -10 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog168 hydrog ? ? I DT 85  N3 ? ? ? 1_555 J DA 63  N1 ? ? I DT 11  J DA -11 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog169 hydrog ? ? I DT 85  O4 ? ? ? 1_555 J DA 63  N6 ? ? I DT 11  J DA -11 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog170 hydrog ? ? I DC 86  N3 ? ? ? 1_555 J DG 62  N1 ? ? I DC 12  J DG -12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog171 hydrog ? ? I DC 86  N4 ? ? ? 1_555 J DG 62  O6 ? ? I DC 12  J DG -12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog172 hydrog ? ? I DC 86  O2 ? ? ? 1_555 J DG 62  N2 ? ? I DC 12  J DG -12 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog173 hydrog ? ? I DC 87  N3 ? ? ? 1_555 J DG 61  N1 ? ? I DC 13  J DG -13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog174 hydrog ? ? I DC 87  N4 ? ? ? 1_555 J DG 61  O6 ? ? I DC 13  J DG -13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog175 hydrog ? ? I DC 87  O2 ? ? ? 1_555 J DG 61  N2 ? ? I DC 13  J DG -13 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog176 hydrog ? ? I DA 88  N1 ? ? ? 1_555 J DT 60  N3 ? ? I DA 14  J DT -14 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog177 hydrog ? ? I DA 88  N6 ? ? ? 1_555 J DT 60  O4 ? ? I DA 14  J DT -14 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog178 hydrog ? ? I DC 90  O2 ? ? ? 1_555 J DG 58  N2 ? ? I DC 16  J DG -16 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog179 hydrog ? ? I DA 91  N1 ? ? ? 1_555 J DT 57  N3 ? ? I DA 17  J DT -17 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog180 hydrog ? ? I DA 91  N6 ? ? ? 1_555 J DT 57  O4 ? ? I DA 17  J DT -17 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog181 hydrog ? ? I DT 92  N3 ? ? ? 1_555 J DA 56  N1 ? ? I DT 18  J DA -18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog182 hydrog ? ? I DT 92  O4 ? ? ? 1_555 J DA 56  N6 ? ? I DT 18  J DA -18 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog183 hydrog ? ? I DC 93  N3 ? ? ? 1_555 J DG 55  N1 ? ? I DC 19  J DG -19 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog184 hydrog ? ? I DC 93  N4 ? ? ? 1_555 J DG 55  O6 ? ? I DC 19  J DG -19 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog185 hydrog ? ? I DC 93  O2 ? ? ? 1_555 J DG 55  N2 ? ? I DC 19  J DG -19 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog186 hydrog ? ? I DA 94  N1 ? ? ? 1_555 J DT 54  N3 ? ? I DA 20  J DT -20 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog187 hydrog ? ? I DA 94  N6 ? ? ? 1_555 J DT 54  O4 ? ? I DA 20  J DT -20 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog188 hydrog ? ? I DC 95  N3 ? ? ? 1_555 J DG 53  N1 ? ? I DC 21  J DG -21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog189 hydrog ? ? I DC 95  N4 ? ? ? 1_555 J DG 53  O6 ? ? I DC 21  J DG -21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog190 hydrog ? ? I DC 95  O2 ? ? ? 1_555 J DG 53  N2 ? ? I DC 21  J DG -21 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog191 hydrog ? ? I DA 96  N1 ? ? ? 1_555 J DT 52  N3 ? ? I DA 22  J DT -22 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog192 hydrog ? ? I DA 96  N6 ? ? ? 1_555 J DT 52  O4 ? ? I DA 22  J DT -22 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog193 hydrog ? ? I DA 98  N1 ? ? ? 1_555 J DT 50  N3 ? ? I DA 24  J DT -24 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog194 hydrog ? ? I DA 98  N6 ? ? ? 1_555 J DT 50  O4 ? ? I DA 24  J DT -24 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog195 hydrog ? ? I DG 99  N1 ? ? ? 1_555 J DC 49  N3 ? ? I DG 25  J DC -25 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog196 hydrog ? ? I DG 99  N2 ? ? ? 1_555 J DC 49  O2 ? ? I DG 25  J DC -25 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog197 hydrog ? ? I DG 99  O6 ? ? ? 1_555 J DC 49  N4 ? ? I DG 25  J DC -25 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog198 hydrog ? ? I DA 101 N1 ? ? ? 1_555 J DT 47  N3 ? ? I DA 27  J DT -27 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog199 hydrog ? ? I DA 101 N6 ? ? ? 1_555 J DT 47  O4 ? ? I DA 27  J DT -27 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog200 hydrog ? ? I DT 102 N3 ? ? ? 1_555 J DA 46  N1 ? ? I DT 28  J DA -28 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog201 hydrog ? ? I DT 102 O4 ? ? ? 1_555 J DA 46  N6 ? ? I DT 28  J DA -28 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog202 hydrog ? ? I DA 103 N1 ? ? ? 1_555 J DT 45  N3 ? ? I DA 29  J DT -29 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog203 hydrog ? ? I DA 103 N6 ? ? ? 1_555 J DT 45  O4 ? ? I DA 29  J DT -29 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog204 hydrog ? ? I DT 104 N3 ? ? ? 1_555 J DA 44  N1 ? ? I DT 30  J DA -30 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog205 hydrog ? ? I DT 104 O4 ? ? ? 1_555 J DA 44  N6 ? ? I DT 30  J DA -30 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog206 hydrog ? ? I DT 105 N3 ? ? ? 1_555 J DA 43  N1 ? ? I DT 31  J DA -31 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog207 hydrog ? ? I DT 105 O4 ? ? ? 1_555 J DA 43  N6 ? ? I DT 31  J DA -31 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog208 hydrog ? ? I DC 106 N3 ? ? ? 1_555 J DG 42  N1 ? ? I DC 32  J DG -32 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog209 hydrog ? ? I DC 106 N4 ? ? ? 1_555 J DG 42  O6 ? ? I DC 32  J DG -32 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog210 hydrog ? ? I DC 106 O2 ? ? ? 1_555 J DG 42  N2 ? ? I DC 32  J DG -32 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog211 hydrog ? ? I DT 107 N3 ? ? ? 1_555 J DA 41  N1 ? ? I DT 33  J DA -33 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog212 hydrog ? ? I DT 107 O4 ? ? ? 1_555 J DA 41  N6 ? ? I DT 33  J DA -33 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog213 hydrog ? ? I DG 108 N1 ? ? ? 1_555 J DC 40  N3 ? ? I DG 34  J DC -34 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog214 hydrog ? ? I DG 108 N2 ? ? ? 1_555 J DC 40  O2 ? ? I DG 34  J DC -34 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog215 hydrog ? ? I DG 108 O6 ? ? ? 1_555 J DC 40  N4 ? ? I DG 34  J DC -34 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog216 hydrog ? ? I DA 109 N1 ? ? ? 1_555 J DT 39  N3 ? ? I DA 35  J DT -35 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog217 hydrog ? ? I DA 109 N6 ? ? ? 1_555 J DT 39  O4 ? ? I DA 35  J DT -35 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog218 hydrog ? ? I DG 110 N1 ? ? ? 1_555 J DC 38  N3 ? ? I DG 36  J DC -36 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog219 hydrog ? ? I DG 110 N2 ? ? ? 1_555 J DC 38  O2 ? ? I DG 36  J DC -36 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog220 hydrog ? ? I DG 110 O6 ? ? ? 1_555 J DC 38  N4 ? ? I DG 36  J DC -36 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog221 hydrog ? ? I DA 111 N1 ? ? ? 1_555 J DT 37  N3 ? ? I DA 37  J DT -37 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog222 hydrog ? ? I DA 111 N6 ? ? ? 1_555 J DT 37  O4 ? ? I DA 37  J DT -37 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog223 hydrog ? ? I DA 112 N1 ? ? ? 1_555 J DT 36  N3 ? ? I DA 38  J DT -38 1_555 ? ? ? ? ? ? 'DA-DT PAIR'    ? ? 
hydrog224 hydrog ? ? I DT 113 N3 ? ? ? 1_555 J DA 35  N1 ? ? I DT 39  J DA -39 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog225 hydrog ? ? I DT 113 O4 ? ? ? 1_555 J DA 35  N6 ? ? I DT 39  J DA -39 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog226 hydrog ? ? I DG 114 N1 ? ? ? 1_555 J DC 34  N3 ? ? I DG 40  J DC -40 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog227 hydrog ? ? I DG 114 N2 ? ? ? 1_555 J DC 34  O2 ? ? I DG 40  J DC -40 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog228 hydrog ? ? I DG 114 O6 ? ? ? 1_555 J DC 34  N4 ? ? I DG 40  J DC -40 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog229 hydrog ? ? I DC 115 N3 ? ? ? 1_555 J DG 33  N1 ? ? I DC 41  J DG -41 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog230 hydrog ? ? I DC 115 N4 ? ? ? 1_555 J DG 33  O6 ? ? I DC 41  J DG -41 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog231 hydrog ? ? I DC 115 O2 ? ? ? 1_555 J DG 33  N2 ? ? I DC 41  J DG -41 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog232 hydrog ? ? I DT 116 N3 ? ? ? 1_555 J DA 32  N1 ? ? I DT 42  J DA -42 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog233 hydrog ? ? I DT 116 O4 ? ? ? 1_555 J DA 32  N6 ? ? I DT 42  J DA -42 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog234 hydrog ? ? I DT 117 O4 ? ? ? 1_555 J DG 30  N1 ? ? I DT 43  J DG -44 1_555 ? ? ? ? ? ? 'DT-DG MISPAIR' ? ? 
hydrog235 hydrog ? ? I DC 118 N4 ? ? ? 1_555 J DG 29  O6 ? ? I DC 44  J DG -45 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog236 hydrog ? ? I DC 119 O2 ? ? ? 1_555 J DG 29  N2 ? ? I DC 45  J DG -45 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog237 hydrog ? ? I DG 120 N1 ? ? ? 1_555 J DA 27  N1 ? ? I DG 46  J DA -47 1_555 ? ? ? ? ? ? TYPE_8_PAIR     ? ? 
hydrog238 hydrog ? ? I DG 120 O6 ? ? ? 1_555 J DA 27  N6 ? ? I DG 46  J DA -47 1_555 ? ? ? ? ? ? TYPE_8_PAIR     ? ? 
hydrog239 hydrog ? ? I DT 122 O4 ? ? ? 1_555 J DA 25  N6 ? ? I DT 48  J DA -49 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog240 hydrog ? ? I DT 122 N3 ? ? ? 1_555 J DA 26  N1 ? ? I DT 48  J DA -48 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog241 hydrog ? ? I DT 123 N3 ? ? ? 1_555 J DA 25  N1 ? ? I DT 49  J DA -49 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
hydrog242 hydrog ? ? I DG 124 N1 ? ? ? 1_555 J DG 23  O6 ? ? I DG 50  J DG -51 1_555 ? ? ? ? ? ? 'DG-DG MISPAIR' ? ? 
hydrog243 hydrog ? ? I DG 124 N2 ? ? ? 1_555 J DC 24  O2 ? ? I DG 50  J DC -50 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog244 hydrog ? ? I DC 125 N3 ? ? ? 1_555 J DG 23  N1 ? ? I DC 51  J DG -51 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog245 hydrog ? ? I DC 125 N4 ? ? ? 1_555 J DG 23  O6 ? ? I DC 51  J DG -51 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog246 hydrog ? ? I DC 125 O2 ? ? ? 1_555 J DG 23  N2 ? ? I DC 51  J DG -51 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog247 hydrog ? ? I DC 126 N3 ? ? ? 1_555 J DG 22  N1 ? ? I DC 52  J DG -52 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog248 hydrog ? ? I DC 126 N4 ? ? ? 1_555 J DG 22  O6 ? ? I DC 52  J DG -52 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog249 hydrog ? ? I DC 126 O2 ? ? ? 1_555 J DG 22  N2 ? ? I DC 52  J DG -52 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog250 hydrog ? ? I DT 127 N3 ? ? ? 1_555 J DA 21  N1 ? ? I DT 53  J DA -53 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog251 hydrog ? ? I DT 127 O4 ? ? ? 1_555 J DA 21  N6 ? ? I DT 53  J DA -53 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog252 hydrog ? ? I DT 128 N3 ? ? ? 1_555 J DA 20  N1 ? ? I DT 54  J DA -54 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog253 hydrog ? ? I DT 128 O4 ? ? ? 1_555 J DA 20  N6 ? ? I DT 54  J DA -54 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog254 hydrog ? ? I DT 129 N3 ? ? ? 1_555 J DA 19  N1 ? ? I DT 55  J DA -55 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog255 hydrog ? ? I DT 129 O4 ? ? ? 1_555 J DA 19  N6 ? ? I DT 55  J DA -55 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog256 hydrog ? ? I DT 130 N3 ? ? ? 1_555 J DA 18  N1 ? ? I DT 56  J DA -56 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog257 hydrog ? ? I DT 130 O4 ? ? ? 1_555 J DA 18  N6 ? ? I DT 56  J DA -56 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog258 hydrog ? ? I DA 131 N1 ? ? ? 1_555 J DT 17  N3 ? ? I DA 57  J DT -57 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog259 hydrog ? ? I DA 131 N6 ? ? ? 1_555 J DT 17  O4 ? ? I DA 57  J DT -57 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog260 hydrog ? ? I DT 132 N3 ? ? ? 1_555 J DA 16  N1 ? ? I DT 58  J DA -58 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog261 hydrog ? ? I DT 132 O4 ? ? ? 1_555 J DA 16  N6 ? ? I DT 58  J DA -58 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog262 hydrog ? ? I DA 133 N1 ? ? ? 1_555 J DT 15  N3 ? ? I DA 59  J DT -59 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog263 hydrog ? ? I DA 133 N6 ? ? ? 1_555 J DT 15  O4 ? ? I DA 59  J DT -59 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog264 hydrog ? ? I DG 135 N1 ? ? ? 1_555 J DC 13  N3 ? ? I DG 61  J DC -61 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog265 hydrog ? ? I DG 135 N2 ? ? ? 1_555 J DC 13  O2 ? ? I DG 61  J DC -61 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog266 hydrog ? ? I DG 135 O6 ? ? ? 1_555 J DC 13  N4 ? ? I DG 61  J DC -61 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog267 hydrog ? ? I DA 136 N1 ? ? ? 1_555 J DT 12  N3 ? ? I DA 62  J DT -62 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog268 hydrog ? ? I DA 136 N6 ? ? ? 1_555 J DT 12  O4 ? ? I DA 62  J DT -62 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog269 hydrog ? ? I DA 137 N1 ? ? ? 1_555 J DG 10  N1 ? ? I DA 63  J DG -64 1_555 ? ? ? ? ? ? TYPE_8_PAIR     ? ? 
hydrog270 hydrog ? ? I DA 137 N6 ? ? ? 1_555 J DG 10  O6 ? ? I DA 63  J DG -64 1_555 ? ? ? ? ? ? TYPE_8_PAIR     ? ? 
hydrog271 hydrog ? ? I DA 137 N1 ? ? ? 1_555 J DT 11  N3 ? ? I DA 63  J DT -63 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog272 hydrog ? ? I DA 137 N6 ? ? ? 1_555 J DT 11  O4 ? ? I DA 63  J DT -63 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog273 hydrog ? ? I DC 138 N3 ? ? ? 1_555 J DA 9   N6 ? ? I DC 64  J DA -65 1_555 ? ? ? ? ? ? 'DC-DA MISPAIR' ? ? 
hydrog274 hydrog ? ? I DC 138 O2 ? ? ? 1_555 J DG 10  N2 ? ? I DC 64  J DG -64 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog275 hydrog ? ? I DT 139 N3 ? ? ? 1_555 J DA 9   N1 ? ? I DT 65  J DA -65 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog276 hydrog ? ? I DT 139 O4 ? ? ? 1_555 J DA 9   N6 ? ? I DT 65  J DA -65 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog277 hydrog ? ? I DT 140 N3 ? ? ? 1_555 J DA 8   N1 ? ? I DT 66  J DA -66 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog278 hydrog ? ? I DT 140 O4 ? ? ? 1_555 J DA 8   N6 ? ? I DT 66  J DA -66 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog279 hydrog ? ? I DC 141 N3 ? ? ? 1_555 J DG 7   N1 ? ? I DC 67  J DG -67 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog280 hydrog ? ? I DC 141 N4 ? ? ? 1_555 J DG 7   O6 ? ? I DC 67  J DG -67 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog281 hydrog ? ? I DC 141 O2 ? ? ? 1_555 J DG 7   N2 ? ? I DC 67  J DG -67 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog282 hydrog ? ? I DC 142 O2 ? ? ? 1_555 J DG 6   N2 ? ? I DC 68  J DG -68 1_555 ? ? ? ? ? ? 'DC-DG PAIR'    ? ? 
hydrog283 hydrog ? ? I DT 143 N3 ? ? ? 1_555 J DA 5   N1 ? ? I DT 69  J DA -69 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog284 hydrog ? ? I DT 143 O4 ? ? ? 1_555 J DA 5   N6 ? ? I DT 69  J DA -69 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog285 hydrog ? ? I DC 144 N3 ? ? ? 1_555 J DG 4   N1 ? ? I DC 70  J DG -70 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog286 hydrog ? ? I DC 144 N4 ? ? ? 1_555 J DG 4   O6 ? ? I DC 70  J DG -70 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog287 hydrog ? ? I DC 144 O2 ? ? ? 1_555 J DG 4   N2 ? ? I DC 70  J DG -70 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog288 hydrog ? ? I DG 145 N1 ? ? ? 1_555 J DC 3   O2 ? ? I DG 71  J DC -71 1_555 ? ? ? ? ? ? 'DG-DC PAIR'    ? ? 
hydrog289 hydrog ? ? I DA 146 N1 ? ? ? 1_555 J DT 2   N3 ? ? I DA 72  J DT -72 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog290 hydrog ? ? I DA 146 N6 ? ? ? 1_555 J DT 2   O4 ? ? I DA 72  J DT -72 1_555 ? ? ? ? ? ? WATSON-CRICK    ? ? 
hydrog291 hydrog ? ? I DT 147 N3 ? ? ? 1_555 J DA 1   N1 ? ? I DT 73  J DA -73 1_555 ? ? ? ? ? ? 'DT-DA PAIR'    ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 2 ? 
AA8 ? 6 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel      
AA2 1 2 ? parallel      
AA3 1 2 ? parallel      
AA4 1 2 ? parallel      
AA5 1 2 ? parallel      
AA6 1 2 ? parallel      
AA7 1 2 ? parallel      
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA8 3 4 ? anti-parallel 
AA8 4 5 ? anti-parallel 
AA8 5 6 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ASN A 48  ? TRP A 49  ? ASN A 85  TRP A 86  
AA1 2 THR B 73  ? VAL B 74  ? THR B 80  VAL B 81  
AA2 1 THR B 89  ? LEU B 90  ? THR B 96  LEU B 97  
AA2 2 VAL G 88  ? THR G 89  ? VAL G 100 THR G 101 
AA3 1 ARG C 65  ? ILE C 66  ? ARG C 77  ILE C 78  
AA3 2 GLY D 21  ? ILE D 22  ? GLY D 53  ILE D 54  
AA4 1 VAL C 88  ? THR C 89  ? VAL C 100 THR C 101 
AA4 2 THR F 89  ? LEU F 90  ? THR F 96  LEU F 97  
AA5 1 ASN E 48  ? TRP E 49  ? ASN E 85  TRP E 86  
AA5 2 THR F 73  ? VAL F 74  ? THR F 80  VAL F 81  
AA6 1 ARG G 30  ? VAL G 31  ? ARG G 42  VAL G 43  
AA6 2 THR H 56  ? ILE H 57  ? THR H 88  ILE H 89  
AA7 1 ARG G 65  ? ILE G 66  ? ARG G 77  ILE G 78  
AA7 2 GLY H 21  ? ILE H 22  ? GLY H 53  ILE H 54  
AA8 1 GLU M 125 ? THR M 126 ? GLU M 125 THR M 126 
AA8 2 ALA M 130 ? TRP M 137 ? ALA M 130 TRP M 137 
AA8 3 ASN M 145 ? TYR M 155 ? ASN M 145 TYR M 155 
AA8 4 TYR M 160 ? SER M 164 ? TYR M 160 SER M 164 
AA8 5 TRP M 83  ? SER M 89  ? TRP M 83  SER M 89  
AA8 6 GLN M 187 ? ILE M 188 ? GLN M 187 ILE M 188 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ASN A 48  ? N ASN A 85  O VAL B 74  ? O VAL B 81  
AA2 1 2 N THR B 89  ? N THR B 96  O THR G 89  ? O THR G 101 
AA3 1 2 N ILE C 66  ? N ILE C 78  O GLY D 21  ? O GLY D 53  
AA4 1 2 N THR C 89  ? N THR C 101 O THR F 89  ? O THR F 96  
AA5 1 2 N ASN E 48  ? N ASN E 85  O VAL F 74  ? O VAL F 81  
AA6 1 2 N ARG G 30  ? N ARG G 42  O ILE H 57  ? O ILE H 89  
AA7 1 2 N ILE G 66  ? N ILE G 78  O GLY H 21  ? O GLY H 53  
AA8 1 2 N THR M 126 ? N THR M 126 O ALA M 130 ? O ALA M 130 
AA8 2 3 N ILE M 135 ? N ILE M 135 O THR M 150 ? O THR M 150 
AA8 3 4 N VAL M 153 ? N VAL M 153 O PHE M 162 ? O PHE M 162 
AA8 4 5 O THR M 163 ? O THR M 163 N ASP M 84  ? N ASP M 84  
AA8 5 6 N SER M 89  ? N SER M 89  O GLN M 187 ? O GLN M 187 
# 
_atom_sites.entry_id                    6MUO 
_atom_sites.Cartn_transf_matrix[1][1]   ? 
_atom_sites.Cartn_transf_matrix[1][2]   ? 
_atom_sites.Cartn_transf_matrix[1][3]   ? 
_atom_sites.Cartn_transf_matrix[2][1]   ? 
_atom_sites.Cartn_transf_matrix[2][2]   ? 
_atom_sites.Cartn_transf_matrix[2][3]   ? 
_atom_sites.Cartn_transf_matrix[3][1]   ? 
_atom_sites.Cartn_transf_matrix[3][2]   ? 
_atom_sites.Cartn_transf_matrix[3][3]   ? 
_atom_sites.Cartn_transf_vector[1]      ? 
_atom_sites.Cartn_transf_vector[2]      ? 
_atom_sites.Cartn_transf_vector[3]      ? 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
_atom_sites.solution_primary            ? 
_atom_sites.solution_secondary          ? 
_atom_sites.solution_hydrogens          ? 
_atom_sites.special_details             ? 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N     . SER A 1 4   ? 119.382 136.587 143.285 1.00 275.40 ?  41  SER A N     1 
ATOM 2     C CA    . SER A 1 4   ? 119.607 135.644 144.375 1.00 275.40 ?  41  SER A CA    1 
ATOM 3     C C     . SER A 1 4   ? 120.338 134.406 143.872 1.00 275.40 ?  41  SER A C     1 
ATOM 4     O O     . SER A 1 4   ? 121.053 134.464 142.873 1.00 275.40 ?  41  SER A O     1 
ATOM 5     C CB    . SER A 1 4   ? 118.288 135.258 145.023 1.00 275.40 ?  41  SER A CB    1 
ATOM 6     N N     . ARG A 1 5   ? 120.156 133.286 144.573 1.00 284.16 ?  42  ARG A N     1 
ATOM 7     C CA    . ARG A 1 5   ? 120.797 132.041 144.164 1.00 284.16 ?  42  ARG A CA    1 
ATOM 8     C C     . ARG A 1 5   ? 120.148 131.480 142.905 1.00 284.16 ?  42  ARG A C     1 
ATOM 9     O O     . ARG A 1 5   ? 120.799 131.342 141.864 1.00 284.16 ?  42  ARG A O     1 
ATOM 10    C CB    . ARG A 1 5   ? 120.738 131.022 145.303 1.00 284.16 ?  42  ARG A CB    1 
ATOM 11    N N     . ARG A 1 6   ? 118.861 131.160 142.981 1.00 272.86 ?  43  ARG A N     1 
ATOM 12    C CA    . ARG A 1 6   ? 118.121 130.627 141.850 1.00 272.86 ?  43  ARG A CA    1 
ATOM 13    C C     . ARG A 1 6   ? 116.798 131.361 141.711 1.00 272.86 ?  43  ARG A C     1 
ATOM 14    O O     . ARG A 1 6   ? 115.804 130.992 142.343 1.00 272.86 ?  43  ARG A O     1 
ATOM 15    C CB    . ARG A 1 6   ? 117.864 129.123 142.006 1.00 272.86 ?  43  ARG A CB    1 
ATOM 16    N N     . ARG A 1 7   ? 116.801 132.420 140.897 1.00 272.12 ?  44  ARG A N     1 
ATOM 17    C CA    . ARG A 1 7   ? 115.575 133.149 140.596 1.00 272.12 ?  44  ARG A CA    1 
ATOM 18    C C     . ARG A 1 7   ? 114.605 132.251 139.840 1.00 272.12 ?  44  ARG A C     1 
ATOM 19    O O     . ARG A 1 7   ? 113.569 131.858 140.387 1.00 272.12 ?  44  ARG A O     1 
ATOM 20    C CB    . ARG A 1 7   ? 115.878 134.409 139.784 1.00 272.12 ?  44  ARG A CB    1 
ATOM 21    N N     . GLN A 1 8   ? 114.965 131.899 138.602 1.00 245.99 ?  45  GLN A N     1 
ATOM 22    C CA    . GLN A 1 8   ? 114.323 130.847 137.818 1.00 245.99 ?  45  GLN A CA    1 
ATOM 23    C C     . GLN A 1 8   ? 115.208 130.497 136.633 1.00 245.99 ?  45  GLN A C     1 
ATOM 24    O O     . GLN A 1 8   ? 115.560 131.373 135.837 1.00 245.99 ?  45  GLN A O     1 
ATOM 25    C CB    . GLN A 1 8   ? 112.940 131.257 137.312 1.00 245.99 ?  45  GLN A CB    1 
ATOM 26    C CG    . GLN A 1 8   ? 112.232 130.099 136.675 1.00 245.99 ?  45  GLN A CG    1 
ATOM 27    C CD    . GLN A 1 8   ? 111.989 128.990 137.674 1.00 245.99 ?  45  GLN A CD    1 
ATOM 28    O OE1   . GLN A 1 8   ? 111.542 129.234 138.794 1.00 245.99 ?  45  GLN A OE1   1 
ATOM 29    N NE2   . GLN A 1 8   ? 112.321 127.767 137.290 1.00 245.99 ?  45  GLN A NE2   1 
ATOM 30    N N     . GLY A 1 9   ? 115.560 129.228 136.490 1.00 230.92 ?  46  GLY A N     1 
ATOM 31    C CA    . GLY A 1 9   ? 116.539 128.861 135.489 1.00 230.92 ?  46  GLY A CA    1 
ATOM 32    C C     . GLY A 1 9   ? 116.010 128.601 134.095 1.00 230.92 ?  46  GLY A C     1 
ATOM 33    O O     . GLY A 1 9   ? 116.532 129.148 133.121 1.00 230.92 ?  46  GLY A O     1 
ATOM 34    N N     . TRP A 1 10  ? 114.975 127.768 133.982 1.00 214.49 ?  47  TRP A N     1 
ATOM 35    C CA    . TRP A 1 10  ? 114.615 127.227 132.678 1.00 214.49 ?  47  TRP A CA    1 
ATOM 36    C C     . TRP A 1 10  ? 113.275 127.743 132.173 1.00 214.49 ?  47  TRP A C     1 
ATOM 37    O O     . TRP A 1 10  ? 113.101 127.894 130.960 1.00 214.49 ?  47  TRP A O     1 
ATOM 38    C CB    . TRP A 1 10  ? 114.612 125.704 132.738 1.00 214.49 ?  47  TRP A CB    1 
ATOM 39    C CG    . TRP A 1 10  ? 113.769 125.165 133.827 1.00 214.49 ?  47  TRP A CG    1 
ATOM 40    C CD1   . TRP A 1 10  ? 114.165 124.898 135.101 1.00 214.49 ?  47  TRP A CD1   1 
ATOM 41    C CD2   . TRP A 1 10  ? 112.383 124.824 133.759 1.00 214.49 ?  47  TRP A CD2   1 
ATOM 42    N NE1   . TRP A 1 10  ? 113.114 124.410 135.831 1.00 214.49 ?  47  TRP A NE1   1 
ATOM 43    C CE2   . TRP A 1 10  ? 112.008 124.353 135.028 1.00 214.49 ?  47  TRP A CE2   1 
ATOM 44    C CE3   . TRP A 1 10  ? 111.428 124.856 132.746 1.00 214.49 ?  47  TRP A CE3   1 
ATOM 45    C CZ2   . TRP A 1 10  ? 110.717 123.931 135.314 1.00 214.49 ?  47  TRP A CZ2   1 
ATOM 46    C CZ3   . TRP A 1 10  ? 110.146 124.446 133.031 1.00 214.49 ?  47  TRP A CZ3   1 
ATOM 47    C CH2   . TRP A 1 10  ? 109.801 123.985 134.304 1.00 214.49 ?  47  TRP A CH2   1 
ATOM 48    N N     . LEU A 1 11  ? 112.328 128.030 133.065 1.00 205.08 ?  48  LEU A N     1 
ATOM 49    C CA    . LEU A 1 11  ? 110.973 128.350 132.624 1.00 205.08 ?  48  LEU A CA    1 
ATOM 50    C C     . LEU A 1 11  ? 110.902 129.736 131.997 1.00 205.08 ?  48  LEU A C     1 
ATOM 51    O O     . LEU A 1 11  ? 109.970 130.038 131.245 1.00 205.08 ?  48  LEU A O     1 
ATOM 52    C CB    . LEU A 1 11  ? 110.008 128.202 133.803 1.00 205.08 ?  48  LEU A CB    1 
ATOM 53    C CG    . LEU A 1 11  ? 108.483 128.177 133.648 1.00 205.08 ?  48  LEU A CG    1 
ATOM 54    C CD1   . LEU A 1 11  ? 107.839 129.557 133.653 1.00 205.08 ?  48  LEU A CD1   1 
ATOM 55    C CD2   . LEU A 1 11  ? 108.110 127.425 132.389 1.00 205.08 ?  48  LEU A CD2   1 
ATOM 56    N N     . LYS A 1 12  ? 111.889 130.583 132.267 1.00 201.73 ?  49  LYS A N     1 
ATOM 57    C CA    . LYS A 1 12  ? 112.046 131.770 131.442 1.00 201.73 ?  49  LYS A CA    1 
ATOM 58    C C     . LYS A 1 12  ? 112.512 131.413 130.041 1.00 201.73 ?  49  LYS A C     1 
ATOM 59    O O     . LYS A 1 12  ? 112.185 132.123 129.087 1.00 201.73 ?  49  LYS A O     1 
ATOM 60    C CB    . LYS A 1 12  ? 113.036 132.746 132.080 1.00 201.73 ?  49  LYS A CB    1 
ATOM 61    C CG    . LYS A 1 12  ? 112.603 133.327 133.415 1.00 201.73 ?  49  LYS A CG    1 
ATOM 62    C CD    . LYS A 1 12  ? 111.458 134.312 133.262 1.00 201.73 ?  49  LYS A CD    1 
ATOM 63    C CE    . LYS A 1 12  ? 111.123 134.951 134.601 1.00 201.73 ?  49  LYS A CE    1 
ATOM 64    N NZ    . LYS A 1 12  ? 109.983 135.900 134.505 1.00 201.73 ?  49  LYS A NZ    1 
ATOM 65    N N     . GLU A 1 13  ? 113.261 130.320 129.889 1.00 203.69 ?  50  GLU A N     1 
ATOM 66    C CA    . GLU A 1 13  ? 113.955 130.101 128.626 1.00 203.69 ?  50  GLU A CA    1 
ATOM 67    C C     . GLU A 1 13  ? 113.119 129.277 127.651 1.00 203.69 ?  50  GLU A C     1 
ATOM 68    O O     . GLU A 1 13  ? 113.173 129.511 126.439 1.00 203.69 ?  50  GLU A O     1 
ATOM 69    C CB    . GLU A 1 13  ? 115.310 129.446 128.888 1.00 203.69 ?  50  GLU A CB    1 
ATOM 70    C CG    . GLU A 1 13  ? 116.226 129.441 127.679 1.00 203.69 ?  50  GLU A CG    1 
ATOM 71    C CD    . GLU A 1 13  ? 117.632 128.993 128.006 1.00 203.69 ?  50  GLU A CD    1 
ATOM 72    O OE1   . GLU A 1 13  ? 117.877 128.614 129.166 1.00 203.69 ?  50  GLU A OE1   1 
ATOM 73    O OE2   . GLU A 1 13  ? 118.499 129.043 127.110 1.00 203.69 -1 50  GLU A OE2   1 
ATOM 74    N N     . ILE A 1 14  ? 112.338 128.315 128.151 1.00 196.16 ?  51  ILE A N     1 
ATOM 75    C CA    . ILE A 1 14  ? 111.550 127.461 127.262 1.00 196.16 ?  51  ILE A CA    1 
ATOM 76    C C     . ILE A 1 14  ? 110.405 128.243 126.636 1.00 196.16 ?  51  ILE A C     1 
ATOM 77    O O     . ILE A 1 14  ? 110.159 128.149 125.428 1.00 196.16 ?  51  ILE A O     1 
ATOM 78    C CB    . ILE A 1 14  ? 111.050 126.216 128.012 1.00 196.16 ?  51  ILE A CB    1 
ATOM 79    C CG1   . ILE A 1 14  ? 112.207 125.262 128.250 1.00 196.16 ?  51  ILE A CG1   1 
ATOM 80    C CG2   . ILE A 1 14  ? 109.938 125.513 127.261 1.00 196.16 ?  51  ILE A CG2   1 
ATOM 81    C CD1   . ILE A 1 14  ? 111.823 124.091 129.089 1.00 196.16 ?  51  ILE A CD1   1 
ATOM 82    N N     . ARG A 1 15  ? 109.722 129.069 127.426 1.00 189.36 ?  52  ARG A N     1 
ATOM 83    C CA    . ARG A 1 15  ? 108.631 129.853 126.862 1.00 189.36 ?  52  ARG A CA    1 
ATOM 84    C C     . ARG A 1 15  ? 109.165 130.975 125.979 1.00 189.36 ?  52  ARG A C     1 
ATOM 85    O O     . ARG A 1 15  ? 108.442 131.493 125.122 1.00 189.36 ?  52  ARG A O     1 
ATOM 86    C CB    . ARG A 1 15  ? 107.739 130.389 127.983 1.00 189.36 ?  52  ARG A CB    1 
ATOM 87    C CG    . ARG A 1 15  ? 106.389 130.926 127.520 1.00 189.36 ?  52  ARG A CG    1 
ATOM 88    C CD    . ARG A 1 15  ? 105.527 131.372 128.679 1.00 189.36 ?  52  ARG A CD    1 
ATOM 89    N NE    . ARG A 1 15  ? 105.164 130.259 129.548 1.00 189.36 ?  52  ARG A NE    1 
ATOM 90    C CZ    . ARG A 1 15  ? 105.566 130.136 130.806 1.00 189.36 ?  52  ARG A CZ    1 
ATOM 91    N NH1   . ARG A 1 15  ? 106.342 131.064 131.347 1.00 189.36 ?  52  ARG A NH1   1 
ATOM 92    N NH2   . ARG A 1 15  ? 105.189 129.089 131.524 1.00 189.36 ?  52  ARG A NH2   1 
ATOM 93    N N     . LYS A 1 16  ? 110.440 131.323 126.130 1.00 188.78 ?  53  LYS A N     1 
ATOM 94    C CA    . LYS A 1 16  ? 111.065 132.231 125.181 1.00 188.78 ?  53  LYS A CA    1 
ATOM 95    C C     . LYS A 1 16  ? 111.322 131.545 123.845 1.00 188.78 ?  53  LYS A C     1 
ATOM 96    O O     . LYS A 1 16  ? 110.969 132.084 122.792 1.00 188.78 ?  53  LYS A O     1 
ATOM 97    C CB    . LYS A 1 16  ? 112.366 132.774 125.761 1.00 188.78 ?  53  LYS A CB    1 
ATOM 98    C CG    . LYS A 1 16  ? 113.061 133.802 124.895 1.00 188.78 ?  53  LYS A CG    1 
ATOM 99    C CD    . LYS A 1 16  ? 114.305 134.307 125.589 1.00 188.78 ?  53  LYS A CD    1 
ATOM 100   C CE    . LYS A 1 16  ? 115.054 135.289 124.727 1.00 188.78 ?  53  LYS A CE    1 
ATOM 101   N NZ    . LYS A 1 16  ? 116.292 135.736 125.412 1.00 188.78 ?  53  LYS A NZ    1 
ATOM 102   N N     . LEU A 1 17  ? 111.926 130.356 123.862 1.00 178.58 ?  54  LEU A N     1 
ATOM 103   C CA    . LEU A 1 17  ? 112.362 129.754 122.608 1.00 178.58 ?  54  LEU A CA    1 
ATOM 104   C C     . LEU A 1 17  ? 111.219 129.156 121.802 1.00 178.58 ?  54  LEU A C     1 
ATOM 105   O O     . LEU A 1 17  ? 111.310 129.097 120.574 1.00 178.58 ?  54  LEU A O     1 
ATOM 106   C CB    . LEU A 1 17  ? 113.421 128.690 122.863 1.00 178.58 ?  54  LEU A CB    1 
ATOM 107   C CG    . LEU A 1 17  ? 114.746 129.268 123.330 1.00 178.58 ?  54  LEU A CG    1 
ATOM 108   C CD1   . LEU A 1 17  ? 115.729 128.156 123.609 1.00 178.58 ?  54  LEU A CD1   1 
ATOM 109   C CD2   . LEU A 1 17  ? 115.289 130.219 122.289 1.00 178.58 ?  54  LEU A CD2   1 
ATOM 110   N N     . GLN A 1 18  ? 110.146 128.710 122.447 1.00 184.50 ?  55  GLN A N     1 
ATOM 111   C CA    . GLN A 1 18  ? 108.990 128.296 121.667 1.00 184.50 ?  55  GLN A CA    1 
ATOM 112   C C     . GLN A 1 18  ? 108.246 129.473 121.066 1.00 184.50 ?  55  GLN A C     1 
ATOM 113   O O     . GLN A 1 18  ? 107.492 129.284 120.111 1.00 184.50 ?  55  GLN A O     1 
ATOM 114   C CB    . GLN A 1 18  ? 108.021 127.471 122.508 1.00 184.50 ?  55  GLN A CB    1 
ATOM 115   C CG    . GLN A 1 18  ? 108.507 126.086 122.822 1.00 184.50 ?  55  GLN A CG    1 
ATOM 116   C CD    . GLN A 1 18  ? 107.474 125.282 123.566 1.00 184.50 ?  55  GLN A CD    1 
ATOM 117   O OE1   . GLN A 1 18  ? 106.421 125.796 123.932 1.00 184.50 ?  55  GLN A OE1   1 
ATOM 118   N NE2   . GLN A 1 18  ? 107.759 124.006 123.778 1.00 184.50 ?  55  GLN A NE2   1 
ATOM 119   N N     . LYS A 1 19  ? 108.440 130.673 121.600 1.00 180.56 ?  56  LYS A N     1 
ATOM 120   C CA    . LYS A 1 19  ? 107.760 131.842 121.068 1.00 180.56 ?  56  LYS A CA    1 
ATOM 121   C C     . LYS A 1 19  ? 108.327 132.264 119.723 1.00 180.56 ?  56  LYS A C     1 
ATOM 122   O O     . LYS A 1 19  ? 107.572 132.695 118.847 1.00 180.56 ?  56  LYS A O     1 
ATOM 123   C CB    . LYS A 1 19  ? 107.862 132.989 122.072 1.00 180.56 ?  56  LYS A CB    1 
ATOM 124   C CG    . LYS A 1 19  ? 107.113 134.259 121.712 1.00 180.56 ?  56  LYS A CG    1 
ATOM 125   C CD    . LYS A 1 19  ? 107.327 135.300 122.805 1.00 180.56 ?  56  LYS A CD    1 
ATOM 126   C CE    . LYS A 1 19  ? 106.650 136.618 122.487 1.00 180.56 ?  56  LYS A CE    1 
ATOM 127   N NZ    . LYS A 1 19  ? 106.907 137.624 123.555 1.00 180.56 ?  56  LYS A NZ    1 
ATOM 128   N N     . SER A 1 20  ? 109.632 132.134 119.530 1.00 182.77 ?  57  SER A N     1 
ATOM 129   C CA    . SER A 1 20  ? 110.286 132.661 118.345 1.00 182.77 ?  57  SER A CA    1 
ATOM 130   C C     . SER A 1 20  ? 110.498 131.555 117.323 1.00 182.77 ?  57  SER A C     1 
ATOM 131   O O     . SER A 1 20  ? 110.052 130.420 117.488 1.00 182.77 ?  57  SER A O     1 
ATOM 132   C CB    . SER A 1 20  ? 111.617 133.322 118.702 1.00 182.77 ?  57  SER A CB    1 
ATOM 133   O OG    . SER A 1 20  ? 112.576 132.355 119.082 1.00 182.77 ?  57  SER A OG    1 
ATOM 134   N N     . THR A 1 21  ? 111.196 131.913 116.251 1.00 174.68 ?  58  THR A N     1 
ATOM 135   C CA    . THR A 1 21  ? 111.349 131.037 115.103 1.00 174.68 ?  58  THR A CA    1 
ATOM 136   C C     . THR A 1 21  ? 112.746 131.113 114.500 1.00 174.68 ?  58  THR A C     1 
ATOM 137   O O     . THR A 1 21  ? 112.911 130.943 113.289 1.00 174.68 ?  58  THR A O     1 
ATOM 138   C CB    . THR A 1 21  ? 110.296 131.358 114.046 1.00 174.68 ?  58  THR A CB    1 
ATOM 139   O OG1   . THR A 1 21  ? 110.511 130.545 112.885 1.00 174.68 ?  58  THR A OG1   1 
ATOM 140   C CG2   . THR A 1 21  ? 110.309 132.844 113.683 1.00 174.68 ?  58  THR A CG2   1 
ATOM 141   N N     . HIS A 1 22  ? 113.765 131.332 115.322 1.00 161.85 ?  59  HIS A N     1 
ATOM 142   C CA    . HIS A 1 22  ? 115.114 131.472 114.799 1.00 161.85 ?  59  HIS A CA    1 
ATOM 143   C C     . HIS A 1 22  ? 115.686 130.122 114.377 1.00 161.85 ?  59  HIS A C     1 
ATOM 144   O O     . HIS A 1 22  ? 115.022 129.085 114.404 1.00 161.85 ?  59  HIS A O     1 
ATOM 145   C CB    . HIS A 1 22  ? 116.037 132.095 115.842 1.00 161.85 ?  59  HIS A CB    1 
ATOM 146   C CG    . HIS A 1 22  ? 115.670 133.492 116.217 1.00 161.85 ?  59  HIS A CG    1 
ATOM 147   N ND1   . HIS A 1 22  ? 115.874 134.565 115.376 1.00 161.85 ?  59  HIS A ND1   1 
ATOM 148   C CD2   . HIS A 1 22  ? 115.125 133.997 117.348 1.00 161.85 ?  59  HIS A CD2   1 
ATOM 149   C CE1   . HIS A 1 22  ? 115.459 135.671 115.969 1.00 161.85 ?  59  HIS A CE1   1 
ATOM 150   N NE2   . HIS A 1 22  ? 115.001 135.354 117.166 1.00 161.85 ?  59  HIS A NE2   1 
ATOM 151   N N     . LEU A 1 23  ? 116.948 130.155 113.970 1.00 159.82 ?  60  LEU A N     1 
ATOM 152   C CA    . LEU A 1 23  ? 117.738 128.944 113.862 1.00 159.82 ?  60  LEU A CA    1 
ATOM 153   C C     . LEU A 1 23  ? 118.552 128.754 115.135 1.00 159.82 ?  60  LEU A C     1 
ATOM 154   O O     . LEU A 1 23  ? 118.830 129.703 115.869 1.00 159.82 ?  60  LEU A O     1 
ATOM 155   C CB    . LEU A 1 23  ? 118.652 129.010 112.647 1.00 159.82 ?  60  LEU A CB    1 
ATOM 156   C CG    . LEU A 1 23  ? 117.865 129.003 111.346 1.00 159.82 ?  60  LEU A CG    1 
ATOM 157   C CD1   . LEU A 1 23  ? 118.790 129.237 110.176 1.00 159.82 ?  60  LEU A CD1   1 
ATOM 158   C CD2   . LEU A 1 23  ? 117.152 127.679 111.212 1.00 159.82 ?  60  LEU A CD2   1 
ATOM 159   N N     . LEU A 1 24  ? 118.925 127.510 115.408 1.00 165.73 ?  61  LEU A N     1 
ATOM 160   C CA    . LEU A 1 24  ? 119.536 127.193 116.685 1.00 165.73 ?  61  LEU A CA    1 
ATOM 161   C C     . LEU A 1 24  ? 120.940 126.626 116.577 1.00 165.73 ?  61  LEU A C     1 
ATOM 162   O O     . LEU A 1 24  ? 121.675 126.653 117.568 1.00 165.73 ?  61  LEU A O     1 
ATOM 163   C CB    . LEU A 1 24  ? 118.647 126.223 117.465 1.00 165.73 ?  61  LEU A CB    1 
ATOM 164   C CG    . LEU A 1 24  ? 117.296 126.836 117.816 1.00 165.73 ?  61  LEU A CG    1 
ATOM 165   C CD1   . LEU A 1 24  ? 116.431 125.842 118.548 1.00 165.73 ?  61  LEU A CD1   1 
ATOM 166   C CD2   . LEU A 1 24  ? 117.483 128.091 118.632 1.00 165.73 ?  61  LEU A CD2   1 
ATOM 167   N N     . ILE A 1 25  ? 121.335 126.108 115.423 1.00 169.88 ?  62  ILE A N     1 
ATOM 168   C CA    . ILE A 1 25  ? 122.704 125.682 115.183 1.00 169.88 ?  62  ILE A CA    1 
ATOM 169   C C     . ILE A 1 25  ? 123.335 126.696 114.249 1.00 169.88 ?  62  ILE A C     1 
ATOM 170   O O     . ILE A 1 25  ? 122.762 127.013 113.203 1.00 169.88 ?  62  ILE A O     1 
ATOM 171   C CB    . ILE A 1 25  ? 122.759 124.269 114.585 1.00 169.88 ?  62  ILE A CB    1 
ATOM 172   C CG1   . ILE A 1 25  ? 122.217 123.262 115.593 1.00 169.88 ?  62  ILE A CG1   1 
ATOM 173   C CG2   . ILE A 1 25  ? 124.156 123.915 114.209 1.00 169.88 ?  62  ILE A CG2   1 
ATOM 174   C CD1   . ILE A 1 25  ? 122.002 121.890 115.032 1.00 169.88 ?  62  ILE A CD1   1 
ATOM 175   N N     . ARG A 1 26  ? 124.494 127.217 114.636 1.00 188.07 ?  63  ARG A N     1 
ATOM 176   C CA    . ARG A 1 26  ? 125.139 128.276 113.876 1.00 188.07 ?  63  ARG A CA    1 
ATOM 177   C C     . ARG A 1 26  ? 125.620 127.760 112.525 1.00 188.07 ?  63  ARG A C     1 
ATOM 178   O O     . ARG A 1 26  ? 126.032 126.604 112.400 1.00 188.07 ?  63  ARG A O     1 
ATOM 179   C CB    . ARG A 1 26  ? 126.296 128.854 114.681 1.00 188.07 ?  63  ARG A CB    1 
ATOM 180   C CG    . ARG A 1 26  ? 125.844 129.567 115.939 1.00 188.07 ?  63  ARG A CG    1 
ATOM 181   C CD    . ARG A 1 26  ? 125.173 130.876 115.582 1.00 188.07 ?  63  ARG A CD    1 
ATOM 182   N NE    . ARG A 1 26  ? 124.724 131.622 116.751 1.00 188.07 ?  63  ARG A NE    1 
ATOM 183   C CZ    . ARG A 1 26  ? 123.483 131.586 117.223 1.00 188.07 ?  63  ARG A CZ    1 
ATOM 184   N NH1   . ARG A 1 26  ? 122.564 130.854 116.615 1.00 188.07 ?  63  ARG A NH1   1 
ATOM 185   N NH2   . ARG A 1 26  ? 123.154 132.296 118.291 1.00 188.07 ?  63  ARG A NH2   1 
ATOM 186   N N     . LYS A 1 27  ? 125.563 128.637 111.514 1.00 180.86 ?  64  LYS A N     1 
ATOM 187   C CA    . LYS A 1 27  ? 125.598 128.202 110.118 1.00 180.86 ?  64  LYS A CA    1 
ATOM 188   C C     . LYS A 1 27  ? 126.961 127.665 109.710 1.00 180.86 ?  64  LYS A C     1 
ATOM 189   O O     . LYS A 1 27  ? 127.044 126.605 109.081 1.00 180.86 ?  64  LYS A O     1 
ATOM 190   C CB    . LYS A 1 27  ? 125.210 129.354 109.197 1.00 180.86 ?  64  LYS A CB    1 
ATOM 191   C CG    . LYS A 1 27  ? 123.773 129.794 109.304 1.00 180.86 ?  64  LYS A CG    1 
ATOM 192   C CD    . LYS A 1 27  ? 123.513 130.965 108.373 1.00 180.86 ?  64  LYS A CD    1 
ATOM 193   C CE    . LYS A 1 27  ? 122.106 131.513 108.538 1.00 180.86 ?  64  LYS A CE    1 
ATOM 194   N NZ    . LYS A 1 27  ? 121.870 132.697 107.667 1.00 180.86 ?  64  LYS A NZ    1 
ATOM 195   N N     . LEU A 1 28  ? 128.030 128.384 110.034 1.00 187.49 ?  65  LEU A N     1 
ATOM 196   C CA    . LEU A 1 28  ? 129.349 127.983 109.553 1.00 187.49 ?  65  LEU A CA    1 
ATOM 197   C C     . LEU A 1 28  ? 129.860 126.672 110.157 1.00 187.49 ?  65  LEU A C     1 
ATOM 198   O O     . LEU A 1 28  ? 130.542 125.929 109.431 1.00 187.49 ?  65  LEU A O     1 
ATOM 199   C CB    . LEU A 1 28  ? 130.351 129.125 109.768 1.00 187.49 ?  65  LEU A CB    1 
ATOM 200   C CG    . LEU A 1 28  ? 131.681 128.947 109.032 1.00 187.49 ?  65  LEU A CG    1 
ATOM 201   C CD1   . LEU A 1 28  ? 131.435 128.986 107.538 1.00 187.49 ?  65  LEU A CD1   1 
ATOM 202   C CD2   . LEU A 1 28  ? 132.708 129.980 109.429 1.00 187.49 ?  65  LEU A CD2   1 
ATOM 203   N N     . PRO A 1 29  ? 129.580 126.304 111.418 1.00 186.77 ?  66  PRO A N     1 
ATOM 204   C CA    . PRO A 1 29  ? 129.817 124.900 111.788 1.00 186.77 ?  66  PRO A CA    1 
ATOM 205   C C     . PRO A 1 29  ? 128.900 123.933 111.076 1.00 186.77 ?  66  PRO A C     1 
ATOM 206   O O     . PRO A 1 29  ? 129.320 122.818 110.750 1.00 186.77 ?  66  PRO A O     1 
ATOM 207   C CB    . PRO A 1 29  ? 129.580 124.890 113.299 1.00 186.77 ?  66  PRO A CB    1 
ATOM 208   C CG    . PRO A 1 29  ? 129.916 126.216 113.717 1.00 186.77 ?  66  PRO A CG    1 
ATOM 209   C CD    . PRO A 1 29  ? 129.440 127.123 112.636 1.00 186.77 ?  66  PRO A CD    1 
ATOM 210   N N     . PHE A 1 30  ? 127.661 124.332 110.805 1.00 174.56 ?  67  PHE A N     1 
ATOM 211   C CA    . PHE A 1 30  ? 126.731 123.418 110.159 1.00 174.56 ?  67  PHE A CA    1 
ATOM 212   C C     . PHE A 1 30  ? 127.046 123.257 108.680 1.00 174.56 ?  67  PHE A C     1 
ATOM 213   O O     . PHE A 1 30  ? 126.622 122.278 108.059 1.00 174.56 ?  67  PHE A O     1 
ATOM 214   C CB    . PHE A 1 30  ? 125.307 123.909 110.377 1.00 174.56 ?  67  PHE A CB    1 
ATOM 215   C CG    . PHE A 1 30  ? 124.263 122.997 109.847 1.00 174.56 ?  67  PHE A CG    1 
ATOM 216   C CD1   . PHE A 1 30  ? 124.077 121.752 110.397 1.00 174.56 ?  67  PHE A CD1   1 
ATOM 217   C CD2   . PHE A 1 30  ? 123.436 123.409 108.834 1.00 174.56 ?  67  PHE A CD2   1 
ATOM 218   C CE1   . PHE A 1 30  ? 123.110 120.921 109.921 1.00 174.56 ?  67  PHE A CE1   1 
ATOM 219   C CE2   . PHE A 1 30  ? 122.466 122.586 108.354 1.00 174.56 ?  67  PHE A CE2   1 
ATOM 220   C CZ    . PHE A 1 30  ? 122.302 121.339 108.897 1.00 174.56 ?  67  PHE A CZ    1 
ATOM 221   N N     . SER A 1 31  ? 127.799 124.188 108.103 1.00 183.76 ?  68  SER A N     1 
ATOM 222   C CA    . SER A 1 31  ? 128.318 123.965 106.761 1.00 183.76 ?  68  SER A CA    1 
ATOM 223   C C     . SER A 1 31  ? 129.494 123.002 106.793 1.00 183.76 ?  68  SER A C     1 
ATOM 224   O O     . SER A 1 31  ? 129.580 122.088 105.967 1.00 183.76 ?  68  SER A O     1 
ATOM 225   C CB    . SER A 1 31  ? 128.729 125.286 106.119 1.00 183.76 ?  68  SER A CB    1 
ATOM 226   O OG    . SER A 1 31  ? 129.255 125.070 104.821 1.00 183.76 ?  68  SER A OG    1 
ATOM 227   N N     . ARG A 1 32  ? 130.401 123.174 107.757 1.00 188.82 ?  69  ARG A N     1 
ATOM 228   C CA    . ARG A 1 32  ? 131.583 122.321 107.801 1.00 188.82 ?  69  ARG A CA    1 
ATOM 229   C C     . ARG A 1 32  ? 131.274 120.930 108.331 1.00 188.82 ?  69  ARG A C     1 
ATOM 230   O O     . ARG A 1 32  ? 132.159 120.071 108.340 1.00 188.82 ?  69  ARG A O     1 
ATOM 231   C CB    . ARG A 1 32  ? 132.687 122.959 108.637 1.00 188.82 ?  69  ARG A CB    1 
ATOM 232   C CG    . ARG A 1 32  ? 133.385 124.113 107.957 1.00 188.82 ?  69  ARG A CG    1 
ATOM 233   C CD    . ARG A 1 32  ? 134.582 124.572 108.767 1.00 188.82 ?  69  ARG A CD    1 
ATOM 234   N NE    . ARG A 1 32  ? 134.197 125.259 109.993 1.00 188.82 ?  69  ARG A NE    1 
ATOM 235   C CZ    . ARG A 1 32  ? 134.333 124.740 111.206 1.00 188.82 ?  69  ARG A CZ    1 
ATOM 236   N NH1   . ARG A 1 32  ? 134.822 123.517 111.349 1.00 188.82 ?  69  ARG A NH1   1 
ATOM 237   N NH2   . ARG A 1 32  ? 133.961 125.432 112.272 1.00 188.82 ?  69  ARG A NH2   1 
ATOM 238   N N     . LEU A 1 33  ? 130.050 120.684 108.794 1.00 193.59 ?  70  LEU A N     1 
ATOM 239   C CA    . LEU A 1 33  ? 129.637 119.306 109.008 1.00 193.59 ?  70  LEU A CA    1 
ATOM 240   C C     . LEU A 1 33  ? 129.167 118.683 107.704 1.00 193.59 ?  70  LEU A C     1 
ATOM 241   O O     . LEU A 1 33  ? 129.411 117.501 107.445 1.00 193.59 ?  70  LEU A O     1 
ATOM 242   C CB    . LEU A 1 33  ? 128.543 119.229 110.068 1.00 193.59 ?  70  LEU A CB    1 
ATOM 243   C CG    . LEU A 1 33  ? 128.123 117.802 110.406 1.00 193.59 ?  70  LEU A CG    1 
ATOM 244   C CD1   . LEU A 1 33  ? 129.319 117.060 110.921 1.00 193.59 ?  70  LEU A CD1   1 
ATOM 245   C CD2   . LEU A 1 33  ? 127.014 117.784 111.423 1.00 193.59 ?  70  LEU A CD2   1 
ATOM 246   N N     . ALA A 1 34  ? 128.515 119.473 106.852 1.00 185.10 ?  71  ALA A N     1 
ATOM 247   C CA    . ALA A 1 34  ? 127.971 118.909 105.624 1.00 185.10 ?  71  ALA A CA    1 
ATOM 248   C C     . ALA A 1 34  ? 129.069 118.610 104.618 1.00 185.10 ?  71  ALA A C     1 
ATOM 249   O O     . ALA A 1 34  ? 129.105 117.513 104.053 1.00 185.10 ?  71  ALA A O     1 
ATOM 250   C CB    . ALA A 1 34  ? 126.936 119.849 105.020 1.00 185.10 ?  71  ALA A CB    1 
ATOM 251   N N     . ARG A 1 35  ? 129.983 119.562 104.401 1.00 186.26 ?  72  ARG A N     1 
ATOM 252   C CA    . ARG A 1 35  ? 131.009 119.415 103.371 1.00 186.26 ?  72  ARG A CA    1 
ATOM 253   C C     . ARG A 1 35  ? 131.971 118.273 103.669 1.00 186.26 ?  72  ARG A C     1 
ATOM 254   O O     . ARG A 1 35  ? 132.531 117.684 102.741 1.00 186.26 ?  72  ARG A O     1 
ATOM 255   C CB    . ARG A 1 35  ? 131.792 120.714 103.221 1.00 186.26 ?  72  ARG A CB    1 
ATOM 256   C CG    . ARG A 1 35  ? 131.008 121.879 102.663 1.00 186.26 ?  72  ARG A CG    1 
ATOM 257   C CD    . ARG A 1 35  ? 131.848 123.132 102.762 1.00 186.26 ?  72  ARG A CD    1 
ATOM 258   N NE    . ARG A 1 35  ? 131.112 124.335 102.410 1.00 186.26 ?  72  ARG A NE    1 
ATOM 259   C CZ    . ARG A 1 35  ? 131.116 124.871 101.200 1.00 186.26 ?  72  ARG A CZ    1 
ATOM 260   N NH1   . ARG A 1 35  ? 131.831 124.310 100.241 1.00 186.26 ?  72  ARG A NH1   1 
ATOM 261   N NH2   . ARG A 1 35  ? 130.421 125.970 100.952 1.00 186.26 ?  72  ARG A NH2   1 
ATOM 262   N N     . GLU A 1 36  ? 132.173 117.941 104.942 1.00 200.94 ?  73  GLU A N     1 
ATOM 263   C CA    . GLU A 1 36  ? 132.942 116.746 105.264 1.00 200.94 ?  73  GLU A CA    1 
ATOM 264   C C     . GLU A 1 36  ? 132.149 115.486 104.946 1.00 200.94 ?  73  GLU A C     1 
ATOM 265   O O     . GLU A 1 36  ? 132.707 114.504 104.448 1.00 200.94 ?  73  GLU A O     1 
ATOM 266   C CB    . GLU A 1 36  ? 133.359 116.766 106.732 1.00 200.94 ?  73  GLU A CB    1 
ATOM 267   C CG    . GLU A 1 36  ? 134.174 115.567 107.162 1.00 200.94 ?  73  GLU A CG    1 
ATOM 268   C CD    . GLU A 1 36  ? 134.600 115.641 108.611 1.00 200.94 ?  73  GLU A CD    1 
ATOM 269   O OE1   . GLU A 1 36  ? 134.307 116.659 109.271 1.00 200.94 ?  73  GLU A OE1   1 
ATOM 270   O OE2   . GLU A 1 36  ? 135.212 114.671 109.098 1.00 200.94 -1 73  GLU A OE2   1 
ATOM 271   N N     . ILE A 1 37  ? 130.846 115.492 105.216 1.00 192.60 ?  74  ILE A N     1 
ATOM 272   C CA    . ILE A 1 37  ? 130.041 114.307 104.946 1.00 192.60 ?  74  ILE A CA    1 
ATOM 273   C C     . ILE A 1 37  ? 129.684 114.239 103.466 1.00 192.60 ?  74  ILE A C     1 
ATOM 274   O O     . ILE A 1 37  ? 129.493 113.153 102.905 1.00 192.60 ?  74  ILE A O     1 
ATOM 275   C CB    . ILE A 1 37  ? 128.813 114.308 105.873 1.00 192.60 ?  74  ILE A CB    1 
ATOM 276   C CG1   . ILE A 1 37  ? 129.294 114.233 107.314 1.00 192.60 ?  74  ILE A CG1   1 
ATOM 277   C CG2   . ILE A 1 37  ? 127.915 113.116 105.662 1.00 192.60 ?  74  ILE A CG2   1 
ATOM 278   C CD1   . ILE A 1 37  ? 128.216 114.464 108.329 1.00 192.60 ?  74  ILE A CD1   1 
ATOM 279   N N     . CYS A 1 38  ? 129.673 115.386 102.788 1.00 204.23 ?  75  CYS A N     1 
ATOM 280   C CA    . CYS A 1 38  ? 129.430 115.383 101.350 1.00 204.23 ?  75  CYS A CA    1 
ATOM 281   C C     . CYS A 1 38  ? 130.617 114.821 100.582 1.00 204.23 ?  75  CYS A C     1 
ATOM 282   O O     . CYS A 1 38  ? 130.459 114.375 99.445  1.00 204.23 ?  75  CYS A O     1 
ATOM 283   C CB    . CYS A 1 38  ? 129.114 116.796 100.866 1.00 204.23 ?  75  CYS A CB    1 
ATOM 284   S SG    . CYS A 1 38  ? 128.591 116.946 99.150  1.00 204.23 ?  75  CYS A SG    1 
ATOM 285   N N     . VAL A 1 39  ? 131.809 114.822 101.178 1.00 204.65 ?  76  VAL A N     1 
ATOM 286   C CA    . VAL A 1 39  ? 132.968 114.343 100.438 1.00 204.65 ?  76  VAL A CA    1 
ATOM 287   C C     . VAL A 1 39  ? 133.276 112.881 100.750 1.00 204.65 ?  76  VAL A C     1 
ATOM 288   O O     . VAL A 1 39  ? 134.069 112.257 100.038 1.00 204.65 ?  76  VAL A O     1 
ATOM 289   C CB    . VAL A 1 39  ? 134.185 115.246 100.710 1.00 204.65 ?  76  VAL A CB    1 
ATOM 290   C CG1   . VAL A 1 39  ? 134.871 114.876 102.007 1.00 204.65 ?  76  VAL A CG1   1 
ATOM 291   C CG2   . VAL A 1 39  ? 135.148 115.263 99.532  1.00 204.65 ?  76  VAL A CG2   1 
ATOM 292   N N     . LYS A 1 40  ? 132.662 112.298 101.785 1.00 215.27 ?  77  LYS A N     1 
ATOM 293   C CA    . LYS A 1 40  ? 132.811 110.858 101.990 1.00 215.27 ?  77  LYS A CA    1 
ATOM 294   C C     . LYS A 1 40  ? 132.009 110.064 100.974 1.00 215.27 ?  77  LYS A C     1 
ATOM 295   O O     . LYS A 1 40  ? 132.327 108.902 100.707 1.00 215.27 ?  77  LYS A O     1 
ATOM 296   C CB    . LYS A 1 40  ? 132.395 110.449 103.401 1.00 215.27 ?  77  LYS A CB    1 
ATOM 297   C CG    . LYS A 1 40  ? 133.454 110.673 104.458 1.00 215.27 ?  77  LYS A CG    1 
ATOM 298   C CD    . LYS A 1 40  ? 132.900 110.394 105.844 1.00 215.27 ?  77  LYS A CD    1 
ATOM 299   C CE    . LYS A 1 40  ? 132.582 108.926 106.051 1.00 215.27 ?  77  LYS A CE    1 
ATOM 300   N NZ    . LYS A 1 40  ? 132.137 108.671 107.449 1.00 215.27 ?  77  LYS A NZ    1 
ATOM 301   N N     . PHE A 1 41  ? 130.969 110.660 100.411 1.00 191.35 ?  78  PHE A N     1 
ATOM 302   C CA    . PHE A 1 41  ? 130.307 110.116 99.238  1.00 191.35 ?  78  PHE A CA    1 
ATOM 303   C C     . PHE A 1 41  ? 130.869 110.860 98.045  1.00 191.35 ?  78  PHE A C     1 
ATOM 304   O O     . PHE A 1 41  ? 131.359 111.982 98.202  1.00 191.35 ?  78  PHE A O     1 
ATOM 305   C CB    . PHE A 1 41  ? 128.792 110.309 99.291  1.00 191.35 ?  78  PHE A CB    1 
ATOM 306   C CG    . PHE A 1 41  ? 128.119 109.578 100.403 1.00 191.35 ?  78  PHE A CG    1 
ATOM 307   C CD1   . PHE A 1 41  ? 128.742 108.531 101.058 1.00 191.35 ?  78  PHE A CD1   1 
ATOM 308   C CD2   . PHE A 1 41  ? 126.854 109.953 100.800 1.00 191.35 ?  78  PHE A CD2   1 
ATOM 309   C CE1   . PHE A 1 41  ? 128.120 107.877 102.085 1.00 191.35 ?  78  PHE A CE1   1 
ATOM 310   C CE2   . PHE A 1 41  ? 126.227 109.301 101.827 1.00 191.35 ?  78  PHE A CE2   1 
ATOM 311   C CZ    . PHE A 1 41  ? 126.857 108.260 102.469 1.00 191.35 ?  78  PHE A CZ    1 
ATOM 312   N N     . THR A 1 42  ? 130.763 110.250 96.862  1.00 196.33 ?  79  THR A N     1 
ATOM 313   C CA    . THR A 1 42  ? 131.210 110.810 95.580  1.00 196.33 ?  79  THR A CA    1 
ATOM 314   C C     . THR A 1 42  ? 132.661 111.279 95.667  1.00 196.33 ?  79  THR A C     1 
ATOM 315   O O     . THR A 1 42  ? 132.968 112.470 95.629  1.00 196.33 ?  79  THR A O     1 
ATOM 316   C CB    . THR A 1 42  ? 130.297 111.946 95.127  1.00 196.33 ?  79  THR A CB    1 
ATOM 317   O OG1   . THR A 1 42  ? 130.438 113.048 96.027  1.00 196.33 ?  79  THR A OG1   1 
ATOM 318   C CG2   . THR A 1 42  ? 128.863 111.481 95.144  1.00 196.33 ?  79  THR A CG2   1 
ATOM 319   N N     . ARG A 1 43  ? 133.522 110.277 95.824  1.00 243.22 ?  80  ARG A N     1 
ATOM 320   C CA    . ARG A 1 43  ? 134.870 110.443 96.350  1.00 243.22 ?  80  ARG A CA    1 
ATOM 321   C C     . ARG A 1 43  ? 135.717 111.363 95.486  1.00 243.22 ?  80  ARG A C     1 
ATOM 322   O O     . ARG A 1 43  ? 135.559 111.434 94.267  1.00 243.22 ?  80  ARG A O     1 
ATOM 323   C CB    . ARG A 1 43  ? 135.554 109.077 96.500  1.00 243.22 ?  80  ARG A CB    1 
ATOM 324   C CG    . ARG A 1 43  ? 135.835 108.299 95.207  1.00 243.22 ?  80  ARG A CG    1 
ATOM 325   C CD    . ARG A 1 43  ? 134.651 107.406 94.806  1.00 243.22 ?  80  ARG A CD    1 
ATOM 326   N NE    . ARG A 1 43  ? 134.962 106.481 93.723  1.00 243.22 ?  80  ARG A NE    1 
ATOM 327   C CZ    . ARG A 1 43  ? 134.050 105.758 93.078  1.00 243.22 ?  80  ARG A CZ    1 
ATOM 328   N NH1   . ARG A 1 43  ? 132.770 105.851 93.413  1.00 243.22 ?  80  ARG A NH1   1 
ATOM 329   N NH2   . ARG A 1 43  ? 134.420 104.937 92.104  1.00 243.22 ?  80  ARG A NH2   1 
ATOM 330   N N     . GLY A 1 44  ? 136.586 112.115 96.150  1.00 238.92 ?  81  GLY A N     1 
ATOM 331   C CA    . GLY A 1 44  ? 137.495 113.007 95.470  1.00 238.92 ?  81  GLY A CA    1 
ATOM 332   C C     . GLY A 1 44  ? 136.969 114.411 95.280  1.00 238.92 ?  81  GLY A C     1 
ATOM 333   O O     . GLY A 1 44  ? 137.575 115.367 95.767  1.00 238.92 ?  81  GLY A O     1 
ATOM 334   N N     . VAL A 1 45  ? 135.847 114.562 94.586  1.00 224.76 ?  82  VAL A N     1 
ATOM 335   C CA    . VAL A 1 45  ? 135.356 115.882 94.215  1.00 224.76 ?  82  VAL A CA    1 
ATOM 336   C C     . VAL A 1 45  ? 134.549 116.433 95.378  1.00 224.76 ?  82  VAL A C     1 
ATOM 337   O O     . VAL A 1 45  ? 133.425 115.991 95.621  1.00 224.76 ?  82  VAL A O     1 
ATOM 338   C CB    . VAL A 1 45  ? 134.494 115.842 92.950  1.00 224.76 ?  82  VAL A CB    1 
ATOM 339   C CG1   . VAL A 1 45  ? 134.039 117.245 92.599  1.00 224.76 ?  82  VAL A CG1   1 
ATOM 340   C CG2   . VAL A 1 45  ? 135.229 115.217 91.798  1.00 224.76 ?  82  VAL A CG2   1 
ATOM 341   N N     . ASP A 1 46  ? 135.108 117.402 96.092  1.00 221.19 ?  83  ASP A N     1 
ATOM 342   C CA    . ASP A 1 46  ? 134.258 118.213 96.944  1.00 221.19 ?  83  ASP A CA    1 
ATOM 343   C C     . ASP A 1 46  ? 133.382 119.105 96.077  1.00 221.19 ?  83  ASP A C     1 
ATOM 344   O O     . ASP A 1 46  ? 133.842 119.743 95.130  1.00 221.19 ?  83  ASP A O     1 
ATOM 345   C CB    . ASP A 1 46  ? 135.082 119.037 97.935  1.00 221.19 ?  83  ASP A CB    1 
ATOM 346   C CG    . ASP A 1 46  ? 136.188 119.841 97.276  1.00 221.19 ?  83  ASP A CG    1 
ATOM 347   O OD1   . ASP A 1 46  ? 136.483 119.630 96.084  1.00 221.19 ?  83  ASP A OD1   1 
ATOM 348   O OD2   . ASP A 1 46  ? 136.764 120.706 97.966  1.00 221.19 -1 83  ASP A OD2   1 
ATOM 349   N N     . PHE A 1 47  ? 132.105 119.131 96.392  1.00 185.59 ?  84  PHE A N     1 
ATOM 350   C CA    . PHE A 1 47  ? 131.133 119.762 95.521  1.00 185.59 ?  84  PHE A CA    1 
ATOM 351   C C     . PHE A 1 47  ? 130.992 121.229 95.869  1.00 185.59 ?  84  PHE A C     1 
ATOM 352   O O     . PHE A 1 47  ? 131.792 121.802 96.605  1.00 185.59 ?  84  PHE A O     1 
ATOM 353   C CB    . PHE A 1 47  ? 129.797 119.036 95.601  1.00 185.59 ?  84  PHE A CB    1 
ATOM 354   C CG    . PHE A 1 47  ? 129.709 117.860 94.705  1.00 185.59 ?  84  PHE A CG    1 
ATOM 355   C CD1   . PHE A 1 47  ? 129.172 117.995 93.442  1.00 185.59 ?  84  PHE A CD1   1 
ATOM 356   C CD2   . PHE A 1 47  ? 130.221 116.642 95.085  1.00 185.59 ?  84  PHE A CD2   1 
ATOM 357   C CE1   . PHE A 1 47  ? 129.094 116.927 92.596  1.00 185.59 ?  84  PHE A CE1   1 
ATOM 358   C CE2   . PHE A 1 47  ? 130.157 115.570 94.233  1.00 185.59 ?  84  PHE A CE2   1 
ATOM 359   C CZ    . PHE A 1 47  ? 129.590 115.710 92.992  1.00 185.59 ?  84  PHE A CZ    1 
ATOM 360   N N     . ASN A 1 48  ? 129.972 121.838 95.301  1.00 185.30 ?  85  ASN A N     1 
ATOM 361   C CA    . ASN A 1 48  ? 129.717 123.250 95.467  1.00 185.30 ?  85  ASN A CA    1 
ATOM 362   C C     . ASN A 1 48  ? 128.258 123.429 95.864  1.00 185.30 ?  85  ASN A C     1 
ATOM 363   O O     . ASN A 1 48  ? 127.360 122.843 95.257  1.00 185.30 ?  85  ASN A O     1 
ATOM 364   C CB    . ASN A 1 48  ? 130.038 123.992 94.175  1.00 185.30 ?  85  ASN A CB    1 
ATOM 365   C CG    . ASN A 1 48  ? 130.165 125.469 94.379  1.00 185.30 ?  85  ASN A CG    1 
ATOM 366   O OD1   . ASN A 1 48  ? 130.035 125.953 95.494  1.00 185.30 ?  85  ASN A OD1   1 
ATOM 367   N ND2   . ASN A 1 48  ? 130.412 126.203 93.302  1.00 185.30 ?  85  ASN A ND2   1 
ATOM 368   N N     . TRP A 1 49  ? 128.028 124.233 96.898  1.00 181.90 ?  86  TRP A N     1 
ATOM 369   C CA    . TRP A 1 49  ? 126.721 124.342 97.534  1.00 181.90 ?  86  TRP A CA    1 
ATOM 370   C C     . TRP A 1 49  ? 126.120 125.716 97.300  1.00 181.90 ?  86  TRP A C     1 
ATOM 371   O O     . TRP A 1 49  ? 126.770 126.729 97.567  1.00 181.90 ?  86  TRP A O     1 
ATOM 372   C CB    . TRP A 1 49  ? 126.833 124.089 99.035  1.00 181.90 ?  86  TRP A CB    1 
ATOM 373   C CG    . TRP A 1 49  ? 127.066 122.674 99.374  1.00 181.90 ?  86  TRP A CG    1 
ATOM 374   C CD1   . TRP A 1 49  ? 128.260 122.070 99.585  1.00 181.90 ?  86  TRP A CD1   1 
ATOM 375   C CD2   . TRP A 1 49  ? 126.070 121.671 99.560  1.00 181.90 ?  86  TRP A CD2   1 
ATOM 376   N NE1   . TRP A 1 49  ? 128.073 120.745 99.881  1.00 181.90 ?  86  TRP A NE1   1 
ATOM 377   C CE2   . TRP A 1 49  ? 126.732 120.478 99.869  1.00 181.90 ?  86  TRP A CE2   1 
ATOM 378   C CE3   . TRP A 1 49  ? 124.679 121.668 99.490  1.00 181.90 ?  86  TRP A CE3   1 
ATOM 379   C CZ2   . TRP A 1 49  ? 126.054 119.299 100.108 1.00 181.90 ?  86  TRP A CZ2   1 
ATOM 380   C CZ3   . TRP A 1 49  ? 124.012 120.501 99.727  1.00 181.90 ?  86  TRP A CZ3   1 
ATOM 381   C CH2   . TRP A 1 49  ? 124.696 119.331 100.030 1.00 181.90 ?  86  TRP A CH2   1 
ATOM 382   N N     . GLN A 1 50  ? 124.886 125.754 96.808  1.00 174.36 ?  87  GLN A N     1 
ATOM 383   C CA    . GLN A 1 50  ? 124.155 127.008 96.806  1.00 174.36 ?  87  GLN A CA    1 
ATOM 384   C C     . GLN A 1 50  ? 123.778 127.379 98.230  1.00 174.36 ?  87  GLN A C     1 
ATOM 385   O O     . GLN A 1 50  ? 123.546 126.518 99.078  1.00 174.36 ?  87  GLN A O     1 
ATOM 386   C CB    . GLN A 1 50  ? 122.892 126.925 95.951  1.00 174.36 ?  87  GLN A CB    1 
ATOM 387   C CG    . GLN A 1 50  ? 123.124 126.814 94.461  1.00 174.36 ?  87  GLN A CG    1 
ATOM 388   C CD    . GLN A 1 50  ? 121.832 126.888 93.670  1.00 174.36 ?  87  GLN A CD    1 
ATOM 389   O OE1   . GLN A 1 50  ? 120.746 126.967 94.236  1.00 174.36 ?  87  GLN A OE1   1 
ATOM 390   N NE2   . GLN A 1 50  ? 121.948 126.872 92.352  1.00 174.36 ?  87  GLN A NE2   1 
ATOM 391   N N     . ALA A 1 51  ? 123.699 128.685 98.484  1.00 169.86 ?  88  ALA A N     1 
ATOM 392   C CA    . ALA A 1 51  ? 123.413 129.153 99.835  1.00 169.86 ?  88  ALA A CA    1 
ATOM 393   C C     . ALA A 1 51  ? 121.945 128.984 100.200 1.00 169.86 ?  88  ALA A C     1 
ATOM 394   O O     . ALA A 1 51  ? 121.572 129.200 101.355 1.00 169.86 ?  88  ALA A O     1 
ATOM 395   C CB    . ALA A 1 51  ? 123.834 130.611 99.990  1.00 169.86 ?  88  ALA A CB    1 
ATOM 396   N N     . GLN A 1 52  ? 121.097 128.623 99.241  1.00 165.90 ?  89  GLN A N     1 
ATOM 397   C CA    . GLN A 1 52  ? 119.736 128.237 99.585  1.00 165.90 ?  89  GLN A CA    1 
ATOM 398   C C     . GLN A 1 52  ? 119.664 126.781 100.013 1.00 165.90 ?  89  GLN A C     1 
ATOM 399   O O     . GLN A 1 52  ? 118.668 126.353 100.602 1.00 165.90 ?  89  GLN A O     1 
ATOM 400   C CB    . GLN A 1 52  ? 118.801 128.500 98.415  1.00 165.90 ?  89  GLN A CB    1 
ATOM 401   C CG    . GLN A 1 52  ? 118.503 129.947 98.245  1.00 165.90 ?  89  GLN A CG    1 
ATOM 402   C CD    . GLN A 1 52  ? 117.752 130.486 99.429  1.00 165.90 ?  89  GLN A CD    1 
ATOM 403   O OE1   . GLN A 1 52  ? 118.301 131.222 100.243 1.00 165.90 ?  89  GLN A OE1   1 
ATOM 404   N NE2   . GLN A 1 52  ? 116.484 130.123 99.535  1.00 165.90 ?  89  GLN A NE2   1 
ATOM 405   N N     . ALA A 1 53  ? 120.702 126.001 99.732  1.00 156.89 ?  90  ALA A N     1 
ATOM 406   C CA    . ALA A 1 53  ? 120.643 124.595 100.101 1.00 156.89 ?  90  ALA A CA    1 
ATOM 407   C C     . ALA A 1 53  ? 120.976 124.392 101.571 1.00 156.89 ?  90  ALA A C     1 
ATOM 408   O O     . ALA A 1 53  ? 120.370 123.544 102.234 1.00 156.89 ?  90  ALA A O     1 
ATOM 409   C CB    . ALA A 1 53  ? 121.577 123.779 99.220  1.00 156.89 ?  90  ALA A CB    1 
ATOM 410   N N     . LEU A 1 54  ? 121.939 125.150 102.100 1.00 160.58 ?  91  LEU A N     1 
ATOM 411   C CA    . LEU A 1 54  ? 122.262 125.032 103.517 1.00 160.58 ?  91  LEU A CA    1 
ATOM 412   C C     . LEU A 1 54  ? 121.129 125.532 104.392 1.00 160.58 ?  91  LEU A C     1 
ATOM 413   O O     . LEU A 1 54  ? 120.904 124.989 105.476 1.00 160.58 ?  91  LEU A O     1 
ATOM 414   C CB    . LEU A 1 54  ? 123.540 125.787 103.849 1.00 160.58 ?  91  LEU A CB    1 
ATOM 415   C CG    . LEU A 1 54  ? 124.812 125.182 103.279 1.00 160.58 ?  91  LEU A CG    1 
ATOM 416   C CD1   . LEU A 1 54  ? 126.011 126.014 103.689 1.00 160.58 ?  91  LEU A CD1   1 
ATOM 417   C CD2   . LEU A 1 54  ? 124.954 123.763 103.742 1.00 160.58 ?  91  LEU A CD2   1 
ATOM 418   N N     . LEU A 1 55  ? 120.375 126.526 103.930 1.00 160.05 ?  92  LEU A N     1 
ATOM 419   C CA    . LEU A 1 55  ? 119.172 126.900 104.661 1.00 160.05 ?  92  LEU A CA    1 
ATOM 420   C C     . LEU A 1 55  ? 117.999 125.997 104.317 1.00 160.05 ?  92  LEU A C     1 
ATOM 421   O O     . LEU A 1 55  ? 116.872 126.276 104.731 1.00 160.05 ?  92  LEU A O     1 
ATOM 422   C CB    . LEU A 1 55  ? 118.803 128.352 104.392 1.00 160.05 ?  92  LEU A CB    1 
ATOM 423   C CG    . LEU A 1 55  ? 119.789 129.350 104.978 1.00 160.05 ?  92  LEU A CG    1 
ATOM 424   C CD1   . LEU A 1 55  ? 119.411 130.758 104.587 1.00 160.05 ?  92  LEU A CD1   1 
ATOM 425   C CD2   . LEU A 1 55  ? 119.815 129.206 106.476 1.00 160.05 ?  92  LEU A CD2   1 
ATOM 426   N N     . ALA A 1 56  ? 118.231 124.932 103.551 1.00 165.12 ?  93  ALA A N     1 
ATOM 427   C CA    . ALA A 1 56  ? 117.170 123.967 103.315 1.00 165.12 ?  93  ALA A CA    1 
ATOM 428   C C     . ALA A 1 56  ? 117.360 122.705 104.144 1.00 165.12 ?  93  ALA A C     1 
ATOM 429   O O     . ALA A 1 56  ? 116.379 122.019 104.443 1.00 165.12 ?  93  ALA A O     1 
ATOM 430   C CB    . ALA A 1 56  ? 117.080 123.635 101.832 1.00 165.12 ?  93  ALA A CB    1 
ATOM 431   N N     . LEU A 1 57  ? 118.596 122.369 104.518 1.00 162.87 ?  94  LEU A N     1 
ATOM 432   C CA    . LEU A 1 57  ? 118.765 121.312 105.507 1.00 162.87 ?  94  LEU A CA    1 
ATOM 433   C C     . LEU A 1 57  ? 118.422 121.813 106.893 1.00 162.87 ?  94  LEU A C     1 
ATOM 434   O O     . LEU A 1 57  ? 117.817 121.090 107.690 1.00 162.87 ?  94  LEU A O     1 
ATOM 435   C CB    . LEU A 1 57  ? 120.187 120.775 105.515 1.00 162.87 ?  94  LEU A CB    1 
ATOM 436   C CG    . LEU A 1 57  ? 120.638 119.934 104.346 1.00 162.87 ?  94  LEU A CG    1 
ATOM 437   C CD1   . LEU A 1 57  ? 122.053 119.494 104.605 1.00 162.87 ?  94  LEU A CD1   1 
ATOM 438   C CD2   . LEU A 1 57  ? 119.722 118.769 104.217 1.00 162.87 ?  94  LEU A CD2   1 
ATOM 439   N N     . GLN A 1 58  ? 118.806 123.047 107.198 1.00 173.11 ?  95  GLN A N     1 
ATOM 440   C CA    . GLN A 1 58  ? 118.704 123.532 108.564 1.00 173.11 ?  95  GLN A CA    1 
ATOM 441   C C     . GLN A 1 58  ? 117.258 123.828 108.937 1.00 173.11 ?  95  GLN A C     1 
ATOM 442   O O     . GLN A 1 58  ? 116.920 123.878 110.121 1.00 173.11 ?  95  GLN A O     1 
ATOM 443   C CB    . GLN A 1 58  ? 119.607 124.751 108.725 1.00 173.11 ?  95  GLN A CB    1 
ATOM 444   C CG    . GLN A 1 58  ? 119.849 125.192 110.134 1.00 173.11 ?  95  GLN A CG    1 
ATOM 445   C CD    . GLN A 1 58  ? 120.886 126.273 110.205 1.00 173.11 ?  95  GLN A CD    1 
ATOM 446   O OE1   . GLN A 1 58  ? 121.450 126.675 109.190 1.00 173.11 ?  95  GLN A OE1   1 
ATOM 447   N NE2   . GLN A 1 58  ? 121.141 126.766 111.407 1.00 173.11 ?  95  GLN A NE2   1 
ATOM 448   N N     . GLU A 1 59  ? 116.381 123.976 107.949 1.00 171.66 ?  96  GLU A N     1 
ATOM 449   C CA    . GLU A 1 59  ? 114.959 123.987 108.254 1.00 171.66 ?  96  GLU A CA    1 
ATOM 450   C C     . GLU A 1 59  ? 114.354 122.603 108.114 1.00 171.66 ?  96  GLU A C     1 
ATOM 451   O O     . GLU A 1 59  ? 113.129 122.456 108.108 1.00 171.66 ?  96  GLU A O     1 
ATOM 452   C CB    . GLU A 1 59  ? 114.228 124.982 107.369 1.00 171.66 ?  96  GLU A CB    1 
ATOM 453   C CG    . GLU A 1 59  ? 114.464 126.399 107.776 1.00 171.66 ?  96  GLU A CG    1 
ATOM 454   C CD    . GLU A 1 59  ? 113.820 126.707 109.097 1.00 171.66 ?  96  GLU A CD    1 
ATOM 455   O OE1   . GLU A 1 59  ? 112.742 126.146 109.374 1.00 171.66 ?  96  GLU A OE1   1 
ATOM 456   O OE2   . GLU A 1 59  ? 114.390 127.505 109.866 1.00 171.66 -1 96  GLU A OE2   1 
ATOM 457   N N     . ALA A 1 60  ? 115.188 121.578 107.982 1.00 170.04 ?  97  ALA A N     1 
ATOM 458   C CA    . ALA A 1 60  ? 114.678 120.221 108.100 1.00 170.04 ?  97  ALA A CA    1 
ATOM 459   C C     . ALA A 1 60  ? 115.339 119.502 109.261 1.00 170.04 ?  97  ALA A C     1 
ATOM 460   O O     . ALA A 1 60  ? 114.691 118.715 109.956 1.00 170.04 ?  97  ALA A O     1 
ATOM 461   C CB    . ALA A 1 60  ? 114.893 119.455 106.802 1.00 170.04 ?  97  ALA A CB    1 
ATOM 462   N N     . ALA A 1 61  ? 116.630 119.760 109.481 1.00 169.13 ?  98  ALA A N     1 
ATOM 463   C CA    . ALA A 1 61  ? 117.333 119.164 110.611 1.00 169.13 ?  98  ALA A CA    1 
ATOM 464   C C     . ALA A 1 61  ? 116.810 119.716 111.927 1.00 169.13 ?  98  ALA A C     1 
ATOM 465   O O     . ALA A 1 61  ? 116.337 118.960 112.782 1.00 169.13 ?  98  ALA A O     1 
ATOM 466   C CB    . ALA A 1 61  ? 118.832 119.407 110.485 1.00 169.13 ?  98  ALA A CB    1 
ATOM 467   N N     . GLU A 1 62  ? 116.826 121.039 112.087 1.00 178.92 ?  99  GLU A N     1 
ATOM 468   C CA    . GLU A 1 62  ? 116.272 121.647 113.290 1.00 178.92 ?  99  GLU A CA    1 
ATOM 469   C C     . GLU A 1 62  ? 114.753 121.672 113.314 1.00 178.92 ?  99  GLU A C     1 
ATOM 470   O O     . GLU A 1 62  ? 114.182 122.300 114.209 1.00 178.92 ?  99  GLU A O     1 
ATOM 471   C CB    . GLU A 1 62  ? 116.781 123.067 113.466 1.00 178.92 ?  99  GLU A CB    1 
ATOM 472   C CG    . GLU A 1 62  ? 118.227 123.159 113.859 1.00 178.92 ?  99  GLU A CG    1 
ATOM 473   C CD    . GLU A 1 62  ? 118.651 124.591 114.127 1.00 178.92 ?  99  GLU A CD    1 
ATOM 474   O OE1   . GLU A 1 62  ? 117.850 125.514 113.869 1.00 178.92 ?  99  GLU A OE1   1 
ATOM 475   O OE2   . GLU A 1 62  ? 119.778 124.807 114.610 1.00 178.92 -1 99  GLU A OE2   1 
ATOM 476   N N     . ALA A 1 63  ? 114.087 121.049 112.350 1.00 172.63 ?  100 ALA A N     1 
ATOM 477   C CA    . ALA A 1 63  ? 112.692 120.692 112.522 1.00 172.63 ?  100 ALA A CA    1 
ATOM 478   C C     . ALA A 1 63  ? 112.525 119.206 112.766 1.00 172.63 ?  100 ALA A C     1 
ATOM 479   O O     . ALA A 1 63  ? 111.478 118.784 113.263 1.00 172.63 ?  100 ALA A O     1 
ATOM 480   C CB    . ALA A 1 63  ? 111.868 121.107 111.304 1.00 172.63 ?  100 ALA A CB    1 
ATOM 481   N N     . PHE A 1 64  ? 113.529 118.398 112.428 1.00 161.44 ?  101 PHE A N     1 
ATOM 482   C CA    . PHE A 1 64  ? 113.452 116.990 112.789 1.00 161.44 ?  101 PHE A CA    1 
ATOM 483   C C     . PHE A 1 64  ? 113.770 116.780 114.255 1.00 161.44 ?  101 PHE A C     1 
ATOM 484   O O     . PHE A 1 64  ? 113.000 116.126 114.964 1.00 161.44 ?  101 PHE A O     1 
ATOM 485   C CB    . PHE A 1 64  ? 114.391 116.147 111.942 1.00 161.44 ?  101 PHE A CB    1 
ATOM 486   C CG    . PHE A 1 64  ? 114.407 114.709 112.332 1.00 161.44 ?  101 PHE A CG    1 
ATOM 487   C CD1   . PHE A 1 64  ? 113.318 113.908 112.084 1.00 161.44 ?  101 PHE A CD1   1 
ATOM 488   C CD2   . PHE A 1 64  ? 115.516 114.160 112.941 1.00 161.44 ?  101 PHE A CD2   1 
ATOM 489   C CE1   . PHE A 1 64  ? 113.332 112.587 112.436 1.00 161.44 ?  101 PHE A CE1   1 
ATOM 490   C CE2   . PHE A 1 64  ? 115.536 112.840 113.294 1.00 161.44 ?  101 PHE A CE2   1 
ATOM 491   C CZ    . PHE A 1 64  ? 114.445 112.053 113.046 1.00 161.44 ?  101 PHE A CZ    1 
ATOM 492   N N     . LEU A 1 65  ? 114.903 117.314 114.724 1.00 166.93 ?  102 LEU A N     1 
ATOM 493   C CA    . LEU A 1 65  ? 115.343 117.026 116.085 1.00 166.93 ?  102 LEU A CA    1 
ATOM 494   C C     . LEU A 1 65  ? 114.415 117.650 117.111 1.00 166.93 ?  102 LEU A C     1 
ATOM 495   O O     . LEU A 1 65  ? 114.243 117.107 118.205 1.00 166.93 ?  102 LEU A O     1 
ATOM 496   C CB    . LEU A 1 65  ? 116.771 117.505 116.299 1.00 166.93 ?  102 LEU A CB    1 
ATOM 497   C CG    . LEU A 1 65  ? 117.762 116.753 115.427 1.00 166.93 ?  102 LEU A CG    1 
ATOM 498   C CD1   . LEU A 1 65  ? 119.141 117.304 115.642 1.00 166.93 ?  102 LEU A CD1   1 
ATOM 499   C CD2   . LEU A 1 65  ? 117.724 115.288 115.724 1.00 166.93 ?  102 LEU A CD2   1 
ATOM 500   N N     . VAL A 1 66  ? 113.760 118.757 116.763 1.00 170.53 ?  103 VAL A N     1 
ATOM 501   C CA    . VAL A 1 66  ? 112.797 119.305 117.698 1.00 170.53 ?  103 VAL A CA    1 
ATOM 502   C C     . VAL A 1 66  ? 111.524 118.474 117.691 1.00 170.53 ?  103 VAL A C     1 
ATOM 503   O O     . VAL A 1 66  ? 110.768 118.501 118.664 1.00 170.53 ?  103 VAL A O     1 
ATOM 504   C CB    . VAL A 1 66  ? 112.534 120.790 117.396 1.00 170.53 ?  103 VAL A CB    1 
ATOM 505   C CG1   . VAL A 1 66  ? 111.669 120.954 116.175 1.00 170.53 ?  103 VAL A CG1   1 
ATOM 506   C CG2   . VAL A 1 66  ? 111.962 121.497 118.604 1.00 170.53 ?  103 VAL A CG2   1 
ATOM 507   N N     . HIS A 1 67  ? 111.284 117.682 116.649 1.00 174.31 ?  104 HIS A N     1 
ATOM 508   C CA    . HIS A 1 67  ? 110.205 116.716 116.752 1.00 174.31 ?  104 HIS A CA    1 
ATOM 509   C C     . HIS A 1 67  ? 110.671 115.419 117.391 1.00 174.31 ?  104 HIS A C     1 
ATOM 510   O O     . HIS A 1 67  ? 109.845 114.655 117.894 1.00 174.31 ?  104 HIS A O     1 
ATOM 511   C CB    . HIS A 1 67  ? 109.598 116.431 115.383 1.00 174.31 ?  104 HIS A CB    1 
ATOM 512   C CG    . HIS A 1 67  ? 108.385 115.563 115.445 1.00 174.31 ?  104 HIS A CG    1 
ATOM 513   N ND1   . HIS A 1 67  ? 107.153 116.039 115.835 1.00 174.31 ?  104 HIS A ND1   1 
ATOM 514   C CD2   . HIS A 1 67  ? 108.229 114.233 115.246 1.00 174.31 ?  104 HIS A CD2   1 
ATOM 515   C CE1   . HIS A 1 67  ? 106.280 115.048 115.830 1.00 174.31 ?  104 HIS A CE1   1 
ATOM 516   N NE2   . HIS A 1 67  ? 106.907 113.941 115.478 1.00 174.31 ?  104 HIS A NE2   1 
ATOM 517   N N     . LEU A 1 68  ? 111.976 115.165 117.425 1.00 166.75 ?  105 LEU A N     1 
ATOM 518   C CA    . LEU A 1 68  ? 112.432 113.947 118.075 1.00 166.75 ?  105 LEU A CA    1 
ATOM 519   C C     . LEU A 1 68  ? 112.450 114.111 119.582 1.00 166.75 ?  105 LEU A C     1 
ATOM 520   O O     . LEU A 1 68  ? 111.915 113.263 120.297 1.00 166.75 ?  105 LEU A O     1 
ATOM 521   C CB    . LEU A 1 68  ? 113.814 113.549 117.581 1.00 166.75 ?  105 LEU A CB    1 
ATOM 522   C CG    . LEU A 1 68  ? 114.280 112.225 118.156 1.00 166.75 ?  105 LEU A CG    1 
ATOM 523   C CD1   . LEU A 1 68  ? 113.347 111.158 117.676 1.00 166.75 ?  105 LEU A CD1   1 
ATOM 524   C CD2   . LEU A 1 68  ? 115.678 111.934 117.705 1.00 166.75 ?  105 LEU A CD2   1 
ATOM 525   N N     . PHE A 1 69  ? 113.049 115.205 120.073 1.00 169.87 ?  106 PHE A N     1 
ATOM 526   C CA    . PHE A 1 69  ? 113.160 115.450 121.510 1.00 169.87 ?  106 PHE A CA    1 
ATOM 527   C C     . PHE A 1 69  ? 111.811 115.570 122.197 1.00 169.87 ?  106 PHE A C     1 
ATOM 528   O O     . PHE A 1 69  ? 111.642 115.016 123.286 1.00 169.87 ?  106 PHE A O     1 
ATOM 529   C CB    . PHE A 1 69  ? 113.974 116.707 121.775 1.00 169.87 ?  106 PHE A CB    1 
ATOM 530   C CG    . PHE A 1 69  ? 115.442 116.481 121.789 1.00 169.87 ?  106 PHE A CG    1 
ATOM 531   C CD1   . PHE A 1 69  ? 116.069 116.105 122.948 1.00 169.87 ?  106 PHE A CD1   1 
ATOM 532   C CD2   . PHE A 1 69  ? 116.195 116.615 120.644 1.00 169.87 ?  106 PHE A CD2   1 
ATOM 533   C CE1   . PHE A 1 69  ? 117.416 115.887 122.975 1.00 169.87 ?  106 PHE A CE1   1 
ATOM 534   C CE2   . PHE A 1 69  ? 117.546 116.398 120.665 1.00 169.87 ?  106 PHE A CE2   1 
ATOM 535   C CZ    . PHE A 1 69  ? 118.156 116.033 121.833 1.00 169.87 ?  106 PHE A CZ    1 
ATOM 536   N N     . GLU A 1 70  ? 110.859 116.292 121.600 1.00 177.93 ?  107 GLU A N     1 
ATOM 537   C CA    . GLU A 1 70  ? 109.518 116.362 122.170 1.00 177.93 ?  107 GLU A CA    1 
ATOM 538   C C     . GLU A 1 70  ? 108.859 114.990 122.205 1.00 177.93 ?  107 GLU A C     1 
ATOM 539   O O     . GLU A 1 70  ? 108.235 114.617 123.205 1.00 177.93 ?  107 GLU A O     1 
ATOM 540   C CB    . GLU A 1 70  ? 108.647 117.335 121.384 1.00 177.93 ?  107 GLU A CB    1 
ATOM 541   C CG    . GLU A 1 70  ? 107.249 117.464 121.951 1.00 177.93 ?  107 GLU A CG    1 
ATOM 542   C CD    . GLU A 1 70  ? 106.351 118.350 121.125 1.00 177.93 ?  107 GLU A CD    1 
ATOM 543   O OE1   . GLU A 1 70  ? 106.805 118.841 120.073 1.00 177.93 ?  107 GLU A OE1   1 
ATOM 544   O OE2   . GLU A 1 70  ? 105.185 118.550 121.527 1.00 177.93 -1 107 GLU A OE2   1 
ATOM 545   N N     . ASP A 1 71  ? 109.022 114.206 121.143 1.00 176.70 ?  108 ASP A N     1 
ATOM 546   C CA    . ASP A 1 71  ? 108.438 112.873 121.139 1.00 176.70 ?  108 ASP A CA    1 
ATOM 547   C C     . ASP A 1 71  ? 109.333 111.886 121.879 1.00 176.70 ?  108 ASP A C     1 
ATOM 548   O O     . ASP A 1 71  ? 108.918 110.761 122.168 1.00 176.70 ?  108 ASP A O     1 
ATOM 549   C CB    . ASP A 1 71  ? 108.189 112.418 119.706 1.00 176.70 ?  108 ASP A CB    1 
ATOM 550   C CG    . ASP A 1 71  ? 107.161 111.316 119.612 1.00 176.70 ?  108 ASP A CG    1 
ATOM 551   O OD1   . ASP A 1 71  ? 106.572 110.944 120.643 1.00 176.70 ?  108 ASP A OD1   1 
ATOM 552   O OD2   . ASP A 1 71  ? 106.947 110.806 118.495 1.00 176.70 -1 108 ASP A OD2   1 
ATOM 553   N N     . ALA A 1 72  ? 110.573 112.269 122.177 1.00 164.45 ?  109 ALA A N     1 
ATOM 554   C CA    . ALA A 1 72  ? 111.349 111.464 123.111 1.00 164.45 ?  109 ALA A CA    1 
ATOM 555   C C     . ALA A 1 72  ? 111.039 111.822 124.547 1.00 164.45 ?  109 ALA A C     1 
ATOM 556   O O     . ALA A 1 72  ? 111.236 110.992 125.436 1.00 164.45 ?  109 ALA A O     1 
ATOM 557   C CB    . ALA A 1 72  ? 112.846 111.626 122.883 1.00 164.45 ?  109 ALA A CB    1 
ATOM 558   N N     . TYR A 1 73  ? 110.552 113.035 124.791 1.00 176.47 ?  110 TYR A N     1 
ATOM 559   C CA    . TYR A 1 73  ? 110.306 113.459 126.157 1.00 176.47 ?  110 TYR A CA    1 
ATOM 560   C C     . TYR A 1 73  ? 109.072 112.800 126.739 1.00 176.47 ?  110 TYR A C     1 
ATOM 561   O O     . TYR A 1 73  ? 108.950 112.714 127.963 1.00 176.47 ?  110 TYR A O     1 
ATOM 562   C CB    . TYR A 1 73  ? 110.162 114.971 126.222 1.00 176.47 ?  110 TYR A CB    1 
ATOM 563   C CG    . TYR A 1 73  ? 110.198 115.515 127.615 1.00 176.47 ?  110 TYR A CG    1 
ATOM 564   C CD1   . TYR A 1 73  ? 111.395 115.634 128.286 1.00 176.47 ?  110 TYR A CD1   1 
ATOM 565   C CD2   . TYR A 1 73  ? 109.038 115.907 128.257 1.00 176.47 ?  110 TYR A CD2   1 
ATOM 566   C CE1   . TYR A 1 73  ? 111.442 116.130 129.552 1.00 176.47 ?  110 TYR A CE1   1 
ATOM 567   C CE2   . TYR A 1 73  ? 109.073 116.402 129.528 1.00 176.47 ?  110 TYR A CE2   1 
ATOM 568   C CZ    . TYR A 1 73  ? 110.279 116.511 130.172 1.00 176.47 ?  110 TYR A CZ    1 
ATOM 569   O OH    . TYR A 1 73  ? 110.327 117.009 131.449 1.00 176.47 ?  110 TYR A OH    1 
ATOM 570   N N     . LEU A 1 74  ? 108.180 112.276 125.895 1.00 166.87 ?  111 LEU A N     1 
ATOM 571   C CA    . LEU A 1 74  ? 107.034 111.543 126.416 1.00 166.87 ?  111 LEU A CA    1 
ATOM 572   C C     . LEU A 1 74  ? 107.405 110.148 126.886 1.00 166.87 ?  111 LEU A C     1 
ATOM 573   O O     . LEU A 1 74  ? 106.521 109.381 127.274 1.00 166.87 ?  111 LEU A O     1 
ATOM 574   C CB    . LEU A 1 74  ? 105.927 111.447 125.378 1.00 166.87 ?  111 LEU A CB    1 
ATOM 575   C CG    . LEU A 1 74  ? 105.214 112.757 125.096 1.00 166.87 ?  111 LEU A CG    1 
ATOM 576   C CD1   . LEU A 1 74  ? 104.138 112.532 124.082 1.00 166.87 ?  111 LEU A CD1   1 
ATOM 577   C CD2   . LEU A 1 74  ? 104.623 113.300 126.364 1.00 166.87 ?  111 LEU A CD2   1 
ATOM 578   N N     . LEU A 1 75  ? 108.681 109.781 126.843 1.00 171.77 ?  112 LEU A N     1 
ATOM 579   C CA    . LEU A 1 75  ? 109.071 108.525 127.456 1.00 171.77 ?  112 LEU A CA    1 
ATOM 580   C C     . LEU A 1 75  ? 109.658 108.757 128.837 1.00 171.77 ?  112 LEU A C     1 
ATOM 581   O O     . LEU A 1 75  ? 109.660 107.851 129.676 1.00 171.77 ?  112 LEU A O     1 
ATOM 582   C CB    . LEU A 1 75  ? 110.042 107.784 126.551 1.00 171.77 ?  112 LEU A CB    1 
ATOM 583   C CG    . LEU A 1 75  ? 109.396 107.517 125.189 1.00 171.77 ?  112 LEU A CG    1 
ATOM 584   C CD1   . LEU A 1 75  ? 110.309 106.704 124.296 1.00 171.77 ?  112 LEU A CD1   1 
ATOM 585   C CD2   . LEU A 1 75  ? 108.044 106.867 125.305 1.00 171.77 ?  112 LEU A CD2   1 
ATOM 586   N N     . THR A 1 76  ? 110.145 109.967 129.100 1.00 182.70 ?  113 THR A N     1 
ATOM 587   C CA    . THR A 1 76  ? 110.627 110.279 130.438 1.00 182.70 ?  113 THR A CA    1 
ATOM 588   C C     . THR A 1 76  ? 109.475 110.395 131.419 1.00 182.70 ?  113 THR A C     1 
ATOM 589   O O     . THR A 1 76  ? 109.567 109.920 132.556 1.00 182.70 ?  113 THR A O     1 
ATOM 590   C CB    . THR A 1 76  ? 111.421 111.573 130.418 1.00 182.70 ?  113 THR A CB    1 
ATOM 591   O OG1   . THR A 1 76  ? 110.571 112.638 129.972 1.00 182.70 ?  113 THR A OG1   1 
ATOM 592   C CG2   . THR A 1 76  ? 112.578 111.439 129.484 1.00 182.70 ?  113 THR A CG2   1 
ATOM 593   N N     . LEU A 1 77  ? 108.372 111.011 130.992 1.00 185.40 ?  114 LEU A N     1 
ATOM 594   C CA    . LEU A 1 77  ? 107.208 111.122 131.859 1.00 185.40 ?  114 LEU A CA    1 
ATOM 595   C C     . LEU A 1 77  ? 106.508 109.787 132.038 1.00 185.40 ?  114 LEU A C     1 
ATOM 596   O O     . LEU A 1 77  ? 105.661 109.648 132.926 1.00 185.40 ?  114 LEU A O     1 
ATOM 597   C CB    . LEU A 1 77  ? 106.230 112.148 131.305 1.00 185.40 ?  114 LEU A CB    1 
ATOM 598   C CG    . LEU A 1 77  ? 106.738 113.578 131.360 1.00 185.40 ?  114 LEU A CG    1 
ATOM 599   C CD1   . LEU A 1 77  ? 105.729 114.504 130.726 1.00 185.40 ?  114 LEU A CD1   1 
ATOM 600   C CD2   . LEU A 1 77  ? 106.985 113.960 132.794 1.00 185.40 ?  114 LEU A CD2   1 
ATOM 601   N N     . HIS A 1 78  ? 106.834 108.798 131.213 1.00 182.70 ?  115 HIS A N     1 
ATOM 602   C CA    . HIS A 1 78  ? 106.202 107.502 131.369 1.00 182.70 ?  115 HIS A CA    1 
ATOM 603   C C     . HIS A 1 78  ? 106.981 106.628 132.343 1.00 182.70 ?  115 HIS A C     1 
ATOM 604   O O     . HIS A 1 78  ? 106.525 105.543 132.717 1.00 182.70 ?  115 HIS A O     1 
ATOM 605   C CB    . HIS A 1 78  ? 106.073 106.838 130.011 1.00 182.70 ?  115 HIS A CB    1 
ATOM 606   C CG    . HIS A 1 78  ? 105.193 105.641 130.024 1.00 182.70 ?  115 HIS A CG    1 
ATOM 607   N ND1   . HIS A 1 78  ? 103.828 105.737 130.160 1.00 182.70 ?  115 HIS A ND1   1 
ATOM 608   C CD2   . HIS A 1 78  ? 105.477 104.322 129.957 1.00 182.70 ?  115 HIS A CD2   1 
ATOM 609   C CE1   . HIS A 1 78  ? 103.305 104.526 130.158 1.00 182.70 ?  115 HIS A CE1   1 
ATOM 610   N NE2   . HIS A 1 78  ? 104.284 103.649 130.033 1.00 182.70 ?  115 HIS A NE2   1 
ATOM 611   N N     . ALA A 1 79  ? 108.149 107.083 132.780 1.00 180.87 ?  116 ALA A N     1 
ATOM 612   C CA    . ALA A 1 79  ? 108.954 106.316 133.718 1.00 180.87 ?  116 ALA A CA    1 
ATOM 613   C C     . ALA A 1 79  ? 109.236 107.056 135.015 1.00 180.87 ?  116 ALA A C     1 
ATOM 614   O O     . ALA A 1 79  ? 110.170 106.688 135.730 1.00 180.87 ?  116 ALA A O     1 
ATOM 615   C CB    . ALA A 1 79  ? 110.276 105.905 133.072 1.00 180.87 ?  116 ALA A CB    1 
ATOM 616   N N     . GLY A 1 80  ? 108.474 108.097 135.328 1.00 189.64 ?  117 GLY A N     1 
ATOM 617   C CA    . GLY A 1 80  ? 108.641 108.796 136.583 1.00 189.64 ?  117 GLY A CA    1 
ATOM 618   C C     . GLY A 1 80  ? 109.850 109.696 136.675 1.00 189.64 ?  117 GLY A C     1 
ATOM 619   O O     . GLY A 1 80  ? 110.067 110.303 137.730 1.00 189.64 ?  117 GLY A O     1 
ATOM 620   N N     . ARG A 1 81  ? 110.642 109.809 135.617 1.00 188.64 ?  118 ARG A N     1 
ATOM 621   C CA    . ARG A 1 81  ? 111.776 110.713 135.604 1.00 188.64 ?  118 ARG A CA    1 
ATOM 622   C C     . ARG A 1 81  ? 111.306 112.139 135.338 1.00 188.64 ?  118 ARG A C     1 
ATOM 623   O O     . ARG A 1 81  ? 110.111 112.429 135.252 1.00 188.64 ?  118 ARG A O     1 
ATOM 624   C CB    . ARG A 1 81  ? 112.768 110.304 134.523 1.00 188.64 ?  118 ARG A CB    1 
ATOM 625   C CG    . ARG A 1 81  ? 113.418 108.956 134.680 1.00 188.64 ?  118 ARG A CG    1 
ATOM 626   C CD    . ARG A 1 81  ? 114.318 108.719 133.481 1.00 188.64 ?  118 ARG A CD    1 
ATOM 627   N NE    . ARG A 1 81  ? 115.024 107.450 133.549 1.00 188.64 ?  118 ARG A NE    1 
ATOM 628   C CZ    . ARG A 1 81  ? 114.584 106.321 133.011 1.00 188.64 ?  118 ARG A CZ    1 
ATOM 629   N NH1   . ARG A 1 81  ? 113.436 106.300 132.356 1.00 188.64 ?  118 ARG A NH1   1 
ATOM 630   N NH2   . ARG A 1 81  ? 115.298 105.215 133.126 1.00 188.64 ?  118 ARG A NH2   1 
ATOM 631   N N     . VAL A 1 82  ? 112.271 113.050 135.216 1.00 185.21 ?  119 VAL A N     1 
ATOM 632   C CA    . VAL A 1 82  ? 112.087 114.307 134.509 1.00 185.21 ?  119 VAL A CA    1 
ATOM 633   C C     . VAL A 1 82  ? 113.136 114.487 133.422 1.00 185.21 ?  119 VAL A C     1 
ATOM 634   O O     . VAL A 1 82  ? 112.810 114.827 132.280 1.00 185.21 ?  119 VAL A O     1 
ATOM 635   C CB    . VAL A 1 82  ? 112.096 115.509 135.479 1.00 185.21 ?  119 VAL A CB    1 
ATOM 636   C CG1   . VAL A 1 82  ? 112.034 116.815 134.719 1.00 185.21 ?  119 VAL A CG1   1 
ATOM 637   C CG2   . VAL A 1 82  ? 110.926 115.437 136.435 1.00 185.21 ?  119 VAL A CG2   1 
ATOM 638   N N     . THR A 1 83  ? 114.391 114.225 133.748 1.00 190.20 ?  120 THR A N     1 
ATOM 639   C CA    . THR A 1 83  ? 115.521 114.353 132.845 1.00 190.20 ?  120 THR A CA    1 
ATOM 640   C C     . THR A 1 83  ? 115.461 113.273 131.766 1.00 190.20 ?  120 THR A C     1 
ATOM 641   O O     . THR A 1 83  ? 114.911 112.191 131.983 1.00 190.20 ?  120 THR A O     1 
ATOM 642   C CB    . THR A 1 83  ? 116.804 114.224 133.665 1.00 190.20 ?  120 THR A CB    1 
ATOM 643   O OG1   . THR A 1 83  ? 116.679 115.028 134.839 1.00 190.20 ?  120 THR A OG1   1 
ATOM 644   C CG2   . THR A 1 83  ? 118.014 114.714 132.909 1.00 190.20 ?  120 THR A CG2   1 
ATOM 645   N N     . LEU A 1 84  ? 116.022 113.573 130.593 1.00 179.77 ?  121 LEU A N     1 
ATOM 646   C CA    . LEU A 1 84  ? 116.191 112.566 129.557 1.00 179.77 ?  121 LEU A CA    1 
ATOM 647   C C     . LEU A 1 84  ? 117.304 111.589 129.927 1.00 179.77 ?  121 LEU A C     1 
ATOM 648   O O     . LEU A 1 84  ? 117.977 111.715 130.950 1.00 179.77 ?  121 LEU A O     1 
ATOM 649   C CB    . LEU A 1 84  ? 116.551 113.203 128.219 1.00 179.77 ?  121 LEU A CB    1 
ATOM 650   C CG    . LEU A 1 84  ? 115.634 114.131 127.441 1.00 179.77 ?  121 LEU A CG    1 
ATOM 651   C CD1   . LEU A 1 84  ? 116.413 114.623 126.260 1.00 179.77 ?  121 LEU A CD1   1 
ATOM 652   C CD2   . LEU A 1 84  ? 114.409 113.416 126.975 1.00 179.77 ?  121 LEU A CD2   1 
ATOM 653   N N     . PHE A 1 85  ? 117.500 110.616 129.048 1.00 174.15 ?  122 PHE A N     1 
ATOM 654   C CA    . PHE A 1 85  ? 118.648 109.724 129.048 1.00 174.15 ?  122 PHE A CA    1 
ATOM 655   C C     . PHE A 1 85  ? 118.857 109.241 127.629 1.00 174.15 ?  122 PHE A C     1 
ATOM 656   O O     . PHE A 1 85  ? 117.946 109.337 126.801 1.00 174.15 ?  122 PHE A O     1 
ATOM 657   C CB    . PHE A 1 85  ? 118.449 108.514 129.967 1.00 174.15 ?  122 PHE A CB    1 
ATOM 658   C CG    . PHE A 1 85  ? 118.724 108.783 131.397 1.00 174.15 ?  122 PHE A CG    1 
ATOM 659   C CD1   . PHE A 1 85  ? 120.025 108.915 131.837 1.00 174.15 ?  122 PHE A CD1   1 
ATOM 660   C CD2   . PHE A 1 85  ? 117.697 108.846 132.308 1.00 174.15 ?  122 PHE A CD2   1 
ATOM 661   C CE1   . PHE A 1 85  ? 120.297 109.144 133.154 1.00 174.15 ?  122 PHE A CE1   1 
ATOM 662   C CE2   . PHE A 1 85  ? 117.957 109.070 133.629 1.00 174.15 ?  122 PHE A CE2   1 
ATOM 663   C CZ    . PHE A 1 85  ? 119.263 109.221 134.056 1.00 174.15 ?  122 PHE A CZ    1 
ATOM 664   N N     . PRO A 1 86  ? 120.025 108.681 127.319 1.00 163.67 ?  123 PRO A N     1 
ATOM 665   C CA    . PRO A 1 86  ? 120.161 107.952 126.055 1.00 163.67 ?  123 PRO A CA    1 
ATOM 666   C C     . PRO A 1 86  ? 119.343 106.681 125.985 1.00 163.67 ?  123 PRO A C     1 
ATOM 667   O O     . PRO A 1 86  ? 119.255 106.093 124.906 1.00 163.67 ?  123 PRO A O     1 
ATOM 668   C CB    . PRO A 1 86  ? 121.658 107.653 125.984 1.00 163.67 ?  123 PRO A CB    1 
ATOM 669   C CG    . PRO A 1 86  ? 122.258 108.706 126.767 1.00 163.67 ?  123 PRO A CG    1 
ATOM 670   C CD    . PRO A 1 86  ? 121.341 108.975 127.900 1.00 163.67 ?  123 PRO A CD    1 
ATOM 671   N N     . LYS A 1 87  ? 118.752 106.219 127.087 1.00 167.15 ?  124 LYS A N     1 
ATOM 672   C CA    . LYS A 1 87  ? 117.667 105.258 126.961 1.00 167.15 ?  124 LYS A CA    1 
ATOM 673   C C     . LYS A 1 87  ? 116.496 105.882 126.223 1.00 167.15 ?  124 LYS A C     1 
ATOM 674   O O     . LYS A 1 87  ? 115.838 105.222 125.416 1.00 167.15 ?  124 LYS A O     1 
ATOM 675   C CB    . LYS A 1 87  ? 117.214 104.762 128.331 1.00 167.15 ?  124 LYS A CB    1 
ATOM 676   C CG    . LYS A 1 87  ? 118.268 104.047 129.150 1.00 167.15 ?  124 LYS A CG    1 
ATOM 677   C CD    . LYS A 1 87  ? 118.633 102.708 128.569 1.00 167.15 ?  124 LYS A CD    1 
ATOM 678   C CE    . LYS A 1 87  ? 119.633 102.011 129.472 1.00 167.15 ?  124 LYS A CE    1 
ATOM 679   N NZ    . LYS A 1 87  ? 120.082 100.704 128.920 1.00 167.15 ?  124 LYS A NZ    1 
ATOM 680   N N     . ASP A 1 88  ? 116.244 107.165 126.461 1.00 172.50 ?  125 ASP A N     1 
ATOM 681   C CA    . ASP A 1 88  ? 115.024 107.776 125.954 1.00 172.50 ?  125 ASP A CA    1 
ATOM 682   C C     . ASP A 1 88  ? 115.202 108.349 124.554 1.00 172.50 ?  125 ASP A C     1 
ATOM 683   O O     . ASP A 1 88  ? 114.272 108.937 123.998 1.00 172.50 ?  125 ASP A O     1 
ATOM 684   C CB    . ASP A 1 88  ? 114.545 108.843 126.927 1.00 172.50 ?  125 ASP A CB    1 
ATOM 685   C CG    . ASP A 1 88  ? 113.852 108.252 128.124 1.00 172.50 ?  125 ASP A CG    1 
ATOM 686   O OD1   . ASP A 1 88  ? 113.163 107.231 127.948 1.00 172.50 ?  125 ASP A OD1   1 
ATOM 687   O OD2   . ASP A 1 88  ? 114.007 108.786 129.241 1.00 172.50 -1 125 ASP A OD2   1 
ATOM 688   N N     . VAL A 1 89  ? 116.379 108.195 123.958 1.00 170.62 ?  126 VAL A N     1 
ATOM 689   C CA    . VAL A 1 89  ? 116.481 108.495 122.535 1.00 170.62 ?  126 VAL A CA    1 
ATOM 690   C C     . VAL A 1 89  ? 116.631 107.204 121.743 1.00 170.62 ?  126 VAL A C     1 
ATOM 691   O O     . VAL A 1 89  ? 116.051 107.054 120.660 1.00 170.62 ?  126 VAL A O     1 
ATOM 692   C CB    . VAL A 1 89  ? 117.622 109.492 122.271 1.00 170.62 ?  126 VAL A CB    1 
ATOM 693   C CG1   . VAL A 1 89  ? 117.795 109.755 120.802 1.00 170.62 ?  126 VAL A CG1   1 
ATOM 694   C CG2   . VAL A 1 89  ? 117.309 110.787 122.942 1.00 170.62 ?  126 VAL A CG2   1 
ATOM 695   N N     . GLN A 1 90  ? 117.365 106.229 122.294 1.00 181.89 ?  127 GLN A N     1 
ATOM 696   C CA    . GLN A 1 90  ? 117.465 104.915 121.664 1.00 181.89 ?  127 GLN A CA    1 
ATOM 697   C C     . GLN A 1 90  ? 116.122 104.207 121.612 1.00 181.89 ?  127 GLN A C     1 
ATOM 698   O O     . GLN A 1 90  ? 115.877 103.418 120.697 1.00 181.89 ?  127 GLN A O     1 
ATOM 699   C CB    . GLN A 1 90  ? 118.468 104.035 122.403 1.00 181.89 ?  127 GLN A CB    1 
ATOM 700   C CG    . GLN A 1 90  ? 119.905 104.438 122.230 1.00 181.89 ?  127 GLN A CG    1 
ATOM 701   C CD    . GLN A 1 90  ? 120.821 103.626 123.114 1.00 181.89 ?  127 GLN A CD    1 
ATOM 702   O OE1   . GLN A 1 90  ? 120.374 102.739 123.837 1.00 181.89 ?  127 GLN A OE1   1 
ATOM 703   N NE2   . GLN A 1 90  ? 122.104 103.955 123.097 1.00 181.89 ?  127 GLN A NE2   1 
ATOM 704   N N     . LEU A 1 91  ? 115.236 104.478 122.565 1.00 173.13 ?  128 LEU A N     1 
ATOM 705   C CA    . LEU A 1 91  ? 113.929 103.846 122.509 1.00 173.13 ?  128 LEU A CA    1 
ATOM 706   C C     . LEU A 1 91  ? 112.972 104.665 121.660 1.00 173.13 ?  128 LEU A C     1 
ATOM 707   O O     . LEU A 1 91  ? 111.988 104.137 121.138 1.00 173.13 ?  128 LEU A O     1 
ATOM 708   C CB    . LEU A 1 91  ? 113.382 103.659 123.913 1.00 173.13 ?  128 LEU A CB    1 
ATOM 709   C CG    . LEU A 1 91  ? 112.200 102.723 124.051 1.00 173.13 ?  128 LEU A CG    1 
ATOM 710   C CD1   . LEU A 1 91  ? 112.641 101.334 123.684 1.00 173.13 ?  128 LEU A CD1   1 
ATOM 711   C CD2   . LEU A 1 91  ? 111.722 102.763 125.461 1.00 173.13 ?  128 LEU A CD2   1 
ATOM 712   N N     . ALA A 1 92  ? 113.261 105.950 121.473 1.00 168.75 ?  129 ALA A N     1 
ATOM 713   C CA    . ALA A 1 92  ? 112.340 106.788 120.716 1.00 168.75 ?  129 ALA A CA    1 
ATOM 714   C C     . ALA A 1 92  ? 112.559 106.638 119.220 1.00 168.75 ?  129 ALA A C     1 
ATOM 715   O O     . ALA A 1 92  ? 111.743 107.097 118.416 1.00 168.75 ?  129 ALA A O     1 
ATOM 716   C CB    . ALA A 1 92  ? 112.485 108.245 121.142 1.00 168.75 ?  129 ALA A CB    1 
ATOM 717   N N     . ARG A 1 93  ? 113.656 106.005 118.823 1.00 175.94 ?  130 ARG A N     1 
ATOM 718   C CA    . ARG A 1 93  ? 113.837 105.702 117.412 1.00 175.94 ?  130 ARG A CA    1 
ATOM 719   C C     . ARG A 1 93  ? 113.333 104.308 117.069 1.00 175.94 ?  130 ARG A C     1 
ATOM 720   O O     . ARG A 1 93  ? 112.883 104.074 115.943 1.00 175.94 ?  130 ARG A O     1 
ATOM 721   C CB    . ARG A 1 93  ? 115.305 105.866 117.030 1.00 175.94 ?  130 ARG A CB    1 
ATOM 722   C CG    . ARG A 1 93  ? 115.713 107.309 116.932 1.00 175.94 ?  130 ARG A CG    1 
ATOM 723   C CD    . ARG A 1 93  ? 117.203 107.521 116.787 1.00 175.94 ?  130 ARG A CD    1 
ATOM 724   N NE    . ARG A 1 93  ? 117.781 106.955 115.577 1.00 175.94 ?  130 ARG A NE    1 
ATOM 725   C CZ    . ARG A 1 93  ? 118.700 106.001 115.588 1.00 175.94 ?  130 ARG A CZ    1 
ATOM 726   N NH1   . ARG A 1 93  ? 119.140 105.529 116.741 1.00 175.94 ?  130 ARG A NH1   1 
ATOM 727   N NH2   . ARG A 1 93  ? 119.192 105.532 114.458 1.00 175.94 ?  130 ARG A NH2   1 
ATOM 728   N N     . ARG A 1 94  ? 113.386 103.375 118.016 1.00 174.20 ?  131 ARG A N     1 
ATOM 729   C CA    . ARG A 1 94  ? 112.989 102.007 117.713 1.00 174.20 ?  131 ARG A CA    1 
ATOM 730   C C     . ARG A 1 94  ? 111.476 101.877 117.628 1.00 174.20 ?  131 ARG A C     1 
ATOM 731   O O     . ARG A 1 94  ? 110.971 101.114 116.803 1.00 174.20 ?  131 ARG A O     1 
ATOM 732   C CB    . ARG A 1 94  ? 113.565 101.066 118.768 1.00 174.20 ?  131 ARG A CB    1 
ATOM 733   C CG    . ARG A 1 94  ? 113.548 99.597  118.409 1.00 174.20 ?  131 ARG A CG    1 
ATOM 734   C CD    . ARG A 1 94  ? 112.384 98.851  118.993 1.00 174.20 ?  131 ARG A CD    1 
ATOM 735   N NE    . ARG A 1 94  ? 112.488 97.416  118.754 1.00 174.20 ?  131 ARG A NE    1 
ATOM 736   C CZ    . ARG A 1 94  ? 112.049 96.800  117.662 1.00 174.20 ?  131 ARG A CZ    1 
ATOM 737   N NH1   . ARG A 1 94  ? 111.458 97.487  116.695 1.00 174.20 ?  131 ARG A NH1   1 
ATOM 738   N NH2   . ARG A 1 94  ? 112.195 95.489  117.539 1.00 174.20 ?  131 ARG A NH2   1 
ATOM 739   N N     . ILE A 1 95  ? 110.741 102.603 118.469 1.00 175.31 ?  132 ILE A N     1 
ATOM 740   C CA    . ILE A 1 95  ? 109.289 102.628 118.362 1.00 175.31 ?  132 ILE A CA    1 
ATOM 741   C C     . ILE A 1 95  ? 108.872 103.340 117.088 1.00 175.31 ?  132 ILE A C     1 
ATOM 742   O O     . ILE A 1 95  ? 107.861 102.981 116.474 1.00 175.31 ?  132 ILE A O     1 
ATOM 743   C CB    . ILE A 1 95  ? 108.692 103.305 119.605 1.00 175.31 ?  132 ILE A CB    1 
ATOM 744   C CG1   . ILE A 1 95  ? 109.128 102.572 120.858 1.00 175.31 ?  132 ILE A CG1   1 
ATOM 745   C CG2   . ILE A 1 95  ? 107.178 103.310 119.583 1.00 175.31 ?  132 ILE A CG2   1 
ATOM 746   C CD1   . ILE A 1 95  ? 108.839 103.340 122.102 1.00 175.31 ?  132 ILE A CD1   1 
ATOM 747   N N     . ARG A 1 96  ? 109.676 104.313 116.655 1.00 176.82 ?  133 ARG A N     1 
ATOM 748   C CA    . ARG A 1 96  ? 109.316 105.211 115.565 1.00 176.82 ?  133 ARG A CA    1 
ATOM 749   C C     . ARG A 1 96  ? 109.145 104.473 114.242 1.00 176.82 ?  133 ARG A C     1 
ATOM 750   O O     . ARG A 1 96  ? 108.260 104.817 113.452 1.00 176.82 ?  133 ARG A O     1 
ATOM 751   C CB    . ARG A 1 96  ? 110.382 106.300 115.464 1.00 176.82 ?  133 ARG A CB    1 
ATOM 752   C CG    . ARG A 1 96  ? 110.163 107.276 114.364 1.00 176.82 ?  133 ARG A CG    1 
ATOM 753   C CD    . ARG A 1 96  ? 108.977 108.172 114.605 1.00 176.82 ?  133 ARG A CD    1 
ATOM 754   N NE    . ARG A 1 96  ? 109.260 109.207 115.583 1.00 176.82 ?  133 ARG A NE    1 
ATOM 755   C CZ    . ARG A 1 96  ? 109.850 110.350 115.267 1.00 176.82 ?  133 ARG A CZ    1 
ATOM 756   N NH1   . ARG A 1 96  ? 110.207 110.572 114.013 1.00 176.82 ?  133 ARG A NH1   1 
ATOM 757   N NH2   . ARG A 1 96  ? 110.082 111.267 116.191 1.00 176.82 ?  133 ARG A NH2   1 
ATOM 758   N N     . GLY A 1 97  ? 109.934 103.433 114.008 1.00 190.18 ?  134 GLY A N     1 
ATOM 759   C CA    . GLY A 1 97  ? 109.601 102.487 112.963 1.00 190.18 ?  134 GLY A CA    1 
ATOM 760   C C     . GLY A 1 97  ? 110.310 102.636 111.634 1.00 190.18 ?  134 GLY A C     1 
ATOM 761   O O     . GLY A 1 97  ? 109.662 102.593 110.583 1.00 190.18 ?  134 GLY A O     1 
ATOM 762   N N     . LEU A 1 98  ? 111.621 102.892 111.676 1.00 188.14 ?  135 LEU A N     1 
ATOM 763   C CA    . LEU A 1 98  ? 112.580 102.596 110.610 1.00 188.14 ?  135 LEU A CA    1 
ATOM 764   C C     . LEU A 1 98  ? 112.473 103.500 109.379 1.00 188.14 ?  135 LEU A C     1 
ATOM 765   O O     . LEU A 1 98  ? 113.374 103.506 108.536 1.00 188.14 ?  135 LEU A O     1 
ATOM 766   C CB    . LEU A 1 98  ? 112.444 101.115 110.226 1.00 188.14 ?  135 LEU A CB    1 
ATOM 767   C CG    . LEU A 1 98  ? 113.448 100.348 109.375 1.00 188.14 ?  135 LEU A CG    1 
ATOM 768   C CD1   . LEU A 1 98  ? 113.489 98.932  109.886 1.00 188.14 ?  135 LEU A CD1   1 
ATOM 769   C CD2   . LEU A 1 98  ? 113.043 100.339 107.923 1.00 188.14 ?  135 LEU A CD2   1 
ATOM 770   N N     . GLU A 1 99  ? 111.434 104.324 109.285 1.00 190.27 ?  136 GLU A N     1 
ATOM 771   C CA    . GLU A 1 99  ? 111.309 105.258 108.177 1.00 190.27 ?  136 GLU A CA    1 
ATOM 772   C C     . GLU A 1 99  ? 111.234 106.708 108.608 1.00 190.27 ?  136 GLU A C     1 
ATOM 773   O O     . GLU A 1 99  ? 111.157 107.587 107.747 1.00 190.27 ?  136 GLU A O     1 
ATOM 774   C CB    . GLU A 1 99  ? 110.078 104.929 107.323 1.00 190.27 ?  136 GLU A CB    1 
ATOM 775   C CG    . GLU A 1 99  ? 110.253 103.695 106.487 1.00 190.27 ?  136 GLU A CG    1 
ATOM 776   C CD    . GLU A 1 99  ? 111.318 103.878 105.426 1.00 190.27 ?  136 GLU A CD    1 
ATOM 777   O OE1   . GLU A 1 99  ? 111.467 105.003 104.905 1.00 190.27 ?  136 GLU A OE1   1 
ATOM 778   O OE2   . GLU A 1 99  ? 112.017 102.895 105.117 1.00 190.27 -1 136 GLU A OE2   1 
ATOM 779   N N     . GLU A 1 100 ? 111.247 106.983 109.902 1.00 195.46 ?  137 GLU A N     1 
ATOM 780   C CA    . GLU A 1 100 ? 111.185 108.360 110.353 1.00 195.46 ?  137 GLU A CA    1 
ATOM 781   C C     . GLU A 1 100 ? 112.367 108.634 111.265 1.00 195.46 ?  137 GLU A C     1 
ATOM 782   O O     . GLU A 1 100 ? 112.195 109.093 112.398 1.00 195.46 ?  137 GLU A O     1 
ATOM 783   C CB    . GLU A 1 100 ? 109.873 108.645 111.072 1.00 195.46 ?  137 GLU A CB    1 
ATOM 784   C CG    . GLU A 1 100 ? 108.620 108.421 110.261 1.00 195.46 ?  137 GLU A CG    1 
ATOM 785   C CD    . GLU A 1 100 ? 108.451 109.433 109.167 1.00 195.46 ?  137 GLU A CD    1 
ATOM 786   O OE1   . GLU A 1 100 ? 108.912 110.580 109.344 1.00 195.46 ?  137 GLU A OE1   1 
ATOM 787   O OE2   . GLU A 1 100 ? 107.840 109.085 108.137 1.00 195.46 -1 137 GLU A OE2   1 
ATOM 788   N N     . GLY A 1 101 ? 113.568 108.343 110.777 1.00 182.06 ?  138 GLY A N     1 
ATOM 789   C CA    . GLY A 1 101 ? 114.782 108.605 111.518 1.00 182.06 ?  138 GLY A CA    1 
ATOM 790   C C     . GLY A 1 101 ? 115.557 107.360 111.863 1.00 182.06 ?  138 GLY A C     1 
ATOM 791   O O     . GLY A 1 101 ? 115.225 106.632 112.798 1.00 182.06 ?  138 GLY A O     1 
ATOM 792   N N     . LEU A 1 102 ? 116.612 107.120 111.104 1.00 185.98 ?  139 LEU A N     1 
ATOM 793   C CA    . LEU A 1 102 ? 117.450 105.964 111.319 1.00 185.98 ?  139 LEU A CA    1 
ATOM 794   C C     . LEU A 1 102 ? 118.901 106.400 111.415 1.00 185.98 ?  139 LEU A C     1 
ATOM 795   O O     . LEU A 1 102 ? 119.698 105.771 112.104 1.00 185.98 ?  139 LEU A O     1 
ATOM 796   C CB    . LEU A 1 102 ? 117.247 104.950 110.192 1.00 185.98 ?  139 LEU A CB    1 
ATOM 797   C CG    . LEU A 1 102 ? 117.904 103.572 110.279 1.00 185.98 ?  139 LEU A CG    1 
ATOM 798   C CD1   . LEU A 1 102 ? 116.966 102.584 109.657 1.00 185.98 ?  139 LEU A CD1   1 
ATOM 799   C CD2   . LEU A 1 102 ? 119.242 103.508 109.549 1.00 185.98 ?  139 LEU A CD2   1 
ATOM 800   N N     . LYS B 2 1   ? 131.331 104.348 107.753 1.00 264.68 ?  8   LYS B N     1 
ATOM 801   C CA    . LYS B 2 1   ? 131.947 104.479 109.068 1.00 264.68 ?  8   LYS B CA    1 
ATOM 802   C C     . LYS B 2 1   ? 133.022 105.562 109.059 1.00 264.68 ?  8   LYS B C     1 
ATOM 803   O O     . LYS B 2 1   ? 132.731 106.740 109.273 1.00 264.68 ?  8   LYS B O     1 
ATOM 804   C CB    . LYS B 2 1   ? 132.533 103.151 109.514 1.00 264.68 ?  8   LYS B CB    1 
ATOM 805   N N     . GLY B 2 2   ? 134.265 105.155 108.811 1.00 303.47 ?  9   GLY B N     1 
ATOM 806   C CA    . GLY B 2 2   ? 135.409 106.060 108.748 1.00 303.47 ?  9   GLY B CA    1 
ATOM 807   C C     . GLY B 2 2   ? 136.226 105.800 107.489 1.00 303.47 ?  9   GLY B C     1 
ATOM 808   O O     . GLY B 2 2   ? 137.452 105.679 107.524 1.00 303.47 ?  9   GLY B O     1 
ATOM 809   N N     . LEU B 2 3   ? 135.546 105.711 106.346 1.00 309.57 ?  10  LEU B N     1 
ATOM 810   C CA    . LEU B 2 3   ? 136.217 105.537 105.067 1.00 309.57 ?  10  LEU B CA    1 
ATOM 811   C C     . LEU B 2 3   ? 136.880 106.847 104.647 1.00 309.57 ?  10  LEU B C     1 
ATOM 812   O O     . LEU B 2 3   ? 136.666 107.899 105.260 1.00 309.57 ?  10  LEU B O     1 
ATOM 813   C CB    . LEU B 2 3   ? 135.231 105.047 104.010 1.00 309.57 ?  10  LEU B CB    1 
ATOM 814   N N     . GLY B 2 4   ? 137.661 106.776 103.562 1.00 318.13 ?  11  GLY B N     1 
ATOM 815   C CA    . GLY B 2 4   ? 138.623 107.809 103.154 1.00 318.13 ?  11  GLY B CA    1 
ATOM 816   C C     . GLY B 2 4   ? 139.524 108.174 104.337 1.00 318.13 ?  11  GLY B C     1 
ATOM 817   O O     . GLY B 2 4   ? 139.459 109.272 104.892 1.00 318.13 ?  11  GLY B O     1 
ATOM 818   N N     . LYS B 2 5   ? 140.346 107.179 104.695 1.00 347.74 ?  12  LYS B N     1 
ATOM 819   C CA    . LYS B 2 5   ? 140.925 107.017 106.027 1.00 347.74 ?  12  LYS B CA    1 
ATOM 820   C C     . LYS B 2 5   ? 141.732 108.228 106.480 1.00 347.74 ?  12  LYS B C     1 
ATOM 821   O O     . LYS B 2 5   ? 142.351 108.935 105.681 1.00 347.74 ?  12  LYS B O     1 
ATOM 822   C CB    . LYS B 2 5   ? 141.813 105.772 106.063 1.00 347.74 ?  12  LYS B CB    1 
ATOM 823   N N     . GLY B 2 6   ? 141.708 108.455 107.792 1.00 383.45 ?  13  GLY B N     1 
ATOM 824   C CA    . GLY B 2 6   ? 142.233 109.667 108.402 1.00 383.45 ?  13  GLY B CA    1 
ATOM 825   C C     . GLY B 2 6   ? 143.753 109.734 108.398 1.00 383.45 ?  13  GLY B C     1 
ATOM 826   O O     . GLY B 2 6   ? 144.316 110.820 108.217 1.00 383.45 ?  13  GLY B O     1 
ATOM 827   N N     . GLY B 2 7   ? 144.428 108.601 108.577 1.00 395.76 ?  14  GLY B N     1 
ATOM 828   C CA    . GLY B 2 7   ? 145.881 108.581 108.745 1.00 395.76 ?  14  GLY B CA    1 
ATOM 829   C C     . GLY B 2 7   ? 146.588 108.478 107.392 1.00 395.76 ?  14  GLY B C     1 
ATOM 830   O O     . GLY B 2 7   ? 147.269 107.502 107.077 1.00 395.76 ?  14  GLY B O     1 
ATOM 831   N N     . ALA B 2 8   ? 146.406 109.521 106.581 1.00 390.31 ?  15  ALA B N     1 
ATOM 832   C CA    . ALA B 2 8   ? 147.217 109.672 105.380 1.00 390.31 ?  15  ALA B CA    1 
ATOM 833   C C     . ALA B 2 8   ? 148.454 110.516 105.663 1.00 390.31 ?  15  ALA B C     1 
ATOM 834   O O     . ALA B 2 8   ? 149.427 110.479 104.901 1.00 390.31 ?  15  ALA B O     1 
ATOM 835   C CB    . ALA B 2 8   ? 146.387 110.285 104.252 1.00 390.31 ?  15  ALA B CB    1 
ATOM 836   N N     . LYS B 2 9   ? 148.427 111.282 106.753 1.00 384.19 ?  16  LYS B N     1 
ATOM 837   C CA    . LYS B 2 9   ? 149.570 112.056 107.220 1.00 384.19 ?  16  LYS B CA    1 
ATOM 838   C C     . LYS B 2 9   ? 150.099 111.551 108.550 1.00 384.19 ?  16  LYS B C     1 
ATOM 839   O O     . LYS B 2 9   ? 151.276 111.184 108.651 1.00 384.19 ?  16  LYS B O     1 
ATOM 840   C CB    . LYS B 2 9   ? 149.178 113.534 107.353 1.00 384.19 ?  16  LYS B CB    1 
ATOM 841   N N     . ARG B 2 10  ? 149.247 111.513 109.571 1.00 381.64 ?  17  ARG B N     1 
ATOM 842   C CA    . ARG B 2 10  ? 149.576 110.998 110.889 1.00 381.64 ?  17  ARG B CA    1 
ATOM 843   C C     . ARG B 2 10  ? 148.275 110.613 111.576 1.00 381.64 ?  17  ARG B C     1 
ATOM 844   O O     . ARG B 2 10  ? 147.190 110.720 110.999 1.00 381.64 ?  17  ARG B O     1 
ATOM 845   C CB    . ARG B 2 10  ? 150.353 112.023 111.727 1.00 381.64 ?  17  ARG B CB    1 
ATOM 846   N N     . HIS B 2 11  ? 148.384 110.159 112.820 1.00 382.54 ?  18  HIS B N     1 
ATOM 847   C CA    . HIS B 2 11  ? 147.186 109.901 113.599 1.00 382.54 ?  18  HIS B CA    1 
ATOM 848   C C     . HIS B 2 11  ? 146.574 111.219 114.071 1.00 382.54 ?  18  HIS B C     1 
ATOM 849   O O     . HIS B 2 11  ? 147.193 112.285 113.983 1.00 382.54 ?  18  HIS B O     1 
ATOM 850   C CB    . HIS B 2 11  ? 147.501 108.996 114.789 1.00 382.54 ?  18  HIS B CB    1 
ATOM 851   N N     . ARG B 2 12  ? 145.337 111.121 114.575 1.00 380.38 ?  19  ARG B N     1 
ATOM 852   C CA    . ARG B 2 12  ? 144.535 112.236 115.093 1.00 380.38 ?  19  ARG B CA    1 
ATOM 853   C C     . ARG B 2 12  ? 144.344 113.323 114.027 1.00 380.38 ?  19  ARG B C     1 
ATOM 854   O O     . ARG B 2 12  ? 144.825 114.451 114.141 1.00 380.38 ?  19  ARG B O     1 
ATOM 855   C CB    . ARG B 2 12  ? 145.132 112.810 116.387 1.00 380.38 ?  19  ARG B CB    1 
ATOM 856   N N     . LYS B 2 13  ? 143.605 112.940 112.982 1.00 362.24 ?  20  LYS B N     1 
ATOM 857   C CA    . LYS B 2 13  ? 143.302 113.813 111.852 1.00 362.24 ?  20  LYS B CA    1 
ATOM 858   C C     . LYS B 2 13  ? 141.977 114.538 112.028 1.00 362.24 ?  20  LYS B C     1 
ATOM 859   O O     . LYS B 2 13  ? 141.220 114.714 111.063 1.00 362.24 ?  20  LYS B O     1 
ATOM 860   C CB    . LYS B 2 13  ? 143.314 113.022 110.545 1.00 362.24 ?  20  LYS B CB    1 
ATOM 861   N N     . VAL B 2 14  ? 141.687 114.952 113.254 1.00 320.99 ?  21  VAL B N     1 
ATOM 862   C CA    . VAL B 2 14  ? 140.409 115.495 113.684 1.00 320.99 ?  21  VAL B CA    1 
ATOM 863   C C     . VAL B 2 14  ? 140.644 116.986 113.944 1.00 320.99 ?  21  VAL B C     1 
ATOM 864   O O     . VAL B 2 14  ? 139.933 117.621 114.734 1.00 320.99 ?  21  VAL B O     1 
ATOM 865   C CB    . VAL B 2 14  ? 139.908 114.680 114.904 1.00 320.99 ?  21  VAL B CB    1 
ATOM 866   C CG1   . VAL B 2 14  ? 140.788 114.883 116.163 1.00 320.99 ?  21  VAL B CG1   1 
ATOM 867   C CG2   . VAL B 2 14  ? 138.403 114.829 115.164 1.00 320.99 ?  21  VAL B CG2   1 
ATOM 868   N N     . LEU B 2 15  ? 141.546 117.568 113.131 1.00 305.31 ?  22  LEU B N     1 
ATOM 869   C CA    . LEU B 2 15  ? 142.543 118.574 113.523 1.00 305.31 ?  22  LEU B CA    1 
ATOM 870   C C     . LEU B 2 15  ? 142.099 119.630 114.539 1.00 305.31 ?  22  LEU B C     1 
ATOM 871   O O     . LEU B 2 15  ? 142.699 119.741 115.613 1.00 305.31 ?  22  LEU B O     1 
ATOM 872   C CB    . LEU B 2 15  ? 143.101 119.231 112.245 1.00 305.31 ?  22  LEU B CB    1 
ATOM 873   C CG    . LEU B 2 15  ? 142.335 119.999 111.155 1.00 305.31 ?  22  LEU B CG    1 
ATOM 874   C CD1   . LEU B 2 15  ? 142.311 121.507 111.391 1.00 305.31 ?  22  LEU B CD1   1 
ATOM 875   C CD2   . LEU B 2 15  ? 142.922 119.700 109.786 1.00 305.31 ?  22  LEU B CD2   1 
ATOM 876   N N     . ARG B 2 16  ? 141.072 120.426 114.241 1.00 277.30 ?  23  ARG B N     1 
ATOM 877   C CA    . ARG B 2 16  ? 140.527 121.216 115.335 1.00 277.30 ?  23  ARG B CA    1 
ATOM 878   C C     . ARG B 2 16  ? 139.464 120.409 116.062 1.00 277.30 ?  23  ARG B C     1 
ATOM 879   O O     . ARG B 2 16  ? 139.722 119.898 117.155 1.00 277.30 ?  23  ARG B O     1 
ATOM 880   C CB    . ARG B 2 16  ? 139.962 122.549 114.838 1.00 277.30 ?  23  ARG B CB    1 
ATOM 881   C CG    . ARG B 2 16  ? 139.304 123.376 115.943 1.00 277.30 ?  23  ARG B CG    1 
ATOM 882   C CD    . ARG B 2 16  ? 140.302 123.778 117.029 1.00 277.30 ?  23  ARG B CD    1 
ATOM 883   N NE    . ARG B 2 16  ? 139.649 124.448 118.154 1.00 277.30 ?  23  ARG B NE    1 
ATOM 884   C CZ    . ARG B 2 16  ? 139.461 125.761 118.242 1.00 277.30 ?  23  ARG B CZ    1 
ATOM 885   N NH1   . ARG B 2 16  ? 139.882 126.557 117.271 1.00 277.30 ?  23  ARG B NH1   1 
ATOM 886   N NH2   . ARG B 2 16  ? 138.858 126.286 119.301 1.00 277.30 ?  23  ARG B NH2   1 
ATOM 887   N N     . ASP B 2 17  ? 138.287 120.252 115.452 1.00 251.02 ?  24  ASP B N     1 
ATOM 888   C CA    . ASP B 2 17  ? 137.297 119.301 115.932 1.00 251.02 ?  24  ASP B CA    1 
ATOM 889   C C     . ASP B 2 17  ? 136.589 118.564 114.797 1.00 251.02 ?  24  ASP B C     1 
ATOM 890   O O     . ASP B 2 17  ? 136.389 117.350 114.863 1.00 251.02 ?  24  ASP B O     1 
ATOM 891   C CB    . ASP B 2 17  ? 136.276 120.041 116.793 1.00 251.02 ?  24  ASP B CB    1 
ATOM 892   C CG    . ASP B 2 17  ? 136.794 120.364 118.183 1.00 251.02 ?  24  ASP B CG    1 
ATOM 893   O OD1   . ASP B 2 17  ? 137.477 119.511 118.785 1.00 251.02 ?  24  ASP B OD1   1 
ATOM 894   O OD2   . ASP B 2 17  ? 136.529 121.484 118.664 1.00 251.02 -1 24  ASP B OD2   1 
ATOM 895   N N     . ASN B 2 18  ? 136.152 119.321 113.785 1.00 210.39 ?  25  ASN B N     1 
ATOM 896   C CA    . ASN B 2 18  ? 135.452 118.908 112.562 1.00 210.39 ?  25  ASN B CA    1 
ATOM 897   C C     . ASN B 2 18  ? 134.085 118.255 112.789 1.00 210.39 ?  25  ASN B C     1 
ATOM 898   O O     . ASN B 2 18  ? 133.370 118.000 111.815 1.00 210.39 ?  25  ASN B O     1 
ATOM 899   C CB    . ASN B 2 18  ? 136.310 117.986 111.687 1.00 210.39 ?  25  ASN B CB    1 
ATOM 900   C CG    . ASN B 2 18  ? 137.341 118.746 110.882 1.00 210.39 ?  25  ASN B CG    1 
ATOM 901   O OD1   . ASN B 2 18  ? 137.059 119.822 110.355 1.00 210.39 ?  25  ASN B OD1   1 
ATOM 902   N ND2   . ASN B 2 18  ? 138.540 118.186 110.770 1.00 210.39 ?  25  ASN B ND2   1 
ATOM 903   N N     . ILE B 2 19  ? 133.689 117.979 114.030 1.00 189.31 ?  26  ILE B N     1 
ATOM 904   C CA    . ILE B 2 19  ? 132.371 117.437 114.338 1.00 189.31 ?  26  ILE B CA    1 
ATOM 905   C C     . ILE B 2 19  ? 131.757 118.225 115.483 1.00 189.31 ?  26  ILE B C     1 
ATOM 906   O O     . ILE B 2 19  ? 130.539 118.429 115.537 1.00 189.31 ?  26  ILE B O     1 
ATOM 907   C CB    . ILE B 2 19  ? 132.480 115.931 114.657 1.00 189.31 ?  26  ILE B CB    1 
ATOM 908   C CG1   . ILE B 2 19  ? 131.149 115.331 115.129 1.00 189.31 ?  26  ILE B CG1   1 
ATOM 909   C CG2   . ILE B 2 19  ? 133.612 115.665 115.647 1.00 189.31 ?  26  ILE B CG2   1 
ATOM 910   C CD1   . ILE B 2 19  ? 130.051 115.381 114.135 1.00 189.31 ?  26  ILE B CD1   1 
ATOM 911   N N     . GLN B 2 20  ? 132.607 118.772 116.345 1.00 201.25 ?  27  GLN B N     1 
ATOM 912   C CA    . GLN B 2 20  ? 132.164 119.457 117.546 1.00 201.25 ?  27  GLN B CA    1 
ATOM 913   C C     . GLN B 2 20  ? 131.820 120.910 117.289 1.00 201.25 ?  27  GLN B C     1 
ATOM 914   O O     . GLN B 2 20  ? 131.808 121.705 118.230 1.00 201.25 ?  27  GLN B O     1 
ATOM 915   C CB    . GLN B 2 20  ? 133.226 119.366 118.643 1.00 201.25 ?  27  GLN B CB    1 
ATOM 916   C CG    . GLN B 2 20  ? 133.542 117.956 119.101 1.00 201.25 ?  27  GLN B CG    1 
ATOM 917   C CD    . GLN B 2 20  ? 132.387 117.302 119.825 1.00 201.25 ?  27  GLN B CD    1 
ATOM 918   O OE1   . GLN B 2 20  ? 131.681 117.943 120.599 1.00 201.25 ?  27  GLN B OE1   1 
ATOM 919   N NE2   . GLN B 2 20  ? 132.192 116.013 119.583 1.00 201.25 ?  27  GLN B NE2   1 
ATOM 920   N N     . GLY B 2 21  ? 131.568 121.282 116.037 1.00 195.31 ?  28  GLY B N     1 
ATOM 921   C CA    . GLY B 2 21  ? 130.990 122.581 115.771 1.00 195.31 ?  28  GLY B CA    1 
ATOM 922   C C     . GLY B 2 21  ? 129.539 122.662 116.195 1.00 195.31 ?  28  GLY B C     1 
ATOM 923   O O     . GLY B 2 21  ? 129.003 123.755 116.387 1.00 195.31 ?  28  GLY B O     1 
ATOM 924   N N     . ILE B 2 22  ? 128.880 121.517 116.336 1.00 185.32 ?  29  ILE B N     1 
ATOM 925   C CA    . ILE B 2 22  ? 127.575 121.482 116.969 1.00 185.32 ?  29  ILE B CA    1 
ATOM 926   C C     . ILE B 2 22  ? 127.849 121.664 118.449 1.00 185.32 ?  29  ILE B C     1 
ATOM 927   O O     . ILE B 2 22  ? 128.154 120.697 119.153 1.00 185.32 ?  29  ILE B O     1 
ATOM 928   C CB    . ILE B 2 22  ? 126.851 120.158 116.697 1.00 185.32 ?  29  ILE B CB    1 
ATOM 929   C CG1   . ILE B 2 22  ? 126.880 119.822 115.213 1.00 185.32 ?  29  ILE B CG1   1 
ATOM 930   C CG2   . ILE B 2 22  ? 125.425 120.256 117.144 1.00 185.32 ?  29  ILE B CG2   1 
ATOM 931   C CD1   . ILE B 2 22  ? 126.157 120.798 114.356 1.00 185.32 ?  29  ILE B CD1   1 
ATOM 932   N N     . THR B 2 23  ? 127.741 122.893 118.929 1.00 181.88 ?  30  THR B N     1 
ATOM 933   C CA    . THR B 2 23  ? 128.267 123.264 120.232 1.00 181.88 ?  30  THR B CA    1 
ATOM 934   C C     . THR B 2 23  ? 127.417 122.698 121.366 1.00 181.88 ?  30  THR B C     1 
ATOM 935   O O     . THR B 2 23  ? 126.301 122.223 121.159 1.00 181.88 ?  30  THR B O     1 
ATOM 936   C CB    . THR B 2 23  ? 128.351 124.781 120.351 1.00 181.88 ?  30  THR B CB    1 
ATOM 937   O OG1   . THR B 2 23  ? 127.038 125.335 120.241 1.00 181.88 ?  30  THR B OG1   1 
ATOM 938   C CG2   . THR B 2 23  ? 129.217 125.352 119.248 1.00 181.88 ?  30  THR B CG2   1 
ATOM 939   N N     . LYS B 2 24  ? 127.986 122.734 122.576 1.00 168.71 ?  31  LYS B N     1 
ATOM 940   C CA    . LYS B 2 24  ? 127.273 122.277 123.770 1.00 168.71 ?  31  LYS B CA    1 
ATOM 941   C C     . LYS B 2 24  ? 125.958 123.006 124.044 1.00 168.71 ?  31  LYS B C     1 
ATOM 942   O O     . LYS B 2 24  ? 124.959 122.318 124.303 1.00 168.71 ?  31  LYS B O     1 
ATOM 943   C CB    . LYS B 2 24  ? 128.191 122.336 124.999 1.00 168.71 ?  31  LYS B CB    1 
ATOM 944   C CG    . LYS B 2 24  ? 129.336 121.345 125.041 1.00 168.71 ?  31  LYS B CG    1 
ATOM 945   C CD    . LYS B 2 24  ? 128.828 119.941 125.306 1.00 168.71 ?  31  LYS B CD    1 
ATOM 946   C CE    . LYS B 2 24  ? 129.968 118.956 125.543 1.00 168.71 ?  31  LYS B CE    1 
ATOM 947   N NZ    . LYS B 2 24  ? 130.613 119.173 126.866 1.00 168.71 ?  31  LYS B NZ    1 
ATOM 948   N N     . PRO B 2 25  ? 125.855 124.345 124.020 1.00 171.86 ?  32  PRO B N     1 
ATOM 949   C CA    . PRO B 2 25  ? 124.535 124.930 124.289 1.00 171.86 ?  32  PRO B CA    1 
ATOM 950   C C     . PRO B 2 25  ? 123.596 124.884 123.099 1.00 171.86 ?  32  PRO B C     1 
ATOM 951   O O     . PRO B 2 25  ? 122.412 125.205 123.258 1.00 171.86 ?  32  PRO B O     1 
ATOM 952   C CB    . PRO B 2 25  ? 124.860 126.372 124.682 1.00 171.86 ?  32  PRO B CB    1 
ATOM 953   C CG    . PRO B 2 25  ? 126.045 126.676 123.926 1.00 171.86 ?  32  PRO B CG    1 
ATOM 954   C CD    . PRO B 2 25  ? 126.855 125.427 123.889 1.00 171.86 ?  32  PRO B CD    1 
ATOM 955   N N     . ALA B 2 26  ? 124.075 124.507 121.914 1.00 172.36 ?  33  ALA B N     1 
ATOM 956   C CA    . ALA B 2 26  ? 123.186 124.440 120.762 1.00 172.36 ?  33  ALA B CA    1 
ATOM 957   C C     . ALA B 2 26  ? 122.250 123.250 120.870 1.00 172.36 ?  33  ALA B C     1 
ATOM 958   O O     . ALA B 2 26  ? 121.045 123.374 120.631 1.00 172.36 ?  33  ALA B O     1 
ATOM 959   C CB    . ALA B 2 26  ? 123.995 124.369 119.472 1.00 172.36 ?  33  ALA B CB    1 
ATOM 960   N N     . ILE B 2 27  ? 122.788 122.088 121.238 1.00 167.48 ?  34  ILE B N     1 
ATOM 961   C CA    . ILE B 2 27  ? 121.953 120.918 121.472 1.00 167.48 ?  34  ILE B CA    1 
ATOM 962   C C     . ILE B 2 27  ? 121.059 121.141 122.682 1.00 167.48 ?  34  ILE B C     1 
ATOM 963   O O     . ILE B 2 27  ? 119.935 120.624 122.737 1.00 167.48 ?  34  ILE B O     1 
ATOM 964   C CB    . ILE B 2 27  ? 122.857 119.681 121.604 1.00 167.48 ?  34  ILE B CB    1 
ATOM 965   C CG1   . ILE B 2 27  ? 123.563 119.439 120.281 1.00 167.48 ?  34  ILE B CG1   1 
ATOM 966   C CG2   . ILE B 2 27  ? 122.088 118.437 121.943 1.00 167.48 ?  34  ILE B CG2   1 
ATOM 967   C CD1   . ILE B 2 27  ? 124.620 118.379 120.347 1.00 167.48 ?  34  ILE B CD1   1 
ATOM 968   N N     . ARG B 2 28  ? 121.512 121.955 123.638 1.00 175.20 ?  35  ARG B N     1 
ATOM 969   C CA    . ARG B 2 28  ? 120.646 122.390 124.727 1.00 175.20 ?  35  ARG B CA    1 
ATOM 970   C C     . ARG B 2 28  ? 119.455 123.170 124.190 1.00 175.20 ?  35  ARG B C     1 
ATOM 971   O O     . ARG B 2 28  ? 118.302 122.776 124.387 1.00 175.20 ?  35  ARG B O     1 
ATOM 972   C CB    . ARG B 2 28  ? 121.431 123.242 125.722 1.00 175.20 ?  35  ARG B CB    1 
ATOM 973   C CG    . ARG B 2 28  ? 120.660 123.578 126.986 1.00 175.20 ?  35  ARG B CG    1 
ATOM 974   C CD    . ARG B 2 28  ? 121.398 124.600 127.831 1.00 175.20 ?  35  ARG B CD    1 
ATOM 975   N NE    . ARG B 2 28  ? 122.707 124.129 128.258 1.00 175.20 ?  35  ARG B NE    1 
ATOM 976   C CZ    . ARG B 2 28  ? 122.902 123.340 129.305 1.00 175.20 ?  35  ARG B CZ    1 
ATOM 977   N NH1   . ARG B 2 28  ? 121.869 122.921 130.016 1.00 175.20 ?  35  ARG B NH1   1 
ATOM 978   N NH2   . ARG B 2 28  ? 124.126 122.957 129.632 1.00 175.20 ?  35  ARG B NH2   1 
ATOM 979   N N     . ARG B 2 29  ? 119.722 124.246 123.446 1.00 170.06 ?  36  ARG B N     1 
ATOM 980   C CA    . ARG B 2 29  ? 118.648 125.119 122.991 1.00 170.06 ?  36  ARG B CA    1 
ATOM 981   C C     . ARG B 2 29  ? 117.754 124.477 121.936 1.00 170.06 ?  36  ARG B C     1 
ATOM 982   O O     . ARG B 2 29  ? 116.633 124.951 121.742 1.00 170.06 ?  36  ARG B O     1 
ATOM 983   C CB    . ARG B 2 29  ? 119.221 126.447 122.491 1.00 170.06 ?  36  ARG B CB    1 
ATOM 984   C CG    . ARG B 2 29  ? 119.584 127.378 123.633 1.00 170.06 ?  36  ARG B CG    1 
ATOM 985   C CD    . ARG B 2 29  ? 120.051 128.753 123.191 1.00 170.06 ?  36  ARG B CD    1 
ATOM 986   N NE    . ARG B 2 29  ? 121.421 128.750 122.695 1.00 170.06 ?  36  ARG B NE    1 
ATOM 987   C CZ    . ARG B 2 29  ? 121.769 129.076 121.458 1.00 170.06 ?  36  ARG B CZ    1 
ATOM 988   N NH1   . ARG B 2 29  ? 120.844 129.441 120.586 1.00 170.06 ?  36  ARG B NH1   1 
ATOM 989   N NH2   . ARG B 2 29  ? 123.042 129.048 121.096 1.00 170.06 ?  36  ARG B NH2   1 
ATOM 990   N N     . LEU B 2 30  ? 118.198 123.406 121.272 1.00 172.55 ?  37  LEU B N     1 
ATOM 991   C CA    . LEU B 2 30  ? 117.264 122.597 120.495 1.00 172.55 ?  37  LEU B CA    1 
ATOM 992   C C     . LEU B 2 30  ? 116.277 121.895 121.408 1.00 172.55 ?  37  LEU B C     1 
ATOM 993   O O     . LEU B 2 30  ? 115.061 121.956 121.199 1.00 172.55 ?  37  LEU B O     1 
ATOM 994   C CB    . LEU B 2 30  ? 117.998 121.564 119.650 1.00 172.55 ?  37  LEU B CB    1 
ATOM 995   C CG    . LEU B 2 30  ? 118.641 122.024 118.359 1.00 172.55 ?  37  LEU B CG    1 
ATOM 996   C CD1   . LEU B 2 30  ? 119.429 120.897 117.726 1.00 172.55 ?  37  LEU B CD1   1 
ATOM 997   C CD2   . LEU B 2 30  ? 117.542 122.472 117.444 1.00 172.55 ?  37  LEU B CD2   1 
ATOM 998   N N     . ALA B 2 31  ? 116.790 121.219 122.432 1.00 172.66 ?  38  ALA B N     1 
ATOM 999   C CA    . ALA B 2 31  ? 115.928 120.456 123.317 1.00 172.66 ?  38  ALA B CA    1 
ATOM 1000  C C     . ALA B 2 31  ? 115.074 121.348 124.203 1.00 172.66 ?  38  ALA B C     1 
ATOM 1001  O O     . ALA B 2 31  ? 114.030 120.896 124.687 1.00 172.66 ?  38  ALA B O     1 
ATOM 1002  C CB    . ALA B 2 31  ? 116.768 119.511 124.170 1.00 172.66 ?  38  ALA B CB    1 
ATOM 1003  N N     . ARG B 2 32  ? 115.481 122.602 124.414 1.00 183.11 ?  39  ARG B N     1 
ATOM 1004  C CA    . ARG B 2 32  ? 114.662 123.506 125.211 1.00 183.11 ?  39  ARG B CA    1 
ATOM 1005  C C     . ARG B 2 32  ? 113.382 123.871 124.483 1.00 183.11 ?  39  ARG B C     1 
ATOM 1006  O O     . ARG B 2 32  ? 112.381 124.207 125.121 1.00 183.11 ?  39  ARG B O     1 
ATOM 1007  C CB    . ARG B 2 32  ? 115.437 124.769 125.564 1.00 183.11 ?  39  ARG B CB    1 
ATOM 1008  C CG    . ARG B 2 32  ? 116.617 124.555 126.480 1.00 183.11 ?  39  ARG B CG    1 
ATOM 1009  C CD    . ARG B 2 32  ? 116.223 124.265 127.901 1.00 183.11 ?  39  ARG B CD    1 
ATOM 1010  N NE    . ARG B 2 32  ? 117.423 124.143 128.714 1.00 183.11 ?  39  ARG B NE    1 
ATOM 1011  C CZ    . ARG B 2 32  ? 117.415 123.932 130.018 1.00 183.11 ?  39  ARG B CZ    1 
ATOM 1012  N NH1   . ARG B 2 32  ? 116.266 123.837 130.661 1.00 183.11 ?  39  ARG B NH1   1 
ATOM 1013  N NH2   . ARG B 2 32  ? 118.554 123.834 130.676 1.00 183.11 ?  39  ARG B NH2   1 
ATOM 1014  N N     . ARG B 2 33  ? 113.389 123.817 123.154 1.00 173.76 ?  40  ARG B N     1 
ATOM 1015  C CA    . ARG B 2 33  ? 112.154 124.079 122.436 1.00 173.76 ?  40  ARG B CA    1 
ATOM 1016  C C     . ARG B 2 33  ? 111.199 122.906 122.556 1.00 173.76 ?  40  ARG B C     1 
ATOM 1017  O O     . ARG B 2 33  ? 109.982 123.099 122.632 1.00 173.76 ?  40  ARG B O     1 
ATOM 1018  C CB    . ARG B 2 33  ? 112.447 124.377 120.972 1.00 173.76 ?  40  ARG B CB    1 
ATOM 1019  C CG    . ARG B 2 33  ? 111.242 124.870 120.206 1.00 173.76 ?  40  ARG B CG    1 
ATOM 1020  C CD    . ARG B 2 33  ? 111.558 125.148 118.753 1.00 173.76 ?  40  ARG B CD    1 
ATOM 1021  N NE    . ARG B 2 33  ? 112.480 126.255 118.591 1.00 173.76 ?  40  ARG B NE    1 
ATOM 1022  C CZ    . ARG B 2 33  ? 113.007 126.597 117.428 1.00 173.76 ?  40  ARG B CZ    1 
ATOM 1023  N NH1   . ARG B 2 33  ? 112.687 125.919 116.341 1.00 173.76 ?  40  ARG B NH1   1 
ATOM 1024  N NH2   . ARG B 2 33  ? 113.837 127.619 117.348 1.00 173.76 ?  40  ARG B NH2   1 
ATOM 1025  N N     . GLY B 2 34  ? 111.731 121.690 122.617 1.00 166.06 ?  41  GLY B N     1 
ATOM 1026  C CA    . GLY B 2 34  ? 110.875 120.522 122.619 1.00 166.06 ?  41  GLY B CA    1 
ATOM 1027  C C     . GLY B 2 34  ? 110.167 120.276 123.928 1.00 166.06 ?  41  GLY B C     1 
ATOM 1028  O O     . GLY B 2 34  ? 109.218 119.488 123.967 1.00 166.06 ?  41  GLY B O     1 
ATOM 1029  N N     . GLY B 2 35  ? 110.594 120.935 124.994 1.00 168.61 ?  42  GLY B N     1 
ATOM 1030  C CA    . GLY B 2 35  ? 110.034 120.682 126.298 1.00 168.61 ?  42  GLY B CA    1 
ATOM 1031  C C     . GLY B 2 35  ? 110.900 119.828 127.184 1.00 168.61 ?  42  GLY B C     1 
ATOM 1032  O O     . GLY B 2 35  ? 110.406 119.293 128.180 1.00 168.61 ?  42  GLY B O     1 
ATOM 1033  N N     . VAL B 2 36  ? 112.171 119.670 126.854 1.00 175.77 ?  43  VAL B N     1 
ATOM 1034  C CA    . VAL B 2 36  ? 113.081 118.953 127.730 1.00 175.77 ?  43  VAL B CA    1 
ATOM 1035  C C     . VAL B 2 36  ? 113.414 119.849 128.906 1.00 175.77 ?  43  VAL B C     1 
ATOM 1036  O O     . VAL B 2 36  ? 114.089 120.872 128.754 1.00 175.77 ?  43  VAL B O     1 
ATOM 1037  C CB    . VAL B 2 36  ? 114.350 118.540 126.984 1.00 175.77 ?  43  VAL B CB    1 
ATOM 1038  C CG1   . VAL B 2 36  ? 115.273 117.849 127.935 1.00 175.77 ?  43  VAL B CG1   1 
ATOM 1039  C CG2   . VAL B 2 36  ? 113.996 117.637 125.839 1.00 175.77 ?  43  VAL B CG2   1 
ATOM 1040  N N     . LYS B 2 37  ? 112.943 119.466 130.083 1.00 183.09 ?  44  LYS B N     1 
ATOM 1041  C CA    . LYS B 2 37  ? 113.071 120.335 131.238 1.00 183.09 ?  44  LYS B CA    1 
ATOM 1042  C C     . LYS B 2 37  ? 114.469 120.269 131.831 1.00 183.09 ?  44  LYS B C     1 
ATOM 1043  O O     . LYS B 2 37  ? 114.868 121.183 132.557 1.00 183.09 ?  44  LYS B O     1 
ATOM 1044  C CB    . LYS B 2 37  ? 112.008 119.944 132.257 1.00 183.09 ?  44  LYS B CB    1 
ATOM 1045  C CG    . LYS B 2 37  ? 111.697 120.963 133.321 1.00 183.09 ?  44  LYS B CG    1 
ATOM 1046  C CD    . LYS B 2 37  ? 110.579 120.424 134.192 1.00 183.09 ?  44  LYS B CD    1 
ATOM 1047  C CE    . LYS B 2 37  ? 109.270 120.376 133.410 1.00 183.09 ?  44  LYS B CE    1 
ATOM 1048  N NZ    . LYS B 2 37  ? 108.124 119.872 134.217 1.00 183.09 ?  44  LYS B NZ    1 
ATOM 1049  N N     . ARG B 2 38  ? 115.234 119.235 131.487 1.00 194.25 ?  45  ARG B N     1 
ATOM 1050  C CA    . ARG B 2 38  ? 116.565 119.003 132.032 1.00 194.25 ?  45  ARG B CA    1 
ATOM 1051  C C     . ARG B 2 38  ? 117.240 117.922 131.197 1.00 194.25 ?  45  ARG B C     1 
ATOM 1052  O O     . ARG B 2 38  ? 116.618 116.907 130.887 1.00 194.25 ?  45  ARG B O     1 
ATOM 1053  C CB    . ARG B 2 38  ? 116.470 118.578 133.497 1.00 194.25 ?  45  ARG B CB    1 
ATOM 1054  C CG    . ARG B 2 38  ? 117.771 118.464 134.226 1.00 194.25 ?  45  ARG B CG    1 
ATOM 1055  C CD    . ARG B 2 38  ? 117.471 118.166 135.671 1.00 194.25 ?  45  ARG B CD    1 
ATOM 1056  N NE    . ARG B 2 38  ? 118.665 117.902 136.452 1.00 194.25 ?  45  ARG B NE    1 
ATOM 1057  C CZ    . ARG B 2 38  ? 118.633 117.585 137.736 1.00 194.25 ?  45  ARG B CZ    1 
ATOM 1058  N NH1   . ARG B 2 38  ? 117.469 117.496 138.360 1.00 194.25 ?  45  ARG B NH1   1 
ATOM 1059  N NH2   . ARG B 2 38  ? 119.758 117.353 138.390 1.00 194.25 ?  45  ARG B NH2   1 
ATOM 1060  N N     . ILE B 2 39  ? 118.506 118.132 130.843 1.00 191.54 ?  46  ILE B N     1 
ATOM 1061  C CA    . ILE B 2 39  ? 119.221 117.257 129.920 1.00 191.54 ?  46  ILE B CA    1 
ATOM 1062  C C     . ILE B 2 39  ? 120.290 116.486 130.674 1.00 191.54 ?  46  ILE B C     1 
ATOM 1063  O O     . ILE B 2 39  ? 121.102 117.080 131.386 1.00 191.54 ?  46  ILE B O     1 
ATOM 1064  C CB    . ILE B 2 39  ? 119.861 118.059 128.775 1.00 191.54 ?  46  ILE B CB    1 
ATOM 1065  C CG1   . ILE B 2 39  ? 118.797 118.739 127.942 1.00 191.54 ?  46  ILE B CG1   1 
ATOM 1066  C CG2   . ILE B 2 39  ? 120.677 117.174 127.878 1.00 191.54 ?  46  ILE B CG2   1 
ATOM 1067  C CD1   . ILE B 2 39  ? 119.369 119.691 126.943 1.00 191.54 ?  46  ILE B CD1   1 
ATOM 1068  N N     . SER B 2 40  ? 120.317 115.170 130.502 1.00 186.94 ?  47  SER B N     1 
ATOM 1069  C CA    . SER B 2 40  ? 121.360 114.398 131.155 1.00 186.94 ?  47  SER B CA    1 
ATOM 1070  C C     . SER B 2 40  ? 122.672 114.530 130.397 1.00 186.94 ?  47  SER B C     1 
ATOM 1071  O O     . SER B 2 40  ? 122.712 114.889 129.222 1.00 186.94 ?  47  SER B O     1 
ATOM 1072  C CB    . SER B 2 40  ? 120.971 112.932 131.261 1.00 186.94 ?  47  SER B CB    1 
ATOM 1073  O OG    . SER B 2 40  ? 122.010 112.188 131.863 1.00 186.94 ?  47  SER B OG    1 
ATOM 1074  N N     . GLY B 2 41  ? 123.760 114.205 131.086 1.00 188.83 ?  48  GLY B N     1 
ATOM 1075  C CA    . GLY B 2 41  ? 125.090 114.522 130.605 1.00 188.83 ?  48  GLY B CA    1 
ATOM 1076  C C     . GLY B 2 41  ? 125.628 113.657 129.492 1.00 188.83 ?  48  GLY B C     1 
ATOM 1077  O O     . GLY B 2 41  ? 126.811 113.771 129.164 1.00 188.83 ?  48  GLY B O     1 
ATOM 1078  N N     . LEU B 2 42  ? 124.815 112.793 128.904 1.00 167.64 ?  49  LEU B N     1 
ATOM 1079  C CA    . LEU B 2 42  ? 125.279 111.993 127.788 1.00 167.64 ?  49  LEU B CA    1 
ATOM 1080  C C     . LEU B 2 42  ? 124.590 112.325 126.475 1.00 167.64 ?  49  LEU B C     1 
ATOM 1081  O O     . LEU B 2 42  ? 125.023 111.829 125.431 1.00 167.64 ?  49  LEU B O     1 
ATOM 1082  C CB    . LEU B 2 42  ? 125.104 110.511 128.098 1.00 167.64 ?  49  LEU B CB    1 
ATOM 1083  C CG    . LEU B 2 42  ? 126.060 109.993 129.154 1.00 167.64 ?  49  LEU B CG    1 
ATOM 1084  C CD1   . LEU B 2 42  ? 125.723 108.565 129.515 1.00 167.64 ?  49  LEU B CD1   1 
ATOM 1085  C CD2   . LEU B 2 42  ? 127.456 110.087 128.593 1.00 167.64 ?  49  LEU B CD2   1 
ATOM 1086  N N     . ILE B 2 43  ? 123.547 113.160 126.496 1.00 175.37 ?  50  ILE B N     1 
ATOM 1087  C CA    . ILE B 2 43  ? 122.851 113.526 125.266 1.00 175.37 ?  50  ILE B CA    1 
ATOM 1088  C C     . ILE B 2 43  ? 123.740 114.398 124.388 1.00 175.37 ?  50  ILE B C     1 
ATOM 1089  O O     . ILE B 2 43  ? 123.603 114.394 123.160 1.00 175.37 ?  50  ILE B O     1 
ATOM 1090  C CB    . ILE B 2 43  ? 121.514 114.204 125.623 1.00 175.37 ?  50  ILE B CB    1 
ATOM 1091  C CG1   . ILE B 2 43  ? 120.705 113.279 126.519 1.00 175.37 ?  50  ILE B CG1   1 
ATOM 1092  C CG2   . ILE B 2 43  ? 120.666 114.489 124.407 1.00 175.37 ?  50  ILE B CG2   1 
ATOM 1093  C CD1   . ILE B 2 43  ? 120.392 111.951 125.896 1.00 175.37 ?  50  ILE B CD1   1 
ATOM 1094  N N     . TYR B 2 44  ? 124.713 115.090 124.990 1.00 181.92 ?  51  TYR B N     1 
ATOM 1095  C CA    . TYR B 2 44  ? 125.675 115.886 124.231 1.00 181.92 ?  51  TYR B CA    1 
ATOM 1096  C C     . TYR B 2 44  ? 126.537 115.015 123.327 1.00 181.92 ?  51  TYR B C     1 
ATOM 1097  O O     . TYR B 2 44  ? 127.088 115.495 122.331 1.00 181.92 ?  51  TYR B O     1 
ATOM 1098  C CB    . TYR B 2 44  ? 126.564 116.674 125.187 1.00 181.92 ?  51  TYR B CB    1 
ATOM 1099  C CG    . TYR B 2 44  ? 125.852 117.740 125.973 1.00 181.92 ?  51  TYR B CG    1 
ATOM 1100  C CD1   . TYR B 2 44  ? 124.664 118.286 125.523 1.00 181.92 ?  51  TYR B CD1   1 
ATOM 1101  C CD2   . TYR B 2 44  ? 126.353 118.170 127.192 1.00 181.92 ?  51  TYR B CD2   1 
ATOM 1102  C CE1   . TYR B 2 44  ? 124.011 119.247 126.251 1.00 181.92 ?  51  TYR B CE1   1 
ATOM 1103  C CE2   . TYR B 2 44  ? 125.709 119.129 127.924 1.00 181.92 ?  51  TYR B CE2   1 
ATOM 1104  C CZ    . TYR B 2 44  ? 124.539 119.663 127.450 1.00 181.92 ?  51  TYR B CZ    1 
ATOM 1105  O OH    . TYR B 2 44  ? 123.889 120.620 128.182 1.00 181.92 ?  51  TYR B OH    1 
ATOM 1106  N N     . GLU B 2 45  ? 126.678 113.738 123.662 1.00 0.00   ?  52  GLU B N     1 
ATOM 1107  C CA    . GLU B 2 45  ? 127.267 112.779 122.747 1.00 0.00   ?  52  GLU B CA    1 
ATOM 1108  C C     . GLU B 2 45  ? 126.219 112.102 121.879 1.00 0.00   ?  52  GLU B C     1 
ATOM 1109  O O     . GLU B 2 45  ? 126.538 111.675 120.766 1.00 0.00   ?  52  GLU B O     1 
ATOM 1110  C CB    . GLU B 2 45  ? 128.061 111.730 123.537 1.00 0.00   ?  52  GLU B CB    1 
ATOM 1111  C CG    . GLU B 2 45  ? 129.054 110.904 122.734 1.00 0.00   ?  52  GLU B CG    1 
ATOM 1112  C CD    . GLU B 2 45  ? 128.440 109.661 122.135 1.00 0.00   ?  52  GLU B CD    1 
ATOM 1113  O OE1   . GLU B 2 45  ? 127.462 109.147 122.715 1.00 0.00   ?  52  GLU B OE1   1 
ATOM 1114  O OE2   . GLU B 2 45  ? 128.930 109.204 121.083 1.00 0.00   -1 52  GLU B OE2   1 
ATOM 1115  N N     . GLU B 2 46  ? 124.973 112.032 122.342 1.00 189.48 ?  53  GLU B N     1 
ATOM 1116  C CA    . GLU B 2 46  ? 123.968 111.252 121.635 1.00 189.48 ?  53  GLU B CA    1 
ATOM 1117  C C     . GLU B 2 46  ? 123.441 111.968 120.400 1.00 189.48 ?  53  GLU B C     1 
ATOM 1118  O O     . GLU B 2 46  ? 123.318 111.348 119.339 1.00 189.48 ?  53  GLU B O     1 
ATOM 1119  C CB    . GLU B 2 46  ? 122.814 110.923 122.572 1.00 189.48 ?  53  GLU B CB    1 
ATOM 1120  C CG    . GLU B 2 46  ? 121.717 110.103 121.938 1.00 189.48 ?  53  GLU B CG    1 
ATOM 1121  C CD    . GLU B 2 46  ? 122.151 108.699 121.633 1.00 189.48 ?  53  GLU B CD    1 
ATOM 1122  O OE1   . GLU B 2 46  ? 123.040 108.178 122.330 1.00 189.48 ?  53  GLU B OE1   1 
ATOM 1123  O OE2   . GLU B 2 46  ? 121.606 108.106 120.687 1.00 189.48 -1 53  GLU B OE2   1 
ATOM 1124  N N     . THR B 2 47  ? 123.111 113.255 120.522 1.00 178.09 ?  54  THR B N     1 
ATOM 1125  C CA    . THR B 2 47  ? 122.523 113.987 119.405 1.00 178.09 ?  54  THR B CA    1 
ATOM 1126  C C     . THR B 2 47  ? 123.523 114.154 118.271 1.00 178.09 ?  54  THR B C     1 
ATOM 1127  O O     . THR B 2 47  ? 123.146 114.124 117.095 1.00 178.09 ?  54  THR B O     1 
ATOM 1128  C CB    . THR B 2 47  ? 122.003 115.335 119.897 1.00 178.09 ?  54  THR B CB    1 
ATOM 1129  O OG1   . THR B 2 47  ? 121.051 115.105 120.935 1.00 178.09 ?  54  THR B OG1   1 
ATOM 1130  C CG2   . THR B 2 47  ? 121.310 116.107 118.808 1.00 178.09 ?  54  THR B CG2   1 
ATOM 1131  N N     . ARG B 2 48  ? 124.811 114.248 118.602 1.00 184.58 ?  55  ARG B N     1 
ATOM 1132  C CA    . ARG B 2 48  ? 125.845 114.231 117.573 1.00 184.58 ?  55  ARG B CA    1 
ATOM 1133  C C     . ARG B 2 48  ? 125.884 112.906 116.824 1.00 184.58 ?  55  ARG B C     1 
ATOM 1134  O O     . ARG B 2 48  ? 126.317 112.865 115.670 1.00 184.58 ?  55  ARG B O     1 
ATOM 1135  C CB    . ARG B 2 48  ? 127.207 114.511 118.195 1.00 184.58 ?  55  ARG B CB    1 
ATOM 1136  C CG    . ARG B 2 48  ? 127.367 115.924 118.687 1.00 184.58 ?  55  ARG B CG    1 
ATOM 1137  C CD    . ARG B 2 48  ? 128.726 116.134 119.316 1.00 184.58 ?  55  ARG B CD    1 
ATOM 1138  N NE    . ARG B 2 48  ? 128.907 117.529 119.675 1.00 184.58 ?  55  ARG B NE    1 
ATOM 1139  C CZ    . ARG B 2 48  ? 128.555 118.040 120.842 1.00 184.58 ?  55  ARG B CZ    1 
ATOM 1140  N NH1   . ARG B 2 48  ? 128.016 117.264 121.764 1.00 184.58 ?  55  ARG B NH1   1 
ATOM 1141  N NH2   . ARG B 2 48  ? 128.748 119.325 121.087 1.00 184.58 ?  55  ARG B NH2   1 
ATOM 1142  N N     . GLY B 2 49  ? 125.431 111.821 117.450 1.00 176.72 ?  56  GLY B N     1 
ATOM 1143  C CA    . GLY B 2 49  ? 125.296 110.572 116.728 1.00 176.72 ?  56  GLY B CA    1 
ATOM 1144  C C     . GLY B 2 49  ? 124.110 110.556 115.787 1.00 176.72 ?  56  GLY B C     1 
ATOM 1145  O O     . GLY B 2 49  ? 124.228 110.094 114.651 1.00 176.72 ?  56  GLY B O     1 
ATOM 1146  N N     . VAL B 2 50  ? 122.959 111.057 116.239 1.00 168.93 ?  57  VAL B N     1 
ATOM 1147  C CA    . VAL B 2 50  ? 121.748 111.008 115.425 1.00 168.93 ?  57  VAL B CA    1 
ATOM 1148  C C     . VAL B 2 50  ? 121.835 111.997 114.270 1.00 168.93 ?  57  VAL B C     1 
ATOM 1149  O O     . VAL B 2 50  ? 121.409 111.703 113.146 1.00 168.93 ?  57  VAL B O     1 
ATOM 1150  C CB    . VAL B 2 50  ? 120.520 111.251 116.318 1.00 168.93 ?  57  VAL B CB    1 
ATOM 1151  C CG1   . VAL B 2 50  ? 119.260 111.381 115.509 1.00 168.93 ?  57  VAL B CG1   1 
ATOM 1152  C CG2   . VAL B 2 50  ? 120.370 110.103 117.266 1.00 168.93 ?  57  VAL B CG2   1 
ATOM 1153  N N     . LEU B 2 51  ? 122.445 113.155 114.507 1.00 163.29 ?  58  LEU B N     1 
ATOM 1154  C CA    . LEU B 2 51  ? 122.562 114.151 113.450 1.00 163.29 ?  58  LEU B CA    1 
ATOM 1155  C C     . LEU B 2 51  ? 123.558 113.721 112.379 1.00 163.29 ?  58  LEU B C     1 
ATOM 1156  O O     . LEU B 2 51  ? 123.465 114.172 111.234 1.00 163.29 ?  58  LEU B O     1 
ATOM 1157  C CB    . LEU B 2 51  ? 122.949 115.493 114.060 1.00 163.29 ?  58  LEU B CB    1 
ATOM 1158  C CG    . LEU B 2 51  ? 122.903 116.720 113.168 1.00 163.29 ?  58  LEU B CG    1 
ATOM 1159  C CD1   . LEU B 2 51  ? 121.497 116.904 112.691 1.00 163.29 ?  58  LEU B CD1   1 
ATOM 1160  C CD2   . LEU B 2 51  ? 123.359 117.931 113.934 1.00 163.29 ?  58  LEU B CD2   1 
ATOM 1161  N N     . LYS B 2 52  ? 124.488 112.822 112.705 1.00 164.80 ?  59  LYS B N     1 
ATOM 1162  C CA    . LYS B 2 52  ? 125.373 112.315 111.665 1.00 164.80 ?  59  LYS B CA    1 
ATOM 1163  C C     . LYS B 2 52  ? 124.668 111.258 110.827 1.00 164.80 ?  59  LYS B C     1 
ATOM 1164  O O     . LYS B 2 52  ? 124.978 111.080 109.646 1.00 164.80 ?  59  LYS B O     1 
ATOM 1165  C CB    . LYS B 2 52  ? 126.661 111.763 112.272 1.00 164.80 ?  59  LYS B CB    1 
ATOM 1166  C CG    . LYS B 2 52  ? 127.737 111.481 111.232 1.00 164.80 ?  59  LYS B CG    1 
ATOM 1167  C CD    . LYS B 2 52  ? 129.062 111.108 111.848 1.00 164.80 ?  59  LYS B CD    1 
ATOM 1168  C CE    . LYS B 2 52  ? 130.119 110.922 110.776 1.00 164.80 ?  59  LYS B CE    1 
ATOM 1169  N NZ    . LYS B 2 52  ? 131.443 110.591 111.361 1.00 164.80 ?  59  LYS B NZ    1 
ATOM 1170  N N     . VAL B 2 53  ? 123.687 110.567 111.404 1.00 179.88 ?  60  VAL B N     1 
ATOM 1171  C CA    . VAL B 2 53  ? 122.987 109.558 110.621 1.00 179.88 ?  60  VAL B CA    1 
ATOM 1172  C C     . VAL B 2 53  ? 121.687 110.121 110.050 1.00 179.88 ?  60  VAL B C     1 
ATOM 1173  O O     . VAL B 2 53  ? 120.913 109.391 109.422 1.00 179.88 ?  60  VAL B O     1 
ATOM 1174  C CB    . VAL B 2 53  ? 122.793 108.295 111.482 1.00 179.88 ?  60  VAL B CB    1 
ATOM 1175  C CG1   . VAL B 2 53  ? 121.656 108.459 112.463 1.00 179.88 ?  60  VAL B CG1   1 
ATOM 1176  C CG2   . VAL B 2 53  ? 122.684 107.021 110.644 1.00 179.88 ?  60  VAL B CG2   1 
ATOM 1177  N N     . PHE B 2 54  ? 121.436 111.418 110.222 1.00 169.94 ?  61  PHE B N     1 
ATOM 1178  C CA    . PHE B 2 54  ? 120.390 112.060 109.435 1.00 169.94 ?  61  PHE B CA    1 
ATOM 1179  C C     . PHE B 2 54  ? 120.956 112.663 108.160 1.00 169.94 ?  61  PHE B C     1 
ATOM 1180  O O     . PHE B 2 54  ? 120.257 112.752 107.148 1.00 169.94 ?  61  PHE B O     1 
ATOM 1181  C CB    . PHE B 2 54  ? 119.679 113.136 110.247 1.00 169.94 ?  61  PHE B CB    1 
ATOM 1182  C CG    . PHE B 2 54  ? 118.622 113.875 109.479 1.00 169.94 ?  61  PHE B CG    1 
ATOM 1183  C CD1   . PHE B 2 54  ? 117.410 113.283 109.211 1.00 169.94 ?  61  PHE B CD1   1 
ATOM 1184  C CD2   . PHE B 2 54  ? 118.846 115.164 109.032 1.00 169.94 ?  61  PHE B CD2   1 
ATOM 1185  C CE1   . PHE B 2 54  ? 116.442 113.958 108.511 1.00 169.94 ?  61  PHE B CE1   1 
ATOM 1186  C CE2   . PHE B 2 54  ? 117.885 115.839 108.334 1.00 169.94 ?  61  PHE B CE2   1 
ATOM 1187  C CZ    . PHE B 2 54  ? 116.683 115.238 108.073 1.00 169.94 ?  61  PHE B CZ    1 
ATOM 1188  N N     . LEU B 2 55  ? 122.214 113.092 108.185 1.00 169.15 ?  62  LEU B N     1 
ATOM 1189  C CA    . LEU B 2 55  ? 122.789 113.651 106.972 1.00 169.15 ?  62  LEU B CA    1 
ATOM 1190  C C     . LEU B 2 55  ? 123.093 112.570 105.948 1.00 169.15 ?  62  LEU B C     1 
ATOM 1191  O O     . LEU B 2 55  ? 122.983 112.815 104.743 1.00 169.15 ?  62  LEU B O     1 
ATOM 1192  C CB    . LEU B 2 55  ? 124.042 114.446 107.304 1.00 169.15 ?  62  LEU B CB    1 
ATOM 1193  C CG    . LEU B 2 55  ? 123.722 115.655 108.174 1.00 169.15 ?  62  LEU B CG    1 
ATOM 1194  C CD1   . LEU B 2 55  ? 124.980 116.375 108.583 1.00 169.15 ?  62  LEU B CD1   1 
ATOM 1195  C CD2   . LEU B 2 55  ? 122.793 116.598 107.455 1.00 169.15 ?  62  LEU B CD2   1 
ATOM 1196  N N     . GLU B 2 56  ? 123.438 111.363 106.395 1.00 188.19 ?  63  GLU B N     1 
ATOM 1197  C CA    . GLU B 2 56  ? 123.749 110.311 105.436 1.00 188.19 ?  63  GLU B CA    1 
ATOM 1198  C C     . GLU B 2 56  ? 122.496 109.654 104.879 1.00 188.19 ?  63  GLU B C     1 
ATOM 1199  O O     . GLU B 2 56  ? 122.591 108.803 103.992 1.00 188.19 ?  63  GLU B O     1 
ATOM 1200  C CB    . GLU B 2 56  ? 124.670 109.270 106.058 1.00 188.19 ?  63  GLU B CB    1 
ATOM 1201  C CG    . GLU B 2 56  ? 126.079 109.769 106.256 1.00 188.19 ?  63  GLU B CG    1 
ATOM 1202  C CD    . GLU B 2 56  ? 126.987 108.710 106.834 1.00 188.19 ?  63  GLU B CD    1 
ATOM 1203  O OE1   . GLU B 2 56  ? 126.482 107.629 107.194 1.00 188.19 ?  63  GLU B OE1   1 
ATOM 1204  O OE2   . GLU B 2 56  ? 128.206 108.953 106.924 1.00 188.19 -1 63  GLU B OE2   1 
ATOM 1205  N N     . ASN B 2 57  ? 121.323 110.006 105.382 1.00 188.74 ?  64  ASN B N     1 
ATOM 1206  C CA    . ASN B 2 57  ? 120.100 109.626 104.700 1.00 188.74 ?  64  ASN B CA    1 
ATOM 1207  C C     . ASN B 2 57  ? 119.403 110.804 104.051 1.00 188.74 ?  64  ASN B C     1 
ATOM 1208  O O     . ASN B 2 57  ? 118.221 110.702 103.719 1.00 188.74 ?  64  ASN B O     1 
ATOM 1209  C CB    . ASN B 2 57  ? 119.151 108.908 105.648 1.00 188.74 ?  64  ASN B CB    1 
ATOM 1210  C CG    . ASN B 2 57  ? 119.557 107.482 105.882 1.00 188.74 ?  64  ASN B CG    1 
ATOM 1211  O OD1   . ASN B 2 57  ? 120.026 106.808 104.970 1.00 188.74 ?  64  ASN B OD1   1 
ATOM 1212  N ND2   . ASN B 2 57  ? 119.353 106.998 107.096 1.00 188.74 ?  64  ASN B ND2   1 
ATOM 1213  N N     . VAL B 2 58  ? 120.098 111.924 103.881 1.00 171.87 ?  65  VAL B N     1 
ATOM 1214  C CA    . VAL B 2 58  ? 119.653 113.007 103.018 1.00 171.87 ?  65  VAL B CA    1 
ATOM 1215  C C     . VAL B 2 58  ? 120.633 113.236 101.881 1.00 171.87 ?  65  VAL B C     1 
ATOM 1216  O O     . VAL B 2 58  ? 120.245 113.258 100.713 1.00 171.87 ?  65  VAL B O     1 
ATOM 1217  C CB    . VAL B 2 58  ? 119.436 114.309 103.807 1.00 171.87 ?  65  VAL B CB    1 
ATOM 1218  C CG1   . VAL B 2 58  ? 119.040 115.404 102.867 1.00 171.87 ?  65  VAL B CG1   1 
ATOM 1219  C CG2   . VAL B 2 58  ? 118.370 114.118 104.826 1.00 171.87 ?  65  VAL B CG2   1 
ATOM 1220  N N     . ILE B 2 59  ? 121.919 113.367 102.206 1.00 181.71 ?  66  ILE B N     1 
ATOM 1221  C CA    . ILE B 2 59  ? 122.915 113.754 101.215 1.00 181.71 ?  66  ILE B CA    1 
ATOM 1222  C C     . ILE B 2 59  ? 123.150 112.631 100.207 1.00 181.71 ?  66  ILE B C     1 
ATOM 1223  O O     . ILE B 2 59  ? 123.390 112.896 99.022  1.00 181.71 ?  66  ILE B O     1 
ATOM 1224  C CB    . ILE B 2 59  ? 124.200 114.192 101.934 1.00 181.71 ?  66  ILE B CB    1 
ATOM 1225  C CG1   . ILE B 2 59  ? 123.899 115.412 102.782 1.00 181.71 ?  66  ILE B CG1   1 
ATOM 1226  C CG2   . ILE B 2 59  ? 125.300 114.562 100.981 1.00 181.71 ?  66  ILE B CG2   1 
ATOM 1227  C CD1   . ILE B 2 59  ? 125.009 115.770 103.704 1.00 181.71 ?  66  ILE B CD1   1 
ATOM 1228  N N     . ARG B 2 60  ? 123.022 111.367 100.637 1.00 189.72 ?  67  ARG B N     1 
ATOM 1229  C CA    . ARG B 2 60  ? 123.033 110.265 99.675  1.00 189.72 ?  67  ARG B CA    1 
ATOM 1230  C C     . ARG B 2 60  ? 121.840 110.355 98.736  1.00 189.72 ?  67  ARG B C     1 
ATOM 1231  O O     . ARG B 2 60  ? 121.959 110.088 97.536  1.00 189.72 ?  67  ARG B O     1 
ATOM 1232  C CB    . ARG B 2 60  ? 123.034 108.909 100.377 1.00 189.72 ?  67  ARG B CB    1 
ATOM 1233  C CG    . ARG B 2 60  ? 123.276 107.771 99.390  1.00 189.72 ?  67  ARG B CG    1 
ATOM 1234  C CD    . ARG B 2 60  ? 123.382 106.383 99.995  1.00 189.72 ?  67  ARG B CD    1 
ATOM 1235  N NE    . ARG B 2 60  ? 122.121 105.895 100.533 1.00 189.72 ?  67  ARG B NE    1 
ATOM 1236  C CZ    . ARG B 2 60  ? 121.935 105.567 101.804 1.00 189.72 ?  67  ARG B CZ    1 
ATOM 1237  N NH1   . ARG B 2 60  ? 122.938 105.662 102.666 1.00 189.72 ?  67  ARG B NH1   1 
ATOM 1238  N NH2   . ARG B 2 60  ? 120.753 105.129 102.209 1.00 189.72 ?  67  ARG B NH2   1 
ATOM 1239  N N     . ASP B 2 61  ? 120.691 110.774 99.251  1.00 200.70 ?  68  ASP B N     1 
ATOM 1240  C CA    . ASP B 2 61  ? 119.586 111.048 98.350  1.00 200.70 ?  68  ASP B CA    1 
ATOM 1241  C C     . ASP B 2 61  ? 119.745 112.397 97.661  1.00 200.70 ?  68  ASP B C     1 
ATOM 1242  O O     . ASP B 2 61  ? 119.077 112.647 96.657  1.00 200.70 ?  68  ASP B O     1 
ATOM 1243  C CB    . ASP B 2 61  ? 118.255 110.974 99.097  1.00 200.70 ?  68  ASP B CB    1 
ATOM 1244  C CG    . ASP B 2 61  ? 117.881 109.548 99.483  1.00 200.70 ?  68  ASP B CG    1 
ATOM 1245  O OD1   . ASP B 2 61  ? 118.358 108.613 98.813  1.00 200.70 ?  68  ASP B OD1   1 
ATOM 1246  O OD2   . ASP B 2 61  ? 117.091 109.356 100.433 1.00 200.70 -1 68  ASP B OD2   1 
ATOM 1247  N N     . ALA B 2 62  ? 120.625 113.274 98.157  1.00 185.60 ?  69  ALA B N     1 
ATOM 1248  C CA    . ALA B 2 62  ? 120.698 114.611 97.570  1.00 185.60 ?  69  ALA B CA    1 
ATOM 1249  C C     . ALA B 2 62  ? 121.845 114.757 96.587  1.00 185.60 ?  69  ALA B C     1 
ATOM 1250  O O     . ALA B 2 62  ? 121.725 115.511 95.620  1.00 185.60 ?  69  ALA B O     1 
ATOM 1251  C CB    . ALA B 2 62  ? 120.828 115.682 98.647  1.00 185.60 ?  69  ALA B CB    1 
ATOM 1252  N N     . VAL B 2 63  ? 122.970 114.082 96.815  1.00 166.87 ?  70  VAL B N     1 
ATOM 1253  C CA    . VAL B 2 63  ? 124.048 114.209 95.851  1.00 166.87 ?  70  VAL B CA    1 
ATOM 1254  C C     . VAL B 2 63  ? 123.753 113.366 94.619  1.00 166.87 ?  70  VAL B C     1 
ATOM 1255  O O     . VAL B 2 63  ? 124.321 113.612 93.551  1.00 166.87 ?  70  VAL B O     1 
ATOM 1256  C CB    . VAL B 2 63  ? 125.401 113.833 96.485  1.00 166.87 ?  70  VAL B CB    1 
ATOM 1257  C CG1   . VAL B 2 63  ? 125.555 112.340 96.602  1.00 166.87 ?  70  VAL B CG1   1 
ATOM 1258  C CG2   . VAL B 2 63  ? 126.560 114.450 95.728  1.00 166.87 ?  70  VAL B CG2   1 
ATOM 1259  N N     . THR B 2 64  ? 122.828 112.408 94.723  1.00 163.10 ?  71  THR B N     1 
ATOM 1260  C CA    . THR B 2 64  ? 122.536 111.537 93.592  1.00 163.10 ?  71  THR B CA    1 
ATOM 1261  C C     . THR B 2 64  ? 121.733 112.270 92.529  1.00 163.10 ?  71  THR B C     1 
ATOM 1262  O O     . THR B 2 64  ? 122.006 112.124 91.333  1.00 163.10 ?  71  THR B O     1 
ATOM 1263  C CB    . THR B 2 64  ? 121.802 110.295 94.080  1.00 163.10 ?  71  THR B CB    1 
ATOM 1264  O OG1   . THR B 2 64  ? 122.612 109.637 95.055  1.00 163.10 ?  71  THR B OG1   1 
ATOM 1265  C CG2   . THR B 2 64  ? 121.574 109.341 92.949  1.00 163.10 ?  71  THR B CG2   1 
ATOM 1266  N N     . TYR B 2 65  ? 120.762 113.090 92.942  1.00 162.03 ?  72  TYR B N     1 
ATOM 1267  C CA    . TYR B 2 65  ? 120.099 113.979 91.992  1.00 162.03 ?  72  TYR B CA    1 
ATOM 1268  C C     . TYR B 2 65  ? 121.071 115.002 91.423  1.00 162.03 ?  72  TYR B C     1 
ATOM 1269  O O     . TYR B 2 65  ? 120.927 115.431 90.275  1.00 162.03 ?  72  TYR B O     1 
ATOM 1270  C CB    . TYR B 2 65  ? 118.915 114.683 92.650  1.00 162.03 ?  72  TYR B CB    1 
ATOM 1271  C CG    . TYR B 2 65  ? 117.709 113.810 92.855  1.00 162.03 ?  72  TYR B CG    1 
ATOM 1272  C CD1   . TYR B 2 65  ? 117.572 112.629 92.164  1.00 162.03 ?  72  TYR B CD1   1 
ATOM 1273  C CD2   . TYR B 2 65  ? 116.707 114.173 93.738  1.00 162.03 ?  72  TYR B CD2   1 
ATOM 1274  C CE1   . TYR B 2 65  ? 116.478 111.837 92.339  1.00 162.03 ?  72  TYR B CE1   1 
ATOM 1275  C CE2   . TYR B 2 65  ? 115.608 113.375 93.929  1.00 162.03 ?  72  TYR B CE2   1 
ATOM 1276  C CZ    . TYR B 2 65  ? 115.501 112.207 93.226  1.00 162.03 ?  72  TYR B CZ    1 
ATOM 1277  O OH    . TYR B 2 65  ? 114.407 111.399 93.400  1.00 162.03 ?  72  TYR B OH    1 
ATOM 1278  N N     . THR B 2 66  ? 122.073 115.398 92.205  1.00 174.85 ?  73  THR B N     1 
ATOM 1279  C CA    . THR B 2 66  ? 123.075 116.316 91.687  1.00 174.85 ?  73  THR B CA    1 
ATOM 1280  C C     . THR B 2 66  ? 124.011 115.626 90.711  1.00 174.85 ?  73  THR B C     1 
ATOM 1281  O O     . THR B 2 66  ? 124.307 116.181 89.651  1.00 174.85 ?  73  THR B O     1 
ATOM 1282  C CB    . THR B 2 66  ? 123.862 116.941 92.837  1.00 174.85 ?  73  THR B CB    1 
ATOM 1283  O OG1   . THR B 2 66  ? 122.969 117.696 93.662  1.00 174.85 ?  73  THR B OG1   1 
ATOM 1284  C CG2   . THR B 2 66  ? 124.948 117.870 92.322  1.00 174.85 ?  73  THR B CG2   1 
ATOM 1285  N N     . GLU B 2 67  ? 124.454 114.409 91.014  1.00 178.79 ?  74  GLU B N     1 
ATOM 1286  C CA    . GLU B 2 67  ? 125.403 113.754 90.122  1.00 178.79 ?  74  GLU B CA    1 
ATOM 1287  C C     . GLU B 2 67  ? 124.717 113.231 88.865  1.00 178.79 ?  74  GLU B C     1 
ATOM 1288  O O     . GLU B 2 67  ? 125.390 112.930 87.873  1.00 178.79 ?  74  GLU B O     1 
ATOM 1289  C CB    . GLU B 2 67  ? 126.123 112.625 90.864  1.00 178.79 ?  74  GLU B CB    1 
ATOM 1290  C CG    . GLU B 2 67  ? 127.396 112.111 90.201  1.00 178.79 ?  74  GLU B CG    1 
ATOM 1291  C CD    . GLU B 2 67  ? 128.059 111.006 90.991  1.00 178.79 ?  74  GLU B CD    1 
ATOM 1292  O OE1   . GLU B 2 67  ? 127.486 110.578 92.011  1.00 178.79 ?  74  GLU B OE1   1 
ATOM 1293  O OE2   . GLU B 2 67  ? 129.161 110.572 90.601  1.00 178.79 -1 74  GLU B OE2   1 
ATOM 1294  N N     . HIS B 2 68  ? 123.386 113.156 88.871  1.00 175.08 ?  75  HIS B N     1 
ATOM 1295  C CA    . HIS B 2 68  ? 122.669 112.625 87.718  1.00 175.08 ?  75  HIS B CA    1 
ATOM 1296  C C     . HIS B 2 68  ? 122.719 113.575 86.534  1.00 175.08 ?  75  HIS B C     1 
ATOM 1297  O O     . HIS B 2 68  ? 123.299 113.254 85.493  1.00 175.08 ?  75  HIS B O     1 
ATOM 1298  C CB    . HIS B 2 68  ? 121.227 112.336 88.091  1.00 175.08 ?  75  HIS B CB    1 
ATOM 1299  C CG    . HIS B 2 68  ? 120.391 111.933 86.929  1.00 175.08 ?  75  HIS B CG    1 
ATOM 1300  N ND1   . HIS B 2 68  ? 119.646 112.834 86.204  1.00 175.08 ?  75  HIS B ND1   1 
ATOM 1301  C CD2   . HIS B 2 68  ? 120.229 110.736 86.326  1.00 175.08 ?  75  HIS B CD2   1 
ATOM 1302  C CE1   . HIS B 2 68  ? 119.027 112.200 85.226  1.00 175.08 ?  75  HIS B CE1   1 
ATOM 1303  N NE2   . HIS B 2 68  ? 119.364 110.925 85.279  1.00 175.08 ?  75  HIS B NE2   1 
ATOM 1304  N N     . ALA B 2 69  ? 122.109 114.742 86.662  1.00 171.38 ?  76  ALA B N     1 
ATOM 1305  C CA    . ALA B 2 69  ? 122.322 115.779 85.666  1.00 171.38 ?  76  ALA B CA    1 
ATOM 1306  C C     . ALA B 2 69  ? 123.719 116.335 85.871  1.00 171.38 ?  76  ALA B C     1 
ATOM 1307  O O     . ALA B 2 69  ? 124.011 116.894 86.929  1.00 171.38 ?  76  ALA B O     1 
ATOM 1308  C CB    . ALA B 2 69  ? 121.271 116.873 85.791  1.00 171.38 ?  76  ALA B CB    1 
ATOM 1309  N N     . LYS B 2 70  ? 124.571 116.204 84.857  1.00 171.53 ?  77  LYS B N     1 
ATOM 1310  C CA    . LYS B 2 70  ? 126.019 116.168 85.055  1.00 171.53 ?  77  LYS B CA    1 
ATOM 1311  C C     . LYS B 2 70  ? 126.531 117.547 85.461  1.00 171.53 ?  77  LYS B C     1 
ATOM 1312  O O     . LYS B 2 70  ? 126.916 118.381 84.641  1.00 171.53 ?  77  LYS B O     1 
ATOM 1313  C CB    . LYS B 2 70  ? 126.694 115.657 83.790  1.00 171.53 ?  77  LYS B CB    1 
ATOM 1314  C CG    . LYS B 2 70  ? 126.334 114.213 83.467  1.00 171.53 ?  77  LYS B CG    1 
ATOM 1315  C CD    . LYS B 2 70  ? 127.047 113.702 82.228  1.00 171.53 ?  77  LYS B CD    1 
ATOM 1316  C CE    . LYS B 2 70  ? 126.441 114.280 80.969  1.00 171.53 ?  77  LYS B CE    1 
ATOM 1317  N NZ    . LYS B 2 70  ? 125.056 113.780 80.786  1.00 171.53 ?  77  LYS B NZ    1 
ATOM 1318  N N     . ARG B 2 71  ? 126.522 117.779 86.773  1.00 176.41 ?  78  ARG B N     1 
ATOM 1319  C CA    . ARG B 2 71  ? 126.873 119.061 87.361  1.00 176.41 ?  78  ARG B CA    1 
ATOM 1320  C C     . ARG B 2 71  ? 127.881 118.866 88.484  1.00 176.41 ?  78  ARG B C     1 
ATOM 1321  O O     . ARG B 2 71  ? 128.330 117.755 88.762  1.00 176.41 ?  78  ARG B O     1 
ATOM 1322  C CB    . ARG B 2 71  ? 125.637 119.780 87.911  1.00 176.41 ?  78  ARG B CB    1 
ATOM 1323  C CG    . ARG B 2 71  ? 124.668 120.229 86.845  1.00 176.41 ?  78  ARG B CG    1 
ATOM 1324  C CD    . ARG B 2 71  ? 123.478 120.980 87.419  1.00 176.41 ?  78  ARG B CD    1 
ATOM 1325  N NE    . ARG B 2 71  ? 122.536 120.122 88.123  1.00 176.41 ?  78  ARG B NE    1 
ATOM 1326  C CZ    . ARG B 2 71  ? 121.476 120.577 88.776  1.00 176.41 ?  78  ARG B CZ    1 
ATOM 1327  N NH1   . ARG B 2 71  ? 121.227 121.874 88.810  1.00 176.41 ?  78  ARG B NH1   1 
ATOM 1328  N NH2   . ARG B 2 71  ? 120.658 119.737 89.386  1.00 176.41 ?  78  ARG B NH2   1 
ATOM 1329  N N     . LYS B 2 72  ? 128.244 119.979 89.117  1.00 180.14 ?  79  LYS B N     1 
ATOM 1330  C CA    . LYS B 2 72  ? 129.018 119.980 90.351  1.00 180.14 ?  79  LYS B CA    1 
ATOM 1331  C C     . LYS B 2 72  ? 128.343 120.783 91.453  1.00 180.14 ?  79  LYS B C     1 
ATOM 1332  O O     . LYS B 2 72  ? 128.956 121.022 92.499  1.00 180.14 ?  79  LYS B O     1 
ATOM 1333  C CB    . LYS B 2 72  ? 130.423 120.541 90.126  1.00 180.14 ?  79  LYS B CB    1 
ATOM 1334  C CG    . LYS B 2 72  ? 131.490 119.549 89.741  1.00 180.14 ?  79  LYS B CG    1 
ATOM 1335  C CD    . LYS B 2 72  ? 131.425 119.201 88.283  1.00 180.14 ?  79  LYS B CD    1 
ATOM 1336  C CE    . LYS B 2 72  ? 132.624 118.379 87.881  1.00 180.14 ?  79  LYS B CE    1 
ATOM 1337  N NZ    . LYS B 2 72  ? 132.563 117.950 86.458  1.00 180.14 ?  79  LYS B NZ    1 
ATOM 1338  N N     . THR B 2 73  ? 127.109 121.226 91.241  1.00 181.98 ?  80  THR B N     1 
ATOM 1339  C CA    . THR B 2 73  ? 126.447 122.124 92.177  1.00 181.98 ?  80  THR B CA    1 
ATOM 1340  C C     . THR B 2 73  ? 125.153 121.495 92.656  1.00 181.98 ?  80  THR B C     1 
ATOM 1341  O O     . THR B 2 73  ? 124.269 121.201 91.846  1.00 181.98 ?  80  THR B O     1 
ATOM 1342  C CB    . THR B 2 73  ? 126.160 123.477 91.533  1.00 181.98 ?  80  THR B CB    1 
ATOM 1343  O OG1   . THR B 2 73  ? 127.382 124.052 91.063  1.00 181.98 ?  80  THR B OG1   1 
ATOM 1344  C CG2   . THR B 2 73  ? 125.530 124.410 92.537  1.00 181.98 ?  80  THR B CG2   1 
ATOM 1345  N N     . VAL B 2 74  ? 125.038 121.292 93.959  1.00 170.65 ?  81  VAL B N     1 
ATOM 1346  C CA    . VAL B 2 74  ? 123.777 120.864 94.539  1.00 170.65 ?  81  VAL B CA    1 
ATOM 1347  C C     . VAL B 2 74  ? 122.872 122.080 94.628  1.00 170.65 ?  81  VAL B C     1 
ATOM 1348  O O     . VAL B 2 74  ? 123.282 123.131 95.129  1.00 170.65 ?  81  VAL B O     1 
ATOM 1349  C CB    . VAL B 2 74  ? 124.001 120.249 95.924  1.00 170.65 ?  81  VAL B CB    1 
ATOM 1350  C CG1   . VAL B 2 74  ? 122.706 119.724 96.470  1.00 170.65 ?  81  VAL B CG1   1 
ATOM 1351  C CG2   . VAL B 2 74  ? 125.041 119.173 95.855  1.00 170.65 ?  81  VAL B CG2   1 
ATOM 1352  N N     . THR B 2 75  ? 121.650 121.956 94.140  1.00 162.11 ?  82  THR B N     1 
ATOM 1353  C CA    . THR B 2 75  ? 120.746 123.093 94.151  1.00 162.11 ?  82  THR B CA    1 
ATOM 1354  C C     . THR B 2 75  ? 119.801 123.005 95.331  1.00 162.11 ?  82  THR B C     1 
ATOM 1355  O O     . THR B 2 75  ? 119.848 122.080 96.138  1.00 162.11 ?  82  THR B O     1 
ATOM 1356  C CB    . THR B 2 75  ? 119.927 123.167 92.868  1.00 162.11 ?  82  THR B CB    1 
ATOM 1357  O OG1   . THR B 2 75  ? 119.027 122.056 92.829  1.00 162.11 ?  82  THR B OG1   1 
ATOM 1358  C CG2   . THR B 2 75  ? 120.835 123.122 91.658  1.00 162.11 ?  82  THR B CG2   1 
ATOM 1359  N N     . ALA B 2 76  ? 118.916 123.990 95.411  1.00 160.64 ?  83  ALA B N     1 
ATOM 1360  C CA    . ALA B 2 76  ? 117.890 123.955 96.437  1.00 160.64 ?  83  ALA B CA    1 
ATOM 1361  C C     . ALA B 2 76  ? 116.796 122.973 96.070  1.00 160.64 ?  83  ALA B C     1 
ATOM 1362  O O     . ALA B 2 76  ? 116.188 122.360 96.951  1.00 160.64 ?  83  ALA B O     1 
ATOM 1363  C CB    . ALA B 2 76  ? 117.307 125.346 96.650  1.00 160.64 ?  83  ALA B CB    1 
ATOM 1364  N N     . MET B 2 77  ? 116.533 122.802 94.774  1.00 171.86 ?  84  MET B N     1 
ATOM 1365  C CA    . MET B 2 77  ? 115.485 121.874 94.371  1.00 171.86 ?  84  MET B CA    1 
ATOM 1366  C C     . MET B 2 77  ? 115.915 120.429 94.561  1.00 171.86 ?  84  MET B C     1 
ATOM 1367  O O     . MET B 2 77  ? 115.062 119.548 94.674  1.00 171.86 ?  84  MET B O     1 
ATOM 1368  C CB    . MET B 2 77  ? 115.079 122.115 92.922  1.00 171.86 ?  84  MET B CB    1 
ATOM 1369  C CG    . MET B 2 77  ? 114.455 123.469 92.681  1.00 171.86 ?  84  MET B CG    1 
ATOM 1370  S SD    . MET B 2 77  ? 113.004 123.754 93.701  1.00 171.86 ?  84  MET B SD    1 
ATOM 1371  C CE    . MET B 2 77  ? 111.869 122.560 93.013  1.00 171.86 ?  84  MET B CE    1 
ATOM 1372  N N     . ASP B 2 78  ? 117.221 120.173 94.628  1.00 172.24 ?  85  ASP B N     1 
ATOM 1373  C CA    . ASP B 2 78  ? 117.698 118.813 94.842  1.00 172.24 ?  85  ASP B CA    1 
ATOM 1374  C C     . ASP B 2 78  ? 117.396 118.326 96.252  1.00 172.24 ?  85  ASP B C     1 
ATOM 1375  O O     . ASP B 2 78  ? 117.005 117.171 96.446  1.00 172.24 ?  85  ASP B O     1 
ATOM 1376  C CB    . ASP B 2 78  ? 119.192 118.750 94.571  1.00 172.24 ?  85  ASP B CB    1 
ATOM 1377  C CG    . ASP B 2 78  ? 119.517 119.016 93.135  1.00 172.24 ?  85  ASP B CG    1 
ATOM 1378  O OD1   . ASP B 2 78  ? 118.681 118.676 92.276  1.00 172.24 ?  85  ASP B OD1   1 
ATOM 1379  O OD2   . ASP B 2 78  ? 120.591 119.590 92.865  1.00 172.24 -1 85  ASP B OD2   1 
ATOM 1380  N N     . VAL B 2 79  ? 117.576 119.187 97.249  1.00 152.18 ?  86  VAL B N     1 
ATOM 1381  C CA    . VAL B 2 79  ? 117.321 118.782 98.624  1.00 152.18 ?  86  VAL B CA    1 
ATOM 1382  C C     . VAL B 2 79  ? 115.823 118.657 98.873  1.00 152.18 ?  86  VAL B C     1 
ATOM 1383  O O     . VAL B 2 79  ? 115.374 117.751 99.585  1.00 152.18 ?  86  VAL B O     1 
ATOM 1384  C CB    . VAL B 2 79  ? 117.999 119.779 99.579  1.00 152.18 ?  86  VAL B CB    1 
ATOM 1385  C CG1   . VAL B 2 79  ? 117.648 119.509 101.014 1.00 152.18 ?  86  VAL B CG1   1 
ATOM 1386  C CG2   . VAL B 2 79  ? 119.490 119.696 99.413  1.00 152.18 ?  86  VAL B CG2   1 
ATOM 1387  N N     . VAL B 2 80  ? 115.027 119.537 98.261  1.00 161.96 ?  87  VAL B N     1 
ATOM 1388  C CA    . VAL B 2 80  ? 113.573 119.440 98.359  1.00 161.96 ?  87  VAL B CA    1 
ATOM 1389  C C     . VAL B 2 80  ? 113.073 118.156 97.705  1.00 161.96 ?  87  VAL B C     1 
ATOM 1390  O O     . VAL B 2 80  ? 112.190 117.476 98.240  1.00 161.96 ?  87  VAL B O     1 
ATOM 1391  C CB    . VAL B 2 80  ? 112.921 120.688 97.740  1.00 161.96 ?  87  VAL B CB    1 
ATOM 1392  C CG1   . VAL B 2 80  ? 111.413 120.568 97.718  1.00 161.96 ?  87  VAL B CG1   1 
ATOM 1393  C CG2   . VAL B 2 80  ? 113.313 121.905 98.519  1.00 161.96 ?  87  VAL B CG2   1 
ATOM 1394  N N     . TYR B 2 81  ? 113.659 117.778 96.568  1.00 168.86 ?  88  TYR B N     1 
ATOM 1395  C CA    . TYR B 2 81  ? 113.278 116.520 95.933  1.00 168.86 ?  88  TYR B CA    1 
ATOM 1396  C C     . TYR B 2 81  ? 113.746 115.321 96.741  1.00 168.86 ?  88  TYR B C     1 
ATOM 1397  O O     . TYR B 2 81  ? 113.021 114.327 96.837  1.00 168.86 ?  88  TYR B O     1 
ATOM 1398  C CB    . TYR B 2 81  ? 113.838 116.439 94.513  1.00 168.86 ?  88  TYR B CB    1 
ATOM 1399  C CG    . TYR B 2 81  ? 113.189 117.379 93.532  1.00 168.86 ?  88  TYR B CG    1 
ATOM 1400  C CD1   . TYR B 2 81  ? 111.936 117.907 93.782  1.00 168.86 ?  88  TYR B CD1   1 
ATOM 1401  C CD2   . TYR B 2 81  ? 113.855 117.783 92.385  1.00 168.86 ?  88  TYR B CD2   1 
ATOM 1402  C CE1   . TYR B 2 81  ? 111.343 118.774 92.898  1.00 168.86 ?  88  TYR B CE1   1 
ATOM 1403  C CE2   . TYR B 2 81  ? 113.274 118.650 91.496  1.00 168.86 ?  88  TYR B CE2   1 
ATOM 1404  C CZ    . TYR B 2 81  ? 112.021 119.153 91.765  1.00 168.86 ?  88  TYR B CZ    1 
ATOM 1405  O OH    . TYR B 2 81  ? 111.427 120.019 90.878  1.00 168.86 ?  88  TYR B OH    1 
ATOM 1406  N N     . ALA B 2 82  ? 114.938 115.399 97.335  1.00 169.76 ?  89  ALA B N     1 
ATOM 1407  C CA    . ALA B 2 82  ? 115.473 114.254 98.060  1.00 169.76 ?  89  ALA B CA    1 
ATOM 1408  C C     . ALA B 2 82  ? 114.698 114.001 99.338  1.00 169.76 ?  89  ALA B C     1 
ATOM 1409  O O     . ALA B 2 82  ? 114.492 112.849 99.727  1.00 169.76 ?  89  ALA B O     1 
ATOM 1410  C CB    . ALA B 2 82  ? 116.945 114.468 98.376  1.00 169.76 ?  89  ALA B CB    1 
ATOM 1411  N N     . LEU B 2 83  ? 114.243 115.060 99.996  1.00 170.52 ?  90  LEU B N     1 
ATOM 1412  C CA    . LEU B 2 83  ? 113.408 114.856 101.166 1.00 170.52 ?  90  LEU B CA    1 
ATOM 1413  C C     . LEU B 2 83  ? 111.992 114.461 100.781 1.00 170.52 ?  90  LEU B C     1 
ATOM 1414  O O     . LEU B 2 83  ? 111.239 113.968 101.627 1.00 170.52 ?  90  LEU B O     1 
ATOM 1415  C CB    . LEU B 2 83  ? 113.391 116.110 102.025 1.00 170.52 ?  90  LEU B CB    1 
ATOM 1416  C CG    . LEU B 2 83  ? 114.702 116.464 102.699 1.00 170.52 ?  90  LEU B CG    1 
ATOM 1417  C CD1   . LEU B 2 83  ? 114.535 117.730 103.492 1.00 170.52 ?  90  LEU B CD1   1 
ATOM 1418  C CD2   . LEU B 2 83  ? 115.109 115.340 103.587 1.00 170.52 ?  90  LEU B CD2   1 
ATOM 1419  N N     . LYS B 2 84  ? 111.606 114.672 99.522  1.00 166.53 ?  91  LYS B N     1 
ATOM 1420  C CA    . LYS B 2 84  ? 110.257 114.308 99.108  1.00 166.53 ?  91  LYS B CA    1 
ATOM 1421  C C     . LYS B 2 84  ? 110.143 112.808 98.905  1.00 166.53 ?  91  LYS B C     1 
ATOM 1422  O O     . LYS B 2 84  ? 109.122 112.202 99.243  1.00 166.53 ?  91  LYS B O     1 
ATOM 1423  C CB    . LYS B 2 84  ? 109.873 115.057 97.836  1.00 166.53 ?  91  LYS B CB    1 
ATOM 1424  C CG    . LYS B 2 84  ? 108.410 114.917 97.457  1.00 166.53 ?  91  LYS B CG    1 
ATOM 1425  C CD    . LYS B 2 84  ? 108.077 115.761 96.242  1.00 166.53 ?  91  LYS B CD    1 
ATOM 1426  C CE    . LYS B 2 84  ? 106.588 115.778 95.965  1.00 166.53 ?  91  LYS B CE    1 
ATOM 1427  N NZ    . LYS B 2 84  ? 106.088 114.450 95.540  1.00 166.53 ?  91  LYS B NZ    1 
ATOM 1428  N N     . ARG B 2 85  ? 111.188 112.188 98.367  1.00 174.02 ?  92  ARG B N     1 
ATOM 1429  C CA    . ARG B 2 85  ? 111.211 110.737 98.278  1.00 174.02 ?  92  ARG B CA    1 
ATOM 1430  C C     . ARG B 2 85  ? 111.477 110.116 99.642  1.00 174.02 ?  92  ARG B C     1 
ATOM 1431  O O     . ARG B 2 85  ? 111.099 108.966 99.887  1.00 174.02 ?  92  ARG B O     1 
ATOM 1432  C CB    . ARG B 2 85  ? 112.251 110.316 97.231  1.00 174.02 ?  92  ARG B CB    1 
ATOM 1433  C CG    . ARG B 2 85  ? 112.331 108.840 96.926  1.00 174.02 ?  92  ARG B CG    1 
ATOM 1434  C CD    . ARG B 2 85  ? 113.492 108.226 97.663  1.00 174.02 ?  92  ARG B CD    1 
ATOM 1435  N NE    . ARG B 2 85  ? 113.514 106.780 97.560  1.00 174.02 ?  92  ARG B NE    1 
ATOM 1436  C CZ    . ARG B 2 85  ? 114.277 106.012 98.326  1.00 174.02 ?  92  ARG B CZ    1 
ATOM 1437  N NH1   . ARG B 2 85  ? 115.069 106.569 99.233  1.00 174.02 ?  92  ARG B NH1   1 
ATOM 1438  N NH2   . ARG B 2 85  ? 114.245 104.695 98.196  1.00 174.02 ?  92  ARG B NH2   1 
ATOM 1439  N N     . GLN B 2 86  ? 112.122 110.861 100.536 1.00 179.36 ?  93  GLN B N     1 
ATOM 1440  C CA    . GLN B 2 86  ? 112.428 110.355 101.868 1.00 179.36 ?  93  GLN B CA    1 
ATOM 1441  C C     . GLN B 2 86  ? 111.171 110.130 102.696 1.00 179.36 ?  93  GLN B C     1 
ATOM 1442  O O     . GLN B 2 86  ? 111.017 109.070 103.308 1.00 179.36 ?  93  GLN B O     1 
ATOM 1443  C CB    . GLN B 2 86  ? 113.356 111.342 102.569 1.00 179.36 ?  93  GLN B CB    1 
ATOM 1444  C CG    . GLN B 2 86  ? 113.740 110.991 103.983 1.00 179.36 ?  93  GLN B CG    1 
ATOM 1445  C CD    . GLN B 2 86  ? 114.644 109.811 104.061 1.00 179.36 ?  93  GLN B CD    1 
ATOM 1446  O OE1   . GLN B 2 86  ? 114.212 108.711 104.376 1.00 179.36 ?  93  GLN B OE1   1 
ATOM 1447  N NE2   . GLN B 2 86  ? 115.921 110.029 103.794 1.00 179.36 ?  93  GLN B NE2   1 
ATOM 1448  N N     . GLY B 2 87  ? 110.259 111.095 102.707 1.00 178.81 ?  94  GLY B N     1 
ATOM 1449  C CA    . GLY B 2 87  ? 109.104 111.063 103.574 1.00 178.81 ?  94  GLY B CA    1 
ATOM 1450  C C     . GLY B 2 87  ? 108.932 112.286 104.442 1.00 178.81 ?  94  GLY B C     1 
ATOM 1451  O O     . GLY B 2 87  ? 108.109 112.260 105.360 1.00 178.81 ?  94  GLY B O     1 
ATOM 1452  N N     . ARG B 2 88  ? 109.685 113.351 104.183 1.00 178.80 ?  95  ARG B N     1 
ATOM 1453  C CA    . ARG B 2 88  ? 109.669 114.580 104.971 1.00 178.80 ?  95  ARG B CA    1 
ATOM 1454  C C     . ARG B 2 88  ? 109.544 115.699 103.945 1.00 178.80 ?  95  ARG B C     1 
ATOM 1455  O O     . ARG B 2 88  ? 110.549 116.279 103.537 1.00 178.80 ?  95  ARG B O     1 
ATOM 1456  C CB    . ARG B 2 88  ? 110.956 114.778 105.813 1.00 178.80 ?  95  ARG B CB    1 
ATOM 1457  C CG    . ARG B 2 88  ? 111.214 113.903 107.046 1.00 178.80 ?  95  ARG B CG    1 
ATOM 1458  C CD    . ARG B 2 88  ? 111.690 112.541 106.596 1.00 178.80 ?  95  ARG B CD    1 
ATOM 1459  N NE    . ARG B 2 88  ? 112.430 111.738 107.558 1.00 178.80 ?  95  ARG B NE    1 
ATOM 1460  C CZ    . ARG B 2 88  ? 113.755 111.691 107.593 1.00 178.80 ?  95  ARG B CZ    1 
ATOM 1461  N NH1   . ARG B 2 88  ? 114.462 112.402 106.735 1.00 178.80 ?  95  ARG B NH1   1 
ATOM 1462  N NH2   . ARG B 2 88  ? 114.374 110.926 108.470 1.00 178.80 ?  95  ARG B NH2   1 
ATOM 1463  N N     . THR B 2 89  ? 108.328 116.016 103.527 1.00 180.71 ?  96  THR B N     1 
ATOM 1464  C CA    . THR B 2 89  ? 108.151 116.999 102.471 1.00 180.71 ?  96  THR B CA    1 
ATOM 1465  C C     . THR B 2 89  ? 108.326 118.397 103.047 1.00 180.71 ?  96  THR B C     1 
ATOM 1466  O O     . THR B 2 89  ? 107.817 118.695 104.129 1.00 180.71 ?  96  THR B O     1 
ATOM 1467  C CB    . THR B 2 89  ? 106.776 116.837 101.833 1.00 180.71 ?  96  THR B CB    1 
ATOM 1468  O OG1   . THR B 2 89  ? 106.615 115.481 101.414 1.00 180.71 ?  96  THR B OG1   1 
ATOM 1469  C CG2   . THR B 2 89  ? 106.651 117.709 100.611 1.00 180.71 ?  96  THR B CG2   1 
ATOM 1470  N N     . LEU B 2 90  ? 109.058 119.247 102.332 1.00 169.77 ?  97  LEU B N     1 
ATOM 1471  C CA    . LEU B 2 90  ? 109.456 120.566 102.805 1.00 169.77 ?  97  LEU B CA    1 
ATOM 1472  C C     . LEU B 2 90  ? 108.818 121.637 101.932 1.00 169.77 ?  97  LEU B C     1 
ATOM 1473  O O     . LEU B 2 90  ? 108.927 121.578 100.706 1.00 169.77 ?  97  LEU B O     1 
ATOM 1474  C CB    . LEU B 2 90  ? 110.973 120.689 102.760 1.00 169.77 ?  97  LEU B CB    1 
ATOM 1475  C CG    . LEU B 2 90  ? 111.592 121.949 103.318 1.00 169.77 ?  97  LEU B CG    1 
ATOM 1476  C CD1   . LEU B 2 90  ? 111.353 121.973 104.784 1.00 169.77 ?  97  LEU B CD1   1 
ATOM 1477  C CD2   . LEU B 2 90  ? 113.070 121.952 103.023 1.00 169.77 ?  97  LEU B CD2   1 
ATOM 1478  N N     . TYR B 2 91  ? 108.158 122.616 102.552 1.00 173.33 ?  98  TYR B N     1 
ATOM 1479  C CA    . TYR B 2 91  ? 107.421 123.623 101.794 1.00 173.33 ?  98  TYR B CA    1 
ATOM 1480  C C     . TYR B 2 91  ? 108.135 124.956 101.712 1.00 173.33 ?  98  TYR B C     1 
ATOM 1481  O O     . TYR B 2 91  ? 107.476 125.996 101.605 1.00 173.33 ?  98  TYR B O     1 
ATOM 1482  C CB    . TYR B 2 91  ? 106.032 123.858 102.381 1.00 173.33 ?  98  TYR B CB    1 
ATOM 1483  C CG    . TYR B 2 91  ? 105.011 122.793 102.122 1.00 173.33 ?  98  TYR B CG    1 
ATOM 1484  C CD1   . TYR B 2 91  ? 105.313 121.677 101.374 1.00 173.33 ?  98  TYR B CD1   1 
ATOM 1485  C CD2   . TYR B 2 91  ? 103.710 122.955 102.560 1.00 173.33 ?  98  TYR B CD2   1 
ATOM 1486  C CE1   . TYR B 2 91  ? 104.368 120.718 101.132 1.00 173.33 ?  98  TYR B CE1   1 
ATOM 1487  C CE2   . TYR B 2 91  ? 102.759 122.009 102.319 1.00 173.33 ?  98  TYR B CE2   1 
ATOM 1488  C CZ    . TYR B 2 91  ? 103.093 120.895 101.600 1.00 173.33 ?  98  TYR B CZ    1 
ATOM 1489  O OH    . TYR B 2 91  ? 102.144 119.941 101.350 1.00 173.33 ?  98  TYR B OH    1 
ATOM 1490  N N     . GLY B 2 92  ? 109.453 124.974 101.765 1.00 173.66 ?  99  GLY B N     1 
ATOM 1491  C CA    . GLY B 2 92  ? 110.121 126.254 101.816 1.00 173.66 ?  99  GLY B CA    1 
ATOM 1492  C C     . GLY B 2 92  ? 110.545 126.797 100.472 1.00 173.66 ?  99  GLY B C     1 
ATOM 1493  O O     . GLY B 2 92  ? 110.360 127.980 100.184 1.00 173.66 ?  99  GLY B O     1 
ATOM 1494  N N     . PHE B 2 93  ? 111.106 125.934 99.634  1.00 182.25 ?  100 PHE B N     1 
ATOM 1495  C CA    . PHE B 2 93  ? 112.002 126.386 98.583  1.00 182.25 ?  100 PHE B CA    1 
ATOM 1496  C C     . PHE B 2 93  ? 111.620 125.803 97.233  1.00 182.25 ?  100 PHE B C     1 
ATOM 1497  O O     . PHE B 2 93  ? 112.300 126.047 96.234  1.00 182.25 ?  100 PHE B O     1 
ATOM 1498  C CB    . PHE B 2 93  ? 113.433 126.013 98.941  1.00 182.25 ?  100 PHE B CB    1 
ATOM 1499  C CG    . PHE B 2 93  ? 113.791 126.375 100.336 1.00 182.25 ?  100 PHE B CG    1 
ATOM 1500  C CD1   . PHE B 2 93  ? 114.022 127.686 100.678 1.00 182.25 ?  100 PHE B CD1   1 
ATOM 1501  C CD2   . PHE B 2 93  ? 113.853 125.405 101.319 1.00 182.25 ?  100 PHE B CD2   1 
ATOM 1502  C CE1   . PHE B 2 93  ? 114.327 128.024 101.973 1.00 182.25 ?  100 PHE B CE1   1 
ATOM 1503  C CE2   . PHE B 2 93  ? 114.156 125.738 102.611 1.00 182.25 ?  100 PHE B CE2   1 
ATOM 1504  C CZ    . PHE B 2 93  ? 114.395 127.045 102.938 1.00 182.25 ?  100 PHE B CZ    1 
ATOM 1505  N N     . GLY B 2 94  ? 110.542 125.031 97.189  1.00 200.40 ?  101 GLY B N     1 
ATOM 1506  C CA    . GLY B 2 94  ? 110.160 124.312 95.989  1.00 200.40 ?  101 GLY B CA    1 
ATOM 1507  C C     . GLY B 2 94  ? 109.706 125.177 94.835  1.00 200.40 ?  101 GLY B C     1 
ATOM 1508  O O     . GLY B 2 94  ? 108.946 124.731 93.981  1.00 200.40 ?  101 GLY B O     1 
ATOM 1509  O OXT   . GLY B 2 94  ? 110.090 126.340 94.726  1.00 200.40 -1 101 GLY B OXT   1 
ATOM 1510  N N     . ALA C 3 2   ? 116.483 84.832  64.827  1.00 241.85 ?  14  ALA C N     1 
ATOM 1511  C CA    . ALA C 3 2   ? 116.078 83.688  65.634  1.00 241.85 ?  14  ALA C CA    1 
ATOM 1512  C C     . ALA C 3 2   ? 116.872 83.635  66.932  1.00 241.85 ?  14  ALA C C     1 
ATOM 1513  O O     . ALA C 3 2   ? 117.500 82.625  67.248  1.00 241.85 ?  14  ALA C O     1 
ATOM 1514  C CB    . ALA C 3 2   ? 116.253 82.398  64.850  1.00 241.85 ?  14  ALA C CB    1 
ATOM 1515  N N     . LYS C 3 3   ? 116.847 84.736  67.676  1.00 230.30 ?  15  LYS C N     1 
ATOM 1516  C CA    . LYS C 3 3   ? 117.551 84.855  68.944  1.00 230.30 ?  15  LYS C CA    1 
ATOM 1517  C C     . LYS C 3 3   ? 116.664 85.592  69.934  1.00 230.30 ?  15  LYS C C     1 
ATOM 1518  O O     . LYS C 3 3   ? 116.088 86.632  69.598  1.00 230.30 ?  15  LYS C O     1 
ATOM 1519  C CB    . LYS C 3 3   ? 118.878 85.596  68.767  1.00 230.30 ?  15  LYS C CB    1 
ATOM 1520  C CG    . LYS C 3 3   ? 119.686 85.756  70.042  1.00 230.30 ?  15  LYS C CG    1 
ATOM 1521  C CD    . LYS C 3 3   ? 120.206 84.430  70.565  1.00 230.30 ?  15  LYS C CD    1 
ATOM 1522  C CE    . LYS C 3 3   ? 121.336 83.901  69.699  1.00 230.30 ?  15  LYS C CE    1 
ATOM 1523  N NZ    . LYS C 3 3   ? 121.922 82.652  70.253  1.00 230.30 ?  15  LYS C NZ    1 
ATOM 1524  N N     . SER C 3 4   ? 116.548 85.051  71.142  1.00 217.42 ?  16  SER C N     1 
ATOM 1525  C CA    . SER C 3 4   ? 115.825 85.747  72.195  1.00 217.42 ?  16  SER C CA    1 
ATOM 1526  C C     . SER C 3 4   ? 116.657 86.911  72.710  1.00 217.42 ?  16  SER C C     1 
ATOM 1527  O O     . SER C 3 4   ? 117.889 86.854  72.719  1.00 217.42 ?  16  SER C O     1 
ATOM 1528  C CB    . SER C 3 4   ? 115.504 84.790  73.338  1.00 217.42 ?  16  SER C CB    1 
ATOM 1529  O OG    . SER C 3 4   ? 114.657 83.745  72.901  1.00 217.42 ?  16  SER C OG    1 
ATOM 1530  N N     . ARG C 3 5   ? 115.976 87.981  73.131  1.00 206.33 ?  17  ARG C N     1 
ATOM 1531  C CA    . ARG C 3 5   ? 116.684 89.141  73.664  1.00 206.33 ?  17  ARG C CA    1 
ATOM 1532  C C     . ARG C 3 5   ? 117.348 88.819  74.992  1.00 206.33 ?  17  ARG C C     1 
ATOM 1533  O O     . ARG C 3 5   ? 118.432 89.330  75.292  1.00 206.33 ?  17  ARG C O     1 
ATOM 1534  C CB    . ARG C 3 5   ? 115.730 90.321  73.832  1.00 206.33 ?  17  ARG C CB    1 
ATOM 1535  C CG    . ARG C 3 5   ? 115.238 90.940  72.542  1.00 206.33 ?  17  ARG C CG    1 
ATOM 1536  C CD    . ARG C 3 5   ? 114.218 92.033  72.824  1.00 206.33 ?  17  ARG C CD    1 
ATOM 1537  N NE    . ARG C 3 5   ? 114.783 93.180  73.522  1.00 206.33 ?  17  ARG C NE    1 
ATOM 1538  C CZ    . ARG C 3 5   ? 115.291 94.242  72.913  1.00 206.33 ?  17  ARG C CZ    1 
ATOM 1539  N NH1   . ARG C 3 5   ? 115.305 94.301  71.592  1.00 206.33 ?  17  ARG C NH1   1 
ATOM 1540  N NH2   . ARG C 3 5   ? 115.788 95.244  73.620  1.00 206.33 ?  17  ARG C NH2   1 
ATOM 1541  N N     . SER C 3 6   ? 116.713 87.965  75.795  1.00 199.51 ?  18  SER C N     1 
ATOM 1542  C CA    . SER C 3 6   ? 117.227 87.672  77.127  1.00 199.51 ?  18  SER C CA    1 
ATOM 1543  C C     . SER C 3 6   ? 118.513 86.864  77.059  1.00 199.51 ?  18  SER C C     1 
ATOM 1544  O O     . SER C 3 6   ? 119.393 87.011  77.914  1.00 199.51 ?  18  SER C O     1 
ATOM 1545  C CB    . SER C 3 6   ? 116.167 86.931  77.935  1.00 199.51 ?  18  SER C CB    1 
ATOM 1546  O OG    . SER C 3 6   ? 115.020 87.740  78.116  1.00 199.51 ?  18  SER C OG    1 
ATOM 1547  N N     . SER C 3 7   ? 118.654 86.027  76.034  1.00 206.78 ?  19  SER C N     1 
ATOM 1548  C CA    . SER C 3 7   ? 119.869 85.234  75.906  1.00 206.78 ?  19  SER C CA    1 
ATOM 1549  C C     . SER C 3 7   ? 121.029 86.071  75.386  1.00 206.78 ?  19  SER C C     1 
ATOM 1550  O O     . SER C 3 7   ? 122.184 85.635  75.437  1.00 206.78 ?  19  SER C O     1 
ATOM 1551  C CB    . SER C 3 7   ? 119.621 84.032  74.999  1.00 206.78 ?  19  SER C CB    1 
ATOM 1552  O OG    . SER C 3 7   ? 118.699 83.139  75.595  1.00 206.78 ?  19  SER C OG    1 
ATOM 1553  N N     . ARG C 3 8   ? 120.749 87.270  74.871  1.00 219.99 ?  20  ARG C N     1 
ATOM 1554  C CA    . ARG C 3 8   ? 121.843 88.186  74.574  1.00 219.99 ?  20  ARG C CA    1 
ATOM 1555  C C     . ARG C 3 8   ? 122.446 88.744  75.854  1.00 219.99 ?  20  ARG C C     1 
ATOM 1556  O O     . ARG C 3 8   ? 123.631 89.091  75.892  1.00 219.99 ?  20  ARG C O     1 
ATOM 1557  C CB    . ARG C 3 8   ? 121.381 89.328  73.671  1.00 219.99 ?  20  ARG C CB    1 
ATOM 1558  C CG    . ARG C 3 8   ? 121.165 88.965  72.214  1.00 219.99 ?  20  ARG C CG    1 
ATOM 1559  C CD    . ARG C 3 8   ? 120.919 90.224  71.393  1.00 219.99 ?  20  ARG C CD    1 
ATOM 1560  N NE    . ARG C 3 8   ? 120.759 89.952  69.970  1.00 219.99 ?  20  ARG C NE    1 
ATOM 1561  C CZ    . ARG C 3 8   ? 119.587 89.773  69.375  1.00 219.99 ?  20  ARG C CZ    1 
ATOM 1562  N NH1   . ARG C 3 8   ? 118.470 89.846  70.082  1.00 219.99 ?  20  ARG C NH1   1 
ATOM 1563  N NH2   . ARG C 3 8   ? 119.527 89.527  68.074  1.00 219.99 ?  20  ARG C NH2   1 
ATOM 1564  N N     . ALA C 3 9   ? 121.647 88.844  76.913  1.00 206.15 ?  21  ALA C N     1 
ATOM 1565  C CA    . ALA C 3 9   ? 122.173 89.365  78.167  1.00 206.15 ?  21  ALA C CA    1 
ATOM 1566  C C     . ALA C 3 9   ? 122.802 88.261  79.000  1.00 206.15 ?  21  ALA C C     1 
ATOM 1567  O O     . ALA C 3 9   ? 123.817 88.478  79.668  1.00 206.15 ?  21  ALA C O     1 
ATOM 1568  C CB    . ALA C 3 9   ? 121.065 90.064  78.948  1.00 206.15 ?  21  ALA C CB    1 
ATOM 1569  N N     . GLY C 3 10  ? 122.220 87.068  78.967  1.00 199.46 ?  22  GLY C N     1 
ATOM 1570  C CA    . GLY C 3 10  ? 122.663 85.997  79.831  1.00 199.46 ?  22  GLY C CA    1 
ATOM 1571  C C     . GLY C 3 10  ? 121.796 85.780  81.045  1.00 199.46 ?  22  GLY C C     1 
ATOM 1572  O O     . GLY C 3 10  ? 121.944 84.756  81.720  1.00 199.46 ?  22  GLY C O     1 
ATOM 1573  N N     . LEU C 3 11  ? 120.885 86.705  81.334  1.00 186.72 ?  23  LEU C N     1 
ATOM 1574  C CA    . LEU C 3 11  ? 119.968 86.575  82.457  1.00 186.72 ?  23  LEU C CA    1 
ATOM 1575  C C     . LEU C 3 11  ? 118.733 85.770  82.073  1.00 186.72 ?  23  LEU C C     1 
ATOM 1576  O O     . LEU C 3 11  ? 118.704 85.147  81.009  1.00 186.72 ?  23  LEU C O     1 
ATOM 1577  C CB    . LEU C 3 11  ? 119.611 87.964  82.983  1.00 186.72 ?  23  LEU C CB    1 
ATOM 1578  C CG    . LEU C 3 11  ? 119.210 89.060  81.999  1.00 186.72 ?  23  LEU C CG    1 
ATOM 1579  C CD1   . LEU C 3 11  ? 117.740 89.053  81.649  1.00 186.72 ?  23  LEU C CD1   1 
ATOM 1580  C CD2   . LEU C 3 11  ? 119.613 90.404  82.576  1.00 186.72 ?  23  LEU C CD2   1 
ATOM 1581  N N     . GLN C 3 12  ? 117.712 85.763  82.926  1.00 184.55 ?  24  GLN C N     1 
ATOM 1582  C CA    . GLN C 3 12  ? 116.615 84.826  82.736  1.00 184.55 ?  24  GLN C CA    1 
ATOM 1583  C C     . GLN C 3 12  ? 115.263 85.511  82.612  1.00 184.55 ?  24  GLN C C     1 
ATOM 1584  O O     . GLN C 3 12  ? 114.379 85.005  81.917  1.00 184.55 ?  24  GLN C O     1 
ATOM 1585  C CB    . GLN C 3 12  ? 116.572 83.830  83.890  1.00 184.55 ?  24  GLN C CB    1 
ATOM 1586  C CG    . GLN C 3 12  ? 117.816 82.992  84.028  1.00 184.55 ?  24  GLN C CG    1 
ATOM 1587  C CD    . GLN C 3 12  ? 118.018 82.068  82.858  1.00 184.55 ?  24  GLN C CD    1 
ATOM 1588  O OE1   . GLN C 3 12  ? 117.065 81.495  82.335  1.00 184.55 ?  24  GLN C OE1   1 
ATOM 1589  N NE2   . GLN C 3 12  ? 119.266 81.913  82.439  1.00 184.55 ?  24  GLN C NE2   1 
ATOM 1590  N N     . PHE C 3 13  ? 115.078 86.635  83.300  1.00 186.68 ?  25  PHE C N     1 
ATOM 1591  C CA    . PHE C 3 13  ? 113.805 87.338  83.259  1.00 186.68 ?  25  PHE C CA    1 
ATOM 1592  C C     . PHE C 3 13  ? 113.573 87.960  81.885  1.00 186.68 ?  25  PHE C C     1 
ATOM 1593  O O     . PHE C 3 13  ? 114.524 88.377  81.223  1.00 186.68 ?  25  PHE C O     1 
ATOM 1594  C CB    . PHE C 3 13  ? 113.756 88.398  84.354  1.00 186.68 ?  25  PHE C CB    1 
ATOM 1595  C CG    . PHE C 3 13  ? 113.399 87.848  85.694  1.00 186.68 ?  25  PHE C CG    1 
ATOM 1596  C CD1   . PHE C 3 13  ? 112.884 86.571  85.810  1.00 186.68 ?  25  PHE C CD1   1 
ATOM 1597  C CD2   . PHE C 3 13  ? 113.547 88.608  86.829  1.00 186.68 ?  25  PHE C CD2   1 
ATOM 1598  C CE1   . PHE C 3 13  ? 112.539 86.060  87.036  1.00 186.68 ?  25  PHE C CE1   1 
ATOM 1599  C CE2   . PHE C 3 13  ? 113.202 88.104  88.052  1.00 186.68 ?  25  PHE C CE2   1 
ATOM 1600  C CZ    . PHE C 3 13  ? 112.703 86.831  88.158  1.00 186.68 ?  25  PHE C CZ    1 
ATOM 1601  N N     . PRO C 3 14  ? 112.322 88.002  81.416  1.00 185.71 ?  26  PRO C N     1 
ATOM 1602  C CA    . PRO C 3 14  ? 112.076 88.311  80.000  1.00 185.71 ?  26  PRO C CA    1 
ATOM 1603  C C     . PRO C 3 14  ? 112.309 89.785  79.705  1.00 185.71 ?  26  PRO C C     1 
ATOM 1604  O O     . PRO C 3 14  ? 111.761 90.662  80.373  1.00 185.71 ?  26  PRO C O     1 
ATOM 1605  C CB    . PRO C 3 14  ? 110.609 87.918  79.806  1.00 185.71 ?  26  PRO C CB    1 
ATOM 1606  C CG    . PRO C 3 14  ? 110.002 88.108  81.146  1.00 185.71 ?  26  PRO C CG    1 
ATOM 1607  C CD    . PRO C 3 14  ? 111.060 87.771  82.144  1.00 185.71 ?  26  PRO C CD    1 
ATOM 1608  N N     . VAL C 3 15  ? 113.159 90.055  78.721  1.00 187.97 ?  27  VAL C N     1 
ATOM 1609  C CA    . VAL C 3 15  ? 113.442 91.440  78.378  1.00 187.97 ?  27  VAL C CA    1 
ATOM 1610  C C     . VAL C 3 15  ? 112.237 92.062  77.693  1.00 187.97 ?  27  VAL C C     1 
ATOM 1611  O O     . VAL C 3 15  ? 111.848 93.196  77.994  1.00 187.97 ?  27  VAL C O     1 
ATOM 1612  C CB    . VAL C 3 15  ? 114.706 91.523  77.509  1.00 187.97 ?  27  VAL C CB    1 
ATOM 1613  C CG1   . VAL C 3 15  ? 114.985 92.951  77.115  1.00 187.97 ?  27  VAL C CG1   1 
ATOM 1614  C CG2   . VAL C 3 15  ? 115.878 90.965  78.268  1.00 187.97 ?  27  VAL C CG2   1 
ATOM 1615  N N     . GLY C 3 16  ? 111.593 91.302  76.808  1.00 197.17 ?  28  GLY C N     1 
ATOM 1616  C CA    . GLY C 3 16  ? 110.494 91.844  76.033  1.00 197.17 ?  28  GLY C CA    1 
ATOM 1617  C C     . GLY C 3 16  ? 109.251 92.127  76.849  1.00 197.17 ?  28  GLY C C     1 
ATOM 1618  O O     . GLY C 3 16  ? 108.547 93.104  76.581  1.00 197.17 ?  28  GLY C O     1 
ATOM 1619  N N     . ARG C 3 17  ? 108.967 91.295  77.855  1.00 201.58 ?  29  ARG C N     1 
ATOM 1620  C CA    . ARG C 3 17  ? 107.790 91.536  78.682  1.00 201.58 ?  29  ARG C CA    1 
ATOM 1621  C C     . ARG C 3 17  ? 107.985 92.770  79.551  1.00 201.58 ?  29  ARG C C     1 
ATOM 1622  O O     . ARG C 3 17  ? 107.028 93.502  79.829  1.00 201.58 ?  29  ARG C O     1 
ATOM 1623  C CB    . ARG C 3 17  ? 107.470 90.303  79.528  1.00 201.58 ?  29  ARG C CB    1 
ATOM 1624  C CG    . ARG C 3 17  ? 106.194 90.430  80.342  1.00 201.58 ?  29  ARG C CG    1 
ATOM 1625  C CD    . ARG C 3 17  ? 105.825 89.158  81.053  1.00 201.58 ?  29  ARG C CD    1 
ATOM 1626  N NE    . ARG C 3 17  ? 105.389 88.133  80.120  1.00 201.58 ?  29  ARG C NE    1 
ATOM 1627  C CZ    . ARG C 3 17  ? 105.085 86.890  80.470  1.00 201.58 ?  29  ARG C CZ    1 
ATOM 1628  N NH1   . ARG C 3 17  ? 105.155 86.521  81.739  1.00 201.58 ?  29  ARG C NH1   1 
ATOM 1629  N NH2   . ARG C 3 17  ? 104.694 86.019  79.554  1.00 201.58 ?  29  ARG C NH2   1 
ATOM 1630  N N     . VAL C 3 18  ? 109.224 93.043  79.952  1.00 195.71 ?  30  VAL C N     1 
ATOM 1631  C CA    . VAL C 3 18  ? 109.511 94.314  80.600  1.00 195.71 ?  30  VAL C CA    1 
ATOM 1632  C C     . VAL C 3 18  ? 109.387 95.454  79.598  1.00 195.71 ?  30  VAL C C     1 
ATOM 1633  O O     . VAL C 3 18  ? 108.788 96.494  79.893  1.00 195.71 ?  30  VAL C O     1 
ATOM 1634  C CB    . VAL C 3 18  ? 110.900 94.265  81.256  1.00 195.71 ?  30  VAL C CB    1 
ATOM 1635  C CG1   . VAL C 3 18  ? 111.280 95.612  81.811  1.00 195.71 ?  30  VAL C CG1   1 
ATOM 1636  C CG2   . VAL C 3 18  ? 110.901 93.241  82.362  1.00 195.71 ?  30  VAL C CG2   1 
ATOM 1637  N N     . HIS C 3 19  ? 109.895 95.253  78.379  1.00 195.76 ?  31  HIS C N     1 
ATOM 1638  C CA    . HIS C 3 19  ? 109.833 96.301  77.364  1.00 195.76 ?  31  HIS C CA    1 
ATOM 1639  C C     . HIS C 3 19  ? 108.413 96.502  76.857  1.00 195.76 ?  31  HIS C C     1 
ATOM 1640  O O     . HIS C 3 19  ? 108.089 97.572  76.334  1.00 195.76 ?  31  HIS C O     1 
ATOM 1641  C CB    . HIS C 3 19  ? 110.770 95.956  76.205  1.00 195.76 ?  31  HIS C CB    1 
ATOM 1642  C CG    . HIS C 3 19  ? 111.063 97.103  75.287  1.00 195.76 ?  31  HIS C CG    1 
ATOM 1643  N ND1   . HIS C 3 19  ? 111.648 96.929  74.052  1.00 195.76 ?  31  HIS C ND1   1 
ATOM 1644  C CD2   . HIS C 3 19  ? 110.887 98.435  75.432  1.00 195.76 ?  31  HIS C CD2   1 
ATOM 1645  C CE1   . HIS C 3 19  ? 111.799 98.103  73.468  1.00 195.76 ?  31  HIS C CE1   1 
ATOM 1646  N NE2   . HIS C 3 19  ? 111.344 99.034  74.285  1.00 195.76 ?  31  HIS C NE2   1 
ATOM 1647  N N     . ARG C 3 20  ? 107.549 95.503  77.014  1.00 206.81 ?  32  ARG C N     1 
ATOM 1648  C CA    . ARG C 3 20  ? 106.163 95.690  76.611  1.00 206.81 ?  32  ARG C CA    1 
ATOM 1649  C C     . ARG C 3 20  ? 105.412 96.499  77.660  1.00 206.81 ?  32  ARG C C     1 
ATOM 1650  O O     . ARG C 3 20  ? 104.675 97.428  77.319  1.00 206.81 ?  32  ARG C O     1 
ATOM 1651  C CB    . ARG C 3 20  ? 105.492 94.331  76.369  1.00 206.81 ?  32  ARG C CB    1 
ATOM 1652  C CG    . ARG C 3 20  ? 104.217 94.357  75.520  1.00 206.81 ?  32  ARG C CG    1 
ATOM 1653  C CD    . ARG C 3 20  ? 102.937 94.497  76.322  1.00 206.81 ?  32  ARG C CD    1 
ATOM 1654  N NE    . ARG C 3 20  ? 102.802 93.461  77.338  1.00 206.81 ?  32  ARG C NE    1 
ATOM 1655  C CZ    . ARG C 3 20  ? 102.408 92.220  77.084  1.00 206.81 ?  32  ARG C CZ    1 
ATOM 1656  N NH1   . ARG C 3 20  ? 102.132 91.856  75.842  1.00 206.81 ?  32  ARG C NH1   1 
ATOM 1657  N NH2   . ARG C 3 20  ? 102.301 91.341  78.069  1.00 206.81 ?  32  ARG C NH2   1 
ATOM 1658  N N     . LEU C 3 21  ? 105.601 96.170  78.941  1.00 196.51 ?  33  LEU C N     1 
ATOM 1659  C CA    . LEU C 3 21  ? 104.863 96.858  79.995  1.00 196.51 ?  33  LEU C CA    1 
ATOM 1660  C C     . LEU C 3 21  ? 105.337 98.287  80.187  1.00 196.51 ?  33  LEU C C     1 
ATOM 1661  O O     . LEU C 3 21  ? 104.544 99.150  80.574  1.00 196.51 ?  33  LEU C O     1 
ATOM 1662  C CB    . LEU C 3 21  ? 104.986 96.117  81.323  1.00 196.51 ?  33  LEU C CB    1 
ATOM 1663  C CG    . LEU C 3 21  ? 104.287 94.772  81.445  1.00 196.51 ?  33  LEU C CG    1 
ATOM 1664  C CD1   . LEU C 3 21  ? 104.592 94.147  82.789  1.00 196.51 ?  33  LEU C CD1   1 
ATOM 1665  C CD2   . LEU C 3 21  ? 102.797 94.944  81.261  1.00 196.51 ?  33  LEU C CD2   1 
ATOM 1666  N N     . LEU C 3 22  ? 106.608 98.565  79.908  1.00 193.43 ?  34  LEU C N     1 
ATOM 1667  C CA    . LEU C 3 22  ? 107.158 99.851  80.311  1.00 193.43 ?  34  LEU C CA    1 
ATOM 1668  C C     . LEU C 3 22  ? 106.795 100.949 79.313  1.00 193.43 ?  34  LEU C C     1 
ATOM 1669  O O     . LEU C 3 22  ? 107.081 102.125 79.555  1.00 193.43 ?  34  LEU C O     1 
ATOM 1670  C CB    . LEU C 3 22  ? 108.667 99.706  80.517  1.00 193.43 ?  34  LEU C CB    1 
ATOM 1671  C CG    . LEU C 3 22  ? 109.436 100.704 81.377  1.00 193.43 ?  34  LEU C CG    1 
ATOM 1672  C CD1   . LEU C 3 22  ? 110.458 99.957  82.180  1.00 193.43 ?  34  LEU C CD1   1 
ATOM 1673  C CD2   . LEU C 3 22  ? 110.149 101.700 80.518  1.00 193.43 ?  34  LEU C CD2   1 
ATOM 1674  N N     . ARG C 3 23  ? 106.128 100.604 78.211  1.00 197.50 ?  35  ARG C N     1 
ATOM 1675  C CA    . ARG C 3 23  ? 105.493 101.638 77.405  1.00 197.50 ?  35  ARG C CA    1 
ATOM 1676  C C     . ARG C 3 23  ? 104.008 101.772 77.704  1.00 197.50 ?  35  ARG C C     1 
ATOM 1677  O O     . ARG C 3 23  ? 103.453 102.864 77.550  1.00 197.50 ?  35  ARG C O     1 
ATOM 1678  C CB    . ARG C 3 23  ? 105.674 101.371 75.911  1.00 197.50 ?  35  ARG C CB    1 
ATOM 1679  C CG    . ARG C 3 23  ? 107.047 101.666 75.379  1.00 197.50 ?  35  ARG C CG    1 
ATOM 1680  C CD    . ARG C 3 23  ? 107.035 101.743 73.864  1.00 197.50 ?  35  ARG C CD    1 
ATOM 1681  N NE    . ARG C 3 23  ? 106.762 100.459 73.236  1.00 197.50 ?  35  ARG C NE    1 
ATOM 1682  C CZ    . ARG C 3 23  ? 107.703 99.592  72.887  1.00 197.50 ?  35  ARG C CZ    1 
ATOM 1683  N NH1   . ARG C 3 23  ? 108.977 99.876  73.098  1.00 197.50 ?  35  ARG C NH1   1 
ATOM 1684  N NH2   . ARG C 3 23  ? 107.370 98.444  72.318  1.00 197.50 ?  35  ARG C NH2   1 
ATOM 1685  N N     . LYS C 3 24  ? 103.348 100.693 78.129  1.00 197.03 ?  36  LYS C N     1 
ATOM 1686  C CA    . LYS C 3 24  ? 101.891 100.722 78.203  1.00 197.03 ?  36  LYS C CA    1 
ATOM 1687  C C     . LYS C 3 24  ? 101.390 101.480 79.421  1.00 197.03 ?  36  LYS C C     1 
ATOM 1688  O O     . LYS C 3 24  ? 100.207 101.826 79.484  1.00 197.03 ?  36  LYS C O     1 
ATOM 1689  C CB    . LYS C 3 24  ? 101.326 99.305  78.206  1.00 197.03 ?  36  LYS C CB    1 
ATOM 1690  C CG    . LYS C 3 24  ? 101.608 98.523  76.938  1.00 197.03 ?  36  LYS C CG    1 
ATOM 1691  C CD    . LYS C 3 24  ? 100.950 99.148  75.726  1.00 197.03 ?  36  LYS C CD    1 
ATOM 1692  C CE    . LYS C 3 24  ? 99.454  98.938  75.748  1.00 197.03 ?  36  LYS C CE    1 
ATOM 1693  N NZ    . LYS C 3 24  ? 98.825  99.474  74.512  1.00 197.03 ?  36  LYS C NZ    1 
ATOM 1694  N N     . GLY C 3 25  ? 102.253 101.743 80.391  1.00 196.46 ?  37  GLY C N     1 
ATOM 1695  C CA    . GLY C 3 25  ? 101.808 102.482 81.550  1.00 196.46 ?  37  GLY C CA    1 
ATOM 1696  C C     . GLY C 3 25  ? 101.930 103.984 81.457  1.00 196.46 ?  37  GLY C C     1 
ATOM 1697  O O     . GLY C 3 25  ? 101.482 104.675 82.377  1.00 196.46 ?  37  GLY C O     1 
ATOM 1698  N N     . ASN C 3 26  ? 102.489 104.490 80.352  1.00 205.37 ?  38  ASN C N     1 
ATOM 1699  C CA    . ASN C 3 26  ? 102.908 105.886 80.200  1.00 205.37 ?  38  ASN C CA    1 
ATOM 1700  C C     . ASN C 3 26  ? 103.808 106.325 81.351  1.00 205.37 ?  38  ASN C C     1 
ATOM 1701  O O     . ASN C 3 26  ? 103.469 107.209 82.136  1.00 205.37 ?  38  ASN C O     1 
ATOM 1702  C CB    . ASN C 3 26  ? 101.715 106.832 80.038  1.00 205.37 ?  38  ASN C CB    1 
ATOM 1703  C CG    . ASN C 3 26  ? 101.112 106.769 78.653  1.00 205.37 ?  38  ASN C CG    1 
ATOM 1704  O OD1   . ASN C 3 26  ? 101.826 106.731 77.654  1.00 205.37 ?  38  ASN C OD1   1 
ATOM 1705  N ND2   . ASN C 3 26  ? 99.791  106.758 78.585  1.00 205.37 ?  38  ASN C ND2   1 
ATOM 1706  N N     . TYR C 3 27  ? 104.961 105.670 81.458  1.00 194.34 ?  39  TYR C N     1 
ATOM 1707  C CA    . TYR C 3 27  ? 106.006 106.161 82.340  1.00 194.34 ?  39  TYR C CA    1 
ATOM 1708  C C     . TYR C 3 27  ? 106.862 107.202 81.645  1.00 194.34 ?  39  TYR C C     1 
ATOM 1709  O O     . TYR C 3 27  ? 107.379 108.109 82.301  1.00 194.34 ?  39  TYR C O     1 
ATOM 1710  C CB    . TYR C 3 27  ? 106.855 104.999 82.835  1.00 194.34 ?  39  TYR C CB    1 
ATOM 1711  C CG    . TYR C 3 27  ? 106.098 104.101 83.773  1.00 194.34 ?  39  TYR C CG    1 
ATOM 1712  C CD1   . TYR C 3 27  ? 105.952 104.436 85.106  1.00 194.34 ?  39  TYR C CD1   1 
ATOM 1713  C CD2   . TYR C 3 27  ? 105.514 102.932 83.322  1.00 194.34 ?  39  TYR C CD2   1 
ATOM 1714  C CE1   . TYR C 3 27  ? 105.256 103.632 85.965  1.00 194.34 ?  39  TYR C CE1   1 
ATOM 1715  C CE2   . TYR C 3 27  ? 104.813 102.118 84.176  1.00 194.34 ?  39  TYR C CE2   1 
ATOM 1716  C CZ    . TYR C 3 27  ? 104.688 102.475 85.496  1.00 194.34 ?  39  TYR C CZ    1 
ATOM 1717  O OH    . TYR C 3 27  ? 103.987 101.663 86.351  1.00 194.34 ?  39  TYR C OH    1 
ATOM 1718  N N     . ALA C 3 28  ? 107.008 107.092 80.330  1.00 198.06 ?  40  ALA C N     1 
ATOM 1719  C CA    . ALA C 3 28  ? 107.545 108.161 79.502  1.00 198.06 ?  40  ALA C CA    1 
ATOM 1720  C C     . ALA C 3 28  ? 107.040 107.954 78.086  1.00 198.06 ?  40  ALA C C     1 
ATOM 1721  O O     . ALA C 3 28  ? 106.658 106.849 77.701  1.00 198.06 ?  40  ALA C O     1 
ATOM 1722  C CB    . ALA C 3 28  ? 109.072 108.198 79.509  1.00 198.06 ?  40  ALA C CB    1 
ATOM 1723  N N     . GLU C 3 29  ? 107.070 109.022 77.297  1.00 213.85 ?  41  GLU C N     1 
ATOM 1724  C CA    . GLU C 3 29  ? 106.539 108.933 75.945  1.00 213.85 ?  41  GLU C CA    1 
ATOM 1725  C C     . GLU C 3 29  ? 107.487 108.248 74.969  1.00 213.85 ?  41  GLU C C     1 
ATOM 1726  O O     . GLU C 3 29  ? 107.121 108.082 73.803  1.00 213.85 ?  41  GLU C O     1 
ATOM 1727  C CB    . GLU C 3 29  ? 106.186 110.328 75.429  1.00 213.85 ?  41  GLU C CB    1 
ATOM 1728  C CG    . GLU C 3 29  ? 105.059 110.996 76.203  1.00 213.85 ?  41  GLU C CG    1 
ATOM 1729  C CD    . GLU C 3 29  ? 104.729 112.382 75.683  1.00 213.85 ?  41  GLU C CD    1 
ATOM 1730  O OE1   . GLU C 3 29  ? 105.432 112.857 74.767  1.00 213.85 ?  41  GLU C OE1   1 
ATOM 1731  O OE2   . GLU C 3 29  ? 103.773 113.002 76.197  1.00 213.85 -1 41  GLU C OE2   1 
ATOM 1732  N N     . ARG C 3 30  ? 108.677 107.845 75.406  1.00 213.04 ?  42  ARG C N     1 
ATOM 1733  C CA    . ARG C 3 30  ? 109.651 107.203 74.537  1.00 213.04 ?  42  ARG C CA    1 
ATOM 1734  C C     . ARG C 3 30  ? 110.617 106.430 75.422  1.00 213.04 ?  42  ARG C C     1 
ATOM 1735  O O     . ARG C 3 30  ? 111.152 106.986 76.381  1.00 213.04 ?  42  ARG C O     1 
ATOM 1736  C CB    . ARG C 3 30  ? 110.397 108.246 73.695  1.00 213.04 ?  42  ARG C CB    1 
ATOM 1737  C CG    . ARG C 3 30  ? 111.187 107.696 72.523  1.00 213.04 ?  42  ARG C CG    1 
ATOM 1738  C CD    . ARG C 3 30  ? 112.002 108.793 71.848  1.00 213.04 ?  42  ARG C CD    1 
ATOM 1739  N NE    . ARG C 3 30  ? 111.180 109.836 71.251  1.00 213.04 ?  42  ARG C NE    1 
ATOM 1740  C CZ    . ARG C 3 30  ? 110.770 109.821 69.993  1.00 213.04 ?  42  ARG C CZ    1 
ATOM 1741  N NH1   . ARG C 3 30  ? 111.128 108.826 69.199  1.00 213.04 ?  42  ARG C NH1   1 
ATOM 1742  N NH2   . ARG C 3 30  ? 110.020 110.807 69.525  1.00 213.04 ?  42  ARG C NH2   1 
ATOM 1743  N N     . VAL C 3 31  ? 110.837 105.155 75.108  1.00 211.06 ?  43  VAL C N     1 
ATOM 1744  C CA    . VAL C 3 31  ? 111.591 104.245 75.965  1.00 211.06 ?  43  VAL C CA    1 
ATOM 1745  C C     . VAL C 3 31  ? 112.840 103.788 75.234  1.00 211.06 ?  43  VAL C C     1 
ATOM 1746  O O     . VAL C 3 31  ? 112.752 103.265 74.119  1.00 211.06 ?  43  VAL C O     1 
ATOM 1747  C CB    . VAL C 3 31  ? 110.741 103.037 76.380  1.00 211.06 ?  43  VAL C CB    1 
ATOM 1748  C CG1   . VAL C 3 31  ? 111.591 102.014 77.078  1.00 211.06 ?  43  VAL C CG1   1 
ATOM 1749  C CG2   . VAL C 3 31  ? 109.627 103.496 77.284  1.00 211.06 ?  43  VAL C CG2   1 
ATOM 1750  N N     . GLY C 3 32  ? 113.993 103.965 75.869  1.00 209.14 ?  44  GLY C N     1 
ATOM 1751  C CA    . GLY C 3 32  ? 115.258 103.653 75.240  1.00 209.14 ?  44  GLY C CA    1 
ATOM 1752  C C     . GLY C 3 32  ? 115.475 102.168 75.044  1.00 209.14 ?  44  GLY C C     1 
ATOM 1753  O O     . GLY C 3 32  ? 114.740 101.320 75.545  1.00 209.14 ?  44  GLY C O     1 
ATOM 1754  N N     . ALA C 3 33  ? 116.516 101.852 74.276  1.00 202.81 ?  45  ALA C N     1 
ATOM 1755  C CA    . ALA C 3 33  ? 116.784 100.462 73.928  1.00 202.81 ?  45  ALA C CA    1 
ATOM 1756  C C     . ALA C 3 33  ? 117.528 99.746  75.041  1.00 202.81 ?  45  ALA C C     1 
ATOM 1757  O O     . ALA C 3 33  ? 117.197 98.612  75.394  1.00 202.81 ?  45  ALA C O     1 
ATOM 1758  C CB    . ALA C 3 33  ? 117.582 100.382 72.628  1.00 202.81 ?  45  ALA C CB    1 
ATOM 1759  N N     . GLY C 3 34  ? 118.542 100.385 75.594  1.00 196.55 ?  46  GLY C N     1 
ATOM 1760  C CA    . GLY C 3 34  ? 119.300 99.722  76.625  1.00 196.55 ?  46  GLY C CA    1 
ATOM 1761  C C     . GLY C 3 34  ? 118.635 99.634  77.976  1.00 196.55 ?  46  GLY C C     1 
ATOM 1762  O O     . GLY C 3 34  ? 119.166 98.961  78.862  1.00 196.55 ?  46  GLY C O     1 
ATOM 1763  N N     . ALA C 3 35  ? 117.488 100.293 78.170  1.00 193.20 ?  47  ALA C N     1 
ATOM 1764  C CA    . ALA C 3 35  ? 116.891 100.338 79.505  1.00 193.20 ?  47  ALA C CA    1 
ATOM 1765  C C     . ALA C 3 35  ? 116.294 99.006  79.953  1.00 193.20 ?  47  ALA C C     1 
ATOM 1766  O O     . ALA C 3 35  ? 116.732 98.497  80.997  1.00 193.20 ?  47  ALA C O     1 
ATOM 1767  C CB    . ALA C 3 35  ? 115.886 101.493 79.601  1.00 193.20 ?  47  ALA C CB    1 
ATOM 1768  N N     . PRO C 3 36  ? 115.349 98.365  79.242  1.00 187.16 ?  48  PRO C N     1 
ATOM 1769  C CA    . PRO C 3 36  ? 114.744 97.166  79.832  1.00 187.16 ?  48  PRO C CA    1 
ATOM 1770  C C     . PRO C 3 36  ? 115.609 95.921  79.723  1.00 187.16 ?  48  PRO C C     1 
ATOM 1771  O O     . PRO C 3 36  ? 115.097 94.819  79.935  1.00 187.16 ?  48  PRO C O     1 
ATOM 1772  C CB    . PRO C 3 36  ? 113.444 97.008  79.048  1.00 187.16 ?  48  PRO C CB    1 
ATOM 1773  C CG    . PRO C 3 36  ? 113.794 97.465  77.741  1.00 187.16 ?  48  PRO C CG    1 
ATOM 1774  C CD    . PRO C 3 36  ? 114.759 98.593  77.906  1.00 187.16 ?  48  PRO C CD    1 
ATOM 1775  N N     . VAL C 3 37  ? 116.883 96.048  79.362  1.00 188.12 ?  49  VAL C N     1 
ATOM 1776  C CA    . VAL C 3 37  ? 117.853 95.022  79.716  1.00 188.12 ?  49  VAL C CA    1 
ATOM 1777  C C     . VAL C 3 37  ? 118.382 95.274  81.117  1.00 188.12 ?  49  VAL C C     1 
ATOM 1778  O O     . VAL C 3 37  ? 118.428 94.368  81.957  1.00 188.12 ?  49  VAL C O     1 
ATOM 1779  C CB    . VAL C 3 37  ? 118.992 94.977  78.686  1.00 188.12 ?  49  VAL C CB    1 
ATOM 1780  C CG1   . VAL C 3 37  ? 120.141 94.130  79.199  1.00 188.12 ?  49  VAL C CG1   1 
ATOM 1781  C CG2   . VAL C 3 37  ? 118.478 94.411  77.384  1.00 188.12 ?  49  VAL C CG2   1 
ATOM 1782  N N     . TYR C 3 38  ? 118.753 96.523  81.394  1.00 188.91 ?  50  TYR C N     1 
ATOM 1783  C CA    . TYR C 3 38  ? 119.331 96.889  82.682  1.00 188.91 ?  50  TYR C CA    1 
ATOM 1784  C C     . TYR C 3 38  ? 118.329 96.760  83.818  1.00 188.91 ?  50  TYR C C     1 
ATOM 1785  O O     . TYR C 3 38  ? 118.724 96.560  84.969  1.00 188.91 ?  50  TYR C O     1 
ATOM 1786  C CB    . TYR C 3 38  ? 119.857 98.313  82.607  1.00 188.91 ?  50  TYR C CB    1 
ATOM 1787  C CG    . TYR C 3 38  ? 120.512 98.826  83.855  1.00 188.91 ?  50  TYR C CG    1 
ATOM 1788  C CD1   . TYR C 3 38  ? 121.798 98.454  84.192  1.00 188.91 ?  50  TYR C CD1   1 
ATOM 1789  C CD2   . TYR C 3 38  ? 119.844 99.704  84.685  1.00 188.91 ?  50  TYR C CD2   1 
ATOM 1790  C CE1   . TYR C 3 38  ? 122.398 98.941  85.318  1.00 188.91 ?  50  TYR C CE1   1 
ATOM 1791  C CE2   . TYR C 3 38  ? 120.433 100.194 85.812  1.00 188.91 ?  50  TYR C CE2   1 
ATOM 1792  C CZ    . TYR C 3 38  ? 121.709 99.809  86.126  1.00 188.91 ?  50  TYR C CZ    1 
ATOM 1793  O OH    . TYR C 3 38  ? 122.294 100.305 87.263  1.00 188.91 ?  50  TYR C OH    1 
ATOM 1794  N N     . LEU C 3 39  ? 117.036 96.872  83.522  1.00 182.70 ?  51  LEU C N     1 
ATOM 1795  C CA    . LEU C 3 39  ? 116.038 96.636  84.555  1.00 182.70 ?  51  LEU C CA    1 
ATOM 1796  C C     . LEU C 3 39  ? 115.815 95.146  84.750  1.00 182.70 ?  51  LEU C C     1 
ATOM 1797  O O     . LEU C 3 39  ? 115.444 94.700  85.841  1.00 182.70 ?  51  LEU C O     1 
ATOM 1798  C CB    . LEU C 3 39  ? 114.735 97.336  84.189  1.00 182.70 ?  51  LEU C CB    1 
ATOM 1799  C CG    . LEU C 3 39  ? 113.692 97.394  85.289  1.00 182.70 ?  51  LEU C CG    1 
ATOM 1800  C CD1   . LEU C 3 39  ? 114.283 98.172  86.421  1.00 182.70 ?  51  LEU C CD1   1 
ATOM 1801  C CD2   . LEU C 3 39  ? 112.459 98.069  84.785  1.00 182.70 ?  51  LEU C CD2   1 
ATOM 1802  N N     . ALA C 3 40  ? 116.075 94.353  83.712  1.00 183.61 ?  52  ALA C N     1 
ATOM 1803  C CA    . ALA C 3 40  ? 115.889 92.915  83.832  1.00 183.61 ?  52  ALA C CA    1 
ATOM 1804  C C     . ALA C 3 40  ? 117.003 92.267  84.636  1.00 183.61 ?  52  ALA C C     1 
ATOM 1805  O O     . ALA C 3 40  ? 116.881 91.104  85.025  1.00 183.61 ?  52  ALA C O     1 
ATOM 1806  C CB    . ALA C 3 40  ? 115.800 92.276  82.454  1.00 183.61 ?  52  ALA C CB    1 
ATOM 1807  N N     . ALA C 3 41  ? 118.097 92.981  84.884  1.00 183.84 ?  53  ALA C N     1 
ATOM 1808  C CA    . ALA C 3 41  ? 119.107 92.446  85.786  1.00 183.84 ?  53  ALA C CA    1 
ATOM 1809  C C     . ALA C 3 41  ? 118.733 92.703  87.236  1.00 183.84 ?  53  ALA C C     1 
ATOM 1810  O O     . ALA C 3 41  ? 118.781 91.786  88.063  1.00 183.84 ?  53  ALA C O     1 
ATOM 1811  C CB    . ALA C 3 41  ? 120.473 93.046  85.475  1.00 183.84 ?  53  ALA C CB    1 
ATOM 1812  N N     . VAL C 3 42  ? 118.352 93.942  87.554  1.00 176.46 ?  54  VAL C N     1 
ATOM 1813  C CA    . VAL C 3 42  ? 118.073 94.330  88.933  1.00 176.46 ?  54  VAL C CA    1 
ATOM 1814  C C     . VAL C 3 42  ? 116.833 93.613  89.458  1.00 176.46 ?  54  VAL C C     1 
ATOM 1815  O O     . VAL C 3 42  ? 116.777 93.217  90.628  1.00 176.46 ?  54  VAL C O     1 
ATOM 1816  C CB    . VAL C 3 42  ? 117.956 95.864  89.017  1.00 176.46 ?  54  VAL C CB    1 
ATOM 1817  C CG1   . VAL C 3 42  ? 117.525 96.331  90.380  1.00 176.46 ?  54  VAL C CG1   1 
ATOM 1818  C CG2   . VAL C 3 42  ? 119.285 96.477  88.713  1.00 176.46 ?  54  VAL C CG2   1 
ATOM 1819  N N     . LEU C 3 43  ? 115.854 93.363  88.592  1.00 176.70 ?  55  LEU C N     1 
ATOM 1820  C CA    . LEU C 3 43  ? 114.712 92.574  89.032  1.00 176.70 ?  55  LEU C CA    1 
ATOM 1821  C C     . LEU C 3 43  ? 115.064 91.104  89.193  1.00 176.70 ?  55  LEU C C     1 
ATOM 1822  O O     . LEU C 3 43  ? 114.360 90.387  89.906  1.00 176.70 ?  55  LEU C O     1 
ATOM 1823  C CB    . LEU C 3 43  ? 113.540 92.734  88.074  1.00 176.70 ?  55  LEU C CB    1 
ATOM 1824  C CG    . LEU C 3 43  ? 112.861 94.085  88.231  1.00 176.70 ?  55  LEU C CG    1 
ATOM 1825  C CD1   . LEU C 3 43  ? 111.804 94.287  87.177  1.00 176.70 ?  55  LEU C CD1   1 
ATOM 1826  C CD2   . LEU C 3 43  ? 112.251 94.158  89.603  1.00 176.70 ?  55  LEU C CD2   1 
ATOM 1827  N N     . GLU C 3 44  ? 116.150 90.635  88.576  1.00 186.64 ?  56  GLU C N     1 
ATOM 1828  C CA    . GLU C 3 44  ? 116.540 89.251  88.817  1.00 186.64 ?  56  GLU C CA    1 
ATOM 1829  C C     . GLU C 3 44  ? 117.497 89.136  89.991  1.00 186.64 ?  56  GLU C C     1 
ATOM 1830  O O     . GLU C 3 44  ? 117.391 88.185  90.773  1.00 186.64 ?  56  GLU C O     1 
ATOM 1831  C CB    . GLU C 3 44  ? 117.134 88.629  87.557  1.00 186.64 ?  56  GLU C CB    1 
ATOM 1832  C CG    . GLU C 3 44  ? 117.578 87.190  87.749  1.00 186.64 ?  56  GLU C CG    1 
ATOM 1833  C CD    . GLU C 3 44  ? 117.860 86.461  86.461  1.00 186.64 ?  56  GLU C CD    1 
ATOM 1834  O OE1   . GLU C 3 44  ? 117.576 87.009  85.380  1.00 186.64 ?  56  GLU C OE1   1 
ATOM 1835  O OE2   . GLU C 3 44  ? 118.387 85.333  86.529  1.00 186.64 -1 56  GLU C OE2   1 
ATOM 1836  N N     . TYR C 3 45  ? 118.397 90.107  90.160  1.00 182.36 ?  57  TYR C N     1 
ATOM 1837  C CA    . TYR C 3 45  ? 119.365 90.033  91.249  1.00 182.36 ?  57  TYR C CA    1 
ATOM 1838  C C     . TYR C 3 45  ? 118.699 90.138  92.617  1.00 182.36 ?  57  TYR C C     1 
ATOM 1839  O O     . TYR C 3 45  ? 119.188 89.557  93.589  1.00 182.36 ?  57  TYR C O     1 
ATOM 1840  C CB    . TYR C 3 45  ? 120.426 91.115  91.093  1.00 182.36 ?  57  TYR C CB    1 
ATOM 1841  C CG    . TYR C 3 45  ? 121.398 91.116  92.230  1.00 182.36 ?  57  TYR C CG    1 
ATOM 1842  C CD1   . TYR C 3 45  ? 122.309 90.091  92.370  1.00 182.36 ?  57  TYR C CD1   1 
ATOM 1843  C CD2   . TYR C 3 45  ? 121.382 92.123  93.180  1.00 182.36 ?  57  TYR C CD2   1 
ATOM 1844  C CE1   . TYR C 3 45  ? 123.188 90.070  93.415  1.00 182.36 ?  57  TYR C CE1   1 
ATOM 1845  C CE2   . TYR C 3 45  ? 122.255 92.113  94.227  1.00 182.36 ?  57  TYR C CE2   1 
ATOM 1846  C CZ    . TYR C 3 45  ? 123.158 91.085  94.340  1.00 182.36 ?  57  TYR C CZ    1 
ATOM 1847  O OH    . TYR C 3 45  ? 124.043 91.064  95.389  1.00 182.36 ?  57  TYR C OH    1 
ATOM 1848  N N     . LEU C 3 46  ? 117.573 90.844  92.715  1.00 167.47 ?  58  LEU C N     1 
ATOM 1849  C CA    . LEU C 3 46  ? 116.831 90.822  93.970  1.00 167.47 ?  58  LEU C CA    1 
ATOM 1850  C C     . LEU C 3 46  ? 116.122 89.489  94.170  1.00 167.47 ?  58  LEU C C     1 
ATOM 1851  O O     . LEU C 3 46  ? 116.177 88.913  95.261  1.00 167.47 ?  58  LEU C O     1 
ATOM 1852  C CB    . LEU C 3 46  ? 115.838 91.974  94.028  1.00 167.47 ?  58  LEU C CB    1 
ATOM 1853  C CG    . LEU C 3 46  ? 116.529 93.321  94.147  1.00 167.47 ?  58  LEU C CG    1 
ATOM 1854  C CD1   . LEU C 3 46  ? 115.507 94.425  94.145  1.00 167.47 ?  58  LEU C CD1   1 
ATOM 1855  C CD2   . LEU C 3 46  ? 117.364 93.364  95.405  1.00 167.47 ?  58  LEU C CD2   1 
ATOM 1856  N N     . THR C 3 47  ? 115.481 88.964  93.126  1.00 175.54 ?  59  THR C N     1 
ATOM 1857  C CA    . THR C 3 47  ? 114.750 87.710  93.280  1.00 175.54 ?  59  THR C CA    1 
ATOM 1858  C C     . THR C 3 47  ? 115.684 86.510  93.286  1.00 175.54 ?  59  THR C C     1 
ATOM 1859  O O     . THR C 3 47  ? 115.253 85.390  93.567  1.00 175.54 ?  59  THR C O     1 
ATOM 1860  C CB    . THR C 3 47  ? 113.716 87.557  92.179  1.00 175.54 ?  59  THR C CB    1 
ATOM 1861  O OG1   . THR C 3 47  ? 114.384 87.586  90.919  1.00 175.54 ?  59  THR C OG1   1 
ATOM 1862  C CG2   . THR C 3 47  ? 112.713 88.676  92.250  1.00 175.54 ?  59  THR C CG2   1 
ATOM 1863  N N     . ALA C 3 48  ? 116.955 86.708  92.950  1.00 183.65 ?  60  ALA C N     1 
ATOM 1864  C CA    . ALA C 3 48  ? 117.931 85.657  93.206  1.00 183.65 ?  60  ALA C CA    1 
ATOM 1865  C C     . ALA C 3 48  ? 118.638 85.888  94.528  1.00 183.65 ?  60  ALA C C     1 
ATOM 1866  O O     . ALA C 3 48  ? 119.531 85.120  94.898  1.00 183.65 ?  60  ALA C O     1 
ATOM 1867  C CB    . ALA C 3 48  ? 118.947 85.569  92.073  1.00 183.65 ?  60  ALA C CB    1 
ATOM 1868  N N     . GLU C 3 49  ? 118.271 86.950  95.238  1.00 187.86 ?  61  GLU C N     1 
ATOM 1869  C CA    . GLU C 3 49  ? 118.868 87.205  96.539  1.00 187.86 ?  61  GLU C CA    1 
ATOM 1870  C C     . GLU C 3 49  ? 117.948 86.743  97.655  1.00 187.86 ?  61  GLU C C     1 
ATOM 1871  O O     . GLU C 3 49  ? 118.408 86.197  98.663  1.00 187.86 ?  61  GLU C O     1 
ATOM 1872  C CB    . GLU C 3 49  ? 119.174 88.689  96.694  1.00 187.86 ?  61  GLU C CB    1 
ATOM 1873  C CG    . GLU C 3 49  ? 119.960 89.068  97.929  1.00 187.86 ?  61  GLU C CG    1 
ATOM 1874  C CD    . GLU C 3 49  ? 121.418 88.680  97.842  1.00 187.86 ?  61  GLU C CD    1 
ATOM 1875  O OE1   . GLU C 3 49  ? 121.925 88.514  96.715  1.00 187.86 ?  61  GLU C OE1   1 
ATOM 1876  O OE2   . GLU C 3 49  ? 122.068 88.577  98.900  1.00 187.86 -1 61  GLU C OE2   1 
ATOM 1877  N N     . ILE C 3 50  ? 116.641 86.957  97.503  1.00 174.26 ?  62  ILE C N     1 
ATOM 1878  C CA    . ILE C 3 50  ? 115.767 86.608  98.612  1.00 174.26 ?  62  ILE C CA    1 
ATOM 1879  C C     . ILE C 3 50  ? 115.358 85.147  98.515  1.00 174.26 ?  62  ILE C C     1 
ATOM 1880  O O     . ILE C 3 50  ? 114.742 84.613  99.439  1.00 174.26 ?  62  ILE C O     1 
ATOM 1881  C CB    . ILE C 3 50  ? 114.560 87.562  98.686  1.00 174.26 ?  62  ILE C CB    1 
ATOM 1882  C CG1   . ILE C 3 50  ? 113.476 87.252  97.664  1.00 174.26 ?  62  ILE C CG1   1 
ATOM 1883  C CG2   . ILE C 3 50  ? 115.016 88.976  98.485  1.00 174.26 ?  62  ILE C CG2   1 
ATOM 1884  C CD1   . ILE C 3 50  ? 112.256 86.590  98.280  1.00 174.26 ?  62  ILE C CD1   1 
ATOM 1885  N N     . LEU C 3 51  ? 115.673 84.476  97.408  1.00 179.60 ?  63  LEU C N     1 
ATOM 1886  C CA    . LEU C 3 51  ? 115.494 83.033  97.380  1.00 179.60 ?  63  LEU C CA    1 
ATOM 1887  C C     . LEU C 3 51  ? 116.647 82.291  98.026  1.00 179.60 ?  63  LEU C C     1 
ATOM 1888  O O     . LEU C 3 51  ? 116.395 81.333  98.759  1.00 179.60 ?  63  LEU C O     1 
ATOM 1889  C CB    . LEU C 3 51  ? 115.314 82.524  95.959  1.00 179.60 ?  63  LEU C CB    1 
ATOM 1890  C CG    . LEU C 3 51  ? 113.971 82.847  95.330  1.00 179.60 ?  63  LEU C CG    1 
ATOM 1891  C CD1   . LEU C 3 51  ? 113.931 82.313  93.928  1.00 179.60 ?  63  LEU C CD1   1 
ATOM 1892  C CD2   . LEU C 3 51  ? 112.864 82.253  96.152  1.00 179.60 ?  63  LEU C CD2   1 
ATOM 1893  N N     . GLU C 3 52  ? 117.893 82.702  97.764  1.00 195.70 ?  64  GLU C N     1 
ATOM 1894  C CA    . GLU C 3 52  ? 119.056 81.979  98.276  1.00 195.70 ?  64  GLU C CA    1 
ATOM 1895  C C     . GLU C 3 52  ? 119.109 82.027  99.797  1.00 195.70 ?  64  GLU C C     1 
ATOM 1896  O O     . GLU C 3 52  ? 119.561 81.077  100.445 1.00 195.70 ?  64  GLU C O     1 
ATOM 1897  C CB    . GLU C 3 52  ? 120.337 82.557  97.676  1.00 195.70 ?  64  GLU C CB    1 
ATOM 1898  C CG    . GLU C 3 52  ? 121.611 81.804  98.050  1.00 195.70 ?  64  GLU C CG    1 
ATOM 1899  C CD    . GLU C 3 52  ? 122.869 82.442  97.483  1.00 195.70 ?  64  GLU C CD    1 
ATOM 1900  O OE1   . GLU C 3 52  ? 122.764 83.500  96.831  1.00 195.70 ?  64  GLU C OE1   1 
ATOM 1901  O OE2   . GLU C 3 52  ? 123.967 81.883  97.692  1.00 195.70 -1 64  GLU C OE2   1 
ATOM 1902  N N     . LEU C 3 53  ? 118.623 83.119  100.387 1.00 180.22 ?  65  LEU C N     1 
ATOM 1903  C CA    . LEU C 3 53  ? 118.450 83.138  101.832 1.00 180.22 ?  65  LEU C CA    1 
ATOM 1904  C C     . LEU C 3 53  ? 117.319 82.216  102.263 1.00 180.22 ?  65  LEU C C     1 
ATOM 1905  O O     . LEU C 3 53  ? 117.461 81.487  103.251 1.00 180.22 ?  65  LEU C O     1 
ATOM 1906  C CB    . LEU C 3 53  ? 118.198 84.562  102.315 1.00 180.22 ?  65  LEU C CB    1 
ATOM 1907  C CG    . LEU C 3 53  ? 119.389 85.482  102.067 1.00 180.22 ?  65  LEU C CG    1 
ATOM 1908  C CD1   . LEU C 3 53  ? 119.073 86.893  102.506 1.00 180.22 ?  65  LEU C CD1   1 
ATOM 1909  C CD2   . LEU C 3 53  ? 120.619 84.959  102.776 1.00 180.22 ?  65  LEU C CD2   1 
ATOM 1910  N N     . ALA C 3 54  ? 116.204 82.219  101.531 1.00 187.37 ?  66  ALA C N     1 
ATOM 1911  C CA    . ALA C 3 54  ? 115.104 81.321  101.861 1.00 187.37 ?  66  ALA C CA    1 
ATOM 1912  C C     . ALA C 3 54  ? 115.453 79.879  101.532 1.00 187.37 ?  66  ALA C C     1 
ATOM 1913  O O     . ALA C 3 54  ? 115.044 78.958  102.246 1.00 187.37 ?  66  ALA C O     1 
ATOM 1914  C CB    . ALA C 3 54  ? 113.838 81.741  101.121 1.00 187.37 ?  66  ALA C CB    1 
ATOM 1915  N N     . GLY C 3 55  ? 116.203 79.665  100.452 1.00 194.72 ?  67  GLY C N     1 
ATOM 1916  C CA    . GLY C 3 55  ? 116.635 78.322  100.113 1.00 194.72 ?  67  GLY C CA    1 
ATOM 1917  C C     . GLY C 3 55  ? 117.619 77.754  101.109 1.00 194.72 ?  67  GLY C C     1 
ATOM 1918  O O     . GLY C 3 55  ? 117.641 76.544  101.342 1.00 194.72 ?  67  GLY C O     1 
ATOM 1919  N N     . ASN C 3 56  ? 118.437 78.612  101.718 1.00 199.01 ?  68  ASN C N     1 
ATOM 1920  C CA    . ASN C 3 56  ? 119.251 78.162  102.838 1.00 199.01 ?  68  ASN C CA    1 
ATOM 1921  C C     . ASN C 3 56  ? 118.460 78.168  104.135 1.00 199.01 ?  68  ASN C C     1 
ATOM 1922  O O     . ASN C 3 56  ? 118.956 77.695  105.161 1.00 199.01 ?  68  ASN C O     1 
ATOM 1923  C CB    . ASN C 3 56  ? 120.505 79.019  102.970 1.00 199.01 ?  68  ASN C CB    1 
ATOM 1924  C CG    . ASN C 3 56  ? 121.531 78.704  101.908 1.00 199.01 ?  68  ASN C CG    1 
ATOM 1925  O OD1   . ASN C 3 56  ? 121.740 77.543  101.559 1.00 199.01 ?  68  ASN C OD1   1 
ATOM 1926  N ND2   . ASN C 3 56  ? 122.189 79.734  101.395 1.00 199.01 ?  68  ASN C ND2   1 
ATOM 1927  N N     . ALA C 3 57  ? 117.240 78.704  104.116 1.00 192.87 ?  69  ALA C N     1 
ATOM 1928  C CA    . ALA C 3 57  ? 116.373 78.564  105.277 1.00 192.87 ?  69  ALA C CA    1 
ATOM 1929  C C     . ALA C 3 57  ? 115.499 77.326  105.169 1.00 192.87 ?  69  ALA C C     1 
ATOM 1930  O O     . ALA C 3 57  ? 114.844 76.945  106.143 1.00 192.87 ?  69  ALA C O     1 
ATOM 1931  C CB    . ALA C 3 57  ? 115.508 79.807  105.446 1.00 192.87 ?  69  ALA C CB    1 
ATOM 1932  N N     . ALA C 3 58  ? 115.468 76.692  104.000 1.00 200.40 ?  70  ALA C N     1 
ATOM 1933  C CA    . ALA C 3 58  ? 114.655 75.494  103.847 1.00 200.40 ?  70  ALA C CA    1 
ATOM 1934  C C     . ALA C 3 58  ? 115.327 74.292  104.486 1.00 200.40 ?  70  ALA C C     1 
ATOM 1935  O O     . ALA C 3 58  ? 114.672 73.497  105.168 1.00 200.40 ?  70  ALA C O     1 
ATOM 1936  C CB    . ALA C 3 58  ? 114.384 75.229  102.372 1.00 200.40 ?  70  ALA C CB    1 
ATOM 1937  N N     . ARG C 3 59  ? 116.633 74.138  104.268 1.00 204.80 ?  71  ARG C N     1 
ATOM 1938  C CA    . ARG C 3 59  ? 117.352 73.005  104.833 1.00 204.80 ?  71  ARG C CA    1 
ATOM 1939  C C     . ARG C 3 59  ? 117.491 73.122  106.340 1.00 204.80 ?  71  ARG C C     1 
ATOM 1940  O O     . ARG C 3 59  ? 117.446 72.108  107.044 1.00 204.80 ?  71  ARG C O     1 
ATOM 1941  C CB    . ARG C 3 59  ? 118.736 72.888  104.204 1.00 204.80 ?  71  ARG C CB    1 
ATOM 1942  C CG    . ARG C 3 59  ? 118.741 72.548  102.736 1.00 204.80 ?  71  ARG C CG    1 
ATOM 1943  C CD    . ARG C 3 59  ? 120.167 72.532  102.248 1.00 204.80 ?  71  ARG C CD    1 
ATOM 1944  N NE    . ARG C 3 59  ? 120.760 73.858  102.375 1.00 204.80 ?  71  ARG C NE    1 
ATOM 1945  C CZ    . ARG C 3 59  ? 122.048 74.126  102.196 1.00 204.80 ?  71  ARG C CZ    1 
ATOM 1946  N NH1   . ARG C 3 59  ? 122.893 73.155  101.881 1.00 204.80 ?  71  ARG C NH1   1 
ATOM 1947  N NH2   . ARG C 3 59  ? 122.491 75.368  102.334 1.00 204.80 ?  71  ARG C NH2   1 
ATOM 1948  N N     . ASP C 3 60  ? 117.644 74.344  106.852 1.00 217.55 ?  72  ASP C N     1 
ATOM 1949  C CA    . ASP C 3 60  ? 117.944 74.519  108.267 1.00 217.55 ?  72  ASP C CA    1 
ATOM 1950  C C     . ASP C 3 60  ? 116.723 74.251  109.135 1.00 217.55 ?  72  ASP C C     1 
ATOM 1951  O O     . ASP C 3 60  ? 116.861 73.962  110.327 1.00 217.55 ?  72  ASP C O     1 
ATOM 1952  C CB    . ASP C 3 60  ? 118.486 75.926  108.509 1.00 217.55 ?  72  ASP C CB    1 
ATOM 1953  C CG    . ASP C 3 60  ? 119.090 76.089  109.886 1.00 217.55 ?  72  ASP C CG    1 
ATOM 1954  O OD1   . ASP C 3 60  ? 120.197 75.559  110.112 1.00 217.55 ?  72  ASP C OD1   1 
ATOM 1955  O OD2   . ASP C 3 60  ? 118.463 76.749  110.739 1.00 217.55 -1 72  ASP C OD2   1 
ATOM 1956  N N     . ASN C 3 61  ? 115.532 74.331  108.560 1.00 214.78 ?  73  ASN C N     1 
ATOM 1957  C CA    . ASN C 3 61  ? 114.322 73.918  109.249 1.00 214.78 ?  73  ASN C CA    1 
ATOM 1958  C C     . ASN C 3 61  ? 113.821 72.576  108.729 1.00 214.78 ?  73  ASN C C     1 
ATOM 1959  O O     . ASN C 3 61  ? 112.783 72.092  109.192 1.00 214.78 ?  73  ASN C O     1 
ATOM 1960  C CB    . ASN C 3 61  ? 113.249 75.001  109.096 1.00 214.78 ?  73  ASN C CB    1 
ATOM 1961  C CG    . ASN C 3 61  ? 112.216 74.969  110.201 1.00 214.78 ?  73  ASN C CG    1 
ATOM 1962  O OD1   . ASN C 3 61  ? 112.300 74.162  111.123 1.00 214.78 ?  73  ASN C OD1   1 
ATOM 1963  N ND2   . ASN C 3 61  ? 111.236 75.858  110.117 1.00 214.78 ?  73  ASN C ND2   1 
ATOM 1964  N N     . LYS C 3 62  ? 114.534 71.999  107.753 1.00 210.41 ?  74  LYS C N     1 
ATOM 1965  C CA    . LYS C 3 62  ? 114.339 70.631  107.252 1.00 210.41 ?  74  LYS C CA    1 
ATOM 1966  C C     . LYS C 3 62  ? 112.959 70.427  106.629 1.00 210.41 ?  74  LYS C C     1 
ATOM 1967  O O     . LYS C 3 62  ? 112.237 69.487  106.957 1.00 210.41 ?  74  LYS C O     1 
ATOM 1968  C CB    . LYS C 3 62  ? 114.619 69.597  108.343 1.00 210.41 ?  74  LYS C CB    1 
ATOM 1969  C CG    . LYS C 3 62  ? 116.085 69.575  108.743 1.00 210.41 ?  74  LYS C CG    1 
ATOM 1970  C CD    . LYS C 3 62  ? 116.389 68.557  109.823 1.00 210.41 ?  74  LYS C CD    1 
ATOM 1971  C CE    . LYS C 3 62  ? 117.862 68.613  110.206 1.00 210.41 ?  74  LYS C CE    1 
ATOM 1972  N NZ    . LYS C 3 62  ? 118.208 67.639  111.275 1.00 210.41 ?  74  LYS C NZ    1 
ATOM 1973  N N     . LYS C 3 63  ? 112.594 71.331  105.729 1.00 234.26 ?  75  LYS C N     1 
ATOM 1974  C CA    . LYS C 3 63  ? 111.475 71.175  104.815 1.00 234.26 ?  75  LYS C CA    1 
ATOM 1975  C C     . LYS C 3 63  ? 111.973 71.554  103.429 1.00 234.26 ?  75  LYS C C     1 
ATOM 1976  O O     . LYS C 3 63  ? 112.423 72.681  103.214 1.00 234.26 ?  75  LYS C O     1 
ATOM 1977  C CB    . LYS C 3 63  ? 110.306 72.092  105.189 1.00 234.26 ?  75  LYS C CB    1 
ATOM 1978  C CG    . LYS C 3 63  ? 109.779 71.971  106.608 1.00 234.26 ?  75  LYS C CG    1 
ATOM 1979  C CD    . LYS C 3 63  ? 108.986 70.705  106.838 1.00 234.26 ?  75  LYS C CD    1 
ATOM 1980  C CE    . LYS C 3 63  ? 108.342 70.732  108.218 1.00 234.26 ?  75  LYS C CE    1 
ATOM 1981  N NZ    . LYS C 3 63  ? 107.537 69.513  108.500 1.00 234.26 ?  75  LYS C NZ    1 
ATOM 1982  N N     . THR C 3 64  ? 111.898 70.628  102.476 1.00 233.70 ?  76  THR C N     1 
ATOM 1983  C CA    . THR C 3 64  ? 112.558 70.863  101.199 1.00 233.70 ?  76  THR C CA    1 
ATOM 1984  C C     . THR C 3 64  ? 111.723 71.667  100.212 1.00 233.70 ?  76  THR C C     1 
ATOM 1985  O O     . THR C 3 64  ? 112.182 71.898  99.088  1.00 233.70 ?  76  THR C O     1 
ATOM 1986  C CB    . THR C 3 64  ? 112.986 69.538  100.549 1.00 233.70 ?  76  THR C CB    1 
ATOM 1987  O OG1   . THR C 3 64  ? 113.837 69.818  99.432  1.00 233.70 ?  76  THR C OG1   1 
ATOM 1988  C CG2   . THR C 3 64  ? 111.793 68.761  100.056 1.00 233.70 ?  76  THR C CG2   1 
ATOM 1989  N N     . ARG C 3 65  ? 110.536 72.116  100.600 1.00 224.62 ?  77  ARG C N     1 
ATOM 1990  C CA    . ARG C 3 65  ? 109.719 73.006  99.787  1.00 224.62 ?  77  ARG C CA    1 
ATOM 1991  C C     . ARG C 3 65  ? 109.591 74.346  100.499 1.00 224.62 ?  77  ARG C C     1 
ATOM 1992  O O     . ARG C 3 65  ? 109.222 74.388  101.675 1.00 224.62 ?  77  ARG C O     1 
ATOM 1993  C CB    . ARG C 3 65  ? 108.337 72.405  99.547  1.00 224.62 ?  77  ARG C CB    1 
ATOM 1994  C CG    . ARG C 3 65  ? 107.445 73.277  98.706  1.00 224.62 ?  77  ARG C CG    1 
ATOM 1995  C CD    . ARG C 3 65  ? 106.075 72.656  98.506  1.00 224.62 ?  77  ARG C CD    1 
ATOM 1996  N NE    . ARG C 3 65  ? 106.108 71.486  97.637  1.00 224.62 ?  77  ARG C NE    1 
ATOM 1997  C CZ    . ARG C 3 65  ? 105.055 70.717  97.385  1.00 224.62 ?  77  ARG C CZ    1 
ATOM 1998  N NH1   . ARG C 3 65  ? 103.879 70.997  97.927  1.00 224.62 ?  77  ARG C NH1   1 
ATOM 1999  N NH2   . ARG C 3 65  ? 105.173 69.678  96.577  1.00 224.62 ?  77  ARG C NH2   1 
ATOM 2000  N N     . ILE C 3 66  ? 109.901 75.434  99.797  1.00 202.14 ?  78  ILE C N     1 
ATOM 2001  C CA    . ILE C 3 66  ? 109.810 76.767  100.386 1.00 202.14 ?  78  ILE C CA    1 
ATOM 2002  C C     . ILE C 3 66  ? 108.343 77.135  100.562 1.00 202.14 ?  78  ILE C C     1 
ATOM 2003  O O     . ILE C 3 66  ? 107.621 77.353  99.585  1.00 202.14 ?  78  ILE C O     1 
ATOM 2004  C CB    . ILE C 3 66  ? 110.548 77.805  99.532  1.00 202.14 ?  78  ILE C CB    1 
ATOM 2005  C CG1   . ILE C 3 66  ? 112.046 77.547  99.579  1.00 202.14 ?  78  ILE C CG1   1 
ATOM 2006  C CG2   . ILE C 3 66  ? 110.272 79.199  100.021 1.00 202.14 ?  78  ILE C CG2   1 
ATOM 2007  C CD1   . ILE C 3 66  ? 112.829 78.436  98.672  1.00 202.14 ?  78  ILE C CD1   1 
ATOM 2008  N N     . ILE C 3 67  ? 107.894 77.172  101.810 1.00 192.83 ?  79  ILE C N     1 
ATOM 2009  C CA    . ILE C 3 67  ? 106.519 77.521  102.150 1.00 192.83 ?  79  ILE C CA    1 
ATOM 2010  C C     . ILE C 3 67  ? 106.563 78.976  102.600 1.00 192.83 ?  79  ILE C C     1 
ATOM 2011  O O     . ILE C 3 67  ? 107.648 79.446  102.965 1.00 192.83 ?  79  ILE C O     1 
ATOM 2012  C CB    . ILE C 3 67  ? 105.955 76.567  103.218 1.00 192.83 ?  79  ILE C CB    1 
ATOM 2013  C CG1   . ILE C 3 67  ? 106.792 76.611  104.491 1.00 192.83 ?  79  ILE C CG1   1 
ATOM 2014  C CG2   . ILE C 3 67  ? 105.867 75.156  102.679 1.00 192.83 ?  79  ILE C CG2   1 
ATOM 2015  C CD1   . ILE C 3 67  ? 106.162 75.844  105.638 1.00 192.83 ?  79  ILE C CD1   1 
ATOM 2016  N N     . PRO C 3 68  ? 105.452 79.731  102.585 1.00 179.56 ?  80  PRO C N     1 
ATOM 2017  C CA    . PRO C 3 68  ? 105.546 81.186  102.816 1.00 179.56 ?  80  PRO C CA    1 
ATOM 2018  C C     . PRO C 3 68  ? 105.985 81.615  104.204 1.00 179.56 ?  80  PRO C C     1 
ATOM 2019  O O     . PRO C 3 68  ? 106.110 82.820  104.436 1.00 179.56 ?  80  PRO C O     1 
ATOM 2020  C CB    . PRO C 3 68  ? 104.124 81.674  102.527 1.00 179.56 ?  80  PRO C CB    1 
ATOM 2021  C CG    . PRO C 3 68  ? 103.590 80.700  101.590 1.00 179.56 ?  80  PRO C CG    1 
ATOM 2022  C CD    . PRO C 3 68  ? 104.133 79.385  102.026 1.00 179.56 ?  80  PRO C CD    1 
ATOM 2023  N N     . ARG C 3 69  ? 106.214 80.696  105.135 1.00 186.51 ?  81  ARG C N     1 
ATOM 2024  C CA    . ARG C 3 69  ? 106.950 81.073  106.332 1.00 186.51 ?  81  ARG C CA    1 
ATOM 2025  C C     . ARG C 3 69  ? 108.394 81.413  105.997 1.00 186.51 ?  81  ARG C C     1 
ATOM 2026  O O     . ARG C 3 69  ? 108.929 82.411  106.489 1.00 186.51 ?  81  ARG C O     1 
ATOM 2027  C CB    . ARG C 3 69  ? 106.898 79.954  107.366 1.00 186.51 ?  81  ARG C CB    1 
ATOM 2028  C CG    . ARG C 3 69  ? 107.763 80.228  108.574 1.00 186.51 ?  81  ARG C CG    1 
ATOM 2029  C CD    . ARG C 3 69  ? 107.221 81.384  109.363 1.00 186.51 ?  81  ARG C CD    1 
ATOM 2030  N NE    . ARG C 3 69  ? 108.150 81.791  110.401 1.00 186.51 ?  81  ARG C NE    1 
ATOM 2031  C CZ    . ARG C 3 69  ? 108.240 81.206  111.584 1.00 186.51 ?  81  ARG C CZ    1 
ATOM 2032  N NH1   . ARG C 3 69  ? 107.471 80.170  111.865 1.00 186.51 ?  81  ARG C NH1   1 
ATOM 2033  N NH2   . ARG C 3 69  ? 109.109 81.646  112.476 1.00 186.51 ?  81  ARG C NH2   1 
ATOM 2034  N N     . HIS C 3 70  ? 109.027 80.623  105.127 1.00 187.51 ?  82  HIS C N     1 
ATOM 2035  C CA    . HIS C 3 70  ? 110.469 80.745  104.937 1.00 187.51 ?  82  HIS C CA    1 
ATOM 2036  C C     . HIS C 3 70  ? 110.853 81.999  104.166 1.00 187.51 ?  82  HIS C C     1 
ATOM 2037  O O     . HIS C 3 70  ? 112.036 82.345  104.101 1.00 187.51 ?  82  HIS C O     1 
ATOM 2038  C CB    . HIS C 3 70  ? 111.014 79.520  104.218 1.00 187.51 ?  82  HIS C CB    1 
ATOM 2039  C CG    . HIS C 3 70  ? 110.953 78.272  105.028 1.00 187.51 ?  82  HIS C CG    1 
ATOM 2040  N ND1   . HIS C 3 70  ? 111.278 77.037  104.516 1.00 187.51 ?  82  HIS C ND1   1 
ATOM 2041  C CD2   . HIS C 3 70  ? 110.593 78.064  106.314 1.00 187.51 ?  82  HIS C CD2   1 
ATOM 2042  C CE1   . HIS C 3 70  ? 111.129 76.121  105.454 1.00 187.51 ?  82  HIS C CE1   1 
ATOM 2043  N NE2   . HIS C 3 70  ? 110.712 76.718  106.554 1.00 187.51 ?  82  HIS C NE2   1 
ATOM 2044  N N     . LEU C 3 71  ? 109.889 82.687  103.566 1.00 186.78 ?  83  LEU C N     1 
ATOM 2045  C CA    . LEU C 3 71  ? 110.178 84.016  103.054 1.00 186.78 ?  83  LEU C CA    1 
ATOM 2046  C C     . LEU C 3 71  ? 110.241 85.022  104.191 1.00 186.78 ?  83  LEU C C     1 
ATOM 2047  O O     . LEU C 3 71  ? 111.101 85.910  104.198 1.00 186.78 ?  83  LEU C O     1 
ATOM 2048  C CB    . LEU C 3 71  ? 109.130 84.422  102.029 1.00 186.78 ?  83  LEU C CB    1 
ATOM 2049  C CG    . LEU C 3 71  ? 109.189 83.542  100.795 1.00 186.78 ?  83  LEU C CG    1 
ATOM 2050  C CD1   . LEU C 3 71  ? 108.079 83.902  99.846  1.00 186.78 ?  83  LEU C CD1   1 
ATOM 2051  C CD2   . LEU C 3 71  ? 110.529 83.700  100.136 1.00 186.78 ?  83  LEU C CD2   1 
ATOM 2052  N N     . GLN C 3 72  ? 109.334 84.888  105.163 1.00 193.28 ?  84  GLN C N     1 
ATOM 2053  C CA    . GLN C 3 72  ? 109.266 85.820  106.284 1.00 193.28 ?  84  GLN C CA    1 
ATOM 2054  C C     . GLN C 3 72  ? 110.526 85.761  107.135 1.00 193.28 ?  84  GLN C C     1 
ATOM 2055  O O     . GLN C 3 72  ? 111.029 86.796  107.580 1.00 193.28 ?  84  GLN C O     1 
ATOM 2056  C CB    . GLN C 3 72  ? 108.040 85.509  107.134 1.00 193.28 ?  84  GLN C CB    1 
ATOM 2057  C CG    . GLN C 3 72  ? 107.828 86.426  108.303 1.00 193.28 ?  84  GLN C CG    1 
ATOM 2058  C CD    . GLN C 3 72  ? 107.371 87.788  107.893 1.00 193.28 ?  84  GLN C CD    1 
ATOM 2059  O OE1   . GLN C 3 72  ? 108.142 88.737  107.874 1.00 193.28 ?  84  GLN C OE1   1 
ATOM 2060  N NE2   . GLN C 3 72  ? 106.096 87.900  107.581 1.00 193.28 ?  84  GLN C NE2   1 
ATOM 2061  N N     . LEU C 3 73  ? 111.066 84.566  107.351 1.00 191.51 ?  85  LEU C N     1 
ATOM 2062  C CA    . LEU C 3 73  ? 112.302 84.449  108.107 1.00 191.51 ?  85  LEU C CA    1 
ATOM 2063  C C     . LEU C 3 73  ? 113.537 84.699  107.263 1.00 191.51 ?  85  LEU C C     1 
ATOM 2064  O O     . LEU C 3 73  ? 114.645 84.687  107.807 1.00 191.51 ?  85  LEU C O     1 
ATOM 2065  C CB    . LEU C 3 73  ? 112.421 83.070  108.746 1.00 191.51 ?  85  LEU C CB    1 
ATOM 2066  C CG    . LEU C 3 73  ? 111.415 82.706  109.829 1.00 191.51 ?  85  LEU C CG    1 
ATOM 2067  C CD1   . LEU C 3 73  ? 111.631 81.275  110.272 1.00 191.51 ?  85  LEU C CD1   1 
ATOM 2068  C CD2   . LEU C 3 73  ? 111.545 83.647  110.992 1.00 191.51 ?  85  LEU C CD2   1 
ATOM 2069  N N     . ALA C 3 74  ? 113.389 84.898  105.958 1.00 189.40 ?  86  ALA C N     1 
ATOM 2070  C CA    . ALA C 3 74  ? 114.541 85.264  105.149 1.00 189.40 ?  86  ALA C CA    1 
ATOM 2071  C C     . ALA C 3 74  ? 114.600 86.758  104.906 1.00 189.40 ?  86  ALA C C     1 
ATOM 2072  O O     . ALA C 3 74  ? 115.678 87.302  104.663 1.00 189.40 ?  86  ALA C O     1 
ATOM 2073  C CB    . ALA C 3 74  ? 114.522 84.525  103.813 1.00 189.40 ?  86  ALA C CB    1 
ATOM 2074  N N     . ILE C 3 75  ? 113.460 87.435  104.969 1.00 188.67 ?  87  ILE C N     1 
ATOM 2075  C CA    . ILE C 3 75  ? 113.471 88.881  104.812 1.00 188.67 ?  87  ILE C CA    1 
ATOM 2076  C C     . ILE C 3 75  ? 113.873 89.556  106.119 1.00 188.67 ?  87  ILE C C     1 
ATOM 2077  O O     . ILE C 3 75  ? 114.794 90.377  106.151 1.00 188.67 ?  87  ILE C O     1 
ATOM 2078  C CB    . ILE C 3 75  ? 112.105 89.372  104.310 1.00 188.67 ?  87  ILE C CB    1 
ATOM 2079  C CG1   . ILE C 3 75  ? 111.830 88.830  102.914 1.00 188.67 ?  87  ILE C CG1   1 
ATOM 2080  C CG2   . ILE C 3 75  ? 112.075 90.871  104.260 1.00 188.67 ?  87  ILE C CG2   1 
ATOM 2081  C CD1   . ILE C 3 75  ? 110.402 89.010  102.480 1.00 188.67 ?  87  ILE C CD1   1 
ATOM 2082  N N     . ARG C 3 76  ? 113.209 89.208  107.220 1.00 190.01 ?  88  ARG C N     1 
ATOM 2083  C CA    . ARG C 3 76  ? 113.431 89.929  108.467 1.00 190.01 ?  88  ARG C CA    1 
ATOM 2084  C C     . ARG C 3 76  ? 114.729 89.537  109.160 1.00 190.01 ?  88  ARG C C     1 
ATOM 2085  O O     . ARG C 3 76  ? 115.116 90.196  110.126 1.00 190.01 ?  88  ARG C O     1 
ATOM 2086  C CB    . ARG C 3 76  ? 112.273 89.696  109.424 1.00 190.01 ?  88  ARG C CB    1 
ATOM 2087  C CG    . ARG C 3 76  ? 110.931 90.101  108.886 1.00 190.01 ?  88  ARG C CG    1 
ATOM 2088  C CD    . ARG C 3 76  ? 110.776 91.591  108.782 1.00 190.01 ?  88  ARG C CD    1 
ATOM 2089  N NE    . ARG C 3 76  ? 109.411 91.935  108.411 1.00 190.01 ?  88  ARG C NE    1 
ATOM 2090  C CZ    . ARG C 3 76  ? 109.008 92.111  107.163 1.00 190.01 ?  88  ARG C CZ    1 
ATOM 2091  N NH1   . ARG C 3 76  ? 109.871 91.992  106.171 1.00 190.01 ?  88  ARG C NH1   1 
ATOM 2092  N NH2   . ARG C 3 76  ? 107.749 92.415  106.912 1.00 190.01 ?  88  ARG C NH2   1 
ATOM 2093  N N     . ASN C 3 77  ? 115.400 88.476  108.718 1.00 199.44 ?  89  ASN C N     1 
ATOM 2094  C CA    . ASN C 3 77  ? 116.721 88.139  109.233 1.00 199.44 ?  89  ASN C CA    1 
ATOM 2095  C C     . ASN C 3 77  ? 117.833 88.626  108.331 1.00 199.44 ?  89  ASN C C     1 
ATOM 2096  O O     . ASN C 3 77  ? 118.829 87.921  108.145 1.00 199.44 ?  89  ASN C O     1 
ATOM 2097  C CB    . ASN C 3 77  ? 116.863 86.636  109.466 1.00 199.44 ?  89  ASN C CB    1 
ATOM 2098  C CG    . ASN C 3 77  ? 116.137 86.171  110.701 1.00 199.44 ?  89  ASN C CG    1 
ATOM 2099  O OD1   . ASN C 3 77  ? 115.227 85.349  110.630 1.00 199.44 ?  89  ASN C OD1   1 
ATOM 2100  N ND2   . ASN C 3 77  ? 116.531 86.705  111.848 1.00 199.44 ?  89  ASN C ND2   1 
ATOM 2101  N N     . ASP C 3 78  ? 117.676 89.798  107.740 1.00 205.34 ?  90  ASP C N     1 
ATOM 2102  C CA    . ASP C 3 78  ? 118.726 90.433  106.967 1.00 205.34 ?  90  ASP C CA    1 
ATOM 2103  C C     . ASP C 3 78  ? 118.648 91.935  107.180 1.00 205.34 ?  90  ASP C C     1 
ATOM 2104  O O     . ASP C 3 78  ? 117.557 92.510  107.164 1.00 205.34 ?  90  ASP C O     1 
ATOM 2105  C CB    . ASP C 3 78  ? 118.593 90.109  105.490 1.00 205.34 ?  90  ASP C CB    1 
ATOM 2106  C CG    . ASP C 3 78  ? 119.736 90.647  104.682 1.00 205.34 ?  90  ASP C CG    1 
ATOM 2107  O OD1   . ASP C 3 78  ? 120.819 90.027  104.699 1.00 205.34 ?  90  ASP C OD1   1 
ATOM 2108  O OD2   . ASP C 3 78  ? 119.560 91.708  104.051 1.00 205.34 -1 90  ASP C OD2   1 
ATOM 2109  N N     . GLU C 3 79  ? 119.806 92.562  107.393 1.00 210.90 ?  91  GLU C N     1 
ATOM 2110  C CA    . GLU C 3 79  ? 119.845 93.996  107.661 1.00 210.90 ?  91  GLU C CA    1 
ATOM 2111  C C     . GLU C 3 79  ? 119.405 94.792  106.444 1.00 210.90 ?  91  GLU C C     1 
ATOM 2112  O O     . GLU C 3 79  ? 118.637 95.752  106.552 1.00 210.90 ?  91  GLU C O     1 
ATOM 2113  C CB    . GLU C 3 79  ? 121.252 94.423  108.083 1.00 210.90 ?  91  GLU C CB    1 
ATOM 2114  C CG    . GLU C 3 79  ? 121.377 95.918  108.386 1.00 210.90 ?  91  GLU C CG    1 
ATOM 2115  C CD    . GLU C 3 79  ? 122.770 96.325  108.845 1.00 210.90 ?  91  GLU C CD    1 
ATOM 2116  O OE1   . GLU C 3 79  ? 123.660 95.454  108.922 1.00 210.90 ?  91  GLU C OE1   1 
ATOM 2117  O OE2   . GLU C 3 79  ? 122.974 97.523  109.128 1.00 210.90 -1 91  GLU C OE2   1 
ATOM 2118  N N     . GLU C 3 80  ? 119.868 94.391  105.273 1.00 208.82 ?  92  GLU C N     1 
ATOM 2119  C CA    . GLU C 3 80  ? 119.690 95.233  104.107 1.00 208.82 ?  92  GLU C CA    1 
ATOM 2120  C C     . GLU C 3 80  ? 118.370 94.955  103.407 1.00 208.82 ?  92  GLU C C     1 
ATOM 2121  O O     . GLU C 3 80  ? 117.823 95.844  102.752 1.00 208.82 ?  92  GLU C O     1 
ATOM 2122  C CB    . GLU C 3 80  ? 120.880 95.024  103.190 1.00 208.82 ?  92  GLU C CB    1 
ATOM 2123  C CG    . GLU C 3 80  ? 122.160 95.303  103.946 1.00 208.82 ?  92  GLU C CG    1 
ATOM 2124  C CD    . GLU C 3 80  ? 123.410 94.920  103.188 1.00 208.82 ?  92  GLU C CD    1 
ATOM 2125  O OE1   . GLU C 3 80  ? 123.292 94.383  102.067 1.00 208.82 ?  92  GLU C OE1   1 
ATOM 2126  O OE2   . GLU C 3 80  ? 124.515 95.124  103.734 1.00 208.82 -1 92  GLU C OE2   1 
ATOM 2127  N N     . LEU C 3 81  ? 117.825 93.749  103.549 1.00 188.75 ?  93  LEU C N     1 
ATOM 2128  C CA    . LEU C 3 81  ? 116.517 93.486  102.963 1.00 188.75 ?  93  LEU C CA    1 
ATOM 2129  C C     . LEU C 3 81  ? 115.395 94.003  103.843 1.00 188.75 ?  93  LEU C C     1 
ATOM 2130  O O     . LEU C 3 81  ? 114.242 94.049  103.406 1.00 188.75 ?  93  LEU C O     1 
ATOM 2131  C CB    . LEU C 3 81  ? 116.337 91.998  102.704 1.00 188.75 ?  93  LEU C CB    1 
ATOM 2132  C CG    . LEU C 3 81  ? 117.164 91.512  101.530 1.00 188.75 ?  93  LEU C CG    1 
ATOM 2133  C CD1   . LEU C 3 81  ? 117.080 90.020  101.438 1.00 188.75 ?  93  LEU C CD1   1 
ATOM 2134  C CD2   . LEU C 3 81  ? 116.636 92.157  100.273 1.00 188.75 ?  93  LEU C CD2   1 
ATOM 2135  N N     . ASN C 3 82  ? 115.704 94.366  105.083 1.00 190.21 ?  94  ASN C N     1 
ATOM 2136  C CA    . ASN C 3 82  ? 114.704 94.988  105.936 1.00 190.21 ?  94  ASN C CA    1 
ATOM 2137  C C     . ASN C 3 82  ? 114.302 96.345  105.384 1.00 190.21 ?  94  ASN C C     1 
ATOM 2138  O O     . ASN C 3 82  ? 113.109 96.624  105.221 1.00 190.21 ?  94  ASN C O     1 
ATOM 2139  C CB    . ASN C 3 82  ? 115.254 95.129  107.353 1.00 190.21 ?  94  ASN C CB    1 
ATOM 2140  C CG    . ASN C 3 82  ? 114.169 95.155  108.409 1.00 190.21 ?  94  ASN C CG    1 
ATOM 2141  O OD1   . ASN C 3 82  ? 114.454 95.088  109.602 1.00 190.21 ?  94  ASN C OD1   1 
ATOM 2142  N ND2   . ASN C 3 82  ? 112.919 95.211  107.978 1.00 190.21 ?  94  ASN C ND2   1 
ATOM 2143  N N     . LYS C 3 83  ? 115.293 97.177  105.051 1.00 195.78 ?  95  LYS C N     1 
ATOM 2144  C CA    . LYS C 3 83  ? 115.039 98.568  104.685 1.00 195.78 ?  95  LYS C CA    1 
ATOM 2145  C C     . LYS C 3 83  ? 114.329 98.667  103.340 1.00 195.78 ?  95  LYS C C     1 
ATOM 2146  O O     . LYS C 3 83  ? 113.582 99.620  103.090 1.00 195.78 ?  95  LYS C O     1 
ATOM 2147  C CB    . LYS C 3 83  ? 116.367 99.333  104.688 1.00 195.78 ?  95  LYS C CB    1 
ATOM 2148  C CG    . LYS C 3 83  ? 116.317 100.797 104.294 1.00 195.78 ?  95  LYS C CG    1 
ATOM 2149  C CD    . LYS C 3 83  ? 115.534 101.633 105.280 1.00 195.78 ?  95  LYS C CD    1 
ATOM 2150  C CE    . LYS C 3 83  ? 115.667 103.126 104.964 1.00 195.78 ?  95  LYS C CE    1 
ATOM 2151  N NZ    . LYS C 3 83  ? 115.054 103.516 103.662 1.00 195.78 ?  95  LYS C NZ    1 
ATOM 2152  N N     . LEU C 3 84  ? 114.508 97.666  102.479 1.00 184.26 ?  96  LEU C N     1 
ATOM 2153  C CA    . LEU C 3 84  ? 113.759 97.632  101.229 1.00 184.26 ?  96  LEU C CA    1 
ATOM 2154  C C     . LEU C 3 84  ? 112.292 97.313  101.475 1.00 184.26 ?  96  LEU C C     1 
ATOM 2155  O O     . LEU C 3 84  ? 111.403 98.021  100.993 1.00 184.26 ?  96  LEU C O     1 
ATOM 2156  C CB    . LEU C 3 84  ? 114.365 96.611  100.275 1.00 184.26 ?  96  LEU C CB    1 
ATOM 2157  C CG    . LEU C 3 84  ? 113.597 96.499  98.967  1.00 184.26 ?  96  LEU C CG    1 
ATOM 2158  C CD1   . LEU C 3 84  ? 113.648 97.811  98.230  1.00 184.26 ?  96  LEU C CD1   1 
ATOM 2159  C CD2   . LEU C 3 84  ? 114.190 95.401  98.137  1.00 184.26 ?  96  LEU C CD2   1 
ATOM 2160  N N     . LEU C 3 85  ? 112.019 96.244  102.207 1.00 174.15 ?  97  LEU C N     1 
ATOM 2161  C CA    . LEU C 3 85  ? 110.647 95.844  102.497 1.00 174.15 ?  97  LEU C CA    1 
ATOM 2162  C C     . LEU C 3 85  ? 110.227 96.360  103.868 1.00 174.15 ?  97  LEU C C     1 
ATOM 2163  O O     . LEU C 3 85  ? 109.838 95.609  104.756 1.00 174.15 ?  97  LEU C O     1 
ATOM 2164  C CB    . LEU C 3 85  ? 110.518 94.334  102.407 1.00 174.15 ?  97  LEU C CB    1 
ATOM 2165  C CG    . LEU C 3 85  ? 110.892 93.865  101.009 1.00 174.15 ?  97  LEU C CG    1 
ATOM 2166  C CD1   . LEU C 3 85  ? 110.912 92.362  100.944 1.00 174.15 ?  97  LEU C CD1   1 
ATOM 2167  C CD2   . LEU C 3 85  ? 109.918 94.430  100.014 1.00 174.15 ?  97  LEU C CD2   1 
ATOM 2168  N N     . GLY C 3 86  ? 110.321 97.673  104.023 1.00 172.77 ?  98  GLY C N     1 
ATOM 2169  C CA    . GLY C 3 86  ? 110.030 98.301  105.292 1.00 172.77 ?  98  GLY C CA    1 
ATOM 2170  C C     . GLY C 3 86  ? 108.563 98.277  105.649 1.00 172.77 ?  98  GLY C C     1 
ATOM 2171  O O     . GLY C 3 86  ? 108.158 97.623  106.611 1.00 172.77 ?  98  GLY C O     1 
ATOM 2172  N N     . ARG C 3 87  ? 107.752 98.974  104.866 1.00 177.08 ?  99  ARG C N     1 
ATOM 2173  C CA    . ARG C 3 87  ? 106.326 99.087  105.148 1.00 177.08 ?  99  ARG C CA    1 
ATOM 2174  C C     . ARG C 3 87  ? 105.528 98.006  104.429 1.00 177.08 ?  99  ARG C C     1 
ATOM 2175  O O     . ARG C 3 87  ? 104.560 98.291  103.730 1.00 177.08 ?  99  ARG C O     1 
ATOM 2176  C CB    . ARG C 3 87  ? 105.847 100.478 104.754 1.00 177.08 ?  99  ARG C CB    1 
ATOM 2177  C CG    . ARG C 3 87  ? 106.502 101.601 105.550 1.00 177.08 ?  99  ARG C CG    1 
ATOM 2178  C CD    . ARG C 3 87  ? 106.008 102.977 105.103 1.00 177.08 ?  99  ARG C CD    1 
ATOM 2179  N NE    . ARG C 3 87  ? 106.637 104.064 105.852 1.00 177.08 ?  99  ARG C NE    1 
ATOM 2180  C CZ    . ARG C 3 87  ? 106.412 105.357 105.634 1.00 177.08 ?  99  ARG C CZ    1 
ATOM 2181  N NH1   . ARG C 3 87  ? 105.570 105.743 104.686 1.00 177.08 ?  99  ARG C NH1   1 
ATOM 2182  N NH2   . ARG C 3 87  ? 107.031 106.268 106.368 1.00 177.08 ?  99  ARG C NH2   1 
ATOM 2183  N N     . VAL C 3 88  ? 105.929 96.745  104.584 1.00 172.64 ?  100 VAL C N     1 
ATOM 2184  C CA    . VAL C 3 88  ? 105.347 95.622  103.850 1.00 172.64 ?  100 VAL C CA    1 
ATOM 2185  C C     . VAL C 3 88  ? 105.237 94.433  104.792 1.00 172.64 ?  100 VAL C C     1 
ATOM 2186  O O     . VAL C 3 88  ? 106.239 94.008  105.375 1.00 172.64 ?  100 VAL C O     1 
ATOM 2187  C CB    . VAL C 3 88  ? 106.186 95.250  102.615 1.00 172.64 ?  100 VAL C CB    1 
ATOM 2188  C CG1   . VAL C 3 88  ? 105.767 93.911  102.074 1.00 172.64 ?  100 VAL C CG1   1 
ATOM 2189  C CG2   . VAL C 3 88  ? 106.030 96.272  101.508 1.00 172.64 ?  100 VAL C CG2   1 
ATOM 2190  N N     . THR C 3 89  ? 104.034 93.889  104.930 1.00 177.53 ?  101 THR C N     1 
ATOM 2191  C CA    . THR C 3 89  ? 103.832 92.646  105.655 1.00 177.53 ?  101 THR C CA    1 
ATOM 2192  C C     . THR C 3 89  ? 103.738 91.495  104.664 1.00 177.53 ?  101 THR C C     1 
ATOM 2193  O O     . THR C 3 89  ? 103.756 91.705  103.453 1.00 177.53 ?  101 THR C O     1 
ATOM 2194  C CB    . THR C 3 89  ? 102.572 92.708  106.503 1.00 177.53 ?  101 THR C CB    1 
ATOM 2195  O OG1   . THR C 3 89  ? 101.434 92.818  105.649 1.00 177.53 ?  101 THR C OG1   1 
ATOM 2196  C CG2   . THR C 3 89  ? 102.618 93.924  107.393 1.00 177.53 ?  101 THR C CG2   1 
ATOM 2197  N N     . ILE C 3 90  ? 103.647 90.273  105.177 1.00 173.90 ?  102 ILE C N     1 
ATOM 2198  C CA    . ILE C 3 90  ? 103.579 89.071  104.354 1.00 173.90 ?  102 ILE C CA    1 
ATOM 2199  C C     . ILE C 3 90  ? 102.395 88.241  104.820 1.00 173.90 ?  102 ILE C C     1 
ATOM 2200  O O     . ILE C 3 90  ? 102.207 88.054  106.025 1.00 173.90 ?  102 ILE C O     1 
ATOM 2201  C CB    . ILE C 3 90  ? 104.882 88.255  104.434 1.00 173.90 ?  102 ILE C CB    1 
ATOM 2202  C CG1   . ILE C 3 90  ? 106.051 89.044  103.863 1.00 173.90 ?  102 ILE C CG1   1 
ATOM 2203  C CG2   . ILE C 3 90  ? 104.769 86.960  103.678 1.00 173.90 ?  102 ILE C CG2   1 
ATOM 2204  C CD1   . ILE C 3 90  ? 105.894 89.367  102.403 1.00 173.90 ?  102 ILE C CD1   1 
ATOM 2205  N N     . ALA C 3 91  ? 101.588 87.764  103.874 1.00 181.63 ?  103 ALA C N     1 
ATOM 2206  C CA    . ALA C 3 91  ? 100.491 86.867  104.209 1.00 181.63 ?  103 ALA C CA    1 
ATOM 2207  C C     . ALA C 3 91  ? 101.027 85.531  104.701 1.00 181.63 ?  103 ALA C C     1 
ATOM 2208  O O     . ALA C 3 91  ? 102.079 85.073  104.247 1.00 181.63 ?  103 ALA C O     1 
ATOM 2209  C CB    . ALA C 3 91  ? 99.590  86.649  102.998 1.00 181.63 ?  103 ALA C CB    1 
ATOM 2210  N N     . GLN C 3 92  ? 100.283 84.918  105.634 1.00 181.72 ?  104 GLN C N     1 
ATOM 2211  C CA    . GLN C 3 92  ? 100.665 83.683  106.334 1.00 181.72 ?  104 GLN C CA    1 
ATOM 2212  C C     . GLN C 3 92  ? 102.032 83.825  106.993 1.00 181.72 ?  104 GLN C C     1 
ATOM 2213  O O     . GLN C 3 92  ? 102.848 82.905  106.990 1.00 181.72 ?  104 GLN C O     1 
ATOM 2214  C CB    . GLN C 3 92  ? 100.640 82.476  105.395 1.00 181.72 ?  104 GLN C CB    1 
ATOM 2215  C CG    . GLN C 3 92  ? 99.288  82.172  104.809 1.00 181.72 ?  104 GLN C CG    1 
ATOM 2216  C CD    . GLN C 3 92  ? 98.324  81.657  105.840 1.00 181.72 ?  104 GLN C CD    1 
ATOM 2217  O OE1   . GLN C 3 92  ? 98.700  80.887  106.720 1.00 181.72 ?  104 GLN C OE1   1 
ATOM 2218  N NE2   . GLN C 3 92  ? 97.069  82.072  105.740 1.00 181.72 ?  104 GLN C NE2   1 
ATOM 2219  N N     . GLY C 3 93  ? 102.284 84.996  107.563 1.00 185.91 ?  105 GLY C N     1 
ATOM 2220  C CA    . GLY C 3 93  ? 103.643 85.393  107.853 1.00 185.91 ?  105 GLY C CA    1 
ATOM 2221  C C     . GLY C 3 93  ? 104.264 84.828  109.107 1.00 185.91 ?  105 GLY C C     1 
ATOM 2222  O O     . GLY C 3 93  ? 105.237 84.077  109.037 1.00 185.91 ?  105 GLY C O     1 
ATOM 2223  N N     . GLY C 3 94  ? 103.721 85.179  110.256 1.00 191.27 ?  106 GLY C N     1 
ATOM 2224  C CA    . GLY C 3 94  ? 104.408 84.908  111.496 1.00 191.27 ?  106 GLY C CA    1 
ATOM 2225  C C     . GLY C 3 94  ? 105.481 85.946  111.750 1.00 191.27 ?  106 GLY C C     1 
ATOM 2226  O O     . GLY C 3 94  ? 105.794 86.786  110.904 1.00 191.27 ?  106 GLY C O     1 
ATOM 2227  N N     . VAL C 3 95  ? 106.043 85.898  112.951 1.00 179.96 ?  107 VAL C N     1 
ATOM 2228  C CA    . VAL C 3 95  ? 107.104 86.838  113.278 1.00 179.96 ?  107 VAL C CA    1 
ATOM 2229  C C     . VAL C 3 95  ? 108.385 86.074  113.542 1.00 179.96 ?  107 VAL C C     1 
ATOM 2230  O O     . VAL C 3 95  ? 108.411 84.841  113.483 1.00 179.96 ?  107 VAL C O     1 
ATOM 2231  C CB    . VAL C 3 95  ? 106.744 87.709  114.487 1.00 179.96 ?  107 VAL C CB    1 
ATOM 2232  C CG1   . VAL C 3 95  ? 105.522 88.535  114.195 1.00 179.96 ?  107 VAL C CG1   1 
ATOM 2233  C CG2   . VAL C 3 95  ? 106.516 86.834  115.680 1.00 179.96 ?  107 VAL C CG2   1 
ATOM 2234  N N     . LEU C 3 96  ? 109.446 86.804  113.821 1.00 186.65 ?  108 LEU C N     1 
ATOM 2235  C CA    . LEU C 3 96  ? 110.722 86.253  114.227 1.00 186.65 ?  108 LEU C CA    1 
ATOM 2236  C C     . LEU C 3 96  ? 110.587 85.586  115.589 1.00 186.65 ?  108 LEU C C     1 
ATOM 2237  O O     . LEU C 3 96  ? 109.763 86.002  116.405 1.00 186.65 ?  108 LEU C O     1 
ATOM 2238  C CB    . LEU C 3 96  ? 111.755 87.361  114.308 1.00 186.65 ?  108 LEU C CB    1 
ATOM 2239  C CG    . LEU C 3 96  ? 111.989 88.044  112.972 1.00 186.65 ?  108 LEU C CG    1 
ATOM 2240  C CD1   . LEU C 3 96  ? 112.844 89.271  113.158 1.00 186.65 ?  108 LEU C CD1   1 
ATOM 2241  C CD2   . LEU C 3 96  ? 112.656 87.073  112.037 1.00 186.65 ?  108 LEU C CD2   1 
ATOM 2242  N N     . PRO C 3 97  ? 111.368 84.542  115.862 1.00 191.55 ?  109 PRO C N     1 
ATOM 2243  C CA    . PRO C 3 97  ? 111.370 83.975  117.217 1.00 191.55 ?  109 PRO C CA    1 
ATOM 2244  C C     . PRO C 3 97  ? 112.055 84.938  118.175 1.00 191.55 ?  109 PRO C C     1 
ATOM 2245  O O     . PRO C 3 97  ? 113.281 85.056  118.200 1.00 191.55 ?  109 PRO C O     1 
ATOM 2246  C CB    . PRO C 3 97  ? 112.145 82.664  117.056 1.00 191.55 ?  109 PRO C CB    1 
ATOM 2247  C CG    . PRO C 3 97  ? 112.971 82.857  115.839 1.00 191.55 ?  109 PRO C CG    1 
ATOM 2248  C CD    . PRO C 3 97  ? 112.183 83.747  114.931 1.00 191.55 ?  109 PRO C CD    1 
ATOM 2249  N N     . ASN C 3 98  ? 111.242 85.626  118.969 1.00 212.04 ?  110 ASN C N     1 
ATOM 2250  C CA    . ASN C 3 98  ? 111.711 86.744  119.774 1.00 212.04 ?  110 ASN C CA    1 
ATOM 2251  C C     . ASN C 3 98  ? 110.975 86.704  121.101 1.00 212.04 ?  110 ASN C C     1 
ATOM 2252  O O     . ASN C 3 98  ? 109.741 86.721  121.122 1.00 212.04 ?  110 ASN C O     1 
ATOM 2253  C CB    . ASN C 3 98  ? 111.448 88.071  119.057 1.00 212.04 ?  110 ASN C CB    1 
ATOM 2254  C CG    . ASN C 3 98  ? 112.386 89.175  119.495 1.00 212.04 ?  110 ASN C CG    1 
ATOM 2255  O OD1   . ASN C 3 98  ? 112.446 90.229  118.863 1.00 212.04 ?  110 ASN C OD1   1 
ATOM 2256  N ND2   . ASN C 3 98  ? 113.146 88.933  120.557 1.00 212.04 ?  110 ASN C ND2   1 
ATOM 2257  N N     . ILE C 3 99  ? 111.725 86.647  122.195 1.00 235.53 ?  111 ILE C N     1 
ATOM 2258  C CA    . ILE C 3 99  ? 111.128 86.653  123.522 1.00 235.53 ?  111 ILE C CA    1 
ATOM 2259  C C     . ILE C 3 99  ? 111.132 88.068  124.072 1.00 235.53 ?  111 ILE C C     1 
ATOM 2260  O O     . ILE C 3 99  ? 111.918 88.905  123.633 1.00 235.53 ?  111 ILE C O     1 
ATOM 2261  C CB    . ILE C 3 99  ? 111.857 85.701  124.467 1.00 235.53 ?  111 ILE C CB    1 
ATOM 2262  C CG1   . ILE C 3 99  ? 111.736 84.266  123.963 1.00 235.53 ?  111 ILE C CG1   1 
ATOM 2263  C CG2   . ILE C 3 99  ? 111.292 85.817  125.867 1.00 235.53 ?  111 ILE C CG2   1 
ATOM 2264  C CD1   . ILE C 3 99  ? 112.645 83.305  124.674 1.00 235.53 ?  111 ILE C CD1   1 
ATOM 2265  N N     . GLN C 3 100 ? 115.862 87.927  126.090 1.00 279.55 ?  112 GLN C N     1 
ATOM 2266  C CA    . GLN C 3 100 ? 115.581 89.350  125.971 1.00 279.55 ?  112 GLN C CA    1 
ATOM 2267  C C     . GLN C 3 100 ? 116.308 90.121  127.064 1.00 279.55 ?  112 GLN C C     1 
ATOM 2268  O O     . GLN C 3 100 ? 116.830 91.208  126.829 1.00 279.55 ?  112 GLN C O     1 
ATOM 2269  C CB    . GLN C 3 100 ? 114.076 89.609  126.050 1.00 279.55 ?  112 GLN C CB    1 
ATOM 2270  C CG    . GLN C 3 100 ? 113.671 91.030  125.703 1.00 279.55 ?  112 GLN C CG    1 
ATOM 2271  C CD    . GLN C 3 100 ? 112.170 91.234  125.741 1.00 279.55 ?  112 GLN C CD    1 
ATOM 2272  O OE1   . GLN C 3 100 ? 111.425 90.352  126.160 1.00 279.55 ?  112 GLN C OE1   1 
ATOM 2273  N NE2   . GLN C 3 100 ? 111.718 92.389  125.273 1.00 279.55 ?  112 GLN C NE2   1 
ATOM 2274  N N     . SER C 3 101 ? 114.455 86.370  128.403 1.00 277.85 ?  113 SER C N     1 
ATOM 2275  C CA    . SER C 3 101 ? 115.346 86.452  129.552 1.00 277.85 ?  113 SER C CA    1 
ATOM 2276  C C     . SER C 3 101 ? 114.938 87.590  130.482 1.00 277.85 ?  113 SER C C     1 
ATOM 2277  O O     . SER C 3 101 ? 114.778 87.383  131.683 1.00 277.85 ?  113 SER C O     1 
ATOM 2278  C CB    . SER C 3 101 ? 116.792 86.635  129.095 1.00 277.85 ?  113 SER C CB    1 
ATOM 2279  O OG    . SER C 3 101 ? 117.227 85.515  128.345 1.00 277.85 ?  113 SER C OG    1 
ATOM 2280  N N     . VAL C 3 102 ? 114.785 88.796  129.926 1.00 261.41 ?  114 VAL C N     1 
ATOM 2281  C CA    . VAL C 3 102 ? 114.305 89.918  130.726 1.00 261.41 ?  114 VAL C CA    1 
ATOM 2282  C C     . VAL C 3 102 ? 112.844 89.729  131.101 1.00 261.41 ?  114 VAL C C     1 
ATOM 2283  O O     . VAL C 3 102 ? 112.428 90.079  132.211 1.00 261.41 ?  114 VAL C O     1 
ATOM 2284  C CB    . VAL C 3 102 ? 114.503 91.231  129.973 1.00 261.41 ?  114 VAL C CB    1 
ATOM 2285  N N     . LEU C 3 103 ? 112.052 89.173  130.186 1.00 248.40 ?  115 LEU C N     1 
ATOM 2286  C CA    . LEU C 3 103 ? 110.707 88.743  130.536 1.00 248.40 ?  115 LEU C CA    1 
ATOM 2287  C C     . LEU C 3 103 ? 110.714 87.316  131.066 1.00 248.40 ?  115 LEU C C     1 
ATOM 2288  O O     . LEU C 3 103 ? 109.758 86.892  131.723 1.00 248.40 ?  115 LEU C O     1 
ATOM 2289  C CB    . LEU C 3 103 ? 109.782 88.860  129.326 1.00 248.40 ?  115 LEU C CB    1 
ATOM 2290  N N     . LEU C 3 104 ? 111.784 86.572  130.799 1.00 254.06 ?  116 LEU C N     1 
ATOM 2291  C CA    . LEU C 3 104 ? 111.873 85.169  131.192 1.00 254.06 ?  116 LEU C CA    1 
ATOM 2292  C C     . LEU C 3 104 ? 112.916 84.944  132.279 1.00 254.06 ?  116 LEU C C     1 
ATOM 2293  O O     . LEU C 3 104 ? 113.507 83.868  132.368 1.00 254.06 ?  116 LEU C O     1 
ATOM 2294  C CB    . LEU C 3 104 ? 112.187 84.306  129.984 1.00 254.06 ?  116 LEU C CB    1 
ATOM 2295  N N     . ARG D 4 1   ? 93.939  84.538  82.210  1.00 234.90 ?  33  ARG D N     1 
ATOM 2296  C CA    . ARG D 4 1   ? 94.513  85.223  81.061  1.00 234.90 ?  33  ARG D CA    1 
ATOM 2297  C C     . ARG D 4 1   ? 95.516  86.276  81.521  1.00 234.90 ?  33  ARG D C     1 
ATOM 2298  O O     . ARG D 4 1   ? 96.323  86.765  80.733  1.00 234.90 ?  33  ARG D O     1 
ATOM 2299  C CB    . ARG D 4 1   ? 93.411  85.853  80.211  1.00 234.90 ?  33  ARG D CB    1 
ATOM 2300  C CG    . ARG D 4 1   ? 92.691  87.000  80.883  1.00 234.90 ?  33  ARG D CG    1 
ATOM 2301  C CD    . ARG D 4 1   ? 91.471  87.402  80.090  1.00 234.90 ?  33  ARG D CD    1 
ATOM 2302  N NE    . ARG D 4 1   ? 90.455  86.357  80.143  1.00 234.90 ?  33  ARG D NE    1 
ATOM 2303  C CZ    . ARG D 4 1   ? 89.345  86.356  79.414  1.00 234.90 ?  33  ARG D CZ    1 
ATOM 2304  N NH1   . ARG D 4 1   ? 89.105  87.349  78.569  1.00 234.90 ?  33  ARG D NH1   1 
ATOM 2305  N NH2   . ARG D 4 1   ? 88.477  85.361  79.529  1.00 234.90 ?  33  ARG D NH2   1 
ATOM 2306  N N     . LYS D 4 2   ? 95.456  86.619  82.805  1.00 239.39 ?  34  LYS D N     1 
ATOM 2307  C CA    . LYS D 4 2   ? 96.452  87.492  83.406  1.00 239.39 ?  34  LYS D CA    1 
ATOM 2308  C C     . LYS D 4 2   ? 97.771  86.748  83.535  1.00 239.39 ?  34  LYS D C     1 
ATOM 2309  O O     . LYS D 4 2   ? 97.817  85.632  84.058  1.00 239.39 ?  34  LYS D O     1 
ATOM 2310  C CB    . LYS D 4 2   ? 95.987  87.964  84.782  1.00 239.39 ?  34  LYS D CB    1 
ATOM 2311  C CG    . LYS D 4 2   ? 94.820  88.932  84.757  1.00 239.39 ?  34  LYS D CG    1 
ATOM 2312  C CD    . LYS D 4 2   ? 94.298  89.171  86.163  1.00 239.39 ?  34  LYS D CD    1 
ATOM 2313  C CE    . LYS D 4 2   ? 95.294  89.950  86.999  1.00 239.39 ?  34  LYS D CE    1 
ATOM 2314  N NZ    . LYS D 4 2   ? 94.742  90.232  88.346  1.00 239.39 ?  34  LYS D NZ    1 
ATOM 2315  N N     . GLU D 4 3   ? 98.846  87.365  83.062  1.00 232.50 ?  35  GLU D N     1 
ATOM 2316  C CA    . GLU D 4 3   ? 100.134 86.692  83.043  1.00 232.50 ?  35  GLU D CA    1 
ATOM 2317  C C     . GLU D 4 3   ? 100.915 86.978  84.319  1.00 232.50 ?  35  GLU D C     1 
ATOM 2318  O O     . GLU D 4 3   ? 100.783 88.033  84.943  1.00 232.50 ?  35  GLU D O     1 
ATOM 2319  C CB    . GLU D 4 3   ? 100.956 87.097  81.814  1.00 232.50 ?  35  GLU D CB    1 
ATOM 2320  C CG    . GLU D 4 3   ? 101.488 88.519  81.800  1.00 232.50 ?  35  GLU D CG    1 
ATOM 2321  C CD    . GLU D 4 3   ? 102.253 88.830  80.526  1.00 232.50 ?  35  GLU D CD    1 
ATOM 2322  O OE1   . GLU D 4 3   ? 102.266 87.972  79.620  1.00 232.50 ?  35  GLU D OE1   1 
ATOM 2323  O OE2   . GLU D 4 3   ? 102.863 89.915  80.437  1.00 232.50 -1 35  GLU D OE2   1 
ATOM 2324  N N     . SER D 4 4   ? 101.721 85.998  84.711  1.00 213.10 ?  36  SER D N     1 
ATOM 2325  C CA    . SER D 4 4   ? 102.557 86.108  85.896  1.00 213.10 ?  36  SER D CA    1 
ATOM 2326  C C     . SER D 4 4   ? 104.017 85.924  85.529  1.00 213.10 ?  36  SER D C     1 
ATOM 2327  O O     . SER D 4 4   ? 104.356 85.849  84.345  1.00 213.10 ?  36  SER D O     1 
ATOM 2328  C CB    . SER D 4 4   ? 102.158 85.071  86.940  1.00 213.10 ?  36  SER D CB    1 
ATOM 2329  O OG    . SER D 4 4   ? 103.076 85.081  88.015  1.00 213.10 ?  36  SER D OG    1 
ATOM 2330  N N     . TYR D 4 5   ? 104.888 85.848  86.531  1.00 188.96 ?  37  TYR D N     1 
ATOM 2331  C CA    . TYR D 4 5   ? 106.284 85.515  86.298  1.00 188.96 ?  37  TYR D CA    1 
ATOM 2332  C C     . TYR D 4 5   ? 106.608 84.109  86.770  1.00 188.96 ?  37  TYR D C     1 
ATOM 2333  O O     . TYR D 4 5   ? 107.780 83.800  87.005  1.00 188.96 ?  37  TYR D O     1 
ATOM 2334  C CB    . TYR D 4 5   ? 107.223 86.499  86.996  1.00 188.96 ?  37  TYR D CB    1 
ATOM 2335  C CG    . TYR D 4 5   ? 107.246 87.922  86.481  1.00 188.96 ?  37  TYR D CG    1 
ATOM 2336  C CD1   . TYR D 4 5   ? 106.513 88.317  85.379  1.00 188.96 ?  37  TYR D CD1   1 
ATOM 2337  C CD2   . TYR D 4 5   ? 108.081 88.850  87.065  1.00 188.96 ?  37  TYR D CD2   1 
ATOM 2338  C CE1   . TYR D 4 5   ? 106.561 89.612  84.929  1.00 188.96 ?  37  TYR D CE1   1 
ATOM 2339  C CE2   . TYR D 4 5   ? 108.137 90.138  86.628  1.00 188.96 ?  37  TYR D CE2   1 
ATOM 2340  C CZ    . TYR D 4 5   ? 107.381 90.514  85.559  1.00 188.96 ?  37  TYR D CZ    1 
ATOM 2341  O OH    . TYR D 4 5   ? 107.446 91.805  85.110  1.00 188.96 ?  37  TYR D OH    1 
ATOM 2342  N N     . SER D 4 6   ? 105.593 83.254  86.901  1.00 186.98 ?  38  SER D N     1 
ATOM 2343  C CA    . SER D 4 6   ? 105.737 82.005  87.637  1.00 186.98 ?  38  SER D CA    1 
ATOM 2344  C C     . SER D 4 6   ? 106.642 81.011  86.924  1.00 186.98 ?  38  SER D C     1 
ATOM 2345  O O     . SER D 4 6   ? 107.319 80.215  87.581  1.00 186.98 ?  38  SER D O     1 
ATOM 2346  C CB    . SER D 4 6   ? 104.362 81.391  87.877  1.00 186.98 ?  38  SER D CB    1 
ATOM 2347  O OG    . SER D 4 6   ? 103.761 81.009  86.656  1.00 186.98 ?  38  SER D OG    1 
ATOM 2348  N N     . VAL D 4 7   ? 106.680 81.040  85.596  1.00 185.79 ?  39  VAL D N     1 
ATOM 2349  C CA    . VAL D 4 7   ? 107.605 80.166  84.885  1.00 185.79 ?  39  VAL D CA    1 
ATOM 2350  C C     . VAL D 4 7   ? 109.012 80.738  84.964  1.00 185.79 ?  39  VAL D C     1 
ATOM 2351  O O     . VAL D 4 7   ? 110.005 80.001  84.982  1.00 185.79 ?  39  VAL D O     1 
ATOM 2352  C CB    . VAL D 4 7   ? 107.124 79.965  83.435  1.00 185.79 ?  39  VAL D CB    1 
ATOM 2353  C CG1   . VAL D 4 7   ? 108.027 79.016  82.662  1.00 185.79 ?  39  VAL D CG1   1 
ATOM 2354  C CG2   . VAL D 4 7   ? 105.703 79.447  83.433  1.00 185.79 ?  39  VAL D CG2   1 
ATOM 2355  N N     . TYR D 4 8   ? 109.118 82.058  85.093  1.00 190.16 ?  40  TYR D N     1 
ATOM 2356  C CA    . TYR D 4 8   ? 110.431 82.685  85.149  1.00 190.16 ?  40  TYR D CA    1 
ATOM 2357  C C     . TYR D 4 8   ? 111.109 82.504  86.497  1.00 190.16 ?  40  TYR D C     1 
ATOM 2358  O O     . TYR D 4 8   ? 112.285 82.124  86.543  1.00 190.16 ?  40  TYR D O     1 
ATOM 2359  C CB    . TYR D 4 8   ? 110.309 84.162  84.837  1.00 190.16 ?  40  TYR D CB    1 
ATOM 2360  C CG    . TYR D 4 8   ? 109.898 84.394  83.430  1.00 190.16 ?  40  TYR D CG    1 
ATOM 2361  C CD1   . TYR D 4 8   ? 110.807 84.244  82.406  1.00 190.16 ?  40  TYR D CD1   1 
ATOM 2362  C CD2   . TYR D 4 8   ? 108.599 84.751  83.120  1.00 190.16 ?  40  TYR D CD2   1 
ATOM 2363  C CE1   . TYR D 4 8   ? 110.442 84.454  81.111  1.00 190.16 ?  40  TYR D CE1   1 
ATOM 2364  C CE2   . TYR D 4 8   ? 108.218 84.964  81.819  1.00 190.16 ?  40  TYR D CE2   1 
ATOM 2365  C CZ    . TYR D 4 8   ? 109.143 84.805  80.818  1.00 190.16 ?  40  TYR D CZ    1 
ATOM 2366  O OH    . TYR D 4 8   ? 108.779 85.019  79.512  1.00 190.16 ?  40  TYR D OH    1 
ATOM 2367  N N     . VAL D 4 9   ? 110.396 82.799  87.588  1.00 182.92 ?  41  VAL D N     1 
ATOM 2368  C CA    . VAL D 4 9   ? 110.969 82.735  88.931  1.00 182.92 ?  41  VAL D CA    1 
ATOM 2369  C C     . VAL D 4 9   ? 111.373 81.309  89.272  1.00 182.92 ?  41  VAL D C     1 
ATOM 2370  O O     . VAL D 4 9   ? 112.412 81.073  89.901  1.00 182.92 ?  41  VAL D O     1 
ATOM 2371  C CB    . VAL D 4 9   ? 109.957 83.303  89.940  1.00 182.92 ?  41  VAL D CB    1 
ATOM 2372  C CG1   . VAL D 4 9   ? 110.457 83.192  91.360  1.00 182.92 ?  41  VAL D CG1   1 
ATOM 2373  C CG2   . VAL D 4 9   ? 109.657 84.739  89.605  1.00 182.92 ?  41  VAL D CG2   1 
ATOM 2374  N N     . TYR D 4 10  ? 110.587 80.338  88.807  1.00 189.35 ?  42  TYR D N     1 
ATOM 2375  C CA    . TYR D 4 10  ? 110.908 78.931  88.994  1.00 189.35 ?  42  TYR D CA    1 
ATOM 2376  C C     . TYR D 4 10  ? 112.191 78.539  88.271  1.00 189.35 ?  42  TYR D C     1 
ATOM 2377  O O     . TYR D 4 10  ? 112.887 77.621  88.714  1.00 189.35 ?  42  TYR D O     1 
ATOM 2378  C CB    . TYR D 4 10  ? 109.737 78.081  88.512  1.00 189.35 ?  42  TYR D CB    1 
ATOM 2379  C CG    . TYR D 4 10  ? 109.888 76.613  88.778  1.00 189.35 ?  42  TYR D CG    1 
ATOM 2380  C CD1   . TYR D 4 10  ? 109.656 76.095  90.038  1.00 189.35 ?  42  TYR D CD1   1 
ATOM 2381  C CD2   . TYR D 4 10  ? 110.262 75.744  87.768  1.00 189.35 ?  42  TYR D CD2   1 
ATOM 2382  C CE1   . TYR D 4 10  ? 109.793 74.747  90.287  1.00 189.35 ?  42  TYR D CE1   1 
ATOM 2383  C CE2   . TYR D 4 10  ? 110.404 74.396  88.006  1.00 189.35 ?  42  TYR D CE2   1 
ATOM 2384  C CZ    . TYR D 4 10  ? 110.168 73.904  89.268  1.00 189.35 ?  42  TYR D CZ    1 
ATOM 2385  O OH    . TYR D 4 10  ? 110.308 72.560  89.515  1.00 189.35 ?  42  TYR D OH    1 
ATOM 2386  N N     . LYS D 4 11  ? 112.532 79.223  87.176  1.00 180.65 ?  43  LYS D N     1 
ATOM 2387  C CA    . LYS D 4 11  ? 113.812 78.956  86.532  1.00 180.65 ?  43  LYS D CA    1 
ATOM 2388  C C     . LYS D 4 11  ? 114.968 79.604  87.277  1.00 180.65 ?  43  LYS D C     1 
ATOM 2389  O O     . LYS D 4 11  ? 116.110 79.152  87.156  1.00 180.65 ?  43  LYS D O     1 
ATOM 2390  C CB    . LYS D 4 11  ? 113.805 79.429  85.081  1.00 180.65 ?  43  LYS D CB    1 
ATOM 2391  C CG    . LYS D 4 11  ? 113.025 78.542  84.141  1.00 180.65 ?  43  LYS D CG    1 
ATOM 2392  C CD    . LYS D 4 11  ? 113.166 79.024  82.709  1.00 180.65 ?  43  LYS D CD    1 
ATOM 2393  C CE    . LYS D 4 11  ? 112.391 78.144  81.747  1.00 180.65 ?  43  LYS D CE    1 
ATOM 2394  N NZ    . LYS D 4 11  ? 112.527 78.617  80.345  1.00 180.65 ?  43  LYS D NZ    1 
ATOM 2395  N N     . VAL D 4 12  ? 114.702 80.664  88.040  1.00 181.31 ?  44  VAL D N     1 
ATOM 2396  C CA    . VAL D 4 12  ? 115.774 81.311  88.789  1.00 181.31 ?  44  VAL D CA    1 
ATOM 2397  C C     . VAL D 4 12  ? 116.185 80.448  89.967  1.00 181.31 ?  44  VAL D C     1 
ATOM 2398  O O     . VAL D 4 12  ? 117.374 80.339  90.294  1.00 181.31 ?  44  VAL D O     1 
ATOM 2399  C CB    . VAL D 4 12  ? 115.330 82.710  89.238  1.00 181.31 ?  44  VAL D CB    1 
ATOM 2400  C CG1   . VAL D 4 12  ? 116.426 83.406  90.030  1.00 181.31 ?  44  VAL D CG1   1 
ATOM 2401  C CG2   . VAL D 4 12  ? 114.950 83.521  88.041  1.00 181.31 ?  44  VAL D CG2   1 
ATOM 2402  N N     . LEU D 4 13  ? 115.207 79.789  90.594  1.00 197.21 ?  45  LEU D N     1 
ATOM 2403  C CA    . LEU D 4 13  ? 115.460 78.967  91.771  1.00 197.21 ?  45  LEU D CA    1 
ATOM 2404  C C     . LEU D 4 13  ? 116.330 77.766  91.432  1.00 197.21 ?  45  LEU D C     1 
ATOM 2405  O O     . LEU D 4 13  ? 117.143 77.328  92.253  1.00 197.21 ?  45  LEU D O     1 
ATOM 2406  C CB    . LEU D 4 13  ? 114.132 78.513  92.367  1.00 197.21 ?  45  LEU D CB    1 
ATOM 2407  C CG    . LEU D 4 13  ? 114.216 77.795  93.702  1.00 197.21 ?  45  LEU D CG    1 
ATOM 2408  C CD1   . LEU D 4 13  ? 114.776 78.757  94.708  1.00 197.21 ?  45  LEU D CD1   1 
ATOM 2409  C CD2   . LEU D 4 13  ? 112.857 77.300  94.138  1.00 197.21 ?  45  LEU D CD2   1 
ATOM 2410  N N     . LYS D 4 14  ? 116.204 77.250  90.211  1.00 202.70 ?  46  LYS D N     1 
ATOM 2411  C CA    . LYS D 4 14  ? 117.018 76.117  89.802  1.00 202.70 ?  46  LYS D CA    1 
ATOM 2412  C C     . LYS D 4 14  ? 118.466 76.503  89.540  1.00 202.70 ?  46  LYS D C     1 
ATOM 2413  O O     . LYS D 4 14  ? 119.332 75.624  89.538  1.00 202.70 ?  46  LYS D O     1 
ATOM 2414  C CB    . LYS D 4 14  ? 116.410 75.468  88.565  1.00 202.70 ?  46  LYS D CB    1 
ATOM 2415  C CG    . LYS D 4 14  ? 115.004 74.964  88.796  1.00 202.70 ?  46  LYS D CG    1 
ATOM 2416  C CD    . LYS D 4 14  ? 114.998 73.770  89.725  1.00 202.70 ?  46  LYS D CD    1 
ATOM 2417  C CE    . LYS D 4 14  ? 113.580 73.320  90.015  1.00 202.70 ?  46  LYS D CE    1 
ATOM 2418  N NZ    . LYS D 4 14  ? 112.900 72.819  88.796  1.00 202.70 ?  46  LYS D NZ    1 
ATOM 2419  N N     . GLN D 4 15  ? 118.756 77.788  89.331  1.00 198.55 ?  47  GLN D N     1 
ATOM 2420  C CA    . GLN D 4 15  ? 120.138 78.183  89.089  1.00 198.55 ?  47  GLN D CA    1 
ATOM 2421  C C     . GLN D 4 15  ? 120.924 78.256  90.395  1.00 198.55 ?  47  GLN D C     1 
ATOM 2422  O O     . GLN D 4 15  ? 122.151 78.106  90.397  1.00 198.55 ?  47  GLN D O     1 
ATOM 2423  C CB    . GLN D 4 15  ? 120.177 79.515  88.336  1.00 198.55 ?  47  GLN D CB    1 
ATOM 2424  C CG    . GLN D 4 15  ? 121.559 79.939  87.836  1.00 198.55 ?  47  GLN D CG    1 
ATOM 2425  C CD    . GLN D 4 15  ? 121.534 81.224  87.029  1.00 198.55 ?  47  GLN D CD    1 
ATOM 2426  O OE1   . GLN D 4 15  ? 120.477 81.809  86.806  1.00 198.55 ?  47  GLN D OE1   1 
ATOM 2427  N NE2   . GLN D 4 15  ? 122.706 81.680  86.606  1.00 198.55 ?  47  GLN D NE2   1 
ATOM 2428  N N     . VAL D 4 16  ? 120.242 78.445  91.524  1.00 191.15 ?  48  VAL D N     1 
ATOM 2429  C CA    . VAL D 4 16  ? 120.931 78.503  92.810  1.00 191.15 ?  48  VAL D CA    1 
ATOM 2430  C C     . VAL D 4 16  ? 120.568 77.351  93.742  1.00 191.15 ?  48  VAL D C     1 
ATOM 2431  O O     . VAL D 4 16  ? 121.159 77.244  94.828  1.00 191.15 ?  48  VAL D O     1 
ATOM 2432  C CB    . VAL D 4 16  ? 120.664 79.840  93.522  1.00 191.15 ?  48  VAL D CB    1 
ATOM 2433  C CG1   . VAL D 4 16  ? 121.135 80.992  92.665  1.00 191.15 ?  48  VAL D CG1   1 
ATOM 2434  C CG2   . VAL D 4 16  ? 119.199 79.961  93.853  1.00 191.15 ?  48  VAL D CG2   1 
ATOM 2435  N N     . HIS D 4 17  ? 119.618 76.503  93.364  1.00 195.26 ?  49  HIS D N     1 
ATOM 2436  C CA    . HIS D 4 17  ? 119.261 75.316  94.139  1.00 195.26 ?  49  HIS D CA    1 
ATOM 2437  C C     . HIS D 4 17  ? 118.823 74.234  93.166  1.00 195.26 ?  49  HIS D C     1 
ATOM 2438  O O     . HIS D 4 17  ? 117.802 74.385  92.477  1.00 195.26 ?  49  HIS D O     1 
ATOM 2439  C CB    . HIS D 4 17  ? 118.158 75.604  95.152  1.00 195.26 ?  49  HIS D CB    1 
ATOM 2440  C CG    . HIS D 4 17  ? 118.620 76.337  96.366  1.00 195.26 ?  49  HIS D CG    1 
ATOM 2441  N ND1   . HIS D 4 17  ? 118.748 77.706  96.404  1.00 195.26 ?  49  HIS D ND1   1 
ATOM 2442  C CD2   . HIS D 4 17  ? 118.956 75.892  97.598  1.00 195.26 ?  49  HIS D CD2   1 
ATOM 2443  C CE1   . HIS D 4 17  ? 119.163 78.072  97.603  1.00 195.26 ?  49  HIS D CE1   1 
ATOM 2444  N NE2   . HIS D 4 17  ? 119.294 76.990  98.347  1.00 195.26 ?  49  HIS D NE2   1 
ATOM 2445  N N     . PRO D 4 18  ? 119.565 73.131  93.074  1.00 200.36 ?  50  PRO D N     1 
ATOM 2446  C CA    . PRO D 4 18  ? 119.183 72.065  92.142  1.00 200.36 ?  50  PRO D CA    1 
ATOM 2447  C C     . PRO D 4 18  ? 117.945 71.284  92.548  1.00 200.36 ?  50  PRO D C     1 
ATOM 2448  O O     . PRO D 4 18  ? 117.375 70.593  91.698  1.00 200.36 ?  50  PRO D O     1 
ATOM 2449  C CB    . PRO D 4 18  ? 120.421 71.158  92.133  1.00 200.36 ?  50  PRO D CB    1 
ATOM 2450  C CG    . PRO D 4 18  ? 121.541 72.042  92.566  1.00 200.36 ?  50  PRO D CG    1 
ATOM 2451  C CD    . PRO D 4 18  ? 120.938 72.963  93.572  1.00 200.36 ?  50  PRO D CD    1 
ATOM 2452  N N     . ASP D 4 19  ? 117.494 71.362  93.797  1.00 210.80 ?  51  ASP D N     1 
ATOM 2453  C CA    . ASP D 4 19  ? 116.435 70.479  94.258  1.00 210.80 ?  51  ASP D CA    1 
ATOM 2454  C C     . ASP D 4 19  ? 115.386 71.123  95.151  1.00 210.80 ?  51  ASP D C     1 
ATOM 2455  O O     . ASP D 4 19  ? 114.565 70.395  95.716  1.00 210.80 ?  51  ASP D O     1 
ATOM 2456  C CB    . ASP D 4 19  ? 117.043 69.279  94.995  1.00 210.80 ?  51  ASP D CB    1 
ATOM 2457  C CG    . ASP D 4 19  ? 117.991 69.698  96.091  1.00 210.80 ?  51  ASP D CG    1 
ATOM 2458  O OD1   . ASP D 4 19  ? 118.270 70.910  96.206  1.00 210.80 ?  51  ASP D OD1   1 
ATOM 2459  O OD2   . ASP D 4 19  ? 118.458 68.817  96.839  1.00 210.80 -1 51  ASP D OD2   1 
ATOM 2460  N N     . THR D 4 20  ? 115.379 72.439  95.305  1.00 207.08 ?  52  THR D N     1 
ATOM 2461  C CA    . THR D 4 20  ? 114.421 73.089  96.188  1.00 207.08 ?  52  THR D CA    1 
ATOM 2462  C C     . THR D 4 20  ? 113.124 73.367  95.437  1.00 207.08 ?  52  THR D C     1 
ATOM 2463  O O     . THR D 4 20  ? 113.144 73.959  94.355  1.00 207.08 ?  52  THR D O     1 
ATOM 2464  C CB    . THR D 4 20  ? 115.008 74.385  96.730  1.00 207.08 ?  52  THR D CB    1 
ATOM 2465  O OG1   . THR D 4 20  ? 116.231 74.102  97.417  1.00 207.08 ?  52  THR D OG1   1 
ATOM 2466  C CG2   . THR D 4 20  ? 114.050 75.026  97.693  1.00 207.08 ?  52  THR D CG2   1 
ATOM 2467  N N     . GLY D 4 21  ? 111.999 72.951  96.012  1.00 206.44 ?  53  GLY D N     1 
ATOM 2468  C CA    . GLY D 4 21  ? 110.703 73.254  95.445  1.00 206.44 ?  53  GLY D CA    1 
ATOM 2469  C C     . GLY D 4 21  ? 110.052 74.456  96.105  1.00 206.44 ?  53  GLY D C     1 
ATOM 2470  O O     . GLY D 4 21  ? 110.471 74.937  97.155  1.00 206.44 ?  53  GLY D O     1 
ATOM 2471  N N     . ILE D 4 22  ? 108.992 74.942  95.469  1.00 189.13 ?  54  ILE D N     1 
ATOM 2472  C CA    . ILE D 4 22  ? 108.291 76.133  95.935  1.00 189.13 ?  54  ILE D CA    1 
ATOM 2473  C C     . ILE D 4 22  ? 106.796 75.848  95.944  1.00 189.13 ?  54  ILE D C     1 
ATOM 2474  O O     . ILE D 4 22  ? 106.256 75.259  95.005  1.00 189.13 ?  54  ILE D O     1 
ATOM 2475  C CB    . ILE D 4 22  ? 108.667 77.360  95.074  1.00 189.13 ?  54  ILE D CB    1 
ATOM 2476  C CG1   . ILE D 4 22  ? 107.900 78.604  95.515  1.00 189.13 ?  54  ILE D CG1   1 
ATOM 2477  C CG2   . ILE D 4 22  ? 108.514 77.076  93.596  1.00 189.13 ?  54  ILE D CG2   1 
ATOM 2478  C CD1   . ILE D 4 22  ? 108.402 79.880  94.904  1.00 189.13 ?  54  ILE D CD1   1 
ATOM 2479  N N     . SER D 4 23  ? 106.134 76.225  97.034  1.00 188.41 ?  55  SER D N     1 
ATOM 2480  C CA    . SER D 4 23  ? 104.710 75.975  97.178  1.00 188.41 ?  55  SER D CA    1 
ATOM 2481  C C     . SER D 4 23  ? 103.913 76.938  96.317  1.00 188.41 ?  55  SER D C     1 
ATOM 2482  O O     . SER D 4 23  ? 104.390 78.004  95.931  1.00 188.41 ?  55  SER D O     1 
ATOM 2483  C CB    . SER D 4 23  ? 104.266 76.134  98.623  1.00 188.41 ?  55  SER D CB    1 
ATOM 2484  O OG    . SER D 4 23  ? 104.305 77.499  98.988  1.00 188.41 ?  55  SER D OG    1 
ATOM 2485  N N     . SER D 4 24  ? 102.661 76.568  96.056  1.00 181.43 ?  56  SER D N     1 
ATOM 2486  C CA    . SER D 4 24  ? 101.875 77.315  95.082  1.00 181.43 ?  56  SER D CA    1 
ATOM 2487  C C     . SER D 4 24  ? 101.344 78.622  95.648  1.00 181.43 ?  56  SER D C     1 
ATOM 2488  O O     . SER D 4 24  ? 100.769 79.421  94.903  1.00 181.43 ?  56  SER D O     1 
ATOM 2489  C CB    . SER D 4 24  ? 100.718 76.467  94.573  1.00 181.43 ?  56  SER D CB    1 
ATOM 2490  O OG    . SER D 4 24  ? 99.779  76.247  95.605  1.00 181.43 ?  56  SER D OG    1 
ATOM 2491  N N     . LYS D 4 25  ? 101.497 78.857  96.949  1.00 166.71 ?  57  LYS D N     1 
ATOM 2492  C CA    . LYS D 4 25  ? 101.174 80.178  97.474  1.00 166.71 ?  57  LYS D CA    1 
ATOM 2493  C C     . LYS D 4 25  ? 102.421 81.047  97.537  1.00 166.71 ?  57  LYS D C     1 
ATOM 2494  O O     . LYS D 4 25  ? 102.339 82.273  97.409  1.00 166.71 ?  57  LYS D O     1 
ATOM 2495  C CB    . LYS D 4 25  ? 100.516 80.059  98.847  1.00 166.71 ?  57  LYS D CB    1 
ATOM 2496  C CG    . LYS D 4 25  ? 99.944  81.364  99.375  1.00 166.71 ?  57  LYS D CG    1 
ATOM 2497  C CD    . LYS D 4 25  ? 99.300  81.188  100.727 1.00 166.71 ?  57  LYS D CD    1 
ATOM 2498  C CE    . LYS D 4 25  ? 97.803  80.999  100.593 1.00 166.71 ?  57  LYS D CE    1 
ATOM 2499  N NZ    . LYS D 4 25  ? 97.469  79.622  100.146 1.00 166.71 ?  57  LYS D NZ    1 
ATOM 2500  N N     . ALA D 4 26  ? 103.589 80.427  97.699  1.00 178.25 ?  58  ALA D N     1 
ATOM 2501  C CA    . ALA D 4 26  ? 104.830 81.186  97.742  1.00 178.25 ?  58  ALA D CA    1 
ATOM 2502  C C     . ALA D 4 26  ? 105.181 81.789  96.394  1.00 178.25 ?  58  ALA D C     1 
ATOM 2503  O O     . ALA D 4 26  ? 105.897 82.792  96.347  1.00 178.25 ?  58  ALA D O     1 
ATOM 2504  C CB    . ALA D 4 26  ? 105.976 80.303  98.225  1.00 178.25 ?  58  ALA D CB    1 
ATOM 2505  N N     . MET D 4 27  ? 104.691 81.206  95.304  1.00 189.43 ?  59  MET D N     1 
ATOM 2506  C CA    . MET D 4 27  ? 104.824 81.852  94.008  1.00 189.43 ?  59  MET D CA    1 
ATOM 2507  C C     . MET D 4 27  ? 103.979 83.115  93.950  1.00 189.43 ?  59  MET D C     1 
ATOM 2508  O O     . MET D 4 27  ? 104.328 84.072  93.250  1.00 189.43 ?  59  MET D O     1 
ATOM 2509  C CB    . MET D 4 27  ? 104.428 80.878  92.904  1.00 189.43 ?  59  MET D CB    1 
ATOM 2510  C CG    . MET D 4 27  ? 104.728 81.361  91.518  1.00 189.43 ?  59  MET D CG    1 
ATOM 2511  S SD    . MET D 4 27  ? 106.492 81.609  91.314  1.00 189.43 ?  59  MET D SD    1 
ATOM 2512  C CE    . MET D 4 27  ? 107.060 79.918  91.319  1.00 189.43 ?  59  MET D CE    1 
ATOM 2513  N N     . GLY D 4 28  ? 102.876 83.146  94.700  1.00 179.45 ?  60  GLY D N     1 
ATOM 2514  C CA    . GLY D 4 28  ? 102.053 84.341  94.754  1.00 179.45 ?  60  GLY D CA    1 
ATOM 2515  C C     . GLY D 4 28  ? 102.735 85.515  95.428  1.00 179.45 ?  60  GLY D C     1 
ATOM 2516  O O     . GLY D 4 28  ? 102.531 86.664  95.027  1.00 179.45 ?  60  GLY D O     1 
ATOM 2517  N N     . ILE D 4 29  ? 103.552 85.250  96.448  1.00 173.76 ?  61  ILE D N     1 
ATOM 2518  C CA    . ILE D 4 29  ? 104.333 86.315  97.065  1.00 173.76 ?  61  ILE D CA    1 
ATOM 2519  C C     . ILE D 4 29  ? 105.420 86.787  96.112  1.00 173.76 ?  61  ILE D C     1 
ATOM 2520  O O     . ILE D 4 29  ? 105.701 87.986  96.005  1.00 173.76 ?  61  ILE D O     1 
ATOM 2521  C CB    . ILE D 4 29  ? 104.908 85.828  98.403  1.00 173.76 ?  61  ILE D CB    1 
ATOM 2522  C CG1   . ILE D 4 29  ? 103.771 85.529  99.361  1.00 173.76 ?  61  ILE D CG1   1 
ATOM 2523  C CG2   . ILE D 4 29  ? 105.821 86.856  99.027  1.00 173.76 ?  61  ILE D CG2   1 
ATOM 2524  C CD1   . ILE D 4 29  ? 104.228 84.830  100.594 1.00 173.76 ?  61  ILE D CD1   1 
ATOM 2525  N N     . MET D 4 30  ? 105.985 85.866  95.336  1.00 177.23 ?  62  MET D N     1 
ATOM 2526  C CA    . MET D 4 30  ? 107.018 86.251  94.384  1.00 177.23 ?  62  MET D CA    1 
ATOM 2527  C C     . MET D 4 30  ? 106.432 86.919  93.146  1.00 177.23 ?  62  MET D C     1 
ATOM 2528  O O     . MET D 4 30  ? 107.174 87.301  92.240  1.00 177.23 ?  62  MET D O     1 
ATOM 2529  C CB    . MET D 4 30  ? 107.848 85.033  94.003  1.00 177.23 ?  62  MET D CB    1 
ATOM 2530  C CG    . MET D 4 30  ? 108.674 84.510  95.145  1.00 177.23 ?  62  MET D CG    1 
ATOM 2531  S SD    . MET D 4 30  ? 109.881 85.727  95.635  1.00 177.23 ?  62  MET D SD    1 
ATOM 2532  C CE    . MET D 4 30  ? 110.961 85.643  94.219  1.00 177.23 ?  62  MET D CE    1 
ATOM 2533  N N     . ASN D 4 31  ? 105.107 87.038  93.062  1.00 187.22 ?  63  ASN D N     1 
ATOM 2534  C CA    . ASN D 4 31  ? 104.537 88.026  92.156  1.00 187.22 ?  63  ASN D CA    1 
ATOM 2535  C C     . ASN D 4 31  ? 104.589 89.416  92.762  1.00 187.22 ?  63  ASN D C     1 
ATOM 2536  O O     . ASN D 4 31  ? 105.213 90.326  92.208  1.00 187.22 ?  63  ASN D O     1 
ATOM 2537  C CB    . ASN D 4 31  ? 103.101 87.678  91.792  1.00 187.22 ?  63  ASN D CB    1 
ATOM 2538  C CG    . ASN D 4 31  ? 103.015 86.566  90.797  1.00 187.22 ?  63  ASN D CG    1 
ATOM 2539  O OD1   . ASN D 4 31  ? 102.480 85.498  91.084  1.00 187.22 ?  63  ASN D OD1   1 
ATOM 2540  N ND2   . ASN D 4 31  ? 103.545 86.805  89.605  1.00 187.22 ?  63  ASN D ND2   1 
ATOM 2541  N N     . SER D 4 32  ? 103.946 89.603  93.911  1.00 185.23 ?  64  SER D N     1 
ATOM 2542  C CA    . SER D 4 32  ? 103.786 90.958  94.415  1.00 185.23 ?  64  SER D CA    1 
ATOM 2543  C C     . SER D 4 32  ? 105.046 91.477  95.086  1.00 185.23 ?  64  SER D C     1 
ATOM 2544  O O     . SER D 4 32  ? 105.068 92.622  95.537  1.00 185.23 ?  64  SER D O     1 
ATOM 2545  C CB    . SER D 4 32  ? 102.605 91.035  95.375  1.00 185.23 ?  64  SER D CB    1 
ATOM 2546  O OG    . SER D 4 32  ? 101.391 90.832  94.680  1.00 185.23 ?  64  SER D OG    1 
ATOM 2547  N N     . PHE D 4 33  ? 106.106 90.675  95.167  1.00 174.67 ?  65  PHE D N     1 
ATOM 2548  C CA    . PHE D 4 33  ? 107.404 91.268  95.455  1.00 174.67 ?  65  PHE D CA    1 
ATOM 2549  C C     . PHE D 4 33  ? 107.991 91.900  94.208  1.00 174.67 ?  65  PHE D C     1 
ATOM 2550  O O     . PHE D 4 33  ? 108.552 92.996  94.259  1.00 174.67 ?  65  PHE D O     1 
ATOM 2551  C CB    . PHE D 4 33  ? 108.389 90.250  96.018  1.00 174.67 ?  65  PHE D CB    1 
ATOM 2552  C CG    . PHE D 4 33  ? 109.773 90.807  96.174  1.00 174.67 ?  65  PHE D CG    1 
ATOM 2553  C CD1   . PHE D 4 33  ? 110.049 91.712  97.170  1.00 174.67 ?  65  PHE D CD1   1 
ATOM 2554  C CD2   . PHE D 4 33  ? 110.784 90.446  95.303  1.00 174.67 ?  65  PHE D CD2   1 
ATOM 2555  C CE1   . PHE D 4 33  ? 111.304 92.238  97.306  1.00 174.67 ?  65  PHE D CE1   1 
ATOM 2556  C CE2   . PHE D 4 33  ? 112.037 90.972  95.433  1.00 174.67 ?  65  PHE D CE2   1 
ATOM 2557  C CZ    . PHE D 4 33  ? 112.296 91.868  96.437  1.00 174.67 ?  65  PHE D CZ    1 
ATOM 2558  N N     . VAL D 4 34  ? 107.905 91.207  93.074  1.00 171.74 ?  66  VAL D N     1 
ATOM 2559  C CA    . VAL D 4 34  ? 108.655 91.689  91.933  1.00 171.74 ?  66  VAL D CA    1 
ATOM 2560  C C     . VAL D 4 34  ? 107.888 92.768  91.178  1.00 171.74 ?  66  VAL D C     1 
ATOM 2561  O O     . VAL D 4 34  ? 108.512 93.630  90.558  1.00 171.74 ?  66  VAL D O     1 
ATOM 2562  C CB    . VAL D 4 34  ? 109.069 90.495  91.054  1.00 171.74 ?  66  VAL D CB    1 
ATOM 2563  C CG1   . VAL D 4 34  ? 107.887 89.902  90.396  1.00 171.74 ?  66  VAL D CG1   1 
ATOM 2564  C CG2   . VAL D 4 34  ? 110.132 90.884  90.042  1.00 171.74 ?  66  VAL D CG2   1 
ATOM 2565  N N     . ASN D 4 35  ? 106.555 92.808  91.264  1.00 180.32 ?  67  ASN D N     1 
ATOM 2566  C CA    . ASN D 4 35  ? 105.865 93.967  90.709  1.00 180.32 ?  67  ASN D CA    1 
ATOM 2567  C C     . ASN D 4 35  ? 106.017 95.193  91.595  1.00 180.32 ?  67  ASN D C     1 
ATOM 2568  O O     . ASN D 4 35  ? 106.046 96.316  91.086  1.00 180.32 ?  67  ASN D O     1 
ATOM 2569  C CB    . ASN D 4 35  ? 104.386 93.685  90.467  1.00 180.32 ?  67  ASN D CB    1 
ATOM 2570  C CG    . ASN D 4 35  ? 104.144 92.924  89.191  1.00 180.32 ?  67  ASN D CG    1 
ATOM 2571  O OD1   . ASN D 4 35  ? 104.864 93.095  88.215  1.00 180.32 ?  67  ASN D OD1   1 
ATOM 2572  N ND2   . ASN D 4 35  ? 103.094 92.122  89.170  1.00 180.32 ?  67  ASN D ND2   1 
ATOM 2573  N N     . ASP D 4 36  ? 106.120 95.007  92.910  1.00 181.06 ?  68  ASP D N     1 
ATOM 2574  C CA    . ASP D 4 36  ? 106.282 96.154  93.796  1.00 181.06 ?  68  ASP D CA    1 
ATOM 2575  C C     . ASP D 4 36  ? 107.661 96.779  93.648  1.00 181.06 ?  68  ASP D C     1 
ATOM 2576  O O     . ASP D 4 36  ? 107.811 97.992  93.807  1.00 181.06 ?  68  ASP D O     1 
ATOM 2577  C CB    . ASP D 4 36  ? 106.045 95.746  95.244  1.00 181.06 ?  68  ASP D CB    1 
ATOM 2578  C CG    . ASP D 4 36  ? 106.072 96.919  96.182  1.00 181.06 ?  68  ASP D CG    1 
ATOM 2579  O OD1   . ASP D 4 36  ? 105.078 97.667  96.208  1.00 181.06 ?  68  ASP D OD1   1 
ATOM 2580  O OD2   . ASP D 4 36  ? 107.090 97.107  96.877  1.00 181.06 -1 68  ASP D OD2   1 
ATOM 2581  N N     . ILE D 4 37  ? 108.681 95.978  93.347  1.00 170.50 ?  69  ILE D N     1 
ATOM 2582  C CA    . ILE D 4 37  ? 109.964 96.570  92.996  1.00 170.50 ?  69  ILE D CA    1 
ATOM 2583  C C     . ILE D 4 37  ? 109.886 97.181  91.607  1.00 170.50 ?  69  ILE D C     1 
ATOM 2584  O O     . ILE D 4 37  ? 110.481 98.231  91.339  1.00 170.50 ?  69  ILE D O     1 
ATOM 2585  C CB    . ILE D 4 37  ? 111.091 95.530  93.109  1.00 170.50 ?  69  ILE D CB    1 
ATOM 2586  C CG1   . ILE D 4 37  ? 111.141 94.980  94.523  1.00 170.50 ?  69  ILE D CG1   1 
ATOM 2587  C CG2   . ILE D 4 37  ? 112.433 96.149  92.809  1.00 170.50 ?  69  ILE D CG2   1 
ATOM 2588  C CD1   . ILE D 4 37  ? 111.392 96.031  95.563  1.00 170.50 ?  69  ILE D CD1   1 
ATOM 2589  N N     . PHE D 4 38  ? 109.104 96.571  90.718  1.00 172.38 ?  70  PHE D N     1 
ATOM 2590  C CA    . PHE D 4 38  ? 108.977 97.112  89.370  1.00 172.38 ?  70  PHE D CA    1 
ATOM 2591  C C     . PHE D 4 38  ? 108.158 98.392  89.348  1.00 172.38 ?  70  PHE D C     1 
ATOM 2592  O O     . PHE D 4 38  ? 108.495 99.333  88.625  1.00 172.38 ?  70  PHE D O     1 
ATOM 2593  C CB    . PHE D 4 38  ? 108.352 96.085  88.442  1.00 172.38 ?  70  PHE D CB    1 
ATOM 2594  C CG    . PHE D 4 38  ? 108.119 96.594  87.075  1.00 172.38 ?  70  PHE D CG    1 
ATOM 2595  C CD1   . PHE D 4 38  ? 109.173 96.787  86.219  1.00 172.38 ?  70  PHE D CD1   1 
ATOM 2596  C CD2   . PHE D 4 38  ? 106.840 96.887  86.648  1.00 172.38 ?  70  PHE D CD2   1 
ATOM 2597  C CE1   . PHE D 4 38  ? 108.959 97.263  84.962  1.00 172.38 ?  70  PHE D CE1   1 
ATOM 2598  C CE2   . PHE D 4 38  ? 106.618 97.362  85.394  1.00 172.38 ?  70  PHE D CE2   1 
ATOM 2599  C CZ    . PHE D 4 38  ? 107.680 97.549  84.546  1.00 172.38 ?  70  PHE D CZ    1 
ATOM 2600  N N     . GLU D 4 39  ? 107.072 98.449  90.117  1.00 179.57 ?  71  GLU D N     1 
ATOM 2601  C CA    . GLU D 4 39  ? 106.219 99.626  90.035  1.00 179.57 ?  71  GLU D CA    1 
ATOM 2602  C C     . GLU D 4 39  ? 106.816 100.783 90.820  1.00 179.57 ?  71  GLU D C     1 
ATOM 2603  O O     . GLU D 4 39  ? 106.456 101.938 90.584  1.00 179.57 ?  71  GLU D O     1 
ATOM 2604  C CB    . GLU D 4 39  ? 104.809 99.290  90.518  1.00 179.57 ?  71  GLU D CB    1 
ATOM 2605  C CG    . GLU D 4 39  ? 103.696 100.175 89.970  1.00 179.57 ?  71  GLU D CG    1 
ATOM 2606  C CD    . GLU D 4 39  ? 103.434 101.404 90.802  1.00 179.57 ?  71  GLU D CD    1 
ATOM 2607  O OE1   . GLU D 4 39  ? 103.716 101.374 92.016  1.00 179.57 ?  71  GLU D OE1   1 
ATOM 2608  O OE2   . GLU D 4 39  ? 102.929 102.399 90.242  1.00 179.57 -1 71  GLU D OE2   1 
ATOM 2609  N N     . ARG D 4 40  ? 107.746 100.508 91.733  1.00 164.37 ?  72  ARG D N     1 
ATOM 2610  C CA    . ARG D 4 40  ? 108.533 101.603 92.280  1.00 164.37 ?  72  ARG D CA    1 
ATOM 2611  C C     . ARG D 4 40  ? 109.472 102.167 91.231  1.00 164.37 ?  72  ARG D C     1 
ATOM 2612  O O     . ARG D 4 40  ? 109.381 103.352 90.906  1.00 164.37 ?  72  ARG D O     1 
ATOM 2613  C CB    . ARG D 4 40  ? 109.325 101.163 93.508  1.00 164.37 ?  72  ARG D CB    1 
ATOM 2614  C CG    . ARG D 4 40  ? 108.523 101.044 94.784  1.00 164.37 ?  72  ARG D CG    1 
ATOM 2615  C CD    . ARG D 4 40  ? 109.393 100.547 95.927  1.00 164.37 ?  72  ARG D CD    1 
ATOM 2616  N NE    . ARG D 4 40  ? 108.629 100.349 97.150  1.00 164.37 ?  72  ARG D NE    1 
ATOM 2617  C CZ    . ARG D 4 40  ? 109.126 99.825  98.261  1.00 164.37 ?  72  ARG D CZ    1 
ATOM 2618  N NH1   . ARG D 4 40  ? 110.389 99.446  98.306  1.00 164.37 ?  72  ARG D NH1   1 
ATOM 2619  N NH2   . ARG D 4 40  ? 108.357 99.682  99.326  1.00 164.37 ?  72  ARG D NH2   1 
ATOM 2620  N N     . ILE D 4 41  ? 110.329 101.319 90.653  1.00 171.05 ?  73  ILE D N     1 
ATOM 2621  C CA    . ILE D 4 41  ? 111.518 101.786 89.935  1.00 171.05 ?  73  ILE D CA    1 
ATOM 2622  C C     . ILE D 4 41  ? 111.140 102.545 88.668  1.00 171.05 ?  73  ILE D C     1 
ATOM 2623  O O     . ILE D 4 41  ? 111.596 103.671 88.446  1.00 171.05 ?  73  ILE D O     1 
ATOM 2624  C CB    . ILE D 4 41  ? 112.459 100.610 89.628  1.00 171.05 ?  73  ILE D CB    1 
ATOM 2625  C CG1   . ILE D 4 41  ? 113.123 100.114 90.902  1.00 171.05 ?  73  ILE D CG1   1 
ATOM 2626  C CG2   . ILE D 4 41  ? 113.524 101.019 88.668  1.00 171.05 ?  73  ILE D CG2   1 
ATOM 2627  C CD1   . ILE D 4 41  ? 113.926 98.873  90.695  1.00 171.05 ?  73  ILE D CD1   1 
ATOM 2628  N N     . ALA D 4 42  ? 110.287 101.958 87.834  1.00 179.53 ?  74  ALA D N     1 
ATOM 2629  C CA    . ALA D 4 42  ? 109.817 102.697 86.669  1.00 179.53 ?  74  ALA D CA    1 
ATOM 2630  C C     . ALA D 4 42  ? 108.901 103.840 87.074  1.00 179.53 ?  74  ALA D C     1 
ATOM 2631  O O     . ALA D 4 42  ? 108.867 104.872 86.400  1.00 179.53 ?  74  ALA D O     1 
ATOM 2632  C CB    . ALA D 4 42  ? 109.105 101.765 85.695  1.00 179.53 ?  74  ALA D CB    1 
ATOM 2633  N N     . GLY D 4 43  ? 108.191 103.696 88.192  1.00 183.70 ?  75  GLY D N     1 
ATOM 2634  C CA    . GLY D 4 43  ? 107.363 104.785 88.681  1.00 183.70 ?  75  GLY D CA    1 
ATOM 2635  C C     . GLY D 4 43  ? 108.142 105.839 89.440  1.00 183.70 ?  75  GLY D C     1 
ATOM 2636  O O     . GLY D 4 43  ? 107.567 106.830 89.899  1.00 183.70 ?  75  GLY D O     1 
ATOM 2637  N N     . GLU D 4 44  ? 109.445 105.631 89.608  1.00 178.16 ?  76  GLU D N     1 
ATOM 2638  C CA    . GLU D 4 44  ? 110.311 106.643 90.189  1.00 178.16 ?  76  GLU D CA    1 
ATOM 2639  C C     . GLU D 4 44  ? 111.321 107.155 89.174  1.00 178.16 ?  76  GLU D C     1 
ATOM 2640  O O     . GLU D 4 44  ? 111.768 108.302 89.279  1.00 178.16 ?  76  GLU D O     1 
ATOM 2641  C CB    . GLU D 4 44  ? 111.022 106.072 91.417  1.00 178.16 ?  76  GLU D CB    1 
ATOM 2642  C CG    . GLU D 4 44  ? 111.548 107.075 92.401  1.00 178.16 ?  76  GLU D CG    1 
ATOM 2643  C CD    . GLU D 4 44  ? 112.913 107.570 92.039  1.00 178.16 ?  76  GLU D CD    1 
ATOM 2644  O OE1   . GLU D 4 44  ? 113.622 106.849 91.305  1.00 178.16 ?  76  GLU D OE1   1 
ATOM 2645  O OE2   . GLU D 4 44  ? 113.282 108.674 92.490  1.00 178.16 -1 76  GLU D OE2   1 
ATOM 2646  N N     . ALA D 4 45  ? 111.673 106.344 88.175  1.00 170.51 ?  77  ALA D N     1 
ATOM 2647  C CA    . ALA D 4 45  ? 112.524 106.835 87.099  1.00 170.51 ?  77  ALA D CA    1 
ATOM 2648  C C     . ALA D 4 45  ? 111.779 107.768 86.166  1.00 170.51 ?  77  ALA D C     1 
ATOM 2649  O O     . ALA D 4 45  ? 112.417 108.533 85.440  1.00 170.51 ?  77  ALA D O     1 
ATOM 2650  C CB    . ALA D 4 45  ? 113.102 105.677 86.296  1.00 170.51 ?  77  ALA D CB    1 
ATOM 2651  N N     . SER D 4 46  ? 110.448 107.717 86.173  1.00 178.09 ?  78  SER D N     1 
ATOM 2652  C CA    . SER D 4 46  ? 109.658 108.698 85.445  1.00 178.09 ?  78  SER D CA    1 
ATOM 2653  C C     . SER D 4 46  ? 109.830 110.091 86.019  1.00 178.09 ?  78  SER D C     1 
ATOM 2654  O O     . SER D 4 46  ? 109.691 111.080 85.295  1.00 178.09 ?  78  SER D O     1 
ATOM 2655  C CB    . SER D 4 46  ? 108.186 108.311 85.479  1.00 178.09 ?  78  SER D CB    1 
ATOM 2656  O OG    . SER D 4 46  ? 107.401 109.281 84.812  1.00 178.09 ?  78  SER D OG    1 
ATOM 2657  N N     . ARG D 4 47  ? 110.129 110.187 87.311  1.00 174.35 ?  79  ARG D N     1 
ATOM 2658  C CA    . ARG D 4 47  ? 110.220 111.492 87.945  1.00 174.35 ?  79  ARG D CA    1 
ATOM 2659  C C     . ARG D 4 47  ? 111.509 112.210 87.564  1.00 174.35 ?  79  ARG D C     1 
ATOM 2660  O O     . ARG D 4 47  ? 111.535 113.443 87.512  1.00 174.35 ?  79  ARG D O     1 
ATOM 2661  C CB    . ARG D 4 47  ? 110.100 111.328 89.458  1.00 174.35 ?  79  ARG D CB    1 
ATOM 2662  C CG    . ARG D 4 47  ? 109.933 112.610 90.225  1.00 174.35 ?  79  ARG D CG    1 
ATOM 2663  C CD    . ARG D 4 47  ? 109.769 112.336 91.697  1.00 174.35 ?  79  ARG D CD    1 
ATOM 2664  N NE    . ARG D 4 47  ? 108.527 111.629 91.975  1.00 174.35 ?  79  ARG D NE    1 
ATOM 2665  C CZ    . ARG D 4 47  ? 108.207 111.133 93.163  1.00 174.35 ?  79  ARG D CZ    1 
ATOM 2666  N NH1   . ARG D 4 47  ? 109.041 111.279 94.180  1.00 174.35 ?  79  ARG D NH1   1 
ATOM 2667  N NH2   . ARG D 4 47  ? 107.056 110.497 93.336  1.00 174.35 ?  79  ARG D NH2   1 
ATOM 2668  N N     . LEU D 4 48  ? 112.577 111.471 87.262  1.00 170.12 ?  80  LEU D N     1 
ATOM 2669  C CA    . LEU D 4 48  ? 113.798 112.133 86.812  1.00 170.12 ?  80  LEU D CA    1 
ATOM 2670  C C     . LEU D 4 48  ? 113.664 112.641 85.387  1.00 170.12 ?  80  LEU D C     1 
ATOM 2671  O O     . LEU D 4 48  ? 114.093 113.760 85.081  1.00 170.12 ?  80  LEU D O     1 
ATOM 2672  C CB    . LEU D 4 48  ? 114.999 111.205 86.912  1.00 170.12 ?  80  LEU D CB    1 
ATOM 2673  C CG    . LEU D 4 48  ? 115.699 111.154 88.260  1.00 170.12 ?  80  LEU D CG    1 
ATOM 2674  C CD1   . LEU D 4 48  ? 114.989 110.245 89.236  1.00 170.12 ?  80  LEU D CD1   1 
ATOM 2675  C CD2   . LEU D 4 48  ? 117.121 110.727 88.043  1.00 170.12 ?  80  LEU D CD2   1 
ATOM 2676  N N     . ALA D 4 49  ? 113.072 111.837 84.501  1.00 178.33 ?  81  ALA D N     1 
ATOM 2677  C CA    . ALA D 4 49  ? 112.866 112.282 83.129  1.00 178.33 ?  81  ALA D CA    1 
ATOM 2678  C C     . ALA D 4 49  ? 111.842 113.400 83.052  1.00 178.33 ?  81  ALA D C     1 
ATOM 2679  O O     . ALA D 4 49  ? 111.797 114.131 82.059  1.00 178.33 ?  81  ALA D O     1 
ATOM 2680  C CB    . ALA D 4 49  ? 112.430 111.117 82.253  1.00 178.33 ?  81  ALA D CB    1 
ATOM 2681  N N     . HIS D 4 50  ? 111.013 113.545 84.080  1.00 174.44 ?  82  HIS D N     1 
ATOM 2682  C CA    . HIS D 4 50  ? 110.149 114.709 84.173  1.00 174.44 ?  82  HIS D CA    1 
ATOM 2683  C C     . HIS D 4 50  ? 110.857 115.885 84.839  1.00 174.44 ?  82  HIS D C     1 
ATOM 2684  O O     . HIS D 4 50  ? 110.479 117.037 84.608  1.00 174.44 ?  82  HIS D O     1 
ATOM 2685  C CB    . HIS D 4 50  ? 108.880 114.333 84.927  1.00 174.44 ?  82  HIS D CB    1 
ATOM 2686  C CG    . HIS D 4 50  ? 107.856 115.416 84.972  1.00 174.44 ?  82  HIS D CG    1 
ATOM 2687  N ND1   . HIS D 4 50  ? 107.869 116.408 85.928  1.00 174.44 ?  82  HIS D ND1   1 
ATOM 2688  C CD2   . HIS D 4 50  ? 106.775 115.653 84.196  1.00 174.44 ?  82  HIS D CD2   1 
ATOM 2689  C CE1   . HIS D 4 50  ? 106.844 117.216 85.732  1.00 174.44 ?  82  HIS D CE1   1 
ATOM 2690  N NE2   . HIS D 4 50  ? 106.165 116.781 84.687  1.00 174.44 ?  82  HIS D NE2   1 
ATOM 2691  N N     . TYR D 4 51  ? 111.876 115.627 85.666  1.00 184.59 ?  83  TYR D N     1 
ATOM 2692  C CA    . TYR D 4 51  ? 112.618 116.729 86.277  1.00 184.59 ?  83  TYR D CA    1 
ATOM 2693  C C     . TYR D 4 51  ? 113.512 117.426 85.266  1.00 184.59 ?  83  TYR D C     1 
ATOM 2694  O O     . TYR D 4 51  ? 113.388 118.635 85.046  1.00 184.59 ?  83  TYR D O     1 
ATOM 2695  C CB    . TYR D 4 51  ? 113.456 116.245 87.458  1.00 184.59 ?  83  TYR D CB    1 
ATOM 2696  C CG    . TYR D 4 51  ? 112.685 116.066 88.736  1.00 184.59 ?  83  TYR D CG    1 
ATOM 2697  C CD1   . TYR D 4 51  ? 111.471 116.703 88.932  1.00 184.59 ?  83  TYR D CD1   1 
ATOM 2698  C CD2   . TYR D 4 51  ? 113.166 115.246 89.743  1.00 184.59 ?  83  TYR D CD2   1 
ATOM 2699  C CE1   . TYR D 4 51  ? 110.757 116.528 90.102  1.00 184.59 ?  83  TYR D CE1   1 
ATOM 2700  C CE2   . TYR D 4 51  ? 112.458 115.061 90.912  1.00 184.59 ?  83  TYR D CE2   1 
ATOM 2701  C CZ    . TYR D 4 51  ? 111.264 115.718 91.095  1.00 184.59 ?  83  TYR D CZ    1 
ATOM 2702  O OH    . TYR D 4 51  ? 110.559 115.532 92.256  1.00 184.59 ?  83  TYR D OH    1 
ATOM 2703  N N     . ASN D 4 52  ? 114.414 116.687 84.632  1.00 180.05 ?  84  ASN D N     1 
ATOM 2704  C CA    . ASN D 4 52  ? 115.344 117.318 83.707  1.00 180.05 ?  84  ASN D CA    1 
ATOM 2705  C C     . ASN D 4 52  ? 114.728 117.605 82.348  1.00 180.05 ?  84  ASN D C     1 
ATOM 2706  O O     . ASN D 4 52  ? 115.439 118.096 81.465  1.00 180.05 ?  84  ASN D O     1 
ATOM 2707  C CB    . ASN D 4 52  ? 116.582 116.449 83.548  1.00 180.05 ?  84  ASN D CB    1 
ATOM 2708  C CG    . ASN D 4 52  ? 117.391 116.388 84.808  1.00 180.05 ?  84  ASN D CG    1 
ATOM 2709  O OD1   . ASN D 4 52  ? 117.531 117.384 85.511  1.00 180.05 ?  84  ASN D OD1   1 
ATOM 2710  N ND2   . ASN D 4 52  ? 117.930 115.220 85.108  1.00 180.05 ?  84  ASN D ND2   1 
ATOM 2711  N N     . LYS D 4 53  ? 113.448 117.274 82.173  1.00 187.14 ?  85  LYS D N     1 
ATOM 2712  C CA    . LYS D 4 53  ? 112.608 117.690 81.054  1.00 187.14 ?  85  LYS D CA    1 
ATOM 2713  C C     . LYS D 4 53  ? 113.142 117.108 79.742  1.00 187.14 ?  85  LYS D C     1 
ATOM 2714  O O     . LYS D 4 53  ? 113.210 117.761 78.703  1.00 187.14 ?  85  LYS D O     1 
ATOM 2715  C CB    . LYS D 4 53  ? 112.471 119.218 81.024  1.00 187.14 ?  85  LYS D CB    1 
ATOM 2716  C CG    . LYS D 4 53  ? 111.237 119.742 80.317  1.00 187.14 ?  85  LYS D CG    1 
ATOM 2717  C CD    . LYS D 4 53  ? 111.158 121.256 80.416  1.00 187.14 ?  85  LYS D CD    1 
ATOM 2718  C CE    . LYS D 4 53  ? 110.308 121.705 81.600  1.00 187.14 ?  85  LYS D CE    1 
ATOM 2719  N NZ    . LYS D 4 53  ? 111.049 121.614 82.886  1.00 187.14 ?  85  LYS D NZ    1 
ATOM 2720  N N     . ARG D 4 54  ? 113.552 115.848 79.835  1.00 197.73 ?  86  ARG D N     1 
ATOM 2721  C CA    . ARG D 4 54  ? 113.817 114.994 78.691  1.00 197.73 ?  86  ARG D CA    1 
ATOM 2722  C C     . ARG D 4 54  ? 112.585 114.129 78.475  1.00 197.73 ?  86  ARG D C     1 
ATOM 2723  O O     . ARG D 4 54  ? 111.560 114.303 79.138  1.00 197.73 ?  86  ARG D O     1 
ATOM 2724  C CB    . ARG D 4 54  ? 115.067 114.129 78.902  1.00 197.73 ?  86  ARG D CB    1 
ATOM 2725  C CG    . ARG D 4 54  ? 116.390 114.792 78.563  1.00 197.73 ?  86  ARG D CG    1 
ATOM 2726  C CD    . ARG D 4 54  ? 116.857 115.723 79.659  1.00 197.73 ?  86  ARG D CD    1 
ATOM 2727  N NE    . ARG D 4 54  ? 118.150 116.329 79.365  1.00 197.73 ?  86  ARG D NE    1 
ATOM 2728  C CZ    . ARG D 4 54  ? 119.319 115.793 79.698  1.00 197.73 ?  86  ARG D CZ    1 
ATOM 2729  N NH1   . ARG D 4 54  ? 119.357 114.633 80.340  1.00 197.73 ?  86  ARG D NH1   1 
ATOM 2730  N NH2   . ARG D 4 54  ? 120.450 116.415 79.392  1.00 197.73 ?  86  ARG D NH2   1 
ATOM 2731  N N     . SER D 4 55  ? 112.667 113.195 77.538  1.00 213.24 ?  87  SER D N     1 
ATOM 2732  C CA    . SER D 4 55  ? 111.545 112.299 77.310  1.00 213.24 ?  87  SER D CA    1 
ATOM 2733  C C     . SER D 4 55  ? 111.944 110.864 76.998  1.00 213.24 ?  87  SER D C     1 
ATOM 2734  O O     . SER D 4 55  ? 111.125 110.127 76.443  1.00 213.24 ?  87  SER D O     1 
ATOM 2735  C CB    . SER D 4 55  ? 110.656 112.850 76.187  1.00 213.24 ?  87  SER D CB    1 
ATOM 2736  O OG    . SER D 4 55  ? 111.377 112.943 74.977  1.00 213.24 ?  87  SER D OG    1 
ATOM 2737  N N     . THR D 4 56  ? 113.166 110.443 77.316  1.00 211.02 ?  88  THR D N     1 
ATOM 2738  C CA    . THR D 4 56  ? 113.612 109.073 77.086  1.00 211.02 ?  88  THR D CA    1 
ATOM 2739  C C     . THR D 4 56  ? 114.142 108.485 78.385  1.00 211.02 ?  88  THR D C     1 
ATOM 2740  O O     . THR D 4 56  ? 115.184 108.916 78.885  1.00 211.02 ?  88  THR D O     1 
ATOM 2741  C CB    . THR D 4 56  ? 114.698 109.011 76.017  1.00 211.02 ?  88  THR D CB    1 
ATOM 2742  O OG1   . THR D 4 56  ? 115.790 109.850 76.405  1.00 211.02 ?  88  THR D OG1   1 
ATOM 2743  C CG2   . THR D 4 56  ? 114.181 109.461 74.689  1.00 211.02 ?  88  THR D CG2   1 
ATOM 2744  N N     . ILE D 4 57  ? 113.442 107.492 78.921  1.00 197.86 ?  89  ILE D N     1 
ATOM 2745  C CA    . ILE D 4 57  ? 114.005 106.661 79.977  1.00 197.86 ?  89  ILE D CA    1 
ATOM 2746  C C     . ILE D 4 57  ? 115.054 105.769 79.326  1.00 197.86 ?  89  ILE D C     1 
ATOM 2747  O O     . ILE D 4 57  ? 114.721 104.813 78.625  1.00 197.86 ?  89  ILE D O     1 
ATOM 2748  C CB    . ILE D 4 57  ? 112.925 105.834 80.677  1.00 197.86 ?  89  ILE D CB    1 
ATOM 2749  C CG1   . ILE D 4 57  ? 111.959 106.746 81.412  1.00 197.86 ?  89  ILE D CG1   1 
ATOM 2750  C CG2   . ILE D 4 57  ? 113.529 104.875 81.663  1.00 197.86 ?  89  ILE D CG2   1 
ATOM 2751  C CD1   . ILE D 4 57  ? 110.783 106.013 81.963  1.00 197.86 ?  89  ILE D CD1   1 
ATOM 2752  N N     . THR D 4 58  ? 116.321 106.097 79.523  1.00 192.94 ?  90  THR D N     1 
ATOM 2753  C CA    . THR D 4 58  ? 117.406 105.337 78.927  1.00 192.94 ?  90  THR D CA    1 
ATOM 2754  C C     . THR D 4 58  ? 117.947 104.328 79.922  1.00 192.94 ?  90  THR D C     1 
ATOM 2755  O O     . THR D 4 58  ? 117.380 104.100 80.988  1.00 192.94 ?  90  THR D O     1 
ATOM 2756  C CB    . THR D 4 58  ? 118.536 106.254 78.468  1.00 192.94 ?  90  THR D CB    1 
ATOM 2757  O OG1   . THR D 4 58  ? 119.121 106.882 79.612  1.00 192.94 ?  90  THR D OG1   1 
ATOM 2758  C CG2   . THR D 4 58  ? 118.007 107.318 77.532  1.00 192.94 ?  90  THR D CG2   1 
ATOM 2759  N N     . SER D 4 59  ? 119.082 103.732 79.566  1.00 190.41 ?  91  SER D N     1 
ATOM 2760  C CA    . SER D 4 59  ? 119.742 102.817 80.485  1.00 190.41 ?  91  SER D CA    1 
ATOM 2761  C C     . SER D 4 59  ? 120.532 103.562 81.544  1.00 190.41 ?  91  SER D C     1 
ATOM 2762  O O     . SER D 4 59  ? 121.121 102.934 82.426  1.00 190.41 ?  91  SER D O     1 
ATOM 2763  C CB    . SER D 4 59  ? 120.675 101.881 79.733  1.00 190.41 ?  91  SER D CB    1 
ATOM 2764  O OG    . SER D 4 59  ? 121.774 102.602 79.213  1.00 190.41 ?  91  SER D OG    1 
ATOM 2765  N N     . ARG D 4 60  ? 120.591 104.887 81.460  1.00 190.64 ?  92  ARG D N     1 
ATOM 2766  C CA    . ARG D 4 60  ? 121.246 105.641 82.515  1.00 190.64 ?  92  ARG D CA    1 
ATOM 2767  C C     . ARG D 4 60  ? 120.254 106.047 83.594  1.00 190.64 ?  92  ARG D C     1 
ATOM 2768  O O     . ARG D 4 60  ? 120.564 105.978 84.786  1.00 190.64 ?  92  ARG D O     1 
ATOM 2769  C CB    . ARG D 4 60  ? 121.943 106.863 81.936  1.00 190.64 ?  92  ARG D CB    1 
ATOM 2770  C CG    . ARG D 4 60  ? 122.798 107.559 82.947  1.00 190.64 ?  92  ARG D CG    1 
ATOM 2771  C CD    . ARG D 4 60  ? 123.502 108.748 82.376  1.00 190.64 ?  92  ARG D CD    1 
ATOM 2772  N NE    . ARG D 4 60  ? 124.371 109.316 83.389  1.00 190.64 ?  92  ARG D NE    1 
ATOM 2773  C CZ    . ARG D 4 60  ? 123.959 110.177 84.307  1.00 190.64 ?  92  ARG D CZ    1 
ATOM 2774  N NH1   . ARG D 4 60  ? 122.690 110.559 84.332  1.00 190.64 ?  92  ARG D NH1   1 
ATOM 2775  N NH2   . ARG D 4 60  ? 124.812 110.645 85.205  1.00 190.64 ?  92  ARG D NH2   1 
ATOM 2776  N N     . GLU D 4 61  ? 119.038 106.433 83.205  1.00 195.74 ?  93  GLU D N     1 
ATOM 2777  C CA    . GLU D 4 61  ? 118.094 106.941 84.193  1.00 195.74 ?  93  GLU D CA    1 
ATOM 2778  C C     . GLU D 4 61  ? 117.361 105.835 84.936  1.00 195.74 ?  93  GLU D C     1 
ATOM 2779  O O     . GLU D 4 61  ? 116.388 106.118 85.638  1.00 195.74 ?  93  GLU D O     1 
ATOM 2780  C CB    . GLU D 4 61  ? 117.086 107.874 83.538  1.00 195.74 ?  93  GLU D CB    1 
ATOM 2781  C CG    . GLU D 4 61  ? 117.713 109.125 82.991  1.00 195.74 ?  93  GLU D CG    1 
ATOM 2782  C CD    . GLU D 4 61  ? 116.694 110.105 82.465  1.00 195.74 ?  93  GLU D CD    1 
ATOM 2783  O OE1   . GLU D 4 61  ? 115.496 109.766 82.458  1.00 195.74 ?  93  GLU D OE1   1 
ATOM 2784  O OE2   . GLU D 4 61  ? 117.093 111.214 82.054  1.00 195.74 -1 93  GLU D OE2   1 
ATOM 2785  N N     . ILE D 4 62  ? 117.781 104.587 84.784  1.00 184.22 ?  94  ILE D N     1 
ATOM 2786  C CA    . ILE D 4 62  ? 117.397 103.570 85.744  1.00 184.22 ?  94  ILE D CA    1 
ATOM 2787  C C     . ILE D 4 62  ? 118.461 103.467 86.824  1.00 184.22 ?  94  ILE D C     1 
ATOM 2788  O O     . ILE D 4 62  ? 118.147 103.189 87.986  1.00 184.22 ?  94  ILE D O     1 
ATOM 2789  C CB    . ILE D 4 62  ? 117.165 102.241 85.008  1.00 184.22 ?  94  ILE D CB    1 
ATOM 2790  C CG1   . ILE D 4 62  ? 116.069 102.420 83.974  1.00 184.22 ?  94  ILE D CG1   1 
ATOM 2791  C CG2   . ILE D 4 62  ? 116.731 101.140 85.939  1.00 184.22 ?  94  ILE D CG2   1 
ATOM 2792  C CD1   . ILE D 4 62  ? 114.754 102.805 84.573  1.00 184.22 ?  94  ILE D CD1   1 
ATOM 2793  N N     . GLN D 4 63  ? 119.718 103.754 86.468  1.00 183.85 ?  95  GLN D N     1 
ATOM 2794  C CA    . GLN D 4 63  ? 120.842 103.540 87.375  1.00 183.85 ?  95  GLN D CA    1 
ATOM 2795  C C     . GLN D 4 63  ? 120.781 104.469 88.578  1.00 183.85 ?  95  GLN D C     1 
ATOM 2796  O O     . GLN D 4 63  ? 120.956 104.025 89.717  1.00 183.85 ?  95  GLN D O     1 
ATOM 2797  C CB    . GLN D 4 63  ? 122.157 103.722 86.625  1.00 183.85 ?  95  GLN D CB    1 
ATOM 2798  C CG    . GLN D 4 63  ? 123.388 103.473 87.458  1.00 183.85 ?  95  GLN D CG    1 
ATOM 2799  C CD    . GLN D 4 63  ? 124.656 103.551 86.642  1.00 183.85 ?  95  GLN D CD    1 
ATOM 2800  O OE1   . GLN D 4 63  ? 124.616 103.800 85.442  1.00 183.85 ?  95  GLN D OE1   1 
ATOM 2801  N NE2   . GLN D 4 63  ? 125.791 103.342 87.288  1.00 183.85 ?  95  GLN D NE2   1 
ATOM 2802  N N     . THR D 4 64  ? 120.488 105.750 88.358  1.00 184.66 ?  96  THR D N     1 
ATOM 2803  C CA    . THR D 4 64  ? 120.315 106.644 89.497  1.00 184.66 ?  96  THR D CA    1 
ATOM 2804  C C     . THR D 4 64  ? 118.981 106.420 90.194  1.00 184.66 ?  96  THR D C     1 
ATOM 2805  O O     . THR D 4 64  ? 118.746 106.984 91.265  1.00 184.66 ?  96  THR D O     1 
ATOM 2806  C CB    . THR D 4 64  ? 120.432 108.101 89.072  1.00 184.66 ?  96  THR D CB    1 
ATOM 2807  O OG1   . THR D 4 64  ? 119.417 108.388 88.115  1.00 184.66 ?  96  THR D OG1   1 
ATOM 2808  C CG2   . THR D 4 64  ? 121.777 108.372 88.459  1.00 184.66 ?  96  THR D CG2   1 
ATOM 2809  N N     . ALA D 4 65  ? 118.089 105.622 89.610  1.00 182.24 ?  97  ALA D N     1 
ATOM 2810  C CA    . ALA D 4 65  ? 116.919 105.197 90.364  1.00 182.24 ?  97  ALA D CA    1 
ATOM 2811  C C     . ALA D 4 65  ? 117.211 103.935 91.156  1.00 182.24 ?  97  ALA D C     1 
ATOM 2812  O O     . ALA D 4 65  ? 116.561 103.683 92.174  1.00 182.24 ?  97  ALA D O     1 
ATOM 2813  C CB    . ALA D 4 65  ? 115.730 104.983 89.434  1.00 182.24 ?  97  ALA D CB    1 
ATOM 2814  N N     . VAL D 4 66  ? 118.182 103.137 90.714  1.00 183.30 ?  98  VAL D N     1 
ATOM 2815  C CA    . VAL D 4 66  ? 118.565 101.959 91.483  1.00 183.30 ?  98  VAL D CA    1 
ATOM 2816  C C     . VAL D 4 66  ? 119.316 102.377 92.738  1.00 183.30 ?  98  VAL D C     1 
ATOM 2817  O O     . VAL D 4 66  ? 119.109 101.817 93.821  1.00 183.30 ?  98  VAL D O     1 
ATOM 2818  C CB    . VAL D 4 66  ? 119.376 100.993 90.601  1.00 183.30 ?  98  VAL D CB    1 
ATOM 2819  C CG1   . VAL D 4 66  ? 120.005 99.897  91.414  1.00 183.30 ?  98  VAL D CG1   1 
ATOM 2820  C CG2   . VAL D 4 66  ? 118.461 100.348 89.605  1.00 183.30 ?  98  VAL D CG2   1 
ATOM 2821  N N     . ARG D 4 67  ? 120.124 103.430 92.638  1.00 178.80 ?  99  ARG D N     1 
ATOM 2822  C CA    . ARG D 4 67  ? 120.890 103.889 93.790  1.00 178.80 ?  99  ARG D CA    1 
ATOM 2823  C C     . ARG D 4 67  ? 120.040 104.654 94.799  1.00 178.80 ?  99  ARG D C     1 
ATOM 2824  O O     . ARG D 4 67  ? 120.563 105.056 95.839  1.00 178.80 ?  99  ARG D O     1 
ATOM 2825  C CB    . ARG D 4 67  ? 122.053 104.754 93.314  1.00 178.80 ?  99  ARG D CB    1 
ATOM 2826  C CG    . ARG D 4 67  ? 123.039 103.995 92.452  1.00 178.80 ?  99  ARG D CG    1 
ATOM 2827  C CD    . ARG D 4 67  ? 124.007 104.930 91.755  1.00 178.80 ?  99  ARG D CD    1 
ATOM 2828  N NE    . ARG D 4 67  ? 124.958 105.547 92.663  1.00 178.80 ?  99  ARG D NE    1 
ATOM 2829  C CZ    . ARG D 4 67  ? 126.151 105.036 92.934  1.00 178.80 ?  99  ARG D CZ    1 
ATOM 2830  N NH1   . ARG D 4 67  ? 126.534 103.908 92.353  1.00 178.80 ?  99  ARG D NH1   1 
ATOM 2831  N NH2   . ARG D 4 67  ? 126.965 105.657 93.775  1.00 178.80 ?  99  ARG D NH2   1 
ATOM 2832  N N     . LEU D 4 68  ? 118.751 104.868 94.524  1.00 172.39 ?  100 LEU D N     1 
ATOM 2833  C CA    . LEU D 4 68  ? 117.880 105.442 95.542  1.00 172.39 ?  100 LEU D CA    1 
ATOM 2834  C C     . LEU D 4 68  ? 117.030 104.381 96.221  1.00 172.39 ?  100 LEU D C     1 
ATOM 2835  O O     . LEU D 4 68  ? 116.893 104.380 97.447  1.00 172.39 ?  100 LEU D O     1 
ATOM 2836  C CB    . LEU D 4 68  ? 116.973 106.504 94.948  1.00 172.39 ?  100 LEU D CB    1 
ATOM 2837  C CG    . LEU D 4 68  ? 117.670 107.719 94.384  1.00 172.39 ?  100 LEU D CG    1 
ATOM 2838  C CD1   . LEU D 4 68  ? 116.609 108.686 93.960  1.00 172.39 ?  100 LEU D CD1   1 
ATOM 2839  C CD2   . LEU D 4 68  ? 118.590 108.318 95.409  1.00 172.39 ?  100 LEU D CD2   1 
ATOM 2840  N N     . LEU D 4 69  ? 116.448 103.466 95.450  1.00 172.94 ?  101 LEU D N     1 
ATOM 2841  C CA    . LEU D 4 69  ? 115.529 102.486 96.016  1.00 172.94 ?  101 LEU D CA    1 
ATOM 2842  C C     . LEU D 4 69  ? 116.220 101.330 96.719  1.00 172.94 ?  101 LEU D C     1 
ATOM 2843  O O     . LEU D 4 69  ? 115.560 100.328 97.000  1.00 172.94 ?  101 LEU D O     1 
ATOM 2844  C CB    . LEU D 4 69  ? 114.606 101.915 94.942  1.00 172.94 ?  101 LEU D CB    1 
ATOM 2845  C CG    . LEU D 4 69  ? 113.273 102.615 94.702  1.00 172.94 ?  101 LEU D CG    1 
ATOM 2846  C CD1   . LEU D 4 69  ? 112.494 102.609 95.989  1.00 172.94 ?  101 LEU D CD1   1 
ATOM 2847  C CD2   . LEU D 4 69  ? 113.424 104.021 94.172  1.00 172.94 ?  101 LEU D CD2   1 
ATOM 2848  N N     . LEU D 4 70  ? 117.512 101.427 97.004  1.00 188.13 ?  102 LEU D N     1 
ATOM 2849  C CA    . LEU D 4 70  ? 118.208 100.361 97.688  1.00 188.13 ?  102 LEU D CA    1 
ATOM 2850  C C     . LEU D 4 70  ? 119.014 100.923 98.849  1.00 188.13 ?  102 LEU D C     1 
ATOM 2851  O O     . LEU D 4 70  ? 119.450 102.074 98.809  1.00 188.13 ?  102 LEU D O     1 
ATOM 2852  C CB    . LEU D 4 70  ? 119.150 99.618  96.735  1.00 188.13 ?  102 LEU D CB    1 
ATOM 2853  C CG    . LEU D 4 70  ? 118.577 98.952  95.485  1.00 188.13 ?  102 LEU D CG    1 
ATOM 2854  C CD1   . LEU D 4 70  ? 119.708 98.304  94.745  1.00 188.13 ?  102 LEU D CD1   1 
ATOM 2855  C CD2   . LEU D 4 70  ? 117.500 97.944  95.801  1.00 188.13 ?  102 LEU D CD2   1 
ATOM 2856  N N     . PRO D 4 71  ? 119.226 100.140 99.895  1.00 194.94 ?  103 PRO D N     1 
ATOM 2857  C CA    . PRO D 4 71  ? 120.144 100.550 100.958 1.00 194.94 ?  103 PRO D CA    1 
ATOM 2858  C C     . PRO D 4 71  ? 121.592 100.330 100.557 1.00 194.94 ?  103 PRO D C     1 
ATOM 2859  O O     . PRO D 4 71  ? 121.915 100.015 99.411  1.00 194.94 ?  103 PRO D O     1 
ATOM 2860  C CB    . PRO D 4 71  ? 119.756 99.652  102.126 1.00 194.94 ?  103 PRO D CB    1 
ATOM 2861  C CG    . PRO D 4 71  ? 119.218 98.459  101.480 1.00 194.94 ?  103 PRO D CG    1 
ATOM 2862  C CD    . PRO D 4 71  ? 118.494 98.922  100.261 1.00 194.94 ?  103 PRO D CD    1 
ATOM 2863  N N     . GLY D 4 72  ? 122.469 100.498 101.547 1.00 206.09 ?  104 GLY D N     1 
ATOM 2864  C CA    . GLY D 4 72  ? 123.904 100.624 101.361 1.00 206.09 ?  104 GLY D CA    1 
ATOM 2865  C C     . GLY D 4 72  ? 124.661 99.558  100.595 1.00 206.09 ?  104 GLY D C     1 
ATOM 2866  O O     . GLY D 4 72  ? 125.129 99.824  99.487  1.00 206.09 ?  104 GLY D O     1 
ATOM 2867  N N     . GLU D 4 73  ? 124.784 98.351  101.143 1.00 220.14 ?  105 GLU D N     1 
ATOM 2868  C CA    . GLU D 4 73  ? 125.645 97.368  100.496 1.00 220.14 ?  105 GLU D CA    1 
ATOM 2869  C C     . GLU D 4 73  ? 124.915 96.645  99.371  1.00 220.14 ?  105 GLU D C     1 
ATOM 2870  O O     . GLU D 4 73  ? 125.552 96.115  98.455  1.00 220.14 ?  105 GLU D O     1 
ATOM 2871  C CB    . GLU D 4 73  ? 126.190 96.394  101.543 1.00 220.14 ?  105 GLU D CB    1 
ATOM 2872  C CG    . GLU D 4 73  ? 127.246 95.402  101.059 1.00 220.14 ?  105 GLU D CG    1 
ATOM 2873  C CD    . GLU D 4 73  ? 128.540 96.063  100.609 1.00 220.14 ?  105 GLU D CD    1 
ATOM 2874  O OE1   . GLU D 4 73  ? 128.871 97.160  101.108 1.00 220.14 ?  105 GLU D OE1   1 
ATOM 2875  O OE2   . GLU D 4 73  ? 129.233 95.479  99.749  1.00 220.14 -1 105 GLU D OE2   1 
ATOM 2876  N N     . LEU D 4 74  ? 123.584 96.672  99.379  1.00 207.25 ?  106 LEU D N     1 
ATOM 2877  C CA    . LEU D 4 74  ? 122.832 96.097  98.267  1.00 207.25 ?  106 LEU D CA    1 
ATOM 2878  C C     . LEU D 4 74  ? 122.920 96.983  97.027  1.00 207.25 ?  106 LEU D C     1 
ATOM 2879  O O     . LEU D 4 74  ? 122.658 96.529  95.907  1.00 207.25 ?  106 LEU D O     1 
ATOM 2880  C CB    . LEU D 4 74  ? 121.382 95.874  98.697  1.00 207.25 ?  106 LEU D CB    1 
ATOM 2881  C CG    . LEU D 4 74  ? 120.375 95.210  97.765  1.00 207.25 ?  106 LEU D CG    1 
ATOM 2882  C CD1   . LEU D 4 74  ? 120.893 93.863  97.358  1.00 207.25 ?  106 LEU D CD1   1 
ATOM 2883  C CD2   . LEU D 4 74  ? 119.041 95.064  98.461  1.00 207.25 ?  106 LEU D CD2   1 
ATOM 2884  N N     . ALA D 4 75  ? 123.318 98.244  97.205  1.00 199.20 ?  107 ALA D N     1 
ATOM 2885  C CA    . ALA D 4 75  ? 123.481 99.146  96.073  1.00 199.20 ?  107 ALA D CA    1 
ATOM 2886  C C     . ALA D 4 75  ? 124.635 98.739  95.173  1.00 199.20 ?  107 ALA D C     1 
ATOM 2887  O O     . ALA D 4 75  ? 124.451 98.647  93.956  1.00 199.20 ?  107 ALA D O     1 
ATOM 2888  C CB    . ALA D 4 75  ? 123.695 100.574 96.564  1.00 199.20 ?  107 ALA D CB    1 
ATOM 2889  N N     . LYS D 4 76  ? 125.814 98.478  95.748  1.00 192.56 ?  108 LYS D N     1 
ATOM 2890  C CA    . LYS D 4 76  ? 127.032 98.332  94.953  1.00 192.56 ?  108 LYS D CA    1 
ATOM 2891  C C     . LYS D 4 76  ? 127.011 97.071  94.100  1.00 192.56 ?  108 LYS D C     1 
ATOM 2892  O O     . LYS D 4 76  ? 127.613 97.038  93.024  1.00 192.56 ?  108 LYS D O     1 
ATOM 2893  C CB    . LYS D 4 76  ? 128.265 98.326  95.854  1.00 192.56 ?  108 LYS D CB    1 
ATOM 2894  C CG    . LYS D 4 76  ? 128.617 99.662  96.466  1.00 192.56 ?  108 LYS D CG    1 
ATOM 2895  C CD    . LYS D 4 76  ? 129.890 99.545  97.290  1.00 192.56 ?  108 LYS D CD    1 
ATOM 2896  C CE    . LYS D 4 76  ? 130.256 100.863 97.945  1.00 192.56 ?  108 LYS D CE    1 
ATOM 2897  N NZ    . LYS D 4 76  ? 131.501 100.740 98.748  1.00 192.56 ?  108 LYS D NZ    1 
ATOM 2898  N N     . HIS D 4 77  ? 126.330 96.022  94.555  1.00 194.02 ?  109 HIS D N     1 
ATOM 2899  C CA    . HIS D 4 77  ? 126.250 94.828  93.725  1.00 194.02 ?  109 HIS D CA    1 
ATOM 2900  C C     . HIS D 4 77  ? 125.203 94.949  92.635  1.00 194.02 ?  109 HIS D C     1 
ATOM 2901  O O     . HIS D 4 77  ? 125.465 94.537  91.500  1.00 194.02 ?  109 HIS D O     1 
ATOM 2902  C CB    . HIS D 4 77  ? 125.951 93.599  94.566  1.00 194.02 ?  109 HIS D CB    1 
ATOM 2903  C CG    . HIS D 4 77  ? 127.097 93.170  95.414  1.00 194.02 ?  109 HIS D CG    1 
ATOM 2904  N ND1   . HIS D 4 77  ? 126.991 92.176  96.361  1.00 194.02 ?  109 HIS D ND1   1 
ATOM 2905  C CD2   . HIS D 4 77  ? 128.376 93.603  95.461  1.00 194.02 ?  109 HIS D CD2   1 
ATOM 2906  C CE1   . HIS D 4 77  ? 128.159 92.014  96.955  1.00 194.02 ?  109 HIS D CE1   1 
ATOM 2907  N NE2   . HIS D 4 77  ? 129.016 92.869  96.429  1.00 194.02 ?  109 HIS D NE2   1 
ATOM 2908  N N     . ALA D 4 78  ? 124.033 95.503  92.951  1.00 181.75 ?  110 ALA D N     1 
ATOM 2909  C CA    . ALA D 4 78  ? 122.930 95.495  91.999  1.00 181.75 ?  110 ALA D CA    1 
ATOM 2910  C C     . ALA D 4 78  ? 123.191 96.440  90.838  1.00 181.75 ?  110 ALA D C     1 
ATOM 2911  O O     . ALA D 4 78  ? 122.650 96.255  89.745  1.00 181.75 ?  110 ALA D O     1 
ATOM 2912  C CB    . ALA D 4 78  ? 121.629 95.858  92.704  1.00 181.75 ?  110 ALA D CB    1 
ATOM 2913  N N     . VAL D 4 79  ? 124.025 97.456  91.045  1.00 188.23 ?  111 VAL D N     1 
ATOM 2914  C CA    . VAL D 4 79  ? 124.425 98.255  89.898  1.00 188.23 ?  111 VAL D CA    1 
ATOM 2915  C C     . VAL D 4 79  ? 125.561 97.567  89.144  1.00 188.23 ?  111 VAL D C     1 
ATOM 2916  O O     . VAL D 4 79  ? 125.614 97.623  87.910  1.00 188.23 ?  111 VAL D O     1 
ATOM 2917  C CB    . VAL D 4 79  ? 124.768 99.698  90.329  1.00 188.23 ?  111 VAL D CB    1 
ATOM 2918  C CG1   . VAL D 4 79  ? 125.957 99.759  91.267  1.00 188.23 ?  111 VAL D CG1   1 
ATOM 2919  C CG2   . VAL D 4 79  ? 125.011 100.579 89.127  1.00 188.23 ?  111 VAL D CG2   1 
ATOM 2920  N N     . SER D 4 80  ? 126.448 96.854  89.847  1.00 196.35 ?  112 SER D N     1 
ATOM 2921  C CA    . SER D 4 80  ? 127.574 96.225  89.166  1.00 196.35 ?  112 SER D CA    1 
ATOM 2922  C C     . SER D 4 80  ? 127.134 94.972  88.432  1.00 196.35 ?  112 SER D C     1 
ATOM 2923  O O     . SER D 4 80  ? 127.684 94.637  87.378  1.00 196.35 ?  112 SER D O     1 
ATOM 2924  C CB    . SER D 4 80  ? 128.687 95.898  90.157  1.00 196.35 ?  112 SER D CB    1 
ATOM 2925  O OG    . SER D 4 80  ? 129.765 95.245  89.514  1.00 196.35 ?  112 SER D OG    1 
ATOM 2926  N N     . GLU D 4 81  ? 126.136 94.272  88.964  1.00 199.26 ?  113 GLU D N     1 
ATOM 2927  C CA    . GLU D 4 81  ? 125.536 93.190  88.201  1.00 199.26 ?  113 GLU D CA    1 
ATOM 2928  C C     . GLU D 4 81  ? 124.610 93.753  87.135  1.00 199.26 ?  113 GLU D C     1 
ATOM 2929  O O     . GLU D 4 81  ? 124.327 93.085  86.136  1.00 199.26 ?  113 GLU D O     1 
ATOM 2930  C CB    . GLU D 4 81  ? 124.793 92.248  89.146  1.00 199.26 ?  113 GLU D CB    1 
ATOM 2931  C CG    . GLU D 4 81  ? 124.595 90.821  88.657  1.00 199.26 ?  113 GLU D CG    1 
ATOM 2932  C CD    . GLU D 4 81  ? 123.399 90.659  87.755  1.00 199.26 ?  113 GLU D CD    1 
ATOM 2933  O OE1   . GLU D 4 81  ? 122.484 91.503  87.825  1.00 199.26 ?  113 GLU D OE1   1 
ATOM 2934  O OE2   . GLU D 4 81  ? 123.368 89.681  86.981  1.00 199.26 -1 113 GLU D OE2   1 
ATOM 2935  N N     . GLY D 4 82  ? 124.151 94.990  87.316  1.00 191.25 ?  114 GLY D N     1 
ATOM 2936  C CA    . GLY D 4 82  ? 123.334 95.617  86.294  1.00 191.25 ?  114 GLY D CA    1 
ATOM 2937  C C     . GLY D 4 82  ? 124.139 96.016  85.073  1.00 191.25 ?  114 GLY D C     1 
ATOM 2938  O O     . GLY D 4 82  ? 123.725 95.776  83.938  1.00 191.25 ?  114 GLY D O     1 
ATOM 2939  N N     . THR D 4 83  ? 125.305 96.627  85.289  1.00 192.15 ?  115 THR D N     1 
ATOM 2940  C CA    . THR D 4 83  ? 126.130 97.029  84.157  1.00 192.15 ?  115 THR D CA    1 
ATOM 2941  C C     . THR D 4 83  ? 126.777 95.837  83.472  1.00 192.15 ?  115 THR D C     1 
ATOM 2942  O O     . THR D 4 83  ? 127.227 95.959  82.330  1.00 192.15 ?  115 THR D O     1 
ATOM 2943  C CB    . THR D 4 83  ? 127.205 98.018  84.592  1.00 192.15 ?  115 THR D CB    1 
ATOM 2944  O OG1   . THR D 4 83  ? 127.970 97.453  85.662  1.00 192.15 ?  115 THR D OG1   1 
ATOM 2945  C CG2   . THR D 4 83  ? 126.585 99.323  85.026  1.00 192.15 ?  115 THR D CG2   1 
ATOM 2946  N N     . LYS D 4 84  ? 126.826 94.679  84.133  1.00 198.30 ?  116 LYS D N     1 
ATOM 2947  C CA    . LYS D 4 84  ? 127.294 93.485  83.442  1.00 198.30 ?  116 LYS D CA    1 
ATOM 2948  C C     . LYS D 4 84  ? 126.261 93.015  82.425  1.00 198.30 ?  116 LYS D C     1 
ATOM 2949  O O     . LYS D 4 84  ? 126.608 92.331  81.458  1.00 198.30 ?  116 LYS D O     1 
ATOM 2950  C CB    . LYS D 4 84  ? 127.629 92.387  84.457  1.00 198.30 ?  116 LYS D CB    1 
ATOM 2951  C CG    . LYS D 4 84  ? 128.408 91.196  83.902  1.00 198.30 ?  116 LYS D CG    1 
ATOM 2952  C CD    . LYS D 4 84  ? 127.541 89.984  83.600  1.00 198.30 ?  116 LYS D CD    1 
ATOM 2953  C CE    . LYS D 4 84  ? 127.117 89.274  84.869  1.00 198.30 ?  116 LYS D CE    1 
ATOM 2954  N NZ    . LYS D 4 84  ? 126.310 88.056  84.584  1.00 198.30 ?  116 LYS D NZ    1 
ATOM 2955  N N     . ALA D 4 85  ? 124.999 93.410  82.595  1.00 205.08 ?  117 ALA D N     1 
ATOM 2956  C CA    . ALA D 4 85  ? 123.980 93.030  81.627  1.00 205.08 ?  117 ALA D CA    1 
ATOM 2957  C C     . ALA D 4 85  ? 124.042 93.875  80.362  1.00 205.08 ?  117 ALA D C     1 
ATOM 2958  O O     . ALA D 4 85  ? 123.748 93.370  79.276  1.00 205.08 ?  117 ALA D O     1 
ATOM 2959  C CB    . ALA D 4 85  ? 122.594 93.128  82.254  1.00 205.08 ?  117 ALA D CB    1 
ATOM 2960  N N     . VAL D 4 86  ? 124.413 95.151  80.465  1.00 205.35 ?  118 VAL D N     1 
ATOM 2961  C CA    . VAL D 4 86  ? 124.372 96.005  79.283  1.00 205.35 ?  118 VAL D CA    1 
ATOM 2962  C C     . VAL D 4 86  ? 125.623 95.811  78.435  1.00 205.35 ?  118 VAL D C     1 
ATOM 2963  O O     . VAL D 4 86  ? 125.557 95.838  77.200  1.00 205.35 ?  118 VAL D O     1 
ATOM 2964  C CB    . VAL D 4 86  ? 124.168 97.473  79.699  1.00 205.35 ?  118 VAL D CB    1 
ATOM 2965  C CG1   . VAL D 4 86  ? 124.166 98.409  78.506  1.00 205.35 ?  118 VAL D CG1   1 
ATOM 2966  C CG2   . VAL D 4 86  ? 122.864 97.604  80.427  1.00 205.35 ?  118 VAL D CG2   1 
ATOM 2967  N N     . THR D 4 87  ? 126.771 95.565  79.077  1.00 216.57 ?  119 THR D N     1 
ATOM 2968  C CA    . THR D 4 87  ? 128.034 95.494  78.344  1.00 216.57 ?  119 THR D CA    1 
ATOM 2969  C C     . THR D 4 87  ? 128.094 94.284  77.421  1.00 216.57 ?  119 THR D C     1 
ATOM 2970  O O     . THR D 4 87  ? 128.611 94.381  76.303  1.00 216.57 ?  119 THR D O     1 
ATOM 2971  C CB    . THR D 4 87  ? 129.218 95.485  79.307  1.00 216.57 ?  119 THR D CB    1 
ATOM 2972  O OG1   . THR D 4 87  ? 129.047 94.442  80.275  1.00 216.57 ?  119 THR D OG1   1 
ATOM 2973  C CG2   . THR D 4 87  ? 129.372 96.833  79.990  1.00 216.57 ?  119 THR D CG2   1 
ATOM 2974  N N     . LYS D 4 88  ? 127.553 93.145  77.845  1.00 216.90 ?  120 LYS D N     1 
ATOM 2975  C CA    . LYS D 4 88  ? 127.462 92.041  76.902  1.00 216.90 ?  120 LYS D CA    1 
ATOM 2976  C C     . LYS D 4 88  ? 126.137 92.030  76.156  1.00 216.90 ?  120 LYS D C     1 
ATOM 2977  O O     . LYS D 4 88  ? 125.815 91.035  75.504  1.00 216.90 ?  120 LYS D O     1 
ATOM 2978  C CB    . LYS D 4 88  ? 127.705 90.706  77.607  1.00 216.90 ?  120 LYS D CB    1 
ATOM 2979  C CG    . LYS D 4 88  ? 126.655 90.287  78.599  1.00 216.90 ?  120 LYS D CG    1 
ATOM 2980  C CD    . LYS D 4 88  ? 127.092 89.011  79.302  1.00 216.90 ?  120 LYS D CD    1 
ATOM 2981  C CE    . LYS D 4 88  ? 127.071 87.820  78.363  1.00 216.90 ?  120 LYS D CE    1 
ATOM 2982  N NZ    . LYS D 4 88  ? 125.682 87.476  77.962  1.00 216.90 ?  120 LYS D NZ    1 
ATOM 2983  N N     . TYR D 4 89  ? 125.366 93.114  76.236  1.00 207.87 ?  121 TYR D N     1 
ATOM 2984  C CA    . TYR D 4 89  ? 124.224 93.273  75.347  1.00 207.87 ?  121 TYR D CA    1 
ATOM 2985  C C     . TYR D 4 89  ? 124.584 94.105  74.130  1.00 207.87 ?  121 TYR D C     1 
ATOM 2986  O O     . TYR D 4 89  ? 124.071 93.857  73.036  1.00 207.87 ?  121 TYR D O     1 
ATOM 2987  C CB    . TYR D 4 89  ? 123.067 93.922  76.092  1.00 207.87 ?  121 TYR D CB    1 
ATOM 2988  C CG    . TYR D 4 89  ? 121.822 94.080  75.270  1.00 207.87 ?  121 TYR D CG    1 
ATOM 2989  C CD1   . TYR D 4 89  ? 121.016 92.991  74.999  1.00 207.87 ?  121 TYR D CD1   1 
ATOM 2990  C CD2   . TYR D 4 89  ? 121.441 95.317  74.784  1.00 207.87 ?  121 TYR D CD2   1 
ATOM 2991  C CE1   . TYR D 4 89  ? 119.869 93.126  74.257  1.00 207.87 ?  121 TYR D CE1   1 
ATOM 2992  C CE2   . TYR D 4 89  ? 120.295 95.463  74.043  1.00 207.87 ?  121 TYR D CE2   1 
ATOM 2993  C CZ    . TYR D 4 89  ? 119.513 94.363  73.785  1.00 207.87 ?  121 TYR D CZ    1 
ATOM 2994  O OH    . TYR D 4 89  ? 118.369 94.498  73.042  1.00 207.87 ?  121 TYR D OH    1 
ATOM 2995  N N     . THR D 4 90  ? 125.448 95.103  74.306  1.00 211.83 ?  122 THR D N     1 
ATOM 2996  C CA    . THR D 4 90  ? 125.897 95.902  73.174  1.00 211.83 ?  122 THR D CA    1 
ATOM 2997  C C     . THR D 4 90  ? 126.927 95.144  72.350  1.00 211.83 ?  122 THR D C     1 
ATOM 2998  O O     . THR D 4 90  ? 126.769 94.981  71.135  1.00 211.83 ?  122 THR D O     1 
ATOM 2999  C CB    . THR D 4 90  ? 126.470 97.231  73.665  1.00 211.83 ?  122 THR D CB    1 
ATOM 3000  O OG1   . THR D 4 90  ? 125.433 98.002  74.282  1.00 211.83 ?  122 THR D OG1   1 
ATOM 3001  C CG2   . THR D 4 90  ? 127.058 98.018  72.514  1.00 211.83 ?  122 THR D CG2   1 
ATOM 3002  N N     . SER D 4 91  ? 127.983 94.656  72.997  1.00 221.87 ?  123 SER D N     1 
ATOM 3003  C CA    . SER D 4 91  ? 129.041 93.927  72.301  1.00 221.87 ?  123 SER D CA    1 
ATOM 3004  C C     . SER D 4 91  ? 128.583 92.486  72.087  1.00 221.87 ?  123 SER D C     1 
ATOM 3005  O O     . SER D 4 91  ? 129.038 91.544  72.740  1.00 221.87 ?  123 SER D O     1 
ATOM 3006  C CB    . SER D 4 91  ? 130.343 93.994  73.086  1.00 221.87 ?  123 SER D CB    1 
ATOM 3007  O OG    . SER D 4 91  ? 130.233 93.290  74.308  1.00 221.87 ?  123 SER D OG    1 
ATOM 3008  N N     . SER D 4 92  ? 127.663 92.319  71.144  1.00 214.00 ?  124 SER D N     1 
ATOM 3009  C CA    . SER D 4 92  ? 127.130 91.006  70.817  1.00 214.00 ?  124 SER D CA    1 
ATOM 3010  C C     . SER D 4 92  ? 127.656 90.542  69.465  1.00 214.00 ?  124 SER D C     1 
ATOM 3011  O O     . SER D 4 92  ? 128.725 90.969  69.027  1.00 214.00 ?  124 SER D O     1 
ATOM 3012  C CB    . SER D 4 92  ? 125.601 91.031  70.814  1.00 214.00 ?  124 SER D CB    1 
ATOM 3013  O OG    . SER D 4 92  ? 125.107 91.861  69.777  1.00 214.00 ?  124 SER D OG    1 
ATOM 3014  N N     . SER E 1 4   ? 101.911 70.056  141.201 1.00 269.84 ?  41  SER E N     1 
ATOM 3015  C CA    . SER E 1 4   ? 102.495 71.390  141.261 1.00 269.84 ?  41  SER E CA    1 
ATOM 3016  C C     . SER E 1 4   ? 101.408 72.451  141.381 1.00 269.84 ?  41  SER E C     1 
ATOM 3017  O O     . SER E 1 4   ? 100.263 72.220  140.992 1.00 269.84 ?  41  SER E O     1 
ATOM 3018  C CB    . SER E 1 4   ? 103.354 71.647  140.034 1.00 269.84 ?  41  SER E CB    1 
ATOM 3019  N N     . ARG E 1 5   ? 101.771 73.610  141.935 1.00 281.28 ?  42  ARG E N     1 
ATOM 3020  C CA    . ARG E 1 5   ? 100.836 74.728  142.000 1.00 281.28 ?  42  ARG E CA    1 
ATOM 3021  C C     . ARG E 1 5   ? 100.579 75.293  140.610 1.00 281.28 ?  42  ARG E C     1 
ATOM 3022  O O     . ARG E 1 5   ? 99.428  75.421  140.176 1.00 281.28 ?  42  ARG E O     1 
ATOM 3023  C CB    . ARG E 1 5   ? 101.376 75.809  142.937 1.00 281.28 ?  42  ARG E CB    1 
ATOM 3024  N N     . ARG E 1 6   ? 101.645 75.641  139.900 1.00 271.35 ?  43  ARG E N     1 
ATOM 3025  C CA    . ARG E 1 6   ? 101.583 75.999  138.494 1.00 271.35 ?  43  ARG E CA    1 
ATOM 3026  C C     . ARG E 1 6   ? 102.858 75.522  137.821 1.00 271.35 ?  43  ARG E C     1 
ATOM 3027  O O     . ARG E 1 6   ? 103.960 75.910  138.219 1.00 271.35 ?  43  ARG E O     1 
ATOM 3028  C CB    . ARG E 1 6   ? 101.418 77.511  138.301 1.00 271.35 ?  43  ARG E CB    1 
ATOM 3029  N N     . ARG E 1 7   ? 102.702 74.647  136.824 1.00 261.19 ?  44  ARG E N     1 
ATOM 3030  C CA    . ARG E 1 7   ? 103.860 74.095  136.130 1.00 261.19 ?  44  ARG E CA    1 
ATOM 3031  C C     . ARG E 1 7   ? 104.618 75.168  135.356 1.00 261.19 ?  44  ARG E C     1 
ATOM 3032  O O     . ARG E 1 7   ? 105.701 75.584  135.781 1.00 261.19 ?  44  ARG E O     1 
ATOM 3033  C CB    . ARG E 1 7   ? 103.421 72.974  135.185 1.00 261.19 ?  44  ARG E CB    1 
ATOM 3034  N N     . GLN E 1 8   ? 104.026 75.642  134.252 1.00 253.91 ?  45  GLN E N     1 
ATOM 3035  C CA    . GLN E 1 8   ? 104.417 76.856  133.540 1.00 253.91 ?  45  GLN E CA    1 
ATOM 3036  C C     . GLN E 1 8   ? 103.329 77.192  132.530 1.00 253.91 ?  45  GLN E C     1 
ATOM 3037  O O     . GLN E 1 8   ? 103.008 76.364  131.672 1.00 253.91 ?  45  GLN E O     1 
ATOM 3038  C CB    . GLN E 1 8   ? 105.752 76.694  132.810 1.00 253.91 ?  45  GLN E CB    1 
ATOM 3039  C CG    . GLN E 1 8   ? 106.338 78.006  132.363 1.00 253.91 ?  45  GLN E CG    1 
ATOM 3040  C CD    . GLN E 1 8   ? 106.758 78.857  133.543 1.00 253.91 ?  45  GLN E CD    1 
ATOM 3041  O OE1   . GLN E 1 8   ? 107.318 78.354  134.513 1.00 253.91 ?  45  GLN E OE1   1 
ATOM 3042  N NE2   . GLN E 1 8   ? 106.481 80.147  133.471 1.00 253.91 ?  45  GLN E NE2   1 
ATOM 3043  N N     . GLY E 1 9   ? 102.758 78.387  132.601 1.00 239.54 ?  46  GLY E N     1 
ATOM 3044  C CA    . GLY E 1 9   ? 101.702 78.719  131.666 1.00 239.54 ?  46  GLY E CA    1 
ATOM 3045  C C     . GLY E 1 9   ? 102.112 79.593  130.501 1.00 239.54 ?  46  GLY E C     1 
ATOM 3046  O O     . GLY E 1 9   ? 101.834 79.267  129.344 1.00 239.54 ?  46  GLY E O     1 
ATOM 3047  N N     . TRP E 1 10  ? 102.789 80.703  130.789 1.00 223.28 ?  47  TRP E N     1 
ATOM 3048  C CA    . TRP E 1 10  ? 102.974 81.714  129.759 1.00 223.28 ?  47  TRP E CA    1 
ATOM 3049  C C     . TRP E 1 10  ? 104.134 81.384  128.833 1.00 223.28 ?  47  TRP E C     1 
ATOM 3050  O O     . TRP E 1 10  ? 104.081 81.709  127.645 1.00 223.28 ?  47  TRP E O     1 
ATOM 3051  C CB    . TRP E 1 10  ? 103.181 83.082  130.398 1.00 223.28 ?  47  TRP E CB    1 
ATOM 3052  C CG    . TRP E 1 10  ? 104.398 83.163  131.237 1.00 223.28 ?  47  TRP E CG    1 
ATOM 3053  C CD1   . TRP E 1 10  ? 104.501 82.864  132.558 1.00 223.28 ?  47  TRP E CD1   1 
ATOM 3054  C CD2   . TRP E 1 10  ? 105.700 83.568  130.813 1.00 223.28 ?  47  TRP E CD2   1 
ATOM 3055  N NE1   . TRP E 1 10  ? 105.788 83.062  132.989 1.00 223.28 ?  47  TRP E NE1   1 
ATOM 3056  C CE2   . TRP E 1 10  ? 106.545 83.489  131.932 1.00 223.28 ?  47  TRP E CE2   1 
ATOM 3057  C CE3   . TRP E 1 10  ? 106.232 83.990  129.595 1.00 223.28 ?  47  TRP E CE3   1 
ATOM 3058  C CZ2   . TRP E 1 10  ? 107.893 83.816  131.870 1.00 223.28 ?  47  TRP E CZ2   1 
ATOM 3059  C CZ3   . TRP E 1 10  ? 107.567 84.313  129.536 1.00 223.28 ?  47  TRP E CZ3   1 
ATOM 3060  C CH2   . TRP E 1 10  ? 108.384 84.223  130.664 1.00 223.28 ?  47  TRP E CH2   1 
ATOM 3061  N N     . LEU E 1 11  ? 105.182 80.741  129.342 1.00 211.02 ?  48  LEU E N     1 
ATOM 3062  C CA    . LEU E 1 11  ? 106.383 80.562  128.535 1.00 211.02 ?  48  LEU E CA    1 
ATOM 3063  C C     . LEU E 1 11  ? 106.194 79.449  127.514 1.00 211.02 ?  48  LEU E C     1 
ATOM 3064  O O     . LEU E 1 11  ? 106.680 79.548  126.383 1.00 211.02 ?  48  LEU E O     1 
ATOM 3065  C CB    . LEU E 1 11  ? 107.585 80.296  129.448 1.00 211.02 ?  48  LEU E CB    1 
ATOM 3066  C CG    . LEU E 1 11  ? 109.037 80.352  128.955 1.00 211.02 ?  48  LEU E CG    1 
ATOM 3067  C CD1   . LEU E 1 11  ? 109.523 79.062  128.302 1.00 211.02 ?  48  LEU E CD1   1 
ATOM 3068  C CD2   . LEU E 1 11  ? 109.218 81.514  128.001 1.00 211.02 ?  48  LEU E CD2   1 
ATOM 3069  N N     . LYS E 1 12  ? 105.496 78.383  127.890 1.00 202.49 ?  49  LYS E N     1 
ATOM 3070  C CA    . LYS E 1 12  ? 105.266 77.307  126.938 1.00 202.49 ?  49  LYS E CA    1 
ATOM 3071  C C     . LYS E 1 12  ? 104.218 77.678  125.903 1.00 202.49 ?  49  LYS E C     1 
ATOM 3072  O O     . LYS E 1 12  ? 104.201 77.097  124.815 1.00 202.49 ?  49  LYS E O     1 
ATOM 3073  C CB    . LYS E 1 12  ? 104.854 76.030  127.668 1.00 202.49 ?  49  LYS E CB    1 
ATOM 3074  C CG    . LYS E 1 12  ? 105.937 75.449  128.561 1.00 202.49 ?  49  LYS E CG    1 
ATOM 3075  C CD    . LYS E 1 12  ? 107.091 74.889  127.740 1.00 202.49 ?  49  LYS E CD    1 
ATOM 3076  C CE    . LYS E 1 12  ? 108.125 74.211  128.630 1.00 202.49 ?  49  LYS E CE    1 
ATOM 3077  N NZ    . LYS E 1 12  ? 109.274 73.668  127.853 1.00 202.49 ?  49  LYS E NZ    1 
ATOM 3078  N N     . GLU E 1 13  ? 103.343 78.632  126.209 1.00 203.66 ?  50  GLU E N     1 
ATOM 3079  C CA    . GLU E 1 13  ? 102.314 78.990  125.242 1.00 203.66 ?  50  GLU E CA    1 
ATOM 3080  C C     . GLU E 1 13  ? 102.844 79.986  124.215 1.00 203.66 ?  50  GLU E C     1 
ATOM 3081  O O     . GLU E 1 13  ? 102.442 79.948  123.047 1.00 203.66 ?  50  GLU E O     1 
ATOM 3082  C CB    . GLU E 1 13  ? 101.086 79.544  125.963 1.00 203.66 ?  50  GLU E CB    1 
ATOM 3083  C CG    . GLU E 1 13  ? 99.881  79.743  125.061 1.00 203.66 ?  50  GLU E CG    1 
ATOM 3084  C CD    . GLU E 1 13  ? 98.670  80.263  125.800 1.00 203.66 ?  50  GLU E CD    1 
ATOM 3085  O OE1   . GLU E 1 13  ? 98.777  80.518  127.014 1.00 203.66 ?  50  GLU E OE1   1 
ATOM 3086  O OE2   . GLU E 1 13  ? 97.606  80.409  125.166 1.00 203.66 -1 50  GLU E OE2   1 
ATOM 3087  N N     . ILE E 1 14  ? 103.756 80.872  124.625 1.00 199.30 ?  51  ILE E N     1 
ATOM 3088  C CA    . ILE E 1 14  ? 104.257 81.906  123.721 1.00 199.30 ?  51  ILE E CA    1 
ATOM 3089  C C     . ILE E 1 14  ? 105.153 81.304  122.649 1.00 199.30 ?  51  ILE E C     1 
ATOM 3090  O O     . ILE E 1 14  ? 104.976 81.569  121.454 1.00 199.30 ?  51  ILE E O     1 
ATOM 3091  C CB    . ILE E 1 14  ? 104.976 83.011  124.511 1.00 199.30 ?  51  ILE E CB    1 
ATOM 3092  C CG1   . ILE E 1 14  ? 103.951 83.921  125.161 1.00 199.30 ?  51  ILE E CG1   1 
ATOM 3093  C CG2   . ILE E 1 14  ? 105.921 83.809  123.644 1.00 199.30 ?  51  ILE E CG2   1 
ATOM 3094  C CD1   . ILE E 1 14  ? 104.565 84.918  126.085 1.00 199.30 ?  51  ILE E CD1   1 
ATOM 3095  N N     . ARG E 1 15  ? 106.099 80.452  123.048 1.00 202.24 ?  52  ARG E N     1 
ATOM 3096  C CA    . ARG E 1 15  ? 107.018 79.883  122.069 1.00 202.24 ?  52  ARG E CA    1 
ATOM 3097  C C     . ARG E 1 15  ? 106.319 78.838  121.207 1.00 202.24 ?  52  ARG E C     1 
ATOM 3098  O O     . ARG E 1 15  ? 106.821 78.464  120.143 1.00 202.24 ?  52  ARG E O     1 
ATOM 3099  C CB    . ARG E 1 15  ? 108.240 79.303  122.787 1.00 202.24 ?  52  ARG E CB    1 
ATOM 3100  C CG    . ARG E 1 15  ? 109.441 79.046  121.891 1.00 202.24 ?  52  ARG E CG    1 
ATOM 3101  C CD    . ARG E 1 15  ? 110.629 78.529  122.667 1.00 202.24 ?  52  ARG E CD    1 
ATOM 3102  N NE    . ARG E 1 15  ? 111.118 79.502  123.636 1.00 202.24 ?  52  ARG E NE    1 
ATOM 3103  C CZ    . ARG E 1 15  ? 111.088 79.316  124.949 1.00 202.24 ?  52  ARG E CZ    1 
ATOM 3104  N NH1   . ARG E 1 15  ? 110.597 78.191  125.444 1.00 202.24 ?  52  ARG E NH1   1 
ATOM 3105  N NH2   . ARG E 1 15  ? 111.551 80.249  125.766 1.00 202.24 ?  52  ARG E NH2   1 
ATOM 3106  N N     . LYS E 1 16  ? 105.142 78.382  121.629 1.00 191.58 ?  53  LYS E N     1 
ATOM 3107  C CA    . LYS E 1 16  ? 104.292 77.620  120.728 1.00 191.58 ?  53  LYS E CA    1 
ATOM 3108  C C     . LYS E 1 16  ? 103.699 78.514  119.648 1.00 191.58 ?  53  LYS E C     1 
ATOM 3109  O O     . LYS E 1 16  ? 103.646 78.124  118.477 1.00 191.58 ?  53  LYS E O     1 
ATOM 3110  C CB    . LYS E 1 16  ? 103.188 76.927  121.519 1.00 191.58 ?  53  LYS E CB    1 
ATOM 3111  C CG    . LYS E 1 16  ? 102.290 76.029  120.698 1.00 191.58 ?  53  LYS E CG    1 
ATOM 3112  C CD    . LYS E 1 16  ? 101.297 75.326  121.600 1.00 191.58 ?  53  LYS E CD    1 
ATOM 3113  C CE    . LYS E 1 16  ? 100.362 74.438  120.816 1.00 191.58 ?  53  LYS E CE    1 
ATOM 3114  N NZ    . LYS E 1 16  ? 99.406  73.746  121.722 1.00 191.58 ?  53  LYS E NZ    1 
ATOM 3115  N N     . LEU E 1 17  ? 103.263 79.722  120.010 1.00 185.33 ?  54  LEU E N     1 
ATOM 3116  C CA    . LEU E 1 17  ? 102.534 80.547  119.052 1.00 185.33 ?  54  LEU E CA    1 
ATOM 3117  C C     . LEU E 1 17  ? 103.446 81.264  118.067 1.00 185.33 ?  54  LEU E C     1 
ATOM 3118  O O     . LEU E 1 17  ? 103.070 81.429  116.903 1.00 185.33 ?  54  LEU E O     1 
ATOM 3119  C CB    . LEU E 1 17  ? 101.655 81.561  119.775 1.00 185.33 ?  54  LEU E CB    1 
ATOM 3120  C CG    . LEU E 1 17  ? 100.464 80.941  120.494 1.00 185.33 ?  54  LEU E CG    1 
ATOM 3121  C CD1   . LEU E 1 17  ? 99.679  81.999  121.226 1.00 185.33 ?  54  LEU E CD1   1 
ATOM 3122  C CD2   . LEU E 1 17  ? 99.587  80.232  119.497 1.00 185.33 ?  54  LEU E CD2   1 
ATOM 3123  N N     . GLN E 1 18  ? 104.632 81.696  118.488 1.00 192.09 ?  55  GLN E N     1 
ATOM 3124  C CA    . GLN E 1 18  ? 105.566 82.258  117.522 1.00 192.09 ?  55  GLN E CA    1 
ATOM 3125  C C     . GLN E 1 18  ? 106.152 81.207  116.597 1.00 192.09 ?  55  GLN E C     1 
ATOM 3126  O O     . GLN E 1 18  ? 106.673 81.557  115.536 1.00 192.09 ?  55  GLN E O     1 
ATOM 3127  C CB    . GLN E 1 18  ? 106.696 83.000  118.231 1.00 192.09 ?  55  GLN E CB    1 
ATOM 3128  C CG    . GLN E 1 18  ? 106.277 84.319  118.820 1.00 192.09 ?  55  GLN E CG    1 
ATOM 3129  C CD    . GLN E 1 18  ? 107.425 85.042  119.483 1.00 192.09 ?  55  GLN E CD    1 
ATOM 3130  O OE1   . GLN E 1 18  ? 108.517 84.498  119.622 1.00 192.09 ?  55  GLN E OE1   1 
ATOM 3131  N NE2   . GLN E 1 18  ? 107.193 86.288  119.865 1.00 192.09 ?  55  GLN E NE2   1 
ATOM 3132  N N     . LYS E 1 19  ? 106.075 79.936  116.971 1.00 188.72 ?  56  LYS E N     1 
ATOM 3133  C CA    . LYS E 1 19  ? 106.579 78.864  116.129 1.00 188.72 ?  56  LYS E CA    1 
ATOM 3134  C C     . LYS E 1 19  ? 105.690 78.636  114.917 1.00 188.72 ?  56  LYS E C     1 
ATOM 3135  O O     . LYS E 1 19  ? 106.186 78.245  113.857 1.00 188.72 ?  56  LYS E O     1 
ATOM 3136  C CB    . LYS E 1 19  ? 106.689 77.587  116.963 1.00 188.72 ?  56  LYS E CB    1 
ATOM 3137  C CG    . LYS E 1 19  ? 107.335 76.379  116.311 1.00 188.72 ?  56  LYS E CG    1 
ATOM 3138  C CD    . LYS E 1 19  ? 107.370 75.242  117.327 1.00 188.72 ?  56  LYS E CD    1 
ATOM 3139  C CE    . LYS E 1 19  ? 107.966 73.971  116.764 1.00 188.72 ?  56  LYS E CE    1 
ATOM 3140  N NZ    . LYS E 1 19  ? 107.954 72.889  117.787 1.00 188.72 ?  56  LYS E NZ    1 
ATOM 3141  N N     . SER E 1 20  ? 104.393 78.889  115.044 1.00 189.69 ?  57  SER E N     1 
ATOM 3142  C CA    . SER E 1 20  ? 103.429 78.556  114.009 1.00 189.69 ?  57  SER E CA    1 
ATOM 3143  C C     . SER E 1 20  ? 102.909 79.821  113.341 1.00 189.69 ?  57  SER E C     1 
ATOM 3144  O O     . SER E 1 20  ? 103.360 80.932  113.616 1.00 189.69 ?  57  SER E O     1 
ATOM 3145  C CB    . SER E 1 20  ? 102.277 77.737  114.586 1.00 189.69 ?  57  SER E CB    1 
ATOM 3146  O OG    . SER E 1 20  ? 101.496 78.525  115.461 1.00 189.69 ?  57  SER E OG    1 
ATOM 3147  N N     . THR E 1 21  ? 101.944 79.633  112.447 1.00 173.54 ?  58  THR E N     1 
ATOM 3148  C CA    . THR E 1 21  ? 101.465 80.710  111.596 1.00 173.54 ?  58  THR E CA    1 
ATOM 3149  C C     . THR E 1 21  ? 99.949  80.680  111.420 1.00 173.54 ?  58  THR E C     1 
ATOM 3150  O O     . THR E 1 21  ? 99.444  80.817  110.301 1.00 173.54 ?  58  THR E O     1 
ATOM 3151  C CB    . THR E 1 21  ? 102.180 80.673  110.245 1.00 173.54 ?  58  THR E CB    1 
ATOM 3152  O OG1   . THR E 1 21  ? 101.590 81.631  109.358 1.00 173.54 ?  58  THR E OG1   1 
ATOM 3153  C CG2   . THR E 1 21  ? 102.180 79.264  109.633 1.00 173.54 ?  58  THR E CG2   1 
ATOM 3154  N N     . HIS E 1 22  ? 99.205  80.550  112.515 1.00 171.68 ?  59  HIS E N     1 
ATOM 3155  C CA    . HIS E 1 22  ? 97.751  80.482  112.461 1.00 171.68 ?  59  HIS E CA    1 
ATOM 3156  C C     . HIS E 1 22  ? 97.136  81.830  112.099 1.00 171.68 ?  59  HIS E C     1 
ATOM 3157  O O     . HIS E 1 22  ? 97.814  82.811  111.787 1.00 171.68 ?  59  HIS E O     1 
ATOM 3158  C CB    . HIS E 1 22  ? 97.158  80.088  113.814 1.00 171.68 ?  59  HIS E CB    1 
ATOM 3159  C CG    . HIS E 1 22  ? 97.558  78.735  114.297 1.00 171.68 ?  59  HIS E CG    1 
ATOM 3160  N ND1   . HIS E 1 22  ? 97.068  77.573  113.745 1.00 171.68 ?  59  HIS E ND1   1 
ATOM 3161  C CD2   . HIS E 1 22  ? 98.368  78.359  115.314 1.00 171.68 ?  59  HIS E CD2   1 
ATOM 3162  C CE1   . HIS E 1 22  ? 97.581  76.537  114.384 1.00 171.68 ?  59  HIS E CE1   1 
ATOM 3163  N NE2   . HIS E 1 22  ? 98.373  76.987  115.340 1.00 171.68 ?  59  HIS E NE2   1 
ATOM 3164  N N     . LEU E 1 23  ? 95.813  81.852  112.135 1.00 168.21 ?  60  LEU E N     1 
ATOM 3165  C CA    . LEU E 1 23  ? 95.097  83.077  112.425 1.00 168.21 ?  60  LEU E CA    1 
ATOM 3166  C C     . LEU E 1 23  ? 94.492  82.975  113.820 1.00 168.21 ?  60  LEU E C     1 
ATOM 3167  O O     . LEU E 1 23  ? 94.178  81.889  114.309 1.00 168.21 ?  60  LEU E O     1 
ATOM 3168  C CB    . LEU E 1 23  ? 94.024  83.336  111.378 1.00 168.21 ?  60  LEU E CB    1 
ATOM 3169  C CG    . LEU E 1 23  ? 94.642  83.582  110.009 1.00 168.21 ?  60  LEU E CG    1 
ATOM 3170  C CD1   . LEU E 1 23  ? 93.565  83.710  108.958 1.00 168.21 ?  60  LEU E CD1   1 
ATOM 3171  C CD2   . LEU E 1 23  ? 95.513  84.818  110.051 1.00 168.21 ?  60  LEU E CD2   1 
ATOM 3172  N N     . LEU E 1 24  ? 94.343  84.118  114.473 1.00 167.83 ?  61  LEU E N     1 
ATOM 3173  C CA    . LEU E 1 24  ? 94.076  84.127  115.898 1.00 167.83 ?  61  LEU E CA    1 
ATOM 3174  C C     . LEU E 1 24  ? 92.709  84.676  116.265 1.00 167.83 ?  61  LEU E C     1 
ATOM 3175  O O     . LEU E 1 24  ? 92.344  84.643  117.443 1.00 167.83 ?  61  LEU E O     1 
ATOM 3176  C CB    . LEU E 1 24  ? 95.154  84.931  116.621 1.00 167.83 ?  61  LEU E CB    1 
ATOM 3177  C CG    . LEU E 1 24  ? 96.555  84.380  116.401 1.00 167.83 ?  61  LEU E CG    1 
ATOM 3178  C CD1   . LEU E 1 24  ? 97.579  85.228  117.119 1.00 167.83 ?  61  LEU E CD1   1 
ATOM 3179  C CD2   . LEU E 1 24  ? 96.628  82.940  116.844 1.00 167.83 ?  61  LEU E CD2   1 
ATOM 3180  N N     . ILE E 1 25  ? 91.952  85.190  115.307 1.00 172.57 ?  62  ILE E N     1 
ATOM 3181  C CA    . ILE E 1 25  ? 90.569  85.583  115.520 1.00 172.57 ?  62  ILE E CA    1 
ATOM 3182  C C     . ILE E 1 25  ? 89.711  84.714  114.620 1.00 172.57 ?  62  ILE E C     1 
ATOM 3183  O O     . ILE E 1 25  ? 90.004  84.580  113.428 1.00 172.57 ?  62  ILE E O     1 
ATOM 3184  C CB    . ILE E 1 25  ? 90.346  87.073  115.222 1.00 172.57 ?  62  ILE E CB    1 
ATOM 3185  C CG1   . ILE E 1 25  ? 91.138  87.936  116.196 1.00 172.57 ?  62  ILE E CG1   1 
ATOM 3186  C CG2   . ILE E 1 25  ? 88.889  87.418  115.311 1.00 172.57 ?  62  ILE E CG2   1 
ATOM 3187  C CD1   . ILE E 1 25  ? 91.185  89.383  115.800 1.00 172.57 ?  62  ILE E CD1   1 
ATOM 3188  N N     . ARG E 1 26  ? 88.682  84.102  115.196 1.00 191.88 ?  63  ARG E N     1 
ATOM 3189  C CA    . ARG E 1 26  ? 87.806  83.220  114.441 1.00 191.88 ?  63  ARG E CA    1 
ATOM 3190  C C     . ARG E 1 26  ? 87.034  83.994  113.378 1.00 191.88 ?  63  ARG E C     1 
ATOM 3191  O O     . ARG E 1 26  ? 86.641  85.144  113.590 1.00 191.88 ?  63  ARG E O     1 
ATOM 3192  C CB    . ARG E 1 26  ? 86.857  82.505  115.397 1.00 191.88 ?  63  ARG E CB    1 
ATOM 3193  C CG    . ARG E 1 26  ? 87.585  81.560  116.334 1.00 191.88 ?  63  ARG E CG    1 
ATOM 3194  C CD    . ARG E 1 26  ? 88.049  80.336  115.575 1.00 191.88 ?  63  ARG E CD    1 
ATOM 3195  N NE    . ARG E 1 26  ? 88.793  79.405  116.413 1.00 191.88 ?  63  ARG E NE    1 
ATOM 3196  C CZ    . ARG E 1 26  ? 90.119  79.370  116.484 1.00 191.88 ?  63  ARG E CZ    1 
ATOM 3197  N NH1   . ARG E 1 26  ? 90.840  80.204  115.752 1.00 191.88 ?  63  ARG E NH1   1 
ATOM 3198  N NH2   . ARG E 1 26  ? 90.725  78.494  117.271 1.00 191.88 ?  63  ARG E NH2   1 
ATOM 3199  N N     . LYS E 1 27  ? 86.820  83.342  112.228 1.00 179.09 ?  64  LYS E N     1 
ATOM 3200  C CA    . LYS E 1 27  ? 86.505  84.050  110.989 1.00 179.09 ?  64  LYS E CA    1 
ATOM 3201  C C     . LYS E 1 27  ? 85.107  84.653  110.999 1.00 179.09 ?  64  LYS E C     1 
ATOM 3202  O O     . LYS E 1 27  ? 84.933  85.818  110.625 1.00 179.09 ?  64  LYS E O     1 
ATOM 3203  C CB    . LYS E 1 27  ? 86.644  83.109  109.799 1.00 179.09 ?  64  LYS E CB    1 
ATOM 3204  C CG    . LYS E 1 27  ? 88.050  82.664  109.498 1.00 179.09 ?  64  LYS E CG    1 
ATOM 3205  C CD    . LYS E 1 27  ? 88.043  81.732  108.299 1.00 179.09 ?  64  LYS E CD    1 
ATOM 3206  C CE    . LYS E 1 27  ? 89.428  81.192  107.994 1.00 179.09 ?  64  LYS E CE    1 
ATOM 3207  N NZ    . LYS E 1 27  ? 89.405  80.256  106.835 1.00 179.09 ?  64  LYS E NZ    1 
ATOM 3208  N N     . LEU E 1 28  ? 84.101  83.871  111.381 1.00 188.43 ?  65  LEU E N     1 
ATOM 3209  C CA    . LEU E 1 28  ? 82.725  84.356  111.313 1.00 188.43 ?  65  LEU E CA    1 
ATOM 3210  C C     . LEU E 1 28  ? 82.412  85.525  112.252 1.00 188.43 ?  65  LEU E C     1 
ATOM 3211  O O     . LEU E 1 28  ? 81.608  86.385  111.850 1.00 188.43 ?  65  LEU E O     1 
ATOM 3212  C CB    . LEU E 1 28  ? 81.756  83.188  111.540 1.00 188.43 ?  65  LEU E CB    1 
ATOM 3213  C CG    . LEU E 1 28  ? 80.277  83.479  111.276 1.00 188.43 ?  65  LEU E CG    1 
ATOM 3214  C CD1   . LEU E 1 28  ? 80.088  83.845  109.823 1.00 188.43 ?  65  LEU E CD1   1 
ATOM 3215  C CD2   . LEU E 1 28  ? 79.404  82.299  111.634 1.00 188.43 ?  65  LEU E CD2   1 
ATOM 3216  N N     . PRO E 1 29  ? 82.976  85.647  113.466 1.00 186.21 ?  66  PRO E N     1 
ATOM 3217  C CA    . PRO E 1 29  ? 82.862  86.947  114.148 1.00 186.21 ?  66  PRO E CA    1 
ATOM 3218  C C     . PRO E 1 29  ? 83.584  88.059  113.425 1.00 186.21 ?  66  PRO E C     1 
ATOM 3219  O O     . PRO E 1 29  ? 83.114  89.203  113.425 1.00 186.21 ?  66  PRO E O     1 
ATOM 3220  C CB    . PRO E 1 29  ? 83.479  86.681  115.522 1.00 186.21 ?  66  PRO E CB    1 
ATOM 3221  C CG    . PRO E 1 29  ? 83.262  85.281  115.746 1.00 186.21 ?  66  PRO E CG    1 
ATOM 3222  C CD    . PRO E 1 29  ? 83.434  84.621  114.423 1.00 186.21 ?  66  PRO E CD    1 
ATOM 3223  N N     . PHE E 1 30  ? 84.707  87.752  112.786 1.00 175.17 ?  67  PHE E N     1 
ATOM 3224  C CA    . PHE E 1 30  ? 85.449  88.784  112.079 1.00 175.17 ?  67  PHE E CA    1 
ATOM 3225  C C     . PHE E 1 30  ? 84.754  89.183  110.787 1.00 175.17 ?  67  PHE E C     1 
ATOM 3226  O O     . PHE E 1 30  ? 84.988  90.280  110.272 1.00 175.17 ?  67  PHE E O     1 
ATOM 3227  C CB    . PHE E 1 30  ? 86.866  88.294  111.821 1.00 175.17 ?  67  PHE E CB    1 
ATOM 3228  C CG    . PHE E 1 30  ? 87.747  89.307  111.211 1.00 175.17 ?  67  PHE E CG    1 
ATOM 3229  C CD1   . PHE E 1 30  ? 88.092  90.435  111.913 1.00 175.17 ?  67  PHE E CD1   1 
ATOM 3230  C CD2   . PHE E 1 30  ? 88.269  89.112  109.958 1.00 175.17 ?  67  PHE E CD2   1 
ATOM 3231  C CE1   . PHE E 1 30  ? 88.912  91.371  111.361 1.00 175.17 ?  67  PHE E CE1   1 
ATOM 3232  C CE2   . PHE E 1 30  ? 89.096  90.042  109.402 1.00 175.17 ?  67  PHE E CE2   1 
ATOM 3233  C CZ    . PHE E 1 30  ? 89.417  91.175  110.104 1.00 175.17 ?  67  PHE E CZ    1 
ATOM 3234  N N     . SER E 1 31  ? 83.889  88.320  110.259 1.00 188.87 ?  68  SER E N     1 
ATOM 3235  C CA    . SER E 1 31  ? 83.035  88.729  109.151 1.00 188.87 ?  68  SER E CA    1 
ATOM 3236  C C     . SER E 1 31  ? 81.876  89.578  109.652 1.00 188.87 ?  68  SER E C     1 
ATOM 3237  O O     . SER E 1 31  ? 81.499  90.567  109.016 1.00 188.87 ?  68  SER E O     1 
ATOM 3238  C CB    . SER E 1 31  ? 82.519  87.507  108.395 1.00 188.87 ?  68  SER E CB    1 
ATOM 3239  O OG    . SER E 1 31  ? 81.670  87.893  107.326 1.00 188.87 ?  68  SER E OG    1 
ATOM 3240  N N     . ARG E 1 32  ? 81.306  89.216  110.802 1.00 189.97 ?  69  ARG E N     1 
ATOM 3241  C CA    . ARG E 1 32  ? 80.200  90.001  111.335 1.00 189.97 ?  69  ARG E CA    1 
ATOM 3242  C C     . ARG E 1 32  ? 80.670  91.324  111.919 1.00 189.97 ?  69  ARG E C     1 
ATOM 3243  O O     . ARG E 1 32  ? 79.847  92.210  112.165 1.00 189.97 ?  69  ARG E O     1 
ATOM 3244  C CB    . ARG E 1 32  ? 79.429  89.210  112.388 1.00 189.97 ?  69  ARG E CB    1 
ATOM 3245  C CG    . ARG E 1 32  ? 78.557  88.109  111.820 1.00 189.97 ?  69  ARG E CG    1 
ATOM 3246  C CD    . ARG E 1 32  ? 77.722  87.456  112.906 1.00 189.97 ?  69  ARG E CD    1 
ATOM 3247  N NE    . ARG E 1 32  ? 78.536  86.661  113.815 1.00 189.97 ?  69  ARG E NE    1 
ATOM 3248  C CZ    . ARG E 1 32  ? 78.782  86.996  115.075 1.00 189.97 ?  69  ARG E CZ    1 
ATOM 3249  N NH1   . ARG E 1 32  ? 78.287  88.120  115.569 1.00 189.97 ?  69  ARG E NH1   1 
ATOM 3250  N NH2   . ARG E 1 32  ? 79.535  86.215  115.834 1.00 189.97 ?  69  ARG E NH2   1 
ATOM 3251  N N     . LEU E 1 33  ? 81.973  91.485  112.155 1.00 194.49 ?  70  LEU E N     1 
ATOM 3252  C CA    . LEU E 1 33  ? 82.472  92.806  112.516 1.00 194.49 ?  70  LEU E CA    1 
ATOM 3253  C C     . LEU E 1 33  ? 82.640  93.671  111.277 1.00 194.49 ?  70  LEU E C     1 
ATOM 3254  O O     . LEU E 1 33  ? 82.354  94.872  111.302 1.00 194.49 ?  70  LEU E O     1 
ATOM 3255  C CB    . LEU E 1 33  ? 83.791  92.697  113.275 1.00 194.49 ?  70  LEU E CB    1 
ATOM 3256  C CG    . LEU E 1 33  ? 84.321  94.034  113.794 1.00 194.49 ?  70  LEU E CG    1 
ATOM 3257  C CD1   . LEU E 1 33  ? 83.360  94.591  114.805 1.00 194.49 ?  70  LEU E CD1   1 
ATOM 3258  C CD2   . LEU E 1 33  ? 85.691  93.891  114.401 1.00 194.49 ?  70  LEU E CD2   1 
ATOM 3259  N N     . ALA E 1 34  ? 83.086  93.071  110.173 1.00 192.89 ?  71  ALA E N     1 
ATOM 3260  C CA    . ALA E 1 34  ? 83.409  93.861  108.993 1.00 192.89 ?  71  ALA E CA    1 
ATOM 3261  C C     . ALA E 1 34  ? 82.155  94.347  108.287 1.00 192.89 ?  71  ALA E C     1 
ATOM 3262  O O     . ALA E 1 34  ? 82.094  95.503  107.856 1.00 192.89 ?  71  ALA E O     1 
ATOM 3263  C CB    . ALA E 1 34  ? 84.276  93.051  108.038 1.00 192.89 ?  71  ALA E CB    1 
ATOM 3264  N N     . ARG E 1 35  ? 81.141  93.486  108.172 1.00 196.39 ?  72  ARG E N     1 
ATOM 3265  C CA    . ARG E 1 35  ? 79.925  93.858  107.457 1.00 196.39 ?  72  ARG E CA    1 
ATOM 3266  C C     . ARG E 1 35  ? 79.145  94.936  108.193 1.00 196.39 ?  72  ARG E C     1 
ATOM 3267  O O     . ARG E 1 35  ? 78.433  95.722  107.560 1.00 196.39 ?  72  ARG E O     1 
ATOM 3268  C CB    . ARG E 1 35  ? 79.043  92.630  107.253 1.00 196.39 ?  72  ARG E CB    1 
ATOM 3269  C CG    . ARG E 1 35  ? 79.661  91.543  106.406 1.00 196.39 ?  72  ARG E CG    1 
ATOM 3270  C CD    . ARG E 1 35  ? 78.754  90.333  106.363 1.00 196.39 ?  72  ARG E CD    1 
ATOM 3271  N NE    . ARG E 1 35  ? 79.420  89.178  105.782 1.00 196.39 ?  72  ARG E NE    1 
ATOM 3272  C CZ    . ARG E 1 35  ? 79.413  88.897  104.488 1.00 196.39 ?  72  ARG E CZ    1 
ATOM 3273  N NH1   . ARG E 1 35  ? 78.770  89.690  103.648 1.00 196.39 ?  72  ARG E NH1   1 
ATOM 3274  N NH2   . ARG E 1 35  ? 80.043  87.825  104.037 1.00 196.39 ?  72  ARG E NH2   1 
ATOM 3275  N N     . GLU E 1 36  ? 79.263  94.985  109.520 1.00 202.55 ?  73  GLU E N     1 
ATOM 3276  C CA    . GLU E 1 36  ? 78.620  96.046  110.286 1.00 202.55 ?  73  GLU E CA    1 
ATOM 3277  C C     . GLU E 1 36  ? 79.267  97.397  110.014 1.00 202.55 ?  73  GLU E C     1 
ATOM 3278  O O     . GLU E 1 36  ? 78.570  98.406  109.861 1.00 202.55 ?  73  GLU E O     1 
ATOM 3279  C CB    . GLU E 1 36  ? 78.681  95.723  111.774 1.00 202.55 ?  73  GLU E CB    1 
ATOM 3280  C CG    . GLU E 1 36  ? 78.107  96.804  112.656 1.00 202.55 ?  73  GLU E CG    1 
ATOM 3281  C CD    . GLU E 1 36  ? 78.250  96.485  114.120 1.00 202.55 ?  73  GLU E CD    1 
ATOM 3282  O OE1   . GLU E 1 36  ? 78.747  95.390  114.436 1.00 202.55 ?  73  GLU E OE1   1 
ATOM 3283  O OE2   . GLU E 1 36  ? 77.896  97.340  114.956 1.00 202.55 -1 73  GLU E OE2   1 
ATOM 3284  N N     . ILE E 1 37  ? 80.598  97.437  109.945 1.00 190.43 ?  74  ILE E N     1 
ATOM 3285  C CA    . ILE E 1 37  ? 81.290  98.698  109.705 1.00 190.43 ?  74  ILE E CA    1 
ATOM 3286  C C     . ILE E 1 37  ? 81.090  99.146  108.262 1.00 190.43 ?  74  ILE E C     1 
ATOM 3287  O O     . ILE E 1 37  ? 81.045  100.345 107.966 1.00 190.43 ?  74  ILE E O     1 
ATOM 3288  C CB    . ILE E 1 37  ? 82.773  98.540  110.071 1.00 190.43 ?  74  ILE E CB    1 
ATOM 3289  C CG1   . ILE E 1 37  ? 82.878  98.103  111.519 1.00 190.43 ?  74  ILE E CG1   1 
ATOM 3290  C CG2   . ILE E 1 37  ? 83.522  99.842  109.958 1.00 190.43 ?  74  ILE E CG2   1 
ATOM 3291  C CD1   . ILE E 1 37  ? 84.238  97.614  111.889 1.00 190.43 ?  74  ILE E CD1   1 
ATOM 3292  N N     . CYS E 1 38  ? 80.909  98.188  107.353 1.00 202.75 ?  75  CYS E N     1 
ATOM 3293  C CA    . CYS E 1 38  ? 80.668  98.518  105.954 1.00 202.75 ?  75  CYS E CA    1 
ATOM 3294  C C     . CYS E 1 38  ? 79.304  99.157  105.752 1.00 202.75 ?  75  CYS E C     1 
ATOM 3295  O O     . CYS E 1 38  ? 79.136  99.976  104.844 1.00 202.75 ?  75  CYS E O     1 
ATOM 3296  C CB    . CYS E 1 38  ? 80.792  97.260  105.099 1.00 202.75 ?  75  CYS E CB    1 
ATOM 3297  S SG    . CYS E 1 38  ? 80.608  97.510  103.330 1.00 202.75 ?  75  CYS E SG    1 
ATOM 3298  N N     . VAL E 1 39  ? 78.321  98.817  106.586 1.00 200.32 ?  76  VAL E N     1 
ATOM 3299  C CA    . VAL E 1 39  ? 76.985  99.354  106.363 1.00 200.32 ?  76  VAL E CA    1 
ATOM 3300  C C     . VAL E 1 39  ? 76.784  100.683 107.085 1.00 200.32 ?  76  VAL E C     1 
ATOM 3301  O O     . VAL E 1 39  ? 75.832  101.410 106.777 1.00 200.32 ?  76  VAL E O     1 
ATOM 3302  C CB    . VAL E 1 39  ? 75.917  98.324  106.775 1.00 200.32 ?  76  VAL E CB    1 
ATOM 3303  C CG1   . VAL E 1 39  ? 75.700  98.319  108.278 1.00 200.32 ?  76  VAL E CG1   1 
ATOM 3304  C CG2   . VAL E 1 39  ? 74.617  98.521  106.000 1.00 200.32 ?  76  VAL E CG2   1 
ATOM 3305  N N     . LYS E 1 40  ? 77.667  101.049 108.019 1.00 187.53 ?  77  LYS E N     1 
ATOM 3306  C CA    . LYS E 1 40  ? 77.601  102.392 108.588 1.00 187.53 ?  77  LYS E CA    1 
ATOM 3307  C C     . LYS E 1 40  ? 78.101  103.436 107.601 1.00 187.53 ?  77  LYS E C     1 
ATOM 3308  O O     . LYS E 1 40  ? 77.809  104.625 107.759 1.00 187.53 ?  77  LYS E O     1 
ATOM 3309  C CB    . LYS E 1 40  ? 78.390  102.468 109.893 1.00 187.53 ?  77  LYS E CB    1 
ATOM 3310  C CG    . LYS E 1 40  ? 77.685  101.805 111.065 1.00 187.53 ?  77  LYS E CG    1 
ATOM 3311  C CD    . LYS E 1 40  ? 78.574  101.719 112.301 1.00 187.53 ?  77  LYS E CD    1 
ATOM 3312  C CE    . LYS E 1 40  ? 78.812  103.071 112.949 1.00 187.53 ?  77  LYS E CE    1 
ATOM 3313  N NZ    . LYS E 1 40  ? 79.593  102.923 114.211 1.00 187.53 ?  77  LYS E NZ    1 
ATOM 3314  N N     . PHE E 1 41  ? 78.851  103.016 106.589 1.00 188.60 ?  78  PHE E N     1 
ATOM 3315  C CA    . PHE E 1 41  ? 79.103  103.822 105.406 1.00 188.60 ?  78  PHE E CA    1 
ATOM 3316  C C     . PHE E 1 41  ? 78.130  103.371 104.334 1.00 188.60 ?  78  PHE E C     1 
ATOM 3317  O O     . PHE E 1 41  ? 77.489  102.326 104.488 1.00 188.60 ?  78  PHE E O     1 
ATOM 3318  C CB    . PHE E 1 41  ? 80.530  103.651 104.888 1.00 188.60 ?  78  PHE E CB    1 
ATOM 3319  C CG    . PHE E 1 41  ? 81.579  104.164 105.811 1.00 188.60 ?  78  PHE E CG    1 
ATOM 3320  C CD1   . PHE E 1 41  ? 81.273  105.064 106.817 1.00 188.60 ?  78  PHE E CD1   1 
ATOM 3321  C CD2   . PHE E 1 41  ? 82.878  103.731 105.679 1.00 188.60 ?  78  PHE E CD2   1 
ATOM 3322  C CE1   . PHE E 1 41  ? 82.245  105.522 107.666 1.00 188.60 ?  78  PHE E CE1   1 
ATOM 3323  C CE2   . PHE E 1 41  ? 83.849  104.180 106.524 1.00 188.60 ?  78  PHE E CE2   1 
ATOM 3324  C CZ    . PHE E 1 41  ? 83.539  105.079 107.517 1.00 188.60 ?  78  PHE E CZ    1 
ATOM 3325  N N     . THR E 1 42  ? 78.057  104.144 103.246 1.00 205.76 ?  79  THR E N     1 
ATOM 3326  C CA    . THR E 1 42  ? 77.298  103.823 102.031 1.00 205.76 ?  79  THR E CA    1 
ATOM 3327  C C     . THR E 1 42  ? 75.836  103.525 102.362 1.00 205.76 ?  79  THR E C     1 
ATOM 3328  O O     . THR E 1 42  ? 75.380  102.385 102.275 1.00 205.76 ?  79  THR E O     1 
ATOM 3329  C CB    . THR E 1 42  ? 77.918  102.646 101.279 1.00 205.76 ?  79  THR E CB    1 
ATOM 3330  O OG1   . THR E 1 42  ? 77.680  101.441 102.012 1.00 205.76 ?  79  THR E OG1   1 
ATOM 3331  C CG2   . THR E 1 42  ? 79.419  102.842 101.130 1.00 205.76 ?  79  THR E CG2   1 
ATOM 3332  N N     . ARG E 1 43  ? 75.147  104.597 102.773 1.00 226.64 ?  80  ARG E N     1 
ATOM 3333  C CA    . ARG E 1 43  ? 73.956  104.533 103.618 1.00 226.64 ?  80  ARG E CA    1 
ATOM 3334  C C     . ARG E 1 43  ? 72.849  103.671 103.018 1.00 226.64 ?  80  ARG E C     1 
ATOM 3335  O O     . ARG E 1 43  ? 72.631  103.640 101.803 1.00 226.64 ?  80  ARG E O     1 
ATOM 3336  C CB    . ARG E 1 43  ? 73.437  105.951 103.913 1.00 226.64 ?  80  ARG E CB    1 
ATOM 3337  C CG    . ARG E 1 43  ? 72.710  106.689 102.779 1.00 226.64 ?  80  ARG E CG    1 
ATOM 3338  C CD    . ARG E 1 43  ? 73.655  107.377 101.801 1.00 226.64 ?  80  ARG E CD    1 
ATOM 3339  N NE    . ARG E 1 43  ? 72.947  108.273 100.893 1.00 226.64 ?  80  ARG E NE    1 
ATOM 3340  C CZ    . ARG E 1 43  ? 73.495  108.828 99.818  1.00 226.64 ?  80  ARG E CZ    1 
ATOM 3341  N NH1   . ARG E 1 43  ? 74.761  108.577 99.518  1.00 226.64 ?  80  ARG E NH1   1 
ATOM 3342  N NH2   . ARG E 1 43  ? 72.781  109.634 99.044  1.00 226.64 ?  80  ARG E NH2   1 
ATOM 3343  N N     . GLY E 1 44  ? 72.209  102.897 103.890 1.00 226.72 ?  81  GLY E N     1 
ATOM 3344  C CA    . GLY E 1 44  ? 71.157  101.985 103.501 1.00 226.72 ?  81  GLY E CA    1 
ATOM 3345  C C     . GLY E 1 44  ? 71.643  100.701 102.861 1.00 226.72 ?  81  GLY E C     1 
ATOM 3346  O O     . GLY E 1 44  ? 71.496  99.620  103.437 1.00 226.72 ?  81  GLY E O     1 
ATOM 3347  N N     . VAL E 1 45  ? 72.239  100.813 101.679 1.00 215.83 ?  82  VAL E N     1 
ATOM 3348  C CA    . VAL E 1 45  ? 72.481  99.669  100.807 1.00 215.83 ?  82  VAL E CA    1 
ATOM 3349  C C     . VAL E 1 45  ? 73.682  98.895  101.334 1.00 215.83 ?  82  VAL E C     1 
ATOM 3350  O O     . VAL E 1 45  ? 74.739  99.470  101.596 1.00 215.83 ?  82  VAL E O     1 
ATOM 3351  C CB    . VAL E 1 45  ? 72.697  100.118 99.357  1.00 215.83 ?  82  VAL E CB    1 
ATOM 3352  C CG1   . VAL E 1 45  ? 72.984  98.930  98.459  1.00 215.83 ?  82  VAL E CG1   1 
ATOM 3353  C CG2   . VAL E 1 45  ? 71.481  100.881 98.857  1.00 215.83 ?  82  VAL E CG2   1 
ATOM 3354  N N     . ASP E 1 46  ? 73.515  97.584  101.485 1.00 219.60 ?  83  ASP E N     1 
ATOM 3355  C CA    . ASP E 1 46  ? 74.609  96.712  101.883 1.00 219.60 ?  83  ASP E CA    1 
ATOM 3356  C C     . ASP E 1 46  ? 75.541  96.416  100.714 1.00 219.60 ?  83  ASP E C     1 
ATOM 3357  O O     . ASP E 1 46  ? 75.459  97.030  99.649  1.00 219.60 ?  83  ASP E O     1 
ATOM 3358  C CB    . ASP E 1 46  ? 74.062  95.407  102.456 1.00 219.60 ?  83  ASP E CB    1 
ATOM 3359  C CG    . ASP E 1 46  ? 73.086  94.718  101.518 1.00 219.60 ?  83  ASP E CG    1 
ATOM 3360  O OD1   . ASP E 1 46  ? 72.718  95.304  100.478 1.00 219.60 ?  83  ASP E OD1   1 
ATOM 3361  O OD2   . ASP E 1 46  ? 72.683  93.577  101.825 1.00 219.60 -1 83  ASP E OD2   1 
ATOM 3362  N N     . PHE E 1 47  ? 76.438  95.466  100.925 1.00 185.62 ?  84  PHE E N     1 
ATOM 3363  C CA    . PHE E 1 47  ? 77.355  95.030  99.887  1.00 185.62 ?  84  PHE E CA    1 
ATOM 3364  C C     . PHE E 1 47  ? 77.585  93.529  99.970  1.00 185.62 ?  84  PHE E C     1 
ATOM 3365  O O     . PHE E 1 47  ? 76.841  92.794  100.617 1.00 185.62 ?  84  PHE E O     1 
ATOM 3366  C CB    . PHE E 1 47  ? 78.669  95.801  99.965  1.00 185.62 ?  84  PHE E CB    1 
ATOM 3367  C CG    . PHE E 1 47  ? 78.599  97.156  99.352  1.00 185.62 ?  84  PHE E CG    1 
ATOM 3368  C CD1   . PHE E 1 47  ? 78.704  97.298  97.985  1.00 185.62 ?  84  PHE E CD1   1 
ATOM 3369  C CD2   . PHE E 1 47  ? 78.421  98.276  100.125 1.00 185.62 ?  84  PHE E CD2   1 
ATOM 3370  C CE1   . PHE E 1 47  ? 78.638  98.535  97.398  1.00 185.62 ?  84  PHE E CE1   1 
ATOM 3371  C CE2   . PHE E 1 47  ? 78.353  99.520  99.545  1.00 185.62 ?  84  PHE E CE2   1 
ATOM 3372  C CZ    . PHE E 1 47  ? 78.462  99.646  98.183  1.00 185.62 ?  84  PHE E CZ    1 
ATOM 3373  N N     . ASN E 1 48  ? 78.636  93.085  99.298  1.00 197.65 ?  85  ASN E N     1 
ATOM 3374  C CA    . ASN E 1 48  ? 78.900  91.678  99.073  1.00 197.65 ?  85  ASN E CA    1 
ATOM 3375  C C     . ASN E 1 48  ? 80.408  91.468  98.986  1.00 197.65 ?  85  ASN E C     1 
ATOM 3376  O O     . ASN E 1 48  ? 81.097  92.133  98.211  1.00 197.65 ?  85  ASN E O     1 
ATOM 3377  C CB    . ASN E 1 48  ? 78.197  91.225  97.790  1.00 197.65 ?  85  ASN E CB    1 
ATOM 3378  C CG    . ASN E 1 48  ? 78.091  89.731  97.679  1.00 197.65 ?  85  ASN E CG    1 
ATOM 3379  O OD1   . ASN E 1 48  ? 78.553  89.007  98.546  1.00 197.65 ?  85  ASN E OD1   1 
ATOM 3380  N ND2   . ASN E 1 48  ? 77.469  89.257  96.608  1.00 197.65 ?  85  ASN E ND2   1 
ATOM 3381  N N     . TRP E 1 49  ? 80.920  90.538  99.787  1.00 184.51 ?  86  TRP E N     1 
ATOM 3382  C CA    . TRP E 1 49  ? 82.354  90.392  100.006 1.00 184.51 ?  86  TRP E CA    1 
ATOM 3383  C C     . TRP E 1 49  ? 82.837  89.060  99.460  1.00 184.51 ?  86  TRP E C     1 
ATOM 3384  O O     . TRP E 1 49  ? 82.228  88.024  99.728  1.00 184.51 ?  86  TRP E O     1 
ATOM 3385  C CB    . TRP E 1 49  ? 82.670  90.488  101.498 1.00 184.51 ?  86  TRP E CB    1 
ATOM 3386  C CG    . TRP E 1 49  ? 82.472  91.850  102.057 1.00 184.51 ?  86  TRP E CG    1 
ATOM 3387  C CD1   . TRP E 1 49  ? 81.307  92.375  102.503 1.00 184.51 ?  86  TRP E CD1   1 
ATOM 3388  C CD2   . TRP E 1 49  ? 83.478  92.841  102.298 1.00 184.51 ?  86  TRP E CD2   1 
ATOM 3389  N NE1   . TRP E 1 49  ? 81.508  93.649  102.965 1.00 184.51 ?  86  TRP E NE1   1 
ATOM 3390  C CE2   . TRP E 1 49  ? 82.836  93.956  102.854 1.00 184.51 ?  86  TRP E CE2   1 
ATOM 3391  C CE3   . TRP E 1 49  ? 84.855  92.899  102.079 1.00 184.51 ?  86  TRP E CE3   1 
ATOM 3392  C CZ2   . TRP E 1 49  ? 83.519  95.110  103.198 1.00 184.51 ?  86  TRP E CZ2   1 
ATOM 3393  C CZ3   . TRP E 1 49  ? 85.529  94.044  102.425 1.00 184.51 ?  86  TRP E CZ3   1 
ATOM 3394  C CH2   . TRP E 1 49  ? 84.862  95.134  102.973 1.00 184.51 ?  86  TRP E CH2   1 
ATOM 3395  N N     . GLN E 1 50  ? 83.926  89.083  98.698  1.00 173.50 ?  87  GLN E N     1 
ATOM 3396  C CA    . GLN E 1 50  ? 84.546  87.833  98.292  1.00 173.50 ?  87  GLN E CA    1 
ATOM 3397  C C     . GLN E 1 50  ? 85.276  87.206  99.466  1.00 173.50 ?  87  GLN E C     1 
ATOM 3398  O O     . GLN E 1 50  ? 85.661  87.881  100.420 1.00 173.50 ?  87  GLN E O     1 
ATOM 3399  C CB    . GLN E 1 50  ? 85.522  88.041  97.136  1.00 173.50 ?  87  GLN E CB    1 
ATOM 3400  C CG    . GLN E 1 50  ? 84.864  88.367  95.814  1.00 173.50 ?  87  GLN E CG    1 
ATOM 3401  C CD    . GLN E 1 50  ? 85.865  88.515  94.688  1.00 173.50 ?  87  GLN E CD    1 
ATOM 3402  O OE1   . GLN E 1 50  ? 87.071  88.421  94.897  1.00 173.50 ?  87  GLN E OE1   1 
ATOM 3403  N NE2   . GLN E 1 50  ? 85.368  88.749  93.483  1.00 173.50 ?  87  GLN E NE2   1 
ATOM 3404  N N     . ALA E 1 51  ? 85.493  85.895  99.374  1.00 167.79 ?  88  ALA E N     1 
ATOM 3405  C CA    . ALA E 1 51  ? 86.155  85.178  100.456 1.00 167.79 ?  88  ALA E CA    1 
ATOM 3406  C C     . ALA E 1 51  ? 87.669  85.260  100.349 1.00 167.79 ?  88  ALA E C     1 
ATOM 3407  O O     . ALA E 1 51  ? 88.374  84.447  100.952 1.00 167.79 ?  88  ALA E O     1 
ATOM 3408  C CB    . ALA E 1 51  ? 85.707  83.720  100.479 1.00 167.79 ?  88  ALA E CB    1 
ATOM 3409  N N     . GLN E 1 52  ? 88.188  86.192  99.555  1.00 171.05 ?  89  GLN E N     1 
ATOM 3410  C CA    . GLN E 1 52  ? 89.600  86.524  99.651  1.00 171.05 ?  89  GLN E CA    1 
ATOM 3411  C C     . GLN E 1 52  ? 89.804  87.839  100.386 1.00 171.05 ?  89  GLN E C     1 
ATOM 3412  O O     . GLN E 1 52  ? 90.848  88.050  101.010 1.00 171.05 ?  89  GLN E O     1 
ATOM 3413  C CB    . GLN E 1 52  ? 90.220  86.569  98.265  1.00 171.05 ?  89  GLN E CB    1 
ATOM 3414  C CG    . GLN E 1 52  ? 90.330  85.211  97.661  1.00 171.05 ?  89  GLN E CG    1 
ATOM 3415  C CD    . GLN E 1 52  ? 91.222  84.324  98.485  1.00 171.05 ?  89  GLN E CD    1 
ATOM 3416  O OE1   . GLN E 1 52  ? 90.753  83.422  99.174  1.00 171.05 ?  89  GLN E OE1   1 
ATOM 3417  N NE2   . GLN E 1 52  ? 92.521  84.572  98.421  1.00 171.05 ?  89  GLN E NE2   1 
ATOM 3418  N N     . ALA E 1 53  ? 88.815  88.729  100.337 1.00 167.41 ?  90  ALA E N     1 
ATOM 3419  C CA    . ALA E 1 53  ? 88.968  90.019  100.996 1.00 167.41 ?  90  ALA E CA    1 
ATOM 3420  C C     . ALA E 1 53  ? 88.864  89.882  102.507 1.00 167.41 ?  90  ALA E C     1 
ATOM 3421  O O     . ALA E 1 53  ? 89.543  90.600  103.246 1.00 167.41 ?  90  ALA E O     1 
ATOM 3422  C CB    . ALA E 1 53  ? 87.930  91.003  100.473 1.00 167.41 ?  90  ALA E CB    1 
ATOM 3423  N N     . LEU E 1 54  ? 88.037  88.957  102.992 1.00 166.61 ?  91  LEU E N     1 
ATOM 3424  C CA    . LEU E 1 54  ? 88.011  88.727  104.428 1.00 166.61 ?  91  LEU E CA    1 
ATOM 3425  C C     . LEU E 1 54  ? 89.229  87.947  104.886 1.00 166.61 ?  91  LEU E C     1 
ATOM 3426  O O     . LEU E 1 54  ? 89.573  87.979  106.070 1.00 166.61 ?  91  LEU E O     1 
ATOM 3427  C CB    . LEU E 1 54  ? 86.738  88.006  104.842 1.00 166.61 ?  91  LEU E CB    1 
ATOM 3428  C CG    . LEU E 1 54  ? 85.487  88.844  104.625 1.00 166.61 ?  91  LEU E CG    1 
ATOM 3429  C CD1   . LEU E 1 54  ? 84.262  88.091  105.107 1.00 166.61 ?  91  LEU E CD1   1 
ATOM 3430  C CD2   . LEU E 1 54  ? 85.610  90.196  105.291 1.00 166.61 ?  91  LEU E CD2   1 
ATOM 3431  N N     . LEU E 1 55  ? 89.898  87.244  103.977 1.00 165.47 ?  92  LEU E N     1 
ATOM 3432  C CA    . LEU E 1 55  ? 91.226  86.759  104.314 1.00 165.47 ?  92  LEU E CA    1 
ATOM 3433  C C     . LEU E 1 55  ? 92.296  87.738  103.874 1.00 165.47 ?  92  LEU E C     1 
ATOM 3434  O O     . LEU E 1 55  ? 93.480  87.394  103.873 1.00 165.47 ?  92  LEU E O     1 
ATOM 3435  C CB    . LEU E 1 55  ? 91.477  85.390  103.703 1.00 165.47 ?  92  LEU E CB    1 
ATOM 3436  C CG    . LEU E 1 55  ? 90.647  84.305  104.369 1.00 165.47 ?  92  LEU E CG    1 
ATOM 3437  C CD1   . LEU E 1 55  ? 90.865  82.979  103.679 1.00 165.47 ?  92  LEU E CD1   1 
ATOM 3438  C CD2   . LEU E 1 55  ? 91.016  84.216  105.828 1.00 165.47 ?  92  LEU E CD2   1 
ATOM 3439  N N     . ALA E 1 56  ? 91.905  88.953  103.492 1.00 168.81 ?  93  ALA E N     1 
ATOM 3440  C CA    . ALA E 1 56  ? 92.901  89.980  103.228 1.00 168.81 ?  93  ALA E CA    1 
ATOM 3441  C C     . ALA E 1 56  ? 93.019  90.953  104.388 1.00 168.81 ?  93  ALA E C     1 
ATOM 3442  O O     . ALA E 1 56  ? 94.116  91.445  104.666 1.00 168.81 ?  93  ALA E O     1 
ATOM 3443  C CB    . ALA E 1 56  ? 92.574  90.726  101.941 1.00 168.81 ?  93  ALA E CB    1 
ATOM 3444  N N     . LEU E 1 57  ? 91.913  91.251  105.071 1.00 165.98 ?  94  LEU E N     1 
ATOM 3445  C CA    . LEU E 1 57  ? 92.018  92.043  106.289 1.00 165.98 ?  94  LEU E CA    1 
ATOM 3446  C C     . LEU E 1 57  ? 92.653  91.239  107.405 1.00 165.98 ?  94  LEU E C     1 
ATOM 3447  O O     . LEU E 1 57  ? 93.449  91.769  108.185 1.00 165.98 ?  94  LEU E O     1 
ATOM 3448  C CB    . LEU E 1 57  ? 90.653  92.544  106.738 1.00 165.98 ?  94  LEU E CB    1 
ATOM 3449  C CG    . LEU E 1 57  ? 90.021  93.593  105.848 1.00 165.98 ?  94  LEU E CG    1 
ATOM 3450  C CD1   . LEU E 1 57  ? 88.700  94.021  106.430 1.00 165.98 ?  94  LEU E CD1   1 
ATOM 3451  C CD2   . LEU E 1 57  ? 90.954  94.754  105.733 1.00 165.98 ?  94  LEU E CD2   1 
ATOM 3452  N N     . GLN E 1 58  ? 92.326  89.953  107.487 1.00 179.29 ?  95  GLN E N     1 
ATOM 3453  C CA    . GLN E 1 58  ? 92.811  89.150  108.598 1.00 179.29 ?  95  GLN E CA    1 
ATOM 3454  C C     . GLN E 1 58  ? 94.286  88.806  108.425 1.00 179.29 ?  95  GLN E C     1 
ATOM 3455  O O     . GLN E 1 58  ? 94.937  88.368  109.375 1.00 179.29 ?  95  GLN E O     1 
ATOM 3456  C CB    . GLN E 1 58  ? 91.934  87.908  108.733 1.00 179.29 ?  95  GLN E CB    1 
ATOM 3457  C CG    . GLN E 1 58  ? 92.074  87.123  110.013 1.00 179.29 ?  95  GLN E CG    1 
ATOM 3458  C CD    . GLN E 1 58  ? 91.072  86.001  110.094 1.00 179.29 ?  95  GLN E CD    1 
ATOM 3459  O OE1   . GLN E 1 58  ? 90.245  85.830  109.200 1.00 179.29 ?  95  GLN E OE1   1 
ATOM 3460  N NE2   . GLN E 1 58  ? 91.152  85.210  111.154 1.00 179.29 ?  95  GLN E NE2   1 
ATOM 3461  N N     . GLU E 1 59  ? 94.846  89.033  107.239 1.00 180.41 ?  96  GLU E N     1 
ATOM 3462  C CA    . GLU E 1 59  ? 96.297  89.026  107.132 1.00 180.41 ?  96  GLU E CA    1 
ATOM 3463  C C     . GLU E 1 59  ? 96.862  90.432  107.212 1.00 180.41 ?  96  GLU E C     1 
ATOM 3464  O O     . GLU E 1 59  ? 98.034  90.651  106.896 1.00 180.41 ?  96  GLU E O     1 
ATOM 3465  C CB    . GLU E 1 59  ? 96.740  88.346  105.845 1.00 180.41 ?  96  GLU E CB    1 
ATOM 3466  C CG    . GLU E 1 59  ? 96.589  86.856  105.889 1.00 180.41 ?  96  GLU E CG    1 
ATOM 3467  C CD    . GLU E 1 59  ? 97.544  86.224  106.871 1.00 180.41 ?  96  GLU E CD    1 
ATOM 3468  O OE1   . GLU E 1 59  ? 98.660  86.755  107.043 1.00 180.41 ?  96  GLU E OE1   1 
ATOM 3469  O OE2   . GLU E 1 59  ? 97.182  85.191  107.470 1.00 180.41 -1 96  GLU E OE2   1 
ATOM 3470  N N     . ALA E 1 60  ? 96.047  91.402  107.625 1.00 174.12 ?  97  ALA E N     1 
ATOM 3471  C CA    . ALA E 1 60  ? 96.589  92.722  107.926 1.00 174.12 ?  97  ALA E CA    1 
ATOM 3472  C C     . ALA E 1 60  ? 96.244  93.143  109.345 1.00 174.12 ?  97  ALA E C     1 
ATOM 3473  O O     . ALA E 1 60  ? 97.091  93.699  110.051 1.00 174.12 ?  97  ALA E O     1 
ATOM 3474  C CB    . ALA E 1 60  ? 96.079  93.750  106.922 1.00 174.12 ?  97  ALA E CB    1 
ATOM 3475  N N     . ALA E 1 61  ? 95.009  92.883  109.778 1.00 176.00 ?  98  ALA E N     1 
ATOM 3476  C CA    . ALA E 1 61  ? 94.597  93.245  111.129 1.00 176.00 ?  98  ALA E CA    1 
ATOM 3477  C C     . ALA E 1 61  ? 95.328  92.406  112.167 1.00 176.00 ?  98  ALA E C     1 
ATOM 3478  O O     . ALA E 1 61  ? 95.831  92.935  113.161 1.00 176.00 ?  98  ALA E O     1 
ATOM 3479  C CB    . ALA E 1 61  ? 93.088  93.097  111.280 1.00 176.00 ?  98  ALA E CB    1 
ATOM 3480  N N     . GLU E 1 62  ? 95.435  91.099  111.936 1.00 186.28 ?  99  GLU E N     1 
ATOM 3481  C CA    . GLU E 1 62  ? 96.325  90.300  112.766 1.00 186.28 ?  99  GLU E CA    1 
ATOM 3482  C C     . GLU E 1 62  ? 97.767  90.343  112.294 1.00 186.28 ?  99  GLU E C     1 
ATOM 3483  O O     . GLU E 1 62  ? 98.552  89.478  112.686 1.00 186.28 ?  99  GLU E O     1 
ATOM 3484  C CB    . GLU E 1 62  ? 95.869  88.853  112.820 1.00 186.28 ?  99  GLU E CB    1 
ATOM 3485  C CG    . GLU E 1 62  ? 94.593  88.643  113.577 1.00 186.28 ?  99  GLU E CG    1 
ATOM 3486  C CD    . GLU E 1 62  ? 94.233  87.178  113.654 1.00 186.28 ?  99  GLU E CD    1 
ATOM 3487  O OE1   . GLU E 1 62  ? 94.922  86.365  113.004 1.00 186.28 ?  99  GLU E OE1   1 
ATOM 3488  O OE2   . GLU E 1 62  ? 93.275  86.822  114.368 1.00 186.28 -1 99  GLU E OE2   1 
ATOM 3489  N N     . ALA E 1 63  ? 98.118  91.283  111.428 1.00 176.54 ?  100 ALA E N     1 
ATOM 3490  C CA    . ALA E 1 63  ? 99.509  91.635  111.214 1.00 176.54 ?  100 ALA E CA    1 
ATOM 3491  C C     . ALA E 1 63  ? 99.814  93.022  111.735 1.00 176.54 ?  100 ALA E C     1 
ATOM 3492  O O     . ALA E 1 63  ? 100.985 93.405  111.809 1.00 176.54 ?  100 ALA E O     1 
ATOM 3493  C CB    . ALA E 1 63  ? 99.867  91.557  109.732 1.00 176.54 ?  100 ALA E CB    1 
ATOM 3494  N N     . PHE E 1 64  ? 98.785  93.796  112.072 1.00 168.40 ?  101 PHE E N     1 
ATOM 3495  C CA    . PHE E 1 64  ? 99.036  95.114  112.633 1.00 168.40 ?  101 PHE E CA    1 
ATOM 3496  C C     . PHE E 1 64  ? 98.901  95.109  114.146 1.00 168.40 ?  101 PHE E C     1 
ATOM 3497  O O     . PHE E 1 64  ? 99.671  95.783  114.836 1.00 168.40 ?  101 PHE E O     1 
ATOM 3498  C CB    . PHE E 1 64  ? 98.098  96.140  112.021 1.00 168.40 ?  101 PHE E CB    1 
ATOM 3499  C CG    . PHE E 1 64  ? 98.256  97.500  112.588 1.00 168.40 ?  101 PHE E CG    1 
ATOM 3500  C CD1   . PHE E 1 64  ? 99.381  98.243  112.319 1.00 168.40 ?  101 PHE E CD1   1 
ATOM 3501  C CD2   . PHE E 1 64  ? 97.265  98.045  113.376 1.00 168.40 ?  101 PHE E CD2   1 
ATOM 3502  C CE1   . PHE E 1 64  ? 99.522  99.498  112.842 1.00 168.40 ?  101 PHE E CE1   1 
ATOM 3503  C CE2   . PHE E 1 64  ? 97.399  99.297  113.895 1.00 168.40 ?  101 PHE E CE2   1 
ATOM 3504  C CZ    . PHE E 1 64  ? 98.528  100.024 113.627 1.00 168.40 ?  101 PHE E CZ    1 
ATOM 3505  N N     . LEU E 1 65  ? 97.927  94.369  114.683 1.00 165.96 ?  102 LEU E N     1 
ATOM 3506  C CA    . LEU E 1 65  ? 97.782  94.297  116.132 1.00 165.96 ?  102 LEU E CA    1 
ATOM 3507  C C     . LEU E 1 65  ? 98.942  93.550  116.763 1.00 165.96 ?  102 LEU E C     1 
ATOM 3508  O O     . LEU E 1 65  ? 99.369  93.893  117.868 1.00 165.96 ?  102 LEU E O     1 
ATOM 3509  C CB    . LEU E 1 65  ? 96.464  93.640  116.515 1.00 165.96 ?  102 LEU E CB    1 
ATOM 3510  C CG    . LEU E 1 65  ? 95.246  94.481  116.197 1.00 165.96 ?  102 LEU E CG    1 
ATOM 3511  C CD1   . LEU E 1 65  ? 93.991  93.740  116.548 1.00 165.96 ?  102 LEU E CD1   1 
ATOM 3512  C CD2   . LEU E 1 65  ? 95.325  95.763  116.956 1.00 165.96 ?  102 LEU E CD2   1 
ATOM 3513  N N     . VAL E 1 66  ? 99.482  92.544  116.075 1.00 171.53 ?  103 VAL E N     1 
ATOM 3514  C CA    . VAL E 1 66  ? 100.639 91.857  116.619 1.00 171.53 ?  103 VAL E CA    1 
ATOM 3515  C C     . VAL E 1 66  ? 101.873 92.738  116.535 1.00 171.53 ?  103 VAL E C     1 
ATOM 3516  O O     . VAL E 1 66  ? 102.732 92.680  117.418 1.00 171.53 ?  103 VAL E O     1 
ATOM 3517  C CB    . VAL E 1 66  ? 100.825 90.492  115.927 1.00 171.53 ?  103 VAL E CB    1 
ATOM 3518  C CG1   . VAL E 1 66  ? 101.133 90.647  114.462 1.00 171.53 ?  103 VAL E CG1   1 
ATOM 3519  C CG2   . VAL E 1 66  ? 101.897 89.680  116.605 1.00 171.53 ?  103 VAL E CG2   1 
ATOM 3520  N N     . HIS E 1 67  ? 101.956 93.623  115.547 1.00 173.75 ?  104 HIS E N     1 
ATOM 3521  C CA    . HIS E 1 67  ? 103.091 94.525  115.515 1.00 173.75 ?  104 HIS E CA    1 
ATOM 3522  C C     . HIS E 1 67  ? 102.854 95.755  116.372 1.00 173.75 ?  104 HIS E C     1 
ATOM 3523  O O     . HIS E 1 67  ? 103.801 96.488  116.670 1.00 173.75 ?  104 HIS E O     1 
ATOM 3524  C CB    . HIS E 1 67  ? 103.410 94.921  114.080 1.00 173.75 ?  104 HIS E CB    1 
ATOM 3525  C CG    . HIS E 1 67  ? 104.701 95.650  113.938 1.00 173.75 ?  104 HIS E CG    1 
ATOM 3526  N ND1   . HIS E 1 67  ? 105.919 95.037  114.128 1.00 173.75 ?  104 HIS E ND1   1 
ATOM 3527  C CD2   . HIS E 1 67  ? 104.969 96.945  113.656 1.00 173.75 ?  104 HIS E CD2   1 
ATOM 3528  C CE1   . HIS E 1 67  ? 106.884 95.921  113.955 1.00 173.75 ?  104 HIS E CE1   1 
ATOM 3529  N NE2   . HIS E 1 67  ? 106.334 97.087  113.667 1.00 173.75 ?  104 HIS E NE2   1 
ATOM 3530  N N     . LEU E 1 68  ? 101.620 95.991  116.799 1.00 164.70 ?  105 LEU E N     1 
ATOM 3531  C CA    . LEU E 1 68  ? 101.412 97.037  117.787 1.00 164.70 ?  105 LEU E CA    1 
ATOM 3532  C C     . LEU E 1 68  ? 101.809 96.556  119.171 1.00 164.70 ?  105 LEU E C     1 
ATOM 3533  O O     . LEU E 1 68  ? 102.437 97.300  119.927 1.00 164.70 ?  105 LEU E O     1 
ATOM 3534  C CB    . LEU E 1 68  ? 99.963  97.511  117.781 1.00 164.70 ?  105 LEU E CB    1 
ATOM 3535  C CG    . LEU E 1 68  ? 99.664  98.632  118.767 1.00 164.70 ?  105 LEU E CG    1 
ATOM 3536  C CD1   . LEU E 1 68  ? 100.542 99.798  118.453 1.00 164.70 ?  105 LEU E CD1   1 
ATOM 3537  C CD2   . LEU E 1 68  ? 98.225  99.050  118.690 1.00 164.70 ?  105 LEU E CD2   1 
ATOM 3538  N N     . PHE E 1 69  ? 101.480 95.303  119.510 1.00 177.91 ?  106 PHE E N     1 
ATOM 3539  C CA    . PHE E 1 69  ? 101.760 94.812  120.856 1.00 177.91 ?  106 PHE E CA    1 
ATOM 3540  C C     . PHE E 1 69  ? 103.242 94.635  121.129 1.00 177.91 ?  106 PHE E C     1 
ATOM 3541  O O     . PHE E 1 69  ? 103.683 94.933  122.242 1.00 177.91 ?  106 PHE E O     1 
ATOM 3542  C CB    . PHE E 1 69  ? 101.039 93.501  121.141 1.00 177.91 ?  106 PHE E CB    1 
ATOM 3543  C CG    . PHE E 1 69  ? 99.655  93.685  121.635 1.00 177.91 ?  106 PHE E CG    1 
ATOM 3544  C CD1   . PHE E 1 69  ? 99.446  94.178  122.894 1.00 177.91 ?  106 PHE E CD1   1 
ATOM 3545  C CD2   . PHE E 1 69  ? 98.568  93.332  120.871 1.00 177.91 ?  106 PHE E CD2   1 
ATOM 3546  C CE1   . PHE E 1 69  ? 98.185  94.354  123.370 1.00 177.91 ?  106 PHE E CE1   1 
ATOM 3547  C CE2   . PHE E 1 69  ? 97.298  93.503  121.351 1.00 177.91 ?  106 PHE E CE2   1 
ATOM 3548  C CZ    . PHE E 1 69  ? 97.108  94.015  122.603 1.00 177.91 ?  106 PHE E CZ    1 
ATOM 3549  N N     . GLU E 1 70  ? 104.021 94.156  120.158 1.00 178.80 ?  107 GLU E N     1 
ATOM 3550  C CA    . GLU E 1 70  ? 105.458 94.032  120.383 1.00 178.80 ?  107 GLU E CA    1 
ATOM 3551  C C     . GLU E 1 70  ? 106.105 95.400  120.540 1.00 178.80 ?  107 GLU E C     1 
ATOM 3552  O O     . GLU E 1 70  ? 107.022 95.575  121.351 1.00 178.80 ?  107 GLU E O     1 
ATOM 3553  C CB    . GLU E 1 70  ? 106.119 93.262  119.244 1.00 178.80 ?  107 GLU E CB    1 
ATOM 3554  C CG    . GLU E 1 70  ? 107.601 93.022  119.470 1.00 178.80 ?  107 GLU E CG    1 
ATOM 3555  C CD    . GLU E 1 70  ? 108.283 92.333  118.313 1.00 178.80 ?  107 GLU E CD    1 
ATOM 3556  O OE1   . GLU E 1 70  ? 107.610 92.056  117.299 1.00 178.80 ?  107 GLU E OE1   1 
ATOM 3557  O OE2   . GLU E 1 70  ? 109.501 92.078  118.415 1.00 178.80 -1 107 GLU E OE2   1 
ATOM 3558  N N     . ASP E 1 71  ? 105.617 96.392  119.801 1.00 187.30 ?  108 ASP E N     1 
ATOM 3559  C CA    . ASP E 1 71  ? 106.129 97.738  119.996 1.00 187.30 ?  108 ASP E CA    1 
ATOM 3560  C C     . ASP E 1 71  ? 105.614 98.335  121.297 1.00 187.30 ?  108 ASP E C     1 
ATOM 3561  O O     . ASP E 1 71  ? 106.360 99.012  122.009 1.00 187.30 ?  108 ASP E O     1 
ATOM 3562  C CB    . ASP E 1 71  ? 105.752 98.624  118.819 1.00 187.30 ?  108 ASP E CB    1 
ATOM 3563  C CG    . ASP E 1 71  ? 106.578 99.886  118.760 1.00 187.30 ?  108 ASP E CG    1 
ATOM 3564  O OD1   . ASP E 1 71  ? 107.519 100.019 119.561 1.00 187.30 ?  108 ASP E OD1   1 
ATOM 3565  O OD2   . ASP E 1 71  ? 106.276 100.759 117.924 1.00 187.30 -1 108 ASP E OD2   1 
ATOM 3566  N N     . ALA E 1 72  ? 104.350 98.085  121.638 1.00 172.54 ?  109 ALA E N     1 
ATOM 3567  C CA    . ALA E 1 72  ? 103.821 98.650  122.872 1.00 172.54 ?  109 ALA E CA    1 
ATOM 3568  C C     . ALA E 1 72  ? 104.384 97.977  124.106 1.00 172.54 ?  109 ALA E C     1 
ATOM 3569  O O     . ALA E 1 72  ? 104.339 98.568  125.187 1.00 172.54 ?  109 ALA E O     1 
ATOM 3570  C CB    . ALA E 1 72  ? 102.301 98.559  122.911 1.00 172.54 ?  109 ALA E CB    1 
ATOM 3571  N N     . TYR E 1 73  ? 104.920 96.767  123.978 1.00 180.04 ?  110 TYR E N     1 
ATOM 3572  C CA    . TYR E 1 73  ? 105.471 96.101  125.146 1.00 180.04 ?  110 TYR E CA    1 
ATOM 3573  C C     . TYR E 1 73  ? 106.806 96.693  125.555 1.00 180.04 ?  110 TYR E C     1 
ATOM 3574  O O     . TYR E 1 73  ? 107.193 96.569  126.719 1.00 180.04 ?  110 TYR E O     1 
ATOM 3575  C CB    . TYR E 1 73  ? 105.626 94.609  124.883 1.00 180.04 ?  110 TYR E CB    1 
ATOM 3576  C CG    . TYR E 1 73  ? 105.946 93.805  126.110 1.00 180.04 ?  110 TYR E CG    1 
ATOM 3577  C CD1   . TYR E 1 73  ? 104.960 93.498  127.029 1.00 180.04 ?  110 TYR E CD1   1 
ATOM 3578  C CD2   . TYR E 1 73  ? 107.229 93.356  126.350 1.00 180.04 ?  110 TYR E CD2   1 
ATOM 3579  C CE1   . TYR E 1 73  ? 105.243 92.768  128.148 1.00 180.04 ?  110 TYR E CE1   1 
ATOM 3580  C CE2   . TYR E 1 73  ? 107.523 92.626  127.469 1.00 180.04 ?  110 TYR E CE2   1 
ATOM 3581  C CZ    . TYR E 1 73  ? 106.525 92.332  128.361 1.00 180.04 ?  110 TYR E CZ    1 
ATOM 3582  O OH    . TYR E 1 73  ? 106.815 91.600  129.483 1.00 180.04 ?  110 TYR E OH    1 
ATOM 3583  N N     . LEU E 1 74  ? 107.502 97.370  124.641 1.00 167.80 ?  111 LEU E N     1 
ATOM 3584  C CA    . LEU E 1 74  ? 108.784 97.960  125.001 1.00 167.80 ?  111 LEU E CA    1 
ATOM 3585  C C     . LEU E 1 74  ? 108.619 99.220  125.829 1.00 167.80 ?  111 LEU E C     1 
ATOM 3586  O O     . LEU E 1 74  ? 109.609 99.758  126.330 1.00 167.80 ?  111 LEU E O     1 
ATOM 3587  C CB    . LEU E 1 74  ? 109.598 98.257  123.754 1.00 167.80 ?  111 LEU E CB    1 
ATOM 3588  C CG    . LEU E 1 74  ? 109.991 96.964  123.059 1.00 167.80 ?  111 LEU E CG    1 
ATOM 3589  C CD1   . LEU E 1 74  ? 110.692 97.261  121.781 1.00 167.80 ?  111 LEU E CD1   1 
ATOM 3590  C CD2   . LEU E 1 74  ? 110.876 96.137  123.956 1.00 167.80 ?  111 LEU E CD2   1 
ATOM 3591  N N     . LEU E 1 75  ? 107.397 99.715  125.983 1.00 166.11 ?  112 LEU E N     1 
ATOM 3592  C CA    . LEU E 1 75  ? 107.195 100.800 126.928 1.00 166.11 ?  112 LEU E CA    1 
ATOM 3593  C C     . LEU E 1 75  ? 106.845 100.273 128.308 1.00 166.11 ?  112 LEU E C     1 
ATOM 3594  O O     . LEU E 1 75  ? 106.851 101.027 129.284 1.00 166.11 ?  112 LEU E O     1 
ATOM 3595  C CB    . LEU E 1 75  ? 106.139 101.763 126.405 1.00 166.11 ?  112 LEU E CB    1 
ATOM 3596  C CG    . LEU E 1 75  ? 106.726 102.521 125.219 1.00 166.11 ?  112 LEU E CG    1 
ATOM 3597  C CD1   . LEU E 1 75  ? 105.724 103.487 124.648 1.00 166.11 ?  112 LEU E CD1   1 
ATOM 3598  C CD2   . LEU E 1 75  ? 107.971 103.244 125.657 1.00 166.11 ?  112 LEU E CD2   1 
ATOM 3599  N N     . THR E 1 76  ? 106.545 98.984  128.418 1.00 178.08 ?  113 THR E N     1 
ATOM 3600  C CA    . THR E 1 76  ? 106.379 98.408  129.742 1.00 178.08 ?  113 THR E CA    1 
ATOM 3601  C C     . THR E 1 76  ? 107.722 98.186  130.406 1.00 178.08 ?  113 THR E C     1 
ATOM 3602  O O     . THR E 1 76  ? 107.886 98.456  131.600 1.00 178.08 ?  113 THR E O     1 
ATOM 3603  C CB    . THR E 1 76  ? 105.626 97.096  129.655 1.00 178.08 ?  113 THR E CB    1 
ATOM 3604  O OG1   . THR E 1 76  ? 106.384 96.176  128.859 1.00 178.08 ?  113 THR E OG1   1 
ATOM 3605  C CG2   . THR E 1 76  ? 104.301 97.325  129.019 1.00 178.08 ?  113 THR E CG2   1 
ATOM 3606  N N     . LEU E 1 77  ? 108.702 97.700  129.644 1.00 184.97 ?  114 LEU E N     1 
ATOM 3607  C CA    . LEU E 1 77  ? 110.015 97.456  130.219 1.00 184.97 ?  114 LEU E CA    1 
ATOM 3608  C C     . LEU E 1 77  ? 110.751 98.749  130.514 1.00 184.97 ?  114 LEU E C     1 
ATOM 3609  O O     . LEU E 1 77  ? 111.723 98.745  131.274 1.00 184.97 ?  114 LEU E O     1 
ATOM 3610  C CB    . LEU E 1 77  ? 110.849 96.588  129.289 1.00 184.97 ?  114 LEU E CB    1 
ATOM 3611  C CG    . LEU E 1 77  ? 110.321 95.173  129.140 1.00 184.97 ?  114 LEU E CG    1 
ATOM 3612  C CD1   . LEU E 1 77  ? 111.176 94.409  128.158 1.00 184.97 ?  114 LEU E CD1   1 
ATOM 3613  C CD2   . LEU E 1 77  ? 110.317 94.501  130.483 1.00 184.97 ?  114 LEU E CD2   1 
ATOM 3614  N N     . HIS E 1 78  ? 110.306 99.863  129.942 1.00 186.70 ?  115 HIS E N     1 
ATOM 3615  C CA    . HIS E 1 78  ? 111.019 101.108 130.165 1.00 186.70 ?  115 HIS E CA    1 
ATOM 3616  C C     . HIS E 1 78  ? 110.587 101.762 131.468 1.00 186.70 ?  115 HIS E C     1 
ATOM 3617  O O     . HIS E 1 78  ? 111.250 102.682 131.957 1.00 186.70 ?  115 HIS E O     1 
ATOM 3618  C CB    . HIS E 1 78  ? 110.798 102.039 128.988 1.00 186.70 ?  115 HIS E CB    1 
ATOM 3619  C CG    . HIS E 1 78  ? 111.691 103.227 129.002 1.00 186.70 ?  115 HIS E CG    1 
ATOM 3620  N ND1   . HIS E 1 78  ? 113.046 103.127 128.789 1.00 186.70 ?  115 HIS E ND1   1 
ATOM 3621  C CD2   . HIS E 1 78  ? 111.434 104.538 129.203 1.00 186.70 ?  115 HIS E CD2   1 
ATOM 3622  C CE1   . HIS E 1 78  ? 113.589 104.326 128.860 1.00 186.70 ?  115 HIS E CE1   1 
ATOM 3623  N NE2   . HIS E 1 78  ? 112.631 105.201 129.107 1.00 186.70 ?  115 HIS E NE2   1 
ATOM 3624  N N     . ALA E 1 79  ? 109.491 101.298 132.053 1.00 175.75 ?  116 ALA E N     1 
ATOM 3625  C CA    . ALA E 1 79  ? 109.019 101.838 133.317 1.00 175.75 ?  116 ALA E CA    1 
ATOM 3626  C C     . ALA E 1 79  ? 109.274 100.906 134.486 1.00 175.75 ?  116 ALA E C     1 
ATOM 3627  O O     . ALA E 1 79  ? 108.782 101.166 135.585 1.00 175.75 ?  116 ALA E O     1 
ATOM 3628  C CB    . ALA E 1 79  ? 107.528 102.156 133.234 1.00 175.75 ?  116 ALA E CB    1 
ATOM 3629  N N     . GLY E 1 80  ? 110.017 99.827  134.281 1.00 182.43 ?  117 GLY E N     1 
ATOM 3630  C CA    . GLY E 1 80  ? 110.246 98.881  135.347 1.00 182.43 ?  117 GLY E CA    1 
ATOM 3631  C C     . GLY E 1 80  ? 109.079 97.976  135.659 1.00 182.43 ?  117 GLY E C     1 
ATOM 3632  O O     . GLY E 1 80  ? 109.168 97.186  136.604 1.00 182.43 ?  117 GLY E O     1 
ATOM 3633  N N     . ARG E 1 81  ? 107.993 98.059  134.901 1.00 191.50 ?  118 ARG E N     1 
ATOM 3634  C CA    . ARG E 1 81  ? 106.868 97.157  135.062 1.00 191.50 ?  118 ARG E CA    1 
ATOM 3635  C C     . ARG E 1 81  ? 107.174 95.815  134.411 1.00 191.50 ?  118 ARG E C     1 
ATOM 3636  O O     . ARG E 1 81  ? 108.288 95.543  133.959 1.00 191.50 ?  118 ARG E O     1 
ATOM 3637  C CB    . ARG E 1 81  ? 105.617 97.730  134.409 1.00 191.50 ?  118 ARG E CB    1 
ATOM 3638  C CG    . ARG E 1 81  ? 105.042 99.003  134.975 1.00 191.50 ?  118 ARG E CG    1 
ATOM 3639  C CD    . ARG E 1 81  ? 103.832 99.365  134.126 1.00 191.50 ?  118 ARG E CD    1 
ATOM 3640  N NE    . ARG E 1 81  ? 103.142 100.566 134.568 1.00 191.50 ?  118 ARG E NE    1 
ATOM 3641  C CZ    . ARG E 1 81  ? 103.414 101.780 134.117 1.00 191.50 ?  118 ARG E CZ    1 
ATOM 3642  N NH1   . ARG E 1 81  ? 104.368 101.949 133.216 1.00 191.50 ?  118 ARG E NH1   1 
ATOM 3643  N NH2   . ARG E 1 81  ? 102.737 102.822 134.566 1.00 191.50 ?  118 ARG E NH2   1 
ATOM 3644  N N     . VAL E 1 82  ? 106.159 94.955  134.367 1.00 184.34 ?  119 VAL E N     1 
ATOM 3645  C CA    . VAL E 1 82  ? 106.097 93.851  133.423 1.00 184.34 ?  119 VAL E CA    1 
ATOM 3646  C C     . VAL E 1 82  ? 104.802 93.878  132.620 1.00 184.34 ?  119 VAL E C     1 
ATOM 3647  O O     . VAL E 1 82  ? 104.816 93.721  131.395 1.00 184.34 ?  119 VAL E O     1 
ATOM 3648  C CB    . VAL E 1 82  ? 106.276 92.494  134.139 1.00 184.34 ?  119 VAL E CB    1 
ATOM 3649  C CG1   . VAL E 1 82  ? 106.016 91.347  133.204 1.00 184.34 ?  119 VAL E CG1   1 
ATOM 3650  C CG2   . VAL E 1 82  ? 107.688 92.363  134.671 1.00 184.34 ?  119 VAL E CG2   1 
ATOM 3651  N N     . THR E 1 83  ? 103.687 94.125  133.284 1.00 183.36 ?  120 THR E N     1 
ATOM 3652  C CA    . THR E 1 83  ? 102.357 94.114  132.700 1.00 183.36 ?  120 THR E CA    1 
ATOM 3653  C C     . THR E 1 83  ? 102.149 95.321  131.782 1.00 183.36 ?  120 THR E C     1 
ATOM 3654  O O     . THR E 1 83  ? 102.745 96.380  131.983 1.00 183.36 ?  120 THR E O     1 
ATOM 3655  C CB    . THR E 1 83  ? 101.351 94.126  133.850 1.00 183.36 ?  120 THR E CB    1 
ATOM 3656  O OG1   . THR E 1 83  ? 101.740 93.134  134.803 1.00 183.36 ?  120 THR E OG1   1 
ATOM 3657  C CG2   . THR E 1 83  ? 99.951  93.796  133.398 1.00 183.36 ?  120 THR E CG2   1 
ATOM 3658  N N     . LEU E 1 84  ? 101.305 95.151  130.762 1.00 172.05 ?  121 LEU E N     1 
ATOM 3659  C CA    . LEU E 1 84  ? 100.832 96.276  129.966 1.00 172.05 ?  121 LEU E CA    1 
ATOM 3660  C C     . LEU E 1 84  ? 99.852  97.133  130.761 1.00 172.05 ?  121 LEU E C     1 
ATOM 3661  O O     . LEU E 1 84  ? 99.424  96.786  131.862 1.00 172.05 ?  121 LEU E O     1 
ATOM 3662  C CB    . LEU E 1 84  ? 100.114 95.801  128.710 1.00 172.05 ?  121 LEU E CB    1 
ATOM 3663  C CG    . LEU E 1 84  ? 100.802 95.105  127.554 1.00 172.05 ?  121 LEU E CG    1 
ATOM 3664  C CD1   . LEU E 1 84  ? 99.720  94.596  126.660 1.00 172.05 ?  121 LEU E CD1   1 
ATOM 3665  C CD2   . LEU E 1 84  ? 101.653 96.070  126.800 1.00 172.05 ?  121 LEU E CD2   1 
ATOM 3666  N N     . PHE E 1 85  ? 99.481  98.255  130.158 1.00 169.01 ?  122 PHE E N     1 
ATOM 3667  C CA    . PHE E 1 85  ? 98.376  99.104  130.579 1.00 169.01 ?  122 PHE E CA    1 
ATOM 3668  C C     . PHE E 1 85  ? 97.885  99.857  129.361 1.00 169.01 ?  122 PHE E C     1 
ATOM 3669  O O     . PHE E 1 85  ? 98.581  99.916  128.344 1.00 169.01 ?  122 PHE E O     1 
ATOM 3670  C CB    . PHE E 1 85  ? 98.790  100.116 131.655 1.00 169.01 ?  122 PHE E CB    1 
ATOM 3671  C CG    . PHE E 1 85  ? 98.955  99.538  133.008 1.00 169.01 ?  122 PHE E CG    1 
ATOM 3672  C CD1   . PHE E 1 85  ? 97.845  99.197  133.750 1.00 169.01 ?  122 PHE E CD1   1 
ATOM 3673  C CD2   . PHE E 1 85  ? 100.208 99.370  133.551 1.00 169.01 ?  122 PHE E CD2   1 
ATOM 3674  C CE1   . PHE E 1 85  ? 97.976  98.666  135.004 1.00 169.01 ?  122 PHE E CE1   1 
ATOM 3675  C CE2   . PHE E 1 85  ? 100.353 98.842  134.805 1.00 169.01 ?  122 PHE E CE2   1 
ATOM 3676  C CZ    . PHE E 1 85  ? 99.235  98.491  135.533 1.00 169.01 ?  122 PHE E CZ    1 
ATOM 3677  N N     . PRO E 1 86  ? 96.717  100.493 129.444 1.00 161.78 ?  123 PRO E N     1 
ATOM 3678  C CA    . PRO E 1 86  ? 96.381  101.515 128.444 1.00 161.78 ?  123 PRO E CA    1 
ATOM 3679  C C     . PRO E 1 86  ? 97.207  102.787 128.541 1.00 161.78 ?  123 PRO E C     1 
ATOM 3680  O O     . PRO E 1 86  ? 96.959  103.718 127.774 1.00 161.78 ?  123 PRO E O     1 
ATOM 3681  C CB    . PRO E 1 86  ? 94.902  101.789 128.716 1.00 161.78 ?  123 PRO E CB    1 
ATOM 3682  C CG    . PRO E 1 86  ? 94.422  100.550 129.289 1.00 161.78 ?  123 PRO E CG    1 
ATOM 3683  C CD    . PRO E 1 86  ? 95.515  100.026 130.145 1.00 161.78 ?  123 PRO E CD    1 
ATOM 3684  N N     . LYS E 1 87  ? 98.155  102.884 129.473 1.00 159.87 ?  124 LYS E N     1 
ATOM 3685  C CA    . LYS E 1 87  ? 99.209  103.878 129.339 1.00 159.87 ?  124 LYS E CA    1 
ATOM 3686  C C     . LYS E 1 87  ? 100.259 103.415 128.343 1.00 159.87 ?  124 LYS E C     1 
ATOM 3687  O O     . LYS E 1 87  ? 101.097 104.206 127.903 1.00 159.87 ?  124 LYS E O     1 
ATOM 3688  C CB    . LYS E 1 87  ? 99.856  104.162 130.692 1.00 159.87 ?  124 LYS E CB    1 
ATOM 3689  C CG    . LYS E 1 87  ? 98.928  104.754 131.717 1.00 159.87 ?  124 LYS E CG    1 
ATOM 3690  C CD    . LYS E 1 87  ? 98.500  106.138 131.312 1.00 159.87 ?  124 LYS E CD    1 
ATOM 3691  C CE    . LYS E 1 87  ? 97.622  106.759 132.379 1.00 159.87 ?  124 LYS E CE    1 
ATOM 3692  N NZ    . LYS E 1 87  ? 97.131  108.108 131.983 1.00 159.87 ?  124 LYS E NZ    1 
ATOM 3693  N N     . ASP E 1 88  ? 100.248 102.133 127.991 1.00 169.73 ?  125 ASP E N     1 
ATOM 3694  C CA    . ASP E 1 88  ? 101.296 101.616 127.126 1.00 169.73 ?  125 ASP E CA    1 
ATOM 3695  C C     . ASP E 1 88  ? 100.805 101.420 125.699 1.00 169.73 ?  125 ASP E C     1 
ATOM 3696  O O     . ASP E 1 88  ? 101.605 101.210 124.783 1.00 169.73 ?  125 ASP E O     1 
ATOM 3697  C CB    . ASP E 1 88  ? 101.833 100.319 127.706 1.00 169.73 ?  125 ASP E CB    1 
ATOM 3698  C CG    . ASP E 1 88  ? 102.617 100.548 128.961 1.00 169.73 ?  125 ASP E CG    1 
ATOM 3699  O OD1   . ASP E 1 88  ? 103.240 101.621 129.062 1.00 169.73 ?  125 ASP E OD1   1 
ATOM 3700  O OD2   . ASP E 1 88  ? 102.598 99.679  129.854 1.00 169.73 -1 125 ASP E OD2   1 
ATOM 3701  N N     . VAL E 1 89  ? 99.496  101.467 125.485 1.00 166.41 ?  126 VAL E N     1 
ATOM 3702  C CA    . VAL E 1 89  ? 98.997  101.449 124.117 1.00 166.41 ?  126 VAL E CA    1 
ATOM 3703  C C     . VAL E 1 89  ? 98.689  102.864 123.655 1.00 166.41 ?  126 VAL E C     1 
ATOM 3704  O O     . VAL E 1 89  ? 99.030  103.252 122.531 1.00 166.41 ?  126 VAL E O     1 
ATOM 3705  C CB    . VAL E 1 89  ? 97.790  100.503 124.007 1.00 166.41 ?  126 VAL E CB    1 
ATOM 3706  C CG1   . VAL E 1 89  ? 97.073  100.679 122.712 1.00 166.41 ?  126 VAL E CG1   1 
ATOM 3707  C CG2   . VAL E 1 89  ? 98.281  99.093  124.068 1.00 166.41 ?  126 VAL E CG2   1 
ATOM 3708  N N     . GLN E 1 90  ? 98.138  103.693 124.546 1.00 173.74 ?  127 GLN E N     1 
ATOM 3709  C CA    . GLN E 1 90  ? 97.840  105.076 124.183 1.00 173.74 ?  127 GLN E CA    1 
ATOM 3710  C C     . GLN E 1 90  ? 99.094  105.926 124.055 1.00 173.74 ?  127 GLN E C     1 
ATOM 3711  O O     . GLN E 1 90  ? 99.006  107.095 123.676 1.00 173.74 ?  127 GLN E O     1 
ATOM 3712  C CB    . GLN E 1 90  ? 96.913  105.714 125.206 1.00 173.74 ?  127 GLN E CB    1 
ATOM 3713  C CG    . GLN E 1 90  ? 95.521  105.162 125.208 1.00 173.74 ?  127 GLN E CG    1 
ATOM 3714  C CD    . GLN E 1 90  ? 94.697  105.744 126.327 1.00 173.74 ?  127 GLN E CD    1 
ATOM 3715  O OE1   . GLN E 1 90  ? 95.201  106.508 127.146 1.00 173.74 ?  127 GLN E OE1   1 
ATOM 3716  N NE2   . GLN E 1 90  ? 93.426  105.380 126.376 1.00 173.74 ?  127 GLN E NE2   1 
ATOM 3717  N N     . LEU E 1 91  ? 100.259 105.387 124.396 1.00 171.11 ?  128 LEU E N     1 
ATOM 3718  C CA    . LEU E 1 91  ? 101.488 106.094 124.084 1.00 171.11 ?  128 LEU E CA    1 
ATOM 3719  C C     . LEU E 1 91  ? 102.101 105.562 122.800 1.00 171.11 ?  128 LEU E C     1 
ATOM 3720  O O     . LEU E 1 91  ? 102.800 106.289 122.089 1.00 171.11 ?  128 LEU E O     1 
ATOM 3721  C CB    . LEU E 1 91  ? 102.458 105.974 125.247 1.00 171.11 ?  128 LEU E CB    1 
ATOM 3722  C CG    . LEU E 1 91  ? 103.702 106.834 125.176 1.00 171.11 ?  128 LEU E CG    1 
ATOM 3723  C CD1   . LEU E 1 91  ? 103.279 108.267 125.087 1.00 171.11 ?  128 LEU E CD1   1 
ATOM 3724  C CD2   . LEU E 1 91  ? 104.500 106.613 126.424 1.00 171.11 ?  128 LEU E CD2   1 
ATOM 3725  N N     . ALA E 1 92  ? 101.823 104.305 122.467 1.00 170.50 ?  129 ALA E N     1 
ATOM 3726  C CA    . ALA E 1 92  ? 102.458 103.713 121.299 1.00 170.50 ?  129 ALA E CA    1 
ATOM 3727  C C     . ALA E 1 92  ? 101.695 104.040 120.025 1.00 170.50 ?  129 ALA E C     1 
ATOM 3728  O O     . ALA E 1 92  ? 102.206 103.833 118.921 1.00 170.50 ?  129 ALA E O     1 
ATOM 3729  C CB    . ALA E 1 92  ? 102.586 102.207 121.483 1.00 170.50 ?  129 ALA E CB    1 
ATOM 3730  N N     . ARG E 1 93  ? 100.472 104.546 120.152 1.00 175.96 ?  130 ARG E N     1 
ATOM 3731  C CA    . ARG E 1 93  ? 99.798  105.087 118.981 1.00 175.96 ?  130 ARG E CA    1 
ATOM 3732  C C     . ARG E 1 93  ? 100.213 106.527 118.728 1.00 175.96 ?  130 ARG E C     1 
ATOM 3733  O O     . ARG E 1 93  ? 99.910  107.082 117.668 1.00 175.96 ?  130 ARG E O     1 
ATOM 3734  C CB    . ARG E 1 93  ? 98.286  104.994 119.147 1.00 175.96 ?  130 ARG E CB    1 
ATOM 3735  C CG    . ARG E 1 93  ? 97.782  103.590 119.133 1.00 175.96 ?  130 ARG E CG    1 
ATOM 3736  C CD    . ARG E 1 93  ? 96.320  103.498 119.501 1.00 175.96 ?  130 ARG E CD    1 
ATOM 3737  N NE    . ARG E 1 93  ? 95.429  104.079 118.508 1.00 175.96 ?  130 ARG E NE    1 
ATOM 3738  C CZ    . ARG E 1 93  ? 94.677  105.145 118.733 1.00 175.96 ?  130 ARG E CZ    1 
ATOM 3739  N NH1   . ARG E 1 93  ? 94.711  105.738 119.914 1.00 175.96 ?  130 ARG E NH1   1 
ATOM 3740  N NH2   . ARG E 1 93  ? 93.886  105.615 117.785 1.00 175.96 ?  130 ARG E NH2   1 
ATOM 3741  N N     . ARG E 1 94  ? 100.896 107.152 119.686 1.00 171.41 ?  131 ARG E N     1 
ATOM 3742  C CA    . ARG E 1 94  ? 101.288 108.541 119.505 1.00 171.41 ?  131 ARG E CA    1 
ATOM 3743  C C     . ARG E 1 94  ? 102.588 108.651 118.736 1.00 171.41 ?  131 ARG E C     1 
ATOM 3744  O O     . ARG E 1 94  ? 102.652 109.369 117.736 1.00 171.41 ?  131 ARG E O     1 
ATOM 3745  C CB    . ARG E 1 94  ? 101.432 109.225 120.856 1.00 171.41 ?  131 ARG E CB    1 
ATOM 3746  C CG    . ARG E 1 94  ? 101.475 110.731 120.792 1.00 171.41 ?  131 ARG E CG    1 
ATOM 3747  C CD    . ARG E 1 94  ? 102.840 111.364 120.845 1.00 171.41 ?  131 ARG E CD    1 
ATOM 3748  N NE    . ARG E 1 94  ? 102.737 112.814 121.001 1.00 171.41 ?  131 ARG E NE    1 
ATOM 3749  C CZ    . ARG E 1 94  ? 102.616 113.684 120.004 1.00 171.41 ?  131 ARG E CZ    1 
ATOM 3750  N NH1   . ARG E 1 94  ? 102.590 113.269 118.747 1.00 171.41 ?  131 ARG E NH1   1 
ATOM 3751  N NH2   . ARG E 1 94  ? 102.528 114.979 120.269 1.00 171.41 ?  131 ARG E NH2   1 
ATOM 3752  N N     . ILE E 1 95  ? 103.618 107.933 119.181 1.00 176.57 ?  132 ILE E N     1 
ATOM 3753  C CA    . ILE E 1 95  ? 104.978 108.153 118.711 1.00 176.57 ?  132 ILE E CA    1 
ATOM 3754  C C     . ILE E 1 95  ? 105.138 107.719 117.263 1.00 176.57 ?  132 ILE E C     1 
ATOM 3755  O O     . ILE E 1 95  ? 106.024 108.210 116.555 1.00 176.57 ?  132 ILE E O     1 
ATOM 3756  C CB    . ILE E 1 95  ? 105.931 107.414 119.655 1.00 176.57 ?  132 ILE E CB    1 
ATOM 3757  C CG1   . ILE E 1 95  ? 105.613 107.823 121.074 1.00 176.57 ?  132 ILE E CG1   1 
ATOM 3758  C CG2   . ILE E 1 95  ? 107.359 107.817 119.442 1.00 176.57 ?  132 ILE E CG2   1 
ATOM 3759  C CD1   . ILE E 1 95  ? 106.277 106.965 122.076 1.00 176.57 ?  132 ILE E CD1   1 
ATOM 3760  N N     . ARG E 1 96  ? 104.261 106.842 116.781 1.00 180.17 ?  133 ARG E N     1 
ATOM 3761  C CA    . ARG E 1 96  ? 104.275 106.494 115.368 1.00 180.17 ?  133 ARG E CA    1 
ATOM 3762  C C     . ARG E 1 96  ? 103.825 107.653 114.494 1.00 180.17 ?  133 ARG E C     1 
ATOM 3763  O O     . ARG E 1 96  ? 104.167 107.698 113.308 1.00 180.17 ?  133 ARG E O     1 
ATOM 3764  C CB    . ARG E 1 96  ? 103.407 105.270 115.129 1.00 180.17 ?  133 ARG E CB    1 
ATOM 3765  C CG    . ARG E 1 96  ? 104.050 104.012 115.627 1.00 180.17 ?  133 ARG E CG    1 
ATOM 3766  C CD    . ARG E 1 96  ? 103.227 102.818 115.302 1.00 180.17 ?  133 ARG E CD    1 
ATOM 3767  N NE    . ARG E 1 96  ? 103.969 101.604 115.577 1.00 180.17 ?  133 ARG E NE    1 
ATOM 3768  C CZ    . ARG E 1 96  ? 103.486 100.395 115.358 1.00 180.17 ?  133 ARG E CZ    1 
ATOM 3769  N NH1   . ARG E 1 96  ? 102.268 100.264 114.863 1.00 180.17 ?  133 ARG E NH1   1 
ATOM 3770  N NH2   . ARG E 1 96  ? 104.214 99.326  115.624 1.00 180.17 ?  133 ARG E NH2   1 
ATOM 3771  N N     . GLY E 1 97  ? 103.079 108.596 115.054 1.00 198.56 ?  134 GLY E N     1 
ATOM 3772  C CA    . GLY E 1 97  ? 102.844 109.855 114.383 1.00 198.56 ?  134 GLY E CA    1 
ATOM 3773  C C     . GLY E 1 97  ? 101.876 109.803 113.223 1.00 198.56 ?  134 GLY E C     1 
ATOM 3774  O O     . GLY E 1 97  ? 102.284 109.969 112.069 1.00 198.56 ?  134 GLY E O     1 
ATOM 3775  N N     . LEU E 1 98  ? 100.616 109.473 113.517 1.00 197.88 ?  135 LEU E N     1 
ATOM 3776  C CA    . LEU E 1 98  ? 99.453  109.819 112.703 1.00 197.88 ?  135 LEU E CA    1 
ATOM 3777  C C     . LEU E 1 98  ? 99.328  109.034 111.394 1.00 197.88 ?  135 LEU E C     1 
ATOM 3778  O O     . LEU E 1 98  ? 98.280  109.084 110.742 1.00 197.88 ?  135 LEU E O     1 
ATOM 3779  C CB    . LEU E 1 98  ? 99.472  111.338 112.470 1.00 197.88 ?  135 LEU E CB    1 
ATOM 3780  C CG    . LEU E 1 98  ? 98.406  112.146 111.752 1.00 197.88 ?  135 LEU E CG    1 
ATOM 3781  C CD1   . LEU E 1 98  ? 98.280  113.495 112.404 1.00 197.88 ?  135 LEU E CD1   1 
ATOM 3782  C CD2   . LEU E 1 98  ? 98.865  112.312 110.328 1.00 197.88 ?  135 LEU E CD2   1 
ATOM 3783  N N     . GLU E 1 99  ? 100.335 108.253 111.017 1.00 211.12 ?  136 GLU E N     1 
ATOM 3784  C CA    . GLU E 1 99  ? 100.230 107.438 109.817 1.00 211.12 ?  136 GLU E CA    1 
ATOM 3785  C C     . GLU E 1 99  ? 100.551 105.973 110.038 1.00 211.12 ?  136 GLU E C     1 
ATOM 3786  O O     . GLU E 1 99  ? 100.729 105.243 109.059 1.00 211.12 ?  136 GLU E O     1 
ATOM 3787  C CB    . GLU E 1 99  ? 101.133 107.989 108.709 1.00 211.12 ?  136 GLU E CB    1 
ATOM 3788  C CG    . GLU E 1 99  ? 100.593 109.240 108.074 1.00 211.12 ?  136 GLU E CG    1 
ATOM 3789  C CD    . GLU E 1 99  ? 99.324  108.971 107.292 1.00 211.12 ?  136 GLU E CD    1 
ATOM 3790  O OE1   . GLU E 1 99  ? 99.204  107.878 106.702 1.00 211.12 ?  136 GLU E OE1   1 
ATOM 3791  O OE2   . GLU E 1 99  ? 98.436  109.843 107.275 1.00 211.12 -1 136 GLU E OE2   1 
ATOM 3792  N N     . GLU E 1 100 ? 100.649 105.523 111.282 1.00 204.13 ?  137 GLU E N     1 
ATOM 3793  C CA    . GLU E 1 100 ? 100.873 104.111 111.542 1.00 204.13 ?  137 GLU E CA    1 
ATOM 3794  C C     . GLU E 1 100 ? 99.947  103.627 112.644 1.00 204.13 ?  137 GLU E C     1 
ATOM 3795  O O     . GLU E 1 100 ? 100.392 102.997 113.608 1.00 204.13 ?  137 GLU E O     1 
ATOM 3796  C CB    . GLU E 1 100 ? 102.328 103.842 111.915 1.00 204.13 ?  137 GLU E CB    1 
ATOM 3797  C CG    . GLU E 1 100 ? 103.328 104.091 110.809 1.00 204.13 ?  137 GLU E CG    1 
ATOM 3798  C CD    . GLU E 1 100 ? 103.157 103.141 109.658 1.00 204.13 ?  137 GLU E CD    1 
ATOM 3799  O OE1   . GLU E 1 100 ? 102.800 101.969 109.898 1.00 204.13 ?  137 GLU E OE1   1 
ATOM 3800  O OE2   . GLU E 1 100 ? 103.369 103.573 108.510 1.00 204.13 -1 137 GLU E OE2   1 
ATOM 3801  N N     . GLY E 1 101 ? 98.660  103.918 112.510 1.00 179.61 ?  138 GLY E N     1 
ATOM 3802  C CA    . GLY E 1 101 ? 97.684  103.512 113.496 1.00 179.61 ?  138 GLY E CA    1 
ATOM 3803  C C     . GLY E 1 101 ? 97.041  104.692 114.174 1.00 179.61 ?  138 GLY E C     1 
ATOM 3804  O O     . GLY E 1 101 ? 97.625  105.318 115.059 1.00 179.61 ?  138 GLY E O     1 
ATOM 3805  N N     . LEU E 1 102 ? 95.827  105.002 113.755 1.00 190.46 ?  139 LEU E N     1 
ATOM 3806  C CA    . LEU E 1 102 ? 95.130  106.155 114.277 1.00 190.46 ?  139 LEU E CA    1 
ATOM 3807  C C     . LEU E 1 102 ? 93.681  105.782 114.551 1.00 190.46 ?  139 LEU E C     1 
ATOM 3808  O O     . LEU E 1 102 ? 93.096  106.235 115.532 1.00 190.46 ?  139 LEU E O     1 
ATOM 3809  C CB    . LEU E 1 102 ? 95.231  107.322 113.295 1.00 190.46 ?  139 LEU E CB    1 
ATOM 3810  C CG    . LEU E 1 102 ? 94.789  108.724 113.714 1.00 190.46 ?  139 LEU E CG    1 
ATOM 3811  C CD1   . LEU E 1 102 ? 95.676  109.716 113.013 1.00 190.46 ?  139 LEU E CD1   1 
ATOM 3812  C CD2   . LEU E 1 102 ? 93.340  109.009 113.352 1.00 190.46 ?  139 LEU E CD2   1 
ATOM 3813  N N     . LEU F 2 15  ? 73.308  95.802  123.136 1.00 317.15 ?  22  LEU F N     1 
ATOM 3814  C CA    . LEU F 2 15  ? 74.194  95.422  124.231 1.00 317.15 ?  22  LEU F CA    1 
ATOM 3815  C C     . LEU F 2 15  ? 74.387  93.913  124.297 1.00 317.15 ?  22  LEU F C     1 
ATOM 3816  O O     . LEU F 2 15  ? 74.746  93.372  125.342 1.00 317.15 ?  22  LEU F O     1 
ATOM 3817  C CB    . LEU F 2 15  ? 73.648  95.930  125.566 1.00 317.15 ?  22  LEU F CB    1 
ATOM 3818  C CG    . LEU F 2 15  ? 73.635  97.441  125.781 1.00 317.15 ?  22  LEU F CG    1 
ATOM 3819  C CD1   . LEU F 2 15  ? 72.919  97.784  127.078 1.00 317.15 ?  22  LEU F CD1   1 
ATOM 3820  C CD2   . LEU F 2 15  ? 75.056  97.972  125.791 1.00 317.15 ?  22  LEU F CD2   1 
ATOM 3821  N N     . ARG F 2 16  ? 74.141  93.233  123.178 1.00 295.17 ?  23  ARG F N     1 
ATOM 3822  C CA    . ARG F 2 16  ? 74.246  91.780  123.123 1.00 295.17 ?  23  ARG F CA    1 
ATOM 3823  C C     . ARG F 2 16  ? 75.540  91.311  122.464 1.00 295.17 ?  23  ARG F C     1 
ATOM 3824  O O     . ARG F 2 16  ? 76.345  90.623  123.097 1.00 295.17 ?  23  ARG F O     1 
ATOM 3825  C CB    . ARG F 2 16  ? 73.028  91.209  122.386 1.00 295.17 ?  23  ARG F CB    1 
ATOM 3826  C CG    . ARG F 2 16  ? 72.944  89.700  122.389 1.00 295.17 ?  23  ARG F CG    1 
ATOM 3827  C CD    . ARG F 2 16  ? 71.675  89.230  121.707 1.00 295.17 ?  23  ARG F CD    1 
ATOM 3828  N NE    . ARG F 2 16  ? 71.576  87.775  121.684 1.00 295.17 ?  23  ARG F NE    1 
ATOM 3829  C CZ    . ARG F 2 16  ? 70.557  87.108  121.156 1.00 295.17 ?  23  ARG F CZ    1 
ATOM 3830  N NH1   . ARG F 2 16  ? 69.549  87.769  120.605 1.00 295.17 ?  23  ARG F NH1   1 
ATOM 3831  N NH2   . ARG F 2 16  ? 70.544  85.782  121.177 1.00 295.17 ?  23  ARG F NH2   1 
ATOM 3832  N N     . ASP F 2 17  ? 75.764  91.692  121.212 1.00 265.80 ?  24  ASP F N     1 
ATOM 3833  C CA    . ASP F 2 17  ? 76.832  91.127  120.391 1.00 265.80 ?  24  ASP F CA    1 
ATOM 3834  C C     . ASP F 2 17  ? 77.293  92.176  119.384 1.00 265.80 ?  24  ASP F C     1 
ATOM 3835  O O     . ASP F 2 17  ? 77.116  93.380  119.599 1.00 265.80 ?  24  ASP F O     1 
ATOM 3836  C CB    . ASP F 2 17  ? 76.366  89.830  119.705 1.00 265.80 ?  24  ASP F CB    1 
ATOM 3837  C CG    . ASP F 2 17  ? 76.444  88.620  120.611 1.00 265.80 ?  24  ASP F CG    1 
ATOM 3838  O OD1   . ASP F 2 17  ? 77.366  88.553  121.448 1.00 265.80 ?  24  ASP F OD1   1 
ATOM 3839  O OD2   . ASP F 2 17  ? 75.586  87.727  120.478 1.00 265.80 -1 24  ASP F OD2   1 
ATOM 3840  N N     . ASN F 2 18  ? 77.951  91.700  118.323 1.00 225.54 ?  25  ASN F N     1 
ATOM 3841  C CA    . ASN F 2 18  ? 78.377  92.324  117.073 1.00 225.54 ?  25  ASN F CA    1 
ATOM 3842  C C     . ASN F 2 18  ? 79.668  93.129  117.192 1.00 225.54 ?  25  ASN F C     1 
ATOM 3843  O O     . ASN F 2 18  ? 80.182  93.573  116.169 1.00 225.54 ?  25  ASN F O     1 
ATOM 3844  C CB    . ASN F 2 18  ? 77.295  93.212  116.429 1.00 225.54 ?  25  ASN F CB    1 
ATOM 3845  C CG    . ASN F 2 18  ? 76.149  92.404  115.861 1.00 225.54 ?  25  ASN F CG    1 
ATOM 3846  O OD1   . ASN F 2 18  ? 76.360  91.352  115.258 1.00 225.54 ?  25  ASN F OD1   1 
ATOM 3847  N ND2   . ASN F 2 18  ? 74.928  92.891  116.047 1.00 225.54 ?  25  ASN F ND2   1 
ATOM 3848  N N     . ILE F 2 19  ? 80.225  93.322  118.384 1.00 190.53 ?  26  ILE F N     1 
ATOM 3849  C CA    . ILE F 2 19  ? 81.628  93.712  118.494 1.00 190.53 ?  26  ILE F CA    1 
ATOM 3850  C C     . ILE F 2 19  ? 82.395  92.845  119.475 1.00 190.53 ?  26  ILE F C     1 
ATOM 3851  O O     . ILE F 2 19  ? 83.624  92.698  119.350 1.00 190.53 ?  26  ILE F O     1 
ATOM 3852  C CB    . ILE F 2 19  ? 81.763  95.210  118.862 1.00 190.53 ?  26  ILE F CB    1 
ATOM 3853  C CG1   . ILE F 2 19  ? 83.178  95.732  118.589 1.00 190.53 ?  26  ILE F CG1   1 
ATOM 3854  C CG2   . ILE F 2 19  ? 81.385  95.459  120.306 1.00 190.53 ?  26  ILE F CG2   1 
ATOM 3855  C CD1   . ILE F 2 19  ? 83.303  97.219  118.664 1.00 190.53 ?  26  ILE F CD1   1 
ATOM 3856  N N     . GLN F 2 20  ? 81.731  92.144  120.388 1.00 189.22 ?  27  GLN F N     1 
ATOM 3857  C CA    . GLN F 2 20  ? 82.405  91.229  121.291 1.00 189.22 ?  27  GLN F CA    1 
ATOM 3858  C C     . GLN F 2 20  ? 82.665  89.875  120.656 1.00 189.22 ?  27  GLN F C     1 
ATOM 3859  O O     . GLN F 2 20  ? 82.930  88.908  121.373 1.00 189.22 ?  27  GLN F O     1 
ATOM 3860  C CB    . GLN F 2 20  ? 81.593  91.060  122.572 1.00 189.22 ?  27  GLN F CB    1 
ATOM 3861  C CG    . GLN F 2 20  ? 81.417  92.352  123.339 1.00 189.22 ?  27  GLN F CG    1 
ATOM 3862  C CD    . GLN F 2 20  ? 82.733  92.930  123.817 1.00 189.22 ?  27  GLN F CD    1 
ATOM 3863  O OE1   . GLN F 2 20  ? 83.633  92.199  124.226 1.00 189.22 ?  27  GLN F OE1   1 
ATOM 3864  N NE2   . GLN F 2 20  ? 82.850  94.251  123.770 1.00 189.22 ?  27  GLN F NE2   1 
ATOM 3865  N N     . GLY F 2 21  ? 82.575  89.781  119.330 1.00 190.72 ?  28  GLY F N     1 
ATOM 3866  C CA    . GLY F 2 21  ? 83.079  88.623  118.625 1.00 190.72 ?  28  GLY F CA    1 
ATOM 3867  C C     . GLY F 2 21  ? 84.589  88.565  118.567 1.00 190.72 ?  28  GLY F C     1 
ATOM 3868  O O     . GLY F 2 21  ? 85.147  87.505  118.272 1.00 190.72 ?  28  GLY F O     1 
ATOM 3869  N N     . ILE F 2 22  ? 85.264  89.679  118.831 1.00 178.65 ?  29  ILE F N     1 
ATOM 3870  C CA    . ILE F 2 22  ? 86.698  89.647  119.078 1.00 178.65 ?  29  ILE F CA    1 
ATOM 3871  C C     . ILE F 2 22  ? 86.839  89.170  120.519 1.00 178.65 ?  29  ILE F C     1 
ATOM 3872  O O     . ILE F 2 22  ? 86.836  89.970  121.453 1.00 178.65 ?  29  ILE F O     1 
ATOM 3873  C CB    . ILE F 2 22  ? 87.344  91.013  118.857 1.00 178.65 ?  29  ILE F CB    1 
ATOM 3874  C CG1   . ILE F 2 22  ? 86.974  91.541  117.480 1.00 178.65 ?  29  ILE F CG1   1 
ATOM 3875  C CG2   . ILE F 2 22  ? 88.837  90.905  118.944 1.00 178.65 ?  29  ILE F CG2   1 
ATOM 3876  C CD1   . ILE F 2 22  ? 87.460  90.686  116.360 1.00 178.65 ?  29  ILE F CD1   1 
ATOM 3877  N N     . THR F 2 23  ? 86.950  87.860  120.699 1.00 182.09 ?  30  THR F N     1 
ATOM 3878  C CA    . THR F 2 23  ? 86.631  87.216  121.962 1.00 182.09 ?  30  THR F CA    1 
ATOM 3879  C C     . THR F 2 23  ? 87.713  87.445  123.014 1.00 182.09 ?  30  THR F C     1 
ATOM 3880  O O     . THR F 2 23  ? 88.797  87.959  122.736 1.00 182.09 ?  30  THR F O     1 
ATOM 3881  C CB    . THR F 2 23  ? 86.399  85.728  121.738 1.00 182.09 ?  30  THR F CB    1 
ATOM 3882  O OG1   . THR F 2 23  ? 87.548  85.161  121.104 1.00 182.09 ?  30  THR F OG1   1 
ATOM 3883  C CG2   . THR F 2 23  ? 85.185  85.503  120.862 1.00 182.09 ?  30  THR F CG2   1 
ATOM 3884  N N     . LYS F 2 24  ? 87.394  87.033  124.243 1.00 166.27 ?  31  LYS F N     1 
ATOM 3885  C CA    . LYS F 2 24  ? 88.218  87.358  125.408 1.00 166.27 ?  31  LYS F CA    1 
ATOM 3886  C C     . LYS F 2 24  ? 89.608  86.721  125.409 1.00 166.27 ?  31  LYS F C     1 
ATOM 3887  O O     . LYS F 2 24  ? 90.566  87.426  125.765 1.00 166.27 ?  31  LYS F O     1 
ATOM 3888  C CB    . LYS F 2 24  ? 87.447  87.019  126.692 1.00 166.27 ?  31  LYS F CB    1 
ATOM 3889  C CG    . LYS F 2 24  ? 86.205  87.852  126.948 1.00 166.27 ?  31  LYS F CG    1 
ATOM 3890  C CD    . LYS F 2 24  ? 86.554  89.271  127.348 1.00 166.27 ?  31  LYS F CD    1 
ATOM 3891  C CE    . LYS F 2 24  ? 87.193  89.306  128.730 1.00 166.27 ?  31  LYS F CE    1 
ATOM 3892  N NZ    . LYS F 2 24  ? 86.251  88.890  129.802 1.00 166.27 ?  31  LYS F NZ    1 
ATOM 3893  N N     . PRO F 2 25  ? 89.816  85.440  125.067 1.00 173.82 ?  32  PRO F N     1 
ATOM 3894  C CA    . PRO F 2 25  ? 91.204  84.971  125.000 1.00 173.82 ?  32  PRO F CA    1 
ATOM 3895  C C     . PRO F 2 25  ? 91.827  85.144  123.635 1.00 173.82 ?  32  PRO F C     1 
ATOM 3896  O O     . PRO F 2 25  ? 93.004  84.807  123.469 1.00 173.82 ?  32  PRO F O     1 
ATOM 3897  C CB    . PRO F 2 25  ? 91.095  83.493  125.370 1.00 173.82 ?  32  PRO F CB    1 
ATOM 3898  C CG    . PRO F 2 25  ? 89.821  83.107  124.818 1.00 173.82 ?  32  PRO F CG    1 
ATOM 3899  C CD    . PRO F 2 25  ? 88.903  84.279  124.987 1.00 173.82 ?  32  PRO F CD    1 
ATOM 3900  N N     . ALA F 2 26  ? 91.085  85.641  122.648 1.00 173.44 ?  33  ALA F N     1 
ATOM 3901  C CA    . ALA F 2 26  ? 91.678  85.814  121.329 1.00 173.44 ?  33  ALA F CA    1 
ATOM 3902  C C     . ALA F 2 26  ? 92.637  86.993  121.312 1.00 173.44 ?  33  ALA F C     1 
ATOM 3903  O O     . ALA F 2 26  ? 93.710  86.915  120.706 1.00 173.44 ?  33  ALA F O     1 
ATOM 3904  C CB    . ALA F 2 26  ? 90.592  85.994  120.277 1.00 173.44 ?  33  ALA F CB    1 
ATOM 3905  N N     . ILE F 2 27  ? 92.266  88.091  121.969 1.00 171.54 ?  34  ILE F N     1 
ATOM 3906  C CA    . ILE F 2 27  ? 93.170  89.225  122.111 1.00 171.54 ?  34  ILE F CA    1 
ATOM 3907  C C     . ILE F 2 27  ? 94.374  88.839  122.959 1.00 171.54 ?  34  ILE F C     1 
ATOM 3908  O O     . ILE F 2 27  ? 95.491  89.323  122.734 1.00 171.54 ?  34  ILE F O     1 
ATOM 3909  C CB    . ILE F 2 27  ? 92.398  90.419  122.696 1.00 171.54 ?  34  ILE F CB    1 
ATOM 3910  C CG1   . ILE F 2 27  ? 91.306  90.835  121.730 1.00 171.54 ?  34  ILE F CG1   1 
ATOM 3911  C CG2   . ILE F 2 27  ? 93.278  91.612  122.906 1.00 171.54 ?  34  ILE F CG2   1 
ATOM 3912  C CD1   . ILE F 2 27  ? 90.357  91.838  122.303 1.00 171.54 ?  34  ILE F CD1   1 
ATOM 3913  N N     . ARG F 2 28  ? 94.171  87.931  123.920 1.00 177.20 ?  35  ARG F N     1 
ATOM 3914  C CA    . ARG F 2 28  ? 95.278  87.383  124.699 1.00 177.20 ?  35  ARG F CA    1 
ATOM 3915  C C     . ARG F 2 28  ? 96.283  86.673  123.807 1.00 177.20 ?  35  ARG F C     1 
ATOM 3916  O O     . ARG F 2 28  ? 97.475  86.994  123.828 1.00 177.20 ?  35  ARG F O     1 
ATOM 3917  C CB    . ARG F 2 28  ? 94.758  86.415  125.759 1.00 177.20 ?  35  ARG F CB    1 
ATOM 3918  C CG    . ARG F 2 28  ? 95.854  85.833  126.634 1.00 177.20 ?  35  ARG F CG    1 
ATOM 3919  C CD    . ARG F 2 28  ? 95.323  84.742  127.538 1.00 177.20 ?  35  ARG F CD    1 
ATOM 3920  N NE    . ARG F 2 28  ? 94.395  85.237  128.543 1.00 177.20 ?  35  ARG F NE    1 
ATOM 3921  C CZ    . ARG F 2 28  ? 93.668  84.448  129.324 1.00 177.20 ?  35  ARG F CZ    1 
ATOM 3922  N NH1   . ARG F 2 28  ? 93.765  83.133  129.203 1.00 177.20 ?  35  ARG F NH1   1 
ATOM 3923  N NH2   . ARG F 2 28  ? 92.846  84.968  130.222 1.00 177.20 ?  35  ARG F NH2   1 
ATOM 3924  N N     . ARG F 2 29  ? 95.810  85.740  122.978 1.00 172.56 ?  36  ARG F N     1 
ATOM 3925  C CA    . ARG F 2 29  ? 96.716  84.976  122.132 1.00 172.56 ?  36  ARG F CA    1 
ATOM 3926  C C     . ARG F 2 29  ? 97.344  85.812  121.028 1.00 172.56 ?  36  ARG F C     1 
ATOM 3927  O O     . ARG F 2 29  ? 98.354  85.387  120.460 1.00 172.56 ?  36  ARG F O     1 
ATOM 3928  C CB    . ARG F 2 29  ? 96.000  83.759  121.547 1.00 172.56 ?  36  ARG F CB    1 
ATOM 3929  C CG    . ARG F 2 29  ? 95.880  82.628  122.546 1.00 172.56 ?  36  ARG F CG    1 
ATOM 3930  C CD    . ARG F 2 29  ? 95.255  81.369  121.975 1.00 172.56 ?  36  ARG F CD    1 
ATOM 3931  N NE    . ARG F 2 29  ? 93.810  81.481  121.825 1.00 172.56 ?  36  ARG F NE    1 
ATOM 3932  C CZ    . ARG F 2 29  ? 93.174  81.424  120.665 1.00 172.56 ?  36  ARG F CZ    1 
ATOM 3933  N NH1   . ARG F 2 29  ? 93.855  81.246  119.545 1.00 172.56 ?  36  ARG F NH1   1 
ATOM 3934  N NH2   . ARG F 2 29  ? 91.855  81.533  120.628 1.00 172.56 ?  36  ARG F NH2   1 
ATOM 3935  N N     . LEU F 2 30  ? 96.781  86.980  120.711 1.00 170.62 ?  37  LEU F N     1 
ATOM 3936  C CA    . LEU F 2 30  ? 97.490  87.940  119.873 1.00 170.62 ?  37  LEU F CA    1 
ATOM 3937  C C     . LEU F 2 30  ? 98.761  88.414  120.553 1.00 170.62 ?  37  LEU F C     1 
ATOM 3938  O O     . LEU F 2 30  ? 99.869  88.197  120.051 1.00 170.62 ?  37  LEU F O     1 
ATOM 3939  C CB    . LEU F 2 30  ? 96.595  89.129  119.549 1.00 170.62 ?  37  LEU F CB    1 
ATOM 3940  C CG    . LEU F 2 30  ? 95.564  88.896  118.465 1.00 170.62 ?  37  LEU F CG    1 
ATOM 3941  C CD1   . LEU F 2 30  ? 94.606  90.054  118.386 1.00 170.62 ?  37  LEU F CD1   1 
ATOM 3942  C CD2   . LEU F 2 30  ? 96.309  88.757  117.172 1.00 170.62 ?  37  LEU F CD2   1 
ATOM 3943  N N     . ALA F 2 31  ? 98.617  89.027  121.727 1.00 169.83 ?  38  ALA F N     1 
ATOM 3944  C CA    . ALA F 2 31  ? 99.748  89.662  122.388 1.00 169.83 ?  38  ALA F CA    1 
ATOM 3945  C C     . ALA F 2 31  ? 100.767 88.661  122.914 1.00 169.83 ?  38  ALA F C     1 
ATOM 3946  O O     . ALA F 2 31  ? 101.879 89.064  123.266 1.00 169.83 ?  38  ALA F O     1 
ATOM 3947  C CB    . ALA F 2 31  ? 99.254  90.554  123.522 1.00 169.83 ?  38  ALA F CB    1 
ATOM 3948  N N     . ARG F 2 32  ? 100.421 87.373  122.967 1.00 181.44 ?  39  ARG F N     1 
ATOM 3949  C CA    . ARG F 2 32  ? 101.434 86.360  123.227 1.00 181.44 ?  39  ARG F CA    1 
ATOM 3950  C C     . ARG F 2 32  ? 102.457 86.323  122.106 1.00 181.44 ?  39  ARG F C     1 
ATOM 3951  O O     . ARG F 2 32  ? 103.635 86.047  122.348 1.00 181.44 ?  39  ARG F O     1 
ATOM 3952  C CB    . ARG F 2 32  ? 100.799 84.983  123.385 1.00 181.44 ?  39  ARG F CB    1 
ATOM 3953  C CG    . ARG F 2 32  ? 99.806  84.864  124.504 1.00 181.44 ?  39  ARG F CG    1 
ATOM 3954  C CD    . ARG F 2 32  ? 100.425 84.892  125.871 1.00 181.44 ?  39  ARG F CD    1 
ATOM 3955  N NE    . ARG F 2 32  ? 99.368  84.753  126.858 1.00 181.44 ?  39  ARG F NE    1 
ATOM 3956  C CZ    . ARG F 2 32  ? 99.557  84.781  128.165 1.00 181.44 ?  39  ARG F CZ    1 
ATOM 3957  N NH1   . ARG F 2 32  ? 100.774 84.935  128.652 1.00 181.44 ?  39  ARG F NH1   1 
ATOM 3958  N NH2   . ARG F 2 32  ? 98.525  84.652  128.981 1.00 181.44 ?  39  ARG F NH2   1 
ATOM 3959  N N     . ARG F 2 33  ? 102.029 86.598  120.874 1.00 178.20 ?  40  ARG F N     1 
ATOM 3960  C CA    . ARG F 2 33  ? 102.975 86.548  119.773 1.00 178.20 ?  40  ARG F CA    1 
ATOM 3961  C C     . ARG F 2 33  ? 103.907 87.744  119.806 1.00 178.20 ?  40  ARG F C     1 
ATOM 3962  O O     . ARG F 2 33  ? 105.078 87.631  119.433 1.00 178.20 ?  40  ARG F O     1 
ATOM 3963  C CB    . ARG F 2 33  ? 102.229 86.468  118.448 1.00 178.20 ?  40  ARG F CB    1 
ATOM 3964  C CG    . ARG F 2 33  ? 103.120 86.182  117.260 1.00 178.20 ?  40  ARG F CG    1 
ATOM 3965  C CD    . ARG F 2 33  ? 102.320 86.049  115.991 1.00 178.20 ?  40  ARG F CD    1 
ATOM 3966  N NE    . ARG F 2 33  ? 101.465 84.879  116.012 1.00 178.20 ?  40  ARG F NE    1 
ATOM 3967  C CZ    . ARG F 2 33  ? 100.536 84.652  115.103 1.00 178.20 ?  40  ARG F CZ    1 
ATOM 3968  N NH1   . ARG F 2 33  ? 100.364 85.518  114.121 1.00 178.20 ?  40  ARG F NH1   1 
ATOM 3969  N NH2   . ARG F 2 33  ? 99.788  83.567  115.172 1.00 178.20 ?  40  ARG F NH2   1 
ATOM 3970  N N     . GLY F 2 34  ? 103.430 88.876  120.308 1.00 176.58 ?  41  GLY F N     1 
ATOM 3971  C CA    . GLY F 2 34  ? 104.287 90.038  120.411 1.00 176.58 ?  41  GLY F CA    1 
ATOM 3972  C C     . GLY F 2 34  ? 105.272 89.989  121.553 1.00 176.58 ?  41  GLY F C     1 
ATOM 3973  O O     . GLY F 2 34  ? 106.179 90.826  121.598 1.00 176.58 ?  41  GLY F O     1 
ATOM 3974  N N     . GLY F 2 35  ? 105.125 89.037  122.463 1.00 179.03 ?  42  GLY F N     1 
ATOM 3975  C CA    . GLY F 2 35  ? 106.002 88.955  123.606 1.00 179.03 ?  42  GLY F CA    1 
ATOM 3976  C C     . GLY F 2 35  ? 105.474 89.619  124.850 1.00 179.03 ?  42  GLY F C     1 
ATOM 3977  O O     . GLY F 2 35  ? 106.260 90.192  125.609 1.00 179.03 ?  42  GLY F O     1 
ATOM 3978  N N     . VAL F 2 36  ? 104.174 89.579  125.081 1.00 177.29 ?  43  VAL F N     1 
ATOM 3979  C CA    . VAL F 2 36  ? 103.599 90.119  126.301 1.00 177.29 ?  43  VAL F CA    1 
ATOM 3980  C C     . VAL F 2 36  ? 103.451 88.991  127.304 1.00 177.29 ?  43  VAL F C     1 
ATOM 3981  O O     . VAL F 2 36  ? 102.685 88.049  127.076 1.00 177.29 ?  43  VAL F O     1 
ATOM 3982  C CB    . VAL F 2 36  ? 102.247 90.780  126.025 1.00 177.29 ?  43  VAL F CB    1 
ATOM 3983  C CG1   . VAL F 2 36  ? 101.666 91.298  127.303 1.00 177.29 ?  43  VAL F CG1   1 
ATOM 3984  C CG2   . VAL F 2 36  ? 102.417 91.881  125.029 1.00 177.29 ?  43  VAL F CG2   1 
ATOM 3985  N N     . LYS F 2 37  ? 104.180 89.085  128.413 1.00 195.25 ?  44  LYS F N     1 
ATOM 3986  C CA    . LYS F 2 37  ? 104.132 88.036  129.423 1.00 195.25 ?  44  LYS F CA    1 
ATOM 3987  C C     . LYS F 2 37  ? 102.784 87.989  130.126 1.00 195.25 ?  44  LYS F C     1 
ATOM 3988  O O     . LYS F 2 37  ? 102.265 86.904  130.400 1.00 195.25 ?  44  LYS F O     1 
ATOM 3989  C CB    . LYS F 2 37  ? 105.251 88.246  130.439 1.00 195.25 ?  44  LYS F CB    1 
ATOM 3990  C CG    . LYS F 2 37  ? 105.292 87.214  131.551 1.00 195.25 ?  44  LYS F CG    1 
ATOM 3991  C CD    . LYS F 2 37  ? 106.443 87.475  132.511 1.00 195.25 ?  44  LYS F CD    1 
ATOM 3992  C CE    . LYS F 2 37  ? 106.412 86.523  133.697 1.00 195.25 ?  44  LYS F CE    1 
ATOM 3993  N NZ    . LYS F 2 37  ? 107.543 86.749  134.637 1.00 195.25 ?  44  LYS F NZ    1 
ATOM 3994  N N     . ARG F 2 38  ? 102.179 89.142  130.377 1.00 183.46 ?  45  ARG F N     1 
ATOM 3995  C CA    . ARG F 2 38  ? 101.034 89.205  131.268 1.00 183.46 ?  45  ARG F CA    1 
ATOM 3996  C C     . ARG F 2 38  ? 100.241 90.474  130.993 1.00 183.46 ?  45  ARG F C     1 
ATOM 3997  O O     . ARG F 2 38  ? 100.759 91.578  131.158 1.00 183.46 ?  45  ARG F O     1 
ATOM 3998  C CB    . ARG F 2 38  ? 101.515 89.165  132.715 1.00 183.46 ?  45  ARG F CB    1 
ATOM 3999  C CG    . ARG F 2 38  ? 100.440 89.181  133.761 1.00 183.46 ?  45  ARG F CG    1 
ATOM 4000  C CD    . ARG F 2 38  ? 101.091 89.069  135.114 1.00 183.46 ?  45  ARG F CD    1 
ATOM 4001  N NE    . ARG F 2 38  ? 100.137 89.214  136.197 1.00 183.46 ?  45  ARG F NE    1 
ATOM 4002  C CZ    . ARG F 2 38  ? 100.476 89.166  137.473 1.00 183.46 ?  45  ARG F CZ    1 
ATOM 4003  N NH1   . ARG F 2 38  ? 101.742 88.973  137.807 1.00 183.46 ?  45  ARG F NH1   1 
ATOM 4004  N NH2   . ARG F 2 38  ? 99.556  89.312  138.409 1.00 183.46 ?  45  ARG F NH2   1 
ATOM 4005  N N     . ILE F 2 39  ? 98.987  90.309  130.582 1.00 182.70 ?  46  ILE F N     1 
ATOM 4006  C CA    . ILE F 2 39  ? 98.146  91.402  130.114 1.00 182.70 ?  46  ILE F CA    1 
ATOM 4007  C C     . ILE F 2 39  ? 97.299  91.908  131.271 1.00 182.70 ?  46  ILE F C     1 
ATOM 4008  O O     . ILE F 2 39  ? 96.745  91.108  132.027 1.00 182.70 ?  46  ILE F O     1 
ATOM 4009  C CB    . ILE F 2 39  ? 97.250  90.936  128.949 1.00 182.70 ?  46  ILE F CB    1 
ATOM 4010  C CG1   . ILE F 2 39  ? 98.097  90.509  127.766 1.00 182.70 ?  46  ILE F CG1   1 
ATOM 4011  C CG2   . ILE F 2 39  ? 96.319  92.016  128.480 1.00 182.70 ?  46  ILE F CG2   1 
ATOM 4012  C CD1   . ILE F 2 39  ? 97.293  89.862  126.682 1.00 182.70 ?  46  ILE F CD1   1 
ATOM 4013  N N     . SER F 2 40  ? 97.177  93.230  131.397 1.00 175.53 ?  47  SER F N     1 
ATOM 4014  C CA    . SER F 2 40  ? 96.323  93.812  132.422 1.00 175.53 ?  47  SER F CA    1 
ATOM 4015  C C     . SER F 2 40  ? 94.849  93.695  132.053 1.00 175.53 ?  47  SER F C     1 
ATOM 4016  O O     . SER F 2 40  ? 94.464  93.075  131.065 1.00 175.53 ?  47  SER F O     1 
ATOM 4017  C CB    . SER F 2 40  ? 96.649  95.279  132.642 1.00 175.53 ?  47  SER F CB    1 
ATOM 4018  O OG    . SER F 2 40  ? 95.755  95.834  133.585 1.00 175.53 ?  47  SER F OG    1 
ATOM 4019  N N     . GLY F 2 41  ? 94.020  94.332  132.862 1.00 172.11 ?  48  GLY F N     1 
ATOM 4020  C CA    . GLY F 2 41  ? 92.591  94.152  132.776 1.00 172.11 ?  48  GLY F CA    1 
ATOM 4021  C C     . GLY F 2 41  ? 91.824  95.217  132.034 1.00 172.11 ?  48  GLY F C     1 
ATOM 4022  O O     . GLY F 2 41  ? 90.616  95.350  132.248 1.00 172.11 ?  48  GLY F O     1 
ATOM 4023  N N     . LEU F 2 42  ? 92.471  95.987  131.171 1.00 168.76 ?  49  LEU F N     1 
ATOM 4024  C CA    . LEU F 2 42  ? 91.761  96.923  130.317 1.00 168.76 ?  49  LEU F CA    1 
ATOM 4025  C C     . LEU F 2 42  ? 92.166  96.820  128.857 1.00 168.76 ?  49  LEU F C     1 
ATOM 4026  O O     . LEU F 2 42  ? 91.506  97.421  128.001 1.00 168.76 ?  49  LEU F O     1 
ATOM 4027  C CB    . LEU F 2 42  ? 91.968  98.356  130.806 1.00 168.76 ?  49  LEU F CB    1 
ATOM 4028  C CG    . LEU F 2 42  ? 91.270  98.721  132.102 1.00 168.76 ?  49  LEU F CG    1 
ATOM 4029  C CD1   . LEU F 2 42  ? 91.659  100.121 132.516 1.00 168.76 ?  49  LEU F CD1   1 
ATOM 4030  C CD2   . LEU F 2 42  ? 89.783  98.615  131.884 1.00 168.76 ?  49  LEU F CD2   1 
ATOM 4031  N N     . ILE F 2 43  ? 93.222  96.068  128.548 1.00 175.20 ?  50  ILE F N     1 
ATOM 4032  C CA    . ILE F 2 43  ? 93.630  95.874  127.165 1.00 175.20 ?  50  ILE F CA    1 
ATOM 4033  C C     . ILE F 2 43  ? 92.601  95.035  126.425 1.00 175.20 ?  50  ILE F C     1 
ATOM 4034  O O     . ILE F 2 43  ? 92.438  95.176  125.209 1.00 175.20 ?  50  ILE F O     1 
ATOM 4035  C CB    . ILE F 2 43  ? 95.037  95.254  127.144 1.00 175.20 ?  50  ILE F CB    1 
ATOM 4036  C CG1   . ILE F 2 43  ? 95.984  96.125  127.958 1.00 175.20 ?  50  ILE F CG1   1 
ATOM 4037  C CG2   . ILE F 2 43  ? 95.594  95.169  125.759 1.00 175.20 ?  50  ILE F CG2   1 
ATOM 4038  C CD1   . ILE F 2 43  ? 96.105  97.526  127.439 1.00 175.20 ?  50  ILE F CD1   1 
ATOM 4039  N N     . TYR F 2 44  ? 91.847  94.201  127.153 1.00 176.08 ?  51  TYR F N     1 
ATOM 4040  C CA    . TYR F 2 44  ? 90.714  93.485  126.567 1.00 176.08 ?  51  TYR F CA    1 
ATOM 4041  C C     . TYR F 2 44  ? 89.650  94.445  126.047 1.00 176.08 ?  51  TYR F C     1 
ATOM 4042  O O     . TYR F 2 44  ? 88.877  94.094  125.151 1.00 176.08 ?  51  TYR F O     1 
ATOM 4043  C CB    . TYR F 2 44  ? 90.071  92.554  127.591 1.00 176.08 ?  51  TYR F CB    1 
ATOM 4044  C CG    . TYR F 2 44  ? 90.883  91.368  128.033 1.00 176.08 ?  51  TYR F CG    1 
ATOM 4045  C CD1   . TYR F 2 44  ? 91.992  90.948  127.326 1.00 176.08 ?  51  TYR F CD1   1 
ATOM 4046  C CD2   . TYR F 2 44  ? 90.521  90.663  129.170 1.00 176.08 ?  51  TYR F CD2   1 
ATOM 4047  C CE1   . TYR F 2 44  ? 92.722  89.862  127.749 1.00 176.08 ?  51  TYR F CE1   1 
ATOM 4048  C CE2   . TYR F 2 44  ? 91.237  89.583  129.594 1.00 176.08 ?  51  TYR F CE2   1 
ATOM 4049  C CZ    . TYR F 2 44  ? 92.336  89.184  128.884 1.00 176.08 ?  51  TYR F CZ    1 
ATOM 4050  O OH    . TYR F 2 44  ? 93.057  88.099  129.312 1.00 176.08 ?  51  TYR F OH    1 
ATOM 4051  N N     . GLU F 2 45  ? 89.574  95.648  126.613 1.00 0.00   ?  52  GLU F N     1 
ATOM 4052  C CA    . GLU F 2 45  ? 88.686  96.650  126.049 1.00 0.00   ?  52  GLU F CA    1 
ATOM 4053  C C     . GLU F 2 45  ? 89.445  97.605  125.143 1.00 0.00   ?  52  GLU F C     1 
ATOM 4054  O O     . GLU F 2 45  ? 88.864  98.156  124.204 1.00 0.00   ?  52  GLU F O     1 
ATOM 4055  C CB    . GLU F 2 45  ? 87.982  97.417  127.169 1.00 0.00   ?  52  GLU F CB    1 
ATOM 4056  C CG    . GLU F 2 45  ? 86.685  98.108  126.768 1.00 0.00   ?  52  GLU F CG    1 
ATOM 4057  C CD    . GLU F 2 45  ? 86.894  99.460  126.130 1.00 0.00   ?  52  GLU F CD    1 
ATOM 4058  O OE1   . GLU F 2 45  ? 87.922  100.101 126.424 1.00 0.00   ?  52  GLU F OE1   1 
ATOM 4059  O OE2   . GLU F 2 45  ? 86.040  99.871  125.319 1.00 0.00   -1 52  GLU F OE2   1 
ATOM 4060  N N     . GLU F 2 46  ? 90.740  97.794  125.389 1.00 188.93 ?  53  GLU F N     1 
ATOM 4061  C CA    . GLU F 2 46  ? 91.493  98.801  124.650 1.00 188.93 ?  53  GLU F CA    1 
ATOM 4062  C C     . GLU F 2 46  ? 91.793  98.344  123.229 1.00 188.93 ?  53  GLU F C     1 
ATOM 4063  O O     . GLU F 2 46  ? 91.734  99.138  122.284 1.00 188.93 ?  53  GLU F O     1 
ATOM 4064  C CB    . GLU F 2 46  ? 92.787  99.126  125.388 1.00 188.93 ?  53  GLU F CB    1 
ATOM 4065  C CG    . GLU F 2 46  ? 93.624  100.195 124.723 1.00 188.93 ?  53  GLU F CG    1 
ATOM 4066  C CD    . GLU F 2 46  ? 92.972  101.547 124.775 1.00 188.93 ?  53  GLU F CD    1 
ATOM 4067  O OE1   . GLU F 2 46  ? 92.219  101.812 125.732 1.00 188.93 ?  53  GLU F OE1   1 
ATOM 4068  O OE2   . GLU F 2 46  ? 93.202  102.347 123.851 1.00 188.93 -1 53  GLU F OE2   1 
ATOM 4069  N N     . THR F 2 47  ? 92.120  97.064  123.058 1.00 177.99 ?  54  THR F N     1 
ATOM 4070  C CA    . THR F 2 47  ? 92.440  96.563  121.728 1.00 177.99 ?  54  THR F CA    1 
ATOM 4071  C C     . THR F 2 47  ? 91.187  96.486  120.868 1.00 177.99 ?  54  THR F C     1 
ATOM 4072  O O     . THR F 2 47  ? 91.252  96.649  119.646 1.00 177.99 ?  54  THR F O     1 
ATOM 4073  C CB    . THR F 2 47  ? 93.131  95.208  121.846 1.00 177.99 ?  54  THR F CB    1 
ATOM 4074  O OG1   . THR F 2 47  ? 94.235  95.339  122.739 1.00 177.99 ?  54  THR F OG1   1 
ATOM 4075  C CG2   . THR F 2 47  ? 93.696  94.759  120.530 1.00 177.99 ?  54  THR F CG2   1 
ATOM 4076  N N     . ARG F 2 48  ? 90.022  96.327  121.495 1.00 184.24 ?  55  ARG F N     1 
ATOM 4077  C CA    . ARG F 2 48  ? 88.780  96.422  120.739 1.00 184.24 ?  55  ARG F CA    1 
ATOM 4078  C C     . ARG F 2 48  ? 88.493  97.849  120.299 1.00 184.24 ?  55  ARG F C     1 
ATOM 4079  O O     . ARG F 2 48  ? 87.678  98.065  119.399 1.00 184.24 ?  55  ARG F O     1 
ATOM 4080  C CB    . ARG F 2 48  ? 87.612  95.901  121.562 1.00 184.24 ?  55  ARG F CB    1 
ATOM 4081  C CG    . ARG F 2 48  ? 87.655  94.429  121.845 1.00 184.24 ?  55  ARG F CG    1 
ATOM 4082  C CD    . ARG F 2 48  ? 86.393  94.014  122.566 1.00 184.24 ?  55  ARG F CD    1 
ATOM 4083  N NE    . ARG F 2 48  ? 86.385  92.590  122.859 1.00 184.24 ?  55  ARG F NE    1 
ATOM 4084  C CZ    . ARG F 2 48  ? 86.765  92.073  124.017 1.00 184.24 ?  55  ARG F CZ    1 
ATOM 4085  N NH1   . ARG F 2 48  ? 87.157  92.872  124.997 1.00 184.24 ?  55  ARG F NH1   1 
ATOM 4086  N NH2   . ARG F 2 48  ? 86.733  90.762  124.199 1.00 184.24 ?  55  ARG F NH2   1 
ATOM 4087  N N     . GLY F 2 49  ? 89.133  98.832  120.922 1.00 176.58 ?  56  GLY F N     1 
ATOM 4088  C CA    . GLY F 2 49  ? 88.999  100.209 120.494 1.00 176.58 ?  56  GLY F CA    1 
ATOM 4089  C C     . GLY F 2 49  ? 89.904  100.534 119.326 1.00 176.58 ?  56  GLY F C     1 
ATOM 4090  O O     . GLY F 2 49  ? 89.497  101.239 118.400 1.00 176.58 ?  56  GLY F O     1 
ATOM 4091  N N     . VAL F 2 50  ? 91.141  100.030 119.372 1.00 167.03 ?  57  VAL F N     1 
ATOM 4092  C CA    . VAL F 2 50  ? 92.088  100.222 118.276 1.00 167.03 ?  57  VAL F CA    1 
ATOM 4093  C C     . VAL F 2 50  ? 91.599  99.519  117.020 1.00 167.03 ?  57  VAL F C     1 
ATOM 4094  O O     . VAL F 2 50  ? 91.721  100.044 115.906 1.00 167.03 ?  57  VAL F O     1 
ATOM 4095  C CB    . VAL F 2 50  ? 93.481  99.726  118.706 1.00 167.03 ?  57  VAL F CB    1 
ATOM 4096  C CG1   . VAL F 2 50  ? 94.458  99.723  117.556 1.00 167.03 ?  57  VAL F CG1   1 
ATOM 4097  C CG2   . VAL F 2 50  ? 94.006  100.599 119.801 1.00 167.03 ?  57  VAL F CG2   1 
ATOM 4098  N N     . LEU F 2 51  ? 90.989  98.348  117.185 1.00 162.42 ?  58  LEU F N     1 
ATOM 4099  C CA    . LEU F 2 51  ? 90.581  97.555  116.035 1.00 162.42 ?  58  LEU F CA    1 
ATOM 4100  C C     . LEU F 2 51  ? 89.412  98.198  115.305 1.00 162.42 ?  58  LEU F C     1 
ATOM 4101  O O     . LEU F 2 51  ? 89.283  98.055  114.085 1.00 162.42 ?  58  LEU F O     1 
ATOM 4102  C CB    . LEU F 2 51  ? 90.234  96.142  116.486 1.00 162.42 ?  58  LEU F CB    1 
ATOM 4103  C CG    . LEU F 2 51  ? 89.937  95.132  115.393 1.00 162.42 ?  58  LEU F CG    1 
ATOM 4104  C CD1   . LEU F 2 51  ? 91.131  95.029  114.498 1.00 162.42 ?  58  LEU F CD1   1 
ATOM 4105  C CD2   . LEU F 2 51  ? 89.641  93.798  116.014 1.00 162.42 ?  58  LEU F CD2   1 
ATOM 4106  N N     . LYS F 2 52  ? 88.571  98.946  116.017 1.00 162.67 ?  59  LYS F N     1 
ATOM 4107  C CA    . LYS F 2 52  ? 87.475  99.614  115.327 1.00 162.67 ?  59  LYS F CA    1 
ATOM 4108  C C     . LYS F 2 52  ? 87.974  100.852 114.591 1.00 162.67 ?  59  LYS F C     1 
ATOM 4109  O O     . LYS F 2 52  ? 87.447  101.212 113.535 1.00 162.67 ?  59  LYS F O     1 
ATOM 4110  C CB    . LYS F 2 52  ? 86.350  99.968  116.298 1.00 162.67 ?  59  LYS F CB    1 
ATOM 4111  C CG    . LYS F 2 52  ? 85.087  100.423 115.580 1.00 162.67 ?  59  LYS F CG    1 
ATOM 4112  C CD    . LYS F 2 52  ? 83.923  100.662 116.509 1.00 162.67 ?  59  LYS F CD    1 
ATOM 4113  C CE    . LYS F 2 52  ? 82.696  101.083 115.714 1.00 162.67 ?  59  LYS F CE    1 
ATOM 4114  N NZ    . LYS F 2 52  ? 81.513  101.336 116.577 1.00 162.67 ?  59  LYS F NZ    1 
ATOM 4115  N N     . VAL F 2 53  ? 89.017  101.503 115.107 1.00 171.81 ?  60  VAL F N     1 
ATOM 4116  C CA    . VAL F 2 53  ? 89.527  102.666 114.395 1.00 171.81 ?  60  VAL F CA    1 
ATOM 4117  C C     . VAL F 2 53  ? 90.605  102.251 113.398 1.00 171.81 ?  60  VAL F C     1 
ATOM 4118  O O     . VAL F 2 53  ? 91.148  103.090 112.671 1.00 171.81 ?  60  VAL F O     1 
ATOM 4119  C CB    . VAL F 2 53  ? 90.021  103.726 115.400 1.00 171.81 ?  60  VAL F CB    1 
ATOM 4120  C CG1   . VAL F 2 53  ? 91.391  103.374 115.934 1.00 171.81 ?  60  VAL F CG1   1 
ATOM 4121  C CG2   . VAL F 2 53  ? 89.951  105.144 114.825 1.00 171.81 ?  60  VAL F CG2   1 
ATOM 4122  N N     . PHE F 2 54  ? 90.922  100.961 113.327 1.00 166.59 ?  61  PHE F N     1 
ATOM 4123  C CA    . PHE F 2 54  ? 91.694  100.467 112.195 1.00 166.59 ?  61  PHE F CA    1 
ATOM 4124  C C     . PHE F 2 54  ? 90.784  100.061 111.049 1.00 166.59 ?  61  PHE F C     1 
ATOM 4125  O O     . PHE F 2 54  ? 91.147  100.207 109.879 1.00 166.59 ?  61  PHE F O     1 
ATOM 4126  C CB    . PHE F 2 54  ? 92.562  99.292  112.618 1.00 166.59 ?  61  PHE F CB    1 
ATOM 4127  C CG    . PHE F 2 54  ? 93.268  98.622  111.481 1.00 166.59 ?  61  PHE F CG    1 
ATOM 4128  C CD1   . PHE F 2 54  ? 94.364  99.205  110.896 1.00 166.59 ?  61  PHE F CD1   1 
ATOM 4129  C CD2   . PHE F 2 54  ? 92.835  97.398  111.014 1.00 166.59 ?  61  PHE F CD2   1 
ATOM 4130  C CE1   . PHE F 2 54  ? 95.010  98.583  109.859 1.00 166.59 ?  61  PHE F CE1   1 
ATOM 4131  C CE2   . PHE F 2 54  ? 93.472  96.778  109.984 1.00 166.59 ?  61  PHE F CE2   1 
ATOM 4132  C CZ    . PHE F 2 54  ? 94.559  97.369  109.402 1.00 166.59 ?  61  PHE F CZ    1 
ATOM 4133  N N     . LEU F 2 55  ? 89.604  99.535  111.358 1.00 163.93 ?  62  LEU F N     1 
ATOM 4134  C CA    . LEU F 2 55  ? 88.726  99.081  110.292 1.00 163.93 ?  62  LEU F CA    1 
ATOM 4135  C C     . LEU F 2 55  ? 87.897  100.217 109.711 1.00 163.93 ?  62  LEU F C     1 
ATOM 4136  O O     . LEU F 2 55  ? 87.197  100.012 108.717 1.00 163.93 ?  62  LEU F O     1 
ATOM 4137  C CB    . LEU F 2 55  ? 87.827  97.959  110.793 1.00 163.93 ?  62  LEU F CB    1 
ATOM 4138  C CG    . LEU F 2 55  ? 88.600  96.680  111.095 1.00 163.93 ?  62  LEU F CG    1 
ATOM 4139  C CD1   . LEU F 2 55  ? 87.708  95.651  111.736 1.00 163.93 ?  62  LEU F CD1   1 
ATOM 4140  C CD2   . LEU F 2 55  ? 89.183  96.130  109.829 1.00 163.93 ?  62  LEU F CD2   1 
ATOM 4141  N N     . GLU F 2 56  ? 87.935  101.408 110.307 1.00 176.74 ?  63  GLU F N     1 
ATOM 4142  C CA    . GLU F 2 56  ? 87.310  102.542 109.636 1.00 176.74 ?  63  GLU F CA    1 
ATOM 4143  C C     . GLU F 2 56  ? 88.307  103.332 108.805 1.00 176.74 ?  63  GLU F C     1 
ATOM 4144  O O     . GLU F 2 56  ? 87.903  104.219 108.049 1.00 176.74 ?  63  GLU F O     1 
ATOM 4145  C CB    . GLU F 2 56  ? 86.615  103.469 110.625 1.00 176.74 ?  63  GLU F CB    1 
ATOM 4146  C CG    . GLU F 2 56  ? 85.297  102.948 111.137 1.00 176.74 ?  63  GLU F CG    1 
ATOM 4147  C CD    . GLU F 2 56  ? 84.581  103.963 112.002 1.00 176.74 ?  63  GLU F CD    1 
ATOM 4148  O OE1   . GLU F 2 56  ? 85.181  105.013 112.307 1.00 176.74 ?  63  GLU F OE1   1 
ATOM 4149  O OE2   . GLU F 2 56  ? 83.414  103.721 112.369 1.00 176.74 -1 63  GLU F OE2   1 
ATOM 4150  N N     . ASN F 2 57  ? 89.596  103.051 108.928 1.00 174.27 ?  64  ASN F N     1 
ATOM 4151  C CA    . ASN F 2 57  ? 90.556  103.633 108.005 1.00 174.27 ?  64  ASN F CA    1 
ATOM 4152  C C     . ASN F 2 57  ? 91.083  102.624 107.008 1.00 174.27 ?  64  ASN F C     1 
ATOM 4153  O O     . ASN F 2 57  ? 92.174  102.817 106.464 1.00 174.27 ?  64  ASN F O     1 
ATOM 4154  C CB    . ASN F 2 57  ? 91.707  104.282 108.757 1.00 174.27 ?  64  ASN F CB    1 
ATOM 4155  C CG    . ASN F 2 57  ? 91.310  105.588 109.380 1.00 174.27 ?  64  ASN F CG    1 
ATOM 4156  O OD1   . ASN F 2 57  ? 90.539  106.349 108.803 1.00 174.27 ?  64  ASN F OD1   1 
ATOM 4157  N ND2   . ASN F 2 57  ? 91.848  105.873 110.553 1.00 174.27 ?  64  ASN F ND2   1 
ATOM 4158  N N     . VAL F 2 58  ? 90.345  101.543 106.774 1.00 163.06 ?  65  VAL F N     1 
ATOM 4159  C CA    . VAL F 2 58  ? 90.567  100.657 105.641 1.00 163.06 ?  65  VAL F CA    1 
ATOM 4160  C C     . VAL F 2 58  ? 89.310  100.524 104.798 1.00 163.06 ?  65  VAL F C     1 
ATOM 4161  O O     . VAL F 2 58  ? 89.339  100.728 103.582 1.00 163.06 ?  65  VAL F O     1 
ATOM 4162  C CB    . VAL F 2 58  ? 91.055  99.271  106.094 1.00 163.06 ?  65  VAL F CB    1 
ATOM 4163  C CG1   . VAL F 2 58  ? 91.197  98.367  104.907 1.00 163.06 ?  65  VAL F CG1   1 
ATOM 4164  C CG2   . VAL F 2 58  ? 92.362  99.385  106.806 1.00 163.06 ?  65  VAL F CG2   1 
ATOM 4165  N N     . ILE F 2 59  ? 88.183  100.210 105.439 1.00 170.96 ?  66  ILE F N     1 
ATOM 4166  C CA    . ILE F 2 59  ? 86.944  99.961  104.717 1.00 170.96 ?  66  ILE F CA    1 
ATOM 4167  C C     . ILE F 2 59  ? 86.403  101.246 104.097 1.00 170.96 ?  66  ILE F C     1 
ATOM 4168  O O     . ILE F 2 59  ? 85.707  101.198 103.076 1.00 170.96 ?  66  ILE F O     1 
ATOM 4169  C CB    . ILE F 2 59  ? 85.945  99.272  105.663 1.00 170.96 ?  66  ILE F CB    1 
ATOM 4170  C CG1   . ILE F 2 59  ? 86.558  97.971  106.147 1.00 170.96 ?  66  ILE F CG1   1 
ATOM 4171  C CG2   . ILE F 2 59  ? 84.658  98.881  104.975 1.00 170.96 ?  66  ILE F CG2   1 
ATOM 4172  C CD1   . ILE F 2 59  ? 85.779  97.317  107.257 1.00 170.96 ?  66  ILE F CD1   1 
ATOM 4173  N N     . ARG F 2 60  ? 86.756  102.415 104.647 1.00 179.15 ?  67  ARG F N     1 
ATOM 4174  C CA    . ARG F 2 60  ? 86.471  103.660 103.933 1.00 179.15 ?  67  ARG F CA    1 
ATOM 4175  C C     . ARG F 2 60  ? 87.259  103.735 102.637 1.00 179.15 ?  67  ARG F C     1 
ATOM 4176  O O     . ARG F 2 60  ? 86.713  104.075 101.584 1.00 179.15 ?  67  ARG F O     1 
ATOM 4177  C CB    . ARG F 2 60  ? 86.794  104.892 104.775 1.00 179.15 ?  67  ARG F CB    1 
ATOM 4178  C CG    . ARG F 2 60  ? 86.285  106.156 104.092 1.00 179.15 ?  67  ARG F CG    1 
ATOM 4179  C CD    . ARG F 2 60  ? 86.558  107.449 104.839 1.00 179.15 ?  67  ARG F CD    1 
ATOM 4180  N NE    . ARG F 2 60  ? 87.976  107.772 104.876 1.00 179.15 ?  67  ARG F NE    1 
ATOM 4181  C CZ    . ARG F 2 60  ? 88.673  107.911 105.994 1.00 179.15 ?  67  ARG F CZ    1 
ATOM 4182  N NH1   . ARG F 2 60  ? 88.074  107.781 107.168 1.00 179.15 ?  67  ARG F NH1   1 
ATOM 4183  N NH2   . ARG F 2 60  ? 89.965  108.198 105.936 1.00 179.15 ?  67  ARG F NH2   1 
ATOM 4184  N N     . ASP F 2 61  ? 88.539  103.396 102.686 1.00 184.08 ?  68  ASP F N     1 
ATOM 4185  C CA    . ASP F 2 61  ? 89.315  103.442 101.462 1.00 184.08 ?  68  ASP F CA    1 
ATOM 4186  C C     . ASP F 2 61  ? 89.052  102.233 100.578 1.00 184.08 ?  68  ASP F C     1 
ATOM 4187  O O     . ASP F 2 61  ? 89.378  102.265 99.391  1.00 184.08 ?  68  ASP F O     1 
ATOM 4188  C CB    . ASP F 2 61  ? 90.804  103.551 101.779 1.00 184.08 ?  68  ASP F CB    1 
ATOM 4189  C CG    . ASP F 2 61  ? 91.148  104.832 102.520 1.00 184.08 ?  68  ASP F CG    1 
ATOM 4190  O OD1   . ASP F 2 61  ? 90.341  105.782 102.475 1.00 184.08 ?  68  ASP F OD1   1 
ATOM 4191  O OD2   . ASP F 2 61  ? 92.243  104.906 103.117 1.00 184.08 -1 68  ASP F OD2   1 
ATOM 4192  N N     . ALA F 2 62  ? 88.456  101.168 101.114 1.00 171.95 ?  69  ALA F N     1 
ATOM 4193  C CA    . ALA F 2 62  ? 88.258  99.977  100.294 1.00 171.95 ?  69  ALA F CA    1 
ATOM 4194  C C     . ALA F 2 62  ? 86.900  99.983  99.613  1.00 171.95 ?  69  ALA F C     1 
ATOM 4195  O O     . ALA F 2 62  ? 86.763  99.472  98.498  1.00 171.95 ?  69  ALA F O     1 
ATOM 4196  C CB    . ALA F 2 62  ? 88.423  98.713  101.127 1.00 171.95 ?  69  ALA F CB    1 
ATOM 4197  N N     . VAL F 2 63  ? 85.878  100.550 100.254 1.00 174.02 ?  70  VAL F N     1 
ATOM 4198  C CA    . VAL F 2 63  ? 84.596  100.610 99.573  1.00 174.02 ?  70  VAL F CA    1 
ATOM 4199  C C     . VAL F 2 63  ? 84.574  101.785 98.607  1.00 174.02 ?  70  VAL F C     1 
ATOM 4200  O O     . VAL F 2 63  ? 83.669  101.888 97.774  1.00 174.02 ?  70  VAL F O     1 
ATOM 4201  C CB    . VAL F 2 63  ? 83.437  100.689 100.583 1.00 174.02 ?  70  VAL F CB    1 
ATOM 4202  C CG1   . VAL F 2 63  ? 83.239  102.102 101.074 1.00 174.02 ?  70  VAL F CG1   1 
ATOM 4203  C CG2   . VAL F 2 63  ? 82.158  100.110 100.007 1.00 174.02 ?  70  VAL F CG2   1 
ATOM 4204  N N     . THR F 2 64  ? 85.567  102.673 98.687  1.00 171.87 ?  71  THR F N     1 
ATOM 4205  C CA    . THR F 2 64  ? 85.652  103.780 97.744  1.00 171.87 ?  71  THR F CA    1 
ATOM 4206  C C     . THR F 2 64  ? 86.017  103.288 96.351  1.00 171.87 ?  71  THR F C     1 
ATOM 4207  O O     . THR F 2 64  ? 85.401  103.703 95.364  1.00 171.87 ?  71  THR F O     1 
ATOM 4208  C CB    . THR F 2 64  ? 86.666  104.799 98.243  1.00 171.87 ?  71  THR F CB    1 
ATOM 4209  O OG1   . THR F 2 64  ? 86.262  105.256 99.535  1.00 171.87 ?  71  THR F OG1   1 
ATOM 4210  C CG2   . THR F 2 64  ? 86.729  105.978 97.315  1.00 171.87 ?  71  THR F CG2   1 
ATOM 4211  N N     . TYR F 2 65  ? 86.999  102.386 96.256  1.00 167.14 ?  72  TYR F N     1 
ATOM 4212  C CA    . TYR F 2 65  ? 87.356  101.805 94.964  1.00 167.14 ?  72  TYR F CA    1 
ATOM 4213  C C     . TYR F 2 65  ? 86.234  100.948 94.399  1.00 167.14 ?  72  TYR F C     1 
ATOM 4214  O O     . TYR F 2 65  ? 86.084  100.839 93.178  1.00 167.14 ?  72  TYR F O     1 
ATOM 4215  C CB    . TYR F 2 65  ? 88.628  100.977 95.084  1.00 167.14 ?  72  TYR F CB    1 
ATOM 4216  C CG    . TYR F 2 65  ? 89.878  101.789 95.192  1.00 167.14 ?  72  TYR F CG    1 
ATOM 4217  C CD1   . TYR F 2 65  ? 90.428  102.377 94.076  1.00 167.14 ?  72  TYR F CD1   1 
ATOM 4218  C CD2   . TYR F 2 65  ? 90.526  101.945 96.399  1.00 167.14 ?  72  TYR F CD2   1 
ATOM 4219  C CE1   . TYR F 2 65  ? 91.581  103.113 94.162  1.00 167.14 ?  72  TYR F CE1   1 
ATOM 4220  C CE2   . TYR F 2 65  ? 91.683  102.680 96.495  1.00 167.14 ?  72  TYR F CE2   1 
ATOM 4221  C CZ    . TYR F 2 65  ? 92.204  103.260 95.376  1.00 167.14 ?  72  TYR F CZ    1 
ATOM 4222  O OH    . TYR F 2 65  ? 93.358  103.994 95.475  1.00 167.14 ?  72  TYR F OH    1 
ATOM 4223  N N     . THR F 2 66  ? 85.439  100.328 95.265  1.00 180.39 ?  73  THR F N     1 
ATOM 4224  C CA    . THR F 2 66  ? 84.324  99.536  94.768  1.00 180.39 ?  73  THR F CA    1 
ATOM 4225  C C     . THR F 2 66  ? 83.198  100.421 94.260  1.00 180.39 ?  73  THR F C     1 
ATOM 4226  O O     . THR F 2 66  ? 82.653  100.164 93.184  1.00 180.39 ?  73  THR F O     1 
ATOM 4227  C CB    . THR F 2 66  ? 83.825  98.592  95.858  1.00 180.39 ?  73  THR F CB    1 
ATOM 4228  O OG1   . THR F 2 66  ? 84.882  97.701  96.226  1.00 180.39 ?  73  THR F OG1   1 
ATOM 4229  C CG2   . THR F 2 66  ? 82.651  97.769  95.373  1.00 180.39 ?  73  THR F CG2   1 
ATOM 4230  N N     . GLU F 2 67  ? 82.859  101.486 94.986  1.00 181.57 ?  74  GLU F N     1 
ATOM 4231  C CA    . GLU F 2 67  ? 81.753  102.327 94.544  1.00 181.57 ?  74  GLU F CA    1 
ATOM 4232  C C     . GLU F 2 67  ? 82.163  103.199 93.365  1.00 181.57 ?  74  GLU F C     1 
ATOM 4233  O O     . GLU F 2 67  ? 81.302  103.706 92.639  1.00 181.57 ?  74  GLU F O     1 
ATOM 4234  C CB    . GLU F 2 67  ? 81.251  103.176 95.711  1.00 181.57 ?  74  GLU F CB    1 
ATOM 4235  C CG    . GLU F 2 67  ? 79.893  103.825 95.504  1.00 181.57 ?  74  GLU F CG    1 
ATOM 4236  C CD    . GLU F 2 67  ? 79.455  104.655 96.691  1.00 181.57 ?  74  GLU F CD    1 
ATOM 4237  O OE1   . GLU F 2 67  ? 80.243  104.787 97.647  1.00 181.57 ?  74  GLU F OE1   1 
ATOM 4238  O OE2   . GLU F 2 67  ? 78.317  105.168 96.676  1.00 181.57 -1 74  GLU F OE2   1 
ATOM 4239  N N     . HIS F 2 68  ? 83.466  103.356 93.134  1.00 172.73 ?  75  HIS F N     1 
ATOM 4240  C CA    . HIS F 2 68  ? 83.921  104.123 91.982  1.00 172.73 ?  75  HIS F CA    1 
ATOM 4241  C C     . HIS F 2 68  ? 83.669  103.385 90.676  1.00 172.73 ?  75  HIS F C     1 
ATOM 4242  O O     . HIS F 2 68  ? 82.863  103.821 89.850  1.00 172.73 ?  75  HIS F O     1 
ATOM 4243  C CB    . HIS F 2 68  ? 85.400  104.448 92.121  1.00 172.73 ?  75  HIS F CB    1 
ATOM 4244  C CG    . HIS F 2 68  ? 86.001  104.991 90.872  1.00 172.73 ?  75  HIS F CG    1 
ATOM 4245  N ND1   . HIS F 2 68  ? 86.661  104.195 89.962  1.00 172.73 ?  75  HIS F ND1   1 
ATOM 4246  C CD2   . HIS F 2 68  ? 85.982  106.231 90.341  1.00 172.73 ?  75  HIS F CD2   1 
ATOM 4247  C CE1   . HIS F 2 68  ? 87.063  104.934 88.946  1.00 172.73 ?  75  HIS F CE1   1 
ATOM 4248  N NE2   . HIS F 2 68  ? 86.660  106.173 89.151  1.00 172.73 ?  75  HIS F NE2   1 
ATOM 4249  N N     . ALA F 2 69  ? 84.347  102.266 90.468  1.00 166.89 ?  76  ALA F N     1 
ATOM 4250  C CA    . ALA F 2 69  ? 84.086  101.451 89.289  1.00 166.89 ?  76  ALA F CA    1 
ATOM 4251  C C     . ALA F 2 69  ? 82.849  100.633 89.592  1.00 166.89 ?  76  ALA F C     1 
ATOM 4252  O O     . ALA F 2 69  ? 82.903  99.698  90.390  1.00 166.89 ?  76  ALA F O     1 
ATOM 4253  C CB    . ALA F 2 69  ? 85.278  100.562 88.967  1.00 166.89 ?  76  ALA F CB    1 
ATOM 4254  N N     . LYS F 2 70  ? 81.750  100.946 88.912  1.00 169.07 ?  77  LYS F N     1 
ATOM 4255  C CA    . LYS F 2 70  ? 80.422  100.736 89.468  1.00 169.07 ?  77  LYS F CA    1 
ATOM 4256  C C     . LYS F 2 70  ? 80.079  99.263  89.603  1.00 169.07 ?  77  LYS F C     1 
ATOM 4257  O O     . LYS F 2 70  ? 79.581  98.631  88.669  1.00 169.07 ?  77  LYS F O     1 
ATOM 4258  C CB    . LYS F 2 70  ? 79.389  101.451 88.601  1.00 169.07 ?  77  LYS F CB    1 
ATOM 4259  C CG    . LYS F 2 70  ? 79.571  102.957 88.577  1.00 169.07 ?  77  LYS F CG    1 
ATOM 4260  C CD    . LYS F 2 70  ? 78.536  103.643 87.705  1.00 169.07 ?  77  LYS F CD    1 
ATOM 4261  C CE    . LYS F 2 70  ? 78.815  103.398 86.235  1.00 169.07 ?  77  LYS F CE    1 
ATOM 4262  N NZ    . LYS F 2 70  ? 80.097  104.030 85.823  1.00 169.07 ?  77  LYS F NZ    1 
ATOM 4263  N N     . ARG F 2 71  ? 80.372  98.717  90.778  1.00 169.95 ?  78  ARG F N     1 
ATOM 4264  C CA    . ARG F 2 71  ? 80.103  97.331  91.107  1.00 169.95 ?  78  ARG F CA    1 
ATOM 4265  C C     . ARG F 2 71  ? 79.296  97.303  92.393  1.00 169.95 ?  78  ARG F C     1 
ATOM 4266  O O     . ARG F 2 71  ? 78.817  98.332  92.874  1.00 169.95 ?  78  ARG F O     1 
ATOM 4267  C CB    . ARG F 2 71  ? 81.401  96.529  91.255  1.00 169.95 ?  78  ARG F CB    1 
ATOM 4268  C CG    . ARG F 2 71  ? 82.167  96.355  89.966  1.00 169.95 ?  78  ARG F CG    1 
ATOM 4269  C CD    . ARG F 2 71  ? 83.422  95.512  90.150  1.00 169.95 ?  78  ARG F CD    1 
ATOM 4270  N NE    . ARG F 2 71  ? 84.480  96.204  90.876  1.00 169.95 ?  78  ARG F NE    1 
ATOM 4271  C CZ    . ARG F 2 71  ? 85.625  95.635  91.233  1.00 169.95 ?  78  ARG F CZ    1 
ATOM 4272  N NH1   . ARG F 2 71  ? 85.857  94.366  90.939  1.00 169.95 ?  78  ARG F NH1   1 
ATOM 4273  N NH2   . ARG F 2 71  ? 86.539  96.333  91.885  1.00 169.95 ?  78  ARG F NH2   1 
ATOM 4274  N N     . LYS F 2 72  ? 79.122  96.107  92.940  1.00 180.63 ?  79  LYS F N     1 
ATOM 4275  C CA    . LYS F 2 72  ? 78.578  95.929  94.275  1.00 180.63 ?  79  LYS F CA    1 
ATOM 4276  C C     . LYS F 2 72  ? 79.407  94.967  95.104  1.00 180.63 ?  79  LYS F C     1 
ATOM 4277  O O     . LYS F 2 72  ? 79.022  94.651  96.234  1.00 180.63 ?  79  LYS F O     1 
ATOM 4278  C CB    . LYS F 2 72  ? 77.132  95.423  94.215  1.00 180.63 ?  79  LYS F CB    1 
ATOM 4279  C CG    . LYS F 2 72  ? 76.142  96.407  93.651  1.00 180.63 ?  79  LYS F CG    1 
ATOM 4280  C CD    . LYS F 2 72  ? 75.994  97.586  94.580  1.00 180.63 ?  79  LYS F CD    1 
ATOM 4281  C CE    . LYS F 2 72  ? 74.857  98.496  94.151  1.00 180.63 ?  79  LYS F CE    1 
ATOM 4282  N NZ    . LYS F 2 72  ? 75.166  99.238  92.901  1.00 180.63 ?  79  LYS F NZ    1 
ATOM 4283  N N     . THR F 2 73  ? 80.529  94.490  94.579  1.00 192.40 ?  80  THR F N     1 
ATOM 4284  C CA    . THR F 2 73  ? 81.334  93.474  95.239  1.00 192.40 ?  80  THR F CA    1 
ATOM 4285  C C     . THR F 2 73  ? 82.700  94.056  95.559  1.00 192.40 ?  80  THR F C     1 
ATOM 4286  O O     . THR F 2 73  ? 83.389  94.550  94.664  1.00 192.40 ?  80  THR F O     1 
ATOM 4287  C CB    . THR F 2 73  ? 81.477  92.240  94.353  1.00 192.40 ?  80  THR F CB    1 
ATOM 4288  O OG1   . THR F 2 73  ? 80.178  91.735  94.030  1.00 192.40 ?  80  THR F OG1   1 
ATOM 4289  C CG2   . THR F 2 73  ? 82.254  91.169  95.072  1.00 192.40 ?  80  THR F CG2   1 
ATOM 4290  N N     . VAL F 2 74  ? 83.087  94.006  96.826  1.00 175.48 ?  81  VAL F N     1 
ATOM 4291  C CA    . VAL F 2 74  ? 84.452  94.342  97.207  1.00 175.48 ?  81  VAL F CA    1 
ATOM 4292  C C     . VAL F 2 74  ? 85.309  93.110  96.979  1.00 175.48 ?  81  VAL F C     1 
ATOM 4293  O O     . VAL F 2 74  ? 85.065  92.057  97.572  1.00 175.48 ?  81  VAL F O     1 
ATOM 4294  C CB    . VAL F 2 74  ? 84.522  94.798  98.666  1.00 175.48 ?  81  VAL F CB    1 
ATOM 4295  C CG1   . VAL F 2 74  ? 85.941  95.090  99.032  1.00 175.48 ?  81  VAL F CG1   1 
ATOM 4296  C CG2   . VAL F 2 74  ? 83.662  96.011  98.866  1.00 175.48 ?  81  VAL F CG2   1 
ATOM 4297  N N     . THR F 2 75  ? 86.299  93.226  96.112  1.00 161.40 ?  82  THR F N     1 
ATOM 4298  C CA    . THR F 2 75  ? 87.080  92.056  95.763  1.00 161.40 ?  82  THR F CA    1 
ATOM 4299  C C     . THR F 2 75  ? 88.405  92.056  96.504  1.00 161.40 ?  82  THR F C     1 
ATOM 4300  O O     . THR F 2 75  ? 88.662  92.885  97.373  1.00 161.40 ?  82  THR F O     1 
ATOM 4301  C CB    . THR F 2 75  ? 87.336  92.000  94.267  1.00 161.40 ?  82  THR F CB    1 
ATOM 4302  O OG1   . THR F 2 75  ? 88.183  93.091  93.895  1.00 161.40 ?  82  THR F OG1   1 
ATOM 4303  C CG2   . THR F 2 75  ? 86.026  92.103  93.520  1.00 161.40 ?  82  THR F CG2   1 
ATOM 4304  N N     . ALA F 2 76  ? 89.248  91.091  96.146  1.00 158.42 ?  83  ALA F N     1 
ATOM 4305  C CA    . ALA F 2 76  ? 90.564  90.994  96.759  1.00 158.42 ?  83  ALA F CA    1 
ATOM 4306  C C     . ALA F 2 76  ? 91.449  92.149  96.336  1.00 158.42 ?  83  ALA F C     1 
ATOM 4307  O O     . ALA F 2 76  ? 92.260  92.635  97.128  1.00 158.42 ?  83  ALA F O     1 
ATOM 4308  C CB    . ALA F 2 76  ? 91.218  89.668  96.393  1.00 158.42 ?  83  ALA F CB    1 
ATOM 4309  N N     . MET F 2 77  ? 91.295  92.620  95.101  1.00 165.42 ?  84  MET F N     1 
ATOM 4310  C CA    . MET F 2 77  ? 92.116  93.737  94.653  1.00 165.42 ?  84  MET F CA    1 
ATOM 4311  C C     . MET F 2 77  ? 91.620  95.056  95.227  1.00 165.42 ?  84  MET F C     1 
ATOM 4312  O O     . MET F 2 77  ? 92.329  96.063  95.164  1.00 165.42 ?  84  MET F O     1 
ATOM 4313  C CB    . MET F 2 77  ? 92.145  93.794  93.129  1.00 165.42 ?  84  MET F CB    1 
ATOM 4314  C CG    . MET F 2 77  ? 92.742  92.560  92.484  1.00 165.42 ?  84  MET F CG    1 
ATOM 4315  S SD    . MET F 2 77  ? 94.436  92.263  92.993  1.00 165.42 ?  84  MET F SD    1 
ATOM 4316  C CE    . MET F 2 77  ? 95.275  93.597  92.157  1.00 165.42 ?  84  MET F CE    1 
ATOM 4317  N N     . ASP F 2 78  ? 90.426  95.065  95.814  1.00 174.76 ?  85  ASP F N     1 
ATOM 4318  C CA    . ASP F 2 78  ? 89.890  96.294  96.377  1.00 174.76 ?  85  ASP F CA    1 
ATOM 4319  C C     . ASP F 2 78  ? 90.436  96.561  97.771  1.00 174.76 ?  85  ASP F C     1 
ATOM 4320  O O     . ASP F 2 78  ? 90.158  97.610  98.358  1.00 174.76 ?  85  ASP F O     1 
ATOM 4321  C CB    . ASP F 2 78  ? 88.376  96.199  96.424  1.00 174.76 ?  85  ASP F CB    1 
ATOM 4322  C CG    . ASP F 2 78  ? 87.780  95.938  95.074  1.00 174.76 ?  85  ASP F CG    1 
ATOM 4323  O OD1   . ASP F 2 78  ? 88.377  96.381  94.071  1.00 174.76 ?  85  ASP F OD1   1 
ATOM 4324  O OD2   . ASP F 2 78  ? 86.734  95.256  95.014  1.00 174.76 -1 85  ASP F OD2   1 
ATOM 4325  N N     . VAL F 2 79  ? 91.173  95.615  98.333  1.00 160.19 ?  86  VAL F N     1 
ATOM 4326  C CA    . VAL F 2 79  ? 91.751  95.804  99.653  1.00 160.19 ?  86  VAL F CA    1 
ATOM 4327  C C     . VAL F 2 79  ? 93.259  95.978  99.566  1.00 160.19 ?  86  VAL F C     1 
ATOM 4328  O O     . VAL F 2 79  ? 93.842  96.768  100.313 1.00 160.19 ?  86  VAL F O     1 
ATOM 4329  C CB    . VAL F 2 79  ? 91.342  94.621  100.551 1.00 160.19 ?  86  VAL F CB    1 
ATOM 4330  C CG1   . VAL F 2 79  ? 91.996  94.692  101.910 1.00 160.19 ?  86  VAL F CG1   1 
ATOM 4331  C CG2   . VAL F 2 79  ? 89.848  94.613  100.715 1.00 160.19 ?  86  VAL F CG2   1 
ATOM 4332  N N     . VAL F 2 80  ? 93.898  95.289  98.619  1.00 160.61 ?  87  VAL F N     1 
ATOM 4333  C CA    . VAL F 2 80  ? 95.340  95.414  98.445  1.00 160.61 ?  87  VAL F CA    1 
ATOM 4334  C C     . VAL F 2 80  ? 95.698  96.810  97.947  1.00 160.61 ?  87  VAL F C     1 
ATOM 4335  O O     . VAL F 2 80  ? 96.721  97.378  98.344  1.00 160.61 ?  87  VAL F O     1 
ATOM 4336  C CB    . VAL F 2 80  ? 95.851  94.316  97.498  1.00 160.61 ?  87  VAL F CB    1 
ATOM 4337  C CG1   . VAL F 2 80  ? 97.352  94.384  97.335  1.00 160.61 ?  87  VAL F CG1   1 
ATOM 4338  C CG2   . VAL F 2 80  ? 95.455  92.968  98.019  1.00 160.61 ?  87  VAL F CG2   1 
ATOM 4339  N N     . TYR F 2 81  ? 94.842  97.404  97.113  1.00 170.93 ?  88  TYR F N     1 
ATOM 4340  C CA    . TYR F 2 81  ? 95.070  98.783  96.690  1.00 170.93 ?  88  TYR F CA    1 
ATOM 4341  C C     . TYR F 2 81  ? 94.907  99.749  97.847  1.00 170.93 ?  88  TYR F C     1 
ATOM 4342  O O     . TYR F 2 81  ? 95.766  100.609 98.064  1.00 170.93 ?  88  TYR F O     1 
ATOM 4343  C CB    . TYR F 2 81  ? 94.099  99.190  95.584  1.00 170.93 ?  88  TYR F CB    1 
ATOM 4344  C CG    . TYR F 2 81  ? 94.267  98.478  94.272  1.00 170.93 ?  88  TYR F CG    1 
ATOM 4345  C CD1   . TYR F 2 81  ? 95.438  97.814  93.964  1.00 170.93 ?  88  TYR F CD1   1 
ATOM 4346  C CD2   . TYR F 2 81  ? 93.232  98.455  93.347  1.00 170.93 ?  88  TYR F CD2   1 
ATOM 4347  C CE1   . TYR F 2 81  ? 95.578  97.151  92.775  1.00 170.93 ?  88  TYR F CE1   1 
ATOM 4348  C CE2   . TYR F 2 81  ? 93.364  97.801  92.154  1.00 170.93 ?  88  TYR F CE2   1 
ATOM 4349  C CZ    . TYR F 2 81  ? 94.538  97.153  91.873  1.00 170.93 ?  88  TYR F CZ    1 
ATOM 4350  O OH    . TYR F 2 81  ? 94.673  96.498  90.675  1.00 170.93 ?  88  TYR F OH    1 
ATOM 4351  N N     . ALA F 2 82  ? 93.823  99.609  98.610  1.00 171.40 ?  89  ALA F N     1 
ATOM 4352  C CA    . ALA F 2 82  ? 93.504  100.590 99.639  1.00 171.40 ?  89  ALA F CA    1 
ATOM 4353  C C     . ALA F 2 82  ? 94.464  100.498 100.811 1.00 171.40 ?  89  ALA F C     1 
ATOM 4354  O O     . ALA F 2 82  ? 94.592  101.447 101.589 1.00 171.40 ?  89  ALA F O     1 
ATOM 4355  C CB    . ALA F 2 82  ? 92.066  100.407 100.113 1.00 171.40 ?  89  ALA F CB    1 
ATOM 4356  N N     . LEU F 2 83  ? 95.149  99.370  100.958 1.00 173.07 ?  90  LEU F N     1 
ATOM 4357  C CA    . LEU F 2 83  ? 96.218  99.322  101.939 1.00 173.07 ?  90  LEU F CA    1 
ATOM 4358  C C     . LEU F 2 83  ? 97.531  99.799  101.346 1.00 173.07 ?  90  LEU F C     1 
ATOM 4359  O O     . LEU F 2 83  ? 98.448  100.158 102.091 1.00 173.07 ?  90  LEU F O     1 
ATOM 4360  C CB    . LEU F 2 83  ? 96.361  97.914  102.497 1.00 173.07 ?  90  LEU F CB    1 
ATOM 4361  C CG    . LEU F 2 83  ? 95.197  97.467  103.361 1.00 173.07 ?  90  LEU F CG    1 
ATOM 4362  C CD1   . LEU F 2 83  ? 95.390  96.043  103.796 1.00 173.07 ?  90  LEU F CD1   1 
ATOM 4363  C CD2   . LEU F 2 83  ? 95.112  98.365  104.547 1.00 173.07 ?  90  LEU F CD2   1 
ATOM 4364  N N     . LYS F 2 84  ? 97.642  99.827  100.018 1.00 176.60 ?  91  LYS F N     1 
ATOM 4365  C CA    . LYS F 2 84  ? 98.856  100.355 99.410  1.00 176.60 ?  91  LYS F CA    1 
ATOM 4366  C C     . LYS F 2 84  ? 98.855  101.873 99.444  1.00 176.60 ?  91  LYS F C     1 
ATOM 4367  O O     . LYS F 2 84  ? 99.900  102.500 99.638  1.00 176.60 ?  91  LYS F O     1 
ATOM 4368  C CB    . LYS F 2 84  ? 98.999  99.850  97.977  1.00 176.60 ?  91  LYS F CB    1 
ATOM 4369  C CG    . LYS F 2 84  ? 100.342 100.158 97.342  1.00 176.60 ?  91  LYS F CG    1 
ATOM 4370  C CD    . LYS F 2 84  ? 100.433 99.581  95.943  1.00 176.60 ?  91  LYS F CD    1 
ATOM 4371  C CE    . LYS F 2 84  ? 101.838 99.700  95.388  1.00 176.60 ?  91  LYS F CE    1 
ATOM 4372  N NZ    . LYS F 2 84  ? 102.247 101.111 95.174  1.00 176.60 ?  91  LYS F NZ    1 
ATOM 4373  N N     . ARG F 2 85  ? 97.689  102.482 99.270  1.00 175.67 ?  92  ARG F N     1 
ATOM 4374  C CA    . ARG F 2 85  ? 97.604  103.927 99.402  1.00 175.67 ?  92  ARG F CA    1 
ATOM 4375  C C     . ARG F 2 85  ? 97.660  104.341 100.868 1.00 175.67 ?  92  ARG F C     1 
ATOM 4376  O O     . ARG F 2 85  ? 98.054  105.468 101.180 1.00 175.67 ?  92  ARG F O     1 
ATOM 4377  C CB    . ARG F 2 85  ? 96.334  104.419 98.694  1.00 175.67 ?  92  ARG F CB    1 
ATOM 4378  C CG    . ARG F 2 85  ? 96.164  105.910 98.628  1.00 175.67 ?  92  ARG F CG    1 
ATOM 4379  C CD    . ARG F 2 85  ? 95.202  106.344 99.689  1.00 175.67 ?  92  ARG F CD    1 
ATOM 4380  N NE    . ARG F 2 85  ? 95.234  107.779 99.881  1.00 175.67 ?  92  ARG F NE    1 
ATOM 4381  C CZ    . ARG F 2 85  ? 94.703  108.376 100.938 1.00 175.67 ?  92  ARG F CZ    1 
ATOM 4382  N NH1   . ARG F 2 85  ? 94.103  107.646 101.871 1.00 175.67 ?  92  ARG F NH1   1 
ATOM 4383  N NH2   . ARG F 2 85  ? 94.780  109.689 101.075 1.00 175.67 ?  92  ARG F NH2   1 
ATOM 4384  N N     . GLN F 2 86  ? 97.280  103.443 101.773 1.00 174.28 ?  93  GLN F N     1 
ATOM 4385  C CA    . GLN F 2 86  ? 97.367  103.725 103.200 1.00 174.28 ?  93  GLN F CA    1 
ATOM 4386  C C     . GLN F 2 86  ? 98.813  103.823 103.665 1.00 174.28 ?  93  GLN F C     1 
ATOM 4387  O O     . GLN F 2 86  ? 99.162  104.740 104.413 1.00 174.28 ?  93  GLN F O     1 
ATOM 4388  C CB    . GLN F 2 86  ? 96.640  102.629 103.973 1.00 174.28 ?  93  GLN F CB    1 
ATOM 4389  C CG    . GLN F 2 86  ? 96.606  102.795 105.470 1.00 174.28 ?  93  GLN F CG    1 
ATOM 4390  C CD    . GLN F 2 86  ? 95.743  103.932 105.897 1.00 174.28 ?  93  GLN F CD    1 
ATOM 4391  O OE1   . GLN F 2 86  ? 96.234  104.997 106.251 1.00 174.28 ?  93  GLN F OE1   1 
ATOM 4392  N NE2   . GLN F 2 86  ? 94.437  103.717 105.876 1.00 174.28 ?  93  GLN F NE2   1 
ATOM 4393  N N     . GLY F 2 87  ? 99.660  102.912 103.217 1.00 175.36 ?  94  GLY F N     1 
ATOM 4394  C CA    . GLY F 2 87  ? 101.017 102.803 103.685 1.00 175.36 ?  94  GLY F CA    1 
ATOM 4395  C C     . GLY F 2 87  ? 101.417 101.418 104.149 1.00 175.36 ?  94  GLY F C     1 
ATOM 4396  O O     . GLY F 2 87  ? 102.467 101.282 104.785 1.00 175.36 ?  94  GLY F O     1 
ATOM 4397  N N     . ARG F 2 88  ? 100.617 100.394 103.856 1.00 181.90 ?  95  ARG F N     1 
ATOM 4398  C CA    . ARG F 2 88  ? 100.826 99.027  104.329 1.00 181.90 ?  95  ARG F CA    1 
ATOM 4399  C C     . ARG F 2 88  ? 100.642 98.136  103.108 1.00 181.90 ?  95  ARG F C     1 
ATOM 4400  O O     . ARG F 2 88  ? 99.557  97.603  102.883 1.00 181.90 ?  95  ARG F O     1 
ATOM 4401  C CB    . ARG F 2 88  ? 99.801  98.604  105.466 1.00 181.90 ?  95  ARG F CB    1 
ATOM 4402  C CG    . ARG F 2 88  ? 99.883  99.256  106.853 1.00 181.90 ?  95  ARG F CG    1 
ATOM 4403  C CD    . ARG F 2 88  ? 99.257  100.633 106.793 1.00 181.90 ?  95  ARG F CD    1 
ATOM 4404  N NE    . ARG F 2 88  ? 98.873  101.237 108.057 1.00 181.90 ?  95  ARG F NE    1 
ATOM 4405  C CZ    . ARG F 2 88  ? 97.631  101.232 108.519 1.00 181.90 ?  95  ARG F CZ    1 
ATOM 4406  N NH1   . ARG F 2 88  ? 96.665  100.661 107.823 1.00 181.90 ?  95  ARG F NH1   1 
ATOM 4407  N NH2   . ARG F 2 88  ? 97.351  101.815 109.665 1.00 181.90 ?  95  ARG F NH2   1 
ATOM 4408  N N     . THR F 2 89  ? 101.697 97.951  102.330 1.00 183.41 ?  96  THR F N     1 
ATOM 4409  C CA    . THR F 2 89  ? 101.575 97.143  101.128 1.00 183.41 ?  96  THR F CA    1 
ATOM 4410  C C     . THR F 2 89  ? 101.580 95.673  101.516 1.00 183.41 ?  96  THR F C     1 
ATOM 4411  O O     . THR F 2 89  ? 102.417 95.239  102.310 1.00 183.41 ?  96  THR F O     1 
ATOM 4412  C CB    . THR F 2 89  ? 102.709 97.449  100.158 1.00 183.41 ?  96  THR F CB    1 
ATOM 4413  O OG1   . THR F 2 89  ? 102.700 98.844  99.854  1.00 183.41 ?  96  THR F OG1   1 
ATOM 4414  C CG2   . THR F 2 89  ? 102.519 96.691  98.870  1.00 183.41 ?  96  THR F CG2   1 
ATOM 4415  N N     . LEU F 2 90  ? 100.636 94.913  100.968 1.00 180.64 ?  97  LEU F N     1 
ATOM 4416  C CA    . LEU F 2 90  ? 100.422 93.517  101.323 1.00 180.64 ?  97  LEU F CA    1 
ATOM 4417  C C     . LEU F 2 90  ? 100.765 92.634  100.134 1.00 180.64 ?  97  LEU F C     1 
ATOM 4418  O O     . LEU F 2 90  ? 100.413 92.961  99.000  1.00 180.64 ?  97  LEU F O     1 
ATOM 4419  C CB    . LEU F 2 90  ? 98.975  93.308  101.750 1.00 180.64 ?  97  LEU F CB    1 
ATOM 4420  C CG    . LEU F 2 90  ? 98.579  91.915  102.175 1.00 180.64 ?  97  LEU F CG    1 
ATOM 4421  C CD1   . LEU F 2 90  ? 99.462  91.497  103.304 1.00 180.64 ?  97  LEU F CD1   1 
ATOM 4422  C CD2   . LEU F 2 90  ? 97.146  91.951  102.624 1.00 180.64 ?  97  LEU F CD2   1 
ATOM 4423  N N     . TYR F 2 91  ? 101.455 91.523  100.385 1.00 181.48 ?  98  TYR F N     1 
ATOM 4424  C CA    . TYR F 2 91  ? 101.980 90.694  99.306  1.00 181.48 ?  98  TYR F CA    1 
ATOM 4425  C C     . TYR F 2 91  ? 101.251 89.369  99.165  1.00 181.48 ?  98  TYR F C     1 
ATOM 4426  O O     . TYR F 2 91  ? 101.818 88.404  98.642  1.00 181.48 ?  98  TYR F O     1 
ATOM 4427  C CB    . TYR F 2 91  ? 103.468 90.409  99.486  1.00 181.48 ?  98  TYR F CB    1 
ATOM 4428  C CG    . TYR F 2 91  ? 104.401 91.541  99.174  1.00 181.48 ?  98  TYR F CG    1 
ATOM 4429  C CD1   . TYR F 2 91  ? 103.927 92.751  98.714  1.00 181.48 ?  98  TYR F CD1   1 
ATOM 4430  C CD2   . TYR F 2 91  ? 105.770 91.360  99.256  1.00 181.48 ?  98  TYR F CD2   1 
ATOM 4431  C CE1   . TYR F 2 91  ? 104.782 93.773  98.425  1.00 181.48 ?  98  TYR F CE1   1 
ATOM 4432  C CE2   . TYR F 2 91  ? 106.635 92.368  98.943  1.00 181.48 ?  98  TYR F CE2   1 
ATOM 4433  C CZ    . TYR F 2 91  ? 106.132 93.575  98.528  1.00 181.48 ?  98  TYR F CZ    1 
ATOM 4434  O OH    . TYR F 2 91  ? 106.980 94.606  98.219  1.00 181.48 ?  98  TYR F OH    1 
ATOM 4435  N N     . GLY F 2 92  ? 100.012 89.290  99.611  1.00 181.76 ?  99  GLY F N     1 
ATOM 4436  C CA    . GLY F 2 92  ? 99.327  88.021  99.528  1.00 181.76 ?  99  GLY F CA    1 
ATOM 4437  C C     . GLY F 2 92  ? 98.630  87.785  98.208  1.00 181.76 ?  99  GLY F C     1 
ATOM 4438  O O     . GLY F 2 92  ? 98.720  86.697  97.638  1.00 181.76 ?  99  GLY F O     1 
ATOM 4439  N N     . PHE F 2 93  ? 97.941  88.804  97.701  1.00 185.02 ?  100 PHE F N     1 
ATOM 4440  C CA    . PHE F 2 93  ? 96.874  88.549  96.750  1.00 185.02 ?  100 PHE F CA    1 
ATOM 4441  C C     . PHE F 2 93  ? 96.986  89.323  95.454  1.00 185.02 ?  100 PHE F C     1 
ATOM 4442  O O     . PHE F 2 93  ? 96.475  88.846  94.438  1.00 185.02 ?  100 PHE F O     1 
ATOM 4443  C CB    . PHE F 2 93  ? 95.539  88.873  97.417  1.00 185.02 ?  100 PHE F CB    1 
ATOM 4444  C CG    . PHE F 2 93  ? 95.449  88.332  98.793  1.00 185.02 ?  100 PHE F CG    1 
ATOM 4445  C CD1   . PHE F 2 93  ? 95.324  86.982  99.007  1.00 185.02 ?  100 PHE F CD1   1 
ATOM 4446  C CD2   . PHE F 2 93  ? 95.549  89.175  99.881  1.00 185.02 ?  100 PHE F CD2   1 
ATOM 4447  C CE1   . PHE F 2 93  ? 95.276  86.483  100.286 1.00 185.02 ?  100 PHE F CE1   1 
ATOM 4448  C CE2   . PHE F 2 93  ? 95.502  88.688  101.156 1.00 185.02 ?  100 PHE F CE2   1 
ATOM 4449  C CZ    . PHE F 2 93  ? 95.364  87.342  101.357 1.00 185.02 ?  100 PHE F CZ    1 
ATOM 4450  N N     . GLY F 2 94  ? 97.618  90.488  95.444  1.00 206.10 ?  101 GLY F N     1 
ATOM 4451  C CA    . GLY F 2 94  ? 97.726  91.286  94.241  1.00 206.10 ?  101 GLY F CA    1 
ATOM 4452  C C     . GLY F 2 94  ? 98.654  90.679  93.218  1.00 206.10 ?  101 GLY F C     1 
ATOM 4453  O O     . GLY F 2 94  ? 99.777  91.142  93.036  1.00 206.10 ?  101 GLY F O     1 
ATOM 4454  O OXT   . GLY F 2 94  ? 98.304  89.704  92.560  1.00 206.10 -1 101 GLY F OXT   1 
ATOM 4455  N N     . LYS G 3 1   ? 81.742  137.412 74.376  1.00 240.47 ?  13  LYS G N     1 
ATOM 4456  C CA    . LYS G 3 1   ? 83.159  137.579 74.667  1.00 240.47 ?  13  LYS G CA    1 
ATOM 4457  C C     . LYS G 3 1   ? 83.498  137.091 76.074  1.00 240.47 ?  13  LYS G C     1 
ATOM 4458  O O     . LYS G 3 1   ? 84.628  137.246 76.535  1.00 240.47 ?  13  LYS G O     1 
ATOM 4459  C CB    . LYS G 3 1   ? 83.566  139.032 74.499  1.00 240.47 ?  13  LYS G CB    1 
ATOM 4460  N N     . ALA G 3 2   ? 82.511  136.499 76.753  1.00 236.96 ?  14  ALA G N     1 
ATOM 4461  C CA    . ALA G 3 2   ? 82.703  135.917 78.084  1.00 236.96 ?  14  ALA G CA    1 
ATOM 4462  C C     . ALA G 3 2   ? 83.434  134.589 77.920  1.00 236.96 ?  14  ALA G C     1 
ATOM 4463  O O     . ALA G 3 2   ? 82.848  133.504 77.934  1.00 236.96 ?  14  ALA G O     1 
ATOM 4464  C CB    . ALA G 3 2   ? 81.368  135.739 78.798  1.00 236.96 ?  14  ALA G CB    1 
ATOM 4465  N N     . LYS G 3 3   ? 84.751  134.684 77.763  1.00 238.43 ?  15  LYS G N     1 
ATOM 4466  C CA    . LYS G 3 3   ? 85.514  133.548 77.270  1.00 238.43 ?  15  LYS G CA    1 
ATOM 4467  C C     . LYS G 3 3   ? 86.524  133.035 78.284  1.00 238.43 ?  15  LYS G C     1 
ATOM 4468  O O     . LYS G 3 3   ? 87.160  132.006 78.041  1.00 238.43 ?  15  LYS G O     1 
ATOM 4469  C CB    . LYS G 3 3   ? 86.202  133.936 75.965  1.00 238.43 ?  15  LYS G CB    1 
ATOM 4470  C CG    . LYS G 3 3   ? 87.187  135.069 76.106  1.00 238.43 ?  15  LYS G CG    1 
ATOM 4471  C CD    . LYS G 3 3   ? 87.684  135.501 74.745  1.00 238.43 ?  15  LYS G CD    1 
ATOM 4472  C CE    . LYS G 3 3   ? 86.583  136.243 74.000  1.00 238.43 ?  15  LYS G CE    1 
ATOM 4473  N NZ    . LYS G 3 3   ? 87.033  136.813 72.703  1.00 238.43 ?  15  LYS G NZ    1 
ATOM 4474  N N     . SER G 3 4   ? 86.692  133.721 79.408  1.00 219.51 ?  16  SER G N     1 
ATOM 4475  C CA    . SER G 3 4   ? 87.538  133.211 80.480  1.00 219.51 ?  16  SER G CA    1 
ATOM 4476  C C     . SER G 3 4   ? 86.782  132.103 81.198  1.00 219.51 ?  16  SER G C     1 
ATOM 4477  O O     . SER G 3 4   ? 85.724  132.350 81.786  1.00 219.51 ?  16  SER G O     1 
ATOM 4478  C CB    . SER G 3 4   ? 87.918  134.331 81.440  1.00 219.51 ?  16  SER G CB    1 
ATOM 4479  O OG    . SER G 3 4   ? 88.698  135.310 80.781  1.00 219.51 ?  16  SER G OG    1 
ATOM 4480  N N     . ARG G 3 5   ? 87.315  130.876 81.143  1.00 209.50 ?  17  ARG G N     1 
ATOM 4481  C CA    . ARG G 3 5   ? 86.601  129.740 81.719  1.00 209.50 ?  17  ARG G CA    1 
ATOM 4482  C C     . ARG G 3 5   ? 86.557  129.803 83.235  1.00 209.50 ?  17  ARG G C     1 
ATOM 4483  O O     . ARG G 3 5   ? 85.653  129.226 83.847  1.00 209.50 ?  17  ARG G O     1 
ATOM 4484  C CB    . ARG G 3 5   ? 87.225  128.419 81.276  1.00 209.50 ?  17  ARG G CB    1 
ATOM 4485  C CG    . ARG G 3 5   ? 86.981  128.072 79.825  1.00 209.50 ?  17  ARG G CG    1 
ATOM 4486  C CD    . ARG G 3 5   ? 87.490  126.680 79.495  1.00 209.50 ?  17  ARG G CD    1 
ATOM 4487  N NE    . ARG G 3 5   ? 88.942  126.584 79.526  1.00 209.50 ?  17  ARG G NE    1 
ATOM 4488  C CZ    . ARG G 3 5   ? 89.606  125.440 79.434  1.00 209.50 ?  17  ARG G CZ    1 
ATOM 4489  N NH1   . ARG G 3 5   ? 88.945  124.299 79.316  1.00 209.50 ?  17  ARG G NH1   1 
ATOM 4490  N NH2   . ARG G 3 5   ? 90.929  125.437 79.466  1.00 209.50 ?  17  ARG G NH2   1 
ATOM 4491  N N     . SER G 3 6   ? 87.518  130.484 83.853  1.00 200.92 ?  18  SER G N     1 
ATOM 4492  C CA    . SER G 3 6   ? 87.449  130.706 85.289  1.00 200.92 ?  18  SER G CA    1 
ATOM 4493  C C     . SER G 3 6   ? 86.268  131.589 85.659  1.00 200.92 ?  18  SER G C     1 
ATOM 4494  O O     . SER G 3 6   ? 85.541  131.281 86.609  1.00 200.92 ?  18  SER G O     1 
ATOM 4495  C CB    . SER G 3 6   ? 88.750  131.325 85.778  1.00 200.92 ?  18  SER G CB    1 
ATOM 4496  O OG    . SER G 3 6   ? 89.825  130.438 85.552  1.00 200.92 ?  18  SER G OG    1 
ATOM 4497  N N     . SER G 3 7   ? 86.047  132.669 84.909  1.00 213.18 ?  19  SER G N     1 
ATOM 4498  C CA    . SER G 3 7   ? 84.896  133.522 85.173  1.00 213.18 ?  19  SER G CA    1 
ATOM 4499  C C     . SER G 3 7   ? 83.601  132.832 84.774  1.00 213.18 ?  19  SER G C     1 
ATOM 4500  O O     . SER G 3 7   ? 82.534  133.149 85.310  1.00 213.18 ?  19  SER G O     1 
ATOM 4501  C CB    . SER G 3 7   ? 85.040  134.845 84.429  1.00 213.18 ?  19  SER G CB    1 
ATOM 4502  O OG    . SER G 3 7   ? 84.958  134.640 83.030  1.00 213.18 ?  19  SER G OG    1 
ATOM 4503  N N     . ARG G 3 8   ? 83.672  131.895 83.828  1.00 210.26 ?  20  ARG G N     1 
ATOM 4504  C CA    . ARG G 3 8   ? 82.495  131.100 83.510  1.00 210.26 ?  20  ARG G CA    1 
ATOM 4505  C C     . ARG G 3 8   ? 82.163  130.153 84.652  1.00 210.26 ?  20  ARG G C     1 
ATOM 4506  O O     . ARG G 3 8   ? 80.988  129.918 84.955  1.00 210.26 ?  20  ARG G O     1 
ATOM 4507  C CB    . ARG G 3 8   ? 82.717  130.323 82.216  1.00 210.26 ?  20  ARG G CB    1 
ATOM 4508  C CG    . ARG G 3 8   ? 81.483  129.588 81.728  1.00 210.26 ?  20  ARG G CG    1 
ATOM 4509  C CD    . ARG G 3 8   ? 81.749  128.842 80.440  1.00 210.26 ?  20  ARG G CD    1 
ATOM 4510  N NE    . ARG G 3 8   ? 82.005  129.739 79.322  1.00 210.26 ?  20  ARG G NE    1 
ATOM 4511  C CZ    . ARG G 3 8   ? 82.443  129.336 78.136  1.00 210.26 ?  20  ARG G CZ    1 
ATOM 4512  N NH1   . ARG G 3 8   ? 82.671  128.049 77.918  1.00 210.26 ?  20  ARG G NH1   1 
ATOM 4513  N NH2   . ARG G 3 8   ? 82.653  130.216 77.169  1.00 210.26 ?  20  ARG G NH2   1 
ATOM 4514  N N     . ALA G 3 9   ? 83.185  129.623 85.315  1.00 206.08 ?  21  ALA G N     1 
ATOM 4515  C CA    . ALA G 3 9   ? 82.970  128.709 86.425  1.00 206.08 ?  21  ALA G CA    1 
ATOM 4516  C C     . ALA G 3 9   ? 82.587  129.419 87.710  1.00 206.08 ?  21  ALA G C     1 
ATOM 4517  O O     . ALA G 3 9   ? 82.104  128.768 88.639  1.00 206.08 ?  21  ALA G O     1 
ATOM 4518  C CB    . ALA G 3 9   ? 84.227  127.884 86.676  1.00 206.08 ?  21  ALA G CB    1 
ATOM 4519  N N     . GLY G 3 10  ? 82.795  130.727 87.787  1.00 207.84 ?  22  GLY G N     1 
ATOM 4520  C CA    . GLY G 3 10  ? 82.586  131.427 89.039  1.00 207.84 ?  22  GLY G CA    1 
ATOM 4521  C C     . GLY G 3 10  ? 83.663  131.128 90.057  1.00 207.84 ?  22  GLY G C     1 
ATOM 4522  O O     . GLY G 3 10  ? 83.413  131.220 91.264  1.00 207.84 ?  22  GLY G O     1 
ATOM 4523  N N     . LEU G 3 11  ? 84.858  130.766 89.597  1.00 191.94 ?  23  LEU G N     1 
ATOM 4524  C CA    . LEU G 3 11  ? 85.964  130.476 90.496  1.00 191.94 ?  23  LEU G CA    1 
ATOM 4525  C C     . LEU G 3 11  ? 86.998  131.587 90.421  1.00 191.94 ?  23  LEU G C     1 
ATOM 4526  O O     . LEU G 3 11  ? 86.765  132.615 89.780  1.00 191.94 ?  23  LEU G O     1 
ATOM 4527  C CB    . LEU G 3 11  ? 86.600  129.134 90.155  1.00 191.94 ?  23  LEU G CB    1 
ATOM 4528  C CG    . LEU G 3 11  ? 85.643  127.956 90.297  1.00 191.94 ?  23  LEU G CG    1 
ATOM 4529  C CD1   . LEU G 3 11  ? 86.343  126.661 89.955  1.00 191.94 ?  23  LEU G CD1   1 
ATOM 4530  C CD2   . LEU G 3 11  ? 85.055  127.902 91.690  1.00 191.94 ?  23  LEU G CD2   1 
ATOM 4531  N N     . GLN G 3 12  ? 88.122  131.415 91.095  1.00 180.13 ?  24  GLN G N     1 
ATOM 4532  C CA    . GLN G 3 12  ? 89.181  132.409 91.040  1.00 180.13 ?  24  GLN G CA    1 
ATOM 4533  C C     . GLN G 3 12  ? 90.526  131.822 90.663  1.00 180.13 ?  24  GLN G C     1 
ATOM 4534  O O     . GLN G 3 12  ? 91.317  132.493 90.002  1.00 180.13 ?  24  GLN G O     1 
ATOM 4535  C CB    . GLN G 3 12  ? 89.297  133.139 92.380  1.00 180.13 ?  24  GLN G CB    1 
ATOM 4536  C CG    . GLN G 3 12  ? 88.046  133.904 92.769  1.00 180.13 ?  24  GLN G CG    1 
ATOM 4537  C CD    . GLN G 3 12  ? 87.711  134.994 91.780  1.00 180.13 ?  24  GLN G CD    1 
ATOM 4538  O OE1   . GLN G 3 12  ? 88.594  135.693 91.286  1.00 180.13 ?  24  GLN G OE1   1 
ATOM 4539  N NE2   . GLN G 3 12  ? 86.428  135.138 91.472  1.00 180.13 ?  24  GLN G NE2   1 
ATOM 4540  N N     . PHE G 3 13  ? 90.815  130.597 91.089  1.00 179.80 ?  25  PHE G N     1 
ATOM 4541  C CA    . PHE G 3 13  ? 91.954  129.865 90.562  1.00 179.80 ?  25  PHE G CA    1 
ATOM 4542  C C     . PHE G 3 13  ? 91.762  129.584 89.072  1.00 179.80 ?  25  PHE G C     1 
ATOM 4543  O O     . PHE G 3 13  ? 90.628  129.451 88.608  1.00 179.80 ?  25  PHE G O     1 
ATOM 4544  C CB    . PHE G 3 13  ? 92.144  128.566 91.340  1.00 179.80 ?  25  PHE G CB    1 
ATOM 4545  C CG    . PHE G 3 13  ? 93.006  128.715 92.548  1.00 179.80 ?  25  PHE G CG    1 
ATOM 4546  C CD1   . PHE G 3 13  ? 93.836  129.808 92.682  1.00 179.80 ?  25  PHE G CD1   1 
ATOM 4547  C CD2   . PHE G 3 13  ? 93.008  127.755 93.532  1.00 179.80 ?  25  PHE G CD2   1 
ATOM 4548  C CE1   . PHE G 3 13  ? 94.645  129.947 93.780  1.00 179.80 ?  25  PHE G CE1   1 
ATOM 4549  C CE2   . PHE G 3 13  ? 93.809  127.889 94.632  1.00 179.80 ?  25  PHE G CE2   1 
ATOM 4550  C CZ    . PHE G 3 13  ? 94.629  128.984 94.758  1.00 179.80 ?  25  PHE G CZ    1 
ATOM 4551  N N     . PRO G 3 14  ? 92.847  129.522 88.295  1.00 185.19 ?  26  PRO G N     1 
ATOM 4552  C CA    . PRO G 3 14  ? 92.696  129.420 86.841  1.00 185.19 ?  26  PRO G CA    1 
ATOM 4553  C C     . PRO G 3 14  ? 92.234  128.037 86.435  1.00 185.19 ?  26  PRO G C     1 
ATOM 4554  O O     . PRO G 3 14  ? 92.313  127.071 87.193  1.00 185.19 ?  26  PRO G O     1 
ATOM 4555  C CB    . PRO G 3 14  ? 94.099  129.698 86.315  1.00 185.19 ?  26  PRO G CB    1 
ATOM 4556  C CG    . PRO G 3 14  ? 94.969  129.217 87.386  1.00 185.19 ?  26  PRO G CG    1 
ATOM 4557  C CD    . PRO G 3 14  ? 94.273  129.518 88.672  1.00 185.19 ?  26  PRO G CD    1 
ATOM 4558  N N     . VAL G 3 15  ? 91.737  127.953 85.212  1.00 176.51 ?  27  VAL G N     1 
ATOM 4559  C CA    . VAL G 3 15  ? 91.286  126.696 84.637  1.00 176.51 ?  27  VAL G CA    1 
ATOM 4560  C C     . VAL G 3 15  ? 92.272  126.183 83.601  1.00 176.51 ?  27  VAL G C     1 
ATOM 4561  O O     . VAL G 3 15  ? 92.680  125.018 83.638  1.00 176.51 ?  27  VAL G O     1 
ATOM 4562  C CB    . VAL G 3 15  ? 89.876  126.833 84.029  1.00 176.51 ?  27  VAL G CB    1 
ATOM 4563  C CG1   . VAL G 3 15  ? 89.437  125.524 83.427  1.00 176.51 ?  27  VAL G CG1   1 
ATOM 4564  C CG2   . VAL G 3 15  ? 88.899  127.268 85.082  1.00 176.51 ?  27  VAL G CG2   1 
ATOM 4565  N N     . GLY G 3 16  ? 92.696  127.055 82.687  1.00 203.83 ?  28  GLY G N     1 
ATOM 4566  C CA    . GLY G 3 16  ? 93.528  126.625 81.580  1.00 203.83 ?  28  GLY G CA    1 
ATOM 4567  C C     . GLY G 3 16  ? 94.926  126.218 81.987  1.00 203.83 ?  28  GLY G C     1 
ATOM 4568  O O     . GLY G 3 16  ? 95.562  125.413 81.303  1.00 203.83 ?  28  GLY G O     1 
ATOM 4569  N N     . ARG G 3 17  ? 95.424  126.753 83.100  1.00 204.45 ?  29  ARG G N     1 
ATOM 4570  C CA    . ARG G 3 17  ? 96.743  126.335 83.554  1.00 204.45 ?  29  ARG G CA    1 
ATOM 4571  C C     . ARG G 3 17  ? 96.677  124.953 84.184  1.00 204.45 ?  29  ARG G C     1 
ATOM 4572  O O     . ARG G 3 17  ? 97.645  124.186 84.123  1.00 204.45 ?  29  ARG G O     1 
ATOM 4573  C CB    . ARG G 3 17  ? 97.324  127.364 84.521  1.00 204.45 ?  29  ARG G CB    1 
ATOM 4574  C CG    . ARG G 3 17  ? 98.775  127.123 84.855  1.00 204.45 ?  29  ARG G CG    1 
ATOM 4575  C CD    . ARG G 3 17  ? 99.339  128.257 85.646  1.00 204.45 ?  29  ARG G CD    1 
ATOM 4576  N NE    . ARG G 3 17  ? 99.395  129.462 84.836  1.00 204.45 ?  29  ARG G NE    1 
ATOM 4577  C CZ    . ARG G 3 17  ? 99.689  130.662 85.317  1.00 204.45 ?  29  ARG G CZ    1 
ATOM 4578  N NH1   . ARG G 3 17  ? 99.957  130.807 86.605  1.00 204.45 ?  29  ARG G NH1   1 
ATOM 4579  N NH2   . ARG G 3 17  ? 99.718  131.716 84.515  1.00 204.45 ?  29  ARG G NH2   1 
ATOM 4580  N N     . VAL G 3 18  ? 95.532  124.602 84.763  1.00 188.40 ?  30  VAL G N     1 
ATOM 4581  C CA    . VAL G 3 18  ? 95.348  123.240 85.243  1.00 188.40 ?  30  VAL G CA    1 
ATOM 4582  C C     . VAL G 3 18  ? 95.212  122.286 84.064  1.00 188.40 ?  30  VAL G C     1 
ATOM 4583  O O     . VAL G 3 18  ? 95.777  121.186 84.065  1.00 188.40 ?  30  VAL G O     1 
ATOM 4584  C CB    . VAL G 3 18  ? 94.137  123.170 86.184  1.00 188.40 ?  30  VAL G CB    1 
ATOM 4585  C CG1   . VAL G 3 18  ? 93.897  121.756 86.652  1.00 188.40 ?  30  VAL G CG1   1 
ATOM 4586  C CG2   . VAL G 3 18  ? 94.365  124.071 87.367  1.00 188.40 ?  30  VAL G CG2   1 
ATOM 4587  N N     . HIS G 3 19  ? 94.497  122.715 83.019  1.00 183.83 ?  31  HIS G N     1 
ATOM 4588  C CA    . HIS G 3 19  ? 94.321  121.874 81.839  1.00 183.83 ?  31  HIS G CA    1 
ATOM 4589  C C     . HIS G 3 19  ? 95.619  121.705 81.064  1.00 183.83 ?  31  HIS G C     1 
ATOM 4590  O O     . HIS G 3 19  ? 95.795  120.700 80.369  1.00 183.83 ?  31  HIS G O     1 
ATOM 4591  C CB    . HIS G 3 19  ? 93.250  122.454 80.923  1.00 183.83 ?  31  HIS G CB    1 
ATOM 4592  C CG    . HIS G 3 19  ? 92.859  121.542 79.807  1.00 183.83 ?  31  HIS G CG    1 
ATOM 4593  N ND1   . HIS G 3 19  ? 93.579  121.447 78.637  1.00 183.83 ?  31  HIS G ND1   1 
ATOM 4594  C CD2   . HIS G 3 19  ? 91.820  120.686 79.680  1.00 183.83 ?  31  HIS G CD2   1 
ATOM 4595  C CE1   . HIS G 3 19  ? 93.004  120.567 77.840  1.00 183.83 ?  31  HIS G CE1   1 
ATOM 4596  N NE2   . HIS G 3 19  ? 91.933  120.092 78.447  1.00 183.83 ?  31  HIS G NE2   1 
ATOM 4597  N N     . ARG G 3 20  ? 96.532  122.670 81.159  1.00 195.34 ?  32  ARG G N     1 
ATOM 4598  C CA    . ARG G 3 20  ? 97.826  122.491 80.517  1.00 195.34 ?  32  ARG G CA    1 
ATOM 4599  C C     . ARG G 3 20  ? 98.692  121.527 81.313  1.00 195.34 ?  32  ARG G C     1 
ATOM 4600  O O     . ARG G 3 20  ? 99.420  120.714 80.733  1.00 195.34 ?  32  ARG G O     1 
ATOM 4601  C CB    . ARG G 3 20  ? 98.526  123.839 80.341  1.00 195.34 ?  32  ARG G CB    1 
ATOM 4602  C CG    . ARG G 3 20  ? 99.789  123.767 79.497  1.00 195.34 ?  32  ARG G CG    1 
ATOM 4603  C CD    . ARG G 3 20  ? 100.400 125.137 79.252  1.00 195.34 ?  32  ARG G CD    1 
ATOM 4604  N NE    . ARG G 3 20  ? 100.967 125.745 80.451  1.00 195.34 ?  32  ARG G NE    1 
ATOM 4605  C CZ    . ARG G 3 20  ? 102.196 125.503 80.892  1.00 195.34 ?  32  ARG G CZ    1 
ATOM 4606  N NH1   . ARG G 3 20  ? 102.981 124.666 80.235  1.00 195.34 ?  32  ARG G NH1   1 
ATOM 4607  N NH2   . ARG G 3 20  ? 102.644 126.099 81.986  1.00 195.34 ?  32  ARG G NH2   1 
ATOM 4608  N N     . LEU G 3 21  ? 98.606  121.576 82.641  1.00 182.71 ?  33  LEU G N     1 
ATOM 4609  C CA    . LEU G 3 21  ? 99.452  120.712 83.450  1.00 182.71 ?  33  LEU G CA    1 
ATOM 4610  C C     . LEU G 3 21  ? 98.948  119.279 83.519  1.00 182.71 ?  33  LEU G C     1 
ATOM 4611  O O     . LEU G 3 21  ? 99.704  118.400 83.937  1.00 182.71 ?  33  LEU G O     1 
ATOM 4612  C CB    . LEU G 3 21  ? 99.603  121.273 84.859  1.00 182.71 ?  33  LEU G CB    1 
ATOM 4613  C CG    . LEU G 3 21  ? 100.469 122.524 84.951  1.00 182.71 ?  33  LEU G CG    1 
ATOM 4614  C CD1   . LEU G 3 21  ? 100.505 123.044 86.369  1.00 182.71 ?  33  LEU G CD1   1 
ATOM 4615  C CD2   . LEU G 3 21  ? 101.863 122.216 84.473  1.00 182.71 ?  33  LEU G CD2   1 
ATOM 4616  N N     . LEU G 3 22  ? 97.705  119.010 83.120  1.00 177.68 ?  34  LEU G N     1 
ATOM 4617  C CA    . LEU G 3 22  ? 97.234  117.628 83.156  1.00 177.68 ?  34  LEU G CA    1 
ATOM 4618  C C     . LEU G 3 22  ? 97.635  116.855 81.907  1.00 177.68 ?  34  LEU G C     1 
ATOM 4619  O O     . LEU G 3 22  ? 97.301  115.673 81.778  1.00 177.68 ?  34  LEU G O     1 
ATOM 4620  C CB    . LEU G 3 22  ? 95.723  117.576 83.350  1.00 177.68 ?  34  LEU G CB    1 
ATOM 4621  C CG    . LEU G 3 22  ? 95.258  117.844 84.772  1.00 177.68 ?  34  LEU G CG    1 
ATOM 4622  C CD1   . LEU G 3 22  ? 93.751  117.910 84.831  1.00 177.68 ?  34  LEU G CD1   1 
ATOM 4623  C CD2   . LEU G 3 22  ? 95.767  116.739 85.657  1.00 177.68 ?  34  LEU G CD2   1 
ATOM 4624  N N     . ARG G 3 23  ? 98.343  117.487 80.975  1.00 190.51 ?  35  ARG G N     1 
ATOM 4625  C CA    . ARG G 3 23  ? 98.843  116.725 79.838  1.00 190.51 ?  35  ARG G CA    1 
ATOM 4626  C C     . ARG G 3 23  ? 100.359 116.670 79.797  1.00 190.51 ?  35  ARG G C     1 
ATOM 4627  O O     . ARG G 3 23  ? 100.921 115.655 79.379  1.00 190.51 ?  35  ARG G O     1 
ATOM 4628  C CB    . ARG G 3 23  ? 98.293  117.288 78.534  1.00 190.51 ?  35  ARG G CB    1 
ATOM 4629  C CG    . ARG G 3 23  ? 96.838  116.954 78.358  1.00 190.51 ?  35  ARG G CG    1 
ATOM 4630  C CD    . ARG G 3 23  ? 96.268  117.474 77.068  1.00 190.51 ?  35  ARG G CD    1 
ATOM 4631  N NE    . ARG G 3 23  ? 96.180  118.924 77.062  1.00 190.51 ?  35  ARG G NE    1 
ATOM 4632  C CZ    . ARG G 3 23  ? 95.743  119.624 76.026  1.00 190.51 ?  35  ARG G CZ    1 
ATOM 4633  N NH1   . ARG G 3 23  ? 95.346  118.995 74.932  1.00 190.51 ?  35  ARG G NH1   1 
ATOM 4634  N NH2   . ARG G 3 23  ? 95.692  120.944 76.085  1.00 190.51 ?  35  ARG G NH2   1 
ATOM 4635  N N     . LYS G 3 24  ? 101.039 117.725 80.233  1.00 183.84 ?  36  LYS G N     1 
ATOM 4636  C CA    . LYS G 3 24  ? 102.493 117.695 80.240  1.00 183.84 ?  36  LYS G CA    1 
ATOM 4637  C C     . LYS G 3 24  ? 103.058 116.848 81.366  1.00 183.84 ?  36  LYS G C     1 
ATOM 4638  O O     . LYS G 3 24  ? 104.267 116.606 81.385  1.00 183.84 ?  36  LYS G O     1 
ATOM 4639  C CB    . LYS G 3 24  ? 103.060 119.112 80.331  1.00 183.84 ?  36  LYS G CB    1 
ATOM 4640  C CG    . LYS G 3 24  ? 102.704 120.053 79.172  1.00 183.84 ?  36  LYS G CG    1 
ATOM 4641  C CD    . LYS G 3 24  ? 103.470 119.766 77.873  1.00 183.84 ?  36  LYS G CD    1 
ATOM 4642  C CE    . LYS G 3 24  ? 102.622 119.033 76.833  1.00 183.84 ?  36  LYS G CE    1 
ATOM 4643  N NZ    . LYS G 3 24  ? 103.322 118.869 75.528  1.00 183.84 ?  36  LYS G NZ    1 
ATOM 4644  N N     . GLY G 3 25  ? 102.228 116.404 82.302  1.00 185.36 ?  37  GLY G N     1 
ATOM 4645  C CA    . GLY G 3 25  ? 102.686 115.475 83.309  1.00 185.36 ?  37  GLY G CA    1 
ATOM 4646  C C     . GLY G 3 25  ? 102.538 114.016 82.948  1.00 185.36 ?  37  GLY G C     1 
ATOM 4647  O O     . GLY G 3 25  ? 103.046 113.171 83.692  1.00 185.36 ?  37  GLY G O     1 
ATOM 4648  N N     . ASN G 3 26  ? 101.867 113.721 81.825  1.00 196.13 ?  38  ASN G N     1 
ATOM 4649  C CA    . ASN G 3 26  ? 101.537 112.358 81.391  1.00 196.13 ?  38  ASN G CA    1 
ATOM 4650  C C     . ASN G 3 26  ? 100.777 111.597 82.471  1.00 196.13 ?  38  ASN G C     1 
ATOM 4651  O O     . ASN G 3 26  ? 101.262 110.605 83.013  1.00 196.13 ?  38  ASN G O     1 
ATOM 4652  C CB    . ASN G 3 26  ? 102.779 111.580 80.953  1.00 196.13 ?  38  ASN G CB    1 
ATOM 4653  C CG    . ASN G 3 26  ? 103.340 112.079 79.645  1.00 196.13 ?  38  ASN G CG    1 
ATOM 4654  O OD1   . ASN G 3 26  ? 102.597 112.356 78.705  1.00 196.13 ?  38  ASN G OD1   1 
ATOM 4655  N ND2   . ASN G 3 26  ? 104.658 112.196 79.573  1.00 196.13 ?  38  ASN G ND2   1 
ATOM 4656  N N     . TYR G 3 27  ? 99.584  112.081 82.800  1.00 190.05 ?  39  TYR G N     1 
ATOM 4657  C CA    . TYR G 3 27  ? 98.778  111.415 83.813  1.00 190.05 ?  39  TYR G CA    1 
ATOM 4658  C C     . TYR G 3 27  ? 97.744  110.501 83.187  1.00 190.05 ?  39  TYR G C     1 
ATOM 4659  O O     . TYR G 3 27  ? 97.325  109.524 83.812  1.00 190.05 ?  39  TYR G O     1 
ATOM 4660  C CB    . TYR G 3 27  ? 98.111  112.455 84.703  1.00 190.05 ?  39  TYR G CB    1 
ATOM 4661  C CG    . TYR G 3 27  ? 99.077  113.194 85.595  1.00 190.05 ?  39  TYR G CG    1 
ATOM 4662  C CD1   . TYR G 3 27  ? 100.312 112.653 85.911  1.00 190.05 ?  39  TYR G CD1   1 
ATOM 4663  C CD2   . TYR G 3 27  ? 98.766  114.446 86.091  1.00 190.05 ?  39  TYR G CD2   1 
ATOM 4664  C CE1   . TYR G 3 27  ? 101.192 113.325 86.713  1.00 190.05 ?  39  TYR G CE1   1 
ATOM 4665  C CE2   . TYR G 3 27  ? 99.645  115.124 86.889  1.00 190.05 ?  39  TYR G CE2   1 
ATOM 4666  C CZ    . TYR G 3 27  ? 100.855 114.559 87.195  1.00 190.05 ?  39  TYR G CZ    1 
ATOM 4667  O OH    . TYR G 3 27  ? 101.739 115.236 87.993  1.00 190.05 ?  39  TYR G OH    1 
ATOM 4668  N N     . ALA G 3 28  ? 97.328  110.805 81.966  1.00 199.06 ?  40  ALA G N     1 
ATOM 4669  C CA    . ALA G 3 28  ? 96.567  109.885 81.140  1.00 199.06 ?  40  ALA G CA    1 
ATOM 4670  C C     . ALA G 3 28  ? 96.843  110.240 79.688  1.00 199.06 ?  40  ALA G C     1 
ATOM 4671  O O     . ALA G 3 28  ? 97.649  111.125 79.391  1.00 199.06 ?  40  ALA G O     1 
ATOM 4672  C CB    . ALA G 3 28  ? 95.072  109.942 81.461  1.00 199.06 ?  40  ALA G CB    1 
ATOM 4673  N N     . GLU G 3 29  ? 96.166  109.558 78.779  1.00 220.31 ?  41  GLU G N     1 
ATOM 4674  C CA    . GLU G 3 29  ? 96.343  109.863 77.370  1.00 220.31 ?  41  GLU G CA    1 
ATOM 4675  C C     . GLU G 3 29  ? 95.386  110.941 76.892  1.00 220.31 ?  41  GLU G C     1 
ATOM 4676  O O     . GLU G 3 29  ? 95.781  111.793 76.092  1.00 220.31 ?  41  GLU G O     1 
ATOM 4677  C CB    . GLU G 3 29  ? 96.194  108.580 76.547  1.00 220.31 ?  41  GLU G CB    1 
ATOM 4678  C CG    . GLU G 3 29  ? 96.579  108.701 75.085  1.00 220.31 ?  41  GLU G CG    1 
ATOM 4679  C CD    . GLU G 3 29  ? 95.389  108.924 74.187  1.00 220.31 ?  41  GLU G CD    1 
ATOM 4680  O OE1   . GLU G 3 29  ? 94.304  108.405 74.516  1.00 220.31 ?  41  GLU G OE1   1 
ATOM 4681  O OE2   . GLU G 3 29  ? 95.535  109.606 73.152  1.00 220.31 -1 41  GLU G OE2   1 
ATOM 4682  N N     . ARG G 3 30  ? 94.150  110.939 77.372  1.00 204.26 ?  42  ARG G N     1 
ATOM 4683  C CA    . ARG G 3 30  ? 93.190  111.987 77.069  1.00 204.26 ?  42  ARG G CA    1 
ATOM 4684  C C     . ARG G 3 30  ? 92.646  112.541 78.376  1.00 204.26 ?  42  ARG G C     1 
ATOM 4685  O O     . ARG G 3 30  ? 92.424  111.800 79.333  1.00 204.26 ?  42  ARG G O     1 
ATOM 4686  C CB    . ARG G 3 30  ? 92.062  111.455 76.165  1.00 204.26 ?  42  ARG G CB    1 
ATOM 4687  C CG    . ARG G 3 30  ? 92.563  111.123 74.769  1.00 204.26 ?  42  ARG G CG    1 
ATOM 4688  C CD    . ARG G 3 30  ? 91.599  110.326 73.886  1.00 204.26 ?  42  ARG G CD    1 
ATOM 4689  N NE    . ARG G 3 30  ? 90.427  111.058 73.420  1.00 204.26 ?  42  ARG G NE    1 
ATOM 4690  C CZ    . ARG G 3 30  ? 89.179  110.730 73.730  1.00 204.26 ?  42  ARG G CZ    1 
ATOM 4691  N NH1   . ARG G 3 30  ? 88.943  109.682 74.501  1.00 204.26 ?  42  ARG G NH1   1 
ATOM 4692  N NH2   . ARG G 3 30  ? 88.164  111.436 73.255  1.00 204.26 ?  42  ARG G NH2   1 
ATOM 4693  N N     . VAL G 3 31  ? 92.461  113.856 78.421  1.00 197.17 ?  43  VAL G N     1 
ATOM 4694  C CA    . VAL G 3 31  ? 92.047  114.558 79.630  1.00 197.17 ?  43  VAL G CA    1 
ATOM 4695  C C     . VAL G 3 31  ? 90.669  115.146 79.397  1.00 197.17 ?  43  VAL G C     1 
ATOM 4696  O O     . VAL G 3 31  ? 90.455  115.852 78.408  1.00 197.17 ?  43  VAL G O     1 
ATOM 4697  C CB    . VAL G 3 31  ? 93.048  115.656 80.009  1.00 197.17 ?  43  VAL G CB    1 
ATOM 4698  C CG1   . VAL G 3 31  ? 92.526  116.470 81.159  1.00 197.17 ?  43  VAL G CG1   1 
ATOM 4699  C CG2   . VAL G 3 31  ? 94.367  115.038 80.366  1.00 197.17 ?  43  VAL G CG2   1 
ATOM 4700  N N     . GLY G 3 32  ? 89.742  114.857 80.307  1.00 196.19 ?  44  GLY G N     1 
ATOM 4701  C CA    . GLY G 3 32  ? 88.359  115.227 80.093  1.00 196.19 ?  44  GLY G CA    1 
ATOM 4702  C C     . GLY G 3 32  ? 88.136  116.723 80.160  1.00 196.19 ?  44  GLY G C     1 
ATOM 4703  O O     . GLY G 3 32  ? 88.953  117.479 80.679  1.00 196.19 ?  44  GLY G O     1 
ATOM 4704  N N     . ALA G 3 33  ? 87.014  117.156 79.588  1.00 201.35 ?  45  ALA G N     1 
ATOM 4705  C CA    . ALA G 3 33  ? 86.696  118.577 79.594  1.00 201.35 ?  45  ALA G CA    1 
ATOM 4706  C C     . ALA G 3 33  ? 86.171  119.023 80.944  1.00 201.35 ?  45  ALA G C     1 
ATOM 4707  O O     . ALA G 3 33  ? 86.557  120.084 81.439  1.00 201.35 ?  45  ALA G O     1 
ATOM 4708  C CB    . ALA G 3 33  ? 85.676  118.901 78.506  1.00 201.35 ?  45  ALA G CB    1 
ATOM 4709  N N     . GLY G 3 34  ? 85.305  118.229 81.560  1.00 197.49 ?  46  GLY G N     1 
ATOM 4710  C CA    . GLY G 3 34  ? 84.785  118.606 82.852  1.00 197.49 ?  46  GLY G CA    1 
ATOM 4711  C C     . GLY G 3 34  ? 85.736  118.379 84.005  1.00 197.49 ?  46  GLY G C     1 
ATOM 4712  O O     . GLY G 3 34  ? 85.396  118.739 85.136  1.00 197.49 ?  46  GLY G O     1 
ATOM 4713  N N     . ALA G 3 35  ? 86.899  117.769 83.764  1.00 190.97 ?  47  ALA G N     1 
ATOM 4714  C CA    . ALA G 3 35  ? 87.806  117.488 84.877  1.00 190.97 ?  47  ALA G CA    1 
ATOM 4715  C C     . ALA G 3 35  ? 88.496  118.733 85.425  1.00 190.97 ?  47  ALA G C     1 
ATOM 4716  O O     . ALA G 3 35  ? 88.327  119.010 86.625  1.00 190.97 ?  47  ALA G O     1 
ATOM 4717  C CB    . ALA G 3 35  ? 88.800  116.388 84.490  1.00 190.97 ?  47  ALA G CB    1 
ATOM 4718  N N     . PRO G 3 36  ? 89.248  119.537 84.654  1.00 176.86 ?  48  PRO G N     1 
ATOM 4719  C CA    . PRO G 3 36  ? 90.032  120.579 85.326  1.00 176.86 ?  48  PRO G CA    1 
ATOM 4720  C C     . PRO G 3 36  ? 89.224  121.806 85.711  1.00 176.86 ?  48  PRO G C     1 
ATOM 4721  O O     . PRO G 3 36  ? 89.819  122.826 86.072  1.00 176.86 ?  48  PRO G O     1 
ATOM 4722  C CB    . PRO G 3 36  ? 91.110  120.919 84.297  1.00 176.86 ?  48  PRO G CB    1 
ATOM 4723  C CG    . PRO G 3 36  ? 90.426  120.769 83.046  1.00 176.86 ?  48  PRO G CG    1 
ATOM 4724  C CD    . PRO G 3 36  ? 89.468  119.629 83.196  1.00 176.86 ?  48  PRO G CD    1 
ATOM 4725  N N     . VAL G 3 37  ? 87.896  121.765 85.623  1.00 176.09 ?  49  VAL G N     1 
ATOM 4726  C CA    . VAL G 3 37  ? 87.122  122.745 86.367  1.00 176.09 ?  49  VAL G CA    1 
ATOM 4727  C C     . VAL G 3 37  ? 86.875  122.217 87.770  1.00 176.09 ?  49  VAL G C     1 
ATOM 4728  O O     . VAL G 3 37  ? 86.764  122.991 88.725  1.00 176.09 ?  49  VAL G O     1 
ATOM 4729  C CB    . VAL G 3 37  ? 85.820  123.103 85.620  1.00 176.09 ?  49  VAL G CB    1 
ATOM 4730  C CG1   . VAL G 3 37  ? 84.845  121.950 85.578  1.00 176.09 ?  49  VAL G CG1   1 
ATOM 4731  C CG2   . VAL G 3 37  ? 85.165  124.313 86.230  1.00 176.09 ?  49  VAL G CG2   1 
ATOM 4732  N N     . TYR G 3 38  ? 86.859  120.897 87.932  1.00 179.51 ?  50  TYR G N     1 
ATOM 4733  C CA    . TYR G 3 38  ? 86.622  120.321 89.245  1.00 179.51 ?  50  TYR G CA    1 
ATOM 4734  C C     . TYR G 3 38  ? 87.898  120.309 90.066  1.00 179.51 ?  50  TYR G C     1 
ATOM 4735  O O     . TYR G 3 38  ? 87.854  120.187 91.293  1.00 179.51 ?  50  TYR G O     1 
ATOM 4736  C CB    . TYR G 3 38  ? 86.065  118.916 89.083  1.00 179.51 ?  50  TYR G CB    1 
ATOM 4737  C CG    . TYR G 3 38  ? 85.641  118.237 90.349  1.00 179.51 ?  50  TYR G CG    1 
ATOM 4738  C CD1   . TYR G 3 38  ? 84.436  118.543 90.950  1.00 179.51 ?  50  TYR G CD1   1 
ATOM 4739  C CD2   . TYR G 3 38  ? 86.437  117.272 90.926  1.00 179.51 ?  50  TYR G CD2   1 
ATOM 4740  C CE1   . TYR G 3 38  ? 84.039  117.904 92.089  1.00 179.51 ?  50  TYR G CE1   1 
ATOM 4741  C CE2   . TYR G 3 38  ? 86.053  116.630 92.064  1.00 179.51 ?  50  TYR G CE2   1 
ATOM 4742  C CZ    . TYR G 3 38  ? 84.856  116.950 92.643  1.00 179.51 ?  50  TYR G CZ    1 
ATOM 4743  O OH    . TYR G 3 38  ? 84.483  116.300 93.789  1.00 179.51 ?  50  TYR G OH    1 
ATOM 4744  N N     . LEU G 3 39  ? 89.046  120.435 89.406  1.00 166.29 ?  51  LEU G N     1 
ATOM 4745  C CA    . LEU G 3 39  ? 90.298  120.500 90.144  1.00 166.29 ?  51  LEU G CA    1 
ATOM 4746  C C     . LEU G 3 39  ? 90.632  121.941 90.492  1.00 166.29 ?  51  LEU G C     1 
ATOM 4747  O O     . LEU G 3 39  ? 91.402  122.206 91.420  1.00 166.29 ?  51  LEU G O     1 
ATOM 4748  C CB    . LEU G 3 39  ? 91.414  119.852 89.334  1.00 166.29 ?  51  LEU G CB    1 
ATOM 4749  C CG    . LEU G 3 39  ? 92.704  119.543 90.077  1.00 166.29 ?  51  LEU G CG    1 
ATOM 4750  C CD1   . LEU G 3 39  ? 92.370  118.599 91.193  1.00 166.29 ?  51  LEU G CD1   1 
ATOM 4751  C CD2   . LEU G 3 39  ? 93.689  118.903 89.150  1.00 166.29 ?  51  LEU G CD2   1 
ATOM 4752  N N     . ALA G 3 40  ? 90.031  122.889 89.780  1.00 168.37 ?  52  ALA G N     1 
ATOM 4753  C CA    . ALA G 3 40  ? 90.220  124.288 90.129  1.00 168.37 ?  52  ALA G CA    1 
ATOM 4754  C C     . ALA G 3 40  ? 89.223  124.740 91.180  1.00 168.37 ?  52  ALA G C     1 
ATOM 4755  O O     . ALA G 3 40  ? 89.182  125.924 91.520  1.00 168.37 ?  52  ALA G O     1 
ATOM 4756  C CB    . ALA G 3 40  ? 90.109  125.164 88.889  1.00 168.37 ?  52  ALA G CB    1 
ATOM 4757  N N     . ALA G 3 41  ? 88.392  123.830 91.680  1.00 172.24 ?  53  ALA G N     1 
ATOM 4758  C CA    . ALA G 3 41  ? 87.553  124.168 92.819  1.00 172.24 ?  53  ALA G CA    1 
ATOM 4759  C C     . ALA G 3 41  ? 88.162  123.663 94.115  1.00 172.24 ?  53  ALA G C     1 
ATOM 4760  O O     . ALA G 3 41  ? 88.207  124.395 95.109  1.00 172.24 ?  53  ALA G O     1 
ATOM 4761  C CB    . ALA G 3 41  ? 86.152  123.598 92.637  1.00 172.24 ?  53  ALA G CB    1 
ATOM 4762  N N     . VAL G 3 42  ? 88.631  122.414 94.119  1.00 166.75 ?  54  VAL G N     1 
ATOM 4763  C CA    . VAL G 3 42  ? 89.124  121.793 95.344  1.00 166.75 ?  54  VAL G CA    1 
ATOM 4764  C C     . VAL G 3 42  ? 90.421  122.455 95.790  1.00 166.75 ?  54  VAL G C     1 
ATOM 4765  O O     . VAL G 3 42  ? 90.687  122.588 96.991  1.00 166.75 ?  54  VAL G O     1 
ATOM 4766  C CB    . VAL G 3 42  ? 89.271  120.274 95.130  1.00 166.75 ?  54  VAL G CB    1 
ATOM 4767  C CG1   . VAL G 3 42  ? 89.854  119.572 96.333  1.00 166.75 ?  54  VAL G CG1   1 
ATOM 4768  C CG2   . VAL G 3 42  ? 87.930  119.685 94.832  1.00 166.75 ?  54  VAL G CG2   1 
ATOM 4769  N N     . LEU G 3 43  ? 91.211  122.958 94.845  1.00 169.40 ?  55  LEU G N     1 
ATOM 4770  C CA    . LEU G 3 43  ? 92.376  123.723 95.262  1.00 169.40 ?  55  LEU G CA    1 
ATOM 4771  C C     . LEU G 3 43  ? 92.002  125.114 95.751  1.00 169.40 ?  55  LEU G C     1 
ATOM 4772  O O     . LEU G 3 43  ? 92.726  125.679 96.574  1.00 169.40 ?  55  LEU G O     1 
ATOM 4773  C CB    . LEU G 3 43  ? 93.400  123.817 94.145  1.00 169.40 ?  55  LEU G CB    1 
ATOM 4774  C CG    . LEU G 3 43  ? 94.113  122.495 93.918  1.00 169.40 ?  55  LEU G CG    1 
ATOM 4775  C CD1   . LEU G 3 43  ? 95.077  122.626 92.778  1.00 169.40 ?  55  LEU G CD1   1 
ATOM 4776  C CD2   . LEU G 3 43  ? 94.834  122.065 95.165  1.00 169.40 ?  55  LEU G CD2   1 
ATOM 4777  N N     . GLU G 3 44  ? 90.883  125.680 95.288  1.00 184.32 ?  56  GLU G N     1 
ATOM 4778  C CA    . GLU G 3 44  ? 90.424  126.922 95.902  1.00 184.32 ?  56  GLU G CA    1 
ATOM 4779  C C     . GLU G 3 44  ? 89.946  126.689 97.322  1.00 184.32 ?  56  GLU G C     1 
ATOM 4780  O O     . GLU G 3 44  ? 90.329  127.430 98.233  1.00 184.32 ?  56  GLU G O     1 
ATOM 4781  C CB    . GLU G 3 44  ? 89.303  127.566 95.097  1.00 184.32 ?  56  GLU G CB    1 
ATOM 4782  C CG    . GLU G 3 44  ? 88.859  128.881 95.713  1.00 184.32 ?  56  GLU G CG    1 
ATOM 4783  C CD    . GLU G 3 44  ? 87.697  129.521 95.002  1.00 184.32 ?  56  GLU G CD    1 
ATOM 4784  O OE1   . GLU G 3 44  ? 87.199  128.937 94.021  1.00 184.32 ?  56  GLU G OE1   1 
ATOM 4785  O OE2   . GLU G 3 44  ? 87.273  130.613 95.429  1.00 184.32 -1 56  GLU G OE2   1 
ATOM 4786  N N     . TYR G 3 45  ? 89.146  125.646 97.532  1.00 174.57 ?  57  TYR G N     1 
ATOM 4787  C CA    . TYR G 3 45  ? 88.597  125.385 98.854  1.00 174.57 ?  57  TYR G CA    1 
ATOM 4788  C C     . TYR G 3 45  ? 89.674  124.921 99.830  1.00 174.57 ?  57  TYR G C     1 
ATOM 4789  O O     . TYR G 3 45  ? 89.510  125.049 101.046 1.00 174.57 ?  57  TYR G O     1 
ATOM 4790  C CB    . TYR G 3 45  ? 87.481  124.357 98.752  1.00 174.57 ?  57  TYR G CB    1 
ATOM 4791  C CG    . TYR G 3 45  ? 86.771  124.157 100.046 1.00 174.57 ?  57  TYR G CG    1 
ATOM 4792  C CD1   . TYR G 3 45  ? 85.942  125.142 100.541 1.00 174.57 ?  57  TYR G CD1   1 
ATOM 4793  C CD2   . TYR G 3 45  ? 86.936  122.999 100.778 1.00 174.57 ?  57  TYR G CD2   1 
ATOM 4794  C CE1   . TYR G 3 45  ? 85.290  124.987 101.729 1.00 174.57 ?  57  TYR G CE1   1 
ATOM 4795  C CE2   . TYR G 3 45  ? 86.285  122.828 101.971 1.00 174.57 ?  57  TYR G CE2   1 
ATOM 4796  C CZ    . TYR G 3 45  ? 85.462  123.830 102.442 1.00 174.57 ?  57  TYR G CZ    1 
ATOM 4797  O OH    . TYR G 3 45  ? 84.800  123.687 103.636 1.00 174.57 ?  57  TYR G OH    1 
ATOM 4798  N N     . LEU G 3 46  ? 90.787  124.391 99.325  1.00 167.34 ?  58  LEU G N     1 
ATOM 4799  C CA    . LEU G 3 46  ? 91.920  124.113 100.200 1.00 167.34 ?  58  LEU G CA    1 
ATOM 4800  C C     . LEU G 3 46  ? 92.858  125.306 100.301 1.00 167.34 ?  58  LEU G C     1 
ATOM 4801  O O     . LEU G 3 46  ? 93.864  125.246 101.012 1.00 167.34 ?  58  LEU G O     1 
ATOM 4802  C CB    . LEU G 3 46  ? 92.673  122.880 99.722  1.00 167.34 ?  58  LEU G CB    1 
ATOM 4803  C CG    . LEU G 3 46  ? 91.902  121.604 100.003 1.00 167.34 ?  58  LEU G CG    1 
ATOM 4804  C CD1   . LEU G 3 46  ? 92.607  120.413 99.413  1.00 167.34 ?  58  LEU G CD1   1 
ATOM 4805  C CD2   . LEU G 3 46  ? 91.746  121.443 101.493 1.00 167.34 ?  58  LEU G CD2   1 
ATOM 4806  N N     . THR G 3 47  ? 92.580  126.381 99.565  1.00 174.92 ?  59  THR G N     1 
ATOM 4807  C CA    . THR G 3 47  ? 93.343  127.604 99.778  1.00 174.92 ?  59  THR G CA    1 
ATOM 4808  C C     . THR G 3 47  ? 92.543  128.599 100.606 1.00 174.92 ?  59  THR G C     1 
ATOM 4809  O O     . THR G 3 47  ? 93.106  129.338 101.419 1.00 174.92 ?  59  THR G O     1 
ATOM 4810  C CB    . THR G 3 47  ? 93.759  128.192 98.437  1.00 174.92 ?  59  THR G CB    1 
ATOM 4811  O OG1   . THR G 3 47  ? 94.461  127.189 97.704  1.00 174.92 ?  59  THR G OG1   1 
ATOM 4812  C CG2   . THR G 3 47  ? 94.695  129.360 98.618  1.00 174.92 ?  59  THR G CG2   1 
ATOM 4813  N N     . ALA G 3 48  ? 91.220  128.596 100.458 1.00 176.86 ?  60  ALA G N     1 
ATOM 4814  C CA    . ALA G 3 48  ? 90.404  129.493 101.265 1.00 176.86 ?  60  ALA G CA    1 
ATOM 4815  C C     . ALA G 3 48  ? 90.250  128.985 102.690 1.00 176.86 ?  60  ALA G C     1 
ATOM 4816  O O     . ALA G 3 48  ? 89.863  129.750 103.576 1.00 176.86 ?  60  ALA G O     1 
ATOM 4817  C CB    . ALA G 3 48  ? 89.031  129.687 100.628 1.00 176.86 ?  60  ALA G CB    1 
ATOM 4818  N N     . GLU G 3 49  ? 90.544  127.711 102.934 1.00 185.22 ?  61  GLU G N     1 
ATOM 4819  C CA    . GLU G 3 49  ? 90.356  127.178 104.275 1.00 185.22 ?  61  GLU G CA    1 
ATOM 4820  C C     . GLU G 3 49  ? 91.567  127.456 105.150 1.00 185.22 ?  61  GLU G C     1 
ATOM 4821  O O     . GLU G 3 49  ? 91.426  127.679 106.356 1.00 185.22 ?  61  GLU G O     1 
ATOM 4822  C CB    . GLU G 3 49  ? 90.079  125.681 104.209 1.00 185.22 ?  61  GLU G CB    1 
ATOM 4823  C CG    . GLU G 3 49  ? 89.627  125.043 105.506 1.00 185.22 ?  61  GLU G CG    1 
ATOM 4824  C CD    . GLU G 3 49  ? 88.216  125.432 105.881 1.00 185.22 ?  61  GLU G CD    1 
ATOM 4825  O OE1   . GLU G 3 49  ? 87.436  125.788 104.977 1.00 185.22 ?  61  GLU G OE1   1 
ATOM 4826  O OE2   . GLU G 3 49  ? 87.876  125.359 107.078 1.00 185.22 -1 61  GLU G OE2   1 
ATOM 4827  N N     . ILE G 3 50  ? 92.766  127.446 104.569 1.00 170.84 ?  62  ILE G N     1 
ATOM 4828  C CA    . ILE G 3 50  ? 93.963  127.763 105.340 1.00 170.84 ?  62  ILE G CA    1 
ATOM 4829  C C     . ILE G 3 50  ? 94.017  129.250 105.667 1.00 170.84 ?  62  ILE G C     1 
ATOM 4830  O O     . ILE G 3 50  ? 94.201  129.638 106.827 1.00 170.84 ?  62  ILE G O     1 
ATOM 4831  C CB    . ILE G 3 50  ? 95.223  127.296 104.593 1.00 170.84 ?  62  ILE G CB    1 
ATOM 4832  C CG1   . ILE G 3 50  ? 95.356  125.788 104.679 1.00 170.84 ?  62  ILE G CG1   1 
ATOM 4833  C CG2   . ILE G 3 50  ? 96.469  127.969 105.107 1.00 170.84 ?  62  ILE G CG2   1 
ATOM 4834  C CD1   . ILE G 3 50  ? 96.473  125.268 103.835 1.00 170.84 ?  62  ILE G CD1   1 
ATOM 4835  N N     . LEU G 3 51  ? 93.837  130.104 104.659 1.00 180.67 ?  63  LEU G N     1 
ATOM 4836  C CA    . LEU G 3 51  ? 94.002  131.535 104.878 1.00 180.67 ?  63  LEU G CA    1 
ATOM 4837  C C     . LEU G 3 51  ? 92.890  132.139 105.720 1.00 180.67 ?  63  LEU G C     1 
ATOM 4838  O O     . LEU G 3 51  ? 93.087  133.211 106.294 1.00 180.67 ?  63  LEU G O     1 
ATOM 4839  C CB    . LEU G 3 51  ? 94.094  132.272 103.550 1.00 180.67 ?  63  LEU G CB    1 
ATOM 4840  C CG    . LEU G 3 51  ? 95.356  131.979 102.757 1.00 180.67 ?  63  LEU G CG    1 
ATOM 4841  C CD1   . LEU G 3 51  ? 95.308  132.703 101.450 1.00 180.67 ?  63  LEU G CD1   1 
ATOM 4842  C CD2   . LEU G 3 51  ? 96.559  132.408 103.538 1.00 180.67 ?  63  LEU G CD2   1 
ATOM 4843  N N     . GLU G 3 52  ? 91.735  131.482 105.822 1.00 192.36 ?  64  GLU G N     1 
ATOM 4844  C CA    . GLU G 3 52  ? 90.731  131.953 106.767 1.00 192.36 ?  64  GLU G CA    1 
ATOM 4845  C C     . GLU G 3 52  ? 91.175  131.680 108.196 1.00 192.36 ?  64  GLU G C     1 
ATOM 4846  O O     . GLU G 3 52  ? 90.874  132.457 109.107 1.00 192.36 ?  64  GLU G O     1 
ATOM 4847  C CB    . GLU G 3 52  ? 89.381  131.298 106.479 1.00 192.36 ?  64  GLU G CB    1 
ATOM 4848  C CG    . GLU G 3 52  ? 88.219  131.867 107.280 1.00 192.36 ?  64  GLU G CG    1 
ATOM 4849  C CD    . GLU G 3 52  ? 86.884  131.240 106.915 1.00 192.36 ?  64  GLU G CD    1 
ATOM 4850  O OE1   . GLU G 3 52  ? 86.859  130.329 106.063 1.00 192.36 ?  64  GLU G OE1   1 
ATOM 4851  O OE2   . GLU G 3 52  ? 85.852  131.663 107.475 1.00 192.36 -1 64  GLU G OE2   1 
ATOM 4852  N N     . LEU G 3 53  ? 91.918  130.593 108.409 1.00 179.81 ?  65  LEU G N     1 
ATOM 4853  C CA    . LEU G 3 53  ? 92.512  130.367 109.719 1.00 179.81 ?  65  LEU G CA    1 
ATOM 4854  C C     . LEU G 3 53  ? 93.779  131.184 109.912 1.00 179.81 ?  65  LEU G C     1 
ATOM 4855  O O     . LEU G 3 53  ? 94.014  131.703 111.008 1.00 179.81 ?  65  LEU G O     1 
ATOM 4856  C CB    . LEU G 3 53  ? 92.811  128.887 109.926 1.00 179.81 ?  65  LEU G CB    1 
ATOM 4857  C CG    . LEU G 3 53  ? 91.563  128.020 110.023 1.00 179.81 ?  65  LEU G CG    1 
ATOM 4858  C CD1   . LEU G 3 53  ? 91.943  126.565 110.130 1.00 179.81 ?  65  LEU G CD1   1 
ATOM 4859  C CD2   . LEU G 3 53  ? 90.732  128.440 111.209 1.00 179.81 ?  65  LEU G CD2   1 
ATOM 4860  N N     . ALA G 3 54  ? 94.596  131.320 108.868 1.00 186.43 ?  66  ALA G N     1 
ATOM 4861  C CA    . ALA G 3 54  ? 95.779  132.162 108.981 1.00 186.43 ?  66  ALA G CA    1 
ATOM 4862  C C     . ALA G 3 54  ? 95.409  133.632 109.053 1.00 186.43 ?  66  ALA G C     1 
ATOM 4863  O O     . ALA G 3 54  ? 96.178  134.435 109.585 1.00 186.43 ?  66  ALA G O     1 
ATOM 4864  C CB    . ALA G 3 54  ? 96.722  131.913 107.811 1.00 186.43 ?  66  ALA G CB    1 
ATOM 4865  N N     . GLY G 3 55  ? 94.248  134.004 108.515 1.00 187.76 ?  67  GLY G N     1 
ATOM 4866  C CA    . GLY G 3 55  ? 93.740  135.344 108.728 1.00 187.76 ?  67  GLY G CA    1 
ATOM 4867  C C     . GLY G 3 55  ? 93.383  135.626 110.167 1.00 187.76 ?  67  GLY G C     1 
ATOM 4868  O O     . GLY G 3 55  ? 93.542  136.761 110.625 1.00 187.76 ?  67  GLY G O     1 
ATOM 4869  N N     . ASN G 3 56  ? 92.925  134.614 110.901 1.00 185.64 ?  68  ASN G N     1 
ATOM 4870  C CA    . ASN G 3 56  ? 92.700  134.809 112.323 1.00 185.64 ?  68  ASN G CA    1 
ATOM 4871  C C     . ASN G 3 56  ? 93.960  134.534 113.126 1.00 185.64 ?  68  ASN G C     1 
ATOM 4872  O O     . ASN G 3 56  ? 93.939  134.617 114.357 1.00 185.64 ?  68  ASN G O     1 
ATOM 4873  C CB    . ASN G 3 56  ? 91.549  133.935 112.802 1.00 185.64 ?  68  ASN G CB    1 
ATOM 4874  C CG    . ASN G 3 56  ? 90.212  134.430 112.310 1.00 185.64 ?  68  ASN G CG    1 
ATOM 4875  O OD1   . ASN G 3 56  ? 89.971  135.634 112.250 1.00 185.64 ?  68  ASN G OD1   1 
ATOM 4876  N ND2   . ASN G 3 56  ? 89.326  133.506 111.971 1.00 185.64 ?  68  ASN G ND2   1 
ATOM 4877  N N     . ALA G 3 57  ? 95.062  134.203 112.459 1.00 183.76 ?  69  ALA G N     1 
ATOM 4878  C CA    . ALA G 3 57  ? 96.321  134.090 113.178 1.00 183.76 ?  69  ALA G CA    1 
ATOM 4879  C C     . ALA G 3 57  ? 96.964  135.453 113.357 1.00 183.76 ?  69  ALA G C     1 
ATOM 4880  O O     . ALA G 3 57  ? 97.539  135.743 114.410 1.00 183.76 ?  69  ALA G O     1 
ATOM 4881  C CB    . ALA G 3 57  ? 97.266  133.146 112.446 1.00 183.76 ?  69  ALA G CB    1 
ATOM 4882  N N     . ALA G 3 58  ? 96.873  136.305 112.340 1.00 190.42 ?  70  ALA G N     1 
ATOM 4883  C CA    . ALA G 3 58  ? 97.489  137.619 112.436 1.00 190.42 ?  70  ALA G CA    1 
ATOM 4884  C C     . ALA G 3 58  ? 96.673  138.555 113.310 1.00 190.42 ?  70  ALA G C     1 
ATOM 4885  O O     . ALA G 3 58  ? 97.244  139.379 114.032 1.00 190.42 ?  70  ALA G O     1 
ATOM 4886  C CB    . ALA G 3 58  ? 97.662  138.216 111.046 1.00 190.42 ?  70  ALA G CB    1 
ATOM 4887  N N     . ARG G 3 59  ? 95.347  138.438 113.259 1.00 201.23 ?  71  ARG G N     1 
ATOM 4888  C CA    . ARG G 3 59  ? 94.481  139.342 114.007 1.00 201.23 ?  71  ARG G CA    1 
ATOM 4889  C C     . ARG G 3 59  ? 94.583  139.092 115.507 1.00 201.23 ?  71  ARG G C     1 
ATOM 4890  O O     . ARG G 3 59  ? 94.520  140.035 116.302 1.00 201.23 ?  71  ARG G O     1 
ATOM 4891  C CB    . ARG G 3 59  ? 93.042  139.194 113.500 1.00 201.23 ?  71  ARG G CB    1 
ATOM 4892  C CG    . ARG G 3 59  ? 91.977  140.057 114.162 1.00 201.23 ?  71  ARG G CG    1 
ATOM 4893  C CD    . ARG G 3 59  ? 91.165  139.258 115.174 1.00 201.23 ?  71  ARG G CD    1 
ATOM 4894  N NE    . ARG G 3 59  ? 90.048  140.022 115.711 1.00 201.23 ?  71  ARG G NE    1 
ATOM 4895  C CZ    . ARG G 3 59  ? 88.834  140.040 115.172 1.00 201.23 ?  71  ARG G CZ    1 
ATOM 4896  N NH1   . ARG G 3 59  ? 88.582  139.326 114.085 1.00 201.23 ?  71  ARG G NH1   1 
ATOM 4897  N NH2   . ARG G 3 59  ? 87.871  140.765 115.724 1.00 201.23 ?  71  ARG G NH2   1 
ATOM 4898  N N     . ASP G 3 60  ? 94.755  137.836 115.915 1.00 208.98 ?  72  ASP G N     1 
ATOM 4899  C CA    . ASP G 3 60  ? 94.863  137.560 117.341 1.00 208.98 ?  72  ASP G CA    1 
ATOM 4900  C C     . ASP G 3 60  ? 96.296  137.671 117.831 1.00 208.98 ?  72  ASP G C     1 
ATOM 4901  O O     . ASP G 3 60  ? 96.549  137.531 119.031 1.00 208.98 ?  72  ASP G O     1 
ATOM 4902  C CB    . ASP G 3 60  ? 94.292  136.186 117.665 1.00 208.98 ?  72  ASP G CB    1 
ATOM 4903  C CG    . ASP G 3 60  ? 92.787  136.155 117.573 1.00 208.98 ?  72  ASP G CG    1 
ATOM 4904  O OD1   . ASP G 3 60  ? 92.169  137.226 117.738 1.00 208.98 ?  72  ASP G OD1   1 
ATOM 4905  O OD2   . ASP G 3 60  ? 92.218  135.066 117.359 1.00 208.98 -1 72  ASP G OD2   1 
ATOM 4906  N N     . ASN G 3 61  ? 97.242  137.907 116.936 1.00 210.74 ?  73  ASN G N     1 
ATOM 4907  C CA    . ASN G 3 61  ? 98.597  138.216 117.357 1.00 210.74 ?  73  ASN G CA    1 
ATOM 4908  C C     . ASN G 3 61  ? 98.977  139.650 117.015 1.00 210.74 ?  73  ASN G C     1 
ATOM 4909  O O     . ASN G 3 61  ? 100.163 139.990 117.073 1.00 210.74 ?  73  ASN G O     1 
ATOM 4910  C CB    . ASN G 3 61  ? 99.581  137.228 116.724 1.00 210.74 ?  73  ASN G CB    1 
ATOM 4911  C CG    . ASN G 3 61  ? 100.796 136.964 117.598 1.00 210.74 ?  73  ASN G CG    1 
ATOM 4912  O OD1   . ASN G 3 61  ? 101.528 136.000 117.381 1.00 210.74 ?  73  ASN G OD1   1 
ATOM 4913  N ND2   . ASN G 3 61  ? 101.005 137.807 118.599 1.00 210.74 ?  73  ASN G ND2   1 
ATOM 4914  N N     . LYS G 3 62  ? 97.993  140.466 116.622 1.00 196.59 ?  74  LYS G N     1 
ATOM 4915  C CA    . LYS G 3 62  ? 98.096  141.925 116.522 1.00 196.59 ?  74  LYS G CA    1 
ATOM 4916  C C     . LYS G 3 62  ? 99.101  142.375 115.469 1.00 196.59 ?  74  LYS G C     1 
ATOM 4917  O O     . LYS G 3 62  ? 99.822  143.353 115.663 1.00 196.59 ?  74  LYS G O     1 
ATOM 4918  C CB    . LYS G 3 62  ? 98.421  142.555 117.878 1.00 196.59 ?  74  LYS G CB    1 
ATOM 4919  C CG    . LYS G 3 62  ? 97.321  142.359 118.899 1.00 196.59 ?  74  LYS G CG    1 
ATOM 4920  C CD    . LYS G 3 62  ? 97.688  142.951 120.239 1.00 196.59 ?  74  LYS G CD    1 
ATOM 4921  C CE    . LYS G 3 62  ? 96.607  142.664 121.258 1.00 196.59 ?  74  LYS G CE    1 
ATOM 4922  N NZ    . LYS G 3 62  ? 96.962  143.209 122.593 1.00 196.59 ?  74  LYS G NZ    1 
ATOM 4923  N N     . LYS G 3 63  ? 99.163  141.663 114.352 1.00 201.32 ?  75  LYS G N     1 
ATOM 4924  C CA    . LYS G 3 63  ? 99.914  142.086 113.182 1.00 201.32 ?  75  LYS G CA    1 
ATOM 4925  C C     . LYS G 3 63  ? 99.007  141.976 111.964 1.00 201.32 ?  75  LYS G C     1 
ATOM 4926  O O     . LYS G 3 63  ? 97.948  141.349 112.014 1.00 201.32 ?  75  LYS G O     1 
ATOM 4927  C CB    . LYS G 3 63  ? 101.191 141.254 113.011 1.00 201.32 ?  75  LYS G CB    1 
ATOM 4928  C CG    . LYS G 3 63  ? 102.201 141.504 114.116 1.00 201.32 ?  75  LYS G CG    1 
ATOM 4929  C CD    . LYS G 3 63  ? 103.462 140.685 113.963 1.00 201.32 ?  75  LYS G CD    1 
ATOM 4930  C CE    . LYS G 3 63  ? 104.404 140.963 115.125 1.00 201.32 ?  75  LYS G CE    1 
ATOM 4931  N NZ    . LYS G 3 63  ? 105.668 140.188 115.049 1.00 201.32 ?  75  LYS G NZ    1 
ATOM 4932  N N     . THR G 3 64  ? 99.406  142.615 110.868 1.00 206.32 ?  76  THR G N     1 
ATOM 4933  C CA    . THR G 3 64  ? 98.517  142.728 109.720 1.00 206.32 ?  76  THR G CA    1 
ATOM 4934  C C     . THR G 3 64  ? 98.991  141.965 108.494 1.00 206.32 ?  76  THR G C     1 
ATOM 4935  O O     . THR G 3 64  ? 98.227  141.841 107.533 1.00 206.32 ?  76  THR G O     1 
ATOM 4936  C CB    . THR G 3 64  ? 98.325  144.199 109.348 1.00 206.32 ?  76  THR G CB    1 
ATOM 4937  O OG1   . THR G 3 64  ? 99.599  144.787 109.067 1.00 206.32 ?  76  THR G OG1   1 
ATOM 4938  C CG2   . THR G 3 64  ? 97.661  144.947 110.485 1.00 206.32 ?  76  THR G CG2   1 
ATOM 4939  N N     . ARG G 3 65  ? 100.214 141.454 108.496 1.00 203.76 ?  77  ARG G N     1 
ATOM 4940  C CA    . ARG G 3 65  ? 100.771 140.751 107.351 1.00 203.76 ?  77  ARG G CA    1 
ATOM 4941  C C     . ARG G 3 65  ? 101.104 139.333 107.781 1.00 203.76 ?  77  ARG G C     1 
ATOM 4942  O O     . ARG G 3 65  ? 101.841 139.141 108.751 1.00 203.76 ?  77  ARG G O     1 
ATOM 4943  C CB    . ARG G 3 65  ? 102.021 141.461 106.848 1.00 203.76 ?  77  ARG G CB    1 
ATOM 4944  C CG    . ARG G 3 65  ? 102.510 141.037 105.492 1.00 203.76 ?  77  ARG G CG    1 
ATOM 4945  C CD    . ARG G 3 65  ? 103.789 141.790 105.159 1.00 203.76 ?  77  ARG G CD    1 
ATOM 4946  N NE    . ARG G 3 65  ? 103.604 143.237 105.221 1.00 203.76 ?  77  ARG G NE    1 
ATOM 4947  C CZ    . ARG G 3 65  ? 103.103 143.979 104.240 1.00 203.76 ?  77  ARG G CZ    1 
ATOM 4948  N NH1   . ARG G 3 65  ? 102.728 143.419 103.099 1.00 203.76 ?  77  ARG G NH1   1 
ATOM 4949  N NH2   . ARG G 3 65  ? 102.978 145.287 104.401 1.00 203.76 ?  77  ARG G NH2   1 
ATOM 4950  N N     . ILE G 3 66  ? 100.565 138.346 107.069 1.00 187.17 ?  78  ILE G N     1 
ATOM 4951  C CA    . ILE G 3 66  ? 100.747 136.950 107.452 1.00 187.17 ?  78  ILE G CA    1 
ATOM 4952  C C     . ILE G 3 66  ? 102.177 136.523 107.150 1.00 187.17 ?  78  ILE G C     1 
ATOM 4953  O O     . ILE G 3 66  ? 102.604 136.507 105.993 1.00 187.17 ?  78  ILE G O     1 
ATOM 4954  C CB    . ILE G 3 66  ? 99.737  136.039 106.745 1.00 187.17 ?  78  ILE G CB    1 
ATOM 4955  C CG1   . ILE G 3 66  ? 98.332  136.304 107.262 1.00 187.17 ?  78  ILE G CG1   1 
ATOM 4956  C CG2   . ILE G 3 66  ? 100.071 134.618 106.993 1.00 187.17 ?  78  ILE G CG2   1 
ATOM 4957  C CD1   . ILE G 3 66  ? 97.278  135.500 106.570 1.00 187.17 ?  78  ILE G CD1   1 
ATOM 4958  N N     . ILE G 3 67  ? 102.914 136.181 108.198 1.00 176.05 ?  79  ILE G N     1 
ATOM 4959  C CA    . ILE G 3 67  ? 104.303 135.741 108.123 1.00 176.05 ?  79  ILE G CA    1 
ATOM 4960  C C     . ILE G 3 67  ? 104.277 134.219 108.197 1.00 176.05 ?  79  ILE G C     1 
ATOM 4961  O O     . ILE G 3 67  ? 103.240 133.673 108.593 1.00 176.05 ?  79  ILE G O     1 
ATOM 4962  C CB    . ILE G 3 67  ? 105.122 136.390 109.249 1.00 176.05 ?  79  ILE G CB    1 
ATOM 4963  C CG1   . ILE G 3 67  ? 104.499 136.069 110.605 1.00 176.05 ?  79  ILE G CG1   1 
ATOM 4964  C CG2   . ILE G 3 67  ? 105.211 137.883 109.041 1.00 176.05 ?  79  ILE G CG2   1 
ATOM 4965  C CD1   . ILE G 3 67  ? 105.340 136.525 111.779 1.00 176.05 ?  79  ILE G CD1   1 
ATOM 4966  N N     . PRO G 3 68  ? 105.342 133.493 107.820 1.00 167.57 ?  80  PRO G N     1 
ATOM 4967  C CA    . PRO G 3 68  ? 105.259 132.020 107.807 1.00 167.57 ?  80  PRO G CA    1 
ATOM 4968  C C     . PRO G 3 68  ? 105.059 131.359 109.155 1.00 167.57 ?  80  PRO G C     1 
ATOM 4969  O O     . PRO G 3 68  ? 104.698 130.179 109.184 1.00 167.57 ?  80  PRO G O     1 
ATOM 4970  C CB    . PRO G 3 68  ? 106.599 131.603 107.197 1.00 167.57 ?  80  PRO G CB    1 
ATOM 4971  C CG    . PRO G 3 68  ? 106.953 132.709 106.342 1.00 167.57 ?  80  PRO G CG    1 
ATOM 4972  C CD    . PRO G 3 68  ? 106.514 133.944 107.052 1.00 167.57 ?  80  PRO G CD    1 
ATOM 4973  N N     . ARG G 3 69  ? 105.289 132.060 110.263 1.00 172.47 ?  81  ARG G N     1 
ATOM 4974  C CA    . ARG G 3 69  ? 104.880 131.524 111.553 1.00 172.47 ?  81  ARG G CA    1 
ATOM 4975  C C     . ARG G 3 69  ? 103.368 131.371 111.634 1.00 172.47 ?  81  ARG G C     1 
ATOM 4976  O O     . ARG G 3 69  ? 102.879 130.367 112.159 1.00 172.47 ?  81  ARG G O     1 
ATOM 4977  C CB    . ARG G 3 69  ? 105.392 132.419 112.682 1.00 172.47 ?  81  ARG G CB    1 
ATOM 4978  C CG    . ARG G 3 69  ? 104.862 132.035 114.041 1.00 172.47 ?  81  ARG G CG    1 
ATOM 4979  C CD    . ARG G 3 69  ? 105.355 130.676 114.448 1.00 172.47 ?  81  ARG G CD    1 
ATOM 4980  N NE    . ARG G 3 69  ? 104.579 130.168 115.565 1.00 172.47 ?  81  ARG G NE    1 
ATOM 4981  C CZ    . ARG G 3 69  ? 104.828 130.449 116.831 1.00 172.47 ?  81  ARG G CZ    1 
ATOM 4982  N NH1   . ARG G 3 69  ? 105.833 131.245 117.143 1.00 172.47 ?  81  ARG G NH1   1 
ATOM 4983  N NH2   . ARG G 3 69  ? 104.065 129.941 117.784 1.00 172.47 ?  81  ARG G NH2   1 
ATOM 4984  N N     . HIS G 3 70  ? 102.620 132.321 111.071 1.00 171.23 ?  82  HIS G N     1 
ATOM 4985  C CA    . HIS G 3 70  ? 101.171 132.330 111.231 1.00 171.23 ?  82  HIS G CA    1 
ATOM 4986  C C     . HIS G 3 70  ? 100.490 131.163 110.531 1.00 171.23 ?  82  HIS G C     1 
ATOM 4987  O O     . HIS G 3 70  ? 99.384  130.785 110.921 1.00 171.23 ?  82  HIS G O     1 
ATOM 4988  C CB    . HIS G 3 70  ? 100.595 133.641 110.721 1.00 171.23 ?  82  HIS G CB    1 
ATOM 4989  C CG    . HIS G 3 70  ? 100.898 134.805 111.598 1.00 171.23 ?  82  HIS G CG    1 
ATOM 4990  N ND1   . HIS G 3 70  ? 100.648 136.105 111.221 1.00 171.23 ?  82  HIS G ND1   1 
ATOM 4991  C CD2   . HIS G 3 70  ? 101.425 134.867 112.841 1.00 171.23 ?  82  HIS G CD2   1 
ATOM 4992  C CE1   . HIS G 3 70  ? 101.012 136.919 112.194 1.00 171.23 ?  82  HIS G CE1   1 
ATOM 4993  N NE2   . HIS G 3 70  ? 101.488 136.193 113.188 1.00 171.23 ?  82  HIS G NE2   1 
ATOM 4994  N N     . LEU G 3 71  ? 101.116 130.573 109.516 1.00 166.58 ?  83  LEU G N     1 
ATOM 4995  C CA    . LEU G 3 71  ? 100.551 129.355 108.949 1.00 166.58 ?  83  LEU G CA    1 
ATOM 4996  C C     . LEU G 3 71  ? 100.757 128.173 109.885 1.00 166.58 ?  83  LEU G C     1 
ATOM 4997  O O     . LEU G 3 71  ? 99.918  127.267 109.951 1.00 166.58 ?  83  LEU G O     1 
ATOM 4998  C CB    . LEU G 3 71  ? 101.151 129.059 107.579 1.00 166.58 ?  83  LEU G CB    1 
ATOM 4999  C CG    . LEU G 3 71  ? 100.456 129.678 106.374 1.00 166.58 ?  83  LEU G CG    1 
ATOM 5000  C CD1   . LEU G 3 71  ? 100.791 131.118 106.217 1.00 166.58 ?  83  LEU G CD1   1 
ATOM 5001  C CD2   . LEU G 3 71  ? 100.825 128.924 105.127 1.00 166.58 ?  83  LEU G CD2   1 
ATOM 5002  N N     . GLN G 3 72  ? 101.871 128.174 110.620 1.00 175.32 ?  84  GLN G N     1 
ATOM 5003  C CA    . GLN G 3 72  ? 102.191 127.056 111.500 1.00 175.32 ?  84  GLN G CA    1 
ATOM 5004  C C     . GLN G 3 72  ? 101.219 126.986 112.665 1.00 175.32 ?  84  GLN G C     1 
ATOM 5005  O O     . GLN G 3 72  ? 100.873 125.897 113.131 1.00 175.32 ?  84  GLN G O     1 
ATOM 5006  C CB    . GLN G 3 72  ? 103.621 127.199 112.006 1.00 175.32 ?  84  GLN G CB    1 
ATOM 5007  C CG    . GLN G 3 72  ? 104.155 126.045 112.793 1.00 175.32 ?  84  GLN G CG    1 
ATOM 5008  C CD    . GLN G 3 72  ? 104.314 124.822 111.953 1.00 175.32 ?  84  GLN G CD    1 
ATOM 5009  O OE1   . GLN G 3 72  ? 103.605 123.840 112.121 1.00 175.32 ?  84  GLN G OE1   1 
ATOM 5010  N NE2   . GLN G 3 72  ? 105.234 124.882 111.010 1.00 175.32 ?  84  GLN G NE2   1 
ATOM 5011  N N     . LEU G 3 73  ? 100.751 128.141 113.136 1.00 176.51 ?  85  LEU G N     1 
ATOM 5012  C CA    . LEU G 3 73  ? 99.696  128.147 114.137 1.00 176.51 ?  85  LEU G CA    1 
ATOM 5013  C C     . LEU G 3 73  ? 98.324  128.054 113.495 1.00 176.51 ?  85  LEU G C     1 
ATOM 5014  O O     . LEU G 3 73  ? 97.319  127.960 114.205 1.00 176.51 ?  85  LEU G O     1 
ATOM 5015  C CB    . LEU G 3 73  ? 99.779  129.401 114.999 1.00 176.51 ?  85  LEU G CB    1 
ATOM 5016  C CG    . LEU G 3 73  ? 101.048 129.549 115.832 1.00 176.51 ?  85  LEU G CG    1 
ATOM 5017  C CD1   . LEU G 3 73  ? 101.028 130.847 116.640 1.00 176.51 ?  85  LEU G CD1   1 
ATOM 5018  C CD2   . LEU G 3 73  ? 101.233 128.339 116.721 1.00 176.51 ?  85  LEU G CD2   1 
ATOM 5019  N N     . ALA G 3 74  ? 98.252  128.108 112.166 1.00 175.61 ?  86  ALA G N     1 
ATOM 5020  C CA    . ALA G 3 74  ? 96.960  127.944 111.514 1.00 175.61 ?  86  ALA G CA    1 
ATOM 5021  C C     . ALA G 3 74  ? 96.704  126.495 111.153 1.00 175.61 ?  86  ALA G C     1 
ATOM 5022  O O     . ALA G 3 74  ? 95.575  126.015 111.272 1.00 175.61 ?  86  ALA G O     1 
ATOM 5023  C CB    . ALA G 3 74  ? 96.869  128.809 110.262 1.00 175.61 ?  86  ALA G CB    1 
ATOM 5024  N N     . ILE G 3 75  ? 97.732  125.785 110.705 1.00 175.61 ?  87  ILE G N     1 
ATOM 5025  C CA    . ILE G 3 75  ? 97.521  124.420 110.251 1.00 175.61 ?  87  ILE G CA    1 
ATOM 5026  C C     . ILE G 3 75  ? 97.425  123.471 111.437 1.00 175.61 ?  87  ILE G C     1 
ATOM 5027  O O     . ILE G 3 75  ? 96.499  122.659 111.524 1.00 175.61 ?  87  ILE G O     1 
ATOM 5028  C CB    . ILE G 3 75  ? 98.628  124.004 109.271 1.00 175.61 ?  87  ILE G CB    1 
ATOM 5029  C CG1   . ILE G 3 75  ? 98.549  124.847 108.007 1.00 175.61 ?  87  ILE G CG1   1 
ATOM 5030  C CG2   . ILE G 3 75  ? 98.495  122.555 108.900 1.00 175.61 ?  87  ILE G CG2   1 
ATOM 5031  C CD1   . ILE G 3 75  ? 99.674  124.595 107.041 1.00 175.61 ?  87  ILE G CD1   1 
ATOM 5032  N N     . ARG G 3 76  ? 98.363  123.571 112.379 1.00 179.06 ?  88  ARG G N     1 
ATOM 5033  C CA    . ARG G 3 76  ? 98.430  122.582 113.450 1.00 179.06 ?  88  ARG G CA    1 
ATOM 5034  C C     . ARG G 3 76  ? 97.302  122.734 114.458 1.00 179.06 ?  88  ARG G C     1 
ATOM 5035  O O     . ARG G 3 76  ? 96.945  121.761 115.125 1.00 179.06 ?  88  ARG G O     1 
ATOM 5036  C CB    . ARG G 3 76  ? 99.761  122.676 114.173 1.00 179.06 ?  88  ARG G CB    1 
ATOM 5037  C CG    . ARG G 3 76  ? 100.968 122.382 113.326 1.00 179.06 ?  88  ARG G CG    1 
ATOM 5038  C CD    . ARG G 3 76  ? 101.118 120.924 112.984 1.00 179.06 ?  88  ARG G CD    1 
ATOM 5039  N NE    . ARG G 3 76  ? 102.442 120.686 112.424 1.00 179.06 ?  88  ARG G NE    1 
ATOM 5040  C CZ    . ARG G 3 76  ? 102.716 120.692 111.131 1.00 179.06 ?  88  ARG G CZ    1 
ATOM 5041  N NH1   . ARG G 3 76  ? 101.754 120.898 110.252 1.00 179.06 ?  88  ARG G NH1   1 
ATOM 5042  N NH2   . ARG G 3 76  ? 103.952 120.477 110.720 1.00 179.06 ?  88  ARG G NH2   1 
ATOM 5043  N N     . ASN G 3 77  ? 96.722  123.923 114.589 1.00 193.61 ?  89  ASN G N     1 
ATOM 5044  C CA    . ASN G 3 77  ? 95.586  124.076 115.489 1.00 193.61 ?  89  ASN G CA    1 
ATOM 5045  C C     . ASN G 3 77  ? 94.262  123.710 114.841 1.00 193.61 ?  89  ASN G C     1 
ATOM 5046  O O     . ASN G 3 77  ? 93.210  124.007 115.411 1.00 193.61 ?  89  ASN G O     1 
ATOM 5047  C CB    . ASN G 3 77  ? 95.511  125.500 116.037 1.00 193.61 ?  89  ASN G CB    1 
ATOM 5048  C CG    . ASN G 3 77  ? 96.522  125.751 117.135 1.00 193.61 ?  89  ASN G CG    1 
ATOM 5049  O OD1   . ASN G 3 77  ? 96.751  124.894 117.985 1.00 193.61 ?  89  ASN G OD1   1 
ATOM 5050  N ND2   . ASN G 3 77  ? 97.122  126.932 117.132 1.00 193.61 ?  89  ASN G ND2   1 
ATOM 5051  N N     . ASP G 3 78  ? 94.289  123.099 113.668 1.00 208.01 ?  90  ASP G N     1 
ATOM 5052  C CA    . ASP G 3 78  ? 93.139  122.409 113.119 1.00 208.01 ?  90  ASP G CA    1 
ATOM 5053  C C     . ASP G 3 78  ? 93.241  120.945 113.515 1.00 208.01 ?  90  ASP G C     1 
ATOM 5054  O O     . ASP G 3 78  ? 94.320  120.468 113.871 1.00 208.01 ?  90  ASP G O     1 
ATOM 5055  C CB    . ASP G 3 78  ? 93.124  122.560 111.597 1.00 208.01 ?  90  ASP G CB    1 
ATOM 5056  C CG    . ASP G 3 78  ? 91.888  121.982 110.956 1.00 208.01 ?  90  ASP G CG    1 
ATOM 5057  O OD1   . ASP G 3 78  ? 90.828  122.637 111.009 1.00 208.01 ?  90  ASP G OD1   1 
ATOM 5058  O OD2   . ASP G 3 78  ? 91.979  120.853 110.426 1.00 208.01 -1 90  ASP G OD2   1 
ATOM 5059  N N     . GLU G 3 79  ? 92.118  120.232 113.484 1.00 216.42 ?  91  GLU G N     1 
ATOM 5060  C CA    . GLU G 3 79  ? 92.198  118.780 113.557 1.00 216.42 ?  91  GLU G CA    1 
ATOM 5061  C C     . GLU G 3 79  ? 92.617  118.199 112.217 1.00 216.42 ?  91  GLU G C     1 
ATOM 5062  O O     . GLU G 3 79  ? 93.595  117.452 112.126 1.00 216.42 ?  91  GLU G O     1 
ATOM 5063  C CB    . GLU G 3 79  ? 90.866  118.179 113.995 1.00 216.42 ?  91  GLU G CB    1 
ATOM 5064  C CG    . GLU G 3 79  ? 90.911  116.656 114.076 1.00 216.42 ?  91  GLU G CG    1 
ATOM 5065  C CD    . GLU G 3 79  ? 89.608  116.039 114.552 1.00 216.42 ?  91  GLU G CD    1 
ATOM 5066  O OE1   . GLU G 3 79  ? 88.639  116.787 114.806 1.00 216.42 ?  91  GLU G OE1   1 
ATOM 5067  O OE2   . GLU G 3 79  ? 89.554  114.797 114.672 1.00 216.42 -1 91  GLU G OE2   1 
ATOM 5068  N N     . GLU G 3 80  ? 91.896  118.546 111.159 1.00 210.74 ?  92  GLU G N     1 
ATOM 5069  C CA    . GLU G 3 80  ? 92.001  117.770 109.934 1.00 210.74 ?  92  GLU G CA    1 
ATOM 5070  C C     . GLU G 3 80  ? 93.160  118.220 109.063 1.00 210.74 ?  92  GLU G C     1 
ATOM 5071  O O     . GLU G 3 80  ? 93.647  117.442 108.237 1.00 210.74 ?  92  GLU G O     1 
ATOM 5072  C CB    . GLU G 3 80  ? 90.687  117.841 109.167 1.00 210.74 ?  92  GLU G CB    1 
ATOM 5073  C CG    . GLU G 3 80  ? 89.570  117.038 109.806 1.00 210.74 ?  92  GLU G CG    1 
ATOM 5074  C CD    . GLU G 3 80  ? 88.867  117.775 110.927 1.00 210.74 ?  92  GLU G CD    1 
ATOM 5075  O OE1   . GLU G 3 80  ? 89.217  118.946 111.180 1.00 210.74 ?  92  GLU G OE1   1 
ATOM 5076  O OE2   . GLU G 3 80  ? 87.966  117.185 111.558 1.00 210.74 -1 92  GLU G OE2   1 
ATOM 5077  N N     . LEU G 3 81  ? 93.633  119.454 109.229 1.00 193.88 ?  93  LEU G N     1 
ATOM 5078  C CA    . LEU G 3 81  ? 94.800  119.859 108.457 1.00 193.88 ?  93  LEU G CA    1 
ATOM 5079  C C     . LEU G 3 81  ? 96.074  119.236 109.001 1.00 193.88 ?  93  LEU G C     1 
ATOM 5080  O O     . LEU G 3 81  ? 97.089  119.201 108.299 1.00 193.88 ?  93  LEU G O     1 
ATOM 5081  C CB    . LEU G 3 81  ? 94.919  121.377 108.414 1.00 193.88 ?  93  LEU G CB    1 
ATOM 5082  C CG    . LEU G 3 81  ? 93.861  122.041 107.545 1.00 193.88 ?  93  LEU G CG    1 
ATOM 5083  C CD1   . LEU G 3 81  ? 94.006  123.534 107.617 1.00 193.88 ?  93  LEU G CD1   1 
ATOM 5084  C CD2   . LEU G 3 81  ? 93.994  121.570 106.119 1.00 193.88 ?  93  LEU G CD2   1 
ATOM 5085  N N     . ASN G 3 82  ? 96.044  118.750 110.239 1.00 198.05 ?  94  ASN G N     1 
ATOM 5086  C CA    . ASN G 3 82  ? 97.154  117.954 110.735 1.00 198.05 ?  94  ASN G CA    1 
ATOM 5087  C C     . ASN G 3 82  ? 97.257  116.655 109.953 1.00 198.05 ?  94  ASN G C     1 
ATOM 5088  O O     . ASN G 3 82  ? 98.311  116.346 109.387 1.00 198.05 ?  94  ASN G O     1 
ATOM 5089  C CB    . ASN G 3 82  ? 96.966  117.677 112.226 1.00 198.05 ?  94  ASN G CB    1 
ATOM 5090  C CG    . ASN G 3 82  ? 98.276  117.464 112.962 1.00 198.05 ?  94  ASN G CG    1 
ATOM 5091  O OD1   . ASN G 3 82  ? 98.312  117.472 114.191 1.00 198.05 ?  94  ASN G OD1   1 
ATOM 5092  N ND2   . ASN G 3 82  ? 99.359  117.300 112.220 1.00 198.05 ?  94  ASN G ND2   1 
ATOM 5093  N N     . LYS G 3 83  ? 96.150  115.918 109.859 1.00 205.04 ?  95  LYS G N     1 
ATOM 5094  C CA    . LYS G 3 83  ? 96.170  114.592 109.253 1.00 205.04 ?  95  LYS G CA    1 
ATOM 5095  C C     . LYS G 3 83  ? 96.279  114.676 107.735 1.00 205.04 ?  95  LYS G C     1 
ATOM 5096  O O     . LYS G 3 83  ? 96.656  113.696 107.084 1.00 205.04 ?  95  LYS G O     1 
ATOM 5097  C CB    . LYS G 3 83  ? 94.926  113.820 109.709 1.00 205.04 ?  95  LYS G CB    1 
ATOM 5098  C CG    . LYS G 3 83  ? 94.907  112.316 109.474 1.00 205.04 ?  95  LYS G CG    1 
ATOM 5099  C CD    . LYS G 3 83  ? 94.099  111.955 108.239 1.00 205.04 ?  95  LYS G CD    1 
ATOM 5100  C CE    . LYS G 3 83  ? 93.848  110.454 108.131 1.00 205.04 ?  95  LYS G CE    1 
ATOM 5101  N NZ    . LYS G 3 83  ? 95.079  109.648 107.881 1.00 205.04 ?  95  LYS G NZ    1 
ATOM 5102  N N     . LEU G 3 84  ? 95.983  115.838 107.157 1.00 174.72 ?  96  LEU G N     1 
ATOM 5103  C CA    . LEU G 3 84  ? 96.313  116.062 105.755 1.00 174.72 ?  96  LEU G CA    1 
ATOM 5104  C C     . LEU G 3 84  ? 97.812  116.220 105.570 1.00 174.72 ?  96  LEU G C     1 
ATOM 5105  O O     . LEU G 3 84  ? 98.440  115.458 104.829 1.00 174.72 ?  96  LEU G O     1 
ATOM 5106  C CB    . LEU G 3 84  ? 95.591  117.296 105.228 1.00 174.72 ?  96  LEU G CB    1 
ATOM 5107  C CG    . LEU G 3 84  ? 95.947  117.647 103.790 1.00 174.72 ?  96  LEU G CG    1 
ATOM 5108  C CD1   . LEU G 3 84  ? 95.483  116.562 102.852 1.00 174.72 ?  96  LEU G CD1   1 
ATOM 5109  C CD2   . LEU G 3 84  ? 95.330  118.967 103.434 1.00 174.72 ?  96  LEU G CD2   1 
ATOM 5110  N N     . LEU G 3 85  ? 98.402  117.209 106.230 1.00 173.03 ?  97  LEU G N     1 
ATOM 5111  C CA    . LEU G 3 85  ? 99.822  117.499 106.072 1.00 173.03 ?  97  LEU G CA    1 
ATOM 5112  C C     . LEU G 3 85  ? 100.653 116.814 107.147 1.00 173.03 ?  97  LEU G C     1 
ATOM 5113  O O     . LEU G 3 85  ? 101.368 117.461 107.905 1.00 173.03 ?  97  LEU G O     1 
ATOM 5114  C CB    . LEU G 3 85  ? 100.042 119.002 106.097 1.00 173.03 ?  97  LEU G CB    1 
ATOM 5115  C CG    . LEU G 3 85  ? 99.314  119.762 105.005 1.00 173.03 ?  97  LEU G CG    1 
ATOM 5116  C CD1   . LEU G 3 85  ? 99.552  121.242 105.181 1.00 173.03 ?  97  LEU G CD1   1 
ATOM 5117  C CD2   . LEU G 3 85  ? 99.790  119.292 103.667 1.00 173.03 ?  97  LEU G CD2   1 
ATOM 5118  N N     . GLY G 3 86  ? 100.568 115.487 107.223 1.00 165.26 ?  98  GLY G N     1 
ATOM 5119  C CA    . GLY G 3 86  ? 101.290 114.774 108.258 1.00 165.26 ?  98  GLY G CA    1 
ATOM 5120  C C     . GLY G 3 86  ? 102.778 114.674 108.016 1.00 165.26 ?  98  GLY G C     1 
ATOM 5121  O O     . GLY G 3 86  ? 103.531 114.395 108.952 1.00 165.26 ?  98  GLY G O     1 
ATOM 5122  N N     . ARG G 3 87  ? 103.219 114.905 106.791 1.00 178.25 ?  99  ARG G N     1 
ATOM 5123  C CA    . ARG G 3 87  ? 104.618 114.765 106.435 1.00 178.25 ?  99  ARG G CA    1 
ATOM 5124  C C     . ARG G 3 87  ? 105.278 116.097 106.117 1.00 178.25 ?  99  ARG G C     1 
ATOM 5125  O O     . ARG G 3 87  ? 106.275 116.120 105.392 1.00 178.25 ?  99  ARG G O     1 
ATOM 5126  C CB    . ARG G 3 87  ? 104.757 113.845 105.223 1.00 178.25 ?  99  ARG G CB    1 
ATOM 5127  C CG    . ARG G 3 87  ? 104.067 112.503 105.338 1.00 178.25 ?  99  ARG G CG    1 
ATOM 5128  C CD    . ARG G 3 87  ? 104.695 111.605 106.376 1.00 178.25 ?  99  ARG G CD    1 
ATOM 5129  N NE    . ARG G 3 87  ? 104.182 110.245 106.245 1.00 178.25 ?  99  ARG G NE    1 
ATOM 5130  C CZ    . ARG G 3 87  ? 104.463 109.249 107.076 1.00 178.25 ?  99  ARG G CZ    1 
ATOM 5131  N NH1   . ARG G 3 87  ? 105.245 109.455 108.128 1.00 178.25 ?  99  ARG G NH1   1 
ATOM 5132  N NH2   . ARG G 3 87  ? 103.955 108.046 106.856 1.00 178.25 ?  99  ARG G NH2   1 
ATOM 5133  N N     . VAL G 3 88  ? 104.747 117.203 106.615 1.00 174.75 ?  100 VAL G N     1 
ATOM 5134  C CA    . VAL G 3 88  ? 105.147 118.523 106.152 1.00 174.75 ?  100 VAL G CA    1 
ATOM 5135  C C     . VAL G 3 88  ? 105.728 119.314 107.309 1.00 174.75 ?  100 VAL G C     1 
ATOM 5136  O O     . VAL G 3 88  ? 105.040 119.575 108.300 1.00 174.75 ?  100 VAL G O     1 
ATOM 5137  C CB    . VAL G 3 88  ? 103.964 119.273 105.532 1.00 174.75 ?  100 VAL G CB    1 
ATOM 5138  C CG1   . VAL G 3 88  ? 104.377 120.684 105.231 1.00 174.75 ?  100 VAL G CG1   1 
ATOM 5139  C CG2   . VAL G 3 88  ? 103.498 118.576 104.276 1.00 174.75 ?  100 VAL G CG2   1 
ATOM 5140  N N     . THR G 3 89  ? 106.984 119.714 107.179 1.00 178.66 ?  101 THR G N     1 
ATOM 5141  C CA    . THR G 3 89  ? 107.603 120.620 108.130 1.00 178.66 ?  101 THR G CA    1 
ATOM 5142  C C     . THR G 3 89  ? 107.824 121.967 107.468 1.00 178.66 ?  101 THR G C     1 
ATOM 5143  O O     . THR G 3 89  ? 108.626 122.091 106.547 1.00 178.66 ?  101 THR G O     1 
ATOM 5144  C CB    . THR G 3 89  ? 108.940 120.073 108.612 1.00 178.66 ?  101 THR G CB    1 
ATOM 5145  O OG1   . THR G 3 89  ? 109.849 120.029 107.510 1.00 178.66 ?  101 THR G OG1   1 
ATOM 5146  C CG2   . THR G 3 89  ? 108.764 118.676 109.150 1.00 178.66 ?  101 THR G CG2   1 
ATOM 5147  N N     . ILE G 3 90  ? 107.131 122.985 107.955 1.00 173.64 ?  102 ILE G N     1 
ATOM 5148  C CA    . ILE G 3 90  ? 107.109 124.284 107.302 1.00 173.64 ?  102 ILE G CA    1 
ATOM 5149  C C     . ILE G 3 90  ? 108.348 125.057 107.712 1.00 173.64 ?  102 ILE G C     1 
ATOM 5150  O O     . ILE G 3 90  ? 108.603 125.238 108.906 1.00 173.64 ?  102 ILE G O     1 
ATOM 5151  C CB    . ILE G 3 90  ? 105.842 125.069 107.656 1.00 173.64 ?  102 ILE G CB    1 
ATOM 5152  C CG1   . ILE G 3 90  ? 104.618 124.343 107.129 1.00 173.64 ?  102 ILE G CG1   1 
ATOM 5153  C CG2   . ILE G 3 90  ? 105.898 126.433 107.056 1.00 173.64 ?  102 ILE G CG2   1 
ATOM 5154  C CD1   . ILE G 3 90  ? 103.344 124.930 107.629 1.00 173.64 ?  102 ILE G CD1   1 
ATOM 5155  N N     . ALA G 3 91  ? 109.111 125.513 106.722 1.00 173.13 ?  103 ALA G N     1 
ATOM 5156  C CA    . ALA G 3 91  ? 110.345 126.239 106.983 1.00 173.13 ?  103 ALA G CA    1 
ATOM 5157  C C     . ALA G 3 91  ? 110.048 127.617 107.547 1.00 173.13 ?  103 ALA G C     1 
ATOM 5158  O O     . ALA G 3 91  ? 108.976 128.178 107.302 1.00 173.13 ?  103 ALA G O     1 
ATOM 5159  C CB    . ALA G 3 91  ? 111.165 126.375 105.706 1.00 173.13 ?  103 ALA G CB    1 
ATOM 5160  N N     . GLN G 3 92  ? 111.029 128.160 108.283 1.00 170.59 ?  104 GLN G N     1 
ATOM 5161  C CA    . GLN G 3 92  ? 110.887 129.369 109.103 1.00 170.59 ?  104 GLN G CA    1 
ATOM 5162  C C     . GLN G 3 92  ? 109.670 129.263 110.016 1.00 170.59 ?  104 GLN G C     1 
ATOM 5163  O O     . GLN G 3 92  ? 108.893 130.204 110.167 1.00 170.59 ?  104 GLN G O     1 
ATOM 5164  C CB    . GLN G 3 92  ? 110.815 130.627 108.237 1.00 170.59 ?  104 GLN G CB    1 
ATOM 5165  C CG    . GLN G 3 92  ? 112.053 130.885 107.407 1.00 170.59 ?  104 GLN G CG    1 
ATOM 5166  C CD    . GLN G 3 92  ? 113.232 131.307 108.241 1.00 170.59 ?  104 GLN G CD    1 
ATOM 5167  O OE1   . GLN G 3 92  ? 113.086 132.068 109.193 1.00 170.59 ?  104 GLN G OE1   1 
ATOM 5168  N NE2   . GLN G 3 92  ? 114.413 130.820 107.889 1.00 170.59 ?  104 GLN G NE2   1 
ATOM 5169  N N     . GLY G 3 93  ? 109.502 128.095 110.622 1.00 167.54 ?  105 GLY G N     1 
ATOM 5170  C CA    . GLY G 3 93  ? 108.237 127.743 111.222 1.00 167.54 ?  105 GLY G CA    1 
ATOM 5171  C C     . GLY G 3 93  ? 108.162 127.968 112.710 1.00 167.54 ?  105 GLY G C     1 
ATOM 5172  O O     . GLY G 3 93  ? 107.999 129.097 113.171 1.00 167.54 ?  105 GLY G O     1 
ATOM 5173  N N     . GLY G 3 94  ? 108.264 126.899 113.463 1.00 169.61 ?  106 GLY G N     1 
ATOM 5174  C CA    . GLY G 3 94  ? 108.102 126.928 114.894 1.00 169.61 ?  106 GLY G CA    1 
ATOM 5175  C C     . GLY G 3 94  ? 107.271 125.748 115.309 1.00 169.61 ?  106 GLY G C     1 
ATOM 5176  O O     . GLY G 3 94  ? 106.814 124.969 114.478 1.00 169.61 ?  106 GLY G O     1 
ATOM 5177  N N     . VAL G 3 95  ? 107.083 125.591 116.614 1.00 177.44 ?  107 VAL G N     1 
ATOM 5178  C CA    . VAL G 3 95  ? 106.255 124.519 117.136 1.00 177.44 ?  107 VAL G CA    1 
ATOM 5179  C C     . VAL G 3 95  ? 105.132 125.127 117.956 1.00 177.44 ?  107 VAL G C     1 
ATOM 5180  O O     . VAL G 3 95  ? 105.073 126.333 118.182 1.00 177.44 ?  107 VAL G O     1 
ATOM 5181  C CB    . VAL G 3 95  ? 107.049 123.511 117.976 1.00 177.44 ?  107 VAL G CB    1 
ATOM 5182  C CG1   . VAL G 3 95  ? 108.085 122.821 117.134 1.00 177.44 ?  107 VAL G CG1   1 
ATOM 5183  C CG2   . VAL G 3 95  ? 107.698 124.217 119.117 1.00 177.44 ?  107 VAL G CG2   1 
ATOM 5184  N N     . LEU G 3 96  ? 104.238 124.266 118.398 1.00 190.61 ?  108 LEU G N     1 
ATOM 5185  C CA    . LEU G 3 96  ? 103.089 124.699 119.165 1.00 190.61 ?  108 LEU G CA    1 
ATOM 5186  C C     . LEU G 3 96  ? 103.520 125.000 120.592 1.00 190.61 ?  108 LEU G C     1 
ATOM 5187  O O     . LEU G 3 96  ? 104.357 124.275 121.137 1.00 190.61 ?  108 LEU G O     1 
ATOM 5188  C CB    . LEU G 3 96  ? 102.041 123.613 119.153 1.00 190.61 ?  108 LEU G CB    1 
ATOM 5189  C CG    . LEU G 3 96  ? 101.602 123.314 117.730 1.00 190.61 ?  108 LEU G CG    1 
ATOM 5190  C CD1   . LEU G 3 96  ? 100.742 122.079 117.704 1.00 190.61 ?  108 LEU G CD1   1 
ATOM 5191  C CD2   . LEU G 3 96  ? 100.849 124.507 117.205 1.00 190.61 ?  108 LEU G CD2   1 
ATOM 5192  N N     . PRO G 3 97  ? 102.989 126.036 121.225 1.00 195.66 ?  109 PRO G N     1 
ATOM 5193  C CA    . PRO G 3 97  ? 103.379 126.327 122.611 1.00 195.66 ?  109 PRO G CA    1 
ATOM 5194  C C     . PRO G 3 97  ? 102.802 125.320 123.595 1.00 195.66 ?  109 PRO G C     1 
ATOM 5195  O O     . PRO G 3 97  ? 101.772 125.567 124.230 1.00 195.66 ?  109 PRO G O     1 
ATOM 5196  C CB    . PRO G 3 97  ? 102.825 127.737 122.840 1.00 195.66 ?  109 PRO G CB    1 
ATOM 5197  C CG    . PRO G 3 97  ? 101.705 127.861 121.871 1.00 195.66 ?  109 PRO G CG    1 
ATOM 5198  C CD    . PRO G 3 97  ? 102.100 127.066 120.668 1.00 195.66 ?  109 PRO G CD    1 
ATOM 5199  N N     . ASN G 3 98  ? 103.468 124.174 123.722 1.00 222.32 ?  110 ASN G N     1 
ATOM 5200  C CA    . ASN G 3 98  ? 102.968 123.046 124.496 1.00 222.32 ?  110 ASN G CA    1 
ATOM 5201  C C     . ASN G 3 98  ? 103.383 123.155 125.955 1.00 222.32 ?  110 ASN G C     1 
ATOM 5202  O O     . ASN G 3 98  ? 104.513 122.811 126.315 1.00 222.32 ?  110 ASN G O     1 
ATOM 5203  C CB    . ASN G 3 98  ? 103.475 121.728 123.919 1.00 222.32 ?  110 ASN G CB    1 
ATOM 5204  C CG    . ASN G 3 98  ? 102.926 121.455 122.549 1.00 222.32 ?  110 ASN G CG    1 
ATOM 5205  O OD1   . ASN G 3 98  ? 103.667 121.398 121.572 1.00 222.32 ?  110 ASN G OD1   1 
ATOM 5206  N ND2   . ASN G 3 98  ? 101.613 121.294 122.462 1.00 222.32 ?  110 ASN G ND2   1 
ATOM 5207  N N     . ILE G 3 99  ? 102.461 123.628 126.791 1.00 254.52 ?  111 ILE G N     1 
ATOM 5208  C CA    . ILE G 3 99  ? 102.636 123.533 128.232 1.00 254.52 ?  111 ILE G CA    1 
ATOM 5209  C C     . ILE G 3 99  ? 102.384 122.092 128.655 1.00 254.52 ?  111 ILE G C     1 
ATOM 5210  O O     . ILE G 3 99  ? 101.271 121.573 128.507 1.00 254.52 ?  111 ILE G O     1 
ATOM 5211  C CB    . ILE G 3 99  ? 101.684 124.500 128.953 1.00 254.52 ?  111 ILE G CB    1 
ATOM 5212  C CG1   . ILE G 3 99  ? 101.921 125.942 128.497 1.00 254.52 ?  111 ILE G CG1   1 
ATOM 5213  C CG2   . ILE G 3 99  ? 101.856 124.397 130.459 1.00 254.52 ?  111 ILE G CG2   1 
ATOM 5214  C CD1   . ILE G 3 99  ? 100.823 126.901 128.928 1.00 254.52 ?  111 ILE G CD1   1 
ATOM 5215  N N     . GLN G 3 100 ? 103.419 121.433 129.171 1.00 266.53 ?  112 GLN G N     1 
ATOM 5216  C CA    . GLN G 3 100 ? 103.300 120.036 129.571 1.00 266.53 ?  112 GLN G CA    1 
ATOM 5217  C C     . GLN G 3 100 ? 102.497 119.891 130.858 1.00 266.53 ?  112 GLN G C     1 
ATOM 5218  O O     . GLN G 3 100 ? 102.148 120.879 131.510 1.00 266.53 ?  112 GLN G O     1 
ATOM 5219  C CB    . GLN G 3 100 ? 104.683 119.412 129.749 1.00 266.53 ?  112 GLN G CB    1 
ATOM 5220  C CG    . GLN G 3 100 ? 105.465 119.237 128.460 1.00 266.53 ?  112 GLN G CG    1 
ATOM 5221  C CD    . GLN G 3 100 ? 104.854 118.193 127.550 1.00 266.53 ?  112 GLN G CD    1 
ATOM 5222  O OE1   . GLN G 3 100 ? 104.324 117.186 128.014 1.00 266.53 ?  112 GLN G OE1   1 
ATOM 5223  N NE2   . GLN G 3 100 ? 104.939 118.420 126.247 1.00 266.53 ?  112 GLN G NE2   1 
ATOM 5224  N N     . SER G 3 101 ? 102.205 118.642 131.224 1.00 274.83 ?  113 SER G N     1 
ATOM 5225  C CA    . SER G 3 101 ? 101.380 118.399 132.402 1.00 274.83 ?  113 SER G CA    1 
ATOM 5226  C C     . SER G 3 101 ? 102.165 118.571 133.694 1.00 274.83 ?  113 SER G C     1 
ATOM 5227  O O     . SER G 3 101 ? 101.758 119.351 134.562 1.00 274.83 ?  113 SER G O     1 
ATOM 5228  C CB    . SER G 3 101 ? 100.774 116.999 132.341 1.00 274.83 ?  113 SER G CB    1 
ATOM 5229  O OG    . SER G 3 101 ? 101.775 116.006 132.464 1.00 274.83 ?  113 SER G OG    1 
ATOM 5230  N N     . VAL G 3 102 ? 103.293 117.875 133.840 1.00 248.21 ?  114 VAL G N     1 
ATOM 5231  C CA    . VAL G 3 102 ? 104.057 117.894 135.083 1.00 248.21 ?  114 VAL G CA    1 
ATOM 5232  C C     . VAL G 3 102 ? 105.000 119.086 135.199 1.00 248.21 ?  114 VAL G C     1 
ATOM 5233  O O     . VAL G 3 102 ? 105.944 119.031 135.993 1.00 248.21 ?  114 VAL G O     1 
ATOM 5234  C CB    . VAL G 3 102 ? 104.851 116.594 135.236 1.00 248.21 ?  114 VAL G CB    1 
ATOM 5235  N N     . LEU G 3 103 ? 104.785 120.145 134.422 1.00 245.34 ?  115 LEU G N     1 
ATOM 5236  C CA    . LEU G 3 103 ? 105.449 121.422 134.623 1.00 245.34 ?  115 LEU G CA    1 
ATOM 5237  C C     . LEU G 3 103 ? 104.561 122.429 135.337 1.00 245.34 ?  115 LEU G C     1 
ATOM 5238  O O     . LEU G 3 103 ? 104.949 123.592 135.479 1.00 245.34 ?  115 LEU G O     1 
ATOM 5239  C CB    . LEU G 3 103 ? 105.907 121.998 133.281 1.00 245.34 ?  115 LEU G CB    1 
ATOM 5240  N N     . LEU G 3 104 ? 103.378 122.010 135.779 1.00 260.95 ?  116 LEU G N     1 
ATOM 5241  C CA    . LEU G 3 104 ? 102.444 122.895 136.466 1.00 260.95 ?  116 LEU G CA    1 
ATOM 5242  C C     . LEU G 3 104 ? 102.834 123.009 137.934 1.00 260.95 ?  116 LEU G C     1 
ATOM 5243  O O     . LEU G 3 104 ? 102.968 121.996 138.629 1.00 260.95 ?  116 LEU G O     1 
ATOM 5244  C CB    . LEU G 3 104 ? 101.019 122.372 136.318 1.00 260.95 ?  116 LEU G CB    1 
ATOM 5245  N N     . PRO G 3 105 ? 103.016 124.238 138.407 1.00 256.60 ?  117 PRO G N     1 
ATOM 5246  C CA    . PRO G 3 105 ? 103.413 124.485 139.786 1.00 256.60 ?  117 PRO G CA    1 
ATOM 5247  C C     . PRO G 3 105 ? 102.274 124.184 140.751 1.00 256.60 ?  117 PRO G C     1 
ATOM 5248  O O     . PRO G 3 105 ? 102.149 123.063 141.243 1.00 256.60 ?  117 PRO G O     1 
ATOM 5249  C CB    . PRO G 3 105 ? 103.877 125.921 139.950 1.00 256.60 ?  117 PRO G CB    1 
ATOM 5250  N N     . ARG H 4 1   ? 110.605 133.695 83.906  1.00 218.02 ?  33  ARG H N     1 
ATOM 5251  C CA    . ARG H 4 1   ? 110.041 132.806 82.900  1.00 218.02 ?  33  ARG H CA    1 
ATOM 5252  C C     . ARG H 4 1   ? 109.234 131.676 83.553  1.00 218.02 ?  33  ARG H C     1 
ATOM 5253  O O     . ARG H 4 1   ? 108.301 131.150 82.948  1.00 218.02 ?  33  ARG H O     1 
ATOM 5254  C CB    . ARG H 4 1   ? 111.157 132.249 82.004  1.00 218.02 ?  33  ARG H CB    1 
ATOM 5255  C CG    . ARG H 4 1   ? 112.156 131.354 82.721  1.00 218.02 ?  33  ARG H CG    1 
ATOM 5256  C CD    . ARG H 4 1   ? 113.319 130.959 81.840  1.00 218.02 ?  33  ARG H CD    1 
ATOM 5257  N NE    . ARG H 4 1   ? 114.206 132.085 81.571  1.00 218.02 ?  33  ARG H NE    1 
ATOM 5258  C CZ    . ARG H 4 1   ? 115.253 132.029 80.756  1.00 218.02 ?  33  ARG H CZ    1 
ATOM 5259  N NH1   . ARG H 4 1   ? 115.551 130.895 80.136  1.00 218.02 ?  33  ARG H NH1   1 
ATOM 5260  N NH2   . ARG H 4 1   ? 116.011 133.101 80.568  1.00 218.02 ?  33  ARG H NH2   1 
ATOM 5261  N N     . LYS H 4 2   ? 109.581 131.321 84.790  1.00 225.67 ?  34  LYS H N     1 
ATOM 5262  C CA    . LYS H 4 2   ? 108.852 130.293 85.518  1.00 225.67 ?  34  LYS H CA    1 
ATOM 5263  C C     . LYS H 4 2   ? 107.617 130.889 86.170  1.00 225.67 ?  34  LYS H C     1 
ATOM 5264  O O     . LYS H 4 2   ? 107.700 131.885 86.892  1.00 225.67 ?  34  LYS H O     1 
ATOM 5265  C CB    . LYS H 4 2   ? 109.734 129.646 86.583  1.00 225.67 ?  34  LYS H CB    1 
ATOM 5266  C CG    . LYS H 4 2   ? 110.805 128.731 86.032  1.00 225.67 ?  34  LYS H CG    1 
ATOM 5267  C CD    . LYS H 4 2   ? 111.683 128.191 87.148  1.00 225.67 ?  34  LYS H CD    1 
ATOM 5268  C CE    . LYS H 4 2   ? 110.925 127.197 88.015  1.00 225.67 ?  34  LYS H CE    1 
ATOM 5269  N NZ    . LYS H 4 2   ? 111.801 126.569 89.039  1.00 225.67 ?  34  LYS H NZ    1 
ATOM 5270  N N     . GLU H 4 3   ? 106.473 130.265 85.926  1.00 223.28 ?  35  GLU H N     1 
ATOM 5271  C CA    . GLU H 4 3   ? 105.196 130.803 86.361  1.00 223.28 ?  35  GLU H CA    1 
ATOM 5272  C C     . GLU H 4 3   ? 104.756 130.198 87.687  1.00 223.28 ?  35  GLU H C     1 
ATOM 5273  O O     . GLU H 4 3   ? 104.968 129.018 87.972  1.00 223.28 ?  35  GLU H O     1 
ATOM 5274  C CB    . GLU H 4 3   ? 104.129 130.585 85.286  1.00 223.28 ?  35  GLU H CB    1 
ATOM 5275  C CG    . GLU H 4 3   ? 103.895 129.145 84.892  1.00 223.28 ?  35  GLU H CG    1 
ATOM 5276  C CD    . GLU H 4 3   ? 102.929 129.020 83.734  1.00 223.28 ?  35  GLU H CD    1 
ATOM 5277  O OE1   . GLU H 4 3   ? 102.434 130.065 83.262  1.00 223.28 ?  35  GLU H OE1   1 
ATOM 5278  O OE2   . GLU H 4 3   ? 102.675 127.884 83.282  1.00 223.28 -1 35  GLU H OE2   1 
ATOM 5279  N N     . SER H 4 4   ? 104.146 131.048 88.506  1.00 206.52 ?  36  SER H N     1 
ATOM 5280  C CA    . SER H 4 4   ? 103.652 130.667 89.820  1.00 206.52 ?  36  SER H CA    1 
ATOM 5281  C C     . SER H 4 4   ? 102.137 130.703 89.863  1.00 206.52 ?  36  SER H C     1 
ATOM 5282  O O     . SER H 4 4   ? 101.487 130.960 88.846  1.00 206.52 ?  36  SER H O     1 
ATOM 5283  C CB    . SER H 4 4   ? 104.204 131.598 90.896  1.00 206.52 ?  36  SER H CB    1 
ATOM 5284  O OG    . SER H 4 4   ? 103.532 131.381 92.123  1.00 206.52 ?  36  SER H OG    1 
ATOM 5285  N N     . TYR H 4 5   ? 101.566 130.453 91.036  1.00 183.01 ?  37  TYR H N     1 
ATOM 5286  C CA    . TYR H 4 5   ? 100.151 130.697 91.254  1.00 183.01 ?  37  TYR H CA    1 
ATOM 5287  C C     . TYR H 4 5   ? 99.934  131.945 92.090  1.00 183.01 ?  37  TYR H C     1 
ATOM 5288  O O     . TYR H 4 5   ? 98.856  132.111 92.666  1.00 183.01 ?  37  TYR H O     1 
ATOM 5289  C CB    . TYR H 4 5   ? 99.465  129.516 91.946  1.00 183.01 ?  37  TYR H CB    1 
ATOM 5290  C CG    . TYR H 4 5   ? 99.368  128.215 91.182  1.00 183.01 ?  37  TYR H CG    1 
ATOM 5291  C CD1   . TYR H 4 5   ? 99.814  128.092 89.879  1.00 183.01 ?  37  TYR H CD1   1 
ATOM 5292  C CD2   . TYR H 4 5   ? 98.753  127.122 91.761  1.00 183.01 ?  37  TYR H CD2   1 
ATOM 5293  C CE1   . TYR H 4 5   ? 99.714  126.898 89.210  1.00 183.01 ?  37  TYR H CE1   1 
ATOM 5294  C CE2   . TYR H 4 5   ? 98.642  125.932 91.103  1.00 183.01 ?  37  TYR H CE2   1 
ATOM 5295  C CZ    . TYR H 4 5   ? 99.121  125.825 89.828  1.00 183.01 ?  37  TYR H CZ    1 
ATOM 5296  O OH    . TYR H 4 5   ? 99.003  124.633 89.163  1.00 183.01 ?  37  TYR H OH    1 
ATOM 5297  N N     . SER H 4 6   ? 100.934 132.824 92.159  1.00 182.77 ?  38  SER H N     1 
ATOM 5298  C CA    . SER H 4 6   ? 100.976 133.841 93.202  1.00 182.77 ?  38  SER H CA    1 
ATOM 5299  C C     . SER H 4 6   ? 99.908  134.907 93.025  1.00 182.77 ?  38  SER H C     1 
ATOM 5300  O O     . SER H 4 6   ? 99.344  135.378 94.017  1.00 182.77 ?  38  SER H O     1 
ATOM 5301  C CB    . SER H 4 6   ? 102.352 134.487 93.232  1.00 182.77 ?  38  SER H CB    1 
ATOM 5302  O OG    . SER H 4 6   ? 102.575 135.205 92.036  1.00 182.77 ?  38  SER H OG    1 
ATOM 5303  N N     . VAL H 4 7   ? 99.616  135.298 91.786  1.00 179.05 ?  39  VAL H N     1 
ATOM 5304  C CA    . VAL H 4 7   ? 98.600  136.320 91.559  1.00 179.05 ?  39  VAL H CA    1 
ATOM 5305  C C     . VAL H 4 7   ? 97.217  135.759 91.854  1.00 179.05 ?  39  VAL H C     1 
ATOM 5306  O O     . VAL H 4 7   ? 96.335  136.466 92.359  1.00 179.05 ?  39  VAL H O     1 
ATOM 5307  C CB    . VAL H 4 7   ? 98.718  136.866 90.123  1.00 179.05 ?  39  VAL H CB    1 
ATOM 5308  C CG1   . VAL H 4 7   ? 97.660  137.917 89.830  1.00 179.05 ?  39  VAL H CG1   1 
ATOM 5309  C CG2   . VAL H 4 7   ? 100.094 137.452 89.914  1.00 179.05 ?  39  VAL H CG2   1 
ATOM 5310  N N     . TYR H 4 8   ? 97.021  134.466 91.607  1.00 189.17 ?  40  TYR H N     1 
ATOM 5311  C CA    . TYR H 4 8   ? 95.722  133.867 91.879  1.00 189.17 ?  40  TYR H CA    1 
ATOM 5312  C C     . TYR H 4 8   ? 95.463  133.703 93.370  1.00 189.17 ?  40  TYR H C     1 
ATOM 5313  O O     . TYR H 4 8   ? 94.326  133.885 93.816  1.00 189.17 ?  40  TYR H O     1 
ATOM 5314  C CB    . TYR H 4 8   ? 95.612  132.520 91.195  1.00 189.17 ?  40  TYR H CB    1 
ATOM 5315  C CG    . TYR H 4 8   ? 95.633  132.603 89.707  1.00 189.17 ?  40  TYR H CG    1 
ATOM 5316  C CD1   . TYR H 4 8   ? 94.521  133.031 89.008  1.00 189.17 ?  40  TYR H CD1   1 
ATOM 5317  C CD2   . TYR H 4 8   ? 96.757  132.231 88.995  1.00 189.17 ?  40  TYR H CD2   1 
ATOM 5318  C CE1   . TYR H 4 8   ? 94.533  133.094 87.638  1.00 189.17 ?  40  TYR H CE1   1 
ATOM 5319  C CE2   . TYR H 4 8   ? 96.782  132.294 87.628  1.00 189.17 ?  40  TYR H CE2   1 
ATOM 5320  C CZ    . TYR H 4 8   ? 95.667  132.729 86.955  1.00 189.17 ?  40  TYR H CZ    1 
ATOM 5321  O OH    . TYR H 4 8   ? 95.675  132.786 85.587  1.00 189.17 ?  40  TYR H OH    1 
ATOM 5322  N N     . VAL H 4 9   ? 96.489  133.358 94.147  1.00 181.03 ?  41  VAL H N     1 
ATOM 5323  C CA    . VAL H 4 9   ? 96.309  133.180 95.584  1.00 181.03 ?  41  VAL H CA    1 
ATOM 5324  C C     . VAL H 4 9   ? 96.028  134.516 96.253  1.00 181.03 ?  41  VAL H C     1 
ATOM 5325  O O     . VAL H 4 9   ? 95.200  134.608 97.168  1.00 181.03 ?  41  VAL H O     1 
ATOM 5326  C CB    . VAL H 4 9   ? 97.545  132.483 96.174  1.00 181.03 ?  41  VAL H CB    1 
ATOM 5327  C CG1   . VAL H 4 9   ? 97.473  132.396 97.677  1.00 181.03 ?  41  VAL H CG1   1 
ATOM 5328  C CG2   . VAL H 4 9   ? 97.654  131.103 95.597  1.00 181.03 ?  41  VAL H CG2   1 
ATOM 5329  N N     . TYR H 4 10  ? 96.654  135.582 95.750  1.00 178.01 ?  42  TYR H N     1 
ATOM 5330  C CA    . TYR H 4 10  ? 96.477  136.916 96.312  1.00 178.01 ?  42  TYR H CA    1 
ATOM 5331  C C     . TYR H 4 10  ? 95.055  137.424 96.121  1.00 178.01 ?  42  TYR H C     1 
ATOM 5332  O O     . TYR H 4 10  ? 94.583  138.246 96.911  1.00 178.01 ?  42  TYR H O     1 
ATOM 5333  C CB    . TYR H 4 10  ? 97.470  137.879 95.669  1.00 178.01 ?  42  TYR H CB    1 
ATOM 5334  C CG    . TYR H 4 10  ? 97.581  139.202 96.371  1.00 178.01 ?  42  TYR H CG    1 
ATOM 5335  C CD1   . TYR H 4 10  ? 98.366  139.336 97.502  1.00 178.01 ?  42  TYR H CD1   1 
ATOM 5336  C CD2   . TYR H 4 10  ? 96.893  140.314 95.916  1.00 178.01 ?  42  TYR H CD2   1 
ATOM 5337  C CE1   . TYR H 4 10  ? 98.474  140.542 98.158  1.00 178.01 ?  42  TYR H CE1   1 
ATOM 5338  C CE2   . TYR H 4 10  ? 96.990  141.527 96.567  1.00 178.01 ?  42  TYR H CE2   1 
ATOM 5339  C CZ    . TYR H 4 10  ? 97.783  141.634 97.689  1.00 178.01 ?  42  TYR H CZ    1 
ATOM 5340  O OH    . TYR H 4 10  ? 97.891  142.837 98.349  1.00 178.01 ?  42  TYR H OH    1 
ATOM 5341  N N     . LYS H 4 11  ? 94.357  136.944 95.091  1.00 167.67 ?  43  LYS H N     1 
ATOM 5342  C CA    . LYS H 4 11  ? 92.950  137.290 94.943  1.00 167.67 ?  43  LYS H CA    1 
ATOM 5343  C C     . LYS H 4 11  ? 92.083  136.551 95.949  1.00 167.67 ?  43  LYS H C     1 
ATOM 5344  O O     . LYS H 4 11  ? 91.030  137.060 96.347  1.00 167.67 ?  43  LYS H O     1 
ATOM 5345  C CB    . LYS H 4 11  ? 92.464  136.992 93.527  1.00 167.67 ?  43  LYS H CB    1 
ATOM 5346  C CG    . LYS H 4 11  ? 92.982  137.942 92.474  1.00 167.67 ?  43  LYS H CG    1 
ATOM 5347  C CD    . LYS H 4 11  ? 92.346  137.638 91.133  1.00 167.67 ?  43  LYS H CD    1 
ATOM 5348  C CE    . LYS H 4 11  ? 92.847  138.577 90.055  1.00 167.67 ?  43  LYS H CE    1 
ATOM 5349  N NZ    . LYS H 4 11  ? 92.221  138.259 88.745  1.00 167.67 ?  43  LYS H NZ    1 
ATOM 5350  N N     . VAL H 4 12  ? 92.493  135.352 96.362  1.00 169.12 ?  44  VAL H N     1 
ATOM 5351  C CA    . VAL H 4 12  ? 91.710  134.610 97.343  1.00 169.12 ?  44  VAL H CA    1 
ATOM 5352  C C     . VAL H 4 12  ? 91.830  135.264 98.709  1.00 169.12 ?  44  VAL H C     1 
ATOM 5353  O O     . VAL H 4 12  ? 90.862  135.318 99.479  1.00 169.12 ?  44  VAL H O     1 
ATOM 5354  C CB    . VAL H 4 12  ? 92.160  133.142 97.371  1.00 169.12 ?  44  VAL H CB    1 
ATOM 5355  C CG1   . VAL H 4 12  ? 91.346  132.333 98.362  1.00 169.12 ?  44  VAL H CG1   1 
ATOM 5356  C CG2   . VAL H 4 12  ? 92.039  132.560 96.001  1.00 169.12 ?  44  VAL H CG2   1 
ATOM 5357  N N     . LEU H 4 13  ? 93.008  135.810 99.007  1.00 181.19 ?  45  LEU H N     1 
ATOM 5358  C CA    . LEU H 4 13  ? 93.244  136.449 100.294 1.00 181.19 ?  45  LEU H CA    1 
ATOM 5359  C C     . LEU H 4 13  ? 92.418  137.718 100.439 1.00 181.19 ?  45  LEU H C     1 
ATOM 5360  O O     . LEU H 4 13  ? 91.862  137.981 101.510 1.00 181.19 ?  45  LEU H O     1 
ATOM 5361  C CB    . LEU H 4 13  ? 94.731  136.747 100.442 1.00 181.19 ?  45  LEU H CB    1 
ATOM 5362  C CG    . LEU H 4 13  ? 95.195  137.253 101.794 1.00 181.19 ?  45  LEU H CG    1 
ATOM 5363  C CD1   . LEU H 4 13  ? 94.900  136.193 102.815 1.00 181.19 ?  45  LEU H CD1   1 
ATOM 5364  C CD2   . LEU H 4 13  ? 96.677  137.547 101.753 1.00 181.19 ?  45  LEU H CD2   1 
ATOM 5365  N N     . LYS H 4 14  ? 92.294  138.496 99.363  1.00 183.77 ?  46  LYS H N     1 
ATOM 5366  C CA    . LYS H 4 14  ? 91.456  139.687 99.402  1.00 183.77 ?  46  LYS H CA    1 
ATOM 5367  C C     . LYS H 4 14  ? 89.972  139.359 99.396  1.00 183.77 ?  46  LYS H C     1 
ATOM 5368  O O     . LYS H 4 14  ? 89.166  140.206 99.790  1.00 183.77 ?  46  LYS H O     1 
ATOM 5369  C CB    . LYS H 4 14  ? 91.780  140.607 98.227  1.00 183.77 ?  46  LYS H CB    1 
ATOM 5370  C CG    . LYS H 4 14  ? 93.175  141.186 98.269  1.00 183.77 ?  46  LYS H CG    1 
ATOM 5371  C CD    . LYS H 4 14  ? 93.304  142.203 99.382  1.00 183.77 ?  46  LYS H CD    1 
ATOM 5372  C CE    . LYS H 4 14  ? 94.713  142.758 99.458  1.00 183.77 ?  46  LYS H CE    1 
ATOM 5373  N NZ    . LYS H 4 14  ? 95.054  143.559 98.258  1.00 183.77 ?  46  LYS H NZ    1 
ATOM 5374  N N     . GLN H 4 15  ? 89.586  138.161 98.959  1.00 178.09 ?  47  GLN H N     1 
ATOM 5375  C CA    . GLN H 4 15  ? 88.169  137.825 98.950  1.00 178.09 ?  47  GLN H CA    1 
ATOM 5376  C C     . GLN H 4 15  ? 87.683  137.473 100.350 1.00 178.09 ?  47  GLN H C     1 
ATOM 5377  O O     . GLN H 4 15  ? 86.510  137.680 100.676 1.00 178.09 ?  47  GLN H O     1 
ATOM 5378  C CB    . GLN H 4 15  ? 87.908  136.683 97.968  1.00 178.09 ?  47  GLN H CB    1 
ATOM 5379  C CG    . GLN H 4 15  ? 86.439  136.377 97.725  1.00 178.09 ?  47  GLN H CG    1 
ATOM 5380  C CD    . GLN H 4 15  ? 86.226  135.301 96.683  1.00 178.09 ?  47  GLN H CD    1 
ATOM 5381  O OE1   . GLN H 4 15  ? 87.179  134.773 96.118  1.00 178.09 ?  47  GLN H OE1   1 
ATOM 5382  N NE2   . GLN H 4 15  ? 84.969  134.959 96.434  1.00 178.09 ?  47  GLN H NE2   1 
ATOM 5383  N N     . VAL H 4 16  ? 88.573  136.978 101.208 1.00 177.99 ?  48  VAL H N     1 
ATOM 5384  C CA    . VAL H 4 16  ? 88.172  136.576 102.552 1.00 177.99 ?  48  VAL H CA    1 
ATOM 5385  C C     . VAL H 4 16  ? 88.683  137.509 103.648 1.00 177.99 ?  48  VAL H C     1 
ATOM 5386  O O     . VAL H 4 16  ? 88.259  137.370 104.805 1.00 177.99 ?  48  VAL H O     1 
ATOM 5387  C CB    . VAL H 4 16  ? 88.630  135.137 102.839 1.00 177.99 ?  48  VAL H CB    1 
ATOM 5388  C CG1   . VAL H 4 16  ? 87.980  134.191 101.858 1.00 177.99 ?  48  VAL H CG1   1 
ATOM 5389  C CG2   . VAL H 4 16  ? 90.132  135.055 102.752 1.00 177.99 ?  48  VAL H CG2   1 
ATOM 5390  N N     . HIS H 4 17  ? 89.575  138.441 103.327 1.00 189.74 ?  49  HIS H N     1 
ATOM 5391  C CA    . HIS H 4 17  ? 90.036  139.453 104.275 1.00 189.74 ?  49  HIS H CA    1 
ATOM 5392  C C     . HIS H 4 17  ? 90.291  140.729 103.488 1.00 189.74 ?  49  HIS H C     1 
ATOM 5393  O O     . HIS H 4 17  ? 91.069  140.724 102.523 1.00 189.74 ?  49  HIS H O     1 
ATOM 5394  C CB    . HIS H 4 17  ? 91.293  139.014 105.017 1.00 189.74 ?  49  HIS H CB    1 
ATOM 5395  C CG    . HIS H 4 17  ? 91.059  137.949 106.038 1.00 189.74 ?  49  HIS H CG    1 
ATOM 5396  N ND1   . HIS H 4 17  ? 91.036  136.608 105.725 1.00 189.74 ?  49  HIS H ND1   1 
ATOM 5397  C CD2   . HIS H 4 17  ? 90.865  138.027 107.374 1.00 189.74 ?  49  HIS H CD2   1 
ATOM 5398  C CE1   . HIS H 4 17  ? 90.822  135.907 106.823 1.00 189.74 ?  49  HIS H CE1   1 
ATOM 5399  N NE2   . HIS H 4 17  ? 90.717  136.744 107.838 1.00 189.74 ?  49  HIS H NE2   1 
ATOM 5400  N N     . PRO H 4 18  ? 89.657  141.839 103.863 1.00 200.00 ?  50  PRO H N     1 
ATOM 5401  C CA    . PRO H 4 18  ? 89.790  143.067 103.070 1.00 200.00 ?  50  PRO H CA    1 
ATOM 5402  C C     . PRO H 4 18  ? 91.134  143.756 103.199 1.00 200.00 ?  50  PRO H C     1 
ATOM 5403  O O     . PRO H 4 18  ? 91.437  144.625 102.376 1.00 200.00 ?  50  PRO H O     1 
ATOM 5404  C CB    . PRO H 4 18  ? 88.674  143.960 103.629 1.00 200.00 ?  50  PRO H CB    1 
ATOM 5405  C CG    . PRO H 4 18  ? 87.716  143.019 104.274 1.00 200.00 ?  50  PRO H CG    1 
ATOM 5406  C CD    . PRO H 4 18  ? 88.570  141.937 104.845 1.00 200.00 ?  50  PRO H CD    1 
ATOM 5407  N N     . ASP H 4 19  ? 91.949  143.414 104.191 1.00 200.22 ?  51  ASP H N     1 
ATOM 5408  C CA    . ASP H 4 19  ? 93.156  144.175 104.465 1.00 200.22 ?  51  ASP H CA    1 
ATOM 5409  C C     . ASP H 4 19  ? 94.395  143.340 104.748 1.00 200.22 ?  51  ASP H C     1 
ATOM 5410  O O     . ASP H 4 19  ? 95.477  143.918 104.886 1.00 200.22 ?  51  ASP H O     1 
ATOM 5411  C CB    . ASP H 4 19  ? 92.920  145.123 105.648 1.00 200.22 ?  51  ASP H CB    1 
ATOM 5412  C CG    . ASP H 4 19  ? 92.387  144.405 106.868 1.00 200.22 ?  51  ASP H CG    1 
ATOM 5413  O OD1   . ASP H 4 19  ? 92.088  143.197 106.767 1.00 200.22 ?  51  ASP H OD1   1 
ATOM 5414  O OD2   . ASP H 4 19  ? 92.265  145.048 107.929 1.00 200.22 -1 51  ASP H OD2   1 
ATOM 5415  N N     . THR H 4 20  ? 94.280  142.023 104.842 1.00 191.49 ?  52  THR H N     1 
ATOM 5416  C CA    . THR H 4 20  ? 95.396  141.194 105.274 1.00 191.49 ?  52  THR H CA    1 
ATOM 5417  C C     . THR H 4 20  ? 96.425  141.062 104.162 1.00 191.49 ?  52  THR H C     1 
ATOM 5418  O O     . THR H 4 20  ? 96.112  140.574 103.073 1.00 191.49 ?  52  THR H O     1 
ATOM 5419  C CB    . THR H 4 20  ? 94.898  139.818 105.692 1.00 191.49 ?  52  THR H CB    1 
ATOM 5420  O OG1   . THR H 4 20  ? 93.974  139.952 106.775 1.00 191.49 ?  52  THR H OG1   1 
ATOM 5421  C CG2   . THR H 4 20  ? 96.052  138.979 106.135 1.00 191.49 ?  52  THR H CG2   1 
ATOM 5422  N N     . GLY H 4 21  ? 97.652  141.493 104.436 1.00 185.70 ?  53  GLY H N     1 
ATOM 5423  C CA    . GLY H 4 21  ? 98.738  141.326 103.498 1.00 185.70 ?  53  GLY H CA    1 
ATOM 5424  C C     . GLY H 4 21  ? 99.378  139.957 103.602 1.00 185.70 ?  53  GLY H C     1 
ATOM 5425  O O     . GLY H 4 21  ? 98.937  139.080 104.342 1.00 185.70 ?  53  GLY H O     1 
ATOM 5426  N N     . ILE H 4 22  ? 100.452 139.778 102.841 1.00 173.48 ?  54  ILE H N     1 
ATOM 5427  C CA    . ILE H 4 22  ? 101.181 138.517 102.832 1.00 173.48 ?  54  ILE H CA    1 
ATOM 5428  C C     . ILE H 4 22  ? 102.633 138.795 102.473 1.00 173.48 ?  54  ILE H C     1 
ATOM 5429  O O     . ILE H 4 22  ? 102.926 139.563 101.553 1.00 173.48 ?  54  ILE H O     1 
ATOM 5430  C CB    . ILE H 4 22  ? 100.510 137.499 101.881 1.00 173.48 ?  54  ILE H CB    1 
ATOM 5431  C CG1   . ILE H 4 22  ? 101.275 136.178 101.866 1.00 173.48 ?  54  ILE H CG1   1 
ATOM 5432  C CG2   . ILE H 4 22  ? 100.287 138.076 100.498 1.00 173.48 ?  54  ILE H CG2   1 
ATOM 5433  C CD1   . ILE H 4 22  ? 100.520 135.047 101.230 1.00 173.48 ?  54  ILE H CD1   1 
ATOM 5434  N N     . SER H 4 23  ? 103.549 138.204 103.232 1.00 174.85 ?  55  SER H N     1 
ATOM 5435  C CA    . SER H 4 23  ? 104.959 138.414 102.961 1.00 174.85 ?  55  SER H CA    1 
ATOM 5436  C C     . SER H 4 23  ? 105.408 137.521 101.818 1.00 174.85 ?  55  SER H C     1 
ATOM 5437  O O     . SER H 4 23  ? 104.701 136.600 101.409 1.00 174.85 ?  55  SER H O     1 
ATOM 5438  C CB    . SER H 4 23  ? 105.809 138.107 104.182 1.00 174.85 ?  55  SER H CB    1 
ATOM 5439  O OG    . SER H 4 23  ? 105.867 136.712 104.383 1.00 174.85 ?  55  SER H OG    1 
ATOM 5440  N N     . SER H 4 24  ? 106.624 137.780 101.332 1.00 180.17 ?  56  SER H N     1 
ATOM 5441  C CA    . SER H 4 24  ? 107.087 137.106 100.125 1.00 180.17 ?  56  SER H CA    1 
ATOM 5442  C C     . SER H 4 24  ? 107.403 135.644 100.375 1.00 180.17 ?  56  SER H C     1 
ATOM 5443  O O     . SER H 4 24  ? 107.085 134.797 99.534  1.00 180.17 ?  56  SER H O     1 
ATOM 5444  C CB    . SER H 4 24  ? 108.323 137.795 99.562  1.00 180.17 ?  56  SER H CB    1 
ATOM 5445  O OG    . SER H 4 24  ? 109.428 137.591 100.422 1.00 180.17 ?  56  SER H OG    1 
ATOM 5446  N N     . LYS H 4 25  ? 108.022 135.322 101.508 1.00 169.13 ?  57  LYS H N     1 
ATOM 5447  C CA    . LYS H 4 25  ? 108.314 133.922 101.780 1.00 169.13 ?  57  LYS H CA    1 
ATOM 5448  C C     . LYS H 4 25  ? 107.039 133.169 102.129 1.00 169.13 ?  57  LYS H C     1 
ATOM 5449  O O     . LYS H 4 25  ? 106.938 131.960 101.895 1.00 169.13 ?  57  LYS H O     1 
ATOM 5450  C CB    . LYS H 4 25  ? 109.361 133.805 102.888 1.00 169.13 ?  57  LYS H CB    1 
ATOM 5451  C CG    . LYS H 4 25  ? 109.910 132.400 103.077 1.00 169.13 ?  57  LYS H CG    1 
ATOM 5452  C CD    . LYS H 4 25  ? 111.007 132.352 104.114 1.00 169.13 ?  57  LYS H CD    1 
ATOM 5453  C CE    . LYS H 4 25  ? 112.378 132.330 103.464 1.00 169.13 ?  57  LYS H CE    1 
ATOM 5454  N NZ    . LYS H 4 25  ? 112.787 133.667 102.965 1.00 169.13 ?  57  LYS H NZ    1 
ATOM 5455  N N     . ALA H 4 26  ? 106.035 133.877 102.644 1.00 172.70 ?  58  ALA H N     1 
ATOM 5456  C CA    . ALA H 4 26  ? 104.734 133.261 102.847 1.00 172.70 ?  58  ALA H CA    1 
ATOM 5457  C C     . ALA H 4 26  ? 104.051 132.924 101.534 1.00 172.70 ?  58  ALA H C     1 
ATOM 5458  O O     . ALA H 4 26  ? 103.279 131.964 101.482 1.00 172.70 ?  58  ALA H O     1 
ATOM 5459  C CB    . ALA H 4 26  ? 103.837 134.175 103.675 1.00 172.70 ?  58  ALA H CB    1 
ATOM 5460  N N     . MET H 4 27  ? 104.323 133.679 100.472 1.00 184.85 ?  59  MET H N     1 
ATOM 5461  C CA    . MET H 4 27  ? 103.792 133.315 99.167  1.00 184.85 ?  59  MET H CA    1 
ATOM 5462  C C     . MET H 4 27  ? 104.529 132.107 98.608  1.00 184.85 ?  59  MET H C     1 
ATOM 5463  O O     . MET H 4 27  ? 103.971 131.344 97.812  1.00 184.85 ?  59  MET H O     1 
ATOM 5464  C CB    . MET H 4 27  ? 103.885 134.507 98.216  1.00 184.85 ?  59  MET H CB    1 
ATOM 5465  C CG    . MET H 4 27  ? 103.181 134.327 96.891  1.00 184.85 ?  59  MET H CG    1 
ATOM 5466  S SD    . MET H 4 27  ? 101.415 134.108 97.114  1.00 184.85 ?  59  MET H SD    1 
ATOM 5467  C CE    . MET H 4 27  ? 100.938 135.775 97.530  1.00 184.85 ?  59  MET H CE    1 
ATOM 5468  N N     . GLY H 4 28  ? 105.777 131.903 99.035  1.00 178.71 ?  60  GLY H N     1 
ATOM 5469  C CA    . GLY H 4 28  ? 106.510 130.720 98.621  1.00 178.71 ?  60  GLY H CA    1 
ATOM 5470  C C     . GLY H 4 28  ? 105.936 129.434 99.181  1.00 178.71 ?  60  GLY H C     1 
ATOM 5471  O O     . GLY H 4 28  ? 105.905 128.414 98.488  1.00 178.71 ?  60  GLY H O     1 
ATOM 5472  N N     . ILE H 4 29  ? 105.462 129.466 100.428 1.00 174.79 ?  61  ILE H N     1 
ATOM 5473  C CA    . ILE H 4 29  ? 104.844 128.287 101.022 1.00 174.79 ?  61  ILE H CA    1 
ATOM 5474  C C     . ILE H 4 29  ? 103.498 128.009 100.375 1.00 174.79 ?  61  ILE H C     1 
ATOM 5475  O O     . ILE H 4 29  ? 103.129 126.852 100.148 1.00 174.79 ?  61  ILE H O     1 
ATOM 5476  C CB    . ILE H 4 29  ? 104.729 128.479 102.540 1.00 174.79 ?  61  ILE H CB    1 
ATOM 5477  C CG1   . ILE H 4 29  ? 106.121 128.632 103.111 1.00 174.79 ?  61  ILE H CG1   1 
ATOM 5478  C CG2   . ILE H 4 29  ? 104.043 127.309 103.204 1.00 174.79 ?  61  ILE H CG2   1 
ATOM 5479  C CD1   . ILE H 4 29  ? 106.118 129.115 104.500 1.00 174.79 ?  61  ILE H CD1   1 
ATOM 5480  N N     . MET H 4 30  ? 102.772 129.059 99.997  1.00 171.27 ?  62  MET H N     1 
ATOM 5481  C CA    . MET H 4 30  ? 101.471 128.852 99.376  1.00 171.27 ?  62  MET H CA    1 
ATOM 5482  C C     . MET H 4 30  ? 101.602 128.354 97.943  1.00 171.27 ?  62  MET H C     1 
ATOM 5483  O O     . MET H 4 30  ? 100.614 127.928 97.343  1.00 171.27 ?  62  MET H O     1 
ATOM 5484  C CB    . MET H 4 30  ? 100.655 130.135 99.428  1.00 171.27 ?  62  MET H CB    1 
ATOM 5485  C CG    . MET H 4 30  ? 100.302 130.520 100.830 1.00 171.27 ?  62  MET H CG    1 
ATOM 5486  S SD    . MET H 4 30  ? 99.374  129.204 101.602 1.00 171.27 ?  62  MET H SD    1 
ATOM 5487  C CE    . MET H 4 30  ? 97.880  129.318 100.639 1.00 171.27 ?  62  MET H CE    1 
ATOM 5488  N N     . ASN H 4 31  ? 102.804 128.405 97.370  1.00 178.71 ?  63  ASN H N     1 
ATOM 5489  C CA    . ASN H 4 31  ? 103.027 127.677 96.128  1.00 178.71 ?  63  ASN H CA    1 
ATOM 5490  C C     . ASN H 4 31  ? 103.303 126.210 96.395  1.00 178.71 ?  63  ASN H C     1 
ATOM 5491  O O     . ASN H 4 31  ? 102.570 125.335 95.924  1.00 178.71 ?  63  ASN H O     1 
ATOM 5492  C CB    . ASN H 4 31  ? 104.165 128.288 95.328  1.00 178.71 ?  63  ASN H CB    1 
ATOM 5493  C CG    . ASN H 4 31  ? 103.750 129.535 94.611  1.00 178.71 ?  63  ASN H CG    1 
ATOM 5494  O OD1   . ASN H 4 31  ? 104.262 130.617 94.878  1.00 178.71 ?  63  ASN H OD1   1 
ATOM 5495  N ND2   . ASN H 4 31  ? 102.807 129.397 93.686  1.00 178.71 ?  63  ASN H ND2   1 
ATOM 5496  N N     . SER H 4 32  ? 104.333 125.911 97.181  1.00 183.48 ?  64  SER H N     1 
ATOM 5497  C CA    . SER H 4 32  ? 104.716 124.513 97.322  1.00 183.48 ?  64  SER H CA    1 
ATOM 5498  C C     . SER H 4 32  ? 103.810 123.764 98.291  1.00 183.48 ?  64  SER H C     1 
ATOM 5499  O O     . SER H 4 32  ? 104.040 122.582 98.559  1.00 183.48 ?  64  SER H O     1 
ATOM 5500  C CB    . SER H 4 32  ? 106.177 124.409 97.738  1.00 183.48 ?  64  SER H CB    1 
ATOM 5501  O OG    . SER H 4 32  ? 107.008 124.875 96.691  1.00 183.48 ?  64  SER H OG    1 
ATOM 5502  N N     . PHE H 4 33  ? 102.779 124.418 98.822  1.00 171.11 ?  65  PHE H N     1 
ATOM 5503  C CA    . PHE H 4 33  ? 101.633 123.677 99.325  1.00 171.11 ?  65  PHE H CA    1 
ATOM 5504  C C     . PHE H 4 33  ? 100.723 123.255 98.186  1.00 171.11 ?  65  PHE H C     1 
ATOM 5505  O O     . PHE H 4 33  ? 100.292 122.102 98.114  1.00 171.11 ?  65  PHE H O     1 
ATOM 5506  C CB    . PHE H 4 33  ? 100.839 124.498 100.333 1.00 171.11 ?  65  PHE H CB    1 
ATOM 5507  C CG    . PHE H 4 33  ? 99.510  123.896 100.663 1.00 171.11 ?  65  PHE H CG    1 
ATOM 5508  C CD1   . PHE H 4 33  ? 99.429  122.758 101.426 1.00 171.11 ?  65  PHE H CD1   1 
ATOM 5509  C CD2   . PHE H 4 33  ? 98.342  124.468 100.198 1.00 171.11 ?  65  PHE H CD2   1 
ATOM 5510  C CE1   . PHE H 4 33  ? 98.210  122.200 101.719 1.00 171.11 ?  65  PHE H CE1   1 
ATOM 5511  C CE2   . PHE H 4 33  ? 97.126  123.915 100.488 1.00 171.11 ?  65  PHE H CE2   1 
ATOM 5512  C CZ    . PHE H 4 33  ? 97.063  122.781 101.248 1.00 171.11 ?  65  PHE H CZ    1 
ATOM 5513  N N     . VAL H 4 34  ? 100.392 124.187 97.296  1.00 163.26 ?  66  VAL H N     1 
ATOM 5514  C CA    . VAL H 4 34  ? 99.316  123.904 96.368  1.00 163.26 ?  66  VAL H CA    1 
ATOM 5515  C C     . VAL H 4 34  ? 99.814  123.093 95.180  1.00 163.26 ?  66  VAL H C     1 
ATOM 5516  O O     . VAL H 4 34  ? 99.006  122.563 94.415  1.00 163.26 ?  66  VAL H O     1 
ATOM 5517  C CB    . VAL H 4 34  ? 98.644  125.223 95.955  1.00 163.26 ?  66  VAL H CB    1 
ATOM 5518  C CG1   . VAL H 4 34  ? 99.498  125.937 94.984  1.00 163.26 ?  66  VAL H CG1   1 
ATOM 5519  C CG2   . VAL H 4 34  ? 97.230  125.015 95.427  1.00 163.26 ?  66  VAL H CG2   1 
ATOM 5520  N N     . ASN H 4 35  ? 101.126 122.929 95.015  1.00 174.94 ?  67  ASN H N     1 
ATOM 5521  C CA    . ASN H 4 35  ? 101.564 121.902 94.078  1.00 174.94 ?  67  ASN H CA    1 
ATOM 5522  C C     . ASN H 4 35  ? 101.592 120.530 94.729  1.00 174.94 ?  67  ASN H C     1 
ATOM 5523  O O     . ASN H 4 35  ? 101.449 119.519 94.036  1.00 174.94 ?  67  ASN H O     1 
ATOM 5524  C CB    . ASN H 4 35  ? 102.929 122.226 93.481  1.00 174.94 ?  67  ASN H CB    1 
ATOM 5525  C CG    . ASN H 4 35  ? 102.850 123.266 92.392  1.00 174.94 ?  67  ASN H CG    1 
ATOM 5526  O OD1   . ASN H 4 35  ? 101.871 123.332 91.657  1.00 174.94 ?  67  ASN H OD1   1 
ATOM 5527  N ND2   . ASN H 4 35  ? 103.905 124.049 92.244  1.00 174.94 ?  67  ASN H ND2   1 
ATOM 5528  N N     . ASP H 4 36  ? 101.755 120.469 96.049  1.00 181.68 ?  68  ASP H N     1 
ATOM 5529  C CA    . ASP H 4 36  ? 101.800 119.174 96.715  1.00 181.68 ?  68  ASP H CA    1 
ATOM 5530  C C     . ASP H 4 36  ? 100.426 118.526 96.764  1.00 181.68 ?  68  ASP H C     1 
ATOM 5531  O O     . ASP H 4 36  ? 100.313 117.304 96.651  1.00 181.68 ?  68  ASP H O     1 
ATOM 5532  C CB    . ASP H 4 36  ? 102.354 119.317 98.125  1.00 181.68 ?  68  ASP H CB    1 
ATOM 5533  C CG    . ASP H 4 36  ? 102.537 117.986 98.803  1.00 181.68 ?  68  ASP H CG    1 
ATOM 5534  O OD1   . ASP H 4 36  ? 103.533 117.306 98.496  1.00 181.68 ?  68  ASP H OD1   1 
ATOM 5535  O OD2   . ASP H 4 36  ? 101.673 117.603 99.618  1.00 181.68 -1 68  ASP H OD2   1 
ATOM 5536  N N     . ILE H 4 37  ? 99.373  119.318 96.949  1.00 174.94 ?  69  ILE H N     1 
ATOM 5537  C CA    . ILE H 4 37  ? 98.029  118.763 96.859  1.00 174.94 ?  69  ILE H CA    1 
ATOM 5538  C C     . ILE H 4 37  ? 97.702  118.435 95.414  1.00 174.94 ?  69  ILE H C     1 
ATOM 5539  O O     . ILE H 4 37  ? 97.017  117.446 95.124  1.00 174.94 ?  69  ILE H O     1 
ATOM 5540  C CB    . ILE H 4 37  ? 97.013  119.735 97.475  1.00 174.94 ?  69  ILE H CB    1 
ATOM 5541  C CG1   . ILE H 4 37  ? 97.386  120.002 98.922  1.00 174.94 ?  69  ILE H CG1   1 
ATOM 5542  C CG2   . ILE H 4 37  ? 95.615  119.171 97.446  1.00 174.94 ?  69  ILE H CG2   1 
ATOM 5543  C CD1   . ILE H 4 37  ? 97.390  118.763 99.767  1.00 174.94 ?  69  ILE H CD1   1 
ATOM 5544  N N     . PHE H 4 38  ? 98.232  119.224 94.484  1.00 173.37 ?  70  PHE H N     1 
ATOM 5545  C CA    . PHE H 4 38  ? 97.992  118.965 93.071  1.00 173.37 ?  70  PHE H CA    1 
ATOM 5546  C C     . PHE H 4 38  ? 98.695  117.704 92.600  1.00 173.37 ?  70  PHE H C     1 
ATOM 5547  O O     . PHE H 4 38  ? 98.134  116.934 91.815  1.00 173.37 ?  70  PHE H O     1 
ATOM 5548  C CB    . PHE H 4 38  ? 98.447  120.151 92.245  1.00 173.37 ?  70  PHE H CB    1 
ATOM 5549  C CG    . PHE H 4 38  ? 98.402  119.910 90.787  1.00 173.37 ?  70  PHE H CG    1 
ATOM 5550  C CD1   . PHE H 4 38  ? 97.205  119.863 90.124  1.00 173.37 ?  70  PHE H CD1   1 
ATOM 5551  C CD2   . PHE H 4 38  ? 99.572  119.750 90.076  1.00 173.37 ?  70  PHE H CD2   1 
ATOM 5552  C CE1   . PHE H 4 38  ? 97.173  119.653 88.781  1.00 173.37 ?  70  PHE H CE1   1 
ATOM 5553  C CE2   . PHE H 4 38  ? 99.550  119.539 88.735  1.00 173.37 ?  70  PHE H CE2   1 
ATOM 5554  C CZ    . PHE H 4 38  ? 98.346  119.491 88.086  1.00 173.37 ?  70  PHE H CZ    1 
ATOM 5555  N N     . GLU H 4 39  ? 99.925  117.480 93.053  1.00 184.17 ?  71  GLU H N     1 
ATOM 5556  C CA    . GLU H 4 39  ? 100.647 116.303 92.594  1.00 184.17 ?  71  GLU H CA    1 
ATOM 5557  C C     . GLU H 4 39  ? 100.108 115.043 93.251  1.00 184.17 ?  71  GLU H C     1 
ATOM 5558  O O     . GLU H 4 39  ? 100.194 113.959 92.669  1.00 184.17 ?  71  GLU H O     1 
ATOM 5559  C CB    . GLU H 4 39  ? 102.142 116.472 92.860  1.00 184.17 ?  71  GLU H CB    1 
ATOM 5560  C CG    . GLU H 4 39  ? 103.060 115.552 92.066  1.00 184.17 ?  71  GLU H CG    1 
ATOM 5561  C CD    . GLU H 4 39  ? 103.289 114.217 92.738  1.00 184.17 ?  71  GLU H CD    1 
ATOM 5562  O OE1   . GLU H 4 39  ? 103.179 114.154 93.978  1.00 184.17 ?  71  GLU H OE1   1 
ATOM 5563  O OE2   . GLU H 4 39  ? 103.584 113.232 92.029  1.00 184.17 -1 71  GLU H OE2   1 
ATOM 5564  N N     . ARG H 4 40  ? 99.526  115.163 94.443  1.00 170.73 ?  72  ARG H N     1 
ATOM 5565  C CA    . ARG H 4 40  ? 98.876  114.006 95.042  1.00 170.73 ?  72  ARG H CA    1 
ATOM 5566  C C     . ARG H 4 40  ? 97.590  113.656 94.316  1.00 170.73 ?  72  ARG H C     1 
ATOM 5567  O O     . ARG H 4 40  ? 97.381  112.494 93.961  1.00 170.73 ?  72  ARG H O     1 
ATOM 5568  C CB    . ARG H 4 40  ? 98.587  114.241 96.520  1.00 170.73 ?  72  ARG H CB    1 
ATOM 5569  C CG    . ARG H 4 40  ? 99.782  114.120 97.425  1.00 170.73 ?  72  ARG H CG    1 
ATOM 5570  C CD    . ARG H 4 40  ? 99.377  114.392 98.857  1.00 170.73 ?  72  ARG H CD    1 
ATOM 5571  N NE    . ARG H 4 40  ? 100.499 114.276 99.773  1.00 170.73 ?  72  ARG H NE    1 
ATOM 5572  C CZ    . ARG H 4 40  ? 100.420 114.521 101.072 1.00 170.73 ?  72  ARG H CZ    1 
ATOM 5573  N NH1   . ARG H 4 40  ? 99.272  114.902 101.605 1.00 170.73 ?  72  ARG H NH1   1 
ATOM 5574  N NH2   . ARG H 4 40  ? 101.490 114.386 101.834 1.00 170.73 ?  72  ARG H NH2   1 
ATOM 5575  N N     . ILE H 4 41  ? 96.720  114.640 94.087  1.00 170.88 ?  73  ILE H N     1 
ATOM 5576  C CA    . ILE H 4 41  ? 95.406  114.354 93.516  1.00 170.88 ?  73  ILE H CA    1 
ATOM 5577  C C     . ILE H 4 41  ? 95.537  113.912 92.066  1.00 170.88 ?  73  ILE H C     1 
ATOM 5578  O O     . ILE H 4 41  ? 95.018  112.865 91.669  1.00 170.88 ?  73  ILE H O     1 
ATOM 5579  C CB    . ILE H 4 41  ? 94.476  115.569 93.653  1.00 170.88 ?  73  ILE H CB    1 
ATOM 5580  C CG1   . ILE H 4 41  ? 94.124  115.794 95.112  1.00 170.88 ?  73  ILE H CG1   1 
ATOM 5581  C CG2   . ILE H 4 41  ? 93.215  115.364 92.874  1.00 170.88 ?  73  ILE H CG2   1 
ATOM 5582  C CD1   . ILE H 4 41  ? 93.324  117.037 95.329  1.00 170.88 ?  73  ILE H CD1   1 
ATOM 5583  N N     . ALA H 4 42  ? 96.291  114.658 91.272  1.00 177.16 ?  74  ALA H N     1 
ATOM 5584  C CA    . ALA H 4 42  ? 96.416  114.282 89.872  1.00 177.16 ?  74  ALA H CA    1 
ATOM 5585  C C     . ALA H 4 42  ? 97.442  113.179 89.674  1.00 177.16 ?  74  ALA H C     1 
ATOM 5586  O O     . ALA H 4 42  ? 97.663  112.741 88.542  1.00 177.16 ?  74  ALA H O     1 
ATOM 5587  C CB    . ALA H 4 42  ? 96.773  115.499 89.031  1.00 177.16 ?  74  ALA H CB    1 
ATOM 5588  N N     . GLY H 4 43  ? 98.094  112.732 90.744  1.00 184.48 ?  75  GLY H N     1 
ATOM 5589  C CA    . GLY H 4 43  ? 98.920  111.544 90.645  1.00 184.48 ?  75  GLY H CA    1 
ATOM 5590  C C     . GLY H 4 43  ? 98.173  110.286 91.028  1.00 184.48 ?  75  GLY H C     1 
ATOM 5591  O O     . GLY H 4 43  ? 98.374  109.229 90.423  1.00 184.48 ?  75  GLY H O     1 
ATOM 5592  N N     . GLU H 4 44  ? 97.301  110.380 92.027  1.00 182.29 ?  76  GLU H N     1 
ATOM 5593  C CA    . GLU H 4 44  ? 96.494  109.252 92.459  1.00 182.29 ?  76  GLU H CA    1 
ATOM 5594  C C     . GLU H 4 44  ? 95.279  109.051 91.565  1.00 182.29 ?  76  GLU H C     1 
ATOM 5595  O O     . GLU H 4 44  ? 94.775  107.928 91.463  1.00 182.29 ?  76  GLU H O     1 
ATOM 5596  C CB    . GLU H 4 44  ? 96.074  109.461 93.916  1.00 182.29 ?  76  GLU H CB    1 
ATOM 5597  C CG    . GLU H 4 44  ? 95.522  108.261 94.638  1.00 182.29 ?  76  GLU H CG    1 
ATOM 5598  C CD    . GLU H 4 44  ? 94.041  108.107 94.432  1.00 182.29 ?  76  GLU H CD    1 
ATOM 5599  O OE1   . GLU H 4 44  ? 93.387  109.124 94.125  1.00 182.29 ?  76  GLU H OE1   1 
ATOM 5600  O OE2   . GLU H 4 44  ? 93.534  106.977 94.570  1.00 182.29 -1 76  GLU H OE2   1 
ATOM 5601  N N     . ALA H 4 45  ? 94.805  110.101 90.893  1.00 170.06 ?  77  ALA H N     1 
ATOM 5602  C CA    . ALA H 4 45  ? 93.747  109.904 89.911  1.00 170.06 ?  77  ALA H CA    1 
ATOM 5603  C C     . ALA H 4 45  ? 94.251  109.187 88.672  1.00 170.06 ?  77  ALA H C     1 
ATOM 5604  O O     . ALA H 4 45  ? 93.452  108.580 87.955  1.00 170.06 ?  77  ALA H O     1 
ATOM 5605  C CB    . ALA H 4 45  ? 93.125  111.235 89.507  1.00 170.06 ?  77  ALA H CB    1 
ATOM 5606  N N     . SER H 4 46  ? 95.555  109.249 88.406  1.00 180.35 ?  78  SER H N     1 
ATOM 5607  C CA    . SER H 4 46  ? 96.123  108.488 87.305  1.00 180.35 ?  78  SER H CA    1 
ATOM 5608  C C     . SER H 4 46  ? 96.084  107.000 87.581  1.00 180.35 ?  78  SER H C     1 
ATOM 5609  O O     . SER H 4 46  ? 95.970  106.201 86.647  1.00 180.35 ?  78  SER H O     1 
ATOM 5610  C CB    . SER H 4 46  ? 97.559  108.916 87.051  1.00 180.35 ?  78  SER H CB    1 
ATOM 5611  O OG    . SER H 4 46  ? 98.125  108.128 86.024  1.00 180.35 ?  78  SER H OG    1 
ATOM 5612  N N     . ARG H 4 47  ? 96.175  106.610 88.848  1.00 181.41 ?  79  ARG H N     1 
ATOM 5613  C CA    . ARG H 4 47  ? 96.238  105.195 89.172  1.00 181.41 ?  79  ARG H CA    1 
ATOM 5614  C C     . ARG H 4 47  ? 94.876  104.528 89.025  1.00 181.41 ?  79  ARG H C     1 
ATOM 5615  O O     . ARG H 4 47  ? 94.805  103.322 88.777  1.00 181.41 ?  79  ARG H O     1 
ATOM 5616  C CB    . ARG H 4 47  ? 96.786  105.026 90.586  1.00 181.41 ?  79  ARG H CB    1 
ATOM 5617  C CG    . ARG H 4 47  ? 97.166  103.628 90.980  1.00 181.41 ?  79  ARG H CG    1 
ATOM 5618  C CD    . ARG H 4 47  ? 97.709  103.644 92.377  1.00 181.41 ?  79  ARG H CD    1 
ATOM 5619  N NE    . ARG H 4 47  ? 98.945  104.409 92.444  1.00 181.41 ?  79  ARG H NE    1 
ATOM 5620  C CZ    . ARG H 4 47  ? 99.532  104.766 93.578  1.00 181.41 ?  79  ARG H CZ    1 
ATOM 5621  N NH1   . ARG H 4 47  ? 98.984  104.422 94.732  1.00 181.41 ?  79  ARG H NH1   1 
ATOM 5622  N NH2   . ARG H 4 47  ? 100.659 105.467 93.561  1.00 181.41 ?  79  ARG H NH2   1 
ATOM 5623  N N     . LEU H 4 48  ? 93.786  105.289 89.139  1.00 171.33 ?  80  LEU H N     1 
ATOM 5624  C CA    . LEU H 4 48  ? 92.471  104.684 88.952  1.00 171.33 ?  80  LEU H CA    1 
ATOM 5625  C C     . LEU H 4 48  ? 92.189  104.396 87.485  1.00 171.33 ?  80  LEU H C     1 
ATOM 5626  O O     . LEU H 4 48  ? 91.712  103.306 87.146  1.00 171.33 ?  80  LEU H O     1 
ATOM 5627  C CB    . LEU H 4 48  ? 91.372  105.563 89.530  1.00 171.33 ?  80  LEU H CB    1 
ATOM 5628  C CG    . LEU H 4 48  ? 91.045  105.322 90.996  1.00 171.33 ?  80  LEU H CG    1 
ATOM 5629  C CD1   . LEU H 4 48  ? 92.062  105.963 91.907  1.00 171.33 ?  80  LEU H CD1   1 
ATOM 5630  C CD2   . LEU H 4 48  ? 89.655  105.830 91.275  1.00 171.33 ?  80  LEU H CD2   1 
ATOM 5631  N N     . ALA H 4 49  ? 92.482  105.351 86.598  1.00 181.82 ?  81  ALA H N     1 
ATOM 5632  C CA    . ALA H 4 49  ? 92.263  105.114 85.176  1.00 181.82 ?  81  ALA H CA    1 
ATOM 5633  C C     . ALA H 4 49  ? 93.243  104.096 84.622  1.00 181.82 ?  81  ALA H C     1 
ATOM 5634  O O     . ALA H 4 49  ? 93.001  103.517 83.560  1.00 181.82 ?  81  ALA H O     1 
ATOM 5635  C CB    . ALA H 4 49  ? 92.372  106.414 84.392  1.00 181.82 ?  81  ALA H CB    1 
ATOM 5636  N N     . HIS H 4 50  ? 94.354  103.875 85.316  1.00 182.55 ?  82  HIS H N     1 
ATOM 5637  C CA    . HIS H 4 50  ? 95.233  102.779 84.953  1.00 182.55 ?  82  HIS H CA    1 
ATOM 5638  C C     . HIS H 4 50  ? 94.756  101.465 85.557  1.00 182.55 ?  82  HIS H C     1 
ATOM 5639  O O     . HIS H 4 50  ? 95.057  100.396 85.020  1.00 182.55 ?  82  HIS H O     1 
ATOM 5640  C CB    . HIS H 4 50  ? 96.651  103.100 85.399  1.00 182.55 ?  82  HIS H CB    1 
ATOM 5641  C CG    . HIS H 4 50  ? 97.677  102.160 84.865  1.00 182.55 ?  82  HIS H CG    1 
ATOM 5642  N ND1   . HIS H 4 50  ? 97.988  100.971 85.485  1.00 182.55 ?  82  HIS H ND1   1 
ATOM 5643  C CD2   . HIS H 4 50  ? 98.473  102.239 83.775  1.00 182.55 ?  82  HIS H CD2   1 
ATOM 5644  C CE1   . HIS H 4 50  ? 98.929  100.353 84.796  1.00 182.55 ?  82  HIS H CE1   1 
ATOM 5645  N NE2   . HIS H 4 50  ? 99.241  101.102 83.753  1.00 182.55 ?  82  HIS H NE2   1 
ATOM 5646  N N     . TYR H 4 51  ? 94.019  101.520 86.669  1.00 178.31 ?  83  TYR H N     1 
ATOM 5647  C CA    . TYR H 4 51  ? 93.435  100.304 87.228  1.00 178.31 ?  83  TYR H CA    1 
ATOM 5648  C C     . TYR H 4 51  ? 92.223  99.854  86.431  1.00 178.31 ?  83  TYR H C     1 
ATOM 5649  O O     . TYR H 4 51  ? 92.177  98.724  85.938  1.00 178.31 ?  83  TYR H O     1 
ATOM 5650  C CB    . TYR H 4 51  ? 93.044  100.511 88.691  1.00 178.31 ?  83  TYR H CB    1 
ATOM 5651  C CG    . TYR H 4 51  ? 94.180  100.384 89.676  1.00 178.31 ?  83  TYR H CG    1 
ATOM 5652  C CD1   . TYR H 4 51  ? 95.340  99.697  89.347  1.00 178.31 ?  83  TYR H CD1   1 
ATOM 5653  C CD2   . TYR H 4 51  ? 94.095  100.961 90.934  1.00 178.31 ?  83  TYR H CD2   1 
ATOM 5654  C CE1   . TYR H 4 51  ? 96.382  99.582  90.253  1.00 178.31 ?  83  TYR H CE1   1 
ATOM 5655  C CE2   . TYR H 4 51  ? 95.132  100.855 91.842  1.00 178.31 ?  83  TYR H CE2   1 
ATOM 5656  C CZ    . TYR H 4 51  ? 96.270  100.169 91.497  1.00 178.31 ?  83  TYR H CZ    1 
ATOM 5657  O OH    . TYR H 4 51  ? 97.298  100.056 92.400  1.00 178.31 ?  83  TYR H OH    1 
ATOM 5658  N N     . ASN H 4 52  ? 91.240  100.729 86.273  1.00 178.29 ?  84  ASN H N     1 
ATOM 5659  C CA    . ASN H 4 52  ? 89.940  100.294 85.788  1.00 178.29 ?  84  ASN H CA    1 
ATOM 5660  C C     . ASN H 4 52  ? 89.841  100.204 84.277  1.00 178.29 ?  84  ASN H C     1 
ATOM 5661  O O     . ASN H 4 52  ? 88.720  100.288 83.762  1.00 178.29 ?  84  ASN H O     1 
ATOM 5662  C CB    . ASN H 4 52  ? 88.847  101.213 86.314  1.00 178.29 ?  84  ASN H CB    1 
ATOM 5663  C CG    . ASN H 4 52  ? 88.556  100.973 87.764  1.00 178.29 ?  84  ASN H CG    1 
ATOM 5664  O OD1   . ASN H 4 52  ? 88.528  99.832  88.217  1.00 178.29 ?  84  ASN H OD1   1 
ATOM 5665  N ND2   . ASN H 4 52  ? 88.324  102.040 88.504  1.00 178.29 ?  84  ASN H ND2   1 
ATOM 5666  N N     . LYS H 4 53  ? 90.971  100.068 83.578  1.00 189.62 ?  85  LYS H N     1 
ATOM 5667  C CA    . LYS H 4 53  ? 91.040  99.706  82.162  1.00 189.62 ?  85  LYS H CA    1 
ATOM 5668  C C     . LYS H 4 53  ? 90.351  100.772 81.306  1.00 189.62 ?  85  LYS H C     1 
ATOM 5669  O O     . LYS H 4 53  ? 89.459  100.507 80.501  1.00 189.62 ?  85  LYS H O     1 
ATOM 5670  C CB    . LYS H 4 53  ? 90.461  98.301  81.943  1.00 189.62 ?  85  LYS H CB    1 
ATOM 5671  C CG    . LYS H 4 53  ? 90.850  97.618  80.644  1.00 189.62 ?  85  LYS H CG    1 
ATOM 5672  C CD    . LYS H 4 53  ? 90.266  96.217  80.584  1.00 189.62 ?  85  LYS H CD    1 
ATOM 5673  C CE    . LYS H 4 53  ? 91.272  95.181  81.064  1.00 189.62 ?  85  LYS H CE    1 
ATOM 5674  N NZ    . LYS H 4 53  ? 91.407  95.175  82.548  1.00 189.62 ?  85  LYS H NZ    1 
ATOM 5675  N N     . ARG H 4 54  ? 90.756  102.011 81.547  1.00 200.93 ?  86  ARG H N     1 
ATOM 5676  C CA    . ARG H 4 54  ? 90.229  103.175 80.860  1.00 200.93 ?  86  ARG H CA    1 
ATOM 5677  C C     . ARG H 4 54  ? 91.398  103.940 80.267  1.00 200.93 ?  86  ARG H C     1 
ATOM 5678  O O     . ARG H 4 54  ? 92.539  103.473 80.273  1.00 200.93 ?  86  ARG H O     1 
ATOM 5679  C CB    . ARG H 4 54  ? 89.437  104.075 81.813  1.00 200.93 ?  86  ARG H CB    1 
ATOM 5680  C CG    . ARG H 4 54  ? 88.332  103.374 82.556  1.00 200.93 ?  86  ARG H CG    1 
ATOM 5681  C CD    . ARG H 4 54  ? 87.180  103.035 81.658  1.00 200.93 ?  86  ARG H CD    1 
ATOM 5682  N NE    . ARG H 4 54  ? 86.169  102.287 82.392  1.00 200.93 ?  86  ARG H NE    1 
ATOM 5683  C CZ    . ARG H 4 54  ? 85.245  102.849 83.161  1.00 200.93 ?  86  ARG H CZ    1 
ATOM 5684  N NH1   . ARG H 4 54  ? 85.223  104.166 83.313  1.00 200.93 ?  86  ARG H NH1   1 
ATOM 5685  N NH2   . ARG H 4 54  ? 84.356  102.093 83.791  1.00 200.93 ?  86  ARG H NH2   1 
ATOM 5686  N N     . SER H 4 55  ? 91.112  105.123 79.741  1.00 220.09 ?  87  SER H N     1 
ATOM 5687  C CA    . SER H 4 55  ? 92.177  105.976 79.247  1.00 220.09 ?  87  SER H CA    1 
ATOM 5688  C C     . SER H 4 55  ? 91.978  107.459 79.522  1.00 220.09 ?  87  SER H C     1 
ATOM 5689  O O     . SER H 4 55  ? 92.868  108.247 79.191  1.00 220.09 ?  87  SER H O     1 
ATOM 5690  C CB    . SER H 4 55  ? 92.355  105.759 77.742  1.00 220.09 ?  87  SER H CB    1 
ATOM 5691  O OG    . SER H 4 55  ? 91.180  106.128 77.047  1.00 220.09 ?  87  SER H OG    1 
ATOM 5692  N N     . THR H 4 56  ? 90.861  107.873 80.111  1.00 215.63 ?  88  THR H N     1 
ATOM 5693  C CA    . THR H 4 56  ? 90.533  109.290 80.243  1.00 215.63 ?  88  THR H CA    1 
ATOM 5694  C C     . THR H 4 56  ? 90.316  109.646 81.708  1.00 215.63 ?  88  THR H C     1 
ATOM 5695  O O     . THR H 4 56  ? 89.412  109.108 82.353  1.00 215.63 ?  88  THR H O     1 
ATOM 5696  C CB    . THR H 4 56  ? 89.290  109.643 79.425  1.00 215.63 ?  88  THR H CB    1 
ATOM 5697  O OG1   . THR H 4 56  ? 88.181  108.864 79.881  1.00 215.63 ?  88  THR H OG1   1 
ATOM 5698  C CG2   . THR H 4 56  ? 89.510  109.373 77.954  1.00 215.63 ?  88  THR H CG2   1 
ATOM 5699  N N     . ILE H 4 57  ? 91.136  110.554 82.230  1.00 188.47 ?  89  ILE H N     1 
ATOM 5700  C CA    . ILE H 4 57  ? 90.843  111.198 83.506  1.00 188.47 ?  89  ILE H CA    1 
ATOM 5701  C C     . ILE H 4 57  ? 89.628  112.086 83.281  1.00 188.47 ?  89  ILE H C     1 
ATOM 5702  O O     . ILE H 4 57  ? 89.713  113.104 82.593  1.00 188.47 ?  89  ILE H O     1 
ATOM 5703  C CB    . ILE H 4 57  ? 92.035  112.005 84.023  1.00 188.47 ?  89  ILE H CB    1 
ATOM 5704  C CG1   . ILE H 4 57  ? 93.163  111.070 84.421  1.00 188.47 ?  89  ILE H CG1   1 
ATOM 5705  C CG2   . ILE H 4 57  ? 91.648  112.823 85.218  1.00 188.47 ?  89  ILE H CG2   1 
ATOM 5706  C CD1   . ILE H 4 57  ? 94.439  111.773 84.721  1.00 188.47 ?  89  ILE H CD1   1 
ATOM 5707  N N     . THR H 4 58  ? 88.491  111.683 83.820  1.00 176.82 ?  90  THR H N     1 
ATOM 5708  C CA    . THR H 4 58  ? 87.252  112.412 83.617  1.00 176.82 ?  90  THR H CA    1 
ATOM 5709  C C     . THR H 4 58  ? 86.981  113.333 84.793  1.00 176.82 ?  90  THR H C     1 
ATOM 5710  O O     . THR H 4 58  ? 87.792  113.483 85.704  1.00 176.82 ?  90  THR H O     1 
ATOM 5711  C CB    . THR H 4 58  ? 86.081  111.454 83.449  1.00 176.82 ?  90  THR H CB    1 
ATOM 5712  O OG1   . THR H 4 58  ? 85.880  110.752 84.679  1.00 176.82 ?  90  THR H OG1   1 
ATOM 5713  C CG2   . THR H 4 58  ? 86.372  110.460 82.353  1.00 176.82 ?  90  THR H CG2   1 
ATOM 5714  N N     . SER H 4 59  ? 85.790  113.929 84.781  1.00 177.73 ?  91  SER H N     1 
ATOM 5715  C CA    . SER H 4 59  ? 85.369  114.735 85.918  1.00 177.73 ?  91  SER H CA    1 
ATOM 5716  C C     . SER H 4 59  ? 84.916  113.868 87.073  1.00 177.73 ?  91  SER H C     1 
ATOM 5717  O O     . SER H 4 59  ? 84.655  114.382 88.162  1.00 177.73 ?  91  SER H O     1 
ATOM 5718  C CB    . SER H 4 59  ? 84.225  115.656 85.534  1.00 177.73 ?  91  SER H CB    1 
ATOM 5719  O OG    . SER H 4 59  ? 83.047  114.903 85.331  1.00 177.73 ?  91  SER H OG    1 
ATOM 5720  N N     . ARG H 4 60  ? 84.772  112.567 86.852  1.00 180.08 ?  92  ARG H N     1 
ATOM 5721  C CA    . ARG H 4 60  ? 84.373  111.697 87.944  1.00 180.08 ?  92  ARG H CA    1 
ATOM 5722  C C     . ARG H 4 60  ? 85.585  111.180 88.702  1.00 180.08 ?  92  ARG H C     1 
ATOM 5723  O O     . ARG H 4 60  ? 85.546  111.052 89.929  1.00 180.08 ?  92  ARG H O     1 
ATOM 5724  C CB    . ARG H 4 60  ? 83.535  110.544 87.409  1.00 180.08 ?  92  ARG H CB    1 
ATOM 5725  C CG    . ARG H 4 60  ? 82.904  109.723 88.487  1.00 180.08 ?  92  ARG H CG    1 
ATOM 5726  C CD    . ARG H 4 60  ? 82.064  108.625 87.914  1.00 180.08 ?  92  ARG H CD    1 
ATOM 5727  N NE    . ARG H 4 60  ? 81.405  107.916 88.994  1.00 180.08 ?  92  ARG H NE    1 
ATOM 5728  C CZ    . ARG H 4 60  ? 81.965  106.924 89.670  1.00 180.08 ?  92  ARG H CZ    1 
ATOM 5729  N NH1   . ARG H 4 60  ? 83.194  106.531 89.367  1.00 180.08 ?  92  ARG H NH1   1 
ATOM 5730  N NH2   . ARG H 4 60  ? 81.300  106.331 90.650  1.00 180.08 ?  92  ARG H NH2   1 
ATOM 5731  N N     . GLU H 4 61  ? 86.688  110.908 88.003  1.00 189.49 ?  93  GLU H N     1 
ATOM 5732  C CA    . GLU H 4 61  ? 87.812  110.277 88.681  1.00 189.49 ?  93  GLU H CA    1 
ATOM 5733  C C     . GLU H 4 61  ? 88.702  111.275 89.401  1.00 189.49 ?  93  GLU H C     1 
ATOM 5734  O O     . GLU H 4 61  ? 89.765  110.893 89.895  1.00 189.49 ?  93  GLU H O     1 
ATOM 5735  C CB    . GLU H 4 61  ? 88.650  109.468 87.706  1.00 189.49 ?  93  GLU H CB    1 
ATOM 5736  C CG    . GLU H 4 61  ? 87.878  108.370 87.046  1.00 189.49 ?  93  GLU H CG    1 
ATOM 5737  C CD    . GLU H 4 61  ? 88.771  107.380 86.347  1.00 189.49 ?  93  GLU H CD    1 
ATOM 5738  O OE1   . GLU H 4 61  ? 89.996  107.601 86.335  1.00 189.49 ?  93  GLU H OE1   1 
ATOM 5739  O OE2   . GLU H 4 61  ? 88.251  106.376 85.819  1.00 189.49 -1 93  GLU H OE2   1 
ATOM 5740  N N     . ILE H 4 62  ? 88.317  112.544 89.453  1.00 173.23 ?  94  ILE H N     1 
ATOM 5741  C CA    . ILE H 4 62  ? 88.907  113.413 90.453  1.00 173.23 ?  94  ILE H CA    1 
ATOM 5742  C C     . ILE H 4 62  ? 88.096  113.317 91.734  1.00 173.23 ?  94  ILE H C     1 
ATOM 5743  O O     . ILE H 4 62  ? 88.641  113.463 92.832  1.00 173.23 ?  94  ILE H O     1 
ATOM 5744  C CB    . ILE H 4 62  ? 88.998  114.849 89.914  1.00 173.23 ?  94  ILE H CB    1 
ATOM 5745  C CG1   . ILE H 4 62  ? 89.801  114.853 88.625  1.00 173.23 ?  94  ILE H CG1   1 
ATOM 5746  C CG2   . ILE H 4 62  ? 89.707  115.775 90.877  1.00 173.23 ?  94  ILE H CG2   1 
ATOM 5747  C CD1   . ILE H 4 62  ? 91.213  114.363 88.798  1.00 173.23 ?  94  ILE H CD1   1 
ATOM 5748  N N     . GLN H 4 63  ? 86.803  112.996 91.620  1.00 168.99 ?  95  GLN H N     1 
ATOM 5749  C CA    . GLN H 4 63  ? 85.926  113.015 92.785  1.00 168.99 ?  95  GLN H CA    1 
ATOM 5750  C C     . GLN H 4 63  ? 86.239  111.870 93.739  1.00 168.99 ?  95  GLN H C     1 
ATOM 5751  O O     . GLN H 4 63  ? 86.245  112.062 94.958  1.00 168.99 ?  95  GLN H O     1 
ATOM 5752  C CB    . GLN H 4 63  ? 84.466  112.973 92.346  1.00 168.99 ?  95  GLN H CB    1 
ATOM 5753  C CG    . GLN H 4 63  ? 83.488  113.119 93.482  1.00 168.99 ?  95  GLN H CG    1 
ATOM 5754  C CD    . GLN H 4 63  ? 82.061  113.188 93.008  1.00 168.99 ?  95  GLN H CD    1 
ATOM 5755  O OE1   . GLN H 4 63  ? 81.793  113.115 91.814  1.00 168.99 ?  95  GLN H OE1   1 
ATOM 5756  N NE2   . GLN H 4 63  ? 81.133  113.324 93.940  1.00 168.99 ?  95  GLN H NE2   1 
ATOM 5757  N N     . THR H 4 64  ? 86.551  110.684 93.214  1.00 176.95 ?  96  THR H N     1 
ATOM 5758  C CA    . THR H 4 64  ? 87.019  109.631 94.108  1.00 176.95 ?  96  THR H CA    1 
ATOM 5759  C C     . THR H 4 64  ? 88.486  109.809 94.456  1.00 176.95 ?  96  THR H C     1 
ATOM 5760  O O     . THR H 4 64  ? 89.015  109.066 95.286  1.00 176.95 ?  96  THR H O     1 
ATOM 5761  C CB    . THR H 4 64  ? 86.801  108.247 93.507  1.00 176.95 ?  96  THR H CB    1 
ATOM 5762  O OG1   . THR H 4 64  ? 87.508  108.145 92.272  1.00 176.95 ?  96  THR H OG1   1 
ATOM 5763  C CG2   . THR H 4 64  ? 85.339  108.003 93.277  1.00 176.95 ?  96  THR H CG2   1 
ATOM 5764  N N     . ALA H 4 65  ? 89.165  110.767 93.830  1.00 172.93 ?  97  ALA H N     1 
ATOM 5765  C CA    . ALA H 4 65  ? 90.497  111.117 94.296  1.00 172.93 ?  97  ALA H CA    1 
ATOM 5766  C C     . ALA H 4 65  ? 90.432  112.184 95.377  1.00 172.93 ?  97  ALA H C     1 
ATOM 5767  O O     . ALA H 4 65  ? 91.367  112.315 96.171  1.00 172.93 ?  97  ALA H O     1 
ATOM 5768  C CB    . ALA H 4 65  ? 91.364  111.580 93.129  1.00 172.93 ?  97  ALA H CB    1 
ATOM 5769  N N     . VAL H 4 66  ? 89.338  112.944 95.433  1.00 175.22 ?  98  VAL H N     1 
ATOM 5770  C CA    . VAL H 4 66  ? 89.171  113.895 96.524  1.00 175.22 ?  98  VAL H CA    1 
ATOM 5771  C C     . VAL H 4 66  ? 88.783  113.167 97.800  1.00 175.22 ?  98  VAL H C     1 
ATOM 5772  O O     . VAL H 4 66  ? 89.302  113.460 98.883  1.00 175.22 ?  98  VAL H O     1 
ATOM 5773  C CB    . VAL H 4 66  ? 88.150  114.979 96.137  1.00 175.22 ?  98  VAL H CB    1 
ATOM 5774  C CG1   . VAL H 4 66  ? 87.758  115.819 97.331  1.00 175.22 ?  98  VAL H CG1   1 
ATOM 5775  C CG2   . VAL H 4 66  ? 88.759  115.883 95.101  1.00 175.22 ?  98  VAL H CG2   1 
ATOM 5776  N N     . ARG H 4 67  ? 87.923  112.155 97.684  1.00 178.93 ?  99  ARG H N     1 
ATOM 5777  C CA    . ARG H 4 67  ? 87.434  111.439 98.857  1.00 178.93 ?  99  ARG H CA    1 
ATOM 5778  C C     . ARG H 4 67  ? 88.481  110.522 99.480  1.00 178.93 ?  99  ARG H C     1 
ATOM 5779  O O     . ARG H 4 67  ? 88.223  109.955 100.543 1.00 178.93 ?  99  ARG H O     1 
ATOM 5780  C CB    . ARG H 4 67  ? 86.195  110.637 98.479  1.00 178.93 ?  99  ARG H CB    1 
ATOM 5781  C CG    . ARG H 4 67  ? 85.054  111.513 98.014  1.00 178.93 ?  99  ARG H CG    1 
ATOM 5782  C CD    . ARG H 4 67  ? 83.946  110.712 97.362  1.00 178.93 ?  99  ARG H CD    1 
ATOM 5783  N NE    . ARG H 4 67  ? 83.195  109.920 98.318  1.00 178.93 ?  99  ARG H NE    1 
ATOM 5784  C CZ    . ARG H 4 67  ? 82.104  110.357 98.929  1.00 178.93 ?  99  ARG H CZ    1 
ATOM 5785  N NH1   . ARG H 4 67  ? 81.643  111.572 98.670  1.00 178.93 ?  99  ARG H NH1   1 
ATOM 5786  N NH2   . ARG H 4 67  ? 81.468  109.579 99.792  1.00 178.93 ?  99  ARG H NH2   1 
ATOM 5787  N N     . LEU H 4 68  ? 89.648  110.359 98.855  1.00 172.79 ?  100 LEU H N     1 
ATOM 5788  C CA    . LEU H 4 68  ? 90.717  109.599 99.489  1.00 172.79 ?  100 LEU H CA    1 
ATOM 5789  C C     . LEU H 4 68  ? 91.815  110.505 100.024 1.00 172.79 ?  100 LEU H C     1 
ATOM 5790  O O     . LEU H 4 68  ? 92.280  110.325 101.151 1.00 172.79 ?  100 LEU H O     1 
ATOM 5791  C CB    . LEU H 4 68  ? 91.307  108.594 98.513  1.00 172.79 ?  100 LEU H CB    1 
ATOM 5792  C CG    . LEU H 4 68  ? 90.343  107.502 98.104  1.00 172.79 ?  100 LEU H CG    1 
ATOM 5793  C CD1   . LEU H 4 68  ? 91.034  106.570 97.143  1.00 172.79 ?  100 LEU H CD1   1 
ATOM 5794  C CD2   . LEU H 4 68  ? 89.873  106.773 99.326  1.00 172.79 ?  100 LEU H CD2   1 
ATOM 5795  N N     . LEU H 4 69  ? 92.234  111.498 99.246  1.00 170.85 ?  101 LEU H N     1 
ATOM 5796  C CA    . LEU H 4 69  ? 93.374  112.325 99.629  1.00 170.85 ?  101 LEU H CA    1 
ATOM 5797  C C     . LEU H 4 69  ? 93.042  113.400 100.649 1.00 170.85 ?  101 LEU H C     1 
ATOM 5798  O O     . LEU H 4 69  ? 93.834  114.331 100.806 1.00 170.85 ?  101 LEU H O     1 
ATOM 5799  C CB    . LEU H 4 69  ? 94.005  112.987 98.406  1.00 170.85 ?  101 LEU H CB    1 
ATOM 5800  C CG    . LEU H 4 69  ? 95.212  112.291 97.790  1.00 170.85 ?  101 LEU H CG    1 
ATOM 5801  C CD1   . LEU H 4 69  ? 96.317  112.280 98.809  1.00 170.85 ?  101 LEU H CD1   1 
ATOM 5802  C CD2   . LEU H 4 69  ? 94.904  110.884 97.337  1.00 170.85 ?  101 LEU H CD2   1 
ATOM 5803  N N     . LEU H 4 70  ? 91.908  113.313 101.330 1.00 180.35 ?  102 LEU H N     1 
ATOM 5804  C CA    . LEU H 4 70  ? 91.529  114.257 102.357 1.00 180.35 ?  102 LEU H CA    1 
ATOM 5805  C C     . LEU H 4 70  ? 90.937  113.506 103.543 1.00 180.35 ?  102 LEU H C     1 
ATOM 5806  O O     . LEU H 4 70  ? 90.395  112.411 103.379 1.00 180.35 ?  102 LEU H O     1 
ATOM 5807  C CB    . LEU H 4 70  ? 90.510  115.270 101.818 1.00 180.35 ?  102 LEU H CB    1 
ATOM 5808  C CG    . LEU H 4 70  ? 90.947  116.207 100.689 1.00 180.35 ?  102 LEU H CG    1 
ATOM 5809  C CD1   . LEU H 4 70  ? 89.783  117.044 100.248 1.00 180.35 ?  102 LEU H CD1   1 
ATOM 5810  C CD2   . LEU H 4 70  ? 92.088  117.092 101.112 1.00 180.35 ?  102 LEU H CD2   1 
ATOM 5811  N N     . PRO H 4 71  ? 91.035  114.052 104.747 1.00 185.85 ?  103 PRO H N     1 
ATOM 5812  C CA    . PRO H 4 71  ? 90.392  113.417 105.899 1.00 185.85 ?  103 PRO H CA    1 
ATOM 5813  C C     . PRO H 4 71  ? 88.893  113.670 105.918 1.00 185.85 ?  103 PRO H C     1 
ATOM 5814  O O     . PRO H 4 71  ? 88.305  114.212 104.981 1.00 185.85 ?  103 PRO H O     1 
ATOM 5815  C CB    . PRO H 4 71  ? 91.082  114.067 107.094 1.00 185.85 ?  103 PRO H CB    1 
ATOM 5816  C CG    . PRO H 4 71  ? 91.541  115.364 106.585 1.00 185.85 ?  103 PRO H CG    1 
ATOM 5817  C CD    . PRO H 4 71  ? 91.923  115.146 105.161 1.00 185.85 ?  103 PRO H CD    1 
ATOM 5818  N N     . GLY H 4 72  ? 88.283  113.274 107.033 1.00 194.06 ?  104 GLY H N     1 
ATOM 5819  C CA    . GLY H 4 72  ? 86.844  113.121 107.156 1.00 194.06 ?  104 GLY H CA    1 
ATOM 5820  C C     . GLY H 4 72  ? 85.947  114.320 106.928 1.00 194.06 ?  104 GLY H C     1 
ATOM 5821  O O     . GLY H 4 72  ? 85.222  114.358 105.932 1.00 194.06 ?  104 GLY H O     1 
ATOM 5822  N N     . GLU H 4 73  ? 85.977  115.302 107.829 1.00 208.93 ?  105 GLU H N     1 
ATOM 5823  C CA    . GLU H 4 73  ? 85.028  116.405 107.733 1.00 208.93 ?  105 GLU H CA    1 
ATOM 5824  C C     . GLU H 4 73  ? 85.381  117.347 106.590 1.00 208.93 ?  105 GLU H C     1 
ATOM 5825  O O     . GLU H 4 73  ? 84.492  117.982 106.012 1.00 208.93 ?  105 GLU H O     1 
ATOM 5826  C CB    . GLU H 4 73  ? 84.966  117.148 109.069 1.00 208.93 ?  105 GLU H CB    1 
ATOM 5827  C CG    . GLU H 4 73  ? 83.924  118.258 109.158 1.00 208.93 ?  105 GLU H CG    1 
ATOM 5828  C CD    . GLU H 4 73  ? 82.494  117.752 109.060 1.00 208.93 ?  105 GLU H CD    1 
ATOM 5829  O OE1   . GLU H 4 73  ? 82.230  116.597 109.453 1.00 208.93 ?  105 GLU H OE1   1 
ATOM 5830  O OE2   . GLU H 4 73  ? 81.628  118.514 108.582 1.00 208.93 -1 105 GLU H OE2   1 
ATOM 5831  N N     . LEU H 4 74  ? 86.654  117.401 106.202 1.00 196.84 ?  106 LEU H N     1 
ATOM 5832  C CA    . LEU H 4 74  ? 87.054  118.288 105.115 1.00 196.84 ?  106 LEU H CA    1 
ATOM 5833  C C     . LEU H 4 74  ? 86.686  117.693 103.760 1.00 196.84 ?  106 LEU H C     1 
ATOM 5834  O O     . LEU H 4 74  ? 86.713  118.386 102.738 1.00 196.84 ?  106 LEU H O     1 
ATOM 5835  C CB    . LEU H 4 74  ? 88.553  118.573 105.222 1.00 196.84 ?  106 LEU H CB    1 
ATOM 5836  C CG    . LEU H 4 74  ? 89.231  119.626 104.352 1.00 196.84 ?  106 LEU H CG    1 
ATOM 5837  C CD1   . LEU H 4 74  ? 88.574  120.958 104.575 1.00 196.84 ?  106 LEU H CD1   1 
ATOM 5838  C CD2   . LEU H 4 74  ? 90.694  119.706 104.705 1.00 196.84 ?  106 LEU H CD2   1 
ATOM 5839  N N     . ALA H 4 75  ? 86.305  116.418 103.735 1.00 192.93 ?  107 ALA H N     1 
ATOM 5840  C CA    . ALA H 4 75  ? 85.894  115.799 102.484 1.00 192.93 ?  107 ALA H CA    1 
ATOM 5841  C C     . ALA H 4 75  ? 84.538  116.301 102.015 1.00 192.93 ?  107 ALA H C     1 
ATOM 5842  O O     . ALA H 4 75  ? 84.426  116.796 100.890 1.00 192.93 ?  107 ALA H O     1 
ATOM 5843  C CB    . ALA H 4 75  ? 85.854  114.283 102.638 1.00 192.93 ?  107 ALA H CB    1 
ATOM 5844  N N     . LYS H 4 76  ? 83.512  116.193 102.866 1.00 186.53 ?  108 LYS H N     1 
ATOM 5845  C CA    . LYS H 4 76  ? 82.131  116.383 102.429 1.00 186.53 ?  108 LYS H CA    1 
ATOM 5846  C C     . LYS H 4 76  ? 81.838  117.836 102.082 1.00 186.53 ?  108 LYS H C     1 
ATOM 5847  O O     . LYS H 4 76  ? 80.926  118.122 101.299 1.00 186.53 ?  108 LYS H O     1 
ATOM 5848  C CB    . LYS H 4 76  ? 81.165  115.895 103.505 1.00 186.53 ?  108 LYS H CB    1 
ATOM 5849  C CG    . LYS H 4 76  ? 81.153  114.398 103.696 1.00 186.53 ?  108 LYS H CG    1 
ATOM 5850  C CD    . LYS H 4 76  ? 80.151  114.009 104.763 1.00 186.53 ?  108 LYS H CD    1 
ATOM 5851  C CE    . LYS H 4 76  ? 80.149  112.512 105.003 1.00 186.53 ?  108 LYS H CE    1 
ATOM 5852  N NZ    . LYS H 4 76  ? 79.171  112.129 106.059 1.00 186.53 ?  108 LYS H NZ    1 
ATOM 5853  N N     . HIS H 4 77  ? 82.588  118.771 102.659 1.00 183.99 ?  109 HIS H N     1 
ATOM 5854  C CA    . HIS H 4 77  ? 82.426  120.157 102.248 1.00 183.99 ?  109 HIS H CA    1 
ATOM 5855  C C     . HIS H 4 77  ? 83.207  120.475 100.987 1.00 183.99 ?  109 HIS H C     1 
ATOM 5856  O O     . HIS H 4 77  ? 82.804  121.369 100.238 1.00 183.99 ?  109 HIS H O     1 
ATOM 5857  C CB    . HIS H 4 77  ? 82.850  121.096 103.363 1.00 183.99 ?  109 HIS H CB    1 
ATOM 5858  C CG    . HIS H 4 77  ? 81.930  121.083 104.533 1.00 183.99 ?  109 HIS H CG    1 
ATOM 5859  N ND1   . HIS H 4 77  ? 82.226  121.721 105.716 1.00 183.99 ?  109 HIS H ND1   1 
ATOM 5860  C CD2   . HIS H 4 77  ? 80.717  120.510 104.706 1.00 183.99 ?  109 HIS H CD2   1 
ATOM 5861  C CE1   . HIS H 4 77  ? 81.235  121.541 106.570 1.00 183.99 ?  109 HIS H CE1   1 
ATOM 5862  N NE2   . HIS H 4 77  ? 80.307  120.809 105.982 1.00 183.99 ?  109 HIS H NE2   1 
ATOM 5863  N N     . ALA H 4 78  ? 84.309  119.771 100.733 1.00 173.39 ?  110 ALA H N     1 
ATOM 5864  C CA    . ALA H 4 78  ? 85.064  120.015 99.512  1.00 173.39 ?  110 ALA H CA    1 
ATOM 5865  C C     . ALA H 4 78  ? 84.320  119.488 98.298  1.00 173.39 ?  110 ALA H C     1 
ATOM 5866  O O     . ALA H 4 78  ? 84.258  120.153 97.259  1.00 173.39 ?  110 ALA H O     1 
ATOM 5867  C CB    . ALA H 4 78  ? 86.444  119.377 99.605  1.00 173.39 ?  110 ALA H CB    1 
ATOM 5868  N N     . VAL H 4 79  ? 83.743  118.294 98.412  1.00 176.34 ?  111 VAL H N     1 
ATOM 5869  C CA    . VAL H 4 79  ? 83.080  117.699 97.262  1.00 176.34 ?  111 VAL H CA    1 
ATOM 5870  C C     . VAL H 4 79  ? 81.762  118.409 96.970  1.00 176.34 ?  111 VAL H C     1 
ATOM 5871  O O     . VAL H 4 79  ? 81.368  118.540 95.807  1.00 176.34 ?  111 VAL H O     1 
ATOM 5872  C CB    . VAL H 4 79  ? 82.917  116.179 97.481  1.00 176.34 ?  111 VAL H CB    1 
ATOM 5873  C CG1   . VAL H 4 79  ? 82.017  115.865 98.663  1.00 176.34 ?  111 VAL H CG1   1 
ATOM 5874  C CG2   . VAL H 4 79  ? 82.420  115.489 96.232  1.00 176.34 ?  111 VAL H CG2   1 
ATOM 5875  N N     . SER H 4 80  ? 81.092  118.941 97.993  1.00 189.04 ?  112 SER H N     1 
ATOM 5876  C CA    . SER H 4 80  ? 79.837  119.637 97.740  1.00 189.04 ?  112 SER H CA    1 
ATOM 5877  C C     . SER H 4 80  ? 80.091  121.044 97.226  1.00 189.04 ?  112 SER H C     1 
ATOM 5878  O O     . SER H 4 80  ? 79.230  121.635 96.567  1.00 189.04 ?  112 SER H O     1 
ATOM 5879  C CB    . SER H 4 80  ? 78.979  119.673 99.001  1.00 189.04 ?  112 SER H CB    1 
ATOM 5880  O OG    . SER H 4 80  ? 77.770  120.373 98.762  1.00 189.04 ?  112 SER H OG    1 
ATOM 5881  N N     . GLU H 4 81  ? 81.266  121.599 97.521  1.00 189.77 ?  113 GLU H N     1 
ATOM 5882  C CA    . GLU H 4 81  ? 81.673  122.820 96.845  1.00 189.77 ?  113 GLU H CA    1 
ATOM 5883  C C     . GLU H 4 81  ? 82.410  122.473 95.562  1.00 189.77 ?  113 GLU H C     1 
ATOM 5884  O O     . GLU H 4 81  ? 82.709  123.350 94.747  1.00 189.77 ?  113 GLU H O     1 
ATOM 5885  C CB    . GLU H 4 81  ? 82.531  123.665 97.783  1.00 189.77 ?  113 GLU H CB    1 
ATOM 5886  C CG    . GLU H 4 81  ? 82.496  125.174 97.552  1.00 189.77 ?  113 GLU H CG    1 
ATOM 5887  C CD    . GLU H 4 81  ? 83.506  125.664 96.547  1.00 189.77 ?  113 GLU H CD    1 
ATOM 5888  O OE1   . GLU H 4 81  ? 84.527  124.978 96.351  1.00 189.77 ?  113 GLU H OE1   1 
ATOM 5889  O OE2   . GLU H 4 81  ? 83.283  126.743 95.963  1.00 189.77 -1 113 GLU H OE2   1 
ATOM 5890  N N     . GLY H 4 82  ? 82.675  121.186 95.350  1.00 174.30 ?  114 GLY H N     1 
ATOM 5891  C CA    . GLY H 4 82  ? 83.285  120.767 94.104  1.00 174.30 ?  114 GLY H CA    1 
ATOM 5892  C C     . GLY H 4 82  ? 82.291  120.712 92.962  1.00 174.30 ?  114 GLY H C     1 
ATOM 5893  O O     . GLY H 4 82  ? 82.468  121.378 91.941  1.00 174.30 ?  114 GLY H O     1 
ATOM 5894  N N     . THR H 4 83  ? 81.226  119.919 93.121  1.00 178.54 ?  115 THR H N     1 
ATOM 5895  C CA    . THR H 4 83  ? 80.294  119.700 92.018  1.00 178.54 ?  115 THR H CA    1 
ATOM 5896  C C     . THR H 4 83  ? 79.458  120.931 91.708  1.00 178.54 ?  115 THR H C     1 
ATOM 5897  O O     . THR H 4 83  ? 78.886  121.022 90.617  1.00 178.54 ?  115 THR H O     1 
ATOM 5898  C CB    . THR H 4 83  ? 79.365  118.528 92.315  1.00 178.54 ?  115 THR H CB    1 
ATOM 5899  O OG1   . THR H 4 83  ? 78.642  118.787 93.523  1.00 178.54 ?  115 THR H OG1   1 
ATOM 5900  C CG2   . THR H 4 83  ? 80.150  117.247 92.451  1.00 178.54 ?  115 THR H CG2   1 
ATOM 5901  N N     . LYS H 4 84  ? 79.365  121.879 92.641  1.00 179.02 ?  116 LYS H N     1 
ATOM 5902  C CA    . LYS H 4 84  ? 78.694  123.137 92.336  1.00 179.02 ?  116 LYS H CA    1 
ATOM 5903  C C     . LYS H 4 84  ? 79.479  123.931 91.301  1.00 179.02 ?  116 LYS H C     1 
ATOM 5904  O O     . LYS H 4 84  ? 78.887  124.664 90.504  1.00 179.02 ?  116 LYS H O     1 
ATOM 5905  C CB    . LYS H 4 84  ? 78.492  123.944 93.623  1.00 179.02 ?  116 LYS H CB    1 
ATOM 5906  C CG    . LYS H 4 84  ? 77.620  125.192 93.501  1.00 179.02 ?  116 LYS H CG    1 
ATOM 5907  C CD    . LYS H 4 84  ? 78.425  126.480 93.351  1.00 179.02 ?  116 LYS H CD    1 
ATOM 5908  C CE    . LYS H 4 84  ? 79.131  126.858 94.634  1.00 179.02 ?  116 LYS H CE    1 
ATOM 5909  N NZ    . LYS H 4 84  ? 79.902  128.120 94.473  1.00 179.02 ?  116 LYS H NZ    1 
ATOM 5910  N N     . ALA H 4 85  ? 80.801  123.773 91.275  1.00 180.10 ?  117 ALA H N     1 
ATOM 5911  C CA    . ALA H 4 85  ? 81.606  124.472 90.284  1.00 180.10 ?  117 ALA H CA    1 
ATOM 5912  C C     . ALA H 4 85  ? 81.619  123.750 88.943  1.00 180.10 ?  117 ALA H C     1 
ATOM 5913  O O     . ALA H 4 85  ? 82.279  124.207 88.006  1.00 180.10 ?  117 ALA H O     1 
ATOM 5914  C CB    . ALA H 4 85  ? 83.028  124.652 90.800  1.00 180.10 ?  117 ALA H CB    1 
ATOM 5915  N N     . VAL H 4 86  ? 80.933  122.614 88.835  1.00 177.09 ?  118 VAL H N     1 
ATOM 5916  C CA    . VAL H 4 86  ? 80.843  121.933 87.549  1.00 177.09 ?  118 VAL H CA    1 
ATOM 5917  C C     . VAL H 4 86  ? 79.490  122.192 86.905  1.00 177.09 ?  118 VAL H C     1 
ATOM 5918  O O     . VAL H 4 86  ? 79.397  122.397 85.687  1.00 177.09 ?  118 VAL H O     1 
ATOM 5919  C CB    . VAL H 4 86  ? 81.128  120.433 87.731  1.00 177.09 ?  118 VAL H CB    1 
ATOM 5920  C CG1   . VAL H 4 86  ? 80.860  119.652 86.462  1.00 177.09 ?  118 VAL H CG1   1 
ATOM 5921  C CG2   . VAL H 4 86  ? 82.565  120.249 88.127  1.00 177.09 ?  118 VAL H CG2   1 
ATOM 5922  N N     . THR H 4 87  ? 78.428  122.232 87.715  1.00 193.01 ?  119 THR H N     1 
ATOM 5923  C CA    . THR H 4 87  ? 77.076  122.373 87.181  1.00 193.01 ?  119 THR H CA    1 
ATOM 5924  C C     . THR H 4 87  ? 76.860  123.737 86.539  1.00 193.01 ?  119 THR H C     1 
ATOM 5925  O O     . THR H 4 87  ? 76.270  123.828 85.456  1.00 193.01 ?  119 THR H O     1 
ATOM 5926  C CB    . THR H 4 87  ? 76.044  122.141 88.281  1.00 193.01 ?  119 THR H CB    1 
ATOM 5927  O OG1   . THR H 4 87  ? 76.277  123.062 89.352  1.00 193.01 ?  119 THR H OG1   1 
ATOM 5928  C CG2   . THR H 4 87  ? 76.122  120.717 88.798  1.00 193.01 ?  119 THR H CG2   1 
ATOM 5929  N N     . LYS H 4 88  ? 77.344  124.804 87.169  1.00 195.81 ?  120 LYS H N     1 
ATOM 5930  C CA    . LYS H 4 88  ? 77.195  126.107 86.545  1.00 195.81 ?  120 LYS H CA    1 
ATOM 5931  C C     . LYS H 4 88  ? 78.153  126.300 85.378  1.00 195.81 ?  120 LYS H C     1 
ATOM 5932  O O     . LYS H 4 88  ? 77.888  127.138 84.512  1.00 195.81 ?  120 LYS H O     1 
ATOM 5933  C CB    . LYS H 4 88  ? 77.371  127.220 87.577  1.00 195.81 ?  120 LYS H CB    1 
ATOM 5934  C CG    . LYS H 4 88  ? 78.763  127.374 88.121  1.00 195.81 ?  120 LYS H CG    1 
ATOM 5935  C CD    . LYS H 4 88  ? 78.785  128.448 89.193  1.00 195.81 ?  120 LYS H CD    1 
ATOM 5936  C CE    . LYS H 4 88  ? 78.570  129.826 88.600  1.00 195.81 ?  120 LYS H CE    1 
ATOM 5937  N NZ    . LYS H 4 88  ? 79.713  130.223 87.736  1.00 195.81 ?  120 LYS H NZ    1 
ATOM 5938  N N     . TYR H 4 89  ? 79.242  125.533 85.318  1.00 190.42 ?  121 TYR H N     1 
ATOM 5939  C CA    . TYR H 4 89  ? 80.071  125.548 84.119  1.00 190.42 ?  121 TYR H CA    1 
ATOM 5940  C C     . TYR H 4 89  ? 79.405  124.803 82.976  1.00 190.42 ?  121 TYR H C     1 
ATOM 5941  O O     . TYR H 4 89  ? 79.652  125.112 81.806  1.00 190.42 ?  121 TYR H O     1 
ATOM 5942  C CB    . TYR H 4 89  ? 81.441  124.948 84.416  1.00 190.42 ?  121 TYR H CB    1 
ATOM 5943  C CG    . TYR H 4 89  ? 82.362  124.877 83.224  1.00 190.42 ?  121 TYR H CG    1 
ATOM 5944  C CD1   . TYR H 4 89  ? 82.942  126.018 82.706  1.00 190.42 ?  121 TYR H CD1   1 
ATOM 5945  C CD2   . TYR H 4 89  ? 82.654  123.665 82.625  1.00 190.42 ?  121 TYR H CD2   1 
ATOM 5946  C CE1   . TYR H 4 89  ? 83.786  125.954 81.620  1.00 190.42 ?  121 TYR H CE1   1 
ATOM 5947  C CE2   . TYR H 4 89  ? 83.496  123.591 81.544  1.00 190.42 ?  121 TYR H CE2   1 
ATOM 5948  C CZ    . TYR H 4 89  ? 84.058  124.738 81.047  1.00 190.42 ?  121 TYR H CZ    1 
ATOM 5949  O OH    . TYR H 4 89  ? 84.899  124.670 79.965  1.00 190.42 ?  121 TYR H OH    1 
ATOM 5950  N N     . THR H 4 90  ? 78.559  123.824 83.288  1.00 195.20 ?  122 THR H N     1 
ATOM 5951  C CA    . THR H 4 90  ? 77.873  123.091 82.232  1.00 195.20 ?  122 THR H CA    1 
ATOM 5952  C C     . THR H 4 90  ? 76.750  123.924 81.633  1.00 195.20 ?  122 THR H C     1 
ATOM 5953  O O     . THR H 4 90  ? 76.732  124.181 80.424  1.00 195.20 ?  122 THR H O     1 
ATOM 5954  C CB    . THR H 4 90  ? 77.332  121.770 82.769  1.00 195.20 ?  122 THR H CB    1 
ATOM 5955  O OG1   . THR H 4 90  ? 78.420  120.968 83.239  1.00 195.20 ?  122 THR H OG1   1 
ATOM 5956  C CG2   . THR H 4 90  ? 76.603  121.021 81.675  1.00 195.20 ?  122 THR H CG2   1 
ATOM 5957  N N     . SER H 4 91  ? 75.808  124.365 82.462  1.00 203.06 ?  123 SER H N     1 
ATOM 5958  C CA    . SER H 4 91  ? 74.678  125.156 81.981  1.00 203.06 ?  123 SER H CA    1 
ATOM 5959  C C     . SER H 4 91  ? 75.019  126.635 82.125  1.00 203.06 ?  123 SER H C     1 
ATOM 5960  O O     . SER H 4 91  ? 74.364  127.397 82.838  1.00 203.06 ?  123 SER H O     1 
ATOM 5961  C CB    . SER H 4 91  ? 73.410  124.796 82.738  1.00 203.06 ?  123 SER H CB    1 
ATOM 5962  O OG    . SER H 4 91  ? 73.517  125.173 84.097  1.00 203.06 ?  123 SER H OG    1 
ATOM 5963  N N     . SER H 4 92  ? 76.068  127.044 81.421  1.00 204.38 ?  124 SER H N     1 
ATOM 5964  C CA    . SER H 4 92  ? 76.487  128.437 81.421  1.00 204.38 ?  124 SER H CA    1 
ATOM 5965  C C     . SER H 4 92  ? 75.555  129.268 80.551  1.00 204.38 ?  124 SER H C     1 
ATOM 5966  O O     . SER H 4 92  ? 74.791  128.724 79.754  1.00 204.38 ?  124 SER H O     1 
ATOM 5967  C CB    . SER H 4 92  ? 77.930  128.570 80.928  1.00 204.38 ?  124 SER H CB    1 
ATOM 5968  O OG    . SER H 4 92  ? 78.046  128.200 79.566  1.00 204.38 ?  124 SER H OG    1 
ATOM 5969  O "O5'" . DA  I 5 1   ? 118.813 60.995  144.246 1.00 604.41 ?  -73 DA  I "O5'" 1 
ATOM 5970  C "C5'" . DA  I 5 1   ? 118.232 59.770  143.821 1.00 604.41 ?  -73 DA  I "C5'" 1 
ATOM 5971  C "C4'" . DA  I 5 1   ? 118.313 58.725  144.919 1.00 604.41 ?  -73 DA  I "C4'" 1 
ATOM 5972  O "O4'" . DA  I 5 1   ? 117.897 59.315  146.181 1.00 604.41 ?  -73 DA  I "O4'" 1 
ATOM 5973  C "C3'" . DA  I 5 1   ? 117.416 57.505  144.712 1.00 604.41 ?  -73 DA  I "C3'" 1 
ATOM 5974  O "O3'" . DA  I 5 1   ? 118.067 56.331  145.188 1.00 604.41 ?  -73 DA  I "O3'" 1 
ATOM 5975  C "C2'" . DA  I 5 1   ? 116.193 57.843  145.556 1.00 604.41 ?  -73 DA  I "C2'" 1 
ATOM 5976  C "C1'" . DA  I 5 1   ? 116.840 58.556  146.730 1.00 604.41 ?  -73 DA  I "C1'" 1 
ATOM 5977  N N9    . DA  I 5 1   ? 115.936 59.455  147.440 1.00 604.41 ?  -73 DA  I N9    1 
ATOM 5978  C C8    . DA  I 5 1   ? 115.649 60.754  147.126 1.00 604.41 ?  -73 DA  I C8    1 
ATOM 5979  N N7    . DA  I 5 1   ? 114.797 61.322  147.946 1.00 604.41 ?  -73 DA  I N7    1 
ATOM 5980  C C5    . DA  I 5 1   ? 114.503 60.326  148.861 1.00 604.41 ?  -73 DA  I C5    1 
ATOM 5981  C C6    . DA  I 5 1   ? 113.659 60.290  149.990 1.00 604.41 ?  -73 DA  I C6    1 
ATOM 5982  N N6    . DA  I 5 1   ? 112.929 61.334  150.395 1.00 604.41 ?  -73 DA  I N6    1 
ATOM 5983  N N1    . DA  I 5 1   ? 113.595 59.136  150.688 1.00 604.41 ?  -73 DA  I N1    1 
ATOM 5984  C C2    . DA  I 5 1   ? 114.326 58.091  150.281 1.00 604.41 ?  -73 DA  I C2    1 
ATOM 5985  N N3    . DA  I 5 1   ? 115.153 58.006  149.239 1.00 604.41 ?  -73 DA  I N3    1 
ATOM 5986  C C4    . DA  I 5 1   ? 115.196 59.168  148.565 1.00 604.41 ?  -73 DA  I C4    1 
ATOM 5987  P P     . DT  I 5 2   ? 117.522 54.879  144.768 1.00 600.88 ?  -72 DT  I P     1 
ATOM 5988  O OP1   . DT  I 5 2   ? 116.413 54.526  145.681 1.00 600.88 ?  -72 DT  I OP1   1 
ATOM 5989  O OP2   . DT  I 5 2   ? 118.690 53.978  144.659 1.00 600.88 -1 -72 DT  I OP2   1 
ATOM 5990  O "O5'" . DT  I 5 2   ? 116.941 55.101  143.294 1.00 600.88 ?  -72 DT  I "O5'" 1 
ATOM 5991  C "C5'" . DT  I 5 2   ? 116.402 54.005  142.565 1.00 600.88 ?  -72 DT  I "C5'" 1 
ATOM 5992  C "C4'" . DT  I 5 2   ? 114.889 53.974  142.677 1.00 600.88 ?  -72 DT  I "C4'" 1 
ATOM 5993  O "O4'" . DT  I 5 2   ? 114.398 55.316  142.930 1.00 600.88 ?  -72 DT  I "O4'" 1 
ATOM 5994  C "C3'" . DT  I 5 2   ? 114.162 53.491  141.426 1.00 600.88 ?  -72 DT  I "C3'" 1 
ATOM 5995  O "O3'" . DT  I 5 2   ? 112.987 52.774  141.785 1.00 600.88 ?  -72 DT  I "O3'" 1 
ATOM 5996  C "C2'" . DT  I 5 2   ? 113.824 54.792  140.710 1.00 600.88 ?  -72 DT  I "C2'" 1 
ATOM 5997  C "C1'" . DT  I 5 2   ? 113.540 55.721  141.884 1.00 600.88 ?  -72 DT  I "C1'" 1 
ATOM 5998  N N1    . DT  I 5 2   ? 113.805 57.160  141.589 1.00 600.88 ?  -72 DT  I N1    1 
ATOM 5999  C C2    . DT  I 5 2   ? 113.229 58.123  142.380 1.00 600.88 ?  -72 DT  I C2    1 
ATOM 6000  O O2    . DT  I 5 2   ? 112.503 57.866  143.321 1.00 600.88 ?  -72 DT  I O2    1 
ATOM 6001  N N3    . DT  I 5 2   ? 113.533 59.408  142.029 1.00 600.88 ?  -72 DT  I N3    1 
ATOM 6002  C C4    . DT  I 5 2   ? 114.341 59.820  140.987 1.00 600.88 ?  -72 DT  I C4    1 
ATOM 6003  O O4    . DT  I 5 2   ? 114.555 61.004  140.752 1.00 600.88 ?  -72 DT  I O4    1 
ATOM 6004  C C5    . DT  I 5 2   ? 114.916 58.760  140.196 1.00 600.88 ?  -72 DT  I C5    1 
ATOM 6005  C C7    . DT  I 5 2   ? 115.811 59.083  139.037 1.00 600.88 ?  -72 DT  I C7    1 
ATOM 6006  C C6    . DT  I 5 2   ? 114.625 57.496  140.532 1.00 600.88 ?  -72 DT  I C6    1 
ATOM 6007  P P     . DC  I 5 3   ? 112.180 51.939  140.673 1.00 584.38 ?  -71 DC  I P     1 
ATOM 6008  O OP1   . DC  I 5 3   ? 111.920 50.592  141.225 1.00 584.38 ?  -71 DC  I OP1   1 
ATOM 6009  O OP2   . DC  I 5 3   ? 112.899 52.082  139.389 1.00 584.38 -1 -71 DC  I OP2   1 
ATOM 6010  O "O5'" . DC  I 5 3   ? 110.793 52.721  140.537 1.00 584.38 ?  -71 DC  I "O5'" 1 
ATOM 6011  C "C5'" . DC  I 5 3   ? 109.892 52.764  141.635 1.00 584.38 ?  -71 DC  I "C5'" 1 
ATOM 6012  C "C4'" . DC  I 5 3   ? 108.763 53.745  141.376 1.00 584.38 ?  -71 DC  I "C4'" 1 
ATOM 6013  O "O4'" . DC  I 5 3   ? 109.301 55.087  141.258 1.00 584.38 ?  -71 DC  I "O4'" 1 
ATOM 6014  C "C3'" . DC  I 5 3   ? 107.959 53.490  140.097 1.00 584.38 ?  -71 DC  I "C3'" 1 
ATOM 6015  O "O3'" . DC  I 5 3   ? 106.564 53.614  140.367 1.00 584.38 ?  -71 DC  I "O3'" 1 
ATOM 6016  C "C2'" . DC  I 5 3   ? 108.450 54.582  139.147 1.00 584.38 ?  -71 DC  I "C2'" 1 
ATOM 6017  C "C1'" . DC  I 5 3   ? 108.767 55.709  140.114 1.00 584.38 ?  -71 DC  I "C1'" 1 
ATOM 6018  N N1    . DC  I 5 3   ? 109.770 56.673  139.590 1.00 584.38 ?  -71 DC  I N1    1 
ATOM 6019  C C2    . DC  I 5 3   ? 109.552 58.049  139.726 1.00 584.38 ?  -71 DC  I C2    1 
ATOM 6020  O O2    . DC  I 5 3   ? 108.524 58.446  140.287 1.00 584.38 ?  -71 DC  I O2    1 
ATOM 6021  N N3    . DC  I 5 3   ? 110.481 58.910  139.241 1.00 584.38 ?  -71 DC  I N3    1 
ATOM 6022  C C4    . DC  I 5 3   ? 111.579 58.441  138.647 1.00 584.38 ?  -71 DC  I C4    1 
ATOM 6023  N N4    . DC  I 5 3   ? 112.466 59.325  138.182 1.00 584.38 ?  -71 DC  I N4    1 
ATOM 6024  C C5    . DC  I 5 3   ? 111.813 57.043  138.496 1.00 584.38 ?  -71 DC  I C5    1 
ATOM 6025  C C6    . DC  I 5 3   ? 110.893 56.205  138.978 1.00 584.38 ?  -71 DC  I C6    1 
ATOM 6026  P P     . DA  I 5 4   ? 105.478 53.254  139.237 1.00 567.47 ?  -70 DA  I P     1 
ATOM 6027  O OP1   . DA  I 5 4   ? 104.236 52.848  139.928 1.00 567.47 ?  -70 DA  I OP1   1 
ATOM 6028  O OP2   . DA  I 5 4   ? 106.112 52.329  138.273 1.00 567.47 -1 -70 DA  I OP2   1 
ATOM 6029  O "O5'" . DA  I 5 4   ? 105.220 54.649  138.497 1.00 567.47 ?  -70 DA  I "O5'" 1 
ATOM 6030  C "C5'" . DA  I 5 4   ? 104.866 55.794  139.259 1.00 567.47 ?  -70 DA  I "C5'" 1 
ATOM 6031  C "C4'" . DA  I 5 4   ? 105.069 57.072  138.462 1.00 567.47 ?  -70 DA  I "C4'" 1 
ATOM 6032  O "O4'" . DA  I 5 4   ? 106.463 57.433  138.448 1.00 567.47 ?  -70 DA  I "O4'" 1 
ATOM 6033  C "C3'" . DA  I 5 4   ? 104.713 56.988  136.995 1.00 567.47 ?  -70 DA  I "C3'" 1 
ATOM 6034  O "O3'" . DA  I 5 4   ? 103.310 57.120  136.821 1.00 567.47 ?  -70 DA  I "O3'" 1 
ATOM 6035  C "C2'" . DA  I 5 4   ? 105.468 58.192  136.426 1.00 567.47 ?  -70 DA  I "C2'" 1 
ATOM 6036  C "C1'" . DA  I 5 4   ? 106.686 58.308  137.357 1.00 567.47 ?  -70 DA  I "C1'" 1 
ATOM 6037  N N9    . DA  I 5 4   ? 107.945 57.960  136.703 1.00 567.47 ?  -70 DA  I N9    1 
ATOM 6038  C C8    . DA  I 5 4   ? 108.336 56.724  136.269 1.00 567.47 ?  -70 DA  I C8    1 
ATOM 6039  N N7    . DA  I 5 4   ? 109.519 56.713  135.699 1.00 567.47 ?  -70 DA  I N7    1 
ATOM 6040  C C5    . DA  I 5 4   ? 109.928 58.035  135.756 1.00 567.47 ?  -70 DA  I C5    1 
ATOM 6041  C C6    . DA  I 5 4   ? 111.099 58.692  135.319 1.00 567.47 ?  -70 DA  I C6    1 
ATOM 6042  N N6    . DA  I 5 4   ? 112.113 58.067  134.713 1.00 567.47 ?  -70 DA  I N6    1 
ATOM 6043  N N1    . DA  I 5 4   ? 111.190 60.021  135.535 1.00 567.47 ?  -70 DA  I N1    1 
ATOM 6044  C C2    . DA  I 5 4   ? 110.178 60.648  136.144 1.00 567.47 ?  -70 DA  I C2    1 
ATOM 6045  N N3    . DA  I 5 4   ? 109.032 60.141  136.596 1.00 567.47 ?  -70 DA  I N3    1 
ATOM 6046  C C4    . DA  I 5 4   ? 108.969 58.818  136.369 1.00 567.47 ?  -70 DA  I C4    1 
ATOM 6047  P P     . DA  I 5 5   ? 102.587 56.446  135.553 1.00 551.18 ?  -69 DA  I P     1 
ATOM 6048  O OP1   . DA  I 5 5   ? 101.299 55.882  136.011 1.00 551.18 ?  -69 DA  I OP1   1 
ATOM 6049  O OP2   . DA  I 5 5   ? 103.574 55.570  134.886 1.00 551.18 -1 -69 DA  I OP2   1 
ATOM 6050  O "O5'" . DA  I 5 5   ? 102.294 57.679  134.579 1.00 551.18 ?  -69 DA  I "O5'" 1 
ATOM 6051  C "C5'" . DA  I 5 5   ? 101.383 58.698  134.978 1.00 551.18 ?  -69 DA  I "C5'" 1 
ATOM 6052  C "C4'" . DA  I 5 5   ? 101.943 60.081  134.682 1.00 551.18 ?  -69 DA  I "C4'" 1 
ATOM 6053  O "O4'" . DA  I 5 5   ? 103.392 60.038  134.716 1.00 551.18 ?  -69 DA  I "O4'" 1 
ATOM 6054  C "C3'" . DA  I 5 5   ? 101.582 60.653  133.318 1.00 551.18 ?  -69 DA  I "C3'" 1 
ATOM 6055  O "O3'" . DA  I 5 5   ? 101.501 62.066  133.402 1.00 551.18 ?  -69 DA  I "O3'" 1 
ATOM 6056  C "C2'" . DA  I 5 5   ? 102.760 60.216  132.457 1.00 551.18 ?  -69 DA  I "C2'" 1 
ATOM 6057  C "C1'" . DA  I 5 5   ? 103.916 60.350  133.440 1.00 551.18 ?  -69 DA  I "C1'" 1 
ATOM 6058  N N9    . DA  I 5 5   ? 105.022 59.441  133.167 1.00 551.18 ?  -69 DA  I N9    1 
ATOM 6059  C C8    . DA  I 5 5   ? 104.942 58.106  132.883 1.00 551.18 ?  -69 DA  I C8    1 
ATOM 6060  N N7    . DA  I 5 5   ? 106.107 57.537  132.681 1.00 551.18 ?  -69 DA  I N7    1 
ATOM 6061  C C5    . DA  I 5 5   ? 107.013 58.571  132.847 1.00 551.18 ?  -69 DA  I C5    1 
ATOM 6062  C C6    . DA  I 5 5   ? 108.420 58.627  132.766 1.00 551.18 ?  -69 DA  I C6    1 
ATOM 6063  N N6    . DA  I 5 5   ? 109.184 57.567  132.485 1.00 551.18 ?  -69 DA  I N6    1 
ATOM 6064  N N1    . DA  I 5 5   ? 109.014 59.822  132.989 1.00 551.18 ?  -69 DA  I N1    1 
ATOM 6065  C C2    . DA  I 5 5   ? 108.246 60.884  133.269 1.00 551.18 ?  -69 DA  I C2    1 
ATOM 6066  N N3    . DA  I 5 5   ? 106.920 60.952  133.372 1.00 551.18 ?  -69 DA  I N3    1 
ATOM 6067  C C4    . DA  I 5 5   ? 106.359 59.751  133.148 1.00 551.18 ?  -69 DA  I C4    1 
ATOM 6068  P P     . DA  I 5 6   ? 100.322 62.854  132.650 1.00 529.84 ?  -68 DA  I P     1 
ATOM 6069  O OP1   . DA  I 5 6   ? 99.474  63.484  133.686 1.00 529.84 ?  -68 DA  I OP1   1 
ATOM 6070  O OP2   . DA  I 5 6   ? 99.722  61.919  131.672 1.00 529.84 -1 -68 DA  I OP2   1 
ATOM 6071  O "O5'" . DA  I 5 6   ? 101.086 64.004  131.840 1.00 529.84 ?  -68 DA  I "O5'" 1 
ATOM 6072  C "C5'" . DA  I 5 6   ? 102.172 63.667  130.984 1.00 529.84 ?  -68 DA  I "C5'" 1 
ATOM 6073  C "C4'" . DA  I 5 6   ? 103.361 64.578  131.235 1.00 529.84 ?  -68 DA  I "C4'" 1 
ATOM 6074  O "O4'" . DA  I 5 6   ? 104.533 63.772  131.532 1.00 529.84 ?  -68 DA  I "O4'" 1 
ATOM 6075  C "C3'" . DA  I 5 6   ? 103.756 65.456  130.055 1.00 529.84 ?  -68 DA  I "C3'" 1 
ATOM 6076  O "O3'" . DA  I 5 6   ? 104.302 66.677  130.522 1.00 529.84 ?  -68 DA  I "O3'" 1 
ATOM 6077  C "C2'" . DA  I 5 6   ? 104.810 64.609  129.355 1.00 529.84 ?  -68 DA  I "C2'" 1 
ATOM 6078  C "C1'" . DA  I 5 6   ? 105.522 63.982  130.545 1.00 529.84 ?  -68 DA  I "C1'" 1 
ATOM 6079  N N9    . DA  I 5 6   ? 106.148 62.701  130.237 1.00 529.84 ?  -68 DA  I N9    1 
ATOM 6080  C C8    . DA  I 5 6   ? 105.523 61.548  129.854 1.00 529.84 ?  -68 DA  I C8    1 
ATOM 6081  N N7    . DA  I 5 6   ? 106.343 60.546  129.641 1.00 529.84 ?  -68 DA  I N7    1 
ATOM 6082  C C5    . DA  I 5 6   ? 107.593 61.082  129.904 1.00 529.84 ?  -68 DA  I C5    1 
ATOM 6083  C C6    . DA  I 5 6   ? 108.890 60.534  129.861 1.00 529.84 ?  -68 DA  I C6    1 
ATOM 6084  N N6    . DA  I 5 6   ? 109.142 59.266  129.527 1.00 529.84 ?  -68 DA  I N6    1 
ATOM 6085  N N1    . DA  I 5 6   ? 109.923 61.343  130.185 1.00 529.84 ?  -68 DA  I N1    1 
ATOM 6086  C C2    . DA  I 5 6   ? 109.669 62.613  130.524 1.00 529.84 ?  -68 DA  I C2    1 
ATOM 6087  N N3    . DA  I 5 6   ? 108.496 63.238  130.599 1.00 529.84 ?  -68 DA  I N3    1 
ATOM 6088  C C4    . DA  I 5 6   ? 107.490 62.409  130.273 1.00 529.84 ?  -68 DA  I C4    1 
ATOM 6089  P P     . DT  I 5 7   ? 104.369 67.950  129.545 1.00 494.68 ?  -67 DT  I P     1 
ATOM 6090  O OP1   . DT  I 5 7   ? 104.386 69.166  130.388 1.00 494.68 ?  -67 DT  I OP1   1 
ATOM 6091  O OP2   . DT  I 5 7   ? 103.319 67.774  128.518 1.00 494.68 -1 -67 DT  I OP2   1 
ATOM 6092  O "O5'" . DT  I 5 7   ? 105.785 67.808  128.817 1.00 494.68 ?  -67 DT  I "O5'" 1 
ATOM 6093  C "C5'" . DT  I 5 7   ? 106.970 68.237  129.475 1.00 494.68 ?  -67 DT  I "C5'" 1 
ATOM 6094  C "C4'" . DT  I 5 7   ? 108.188 68.040  128.587 1.00 494.68 ?  -67 DT  I "C4'" 1 
ATOM 6095  O "O4'" . DT  I 5 7   ? 108.545 66.631  128.545 1.00 494.68 ?  -67 DT  I "O4'" 1 
ATOM 6096  C "C3'" . DT  I 5 7   ? 108.009 68.476  127.128 1.00 494.68 ?  -67 DT  I "C3'" 1 
ATOM 6097  O "O3'" . DT  I 5 7   ? 109.151 69.209  126.699 1.00 494.68 ?  -67 DT  I "O3'" 1 
ATOM 6098  C "C2'" . DT  I 5 7   ? 107.889 67.148  126.382 1.00 494.68 ?  -67 DT  I "C2'" 1 
ATOM 6099  C "C1'" . DT  I 5 7   ? 108.808 66.272  127.211 1.00 494.68 ?  -67 DT  I "C1'" 1 
ATOM 6100  N N1    . DT  I 5 7   ? 108.565 64.811  127.043 1.00 494.68 ?  -67 DT  I N1    1 
ATOM 6101  C C2    . DT  I 5 7   ? 109.610 63.936  127.220 1.00 494.68 ?  -67 DT  I C2    1 
ATOM 6102  O O2    . DT  I 5 7   ? 110.735 64.293  127.519 1.00 494.68 ?  -67 DT  I O2    1 
ATOM 6103  N N3    . DT  I 5 7   ? 109.288 62.616  127.039 1.00 494.68 ?  -67 DT  I N3    1 
ATOM 6104  C C4    . DT  I 5 7   ? 108.051 62.097  126.701 1.00 494.68 ?  -67 DT  I C4    1 
ATOM 6105  O O4    . DT  I 5 7   ? 107.860 60.893  126.559 1.00 494.68 ?  -67 DT  I O4    1 
ATOM 6106  C C5    . DT  I 5 7   ? 107.000 63.071  126.525 1.00 494.68 ?  -67 DT  I C5    1 
ATOM 6107  C C7    . DT  I 5 7   ? 105.618 62.629  126.157 1.00 494.68 ?  -67 DT  I C7    1 
ATOM 6108  C C6    . DT  I 5 7   ? 107.304 64.365  126.700 1.00 494.68 ?  -67 DT  I C6    1 
ATOM 6109  P P     . DA  I 5 8   ? 109.237 69.776  125.197 1.00 457.84 ?  -66 DA  I P     1 
ATOM 6110  O OP1   . DA  I 5 8   ? 110.072 70.995  125.239 1.00 457.84 ?  -66 DA  I OP1   1 
ATOM 6111  O OP2   . DA  I 5 8   ? 107.864 69.835  124.656 1.00 457.84 -1 -66 DA  I OP2   1 
ATOM 6112  O "O5'" . DA  I 5 8   ? 110.025 68.640  124.392 1.00 457.84 ?  -66 DA  I "O5'" 1 
ATOM 6113  C "C5'" . DA  I 5 8   ? 111.196 68.064  124.952 1.00 457.84 ?  -66 DA  I "C5'" 1 
ATOM 6114  C "C4'" . DA  I 5 8   ? 111.774 66.994  124.040 1.00 457.84 ?  -66 DA  I "C4'" 1 
ATOM 6115  O "O4'" . DA  I 5 8   ? 111.167 65.708  124.316 1.00 457.84 ?  -66 DA  I "O4'" 1 
ATOM 6116  C "C3'" . DA  I 5 8   ? 111.588 67.237  122.535 1.00 457.84 ?  -66 DA  I "C3'" 1 
ATOM 6117  O "O3'" . DA  I 5 8   ? 112.862 67.319  121.905 1.00 457.84 ?  -66 DA  I "O3'" 1 
ATOM 6118  C "C2'" . DA  I 5 8   ? 110.796 66.011  122.058 1.00 457.84 ?  -66 DA  I "C2'" 1 
ATOM 6119  C "C1'" . DA  I 5 8   ? 111.153 64.985  123.117 1.00 457.84 ?  -66 DA  I "C1'" 1 
ATOM 6120  N N9    . DA  I 5 8   ? 110.195 63.890  123.221 1.00 457.84 ?  -66 DA  I N9    1 
ATOM 6121  C C8    . DA  I 5 8   ? 108.871 63.976  123.554 1.00 457.84 ?  -66 DA  I C8    1 
ATOM 6122  N N7    . DA  I 5 8   ? 108.252 62.819  123.560 1.00 457.84 ?  -66 DA  I N7    1 
ATOM 6123  C C5    . DA  I 5 8   ? 109.240 61.912  123.210 1.00 457.84 ?  -66 DA  I C5    1 
ATOM 6124  C C6    . DA  I 5 8   ? 109.230 60.514  123.038 1.00 457.84 ?  -66 DA  I C6    1 
ATOM 6125  N N6    . DA  I 5 8   ? 108.143 59.763  123.212 1.00 457.84 ?  -66 DA  I N6    1 
ATOM 6126  N N1    . DA  I 5 8   ? 110.388 59.915  122.681 1.00 457.84 ?  -66 DA  I N1    1 
ATOM 6127  C C2    . DA  I 5 8   ? 111.478 60.670  122.505 1.00 457.84 ?  -66 DA  I C2    1 
ATOM 6128  N N3    . DA  I 5 8   ? 111.610 61.990  122.638 1.00 457.84 ?  -66 DA  I N3    1 
ATOM 6129  C C4    . DA  I 5 8   ? 110.442 62.556  122.993 1.00 457.84 ?  -66 DA  I C4    1 
ATOM 6130  P P     . DT  I 5 9   ? 112.987 67.402  120.305 1.00 432.83 ?  -65 DT  I P     1 
ATOM 6131  O OP1   . DT  I 5 9   ? 114.205 68.188  120.005 1.00 432.83 ?  -65 DT  I OP1   1 
ATOM 6132  O OP2   . DT  I 5 9   ? 111.682 67.830  119.756 1.00 432.83 -1 -65 DT  I OP2   1 
ATOM 6133  O "O5'" . DT  I 5 9   ? 113.242 65.887  119.863 1.00 432.83 ?  -65 DT  I "O5'" 1 
ATOM 6134  C "C5'" . DT  I 5 9   ? 114.148 65.083  120.604 1.00 432.83 ?  -65 DT  I "C5'" 1 
ATOM 6135  C "C4'" . DT  I 5 9   ? 114.403 63.763  119.901 1.00 432.83 ?  -65 DT  I "C4'" 1 
ATOM 6136  O "O4'" . DT  I 5 9   ? 113.363 62.812  120.242 1.00 432.83 ?  -65 DT  I "O4'" 1 
ATOM 6137  C "C3'" . DT  I 5 9   ? 114.431 63.840  118.372 1.00 432.83 ?  -65 DT  I "C3'" 1 
ATOM 6138  O "O3'" . DT  I 5 9   ? 115.601 63.203  117.881 1.00 432.83 ?  -65 DT  I "O3'" 1 
ATOM 6139  C "C2'" . DT  I 5 9   ? 113.162 63.096  117.948 1.00 432.83 ?  -65 DT  I "C2'" 1 
ATOM 6140  C "C1'" . DT  I 5 9   ? 112.996 62.105  119.085 1.00 432.83 ?  -65 DT  I "C1'" 1 
ATOM 6141  N N1    . DT  I 5 9   ? 111.605 61.616  119.256 1.00 432.83 ?  -65 DT  I N1    1 
ATOM 6142  C C2    . DT  I 5 9   ? 111.345 60.275  119.120 1.00 432.83 ?  -65 DT  I C2    1 
ATOM 6143  O O2    . DT  I 5 9   ? 112.204 59.454  118.865 1.00 432.83 ?  -65 DT  I O2    1 
ATOM 6144  N N3    . DT  I 5 9   ? 110.037 59.924  119.304 1.00 432.83 ?  -65 DT  I N3    1 
ATOM 6145  C C4    . DT  I 5 9   ? 108.982 60.765  119.600 1.00 432.83 ?  -65 DT  I C4    1 
ATOM 6146  O O4    . DT  I 5 9   ? 107.835 60.353  119.743 1.00 432.83 ?  -65 DT  I O4    1 
ATOM 6147  C C5    . DT  I 5 9   ? 109.324 62.161  119.726 1.00 432.83 ?  -65 DT  I C5    1 
ATOM 6148  C C7    . DT  I 5 9   ? 108.264 63.172  120.044 1.00 432.83 ?  -65 DT  I C7    1 
ATOM 6149  C C6    . DT  I 5 9   ? 110.604 62.514  119.549 1.00 432.83 ?  -65 DT  I C6    1 
ATOM 6150  P P     . DC  I 5 10  ? 115.906 63.175  116.304 1.00 410.80 ?  -64 DC  I P     1 
ATOM 6151  O OP1   . DC  I 5 10  ? 117.370 63.309  116.130 1.00 410.80 ?  -64 DC  I OP1   1 
ATOM 6152  O OP2   . DC  I 5 10  ? 114.995 64.142  115.652 1.00 410.80 -1 -64 DC  I OP2   1 
ATOM 6153  O "O5'" . DC  I 5 10  ? 115.466 61.704  115.858 1.00 410.80 ?  -64 DC  I "O5'" 1 
ATOM 6154  C "C5'" . DC  I 5 10  ? 116.083 60.566  116.451 1.00 410.80 ?  -64 DC  I "C5'" 1 
ATOM 6155  C "C4'" . DC  I 5 10  ? 115.354 59.289  116.069 1.00 410.80 ?  -64 DC  I "C4'" 1 
ATOM 6156  O "O4'" . DC  I 5 10  ? 113.993 59.328  116.580 1.00 410.80 ?  -64 DC  I "O4'" 1 
ATOM 6157  C "C3'" . DC  I 5 10  ? 115.230 59.033  114.563 1.00 410.80 ?  -64 DC  I "C3'" 1 
ATOM 6158  O "O3'" . DC  I 5 10  ? 115.495 57.664  114.282 1.00 410.80 ?  -64 DC  I "O3'" 1 
ATOM 6159  C "C2'" . DC  I 5 10  ? 113.773 59.381  114.280 1.00 410.80 ?  -64 DC  I "C2'" 1 
ATOM 6160  C "C1'" . DC  I 5 10  ? 113.119 58.912  115.561 1.00 410.80 ?  -64 DC  I "C1'" 1 
ATOM 6161  N N1    . DC  I 5 10  ? 111.781 59.506  115.796 1.00 410.80 ?  -64 DC  I N1    1 
ATOM 6162  C C2    . DC  I 5 10  ? 110.717 58.682  116.168 1.00 410.80 ?  -64 DC  I C2    1 
ATOM 6163  O O2    . DC  I 5 10  ? 110.915 57.470  116.305 1.00 410.80 ?  -64 DC  I O2    1 
ATOM 6164  N N3    . DC  I 5 10  ? 109.499 59.237  116.374 1.00 410.80 ?  -64 DC  I N3    1 
ATOM 6165  C C4    . DC  I 5 10  ? 109.329 60.550  116.215 1.00 410.80 ?  -64 DC  I C4    1 
ATOM 6166  N N4    . DC  I 5 10  ? 108.110 61.054  116.430 1.00 410.80 ?  -64 DC  I N4    1 
ATOM 6167  C C5    . DC  I 5 10  ? 110.401 61.405  115.833 1.00 410.80 ?  -64 DC  I C5    1 
ATOM 6168  C C6    . DC  I 5 10  ? 111.597 60.845  115.631 1.00 410.80 ?  -64 DC  I C6    1 
ATOM 6169  P P     . DC  I 5 11  ? 115.631 57.156  112.762 1.00 391.14 ?  -63 DC  I P     1 
ATOM 6170  O OP1   . DC  I 5 11  ? 116.909 57.682  112.237 1.00 391.14 ?  -63 DC  I OP1   1 
ATOM 6171  O OP2   . DC  I 5 11  ? 114.365 57.429  112.048 1.00 391.14 -1 -63 DC  I OP2   1 
ATOM 6172  O "O5'" . DC  I 5 11  ? 115.743 55.567  112.896 1.00 391.14 ?  -63 DC  I "O5'" 1 
ATOM 6173  C "C5'" . DC  I 5 11  ? 114.975 54.877  113.879 1.00 391.14 ?  -63 DC  I "C5'" 1 
ATOM 6174  C "C4'" . DC  I 5 11  ? 113.589 54.518  113.360 1.00 391.14 ?  -63 DC  I "C4'" 1 
ATOM 6175  O "O4'" . DC  I 5 11  ? 112.654 55.560  113.685 1.00 391.14 ?  -63 DC  I "O4'" 1 
ATOM 6176  C "C3'" . DC  I 5 11  ? 113.478 54.325  111.845 1.00 391.14 ?  -63 DC  I "C3'" 1 
ATOM 6177  O "O3'" . DC  I 5 11  ? 113.335 52.948  111.545 1.00 391.14 ?  -63 DC  I "O3'" 1 
ATOM 6178  C "C2'" . DC  I 5 11  ? 112.225 55.128  111.441 1.00 391.14 ?  -63 DC  I "C2'" 1 
ATOM 6179  C "C1'" . DC  I 5 11  ? 111.590 55.473  112.783 1.00 391.14 ?  -63 DC  I "C1'" 1 
ATOM 6180  N N1    . DC  I 5 11  ? 110.866 56.767  112.792 1.00 391.14 ?  -63 DC  I N1    1 
ATOM 6181  C C2    . DC  I 5 11  ? 109.652 56.873  113.474 1.00 391.14 ?  -63 DC  I C2    1 
ATOM 6182  O O2    . DC  I 5 11  ? 109.201 55.881  114.055 1.00 391.14 ?  -63 DC  I O2    1 
ATOM 6183  N N3    . DC  I 5 11  ? 109.003 58.060  113.479 1.00 391.14 ?  -63 DC  I N3    1 
ATOM 6184  C C4    . DC  I 5 11  ? 109.525 59.106  112.842 1.00 391.14 ?  -63 DC  I C4    1 
ATOM 6185  N N4    . DC  I 5 11  ? 108.848 60.259  112.874 1.00 391.14 ?  -63 DC  I N4    1 
ATOM 6186  C C5    . DC  I 5 11  ? 110.764 59.017  112.141 1.00 391.14 ?  -63 DC  I C5    1 
ATOM 6187  C C6    . DC  I 5 11  ? 111.391 57.838  112.140 1.00 391.14 ?  -63 DC  I C6    1 
ATOM 6188  P P     . DA  I 5 12  ? 113.450 52.439  110.027 1.00 371.45 ?  -62 DA  I P     1 
ATOM 6189  O OP1   . DA  I 5 12  ? 114.016 51.072  110.053 1.00 371.45 ?  -62 DA  I OP1   1 
ATOM 6190  O OP2   . DA  I 5 12  ? 114.123 53.502  109.250 1.00 371.45 -1 -62 DA  I OP2   1 
ATOM 6191  O "O5'" . DA  I 5 12  ? 111.932 52.356  109.541 1.00 371.45 ?  -62 DA  I "O5'" 1 
ATOM 6192  C "C5'" . DA  I 5 12  ? 111.025 51.520  110.234 1.00 371.45 ?  -62 DA  I "C5'" 1 
ATOM 6193  C "C4'" . DA  I 5 12  ? 109.593 51.819  109.837 1.00 371.45 ?  -62 DA  I "C4'" 1 
ATOM 6194  O "O4'" . DA  I 5 12  ? 109.145 53.036  110.474 1.00 371.45 ?  -62 DA  I "O4'" 1 
ATOM 6195  C "C3'" . DA  I 5 12  ? 109.355 52.012  108.335 1.00 371.45 ?  -62 DA  I "C3'" 1 
ATOM 6196  O "O3'" . DA  I 5 12  ? 108.507 50.973  107.855 1.00 371.45 ?  -62 DA  I "O3'" 1 
ATOM 6197  C "C2'" . DA  I 5 12  ? 108.691 53.399  108.234 1.00 371.45 ?  -62 DA  I "C2'" 1 
ATOM 6198  C "C1'" . DA  I 5 12  ? 108.179 53.619  109.648 1.00 371.45 ?  -62 DA  I "C1'" 1 
ATOM 6199  N N9    . DA  I 5 12  ? 108.035 55.026  110.010 1.00 371.45 ?  -62 DA  I N9    1 
ATOM 6200  C C8    . DA  I 5 12  ? 109.016 55.976  110.040 1.00 371.45 ?  -62 DA  I C8    1 
ATOM 6201  N N7    . DA  I 5 12  ? 108.591 57.162  110.404 1.00 371.45 ?  -62 DA  I N7    1 
ATOM 6202  C C5    . DA  I 5 12  ? 107.240 56.976  110.629 1.00 371.45 ?  -62 DA  I C5    1 
ATOM 6203  C C6    . DA  I 5 12  ? 106.214 57.851  111.038 1.00 371.45 ?  -62 DA  I C6    1 
ATOM 6204  N N6    . DA  I 5 12  ? 106.414 59.144  111.306 1.00 371.45 ?  -62 DA  I N6    1 
ATOM 6205  N N1    . DA  I 5 12  ? 104.970 57.342  111.168 1.00 371.45 ?  -62 DA  I N1    1 
ATOM 6206  C C2    . DA  I 5 12  ? 104.770 56.046  110.900 1.00 371.45 ?  -62 DA  I C2    1 
ATOM 6207  N N3    . DA  I 5 12  ? 105.654 55.130  110.507 1.00 371.45 ?  -62 DA  I N3    1 
ATOM 6208  C C4    . DA  I 5 12  ? 106.880 55.664  110.393 1.00 371.45 ?  -62 DA  I C4    1 
ATOM 6209  P P     . DC  I 5 13  ? 107.879 51.029  106.377 1.00 352.57 ?  -61 DC  I P     1 
ATOM 6210  O OP1   . DC  I 5 13  ? 107.711 49.633  105.917 1.00 352.57 ?  -61 DC  I OP1   1 
ATOM 6211  O OP2   . DC  I 5 13  ? 108.676 51.967  105.559 1.00 352.57 -1 -61 DC  I OP2   1 
ATOM 6212  O "O5'" . DC  I 5 13  ? 106.429 51.658  106.613 1.00 352.57 ?  -61 DC  I "O5'" 1 
ATOM 6213  C "C5'" . DC  I 5 13  ? 105.684 51.279  107.759 1.00 352.57 ?  -61 DC  I "C5'" 1 
ATOM 6214  C "C4'" . DC  I 5 13  ? 104.358 52.009  107.815 1.00 352.57 ?  -61 DC  I "C4'" 1 
ATOM 6215  O "O4'" . DC  I 5 13  ? 104.561 53.382  108.240 1.00 352.57 ?  -61 DC  I "O4'" 1 
ATOM 6216  C "C3'" . DC  I 5 13  ? 103.597 52.085  106.486 1.00 352.57 ?  -61 DC  I "C3'" 1 
ATOM 6217  O "O3'" . DC  I 5 13  ? 102.238 51.741  106.707 1.00 352.57 ?  -61 DC  I "O3'" 1 
ATOM 6218  C "C2'" . DC  I 5 13  ? 103.744 53.555  106.092 1.00 352.57 ?  -61 DC  I "C2'" 1 
ATOM 6219  C "C1'" . DC  I 5 13  ? 103.739 54.207  107.457 1.00 352.57 ?  -61 DC  I "C1'" 1 
ATOM 6220  N N1    . DC  I 5 13  ? 104.283 55.588  107.477 1.00 352.57 ?  -61 DC  I N1    1 
ATOM 6221  C C2    . DC  I 5 13  ? 103.428 56.661  107.745 1.00 352.57 ?  -61 DC  I C2    1 
ATOM 6222  O O2    . DC  I 5 13  ? 102.232 56.438  107.955 1.00 352.57 ?  -61 DC  I O2    1 
ATOM 6223  N N3    . DC  I 5 13  ? 103.936 57.915  107.769 1.00 352.57 ?  -61 DC  I N3    1 
ATOM 6224  C C4    . DC  I 5 13  ? 105.235 58.111  107.546 1.00 352.57 ?  -61 DC  I C4    1 
ATOM 6225  N N4    . DC  I 5 13  ? 105.691 59.367  107.573 1.00 352.57 ?  -61 DC  I N4    1 
ATOM 6226  C C5    . DC  I 5 13  ? 106.122 57.031  107.266 1.00 352.57 ?  -61 DC  I C5    1 
ATOM 6227  C C6    . DC  I 5 13  ? 105.608 55.798  107.242 1.00 352.57 ?  -61 DC  I C6    1 
ATOM 6228  P P     . DC  I 5 14  ? 101.243 51.479  105.473 1.00 336.98 ?  -60 DC  I P     1 
ATOM 6229  O OP1   . DC  I 5 14  ? 100.904 50.040  105.489 1.00 336.98 ?  -60 DC  I OP1   1 
ATOM 6230  O OP2   . DC  I 5 14  ? 101.819 52.085  104.254 1.00 336.98 -1 -60 DC  I OP2   1 
ATOM 6231  O "O5'" . DC  I 5 14  ? 99.938  52.317  105.863 1.00 336.98 ?  -60 DC  I "O5'" 1 
ATOM 6232  C "C5'" . DC  I 5 14  ? 100.071 53.546  106.563 1.00 336.98 ?  -60 DC  I "C5'" 1 
ATOM 6233  C "C4'" . DC  I 5 14  ? 99.406  54.672  105.799 1.00 336.98 ?  -60 DC  I "C4'" 1 
ATOM 6234  O "O4'" . DC  I 5 14  ? 100.231 55.863  105.880 1.00 336.98 ?  -60 DC  I "O4'" 1 
ATOM 6235  C "C3'" . DC  I 5 14  ? 99.196  54.397  104.311 1.00 336.98 ?  -60 DC  I "C3'" 1 
ATOM 6236  O "O3'" . DC  I 5 14  ? 97.902  54.806  103.921 1.00 336.98 ?  -60 DC  I "O3'" 1 
ATOM 6237  C "C2'" . DC  I 5 14  ? 100.276 55.234  103.634 1.00 336.98 ?  -60 DC  I "C2'" 1 
ATOM 6238  C "C1'" . DC  I 5 14  ? 100.406 56.406  104.594 1.00 336.98 ?  -60 DC  I "C1'" 1 
ATOM 6239  N N1    . DC  I 5 14  ? 101.739 57.076  104.541 1.00 336.98 ?  -60 DC  I N1    1 
ATOM 6240  C C2    . DC  I 5 14  ? 101.866 58.407  104.942 1.00 336.98 ?  -60 DC  I C2    1 
ATOM 6241  O O2    . DC  I 5 14  ? 100.866 59.019  105.331 1.00 336.98 ?  -60 DC  I O2    1 
ATOM 6242  N N3    . DC  I 5 14  ? 103.084 58.993  104.884 1.00 336.98 ?  -60 DC  I N3    1 
ATOM 6243  C C4    . DC  I 5 14  ? 104.138 58.299  104.451 1.00 336.98 ?  -60 DC  I C4    1 
ATOM 6244  N N4    . DC  I 5 14  ? 105.322 58.916  104.416 1.00 336.98 ?  -60 DC  I N4    1 
ATOM 6245  C C5    . DC  I 5 14  ? 104.028 56.944  104.045 1.00 336.98 ?  -60 DC  I C5    1 
ATOM 6246  C C6    . DC  I 5 14  ? 102.823 56.380  104.102 1.00 336.98 ?  -60 DC  I C6    1 
ATOM 6247  P P     . DT  I 5 15  ? 97.171  54.064  102.703 1.00 322.34 ?  -59 DT  I P     1 
ATOM 6248  O OP1   . DT  I 5 15  ? 95.769  53.810  103.101 1.00 322.34 ?  -59 DT  I OP1   1 
ATOM 6249  O OP2   . DT  I 5 15  ? 98.034  52.932  102.306 1.00 322.34 -1 -59 DT  I OP2   1 
ATOM 6250  O "O5'" . DT  I 5 15  ? 97.209  55.137  101.520 1.00 322.34 ?  -59 DT  I "O5'" 1 
ATOM 6251  C "C5'" . DT  I 5 15  ? 96.033  55.848  101.163 1.00 322.34 ?  -59 DT  I "C5'" 1 
ATOM 6252  C "C4'" . DT  I 5 15  ? 95.783  57.006  102.111 1.00 322.34 ?  -59 DT  I "C4'" 1 
ATOM 6253  O "O4'" . DT  I 5 15  ? 97.040  57.430  102.704 1.00 322.34 ?  -59 DT  I "O4'" 1 
ATOM 6254  C "C3'" . DT  I 5 15  ? 95.205  58.250  101.450 1.00 322.34 ?  -59 DT  I "C3'" 1 
ATOM 6255  O "O3'" . DT  I 5 15  ? 94.371  58.947  102.364 1.00 322.34 ?  -59 DT  I "O3'" 1 
ATOM 6256  C "C2'" . DT  I 5 15  ? 96.460  59.047  101.127 1.00 322.34 ?  -59 DT  I "C2'" 1 
ATOM 6257  C "C1'" . DT  I 5 15  ? 97.286  58.780  102.369 1.00 322.34 ?  -59 DT  I "C1'" 1 
ATOM 6258  N N1    . DT  I 5 15  ? 98.743  58.959  102.164 1.00 322.34 ?  -59 DT  I N1    1 
ATOM 6259  C C2    . DT  I 5 15  ? 99.359  60.074  102.669 1.00 322.34 ?  -59 DT  I C2    1 
ATOM 6260  O O2    . DT  I 5 15  ? 98.768  60.941  103.280 1.00 322.34 ?  -59 DT  I O2    1 
ATOM 6261  N N3    . DT  I 5 15  ? 100.702 60.141  102.435 1.00 322.34 ?  -59 DT  I N3    1 
ATOM 6262  C C4    . DT  I 5 15  ? 101.473 59.222  101.756 1.00 322.34 ?  -59 DT  I C4    1 
ATOM 6263  O O4    . DT  I 5 15  ? 102.677 59.369  101.598 1.00 322.34 ?  -59 DT  I O4    1 
ATOM 6264  C C5    . DT  I 5 15  ? 100.767 58.074  101.255 1.00 322.34 ?  -59 DT  I C5    1 
ATOM 6265  C C7    . DT  I 5 15  ? 101.503 57.007  100.503 1.00 322.34 ?  -59 DT  I C7    1 
ATOM 6266  C C6    . DT  I 5 15  ? 99.449  58.000  101.477 1.00 322.34 ?  -59 DT  I C6    1 
ATOM 6267  P P     . DG  I 5 16  ? 93.073  59.727  101.828 1.00 302.15 ?  -58 DG  I P     1 
ATOM 6268  O OP1   . DG  I 5 16  ? 91.889  59.094  102.447 1.00 302.15 ?  -58 DG  I OP1   1 
ATOM 6269  O OP2   . DG  I 5 16  ? 93.180  59.807  100.356 1.00 302.15 -1 -58 DG  I OP2   1 
ATOM 6270  O "O5'" . DG  I 5 16  ? 93.234  61.211  102.411 1.00 302.15 ?  -58 DG  I "O5'" 1 
ATOM 6271  C "C5'" . DG  I 5 16  ? 94.527  61.731  102.707 1.00 302.15 ?  -58 DG  I "C5'" 1 
ATOM 6272  C "C4'" . DG  I 5 16  ? 94.887  62.871  101.771 1.00 302.15 ?  -58 DG  I "C4'" 1 
ATOM 6273  O "O4'" . DG  I 5 16  ? 96.192  62.624  101.182 1.00 302.15 ?  -58 DG  I "O4'" 1 
ATOM 6274  C "C3'" . DG  I 5 16  ? 93.927  63.079  100.600 1.00 302.15 ?  -58 DG  I "C3'" 1 
ATOM 6275  O "O3'" . DG  I 5 16  ? 93.698  64.456  100.408 1.00 302.15 ?  -58 DG  I "O3'" 1 
ATOM 6276  C "C2'" . DG  I 5 16  ? 94.681  62.476  99.421  1.00 302.15 ?  -58 DG  I "C2'" 1 
ATOM 6277  C "C1'" . DG  I 5 16  ? 96.116  62.802  99.788  1.00 302.15 ?  -58 DG  I "C1'" 1 
ATOM 6278  N N9    . DG  I 5 16  ? 97.084  61.920  99.152  1.00 302.15 ?  -58 DG  I N9    1 
ATOM 6279  C C8    . DG  I 5 16  ? 96.820  60.935  98.238  1.00 302.15 ?  -58 DG  I C8    1 
ATOM 6280  N N7    . DG  I 5 16  ? 97.880  60.295  97.845  1.00 302.15 ?  -58 DG  I N7    1 
ATOM 6281  C C5    . DG  I 5 16  ? 98.915  60.901  98.534  1.00 302.15 ?  -58 DG  I C5    1 
ATOM 6282  C C6    . DG  I 5 16  ? 100.298 60.632  98.508  1.00 302.15 ?  -58 DG  I C6    1 
ATOM 6283  O O6    . DG  I 5 16  ? 100.900 59.775  97.850  1.00 302.15 ?  -58 DG  I O6    1 
ATOM 6284  N N1    . DG  I 5 16  ? 101.001 61.477  99.356  1.00 302.15 ?  -58 DG  I N1    1 
ATOM 6285  C C2    . DG  I 5 16  ? 100.436 62.457  100.132 1.00 302.15 ?  -58 DG  I C2    1 
ATOM 6286  N N2    . DG  I 5 16  ? 101.280 63.173  100.887 1.00 302.15 ?  -58 DG  I N2    1 
ATOM 6287  N N3    . DG  I 5 16  ? 99.138  62.719  100.166 1.00 302.15 ?  -58 DG  I N3    1 
ATOM 6288  C C4    . DG  I 5 16  ? 98.442  61.904  99.344  1.00 302.15 ?  -58 DG  I C4    1 
ATOM 6289  P P     . DC  I 5 17  ? 92.441  64.951  99.543  1.00 288.07 ?  -57 DC  I P     1 
ATOM 6290  O OP1   . DC  I 5 17  ? 91.232  64.791  100.381 1.00 288.07 ?  -57 DC  I OP1   1 
ATOM 6291  O OP2   . DC  I 5 17  ? 92.512  64.297  98.219  1.00 288.07 -1 -57 DC  I OP2   1 
ATOM 6292  O "O5'" . DC  I 5 17  ? 92.727  66.507  99.331  1.00 288.07 ?  -57 DC  I "O5'" 1 
ATOM 6293  C "C5'" . DC  I 5 17  ? 93.153  67.292  100.429 1.00 288.07 ?  -57 DC  I "C5'" 1 
ATOM 6294  C "C4'" . DC  I 5 17  ? 94.545  67.839  100.190 1.00 288.07 ?  -57 DC  I "C4'" 1 
ATOM 6295  O "O4'" . DC  I 5 17  ? 95.427  66.765  99.773  1.00 288.07 ?  -57 DC  I "O4'" 1 
ATOM 6296  C "C3'" . DC  I 5 17  ? 94.635  68.914  99.107  1.00 288.07 ?  -57 DC  I "C3'" 1 
ATOM 6297  O "O3'" . DC  I 5 17  ? 95.336  70.041  99.608  1.00 288.07 ?  -57 DC  I "O3'" 1 
ATOM 6298  C "C2'" . DC  I 5 17  ? 95.399  68.228  97.973  1.00 288.07 ?  -57 DC  I "C2'" 1 
ATOM 6299  C "C1'" . DC  I 5 17  ? 96.249  67.227  98.733  1.00 288.07 ?  -57 DC  I "C1'" 1 
ATOM 6300  N N1    . DC  I 5 17  ? 96.683  66.053  97.912  1.00 288.07 ?  -57 DC  I N1    1 
ATOM 6301  C C2    . DC  I 5 17  ? 98.036  65.696  97.869  1.00 288.07 ?  -57 DC  I C2    1 
ATOM 6302  O O2    . DC  I 5 17  ? 98.855  66.362  98.510  1.00 288.07 ?  -57 DC  I O2    1 
ATOM 6303  N N3    . DC  I 5 17  ? 98.411  64.629  97.125  1.00 288.07 ?  -57 DC  I N3    1 
ATOM 6304  C C4    . DC  I 5 17  ? 97.498  63.936  96.449  1.00 288.07 ?  -57 DC  I C4    1 
ATOM 6305  N N4    . DC  I 5 17  ? 97.915  62.894  95.729  1.00 288.07 ?  -57 DC  I N4    1 
ATOM 6306  C C5    . DC  I 5 17  ? 96.118  64.283  96.477  1.00 288.07 ?  -57 DC  I C5    1 
ATOM 6307  C C6    . DC  I 5 17  ? 95.758  65.337  97.216  1.00 288.07 ?  -57 DC  I C6    1 
ATOM 6308  P P     . DA  I 5 18  ? 95.437  71.387  98.739  1.00 263.04 ?  -56 DA  I P     1 
ATOM 6309  O OP1   . DA  I 5 18  ? 95.253  72.536  99.652  1.00 263.04 ?  -56 DA  I OP1   1 
ATOM 6310  O OP2   . DA  I 5 18  ? 94.565  71.233  97.557  1.00 263.04 -1 -56 DA  I OP2   1 
ATOM 6311  O "O5'" . DA  I 5 18  ? 96.943  71.382  98.225  1.00 263.04 ?  -56 DA  I "O5'" 1 
ATOM 6312  C "C5'" . DA  I 5 18  ? 97.949  70.795  99.022  1.00 263.04 ?  -56 DA  I "C5'" 1 
ATOM 6313  C "C4'" . DA  I 5 18  ? 99.165  70.480  98.184  1.00 263.04 ?  -56 DA  I "C4'" 1 
ATOM 6314  O "O4'" . DA  I 5 18  ? 99.030  69.165  97.593  1.00 263.04 ?  -56 DA  I "O4'" 1 
ATOM 6315  C "C3'" . DA  I 5 18  ? 99.399  71.446  97.023  1.00 263.04 ?  -56 DA  I "C3'" 1 
ATOM 6316  O "O3'" . DA  I 5 18  ? 100.716 71.920  97.066  1.00 263.04 ?  -56 DA  I "O3'" 1 
ATOM 6317  C "C2'" . DA  I 5 18  ? 99.148  70.591  95.778  1.00 263.04 ?  -56 DA  I "C2'" 1 
ATOM 6318  C "C1'" . DA  I 5 18  ? 99.527  69.214  96.283  1.00 263.04 ?  -56 DA  I "C1'" 1 
ATOM 6319  N N9    . DA  I 5 18  ? 98.943  68.118  95.520  1.00 263.04 ?  -56 DA  I N9    1 
ATOM 6320  C C8    . DA  I 5 18  ? 97.620  67.869  95.316  1.00 263.04 ?  -56 DA  I C8    1 
ATOM 6321  N N7    . DA  I 5 18  ? 97.388  66.800  94.597  1.00 263.04 ?  -56 DA  I N7    1 
ATOM 6322  C C5    . DA  I 5 18  ? 98.648  66.317  94.309  1.00 263.04 ?  -56 DA  I C5    1 
ATOM 6323  C C6    . DA  I 5 18  ? 99.092  65.202  93.579  1.00 263.04 ?  -56 DA  I C6    1 
ATOM 6324  N N6    . DA  I 5 18  ? 98.268  64.340  92.976  1.00 263.04 ?  -56 DA  I N6    1 
ATOM 6325  N N1    . DA  I 5 18  ? 100.424 65.008  93.483  1.00 263.04 ?  -56 DA  I N1    1 
ATOM 6326  C C2    . DA  I 5 18  ? 101.248 65.872  94.087  1.00 263.04 ?  -56 DA  I C2    1 
ATOM 6327  N N3    . DA  I 5 18  ? 100.945 66.951  94.799  1.00 263.04 ?  -56 DA  I N3    1 
ATOM 6328  C C4    . DA  I 5 18  ? 99.618  67.117  94.873  1.00 263.04 ?  -56 DA  I C4    1 
ATOM 6329  P P     . DG  I 5 19  ? 100.996 73.474  96.818  1.00 250.38 ?  -55 DG  I P     1 
ATOM 6330  O OP1   . DG  I 5 19  ? 101.494 74.067  98.077  1.00 250.38 ?  -55 DG  I OP1   1 
ATOM 6331  O OP2   . DG  I 5 19  ? 99.777  74.005  96.174  1.00 250.38 -1 -55 DG  I OP2   1 
ATOM 6332  O "O5'" . DG  I 5 19  ? 102.169 73.478  95.743  1.00 250.38 ?  -55 DG  I "O5'" 1 
ATOM 6333  C "C5'" . DG  I 5 19  ? 102.100 72.605  94.644  1.00 250.38 ?  -55 DG  I "C5'" 1 
ATOM 6334  C "C4'" . DG  I 5 19  ? 103.399 71.851  94.469  1.00 250.38 ?  -55 DG  I "C4'" 1 
ATOM 6335  O "O4'" . DG  I 5 19  ? 103.101 70.463  94.227  1.00 250.38 ?  -55 DG  I "O4'" 1 
ATOM 6336  C "C3'" . DG  I 5 19  ? 104.200 72.268  93.260  1.00 250.38 ?  -55 DG  I "C3'" 1 
ATOM 6337  O "O3'" . DG  I 5 19  ? 105.516 71.786  93.361  1.00 250.38 ?  -55 DG  I "O3'" 1 
ATOM 6338  C "C2'" . DG  I 5 19  ? 103.446 71.553  92.162  1.00 250.38 ?  -55 DG  I "C2'" 1 
ATOM 6339  C "C1'" . DG  I 5 19  ? 103.141 70.215  92.833  1.00 250.38 ?  -55 DG  I "C1'" 1 
ATOM 6340  N N9    . DG  I 5 19  ? 101.862 69.641  92.428  1.00 250.38 ?  -55 DG  I N9    1 
ATOM 6341  C C8    . DG  I 5 19  ? 100.616 70.187  92.607  1.00 250.38 ?  -55 DG  I C8    1 
ATOM 6342  N N7    . DG  I 5 19  ? 99.653  69.447  92.144  1.00 250.38 ?  -55 DG  I N7    1 
ATOM 6343  C C5    . DG  I 5 19  ? 100.301 68.342  91.621  1.00 250.38 ?  -55 DG  I C5    1 
ATOM 6344  C C6    . DG  I 5 19  ? 99.774  67.206  90.982  1.00 250.38 ?  -55 DG  I C6    1 
ATOM 6345  O O6    . DG  I 5 19  ? 98.589  66.942  90.746  1.00 250.38 ?  -55 DG  I O6    1 
ATOM 6346  N N1    . DG  I 5 19  ? 100.773 66.319  90.604  1.00 250.38 ?  -55 DG  I N1    1 
ATOM 6347  C C2    . DG  I 5 19  ? 102.113 66.510  90.818  1.00 250.38 ?  -55 DG  I C2    1 
ATOM 6348  N N2    . DG  I 5 19  ? 102.926 65.541  90.382  1.00 250.38 ?  -55 DG  I N2    1 
ATOM 6349  N N3    . DG  I 5 19  ? 102.622 67.576  91.415  1.00 250.38 ?  -55 DG  I N3    1 
ATOM 6350  C C4    . DG  I 5 19  ? 101.660 68.445  91.790  1.00 250.38 ?  -55 DG  I C4    1 
ATOM 6351  P P     . DA  I 5 20  ? 106.594 72.195  92.248  1.00 261.49 ?  -54 DA  I P     1 
ATOM 6352  O OP1   . DA  I 5 20  ? 107.924 72.202  92.887  1.00 261.49 ?  -54 DA  I OP1   1 
ATOM 6353  O OP2   . DA  I 5 20  ? 106.085 73.400  91.565  1.00 261.49 -1 -54 DA  I OP2   1 
ATOM 6354  O "O5'" . DA  I 5 20  ? 106.542 70.996  91.203  1.00 261.49 ?  -54 DA  I "O5'" 1 
ATOM 6355  C "C5'" . DA  I 5 20  ? 106.907 69.699  91.614  1.00 261.49 ?  -54 DA  I "C5'" 1 
ATOM 6356  C "C4'" . DA  I 5 20  ? 106.846 68.731  90.452  1.00 261.49 ?  -54 DA  I "C4'" 1 
ATOM 6357  O "O4'" . DA  I 5 20  ? 105.470 68.369  90.196  1.00 261.49 ?  -54 DA  I "O4'" 1 
ATOM 6358  C "C3'" . DA  I 5 20  ? 107.405 69.266  89.137  1.00 261.49 ?  -54 DA  I "C3'" 1 
ATOM 6359  O "O3'" . DA  I 5 20  ? 108.254 68.304  88.567  1.00 261.49 ?  -54 DA  I "O3'" 1 
ATOM 6360  C "C2'" . DA  I 5 20  ? 106.160 69.501  88.278  1.00 261.49 ?  -54 DA  I "C2'" 1 
ATOM 6361  C "C1'" . DA  I 5 20  ? 105.207 68.452  88.819  1.00 261.49 ?  -54 DA  I "C1'" 1 
ATOM 6362  N N9    . DA  I 5 20  ? 103.801 68.795  88.657  1.00 261.49 ?  -54 DA  I N9    1 
ATOM 6363  C C8    . DA  I 5 20  ? 103.155 69.878  89.171  1.00 261.49 ?  -54 DA  I C8    1 
ATOM 6364  N N7    . DA  I 5 20  ? 101.880 69.925  88.877  1.00 261.49 ?  -54 DA  I N7    1 
ATOM 6365  C C5    . DA  I 5 20  ? 101.678 68.791  88.119  1.00 261.49 ?  -54 DA  I C5    1 
ATOM 6366  C C6    . DA  I 5 20  ? 100.537 68.258  87.494  1.00 261.49 ?  -54 DA  I C6    1 
ATOM 6367  N N6    . DA  I 5 20  ? 99.334  68.835  87.544  1.00 261.49 ?  -54 DA  I N6    1 
ATOM 6368  N N1    . DA  I 5 20  ? 100.680 67.103  86.811  1.00 261.49 ?  -54 DA  I N1    1 
ATOM 6369  C C2    . DA  I 5 20  ? 101.884 66.525  86.764  1.00 261.49 ?  -54 DA  I C2    1 
ATOM 6370  N N3    . DA  I 5 20  ? 103.025 66.934  87.307  1.00 261.49 ?  -54 DA  I N3    1 
ATOM 6371  C C4    . DA  I 5 20  ? 102.852 68.081  87.977  1.00 261.49 ?  -54 DA  I C4    1 
ATOM 6372  P P     . DT  I 5 21  ? 109.011 68.619  87.191  1.00 273.47 ?  -53 DT  I P     1 
ATOM 6373  O OP1   . DT  I 5 21  ? 110.340 67.976  87.257  1.00 273.47 ?  -53 DT  I OP1   1 
ATOM 6374  O OP2   . DT  I 5 21  ? 108.912 70.072  86.951  1.00 273.47 -1 -53 DT  I OP2   1 
ATOM 6375  O "O5'" . DT  I 5 21  ? 108.116 67.876  86.097  1.00 273.47 ?  -53 DT  I "O5'" 1 
ATOM 6376  C "C5'" . DT  I 5 21  ? 107.725 66.527  86.306  1.00 273.47 ?  -53 DT  I "C5'" 1 
ATOM 6377  C "C4'" . DT  I 5 21  ? 107.028 65.970  85.079  1.00 273.47 ?  -53 DT  I "C4'" 1 
ATOM 6378  O "O4'" . DT  I 5 21  ? 105.613 66.277  85.138  1.00 273.47 ?  -53 DT  I "O4'" 1 
ATOM 6379  C "C3'" . DT  I 5 21  ? 107.532 66.521  83.745  1.00 273.47 ?  -53 DT  I "C3'" 1 
ATOM 6380  O "O3'" . DT  I 5 21  ? 107.734 65.456  82.832  1.00 273.47 ?  -53 DT  I "O3'" 1 
ATOM 6381  C "C2'" . DT  I 5 21  ? 106.402 67.445  83.292  1.00 273.47 ?  -53 DT  I "C2'" 1 
ATOM 6382  C "C1'" . DT  I 5 21  ? 105.189 66.755  83.886  1.00 273.47 ?  -53 DT  I "C1'" 1 
ATOM 6383  N N1    . DT  I 5 21  ? 104.036 67.661  84.105  1.00 273.47 ?  -53 DT  I N1    1 
ATOM 6384  C C2    . DT  I 5 21  ? 102.806 67.321  83.597  1.00 273.47 ?  -53 DT  I C2    1 
ATOM 6385  O O2    . DT  I 5 21  ? 102.604 66.301  82.967  1.00 273.47 ?  -53 DT  I O2    1 
ATOM 6386  N N3    . DT  I 5 21  ? 101.810 68.216  83.866  1.00 273.47 ?  -53 DT  I N3    1 
ATOM 6387  C C4    . DT  I 5 21  ? 101.922 69.397  84.571  1.00 273.47 ?  -53 DT  I C4    1 
ATOM 6388  O O4    . DT  I 5 21  ? 100.970 70.146  84.753  1.00 273.47 ?  -53 DT  I O4    1 
ATOM 6389  C C5    . DT  I 5 21  ? 103.240 69.696  85.070  1.00 273.47 ?  -53 DT  I C5    1 
ATOM 6390  C C7    . DT  I 5 21  ? 103.482 70.953  85.847  1.00 273.47 ?  -53 DT  I C7    1 
ATOM 6391  C C6    . DT  I 5 21  ? 104.221 68.821  84.820  1.00 273.47 ?  -53 DT  I C6    1 
ATOM 6392  P P     . DT  I 5 22  ? 108.916 65.536  81.748  1.00 292.16 ?  -52 DT  I P     1 
ATOM 6393  O OP1   . DT  I 5 22  ? 109.874 64.450  82.049  1.00 292.16 ?  -52 DT  I OP1   1 
ATOM 6394  O OP2   . DT  I 5 22  ? 109.388 66.937  81.704  1.00 292.16 -1 -52 DT  I OP2   1 
ATOM 6395  O "O5'" . DT  I 5 22  ? 108.182 65.224  80.362  1.00 292.16 ?  -52 DT  I "O5'" 1 
ATOM 6396  C "C5'" . DT  I 5 22  ? 107.170 66.098  79.888  1.00 292.16 ?  -52 DT  I "C5'" 1 
ATOM 6397  C "C4'" . DT  I 5 22  ? 106.020 65.321  79.281  1.00 292.16 ?  -52 DT  I "C4'" 1 
ATOM 6398  O "O4'" . DT  I 5 22  ? 104.792 65.669  79.969  1.00 292.16 ?  -52 DT  I "O4'" 1 
ATOM 6399  C "C3'" . DT  I 5 22  ? 105.758 65.625  77.816  1.00 292.16 ?  -52 DT  I "C3'" 1 
ATOM 6400  O "O3'" . DT  I 5 22  ? 105.145 64.514  77.186  1.00 292.16 ?  -52 DT  I "O3'" 1 
ATOM 6401  C "C2'" . DT  I 5 22  ? 104.805 66.804  77.904  1.00 292.16 ?  -52 DT  I "C2'" 1 
ATOM 6402  C "C1'" . DT  I 5 22  ? 103.955 66.420  79.109  1.00 292.16 ?  -52 DT  I "C1'" 1 
ATOM 6403  N N1    . DT  I 5 22  ? 103.450 67.598  79.852  1.00 292.16 ?  -52 DT  I N1    1 
ATOM 6404  C C2    . DT  I 5 22  ? 102.095 67.808  79.947  1.00 292.16 ?  -52 DT  I C2    1 
ATOM 6405  O O2    . DT  I 5 22  ? 101.268 67.061  79.460  1.00 292.16 ?  -52 DT  I O2    1 
ATOM 6406  N N3    . DT  I 5 22  ? 101.739 68.930  80.643  1.00 292.16 ?  -52 DT  I N3    1 
ATOM 6407  C C4    . DT  I 5 22  ? 102.588 69.846  81.236  1.00 292.16 ?  -52 DT  I C4    1 
ATOM 6408  O O4    . DT  I 5 22  ? 102.175 70.827  81.839  1.00 292.16 ?  -52 DT  I O4    1 
ATOM 6409  C C5    . DT  I 5 22  ? 103.994 69.570  81.093  1.00 292.16 ?  -52 DT  I C5    1 
ATOM 6410  C C7    . DT  I 5 22  ? 105.009 70.497  81.694  1.00 292.16 ?  -52 DT  I C7    1 
ATOM 6411  C C6    . DT  I 5 22  ? 104.353 68.475  80.413  1.00 292.16 ?  -52 DT  I C6    1 
ATOM 6412  P P     . DC  I 5 23  ? 105.217 64.355  75.589  1.00 303.66 ?  -51 DC  I P     1 
ATOM 6413  O OP1   . DC  I 5 23  ? 104.877 62.956  75.255  1.00 303.66 ?  -51 DC  I OP1   1 
ATOM 6414  O OP2   . DC  I 5 23  ? 106.498 64.932  75.135  1.00 303.66 -1 -51 DC  I OP2   1 
ATOM 6415  O "O5'" . DC  I 5 23  ? 104.056 65.308  75.053  1.00 303.66 ?  -51 DC  I "O5'" 1 
ATOM 6416  C "C5'" . DC  I 5 23  ? 102.708 65.051  75.407  1.00 303.66 ?  -51 DC  I "C5'" 1 
ATOM 6417  C "C4'" . DC  I 5 23  ? 101.814 66.191  74.961  1.00 303.66 ?  -51 DC  I "C4'" 1 
ATOM 6418  O "O4'" . DC  I 5 23  ? 101.741 67.201  76.005  1.00 303.66 ?  -51 DC  I "O4'" 1 
ATOM 6419  C "C3'" . DC  I 5 23  ? 102.285 66.922  73.697  1.00 303.66 ?  -51 DC  I "C3'" 1 
ATOM 6420  O "O3'" . DC  I 5 23  ? 101.188 67.133  72.825  1.00 303.66 ?  -51 DC  I "O3'" 1 
ATOM 6421  C "C2'" . DC  I 5 23  ? 102.813 68.241  74.245  1.00 303.66 ?  -51 DC  I "C2'" 1 
ATOM 6422  C "C1'" . DC  I 5 23  ? 101.861 68.462  75.404  1.00 303.66 ?  -51 DC  I "C1'" 1 
ATOM 6423  N N1    . DC  I 5 23  ? 102.346 69.458  76.412  1.00 303.66 ?  -51 DC  I N1    1 
ATOM 6424  C C2    . DC  I 5 23  ? 101.467 69.941  77.384  1.00 303.66 ?  -51 DC  I C2    1 
ATOM 6425  O O2    . DC  I 5 23  ? 100.304 69.523  77.406  1.00 303.66 ?  -51 DC  I O2    1 
ATOM 6426  N N3    . DC  I 5 23  ? 101.916 70.854  78.277  1.00 303.66 ?  -51 DC  I N3    1 
ATOM 6427  C C4    . DC  I 5 23  ? 103.178 71.279  78.221  1.00 303.66 ?  -51 DC  I C4    1 
ATOM 6428  N N4    . DC  I 5 23  ? 103.576 72.177  79.122  1.00 303.66 ?  -51 DC  I N4    1 
ATOM 6429  C C5    . DC  I 5 23  ? 104.086 70.806  77.236  1.00 303.66 ?  -51 DC  I C5    1 
ATOM 6430  C C6    . DC  I 5 23  ? 103.634 69.906  76.361  1.00 303.66 ?  -51 DC  I C6    1 
ATOM 6431  P P     . DT  I 5 24  ? 101.428 67.557  71.293  1.00 309.86 ?  -50 DT  I P     1 
ATOM 6432  O OP1   . DT  I 5 24  ? 101.507 66.320  70.488  1.00 309.86 ?  -50 DT  I OP1   1 
ATOM 6433  O OP2   . DT  I 5 24  ? 102.523 68.548  71.231  1.00 309.86 -1 -50 DT  I OP2   1 
ATOM 6434  O "O5'" . DT  I 5 24  ? 100.085 68.324  70.915  1.00 309.86 ?  -50 DT  I "O5'" 1 
ATOM 6435  C "C5'" . DT  I 5 24  ? 98.892  68.005  71.599  1.00 309.86 ?  -50 DT  I "C5'" 1 
ATOM 6436  C "C4'" . DT  I 5 24  ? 98.365  69.212  72.349  1.00 309.86 ?  -50 DT  I "C4'" 1 
ATOM 6437  O "O4'" . DT  I 5 24  ? 99.251  69.543  73.433  1.00 309.86 ?  -50 DT  I "O4'" 1 
ATOM 6438  C "C3'" . DT  I 5 24  ? 98.296  70.486  71.538  1.00 309.86 ?  -50 DT  I "C3'" 1 
ATOM 6439  O "O3'" . DT  I 5 24  ? 97.110  70.504  70.775  1.00 309.86 ?  -50 DT  I "O3'" 1 
ATOM 6440  C "C2'" . DT  I 5 24  ? 98.280  71.562  72.627  1.00 309.86 ?  -50 DT  I "C2'" 1 
ATOM 6441  C "C1'" . DT  I 5 24  ? 99.047  70.900  73.782  1.00 309.86 ?  -50 DT  I "C1'" 1 
ATOM 6442  N N1    . DT  I 5 24  ? 100.366 71.528  74.065  1.00 309.86 ?  -50 DT  I N1    1 
ATOM 6443  C C2    . DT  I 5 24  ? 100.515 72.292  75.195  1.00 309.86 ?  -50 DT  I C2    1 
ATOM 6444  O O2    . DT  I 5 24  ? 99.618  72.488  75.990  1.00 309.86 ?  -50 DT  I O2    1 
ATOM 6445  N N3    . DT  I 5 24  ? 101.763 72.818  75.368  1.00 309.86 ?  -50 DT  I N3    1 
ATOM 6446  C C4    . DT  I 5 24  ? 102.854 72.664  74.538  1.00 309.86 ?  -50 DT  I C4    1 
ATOM 6447  O O4    . DT  I 5 24  ? 103.938 73.183  74.779  1.00 309.86 ?  -50 DT  I O4    1 
ATOM 6448  C C5    . DT  I 5 24  ? 102.629 71.855  73.367  1.00 309.86 ?  -50 DT  I C5    1 
ATOM 6449  C C7    . DT  I 5 24  ? 103.740 71.616  72.390  1.00 309.86 ?  -50 DT  I C7    1 
ATOM 6450  C C6    . DT  I 5 24  ? 101.409 71.332  73.189  1.00 309.86 ?  -50 DT  I C6    1 
ATOM 6451  P P     . DA  I 5 25  ? 97.169  70.214  69.198  1.00 304.27 ?  -49 DA  I P     1 
ATOM 6452  O OP1   . DA  I 5 25  ? 96.793  68.800  68.984  1.00 304.27 ?  -49 DA  I OP1   1 
ATOM 6453  O OP2   . DA  I 5 25  ? 98.471  70.718  68.711  1.00 304.27 -1 -49 DA  I OP2   1 
ATOM 6454  O "O5'" . DA  I 5 25  ? 96.021  71.146  68.605  1.00 304.27 ?  -49 DA  I "O5'" 1 
ATOM 6455  C "C5'" . DA  I 5 25  ? 95.305  72.005  69.471  1.00 304.27 ?  -49 DA  I "C5'" 1 
ATOM 6456  C "C4'" . DA  I 5 25  ? 95.776  73.442  69.335  1.00 304.27 ?  -49 DA  I "C4'" 1 
ATOM 6457  O "O4'" . DA  I 5 25  ? 96.702  73.775  70.404  1.00 304.27 ?  -49 DA  I "O4'" 1 
ATOM 6458  C "C3'" . DA  I 5 25  ? 96.523  73.789  68.030  1.00 304.27 ?  -49 DA  I "C3'" 1 
ATOM 6459  O "O3'" . DA  I 5 25  ? 96.219  75.125  67.651  1.00 304.27 ?  -49 DA  I "O3'" 1 
ATOM 6460  C "C2'" . DA  I 5 25  ? 97.966  73.747  68.499  1.00 304.27 ?  -49 DA  I "C2'" 1 
ATOM 6461  C "C1'" . DA  I 5 25  ? 97.760  74.469  69.806  1.00 304.27 ?  -49 DA  I "C1'" 1 
ATOM 6462  N N9    . DA  I 5 25  ? 98.912  74.514  70.690  1.00 304.27 ?  -49 DA  I N9    1 
ATOM 6463  C C8    . DA  I 5 25  ? 100.068 73.792  70.598  1.00 304.27 ?  -49 DA  I C8    1 
ATOM 6464  N N7    . DA  I 5 25  ? 100.936 74.075  71.538  1.00 304.27 ?  -49 DA  I N7    1 
ATOM 6465  C C5    . DA  I 5 25  ? 100.306 75.054  72.285  1.00 304.27 ?  -49 DA  I C5    1 
ATOM 6466  C C6    . DA  I 5 25  ? 100.692 75.778  73.425  1.00 304.27 ?  -49 DA  I C6    1 
ATOM 6467  N N6    . DA  I 5 25  ? 101.860 75.609  74.034  1.00 304.27 ?  -49 DA  I N6    1 
ATOM 6468  N N1    . DA  I 5 25  ? 99.827  76.688  73.917  1.00 304.27 ?  -49 DA  I N1    1 
ATOM 6469  C C2    . DA  I 5 25  ? 98.651  76.855  73.308  1.00 304.27 ?  -49 DA  I C2    1 
ATOM 6470  N N3    . DA  I 5 25  ? 98.180  76.237  72.231  1.00 304.27 ?  -49 DA  I N3    1 
ATOM 6471  C C4    . DA  I 5 25  ? 99.065  75.339  71.768  1.00 304.27 ?  -49 DA  I C4    1 
ATOM 6472  P P     . DC  I 5 26  ? 94.889  75.522  66.844  1.00 301.70 ?  -48 DC  I P     1 
ATOM 6473  O OP1   . DC  I 5 26  ? 93.882  74.438  66.888  1.00 301.70 ?  -48 DC  I OP1   1 
ATOM 6474  O OP2   . DC  I 5 26  ? 95.345  76.017  65.528  1.00 301.70 -1 -48 DC  I OP2   1 
ATOM 6475  O "O5'" . DC  I 5 26  ? 94.355  76.791  67.661  1.00 301.70 ?  -48 DC  I "O5'" 1 
ATOM 6476  C "C5'" . DC  I 5 26  ? 94.749  76.974  69.028  1.00 301.70 ?  -48 DC  I "C5'" 1 
ATOM 6477  C "C4'" . DC  I 5 26  ? 95.653  78.184  69.180  1.00 301.70 ?  -48 DC  I "C4'" 1 
ATOM 6478  O "O4'" . DC  I 5 26  ? 96.941  77.787  69.710  1.00 301.70 ?  -48 DC  I "O4'" 1 
ATOM 6479  C "C3'" . DC  I 5 26  ? 95.938  78.946  67.881  1.00 301.70 ?  -48 DC  I "C3'" 1 
ATOM 6480  O "O3'" . DC  I 5 26  ? 95.564  80.301  68.028  1.00 301.70 ?  -48 DC  I "O3'" 1 
ATOM 6481  C "C2'" . DC  I 5 26  ? 97.452  78.801  67.695  1.00 301.70 ?  -48 DC  I "C2'" 1 
ATOM 6482  C "C1'" . DC  I 5 26  ? 97.921  78.603  69.125  1.00 301.70 ?  -48 DC  I "C1'" 1 
ATOM 6483  N N1    . DC  I 5 26  ? 99.241  77.921  69.235  1.00 301.70 ?  -48 DC  I N1    1 
ATOM 6484  C C2    . DC  I 5 26  ? 100.069 78.184  70.328  1.00 301.70 ?  -48 DC  I C2    1 
ATOM 6485  O O2    . DC  I 5 26  ? 99.691  78.979  71.192  1.00 301.70 ?  -48 DC  I O2    1 
ATOM 6486  N N3    . DC  I 5 26  ? 101.265 77.552  70.411  1.00 301.70 ?  -48 DC  I N3    1 
ATOM 6487  C C4    . DC  I 5 26  ? 101.635 76.699  69.454  1.00 301.70 ?  -48 DC  I C4    1 
ATOM 6488  N N4    . DC  I 5 26  ? 102.821 76.100  69.572  1.00 301.70 ?  -48 DC  I N4    1 
ATOM 6489  C C5    . DC  I 5 26  ? 100.806 76.424  68.331  1.00 301.70 ?  -48 DC  I C5    1 
ATOM 6490  C C6    . DC  I 5 26  ? 99.635  77.057  68.258  1.00 301.70 ?  -48 DC  I C6    1 
ATOM 6491  P P     . DC  I 5 27  ? 94.106  80.794  67.569  1.00 284.15 ?  -47 DC  I P     1 
ATOM 6492  O OP1   . DC  I 5 27  ? 93.213  79.617  67.479  1.00 284.15 ?  -47 DC  I OP1   1 
ATOM 6493  O OP2   . DC  I 5 27  ? 94.286  81.667  66.391  1.00 284.15 -1 -47 DC  I OP2   1 
ATOM 6494  O "O5'" . DC  I 5 27  ? 93.623  81.711  68.782  1.00 284.15 ?  -47 DC  I "O5'" 1 
ATOM 6495  C "C5'" . DC  I 5 27  ? 93.832  81.281  70.117  1.00 284.15 ?  -47 DC  I "C5'" 1 
ATOM 6496  C "C4'" . DC  I 5 27  ? 94.864  82.154  70.803  1.00 284.15 ?  -47 DC  I "C4'" 1 
ATOM 6497  O "O4'" . DC  I 5 27  ? 96.193  81.643  70.561  1.00 284.15 ?  -47 DC  I "O4'" 1 
ATOM 6498  C "C3'" . DC  I 5 27  ? 94.882  83.609  70.334  1.00 284.15 ?  -47 DC  I "C3'" 1 
ATOM 6499  O "O3'" . DC  I 5 27  ? 94.503  84.448  71.402  1.00 284.15 ?  -47 DC  I "O3'" 1 
ATOM 6500  C "C2'" . DC  I 5 27  ? 96.337  83.857  69.896  1.00 284.15 ?  -47 DC  I "C2'" 1 
ATOM 6501  C "C1'" . DC  I 5 27  ? 97.081  82.725  70.582  1.00 284.15 ?  -47 DC  I "C1'" 1 
ATOM 6502  N N1    . DC  I 5 27  ? 98.335  82.322  69.891  1.00 284.15 ?  -47 DC  I N1    1 
ATOM 6503  C C2    . DC  I 5 27  ? 99.489  82.086  70.640  1.00 284.15 ?  -47 DC  I C2    1 
ATOM 6504  O O2    . DC  I 5 27  ? 99.445  82.219  71.865  1.00 284.15 ?  -47 DC  I O2    1 
ATOM 6505  N N3    . DC  I 5 27  ? 100.622 81.713  70.003  1.00 284.15 ?  -47 DC  I N3    1 
ATOM 6506  C C4    . DC  I 5 27  ? 100.624 81.574  68.683  1.00 284.15 ?  -47 DC  I C4    1 
ATOM 6507  N N4    . DC  I 5 27  ? 101.766 81.214  68.097  1.00 284.15 ?  -47 DC  I N4    1 
ATOM 6508  C C5    . DC  I 5 27  ? 99.461  81.817  67.900  1.00 284.15 ?  -47 DC  I C5    1 
ATOM 6509  C C6    . DC  I 5 27  ? 98.348  82.185  68.540  1.00 284.15 ?  -47 DC  I C6    1 
ATOM 6510  P P     . DA  I 5 28  ? 94.377  86.031  71.180  1.00 269.85 ?  -46 DA  I P     1 
ATOM 6511  O OP1   . DA  I 5 28  ? 93.261  86.507  72.025  1.00 269.85 ?  -46 DA  I OP1   1 
ATOM 6512  O OP2   . DA  I 5 28  ? 94.373  86.291  69.724  1.00 269.85 -1 -46 DA  I OP2   1 
ATOM 6513  O "O5'" . DA  I 5 28  ? 95.749  86.591  71.765  1.00 269.85 ?  -46 DA  I "O5'" 1 
ATOM 6514  C "C5'" . DA  I 5 28  ? 96.318  85.988  72.912  1.00 269.85 ?  -46 DA  I "C5'" 1 
ATOM 6515  C "C4'" . DA  I 5 28  ? 97.807  86.236  72.948  1.00 269.85 ?  -46 DA  I "C4'" 1 
ATOM 6516  O "O4'" . DA  I 5 28  ? 98.434  85.514  71.876  1.00 269.85 ?  -46 DA  I "O4'" 1 
ATOM 6517  C "C3'" . DA  I 5 28  ? 98.199  87.695  72.757  1.00 269.85 ?  -46 DA  I "C3'" 1 
ATOM 6518  O "O3'" . DA  I 5 28  ? 98.653  88.226  73.980  1.00 269.85 ?  -46 DA  I "O3'" 1 
ATOM 6519  C "C2'" . DA  I 5 28  ? 99.307  87.676  71.690  1.00 269.85 ?  -46 DA  I "C2'" 1 
ATOM 6520  C "C1'" . DA  I 5 28  ? 99.593  86.193  71.484  1.00 269.85 ?  -46 DA  I "C1'" 1 
ATOM 6521  N N9    . DA  I 5 28  ? 99.858  85.853  70.094  1.00 269.85 ?  -46 DA  I N9    1 
ATOM 6522  C C8    . DA  I 5 28  ? 99.070  86.141  69.020  1.00 269.85 ?  -46 DA  I C8    1 
ATOM 6523  N N7    . DA  I 5 28  ? 99.551  85.713  67.881  1.00 269.85 ?  -46 DA  I N7    1 
ATOM 6524  C C5    . DA  I 5 28  ? 100.735 85.097  68.233  1.00 269.85 ?  -46 DA  I C5    1 
ATOM 6525  C C6    . DA  I 5 28  ? 101.719 84.438  67.479  1.00 269.85 ?  -46 DA  I C6    1 
ATOM 6526  N N6    . DA  I 5 28  ? 101.650 84.289  66.154  1.00 269.85 ?  -46 DA  I N6    1 
ATOM 6527  N N1    . DA  I 5 28  ? 102.779 83.933  68.138  1.00 269.85 ?  -46 DA  I N1    1 
ATOM 6528  C C2    . DA  I 5 28  ? 102.844 84.085  69.463  1.00 269.85 ?  -46 DA  I C2    1 
ATOM 6529  N N3    . DA  I 5 28  ? 101.981 84.683  70.279  1.00 269.85 ?  -46 DA  I N3    1 
ATOM 6530  C C4    . DA  I 5 28  ? 100.940 85.172  69.595  1.00 269.85 ?  -46 DA  I C4    1 
ATOM 6531  P P     . DA  I 5 29  ? 99.074  89.769  74.077  1.00 250.03 ?  -45 DA  I P     1 
ATOM 6532  O OP1   . DA  I 5 29  ? 98.710  90.240  75.428  1.00 250.03 ?  -45 DA  I OP1   1 
ATOM 6533  O OP2   . DA  I 5 29  ? 98.544  90.467  72.889  1.00 250.03 -1 -45 DA  I OP2   1 
ATOM 6534  O "O5'" . DA  I 5 29  ? 100.659 89.720  73.942  1.00 250.03 ?  -45 DA  I "O5'" 1 
ATOM 6535  C "C5'" . DA  I 5 29  ? 101.367 88.674  74.562  1.00 250.03 ?  -45 DA  I "C5'" 1 
ATOM 6536  C "C4'" . DA  I 5 29  ? 102.687 88.437  73.869  1.00 250.03 ?  -45 DA  I "C4'" 1 
ATOM 6537  O "O4'" . DA  I 5 29  ? 102.469 87.858  72.570  1.00 250.03 ?  -45 DA  I "O4'" 1 
ATOM 6538  C "C3'" . DA  I 5 29  ? 103.513 89.697  73.614  1.00 250.03 ?  -45 DA  I "C3'" 1 
ATOM 6539  O "O3'" . DA  I 5 29  ? 104.613 89.724  74.488  1.00 250.03 ?  -45 DA  I "O3'" 1 
ATOM 6540  C "C2'" . DA  I 5 29  ? 103.963 89.570  72.148  1.00 250.03 ?  -45 DA  I "C2'" 1 
ATOM 6541  C "C1'" . DA  I 5 29  ? 103.612 88.129  71.818  1.00 250.03 ?  -45 DA  I "C1'" 1 
ATOM 6542  N N9    . DA  I 5 29  ? 103.338 87.907  70.405  1.00 250.03 ?  -45 DA  I N9    1 
ATOM 6543  C C8    . DA  I 5 29  ? 102.257 88.337  69.693  1.00 250.03 ?  -45 DA  I C8    1 
ATOM 6544  N N7    . DA  I 5 29  ? 102.295 87.997  68.427  1.00 250.03 ?  -45 DA  I N7    1 
ATOM 6545  C C5    . DA  I 5 29  ? 103.484 87.304  68.307  1.00 250.03 ?  -45 DA  I C5    1 
ATOM 6546  C C6    . DA  I 5 29  ? 104.114 86.686  67.217  1.00 250.03 ?  -45 DA  I C6    1 
ATOM 6547  N N6    . DA  I 5 29  ? 103.592 86.660  65.991  1.00 250.03 ?  -45 DA  I N6    1 
ATOM 6548  N N1    . DA  I 5 29  ? 105.295 86.073  67.437  1.00 250.03 ?  -45 DA  I N1    1 
ATOM 6549  C C2    . DA  I 5 29  ? 105.808 86.086  68.669  1.00 250.03 ?  -45 DA  I C2    1 
ATOM 6550  N N3    . DA  I 5 29  ? 105.315 86.650  69.766  1.00 250.03 ?  -45 DA  I N3    1 
ATOM 6551  C C4    . DA  I 5 29  ? 104.140 87.245  69.514  1.00 250.03 ?  -45 DA  I C4    1 
ATOM 6552  P P     . DA  I 5 30  ? 105.672 90.921  74.406  1.00 240.33 ?  -44 DA  I P     1 
ATOM 6553  O OP1   . DA  I 5 30  ? 106.183 91.150  75.770  1.00 240.33 ?  -44 DA  I OP1   1 
ATOM 6554  O OP2   . DA  I 5 30  ? 105.037 92.026  73.659  1.00 240.33 -1 -44 DA  I OP2   1 
ATOM 6555  O "O5'" . DA  I 5 30  ? 106.847 90.318  73.517  1.00 240.33 ?  -44 DA  I "O5'" 1 
ATOM 6556  C "C5'" . DA  I 5 30  ? 107.287 89.005  73.756  1.00 240.33 ?  -44 DA  I "C5'" 1 
ATOM 6557  C "C4'" . DA  I 5 30  ? 108.044 88.480  72.561  1.00 240.33 ?  -44 DA  I "C4'" 1 
ATOM 6558  O "O4'" . DA  I 5 30  ? 107.187 88.518  71.398  1.00 240.33 ?  -44 DA  I "O4'" 1 
ATOM 6559  C "C3'" . DA  I 5 30  ? 109.292 89.284  72.192  1.00 240.33 ?  -44 DA  I "C3'" 1 
ATOM 6560  O "O3'" . DA  I 5 30  ? 110.410 88.436  72.123  1.00 240.33 ?  -44 DA  I "O3'" 1 
ATOM 6561  C "C2'" . DA  I 5 30  ? 108.960 89.879  70.823  1.00 240.33 ?  -44 DA  I "C2'" 1 
ATOM 6562  C "C1'" . DA  I 5 30  ? 107.967 88.868  70.291  1.00 240.33 ?  -44 DA  I "C1'" 1 
ATOM 6563  N N9    . DA  I 5 30  ? 107.095 89.390  69.248  1.00 240.33 ?  -44 DA  I N9    1 
ATOM 6564  C C8    . DA  I 5 30  ? 106.091 90.301  69.391  1.00 240.33 ?  -44 DA  I C8    1 
ATOM 6565  N N7    . DA  I 5 30  ? 105.473 90.584  68.272  1.00 240.33 ?  -44 DA  I N7    1 
ATOM 6566  C C5    . DA  I 5 30  ? 106.116 89.803  67.335  1.00 240.33 ?  -44 DA  I C5    1 
ATOM 6567  C C6    . DA  I 5 30  ? 105.935 89.641  65.955  1.00 240.33 ?  -44 DA  I C6    1 
ATOM 6568  N N6    . DA  I 5 30  ? 105.005 90.295  65.257  1.00 240.33 ?  -44 DA  I N6    1 
ATOM 6569  N N1    . DA  I 5 30  ? 106.749 88.778  65.313  1.00 240.33 ?  -44 DA  I N1    1 
ATOM 6570  C C2    . DA  I 5 30  ? 107.674 88.119  66.014  1.00 240.33 ?  -44 DA  I C2    1 
ATOM 6571  N N3    . DA  I 5 30  ? 107.943 88.197  67.312  1.00 240.33 ?  -44 DA  I N3    1 
ATOM 6572  C C4    . DA  I 5 30  ? 107.120 89.065  67.918  1.00 240.33 ?  -44 DA  I C4    1 
ATOM 6573  P P     . DA  I 5 31  ? 111.870 89.082  72.007  1.00 241.48 ?  -43 DA  I P     1 
ATOM 6574  O OP1   . DA  I 5 31  ? 112.822 88.273  72.797  1.00 241.48 ?  -43 DA  I OP1   1 
ATOM 6575  O OP2   . DA  I 5 31  ? 111.674 90.514  72.295  1.00 241.48 -1 -43 DA  I OP2   1 
ATOM 6576  O "O5'" . DA  I 5 31  ? 112.230 88.951  70.460  1.00 241.48 ?  -43 DA  I "O5'" 1 
ATOM 6577  C "C5'" . DA  I 5 31  ? 112.467 87.675  69.907  1.00 241.48 ?  -43 DA  I "C5'" 1 
ATOM 6578  C "C4'" . DA  I 5 31  ? 112.762 87.773  68.424  1.00 241.48 ?  -43 DA  I "C4'" 1 
ATOM 6579  O "O4'" . DA  I 5 31  ? 111.573 88.204  67.722  1.00 241.48 ?  -43 DA  I "O4'" 1 
ATOM 6580  C "C3'" . DA  I 5 31  ? 113.867 88.762  68.049  1.00 241.48 ?  -43 DA  I "C3'" 1 
ATOM 6581  O "O3'" . DA  I 5 31  ? 114.788 88.141  67.175  1.00 241.48 ?  -43 DA  I "O3'" 1 
ATOM 6582  C "C2'" . DA  I 5 31  ? 113.117 89.900  67.360  1.00 241.48 ?  -43 DA  I "C2'" 1 
ATOM 6583  C "C1'" . DA  I 5 31  ? 111.926 89.170  66.771  1.00 241.48 ?  -43 DA  I "C1'" 1 
ATOM 6584  N N9    . DA  I 5 31  ? 110.778 90.033  66.550  1.00 241.48 ?  -43 DA  I N9    1 
ATOM 6585  C C8    . DA  I 5 31  ? 110.083 90.731  67.491  1.00 241.48 ?  -43 DA  I C8    1 
ATOM 6586  N N7    . DA  I 5 31  ? 109.091 91.431  67.002  1.00 241.48 ?  -43 DA  I N7    1 
ATOM 6587  C C5    . DA  I 5 31  ? 109.141 91.173  65.649  1.00 241.48 ?  -43 DA  I C5    1 
ATOM 6588  C C6    . DA  I 5 31  ? 108.355 91.611  64.575  1.00 241.48 ?  -43 DA  I C6    1 
ATOM 6589  N N6    . DA  I 5 31  ? 107.324 92.444  64.719  1.00 241.48 ?  -43 DA  I N6    1 
ATOM 6590  N N1    . DA  I 5 31  ? 108.670 91.163  63.341  1.00 241.48 ?  -43 DA  I N1    1 
ATOM 6591  C C2    . DA  I 5 31  ? 109.700 90.322  63.204  1.00 241.48 ?  -43 DA  I C2    1 
ATOM 6592  N N3    . DA  I 5 31  ? 110.516 89.845  64.142  1.00 241.48 ?  -43 DA  I N3    1 
ATOM 6593  C C4    . DA  I 5 31  ? 110.174 90.311  65.353  1.00 241.48 ?  -43 DA  I C4    1 
ATOM 6594  P P     . DG  I 5 32  ? 116.038 88.967  66.602  1.00 259.98 ?  -42 DG  I P     1 
ATOM 6595  O OP1   . DG  I 5 32  ? 117.168 88.024  66.460  1.00 259.98 ?  -42 DG  I OP1   1 
ATOM 6596  O OP2   . DG  I 5 32  ? 116.197 90.172  67.444  1.00 259.98 -1 -42 DG  I OP2   1 
ATOM 6597  O "O5'" . DG  I 5 32  ? 115.556 89.430  65.148  1.00 259.98 ?  -42 DG  I "O5'" 1 
ATOM 6598  C "C5'" . DG  I 5 32  ? 115.033 88.470  64.243  1.00 259.98 ?  -42 DG  I "C5'" 1 
ATOM 6599  C "C4'" . DG  I 5 32  ? 114.622 89.118  62.935  1.00 259.98 ?  -42 DG  I "C4'" 1 
ATOM 6600  O "O4'" . DG  I 5 32  ? 113.413 89.885  63.125  1.00 259.98 ?  -42 DG  I "O4'" 1 
ATOM 6601  C "C3'" . DG  I 5 32  ? 115.651 90.079  62.337  1.00 259.98 ?  -42 DG  I "C3'" 1 
ATOM 6602  O "O3'" . DG  I 5 32  ? 115.980 89.667  61.024  1.00 259.98 ?  -42 DG  I "O3'" 1 
ATOM 6603  C "C2'" . DG  I 5 32  ? 114.941 91.437  62.341  1.00 259.98 ?  -42 DG  I "C2'" 1 
ATOM 6604  C "C1'" . DG  I 5 32  ? 113.481 91.029  62.321  1.00 259.98 ?  -42 DG  I "C1'" 1 
ATOM 6605  N N9    . DG  I 5 32  ? 112.589 92.028  62.883  1.00 259.98 ?  -42 DG  I N9    1 
ATOM 6606  C C8    . DG  I 5 32  ? 112.478 92.377  64.202  1.00 259.98 ?  -42 DG  I C8    1 
ATOM 6607  N N7    . DG  I 5 32  ? 111.586 93.299  64.421  1.00 259.98 ?  -42 DG  I N7    1 
ATOM 6608  C C5    . DG  I 5 32  ? 111.075 93.583  63.165  1.00 259.98 ?  -42 DG  I C5    1 
ATOM 6609  C C6    . DG  I 5 32  ? 110.083 94.507  62.778  1.00 259.98 ?  -42 DG  I C6    1 
ATOM 6610  O O6    . DG  I 5 32  ? 109.436 95.279  63.496  1.00 259.98 ?  -42 DG  I O6    1 
ATOM 6611  N N1    . DG  I 5 32  ? 109.861 94.482  61.407  1.00 259.98 ?  -42 DG  I N1    1 
ATOM 6612  C C2    . DG  I 5 32  ? 110.520 93.667  60.523  1.00 259.98 ?  -42 DG  I C2    1 
ATOM 6613  N N2    . DG  I 5 32  ? 110.164 93.779  59.236  1.00 259.98 ?  -42 DG  I N2    1 
ATOM 6614  N N3    . DG  I 5 32  ? 111.454 92.794  60.873  1.00 259.98 ?  -42 DG  I N3    1 
ATOM 6615  C C4    . DG  I 5 32  ? 111.685 92.813  62.205  1.00 259.98 ?  -42 DG  I C4    1 
ATOM 6616  P P     . DT  I 5 33  ? 117.141 90.416  60.206  1.00 262.95 ?  -41 DT  I P     1 
ATOM 6617  O OP1   . DT  I 5 33  ? 117.801 89.412  59.344  1.00 262.95 ?  -41 DT  I OP1   1 
ATOM 6618  O OP2   . DT  I 5 33  ? 117.939 91.193  61.176  1.00 262.95 -1 -41 DT  I OP2   1 
ATOM 6619  O "O5'" . DT  I 5 33  ? 116.350 91.456  59.287  1.00 262.95 ?  -41 DT  I "O5'" 1 
ATOM 6620  C "C5'" . DT  I 5 33  ? 115.276 91.004  58.474  1.00 262.95 ?  -41 DT  I "C5'" 1 
ATOM 6621  C "C4'" . DT  I 5 33  ? 114.728 92.131  57.617  1.00 262.95 ?  -41 DT  I "C4'" 1 
ATOM 6622  O "O4'" . DT  I 5 33  ? 113.750 92.898  58.369  1.00 262.95 ?  -41 DT  I "O4'" 1 
ATOM 6623  C "C3'" . DT  I 5 33  ? 115.770 93.139  57.128  1.00 262.95 ?  -41 DT  I "C3'" 1 
ATOM 6624  O "O3'" . DT  I 5 33  ? 115.568 93.404  55.751  1.00 262.95 ?  -41 DT  I "O3'" 1 
ATOM 6625  C "C2'" . DT  I 5 33  ? 115.482 94.374  57.980  1.00 262.95 ?  -41 DT  I "C2'" 1 
ATOM 6626  C "C1'" . DT  I 5 33  ? 113.981 94.264  58.138  1.00 262.95 ?  -41 DT  I "C1'" 1 
ATOM 6627  N N1    . DT  I 5 33  ? 113.447 95.039  59.279  1.00 262.95 ?  -41 DT  I N1    1 
ATOM 6628  C C2    . DT  I 5 33  ? 112.433 95.937  59.062  1.00 262.95 ?  -41 DT  I C2    1 
ATOM 6629  O O2    . DT  I 5 33  ? 111.924 96.117  57.974  1.00 262.95 ?  -41 DT  I O2    1 
ATOM 6630  N N3    . DT  I 5 33  ? 112.007 96.598  60.178  1.00 262.95 ?  -41 DT  I N3    1 
ATOM 6631  C C4    . DT  I 5 33  ? 112.499 96.467  61.457  1.00 262.95 ?  -41 DT  I C4    1 
ATOM 6632  O O4    . DT  I 5 33  ? 112.058 97.113  62.396  1.00 262.95 ?  -41 DT  I O4    1 
ATOM 6633  C C5    . DT  I 5 33  ? 113.571 95.518  61.611  1.00 262.95 ?  -41 DT  I C5    1 
ATOM 6634  C C7    . DT  I 5 33  ? 114.187 95.292  62.956  1.00 262.95 ?  -41 DT  I C7    1 
ATOM 6635  C C6    . DT  I 5 33  ? 113.990 94.859  60.527  1.00 262.95 ?  -41 DT  I C6    1 
ATOM 6636  P P     . DG  I 5 34  ? 116.671 94.213  54.910  1.00 266.36 ?  -40 DG  I P     1 
ATOM 6637  O OP1   . DG  I 5 34  ? 117.025 93.393  53.732  1.00 266.36 ?  -40 DG  I OP1   1 
ATOM 6638  O OP2   . DG  I 5 34  ? 117.733 94.631  55.847  1.00 266.36 -1 -40 DG  I OP2   1 
ATOM 6639  O "O5'" . DG  I 5 34  ? 115.897 95.528  54.427  1.00 266.36 ?  -40 DG  I "O5'" 1 
ATOM 6640  C "C5'" . DG  I 5 34  ? 115.952 96.716  55.209  1.00 266.36 ?  -40 DG  I "C5'" 1 
ATOM 6641  C "C4'" . DG  I 5 34  ? 114.635 97.467  55.152  1.00 266.36 ?  -40 DG  I "C4'" 1 
ATOM 6642  O "O4'" . DG  I 5 34  ? 114.029 97.481  56.470  1.00 266.36 ?  -40 DG  I "O4'" 1 
ATOM 6643  C "C3'" . DG  I 5 34  ? 114.757 98.929  54.718  1.00 266.36 ?  -40 DG  I "C3'" 1 
ATOM 6644  O "O3'" . DG  I 5 34  ? 113.826 99.219  53.689  1.00 266.36 ?  -40 DG  I "O3'" 1 
ATOM 6645  C "C2'" . DG  I 5 34  ? 114.455 99.721  55.989  1.00 266.36 ?  -40 DG  I "C2'" 1 
ATOM 6646  C "C1'" . DG  I 5 34  ? 113.547 98.773  56.751  1.00 266.36 ?  -40 DG  I "C1'" 1 
ATOM 6647  N N9    . DG  I 5 34  ? 113.582 98.984  58.197  1.00 266.36 ?  -40 DG  I N9    1 
ATOM 6648  C C8    . DG  I 5 34  ? 114.546 98.551  59.072  1.00 266.36 ?  -40 DG  I C8    1 
ATOM 6649  N N7    . DG  I 5 34  ? 114.319 98.896  60.307  1.00 266.36 ?  -40 DG  I N7    1 
ATOM 6650  C C5    . DG  I 5 34  ? 113.132 99.609  60.247  1.00 266.36 ?  -40 DG  I C5    1 
ATOM 6651  C C6    . DG  I 5 34  ? 112.392 100.229 61.276  1.00 266.36 ?  -40 DG  I C6    1 
ATOM 6652  O O6    . DG  I 5 34  ? 112.648 100.275 62.484  1.00 266.36 ?  -40 DG  I O6    1 
ATOM 6653  N N1    . DG  I 5 34  ? 111.247 100.842 60.790  1.00 266.36 ?  -40 DG  I N1    1 
ATOM 6654  C C2    . DG  I 5 34  ? 110.864 100.854 59.477  1.00 266.36 ?  -40 DG  I C2    1 
ATOM 6655  N N2    . DG  I 5 34  ? 109.725 101.498 59.200  1.00 266.36 ?  -40 DG  I N2    1 
ATOM 6656  N N3    . DG  I 5 34  ? 111.546 100.275 58.500  1.00 266.36 ?  -40 DG  I N3    1 
ATOM 6657  C C4    . DG  I 5 34  ? 112.666 99.674  58.957  1.00 266.36 ?  -40 DG  I C4    1 
ATOM 6658  P P     . DT  I 5 35  ? 113.927 100.605 52.883  1.00 268.97 ?  -39 DT  I P     1 
ATOM 6659  O OP1   . DT  I 5 35  ? 113.389 100.375 51.526  1.00 268.97 ?  -39 DT  I OP1   1 
ATOM 6660  O OP2   . DT  I 5 35  ? 115.297 101.134 53.054  1.00 268.97 -1 -39 DT  I OP2   1 
ATOM 6661  O "O5'" . DT  I 5 35  ? 112.939 101.579 53.674  1.00 268.97 ?  -39 DT  I "O5'" 1 
ATOM 6662  C "C5'" . DT  I 5 35  ? 111.610 101.162 53.955  1.00 268.97 ?  -39 DT  I "C5'" 1 
ATOM 6663  C "C4'" . DT  I 5 35  ? 110.827 102.276 54.624  1.00 268.97 ?  -39 DT  I "C4'" 1 
ATOM 6664  O "O4'" . DT  I 5 35  ? 111.059 102.247 56.058  1.00 268.97 ?  -39 DT  I "O4'" 1 
ATOM 6665  C "C3'" . DT  I 5 35  ? 111.193 103.687 54.159  1.00 268.97 ?  -39 DT  I "C3'" 1 
ATOM 6666  O "O3'" . DT  I 5 35  ? 110.016 104.432 53.896  1.00 268.97 ?  -39 DT  I "O3'" 1 
ATOM 6667  C "C2'" . DT  I 5 35  ? 111.967 104.260 55.345  1.00 268.97 ?  -39 DT  I "C2'" 1 
ATOM 6668  C "C1'" . DT  I 5 35  ? 111.294 103.558 56.510  1.00 268.97 ?  -39 DT  I "C1'" 1 
ATOM 6669  N N1    . DT  I 5 35  ? 112.130 103.498 57.753  1.00 268.97 ?  -39 DT  I N1    1 
ATOM 6670  C C2    . DT  I 5 35  ? 111.654 104.065 58.914  1.00 268.97 ?  -39 DT  I C2    1 
ATOM 6671  O O2    . DT  I 5 35  ? 110.575 104.619 58.994  1.00 268.97 ?  -39 DT  I O2    1 
ATOM 6672  N N3    . DT  I 5 35  ? 112.489 103.951 59.988  1.00 268.97 ?  -39 DT  I N3    1 
ATOM 6673  C C4    . DT  I 5 35  ? 113.726 103.345 60.020  1.00 268.97 ?  -39 DT  I C4    1 
ATOM 6674  O O4    . DT  I 5 35  ? 114.406 103.298 61.035  1.00 268.97 ?  -39 DT  I O4    1 
ATOM 6675  C C5    . DT  I 5 35  ? 114.168 102.776 58.776  1.00 268.97 ?  -39 DT  I C5    1 
ATOM 6676  C C7    . DT  I 5 35  ? 115.499 102.095 58.696  1.00 268.97 ?  -39 DT  I C7    1 
ATOM 6677  C C6    . DT  I 5 35  ? 113.361 102.879 57.713  1.00 268.97 ?  -39 DT  I C6    1 
ATOM 6678  P P     . DA  I 5 36  ? 110.108 105.841 53.130  1.00 258.15 ?  -38 DA  I P     1 
ATOM 6679  O OP1   . DA  I 5 36  ? 108.825 106.049 52.427  1.00 258.15 ?  -38 DA  I OP1   1 
ATOM 6680  O OP2   . DA  I 5 36  ? 111.379 105.868 52.375  1.00 258.15 -1 -38 DA  I OP2   1 
ATOM 6681  O "O5'" . DA  I 5 36  ? 110.223 106.910 54.311  1.00 258.15 ?  -38 DA  I "O5'" 1 
ATOM 6682  C "C5'" . DA  I 5 36  ? 109.164 107.041 55.242  1.00 258.15 ?  -38 DA  I "C5'" 1 
ATOM 6683  C "C4'" . DA  I 5 36  ? 109.659 107.638 56.544  1.00 258.15 ?  -38 DA  I "C4'" 1 
ATOM 6684  O "O4'" . DA  I 5 36  ? 110.773 106.873 57.031  1.00 258.15 ?  -38 DA  I "O4'" 1 
ATOM 6685  C "C3'" . DA  I 5 36  ? 110.157 109.079 56.449  1.00 258.15 ?  -38 DA  I "C3'" 1 
ATOM 6686  O "O3'" . DA  I 5 36  ? 109.208 109.949 57.054  1.00 258.15 ?  -38 DA  I "O3'" 1 
ATOM 6687  C "C2'" . DA  I 5 36  ? 111.498 109.074 57.204  1.00 258.15 ?  -38 DA  I "C2'" 1 
ATOM 6688  C "C1'" . DA  I 5 36  ? 111.539 107.700 57.854  1.00 258.15 ?  -38 DA  I "C1'" 1 
ATOM 6689  N N9    . DA  I 5 36  ? 112.885 107.148 57.939  1.00 258.15 ?  -38 DA  I N9    1 
ATOM 6690  C C8    . DA  I 5 36  ? 113.705 106.821 56.899  1.00 258.15 ?  -38 DA  I C8    1 
ATOM 6691  N N7    . DA  I 5 36  ? 114.867 106.345 57.270  1.00 258.15 ?  -38 DA  I N7    1 
ATOM 6692  C C5    . DA  I 5 36  ? 114.808 106.370 58.650  1.00 258.15 ?  -38 DA  I C5    1 
ATOM 6693  C C6    . DA  I 5 36  ? 115.730 106.000 59.643  1.00 258.15 ?  -38 DA  I C6    1 
ATOM 6694  N N6    . DA  I 5 36  ? 116.940 105.507 59.375  1.00 258.15 ?  -38 DA  I N6    1 
ATOM 6695  N N1    . DA  I 5 36  ? 115.358 106.152 60.930  1.00 258.15 ?  -38 DA  I N1    1 
ATOM 6696  C C2    . DA  I 5 36  ? 114.143 106.645 61.198  1.00 258.15 ?  -38 DA  I C2    1 
ATOM 6697  N N3    . DA  I 5 36  ? 113.193 107.028 60.349  1.00 258.15 ?  -38 DA  I N3    1 
ATOM 6698  C C4    . DA  I 5 36  ? 113.593 106.862 59.080  1.00 258.15 ?  -38 DA  I C4    1 
ATOM 6699  P P     . DT  I 5 37  ? 109.575 111.479 57.386  1.00 245.68 ?  -37 DT  I P     1 
ATOM 6700  O OP1   . DT  I 5 37  ? 108.314 112.245 57.303  1.00 245.68 ?  -37 DT  I OP1   1 
ATOM 6701  O OP2   . DT  I 5 37  ? 110.723 111.901 56.554  1.00 245.68 -1 -37 DT  I OP2   1 
ATOM 6702  O "O5'" . DT  I 5 37  ? 110.025 111.430 58.920  1.00 245.68 ?  -37 DT  I "O5'" 1 
ATOM 6703  C "C5'" . DT  I 5 37  ? 109.264 110.663 59.845  1.00 245.68 ?  -37 DT  I "C5'" 1 
ATOM 6704  C "C4'" . DT  I 5 37  ? 109.887 110.686 61.227  1.00 245.68 ?  -37 DT  I "C4'" 1 
ATOM 6705  O "O4'" . DT  I 5 37  ? 111.131 109.946 61.214  1.00 245.68 ?  -37 DT  I "O4'" 1 
ATOM 6706  C "C3'" . DT  I 5 37  ? 110.221 112.077 61.764  1.00 245.68 ?  -37 DT  I "C3'" 1 
ATOM 6707  O "O3'" . DT  I 5 37  ? 109.747 112.202 63.089  1.00 245.68 ?  -37 DT  I "O3'" 1 
ATOM 6708  C "C2'" . DT  I 5 37  ? 111.746 112.124 61.709  1.00 245.68 ?  -37 DT  I "C2'" 1 
ATOM 6709  C "C1'" . DT  I 5 37  ? 112.095 110.668 61.929  1.00 245.68 ?  -37 DT  I "C1'" 1 
ATOM 6710  N N1    . DT  I 5 37  ? 113.427 110.289 61.419  1.00 245.68 ?  -37 DT  I N1    1 
ATOM 6711  C C2    . DT  I 5 37  ? 114.407 109.945 62.310  1.00 245.68 ?  -37 DT  I C2    1 
ATOM 6712  O O2    . DT  I 5 37  ? 114.243 109.950 63.513  1.00 245.68 ?  -37 DT  I O2    1 
ATOM 6713  N N3    . DT  I 5 37  ? 115.601 109.606 61.745  1.00 245.68 ?  -37 DT  I N3    1 
ATOM 6714  C C4    . DT  I 5 37  ? 115.903 109.568 60.402  1.00 245.68 ?  -37 DT  I C4    1 
ATOM 6715  O O4    . DT  I 5 37  ? 117.010 109.246 59.988  1.00 245.68 ?  -37 DT  I O4    1 
ATOM 6716  C C5    . DT  I 5 37  ? 114.830 109.937 59.518  1.00 245.68 ?  -37 DT  I C5    1 
ATOM 6717  C C7    . DT  I 5 37  ? 115.047 109.935 58.035  1.00 245.68 ?  -37 DT  I C7    1 
ATOM 6718  C C6    . DT  I 5 37  ? 113.653 110.273 60.064  1.00 245.68 ?  -37 DT  I C6    1 
ATOM 6719  P P     . DT  I 5 38  ? 109.454 113.654 63.704  1.00 234.62 ?  -36 DT  I P     1 
ATOM 6720  O OP1   . DT  I 5 38  ? 108.179 113.581 64.448  1.00 234.62 ?  -36 DT  I OP1   1 
ATOM 6721  O OP2   . DT  I 5 38  ? 109.618 114.642 62.618  1.00 234.62 -1 -36 DT  I OP2   1 
ATOM 6722  O "O5'" . DT  I 5 38  ? 110.632 113.863 64.758  1.00 234.62 ?  -36 DT  I "O5'" 1 
ATOM 6723  C "C5'" . DT  I 5 38  ? 110.613 113.140 65.965  1.00 234.62 ?  -36 DT  I "C5'" 1 
ATOM 6724  C "C4'" . DT  I 5 38  ? 111.971 113.154 66.633  1.00 234.62 ?  -36 DT  I "C4'" 1 
ATOM 6725  O "O4'" . DT  I 5 38  ? 112.963 112.581 65.756  1.00 234.62 ?  -36 DT  I "O4'" 1 
ATOM 6726  C "C3'" . DT  I 5 38  ? 112.504 114.540 67.014  1.00 234.62 ?  -36 DT  I "C3'" 1 
ATOM 6727  O "O3'" . DT  I 5 38  ? 112.717 114.596 68.408  1.00 234.62 ?  -36 DT  I "O3'" 1 
ATOM 6728  C "C2'" . DT  I 5 38  ? 113.831 114.649 66.249  1.00 234.62 ?  -36 DT  I "C2'" 1 
ATOM 6729  C "C1'" . DT  I 5 38  ? 114.180 113.192 66.063  1.00 234.62 ?  -36 DT  I "C1'" 1 
ATOM 6730  N N1    . DT  I 5 38  ? 115.136 112.930 64.976  1.00 234.62 ?  -36 DT  I N1    1 
ATOM 6731  C C2    . DT  I 5 38  ? 116.353 112.390 65.291  1.00 234.62 ?  -36 DT  I C2    1 
ATOM 6732  O O2    . DT  I 5 38  ? 116.685 112.123 66.428  1.00 234.62 ?  -36 DT  I O2    1 
ATOM 6733  N N3    . DT  I 5 38  ? 117.174 112.167 64.229  1.00 234.62 ?  -36 DT  I N3    1 
ATOM 6734  C C4    . DT  I 5 38  ? 116.908 112.430 62.906  1.00 234.62 ?  -36 DT  I C4    1 
ATOM 6735  O O4    . DT  I 5 38  ? 117.721 112.200 62.021  1.00 234.62 ?  -36 DT  I O4    1 
ATOM 6736  C C5    . DT  I 5 38  ? 115.610 113.002 62.639  1.00 234.62 ?  -36 DT  I C5    1 
ATOM 6737  C C7    . DT  I 5 38  ? 115.209 113.329 61.235  1.00 234.62 ?  -36 DT  I C7    1 
ATOM 6738  C C6    . DT  I 5 38  ? 114.791 113.217 63.677  1.00 234.62 ?  -36 DT  I C6    1 
ATOM 6739  P P     . DT  I 5 39  ? 111.759 115.486 69.337  1.00 234.39 ?  -35 DT  I P     1 
ATOM 6740  O OP1   . DT  I 5 39  ? 110.396 114.927 69.232  1.00 234.39 ?  -35 DT  I OP1   1 
ATOM 6741  O OP2   . DT  I 5 39  ? 112.003 116.906 69.014  1.00 234.39 -1 -35 DT  I OP2   1 
ATOM 6742  O "O5'" . DT  I 5 39  ? 112.305 115.214 70.809  1.00 234.39 ?  -35 DT  I "O5'" 1 
ATOM 6743  C "C5'" . DT  I 5 39  ? 112.163 113.932 71.375  1.00 234.39 ?  -35 DT  I "C5'" 1 
ATOM 6744  C "C4'" . DT  I 5 39  ? 113.516 113.320 71.674  1.00 234.39 ?  -35 DT  I "C4'" 1 
ATOM 6745  O "O4'" . DT  I 5 39  ? 114.365 113.431 70.510  1.00 234.39 ?  -35 DT  I "O4'" 1 
ATOM 6746  C "C3'" . DT  I 5 39  ? 114.277 113.972 72.829  1.00 234.39 ?  -35 DT  I "C3'" 1 
ATOM 6747  O "O3'" . DT  I 5 39  ? 114.642 112.995 73.771  1.00 234.39 ?  -35 DT  I "O3'" 1 
ATOM 6748  C "C2'" . DT  I 5 39  ? 115.505 114.587 72.167  1.00 234.39 ?  -35 DT  I "C2'" 1 
ATOM 6749  C "C1'" . DT  I 5 39  ? 115.668 113.738 70.921  1.00 234.39 ?  -35 DT  I "C1'" 1 
ATOM 6750  N N1    . DT  I 5 39  ? 116.345 114.464 69.822  1.00 234.39 ?  -35 DT  I N1    1 
ATOM 6751  C C2    . DT  I 5 39  ? 117.275 113.815 69.050  1.00 234.39 ?  -35 DT  I C2    1 
ATOM 6752  O O2    . DT  I 5 39  ? 117.575 112.648 69.208  1.00 234.39 ?  -35 DT  I O2    1 
ATOM 6753  N N3    . DT  I 5 39  ? 117.840 114.584 68.074  1.00 234.39 ?  -35 DT  I N3    1 
ATOM 6754  C C4    . DT  I 5 39  ? 117.576 115.911 67.805  1.00 234.39 ?  -35 DT  I C4    1 
ATOM 6755  O O4    . DT  I 5 39  ? 118.136 116.524 66.907  1.00 234.39 ?  -35 DT  I O4    1 
ATOM 6756  C C5    . DT  I 5 39  ? 116.598 116.529 68.658  1.00 234.39 ?  -35 DT  I C5    1 
ATOM 6757  C C7    . DT  I 5 39  ? 116.228 117.967 68.463  1.00 234.39 ?  -35 DT  I C7    1 
ATOM 6758  C C6    . DT  I 5 39  ? 116.038 115.785 69.612  1.00 234.39 ?  -35 DT  I C6    1 
ATOM 6759  P P     . DG  I 5 40  ? 115.157 113.434 75.225  1.00 231.31 ?  -34 DG  I P     1 
ATOM 6760  O OP1   . DG  I 5 40  ? 114.824 112.348 76.169  1.00 231.31 ?  -34 DG  I OP1   1 
ATOM 6761  O OP2   . DG  I 5 40  ? 114.663 114.800 75.476  1.00 231.31 -1 -34 DG  I OP2   1 
ATOM 6762  O "O5'" . DG  I 5 40  ? 116.738 113.527 75.054  1.00 231.31 ?  -34 DG  I "O5'" 1 
ATOM 6763  C "C5'" . DG  I 5 40  ? 117.439 112.461 74.461  1.00 231.31 ?  -34 DG  I "C5'" 1 
ATOM 6764  C "C4'" . DG  I 5 40  ? 118.817 112.905 74.031  1.00 231.31 ?  -34 DG  I "C4'" 1 
ATOM 6765  O "O4'" . DG  I 5 40  ? 118.718 113.738 72.847  1.00 231.31 ?  -34 DG  I "O4'" 1 
ATOM 6766  C "C3'" . DG  I 5 40  ? 119.579 113.740 75.065  1.00 231.31 ?  -34 DG  I "C3'" 1 
ATOM 6767  O "O3'" . DG  I 5 40  ? 120.892 113.246 75.196  1.00 231.31 ?  -34 DG  I "O3'" 1 
ATOM 6768  C "C2'" . DG  I 5 40  ? 119.581 115.133 74.444  1.00 231.31 ?  -34 DG  I "C2'" 1 
ATOM 6769  C "C1'" . DG  I 5 40  ? 119.659 114.763 72.984  1.00 231.31 ?  -34 DG  I "C1'" 1 
ATOM 6770  N N9    . DG  I 5 40  ? 119.354 115.854 72.061  1.00 231.31 ?  -34 DG  I N9    1 
ATOM 6771  C C8    . DG  I 5 40  ? 118.323 116.753 72.141  1.00 231.31 ?  -34 DG  I C8    1 
ATOM 6772  N N7    . DG  I 5 40  ? 118.318 117.621 71.168  1.00 231.31 ?  -34 DG  I N7    1 
ATOM 6773  C C5    . DG  I 5 40  ? 119.415 117.274 70.401  1.00 231.31 ?  -34 DG  I C5    1 
ATOM 6774  C C6    . DG  I 5 40  ? 119.916 117.852 69.219  1.00 231.31 ?  -34 DG  I C6    1 
ATOM 6775  O O6    . DG  I 5 40  ? 119.473 118.821 68.591  1.00 231.31 ?  -34 DG  I O6    1 
ATOM 6776  N N1    . DG  I 5 40  ? 121.050 117.194 68.765  1.00 231.31 ?  -34 DG  I N1    1 
ATOM 6777  C C2    . DG  I 5 40  ? 121.626 116.115 69.380  1.00 231.31 ?  -34 DG  I C2    1 
ATOM 6778  N N2    . DG  I 5 40  ? 122.718 115.610 68.794  1.00 231.31 ?  -34 DG  I N2    1 
ATOM 6779  N N3    . DG  I 5 40  ? 121.165 115.563 70.486  1.00 231.31 ?  -34 DG  I N3    1 
ATOM 6780  C C4    . DG  I 5 40  ? 120.064 116.194 70.940  1.00 231.31 ?  -34 DG  I C4    1 
ATOM 6781  P P     . DG  I 5 41  ? 121.769 113.632 76.482  1.00 233.54 ?  -33 DG  I P     1 
ATOM 6782  O OP1   . DG  I 5 41  ? 121.544 112.594 77.506  1.00 233.54 ?  -33 DG  I OP1   1 
ATOM 6783  O OP2   . DG  I 5 41  ? 121.524 115.050 76.804  1.00 233.54 -1 -33 DG  I OP2   1 
ATOM 6784  O "O5'" . DG  I 5 41  ? 123.268 113.520 75.967  1.00 233.54 ?  -33 DG  I "O5'" 1 
ATOM 6785  C "C5'" . DG  I 5 41  ? 123.776 112.274 75.560  1.00 233.54 ?  -33 DG  I "C5'" 1 
ATOM 6786  C "C4'" . DG  I 5 41  ? 124.577 112.415 74.286  1.00 233.54 ?  -33 DG  I "C4'" 1 
ATOM 6787  O "O4'" . DG  I 5 41  ? 123.893 113.316 73.384  1.00 233.54 ?  -33 DG  I "O4'" 1 
ATOM 6788  C "C3'" . DG  I 5 41  ? 125.980 112.984 74.457  1.00 233.54 ?  -33 DG  I "C3'" 1 
ATOM 6789  O "O3'" . DG  I 5 41  ? 126.844 112.362 73.545  1.00 233.54 ?  -33 DG  I "O3'" 1 
ATOM 6790  C "C2'" . DG  I 5 41  ? 125.794 114.455 74.118  1.00 233.54 ?  -33 DG  I "C2'" 1 
ATOM 6791  C "C1'" . DG  I 5 41  ? 124.751 114.373 73.021  1.00 233.54 ?  -33 DG  I "C1'" 1 
ATOM 6792  N N9    . DG  I 5 41  ? 123.943 115.574 72.888  1.00 233.54 ?  -33 DG  I N9    1 
ATOM 6793  C C8    . DG  I 5 41  ? 122.899 115.949 73.685  1.00 233.54 ?  -33 DG  I C8    1 
ATOM 6794  N N7    . DG  I 5 41  ? 122.341 117.066 73.320  1.00 233.54 ?  -33 DG  I N7    1 
ATOM 6795  C C5    . DG  I 5 41  ? 123.066 117.456 72.211  1.00 233.54 ?  -33 DG  I C5    1 
ATOM 6796  C C6    . DG  I 5 41  ? 122.918 118.585 71.391  1.00 233.54 ?  -33 DG  I C6    1 
ATOM 6797  O O6    . DG  I 5 41  ? 122.098 119.501 71.497  1.00 233.54 ?  -33 DG  I O6    1 
ATOM 6798  N N1    . DG  I 5 41  ? 123.857 118.606 70.371  1.00 233.54 ?  -33 DG  I N1    1 
ATOM 6799  C C2    . DG  I 5 41  ? 124.809 117.641 70.164  1.00 233.54 ?  -33 DG  I C2    1 
ATOM 6800  N N2    . DG  I 5 41  ? 125.630 117.830 69.122  1.00 233.54 ?  -33 DG  I N2    1 
ATOM 6801  N N3    . DG  I 5 41  ? 124.957 116.573 70.929  1.00 233.54 ?  -33 DG  I N3    1 
ATOM 6802  C C4    . DG  I 5 41  ? 124.051 116.546 71.927  1.00 233.54 ?  -33 DG  I C4    1 
ATOM 6803  P P     . DA  I 5 42  ? 128.419 112.315 73.833  1.00 226.97 ?  -32 DA  I P     1 
ATOM 6804  O OP1   . DA  I 5 42  ? 128.954 111.246 72.966  1.00 226.97 ?  -32 DA  I OP1   1 
ATOM 6805  O OP2   . DA  I 5 42  ? 128.630 112.260 75.295  1.00 226.97 -1 -32 DA  I OP2   1 
ATOM 6806  O "O5'" . DA  I 5 42  ? 128.947 113.726 73.302  1.00 226.97 ?  -32 DA  I "O5'" 1 
ATOM 6807  C "C5'" . DA  I 5 42  ? 129.004 113.967 71.914  1.00 226.97 ?  -32 DA  I "C5'" 1 
ATOM 6808  C "C4'" . DA  I 5 42  ? 129.243 115.434 71.616  1.00 226.97 ?  -32 DA  I "C4'" 1 
ATOM 6809  O "O4'" . DA  I 5 42  ? 128.039 116.186 71.833  1.00 226.97 ?  -32 DA  I "O4'" 1 
ATOM 6810  C "C3'" . DA  I 5 42  ? 130.313 116.119 72.468  1.00 226.97 ?  -32 DA  I "C3'" 1 
ATOM 6811  O "O3'" . DA  I 5 42  ? 131.436 116.402 71.662  1.00 226.97 ?  -32 DA  I "O3'" 1 
ATOM 6812  C "C2'" . DA  I 5 42  ? 129.633 117.410 72.970  1.00 226.97 ?  -32 DA  I "C2'" 1 
ATOM 6813  C "C1'" . DA  I 5 42  ? 128.416 117.509 72.066  1.00 226.97 ?  -32 DA  I "C1'" 1 
ATOM 6814  N N9    . DA  I 5 42  ? 127.285 118.209 72.656  1.00 226.97 ?  -32 DA  I N9    1 
ATOM 6815  C C8    . DA  I 5 42  ? 126.570 117.836 73.752  1.00 226.97 ?  -32 DA  I C8    1 
ATOM 6816  N N7    . DA  I 5 42  ? 125.591 118.653 74.047  1.00 226.97 ?  -32 DA  I N7    1 
ATOM 6817  C C5    . DA  I 5 42  ? 125.672 119.627 73.074  1.00 226.97 ?  -32 DA  I C5    1 
ATOM 6818  C C6    . DA  I 5 42  ? 124.917 120.784 72.831  1.00 226.97 ?  -32 DA  I C6    1 
ATOM 6819  N N6    . DA  I 5 42  ? 123.885 121.156 73.589  1.00 226.97 ?  -32 DA  I N6    1 
ATOM 6820  N N1    . DA  I 5 42  ? 125.257 121.544 71.771  1.00 226.97 ?  -32 DA  I N1    1 
ATOM 6821  C C2    . DA  I 5 42  ? 126.284 121.162 71.007  1.00 226.97 ?  -32 DA  I C2    1 
ATOM 6822  N N3    . DA  I 5 42  ? 127.074 120.100 71.145  1.00 226.97 ?  -32 DA  I N3    1 
ATOM 6823  C C4    . DA  I 5 42  ? 126.710 119.370 72.208  1.00 226.97 ?  -32 DA  I C4    1 
ATOM 6824  P P     . DA  I 5 43  ? 132.704 117.168 72.276  1.00 228.92 ?  -31 DA  I P     1 
ATOM 6825  O OP1   . DA  I 5 43  ? 133.910 116.634 71.610  1.00 228.92 ?  -31 DA  I OP1   1 
ATOM 6826  O OP2   . DA  I 5 43  ? 132.595 117.120 73.747  1.00 228.92 -1 -31 DA  I OP2   1 
ATOM 6827  O "O5'" . DA  I 5 43  ? 132.488 118.682 71.820  1.00 228.92 ?  -31 DA  I "O5'" 1 
ATOM 6828  C "C5'" . DA  I 5 43  ? 132.382 118.989 70.442  1.00 228.92 ?  -31 DA  I "C5'" 1 
ATOM 6829  C "C4'" . DA  I 5 43  ? 132.124 120.467 70.240  1.00 228.92 ?  -31 DA  I "C4'" 1 
ATOM 6830  O "O4'" . DA  I 5 43  ? 130.796 120.790 70.713  1.00 228.92 ?  -31 DA  I "O4'" 1 
ATOM 6831  C "C3'" . DA  I 5 43  ? 133.086 121.394 70.987  1.00 228.92 ?  -31 DA  I "C3'" 1 
ATOM 6832  O "O3'" . DA  I 5 43  ? 133.602 122.375 70.107  1.00 228.92 ?  -31 DA  I "O3'" 1 
ATOM 6833  C "C2'" . DA  I 5 43  ? 132.218 122.022 72.076  1.00 228.92 ?  -31 DA  I "C2'" 1 
ATOM 6834  C "C1'" . DA  I 5 43  ? 130.844 121.989 71.436  1.00 228.92 ?  -31 DA  I "C1'" 1 
ATOM 6835  N N9    . DA  I 5 43  ? 129.764 121.982 72.407  1.00 228.92 ?  -31 DA  I N9    1 
ATOM 6836  C C8    . DA  I 5 43  ? 129.537 121.053 73.376  1.00 228.92 ?  -31 DA  I C8    1 
ATOM 6837  N N7    . DA  I 5 43  ? 128.487 121.308 74.115  1.00 228.92 ?  -31 DA  I N7    1 
ATOM 6838  C C5    . DA  I 5 43  ? 127.998 122.488 73.593  1.00 228.92 ?  -31 DA  I C5    1 
ATOM 6839  C C6    . DA  I 5 43  ? 126.893 123.284 73.927  1.00 228.92 ?  -31 DA  I C6    1 
ATOM 6840  N N6    . DA  I 5 43  ? 126.056 122.993 74.921  1.00 228.92 ?  -31 DA  I N6    1 
ATOM 6841  N N1    . DA  I 5 43  ? 126.678 124.397 73.200  1.00 228.92 ?  -31 DA  I N1    1 
ATOM 6842  C C2    . DA  I 5 43  ? 127.517 124.686 72.201  1.00 228.92 ?  -31 DA  I C2    1 
ATOM 6843  N N3    . DA  I 5 43  ? 128.590 124.015 71.798  1.00 228.92 ?  -31 DA  I N3    1 
ATOM 6844  C C4    . DA  I 5 43  ? 128.768 122.911 72.534  1.00 228.92 ?  -31 DA  I C4    1 
ATOM 6845  P P     . DA  I 5 44  ? 134.724 123.401 70.623  1.00 232.93 ?  -30 DA  I P     1 
ATOM 6846  O OP1   . DA  I 5 44  ? 135.633 123.682 69.493  1.00 232.93 ?  -30 DA  I OP1   1 
ATOM 6847  O OP2   . DA  I 5 44  ? 135.267 122.874 71.892  1.00 232.93 -1 -30 DA  I OP2   1 
ATOM 6848  O "O5'" . DA  I 5 44  ? 133.901 124.728 70.951  1.00 232.93 ?  -30 DA  I "O5'" 1 
ATOM 6849  C "C5'" . DA  I 5 44  ? 133.177 125.370 69.921  1.00 232.93 ?  -30 DA  I "C5'" 1 
ATOM 6850  C "C4'" . DA  I 5 44  ? 132.368 126.528 70.471  1.00 232.93 ?  -30 DA  I "C4'" 1 
ATOM 6851  O "O4'" . DA  I 5 44  ? 131.300 126.022 71.309  1.00 232.93 ?  -30 DA  I "O4'" 1 
ATOM 6852  C "C3'" . DA  I 5 44  ? 133.157 127.520 71.330  1.00 232.93 ?  -30 DA  I "C3'" 1 
ATOM 6853  O "O3'" . DA  I 5 44  ? 132.927 128.841 70.872  1.00 232.93 ?  -30 DA  I "O3'" 1 
ATOM 6854  C "C2'" . DA  I 5 44  ? 132.600 127.308 72.739  1.00 232.93 ?  -30 DA  I "C2'" 1 
ATOM 6855  C "C1'" . DA  I 5 44  ? 131.190 126.835 72.446  1.00 232.93 ?  -30 DA  I "C1'" 1 
ATOM 6856  N N9    . DA  I 5 44  ? 130.614 126.040 73.518  1.00 232.93 ?  -30 DA  I N9    1 
ATOM 6857  C C8    . DA  I 5 44  ? 131.029 124.814 73.943  1.00 232.93 ?  -30 DA  I C8    1 
ATOM 6858  N N7    . DA  I 5 44  ? 130.318 124.329 74.932  1.00 232.93 ?  -30 DA  I N7    1 
ATOM 6859  C C5    . DA  I 5 44  ? 129.377 125.311 75.173  1.00 232.93 ?  -30 DA  I C5    1 
ATOM 6860  C C6    . DA  I 5 44  ? 128.329 125.412 76.104  1.00 232.93 ?  -30 DA  I C6    1 
ATOM 6861  N N6    . DA  I 5 44  ? 128.046 124.461 76.998  1.00 232.93 ?  -30 DA  I N6    1 
ATOM 6862  N N1    . DA  I 5 44  ? 127.577 126.533 76.082  1.00 232.93 ?  -30 DA  I N1    1 
ATOM 6863  C C2    . DA  I 5 44  ? 127.857 127.480 75.181  1.00 232.93 ?  -30 DA  I C2    1 
ATOM 6864  N N3    . DA  I 5 44  ? 128.820 127.498 74.262  1.00 232.93 ?  -30 DA  I N3    1 
ATOM 6865  C C4    . DA  I 5 44  ? 129.547 126.373 74.310  1.00 232.93 ?  -30 DA  I C4    1 
ATOM 6866  P P     . DC  I 5 45  ? 133.622 130.084 71.611  1.00 232.22 ?  -29 DC  I P     1 
ATOM 6867  O OP1   . DC  I 5 45  ? 133.928 131.101 70.581  1.00 232.22 ?  -29 DC  I OP1   1 
ATOM 6868  O OP2   . DC  I 5 45  ? 134.699 129.552 72.475  1.00 232.22 -1 -29 DC  I OP2   1 
ATOM 6869  O "O5'" . DC  I 5 45  ? 132.472 130.655 72.559  1.00 232.22 ?  -29 DC  I "O5'" 1 
ATOM 6870  C "C5'" . DC  I 5 45  ? 131.286 131.185 71.992  1.00 232.22 ?  -29 DC  I "C5'" 1 
ATOM 6871  C "C4'" . DC  I 5 45  ? 130.402 131.796 73.061  1.00 232.22 ?  -29 DC  I "C4'" 1 
ATOM 6872  O "O4'" . DC  I 5 45  ? 129.912 130.751 73.939  1.00 232.22 ?  -29 DC  I "O4'" 1 
ATOM 6873  C "C3'" . DC  I 5 45  ? 131.093 132.822 73.960  1.00 232.22 ?  -29 DC  I "C3'" 1 
ATOM 6874  O "O3'" . DC  I 5 45  ? 130.257 133.945 74.141  1.00 232.22 ?  -29 DC  I "O3'" 1 
ATOM 6875  C "C2'" . DC  I 5 45  ? 131.292 132.067 75.268  1.00 232.22 ?  -29 DC  I "C2'" 1 
ATOM 6876  C "C1'" . DC  I 5 45  ? 130.093 131.141 75.276  1.00 232.22 ?  -29 DC  I "C1'" 1 
ATOM 6877  N N1    . DC  I 5 45  ? 130.314 129.926 76.085  1.00 232.22 ?  -29 DC  I N1    1 
ATOM 6878  C C2    . DC  I 5 45  ? 129.497 129.662 77.186  1.00 232.22 ?  -29 DC  I C2    1 
ATOM 6879  O O2    . DC  I 5 45  ? 128.581 130.441 77.459  1.00 232.22 ?  -29 DC  I O2    1 
ATOM 6880  N N3    . DC  I 5 45  ? 129.721 128.545 77.909  1.00 232.22 ?  -29 DC  I N3    1 
ATOM 6881  C C4    . DC  I 5 45  ? 130.715 127.725 77.576  1.00 232.22 ?  -29 DC  I C4    1 
ATOM 6882  N N4    . DC  I 5 45  ? 130.904 126.636 78.323  1.00 232.22 ?  -29 DC  I N4    1 
ATOM 6883  C C5    . DC  I 5 45  ? 131.566 127.985 76.469  1.00 232.22 ?  -29 DC  I C5    1 
ATOM 6884  C C6    . DC  I 5 45  ? 131.329 129.084 75.757  1.00 232.22 ?  -29 DC  I C6    1 
ATOM 6885  P P     . DT  I 5 46  ? 130.843 135.306 74.762  1.00 225.82 ?  -28 DT  I P     1 
ATOM 6886  O OP1   . DT  I 5 46  ? 131.004 136.267 73.652  1.00 225.82 ?  -28 DT  I OP1   1 
ATOM 6887  O OP2   . DT  I 5 46  ? 131.989 134.989 75.638  1.00 225.82 -1 -28 DT  I OP2   1 
ATOM 6888  O "O5'" . DT  I 5 46  ? 129.663 135.813 75.696  1.00 225.82 ?  -28 DT  I "O5'" 1 
ATOM 6889  C "C5'" . DT  I 5 46  ? 128.341 135.752 75.221  1.00 225.82 ?  -28 DT  I "C5'" 1 
ATOM 6890  C "C4'" . DT  I 5 46  ? 127.369 135.607 76.369  1.00 225.82 ?  -28 DT  I "C4'" 1 
ATOM 6891  O "O4'" . DT  I 5 46  ? 127.578 134.332 77.028  1.00 225.82 ?  -28 DT  I "O4'" 1 
ATOM 6892  C "C3'" . DT  I 5 46  ? 127.497 136.675 77.455  1.00 225.82 ?  -28 DT  I "C3'" 1 
ATOM 6893  O "O3'" . DT  I 5 46  ? 126.214 137.180 77.772  1.00 225.82 ?  -28 DT  I "O3'" 1 
ATOM 6894  C "C2'" . DT  I 5 46  ? 128.110 135.915 78.633  1.00 225.82 ?  -28 DT  I "C2'" 1 
ATOM 6895  C "C1'" . DT  I 5 46  ? 127.532 134.529 78.419  1.00 225.82 ?  -28 DT  I "C1'" 1 
ATOM 6896  N N1    . DT  I 5 46  ? 128.294 133.423 79.093  1.00 225.82 ?  -28 DT  I N1    1 
ATOM 6897  C C2    . DT  I 5 46  ? 127.656 132.639 80.025  1.00 225.82 ?  -28 DT  I C2    1 
ATOM 6898  O O2    . DT  I 5 46  ? 126.496 132.797 80.349  1.00 225.82 ?  -28 DT  I O2    1 
ATOM 6899  N N3    . DT  I 5 46  ? 128.428 131.659 80.570  1.00 225.82 ?  -28 DT  I N3    1 
ATOM 6900  C C4    . DT  I 5 46  ? 129.742 131.380 80.279  1.00 225.82 ?  -28 DT  I C4    1 
ATOM 6901  O O4    . DT  I 5 46  ? 130.354 130.479 80.830  1.00 225.82 ?  -28 DT  I O4    1 
ATOM 6902  C C5    . DT  I 5 46  ? 130.356 132.234 79.303  1.00 225.82 ?  -28 DT  I C5    1 
ATOM 6903  C C7    . DT  I 5 46  ? 131.785 132.018 78.916  1.00 225.82 ?  -28 DT  I C7    1 
ATOM 6904  C C6    . DT  I 5 46  ? 129.611 133.203 78.757  1.00 225.82 ?  -28 DT  I C6    1 
ATOM 6905  P P     . DG  I 5 47  ? 126.067 138.559 78.577  1.00 226.22 ?  -27 DG  I P     1 
ATOM 6906  O OP1   . DG  I 5 47  ? 124.748 139.136 78.242  1.00 226.22 ?  -27 DG  I OP1   1 
ATOM 6907  O OP2   . DG  I 5 47  ? 127.300 139.342 78.354  1.00 226.22 -1 -27 DG  I OP2   1 
ATOM 6908  O "O5'" . DG  I 5 47  ? 126.055 138.101 80.105  1.00 226.22 ?  -27 DG  I "O5'" 1 
ATOM 6909  C "C5'" . DG  I 5 47  ? 125.111 137.143 80.546  1.00 226.22 ?  -27 DG  I "C5'" 1 
ATOM 6910  C "C4'" . DG  I 5 47  ? 125.497 136.597 81.904  1.00 226.22 ?  -27 DG  I "C4'" 1 
ATOM 6911  O "O4'" . DG  I 5 47  ? 126.655 135.734 81.772  1.00 226.22 ?  -27 DG  I "O4'" 1 
ATOM 6912  C "C3'" . DG  I 5 47  ? 125.873 137.657 82.942  1.00 226.22 ?  -27 DG  I "C3'" 1 
ATOM 6913  O "O3'" . DG  I 5 47  ? 125.225 137.377 84.158  1.00 226.22 ?  -27 DG  I "O3'" 1 
ATOM 6914  C "C2'" . DG  I 5 47  ? 127.383 137.499 83.079  1.00 226.22 ?  -27 DG  I "C2'" 1 
ATOM 6915  C "C1'" . DG  I 5 47  ? 127.549 136.017 82.813  1.00 226.22 ?  -27 DG  I "C1'" 1 
ATOM 6916  N N9    . DG  I 5 47  ? 128.889 135.659 82.384  1.00 226.22 ?  -27 DG  I N9    1 
ATOM 6917  C C8    . DG  I 5 47  ? 129.750 136.431 81.654  1.00 226.22 ?  -27 DG  I C8    1 
ATOM 6918  N N7    . DG  I 5 47  ? 130.891 135.854 81.416  1.00 226.22 ?  -27 DG  I N7    1 
ATOM 6919  C C5    . DG  I 5 47  ? 130.780 134.621 82.035  1.00 226.22 ?  -27 DG  I C5    1 
ATOM 6920  C C6    . DG  I 5 47  ? 131.709 133.566 82.120  1.00 226.22 ?  -27 DG  I C6    1 
ATOM 6921  O O6    . DG  I 5 47  ? 132.852 133.511 81.649  1.00 226.22 ?  -27 DG  I O6    1 
ATOM 6922  N N1    . DG  I 5 47  ? 131.203 132.495 82.844  1.00 226.22 ?  -27 DG  I N1    1 
ATOM 6923  C C2    . DG  I 5 47  ? 129.954 132.451 83.409  1.00 226.22 ?  -27 DG  I C2    1 
ATOM 6924  N N2    . DG  I 5 47  ? 129.640 131.326 84.066  1.00 226.22 ?  -27 DG  I N2    1 
ATOM 6925  N N3    . DG  I 5 47  ? 129.072 133.437 83.336  1.00 226.22 ?  -27 DG  I N3    1 
ATOM 6926  C C4    . DG  I 5 47  ? 129.553 134.486 82.637  1.00 226.22 ?  -27 DG  I C4    1 
ATOM 6927  P P     . DC  I 5 48  ? 124.244 138.460 84.818  1.00 225.50 ?  -26 DC  I P     1 
ATOM 6928  O OP1   . DC  I 5 48  ? 123.262 138.854 83.787  1.00 225.50 ?  -26 DC  I OP1   1 
ATOM 6929  O OP2   . DC  I 5 48  ? 125.072 139.490 85.479  1.00 225.50 -1 -26 DC  I OP2   1 
ATOM 6930  O "O5'" . DC  I 5 48  ? 123.490 137.627 85.950  1.00 225.50 ?  -26 DC  I "O5'" 1 
ATOM 6931  C "C5'" . DC  I 5 48  ? 122.692 136.519 85.580  1.00 225.50 ?  -26 DC  I "C5'" 1 
ATOM 6932  C "C4'" . DC  I 5 48  ? 123.093 135.279 86.353  1.00 225.50 ?  -26 DC  I "C4'" 1 
ATOM 6933  O "O4'" . DC  I 5 48  ? 124.469 134.940 86.055  1.00 225.50 ?  -26 DC  I "O4'" 1 
ATOM 6934  C "C3'" . DC  I 5 48  ? 123.003 135.407 87.871  1.00 225.50 ?  -26 DC  I "C3'" 1 
ATOM 6935  O "O3'" . DC  I 5 48  ? 122.342 134.278 88.396  1.00 225.50 ?  -26 DC  I "O3'" 1 
ATOM 6936  C "C2'" . DC  I 5 48  ? 124.465 135.462 88.314  1.00 225.50 ?  -26 DC  I "C2'" 1 
ATOM 6937  C "C1'" . DC  I 5 48  ? 125.133 134.616 87.248  1.00 225.50 ?  -26 DC  I "C1'" 1 
ATOM 6938  N N1    . DC  I 5 48  ? 126.589 134.899 87.071  1.00 225.50 ?  -26 DC  I N1    1 
ATOM 6939  C C2    . DC  I 5 48  ? 127.531 133.926 87.416  1.00 225.50 ?  -26 DC  I C2    1 
ATOM 6940  O O2    . DC  I 5 48  ? 127.144 132.845 87.865  1.00 225.50 ?  -26 DC  I O2    1 
ATOM 6941  N N3    . DC  I 5 48  ? 128.844 134.193 87.242  1.00 225.50 ?  -26 DC  I N3    1 
ATOM 6942  C C4    . DC  I 5 48  ? 129.223 135.364 86.750  1.00 225.50 ?  -26 DC  I C4    1 
ATOM 6943  N N4    . DC  I 5 48  ? 130.529 135.577 86.596  1.00 225.50 ?  -26 DC  I N4    1 
ATOM 6944  C C5    . DC  I 5 48  ? 128.283 136.369 86.391  1.00 225.50 ?  -26 DC  I C5    1 
ATOM 6945  C C6    . DC  I 5 48  ? 126.988 136.096 86.565  1.00 225.50 ?  -26 DC  I C6    1 
ATOM 6946  P P     . DT  I 5 49  ? 121.853 134.264 89.923  1.00 226.14 ?  -25 DT  I P     1 
ATOM 6947  O OP1   . DT  I 5 49  ? 120.674 133.377 90.016  1.00 226.14 ?  -25 DT  I OP1   1 
ATOM 6948  O OP2   . DT  I 5 49  ? 121.768 135.664 90.384  1.00 226.14 -1 -25 DT  I OP2   1 
ATOM 6949  O "O5'" . DT  I 5 49  ? 123.060 133.565 90.690  1.00 226.14 ?  -25 DT  I "O5'" 1 
ATOM 6950  C "C5'" . DT  I 5 49  ? 123.574 132.344 90.207  1.00 226.14 ?  -25 DT  I "C5'" 1 
ATOM 6951  C "C4'" . DT  I 5 49  ? 124.813 131.944 90.976  1.00 226.14 ?  -25 DT  I "C4'" 1 
ATOM 6952  O "O4'" . DT  I 5 49  ? 125.961 132.659 90.461  1.00 226.14 ?  -25 DT  I "O4'" 1 
ATOM 6953  C "C3'" . DT  I 5 49  ? 124.764 132.241 92.473  1.00 226.14 ?  -25 DT  I "C3'" 1 
ATOM 6954  O "O3'" . DT  I 5 49  ? 125.205 131.115 93.180  1.00 226.14 ?  -25 DT  I "O3'" 1 
ATOM 6955  C "C2'" . DT  I 5 49  ? 125.732 133.413 92.634  1.00 226.14 ?  -25 DT  I "C2'" 1 
ATOM 6956  C "C1'" . DT  I 5 49  ? 126.733 133.116 91.538  1.00 226.14 ?  -25 DT  I "C1'" 1 
ATOM 6957  N N1    . DT  I 5 49  ? 127.512 134.301 91.092  1.00 226.14 ?  -25 DT  I N1    1 
ATOM 6958  C C2    . DT  I 5 49  ? 128.839 134.150 90.779  1.00 226.14 ?  -25 DT  I C2    1 
ATOM 6959  O O2    . DT  I 5 49  ? 129.424 133.089 90.853  1.00 226.14 ?  -25 DT  I O2    1 
ATOM 6960  N N3    . DT  I 5 49  ? 129.465 135.292 90.375  1.00 226.14 ?  -25 DT  I N3    1 
ATOM 6961  C C4    . DT  I 5 49  ? 128.909 136.546 90.252  1.00 226.14 ?  -25 DT  I C4    1 
ATOM 6962  O O4    . DT  I 5 49  ? 129.558 137.516 89.881  1.00 226.14 ?  -25 DT  I O4    1 
ATOM 6963  C C5    . DT  I 5 49  ? 127.514 136.637 90.595  1.00 226.14 ?  -25 DT  I C5    1 
ATOM 6964  C C7    . DT  I 5 49  ? 126.803 137.952 90.502  1.00 226.14 ?  -25 DT  I C7    1 
ATOM 6965  C C6    . DT  I 5 49  ? 126.889 135.522 90.994  1.00 226.14 ?  -25 DT  I C6    1 
ATOM 6966  P P     . DC  I 5 50  ? 124.864 130.952 94.735  1.00 203.87 ?  -24 DC  I P     1 
ATOM 6967  O OP1   . DC  I 5 50  ? 123.749 129.995 94.850  1.00 203.87 ?  -24 DC  I OP1   1 
ATOM 6968  O OP2   . DC  I 5 50  ? 124.723 132.297 95.324  1.00 203.87 -1 -24 DC  I OP2   1 
ATOM 6969  O "O5'" . DC  I 5 50  ? 126.183 130.287 95.325  1.00 203.87 ?  -24 DC  I "O5'" 1 
ATOM 6970  C "C5'" . DC  I 5 50  ? 126.823 129.241 94.613  1.00 203.87 ?  -24 DC  I "C5'" 1 
ATOM 6971  C "C4'" . DC  I 5 50  ? 128.315 129.212 94.896  1.00 203.87 ?  -24 DC  I "C4'" 1 
ATOM 6972  O "O4'" . DC  I 5 50  ? 128.961 130.312 94.212  1.00 203.87 ?  -24 DC  I "O4'" 1 
ATOM 6973  C "C3'" . DC  I 5 50  ? 128.710 129.346 96.366  1.00 203.87 ?  -24 DC  I "C3'" 1 
ATOM 6974  O "O3'" . DC  I 5 50  ? 129.792 128.499 96.647  1.00 203.87 ?  -24 DC  I "O3'" 1 
ATOM 6975  C "C2'" . DC  I 5 50  ? 129.134 130.801 96.466  1.00 203.87 ?  -24 DC  I "C2'" 1 
ATOM 6976  C "C1'" . DC  I 5 50  ? 129.793 130.991 95.119  1.00 203.87 ?  -24 DC  I "C1'" 1 
ATOM 6977  N N1    . DC  I 5 50  ? 129.890 132.408 94.695  1.00 203.87 ?  -24 DC  I N1    1 
ATOM 6978  C C2    . DC  I 5 50  ? 131.137 132.958 94.398  1.00 203.87 ?  -24 DC  I C2    1 
ATOM 6979  O O2    . DC  I 5 50  ? 132.146 132.254 94.495  1.00 203.87 ?  -24 DC  I O2    1 
ATOM 6980  N N3    . DC  I 5 50  ? 131.205 134.248 94.009  1.00 203.87 ?  -24 DC  I N3    1 
ATOM 6981  C C4    . DC  I 5 50  ? 130.094 134.971 93.915  1.00 203.87 ?  -24 DC  I C4    1 
ATOM 6982  N N4    . DC  I 5 50  ? 130.210 136.240 93.528  1.00 203.87 ?  -24 DC  I N4    1 
ATOM 6983  C C5    . DC  I 5 50  ? 128.817 134.431 94.216  1.00 203.87 ?  -24 DC  I C5    1 
ATOM 6984  C C6    . DC  I 5 50  ? 128.761 133.157 94.596  1.00 203.87 ?  -24 DC  I C6    1 
ATOM 6985  P P     . DC  I 5 51  ? 130.088 128.050 98.156  1.00 213.65 ?  -23 DC  I P     1 
ATOM 6986  O OP1   . DC  I 5 51  ? 129.589 126.675 98.333  1.00 213.65 ?  -23 DC  I OP1   1 
ATOM 6987  O OP2   . DC  I 5 51  ? 129.617 129.128 99.042  1.00 213.65 -1 -23 DC  I OP2   1 
ATOM 6988  O "O5'" . DC  I 5 51  ? 131.672 128.001 98.234  1.00 213.65 ?  -23 DC  I "O5'" 1 
ATOM 6989  C "C5'" . DC  I 5 51  ? 132.363 126.978 97.563  1.00 213.65 ?  -23 DC  I "C5'" 1 
ATOM 6990  C "C4'" . DC  I 5 51  ? 133.709 127.463 97.080  1.00 213.65 ?  -23 DC  I "C4'" 1 
ATOM 6991  O "O4'" . DC  I 5 51  ? 133.584 128.825 96.593  1.00 213.65 ?  -23 DC  I "O4'" 1 
ATOM 6992  C "C3'" . DC  I 5 51  ? 134.791 127.499 98.149  1.00 213.65 ?  -23 DC  I "C3'" 1 
ATOM 6993  O "O3'" . DC  I 5 51  ? 136.027 127.133 97.590  1.00 213.65 ?  -23 DC  I "O3'" 1 
ATOM 6994  C "C2'" . DC  I 5 51  ? 134.790 128.955 98.574  1.00 213.65 ?  -23 DC  I "C2'" 1 
ATOM 6995  C "C1'" . DC  I 5 51  ? 134.515 129.647 97.256  1.00 213.65 ?  -23 DC  I "C1'" 1 
ATOM 6996  N N1    . DC  I 5 51  ? 133.928 131.015 97.395  1.00 213.65 ?  -23 DC  I N1    1 
ATOM 6997  C C2    . DC  I 5 51  ? 134.754 132.138 97.330  1.00 213.65 ?  -23 DC  I C2    1 
ATOM 6998  O O2    . DC  I 5 51  ? 135.965 131.984 97.174  1.00 213.65 ?  -23 DC  I O2    1 
ATOM 6999  N N3    . DC  I 5 51  ? 134.203 133.366 97.440  1.00 213.65 ?  -23 DC  I N3    1 
ATOM 7000  C C4    . DC  I 5 51  ? 132.897 133.493 97.616  1.00 213.65 ?  -23 DC  I C4    1 
ATOM 7001  N N4    . DC  I 5 51  ? 132.398 134.722 97.724  1.00 213.65 ?  -23 DC  I N4    1 
ATOM 7002  C C5    . DC  I 5 51  ? 132.043 132.369 97.686  1.00 213.65 ?  -23 DC  I C5    1 
ATOM 7003  C C6    . DC  I 5 51  ? 132.591 131.159 97.562  1.00 213.65 ?  -23 DC  I C6    1 
ATOM 7004  P P     . DA  I 5 52  ? 137.227 126.679 98.550  1.00 234.00 ?  -22 DA  I P     1 
ATOM 7005  O OP1   . DA  I 5 52  ? 138.145 125.841 97.755  1.00 234.00 ?  -22 DA  I OP1   1 
ATOM 7006  O OP2   . DA  I 5 52  ? 136.619 126.136 99.778  1.00 234.00 -1 -22 DA  I OP2   1 
ATOM 7007  O "O5'" . DA  I 5 52  ? 137.957 128.045 98.937  1.00 234.00 ?  -22 DA  I "O5'" 1 
ATOM 7008  C "C5'" . DA  I 5 52  ? 138.595 128.819 97.930  1.00 234.00 ?  -22 DA  I "C5'" 1 
ATOM 7009  C "C4'" . DA  I 5 52  ? 139.303 130.036 98.513  1.00 234.00 ?  -22 DA  I "C4'" 1 
ATOM 7010  O "O4'" . DA  I 5 52  ? 138.406 131.178 98.522  1.00 234.00 ?  -22 DA  I "O4'" 1 
ATOM 7011  C "C3'" . DA  I 5 52  ? 139.807 129.891 99.945  1.00 234.00 ?  -22 DA  I "C3'" 1 
ATOM 7012  O "O3'" . DA  I 5 52  ? 141.049 130.552 100.069 1.00 234.00 ?  -22 DA  I "O3'" 1 
ATOM 7013  C "C2'" . DA  I 5 52  ? 138.726 130.603 100.743 1.00 234.00 ?  -22 DA  I "C2'" 1 
ATOM 7014  C "C1'" . DA  I 5 52  ? 138.386 131.741 99.810  1.00 234.00 ?  -22 DA  I "C1'" 1 
ATOM 7015  N N9    . DA  I 5 52  ? 137.065 132.283 100.051 1.00 234.00 ?  -22 DA  I N9    1 
ATOM 7016  C C8    . DA  I 5 52  ? 135.951 131.586 100.395 1.00 234.00 ?  -22 DA  I C8    1 
ATOM 7017  N N7    . DA  I 5 52  ? 134.887 132.324 100.551 1.00 234.00 ?  -22 DA  I N7    1 
ATOM 7018  C C5    . DA  I 5 52  ? 135.343 133.600 100.321 1.00 234.00 ?  -22 DA  I C5    1 
ATOM 7019  C C6    . DA  I 5 52  ? 134.700 134.841 100.326 1.00 234.00 ?  -22 DA  I C6    1 
ATOM 7020  N N6    . DA  I 5 52  ? 133.405 134.988 100.612 1.00 234.00 ?  -22 DA  I N6    1 
ATOM 7021  N N1    . DA  I 5 52  ? 135.442 135.934 100.044 1.00 234.00 ?  -22 DA  I N1    1 
ATOM 7022  C C2    . DA  I 5 52  ? 136.741 135.776 99.760  1.00 234.00 ?  -22 DA  I C2    1 
ATOM 7023  N N3    . DA  I 5 52  ? 137.454 134.653 99.717  1.00 234.00 ?  -22 DA  I N3    1 
ATOM 7024  C C4    . DA  I 5 52  ? 136.686 133.594 100.004 1.00 234.00 ?  -22 DA  I C4    1 
ATOM 7025  P P     . DT  I 5 53  ? 141.913 130.442 101.419 1.00 257.64 ?  -21 DT  I P     1 
ATOM 7026  O OP1   . DT  I 5 53  ? 143.137 129.688 101.084 1.00 257.64 ?  -21 DT  I OP1   1 
ATOM 7027  O OP2   . DT  I 5 53  ? 141.056 129.962 102.522 1.00 257.64 -1 -21 DT  I OP2   1 
ATOM 7028  O "O5'" . DT  I 5 53  ? 142.291 131.959 101.738 1.00 257.64 ?  -21 DT  I "O5'" 1 
ATOM 7029  C "C5'" . DT  I 5 53  ? 141.258 132.909 101.909 1.00 257.64 ?  -21 DT  I "C5'" 1 
ATOM 7030  C "C4'" . DT  I 5 53  ? 141.776 134.318 101.757 1.00 257.64 ?  -21 DT  I "C4'" 1 
ATOM 7031  O "O4'" . DT  I 5 53  ? 140.668 135.192 101.432 1.00 257.64 ?  -21 DT  I "O4'" 1 
ATOM 7032  C "C3'" . DT  I 5 53  ? 142.379 134.900 103.016 1.00 257.64 ?  -21 DT  I "C3'" 1 
ATOM 7033  O "O3'" . DT  I 5 53  ? 143.274 135.935 102.687 1.00 257.64 ?  -21 DT  I "O3'" 1 
ATOM 7034  C "C2'" . DT  I 5 53  ? 141.149 135.440 103.725 1.00 257.64 ?  -21 DT  I "C2'" 1 
ATOM 7035  C "C1'" . DT  I 5 53  ? 140.341 135.987 102.553 1.00 257.64 ?  -21 DT  I "C1'" 1 
ATOM 7036  N N1    . DT  I 5 53  ? 138.872 135.923 102.767 1.00 257.64 ?  -21 DT  I N1    1 
ATOM 7037  C C2    . DT  I 5 53  ? 138.123 137.061 102.615 1.00 257.64 ?  -21 DT  I C2    1 
ATOM 7038  O O2    . DT  I 5 53  ? 138.599 138.134 102.309 1.00 257.64 ?  -21 DT  I O2    1 
ATOM 7039  N N3    . DT  I 5 53  ? 136.787 136.901 102.842 1.00 257.64 ?  -21 DT  I N3    1 
ATOM 7040  C C4    . DT  I 5 53  ? 136.137 135.739 103.196 1.00 257.64 ?  -21 DT  I C4    1 
ATOM 7041  O O4    . DT  I 5 53  ? 134.926 135.694 103.373 1.00 257.64 ?  -21 DT  I O4    1 
ATOM 7042  C C5    . DT  I 5 53  ? 136.979 134.580 103.336 1.00 257.64 ?  -21 DT  I C5    1 
ATOM 7043  C C7    . DT  I 5 53  ? 136.383 133.260 103.719 1.00 257.64 ?  -21 DT  I C7    1 
ATOM 7044  C C6    . DT  I 5 53  ? 138.292 134.727 103.119 1.00 257.64 ?  -21 DT  I C6    1 
ATOM 7045  P P     . DC  I 5 54  ? 144.303 136.475 103.792 1.00 256.81 ?  -20 DC  I P     1 
ATOM 7046  O OP1   . DC  I 5 54  ? 145.514 136.933 103.079 1.00 256.81 ?  -20 DC  I OP1   1 
ATOM 7047  O OP2   . DC  I 5 54  ? 144.408 135.440 104.843 1.00 256.81 -1 -20 DC  I OP2   1 
ATOM 7048  O "O5'" . DC  I 5 54  ? 143.564 137.743 104.425 1.00 256.81 ?  -20 DC  I "O5'" 1 
ATOM 7049  C "C5'" . DC  I 5 54  ? 143.619 138.992 103.758 1.00 256.81 ?  -20 DC  I "C5'" 1 
ATOM 7050  C "C4'" . DC  I 5 54  ? 142.713 140.010 104.424 1.00 256.81 ?  -20 DC  I "C4'" 1 
ATOM 7051  O "O4'" . DC  I 5 54  ? 141.346 139.527 104.424 1.00 256.81 ?  -20 DC  I "O4'" 1 
ATOM 7052  C "C3'" . DC  I 5 54  ? 143.052 140.345 105.875 1.00 256.81 ?  -20 DC  I "C3'" 1 
ATOM 7053  O "O3'" . DC  I 5 54  ? 143.021 141.770 106.042 1.00 256.81 ?  -20 DC  I "O3'" 1 
ATOM 7054  C "C2'" . DC  I 5 54  ? 141.957 139.626 106.667 1.00 256.81 ?  -20 DC  I "C2'" 1 
ATOM 7055  C "C1'" . DC  I 5 54  ? 140.787 139.690 105.704 1.00 256.81 ?  -20 DC  I "C1'" 1 
ATOM 7056  N N1    . DC  I 5 54  ? 139.787 138.610 105.906 1.00 256.81 ?  -20 DC  I N1    1 
ATOM 7057  C C2    . DC  I 5 54  ? 138.475 138.793 105.468 1.00 256.81 ?  -20 DC  I C2    1 
ATOM 7058  O O2    . DC  I 5 54  ? 138.166 139.858 104.924 1.00 256.81 ?  -20 DC  I O2    1 
ATOM 7059  N N3    . DC  I 5 54  ? 137.577 137.798 105.654 1.00 256.81 ?  -20 DC  I N3    1 
ATOM 7060  C C4    . DC  I 5 54  ? 137.952 136.665 106.240 1.00 256.81 ?  -20 DC  I C4    1 
ATOM 7061  N N4    . DC  I 5 54  ? 137.035 135.710 106.397 1.00 256.81 ?  -20 DC  I N4    1 
ATOM 7062  C C5    . DC  I 5 54  ? 139.284 136.459 106.692 1.00 256.81 ?  -20 DC  I C5    1 
ATOM 7063  C C6    . DC  I 5 54  ? 140.159 137.448 106.507 1.00 256.81 ?  -20 DC  I C6    1 
ATOM 7064  P P     . DA  I 5 55  ? 142.755 142.465 107.469 1.00 260.76 ?  -19 DA  I P     1 
ATOM 7065  O OP1   . DA  I 5 55  ? 143.349 143.815 107.395 1.00 260.76 ?  -19 DA  I OP1   1 
ATOM 7066  O OP2   . DA  I 5 55  ? 143.162 141.574 108.576 1.00 260.76 -1 -19 DA  I OP2   1 
ATOM 7067  O "O5'" . DA  I 5 55  ? 141.170 142.647 107.502 1.00 260.76 ?  -19 DA  I "O5'" 1 
ATOM 7068  C "C5'" . DA  I 5 55  ? 140.607 143.888 107.869 1.00 260.76 ?  -19 DA  I "C5'" 1 
ATOM 7069  C "C4'" . DA  I 5 55  ? 139.822 143.751 109.153 1.00 260.76 ?  -19 DA  I "C4'" 1 
ATOM 7070  O "O4'" . DA  I 5 55  ? 138.796 142.738 108.989 1.00 260.76 ?  -19 DA  I "O4'" 1 
ATOM 7071  C "C3'" . DA  I 5 55  ? 140.650 143.314 110.366 1.00 260.76 ?  -19 DA  I "C3'" 1 
ATOM 7072  O "O3'" . DA  I 5 55  ? 140.279 144.079 111.486 1.00 260.76 ?  -19 DA  I "O3'" 1 
ATOM 7073  C "C2'" . DA  I 5 55  ? 140.253 141.853 110.545 1.00 260.76 ?  -19 DA  I "C2'" 1 
ATOM 7074  C "C1'" . DA  I 5 55  ? 138.803 141.924 110.130 1.00 260.76 ?  -19 DA  I "C1'" 1 
ATOM 7075  N N9    . DA  I 5 55  ? 138.208 140.636 109.817 1.00 260.76 ?  -19 DA  I N9    1 
ATOM 7076  C C8    . DA  I 5 55  ? 138.716 139.403 110.100 1.00 260.76 ?  -19 DA  I C8    1 
ATOM 7077  N N7    . DA  I 5 55  ? 137.948 138.414 109.712 1.00 260.76 ?  -19 DA  I N7    1 
ATOM 7078  C C5    . DA  I 5 55  ? 136.864 139.047 109.138 1.00 260.76 ?  -19 DA  I C5    1 
ATOM 7079  C C6    . DA  I 5 55  ? 135.689 138.563 108.539 1.00 260.76 ?  -19 DA  I C6    1 
ATOM 7080  N N6    . DA  I 5 55  ? 135.410 137.266 108.410 1.00 260.76 ?  -19 DA  I N6    1 
ATOM 7081  N N1    . DA  I 5 55  ? 134.805 139.469 108.073 1.00 260.76 ?  -19 DA  I N1    1 
ATOM 7082  C C2    . DA  I 5 55  ? 135.084 140.770 108.199 1.00 260.76 ?  -19 DA  I C2    1 
ATOM 7083  N N3    . DA  I 5 55  ? 136.148 141.343 108.754 1.00 260.76 ?  -19 DA  I N3    1 
ATOM 7084  C C4    . DA  I 5 55  ? 137.006 140.418 109.206 1.00 260.76 ?  -19 DA  I C4    1 
ATOM 7085  P P     . DA  I 5 56  ? 141.220 145.276 111.987 1.00 266.37 ?  -18 DA  I P     1 
ATOM 7086  O OP1   . DA  I 5 56  ? 142.019 145.728 110.826 1.00 266.37 ?  -18 DA  I OP1   1 
ATOM 7087  O OP2   . DA  I 5 56  ? 141.894 144.825 113.224 1.00 266.37 -1 -18 DA  I OP2   1 
ATOM 7088  O "O5'" . DA  I 5 56  ? 140.187 146.423 112.390 1.00 266.37 ?  -18 DA  I "O5'" 1 
ATOM 7089  C "C5'" . DA  I 5 56  ? 139.224 146.178 113.399 1.00 266.37 ?  -18 DA  I "C5'" 1 
ATOM 7090  C "C4'" . DA  I 5 56  ? 137.823 146.193 112.824 1.00 266.37 ?  -18 DA  I "C4'" 1 
ATOM 7091  O "O4'" . DA  I 5 56  ? 137.543 144.914 112.199 1.00 266.37 ?  -18 DA  I "O4'" 1 
ATOM 7092  C "C3'" . DA  I 5 56  ? 136.723 146.366 113.854 1.00 266.37 ?  -18 DA  I "C3'" 1 
ATOM 7093  O "O3'" . DA  I 5 56  ? 135.575 146.893 113.226 1.00 266.37 ?  -18 DA  I "O3'" 1 
ATOM 7094  C "C2'" . DA  I 5 56  ? 136.497 144.930 114.286 1.00 266.37 ?  -18 DA  I "C2'" 1 
ATOM 7095  C "C1'" . DA  I 5 56  ? 136.527 144.252 112.932 1.00 266.37 ?  -18 DA  I "C1'" 1 
ATOM 7096  N N9    . DA  I 5 56  ? 136.844 142.833 112.984 1.00 266.37 ?  -18 DA  I N9    1 
ATOM 7097  C C8    . DA  I 5 56  ? 137.964 142.256 113.509 1.00 266.37 ?  -18 DA  I C8    1 
ATOM 7098  N N7    . DA  I 5 56  ? 137.984 140.949 113.397 1.00 266.37 ?  -18 DA  I N7    1 
ATOM 7099  C C5    . DA  I 5 56  ? 136.795 140.654 112.756 1.00 266.37 ?  -18 DA  I C5    1 
ATOM 7100  C C6    . DA  I 5 56  ? 136.214 139.445 112.350 1.00 266.37 ?  -18 DA  I C6    1 
ATOM 7101  N N6    . DA  I 5 56  ? 136.786 138.256 112.541 1.00 266.37 ?  -18 DA  I N6    1 
ATOM 7102  N N1    . DA  I 5 56  ? 135.014 139.499 111.742 1.00 266.37 ?  -18 DA  I N1    1 
ATOM 7103  C C2    . DA  I 5 56  ? 134.437 140.688 111.559 1.00 266.37 ?  -18 DA  I C2    1 
ATOM 7104  N N3    . DA  I 5 56  ? 134.889 141.892 111.890 1.00 266.37 ?  -18 DA  I N3    1 
ATOM 7105  C C4    . DA  I 5 56  ? 136.081 141.803 112.496 1.00 266.37 ?  -18 DA  I C4    1 
ATOM 7106  P P     . DA  I 5 57  ? 134.553 147.808 114.057 1.00 263.28 ?  -17 DA  I P     1 
ATOM 7107  O OP1   . DA  I 5 57  ? 133.625 148.431 113.087 1.00 263.28 ?  -17 DA  I OP1   1 
ATOM 7108  O OP2   . DA  I 5 57  ? 135.352 148.652 114.972 1.00 263.28 -1 -17 DA  I OP2   1 
ATOM 7109  O "O5'" . DA  I 5 57  ? 133.742 146.758 114.943 1.00 263.28 ?  -17 DA  I "O5'" 1 
ATOM 7110  C "C5'" . DA  I 5 57  ? 132.941 145.770 114.314 1.00 263.28 ?  -17 DA  I "C5'" 1 
ATOM 7111  C "C4'" . DA  I 5 57  ? 132.640 144.641 115.277 1.00 263.28 ?  -17 DA  I "C4'" 1 
ATOM 7112  O "O4'" . DA  I 5 57  ? 133.445 143.494 114.963 1.00 263.28 ?  -17 DA  I "O4'" 1 
ATOM 7113  C "C3'" . DA  I 5 57  ? 132.971 144.935 116.727 1.00 263.28 ?  -17 DA  I "C3'" 1 
ATOM 7114  O "O3'" . DA  I 5 57  ? 131.860 145.559 117.350 1.00 263.28 ?  -17 DA  I "O3'" 1 
ATOM 7115  C "C2'" . DA  I 5 57  ? 133.252 143.541 117.317 1.00 263.28 ?  -17 DA  I "C2'" 1 
ATOM 7116  C "C1'" . DA  I 5 57  ? 133.427 142.645 116.085 1.00 263.28 ?  -17 DA  I "C1'" 1 
ATOM 7117  N N9    . DA  I 5 57  ? 134.657 141.867 116.111 1.00 263.28 ?  -17 DA  I N9    1 
ATOM 7118  C C8    . DA  I 5 57  ? 135.887 142.289 116.524 1.00 263.28 ?  -17 DA  I C8    1 
ATOM 7119  N N7    . DA  I 5 57  ? 136.814 141.367 116.446 1.00 263.28 ?  -17 DA  I N7    1 
ATOM 7120  C C5    . DA  I 5 57  ? 136.140 140.264 115.960 1.00 263.28 ?  -17 DA  I C5    1 
ATOM 7121  C C6    . DA  I 5 57  ? 136.560 138.961 115.647 1.00 263.28 ?  -17 DA  I C6    1 
ATOM 7122  N N6    . DA  I 5 57  ? 137.817 138.542 115.796 1.00 263.28 ?  -17 DA  I N6    1 
ATOM 7123  N N1    . DA  I 5 57  ? 135.635 138.100 115.175 1.00 263.28 ?  -17 DA  I N1    1 
ATOM 7124  C C2    . DA  I 5 57  ? 134.377 138.525 115.021 1.00 263.28 ?  -17 DA  I C2    1 
ATOM 7125  N N3    . DA  I 5 57  ? 133.867 139.727 115.279 1.00 263.28 ?  -17 DA  I N3    1 
ATOM 7126  C C4    . DA  I 5 57  ? 134.810 140.556 115.745 1.00 263.28 ?  -17 DA  I C4    1 
ATOM 7127  P P     . DA  I 5 58  ? 131.863 145.847 118.930 1.00 261.66 ?  -16 DA  I P     1 
ATOM 7128  O OP1   . DA  I 5 58  ? 131.061 147.065 119.164 1.00 261.66 ?  -16 DA  I OP1   1 
ATOM 7129  O OP2   . DA  I 5 58  ? 133.263 145.790 119.405 1.00 261.66 -1 -16 DA  I OP2   1 
ATOM 7130  O "O5'" . DA  I 5 58  ? 131.069 144.602 119.536 1.00 261.66 ?  -16 DA  I "O5'" 1 
ATOM 7131  C "C5'" . DA  I 5 58  ? 129.948 144.076 118.838 1.00 261.66 ?  -16 DA  I "C5'" 1 
ATOM 7132  C "C4'" . DA  I 5 58  ? 129.707 142.623 119.206 1.00 261.66 ?  -16 DA  I "C4'" 1 
ATOM 7133  O "O4'" . DA  I 5 58  ? 130.837 141.803 118.800 1.00 261.66 ?  -16 DA  I "O4'" 1 
ATOM 7134  C "C3'" . DA  I 5 58  ? 129.513 142.352 120.702 1.00 261.66 ?  -16 DA  I "C3'" 1 
ATOM 7135  O "O3'" . DA  I 5 58  ? 128.481 141.400 120.875 1.00 261.66 ?  -16 DA  I "O3'" 1 
ATOM 7136  C "C2'" . DA  I 5 58  ? 130.861 141.763 121.106 1.00 261.66 ?  -16 DA  I "C2'" 1 
ATOM 7137  C "C1'" . DA  I 5 58  ? 131.165 140.948 119.868 1.00 261.66 ?  -16 DA  I "C1'" 1 
ATOM 7138  N N9    . DA  I 5 58  ? 132.557 140.538 119.745 1.00 261.66 ?  -16 DA  I N9    1 
ATOM 7139  C C8    . DA  I 5 58  ? 133.659 141.198 120.203 1.00 261.66 ?  -16 DA  I C8    1 
ATOM 7140  N N7    . DA  I 5 58  ? 134.787 140.584 119.944 1.00 261.66 ?  -16 DA  I N7    1 
ATOM 7141  C C5    . DA  I 5 58  ? 134.393 139.443 119.272 1.00 261.66 ?  -16 DA  I C5    1 
ATOM 7142  C C6    . DA  I 5 58  ? 135.113 138.368 118.722 1.00 261.66 ?  -16 DA  I C6    1 
ATOM 7143  N N6    . DA  I 5 58  ? 136.442 138.273 118.769 1.00 261.66 ?  -16 DA  I N6    1 
ATOM 7144  N N1    . DA  I 5 58  ? 134.411 137.387 118.118 1.00 261.66 ?  -16 DA  I N1    1 
ATOM 7145  C C2    . DA  I 5 58  ? 133.080 137.487 118.064 1.00 261.66 ?  -16 DA  I C2    1 
ATOM 7146  N N3    . DA  I 5 58  ? 132.297 138.444 118.549 1.00 261.66 ?  -16 DA  I N3    1 
ATOM 7147  C C4    . DA  I 5 58  ? 133.023 139.400 119.144 1.00 261.66 ?  -16 DA  I C4    1 
ATOM 7148  P P     . DG  I 5 59  ? 126.957 141.863 121.075 1.00 246.70 ?  -15 DG  I P     1 
ATOM 7149  O OP1   . DG  I 5 59  ? 126.808 143.265 120.627 1.00 246.70 ?  -15 DG  I OP1   1 
ATOM 7150  O OP2   . DG  I 5 59  ? 126.577 141.493 122.455 1.00 246.70 -1 -15 DG  I OP2   1 
ATOM 7151  O "O5'" . DG  I 5 59  ? 126.142 140.909 120.086 1.00 246.70 ?  -15 DG  I "O5'" 1 
ATOM 7152  C "C5'" . DG  I 5 59  ? 126.804 140.276 119.001 1.00 246.70 ?  -15 DG  I "C5'" 1 
ATOM 7153  C "C4'" . DG  I 5 59  ? 127.066 138.816 119.314 1.00 246.70 ?  -15 DG  I "C4'" 1 
ATOM 7154  O "O4'" . DG  I 5 59  ? 128.414 138.660 119.800 1.00 246.70 ?  -15 DG  I "O4'" 1 
ATOM 7155  C "C3'" . DG  I 5 59  ? 126.145 138.214 120.372 1.00 246.70 ?  -15 DG  I "C3'" 1 
ATOM 7156  O "O3'" . DG  I 5 59  ? 125.406 137.146 119.798 1.00 246.70 ?  -15 DG  I "O3'" 1 
ATOM 7157  C "C2'" . DG  I 5 59  ? 127.086 137.739 121.489 1.00 246.70 ?  -15 DG  I "C2'" 1 
ATOM 7158  C "C1'" . DG  I 5 59  ? 128.449 137.692 120.814 1.00 246.70 ?  -15 DG  I "C1'" 1 
ATOM 7159  N N9    . DG  I 5 59  ? 129.543 138.049 121.707 1.00 246.70 ?  -15 DG  I N9    1 
ATOM 7160  C C8    . DG  I 5 59  ? 129.515 139.002 122.687 1.00 246.70 ?  -15 DG  I C8    1 
ATOM 7161  N N7    . DG  I 5 59  ? 130.645 139.133 123.318 1.00 246.70 ?  -15 DG  I N7    1 
ATOM 7162  C C5    . DG  I 5 59  ? 131.479 138.206 122.717 1.00 246.70 ?  -15 DG  I C5    1 
ATOM 7163  C C6    . DG  I 5 59  ? 132.828 137.897 122.982 1.00 246.70 ?  -15 DG  I C6    1 
ATOM 7164  O O6    . DG  I 5 59  ? 133.570 138.387 123.841 1.00 246.70 ?  -15 DG  I O6    1 
ATOM 7165  N N1    . DG  I 5 59  ? 133.299 136.892 122.152 1.00 246.70 ?  -15 DG  I N1    1 
ATOM 7166  C C2    . DG  I 5 59  ? 132.562 136.274 121.180 1.00 246.70 ?  -15 DG  I C2    1 
ATOM 7167  N N2    . DG  I 5 59  ? 133.196 135.329 120.472 1.00 246.70 ?  -15 DG  I N2    1 
ATOM 7168  N N3    . DG  I 5 59  ? 131.295 136.560 120.912 1.00 246.70 ?  -15 DG  I N3    1 
ATOM 7169  C C4    . DG  I 5 59  ? 130.820 137.532 121.719 1.00 246.70 ?  -15 DG  I C4    1 
ATOM 7170  P P     . DG  I 5 60  ? 124.449 136.225 120.700 1.00 236.15 ?  -14 DG  I P     1 
ATOM 7171  O OP1   . DG  I 5 60  ? 123.316 135.798 119.853 1.00 236.15 ?  -14 DG  I OP1   1 
ATOM 7172  O OP2   . DG  I 5 60  ? 124.185 136.911 121.981 1.00 236.15 -1 -14 DG  I OP2   1 
ATOM 7173  O "O5'" . DG  I 5 60  ? 125.353 134.950 120.986 1.00 236.15 ?  -14 DG  I "O5'" 1 
ATOM 7174  C "C5'" . DG  I 5 60  ? 126.184 134.454 119.959 1.00 236.15 ?  -14 DG  I "C5'" 1 
ATOM 7175  C "C4'" . DG  I 5 60  ? 127.217 133.511 120.524 1.00 236.15 ?  -14 DG  I "C4'" 1 
ATOM 7176  O "O4'" . DG  I 5 60  ? 128.257 134.268 121.189 1.00 236.15 ?  -14 DG  I "O4'" 1 
ATOM 7177  C "C3'" . DG  I 5 60  ? 126.676 132.525 121.560 1.00 236.15 ?  -14 DG  I "C3'" 1 
ATOM 7178  O "O3'" . DG  I 5 60  ? 127.066 131.219 121.212 1.00 236.15 ?  -14 DG  I "O3'" 1 
ATOM 7179  C "C2'" . DG  I 5 60  ? 127.330 132.978 122.863 1.00 236.15 ?  -14 DG  I "C2'" 1 
ATOM 7180  C "C1'" . DG  I 5 60  ? 128.619 133.588 122.358 1.00 236.15 ?  -14 DG  I "C1'" 1 
ATOM 7181  N N9    . DG  I 5 60  ? 129.215 134.536 123.287 1.00 236.15 ?  -14 DG  I N9    1 
ATOM 7182  C C8    . DG  I 5 60  ? 128.611 135.622 123.859 1.00 236.15 ?  -14 DG  I C8    1 
ATOM 7183  N N7    . DG  I 5 60  ? 129.391 136.289 124.657 1.00 236.15 ?  -14 DG  I N7    1 
ATOM 7184  C C5    . DG  I 5 60  ? 130.589 135.596 124.613 1.00 236.15 ?  -14 DG  I C5    1 
ATOM 7185  C C6    . DG  I 5 60  ? 131.806 135.845 125.281 1.00 236.15 ?  -14 DG  I C6    1 
ATOM 7186  O O6    . DG  I 5 60  ? 132.080 136.767 126.057 1.00 236.15 ?  -14 DG  I O6    1 
ATOM 7187  N N1    . DG  I 5 60  ? 132.774 134.907 124.950 1.00 236.15 ?  -14 DG  I N1    1 
ATOM 7188  C C2    . DG  I 5 60  ? 132.584 133.855 124.093 1.00 236.15 ?  -14 DG  I C2    1 
ATOM 7189  N N2    . DG  I 5 60  ? 133.634 133.045 123.907 1.00 236.15 ?  -14 DG  I N2    1 
ATOM 7190  N N3    . DG  I 5 60  ? 131.444 133.604 123.471 1.00 236.15 ?  -14 DG  I N3    1 
ATOM 7191  C C4    . DG  I 5 60  ? 130.496 134.517 123.773 1.00 236.15 ?  -14 DG  I C4    1 
ATOM 7192  P P     . DC  I 5 61  ? 126.448 129.950 121.972 1.00 221.99 ?  -13 DC  I P     1 
ATOM 7193  O OP1   . DC  I 5 61  ? 125.709 129.154 120.972 1.00 221.99 ?  -13 DC  I OP1   1 
ATOM 7194  O OP2   . DC  I 5 61  ? 125.755 130.401 123.194 1.00 221.99 -1 -13 DC  I OP2   1 
ATOM 7195  O "O5'" . DC  I 5 61  ? 127.743 129.138 122.401 1.00 221.99 ?  -13 DC  I "O5'" 1 
ATOM 7196  C "C5'" . DC  I 5 61  ? 128.769 128.968 121.459 1.00 221.99 ?  -13 DC  I "C5'" 1 
ATOM 7197  C "C4'" . DC  I 5 61  ? 130.114 128.900 122.134 1.00 221.99 ?  -13 DC  I "C4'" 1 
ATOM 7198  O "O4'" . DC  I 5 61  ? 130.333 130.101 122.909 1.00 221.99 ?  -13 DC  I "O4'" 1 
ATOM 7199  C "C3'" . DC  I 5 61  ? 130.280 127.732 123.102 1.00 221.99 ?  -13 DC  I "C3'" 1 
ATOM 7200  O "O3'" . DC  I 5 61  ? 131.448 127.024 122.782 1.00 221.99 ?  -13 DC  I "O3'" 1 
ATOM 7201  C "C2'" . DC  I 5 61  ? 130.389 128.403 124.472 1.00 221.99 ?  -13 DC  I "C2'" 1 
ATOM 7202  C "C1'" . DC  I 5 61  ? 130.979 129.749 124.100 1.00 221.99 ?  -13 DC  I "C1'" 1 
ATOM 7203  N N1    . DC  I 5 61  ? 130.734 130.822 125.108 1.00 221.99 ?  -13 DC  I N1    1 
ATOM 7204  C C2    . DC  I 5 61  ? 131.770 131.238 125.949 1.00 221.99 ?  -13 DC  I C2    1 
ATOM 7205  O O2    . DC  I 5 61  ? 132.879 130.708 125.849 1.00 221.99 ?  -13 DC  I O2    1 
ATOM 7206  N N3    . DC  I 5 61  ? 131.528 132.213 126.851 1.00 221.99 ?  -13 DC  I N3    1 
ATOM 7207  C C4    . DC  I 5 61  ? 130.321 132.763 126.926 1.00 221.99 ?  -13 DC  I C4    1 
ATOM 7208  N N4    . DC  I 5 61  ? 130.131 133.721 127.832 1.00 221.99 ?  -13 DC  I N4    1 
ATOM 7209  C C5    . DC  I 5 61  ? 129.255 132.355 126.081 1.00 221.99 ?  -13 DC  I C5    1 
ATOM 7210  C C6    . DC  I 5 61  ? 129.505 131.391 125.195 1.00 221.99 ?  -13 DC  I C6    1 
ATOM 7211  P P     . DA  I 5 62  ? 131.696 125.574 123.413 1.00 224.43 ?  -12 DA  I P     1 
ATOM 7212  O OP1   . DA  I 5 62  ? 132.206 124.699 122.339 1.00 224.43 ?  -12 DA  I OP1   1 
ATOM 7213  O OP2   . DA  I 5 62  ? 130.485 125.207 124.166 1.00 224.43 -1 -12 DA  I OP2   1 
ATOM 7214  O "O5'" . DA  I 5 62  ? 132.860 125.817 124.470 1.00 224.43 ?  -12 DA  I "O5'" 1 
ATOM 7215  C "C5'" . DA  I 5 62  ? 134.157 126.146 124.014 1.00 224.43 ?  -12 DA  I "C5'" 1 
ATOM 7216  C "C4'" . DA  I 5 62  ? 135.152 126.201 125.160 1.00 224.43 ?  -12 DA  I "C4'" 1 
ATOM 7217  O "O4'" . DA  I 5 62  ? 134.905 127.377 125.964 1.00 224.43 ?  -12 DA  I "O4'" 1 
ATOM 7218  C "C3'" . DA  I 5 62  ? 135.118 125.011 126.109 1.00 224.43 ?  -12 DA  I "C3'" 1 
ATOM 7219  O "O3'" . DA  I 5 62  ? 136.433 124.637 126.443 1.00 224.43 ?  -12 DA  I "O3'" 1 
ATOM 7220  C "C2'" . DA  I 5 62  ? 134.358 125.537 127.325 1.00 224.43 ?  -12 DA  I "C2'" 1 
ATOM 7221  C "C1'" . DA  I 5 62  ? 134.705 127.018 127.312 1.00 224.43 ?  -12 DA  I "C1'" 1 
ATOM 7222  N N9    . DA  I 5 62  ? 133.644 127.864 127.843 1.00 224.43 ?  -12 DA  I N9    1 
ATOM 7223  C C8    . DA  I 5 62  ? 132.389 128.020 127.337 1.00 224.43 ?  -12 DA  I C8    1 
ATOM 7224  N N7    . DA  I 5 62  ? 131.644 128.853 128.020 1.00 224.43 ?  -12 DA  I N7    1 
ATOM 7225  C C5    . DA  I 5 62  ? 132.473 129.276 129.037 1.00 224.43 ?  -12 DA  I C5    1 
ATOM 7226  C C6    . DA  I 5 62  ? 132.284 130.166 130.101 1.00 224.43 ?  -12 DA  I C6    1 
ATOM 7227  N N6    . DA  I 5 62  ? 131.141 130.816 130.315 1.00 224.43 ?  -12 DA  I N6    1 
ATOM 7228  N N1    . DA  I 5 62  ? 133.315 130.364 130.942 1.00 224.43 ?  -12 DA  I N1    1 
ATOM 7229  C C2    . DA  I 5 62  ? 134.460 129.713 130.725 1.00 224.43 ?  -12 DA  I C2    1 
ATOM 7230  N N3    . DA  I 5 62  ? 134.754 128.852 129.761 1.00 224.43 ?  -12 DA  I N3    1 
ATOM 7231  C C4    . DA  I 5 62  ? 133.710 128.678 128.942 1.00 224.43 ?  -12 DA  I C4    1 
ATOM 7232  P P     . DT  I 5 63  ? 136.688 123.338 127.345 1.00 239.56 ?  -11 DT  I P     1 
ATOM 7233  O OP1   . DT  I 5 63  ? 137.984 122.757 126.936 1.00 239.56 ?  -11 DT  I OP1   1 
ATOM 7234  O OP2   . DT  I 5 63  ? 135.463 122.514 127.298 1.00 239.56 -1 -11 DT  I OP2   1 
ATOM 7235  O "O5'" . DT  I 5 63  ? 136.841 123.931 128.818 1.00 239.56 ?  -11 DT  I "O5'" 1 
ATOM 7236  C "C5'" . DT  I 5 63  ? 137.782 124.962 129.060 1.00 239.56 ?  -11 DT  I "C5'" 1 
ATOM 7237  C "C4'" . DT  I 5 63  ? 137.826 125.321 130.530 1.00 239.56 ?  -11 DT  I "C4'" 1 
ATOM 7238  O "O4'" . DT  I 5 63  ? 136.756 126.243 130.837 1.00 239.56 ?  -11 DT  I "O4'" 1 
ATOM 7239  C "C3'" . DT  I 5 63  ? 137.664 124.140 131.488 1.00 239.56 ?  -11 DT  I "C3'" 1 
ATOM 7240  O "O3'" . DT  I 5 63  ? 138.711 124.144 132.432 1.00 239.56 ?  -11 DT  I "O3'" 1 
ATOM 7241  C "C2'" . DT  I 5 63  ? 136.307 124.389 132.150 1.00 239.56 ?  -11 DT  I "C2'" 1 
ATOM 7242  C "C1'" . DT  I 5 63  ? 136.198 125.897 132.074 1.00 239.56 ?  -11 DT  I "C1'" 1 
ATOM 7243  N N1    . DT  I 5 63  ? 134.805 126.390 132.106 1.00 239.56 ?  -11 DT  I N1    1 
ATOM 7244  C C2    . DT  I 5 63  ? 134.427 127.262 133.092 1.00 239.56 ?  -11 DT  I C2    1 
ATOM 7245  O O2    . DT  I 5 63  ? 135.184 127.658 133.956 1.00 239.56 ?  -11 DT  I O2    1 
ATOM 7246  N N3    . DT  I 5 63  ? 133.125 127.664 133.031 1.00 239.56 ?  -11 DT  I N3    1 
ATOM 7247  C C4    . DT  I 5 63  ? 132.182 127.284 132.105 1.00 239.56 ?  -11 DT  I C4    1 
ATOM 7248  O O4    . DT  I 5 63  ? 131.031 127.698 132.135 1.00 239.56 ?  -11 DT  I O4    1 
ATOM 7249  C C5    . DT  I 5 63  ? 132.642 126.367 131.100 1.00 239.56 ?  -11 DT  I C5    1 
ATOM 7250  C C7    . DT  I 5 63  ? 131.704 125.884 130.040 1.00 239.56 ?  -11 DT  I C7    1 
ATOM 7251  C C6    . DT  I 5 63  ? 133.918 125.969 131.146 1.00 239.56 ?  -11 DT  I C6    1 
ATOM 7252  P P     . DG  I 5 64  ? 138.773 123.013 133.568 1.00 241.54 ?  -10 DG  I P     1 
ATOM 7253  O OP1   . DG  I 5 64  ? 140.198 122.752 133.861 1.00 241.54 ?  -10 DG  I OP1   1 
ATOM 7254  O OP2   . DG  I 5 64  ? 137.894 121.902 133.150 1.00 241.54 -1 -10 DG  I OP2   1 
ATOM 7255  O "O5'" . DG  I 5 64  ? 138.103 123.713 134.835 1.00 241.54 ?  -10 DG  I "O5'" 1 
ATOM 7256  C "C5'" . DG  I 5 64  ? 138.607 124.951 135.300 1.00 241.54 ?  -10 DG  I "C5'" 1 
ATOM 7257  C "C4'" . DG  I 5 64  ? 137.831 125.433 136.512 1.00 241.54 ?  -10 DG  I "C4'" 1 
ATOM 7258  O "O4'" . DG  I 5 64  ? 136.540 125.938 136.094 1.00 241.54 ?  -10 DG  I "O4'" 1 
ATOM 7259  C "C3'" . DG  I 5 64  ? 137.549 124.369 137.573 1.00 241.54 ?  -10 DG  I "C3'" 1 
ATOM 7260  O "O3'" . DG  I 5 64  ? 137.804 124.901 138.860 1.00 241.54 ?  -10 DG  I "O3'" 1 
ATOM 7261  C "C2'" . DG  I 5 64  ? 136.066 124.063 137.383 1.00 241.54 ?  -10 DG  I "C2'" 1 
ATOM 7262  C "C1'" . DG  I 5 64  ? 135.544 125.414 136.936 1.00 241.54 ?  -10 DG  I "C1'" 1 
ATOM 7263  N N9    . DG  I 5 64  ? 134.304 125.351 136.179 1.00 241.54 ?  -10 DG  I N9    1 
ATOM 7264  C C8    . DG  I 5 64  ? 134.041 124.566 135.087 1.00 241.54 ?  -10 DG  I C8    1 
ATOM 7265  N N7    . DG  I 5 64  ? 132.844 124.736 134.604 1.00 241.54 ?  -10 DG  I N7    1 
ATOM 7266  C C5    . DG  I 5 64  ? 132.286 125.704 135.421 1.00 241.54 ?  -10 DG  I C5    1 
ATOM 7267  C C6    . DG  I 5 64  ? 131.007 126.293 135.384 1.00 241.54 ?  -10 DG  I C6    1 
ATOM 7268  O O6    . DG  I 5 64  ? 130.083 126.069 134.594 1.00 241.54 ?  -10 DG  I O6    1 
ATOM 7269  N N1    . DG  I 5 64  ? 130.843 127.229 136.394 1.00 241.54 ?  -10 DG  I N1    1 
ATOM 7270  C C2    . DG  I 5 64  ? 131.797 127.554 137.322 1.00 241.54 ?  -10 DG  I C2    1 
ATOM 7271  N N2    . DG  I 5 64  ? 131.455 128.485 138.220 1.00 241.54 ?  -10 DG  I N2    1 
ATOM 7272  N N3    . DG  I 5 64  ? 133.000 127.007 137.369 1.00 241.54 ?  -10 DG  I N3    1 
ATOM 7273  C C4    . DG  I 5 64  ? 133.173 126.093 136.393 1.00 241.54 ?  -10 DG  I C4    1 
ATOM 7274  P P     . DT  I 5 65  ? 137.849 123.934 140.139 1.00 246.39 ?  -9  DT  I P     1 
ATOM 7275  O OP1   . DT  I 5 65  ? 139.051 124.290 140.919 1.00 246.39 ?  -9  DT  I OP1   1 
ATOM 7276  O OP2   . DT  I 5 65  ? 137.661 122.546 139.667 1.00 246.39 -1 -9  DT  I OP2   1 
ATOM 7277  O "O5'" . DT  I 5 65  ? 136.554 124.346 140.975 1.00 246.39 ?  -9  DT  I "O5'" 1 
ATOM 7278  C "C5'" . DT  I 5 65  ? 136.463 125.641 141.546 1.00 246.39 ?  -9  DT  I "C5'" 1 
ATOM 7279  C "C4'" . DT  I 5 65  ? 135.104 125.853 142.182 1.00 246.39 ?  -9  DT  I "C4'" 1 
ATOM 7280  O "O4'" . DT  I 5 65  ? 134.095 125.967 141.147 1.00 246.39 ?  -9  DT  I "O4'" 1 
ATOM 7281  C "C3'" . DT  I 5 65  ? 134.638 124.724 143.107 1.00 246.39 ?  -9  DT  I "C3'" 1 
ATOM 7282  O "O3'" . DT  I 5 65  ? 134.107 125.268 144.307 1.00 246.39 ?  -9  DT  I "O3'" 1 
ATOM 7283  C "C2'" . DT  I 5 65  ? 133.558 124.022 142.290 1.00 246.39 ?  -9  DT  I "C2'" 1 
ATOM 7284  C "C1'" . DT  I 5 65  ? 132.987 125.178 141.498 1.00 246.39 ?  -9  DT  I "C1'" 1 
ATOM 7285  N N1    . DT  I 5 65  ? 132.287 124.762 140.256 1.00 246.39 ?  -9  DT  I N1    1 
ATOM 7286  C C2    . DT  I 5 65  ? 131.111 125.375 139.919 1.00 246.39 ?  -9  DT  I C2    1 
ATOM 7287  O O2    . DT  I 5 65  ? 130.605 126.255 140.586 1.00 246.39 ?  -9  DT  I O2    1 
ATOM 7288  N N3    . DT  I 5 65  ? 130.544 124.927 138.761 1.00 246.39 ?  -9  DT  I N3    1 
ATOM 7289  C C4    . DT  I 5 65  ? 131.023 123.942 137.928 1.00 246.39 ?  -9  DT  I C4    1 
ATOM 7290  O O4    . DT  I 5 65  ? 130.439 123.604 136.907 1.00 246.39 ?  -9  DT  I O4    1 
ATOM 7291  C C5    . DT  I 5 65  ? 132.257 123.336 138.338 1.00 246.39 ?  -9  DT  I C5    1 
ATOM 7292  C C7    . DT  I 5 65  ? 132.865 122.250 137.509 1.00 246.39 ?  -9  DT  I C7    1 
ATOM 7293  C C6    . DT  I 5 65  ? 132.826 123.768 139.471 1.00 246.39 ?  -9  DT  I C6    1 
ATOM 7294  P P     . DT  I 5 66  ? 133.640 124.303 145.505 1.00 242.62 ?  -8  DT  I P     1 
ATOM 7295  O OP1   . DT  I 5 66  ? 134.258 124.818 146.745 1.00 242.62 ?  -8  DT  I OP1   1 
ATOM 7296  O OP2   . DT  I 5 66  ? 133.859 122.896 145.106 1.00 242.62 -1 -8  DT  I OP2   1 
ATOM 7297  O "O5'" . DT  I 5 66  ? 132.066 124.544 145.594 1.00 242.62 ?  -8  DT  I "O5'" 1 
ATOM 7298  C "C5'" . DT  I 5 66  ? 131.574 125.838 145.876 1.00 242.62 ?  -8  DT  I "C5'" 1 
ATOM 7299  C "C4'" . DT  I 5 66  ? 130.168 126.003 145.345 1.00 242.62 ?  -8  DT  I "C4'" 1 
ATOM 7300  O "O4'" . DT  I 5 66  ? 130.117 125.585 143.957 1.00 242.62 ?  -8  DT  I "O4'" 1 
ATOM 7301  C "C3'" . DT  I 5 66  ? 129.103 125.181 146.073 1.00 242.62 ?  -8  DT  I "C3'" 1 
ATOM 7302  O "O3'" . DT  I 5 66  ? 127.991 125.998 146.350 1.00 242.62 ?  -8  DT  I "O3'" 1 
ATOM 7303  C "C2'" . DT  I 5 66  ? 128.749 124.088 145.067 1.00 242.62 ?  -8  DT  I "C2'" 1 
ATOM 7304  C "C1'" . DT  I 5 66  ? 128.951 124.830 143.762 1.00 242.62 ?  -8  DT  I "C1'" 1 
ATOM 7305  N N1    . DT  I 5 66  ? 129.142 123.946 142.589 1.00 242.62 ?  -8  DT  I N1    1 
ATOM 7306  C C2    . DT  I 5 66  ? 128.349 124.124 141.489 1.00 242.62 ?  -8  DT  I C2    1 
ATOM 7307  O O2    . DT  I 5 66  ? 127.488 124.977 141.420 1.00 242.62 ?  -8  DT  I O2    1 
ATOM 7308  N N3    . DT  I 5 66  ? 128.598 123.265 140.462 1.00 242.62 ?  -8  DT  I N3    1 
ATOM 7309  C C4    . DT  I 5 66  ? 129.543 122.265 140.425 1.00 242.62 ?  -8  DT  I C4    1 
ATOM 7310  O O4    . DT  I 5 66  ? 129.695 121.542 139.450 1.00 242.62 ?  -8  DT  I O4    1 
ATOM 7311  C C5    . DT  I 5 66  ? 130.342 122.130 141.607 1.00 242.62 ?  -8  DT  I C5    1 
ATOM 7312  C C7    . DT  I 5 66  ? 131.400 121.072 141.675 1.00 242.62 ?  -8  DT  I C7    1 
ATOM 7313  C C6    . DT  I 5 66  ? 130.106 122.967 142.625 1.00 242.62 ?  -8  DT  I C6    1 
ATOM 7314  P P     . DC  I 5 67  ? 127.398 126.059 147.838 1.00 240.44 ?  -7  DC  I P     1 
ATOM 7315  O OP1   . DC  I 5 67  ? 127.121 127.477 148.145 1.00 240.44 ?  -7  DC  I OP1   1 
ATOM 7316  O OP2   . DC  I 5 67  ? 128.309 125.278 148.701 1.00 240.44 -1 -7  DC  I OP2   1 
ATOM 7317  O "O5'" . DC  I 5 67  ? 126.017 125.264 147.734 1.00 240.44 ?  -7  DC  I "O5'" 1 
ATOM 7318  C "C5'" . DC  I 5 67  ? 124.879 125.897 147.171 1.00 240.44 ?  -7  DC  I "C5'" 1 
ATOM 7319  C "C4'" . DC  I 5 67  ? 124.035 124.899 146.406 1.00 240.44 ?  -7  DC  I "C4'" 1 
ATOM 7320  O "O4'" . DC  I 5 67  ? 124.859 124.230 145.431 1.00 240.44 ?  -7  DC  I "O4'" 1 
ATOM 7321  C "C3'" . DC  I 5 67  ? 123.401 123.800 147.260 1.00 240.44 ?  -7  DC  I "C3'" 1 
ATOM 7322  O "O3'" . DC  I 5 67  ? 122.000 123.862 147.151 1.00 240.44 ?  -7  DC  I "O3'" 1 
ATOM 7323  C "C2'" . DC  I 5 67  ? 123.949 122.490 146.678 1.00 240.44 ?  -7  DC  I "C2'" 1 
ATOM 7324  C "C1'" . DC  I 5 67  ? 124.423 122.906 145.295 1.00 240.44 ?  -7  DC  I "C1'" 1 
ATOM 7325  N N1    . DC  I 5 67  ? 125.564 122.095 144.779 1.00 240.44 ?  -7  DC  I N1    1 
ATOM 7326  C C2    . DC  I 5 67  ? 126.075 122.355 143.506 1.00 240.44 ?  -7  DC  I C2    1 
ATOM 7327  O O2    . DC  I 5 67  ? 125.569 123.249 142.822 1.00 240.44 ?  -7  DC  I O2    1 
ATOM 7328  N N3    . DC  I 5 67  ? 127.111 121.619 143.055 1.00 240.44 ?  -7  DC  I N3    1 
ATOM 7329  C C4    . DC  I 5 67  ? 127.629 120.662 143.816 1.00 240.44 ?  -7  DC  I C4    1 
ATOM 7330  N N4    . DC  I 5 67  ? 128.648 119.959 143.323 1.00 240.44 ?  -7  DC  I N4    1 
ATOM 7331  C C5    . DC  I 5 67  ? 127.127 120.381 145.115 1.00 240.44 ?  -7  DC  I C5    1 
ATOM 7332  C C6    . DC  I 5 67  ? 126.109 121.119 145.555 1.00 240.44 ?  -7  DC  I C6    1 
ATOM 7333  P P     . DA  I 5 68  ? 121.137 124.566 148.303 1.00 230.88 ?  -6  DA  I P     1 
ATOM 7334  O OP1   . DA  I 5 68  ? 121.361 126.024 148.197 1.00 230.88 ?  -6  DA  I OP1   1 
ATOM 7335  O OP2   . DA  I 5 68  ? 121.433 123.866 149.570 1.00 230.88 -1 -6  DA  I OP2   1 
ATOM 7336  O "O5'" . DA  I 5 68  ? 119.630 124.245 147.889 1.00 230.88 ?  -6  DA  I "O5'" 1 
ATOM 7337  C "C5'" . DA  I 5 68  ? 119.134 124.706 146.650 1.00 230.88 ?  -6  DA  I "C5'" 1 
ATOM 7338  C "C4'" . DA  I 5 68  ? 118.742 123.546 145.760 1.00 230.88 ?  -6  DA  I "C4'" 1 
ATOM 7339  O "O4'" . DA  I 5 68  ? 119.871 122.649 145.595 1.00 230.88 ?  -6  DA  I "O4'" 1 
ATOM 7340  C "C3'" . DA  I 5 68  ? 117.595 122.688 146.288 1.00 230.88 ?  -6  DA  I "C3'" 1 
ATOM 7341  O "O3'" . DA  I 5 68  ? 116.675 122.453 145.257 1.00 230.88 ?  -6  DA  I "O3'" 1 
ATOM 7342  C "C2'" . DA  I 5 68  ? 118.284 121.394 146.714 1.00 230.88 ?  -6  DA  I "C2'" 1 
ATOM 7343  C "C1'" . DA  I 5 68  ? 119.418 121.326 145.714 1.00 230.88 ?  -6  DA  I "C1'" 1 
ATOM 7344  N N9    . DA  I 5 68  ? 120.531 120.489 146.146 1.00 230.88 ?  -6  DA  I N9    1 
ATOM 7345  C C8    . DA  I 5 68  ? 120.709 119.929 147.375 1.00 230.88 ?  -6  DA  I C8    1 
ATOM 7346  N N7    . DA  I 5 68  ? 121.806 119.222 147.479 1.00 230.88 ?  -6  DA  I N7    1 
ATOM 7347  C C5    . DA  I 5 68  ? 122.387 119.330 146.232 1.00 230.88 ?  -6  DA  I C5    1 
ATOM 7348  C C6    . DA  I 5 68  ? 123.568 118.799 145.687 1.00 230.88 ?  -6  DA  I C6    1 
ATOM 7349  N N6    . DA  I 5 68  ? 124.413 118.032 146.376 1.00 230.88 ?  -6  DA  I N6    1 
ATOM 7350  N N1    . DA  I 5 68  ? 123.853 119.092 144.406 1.00 230.88 ?  -6  DA  I N1    1 
ATOM 7351  C C2    . DA  I 5 68  ? 123.010 119.865 143.720 1.00 230.88 ?  -6  DA  I C2    1 
ATOM 7352  N N3    . DA  I 5 68  ? 121.867 120.413 144.122 1.00 230.88 ?  -6  DA  I N3    1 
ATOM 7353  C C4    . DA  I 5 68  ? 121.610 120.100 145.396 1.00 230.88 ?  -6  DA  I C4    1 
ATOM 7354  P P     . DG  I 5 69  ? 115.105 122.437 145.575 1.00 225.45 ?  -5  DG  I P     1 
ATOM 7355  O OP1   . DG  I 5 69  ? 114.628 123.835 145.528 1.00 225.45 ?  -5  DG  I OP1   1 
ATOM 7356  O OP2   . DG  I 5 69  ? 114.903 121.630 146.795 1.00 225.45 -1 -5  DG  I OP2   1 
ATOM 7357  O "O5'" . DG  I 5 69  ? 114.491 121.624 144.350 1.00 225.45 ?  -5  DG  I "O5'" 1 
ATOM 7358  C "C5'" . DG  I 5 69  ? 114.906 121.931 143.036 1.00 225.45 ?  -5  DG  I "C5'" 1 
ATOM 7359  C "C4'" . DG  I 5 69  ? 115.535 120.723 142.378 1.00 225.45 ?  -5  DG  I "C4'" 1 
ATOM 7360  O "O4'" . DG  I 5 69  ? 116.638 120.248 143.182 1.00 225.45 ?  -5  DG  I "O4'" 1 
ATOM 7361  C "C3'" . DG  I 5 69  ? 114.597 119.528 142.195 1.00 225.45 ?  -5  DG  I "C3'" 1 
ATOM 7362  O "O3'" . DG  I 5 69  ? 114.586 119.141 140.845 1.00 225.45 ?  -5  DG  I "O3'" 1 
ATOM 7363  C "C2'" . DG  I 5 69  ? 115.210 118.441 143.078 1.00 225.45 ?  -5  DG  I "C2'" 1 
ATOM 7364  C "C1'" . DG  I 5 69  ? 116.665 118.852 143.102 1.00 225.45 ?  -5  DG  I "C1'" 1 
ATOM 7365  N N9    . DG  I 5 69  ? 117.389 118.333 144.250 1.00 225.45 ?  -5  DG  I N9    1 
ATOM 7366  C C8    . DG  I 5 69  ? 116.925 118.228 145.532 1.00 225.45 ?  -5  DG  I C8    1 
ATOM 7367  N N7    . DG  I 5 69  ? 117.793 117.720 146.356 1.00 225.45 ?  -5  DG  I N7    1 
ATOM 7368  C C5    . DG  I 5 69  ? 118.904 117.476 145.570 1.00 225.45 ?  -5  DG  I C5    1 
ATOM 7369  C C6    . DG  I 5 69  ? 120.151 116.923 145.915 1.00 225.45 ?  -5  DG  I C6    1 
ATOM 7370  O O6    . DG  I 5 69  ? 120.538 116.539 147.022 1.00 225.45 ?  -5  DG  I O6    1 
ATOM 7371  N N1    . DG  I 5 69  ? 120.996 116.843 144.821 1.00 225.45 ?  -5  DG  I N1    1 
ATOM 7372  C C2    . DG  I 5 69  ? 120.675 117.246 143.554 1.00 225.45 ?  -5  DG  I C2    1 
ATOM 7373  N N2    . DG  I 5 69  ? 121.622 117.085 142.621 1.00 225.45 ?  -5  DG  I N2    1 
ATOM 7374  N N3    . DG  I 5 69  ? 119.503 117.757 143.214 1.00 225.45 ?  -5  DG  I N3    1 
ATOM 7375  C C4    . DG  I 5 69  ? 118.670 117.841 144.270 1.00 225.45 ?  -5  DG  I C4    1 
ATOM 7376  P P     . DC  I 5 70  ? 113.298 118.414 140.231 1.00 217.59 ?  -4  DC  I P     1 
ATOM 7377  O OP1   . DC  I 5 70  ? 113.467 118.403 138.763 1.00 217.59 ?  -4  DC  I OP1   1 
ATOM 7378  O OP2   . DC  I 5 70  ? 112.103 119.033 140.841 1.00 217.59 -1 -4  DC  I OP2   1 
ATOM 7379  O "O5'" . DC  I 5 70  ? 113.399 116.921 140.786 1.00 217.59 ?  -4  DC  I "O5'" 1 
ATOM 7380  C "C5'" . DC  I 5 70  ? 113.595 115.843 139.891 1.00 217.59 ?  -4  DC  I "C5'" 1 
ATOM 7381  C "C4'" . DC  I 5 70  ? 115.048 115.430 139.861 1.00 217.59 ?  -4  DC  I "C4'" 1 
ATOM 7382  O "O4'" . DC  I 5 70  ? 115.641 115.685 141.138 1.00 217.59 ?  -4  DC  I "O4'" 1 
ATOM 7383  C "C3'" . DC  I 5 70  ? 115.282 113.946 139.615 1.00 217.59 ?  -4  DC  I "C3'" 1 
ATOM 7384  O "O3'" . DC  I 5 70  ? 115.555 113.726 138.252 1.00 217.59 ?  -4  DC  I "O3'" 1 
ATOM 7385  C "C2'" . DC  I 5 70  ? 116.497 113.601 140.490 1.00 217.59 ?  -4  DC  I "C2'" 1 
ATOM 7386  C "C1'" . DC  I 5 70  ? 116.799 114.906 141.227 1.00 217.59 ?  -4  DC  I "C1'" 1 
ATOM 7387  N N1    . DC  I 5 70  ? 117.142 114.712 142.658 1.00 217.59 ?  -4  DC  I N1    1 
ATOM 7388  C C2    . DC  I 5 70  ? 118.480 114.676 143.039 1.00 217.59 ?  -4  DC  I C2    1 
ATOM 7389  O O2    . DC  I 5 70  ? 119.351 114.811 142.178 1.00 217.59 ?  -4  DC  I O2    1 
ATOM 7390  N N3    . DC  I 5 70  ? 118.786 114.494 144.338 1.00 217.59 ?  -4  DC  I N3    1 
ATOM 7391  C C4    . DC  I 5 70  ? 117.817 114.350 145.233 1.00 217.59 ?  -4  DC  I C4    1 
ATOM 7392  N N4    . DC  I 5 70  ? 118.170 114.177 146.507 1.00 217.59 ?  -4  DC  I N4    1 
ATOM 7393  C C5    . DC  I 5 70  ? 116.443 114.383 144.868 1.00 217.59 ?  -4  DC  I C5    1 
ATOM 7394  C C6    . DC  I 5 70  ? 116.155 114.563 143.580 1.00 217.59 ?  -4  DC  I C6    1 
ATOM 7395  P P     . DT  I 5 71  ? 115.042 112.384 137.542 1.00 211.40 ?  -3  DT  I P     1 
ATOM 7396  O OP1   . DT  I 5 71  ? 115.208 112.544 136.083 1.00 211.40 ?  -3  DT  I OP1   1 
ATOM 7397  O OP2   . DT  I 5 71  ? 113.708 112.085 138.096 1.00 211.40 -1 -3  DT  I OP2   1 
ATOM 7398  O "O5'" . DT  I 5 71  ? 116.040 111.260 138.080 1.00 211.40 ?  -3  DT  I "O5'" 1 
ATOM 7399  C "C5'" . DT  I 5 71  ? 117.403 111.260 137.675 1.00 211.40 ?  -3  DT  I "C5'" 1 
ATOM 7400  C "C4'" . DT  I 5 71  ? 118.156 110.080 138.272 1.00 211.40 ?  -3  DT  I "C4'" 1 
ATOM 7401  O "O4'" . DT  I 5 71  ? 118.284 110.258 139.705 1.00 211.40 ?  -3  DT  I "O4'" 1 
ATOM 7402  C "C3'" . DT  I 5 71  ? 117.497 108.714 138.071 1.00 211.40 ?  -3  DT  I "C3'" 1 
ATOM 7403  O "O3'" . DT  I 5 71  ? 118.476 107.743 137.770 1.00 211.40 ?  -3  DT  I "O3'" 1 
ATOM 7404  C "C2'" . DT  I 5 71  ? 116.855 108.441 139.423 1.00 211.40 ?  -3  DT  I "C2'" 1 
ATOM 7405  C "C1'" . DT  I 5 71  ? 117.853 109.091 140.361 1.00 211.40 ?  -3  DT  I "C1'" 1 
ATOM 7406  N N1    . DT  I 5 71  ? 117.265 109.475 141.668 1.00 211.40 ?  -3  DT  I N1    1 
ATOM 7407  C C2    . DT  I 5 71  ? 117.890 109.091 142.824 1.00 211.40 ?  -3  DT  I C2    1 
ATOM 7408  O O2    . DT  I 5 71  ? 118.919 108.445 142.842 1.00 211.40 ?  -3  DT  I O2    1 
ATOM 7409  N N3    . DT  I 5 71  ? 117.263 109.488 143.970 1.00 211.40 ?  -3  DT  I N3    1 
ATOM 7410  C C4    . DT  I 5 71  ? 116.101 110.218 144.069 1.00 211.40 ?  -3  DT  I C4    1 
ATOM 7411  O O4    . DT  I 5 71  ? 115.614 110.532 145.143 1.00 211.40 ?  -3  DT  I O4    1 
ATOM 7412  C C5    . DT  I 5 71  ? 115.497 110.585 142.822 1.00 211.40 ?  -3  DT  I C5    1 
ATOM 7413  C C7    . DT  I 5 71  ? 114.230 111.378 142.809 1.00 211.40 ?  -3  DT  I C7    1 
ATOM 7414  C C6    . DT  I 5 71  ? 116.100 110.200 141.693 1.00 211.40 ?  -3  DT  I C6    1 
ATOM 7415  P P     . DC  I 5 72  ? 118.055 106.203 137.608 1.00 222.99 ?  -2  DC  I P     1 
ATOM 7416  O OP1   . DC  I 5 72  ? 118.951 105.612 136.596 1.00 222.99 ?  -2  DC  I OP1   1 
ATOM 7417  O OP2   . DC  I 5 72  ? 116.589 106.139 137.445 1.00 222.99 -1 -2  DC  I OP2   1 
ATOM 7418  O "O5'" . DC  I 5 72  ? 118.381 105.552 139.026 1.00 222.99 ?  -2  DC  I "O5'" 1 
ATOM 7419  C "C5'" . DC  I 5 72  ? 119.712 105.526 139.506 1.00 222.99 ?  -2  DC  I "C5'" 1 
ATOM 7420  C "C4'" . DC  I 5 72  ? 119.818 104.667 140.753 1.00 222.99 ?  -2  DC  I "C4'" 1 
ATOM 7421  O "O4'" . DC  I 5 72  ? 119.191 105.344 141.867 1.00 222.99 ?  -2  DC  I "O4'" 1 
ATOM 7422  C "C3'" . DC  I 5 72  ? 119.162 103.296 140.645 1.00 222.99 ?  -2  DC  I "C3'" 1 
ATOM 7423  O "O3'" . DC  I 5 72  ? 120.041 102.311 141.130 1.00 222.99 ?  -2  DC  I "O3'" 1 
ATOM 7424  C "C2'" . DC  I 5 72  ? 117.903 103.412 141.507 1.00 222.99 ?  -2  DC  I "C2'" 1 
ATOM 7425  C "C1'" . DC  I 5 72  ? 118.281 104.486 142.515 1.00 222.99 ?  -2  DC  I "C1'" 1 
ATOM 7426  N N1    . DC  I 5 72  ? 117.126 105.308 142.961 1.00 222.99 ?  -2  DC  I N1    1 
ATOM 7427  C C2    . DC  I 5 72  ? 116.763 105.330 144.305 1.00 222.99 ?  -2  DC  I C2    1 
ATOM 7428  O O2    . DC  I 5 72  ? 117.400 104.647 145.111 1.00 222.99 ?  -2  DC  I O2    1 
ATOM 7429  N N3    . DC  I 5 72  ? 115.710 106.088 144.687 1.00 222.99 ?  -2  DC  I N3    1 
ATOM 7430  C C4    . DC  I 5 72  ? 115.050 106.809 143.788 1.00 222.99 ?  -2  DC  I C4    1 
ATOM 7431  N N4    . DC  I 5 72  ? 114.024 107.546 144.209 1.00 222.99 ?  -2  DC  I N4    1 
ATOM 7432  C C5    . DC  I 5 72  ? 115.406 106.802 142.417 1.00 222.99 ?  -2  DC  I C5    1 
ATOM 7433  C C6    . DC  I 5 72  ? 116.442 106.048 142.052 1.00 222.99 ?  -2  DC  I C6    1 
ATOM 7434  P P     . DT  I 5 73  ? 119.629 100.763 141.068 1.00 239.18 ?  -1  DT  I P     1 
ATOM 7435  O OP1   . DT  I 5 73  ? 120.851 99.992  140.762 1.00 239.18 ?  -1  DT  I OP1   1 
ATOM 7436  O OP2   . DT  I 5 73  ? 118.444 100.650 140.192 1.00 239.18 -1 -1  DT  I OP2   1 
ATOM 7437  O "O5'" . DT  I 5 73  ? 119.183 100.436 142.565 1.00 239.18 ?  -1  DT  I "O5'" 1 
ATOM 7438  C "C5'" . DT  I 5 73  ? 120.062 100.737 143.637 1.00 239.18 ?  -1  DT  I "C5'" 1 
ATOM 7439  C "C4'" . DT  I 5 73  ? 119.421 100.422 144.974 1.00 239.18 ?  -1  DT  I "C4'" 1 
ATOM 7440  O "O4'" . DT  I 5 73  ? 118.438 101.434 145.301 1.00 239.18 ?  -1  DT  I "O4'" 1 
ATOM 7441  C "C3'" . DT  I 5 73  ? 118.692 99.082  145.039 1.00 239.18 ?  -1  DT  I "C3'" 1 
ATOM 7442  O "O3'" . DT  I 5 73  ? 119.107 98.380  146.185 1.00 239.18 ?  -1  DT  I "O3'" 1 
ATOM 7443  C "C2'" . DT  I 5 73  ? 117.216 99.475  145.124 1.00 239.18 ?  -1  DT  I "C2'" 1 
ATOM 7444  C "C1'" . DT  I 5 73  ? 117.303 100.808 145.837 1.00 239.18 ?  -1  DT  I "C1'" 1 
ATOM 7445  N N1    . DT  I 5 73  ? 116.126 101.693 145.612 1.00 239.18 ?  -1  DT  I N1    1 
ATOM 7446  C C2    . DT  I 5 73  ? 115.450 102.194 146.696 1.00 239.18 ?  -1  DT  I C2    1 
ATOM 7447  O O2    . DT  I 5 73  ? 115.754 101.940 147.844 1.00 239.18 ?  -1  DT  I O2    1 
ATOM 7448  N N3    . DT  I 5 73  ? 114.389 102.996 146.388 1.00 239.18 ?  -1  DT  I N3    1 
ATOM 7449  C C4    . DT  I 5 73  ? 113.952 103.350 145.131 1.00 239.18 ?  -1  DT  I C4    1 
ATOM 7450  O O4    . DT  I 5 73  ? 112.988 104.081 144.956 1.00 239.18 ?  -1  DT  I O4    1 
ATOM 7451  C C5    . DT  I 5 73  ? 114.702 102.794 144.039 1.00 239.18 ?  -1  DT  I C5    1 
ATOM 7452  C C7    . DT  I 5 73  ? 114.319 103.114 142.631 1.00 239.18 ?  -1  DT  I C7    1 
ATOM 7453  C C6    . DT  I 5 73  ? 115.745 102.004 144.326 1.00 239.18 ?  -1  DT  I C6    1 
ATOM 7454  P P     . DG  I 5 74  ? 118.668 96.852  146.397 1.00 253.73 ?  0   DG  I P     1 
ATOM 7455  O OP1   . DG  I 5 74  ? 119.864 96.115  146.854 1.00 253.73 ?  0   DG  I OP1   1 
ATOM 7456  O OP2   . DG  I 5 74  ? 117.939 96.412  145.189 1.00 253.73 -1 0   DG  I OP2   1 
ATOM 7457  O "O5'" . DG  I 5 74  ? 117.620 96.928  147.596 1.00 253.73 ?  0   DG  I "O5'" 1 
ATOM 7458  C "C5'" . DG  I 5 74  ? 118.002 97.526  148.819 1.00 253.73 ?  0   DG  I "C5'" 1 
ATOM 7459  C "C4'" . DG  I 5 74  ? 116.797 97.749  149.707 1.00 253.73 ?  0   DG  I "C4'" 1 
ATOM 7460  O "O4'" . DG  I 5 74  ? 115.988 98.818  149.166 1.00 253.73 ?  0   DG  I "O4'" 1 
ATOM 7461  C "C3'" . DG  I 5 74  ? 115.875 96.539  149.849 1.00 253.73 ?  0   DG  I "C3'" 1 
ATOM 7462  O "O3'" . DG  I 5 74  ? 115.637 96.280  151.212 1.00 253.73 ?  0   DG  I "O3'" 1 
ATOM 7463  C "C2'" . DG  I 5 74  ? 114.596 96.958  149.123 1.00 253.73 ?  0   DG  I "C2'" 1 
ATOM 7464  C "C1'" . DG  I 5 74  ? 114.634 98.468  149.262 1.00 253.73 ?  0   DG  I "C1'" 1 
ATOM 7465  N N9    . DG  I 5 74  ? 113.912 99.165  148.208 1.00 253.73 ?  0   DG  I N9    1 
ATOM 7466  C C8    . DG  I 5 74  ? 114.172 99.120  146.865 1.00 253.73 ?  0   DG  I C8    1 
ATOM 7467  N N7    . DG  I 5 74  ? 113.362 99.852  146.157 1.00 253.73 ?  0   DG  I N7    1 
ATOM 7468  C C5    . DG  I 5 74  ? 112.517 100.424 147.094 1.00 253.73 ?  0   DG  I C5    1 
ATOM 7469  C C6    . DG  I 5 74  ? 111.438 101.316 146.920 1.00 253.73 ?  0   DG  I C6    1 
ATOM 7470  O O6    . DG  I 5 74  ? 111.000 101.791 145.866 1.00 253.73 ?  0   DG  I O6    1 
ATOM 7471  N N1    . DG  I 5 74  ? 110.844 101.649 148.130 1.00 253.73 ?  0   DG  I N1    1 
ATOM 7472  C C2    . DG  I 5 74  ? 111.248 101.185 149.353 1.00 253.73 ?  0   DG  I C2    1 
ATOM 7473  N N2    . DG  I 5 74  ? 110.550 101.619 150.411 1.00 253.73 ?  0   DG  I N2    1 
ATOM 7474  N N3    . DG  I 5 74  ? 112.256 100.345 149.530 1.00 253.73 ?  0   DG  I N3    1 
ATOM 7475  C C4    . DG  I 5 74  ? 112.844 100.013 148.360 1.00 253.73 ?  0   DG  I C4    1 
ATOM 7476  P P     . DT  I 5 75  ? 115.003 94.879  151.663 1.00 246.59 ?  1   DT  I P     1 
ATOM 7477  O OP1   . DT  I 5 75  ? 115.867 94.311  152.719 1.00 246.59 ?  1   DT  I OP1   1 
ATOM 7478  O OP2   . DT  I 5 75  ? 114.735 94.096  150.438 1.00 246.59 -1 1   DT  I OP2   1 
ATOM 7479  O "O5'" . DT  I 5 75  ? 113.601 95.294  152.298 1.00 246.59 ?  1   DT  I "O5'" 1 
ATOM 7480  C "C5'" . DT  I 5 75  ? 113.517 96.444  153.123 1.00 246.59 ?  1   DT  I "C5'" 1 
ATOM 7481  C "C4'" . DT  I 5 75  ? 112.072 96.817  153.378 1.00 246.59 ?  1   DT  I "C4'" 1 
ATOM 7482  O "O4'" . DT  I 5 75  ? 111.598 97.701  152.327 1.00 246.59 ?  1   DT  I "O4'" 1 
ATOM 7483  C "C3'" . DT  I 5 75  ? 111.096 95.639  153.408 1.00 246.59 ?  1   DT  I "C3'" 1 
ATOM 7484  O "O3'" . DT  I 5 75  ? 110.205 95.788  154.491 1.00 246.59 ?  1   DT  I "O3'" 1 
ATOM 7485  C "C2'" . DT  I 5 75  ? 110.364 95.765  152.075 1.00 246.59 ?  1   DT  I "C2'" 1 
ATOM 7486  C "C1'" . DT  I 5 75  ? 110.326 97.268  151.919 1.00 246.59 ?  1   DT  I "C1'" 1 
ATOM 7487  N N1    . DT  I 5 75  ? 110.080 97.722  150.522 1.00 246.59 ?  1   DT  I N1    1 
ATOM 7488  C C2    . DT  I 5 75  ? 109.123 98.677  150.290 1.00 246.59 ?  1   DT  I C2    1 
ATOM 7489  O O2    . DT  I 5 75  ? 108.462 99.184  151.173 1.00 246.59 ?  1   DT  I O2    1 
ATOM 7490  N N3    . DT  I 5 75  ? 108.968 99.026  148.981 1.00 246.59 ?  1   DT  I N3    1 
ATOM 7491  C C4    . DT  I 5 75  ? 109.662 98.527  147.901 1.00 246.59 ?  1   DT  I C4    1 
ATOM 7492  O O4    . DT  I 5 75  ? 109.448 98.902  146.757 1.00 246.59 ?  1   DT  I O4    1 
ATOM 7493  C C5    . DT  I 5 75  ? 110.643 97.522  148.209 1.00 246.59 ?  1   DT  I C5    1 
ATOM 7494  C C7    . DT  I 5 75  ? 111.450 96.905  147.112 1.00 246.59 ?  1   DT  I C7    1 
ATOM 7495  C C6    . DT  I 5 75  ? 110.806 97.172  149.490 1.00 246.59 ?  1   DT  I C6    1 
ATOM 7496  P P     . DG  I 5 76  ? 109.303 94.554  154.978 1.00 242.52 ?  2   DG  I P     1 
ATOM 7497  O OP1   . DG  I 5 76  ? 110.141 93.715  155.861 1.00 242.52 ?  2   DG  I OP1   1 
ATOM 7498  O OP2   . DG  I 5 76  ? 108.641 93.955  153.801 1.00 242.52 -1 2   DG  I OP2   1 
ATOM 7499  O "O5'" . DG  I 5 76  ? 108.174 95.251  155.857 1.00 242.52 ?  2   DG  I "O5'" 1 
ATOM 7500  C "C5'" . DG  I 5 76  ? 107.859 96.607  155.629 1.00 242.52 ?  2   DG  I "C5'" 1 
ATOM 7501  C "C4'" . DG  I 5 76  ? 106.552 96.734  154.879 1.00 242.52 ?  2   DG  I "C4'" 1 
ATOM 7502  O "O4'" . DG  I 5 76  ? 106.804 96.995  153.475 1.00 242.52 ?  2   DG  I "O4'" 1 
ATOM 7503  C "C3'" . DG  I 5 76  ? 105.656 95.491  154.919 1.00 242.52 ?  2   DG  I "C3'" 1 
ATOM 7504  O "O3'" . DG  I 5 76  ? 104.334 95.879  155.214 1.00 242.52 ?  2   DG  I "O3'" 1 
ATOM 7505  C "C2'" . DG  I 5 76  ? 105.761 94.948  153.497 1.00 242.52 ?  2   DG  I "C2'" 1 
ATOM 7506  C "C1'" . DG  I 5 76  ? 105.884 96.244  152.730 1.00 242.52 ?  2   DG  I "C1'" 1 
ATOM 7507  N N9    . DG  I 5 76  ? 106.371 96.095  151.364 1.00 242.52 ?  2   DG  I N9    1 
ATOM 7508  C C8    . DG  I 5 76  ? 107.155 95.087  150.862 1.00 242.52 ?  2   DG  I C8    1 
ATOM 7509  N N7    . DG  I 5 76  ? 107.427 95.225  149.597 1.00 242.52 ?  2   DG  I N7    1 
ATOM 7510  C C5    . DG  I 5 76  ? 106.775 96.392  149.240 1.00 242.52 ?  2   DG  I C5    1 
ATOM 7511  C C6    . DG  I 5 76  ? 106.701 97.039  147.996 1.00 242.52 ?  2   DG  I C6    1 
ATOM 7512  O O6    . DG  I 5 76  ? 107.227 96.707  146.932 1.00 242.52 ?  2   DG  I O6    1 
ATOM 7513  N N1    . DG  I 5 76  ? 105.941 98.199  148.063 1.00 242.52 ?  2   DG  I N1    1 
ATOM 7514  C C2    . DG  I 5 76  ? 105.321 98.663  149.191 1.00 242.52 ?  2   DG  I C2    1 
ATOM 7515  N N2    . DG  I 5 76  ? 104.625 99.799  149.061 1.00 242.52 ?  2   DG  I N2    1 
ATOM 7516  N N3    . DG  I 5 76  ? 105.378 98.061  150.364 1.00 242.52 ?  2   DG  I N3    1 
ATOM 7517  C C4    . DG  I 5 76  ? 106.119 96.935  150.313 1.00 242.52 ?  2   DG  I C4    1 
ATOM 7518  P P     . DA  I 5 77  ? 103.273 94.796  155.736 1.00 243.26 ?  3   DA  I P     1 
ATOM 7519  O OP1   . DA  I 5 77  ? 103.535 94.558  157.172 1.00 243.26 ?  3   DA  I OP1   1 
ATOM 7520  O OP2   . DA  I 5 77  ? 103.292 93.662  154.787 1.00 243.26 -1 3   DA  I OP2   1 
ATOM 7521  O "O5'" . DA  I 5 77  ? 101.866 95.534  155.568 1.00 243.26 ?  3   DA  I "O5'" 1 
ATOM 7522  C "C5'" . DA  I 5 77  ? 101.738 96.919  155.877 1.00 243.26 ?  3   DA  I "C5'" 1 
ATOM 7523  C "C4'" . DA  I 5 77  ? 100.865 97.636  154.856 1.00 243.26 ?  3   DA  I "C4'" 1 
ATOM 7524  O "O4'" . DA  I 5 77  ? 101.537 97.653  153.578 1.00 243.26 ?  3   DA  I "O4'" 1 
ATOM 7525  C "C3'" . DA  I 5 77  ? 99.493  97.015  154.611 1.00 243.26 ?  3   DA  I "C3'" 1 
ATOM 7526  O "O3'" . DA  I 5 77  ? 98.515  98.024  154.436 1.00 243.26 ?  3   DA  I "O3'" 1 
ATOM 7527  C "C2'" . DA  I 5 77  ? 99.689  96.214  153.334 1.00 243.26 ?  3   DA  I "C2'" 1 
ATOM 7528  C "C1'" . DA  I 5 77  ? 100.753 97.013  152.599 1.00 243.26 ?  3   DA  I "C1'" 1 
ATOM 7529  N N9    . DA  I 5 77  ? 101.638 96.176  151.806 1.00 243.26 ?  3   DA  I N9    1 
ATOM 7530  C C8    . DA  I 5 77  ? 102.450 95.183  152.267 1.00 243.26 ?  3   DA  I C8    1 
ATOM 7531  N N7    . DA  I 5 77  ? 103.144 94.590  151.329 1.00 243.26 ?  3   DA  I N7    1 
ATOM 7532  C C5    . DA  I 5 77  ? 102.763 95.240  150.174 1.00 243.26 ?  3   DA  I C5    1 
ATOM 7533  C C6    . DA  I 5 77  ? 103.142 95.081  148.835 1.00 243.26 ?  3   DA  I C6    1 
ATOM 7534  N N6    . DA  I 5 77  ? 104.026 94.171  148.428 1.00 243.26 ?  3   DA  I N6    1 
ATOM 7535  N N1    . DA  I 5 77  ? 102.569 95.890  147.924 1.00 243.26 ?  3   DA  I N1    1 
ATOM 7536  C C2    . DA  I 5 77  ? 101.683 96.803  148.333 1.00 243.26 ?  3   DA  I C2    1 
ATOM 7537  N N3    . DA  I 5 77  ? 101.247 97.044  149.565 1.00 243.26 ?  3   DA  I N3    1 
ATOM 7538  C C4    . DA  I 5 77  ? 101.836 96.224  150.447 1.00 243.26 ?  3   DA  I C4    1 
ATOM 7539  P P     . DG  I 5 78  ? 96.956  97.632  154.405 1.00 228.27 ?  4   DG  I P     1 
ATOM 7540  O OP1   . DG  I 5 78  ? 96.187  98.834  154.787 1.00 228.27 ?  4   DG  I OP1   1 
ATOM 7541  O OP2   . DG  I 5 78  ? 96.789  96.374  155.165 1.00 228.27 -1 4   DG  I OP2   1 
ATOM 7542  O "O5'" . DG  I 5 78  ? 96.661  97.320  152.866 1.00 228.27 ?  4   DG  I "O5'" 1 
ATOM 7543  C "C5'" . DG  I 5 78  ? 96.909  98.314  151.892 1.00 228.27 ?  4   DG  I "C5'" 1 
ATOM 7544  C "C4'" . DG  I 5 78  ? 96.855  97.735  150.490 1.00 228.27 ?  4   DG  I "C4'" 1 
ATOM 7545  O "O4'" . DG  I 5 78  ? 98.036  96.948  150.235 1.00 228.27 ?  4   DG  I "O4'" 1 
ATOM 7546  C "C3'" . DG  I 5 78  ? 95.663  96.819  150.204 1.00 228.27 ?  4   DG  I "C3'" 1 
ATOM 7547  O "O3'" . DG  I 5 78  ? 94.831  97.419  149.225 1.00 228.27 ?  4   DG  I "O3'" 1 
ATOM 7548  C "C2'" . DG  I 5 78  ? 96.299  95.516  149.690 1.00 228.27 ?  4   DG  I "C2'" 1 
ATOM 7549  C "C1'" . DG  I 5 78  ? 97.702  95.958  149.306 1.00 228.27 ?  4   DG  I "C1'" 1 
ATOM 7550  N N9    . DG  I 5 78  ? 98.702  94.897  149.385 1.00 228.27 ?  4   DG  I N9    1 
ATOM 7551  C C8    . DG  I 5 78  ? 99.168  94.288  150.518 1.00 228.27 ?  4   DG  I C8    1 
ATOM 7552  N N7    . DG  I 5 78  ? 100.071 93.382  150.289 1.00 228.27 ?  4   DG  I N7    1 
ATOM 7553  C C5    . DG  I 5 78  ? 100.210 93.385  148.914 1.00 228.27 ?  4   DG  I C5    1 
ATOM 7554  C C6    . DG  I 5 78  ? 101.040 92.607  148.089 1.00 228.27 ?  4   DG  I C6    1 
ATOM 7555  O O6    . DG  I 5 78  ? 101.848 91.734  148.423 1.00 228.27 ?  4   DG  I O6    1 
ATOM 7556  N N1    . DG  I 5 78  ? 100.875 92.925  146.750 1.00 228.27 ?  4   DG  I N1    1 
ATOM 7557  C C2    . DG  I 5 78  ? 100.012 93.876  146.272 1.00 228.27 ?  4   DG  I C2    1 
ATOM 7558  N N2    . DG  I 5 78  ? 99.989  94.041  144.945 1.00 228.27 ?  4   DG  I N2    1 
ATOM 7559  N N3    . DG  I 5 78  ? 99.224  94.611  147.037 1.00 228.27 ?  4   DG  I N3    1 
ATOM 7560  C C4    . DG  I 5 78  ? 99.376  94.313  148.342 1.00 228.27 ?  4   DG  I C4    1 
ATOM 7561  P P     . DT  I 5 79  ? 93.550  96.639  148.652 1.00 229.26 ?  5   DT  I P     1 
ATOM 7562  O OP1   . DT  I 5 79  ? 92.525  97.651  148.328 1.00 229.26 ?  5   DT  I OP1   1 
ATOM 7563  O OP2   . DT  I 5 79  ? 93.230  95.534  149.576 1.00 229.26 -1 5   DT  I OP2   1 
ATOM 7564  O "O5'" . DT  I 5 79  ? 94.074  96.006  147.287 1.00 229.26 ?  5   DT  I "O5'" 1 
ATOM 7565  C "C5'" . DT  I 5 79  ? 94.796  96.810  146.377 1.00 229.26 ?  5   DT  I "C5'" 1 
ATOM 7566  C "C4'" . DT  I 5 79  ? 95.340  95.982  145.230 1.00 229.26 ?  5   DT  I "C4'" 1 
ATOM 7567  O "O4'" . DT  I 5 79  ? 96.356  95.068  145.719 1.00 229.26 ?  5   DT  I "O4'" 1 
ATOM 7568  C "C3'" . DT  I 5 79  ? 94.305  95.114  144.508 1.00 229.26 ?  5   DT  I "C3'" 1 
ATOM 7569  O "O3'" . DT  I 5 79  ? 94.488  95.220  143.106 1.00 229.26 ?  5   DT  I "O3'" 1 
ATOM 7570  C "C2'" . DT  I 5 79  ? 94.639  93.707  144.999 1.00 229.26 ?  5   DT  I "C2'" 1 
ATOM 7571  C "C1'" . DT  I 5 79  ? 96.142  93.815  145.126 1.00 229.26 ?  5   DT  I "C1'" 1 
ATOM 7572  N N1    . DT  I 5 79  ? 96.758  92.770  145.970 1.00 229.26 ?  5   DT  I N1    1 
ATOM 7573  C C2    . DT  I 5 79  ? 97.556  91.828  145.377 1.00 229.26 ?  5   DT  I C2    1 
ATOM 7574  O O2    . DT  I 5 79  ? 97.788  91.808  144.186 1.00 229.26 ?  5   DT  I O2    1 
ATOM 7575  N N3    . DT  I 5 79  ? 98.086  90.908  146.230 1.00 229.26 ?  5   DT  I N3    1 
ATOM 7576  C C4    . DT  I 5 79  ? 97.898  90.834  147.591 1.00 229.26 ?  5   DT  I C4    1 
ATOM 7577  O O4    . DT  I 5 79  ? 98.417  89.962  148.276 1.00 229.26 ?  5   DT  I O4    1 
ATOM 7578  C C5    . DT  I 5 79  ? 97.047  91.849  148.153 1.00 229.26 ?  5   DT  I C5    1 
ATOM 7579  C C7    . DT  I 5 79  ? 96.768  91.859  149.625 1.00 229.26 ?  5   DT  I C7    1 
ATOM 7580  C C6    . DT  I 5 79  ? 96.519  92.759  147.323 1.00 229.26 ?  5   DT  I C6    1 
ATOM 7581  P P     . DG  I 5 80  ? 93.754  96.379  142.273 1.00 217.51 ?  6   DG  I P     1 
ATOM 7582  O OP1   . DG  I 5 80  ? 94.537  97.619  142.437 1.00 217.51 ?  6   DG  I OP1   1 
ATOM 7583  O OP2   . DG  I 5 80  ? 92.318  96.355  142.611 1.00 217.51 -1 6   DG  I OP2   1 
ATOM 7584  O "O5'" . DG  I 5 80  ? 93.902  95.905  140.761 1.00 217.51 ?  6   DG  I "O5'" 1 
ATOM 7585  C "C5'" . DG  I 5 80  ? 95.186  95.818  140.179 1.00 217.51 ?  6   DG  I "C5'" 1 
ATOM 7586  C "C4'" . DG  I 5 80  ? 95.440  94.435  139.605 1.00 217.51 ?  6   DG  I "C4'" 1 
ATOM 7587  O "O4'" . DG  I 5 80  ? 95.450  93.450  140.669 1.00 217.51 ?  6   DG  I "O4'" 1 
ATOM 7588  C "C3'" . DG  I 5 80  ? 94.408  93.939  138.591 1.00 217.51 ?  6   DG  I "C3'" 1 
ATOM 7589  O "O3'" . DG  I 5 80  ? 95.079  93.268  137.554 1.00 217.51 ?  6   DG  I "O3'" 1 
ATOM 7590  C "C2'" . DG  I 5 80  ? 93.572  92.967  139.415 1.00 217.51 ?  6   DG  I "C2'" 1 
ATOM 7591  C "C1'" . DG  I 5 80  ? 94.656  92.358  140.275 1.00 217.51 ?  6   DG  I "C1'" 1 
ATOM 7592  N N9    . DG  I 5 80  ? 94.169  91.685  141.468 1.00 217.51 ?  6   DG  I N9    1 
ATOM 7593  C C8    . DG  I 5 80  ? 93.137  92.077  142.278 1.00 217.51 ?  6   DG  I C8    1 
ATOM 7594  N N7    . DG  I 5 80  ? 92.939  91.274  143.284 1.00 217.51 ?  6   DG  I N7    1 
ATOM 7595  C C5    . DG  I 5 80  ? 93.902  90.291  143.127 1.00 217.51 ?  6   DG  I C5    1 
ATOM 7596  C C6    . DG  I 5 80  ? 94.176  89.153  143.913 1.00 217.51 ?  6   DG  I C6    1 
ATOM 7597  O O6    . DG  I 5 80  ? 93.600  88.775  144.940 1.00 217.51 ?  6   DG  I O6    1 
ATOM 7598  N N1    . DG  I 5 80  ? 95.238  88.418  143.399 1.00 217.51 ?  6   DG  I N1    1 
ATOM 7599  C C2    . DG  I 5 80  ? 95.942  88.745  142.269 1.00 217.51 ?  6   DG  I C2    1 
ATOM 7600  N N2    . DG  I 5 80  ? 96.933  87.917  141.927 1.00 217.51 ?  6   DG  I N2    1 
ATOM 7601  N N3    . DG  I 5 80  ? 95.694  89.808  141.527 1.00 217.51 ?  6   DG  I N3    1 
ATOM 7602  C C4    . DG  I 5 80  ? 94.665  90.531  142.014 1.00 217.51 ?  6   DG  I C4    1 
ATOM 7603  P P     . DA  I 5 81  ? 94.270  92.351  136.519 1.00 215.34 ?  7   DA  I P     1 
ATOM 7604  O OP1   . DA  I 5 81  ? 93.172  93.156  135.951 1.00 215.34 ?  7   DA  I OP1   1 
ATOM 7605  O OP2   . DA  I 5 81  ? 93.993  91.052  137.141 1.00 215.34 -1 7   DA  I OP2   1 
ATOM 7606  O "O5'" . DA  I 5 81  ? 95.353  92.029  135.412 1.00 215.34 ?  7   DA  I "O5'" 1 
ATOM 7607  C "C5'" . DA  I 5 81  ? 96.670  91.749  135.815 1.00 215.34 ?  7   DA  I "C5'" 1 
ATOM 7608  C "C4'" . DA  I 5 81  ? 96.900  90.260  135.917 1.00 215.34 ?  7   DA  I "C4'" 1 
ATOM 7609  O "O4'" . DA  I 5 81  ? 96.355  89.752  137.158 1.00 215.34 ?  7   DA  I "O4'" 1 
ATOM 7610  C "C3'" . DA  I 5 81  ? 96.253  89.420  134.810 1.00 215.34 ?  7   DA  I "C3'" 1 
ATOM 7611  O "O3'" . DA  I 5 81  ? 97.202  88.509  134.307 1.00 215.34 ?  7   DA  I "O3'" 1 
ATOM 7612  C "C2'" . DA  I 5 81  ? 95.137  88.693  135.549 1.00 215.34 ?  7   DA  I "C2'" 1 
ATOM 7613  C "C1'" . DA  I 5 81  ? 95.823  88.492  136.872 1.00 215.34 ?  7   DA  I "C1'" 1 
ATOM 7614  N N9    . DA  I 5 81  ? 94.957  88.042  137.958 1.00 215.34 ?  7   DA  I N9    1 
ATOM 7615  C C8    . DA  I 5 81  ? 93.717  88.502  138.286 1.00 215.34 ?  7   DA  I C8    1 
ATOM 7616  N N7    . DA  I 5 81  ? 93.183  87.892  139.310 1.00 215.34 ?  7   DA  I N7    1 
ATOM 7617  C C5    . DA  I 5 81  ? 94.135  86.966  139.669 1.00 215.34 ?  7   DA  I C5    1 
ATOM 7618  C C6    . DA  I 5 81  ? 94.177  86.004  140.680 1.00 215.34 ?  7   DA  I C6    1 
ATOM 7619  N N6    . DA  I 5 81  ? 93.185  85.816  141.548 1.00 215.34 ?  7   DA  I N6    1 
ATOM 7620  N N1    . DA  I 5 81  ? 95.278  85.233  140.767 1.00 215.34 ?  7   DA  I N1    1 
ATOM 7621  C C2    . DA  I 5 81  ? 96.268  85.423  139.895 1.00 215.34 ?  7   DA  I C2    1 
ATOM 7622  N N3    . DA  I 5 81  ? 96.337  86.293  138.901 1.00 215.34 ?  7   DA  I N3    1 
ATOM 7623  C C4    . DA  I 5 81  ? 95.230  87.042  138.846 1.00 215.34 ?  7   DA  I C4    1 
ATOM 7624  P P     . DA  I 5 82  ? 96.906  87.689  132.962 1.00 218.90 ?  8   DA  I P     1 
ATOM 7625  O OP1   . DA  I 5 82  ? 97.844  88.185  131.936 1.00 218.90 ?  8   DA  I OP1   1 
ATOM 7626  O OP2   . DA  I 5 82  ? 95.454  87.709  132.703 1.00 218.90 -1 8   DA  I OP2   1 
ATOM 7627  O "O5'" . DA  I 5 82  ? 97.306  86.194  133.334 1.00 218.90 ?  8   DA  I "O5'" 1 
ATOM 7628  C "C5'" . DA  I 5 82  ? 98.661  85.816  133.324 1.00 218.90 ?  8   DA  I "C5'" 1 
ATOM 7629  C "C4'" . DA  I 5 82  ? 98.929  84.713  134.326 1.00 218.90 ?  8   DA  I "C4'" 1 
ATOM 7630  O "O4'" . DA  I 5 82  ? 98.077  84.883  135.483 1.00 218.90 ?  8   DA  I "O4'" 1 
ATOM 7631  C "C3'" . DA  I 5 82  ? 98.663  83.307  133.826 1.00 218.90 ?  8   DA  I "C3'" 1 
ATOM 7632  O "O3'" . DA  I 5 82  ? 99.560  82.432  134.438 1.00 218.90 ?  8   DA  I "O3'" 1 
ATOM 7633  C "C2'" . DA  I 5 82  ? 97.245  83.047  134.302 1.00 218.90 ?  8   DA  I "C2'" 1 
ATOM 7634  C "C1'" . DA  I 5 82  ? 97.256  83.747  135.647 1.00 218.90 ?  8   DA  I "C1'" 1 
ATOM 7635  N N9    . DA  I 5 82  ? 95.945  84.208  136.068 1.00 218.90 ?  8   DA  I N9    1 
ATOM 7636  C C8    . DA  I 5 82  ? 95.221  85.211  135.507 1.00 218.90 ?  8   DA  I C8    1 
ATOM 7637  N N7    . DA  I 5 82  ? 94.073  85.428  136.094 1.00 218.90 ?  8   DA  I N7    1 
ATOM 7638  C C5    . DA  I 5 82  ? 94.041  84.500  137.107 1.00 218.90 ?  8   DA  I C5    1 
ATOM 7639  C C6    . DA  I 5 82  ? 93.086  84.214  138.088 1.00 218.90 ?  8   DA  I C6    1 
ATOM 7640  N N6    . DA  I 5 82  ? 91.936  84.875  138.201 1.00 218.90 ?  8   DA  I N6    1 
ATOM 7641  N N1    . DA  I 5 82  ? 93.360  83.226  138.960 1.00 218.90 ?  8   DA  I N1    1 
ATOM 7642  C C2    . DA  I 5 82  ? 94.519  82.571  138.847 1.00 218.90 ?  8   DA  I C2    1 
ATOM 7643  N N3    . DA  I 5 82  ? 95.494  82.751  137.959 1.00 218.90 ?  8   DA  I N3    1 
ATOM 7644  C C4    . DA  I 5 82  ? 95.192  83.745  137.117 1.00 218.90 ?  8   DA  I C4    1 
ATOM 7645  P P     . DA  I 5 83  ? 99.802  80.973  133.827 1.00 242.84 ?  9   DA  I P     1 
ATOM 7646  O OP1   . DA  I 5 83  ? 101.154 80.575  134.271 1.00 242.84 ?  9   DA  I OP1   1 
ATOM 7647  O OP2   . DA  I 5 83  ? 99.443  80.992  132.393 1.00 242.84 -1 9   DA  I OP2   1 
ATOM 7648  O "O5'" . DA  I 5 83  ? 98.752  80.050  134.593 1.00 242.84 ?  9   DA  I "O5'" 1 
ATOM 7649  C "C5'" . DA  I 5 83  ? 99.132  79.452  135.810 1.00 242.84 ?  9   DA  I "C5'" 1 
ATOM 7650  C "C4'" . DA  I 5 83  ? 97.971  78.727  136.446 1.00 242.84 ?  9   DA  I "C4'" 1 
ATOM 7651  O "O4'" . DA  I 5 83  ? 96.891  79.654  136.686 1.00 242.84 ?  9   DA  I "O4'" 1 
ATOM 7652  C "C3'" . DA  I 5 83  ? 97.380  77.590  135.611 1.00 242.84 ?  9   DA  I "C3'" 1 
ATOM 7653  O "O3'" . DA  I 5 83  ? 97.432  76.393  136.356 1.00 242.84 ?  9   DA  I "O3'" 1 
ATOM 7654  C "C2'" . DA  I 5 83  ? 95.935  78.033  135.356 1.00 242.84 ?  9   DA  I "C2'" 1 
ATOM 7655  C "C1'" . DA  I 5 83  ? 95.687  78.965  136.523 1.00 242.84 ?  9   DA  I "C1'" 1 
ATOM 7656  N N9    . DA  I 5 83  ? 94.628  79.933  136.284 1.00 242.84 ?  9   DA  I N9    1 
ATOM 7657  C C8    . DA  I 5 83  ? 94.642  80.966  135.398 1.00 242.84 ?  9   DA  I C8    1 
ATOM 7658  N N7    . DA  I 5 83  ? 93.543  81.678  135.399 1.00 242.84 ?  9   DA  I N7    1 
ATOM 7659  C C5    . DA  I 5 83  ? 92.757  81.067  136.351 1.00 242.84 ?  9   DA  I C5    1 
ATOM 7660  C C6    . DA  I 5 83  ? 91.471  81.343  136.831 1.00 242.84 ?  9   DA  I C6    1 
ATOM 7661  N N6    . DA  I 5 83  ? 90.723  82.350  136.383 1.00 242.84 ?  9   DA  I N6    1 
ATOM 7662  N N1    . DA  I 5 83  ? 90.972  80.533  137.786 1.00 242.84 ?  9   DA  I N1    1 
ATOM 7663  C C2    . DA  I 5 83  ? 91.723  79.522  138.232 1.00 242.84 ?  9   DA  I C2    1 
ATOM 7664  N N3    . DA  I 5 83  ? 92.947  79.168  137.857 1.00 242.84 ?  9   DA  I N3    1 
ATOM 7665  C C4    . DA  I 5 83  ? 93.411  79.991  136.908 1.00 242.84 ?  9   DA  I C4    1 
ATOM 7666  P P     . DC  I 5 84  ? 97.147  74.978  135.654 1.00 260.85 ?  10  DC  I P     1 
ATOM 7667  O OP1   . DC  I 5 84  ? 98.423  74.230  135.650 1.00 260.85 ?  10  DC  I OP1   1 
ATOM 7668  O OP2   . DC  I 5 84  ? 96.442  75.213  134.379 1.00 260.85 -1 10  DC  I OP2   1 
ATOM 7669  O "O5'" . DC  I 5 84  ? 96.111  74.276  136.649 1.00 260.85 ?  10  DC  I "O5'" 1 
ATOM 7670  C "C5'" . DC  I 5 84  ? 95.288  75.078  137.489 1.00 260.85 ?  10  DC  I "C5'" 1 
ATOM 7671  C "C4'" . DC  I 5 84  ? 93.916  74.458  137.659 1.00 260.85 ?  10  DC  I "C4'" 1 
ATOM 7672  O "O4'" . DC  I 5 84  ? 92.905  75.501  137.584 1.00 260.85 ?  10  DC  I "O4'" 1 
ATOM 7673  C "C3'" . DC  I 5 84  ? 93.537  73.446  136.587 1.00 260.85 ?  10  DC  I "C3'" 1 
ATOM 7674  O "O3'" . DC  I 5 84  ? 92.688  72.464  137.137 1.00 260.85 ?  10  DC  I "O3'" 1 
ATOM 7675  C "C2'" . DC  I 5 84  ? 92.792  74.308  135.586 1.00 260.85 ?  10  DC  I "C2'" 1 
ATOM 7676  C "C1'" . DC  I 5 84  ? 92.020  75.216  136.523 1.00 260.85 ?  10  DC  I "C1'" 1 
ATOM 7677  N N1    . DC  I 5 84  ? 91.594  76.493  135.893 1.00 260.85 ?  10  DC  I N1    1 
ATOM 7678  C C2    . DC  I 5 84  ? 90.360  77.051  136.231 1.00 260.85 ?  10  DC  I C2    1 
ATOM 7679  O O2    . DC  I 5 84  ? 89.645  76.476  137.057 1.00 260.85 ?  10  DC  I O2    1 
ATOM 7680  N N3    . DC  I 5 84  ? 89.982  78.210  135.643 1.00 260.85 ?  10  DC  I N3    1 
ATOM 7681  C C4    . DC  I 5 84  ? 90.780  78.797  134.756 1.00 260.85 ?  10  DC  I C4    1 
ATOM 7682  N N4    . DC  I 5 84  ? 90.365  79.935  134.201 1.00 260.85 ?  10  DC  I N4    1 
ATOM 7683  C C5    . DC  I 5 84  ? 92.037  78.239  134.392 1.00 260.85 ?  10  DC  I C5    1 
ATOM 7684  C C6    . DC  I 5 84  ? 92.402  77.099  134.982 1.00 260.85 ?  10  DC  I C6    1 
ATOM 7685  P P     . DT  I 5 85  ? 92.490  71.058  136.388 1.00 271.91 ?  11  DT  I P     1 
ATOM 7686  O OP1   . DT  I 5 85  ? 93.653  70.208  136.718 1.00 271.91 ?  11  DT  I OP1   1 
ATOM 7687  O OP2   . DT  I 5 85  ? 92.147  71.333  134.977 1.00 271.91 -1 11  DT  I OP2   1 
ATOM 7688  O "O5'" . DT  I 5 85  ? 91.191  70.450  137.078 1.00 271.91 ?  11  DT  I "O5'" 1 
ATOM 7689  C "C5'" . DT  I 5 85  ? 90.792  70.919  138.349 1.00 271.91 ?  11  DT  I "C5'" 1 
ATOM 7690  C "C4'" . DT  I 5 85  ? 89.308  71.215  138.359 1.00 271.91 ?  11  DT  I "C4'" 1 
ATOM 7691  O "O4'" . DT  I 5 85  ? 89.072  72.545  137.834 1.00 271.91 ?  11  DT  I "O4'" 1 
ATOM 7692  C "C3'" . DT  I 5 85  ? 88.465  70.263  137.505 1.00 271.91 ?  11  DT  I "C3'" 1 
ATOM 7693  O "O3'" . DT  I 5 85  ? 87.425  69.703  138.286 1.00 271.91 ?  11  DT  I "O3'" 1 
ATOM 7694  C "C2'" . DT  I 5 85  ? 87.916  71.157  136.388 1.00 271.91 ?  11  DT  I "C2'" 1 
ATOM 7695  C "C1'" . DT  I 5 85  ? 87.904  72.515  137.061 1.00 271.91 ?  11  DT  I "C1'" 1 
ATOM 7696  N N1    . DT  I 5 85  ? 87.925  73.655  136.102 1.00 271.91 ?  11  DT  I N1    1 
ATOM 7697  C C2    . DT  I 5 85  ? 86.966  74.631  136.207 1.00 271.91 ?  11  DT  I C2    1 
ATOM 7698  O O2    . DT  I 5 85  ? 86.097  74.620  137.058 1.00 271.91 ?  11  DT  I O2    1 
ATOM 7699  N N3    . DT  I 5 85  ? 87.062  75.630  135.279 1.00 271.91 ?  11  DT  I N3    1 
ATOM 7700  C C4    . DT  I 5 85  ? 88.001  75.748  134.275 1.00 271.91 ?  11  DT  I C4    1 
ATOM 7701  O O4    . DT  I 5 85  ? 88.004  76.685  133.488 1.00 271.91 ?  11  DT  I O4    1 
ATOM 7702  C C5    . DT  I 5 85  ? 88.975  74.689  134.215 1.00 271.91 ?  11  DT  I C5    1 
ATOM 7703  C C7    . DT  I 5 85  ? 90.041  74.712  133.163 1.00 271.91 ?  11  DT  I C7    1 
ATOM 7704  C C6    . DT  I 5 85  ? 88.892  73.703  135.120 1.00 271.91 ?  11  DT  I C6    1 
ATOM 7705  P P     . DC  I 5 86  ? 86.365  68.702  137.615 1.00 270.61 ?  12  DC  I P     1 
ATOM 7706  O OP1   . DC  I 5 86  ? 85.950  67.725  138.644 1.00 270.61 ?  12  DC  I OP1   1 
ATOM 7707  O OP2   . DC  I 5 86  ? 86.942  68.221  136.342 1.00 270.61 -1 12  DC  I OP2   1 
ATOM 7708  O "O5'" . DC  I 5 86  ? 85.128  69.648  137.265 1.00 270.61 ?  12  DC  I "O5'" 1 
ATOM 7709  C "C5'" . DC  I 5 86  ? 84.354  69.402  136.108 1.00 270.61 ?  12  DC  I "C5'" 1 
ATOM 7710  C "C4'" . DC  I 5 86  ? 83.445  70.579  135.822 1.00 270.61 ?  12  DC  I "C4'" 1 
ATOM 7711  O "O4'" . DC  I 5 86  ? 84.236  71.705  135.357 1.00 270.61 ?  12  DC  I "O4'" 1 
ATOM 7712  C "C3'" . DC  I 5 86  ? 82.386  70.329  134.748 1.00 270.61 ?  12  DC  I "C3'" 1 
ATOM 7713  O "O3'" . DC  I 5 86  ? 81.138  70.823  135.185 1.00 270.61 ?  12  DC  I "O3'" 1 
ATOM 7714  C "C2'" . DC  I 5 86  ? 82.905  71.113  133.546 1.00 270.61 ?  12  DC  I "C2'" 1 
ATOM 7715  C "C1'" . DC  I 5 86  ? 83.614  72.268  134.228 1.00 270.61 ?  12  DC  I "C1'" 1 
ATOM 7716  N N1    . DC  I 5 86  ? 84.651  72.911  133.378 1.00 270.61 ?  12  DC  I N1    1 
ATOM 7717  C C2    . DC  I 5 86  ? 84.419  74.184  132.855 1.00 270.61 ?  12  DC  I C2    1 
ATOM 7718  O O2    . DC  I 5 86  ? 83.355  74.756  133.115 1.00 270.61 ?  12  DC  I O2    1 
ATOM 7719  N N3    . DC  I 5 86  ? 85.367  74.756  132.081 1.00 270.61 ?  12  DC  I N3    1 
ATOM 7720  C C4    . DC  I 5 86  ? 86.497  74.105  131.822 1.00 270.61 ?  12  DC  I C4    1 
ATOM 7721  N N4    . DC  I 5 86  ? 87.402  74.712  131.054 1.00 270.61 ?  12  DC  I N4    1 
ATOM 7722  C C5    . DC  I 5 86  ? 86.755  72.808  132.347 1.00 270.61 ?  12  DC  I C5    1 
ATOM 7723  C C6    . DC  I 5 86  ? 85.811  72.252  133.108 1.00 270.61 ?  12  DC  I C6    1 
ATOM 7724  P P     . DC  I 5 87  ? 79.786  70.098  134.717 1.00 262.84 ?  13  DC  I P     1 
ATOM 7725  O OP1   . DC  I 5 87  ? 78.775  70.315  135.775 1.00 262.84 ?  13  DC  I OP1   1 
ATOM 7726  O OP2   . DC  I 5 87  ? 80.146  68.727  134.292 1.00 262.84 -1 13  DC  I OP2   1 
ATOM 7727  O "O5'" . DC  I 5 87  ? 79.349  70.908  133.412 1.00 262.84 ?  13  DC  I "O5'" 1 
ATOM 7728  C "C5'" . DC  I 5 87  ? 78.730  72.176  133.543 1.00 262.84 ?  13  DC  I "C5'" 1 
ATOM 7729  C "C4'" . DC  I 5 87  ? 78.601  72.857  132.194 1.00 262.84 ?  13  DC  I "C4'" 1 
ATOM 7730  O "O4'" . DC  I 5 87  ? 79.915  73.249  131.720 1.00 262.84 ?  13  DC  I "O4'" 1 
ATOM 7731  C "C3'" . DC  I 5 87  ? 77.984  71.999  131.088 1.00 262.84 ?  13  DC  I "C3'" 1 
ATOM 7732  O "O3'" . DC  I 5 87  ? 77.053  72.767  130.356 1.00 262.84 ?  13  DC  I "O3'" 1 
ATOM 7733  C "C2'" . DC  I 5 87  ? 79.184  71.620  130.223 1.00 262.84 ?  13  DC  I "C2'" 1 
ATOM 7734  C "C1'" . DC  I 5 87  ? 80.067  72.847  130.381 1.00 262.84 ?  13  DC  I "C1'" 1 
ATOM 7735  N N1    . DC  I 5 87  ? 81.514  72.594  130.131 1.00 262.84 ?  13  DC  I N1    1 
ATOM 7736  C C2    . DC  I 5 87  ? 82.385  73.674  129.998 1.00 262.84 ?  13  DC  I C2    1 
ATOM 7737  O O2    . DC  I 5 87  ? 81.936  74.821  130.083 1.00 262.84 ?  13  DC  I O2    1 
ATOM 7738  N N3    . DC  I 5 87  ? 83.698  73.434  129.774 1.00 262.84 ?  13  DC  I N3    1 
ATOM 7739  C C4    . DC  I 5 87  ? 84.142  72.182  129.689 1.00 262.84 ?  13  DC  I C4    1 
ATOM 7740  N N4    . DC  I 5 87  ? 85.443  71.994  129.466 1.00 262.84 ?  13  DC  I N4    1 
ATOM 7741  C C5    . DC  I 5 87  ? 83.270  71.066  129.826 1.00 262.84 ?  13  DC  I C5    1 
ATOM 7742  C C6    . DC  I 5 87  ? 81.978  71.315  130.043 1.00 262.84 ?  13  DC  I C6    1 
ATOM 7743  P P     . DA  I 5 88  ? 75.489  72.420  130.426 1.00 252.25 ?  14  DA  I P     1 
ATOM 7744  O OP1   . DA  I 5 88  ? 74.999  72.902  131.733 1.00 252.25 ?  14  DA  I OP1   1 
ATOM 7745  O OP2   . DA  I 5 88  ? 75.319  71.000  130.049 1.00 252.25 -1 14  DA  I OP2   1 
ATOM 7746  O "O5'" . DA  I 5 88  ? 74.852  73.331  129.282 1.00 252.25 ?  14  DA  I "O5'" 1 
ATOM 7747  C "C5'" . DA  I 5 88  ? 74.800  74.733  129.458 1.00 252.25 ?  14  DA  I "C5'" 1 
ATOM 7748  C "C4'" . DA  I 5 88  ? 75.554  75.447  128.356 1.00 252.25 ?  14  DA  I "C4'" 1 
ATOM 7749  O "O4'" . DA  I 5 88  ? 76.920  74.966  128.302 1.00 252.25 ?  14  DA  I "O4'" 1 
ATOM 7750  C "C3'" . DA  I 5 88  ? 74.980  75.256  126.951 1.00 252.25 ?  14  DA  I "C3'" 1 
ATOM 7751  O "O3'" . DA  I 5 88  ? 74.918  76.503  126.291 1.00 252.25 ?  14  DA  I "O3'" 1 
ATOM 7752  C "C2'" . DA  I 5 88  ? 75.992  74.330  126.283 1.00 252.25 ?  14  DA  I "C2'" 1 
ATOM 7753  C "C1'" . DA  I 5 88  ? 77.273  74.770  126.959 1.00 252.25 ?  14  DA  I "C1'" 1 
ATOM 7754  N N9    . DA  I 5 88  ? 78.337  73.779  126.892 1.00 252.25 ?  14  DA  I N9    1 
ATOM 7755  C C8    . DA  I 5 88  ? 78.195  72.424  126.830 1.00 252.25 ?  14  DA  I C8    1 
ATOM 7756  N N7    . DA  I 5 88  ? 79.333  71.776  126.777 1.00 252.25 ?  14  DA  I N7    1 
ATOM 7757  C C5    . DA  I 5 88  ? 80.284  72.777  126.804 1.00 252.25 ?  14  DA  I C5    1 
ATOM 7758  C C6    . DA  I 5 88  ? 81.688  72.750  126.777 1.00 252.25 ?  14  DA  I C6    1 
ATOM 7759  N N6    . DA  I 5 88  ? 82.397  71.623  126.707 1.00 252.25 ?  14  DA  I N6    1 
ATOM 7760  N N1    . DA  I 5 88  ? 82.339  73.930  126.813 1.00 252.25 ?  14  DA  I N1    1 
ATOM 7761  C C2    . DA  I 5 88  ? 81.626  75.057  126.881 1.00 252.25 ?  14  DA  I C2    1 
ATOM 7762  N N3    . DA  I 5 88  ? 80.304  75.206  126.917 1.00 252.25 ?  14  DA  I N3    1 
ATOM 7763  C C4    . DA  I 5 88  ? 79.688  74.018  126.874 1.00 252.25 ?  14  DA  I C4    1 
ATOM 7764  P P     . DT  I 5 89  ? 73.546  77.336  126.270 1.00 254.15 ?  15  DT  I P     1 
ATOM 7765  O OP1   . DT  I 5 89  ? 73.220  77.723  127.659 1.00 254.15 ?  15  DT  I OP1   1 
ATOM 7766  O OP2   . DT  I 5 89  ? 72.567  76.567  125.473 1.00 254.15 -1 15  DT  I OP2   1 
ATOM 7767  O "O5'" . DT  I 5 89  ? 73.923  78.653  125.454 1.00 254.15 ?  15  DT  I "O5'" 1 
ATOM 7768  C "C5'" . DT  I 5 89  ? 75.186  79.255  125.643 1.00 254.15 ?  15  DT  I "C5'" 1 
ATOM 7769  C "C4'" . DT  I 5 89  ? 76.038  79.121  124.396 1.00 254.15 ?  15  DT  I "C4'" 1 
ATOM 7770  O "O4'" . DT  I 5 89  ? 76.732  77.845  124.399 1.00 254.15 ?  15  DT  I "O4'" 1 
ATOM 7771  C "C3'" . DT  I 5 89  ? 75.266  79.174  123.072 1.00 254.15 ?  15  DT  I "C3'" 1 
ATOM 7772  O "O3'" . DT  I 5 89  ? 75.966  79.990  122.152 1.00 254.15 ?  15  DT  I "O3'" 1 
ATOM 7773  C "C2'" . DT  I 5 89  ? 75.287  77.717  122.618 1.00 254.15 ?  15  DT  I "C2'" 1 
ATOM 7774  C "C1'" . DT  I 5 89  ? 76.666  77.318  123.101 1.00 254.15 ?  15  DT  I "C1'" 1 
ATOM 7775  N N1    . DT  I 5 89  ? 76.912  75.848  123.150 1.00 254.15 ?  15  DT  I N1    1 
ATOM 7776  C C2    . DT  I 5 89  ? 78.131  75.388  123.589 1.00 254.15 ?  15  DT  I C2    1 
ATOM 7777  O O2    . DT  I 5 89  ? 79.025  76.121  123.962 1.00 254.15 ?  15  DT  I O2    1 
ATOM 7778  N N3    . DT  I 5 89  ? 78.263  74.030  123.593 1.00 254.15 ?  15  DT  I N3    1 
ATOM 7779  C C4    . DT  I 5 89  ? 77.324  73.102  123.199 1.00 254.15 ?  15  DT  I C4    1 
ATOM 7780  O O4    . DT  I 5 89  ? 77.538  71.897  123.237 1.00 254.15 ?  15  DT  I O4    1 
ATOM 7781  C C5    . DT  I 5 89  ? 76.071  73.649  122.739 1.00 254.15 ?  15  DT  I C5    1 
ATOM 7782  C C7    . DT  I 5 89  ? 74.973  72.736  122.285 1.00 254.15 ?  15  DT  I C7    1 
ATOM 7783  C C6    . DT  I 5 89  ? 75.930  74.980  122.732 1.00 254.15 ?  15  DT  I C6    1 
ATOM 7784  P P     . DC  I 5 90  ? 75.558  81.528  121.935 1.00 241.52 ?  16  DC  I P     1 
ATOM 7785  O OP1   . DC  I 5 90  ? 75.348  82.155  123.257 1.00 241.52 ?  16  DC  I OP1   1 
ATOM 7786  O OP2   . DC  I 5 90  ? 74.483  81.571  120.923 1.00 241.52 -1 16  DC  I OP2   1 
ATOM 7787  O "O5'" . DC  I 5 90  ? 76.869  82.158  121.282 1.00 241.52 ?  16  DC  I "O5'" 1 
ATOM 7788  C "C5'" . DC  I 5 90  ? 78.140  81.804  121.794 1.00 241.52 ?  16  DC  I "C5'" 1 
ATOM 7789  C "C4'" . DC  I 5 90  ? 78.959  81.070  120.750 1.00 241.52 ?  16  DC  I "C4'" 1 
ATOM 7790  O "O4'" . DC  I 5 90  ? 78.522  79.690  120.650 1.00 241.52 ?  16  DC  I "O4'" 1 
ATOM 7791  C "C3'" . DC  I 5 90  ? 78.870  81.642  119.332 1.00 241.52 ?  16  DC  I "C3'" 1 
ATOM 7792  O "O3'" . DC  I 5 90  ? 80.163  81.763  118.797 1.00 241.52 ?  16  DC  I "O3'" 1 
ATOM 7793  C "C2'" . DC  I 5 90  ? 78.064  80.585  118.580 1.00 241.52 ?  16  DC  I "C2'" 1 
ATOM 7794  C "C1'" . DC  I 5 90  ? 78.523  79.334  119.292 1.00 241.52 ?  16  DC  I "C1'" 1 
ATOM 7795  N N1    . DC  I 5 90  ? 77.632  78.165  119.093 1.00 241.52 ?  16  DC  I N1    1 
ATOM 7796  C C2    . DC  I 5 90  ? 78.185  76.925  118.763 1.00 241.52 ?  16  DC  I C2    1 
ATOM 7797  O O2    . DC  I 5 90  ? 79.408  76.824  118.645 1.00 241.52 ?  16  DC  I O2    1 
ATOM 7798  N N3    . DC  I 5 90  ? 77.364  75.870  118.583 1.00 241.52 ?  16  DC  I N3    1 
ATOM 7799  C C4    . DC  I 5 90  ? 76.051  76.019  118.721 1.00 241.52 ?  16  DC  I C4    1 
ATOM 7800  N N4    . DC  I 5 90  ? 75.279  74.947  118.531 1.00 241.52 ?  16  DC  I N4    1 
ATOM 7801  C C5    . DC  I 5 90  ? 75.467  77.275  119.049 1.00 241.52 ?  16  DC  I C5    1 
ATOM 7802  C C6    . DC  I 5 90  ? 76.288  78.310  119.224 1.00 241.52 ?  16  DC  I C6    1 
ATOM 7803  P P     . DA  I 5 91  ? 80.406  82.637  117.478 1.00 227.28 ?  17  DA  I P     1 
ATOM 7804  O OP1   . DA  I 5 91  ? 81.184  83.824  117.885 1.00 227.28 ?  17  DA  I OP1   1 
ATOM 7805  O OP2   . DA  I 5 91  ? 79.113  82.792  116.781 1.00 227.28 -1 17  DA  I OP2   1 
ATOM 7806  O "O5'" . DA  I 5 91  ? 81.333  81.711  116.576 1.00 227.28 ?  17  DA  I "O5'" 1 
ATOM 7807  C "C5'" . DA  I 5 91  ? 82.719  81.643  116.837 1.00 227.28 ?  17  DA  I "C5'" 1 
ATOM 7808  C "C4'" . DA  I 5 91  ? 83.334  80.420  116.187 1.00 227.28 ?  17  DA  I "C4'" 1 
ATOM 7809  O "O4'" . DA  I 5 91  ? 82.489  79.275  116.435 1.00 227.28 ?  17  DA  I "O4'" 1 
ATOM 7810  C "C3'" . DA  I 5 91  ? 83.501  80.500  114.675 1.00 227.28 ?  17  DA  I "C3'" 1 
ATOM 7811  O "O3'" . DA  I 5 91  ? 84.689  79.840  114.286 1.00 227.28 ?  17  DA  I "O3'" 1 
ATOM 7812  C "C2'" . DA  I 5 91  ? 82.267  79.781  114.150 1.00 227.28 ?  17  DA  I "C2'" 1 
ATOM 7813  C "C1'" . DA  I 5 91  ? 82.043  78.724  115.217 1.00 227.28 ?  17  DA  I "C1'" 1 
ATOM 7814  N N9    . DA  I 5 91  ? 80.645  78.364  115.379 1.00 227.28 ?  17  DA  I N9    1 
ATOM 7815  C C8    . DA  I 5 91  ? 79.627  79.187  115.757 1.00 227.28 ?  17  DA  I C8    1 
ATOM 7816  N N7    . DA  I 5 91  ? 78.465  78.588  115.830 1.00 227.28 ?  17  DA  I N7    1 
ATOM 7817  C C5    . DA  I 5 91  ? 78.744  77.283  115.477 1.00 227.28 ?  17  DA  I C5    1 
ATOM 7818  C C6    . DA  I 5 91  ? 77.938  76.144  115.358 1.00 227.28 ?  17  DA  I C6    1 
ATOM 7819  N N6    . DA  I 5 91  ? 76.627  76.150  115.594 1.00 227.28 ?  17  DA  I N6    1 
ATOM 7820  N N1    . DA  I 5 91  ? 78.530  74.991  114.982 1.00 227.28 ?  17  DA  I N1    1 
ATOM 7821  C C2    . DA  I 5 91  ? 79.844  74.989  114.744 1.00 227.28 ?  17  DA  I C2    1 
ATOM 7822  N N3    . DA  I 5 91  ? 80.705  75.998  114.826 1.00 227.28 ?  17  DA  I N3    1 
ATOM 7823  C C4    . DA  I 5 91  ? 80.084  77.127  115.198 1.00 227.28 ?  17  DA  I C4    1 
ATOM 7824  P P     . DT  I 5 92  ? 85.116  79.808  112.740 1.00 227.12 ?  18  DT  I P     1 
ATOM 7825  O OP1   . DT  I 5 92  ? 86.589  79.770  112.671 1.00 227.12 ?  18  DT  I OP1   1 
ATOM 7826  O OP2   . DT  I 5 92  ? 84.376  80.883  112.048 1.00 227.12 -1 18  DT  I OP2   1 
ATOM 7827  O "O5'" . DT  I 5 92  ? 84.566  78.405  112.230 1.00 227.12 ?  18  DT  I "O5'" 1 
ATOM 7828  C "C5'" . DT  I 5 92  ? 84.777  77.254  113.020 1.00 227.12 ?  18  DT  I "C5'" 1 
ATOM 7829  C "C4'" . DT  I 5 92  ? 84.492  75.994  112.232 1.00 227.12 ?  18  DT  I "C4'" 1 
ATOM 7830  O "O4'" . DT  I 5 92  ? 83.136  75.555  112.483 1.00 227.12 ?  18  DT  I "O4'" 1 
ATOM 7831  C "C3'" . DT  I 5 92  ? 84.626  76.134  110.720 1.00 227.12 ?  18  DT  I "C3'" 1 
ATOM 7832  O "O3'" . DT  I 5 92  ? 85.302  75.010  110.209 1.00 227.12 ?  18  DT  I "O3'" 1 
ATOM 7833  C "C2'" . DT  I 5 92  ? 83.175  76.178  110.246 1.00 227.12 ?  18  DT  I "C2'" 1 
ATOM 7834  C "C1'" . DT  I 5 92  ? 82.506  75.274  111.261 1.00 227.12 ?  18  DT  I "C1'" 1 
ATOM 7835  N N1    . DT  I 5 92  ? 81.060  75.526  111.428 1.00 227.12 ?  18  DT  I N1    1 
ATOM 7836  C C2    . DT  I 5 92  ? 80.185  74.477  111.323 1.00 227.12 ?  18  DT  I C2    1 
ATOM 7837  O O2    . DT  I 5 92  ? 80.537  73.341  111.081 1.00 227.12 ?  18  DT  I O2    1 
ATOM 7838  N N3    . DT  I 5 92  ? 78.873  74.806  111.500 1.00 227.12 ?  18  DT  I N3    1 
ATOM 7839  C C4    . DT  I 5 92  ? 78.360  76.054  111.774 1.00 227.12 ?  18  DT  I C4    1 
ATOM 7840  O O4    . DT  I 5 92  ? 77.161  76.251  111.918 1.00 227.12 ?  18  DT  I O4    1 
ATOM 7841  C C5    . DT  I 5 92  ? 79.331  77.111  111.879 1.00 227.12 ?  18  DT  I C5    1 
ATOM 7842  C C7    . DT  I 5 92  ? 78.887  78.511  112.168 1.00 227.12 ?  18  DT  I C7    1 
ATOM 7843  C C6    . DT  I 5 92  ? 80.622  76.800  111.700 1.00 227.12 ?  18  DT  I C6    1 
ATOM 7844  P P     . DC  I 5 93  ? 86.122  75.107  108.835 1.00 252.54 ?  19  DC  I P     1 
ATOM 7845  O OP1   . DC  I 5 93  ? 87.552  74.903  109.141 1.00 252.54 ?  19  DC  I OP1   1 
ATOM 7846  O OP2   . DC  I 5 93  ? 85.693  76.326  108.125 1.00 252.54 -1 19  DC  I OP2   1 
ATOM 7847  O "O5'" . DC  I 5 93  ? 85.597  73.851  108.015 1.00 252.54 ?  19  DC  I "O5'" 1 
ATOM 7848  C "C5'" . DC  I 5 93  ? 85.436  72.615  108.678 1.00 252.54 ?  19  DC  I "C5'" 1 
ATOM 7849  C "C4'" . DC  I 5 93  ? 84.334  71.802  108.036 1.00 252.54 ?  19  DC  I "C4'" 1 
ATOM 7850  O "O4'" . DC  I 5 93  ? 83.047  72.262  108.509 1.00 252.54 ?  19  DC  I "O4'" 1 
ATOM 7851  C "C3'" . DC  I 5 93  ? 84.287  71.884  106.510 1.00 252.54 ?  19  DC  I "C3'" 1 
ATOM 7852  O "O3'" . DC  I 5 93  ? 84.327  70.588  105.962 1.00 252.54 ?  19  DC  I "O3'" 1 
ATOM 7853  C "C2'" . DC  I 5 93  ? 82.956  72.577  106.215 1.00 252.54 ?  19  DC  I "C2'" 1 
ATOM 7854  C "C1'" . DC  I 5 93  ? 82.138  72.230  107.444 1.00 252.54 ?  19  DC  I "C1'" 1 
ATOM 7855  N N1    . DC  I 5 93  ? 81.057  73.203  107.723 1.00 252.54 ?  19  DC  I N1    1 
ATOM 7856  C C2    . DC  I 5 93  ? 79.786  72.742  108.058 1.00 252.54 ?  19  DC  I C2    1 
ATOM 7857  O O2    . DC  I 5 93  ? 79.586  71.526  108.118 1.00 252.54 ?  19  DC  I O2    1 
ATOM 7858  N N3    . DC  I 5 93  ? 78.807  73.642  108.309 1.00 252.54 ?  19  DC  I N3    1 
ATOM 7859  C C4    . DC  I 5 93  ? 79.065  74.945  108.230 1.00 252.54 ?  19  DC  I C4    1 
ATOM 7860  N N4    . DC  I 5 93  ? 78.069  75.795  108.489 1.00 252.54 ?  19  DC  I N4    1 
ATOM 7861  C C5    . DC  I 5 93  ? 80.357  75.435  107.892 1.00 252.54 ?  19  DC  I C5    1 
ATOM 7862  C C6    . DC  I 5 93  ? 81.312  74.535  107.645 1.00 252.54 ?  19  DC  I C6    1 
ATOM 7863  P P     . DA  I 5 94  ? 84.684  70.382  104.413 1.00 268.30 ?  20  DA  I P     1 
ATOM 7864  O OP1   . DA  I 5 94  ? 85.933  69.597  104.342 1.00 268.30 ?  20  DA  I OP1   1 
ATOM 7865  O OP2   . DA  I 5 94  ? 84.603  71.698  103.748 1.00 268.30 -1 20  DA  I OP2   1 
ATOM 7866  O "O5'" . DA  I 5 94  ? 83.471  69.505  103.866 1.00 268.30 ?  20  DA  I "O5'" 1 
ATOM 7867  C "C5'" . DA  I 5 94  ? 82.581  68.893  104.781 1.00 268.30 ?  20  DA  I "C5'" 1 
ATOM 7868  C "C4'" . DA  I 5 94  ? 81.184  68.834  104.201 1.00 268.30 ?  20  DA  I "C4'" 1 
ATOM 7869  O "O4'" . DA  I 5 94  ? 80.351  69.829  104.838 1.00 268.30 ?  20  DA  I "O4'" 1 
ATOM 7870  C "C3'" . DA  I 5 94  ? 81.104  69.108  102.697 1.00 268.30 ?  20  DA  I "C3'" 1 
ATOM 7871  O "O3'" . DA  I 5 94  ? 80.482  68.019  102.043 1.00 268.30 ?  20  DA  I "O3'" 1 
ATOM 7872  C "C2'" . DA  I 5 94  ? 80.266  70.386  102.592 1.00 268.30 ?  20  DA  I "C2'" 1 
ATOM 7873  C "C1'" . DA  I 5 94  ? 79.470  70.351  103.883 1.00 268.30 ?  20  DA  I "C1'" 1 
ATOM 7874  N N9    . DA  I 5 94  ? 79.022  71.665  104.333 1.00 268.30 ?  20  DA  I N9    1 
ATOM 7875  C C8    . DA  I 5 94  ? 79.805  72.727  104.678 1.00 268.30 ?  20  DA  I C8    1 
ATOM 7876  N N7    . DA  I 5 94  ? 79.129  73.786  105.049 1.00 268.30 ?  20  DA  I N7    1 
ATOM 7877  C C5    . DA  I 5 94  ? 77.811  73.390  104.940 1.00 268.30 ?  20  DA  I C5    1 
ATOM 7878  C C6    . DA  I 5 94  ? 76.599  74.057  105.184 1.00 268.30 ?  20  DA  I C6    1 
ATOM 7879  N N6    . DA  I 5 94  ? 76.528  75.318  105.612 1.00 268.30 ?  20  DA  I N6    1 
ATOM 7880  N N1    . DA  I 5 94  ? 75.458  73.376  104.973 1.00 268.30 ?  20  DA  I N1    1 
ATOM 7881  C C2    . DA  I 5 94  ? 75.528  72.111  104.548 1.00 268.30 ?  20  DA  I C2    1 
ATOM 7882  N N3    . DA  I 5 94  ? 76.607  71.381  104.281 1.00 268.30 ?  20  DA  I N3    1 
ATOM 7883  C C4    . DA  I 5 94  ? 77.725  72.085  104.503 1.00 268.30 ?  20  DA  I C4    1 
ATOM 7884  P P     . DC  I 5 95  ? 80.383  67.994  100.442 1.00 276.16 ?  21  DC  I P     1 
ATOM 7885  O OP1   . DC  I 5 95  ? 80.421  66.582  100.007 1.00 276.16 ?  21  DC  I OP1   1 
ATOM 7886  O OP2   . DC  I 5 95  ? 81.372  68.957  99.916  1.00 276.16 -1 21  DC  I OP2   1 
ATOM 7887  O "O5'" . DC  I 5 95  ? 78.930  68.577  100.148 1.00 276.16 ?  21  DC  I "O5'" 1 
ATOM 7888  C "C5'" . DC  I 5 95  ? 77.816  68.023  100.813 1.00 276.16 ?  21  DC  I "C5'" 1 
ATOM 7889  C "C4'" . DC  I 5 95  ? 76.583  68.870  100.596 1.00 276.16 ?  21  DC  I "C4'" 1 
ATOM 7890  O "O4'" . DC  I 5 95  ? 76.697  70.103  101.338 1.00 276.16 ?  21  DC  I "O4'" 1 
ATOM 7891  C "C3'" . DC  I 5 95  ? 76.327  69.272  99.143  1.00 276.16 ?  21  DC  I "C3'" 1 
ATOM 7892  O "O3'" . DC  I 5 95  ? 75.068  68.787  98.738  1.00 276.16 ?  21  DC  I "O3'" 1 
ATOM 7893  C "C2'" . DC  I 5 95  ? 76.359  70.805  99.164  1.00 276.16 ?  21  DC  I "C2'" 1 
ATOM 7894  C "C1'" . DC  I 5 95  ? 76.043  71.106  100.614 1.00 276.16 ?  21  DC  I "C1'" 1 
ATOM 7895  N N1    . DC  I 5 95  ? 76.541  72.430  101.080 1.00 276.16 ?  21  DC  I N1    1 
ATOM 7896  C C2    . DC  I 5 95  ? 75.627  73.423  101.441 1.00 276.16 ?  21  DC  I C2    1 
ATOM 7897  O O2    . DC  I 5 95  ? 74.420  73.180  101.370 1.00 276.16 ?  21  DC  I O2    1 
ATOM 7898  N N3    . DC  I 5 95  ? 76.092  74.616  101.877 1.00 276.16 ?  21  DC  I N3    1 
ATOM 7899  C C4    . DC  I 5 95  ? 77.402  74.838  101.937 1.00 276.16 ?  21  DC  I C4    1 
ATOM 7900  N N4    . DC  I 5 95  ? 77.813  76.033  102.363 1.00 276.16 ?  21  DC  I N4    1 
ATOM 7901  C C5    . DC  I 5 95  ? 78.351  73.842  101.570 1.00 276.16 ?  21  DC  I C5    1 
ATOM 7902  C C6    . DC  I 5 95  ? 77.879  72.664  101.149 1.00 276.16 ?  21  DC  I C6    1 
ATOM 7903  P P     . DA  I 5 96  ? 74.739  68.583  97.180  1.00 273.70 ?  22  DA  I P     1 
ATOM 7904  O OP1   . DA  I 5 96  ? 75.127  67.208  96.796  1.00 273.70 ?  22  DA  I OP1   1 
ATOM 7905  O OP2   . DA  I 5 96  ? 75.294  69.740  96.448  1.00 273.70 -1 22  DA  I OP2   1 
ATOM 7906  O "O5'" . DA  I 5 96  ? 73.152  68.687  97.133  1.00 273.70 ?  22  DA  I "O5'" 1 
ATOM 7907  C "C5'" . DA  I 5 96  ? 72.474  69.370  98.169  1.00 273.70 ?  22  DA  I "C5'" 1 
ATOM 7908  C "C4'" . DA  I 5 96  ? 71.934  70.691  97.669  1.00 273.70 ?  22  DA  I "C4'" 1 
ATOM 7909  O "O4'" . DA  I 5 96  ? 72.675  71.790  98.262  1.00 273.70 ?  22  DA  I "O4'" 1 
ATOM 7910  C "C3'" . DA  I 5 96  ? 72.029  70.897  96.153  1.00 273.70 ?  22  DA  I "C3'" 1 
ATOM 7911  O "O3'" . DA  I 5 96  ? 70.836  71.468  95.697  1.00 273.70 ?  22  DA  I "O3'" 1 
ATOM 7912  C "C2'" . DA  I 5 96  ? 73.179  71.885  96.025  1.00 273.70 ?  22  DA  I "C2'" 1 
ATOM 7913  C "C1'" . DA  I 5 96  ? 72.915  72.729  97.249  1.00 273.70 ?  22  DA  I "C1'" 1 
ATOM 7914  N N9    . DA  I 5 96  ? 74.017  73.602  97.633  1.00 273.70 ?  22  DA  I N9    1 
ATOM 7915  C C8    . DA  I 5 96  ? 75.315  73.531  97.215  1.00 273.70 ?  22  DA  I C8    1 
ATOM 7916  N N7    . DA  I 5 96  ? 76.084  74.463  97.723  1.00 273.70 ?  22  DA  I N7    1 
ATOM 7917  C C5    . DA  I 5 96  ? 75.228  75.196  98.520  1.00 273.70 ?  22  DA  I C5    1 
ATOM 7918  C C6    . DA  I 5 96  ? 75.421  76.327  99.324  1.00 273.70 ?  22  DA  I C6    1 
ATOM 7919  N N6    . DA  I 5 96  ? 76.603  76.925  99.471  1.00 273.70 ?  22  DA  I N6    1 
ATOM 7920  N N1    . DA  I 5 96  ? 74.354  76.813  99.992  1.00 273.70 ?  22  DA  I N1    1 
ATOM 7921  C C2    . DA  I 5 96  ? 73.172  76.209  99.847  1.00 273.70 ?  22  DA  I C2    1 
ATOM 7922  N N3    . DA  I 5 96  ? 72.868  75.145  99.113  1.00 273.70 ?  22  DA  I N3    1 
ATOM 7923  C C4    . DA  I 5 96  ? 73.949  74.685  98.469  1.00 273.70 ?  22  DA  I C4    1 
ATOM 7924  P P     . DA  I 5 97  ? 70.447  71.427  94.142  1.00 267.08 ?  23  DA  I P     1 
ATOM 7925  O OP1   . DA  I 5 97  ? 70.606  70.038  93.662  1.00 267.08 ?  23  DA  I OP1   1 
ATOM 7926  O OP2   . DA  I 5 97  ? 71.161  72.523  93.456  1.00 267.08 -1 23  DA  I OP2   1 
ATOM 7927  O "O5'" . DA  I 5 97  ? 68.899  71.794  94.164  1.00 267.08 ?  23  DA  I "O5'" 1 
ATOM 7928  C "C5'" . DA  I 5 97  ? 68.301  72.185  95.389  1.00 267.08 ?  23  DA  I "C5'" 1 
ATOM 7929  C "C4'" . DA  I 5 97  ? 68.308  73.694  95.538  1.00 267.08 ?  23  DA  I "C4'" 1 
ATOM 7930  O "O4'" . DA  I 5 97  ? 69.622  74.164  95.956  1.00 267.08 ?  23  DA  I "O4'" 1 
ATOM 7931  C "C3'" . DA  I 5 97  ? 67.978  74.471  94.262  1.00 267.08 ?  23  DA  I "C3'" 1 
ATOM 7932  O "O3'" . DA  I 5 97  ? 67.072  75.503  94.574  1.00 267.08 ?  23  DA  I "O3'" 1 
ATOM 7933  C "C2'" . DA  I 5 97  ? 69.333  75.038  93.861  1.00 267.08 ?  23  DA  I "C2'" 1 
ATOM 7934  C "C1'" . DA  I 5 97  ? 69.900  75.332  95.227  1.00 267.08 ?  23  DA  I "C1'" 1 
ATOM 7935  N N9    . DA  I 5 97  ? 71.334  75.589  95.237  1.00 267.08 ?  23  DA  I N9    1 
ATOM 7936  C C8    . DA  I 5 97  ? 72.299  74.903  94.563  1.00 267.08 ?  23  DA  I C8    1 
ATOM 7937  N N7    . DA  I 5 97  ? 73.512  75.359  94.762  1.00 267.08 ?  23  DA  I N7    1 
ATOM 7938  C C5    . DA  I 5 97  ? 73.325  76.432  95.610  1.00 267.08 ?  23  DA  I C5    1 
ATOM 7939  C C6    . DA  I 5 97  ? 74.220  77.341  96.194  1.00 267.08 ?  23  DA  I C6    1 
ATOM 7940  N N6    . DA  I 5 97  ? 75.536  77.306  95.988  1.00 267.08 ?  23  DA  I N6    1 
ATOM 7941  N N1    . DA  I 5 97  ? 73.707  78.298  96.993  1.00 267.08 ?  23  DA  I N1    1 
ATOM 7942  C C2    . DA  I 5 97  ? 72.386  78.333  97.193  1.00 267.08 ?  23  DA  I C2    1 
ATOM 7943  N N3    . DA  I 5 97  ? 71.448  77.528  96.703  1.00 267.08 ?  23  DA  I N3    1 
ATOM 7944  C C4    . DA  I 5 97  ? 71.989  76.591  95.912  1.00 267.08 ?  23  DA  I C4    1 
ATOM 7945  P P     . DA  I 5 98  ? 66.425  76.403  93.414  1.00 247.09 ?  24  DA  I P     1 
ATOM 7946  O OP1   . DA  I 5 98  ? 65.480  75.544  92.667  1.00 247.09 ?  24  DA  I OP1   1 
ATOM 7947  O OP2   . DA  I 5 98  ? 67.502  77.133  92.707  1.00 247.09 -1 24  DA  I OP2   1 
ATOM 7948  O "O5'" . DA  I 5 98  ? 65.606  77.507  94.225  1.00 247.09 ?  24  DA  I "O5'" 1 
ATOM 7949  C "C5'" . DA  I 5 98  ? 66.145  78.040  95.429  1.00 247.09 ?  24  DA  I "C5'" 1 
ATOM 7950  C "C4'" . DA  I 5 98  ? 66.951  79.295  95.156  1.00 247.09 ?  24  DA  I "C4'" 1 
ATOM 7951  O "O4'" . DA  I 5 98  ? 68.352  78.976  95.090  1.00 247.09 ?  24  DA  I "O4'" 1 
ATOM 7952  C "C3'" . DA  I 5 98  ? 66.621  80.003  93.843  1.00 247.09 ?  24  DA  I "C3'" 1 
ATOM 7953  O "O3'" . DA  I 5 98  ? 65.998  81.231  94.116  1.00 247.09 ?  24  DA  I "O3'" 1 
ATOM 7954  C "C2'" . DA  I 5 98  ? 67.982  80.190  93.145  1.00 247.09 ?  24  DA  I "C2'" 1 
ATOM 7955  C "C1'" . DA  I 5 98  ? 68.976  79.919  94.264  1.00 247.09 ?  24  DA  I "C1'" 1 
ATOM 7956  N N9    . DA  I 5 98  ? 70.237  79.349  93.809  1.00 247.09 ?  24  DA  I N9    1 
ATOM 7957  C C8    . DA  I 5 98  ? 70.402  78.216  93.074  1.00 247.09 ?  24  DA  I C8    1 
ATOM 7958  N N7    . DA  I 5 98  ? 71.653  77.924  92.823  1.00 247.09 ?  24  DA  I N7    1 
ATOM 7959  C C5    . DA  I 5 98  ? 72.357  78.938  93.436  1.00 247.09 ?  24  DA  I C5    1 
ATOM 7960  C C6    . DA  I 5 98  ? 73.729  79.205  93.540  1.00 247.09 ?  24  DA  I C6    1 
ATOM 7961  N N6    . DA  I 5 98  ? 74.667  78.437  92.988  1.00 247.09 ?  24  DA  I N6    1 
ATOM 7962  N N1    . DA  I 5 98  ? 74.103  80.305  94.219  1.00 247.09 ?  24  DA  I N1    1 
ATOM 7963  C C2    . DA  I 5 98  ? 73.161  81.076  94.768  1.00 247.09 ?  24  DA  I C2    1 
ATOM 7964  N N3    . DA  I 5 98  ? 71.840  80.923  94.741  1.00 247.09 ?  24  DA  I N3    1 
ATOM 7965  C C4    . DA  I 5 98  ? 71.502  79.825  94.054  1.00 247.09 ?  24  DA  I C4    1 
ATOM 7966  P P     . DG  I 5 99  ? 65.429  82.119  92.911  1.00 234.82 ?  25  DG  I P     1 
ATOM 7967  O OP1   . DG  I 5 99  ? 64.214  82.809  93.400  1.00 234.82 ?  25  DG  I OP1   1 
ATOM 7968  O OP2   . DG  I 5 99  ? 65.370  81.251  91.714  1.00 234.82 -1 25  DG  I OP2   1 
ATOM 7969  O "O5'" . DG  I 5 99  ? 66.583  83.192  92.673  1.00 234.82 ?  25  DG  I "O5'" 1 
ATOM 7970  C "C5'" . DG  I 5 99  ? 67.241  83.757  93.784  1.00 234.82 ?  25  DG  I "C5'" 1 
ATOM 7971  C "C4'" . DG  I 5 99  ? 68.539  84.398  93.361  1.00 234.82 ?  25  DG  I "C4'" 1 
ATOM 7972  O "O4'" . DG  I 5 99  ? 69.549  83.386  93.153  1.00 234.82 ?  25  DG  I "O4'" 1 
ATOM 7973  C "C3'" . DG  I 5 99  ? 68.467  85.190  92.051  1.00 234.82 ?  25  DG  I "C3'" 1 
ATOM 7974  O "O3'" . DG  I 5 99  ? 68.823  86.528  92.290  1.00 234.82 ?  25  DG  I "O3'" 1 
ATOM 7975  C "C2'" . DG  I 5 99  ? 69.489  84.495  91.146  1.00 234.82 ?  25  DG  I "C2'" 1 
ATOM 7976  C "C1'" . DG  I 5 99  ? 70.411  83.873  92.171  1.00 234.82 ?  25  DG  I "C1'" 1 
ATOM 7977  N N9    . DG  I 5 99  ? 71.218  82.787  91.649  1.00 234.82 ?  25  DG  I N9    1 
ATOM 7978  C C8    . DG  I 5 99  ? 70.785  81.689  90.961  1.00 234.82 ?  25  DG  I C8    1 
ATOM 7979  N N7    . DG  I 5 99  ? 71.750  80.890  90.606  1.00 234.82 ?  25  DG  I N7    1 
ATOM 7980  C C5    . DG  I 5 99  ? 72.893  81.505  91.089  1.00 234.82 ?  25  DG  I C5    1 
ATOM 7981  C C6    . DG  I 5 99  ? 74.244  81.112  90.996  1.00 234.82 ?  25  DG  I C6    1 
ATOM 7982  O O6    . DG  I 5 99  ? 74.711  80.095  90.475  1.00 234.82 ?  25  DG  I O6    1 
ATOM 7983  N N1    . DG  I 5 99  ? 75.086  82.016  91.627  1.00 234.82 ?  25  DG  I N1    1 
ATOM 7984  C C2    . DG  I 5 99  ? 74.672  83.165  92.249  1.00 234.82 ?  25  DG  I C2    1 
ATOM 7985  N N2    . DG  I 5 99  ? 75.630  83.924  92.794  1.00 234.82 ?  25  DG  I N2    1 
ATOM 7986  N N3    . DG  I 5 99  ? 73.409  83.552  92.326  1.00 234.82 ?  25  DG  I N3    1 
ATOM 7987  C C4    . DG  I 5 99  ? 72.580  82.674  91.728  1.00 234.82 ?  25  DG  I C4    1 
ATOM 7988  P P     . DA  I 5 100 ? 67.708  87.676  92.224  1.00 222.51 ?  26  DA  I P     1 
ATOM 7989  O OP1   . DA  I 5 100 ? 66.589  87.251  93.090  1.00 222.51 ?  26  DA  I OP1   1 
ATOM 7990  O OP2   . DA  I 5 100 ? 67.475  87.983  90.799  1.00 222.51 -1 26  DA  I OP2   1 
ATOM 7991  O "O5'" . DA  I 5 100 ? 68.422  88.940  92.882  1.00 222.51 ?  26  DA  I "O5'" 1 
ATOM 7992  C "C5'" . DA  I 5 100 ? 69.041  88.816  94.143  1.00 222.51 ?  26  DA  I "C5'" 1 
ATOM 7993  C "C4'" . DA  I 5 100 ? 70.529  89.080  94.036  1.00 222.51 ?  26  DA  I "C4'" 1 
ATOM 7994  O "O4'" . DA  I 5 100 ? 71.144  88.053  93.224  1.00 222.51 ?  26  DA  I "O4'" 1 
ATOM 7995  C "C3'" . DA  I 5 100 ? 70.898  90.414  93.400  1.00 222.51 ?  26  DA  I "C3'" 1 
ATOM 7996  O "O3'" . DA  I 5 100 ? 71.885  91.051  94.173  1.00 222.51 ?  26  DA  I "O3'" 1 
ATOM 7997  C "C2'" . DA  I 5 100 ? 71.423  90.034  92.016  1.00 222.51 ?  26  DA  I "C2'" 1 
ATOM 7998  C "C1'" . DA  I 5 100 ? 71.970  88.638  92.249  1.00 222.51 ?  26  DA  I "C1'" 1 
ATOM 7999  N N9    . DA  I 5 100 ? 71.916  87.793  91.066  1.00 222.51 ?  26  DA  I N9    1 
ATOM 8000  C C8    . DA  I 5 100 ? 70.855  87.627  90.230  1.00 222.51 ?  26  DA  I C8    1 
ATOM 8001  N N7    . DA  I 5 100 ? 71.083  86.793  89.248  1.00 222.51 ?  26  DA  I N7    1 
ATOM 8002  C C5    . DA  I 5 100 ? 72.381  86.379  89.460  1.00 222.51 ?  26  DA  I C5    1 
ATOM 8003  C C6    . DA  I 5 100 ? 73.216  85.490  88.765  1.00 222.51 ?  26  DA  I C6    1 
ATOM 8004  N N6    . DA  I 5 100 ? 72.840  84.841  87.663  1.00 222.51 ?  26  DA  I N6    1 
ATOM 8005  N N1    . DA  I 5 100 ? 74.462  85.307  89.233  1.00 222.51 ?  26  DA  I N1    1 
ATOM 8006  C C2    . DA  I 5 100 ? 74.840  85.965  90.330  1.00 222.51 ?  26  DA  I C2    1 
ATOM 8007  N N3    . DA  I 5 100 ? 74.142  86.819  91.071  1.00 222.51 ?  26  DA  I N3    1 
ATOM 8008  C C4    . DA  I 5 100 ? 72.911  86.984  90.576  1.00 222.51 ?  26  DA  I C4    1 
ATOM 8009  P P     . DA  I 5 101 ? 72.368  92.528  93.785  1.00 220.23 ?  27  DA  I P     1 
ATOM 8010  O OP1   . DA  I 5 101 ? 72.704  93.237  95.037  1.00 220.23 ?  27  DA  I OP1   1 
ATOM 8011  O OP2   . DA  I 5 101 ? 71.362  93.095  92.864  1.00 220.23 -1 27  DA  I OP2   1 
ATOM 8012  O "O5'" . DA  I 5 101 ? 73.707  92.272  92.960  1.00 220.23 ?  27  DA  I "O5'" 1 
ATOM 8013  C "C5'" . DA  I 5 101 ? 74.715  91.461  93.518  1.00 220.23 ?  27  DA  I "C5'" 1 
ATOM 8014  C "C4'" . DA  I 5 101 ? 75.685  91.001  92.456  1.00 220.23 ?  27  DA  I "C4'" 1 
ATOM 8015  O "O4'" . DA  I 5 101 ? 75.023  90.104  91.551  1.00 220.23 ?  27  DA  I "O4'" 1 
ATOM 8016  C "C3'" . DA  I 5 101 ? 76.269  92.113  91.584  1.00 220.23 ?  27  DA  I "C3'" 1 
ATOM 8017  O "O3'" . DA  I 5 101 ? 77.639  92.244  91.856  1.00 220.23 ?  27  DA  I "O3'" 1 
ATOM 8018  C "C2'" . DA  I 5 101 ? 76.026  91.637  90.145  1.00 220.23 ?  27  DA  I "C2'" 1 
ATOM 8019  C "C1'" . DA  I 5 101 ? 75.696  90.168  90.330  1.00 220.23 ?  27  DA  I "C1'" 1 
ATOM 8020  N N9    . DA  I 5 101 ? 74.831  89.628  89.289  1.00 220.23 ?  27  DA  I N9    1 
ATOM 8021  C C8    . DA  I 5 101 ? 73.511  89.904  89.090  1.00 220.23 ?  27  DA  I C8    1 
ATOM 8022  N N7    . DA  I 5 101 ? 72.989  89.271  88.072  1.00 220.23 ?  27  DA  I N7    1 
ATOM 8023  C C5    . DA  I 5 101 ? 74.042  88.536  87.567  1.00 220.23 ?  27  DA  I C5    1 
ATOM 8024  C C6    . DA  I 5 101 ? 74.142  87.654  86.484  1.00 220.23 ?  27  DA  I C6    1 
ATOM 8025  N N6    . DA  I 5 101 ? 73.115  87.353  85.690  1.00 220.23 ?  27  DA  I N6    1 
ATOM 8026  N N1    . DA  I 5 101 ? 75.336  87.076  86.253  1.00 220.23 ?  27  DA  I N1    1 
ATOM 8027  C C2    . DA  I 5 101 ? 76.360  87.374  87.053  1.00 220.23 ?  27  DA  I C2    1 
ATOM 8028  N N3    . DA  I 5 101 ? 76.383  88.185  88.103  1.00 220.23 ?  27  DA  I N3    1 
ATOM 8029  C C4    . DA  I 5 101 ? 75.182  88.741  88.305  1.00 220.23 ?  27  DA  I C4    1 
ATOM 8030  P P     . DT  I 5 102 ? 78.543  93.247  90.991  1.00 221.04 ?  28  DT  I P     1 
ATOM 8031  O OP1   . DT  I 5 102 ? 79.574  93.794  91.898  1.00 221.04 ?  28  DT  I OP1   1 
ATOM 8032  O OP2   . DT  I 5 102 ? 77.650  94.166  90.257  1.00 221.04 -1 28  DT  I OP2   1 
ATOM 8033  O "O5'" . DT  I 5 102 ? 79.252  92.294  89.930  1.00 221.04 ?  28  DT  I "O5'" 1 
ATOM 8034  C "C5'" . DT  I 5 102 ? 79.997  91.192  90.386  1.00 221.04 ?  28  DT  I "C5'" 1 
ATOM 8035  C "C4'" . DT  I 5 102 ? 80.525  90.382  89.226  1.00 221.04 ?  28  DT  I "C4'" 1 
ATOM 8036  O "O4'" . DT  I 5 102 ? 79.420  89.926  88.413  1.00 221.04 ?  28  DT  I "O4'" 1 
ATOM 8037  C "C3'" . DT  I 5 102 ? 81.465  91.135  88.285  1.00 221.04 ?  28  DT  I "C3'" 1 
ATOM 8038  O "O3'" . DT  I 5 102 ? 82.626  90.363  88.069  1.00 221.04 ?  28  DT  I "O3'" 1 
ATOM 8039  C "C2'" . DT  I 5 102 ? 80.644  91.284  87.005  1.00 221.04 ?  28  DT  I "C2'" 1 
ATOM 8040  C "C1'" . DT  I 5 102 ? 79.780  90.043  87.067  1.00 221.04 ?  28  DT  I "C1'" 1 
ATOM 8041  N N1    . DT  I 5 102 ? 78.537  90.113  86.252  1.00 221.04 ?  28  DT  I N1    1 
ATOM 8042  C C2    . DT  I 5 102 ? 78.462  89.390  85.093  1.00 221.04 ?  28  DT  I C2    1 
ATOM 8043  O O2    . DT  I 5 102 ? 79.376  88.709  84.676  1.00 221.04 ?  28  DT  I O2    1 
ATOM 8044  N N3    . DT  I 5 102 ? 77.283  89.506  84.421  1.00 221.04 ?  28  DT  I N3    1 
ATOM 8045  C C4    . DT  I 5 102 ? 76.188  90.249  84.789  1.00 221.04 ?  28  DT  I C4    1 
ATOM 8046  O O4    . DT  I 5 102 ? 75.169  90.289  84.116  1.00 221.04 ?  28  DT  I O4    1 
ATOM 8047  C C5    . DT  I 5 102 ? 76.321  90.976  86.018  1.00 221.04 ?  28  DT  I C5    1 
ATOM 8048  C C7    . DT  I 5 102 ? 75.187  91.818  86.512  1.00 221.04 ?  28  DT  I C7    1 
ATOM 8049  C C6    . DT  I 5 102 ? 77.477  90.877  86.687  1.00 221.04 ?  28  DT  I C6    1 
ATOM 8050  P P     . DA  I 5 103 ? 83.952  91.048  87.485  1.00 233.60 ?  29  DA  I P     1 
ATOM 8051  O OP1   . DA  I 5 103 ? 85.114  90.402  88.128  1.00 233.60 ?  29  DA  I OP1   1 
ATOM 8052  O OP2   . DA  I 5 103 ? 83.773  92.509  87.566  1.00 233.60 -1 29  DA  I OP2   1 
ATOM 8053  O "O5'" . DA  I 5 103 ? 83.939  90.635  85.947  1.00 233.60 ?  29  DA  I "O5'" 1 
ATOM 8054  C "C5'" . DA  I 5 103 ? 83.999  89.268  85.599  1.00 233.60 ?  29  DA  I "C5'" 1 
ATOM 8055  C "C4'" . DA  I 5 103 ? 83.564  89.051  84.165  1.00 233.60 ?  29  DA  I "C4'" 1 
ATOM 8056  O "O4'" . DA  I 5 103 ? 82.165  89.357  84.027  1.00 233.60 ?  29  DA  I "O4'" 1 
ATOM 8057  C "C3'" . DA  I 5 103 ? 84.288  89.913  83.132  1.00 233.60 ?  29  DA  I "C3'" 1 
ATOM 8058  O "O3'" . DA  I 5 103 ? 85.069  89.084  82.298  1.00 233.60 ?  29  DA  I "O3'" 1 
ATOM 8059  C "C2'" . DA  I 5 103 ? 83.160  90.609  82.351  1.00 233.60 ?  29  DA  I "C2'" 1 
ATOM 8060  C "C1'" . DA  I 5 103 ? 81.940  89.784  82.717  1.00 233.60 ?  29  DA  I "C1'" 1 
ATOM 8061  N N9    . DA  I 5 103 ? 80.701  90.538  82.700  1.00 233.60 ?  29  DA  I N9    1 
ATOM 8062  C C8    . DA  I 5 103 ? 80.351  91.552  83.536  1.00 233.60 ?  29  DA  I C8    1 
ATOM 8063  N N7    . DA  I 5 103 ? 79.161  92.041  83.301  1.00 233.60 ?  29  DA  I N7    1 
ATOM 8064  C C5    . DA  I 5 103 ? 78.705  91.298  82.232  1.00 233.60 ?  29  DA  I C5    1 
ATOM 8065  C C6    . DA  I 5 103 ? 77.505  91.326  81.502  1.00 233.60 ?  29  DA  I C6    1 
ATOM 8066  N N6    . DA  I 5 103 ? 76.512  92.178  81.760  1.00 233.60 ?  29  DA  I N6    1 
ATOM 8067  N N1    . DA  I 5 103 ? 77.364  90.445  80.492  1.00 233.60 ?  29  DA  I N1    1 
ATOM 8068  C C2    . DA  I 5 103 ? 78.362  89.593  80.239  1.00 233.60 ?  29  DA  I C2    1 
ATOM 8069  N N3    . DA  I 5 103 ? 79.534  89.475  80.857  1.00 233.60 ?  29  DA  I N3    1 
ATOM 8070  C C4    . DA  I 5 103 ? 79.639  90.361  81.855  1.00 233.60 ?  29  DA  I C4    1 
ATOM 8071  P P     . DT  I 5 104 ? 85.895  89.714  81.077  1.00 244.65 ?  30  DT  I P     1 
ATOM 8072  O OP1   . DT  I 5 104 ? 87.129  88.916  80.921  1.00 244.65 ?  30  DT  I OP1   1 
ATOM 8073  O OP2   . DT  I 5 104 ? 85.985  91.173  81.293  1.00 244.65 -1 30  DT  I OP2   1 
ATOM 8074  O "O5'" . DT  I 5 104 ? 84.955  89.451  79.816  1.00 244.65 ?  30  DT  I "O5'" 1 
ATOM 8075  C "C5'" . DT  I 5 104 ? 84.410  88.161  79.604  1.00 244.65 ?  30  DT  I "C5'" 1 
ATOM 8076  C "C4'" . DT  I 5 104 ? 83.586  88.134  78.336  1.00 244.65 ?  30  DT  I "C4'" 1 
ATOM 8077  O "O4'" . DT  I 5 104 ? 82.303  88.762  78.579  1.00 244.65 ?  30  DT  I "O4'" 1 
ATOM 8078  C "C3'" . DT  I 5 104 ? 84.209  88.881  77.156  1.00 244.65 ?  30  DT  I "C3'" 1 
ATOM 8079  O "O3'" . DT  I 5 104 ? 84.173  88.072  75.998  1.00 244.65 ?  30  DT  I "O3'" 1 
ATOM 8080  C "C2'" . DT  I 5 104 ? 83.325  90.117  77.003  1.00 244.65 ?  30  DT  I "C2'" 1 
ATOM 8081  C "C1'" . DT  I 5 104 ? 81.991  89.596  77.495  1.00 244.65 ?  30  DT  I "C1'" 1 
ATOM 8082  N N1    . DT  I 5 104 ? 81.062  90.663  77.967  1.00 244.65 ?  30  DT  I N1    1 
ATOM 8083  C C2    . DT  I 5 104 ? 79.835  90.796  77.369  1.00 244.65 ?  30  DT  I C2    1 
ATOM 8084  O O2    . DT  I 5 104 ? 79.457  90.086  76.461  1.00 244.65 ?  30  DT  I O2    1 
ATOM 8085  N N3    . DT  I 5 104 ? 79.056  91.795  77.873  1.00 244.65 ?  30  DT  I N3    1 
ATOM 8086  C C4    . DT  I 5 104 ? 79.372  92.654  78.898  1.00 244.65 ?  30  DT  I C4    1 
ATOM 8087  O O4    . DT  I 5 104 ? 78.604  93.525  79.280  1.00 244.65 ?  30  DT  I O4    1 
ATOM 8088  C C5    . DT  I 5 104 ? 80.673  92.465  79.481  1.00 244.65 ?  30  DT  I C5    1 
ATOM 8089  C C7    . DT  I 5 104 ? 81.128  93.349  80.599  1.00 244.65 ?  30  DT  I C7    1 
ATOM 8090  C C6    . DT  I 5 104 ? 81.447  91.487  78.996  1.00 244.65 ?  30  DT  I C6    1 
ATOM 8091  P P     . DT  I 5 105 ? 84.822  88.602  74.628  1.00 256.56 ?  31  DT  I P     1 
ATOM 8092  O OP1   . DT  I 5 105 ? 85.445  87.444  73.953  1.00 256.56 ?  31  DT  I OP1   1 
ATOM 8093  O OP2   . DT  I 5 105 ? 85.636  89.793  74.946  1.00 256.56 -1 31  DT  I OP2   1 
ATOM 8094  O "O5'" . DT  I 5 105 ? 83.563  89.087  73.773  1.00 256.56 ?  31  DT  I "O5'" 1 
ATOM 8095  C "C5'" . DT  I 5 105 ? 82.528  88.170  73.474  1.00 256.56 ?  31  DT  I "C5'" 1 
ATOM 8096  C "C4'" . DT  I 5 105 ? 81.324  88.883  72.894  1.00 256.56 ?  31  DT  I "C4'" 1 
ATOM 8097  O "O4'" . DT  I 5 105 ? 80.775  89.791  73.879  1.00 256.56 ?  31  DT  I "O4'" 1 
ATOM 8098  C "C3'" . DT  I 5 105 ? 81.608  89.724  71.648  1.00 256.56 ?  31  DT  I "C3'" 1 
ATOM 8099  O "O3'" . DT  I 5 105 ? 80.684  89.390  70.626  1.00 256.56 ?  31  DT  I "O3'" 1 
ATOM 8100  C "C2'" . DT  I 5 105 ? 81.416  91.163  72.131  1.00 256.56 ?  31  DT  I "C2'" 1 
ATOM 8101  C "C1'" . DT  I 5 105 ? 80.394  90.974  73.233  1.00 256.56 ?  31  DT  I "C1'" 1 
ATOM 8102  N N1    . DT  I 5 105 ? 80.372  92.077  74.231  1.00 256.56 ?  31  DT  I N1    1 
ATOM 8103  C C2    . DT  I 5 105 ? 79.192  92.731  74.474  1.00 256.56 ?  31  DT  I C2    1 
ATOM 8104  O O2    . DT  I 5 105 ? 78.150  92.456  73.911  1.00 256.56 ?  31  DT  I O2    1 
ATOM 8105  N N3    . DT  I 5 105 ? 79.271  93.727  75.404  1.00 256.56 ?  31  DT  I N3    1 
ATOM 8106  C C4    . DT  I 5 105 ? 80.391  94.128  76.100  1.00 256.56 ?  31  DT  I C4    1 
ATOM 8107  O O4    . DT  I 5 105 ? 80.362  95.035  76.920  1.00 256.56 ?  31  DT  I O4    1 
ATOM 8108  C C5    . DT  I 5 105 ? 81.594  93.401  75.804  1.00 256.56 ?  31  DT  I C5    1 
ATOM 8109  C C7    . DT  I 5 105 ? 82.872  93.756  76.500  1.00 256.56 ?  31  DT  I C7    1 
ATOM 8110  C C6    . DT  I 5 105 ? 81.531  92.421  74.890  1.00 256.56 ?  31  DT  I C6    1 
ATOM 8111  P P     . DC  I 5 106 ? 80.928  89.897  69.122  1.00 254.25 ?  32  DC  I P     1 
ATOM 8112  O OP1   . DC  I 5 106 ? 80.344  88.891  68.210  1.00 254.25 ?  32  DC  I OP1   1 
ATOM 8113  O OP2   . DC  I 5 106 ? 82.357  90.256  69.001  1.00 254.25 -1 32  DC  I OP2   1 
ATOM 8114  O "O5'" . DC  I 5 106 ? 80.074  91.244  69.030  1.00 254.25 ?  32  DC  I "O5'" 1 
ATOM 8115  C "C5'" . DC  I 5 106 ? 78.714  91.237  69.426  1.00 254.25 ?  32  DC  I "C5'" 1 
ATOM 8116  C "C4'" . DC  I 5 106 ? 78.088  92.608  69.256  1.00 254.25 ?  32  DC  I "C4'" 1 
ATOM 8117  O "O4'" . DC  I 5 106 ? 78.205  93.362  70.490  1.00 254.25 ?  32  DC  I "O4'" 1 
ATOM 8118  C "C3'" . DC  I 5 106 ? 78.710  93.481  68.161  1.00 254.25 ?  32  DC  I "C3'" 1 
ATOM 8119  O "O3'" . DC  I 5 106 ? 77.680  94.032  67.355  1.00 254.25 ?  32  DC  I "O3'" 1 
ATOM 8120  C "C2'" . DC  I 5 106 ? 79.443  94.563  68.952  1.00 254.25 ?  32  DC  I "C2'" 1 
ATOM 8121  C "C1'" . DC  I 5 106 ? 78.558  94.683  70.174  1.00 254.25 ?  32  DC  I "C1'" 1 
ATOM 8122  N N1    . DC  I 5 106 ? 79.236  95.290  71.348  1.00 254.25 ?  32  DC  I N1    1 
ATOM 8123  C C2    . DC  I 5 106 ? 78.718  96.456  71.918  1.00 254.25 ?  32  DC  I C2    1 
ATOM 8124  O O2    . DC  I 5 106 ? 77.701  96.961  71.434  1.00 254.25 ?  32  DC  I O2    1 
ATOM 8125  N N3    . DC  I 5 106 ? 79.344  96.996  72.986  1.00 254.25 ?  32  DC  I N3    1 
ATOM 8126  C C4    . DC  I 5 106 ? 80.436  96.419  73.478  1.00 254.25 ?  32  DC  I C4    1 
ATOM 8127  N N4    . DC  I 5 106 ? 81.019  96.988  74.533  1.00 254.25 ?  32  DC  I N4    1 
ATOM 8128  C C5    . DC  I 5 106 ? 80.982  95.236  72.908  1.00 254.25 ?  32  DC  I C5    1 
ATOM 8129  C C6    . DC  I 5 106 ? 80.354  94.709  71.858  1.00 254.25 ?  32  DC  I C6    1 
ATOM 8130  P P     . DT  I 5 107 ? 78.027  94.965  66.092  1.00 250.11 ?  33  DT  I P     1 
ATOM 8131  O OP1   . DT  I 5 107 ? 77.260  94.436  64.945  1.00 250.11 ?  33  DT  I OP1   1 
ATOM 8132  O OP2   . DT  I 5 107 ? 79.494  95.119  65.980  1.00 250.11 -1 33  DT  I OP2   1 
ATOM 8133  O "O5'" . DT  I 5 107 ? 77.405  96.378  66.493  1.00 250.11 ?  33  DT  I "O5'" 1 
ATOM 8134  C "C5'" . DT  I 5 107 ? 76.037  96.460  66.854  1.00 250.11 ?  33  DT  I "C5'" 1 
ATOM 8135  C "C4'" . DT  I 5 107 ? 75.696  97.837  67.389  1.00 250.11 ?  33  DT  I "C4'" 1 
ATOM 8136  O "O4'" . DT  I 5 107 ? 76.460  98.096  68.596  1.00 250.11 ?  33  DT  I "O4'" 1 
ATOM 8137  C "C3'" . DT  I 5 107 ? 75.998  99.000  66.438  1.00 250.11 ?  33  DT  I "C3'" 1 
ATOM 8138  O "O3'" . DT  I 5 107 ? 74.896  99.895  66.412  1.00 250.11 ?  33  DT  I "O3'" 1 
ATOM 8139  C "C2'" . DT  I 5 107 ? 77.231  99.650  67.060  1.00 250.11 ?  33  DT  I "C2'" 1 
ATOM 8140  C "C1'" . DT  I 5 107 ? 76.977  99.401  68.532  1.00 250.11 ?  33  DT  I "C1'" 1 
ATOM 8141  N N1    . DT  I 5 107 ? 78.199  99.476  69.374  1.00 250.11 ?  33  DT  I N1    1 
ATOM 8142  C C2    . DT  I 5 107 ? 78.273  100.428 70.357  1.00 250.11 ?  33  DT  I C2    1 
ATOM 8143  O O2    . DT  I 5 107 ? 77.382  101.223 70.585  1.00 250.11 ?  33  DT  I O2    1 
ATOM 8144  N N3    . DT  I 5 107 ? 79.432  100.416 71.075  1.00 250.11 ?  33  DT  I N3    1 
ATOM 8145  C C4    . DT  I 5 107 ? 80.504  99.566  70.910  1.00 250.11 ?  33  DT  I C4    1 
ATOM 8146  O O4    . DT  I 5 107 ? 81.505  99.634  71.605  1.00 250.11 ?  33  DT  I O4    1 
ATOM 8147  C C5    . DT  I 5 107 ? 80.366  98.595  69.861  1.00 250.11 ?  33  DT  I C5    1 
ATOM 8148  C C7    . DT  I 5 107 ? 81.472  97.621  69.595  1.00 250.11 ?  33  DT  I C7    1 
ATOM 8149  C C6    . DT  I 5 107 ? 79.234  98.595  69.148  1.00 250.11 ?  33  DT  I C6    1 
ATOM 8150  P P     . DG  I 5 108 ? 74.949  101.225 65.512  1.00 240.44 ?  34  DG  I P     1 
ATOM 8151  O OP1   . DG  I 5 108 ? 73.608  101.402 64.917  1.00 240.44 ?  34  DG  I OP1   1 
ATOM 8152  O OP2   . DG  I 5 108 ? 76.137  101.156 64.635  1.00 240.44 -1 34  DG  I OP2   1 
ATOM 8153  O "O5'" . DG  I 5 108 ? 75.197  102.394 66.570  1.00 240.44 ?  34  DG  I "O5'" 1 
ATOM 8154  C "C5'" . DG  I 5 108 ? 74.184  103.365 66.806  1.00 240.44 ?  34  DG  I "C5'" 1 
ATOM 8155  C "C4'" . DG  I 5 108 ? 74.751  104.589 67.506  1.00 240.44 ?  34  DG  I "C4'" 1 
ATOM 8156  O "O4'" . DG  I 5 108 ? 75.938  104.217 68.248  1.00 240.44 ?  34  DG  I "O4'" 1 
ATOM 8157  C "C3'" . DG  I 5 108 ? 75.195  105.715 66.583  1.00 240.44 ?  34  DG  I "C3'" 1 
ATOM 8158  O "O3'" . DG  I 5 108 ? 75.105  106.949 67.265  1.00 240.44 ?  34  DG  I "O3'" 1 
ATOM 8159  C "C2'" . DG  I 5 108 ? 76.645  105.348 66.318  1.00 240.44 ?  34  DG  I "C2'" 1 
ATOM 8160  C "C1'" . DG  I 5 108 ? 77.071  104.858 67.694  1.00 240.44 ?  34  DG  I "C1'" 1 
ATOM 8161  N N9    . DG  I 5 108 ? 78.153  103.892 67.652  1.00 240.44 ?  34  DG  I N9    1 
ATOM 8162  C C8    . DG  I 5 108 ? 78.403  102.980 66.659  1.00 240.44 ?  34  DG  I C8    1 
ATOM 8163  N N7    . DG  I 5 108 ? 79.441  102.230 66.896  1.00 240.44 ?  34  DG  I N7    1 
ATOM 8164  C C5    . DG  I 5 108 ? 79.904  102.669 68.127  1.00 240.44 ?  34  DG  I C5    1 
ATOM 8165  C C6    . DG  I 5 108 ? 81.003  102.229 68.893  1.00 240.44 ?  34  DG  I C6    1 
ATOM 8166  O O6    . DG  I 5 108 ? 81.812  101.332 68.628  1.00 240.44 ?  34  DG  I O6    1 
ATOM 8167  N N1    . DG  I 5 108 ? 81.120  102.943 70.080  1.00 240.44 ?  34  DG  I N1    1 
ATOM 8168  C C2    . DG  I 5 108 ? 80.279  103.954 70.473  1.00 240.44 ?  34  DG  I C2    1 
ATOM 8169  N N2    . DG  I 5 108 ? 80.552  104.526 71.651  1.00 240.44 ?  34  DG  I N2    1 
ATOM 8170  N N3    . DG  I 5 108 ? 79.245  104.378 69.762  1.00 240.44 ?  34  DG  I N3    1 
ATOM 8171  C C4    . DG  I 5 108 ? 79.119  103.692 68.606  1.00 240.44 ?  34  DG  I C4    1 
ATOM 8172  P P     . DA  I 5 109 ? 73.884  107.948 66.979  1.00 238.02 ?  35  DA  I P     1 
ATOM 8173  O OP1   . DA  I 5 109 ? 72.722  107.135 66.559  1.00 238.02 ?  35  DA  I OP1   1 
ATOM 8174  O OP2   . DA  I 5 109 ? 74.394  109.023 66.103  1.00 238.02 -1 35  DA  I OP2   1 
ATOM 8175  O "O5'" . DA  I 5 109 ? 73.582  108.587 68.413  1.00 238.02 ?  35  DA  I "O5'" 1 
ATOM 8176  C "C5'" . DA  I 5 109 ? 74.258  108.084 69.563  1.00 238.02 ?  35  DA  I "C5'" 1 
ATOM 8177  C "C4'" . DA  I 5 109 ? 75.064  109.173 70.256  1.00 238.02 ?  35  DA  I "C4'" 1 
ATOM 8178  O "O4'" . DA  I 5 109 ? 76.448  108.747 70.386  1.00 238.02 ?  35  DA  I "O4'" 1 
ATOM 8179  C "C3'" . DA  I 5 109 ? 75.136  110.500 69.523  1.00 238.02 ?  35  DA  I "C3'" 1 
ATOM 8180  O "O3'" . DA  I 5 109 ? 75.398  111.528 70.454  1.00 238.02 ?  35  DA  I "O3'" 1 
ATOM 8181  C "C2'" . DA  I 5 109 ? 76.337  110.278 68.621  1.00 238.02 ?  35  DA  I "C2'" 1 
ATOM 8182  C "C1'" . DA  I 5 109 ? 77.274  109.566 69.581  1.00 238.02 ?  35  DA  I "C1'" 1 
ATOM 8183  N N9    . DA  I 5 109 ? 78.241  108.715 68.912  1.00 238.02 ?  35  DA  I N9    1 
ATOM 8184  C C8    . DA  I 5 109 ? 78.184  108.265 67.628  1.00 238.02 ?  35  DA  I C8    1 
ATOM 8185  N N7    . DA  I 5 109 ? 79.192  107.501 67.292  1.00 238.02 ?  35  DA  I N7    1 
ATOM 8186  C C5    . DA  I 5 109 ? 79.958  107.444 68.437  1.00 238.02 ?  35  DA  I C5    1 
ATOM 8187  C C6    . DA  I 5 109 ? 81.165  106.793 68.736  1.00 238.02 ?  35  DA  I C6    1 
ATOM 8188  N N6    . DA  I 5 109 ? 81.831  106.042 67.856  1.00 238.02 ?  35  DA  I N6    1 
ATOM 8189  N N1    . DA  I 5 109 ? 81.667  106.943 69.978  1.00 238.02 ?  35  DA  I N1    1 
ATOM 8190  C C2    . DA  I 5 109 ? 80.996  107.695 70.857  1.00 238.02 ?  35  DA  I C2    1 
ATOM 8191  N N3    . DA  I 5 109 ? 79.853  108.357 70.687  1.00 238.02 ?  35  DA  I N3    1 
ATOM 8192  C C4    . DA  I 5 109 ? 79.385  108.188 69.445  1.00 238.02 ?  35  DA  I C4    1 
ATOM 8193  P P     . DG  I 5 110 ? 74.320  112.686 70.716  1.00 238.21 ?  36  DG  I P     1 
ATOM 8194  O OP1   . DG  I 5 110 ? 73.094  112.038 71.229  1.00 238.21 ?  36  DG  I OP1   1 
ATOM 8195  O OP2   . DG  I 5 110 ? 74.246  113.524 69.501  1.00 238.21 -1 36  DG  I OP2   1 
ATOM 8196  O "O5'" . DG  I 5 110 ? 74.982  113.559 71.880  1.00 238.21 ?  36  DG  I "O5'" 1 
ATOM 8197  C "C5'" . DG  I 5 110 ? 75.120  113.013 73.181  1.00 238.21 ?  36  DG  I "C5'" 1 
ATOM 8198  C "C4'" . DG  I 5 110 ? 76.581  112.903 73.576  1.00 238.21 ?  36  DG  I "C4'" 1 
ATOM 8199  O "O4'" . DG  I 5 110 ? 77.321  112.225 72.529  1.00 238.21 ?  36  DG  I "O4'" 1 
ATOM 8200  C "C3'" . DG  I 5 110 ? 77.293  114.233 73.810  1.00 238.21 ?  36  DG  I "C3'" 1 
ATOM 8201  O "O3'" . DG  I 5 110 ? 78.096  114.143 74.969  1.00 238.21 ?  36  DG  I "O3'" 1 
ATOM 8202  C "C2'" . DG  I 5 110 ? 78.143  114.406 72.553  1.00 238.21 ?  36  DG  I "C2'" 1 
ATOM 8203  C "C1'" . DG  I 5 110 ? 78.471  112.966 72.202  1.00 238.21 ?  36  DG  I "C1'" 1 
ATOM 8204  N N9    . DG  I 5 110 ? 78.745  112.765 70.787  1.00 238.21 ?  36  DG  I N9    1 
ATOM 8205  C C8    . DG  I 5 110 ? 77.968  113.176 69.740  1.00 238.21 ?  36  DG  I C8    1 
ATOM 8206  N N7    . DG  I 5 110 ? 78.454  112.855 68.578  1.00 238.21 ?  36  DG  I N7    1 
ATOM 8207  C C5    . DG  I 5 110 ? 79.627  112.181 68.872  1.00 238.21 ?  36  DG  I C5    1 
ATOM 8208  C C6    . DG  I 5 110 ? 80.577  111.599 68.010  1.00 238.21 ?  36  DG  I C6    1 
ATOM 8209  O O6    . DG  I 5 110 ? 80.567  111.559 66.776  1.00 238.21 ?  36  DG  I O6    1 
ATOM 8210  N N1    . DG  I 5 110 ? 81.622  111.020 68.711  1.00 238.21 ?  36  DG  I N1    1 
ATOM 8211  C C2    . DG  I 5 110 ? 81.734  111.005 70.073  1.00 238.21 ?  36  DG  I C2    1 
ATOM 8212  N N2    . DG  I 5 110 ? 82.820  110.400 70.568  1.00 238.21 ?  36  DG  I N2    1 
ATOM 8213  N N3    . DG  I 5 110 ? 80.849  111.550 70.897  1.00 238.21 ?  36  DG  I N3    1 
ATOM 8214  C C4    . DG  I 5 110 ? 79.822  112.114 70.227  1.00 238.21 ?  36  DG  I C4    1 
ATOM 8215  P P     . DA  I 5 111 ? 78.663  115.471 75.667  1.00 234.04 ?  37  DA  I P     1 
ATOM 8216  O OP1   . DA  I 5 111 ? 78.153  115.505 77.053  1.00 234.04 ?  37  DA  I OP1   1 
ATOM 8217  O OP2   . DA  I 5 111 ? 78.418  116.607 74.753  1.00 234.04 -1 37  DA  I OP2   1 
ATOM 8218  O "O5'" . DA  I 5 111 ? 80.233  115.216 75.723  1.00 234.04 ?  37  DA  I "O5'" 1 
ATOM 8219  C "C5'" . DA  I 5 111 ? 80.716  113.971 76.179  1.00 234.04 ?  37  DA  I "C5'" 1 
ATOM 8220  C "C4'" . DA  I 5 111 ? 82.112  113.712 75.653  1.00 234.04 ?  37  DA  I "C4'" 1 
ATOM 8221  O "O4'" . DA  I 5 111 ? 82.051  113.377 74.242  1.00 234.04 ?  37  DA  I "O4'" 1 
ATOM 8222  C "C3'" . DA  I 5 111 ? 83.064  114.900 75.765  1.00 234.04 ?  37  DA  I "C3'" 1 
ATOM 8223  O "O3'" . DA  I 5 111 ? 84.296  114.478 76.296  1.00 234.04 ?  37  DA  I "O3'" 1 
ATOM 8224  C "C2'" . DA  I 5 111 ? 83.217  115.371 74.321  1.00 234.04 ?  37  DA  I "C2'" 1 
ATOM 8225  C "C1'" . DA  I 5 111 ? 83.076  114.065 73.574  1.00 234.04 ?  37  DA  I "C1'" 1 
ATOM 8226  N N9    . DA  I 5 111 ? 82.698  114.231 72.180  1.00 234.04 ?  37  DA  I N9    1 
ATOM 8227  C C8    . DA  I 5 111 ? 81.563  114.809 71.697  1.00 234.04 ?  37  DA  I C8    1 
ATOM 8228  N N7    . DA  I 5 111 ? 81.493  114.819 70.390  1.00 234.04 ?  37  DA  I N7    1 
ATOM 8229  C C5    . DA  I 5 111 ? 82.663  114.207 69.994  1.00 234.04 ?  37  DA  I C5    1 
ATOM 8230  C C6    . DA  I 5 111 ? 83.190  113.902 68.732  1.00 234.04 ?  37  DA  I C6    1 
ATOM 8231  N N6    . DA  I 5 111 ? 82.570  114.198 67.589  1.00 234.04 ?  37  DA  I N6    1 
ATOM 8232  N N1    . DA  I 5 111 ? 84.386  113.284 68.687  1.00 234.04 ?  37  DA  I N1    1 
ATOM 8233  C C2    . DA  I 5 111 ? 85.004  112.985 69.833  1.00 234.04 ?  37  DA  I C2    1 
ATOM 8234  N N3    . DA  I 5 111 ? 84.605  113.224 71.077  1.00 234.04 ?  37  DA  I N3    1 
ATOM 8235  C C4    . DA  I 5 111 ? 83.417  113.839 71.085  1.00 234.04 ?  37  DA  I C4    1 
ATOM 8236  P P     . DA  I 5 112 ? 85.364  115.573 76.772  1.00 231.15 ?  38  DA  I P     1 
ATOM 8237  O OP1   . DA  I 5 112 ? 85.678  115.298 78.188  1.00 231.15 ?  38  DA  I OP1   1 
ATOM 8238  O OP2   . DA  I 5 112 ? 84.853  116.897 76.363  1.00 231.15 -1 38  DA  I OP2   1 
ATOM 8239  O "O5'" . DA  I 5 112 ? 86.652  115.266 75.886  1.00 231.15 ?  38  DA  I "O5'" 1 
ATOM 8240  C "C5'" . DA  I 5 112 ? 87.546  114.248 76.286  1.00 231.15 ?  38  DA  I "C5'" 1 
ATOM 8241  C "C4'" . DA  I 5 112 ? 88.666  114.077 75.279  1.00 231.15 ?  38  DA  I "C4'" 1 
ATOM 8242  O "O4'" . DA  I 5 112 ? 88.110  113.973 73.952  1.00 231.15 ?  38  DA  I "O4'" 1 
ATOM 8243  C "C3'" . DA  I 5 112 ? 89.684  115.207 75.229  1.00 231.15 ?  38  DA  I "C3'" 1 
ATOM 8244  O "O3'" . DA  I 5 112 ? 90.974  114.680 75.013  1.00 231.15 ?  38  DA  I "O3'" 1 
ATOM 8245  C "C2'" . DA  I 5 112 ? 89.219  116.047 74.050  1.00 231.15 ?  38  DA  I "C2'" 1 
ATOM 8246  C "C1'" . DA  I 5 112 ? 88.598  115.010 73.130  1.00 231.15 ?  38  DA  I "C1'" 1 
ATOM 8247  N N9    . DA  I 5 112 ? 87.474  115.535 72.372  1.00 231.15 ?  38  DA  I N9    1 
ATOM 8248  C C8    . DA  I 5 112 ? 86.357  116.125 72.879  1.00 231.15 ?  38  DA  I C8    1 
ATOM 8249  N N7    . DA  I 5 112 ? 85.497  116.503 71.970  1.00 231.15 ?  38  DA  I N7    1 
ATOM 8250  C C5    . DA  I 5 112 ? 86.092  116.135 70.784  1.00 231.15 ?  38  DA  I C5    1 
ATOM 8251  C C6    . DA  I 5 112 ? 85.688  116.264 69.453  1.00 231.15 ?  38  DA  I C6    1 
ATOM 8252  N N6    . DA  I 5 112 ? 84.531  116.819 69.093  1.00 231.15 ?  38  DA  I N6    1 
ATOM 8253  N N1    . DA  I 5 112 ? 86.513  115.787 68.502  1.00 231.15 ?  38  DA  I N1    1 
ATOM 8254  C C2    . DA  I 5 112 ? 87.667  115.222 68.869  1.00 231.15 ?  38  DA  I C2    1 
ATOM 8255  N N3    . DA  I 5 112 ? 88.158  115.055 70.089  1.00 231.15 ?  38  DA  I N3    1 
ATOM 8256  C C4    . DA  I 5 112 ? 87.311  115.533 71.010  1.00 231.15 ?  38  DA  I C4    1 
ATOM 8257  P P     . DT  I 5 113 ? 92.249  115.653 74.962  1.00 232.80 ?  39  DT  I P     1 
ATOM 8258  O OP1   . DT  I 5 113 ? 93.300  115.041 75.793  1.00 232.80 ?  39  DT  I OP1   1 
ATOM 8259  O OP2   . DT  I 5 113 ? 91.826  117.047 75.202  1.00 232.80 -1 39  DT  I OP2   1 
ATOM 8260  O "O5'" . DT  I 5 113 ? 92.723  115.561 73.454  1.00 232.80 ?  39  DT  I "O5'" 1 
ATOM 8261  C "C5'" . DT  I 5 113 ? 93.045  114.313 72.911  1.00 232.80 ?  39  DT  I "C5'" 1 
ATOM 8262  C "C4'" . DT  I 5 113 ? 93.217  114.424 71.420  1.00 232.80 ?  39  DT  I "C4'" 1 
ATOM 8263  O "O4'" . DT  I 5 113 ? 91.983  114.908 70.833  1.00 232.80 ?  39  DT  I "O4'" 1 
ATOM 8264  C "C3'" . DT  I 5 113 ? 94.305  115.403 70.986  1.00 232.80 ?  39  DT  I "C3'" 1 
ATOM 8265  O "O3'" . DT  I 5 113 ? 95.143  114.794 70.034  1.00 232.80 ?  39  DT  I "O3'" 1 
ATOM 8266  C "C2'" . DT  I 5 113 ? 93.521  116.565 70.382  1.00 232.80 ?  39  DT  I "C2'" 1 
ATOM 8267  C "C1'" . DT  I 5 113 ? 92.304  115.846 69.848  1.00 232.80 ?  39  DT  I "C1'" 1 
ATOM 8268  N N1    . DT  I 5 113 ? 91.124  116.723 69.606  1.00 232.80 ?  39  DT  I N1    1 
ATOM 8269  C C2    . DT  I 5 113 ? 90.703  116.910 68.320  1.00 232.80 ?  39  DT  I C2    1 
ATOM 8270  O O2    . DT  I 5 113 ? 91.253  116.402 67.363  1.00 232.80 ?  39  DT  I O2    1 
ATOM 8271  N N3    . DT  I 5 113 ? 89.621  117.727 68.182  1.00 232.80 ?  39  DT  I N3    1 
ATOM 8272  C C4    . DT  I 5 113 ? 88.922  118.355 69.184  1.00 232.80 ?  39  DT  I C4    1 
ATOM 8273  O O4    . DT  I 5 113 ? 87.953  119.065 68.964  1.00 232.80 ?  39  DT  I O4    1 
ATOM 8274  C C5    . DT  I 5 113 ? 89.403  118.117 70.509  1.00 232.80 ?  39  DT  I C5    1 
ATOM 8275  C C7    . DT  I 5 113 ? 88.713  118.764 71.666  1.00 232.80 ?  39  DT  I C7    1 
ATOM 8276  C C6    . DT  I 5 113 ? 90.474  117.320 70.664  1.00 232.80 ?  39  DT  I C6    1 
ATOM 8277  P P     . DG  I 5 114 ? 96.597  115.405 69.746  1.00 250.51 ?  40  DG  I P     1 
ATOM 8278  O OP1   . DG  I 5 114 ? 97.449  114.304 69.250  1.00 250.51 ?  40  DG  I OP1   1 
ATOM 8279  O OP2   . DG  I 5 114 ? 97.007  116.160 70.949  1.00 250.51 -1 40  DG  I OP2   1 
ATOM 8280  O "O5'" . DG  I 5 114 ? 96.344  116.454 68.565  1.00 250.51 ?  40  DG  I "O5'" 1 
ATOM 8281  C "C5'" . DG  I 5 114 ? 95.877  116.002 67.298  1.00 250.51 ?  40  DG  I "C5'" 1 
ATOM 8282  C "C4'" . DG  I 5 114 ? 95.562  117.178 66.395  1.00 250.51 ?  40  DG  I "C4'" 1 
ATOM 8283  O "O4'" . DG  I 5 114 ? 94.224  117.631 66.652  1.00 250.51 ?  40  DG  I "O4'" 1 
ATOM 8284  C "C3'" . DG  I 5 114 ? 96.461  118.391 66.603  1.00 250.51 ?  40  DG  I "C3'" 1 
ATOM 8285  O "O3'" . DG  I 5 114 ? 97.358  118.512 65.516  1.00 250.51 ?  40  DG  I "O3'" 1 
ATOM 8286  C "C2'" . DG  I 5 114 ? 95.503  119.592 66.688  1.00 250.51 ?  40  DG  I "C2'" 1 
ATOM 8287  C "C1'" . DG  I 5 114 ? 94.138  118.999 66.364  1.00 250.51 ?  40  DG  I "C1'" 1 
ATOM 8288  N N9    . DG  I 5 114 ? 93.057  119.546 67.173  1.00 250.51 ?  40  DG  I N9    1 
ATOM 8289  C C8    . DG  I 5 114 ? 92.888  119.393 68.521  1.00 250.51 ?  40  DG  I C8    1 
ATOM 8290  N N7    . DG  I 5 114 ? 91.819  119.968 68.983  1.00 250.51 ?  40  DG  I N7    1 
ATOM 8291  C C5    . DG  I 5 114 ? 91.241  120.546 67.867  1.00 250.51 ?  40  DG  I C5    1 
ATOM 8292  C C6    . DG  I 5 114 ? 90.059  121.305 67.751  1.00 250.51 ?  40  DG  I C6    1 
ATOM 8293  O O6    . DG  I 5 114 ? 89.273  121.637 68.644  1.00 250.51 ?  40  DG  I O6    1 
ATOM 8294  N N1    . DG  I 5 114 ? 89.831  121.704 66.443  1.00 250.51 ?  40  DG  I N1    1 
ATOM 8295  C C2    . DG  I 5 114 ? 90.639  121.397 65.382  1.00 250.51 ?  40  DG  I C2    1 
ATOM 8296  N N2    . DG  I 5 114 ? 90.254  121.866 64.192  1.00 250.51 ?  40  DG  I N2    1 
ATOM 8297  N N3    . DG  I 5 114 ? 91.750  120.683 65.476  1.00 250.51 ?  40  DG  I N3    1 
ATOM 8298  C C4    . DG  I 5 114 ? 91.986  120.291 66.743  1.00 250.51 ?  40  DG  I C4    1 
ATOM 8299  P P     . DC  I 5 115 ? 98.511  119.628 65.544  1.00 261.58 ?  41  DC  I P     1 
ATOM 8300  O OP1   . DC  I 5 115 ? 99.708  119.063 64.883  1.00 261.58 ?  41  DC  I OP1   1 
ATOM 8301  O OP2   . DC  I 5 115 ? 98.611  120.127 66.931  1.00 261.58 -1 41  DC  I OP2   1 
ATOM 8302  O "O5'" . DC  I 5 115 ? 97.915  120.802 64.639  1.00 261.58 ?  41  DC  I "O5'" 1 
ATOM 8303  C "C5'" . DC  I 5 115 ? 97.488  120.519 63.318  1.00 261.58 ?  41  DC  I "C5'" 1 
ATOM 8304  C "C4'" . DC  I 5 115 ? 96.790  121.716 62.708  1.00 261.58 ?  41  DC  I "C4'" 1 
ATOM 8305  O "O4'" . DC  I 5 115 ? 95.503  121.904 63.346  1.00 261.58 ?  41  DC  I "O4'" 1 
ATOM 8306  C "C3'" . DC  I 5 115 ? 97.539  123.044 62.852  1.00 261.58 ?  41  DC  I "C3'" 1 
ATOM 8307  O "O3'" . DC  I 5 115 ? 97.606  123.701 61.600  1.00 261.58 ?  41  DC  I "O3'" 1 
ATOM 8308  C "C2'" . DC  I 5 115 ? 96.691  123.830 63.849  1.00 261.58 ?  41  DC  I "C2'" 1 
ATOM 8309  C "C1'" . DC  I 5 115 ? 95.308  123.274 63.571  1.00 261.58 ?  41  DC  I "C1'" 1 
ATOM 8310  N N1    . DC  I 5 115 ? 94.373  123.436 64.705  1.00 261.58 ?  41  DC  I N1    1 
ATOM 8311  C C2    . DC  I 5 115 ? 93.146  124.068 64.501  1.00 261.58 ?  41  DC  I C2    1 
ATOM 8312  O O2    . DC  I 5 115 ? 92.859  124.476 63.370  1.00 261.58 ?  41  DC  I O2    1 
ATOM 8313  N N3    . DC  I 5 115 ? 92.302  124.214 65.551  1.00 261.58 ?  41  DC  I N3    1 
ATOM 8314  C C4    . DC  I 5 115 ? 92.651  123.758 66.751  1.00 261.58 ?  41  DC  I C4    1 
ATOM 8315  N N4    . DC  I 5 115 ? 91.794  123.932 67.756  1.00 261.58 ?  41  DC  I N4    1 
ATOM 8316  C C5    . DC  I 5 115 ? 93.902  123.118 66.978  1.00 261.58 ?  41  DC  I C5    1 
ATOM 8317  C C6    . DC  I 5 115 ? 94.723  122.981 65.936  1.00 261.58 ?  41  DC  I C6    1 
ATOM 8318  P P     . DT  I 5 116 ? 98.460  125.051 61.447  1.00 264.68 ?  42  DT  I P     1 
ATOM 8319  O OP1   . DT  I 5 116 ? 98.975  125.104 60.063  1.00 264.68 ?  42  DT  I OP1   1 
ATOM 8320  O OP2   . DT  I 5 116 ? 99.401  125.103 62.586  1.00 264.68 -1 42  DT  I OP2   1 
ATOM 8321  O "O5'" . DT  I 5 116 ? 97.381  126.217 61.637  1.00 264.68 ?  42  DT  I "O5'" 1 
ATOM 8322  C "C5'" . DT  I 5 116 ? 96.271  126.314 60.751  1.00 264.68 ?  42  DT  I "C5'" 1 
ATOM 8323  C "C4'" . DT  I 5 116 ? 95.296  127.373 61.229  1.00 264.68 ?  42  DT  I "C4'" 1 
ATOM 8324  O "O4'" . DT  I 5 116 ? 94.633  126.908 62.419  1.00 264.68 ?  42  DT  I "O4'" 1 
ATOM 8325  C "C3'" . DT  I 5 116 ? 95.939  128.709 61.600  1.00 264.68 ?  42  DT  I "C3'" 1 
ATOM 8326  O "O3'" . DT  I 5 116 ? 95.601  129.696 60.643  1.00 264.68 ?  42  DT  I "O3'" 1 
ATOM 8327  C "C2'" . DT  I 5 116 ? 95.374  129.053 62.987  1.00 264.68 ?  42  DT  I "C2'" 1 
ATOM 8328  C "C1'" . DT  I 5 116 ? 94.285  128.013 63.207  1.00 264.68 ?  42  DT  I "C1'" 1 
ATOM 8329  N N1    . DT  I 5 116 ? 94.193  127.562 64.618  1.00 264.68 ?  42  DT  I N1    1 
ATOM 8330  C C2    . DT  I 5 116 ? 92.960  127.368 65.186  1.00 264.68 ?  42  DT  I C2    1 
ATOM 8331  O O2    . DT  I 5 116 ? 91.915  127.544 64.591  1.00 264.68 ?  42  DT  I O2    1 
ATOM 8332  N N3    . DT  I 5 116 ? 92.991  126.952 66.488  1.00 264.68 ?  42  DT  I N3    1 
ATOM 8333  C C4    . DT  I 5 116 ? 94.110  126.715 67.259  1.00 264.68 ?  42  DT  I C4    1 
ATOM 8334  O O4    . DT  I 5 116 ? 94.036  126.342 68.424  1.00 264.68 ?  42  DT  I O4    1 
ATOM 8335  C C5    . DT  I 5 116 ? 95.371  126.942 66.603  1.00 264.68 ?  42  DT  I C5    1 
ATOM 8336  C C7    . DT  I 5 116 ? 96.656  126.721 67.341  1.00 264.68 ?  42  DT  I C7    1 
ATOM 8337  C C6    . DT  I 5 116 ? 95.351  127.346 65.329  1.00 264.68 ?  42  DT  I C6    1 
ATOM 8338  P P     . DT  I 5 117 ? 96.292  131.146 60.708  1.00 266.03 ?  43  DT  I P     1 
ATOM 8339  O OP1   . DT  I 5 117 ? 96.389  131.669 59.327  1.00 266.03 ?  43  DT  I OP1   1 
ATOM 8340  O OP2   . DT  I 5 117 ? 97.516  131.015 61.528  1.00 266.03 -1 43  DT  I OP2   1 
ATOM 8341  O "O5'" . DT  I 5 117 ? 95.247  132.031 61.535  1.00 266.03 ?  43  DT  I "O5'" 1 
ATOM 8342  C "C5'" . DT  I 5 117 ? 93.863  131.991 61.204  1.00 266.03 ?  43  DT  I "C5'" 1 
ATOM 8343  C "C4'" . DT  I 5 117 ? 93.035  132.748 62.227  1.00 266.03 ?  43  DT  I "C4'" 1 
ATOM 8344  O "O4'" . DT  I 5 117 ? 93.174  132.121 63.531  1.00 266.03 ?  43  DT  I "O4'" 1 
ATOM 8345  C "C3'" . DT  I 5 117 ? 93.426  134.216 62.421  1.00 266.03 ?  43  DT  I "C3'" 1 
ATOM 8346  O "O3'" . DT  I 5 117 ? 92.260  135.025 62.492  1.00 266.03 ?  43  DT  I "O3'" 1 
ATOM 8347  C "C2'" . DT  I 5 117 ? 94.169  134.201 63.750  1.00 266.03 ?  43  DT  I "C2'" 1 
ATOM 8348  C "C1'" . DT  I 5 117 ? 93.405  133.122 64.490  1.00 266.03 ?  43  DT  I "C1'" 1 
ATOM 8349  N N1    . DT  I 5 117 ? 94.152  132.532 65.636  1.00 266.03 ?  43  DT  I N1    1 
ATOM 8350  C C2    . DT  I 5 117 ? 93.723  132.788 66.912  1.00 266.03 ?  43  DT  I C2    1 
ATOM 8351  O O2    . DT  I 5 117 ? 92.753  133.475 67.162  1.00 266.03 ?  43  DT  I O2    1 
ATOM 8352  N N3    . DT  I 5 117 ? 94.470  132.205 67.896  1.00 266.03 ?  43  DT  I N3    1 
ATOM 8353  C C4    . DT  I 5 117 ? 95.583  131.408 67.734  1.00 266.03 ?  43  DT  I C4    1 
ATOM 8354  O O4    . DT  I 5 117 ? 96.192  130.931 68.682  1.00 266.03 ?  43  DT  I O4    1 
ATOM 8355  C C5    . DT  I 5 117 ? 95.984  131.179 66.373  1.00 266.03 ?  43  DT  I C5    1 
ATOM 8356  C C7    . DT  I 5 117 ? 97.183  130.332 66.079  1.00 266.03 ?  43  DT  I C7    1 
ATOM 8357  C C6    . DT  I 5 117 ? 95.258  131.746 65.397  1.00 266.03 ?  43  DT  I C6    1 
ATOM 8358  P P     . DC  I 5 118 ? 92.389  136.627 62.500  1.00 265.85 ?  44  DC  I P     1 
ATOM 8359  O OP1   . DC  I 5 118 ? 91.163  137.174 61.878  1.00 265.85 ?  44  DC  I OP1   1 
ATOM 8360  O OP2   . DC  I 5 118 ? 93.720  136.970 61.954  1.00 265.85 -1 44  DC  I OP2   1 
ATOM 8361  O "O5'" . DC  I 5 118 ? 92.394  137.014 64.053  1.00 265.85 ?  44  DC  I "O5'" 1 
ATOM 8362  C "C5'" . DC  I 5 118 ? 91.181  136.981 64.791  1.00 265.85 ?  44  DC  I "C5'" 1 
ATOM 8363  C "C4'" . DC  I 5 118 ? 91.416  137.303 66.258  1.00 265.85 ?  44  DC  I "C4'" 1 
ATOM 8364  O "O4'" . DC  I 5 118 ? 92.297  136.312 66.849  1.00 265.85 ?  44  DC  I "O4'" 1 
ATOM 8365  C "C3'" . DC  I 5 118 ? 92.057  138.666 66.544  1.00 265.85 ?  44  DC  I "C3'" 1 
ATOM 8366  O "O3'" . DC  I 5 118 ? 91.379  139.281 67.627  1.00 265.85 ?  44  DC  I "O3'" 1 
ATOM 8367  C "C2'" . DC  I 5 118 ? 93.486  138.292 66.929  1.00 265.85 ?  44  DC  I "C2'" 1 
ATOM 8368  C "C1'" . DC  I 5 118 ? 93.247  136.977 67.642  1.00 265.85 ?  44  DC  I "C1'" 1 
ATOM 8369  N N1    . DC  I 5 118 ? 94.454  136.127 67.756  1.00 265.85 ?  44  DC  I N1    1 
ATOM 8370  C C2    . DC  I 5 118 ? 94.792  135.575 68.989  1.00 265.85 ?  44  DC  I C2    1 
ATOM 8371  O O2    . DC  I 5 118 ? 94.075  135.806 69.966  1.00 265.85 ?  44  DC  I O2    1 
ATOM 8372  N N3    . DC  I 5 118 ? 95.900  134.801 69.080  1.00 265.85 ?  44  DC  I N3    1 
ATOM 8373  C C4    . DC  I 5 118 ? 96.648  134.580 68.001  1.00 265.85 ?  44  DC  I C4    1 
ATOM 8374  N N4    . DC  I 5 118 ? 97.730  133.809 68.136  1.00 265.85 ?  44  DC  I N4    1 
ATOM 8375  C C5    . DC  I 5 118 ? 96.316  135.134 66.735  1.00 265.85 ?  44  DC  I C5    1 
ATOM 8376  C C6    . DC  I 5 118 ? 95.225  135.900 66.663  1.00 265.85 ?  44  DC  I C6    1 
ATOM 8377  P P     . DC  I 5 119 ? 91.599  140.836 67.964  1.00 257.43 ?  45  DC  I P     1 
ATOM 8378  O OP1   . DC  I 5 119 ? 90.437  141.570 67.418  1.00 257.43 ?  45  DC  I OP1   1 
ATOM 8379  O OP2   . DC  I 5 119 ? 92.971  141.216 67.566  1.00 257.43 -1 45  DC  I OP2   1 
ATOM 8380  O "O5'" . DC  I 5 119 ? 91.531  140.884 69.560  1.00 257.43 ?  45  DC  I "O5'" 1 
ATOM 8381  C "C5'" . DC  I 5 119 ? 90.430  140.291 70.238  1.00 257.43 ?  45  DC  I "C5'" 1 
ATOM 8382  C "C4'" . DC  I 5 119 ? 90.887  139.543 71.479  1.00 257.43 ?  45  DC  I "C4'" 1 
ATOM 8383  O "O4'" . DC  I 5 119 ? 92.003  138.672 71.148  1.00 257.43 ?  45  DC  I "O4'" 1 
ATOM 8384  C "C3'" . DC  I 5 119 ? 91.374  140.426 72.627  1.00 257.43 ?  45  DC  I "C3'" 1 
ATOM 8385  O "O3'" . DC  I 5 119 ? 90.920  139.901 73.847  1.00 257.43 ?  45  DC  I "O3'" 1 
ATOM 8386  C "C2'" . DC  I 5 119 ? 92.887  140.313 72.519  1.00 257.43 ?  45  DC  I "C2'" 1 
ATOM 8387  C "C1'" . DC  I 5 119 ? 93.025  138.867 72.095  1.00 257.43 ?  45  DC  I "C1'" 1 
ATOM 8388  N N1    . DC  I 5 119 ? 94.332  138.551 71.468  1.00 257.43 ?  45  DC  I N1    1 
ATOM 8389  C C2    . DC  I 5 119 ? 95.234  137.726 72.139  1.00 257.43 ?  45  DC  I C2    1 
ATOM 8390  O O2    . DC  I 5 119 ? 94.922  137.268 73.239  1.00 257.43 ?  45  DC  I O2    1 
ATOM 8391  N N3    . DC  I 5 119 ? 96.421  137.444 71.560  1.00 257.43 ?  45  DC  I N3    1 
ATOM 8392  C C4    . DC  I 5 119 ? 96.717  137.955 70.369  1.00 257.43 ?  45  DC  I C4    1 
ATOM 8393  N N4    . DC  I 5 119 ? 97.902  137.650 69.837  1.00 257.43 ?  45  DC  I N4    1 
ATOM 8394  C C5    . DC  I 5 119 ? 95.812  138.803 69.670  1.00 257.43 ?  45  DC  I C5    1 
ATOM 8395  C C6    . DC  I 5 119 ? 94.643  139.073 70.254  1.00 257.43 ?  45  DC  I C6    1 
ATOM 8396  P P     . DG  I 5 120 ? 89.816  140.692 74.697  1.00 252.00 ?  46  DG  I P     1 
ATOM 8397  O OP1   . DG  I 5 120 ? 88.497  140.136 74.332  1.00 252.00 ?  46  DG  I OP1   1 
ATOM 8398  O OP2   . DG  I 5 120 ? 90.075  142.137 74.530  1.00 252.00 -1 46  DG  I OP2   1 
ATOM 8399  O "O5'" . DG  I 5 120 ? 90.150  140.294 76.205  1.00 252.00 ?  46  DG  I "O5'" 1 
ATOM 8400  C "C5'" . DG  I 5 120 ? 90.180  138.928 76.581  1.00 252.00 ?  46  DG  I "C5'" 1 
ATOM 8401  C "C4'" . DG  I 5 120 ? 91.431  138.601 77.379  1.00 252.00 ?  46  DG  I "C4'" 1 
ATOM 8402  O "O4'" . DG  I 5 120 ? 92.590  138.572 76.504  1.00 252.00 ?  46  DG  I "O4'" 1 
ATOM 8403  C "C3'" . DG  I 5 120 ? 91.781  139.587 78.500  1.00 252.00 ?  46  DG  I "C3'" 1 
ATOM 8404  O "O3'" . DG  I 5 120 ? 92.230  138.868 79.623  1.00 252.00 ?  46  DG  I "O3'" 1 
ATOM 8405  C "C2'" . DG  I 5 120 ? 92.936  140.373 77.891  1.00 252.00 ?  46  DG  I "C2'" 1 
ATOM 8406  C "C1'" . DG  I 5 120 ? 93.633  139.257 77.145  1.00 252.00 ?  46  DG  I "C1'" 1 
ATOM 8407  N N9    . DG  I 5 120 ? 94.584  139.709 76.146  1.00 252.00 ?  46  DG  I N9    1 
ATOM 8408  C C8    . DG  I 5 120 ? 94.581  140.905 75.486  1.00 252.00 ?  46  DG  I C8    1 
ATOM 8409  N N7    . DG  I 5 120 ? 95.561  141.030 74.639  1.00 252.00 ?  46  DG  I N7    1 
ATOM 8410  C C5    . DG  I 5 120 ? 96.262  139.840 74.753  1.00 252.00 ?  46  DG  I C5    1 
ATOM 8411  C C6    . DG  I 5 120 ? 97.424  139.403 74.083  1.00 252.00 ?  46  DG  I C6    1 
ATOM 8412  O O6    . DG  I 5 120 ? 98.086  139.999 73.228  1.00 252.00 ?  46  DG  I O6    1 
ATOM 8413  N N1    . DG  I 5 120 ? 97.806  138.133 74.491  1.00 252.00 ?  46  DG  I N1    1 
ATOM 8414  C C2    . DG  I 5 120 ? 97.152  137.384 75.430  1.00 252.00 ?  46  DG  I C2    1 
ATOM 8415  N N2    . DG  I 5 120 ? 97.672  136.177 75.692  1.00 252.00 ?  46  DG  I N2    1 
ATOM 8416  N N3    . DG  I 5 120 ? 96.059  137.782 76.066  1.00 252.00 ?  46  DG  I N3    1 
ATOM 8417  C C4    . DG  I 5 120 ? 95.670  139.016 75.673  1.00 252.00 ?  46  DG  I C4    1 
ATOM 8418  P P     . DT  I 5 121 ? 91.244  138.504 80.834  1.00 252.54 ?  47  DT  I P     1 
ATOM 8419  O OP1   . DT  I 5 121 ? 90.043  137.839 80.294  1.00 252.54 ?  47  DT  I OP1   1 
ATOM 8420  O OP2   . DT  I 5 121 ? 91.097  139.703 81.683  1.00 252.54 -1 47  DT  I OP2   1 
ATOM 8421  O "O5'" . DT  I 5 121 ? 92.087  137.424 81.641  1.00 252.54 ?  47  DT  I "O5'" 1 
ATOM 8422  C "C5'" . DT  I 5 121 ? 92.887  136.497 80.920  1.00 252.54 ?  47  DT  I "C5'" 1 
ATOM 8423  C "C4'" . DT  I 5 121 ? 94.334  136.525 81.384  1.00 252.54 ?  47  DT  I "C4'" 1 
ATOM 8424  O "O4'" . DT  I 5 121 ? 95.188  137.079 80.342  1.00 252.54 ?  47  DT  I "O4'" 1 
ATOM 8425  C "C3'" . DT  I 5 121 ? 94.618  137.374 82.625  1.00 252.54 ?  47  DT  I "C3'" 1 
ATOM 8426  O "O3'" . DT  I 5 121 ? 95.684  136.801 83.327  1.00 252.54 ?  47  DT  I "O3'" 1 
ATOM 8427  C "C2'" . DT  I 5 121 ? 95.082  138.671 81.994  1.00 252.54 ?  47  DT  I "C2'" 1 
ATOM 8428  C "C1'" . DT  I 5 121 ? 95.979  138.086 80.927  1.00 252.54 ?  47  DT  I "C1'" 1 
ATOM 8429  N N1    . DT  I 5 121 ? 96.414  139.041 79.884  1.00 252.54 ?  47  DT  I N1    1 
ATOM 8430  C C2    . DT  I 5 121 ? 97.320  138.626 78.946  1.00 252.54 ?  47  DT  I C2    1 
ATOM 8431  O O2    . DT  I 5 121 ? 97.776  137.501 78.918  1.00 252.54 ?  47  DT  I O2    1 
ATOM 8432  N N3    . DT  I 5 121 ? 97.672  139.573 78.032  1.00 252.54 ?  47  DT  I N3    1 
ATOM 8433  C C4    . DT  I 5 121 ? 97.217  140.870 77.964  1.00 252.54 ?  47  DT  I C4    1 
ATOM 8434  O O4    . DT  I 5 121 ? 97.587  141.647 77.097  1.00 252.54 ?  47  DT  I O4    1 
ATOM 8435  C C5    . DT  I 5 121 ? 96.271  141.245 78.983  1.00 252.54 ?  47  DT  I C5    1 
ATOM 8436  C C7    . DT  I 5 121 ? 95.708  142.632 79.015  1.00 252.54 ?  47  DT  I C7    1 
ATOM 8437  C C6    . DT  I 5 121 ? 95.925  140.325 79.887  1.00 252.54 ?  47  DT  I C6    1 
ATOM 8438  P P     . DT  I 5 122 ? 95.440  135.835 84.577  1.00 248.84 ?  48  DT  I P     1 
ATOM 8439  O OP1   . DT  I 5 122 ? 94.493  134.770 84.184  1.00 248.84 ?  48  DT  I OP1   1 
ATOM 8440  O OP2   . DT  I 5 122 ? 95.141  136.687 85.744  1.00 248.84 -1 48  DT  I OP2   1 
ATOM 8441  O "O5'" . DT  I 5 122 ? 96.876  135.175 84.778  1.00 248.84 ?  48  DT  I "O5'" 1 
ATOM 8442  C "C5'" . DT  I 5 122 ? 97.538  134.609 83.657  1.00 248.84 ?  48  DT  I "C5'" 1 
ATOM 8443  C "C4'" . DT  I 5 122 ? 98.976  135.073 83.574  1.00 248.84 ?  48  DT  I "C4'" 1 
ATOM 8444  O "O4'" . DT  I 5 122 ? 99.075  136.218 82.689  1.00 248.84 ?  48  DT  I "O4'" 1 
ATOM 8445  C "C3'" . DT  I 5 122 ? 99.601  135.513 84.899  1.00 248.84 ?  48  DT  I "C3'" 1 
ATOM 8446  O "O3'" . DT  I 5 122 ? 100.884 134.935 85.028  1.00 248.84 ?  48  DT  I "O3'" 1 
ATOM 8447  C "C2'" . DT  I 5 122 ? 99.692  137.031 84.749  1.00 248.84 ?  48  DT  I "C2'" 1 
ATOM 8448  C "C1'" . DT  I 5 122 ? 99.966  137.132 83.265  1.00 248.84 ?  48  DT  I "C1'" 1 
ATOM 8449  N N1    . DT  I 5 122 ? 99.737  138.477 82.669  1.00 248.84 ?  48  DT  I N1    1 
ATOM 8450  C C2    . DT  I 5 122 ? 100.558 138.893 81.654  1.00 248.84 ?  48  DT  I C2    1 
ATOM 8451  O O2    . DT  I 5 122 ? 101.469 138.219 81.219  1.00 248.84 ?  48  DT  I O2    1 
ATOM 8452  N N3    . DT  I 5 122 ? 100.278 140.129 81.158  1.00 248.84 ?  48  DT  I N3    1 
ATOM 8453  C C4    . DT  I 5 122 ? 99.278  140.979 81.564  1.00 248.84 ?  48  DT  I C4    1 
ATOM 8454  O O4    . DT  I 5 122 ? 99.107  142.079 81.055  1.00 248.84 ?  48  DT  I O4    1 
ATOM 8455  C C5    . DT  I 5 122 ? 98.449  140.488 82.633  1.00 248.84 ?  48  DT  I C5    1 
ATOM 8456  C C7    . DT  I 5 122 ? 97.332  141.336 83.161  1.00 248.84 ?  48  DT  I C7    1 
ATOM 8457  C C6    . DT  I 5 122 ? 98.713  139.270 83.129  1.00 248.84 ?  48  DT  I C6    1 
ATOM 8458  P P     . DT  I 5 123 ? 101.557 134.808 86.475  1.00 245.68 ?  49  DT  I P     1 
ATOM 8459  O OP1   . DT  I 5 123 ? 101.837 133.379 86.728  1.00 245.68 ?  49  DT  I OP1   1 
ATOM 8460  O OP2   . DT  I 5 123 ? 100.720 135.597 87.396  1.00 245.68 -1 49  DT  I OP2   1 
ATOM 8461  O "O5'" . DT  I 5 123 ? 102.943 135.571 86.330  1.00 245.68 ?  49  DT  I "O5'" 1 
ATOM 8462  C "C5'" . DT  I 5 123 ? 104.027 134.923 85.722  1.00 245.68 ?  49  DT  I "C5'" 1 
ATOM 8463  C "C4'" . DT  I 5 123 ? 104.659 135.817 84.684  1.00 245.68 ?  49  DT  I "C4'" 1 
ATOM 8464  O "O4'" . DT  I 5 123 ? 103.693 136.779 84.244  1.00 245.68 ?  49  DT  I "O4'" 1 
ATOM 8465  C "C3'" . DT  I 5 123 ? 105.829 136.648 85.187  1.00 245.68 ?  49  DT  I "C3'" 1 
ATOM 8466  O "O3'" . DT  I 5 123 ? 107.043 136.009 84.856  1.00 245.68 ?  49  DT  I "O3'" 1 
ATOM 8467  C "C2'" . DT  I 5 123 ? 105.684 137.998 84.460  1.00 245.68 ?  49  DT  I "C2'" 1 
ATOM 8468  C "C1'" . DT  I 5 123 ? 104.388 137.847 83.666  1.00 245.68 ?  49  DT  I "C1'" 1 
ATOM 8469  N N1    . DT  I 5 123 ? 103.516 139.049 83.694  1.00 245.68 ?  49  DT  I N1    1 
ATOM 8470  C C2    . DT  I 5 123 ? 103.640 139.981 82.701  1.00 245.68 ?  49  DT  I C2    1 
ATOM 8471  O O2    . DT  I 5 123 ? 104.441 139.883 81.794  1.00 245.68 ?  49  DT  I O2    1 
ATOM 8472  N N3    . DT  I 5 123 ? 102.792 141.041 82.805  1.00 245.68 ?  49  DT  I N3    1 
ATOM 8473  C C4    . DT  I 5 123 ? 101.849 141.257 83.782  1.00 245.68 ?  49  DT  I C4    1 
ATOM 8474  O O4    . DT  I 5 123 ? 101.131 142.247 83.791  1.00 245.68 ?  49  DT  I O4    1 
ATOM 8475  C C5    . DT  I 5 123 ? 101.765 140.241 84.791  1.00 245.68 ?  49  DT  I C5    1 
ATOM 8476  C C7    . DT  I 5 123 ? 100.775 140.376 85.906  1.00 245.68 ?  49  DT  I C7    1 
ATOM 8477  C C6    . DT  I 5 123 ? 102.595 139.197 84.703  1.00 245.68 ?  49  DT  I C6    1 
ATOM 8478  P P     . DG  I 5 124 ? 108.069 135.606 86.020  1.00 264.24 ?  50  DG  I P     1 
ATOM 8479  O OP1   . DG  I 5 124 ? 108.809 134.405 85.582  1.00 264.24 ?  50  DG  I OP1   1 
ATOM 8480  O OP2   . DG  I 5 124 ? 107.319 135.584 87.290  1.00 264.24 -1 50  DG  I OP2   1 
ATOM 8481  O "O5'" . DG  I 5 124 ? 109.080 136.836 86.077  1.00 264.24 ?  50  DG  I "O5'" 1 
ATOM 8482  C "C5'" . DG  I 5 124 ? 110.176 136.873 85.192  1.00 264.24 ?  50  DG  I "C5'" 1 
ATOM 8483  C "C4'" . DG  I 5 124 ? 110.359 138.261 84.618  1.00 264.24 ?  50  DG  I "C4'" 1 
ATOM 8484  O "O4'" . DG  I 5 124 ? 109.074 138.917 84.518  1.00 264.24 ?  50  DG  I "O4'" 1 
ATOM 8485  C "C3'" . DG  I 5 124 ? 111.256 139.182 85.433  1.00 264.24 ?  50  DG  I "C3'" 1 
ATOM 8486  O "O3'" . DG  I 5 124 ? 112.138 139.851 84.572  1.00 264.24 ?  50  DG  I "O3'" 1 
ATOM 8487  C "C2'" . DG  I 5 124 ? 110.280 140.148 86.102  1.00 264.24 ?  50  DG  I "C2'" 1 
ATOM 8488  C "C1'" . DG  I 5 124 ? 109.126 140.187 85.117  1.00 264.24 ?  50  DG  I "C1'" 1 
ATOM 8489  N N9    . DG  I 5 124 ? 107.844 140.412 85.760  1.00 264.24 ?  50  DG  I N9    1 
ATOM 8490  C C8    . DG  I 5 124 ? 107.399 139.837 86.919  1.00 264.24 ?  50  DG  I C8    1 
ATOM 8491  N N7    . DG  I 5 124 ? 106.200 140.210 87.256  1.00 264.24 ?  50  DG  I N7    1 
ATOM 8492  C C5    . DG  I 5 124 ? 105.823 141.084 86.251  1.00 264.24 ?  50  DG  I C5    1 
ATOM 8493  C C6    . DG  I 5 124 ? 104.623 141.800 86.080  1.00 264.24 ?  50  DG  I C6    1 
ATOM 8494  O O6    . DG  I 5 124 ? 103.628 141.810 86.810  1.00 264.24 ?  50  DG  I O6    1 
ATOM 8495  N N1    . DG  I 5 124 ? 104.648 142.575 84.932  1.00 264.24 ?  50  DG  I N1    1 
ATOM 8496  C C2    . DG  I 5 124 ? 105.701 142.647 84.060  1.00 264.24 ?  50  DG  I C2    1 
ATOM 8497  N N2    . DG  I 5 124 ? 105.540 143.452 83.005  1.00 264.24 ?  50  DG  I N2    1 
ATOM 8498  N N3    . DG  I 5 124 ? 106.834 141.977 84.207  1.00 264.24 ?  50  DG  I N3    1 
ATOM 8499  C C4    . DG  I 5 124 ? 106.822 141.217 85.320  1.00 264.24 ?  50  DG  I C4    1 
ATOM 8500  P P     . DC  I 5 125 ? 113.469 140.538 85.145  1.00 276.70 ?  51  DC  I P     1 
ATOM 8501  O OP1   . DC  I 5 125 ? 114.609 139.661 84.808  1.00 276.70 ?  51  DC  I OP1   1 
ATOM 8502  O OP2   . DC  I 5 125 ? 113.229 140.925 86.551  1.00 276.70 -1 51  DC  I OP2   1 
ATOM 8503  O "O5'" . DC  I 5 125 ? 113.568 141.876 84.287  1.00 276.70 ?  51  DC  I "O5'" 1 
ATOM 8504  C "C5'" . DC  I 5 125 ? 112.378 142.465 83.782  1.00 276.70 ?  51  DC  I "C5'" 1 
ATOM 8505  C "C4'" . DC  I 5 125 ? 112.234 143.882 84.288  1.00 276.70 ?  51  DC  I "C4'" 1 
ATOM 8506  O "O4'" . DC  I 5 125 ? 110.842 144.162 84.564  1.00 276.70 ?  51  DC  I "O4'" 1 
ATOM 8507  C "C3'" . DC  I 5 125 ? 112.995 144.173 85.580  1.00 276.70 ?  51  DC  I "C3'" 1 
ATOM 8508  O "O3'" . DC  I 5 125 ? 113.801 145.313 85.405  1.00 276.70 ?  51  DC  I "O3'" 1 
ATOM 8509  C "C2'" . DC  I 5 125 ? 111.893 144.406 86.616  1.00 276.70 ?  51  DC  I "C2'" 1 
ATOM 8510  C "C1'" . DC  I 5 125 ? 110.753 144.904 85.749  1.00 276.70 ?  51  DC  I "C1'" 1 
ATOM 8511  N N1    . DC  I 5 125 ? 109.407 144.682 86.340  1.00 276.70 ?  51  DC  I N1    1 
ATOM 8512  C C2    . DC  I 5 125 ? 108.387 145.596 86.086  1.00 276.70 ?  51  DC  I C2    1 
ATOM 8513  O O2    . DC  I 5 125 ? 108.622 146.575 85.376  1.00 276.70 ?  51  DC  I O2    1 
ATOM 8514  N N3    . DC  I 5 125 ? 107.166 145.386 86.625  1.00 276.70 ?  51  DC  I N3    1 
ATOM 8515  C C4    . DC  I 5 125 ? 106.950 144.319 87.382  1.00 276.70 ?  51  DC  I C4    1 
ATOM 8516  N N4    . DC  I 5 125 ? 105.731 144.158 87.896  1.00 276.70 ?  51  DC  I N4    1 
ATOM 8517  C C5    . DC  I 5 125 ? 107.979 143.374 87.660  1.00 276.70 ?  51  DC  I C5    1 
ATOM 8518  C C6    . DC  I 5 125 ? 109.179 143.590 87.117  1.00 276.70 ?  51  DC  I C6    1 
ATOM 8519  P P     . DC  I 5 126 ? 115.330 145.300 85.893  1.00 283.14 ?  52  DC  I P     1 
ATOM 8520  O OP1   . DC  I 5 126 ? 116.183 145.239 84.687  1.00 283.14 ?  52  DC  I OP1   1 
ATOM 8521  O OP2   . DC  I 5 126 ? 115.450 144.264 86.941  1.00 283.14 -1 52  DC  I OP2   1 
ATOM 8522  O "O5'" . DC  I 5 126 ? 115.531 146.723 86.592  1.00 283.14 ?  52  DC  I "O5'" 1 
ATOM 8523  C "C5'" . DC  I 5 126 ? 114.568 147.201 87.516  1.00 283.14 ?  52  DC  I "C5'" 1 
ATOM 8524  C "C4'" . DC  I 5 126 ? 113.654 148.208 86.851  1.00 283.14 ?  52  DC  I "C4'" 1 
ATOM 8525  O "O4'" . DC  I 5 126 ? 112.291 147.706 86.842  1.00 283.14 ?  52  DC  I "O4'" 1 
ATOM 8526  C "C3'" . DC  I 5 126 ? 113.590 149.565 87.522  1.00 283.14 ?  52  DC  I "C3'" 1 
ATOM 8527  O "O3'" . DC  I 5 126 ? 113.380 150.541 86.531  1.00 283.14 ?  52  DC  I "O3'" 1 
ATOM 8528  C "C2'" . DC  I 5 126 ? 112.371 149.420 88.424  1.00 283.14 ?  52  DC  I "C2'" 1 
ATOM 8529  C "C1'" . DC  I 5 126 ? 111.451 148.608 87.528  1.00 283.14 ?  52  DC  I "C1'" 1 
ATOM 8530  N N1    . DC  I 5 126 ? 110.428 147.823 88.266  1.00 283.14 ?  52  DC  I N1    1 
ATOM 8531  C C2    . DC  I 5 126 ? 109.077 148.142 88.122  1.00 283.14 ?  52  DC  I C2    1 
ATOM 8532  O O2    . DC  I 5 126 ? 108.755 149.076 87.383  1.00 283.14 ?  52  DC  I O2    1 
ATOM 8533  N N3    . DC  I 5 126 ? 108.155 147.411 88.793  1.00 283.14 ?  52  DC  I N3    1 
ATOM 8534  C C4    . DC  I 5 126 ? 108.544 146.405 89.574  1.00 283.14 ?  52  DC  I C4    1 
ATOM 8535  N N4    . DC  I 5 126 ? 107.600 145.718 90.222  1.00 283.14 ?  52  DC  I N4    1 
ATOM 8536  C C5    . DC  I 5 126 ? 109.917 146.067 89.737  1.00 283.14 ?  52  DC  I C5    1 
ATOM 8537  C C6    . DC  I 5 126 ? 110.816 146.795 89.070  1.00 283.14 ?  52  DC  I C6    1 
ATOM 8538  P P     . DT  I 5 127 ? 113.958 152.025 86.708  1.00 276.93 ?  53  DT  I P     1 
ATOM 8539  O OP1   . DT  I 5 127 ? 114.946 152.263 85.633  1.00 276.93 ?  53  DT  I OP1   1 
ATOM 8540  O OP2   . DT  I 5 127 ? 114.346 152.199 88.125  1.00 276.93 -1 53  DT  I OP2   1 
ATOM 8541  O "O5'" . DT  I 5 127 ? 112.672 152.937 86.452  1.00 276.93 ?  53  DT  I "O5'" 1 
ATOM 8542  C "C5'" . DT  I 5 127 ? 111.380 152.332 86.405  1.00 276.93 ?  53  DT  I "C5'" 1 
ATOM 8543  C "C4'" . DT  I 5 127 ? 110.532 152.794 87.571  1.00 276.93 ?  53  DT  I "C4'" 1 
ATOM 8544  O "O4'" . DT  I 5 127 ? 109.854 151.680 88.167  1.00 276.93 ?  53  DT  I "O4'" 1 
ATOM 8545  C "C3'" . DT  I 5 127 ? 111.306 153.421 88.719  1.00 276.93 ?  53  DT  I "C3'" 1 
ATOM 8546  O "O3'" . DT  I 5 127 ? 111.322 154.822 88.554  1.00 276.93 ?  53  DT  I "O3'" 1 
ATOM 8547  C "C2'" . DT  I 5 127 ? 110.527 152.989 89.977  1.00 276.93 ?  53  DT  I "C2'" 1 
ATOM 8548  C "C1'" . DT  I 5 127 ? 109.407 152.114 89.421  1.00 276.93 ?  53  DT  I "C1'" 1 
ATOM 8549  N N1    . DT  I 5 127 ? 109.084 150.933 90.272  1.00 276.93 ?  53  DT  I N1    1 
ATOM 8550  C C2    . DT  I 5 127 ? 107.793 150.463 90.303  1.00 276.93 ?  53  DT  I C2    1 
ATOM 8551  O O2    . DT  I 5 127 ? 106.892 150.952 89.651  1.00 276.93 ?  53  DT  I O2    1 
ATOM 8552  N N3    . DT  I 5 127 ? 107.595 149.387 91.120  1.00 276.93 ?  53  DT  I N3    1 
ATOM 8553  C C4    . DT  I 5 127 ? 108.536 148.753 91.904  1.00 276.93 ?  53  DT  I C4    1 
ATOM 8554  O O4    . DT  I 5 127 ? 108.259 147.788 92.606  1.00 276.93 ?  53  DT  I O4    1 
ATOM 8555  C C5    . DT  I 5 127 ? 109.870 149.298 91.829  1.00 276.93 ?  53  DT  I C5    1 
ATOM 8556  C C7    . DT  I 5 127 ? 110.980 148.687 92.631  1.00 276.93 ?  53  DT  I C7    1 
ATOM 8557  C C6    . DT  I 5 127 ? 110.076 150.353 91.032  1.00 276.93 ?  53  DT  I C6    1 
ATOM 8558  P P     . DT  I 5 128 ? 111.874 155.781 89.714  1.00 264.86 ?  54  DT  I P     1 
ATOM 8559  O OP1   . DT  I 5 128 ? 112.473 156.962 89.056  1.00 264.86 ?  54  DT  I OP1   1 
ATOM 8560  O OP2   . DT  I 5 128 ? 112.694 154.976 90.643  1.00 264.86 -1 54  DT  I OP2   1 
ATOM 8561  O "O5'" . DT  I 5 128 ? 110.543 156.238 90.461  1.00 264.86 ?  54  DT  I "O5'" 1 
ATOM 8562  C "C5'" . DT  I 5 128 ? 109.368 156.468 89.703  1.00 264.86 ?  54  DT  I "C5'" 1 
ATOM 8563  C "C4'" . DT  I 5 128 ? 108.139 156.304 90.563  1.00 264.86 ?  54  DT  I "C4'" 1 
ATOM 8564  O "O4'" . DT  I 5 128 ? 108.050 154.938 91.036  1.00 264.86 ?  54  DT  I "O4'" 1 
ATOM 8565  C "C3'" . DT  I 5 128 ? 108.117 157.191 91.807  1.00 264.86 ?  54  DT  I "C3'" 1 
ATOM 8566  O "O3'" . DT  I 5 128 ? 106.934 157.957 91.820  1.00 264.86 ?  54  DT  I "O3'" 1 
ATOM 8567  C "C2'" . DT  I 5 128 ? 108.166 156.197 92.972  1.00 264.86 ?  54  DT  I "C2'" 1 
ATOM 8568  C "C1'" . DT  I 5 128 ? 107.557 154.957 92.348  1.00 264.86 ?  54  DT  I "C1'" 1 
ATOM 8569  N N1    . DT  I 5 128 ? 107.946 153.686 93.030  1.00 264.86 ?  54  DT  I N1    1 
ATOM 8570  C C2    . DT  I 5 128 ? 106.969 152.794 93.399  1.00 264.86 ?  54  DT  I C2    1 
ATOM 8571  O O2    . DT  I 5 128 ? 105.786 152.980 93.194  1.00 264.86 ?  54  DT  I O2    1 
ATOM 8572  N N3    . DT  I 5 128 ? 107.429 151.665 94.017  1.00 264.86 ?  54  DT  I N3    1 
ATOM 8573  C C4    . DT  I 5 128 ? 108.740 151.345 94.299  1.00 264.86 ?  54  DT  I C4    1 
ATOM 8574  O O4    . DT  I 5 128 ? 109.053 150.304 94.861  1.00 264.86 ?  54  DT  I O4    1 
ATOM 8575  C C5    . DT  I 5 128 ? 109.714 152.324 93.890  1.00 264.86 ?  54  DT  I C5    1 
ATOM 8576  C C7    . DT  I 5 128 ? 111.172 152.090 94.144  1.00 264.86 ?  54  DT  I C7    1 
ATOM 8577  C C6    . DT  I 5 128 ? 109.274 153.434 93.282  1.00 264.86 ?  54  DT  I C6    1 
ATOM 8578  P P     . DT  I 5 129 ? 106.660 158.994 93.012  1.00 251.55 ?  55  DT  I P     1 
ATOM 8579  O OP1   . DT  I 5 129 ? 105.894 160.130 92.456  1.00 251.55 ?  55  DT  I OP1   1 
ATOM 8580  O OP2   . DT  I 5 129 ? 107.947 159.228 93.700  1.00 251.55 -1 55  DT  I OP2   1 
ATOM 8581  O "O5'" . DT  I 5 129 ? 105.713 158.178 94.003  1.00 251.55 ?  55  DT  I "O5'" 1 
ATOM 8582  C "C5'" . DT  I 5 129 ? 104.672 157.377 93.473  1.00 251.55 ?  55  DT  I "C5'" 1 
ATOM 8583  C "C4'" . DT  I 5 129 ? 104.124 156.454 94.536  1.00 251.55 ?  55  DT  I "C4'" 1 
ATOM 8584  O "O4'" . DT  I 5 129 ? 105.057 155.372 94.770  1.00 251.55 ?  55  DT  I "O4'" 1 
ATOM 8585  C "C3'" . DT  I 5 129 ? 103.894 157.119 95.892  1.00 251.55 ?  55  DT  I "C3'" 1 
ATOM 8586  O "O3'" . DT  I 5 129 ? 102.544 156.987 96.264  1.00 251.55 ?  55  DT  I "O3'" 1 
ATOM 8587  C "C2'" . DT  I 5 129 ? 104.826 156.364 96.850  1.00 251.55 ?  55  DT  I "C2'" 1 
ATOM 8588  C "C1'" . DT  I 5 129 ? 105.024 155.043 96.131  1.00 251.55 ?  55  DT  I "C1'" 1 
ATOM 8589  N N1    . DT  I 5 129 ? 106.297 154.354 96.488  1.00 251.55 ?  55  DT  I N1    1 
ATOM 8590  C C2    . DT  I 5 129 ? 106.251 153.093 97.029  1.00 251.55 ?  55  DT  I C2    1 
ATOM 8591  O O2    . DT  I 5 129 ? 105.214 152.493 97.233  1.00 251.55 ?  55  DT  I O2    1 
ATOM 8592  N N3    . DT  I 5 129 ? 107.470 152.551 97.322  1.00 251.55 ?  55  DT  I N3    1 
ATOM 8593  C C4    . DT  I 5 129 ? 108.705 153.133 97.134  1.00 251.55 ?  55  DT  I C4    1 
ATOM 8594  O O4    . DT  I 5 129 ? 109.748 152.564 97.433  1.00 251.55 ?  55  DT  I O4    1 
ATOM 8595  C C5    . DT  I 5 129 ? 108.683 154.458 96.568  1.00 251.55 ?  55  DT  I C5    1 
ATOM 8596  C C7    . DT  I 5 129 ? 109.964 155.197 96.324  1.00 251.55 ?  55  DT  I C7    1 
ATOM 8597  C C6    . DT  I 5 129 ? 107.494 154.996 96.275  1.00 251.55 ?  55  DT  I C6    1 
ATOM 8598  P P     . DT  I 5 130 ? 102.023 157.637 97.634  1.00 241.02 ?  56  DT  I P     1 
ATOM 8599  O OP1   . DT  I 5 130 ? 100.638 158.103 97.417  1.00 241.02 ?  56  DT  I OP1   1 
ATOM 8600  O OP2   . DT  I 5 130 ? 103.057 158.581 98.107  1.00 241.02 -1 56  DT  I OP2   1 
ATOM 8601  O "O5'" . DT  I 5 130 ? 102.002 156.403 98.640  1.00 241.02 ?  56  DT  I "O5'" 1 
ATOM 8602  C "C5'" . DT  I 5 130 ? 101.594 155.137 98.171  1.00 241.02 ?  56  DT  I "C5'" 1 
ATOM 8603  C "C4'" . DT  I 5 130 ? 101.880 154.071 99.201  1.00 241.02 ?  56  DT  I "C4'" 1 
ATOM 8604  O "O4'" . DT  I 5 130 ? 103.263 153.653 99.107  1.00 241.02 ?  56  DT  I "O4'" 1 
ATOM 8605  C "C3'" . DT  I 5 130 ? 101.666 154.505 100.651 1.00 241.02 ?  56  DT  I "C3'" 1 
ATOM 8606  O "O3'" . DT  I 5 130 ? 100.872 153.549 101.311 1.00 241.02 ?  56  DT  I "O3'" 1 
ATOM 8607  C "C2'" . DT  I 5 130 ? 103.082 154.544 101.223 1.00 241.02 ?  56  DT  I "C2'" 1 
ATOM 8608  C "C1'" . DT  I 5 130 ? 103.745 153.457 100.405 1.00 241.02 ?  56  DT  I "C1'" 1 
ATOM 8609  N N1    . DT  I 5 130 ? 105.220 153.530 100.381 1.00 241.02 ?  56  DT  I N1    1 
ATOM 8610  C C2    . DT  I 5 130 ? 105.944 152.408 100.681 1.00 241.02 ?  56  DT  I C2    1 
ATOM 8611  O O2    . DT  I 5 130 ? 105.432 151.345 100.971 1.00 241.02 ?  56  DT  I O2    1 
ATOM 8612  N N3    . DT  I 5 130 ? 107.296 152.567 100.633 1.00 241.02 ?  56  DT  I N3    1 
ATOM 8613  C C4    . DT  I 5 130 ? 107.984 153.716 100.320 1.00 241.02 ?  56  DT  I C4    1 
ATOM 8614  O O4    . DT  I 5 130 ? 109.208 153.759 100.302 1.00 241.02 ?  56  DT  I O4    1 
ATOM 8615  C C5    . DT  I 5 130 ? 107.167 154.861 100.012 1.00 241.02 ?  56  DT  I C5    1 
ATOM 8616  C C7    . DT  I 5 130 ? 107.808 156.170 99.660  1.00 241.02 ?  56  DT  I C7    1 
ATOM 8617  C C6    . DT  I 5 130 ? 105.836 154.714 100.057 1.00 241.02 ?  56  DT  I C6    1 
ATOM 8618  P P     . DA  I 5 131 ? 100.169 153.911 102.705 1.00 238.06 ?  57  DA  I P     1 
ATOM 8619  O OP1   . DA  I 5 131 ? 98.716  153.683 102.553 1.00 238.06 ?  57  DA  I OP1   1 
ATOM 8620  O OP2   . DA  I 5 131 ? 100.676 155.239 103.111 1.00 238.06 -1 57  DA  I OP2   1 
ATOM 8621  O "O5'" . DA  I 5 131 ? 100.759 152.828 103.716 1.00 238.06 ?  57  DA  I "O5'" 1 
ATOM 8622  C "C5'" . DA  I 5 131 ? 100.567 151.447 103.464 1.00 238.06 ?  57  DA  I "C5'" 1 
ATOM 8623  C "C4'" . DA  I 5 131 ? 101.518 150.606 104.291 1.00 238.06 ?  57  DA  I "C4'" 1 
ATOM 8624  O "O4'" . DA  I 5 131 ? 102.877 150.816 103.835 1.00 238.06 ?  57  DA  I "O4'" 1 
ATOM 8625  C "C3'" . DA  I 5 131 ? 101.519 150.912 105.788 1.00 238.06 ?  57  DA  I "C3'" 1 
ATOM 8626  O "O3'" . DA  I 5 131 ? 101.551 149.702 106.524 1.00 238.06 ?  57  DA  I "O3'" 1 
ATOM 8627  C "C2'" . DA  I 5 131 ? 102.805 151.712 105.978 1.00 238.06 ?  57  DA  I "C2'" 1 
ATOM 8628  C "C1'" . DA  I 5 131 ? 103.705 151.073 104.942 1.00 238.06 ?  57  DA  I "C1'" 1 
ATOM 8629  N N9    . DA  I 5 131 ? 104.797 151.929 104.503 1.00 238.06 ?  57  DA  I N9    1 
ATOM 8630  C C8    . DA  I 5 131 ? 104.704 153.199 104.016 1.00 238.06 ?  57  DA  I C8    1 
ATOM 8631  N N7    . DA  I 5 131 ? 105.859 153.721 103.681 1.00 238.06 ?  57  DA  I N7    1 
ATOM 8632  C C5    . DA  I 5 131 ? 106.769 152.722 103.967 1.00 238.06 ?  57  DA  I C5    1 
ATOM 8633  C C6    . DA  I 5 131 ? 108.168 152.644 103.840 1.00 238.06 ?  57  DA  I C6    1 
ATOM 8634  N N6    . DA  I 5 131 ? 108.919 153.640 103.371 1.00 238.06 ?  57  DA  I N6    1 
ATOM 8635  N N1    . DA  I 5 131 ? 108.769 151.497 104.215 1.00 238.06 ?  57  DA  I N1    1 
ATOM 8636  C C2    . DA  I 5 131 ? 108.015 150.500 104.688 1.00 238.06 ?  57  DA  I C2    1 
ATOM 8637  N N3    . DA  I 5 131 ? 106.695 150.458 104.856 1.00 238.06 ?  57  DA  I N3    1 
ATOM 8638  C C4    . DA  I 5 131 ? 106.129 151.610 104.472 1.00 238.06 ?  57  DA  I C4    1 
ATOM 8639  P P     . DT  I 5 132 ? 100.191 149.074 107.100 1.00 245.60 ?  58  DT  I P     1 
ATOM 8640  O OP1   . DT  I 5 132 ? 99.371  148.633 105.953 1.00 245.60 ?  58  DT  I OP1   1 
ATOM 8641  O OP2   . DT  I 5 132 ? 99.630  150.052 108.057 1.00 245.60 -1 58  DT  I OP2   1 
ATOM 8642  O "O5'" . DT  I 5 132 ? 100.677 147.785 107.917 1.00 245.60 ?  58  DT  I "O5'" 1 
ATOM 8643  C "C5'" . DT  I 5 132 ? 101.512 146.809 107.295 1.00 245.60 ?  58  DT  I "C5'" 1 
ATOM 8644  C "C4'" . DT  I 5 132 ? 102.695 146.490 108.184 1.00 245.60 ?  58  DT  I "C4'" 1 
ATOM 8645  O "O4'" . DT  I 5 132 ? 103.804 147.317 107.781 1.00 245.60 ?  58  DT  I "O4'" 1 
ATOM 8646  C "C3'" . DT  I 5 132 ? 102.447 146.789 109.660 1.00 245.60 ?  58  DT  I "C3'" 1 
ATOM 8647  O "O3'" . DT  I 5 132 ? 102.387 145.588 110.520 1.00 245.60 ?  58  DT  I "O3'" 1 
ATOM 8648  C "C2'" . DT  I 5 132 ? 103.537 147.778 110.075 1.00 245.60 ?  58  DT  I "C2'" 1 
ATOM 8649  C "C1'" . DT  I 5 132 ? 104.516 147.759 108.908 1.00 245.60 ?  58  DT  I "C1'" 1 
ATOM 8650  N N1    . DT  I 5 132 ? 105.096 149.094 108.599 1.00 245.60 ?  58  DT  I N1    1 
ATOM 8651  C C2    . DT  I 5 132 ? 106.267 149.164 107.893 1.00 245.60 ?  58  DT  I C2    1 
ATOM 8652  O O2    . DT  I 5 132 ? 106.867 148.184 107.501 1.00 245.60 ?  58  DT  I O2    1 
ATOM 8653  N N3    . DT  I 5 132 ? 106.717 150.429 107.659 1.00 245.60 ?  58  DT  I N3    1 
ATOM 8654  C C4    . DT  I 5 132 ? 106.123 151.609 108.045 1.00 245.60 ?  58  DT  I C4    1 
ATOM 8655  O O4    . DT  I 5 132 ? 106.609 152.702 107.784 1.00 245.60 ?  58  DT  I O4    1 
ATOM 8656  C C5    . DT  I 5 132 ? 104.897 151.468 108.788 1.00 245.60 ?  58  DT  I C5    1 
ATOM 8657  C C7    . DT  I 5 132 ? 104.159 152.682 109.270 1.00 245.60 ?  58  DT  I C7    1 
ATOM 8658  C C6    . DT  I 5 132 ? 104.447 150.231 109.024 1.00 245.60 ?  58  DT  I C6    1 
ATOM 8659  P P     . DA  I 5 133 ? 103.342 144.289 110.391 1.00 261.40 ?  59  DA  I P     1 
ATOM 8660  O OP1   . DA  I 5 133 ? 102.987 143.460 109.226 1.00 261.40 ?  59  DA  I OP1   1 
ATOM 8661  O OP2   . DA  I 5 133 ? 103.272 143.650 111.720 1.00 261.40 -1 59  DA  I OP2   1 
ATOM 8662  O "O5'" . DA  I 5 133 ? 104.837 144.826 110.268 1.00 261.40 ?  59  DA  I "O5'" 1 
ATOM 8663  C "C5'" . DA  I 5 133 ? 105.903 143.890 110.132 1.00 261.40 ?  59  DA  I "C5'" 1 
ATOM 8664  C "C4'" . DA  I 5 133 ? 107.129 144.309 110.929 1.00 261.40 ?  59  DA  I "C4'" 1 
ATOM 8665  O "O4'" . DA  I 5 133 ? 107.367 145.730 110.760 1.00 261.40 ?  59  DA  I "O4'" 1 
ATOM 8666  C "C3'" . DA  I 5 133 ? 107.047 144.091 112.441 1.00 261.40 ?  59  DA  I "C3'" 1 
ATOM 8667  O "O3'" . DA  I 5 133 ? 108.339 143.821 112.937 1.00 261.40 ?  59  DA  I "O3'" 1 
ATOM 8668  C "C2'" . DA  I 5 133 ? 106.601 145.461 112.921 1.00 261.40 ?  59  DA  I "C2'" 1 
ATOM 8669  C "C1'" . DA  I 5 133 ? 107.484 146.312 112.036 1.00 261.40 ?  59  DA  I "C1'" 1 
ATOM 8670  N N9    . DA  I 5 133 ? 107.099 147.709 111.955 1.00 261.40 ?  59  DA  I N9    1 
ATOM 8671  C C8    . DA  I 5 133 ? 105.973 148.292 112.452 1.00 261.40 ?  59  DA  I C8    1 
ATOM 8672  N N7    . DA  I 5 133 ? 105.898 149.578 112.219 1.00 261.40 ?  59  DA  I N7    1 
ATOM 8673  C C5    . DA  I 5 133 ? 107.063 149.853 111.533 1.00 261.40 ?  59  DA  I C5    1 
ATOM 8674  C C6    . DA  I 5 133 ? 107.596 151.039 111.002 1.00 261.40 ?  59  DA  I C6    1 
ATOM 8675  N N6    . DA  I 5 133 ? 106.988 152.220 111.092 1.00 261.40 ?  59  DA  I N6    1 
ATOM 8676  N N1    . DA  I 5 133 ? 108.785 150.964 110.372 1.00 261.40 ?  59  DA  I N1    1 
ATOM 8677  C C2    . DA  I 5 133 ? 109.397 149.780 110.288 1.00 261.40 ?  59  DA  I C2    1 
ATOM 8678  N N3    . DA  I 5 133 ? 108.995 148.602 110.747 1.00 261.40 ?  59  DA  I N3    1 
ATOM 8679  C C4    . DA  I 5 133 ? 107.813 148.711 111.365 1.00 261.40 ?  59  DA  I C4    1 
ATOM 8680  P P     . DT  I 5 134 ? 108.843 142.322 113.202 1.00 289.26 ?  60  DT  I P     1 
ATOM 8681  O OP1   . DT  I 5 134 ? 108.723 141.551 111.946 1.00 289.26 ?  60  DT  I OP1   1 
ATOM 8682  O OP2   . DT  I 5 134 ? 108.196 141.836 114.438 1.00 289.26 -1 60  DT  I OP2   1 
ATOM 8683  O "O5'" . DT  I 5 134 ? 110.392 142.531 113.507 1.00 289.26 ?  60  DT  I "O5'" 1 
ATOM 8684  C "C5'" . DT  I 5 134 ? 111.115 143.519 112.780 1.00 289.26 ?  60  DT  I "C5'" 1 
ATOM 8685  C "C4'" . DT  I 5 134 ? 111.874 144.442 113.716 1.00 289.26 ?  60  DT  I "C4'" 1 
ATOM 8686  O "O4'" . DT  I 5 134 ? 111.375 145.805 113.587 1.00 289.26 ?  60  DT  I "O4'" 1 
ATOM 8687  C "C3'" . DT  I 5 134 ? 111.757 144.100 115.203 1.00 289.26 ?  60  DT  I "C3'" 1 
ATOM 8688  O "O3'" . DT  I 5 134 ? 112.978 144.398 115.846 1.00 289.26 ?  60  DT  I "O3'" 1 
ATOM 8689  C "C2'" . DT  I 5 134 ? 110.677 145.071 115.657 1.00 289.26 ?  60  DT  I "C2'" 1 
ATOM 8690  C "C1'" . DT  I 5 134 ? 111.116 146.295 114.879 1.00 289.26 ?  60  DT  I "C1'" 1 
ATOM 8691  N N1    . DT  I 5 134 ? 110.106 147.396 114.808 1.00 289.26 ?  60  DT  I N1    1 
ATOM 8692  C C2    . DT  I 5 134 ? 110.465 148.591 114.238 1.00 289.26 ?  60  DT  I C2    1 
ATOM 8693  O O2    . DT  I 5 134 ? 111.566 148.799 113.769 1.00 289.26 ?  60  DT  I O2    1 
ATOM 8694  N N3    . DT  I 5 134 ? 109.482 149.539 114.227 1.00 289.26 ?  60  DT  I N3    1 
ATOM 8695  C C4    . DT  I 5 134 ? 108.203 149.418 114.726 1.00 289.26 ?  60  DT  I C4    1 
ATOM 8696  O O4    . DT  I 5 134 ? 107.391 150.332 114.672 1.00 289.26 ?  60  DT  I O4    1 
ATOM 8697  C C5    . DT  I 5 134 ? 107.890 148.142 115.318 1.00 289.26 ?  60  DT  I C5    1 
ATOM 8698  C C7    . DT  I 5 134 ? 106.529 147.894 115.900 1.00 289.26 ?  60  DT  I C7    1 
ATOM 8699  C C6    . DT  I 5 134 ? 108.847 147.205 115.336 1.00 289.26 ?  60  DT  I C6    1 
ATOM 8700  P P     . DG  I 5 135 ? 114.101 143.274 116.080 1.00 312.04 ?  61  DG  I P     1 
ATOM 8701  O OP1   . DG  I 5 135 ? 114.279 142.493 114.838 1.00 312.04 ?  61  DG  I OP1   1 
ATOM 8702  O OP2   . DG  I 5 135 ? 113.786 142.571 117.343 1.00 312.04 -1 61  DG  I OP2   1 
ATOM 8703  O "O5'" . DG  I 5 135 ? 115.420 144.144 116.307 1.00 312.04 ?  61  DG  I "O5'" 1 
ATOM 8704  C "C5'" . DG  I 5 135 ? 115.702 145.229 115.428 1.00 312.04 ?  61  DG  I "C5'" 1 
ATOM 8705  C "C4'" . DG  I 5 135 ? 115.640 146.557 116.163 1.00 312.04 ?  61  DG  I "C4'" 1 
ATOM 8706  O "O4'" . DG  I 5 135 ? 114.286 147.046 116.187 1.00 312.04 ?  61  DG  I "O4'" 1 
ATOM 8707  C "C3'" . DG  I 5 135 ? 116.087 146.509 117.623 1.00 312.04 ?  61  DG  I "C3'" 1 
ATOM 8708  O "O3'" . DG  I 5 135 ? 117.343 147.143 117.759 1.00 312.04 ?  61  DG  I "O3'" 1 
ATOM 8709  C "C2'" . DG  I 5 135 ? 114.986 147.258 118.394 1.00 312.04 ?  61  DG  I "C2'" 1 
ATOM 8710  C "C1'" . DG  I 5 135 ? 114.156 147.896 117.290 1.00 312.04 ?  61  DG  I "C1'" 1 
ATOM 8711  N N9    . DG  I 5 135 ? 112.745 148.004 117.628 1.00 312.04 ?  61  DG  I N9    1 
ATOM 8712  C C8    . DG  I 5 135 ? 111.978 147.062 118.262 1.00 312.04 ?  61  DG  I C8    1 
ATOM 8713  N N7    . DG  I 5 135 ? 110.742 147.431 118.436 1.00 312.04 ?  61  DG  I N7    1 
ATOM 8714  C C5    . DG  I 5 135 ? 110.688 148.701 117.886 1.00 312.04 ?  61  DG  I C5    1 
ATOM 8715  C C6    . DG  I 5 135 ? 109.607 149.600 117.786 1.00 312.04 ?  61  DG  I C6    1 
ATOM 8716  O O6    . DG  I 5 135 ? 108.444 149.446 118.175 1.00 312.04 ?  61  DG  I O6    1 
ATOM 8717  N N1    . DG  I 5 135 ? 109.977 150.781 117.158 1.00 312.04 ?  61  DG  I N1    1 
ATOM 8718  C C2    . DG  I 5 135 ? 111.236 151.058 116.689 1.00 312.04 ?  61  DG  I C2    1 
ATOM 8719  N N2    . DG  I 5 135 ? 111.404 152.254 116.114 1.00 312.04 ?  61  DG  I N2    1 
ATOM 8720  N N3    . DG  I 5 135 ? 112.260 150.223 116.777 1.00 312.04 ?  61  DG  I N3    1 
ATOM 8721  C C4    . DG  I 5 135 ? 111.914 149.069 117.386 1.00 312.04 ?  61  DG  I C4    1 
ATOM 8722  P P     . DA  I 5 136 ? 118.045 147.244 119.199 1.00 325.63 ?  62  DA  I P     1 
ATOM 8723  O OP1   . DA  I 5 136 ? 119.509 147.209 118.996 1.00 325.63 ?  62  DA  I OP1   1 
ATOM 8724  O OP2   . DA  I 5 136 ? 117.403 146.243 120.078 1.00 325.63 -1 62  DA  I OP2   1 
ATOM 8725  O "O5'" . DA  I 5 136 ? 117.633 148.697 119.716 1.00 325.63 ?  62  DA  I "O5'" 1 
ATOM 8726  C "C5'" . DA  I 5 136 ? 117.656 149.799 118.819 1.00 325.63 ?  62  DA  I "C5'" 1 
ATOM 8727  C "C4'" . DA  I 5 136 ? 117.073 151.032 119.478 1.00 325.63 ?  62  DA  I "C4'" 1 
ATOM 8728  O "O4'" . DA  I 5 136 ? 115.638 151.028 119.340 1.00 325.63 ?  62  DA  I "O4'" 1 
ATOM 8729  C "C3'" . DA  I 5 136 ? 117.347 151.136 120.979 1.00 325.63 ?  62  DA  I "C3'" 1 
ATOM 8730  O "O3'" . DA  I 5 136 ? 118.241 152.202 121.239 1.00 325.63 ?  62  DA  I "O3'" 1 
ATOM 8731  C "C2'" . DA  I 5 136 ? 115.969 151.385 121.611 1.00 325.63 ?  62  DA  I "C2'" 1 
ATOM 8732  C "C1'" . DA  I 5 136 ? 115.096 151.737 120.417 1.00 325.63 ?  62  DA  I "C1'" 1 
ATOM 8733  N N9    . DA  I 5 136 ? 113.702 151.339 120.584 1.00 325.63 ?  62  DA  I N9    1 
ATOM 8734  C C8    . DA  I 5 136 ? 113.241 150.188 121.156 1.00 325.63 ?  62  DA  I C8    1 
ATOM 8735  N N7    . DA  I 5 136 ? 111.934 150.094 121.176 1.00 325.63 ?  62  DA  I N7    1 
ATOM 8736  C C5    . DA  I 5 136 ? 111.507 151.262 120.573 1.00 325.63 ?  62  DA  I C5    1 
ATOM 8737  C C6    . DA  I 5 136 ? 110.226 151.769 120.292 1.00 325.63 ?  62  DA  I C6    1 
ATOM 8738  N N6    . DA  I 5 136 ? 109.099 151.122 120.597 1.00 325.63 ?  62  DA  I N6    1 
ATOM 8739  N N1    . DA  I 5 136 ? 110.147 152.972 119.684 1.00 325.63 ?  62  DA  I N1    1 
ATOM 8740  C C2    . DA  I 5 136 ? 111.279 153.619 119.381 1.00 325.63 ?  62  DA  I C2    1 
ATOM 8741  N N3    . DA  I 5 136 ? 112.540 153.242 119.598 1.00 325.63 ?  62  DA  I N3    1 
ATOM 8742  C C4    . DA  I 5 136 ? 112.584 152.045 120.204 1.00 325.63 ?  62  DA  I C4    1 
ATOM 8743  P P     . DA  I 5 137 ? 118.765 152.461 122.734 1.00 345.27 ?  63  DA  I P     1 
ATOM 8744  O OP1   . DA  I 5 137 ? 120.134 153.011 122.642 1.00 345.27 ?  63  DA  I OP1   1 
ATOM 8745  O OP2   . DA  I 5 137 ? 118.510 151.229 123.512 1.00 345.27 -1 63  DA  I OP2   1 
ATOM 8746  O "O5'" . DA  I 5 137 ? 117.785 153.596 123.283 1.00 345.27 ?  63  DA  I "O5'" 1 
ATOM 8747  C "C5'" . DA  I 5 137 ? 117.510 154.724 122.478 1.00 345.27 ?  63  DA  I "C5'" 1 
ATOM 8748  C "C4'" . DA  I 5 137 ? 116.211 155.386 122.891 1.00 345.27 ?  63  DA  I "C4'" 1 
ATOM 8749  O "O4'" . DA  I 5 137 ? 115.097 154.480 122.686 1.00 345.27 ?  63  DA  I "O4'" 1 
ATOM 8750  C "C3'" . DA  I 5 137 ? 116.138 155.828 124.354 1.00 345.27 ?  63  DA  I "C3'" 1 
ATOM 8751  O "O3'" . DA  I 5 137 ? 115.722 157.184 124.400 1.00 345.27 ?  63  DA  I "O3'" 1 
ATOM 8752  C "C2'" . DA  I 5 137 ? 115.086 154.887 124.956 1.00 345.27 ?  63  DA  I "C2'" 1 
ATOM 8753  C "C1'" . DA  I 5 137 ? 114.201 154.634 123.754 1.00 345.27 ?  63  DA  I "C1'" 1 
ATOM 8754  N N9    . DA  I 5 137 ? 113.384 153.430 123.858 1.00 345.27 ?  63  DA  I N9    1 
ATOM 8755  C C8    . DA  I 5 137 ? 113.805 152.174 124.189 1.00 345.27 ?  63  DA  I C8    1 
ATOM 8756  N N7    . DA  I 5 137 ? 112.847 151.278 124.196 1.00 345.27 ?  63  DA  I N7    1 
ATOM 8757  C C5    . DA  I 5 137 ? 111.720 151.996 123.844 1.00 345.27 ?  63  DA  I C5    1 
ATOM 8758  C C6    . DA  I 5 137 ? 110.373 151.624 123.676 1.00 345.27 ?  63  DA  I C6    1 
ATOM 8759  N N6    . DA  I 5 137 ? 109.931 150.377 123.846 1.00 345.27 ?  63  DA  I N6    1 
ATOM 8760  N N1    . DA  I 5 137 ? 109.497 152.587 123.319 1.00 345.27 ?  63  DA  I N1    1 
ATOM 8761  C C2    . DA  I 5 137 ? 109.946 153.837 123.145 1.00 345.27 ?  63  DA  I C2    1 
ATOM 8762  N N3    . DA  I 5 137 ? 111.187 154.305 123.277 1.00 345.27 ?  63  DA  I N3    1 
ATOM 8763  C C4    . DA  I 5 137 ? 112.033 153.325 123.631 1.00 345.27 ?  63  DA  I C4    1 
ATOM 8764  P P     . DC  I 5 138 ? 115.726 158.014 125.776 1.00 363.98 ?  64  DC  I P     1 
ATOM 8765  O OP1   . DC  I 5 138 ? 116.692 159.122 125.622 1.00 363.98 ?  64  DC  I OP1   1 
ATOM 8766  O OP2   . DC  I 5 138 ? 115.874 157.077 126.910 1.00 363.98 -1 64  DC  I OP2   1 
ATOM 8767  O "O5'" . DC  I 5 138 ? 114.254 158.634 125.827 1.00 363.98 ?  64  DC  I "O5'" 1 
ATOM 8768  C "C5'" . DC  I 5 138 ? 113.203 158.029 125.071 1.00 363.98 ?  64  DC  I "C5'" 1 
ATOM 8769  C "C4'" . DC  I 5 138 ? 112.085 157.572 125.985 1.00 363.98 ?  64  DC  I "C4'" 1 
ATOM 8770  O "O4'" . DC  I 5 138 ? 111.718 156.216 125.689 1.00 363.98 ?  64  DC  I "O4'" 1 
ATOM 8771  C "C3'" . DC  I 5 138 ? 112.448 157.523 127.450 1.00 363.98 ?  64  DC  I "C3'" 1 
ATOM 8772  O "O3'" . DC  I 5 138 ? 112.289 158.800 128.019 1.00 363.98 ?  64  DC  I "O3'" 1 
ATOM 8773  C "C2'" . DC  I 5 138 ? 111.442 156.515 128.021 1.00 363.98 ?  64  DC  I "C2'" 1 
ATOM 8774  C "C1'" . DC  I 5 138 ? 110.967 155.740 126.784 1.00 363.98 ?  64  DC  I "C1'" 1 
ATOM 8775  N N1    . DC  I 5 138 ? 111.146 154.273 126.904 1.00 363.98 ?  64  DC  I N1    1 
ATOM 8776  C C2    . DC  I 5 138 ? 110.043 153.433 126.739 1.00 363.98 ?  64  DC  I C2    1 
ATOM 8777  O O2    . DC  I 5 138 ? 108.944 153.930 126.478 1.00 363.98 ?  64  DC  I O2    1 
ATOM 8778  N N3    . DC  I 5 138 ? 110.212 152.097 126.860 1.00 363.98 ?  64  DC  I N3    1 
ATOM 8779  C C4    . DC  I 5 138 ? 111.414 151.602 127.141 1.00 363.98 ?  64  DC  I C4    1 
ATOM 8780  N N4    . DC  I 5 138 ? 111.532 150.276 127.251 1.00 363.98 ?  64  DC  I N4    1 
ATOM 8781  C C5    . DC  I 5 138 ? 112.550 152.443 127.325 1.00 363.98 ?  64  DC  I C5    1 
ATOM 8782  C C6    . DC  I 5 138 ? 112.371 153.760 127.198 1.00 363.98 ?  64  DC  I C6    1 
ATOM 8783  P P     . DT  I 5 139 ? 112.670 159.041 129.556 1.00 380.27 ?  65  DT  I P     1 
ATOM 8784  O OP1   . DT  I 5 139 ? 113.209 160.413 129.678 1.00 380.27 ?  65  DT  I OP1   1 
ATOM 8785  O OP2   . DT  I 5 139 ? 113.479 157.885 129.998 1.00 380.27 -1 65  DT  I OP2   1 
ATOM 8786  O "O5'" . DT  I 5 139 ? 111.263 158.965 130.298 1.00 380.27 ?  65  DT  I "O5'" 1 
ATOM 8787  C "C5'" . DT  I 5 139 ? 110.115 159.513 129.674 1.00 380.27 ?  65  DT  I "C5'" 1 
ATOM 8788  C "C4'" . DT  I 5 139 ? 108.851 158.849 130.183 1.00 380.27 ?  65  DT  I "C4'" 1 
ATOM 8789  O "O4'" . DT  I 5 139 ? 108.755 157.485 129.679 1.00 380.27 ?  65  DT  I "O4'" 1 
ATOM 8790  C "C3'" . DT  I 5 139 ? 108.744 158.738 131.707 1.00 380.27 ?  65  DT  I "C3'" 1 
ATOM 8791  O "O3'" . DT  I 5 139 ? 107.436 159.078 132.100 1.00 380.27 ?  65  DT  I "O3'" 1 
ATOM 8792  C "C2'" . DT  I 5 139 ? 109.021 157.260 131.952 1.00 380.27 ?  65  DT  I "C2'" 1 
ATOM 8793  C "C1'" . DT  I 5 139 ? 108.339 156.665 130.740 1.00 380.27 ?  65  DT  I "C1'" 1 
ATOM 8794  N N1    . DT  I 5 139 ? 108.710 155.247 130.463 1.00 380.27 ?  65  DT  I N1    1 
ATOM 8795  C C2    . DT  I 5 139 ? 107.774 154.412 129.902 1.00 380.27 ?  65  DT  I C2    1 
ATOM 8796  O O2    . DT  I 5 139 ? 106.653 154.776 129.599 1.00 380.27 ?  65  DT  I O2    1 
ATOM 8797  N N3    . DT  I 5 139 ? 108.202 153.128 129.696 1.00 380.27 ?  65  DT  I N3    1 
ATOM 8798  C C4    . DT  I 5 139 ? 109.444 152.606 129.997 1.00 380.27 ?  65  DT  I C4    1 
ATOM 8799  O O4    . DT  I 5 139 ? 109.733 151.435 129.777 1.00 380.27 ?  65  DT  I O4    1 
ATOM 8800  C C5    . DT  I 5 139 ? 110.375 153.533 130.592 1.00 380.27 ?  65  DT  I C5    1 
ATOM 8801  C C7    . DT  I 5 139 ? 111.755 153.080 130.963 1.00 380.27 ?  65  DT  I C7    1 
ATOM 8802  C C6    . DT  I 5 139 ? 109.967 154.793 130.799 1.00 380.27 ?  65  DT  I C6    1 
ATOM 8803  P P     . DT  I 5 140 ? 107.037 159.167 133.651 1.00 404.89 ?  66  DT  I P     1 
ATOM 8804  O OP1   . DT  I 5 140 ? 107.755 160.323 134.230 1.00 404.89 ?  66  DT  I OP1   1 
ATOM 8805  O OP2   . DT  I 5 140 ? 107.164 157.827 134.264 1.00 404.89 -1 66  DT  I OP2   1 
ATOM 8806  O "O5'" . DT  I 5 140 ? 105.480 159.491 133.592 1.00 404.89 ?  66  DT  I "O5'" 1 
ATOM 8807  C "C5'" . DT  I 5 140 ? 104.709 158.982 132.518 1.00 404.89 ?  66  DT  I "C5'" 1 
ATOM 8808  C "C4'" . DT  I 5 140 ? 104.167 157.603 132.846 1.00 404.89 ?  66  DT  I "C4'" 1 
ATOM 8809  O "O4'" . DT  I 5 140 ? 105.114 156.578 132.472 1.00 404.89 ?  66  DT  I "O4'" 1 
ATOM 8810  C "C3'" . DT  I 5 140 ? 103.851 157.357 134.327 1.00 404.89 ?  66  DT  I "C3'" 1 
ATOM 8811  O "O3'" . DT  I 5 140 ? 102.447 157.206 134.491 1.00 404.89 ?  66  DT  I "O3'" 1 
ATOM 8812  C "C2'" . DT  I 5 140 ? 104.615 156.061 134.663 1.00 404.89 ?  66  DT  I "C2'" 1 
ATOM 8813  C "C1'" . DT  I 5 140 ? 104.852 155.469 133.285 1.00 404.89 ?  66  DT  I "C1'" 1 
ATOM 8814  N N1    . DT  I 5 140 ? 105.999 154.523 133.221 1.00 404.89 ?  66  DT  I N1    1 
ATOM 8815  C C2    . DT  I 5 140 ? 105.832 153.310 132.595 1.00 404.89 ?  66  DT  I C2    1 
ATOM 8816  O O2    . DT  I 5 140 ? 104.787 152.966 132.075 1.00 404.89 ?  66  DT  I O2    1 
ATOM 8817  N N3    . DT  I 5 140 ? 106.943 152.509 132.593 1.00 404.89 ?  66  DT  I N3    1 
ATOM 8818  C C4    . DT  I 5 140 ? 108.176 152.792 133.147 1.00 404.89 ?  66  DT  I C4    1 
ATOM 8819  O O4    . DT  I 5 140 ? 109.115 152.006 133.095 1.00 404.89 ?  66  DT  I O4    1 
ATOM 8820  C C5    . DT  I 5 140 ? 108.281 154.078 133.792 1.00 404.89 ?  66  DT  I C5    1 
ATOM 8821  C C7    . DT  I 5 140 ? 109.571 154.494 134.432 1.00 404.89 ?  66  DT  I C7    1 
ATOM 8822  C C6    . DT  I 5 140 ? 107.197 154.870 133.801 1.00 404.89 ?  66  DT  I C6    1 
ATOM 8823  P P     . DC  I 5 141 ? 101.824 156.759 135.902 1.00 428.52 ?  67  DC  I P     1 
ATOM 8824  O OP1   . DC  I 5 141 ? 100.480 157.367 136.002 1.00 428.52 ?  67  DC  I OP1   1 
ATOM 8825  O OP2   . DC  I 5 141 ? 102.826 157.018 136.959 1.00 428.52 -1 67  DC  I OP2   1 
ATOM 8826  O "O5'" . DC  I 5 141 ? 101.652 155.178 135.749 1.00 428.52 ?  67  DC  I "O5'" 1 
ATOM 8827  C "C5'" . DC  I 5 141 ? 101.216 154.639 134.513 1.00 428.52 ?  67  DC  I "C5'" 1 
ATOM 8828  C "C4'" . DC  I 5 141 ? 101.391 153.137 134.491 1.00 428.52 ?  67  DC  I "C4'" 1 
ATOM 8829  O "O4'" . DC  I 5 141 ? 102.798 152.803 134.373 1.00 428.52 ?  67  DC  I "O4'" 1 
ATOM 8830  C "C3'" . DC  I 5 141 ? 100.887 152.412 135.744 1.00 428.52 ?  67  DC  I "C3'" 1 
ATOM 8831  O "O3'" . DC  I 5 141 ? 100.043 151.339 135.364 1.00 428.52 ?  67  DC  I "O3'" 1 
ATOM 8832  C "C2'" . DC  I 5 141 ? 102.173 151.910 136.405 1.00 428.52 ?  67  DC  I "C2'" 1 
ATOM 8833  C "C1'" . DC  I 5 141 ? 103.049 151.691 135.190 1.00 428.52 ?  67  DC  I "C1'" 1 
ATOM 8834  N N1    . DC  I 5 141 ? 104.502 151.627 135.496 1.00 428.52 ?  67  DC  I N1    1 
ATOM 8835  C C2    . DC  I 5 141 ? 105.217 150.459 135.207 1.00 428.52 ?  67  DC  I C2    1 
ATOM 8836  O O2    . DC  I 5 141 ? 104.625 149.501 134.695 1.00 428.52 ?  67  DC  I O2    1 
ATOM 8837  N N3    . DC  I 5 141 ? 106.539 150.412 135.492 1.00 428.52 ?  67  DC  I N3    1 
ATOM 8838  C C4    . DC  I 5 141 ? 107.138 151.464 136.043 1.00 428.52 ?  67  DC  I C4    1 
ATOM 8839  N N4    . DC  I 5 141 ? 108.443 151.371 136.305 1.00 428.52 ?  67  DC  I N4    1 
ATOM 8840  C C5    . DC  I 5 141 ? 106.426 152.660 136.349 1.00 428.52 ?  67  DC  I C5    1 
ATOM 8841  C C6    . DC  I 5 141 ? 105.123 152.698 136.061 1.00 428.52 ?  67  DC  I C6    1 
ATOM 8842  P P     . DC  I 5 142 ? 99.113  150.612 136.453 1.00 461.43 ?  68  DC  I P     1 
ATOM 8843  O OP1   . DC  I 5 142 ? 97.987  149.982 135.729 1.00 461.43 ?  68  DC  I OP1   1 
ATOM 8844  O OP2   . DC  I 5 142 ? 98.838  151.589 137.530 1.00 461.43 -1 68  DC  I OP2   1 
ATOM 8845  O "O5'" . DC  I 5 142 ? 100.052 149.463 137.053 1.00 461.43 ?  68  DC  I "O5'" 1 
ATOM 8846  C "C5'" . DC  I 5 142 ? 100.673 148.521 136.182 1.00 461.43 ?  68  DC  I "C5'" 1 
ATOM 8847  C "C4'" . DC  I 5 142 ? 101.655 147.655 136.945 1.00 461.43 ?  68  DC  I "C4'" 1 
ATOM 8848  O "O4'" . DC  I 5 142 ? 102.920 148.353 137.084 1.00 461.43 ?  68  DC  I "O4'" 1 
ATOM 8849  C "C3'" . DC  I 5 142 ? 101.214 147.289 138.367 1.00 461.43 ?  68  DC  I "C3'" 1 
ATOM 8850  O "O3'" . DC  I 5 142 ? 101.346 145.895 138.576 1.00 461.43 ?  68  DC  I "O3'" 1 
ATOM 8851  C "C2'" . DC  I 5 142 ? 102.173 148.078 139.257 1.00 461.43 ?  68  DC  I "C2'" 1 
ATOM 8852  C "C1'" . DC  I 5 142 ? 103.408 148.132 138.381 1.00 461.43 ?  68  DC  I "C1'" 1 
ATOM 8853  N N1    . DC  I 5 142 ? 104.351 149.226 138.744 1.00 461.43 ?  68  DC  I N1    1 
ATOM 8854  C C2    . DC  I 5 142 ? 105.726 149.031 138.587 1.00 461.43 ?  68  DC  I C2    1 
ATOM 8855  O O2    . DC  I 5 142 ? 106.134 147.956 138.135 1.00 461.43 ?  68  DC  I O2    1 
ATOM 8856  N N3    . DC  I 5 142 ? 106.574 150.031 138.930 1.00 461.43 ?  68  DC  I N3    1 
ATOM 8857  C C4    . DC  I 5 142 ? 106.094 151.175 139.416 1.00 461.43 ?  68  DC  I C4    1 
ATOM 8858  N N4    . DC  I 5 142 ? 106.970 152.133 139.738 1.00 461.43 ?  68  DC  I N4    1 
ATOM 8859  C C5    . DC  I 5 142 ? 104.695 151.392 139.588 1.00 461.43 ?  68  DC  I C5    1 
ATOM 8860  C C6    . DC  I 5 142 ? 103.868 150.399 139.246 1.00 461.43 ?  68  DC  I C6    1 
ATOM 8861  P P     . DT  I 5 143 ? 100.496 145.177 139.735 1.00 501.55 ?  69  DT  I P     1 
ATOM 8862  O OP1   . DT  I 5 143 ? 99.108  145.021 139.249 1.00 501.55 ?  69  DT  I OP1   1 
ATOM 8863  O OP2   . DT  I 5 143 ? 100.759 145.904 140.995 1.00 501.55 -1 69  DT  I OP2   1 
ATOM 8864  O "O5'" . DT  I 5 143 ? 101.169 143.736 139.866 1.00 501.55 ?  69  DT  I "O5'" 1 
ATOM 8865  C "C5'" . DT  I 5 143 ? 101.403 142.954 138.707 1.00 501.55 ?  69  DT  I "C5'" 1 
ATOM 8866  C "C4'" . DT  I 5 143 ? 102.748 142.256 138.790 1.00 501.55 ?  69  DT  I "C4'" 1 
ATOM 8867  O "O4'" . DT  I 5 143 ? 103.797 143.246 138.939 1.00 501.55 ?  69  DT  I "O4'" 1 
ATOM 8868  C "C3'" . DT  I 5 143 ? 102.906 141.284 139.958 1.00 501.55 ?  69  DT  I "C3'" 1 
ATOM 8869  O "O3'" . DT  I 5 143 ? 103.564 140.106 139.518 1.00 501.55 ?  69  DT  I "O3'" 1 
ATOM 8870  C "C2'" . DT  I 5 143 ? 103.755 142.063 140.963 1.00 501.55 ?  69  DT  I "C2'" 1 
ATOM 8871  C "C1'" . DT  I 5 143 ? 104.605 142.933 140.051 1.00 501.55 ?  69  DT  I "C1'" 1 
ATOM 8872  N N1    . DT  I 5 143 ? 105.028 144.208 140.681 1.00 501.55 ?  69  DT  I N1    1 
ATOM 8873  C C2    . DT  I 5 143 ? 106.341 144.600 140.591 1.00 501.55 ?  69  DT  I C2    1 
ATOM 8874  O O2    . DT  I 5 143 ? 107.194 143.949 140.018 1.00 501.55 ?  69  DT  I O2    1 
ATOM 8875  N N3    . DT  I 5 143 ? 106.624 145.792 141.197 1.00 501.55 ?  69  DT  I N3    1 
ATOM 8876  C C4    . DT  I 5 143 ? 105.744 146.616 141.871 1.00 501.55 ?  69  DT  I C4    1 
ATOM 8877  O O4    . DT  I 5 143 ? 106.098 147.671 142.388 1.00 501.55 ?  69  DT  I O4    1 
ATOM 8878  C C5    . DT  I 5 143 ? 104.382 146.145 141.930 1.00 501.55 ?  69  DT  I C5    1 
ATOM 8879  C C7    . DT  I 5 143 ? 103.335 146.953 142.637 1.00 501.55 ?  69  DT  I C7    1 
ATOM 8880  C C6    . DT  I 5 143 ? 104.092 144.979 141.336 1.00 501.55 ?  69  DT  I C6    1 
ATOM 8881  P P     . DC  I 5 144 ? 103.621 138.810 140.465 1.00 515.54 ?  70  DC  I P     1 
ATOM 8882  O OP1   . DC  I 5 144 ? 103.741 137.621 139.592 1.00 515.54 ?  70  DC  I OP1   1 
ATOM 8883  O OP2   . DC  I 5 144 ? 102.507 138.908 141.433 1.00 515.54 -1 70  DC  I OP2   1 
ATOM 8884  O "O5'" . DC  I 5 144 ? 104.986 138.993 141.273 1.00 515.54 ?  70  DC  I "O5'" 1 
ATOM 8885  C "C5'" . DC  I 5 144 ? 106.199 139.204 140.566 1.00 515.54 ?  70  DC  I "C5'" 1 
ATOM 8886  C "C4'" . DC  I 5 144 ? 107.300 139.651 141.508 1.00 515.54 ?  70  DC  I "C4'" 1 
ATOM 8887  O "O4'" . DC  I 5 144 ? 107.139 141.049 141.818 1.00 515.54 ?  70  DC  I "O4'" 1 
ATOM 8888  C "C3'" . DC  I 5 144 ? 107.331 138.926 142.859 1.00 515.54 ?  70  DC  I "C3'" 1 
ATOM 8889  O "O3'" . DC  I 5 144 ? 108.474 138.085 142.935 1.00 515.54 ?  70  DC  I "O3'" 1 
ATOM 8890  C "C2'" . DC  I 5 144 ? 107.387 140.056 143.903 1.00 515.54 ?  70  DC  I "C2'" 1 
ATOM 8891  C "C1'" . DC  I 5 144 ? 107.729 141.279 143.064 1.00 515.54 ?  70  DC  I "C1'" 1 
ATOM 8892  N N1    . DC  I 5 144 ? 107.191 142.541 143.622 1.00 515.54 ?  70  DC  I N1    1 
ATOM 8893  C C2    . DC  I 5 144 ? 108.057 143.609 143.864 1.00 515.54 ?  70  DC  I C2    1 
ATOM 8894  O O2    . DC  I 5 144 ? 109.259 143.484 143.599 1.00 515.54 ?  70  DC  I O2    1 
ATOM 8895  N N3    . DC  I 5 144 ? 107.554 144.754 144.384 1.00 515.54 ?  70  DC  I N3    1 
ATOM 8896  C C4    . DC  I 5 144 ? 106.253 144.848 144.659 1.00 515.54 ?  70  DC  I C4    1 
ATOM 8897  N N4    . DC  I 5 144 ? 105.804 145.999 145.167 1.00 515.54 ?  70  DC  I N4    1 
ATOM 8898  C C5    . DC  I 5 144 ? 105.354 143.768 144.420 1.00 515.54 ?  70  DC  I C5    1 
ATOM 8899  C C6    . DC  I 5 144 ? 105.862 142.643 143.908 1.00 515.54 ?  70  DC  I C6    1 
ATOM 8900  P P     . DG  I 5 145 ? 108.767 137.230 144.263 1.00 529.50 ?  71  DG  I P     1 
ATOM 8901  O OP1   . DG  I 5 145 ? 109.367 135.949 143.835 1.00 529.50 ?  71  DG  I OP1   1 
ATOM 8902  O OP2   . DG  I 5 145 ? 107.538 137.220 145.086 1.00 529.50 -1 71  DG  I OP2   1 
ATOM 8903  O "O5'" . DG  I 5 145 ? 109.879 138.088 145.033 1.00 529.50 ?  71  DG  I "O5'" 1 
ATOM 8904  C "C5'" . DG  I 5 145 ? 111.128 138.356 144.402 1.00 529.50 ?  71  DG  I "C5'" 1 
ATOM 8905  C "C4'" . DG  I 5 145 ? 111.965 139.328 145.219 1.00 529.50 ?  71  DG  I "C4'" 1 
ATOM 8906  O "O4'" . DG  I 5 145 ? 111.300 140.618 145.289 1.00 529.50 ?  71  DG  I "O4'" 1 
ATOM 8907  C "C3'" . DG  I 5 145 ? 112.234 138.908 146.668 1.00 529.50 ?  71  DG  I "C3'" 1 
ATOM 8908  O "O3'" . DG  I 5 145 ? 113.605 139.127 146.985 1.00 529.50 ?  71  DG  I "O3'" 1 
ATOM 8909  C "C2'" . DG  I 5 145 ? 111.321 139.832 147.474 1.00 529.50 ?  71  DG  I "C2'" 1 
ATOM 8910  C "C1'" . DG  I 5 145 ? 111.347 141.084 146.616 1.00 529.50 ?  71  DG  I "C1'" 1 
ATOM 8911  N N9    . DG  I 5 145 ? 110.216 141.983 146.838 1.00 529.50 ?  71  DG  I N9    1 
ATOM 8912  C C8    . DG  I 5 145 ? 108.883 141.693 146.680 1.00 529.50 ?  71  DG  I C8    1 
ATOM 8913  N N7    . DG  I 5 145 ? 108.098 142.699 146.948 1.00 529.50 ?  71  DG  I N7    1 
ATOM 8914  C C5    . DG  I 5 145 ? 108.964 143.722 147.301 1.00 529.50 ?  71  DG  I C5    1 
ATOM 8915  C C6    . DG  I 5 145 ? 108.689 145.051 147.691 1.00 529.50 ?  71  DG  I C6    1 
ATOM 8916  O O6    . DG  I 5 145 ? 107.587 145.601 147.802 1.00 529.50 ?  71  DG  I O6    1 
ATOM 8917  N N1    . DG  I 5 145 ? 109.855 145.761 147.967 1.00 529.50 ?  71  DG  I N1    1 
ATOM 8918  C C2    . DG  I 5 145 ? 111.126 145.247 147.880 1.00 529.50 ?  71  DG  I C2    1 
ATOM 8919  N N2    . DG  I 5 145 ? 112.130 146.086 148.180 1.00 529.50 ?  71  DG  I N2    1 
ATOM 8920  N N3    . DG  I 5 145 ? 111.398 144.003 147.511 1.00 529.50 ?  71  DG  I N3    1 
ATOM 8921  C C4    . DG  I 5 145 ? 110.272 143.300 147.240 1.00 529.50 ?  71  DG  I C4    1 
ATOM 8922  P P     . DA  I 5 146 ? 114.237 138.508 148.326 1.00 538.80 ?  72  DA  I P     1 
ATOM 8923  O OP1   . DA  I 5 146 ? 115.442 137.742 147.937 1.00 538.80 ?  72  DA  I OP1   1 
ATOM 8924  O OP2   . DA  I 5 146 ? 113.146 137.836 149.065 1.00 538.80 -1 72  DA  I OP2   1 
ATOM 8925  O "O5'" . DA  I 5 146 ? 114.698 139.792 149.166 1.00 538.80 ?  72  DA  I "O5'" 1 
ATOM 8926  C "C5'" . DA  I 5 146 ? 115.900 140.481 148.819 1.00 538.80 ?  72  DA  I "C5'" 1 
ATOM 8927  C "C4'" . DA  I 5 146 ? 115.969 141.849 149.485 1.00 538.80 ?  72  DA  I "C4'" 1 
ATOM 8928  O "O4'" . DA  I 5 146 ? 114.697 142.533 149.330 1.00 538.80 ?  72  DA  I "O4'" 1 
ATOM 8929  C "C3'" . DA  I 5 146 ? 116.258 141.837 150.988 1.00 538.80 ?  72  DA  I "C3'" 1 
ATOM 8930  O "O3'" . DA  I 5 146 ? 117.111 142.928 151.322 1.00 538.80 ?  72  DA  I "O3'" 1 
ATOM 8931  C "C2'" . DA  I 5 146 ? 114.873 142.010 151.601 1.00 538.80 ?  72  DA  I "C2'" 1 
ATOM 8932  C "C1'" . DA  I 5 146 ? 114.227 142.947 150.594 1.00 538.80 ?  72  DA  I "C1'" 1 
ATOM 8933  N N9    . DA  I 5 146 ? 112.771 142.882 150.586 1.00 538.80 ?  72  DA  I N9    1 
ATOM 8934  C C8    . DA  I 5 146 ? 111.998 141.784 150.337 1.00 538.80 ?  72  DA  I C8    1 
ATOM 8935  N N7    . DA  I 5 146 ? 110.709 142.020 150.392 1.00 538.80 ?  72  DA  I N7    1 
ATOM 8936  C C5    . DA  I 5 146 ? 110.633 143.368 150.697 1.00 538.80 ?  72  DA  I C5    1 
ATOM 8937  C C6    . DA  I 5 146 ? 109.542 144.236 150.899 1.00 538.80 ?  72  DA  I C6    1 
ATOM 8938  N N6    . DA  I 5 146 ? 108.266 143.845 150.812 1.00 538.80 ?  72  DA  I N6    1 
ATOM 8939  N N1    . DA  I 5 146 ? 109.813 145.527 151.193 1.00 538.80 ?  72  DA  I N1    1 
ATOM 8940  C C2    . DA  I 5 146 ? 111.091 145.917 151.281 1.00 538.80 ?  72  DA  I C2    1 
ATOM 8941  N N3    . DA  I 5 146 ? 112.197 145.193 151.112 1.00 538.80 ?  72  DA  I N3    1 
ATOM 8942  C C4    . DA  I 5 146 ? 111.895 143.915 150.824 1.00 538.80 ?  72  DA  I C4    1 
ATOM 8943  P P     . DT  I 5 147 ? 117.607 143.135 152.837 1.00 523.92 ?  73  DT  I P     1 
ATOM 8944  O OP1   . DT  I 5 147 ? 118.953 143.747 152.785 1.00 523.92 ?  73  DT  I OP1   1 
ATOM 8945  O OP2   . DT  I 5 147 ? 117.408 141.853 153.548 1.00 523.92 -1 73  DT  I OP2   1 
ATOM 8946  O "O5'" . DT  I 5 147 ? 116.580 144.204 153.445 1.00 523.92 ?  73  DT  I "O5'" 1 
ATOM 8947  C "C5'" . DT  I 5 147 ? 116.552 144.445 154.851 1.00 523.92 ?  73  DT  I "C5'" 1 
ATOM 8948  C "C4'" . DT  I 5 147 ? 115.815 145.735 155.169 1.00 523.92 ?  73  DT  I "C4'" 1 
ATOM 8949  O "O4'" . DT  I 5 147 ? 114.543 145.748 154.471 1.00 523.92 ?  73  DT  I "O4'" 1 
ATOM 8950  C "C3'" . DT  I 5 147 ? 115.479 145.937 156.643 1.00 523.92 ?  73  DT  I "C3'" 1 
ATOM 8951  O "O3'" . DT  I 5 147 ? 115.480 147.323 156.958 1.00 523.92 ?  73  DT  I "O3'" 1 
ATOM 8952  C "C2'" . DT  I 5 147 ? 114.081 145.346 156.741 1.00 523.92 ?  73  DT  I "C2'" 1 
ATOM 8953  C "C1'" . DT  I 5 147 ? 113.483 145.769 155.406 1.00 523.92 ?  73  DT  I "C1'" 1 
ATOM 8954  N N1    . DT  I 5 147 ? 112.414 144.857 154.922 1.00 523.92 ?  73  DT  I N1    1 
ATOM 8955  C C2    . DT  I 5 147 ? 111.167 145.366 154.654 1.00 523.92 ?  73  DT  I C2    1 
ATOM 8956  O O2    . DT  I 5 147 ? 110.882 146.542 154.784 1.00 523.92 ?  73  DT  I O2    1 
ATOM 8957  N N3    . DT  I 5 147 ? 110.256 144.444 154.215 1.00 523.92 ?  73  DT  I N3    1 
ATOM 8958  C C4    . DT  I 5 147 ? 110.464 143.091 154.029 1.00 523.92 ?  73  DT  I C4    1 
ATOM 8959  O O4    . DT  I 5 147 ? 109.579 142.342 153.630 1.00 523.92 ?  73  DT  I O4    1 
ATOM 8960  C C5    . DT  I 5 147 ? 111.795 142.622 154.331 1.00 523.92 ?  73  DT  I C5    1 
ATOM 8961  C C7    . DT  I 5 147 ? 112.141 141.172 154.165 1.00 523.92 ?  73  DT  I C7    1 
ATOM 8962  C C6    . DT  I 5 147 ? 112.695 143.518 154.759 1.00 523.92 ?  73  DT  I C6    1 
ATOM 8963  O "O5'" . DA  J 6 1   ? 99.413  147.181 155.397 1.00 528.55 ?  -73 DA  J "O5'" 1 
ATOM 8964  C "C5'" . DA  J 6 1   ? 99.292  148.047 156.521 1.00 528.55 ?  -73 DA  J "C5'" 1 
ATOM 8965  C "C4'" . DA  J 6 1   ? 100.655 148.361 157.113 1.00 528.55 ?  -73 DA  J "C4'" 1 
ATOM 8966  O "O4'" . DA  J 6 1   ? 101.485 147.167 157.069 1.00 528.55 ?  -73 DA  J "O4'" 1 
ATOM 8967  C "C3'" . DA  J 6 1   ? 101.447 149.448 156.382 1.00 528.55 ?  -73 DA  J "C3'" 1 
ATOM 8968  O "O3'" . DA  J 6 1   ? 102.185 150.230 157.322 1.00 528.55 ?  -73 DA  J "O3'" 1 
ATOM 8969  C "C2'" . DA  J 6 1   ? 102.374 148.637 155.484 1.00 528.55 ?  -73 DA  J "C2'" 1 
ATOM 8970  C "C1'" . DA  J 6 1   ? 102.686 147.454 156.385 1.00 528.55 ?  -73 DA  J "C1'" 1 
ATOM 8971  N N9    . DA  J 6 1   ? 103.105 146.263 155.655 1.00 528.55 ?  -73 DA  J N9    1 
ATOM 8972  C C8    . DA  J 6 1   ? 102.299 145.304 155.107 1.00 528.55 ?  -73 DA  J C8    1 
ATOM 8973  N N7    . DA  J 6 1   ? 102.958 144.342 154.503 1.00 528.55 ?  -73 DA  J N7    1 
ATOM 8974  C C5    . DA  J 6 1   ? 104.287 144.696 154.667 1.00 528.55 ?  -73 DA  J C5    1 
ATOM 8975  C C6    . DA  J 6 1   ? 105.492 144.090 154.257 1.00 528.55 ?  -73 DA  J C6    1 
ATOM 8976  N N6    . DA  J 6 1   ? 105.542 142.946 153.566 1.00 528.55 ?  -73 DA  J N6    1 
ATOM 8977  N N1    . DA  J 6 1   ? 106.648 144.707 154.585 1.00 528.55 ?  -73 DA  J N1    1 
ATOM 8978  C C2    . DA  J 6 1   ? 106.597 145.853 155.278 1.00 528.55 ?  -73 DA  J C2    1 
ATOM 8979  N N3    . DA  J 6 1   ? 105.528 146.516 155.717 1.00 528.55 ?  -73 DA  J N3    1 
ATOM 8980  C C4    . DA  J 6 1   ? 104.395 145.879 155.375 1.00 528.55 ?  -73 DA  J C4    1 
ATOM 8981  P P     . DT  J 6 2   ? 102.737 151.685 156.917 1.00 536.01 ?  -72 DT  J P     1 
ATOM 8982  O OP1   . DT  J 6 2   ? 103.079 152.398 158.167 1.00 536.01 ?  -72 DT  J OP1   1 
ATOM 8983  O OP2   . DT  J 6 2   ? 101.779 152.291 155.969 1.00 536.01 -1 -72 DT  J OP2   1 
ATOM 8984  O "O5'" . DT  J 6 2   ? 104.092 151.381 156.123 1.00 536.01 ?  -72 DT  J "O5'" 1 
ATOM 8985  C "C5'" . DT  J 6 2   ? 105.169 150.720 156.778 1.00 536.01 ?  -72 DT  J "C5'" 1 
ATOM 8986  C "C4'" . DT  J 6 2   ? 106.409 150.705 155.900 1.00 536.01 ?  -72 DT  J "C4'" 1 
ATOM 8987  O "O4'" . DT  J 6 2   ? 106.531 149.418 155.240 1.00 536.01 ?  -72 DT  J "O4'" 1 
ATOM 8988  C "C3'" . DT  J 6 2   ? 106.425 151.761 154.786 1.00 536.01 ?  -72 DT  J "C3'" 1 
ATOM 8989  O "O3'" . DT  J 6 2   ? 107.663 152.462 154.793 1.00 536.01 ?  -72 DT  J "O3'" 1 
ATOM 8990  C "C2'" . DT  J 6 2   ? 106.258 150.936 153.511 1.00 536.01 ?  -72 DT  J "C2'" 1 
ATOM 8991  C "C1'" . DT  J 6 2   ? 106.929 149.636 153.911 1.00 536.01 ?  -72 DT  J "C1'" 1 
ATOM 8992  N N1    . DT  J 6 2   ? 106.518 148.467 153.084 1.00 536.01 ?  -72 DT  J N1    1 
ATOM 8993  C C2    . DT  J 6 2   ? 107.487 147.694 152.491 1.00 536.01 ?  -72 DT  J C2    1 
ATOM 8994  O O2    . DT  J 6 2   ? 108.678 147.910 152.612 1.00 536.01 ?  -72 DT  J O2    1 
ATOM 8995  N N3    . DT  J 6 2   ? 107.009 146.647 151.750 1.00 536.01 ?  -72 DT  J N3    1 
ATOM 8996  C C4    . DT  J 6 2   ? 105.685 146.304 151.545 1.00 536.01 ?  -72 DT  J C4    1 
ATOM 8997  O O4    . DT  J 6 2   ? 105.354 145.343 150.859 1.00 536.01 ?  -72 DT  J O4    1 
ATOM 8998  C C5    . DT  J 6 2   ? 104.719 147.161 152.190 1.00 536.01 ?  -72 DT  J C5    1 
ATOM 8999  C C7    . DT  J 6 2   ? 103.251 146.890 152.038 1.00 536.01 ?  -72 DT  J C7    1 
ATOM 9000  C C6    . DT  J 6 2   ? 105.177 148.191 152.918 1.00 536.01 ?  -72 DT  J C6    1 
ATOM 9001  P P     . DC  J 6 3   ? 107.911 153.667 153.759 1.00 533.11 ?  -71 DC  J P     1 
ATOM 9002  O OP1   . DC  J 6 3   ? 108.790 154.654 154.423 1.00 533.11 ?  -71 DC  J OP1   1 
ATOM 9003  O OP2   . DC  J 6 3   ? 106.592 154.083 153.232 1.00 533.11 -1 -71 DC  J OP2   1 
ATOM 9004  O "O5'" . DC  J 6 3   ? 108.719 152.988 152.559 1.00 533.11 ?  -71 DC  J "O5'" 1 
ATOM 9005  C "C5'" . DC  J 6 3   ? 109.987 152.399 152.806 1.00 533.11 ?  -71 DC  J "C5'" 1 
ATOM 9006  C "C4'" . DC  J 6 3   ? 110.472 151.632 151.590 1.00 533.11 ?  -71 DC  J "C4'" 1 
ATOM 9007  O "O4'" . DC  J 6 3   ? 109.554 150.547 151.303 1.00 533.11 ?  -71 DC  J "O4'" 1 
ATOM 9008  C "C3'" . DC  J 6 3   ? 110.575 152.458 150.304 1.00 533.11 ?  -71 DC  J "C3'" 1 
ATOM 9009  O "O3'" . DC  J 6 3   ? 111.815 152.209 149.669 1.00 533.11 ?  -71 DC  J "O3'" 1 
ATOM 9010  C "C2'" . DC  J 6 3   ? 109.406 151.957 149.459 1.00 533.11 ?  -71 DC  J "C2'" 1 
ATOM 9011  C "C1'" . DC  J 6 3   ? 109.291 150.517 149.923 1.00 533.11 ?  -71 DC  J "C1'" 1 
ATOM 9012  N N1    . DC  J 6 3   ? 107.944 149.938 149.713 1.00 533.11 ?  -71 DC  J N1    1 
ATOM 9013  C C2    . DC  J 6 3   ? 107.820 148.631 149.240 1.00 533.11 ?  -71 DC  J C2    1 
ATOM 9014  O O2    . DC  J 6 3   ? 108.842 147.975 149.010 1.00 533.11 ?  -71 DC  J O2    1 
ATOM 9015  N N3    . DC  J 6 3   ? 106.581 148.119 149.050 1.00 533.11 ?  -71 DC  J N3    1 
ATOM 9016  C C4    . DC  J 6 3   ? 105.504 148.859 149.311 1.00 533.11 ?  -71 DC  J C4    1 
ATOM 9017  N N4    . DC  J 6 3   ? 104.304 148.309 149.107 1.00 533.11 ?  -71 DC  J N4    1 
ATOM 9018  C C5    . DC  J 6 3   ? 105.611 150.196 149.790 1.00 533.11 ?  -71 DC  J C5    1 
ATOM 9019  C C6    . DC  J 6 3   ? 106.838 150.691 149.972 1.00 533.11 ?  -71 DC  J C6    1 
ATOM 9020  P P     . DG  J 6 4   ? 112.317 153.160 148.476 1.00 509.31 ?  -70 DG  J P     1 
ATOM 9021  O OP1   . DG  J 6 4   ? 112.311 154.554 148.971 1.00 509.31 ?  -70 DG  J OP1   1 
ATOM 9022  O OP2   . DG  J 6 4   ? 111.550 152.809 147.261 1.00 509.31 -1 -70 DG  J OP2   1 
ATOM 9023  O "O5'" . DG  J 6 4   ? 113.830 152.705 148.250 1.00 509.31 ?  -70 DG  J "O5'" 1 
ATOM 9024  C "C5'" . DG  J 6 4   ? 114.364 151.636 149.016 1.00 509.31 ?  -70 DG  J "C5'" 1 
ATOM 9025  C "C4'" . DG  J 6 4   ? 114.567 150.406 148.152 1.00 509.31 ?  -70 DG  J "C4'" 1 
ATOM 9026  O "O4'" . DG  J 6 4   ? 113.312 149.693 148.012 1.00 509.31 ?  -70 DG  J "O4'" 1 
ATOM 9027  C "C3'" . DG  J 6 4   ? 115.059 150.697 146.733 1.00 509.31 ?  -70 DG  J "C3'" 1 
ATOM 9028  O "O3'" . DG  J 6 4   ? 116.184 149.892 146.438 1.00 509.31 ?  -70 DG  J "O3'" 1 
ATOM 9029  C "C2'" . DG  J 6 4   ? 113.863 150.343 145.846 1.00 509.31 ?  -70 DG  J "C2'" 1 
ATOM 9030  C "C1'" . DG  J 6 4   ? 113.160 149.285 146.676 1.00 509.31 ?  -70 DG  J "C1'" 1 
ATOM 9031  N N9    . DG  J 6 4   ? 111.734 149.171 146.387 1.00 509.31 ?  -70 DG  J N9    1 
ATOM 9032  C C8    . DG  J 6 4   ? 110.754 150.084 146.688 1.00 509.31 ?  -70 DG  J C8    1 
ATOM 9033  N N7    . DG  J 6 4   ? 109.562 149.713 146.310 1.00 509.31 ?  -70 DG  J N7    1 
ATOM 9034  C C5    . DG  J 6 4   ? 109.765 148.473 145.720 1.00 509.31 ?  -70 DG  J C5    1 
ATOM 9035  C C6    . DG  J 6 4   ? 108.839 147.586 145.124 1.00 509.31 ?  -70 DG  J C6    1 
ATOM 9036  O O6    . DG  J 6 4   ? 107.616 147.726 144.998 1.00 509.31 ?  -70 DG  J O6    1 
ATOM 9037  N N1    . DG  J 6 4   ? 109.461 146.436 144.646 1.00 509.31 ?  -70 DG  J N1    1 
ATOM 9038  C C2    . DG  J 6 4   ? 110.808 146.178 144.733 1.00 509.31 ?  -70 DG  J C2    1 
ATOM 9039  N N2    . DG  J 6 4   ? 111.226 145.014 144.217 1.00 509.31 ?  -70 DG  J N2    1 
ATOM 9040  N N3    . DG  J 6 4   ? 111.687 147.003 145.286 1.00 509.31 ?  -70 DG  J N3    1 
ATOM 9041  C C4    . DG  J 6 4   ? 111.096 148.125 145.758 1.00 509.31 ?  -70 DG  J C4    1 
ATOM 9042  P P     . DA  J 6 5   ? 117.032 150.158 145.102 1.00 489.14 ?  -69 DA  J P     1 
ATOM 9043  O OP1   . DA  J 6 5   ? 118.445 149.825 145.392 1.00 489.14 ?  -69 DA  J OP1   1 
ATOM 9044  O OP2   . DA  J 6 5   ? 116.676 151.508 144.611 1.00 489.14 -1 -69 DA  J OP2   1 
ATOM 9045  O "O5'" . DA  J 6 5   ? 116.447 149.094 144.063 1.00 489.14 ?  -69 DA  J "O5'" 1 
ATOM 9046  C "C5'" . DA  J 6 5   ? 116.373 147.719 144.422 1.00 489.14 ?  -69 DA  J "C5'" 1 
ATOM 9047  C "C4'" . DA  J 6 5   ? 115.874 146.887 143.257 1.00 489.14 ?  -69 DA  J "C4'" 1 
ATOM 9048  O "O4'" . DA  J 6 5   ? 114.426 146.938 143.205 1.00 489.14 ?  -69 DA  J "O4'" 1 
ATOM 9049  C "C3'" . DA  J 6 5   ? 116.370 147.346 141.883 1.00 489.14 ?  -69 DA  J "C3'" 1 
ATOM 9050  O "O3'" . DA  J 6 5   ? 116.847 146.235 141.140 1.00 489.14 ?  -69 DA  J "O3'" 1 
ATOM 9051  C "C2'" . DA  J 6 5   ? 115.127 147.960 141.238 1.00 489.14 ?  -69 DA  J "C2'" 1 
ATOM 9052  C "C1'" . DA  J 6 5   ? 114.021 147.140 141.875 1.00 489.14 ?  -69 DA  J "C1'" 1 
ATOM 9053  N N9    . DA  J 6 5   ? 112.726 147.809 141.879 1.00 489.14 ?  -69 DA  J N9    1 
ATOM 9054  C C8    . DA  J 6 5   ? 112.483 149.140 142.073 1.00 489.14 ?  -69 DA  J C8    1 
ATOM 9055  N N7    . DA  J 6 5   ? 111.212 149.457 142.020 1.00 489.14 ?  -69 DA  J N7    1 
ATOM 9056  C C5    . DA  J 6 5   ? 110.581 148.251 141.776 1.00 489.14 ?  -69 DA  J C5    1 
ATOM 9057  C C6    . DA  J 6 5   ? 109.226 147.901 141.610 1.00 489.14 ?  -69 DA  J C6    1 
ATOM 9058  N N6    . DA  J 6 5   ? 108.225 148.785 141.670 1.00 489.14 ?  -69 DA  J N6    1 
ATOM 9059  N N1    . DA  J 6 5   ? 108.937 146.603 141.378 1.00 489.14 ?  -69 DA  J N1    1 
ATOM 9060  C C2    . DA  J 6 5   ? 109.938 145.718 141.316 1.00 489.14 ?  -69 DA  J C2    1 
ATOM 9061  N N3    . DA  J 6 5   ? 111.245 145.927 141.456 1.00 489.14 ?  -69 DA  J N3    1 
ATOM 9062  C C4    . DA  J 6 5   ? 111.501 147.226 141.681 1.00 489.14 ?  -69 DA  J C4    1 
ATOM 9063  P P     . DG  J 6 6   ? 118.092 146.414 140.142 1.00 463.74 ?  -68 DG  J P     1 
ATOM 9064  O OP1   . DG  J 6 6   ? 119.226 145.639 140.695 1.00 463.74 ?  -68 DG  J OP1   1 
ATOM 9065  O OP2   . DG  J 6 6   ? 118.241 147.862 139.873 1.00 463.74 -1 -68 DG  J OP2   1 
ATOM 9066  O "O5'" . DG  J 6 6   ? 117.607 145.714 138.790 1.00 463.74 ?  -68 DG  J "O5'" 1 
ATOM 9067  C "C5'" . DG  J 6 6   ? 116.321 145.998 138.273 1.00 463.74 ?  -68 DG  J "C5'" 1 
ATOM 9068  C "C4'" . DG  J 6 6   ? 115.397 144.809 138.451 1.00 463.74 ?  -68 DG  J "C4'" 1 
ATOM 9069  O "O4'" . DG  J 6 6   ? 114.133 145.260 138.985 1.00 463.74 ?  -68 DG  J "O4'" 1 
ATOM 9070  C "C3'" . DG  J 6 6   ? 115.037 144.093 137.167 1.00 463.74 ?  -68 DG  J "C3'" 1 
ATOM 9071  O "O3'" . DG  J 6 6   ? 114.620 142.769 137.452 1.00 463.74 ?  -68 DG  J "O3'" 1 
ATOM 9072  C "C2'" . DG  J 6 6   ? 113.883 144.943 136.649 1.00 463.74 ?  -68 DG  J "C2'" 1 
ATOM 9073  C "C1'" . DG  J 6 6   ? 113.174 145.339 137.944 1.00 463.74 ?  -68 DG  J "C1'" 1 
ATOM 9074  N N9    . DG  J 6 6   ? 112.633 146.694 137.925 1.00 463.74 ?  -68 DG  J N9    1 
ATOM 9075  C C8    . DG  J 6 6   ? 113.340 147.870 137.841 1.00 463.74 ?  -68 DG  J C8    1 
ATOM 9076  N N7    . DG  J 6 6   ? 112.585 148.932 137.854 1.00 463.74 ?  -68 DG  J N7    1 
ATOM 9077  C C5    . DG  J 6 6   ? 111.297 148.429 137.956 1.00 463.74 ?  -68 DG  J C5    1 
ATOM 9078  C C6    . DG  J 6 6   ? 110.060 149.107 138.016 1.00 463.74 ?  -68 DG  J C6    1 
ATOM 9079  O O6    . DG  J 6 6   ? 109.852 150.327 137.985 1.00 463.74 ?  -68 DG  J O6    1 
ATOM 9080  N N1    . DG  J 6 6   ? 108.991 148.220 138.114 1.00 463.74 ?  -68 DG  J N1    1 
ATOM 9081  C C2    . DG  J 6 6   ? 109.107 146.851 138.153 1.00 463.74 ?  -68 DG  J C2    1 
ATOM 9082  N N2    . DG  J 6 6   ? 107.964 146.158 138.255 1.00 463.74 ?  -68 DG  J N2    1 
ATOM 9083  N N3    . DG  J 6 6   ? 110.262 146.204 138.098 1.00 463.74 ?  -68 DG  J N3    1 
ATOM 9084  C C4    . DG  J 6 6   ? 111.310 147.054 138.002 1.00 463.74 ?  -68 DG  J C4    1 
ATOM 9085  P P     . DG  J 6 7   ? 114.550 141.680 136.274 1.00 437.04 ?  -67 DG  J P     1 
ATOM 9086  O OP1   . DG  J 6 7   ? 114.718 140.341 136.880 1.00 437.04 ?  -67 DG  J OP1   1 
ATOM 9087  O OP2   . DG  J 6 7   ? 115.470 142.120 135.203 1.00 437.04 -1 -67 DG  J OP2   1 
ATOM 9088  O "O5'" . DG  J 6 7   ? 113.058 141.815 135.721 1.00 437.04 ?  -67 DG  J "O5'" 1 
ATOM 9089  C "C5'" . DG  J 6 7   ? 111.963 141.655 136.608 1.00 437.04 ?  -67 DG  J "C5'" 1 
ATOM 9090  C "C4'" . DG  J 6 7   ? 110.647 141.816 135.873 1.00 437.04 ?  -67 DG  J "C4'" 1 
ATOM 9091  O "O4'" . DG  J 6 7   ? 110.202 143.190 135.963 1.00 437.04 ?  -67 DG  J "O4'" 1 
ATOM 9092  C "C3'" . DG  J 6 7   ? 110.688 141.461 134.387 1.00 437.04 ?  -67 DG  J "C3'" 1 
ATOM 9093  O "O3'" . DG  J 6 7   ? 109.634 140.556 134.087 1.00 437.04 ?  -67 DG  J "O3'" 1 
ATOM 9094  C "C2'" . DG  J 6 7   ? 110.518 142.810 133.676 1.00 437.04 ?  -67 DG  J "C2'" 1 
ATOM 9095  C "C1'" . DG  J 6 7   ? 109.767 143.640 134.704 1.00 437.04 ?  -67 DG  J "C1'" 1 
ATOM 9096  N N9    . DG  J 6 7   ? 110.060 145.066 134.620 1.00 437.04 ?  -67 DG  J N9    1 
ATOM 9097  C C8    . DG  J 6 7   ? 111.273 145.642 134.333 1.00 437.04 ?  -67 DG  J C8    1 
ATOM 9098  N N7    . DG  J 6 7   ? 111.245 146.945 134.340 1.00 437.04 ?  -67 DG  J N7    1 
ATOM 9099  C C5    . DG  J 6 7   ? 109.930 147.254 134.658 1.00 437.04 ?  -67 DG  J C5    1 
ATOM 9100  C C6    . DG  J 6 7   ? 109.304 148.513 134.813 1.00 437.04 ?  -67 DG  J C6    1 
ATOM 9101  O O6    . DG  J 6 7   ? 109.804 149.638 134.689 1.00 437.04 ?  -67 DG  J O6    1 
ATOM 9102  N N1    . DG  J 6 7   ? 107.956 148.382 135.137 1.00 437.04 ?  -67 DG  J N1    1 
ATOM 9103  C C2    . DG  J 6 7   ? 107.298 147.186 135.292 1.00 437.04 ?  -67 DG  J C2    1 
ATOM 9104  N N2    . DG  J 6 7   ? 105.997 147.263 135.609 1.00 437.04 ?  -67 DG  J N2    1 
ATOM 9105  N N3    . DG  J 6 7   ? 107.874 145.997 135.155 1.00 437.04 ?  -67 DG  J N3    1 
ATOM 9106  C C4    . DG  J 6 7   ? 109.187 146.108 134.837 1.00 437.04 ?  -67 DG  J C4    1 
ATOM 9107  P P     . DA  J 6 8   ? 109.310 140.135 132.571 1.00 405.85 ?  -66 DA  J P     1 
ATOM 9108  O OP1   . DA  J 6 8   ? 108.828 138.739 132.602 1.00 405.85 ?  -66 DA  J OP1   1 
ATOM 9109  O OP2   . DA  J 6 8   ? 110.464 140.489 131.716 1.00 405.85 -1 -66 DA  J OP2   1 
ATOM 9110  O "O5'" . DA  J 6 8   ? 108.086 141.081 132.181 1.00 405.85 ?  -66 DA  J "O5'" 1 
ATOM 9111  C "C5'" . DA  J 6 8   ? 107.098 141.391 133.158 1.00 405.85 ?  -66 DA  J "C5'" 1 
ATOM 9112  C "C4'" . DA  J 6 8   ? 106.175 142.486 132.660 1.00 405.85 ?  -66 DA  J "C4'" 1 
ATOM 9113  O "O4'" . DA  J 6 8   ? 106.811 143.777 132.824 1.00 405.85 ?  -66 DA  J "O4'" 1 
ATOM 9114  C "C3'" . DA  J 6 8   ? 105.806 142.372 131.183 1.00 405.85 ?  -66 DA  J "C3'" 1 
ATOM 9115  O "O3'" . DA  J 6 8   ? 104.408 142.298 131.034 1.00 405.85 ?  -66 DA  J "O3'" 1 
ATOM 9116  C "C2'" . DA  J 6 8   ? 106.379 143.639 130.544 1.00 405.85 ?  -66 DA  J "C2'" 1 
ATOM 9117  C "C1'" . DA  J 6 8   ? 106.487 144.586 131.725 1.00 405.85 ?  -66 DA  J "C1'" 1 
ATOM 9118  N N9    . DA  J 6 8   ? 107.537 145.583 131.561 1.00 405.85 ?  -66 DA  J N9    1 
ATOM 9119  C C8    . DA  J 6 8   ? 108.834 145.357 131.196 1.00 405.85 ?  -66 DA  J C8    1 
ATOM 9120  N N7    . DA  J 6 8   ? 109.562 146.445 131.122 1.00 405.85 ?  -66 DA  J N7    1 
ATOM 9121  C C5    . DA  J 6 8   ? 108.680 147.456 131.461 1.00 405.85 ?  -66 DA  J C5    1 
ATOM 9122  C C6    . DA  J 6 8   ? 108.830 148.854 131.569 1.00 405.85 ?  -66 DA  J C6    1 
ATOM 9123  N N6    . DA  J 6 8   ? 109.984 149.490 131.339 1.00 405.85 ?  -66 DA  J N6    1 
ATOM 9124  N N1    . DA  J 6 8   ? 107.747 149.574 131.936 1.00 405.85 ?  -66 DA  J N1    1 
ATOM 9125  C C2    . DA  J 6 8   ? 106.593 148.934 132.171 1.00 405.85 ?  -66 DA  J C2    1 
ATOM 9126  N N3    . DA  J 6 8   ? 106.330 147.629 132.096 1.00 405.85 ?  -66 DA  J N3    1 
ATOM 9127  C C4    . DA  J 6 8   ? 107.426 146.941 131.734 1.00 405.85 ?  -66 DA  J C4    1 
ATOM 9128  P P     . DA  J 6 9   ? 103.793 141.416 129.845 1.00 377.09 ?  -65 DA  J P     1 
ATOM 9129  O OP1   . DA  J 6 9   ? 102.358 141.185 130.126 1.00 377.09 ?  -65 DA  J OP1   1 
ATOM 9130  O OP2   . DA  J 6 9   ? 104.701 140.261 129.671 1.00 377.09 -1 -65 DA  J OP2   1 
ATOM 9131  O "O5'" . DA  J 6 9   ? 103.958 142.353 128.558 1.00 377.09 ?  -65 DA  J "O5'" 1 
ATOM 9132  C "C5'" . DA  J 6 9   ? 102.832 143.026 128.007 1.00 377.09 ?  -65 DA  J "C5'" 1 
ATOM 9133  C "C4'" . DA  J 6 9   ? 102.454 144.244 128.833 1.00 377.09 ?  -65 DA  J "C4'" 1 
ATOM 9134  O "O4'" . DA  J 6 9   ? 103.657 144.949 129.252 1.00 377.09 ?  -65 DA  J "O4'" 1 
ATOM 9135  C "C3'" . DA  J 6 9   ? 101.599 145.274 128.091 1.00 377.09 ?  -65 DA  J "C3'" 1 
ATOM 9136  O "O3'" . DA  J 6 9   ? 100.566 145.761 128.935 1.00 377.09 ?  -65 DA  J "O3'" 1 
ATOM 9137  C "C2'" . DA  J 6 9   ? 102.604 146.368 127.761 1.00 377.09 ?  -65 DA  J "C2'" 1 
ATOM 9138  C "C1'" . DA  J 6 9   ? 103.488 146.320 128.988 1.00 377.09 ?  -65 DA  J "C1'" 1 
ATOM 9139  N N9    . DA  J 6 9   ? 104.795 146.943 128.796 1.00 377.09 ?  -65 DA  J N9    1 
ATOM 9140  C C8    . DA  J 6 9   ? 105.946 146.341 128.373 1.00 377.09 ?  -65 DA  J C8    1 
ATOM 9141  N N7    . DA  J 6 9   ? 106.971 147.156 128.293 1.00 377.09 ?  -65 DA  J N7    1 
ATOM 9142  C C5    . DA  J 6 9   ? 106.455 148.379 128.684 1.00 377.09 ?  -65 DA  J C5    1 
ATOM 9143  C C6    . DA  J 6 9   ? 107.032 149.658 128.815 1.00 377.09 ?  -65 DA  J C6    1 
ATOM 9144  N N6    . DA  J 6 9   ? 108.315 149.916 128.547 1.00 377.09 ?  -65 DA  J N6    1 
ATOM 9145  N N1    . DA  J 6 9   ? 106.235 150.668 129.231 1.00 377.09 ?  -65 DA  J N1    1 
ATOM 9146  C C2    . DA  J 6 9   ? 104.949 150.409 129.497 1.00 377.09 ?  -65 DA  J C2    1 
ATOM 9147  N N3    . DA  J 6 9   ? 104.297 149.250 129.414 1.00 377.09 ?  -65 DA  J N3    1 
ATOM 9148  C C4    . DA  J 6 9   ? 105.114 148.267 128.997 1.00 377.09 ?  -65 DA  J C4    1 
ATOM 9149  P P     . DG  J 6 10  ? 99.218  146.361 128.296 1.00 355.18 ?  -64 DG  J P     1 
ATOM 9150  O OP1   . DG  J 6 10  ? 98.259  146.579 129.400 1.00 355.18 ?  -64 DG  J OP1   1 
ATOM 9151  O OP2   . DG  J 6 10  ? 98.848  145.492 127.158 1.00 355.18 -1 -64 DG  J OP2   1 
ATOM 9152  O "O5'" . DG  J 6 10  ? 99.654  147.789 127.713 1.00 355.18 ?  -64 DG  J "O5'" 1 
ATOM 9153  C "C5'" . DG  J 6 10  ? 99.957  148.853 128.604 1.00 355.18 ?  -64 DG  J "C5'" 1 
ATOM 9154  C "C4'" . DG  J 6 10  ? 100.459 150.075 127.853 1.00 355.18 ?  -64 DG  J "C4'" 1 
ATOM 9155  O "O4'" . DG  J 6 10  ? 101.902 150.033 127.738 1.00 355.18 ?  -64 DG  J "O4'" 1 
ATOM 9156  C "C3'" . DG  J 6 10  ? 99.921  150.250 126.427 1.00 355.18 ?  -64 DG  J "C3'" 1 
ATOM 9157  O "O3'" . DG  J 6 10  ? 99.296  151.529 126.314 1.00 355.18 ?  -64 DG  J "O3'" 1 
ATOM 9158  C "C2'" . DG  J 6 10  ? 101.177 150.141 125.549 1.00 355.18 ?  -64 DG  J "C2'" 1 
ATOM 9159  C "C1'" . DG  J 6 10  ? 102.259 150.597 126.506 1.00 355.18 ?  -64 DG  J "C1'" 1 
ATOM 9160  N N9    . DG  J 6 10  ? 103.595 150.135 126.152 1.00 355.18 ?  -64 DG  J N9    1 
ATOM 9161  C C8    . DG  J 6 10  ? 103.964 148.863 125.805 1.00 355.18 ?  -64 DG  J C8    1 
ATOM 9162  N N7    . DG  J 6 10  ? 105.234 148.741 125.550 1.00 355.18 ?  -64 DG  J N7    1 
ATOM 9163  C C5    . DG  J 6 10  ? 105.739 150.016 125.738 1.00 355.18 ?  -64 DG  J C5    1 
ATOM 9164  C C6    . DG  J 6 10  ? 107.058 150.499 125.602 1.00 355.18 ?  -64 DG  J C6    1 
ATOM 9165  O O6    . DG  J 6 10  ? 108.074 149.873 125.278 1.00 355.18 ?  -64 DG  J O6    1 
ATOM 9166  N N1    . DG  J 6 10  ? 107.139 151.858 125.885 1.00 355.18 ?  -64 DG  J N1    1 
ATOM 9167  C C2    . DG  J 6 10  ? 106.079 152.646 126.255 1.00 355.18 ?  -64 DG  J C2    1 
ATOM 9168  N N2    . DG  J 6 10  ? 106.353 153.937 126.487 1.00 355.18 ?  -64 DG  J N2    1 
ATOM 9169  N N3    . DG  J 6 10  ? 104.836 152.205 126.382 1.00 355.18 ?  -64 DG  J N3    1 
ATOM 9170  C C4    . DG  J 6 10  ? 104.742 150.886 126.109 1.00 355.18 ?  -64 DG  J C4    1 
ATOM 9171  P P     . DT  J 6 11  ? 98.926  152.160 124.881 1.00 334.55 ?  -63 DT  J P     1 
ATOM 9172  O OP1   . DT  J 6 11  ? 97.745  153.025 125.087 1.00 334.55 ?  -63 DT  J OP1   1 
ATOM 9173  O OP2   . DT  J 6 11  ? 98.852  151.081 123.873 1.00 334.55 -1 -63 DT  J OP2   1 
ATOM 9174  O "O5'" . DT  J 6 11  ? 100.175 153.101 124.550 1.00 334.55 ?  -63 DT  J "O5'" 1 
ATOM 9175  C "C5'" . DT  J 6 11  ? 100.712 153.934 125.566 1.00 334.55 ?  -63 DT  J "C5'" 1 
ATOM 9176  C "C4'" . DT  J 6 11  ? 101.724 154.903 124.991 1.00 334.55 ?  -63 DT  J "C4'" 1 
ATOM 9177  O "O4'" . DT  J 6 11  ? 103.019 154.261 124.896 1.00 334.55 ?  -63 DT  J "O4'" 1 
ATOM 9178  C "C3'" . DT  J 6 11  ? 101.399 155.419 123.586 1.00 334.55 ?  -63 DT  J "C3'" 1 
ATOM 9179  O "O3'" . DT  J 6 11  ? 101.454 156.833 123.568 1.00 334.55 ?  -63 DT  J "O3'" 1 
ATOM 9180  C "C2'" . DT  J 6 11  ? 102.492 154.804 122.708 1.00 334.55 ?  -63 DT  J "C2'" 1 
ATOM 9181  C "C1'" . DT  J 6 11  ? 103.630 154.660 123.698 1.00 334.55 ?  -63 DT  J "C1'" 1 
ATOM 9182  N N1    . DT  J 6 11  ? 104.624 153.633 123.311 1.00 334.55 ?  -63 DT  J N1    1 
ATOM 9183  C C2    . DT  J 6 11  ? 105.949 153.982 123.211 1.00 334.55 ?  -63 DT  J C2    1 
ATOM 9184  O O2    . DT  J 6 11  ? 106.362 155.104 123.432 1.00 334.55 ?  -63 DT  J O2    1 
ATOM 9185  N N3    . DT  J 6 11  ? 106.782 152.961 122.849 1.00 334.55 ?  -63 DT  J N3    1 
ATOM 9186  C C4    . DT  J 6 11  ? 106.430 151.654 122.578 1.00 334.55 ?  -63 DT  J C4    1 
ATOM 9187  O O4    . DT  J 6 11  ? 107.258 150.805 122.256 1.00 334.55 ?  -63 DT  J O4    1 
ATOM 9188  C C5    . DT  J 6 11  ? 105.023 151.356 122.699 1.00 334.55 ?  -63 DT  J C5    1 
ATOM 9189  C C7    . DT  J 6 11  ? 104.517 149.971 122.425 1.00 334.55 ?  -63 DT  J C7    1 
ATOM 9190  C C6    . DT  J 6 11  ? 104.198 152.349 123.055 1.00 334.55 ?  -63 DT  J C6    1 
ATOM 9191  P P     . DT  J 6 12  ? 101.163 157.633 122.207 1.00 317.23 ?  -62 DT  J P     1 
ATOM 9192  O OP1   . DT  J 6 12  ? 100.506 158.906 122.574 1.00 317.23 ?  -62 DT  J OP1   1 
ATOM 9193  O OP2   . DT  J 6 12  ? 100.499 156.703 121.268 1.00 317.23 -1 -62 DT  J OP2   1 
ATOM 9194  O "O5'" . DT  J 6 12  ? 102.620 157.956 121.636 1.00 317.23 ?  -62 DT  J "O5'" 1 
ATOM 9195  C "C5'" . DT  J 6 12  ? 103.542 158.664 122.440 1.00 317.23 ?  -62 DT  J "C5'" 1 
ATOM 9196  C "C4'" . DT  J 6 12  ? 104.920 158.678 121.809 1.00 317.23 ?  -62 DT  J "C4'" 1 
ATOM 9197  O "O4'" . DT  J 6 12  ? 105.465 157.331 121.766 1.00 317.23 ?  -62 DT  J "O4'" 1 
ATOM 9198  C "C3'" . DT  J 6 12  ? 104.983 159.204 120.367 1.00 317.23 ?  -62 DT  J "C3'" 1 
ATOM 9199  O "O3'" . DT  J 6 12  ? 106.033 160.153 120.268 1.00 317.23 ?  -62 DT  J "O3'" 1 
ATOM 9200  C "C2'" . DT  J 6 12  ? 105.294 157.945 119.560 1.00 317.23 ?  -62 DT  J "C2'" 1 
ATOM 9201  C "C1'" . DT  J 6 12  ? 106.147 157.189 120.550 1.00 317.23 ?  -62 DT  J "C1'" 1 
ATOM 9202  N N1    . DT  J 6 12  ? 106.301 155.753 120.228 1.00 317.23 ?  -62 DT  J N1    1 
ATOM 9203  C C2    . DT  J 6 12  ? 107.565 155.224 120.133 1.00 317.23 ?  -62 DT  J C2    1 
ATOM 9204  O O2    . DT  J 6 12  ? 108.577 155.875 120.318 1.00 317.23 ?  -62 DT  J O2    1 
ATOM 9205  N N3    . DT  J 6 12  ? 107.606 153.897 119.820 1.00 317.23 ?  -62 DT  J N3    1 
ATOM 9206  C C4    . DT  J 6 12  ? 106.531 153.064 119.591 1.00 317.23 ?  -62 DT  J C4    1 
ATOM 9207  O O4    . DT  J 6 12  ? 106.670 151.879 119.314 1.00 317.23 ?  -62 DT  J O4    1 
ATOM 9208  C C5    . DT  J 6 12  ? 105.234 153.684 119.698 1.00 317.23 ?  -62 DT  J C5    1 
ATOM 9209  C C7    . DT  J 6 12  ? 103.993 152.878 119.468 1.00 317.23 ?  -62 DT  J C7    1 
ATOM 9210  C C6    . DT  J 6 12  ? 105.182 154.985 120.004 1.00 317.23 ?  -62 DT  J C6    1 
ATOM 9211  P P     . DC  J 6 13  ? 106.320 160.954 118.903 1.00 305.66 ?  -61 DC  J P     1 
ATOM 9212  O OP1   . DC  J 6 13  ? 105.967 162.365 119.159 1.00 305.66 ?  -61 DC  J OP1   1 
ATOM 9213  O OP2   . DC  J 6 13  ? 105.724 160.260 117.742 1.00 305.66 -1 -61 DC  J OP2   1 
ATOM 9214  O "O5'" . DC  J 6 13  ? 107.904 160.852 118.752 1.00 305.66 ?  -61 DC  J "O5'" 1 
ATOM 9215  C "C5'" . DC  J 6 13  ? 108.565 159.637 119.071 1.00 305.66 ?  -61 DC  J "C5'" 1 
ATOM 9216  C "C4'" . DC  J 6 13  ? 109.472 159.220 117.938 1.00 305.66 ?  -61 DC  J "C4'" 1 
ATOM 9217  O "O4'" . DC  J 6 13  ? 109.487 157.768 117.833 1.00 305.66 ?  -61 DC  J "O4'" 1 
ATOM 9218  C "C3'" . DC  J 6 13  ? 109.035 159.728 116.567 1.00 305.66 ?  -61 DC  J "C3'" 1 
ATOM 9219  O "O3'" . DC  J 6 13  ? 110.173 160.025 115.783 1.00 305.66 ?  -61 DC  J "O3'" 1 
ATOM 9220  C "C2'" . DC  J 6 13  ? 108.282 158.532 116.011 1.00 305.66 ?  -61 DC  J "C2'" 1 
ATOM 9221  C "C1'" . DC  J 6 13  ? 109.175 157.412 116.507 1.00 305.66 ?  -61 DC  J "C1'" 1 
ATOM 9222  N N1    . DC  J 6 13  ? 108.532 156.069 116.495 1.00 305.66 ?  -61 DC  J N1    1 
ATOM 9223  C C2    . DC  J 6 13  ? 109.325 154.930 116.344 1.00 305.66 ?  -61 DC  J C2    1 
ATOM 9224  O O2    . DC  J 6 13  ? 110.548 155.059 116.231 1.00 305.66 ?  -61 DC  J O2    1 
ATOM 9225  N N3    . DC  J 6 13  ? 108.730 153.716 116.327 1.00 305.66 ?  -61 DC  J N3    1 
ATOM 9226  C C4    . DC  J 6 13  ? 107.408 153.620 116.445 1.00 305.66 ?  -61 DC  J C4    1 
ATOM 9227  N N4    . DC  J 6 13  ? 106.867 152.400 116.426 1.00 305.66 ?  -61 DC  J N4    1 
ATOM 9228  C C5    . DC  J 6 13  ? 106.581 154.768 116.600 1.00 305.66 ?  -61 DC  J C5    1 
ATOM 9229  C C6    . DC  J 6 13  ? 107.179 155.961 116.616 1.00 305.66 ?  -61 DC  J C6    1 
ATOM 9230  P P     . DA  J 6 14  ? 110.051 161.032 114.539 1.00 302.74 ?  -60 DA  J P     1 
ATOM 9231  O OP1   . DA  J 6 14  ? 110.301 162.401 115.042 1.00 302.74 ?  -60 DA  J OP1   1 
ATOM 9232  O OP2   . DA  J 6 14  ? 108.789 160.720 113.833 1.00 302.74 -1 -60 DA  J OP2   1 
ATOM 9233  O "O5'" . DA  J 6 14  ? 111.255 160.605 113.585 1.00 302.74 ?  -60 DA  J "O5'" 1 
ATOM 9234  C "C5'" . DA  J 6 14  ? 112.577 160.567 114.092 1.00 302.74 ?  -60 DA  J "C5'" 1 
ATOM 9235  C "C4'" . DA  J 6 14  ? 113.256 159.256 113.743 1.00 302.74 ?  -60 DA  J "C4'" 1 
ATOM 9236  O "O4'" . DA  J 6 14  ? 112.385 158.151 114.089 1.00 302.74 ?  -60 DA  J "O4'" 1 
ATOM 9237  C "C3'" . DA  J 6 14  ? 113.608 159.075 112.270 1.00 302.74 ?  -60 DA  J "C3'" 1 
ATOM 9238  O "O3'" . DA  J 6 14  ? 114.850 158.416 112.166 1.00 302.74 ?  -60 DA  J "O3'" 1 
ATOM 9239  C "C2'" . DA  J 6 14  ? 112.472 158.204 111.747 1.00 302.74 ?  -60 DA  J "C2'" 1 
ATOM 9240  C "C1'" . DA  J 6 14  ? 112.161 157.341 112.957 1.00 302.74 ?  -60 DA  J "C1'" 1 
ATOM 9241  N N9    . DA  J 6 14  ? 110.779 156.899 112.993 1.00 302.74 ?  -60 DA  J N9    1 
ATOM 9242  C C8    . DA  J 6 14  ? 109.671 157.690 112.932 1.00 302.74 ?  -60 DA  J C8    1 
ATOM 9243  N N7    . DA  J 6 14  ? 108.544 157.025 112.990 1.00 302.74 ?  -60 DA  J N7    1 
ATOM 9244  C C5    . DA  J 6 14  ? 108.943 155.707 113.092 1.00 302.74 ?  -60 DA  J C5    1 
ATOM 9245  C C6    . DA  J 6 14  ? 108.223 154.507 113.188 1.00 302.74 ?  -60 DA  J C6    1 
ATOM 9246  N N6    . DA  J 6 14  ? 106.889 154.453 113.199 1.00 302.74 ?  -60 DA  J N6    1 
ATOM 9247  N N1    . DA  J 6 14  ? 108.927 153.359 113.274 1.00 302.74 ?  -60 DA  J N1    1 
ATOM 9248  C C2    . DA  J 6 14  ? 110.264 153.418 113.267 1.00 302.74 ?  -60 DA  J C2    1 
ATOM 9249  N N3    . DA  J 6 14  ? 111.050 154.488 113.180 1.00 302.74 ?  -60 DA  J N3    1 
ATOM 9250  C C4    . DA  J 6 14  ? 110.320 155.610 113.095 1.00 302.74 ?  -60 DA  J C4    1 
ATOM 9251  P P     . DT  J 6 15  ? 115.623 158.330 110.762 1.00 284.41 ?  -59 DT  J P     1 
ATOM 9252  O OP1   . DT  J 6 15  ? 116.633 159.408 110.747 1.00 284.41 ?  -59 DT  J OP1   1 
ATOM 9253  O OP2   . DT  J 6 15  ? 114.643 158.228 109.659 1.00 284.41 -1 -59 DT  J OP2   1 
ATOM 9254  O "O5'" . DT  J 6 15  ? 116.365 156.921 110.852 1.00 284.41 ?  -59 DT  J "O5'" 1 
ATOM 9255  C "C5'" . DT  J 6 15  ? 115.729 155.840 111.518 1.00 284.41 ?  -59 DT  J "C5'" 1 
ATOM 9256  C "C4'" . DT  J 6 15  ? 115.446 154.712 110.552 1.00 284.41 ?  -59 DT  J "C4'" 1 
ATOM 9257  O "O4'" . DT  J 6 15  ? 114.089 154.237 110.731 1.00 284.41 ?  -59 DT  J "O4'" 1 
ATOM 9258  C "C3'" . DT  J 6 15  ? 115.575 155.090 109.076 1.00 284.41 ?  -59 DT  J "C3'" 1 
ATOM 9259  O "O3'" . DT  J 6 15  ? 116.361 154.129 108.406 1.00 284.41 ?  -59 DT  J "O3'" 1 
ATOM 9260  C "C2'" . DT  J 6 15  ? 114.131 155.093 108.579 1.00 284.41 ?  -59 DT  J "C2'" 1 
ATOM 9261  C "C1'" . DT  J 6 15  ? 113.508 154.036 109.470 1.00 284.41 ?  -59 DT  J "C1'" 1 
ATOM 9262  N N1    . DT  J 6 15  ? 112.037 154.155 109.612 1.00 284.41 ?  -59 DT  J N1    1 
ATOM 9263  C C2    . DT  J 6 15  ? 111.306 153.035 109.900 1.00 284.41 ?  -59 DT  J C2    1 
ATOM 9264  O O2    . DT  J 6 15  ? 111.805 151.936 110.040 1.00 284.41 ?  -59 DT  J O2    1 
ATOM 9265  N N3    . DT  J 6 15  ? 109.962 153.243 110.015 1.00 284.41 ?  -59 DT  J N3    1 
ATOM 9266  C C4    . DT  J 6 15  ? 109.290 154.439 109.881 1.00 284.41 ?  -59 DT  J C4    1 
ATOM 9267  O O4    . DT  J 6 15  ? 108.076 154.526 110.004 1.00 284.41 ?  -59 DT  J O4    1 
ATOM 9268  C C5    . DT  J 6 15  ? 110.118 155.579 109.580 1.00 284.41 ?  -59 DT  J C5    1 
ATOM 9269  C C7    . DT  J 6 15  ? 109.500 156.933 109.407 1.00 284.41 ?  -59 DT  J C7    1 
ATOM 9270  C C6    . DT  J 6 15  ? 111.436 155.385 109.464 1.00 284.41 ?  -59 DT  J C6    1 
ATOM 9271  P P     . DA  J 6 16  ? 117.937 154.373 108.217 1.00 262.56 ?  -58 DA  J P     1 
ATOM 9272  O OP1   . DA  J 6 16  ? 118.570 154.475 109.551 1.00 262.56 ?  -58 DA  J OP1   1 
ATOM 9273  O OP2   . DA  J 6 16  ? 118.096 155.473 107.242 1.00 262.56 -1 -58 DA  J OP2   1 
ATOM 9274  O "O5'" . DA  J 6 16  ? 118.443 153.029 107.529 1.00 262.56 ?  -58 DA  J "O5'" 1 
ATOM 9275  C "C5'" . DA  J 6 16  ? 117.799 152.555 106.366 1.00 262.56 ?  -58 DA  J "C5'" 1 
ATOM 9276  C "C4'" . DA  J 6 16  ? 117.127 151.223 106.627 1.00 262.56 ?  -58 DA  J "C4'" 1 
ATOM 9277  O "O4'" . DA  J 6 16  ? 115.789 151.447 107.142 1.00 262.56 ?  -58 DA  J "O4'" 1 
ATOM 9278  C "C3'" . DA  J 6 16  ? 116.947 150.366 105.389 1.00 262.56 ?  -58 DA  J "C3'" 1 
ATOM 9279  O "O3'" . DA  J 6 16  ? 117.001 149.008 105.729 1.00 262.56 ?  -58 DA  J "O3'" 1 
ATOM 9280  C "C2'" . DA  J 6 16  ? 115.562 150.762 104.905 1.00 262.56 ?  -58 DA  J "C2'" 1 
ATOM 9281  C "C1'" . DA  J 6 16  ? 114.829 150.970 106.219 1.00 262.56 ?  -58 DA  J "C1'" 1 
ATOM 9282  N N9    . DA  J 6 16  ? 113.764 151.953 106.126 1.00 262.56 ?  -58 DA  J N9    1 
ATOM 9283  C C8    . DA  J 6 16  ? 113.866 153.228 105.657 1.00 262.56 ?  -58 DA  J C8    1 
ATOM 9284  N N7    . DA  J 6 16  ? 112.740 153.896 105.692 1.00 262.56 ?  -58 DA  J N7    1 
ATOM 9285  C C5    . DA  J 6 16  ? 111.838 152.991 106.216 1.00 262.56 ?  -58 DA  J C5    1 
ATOM 9286  C C6    . DA  J 6 16  ? 110.465 153.081 106.507 1.00 262.56 ?  -58 DA  J C6    1 
ATOM 9287  N N6    . DA  J 6 16  ? 109.740 154.181 106.298 1.00 262.56 ?  -58 DA  J N6    1 
ATOM 9288  N N1    . DA  J 6 16  ? 109.863 151.993 107.027 1.00 262.56 ?  -58 DA  J N1    1 
ATOM 9289  C C2    . DA  J 6 16  ? 110.590 150.891 107.231 1.00 262.56 ?  -58 DA  J C2    1 
ATOM 9290  N N3    . DA  J 6 16  ? 111.884 150.692 107.003 1.00 262.56 ?  -58 DA  J N3    1 
ATOM 9291  C C4    . DA  J 6 16  ? 112.453 151.788 106.488 1.00 262.56 ?  -58 DA  J C4    1 
ATOM 9292  P P     . DT  J 6 17  ? 117.283 147.924 104.583 1.00 247.59 ?  -57 DT  J P     1 
ATOM 9293  O OP1   . DT  J 6 17  ? 118.654 148.154 104.079 1.00 247.59 ?  -57 DT  J OP1   1 
ATOM 9294  O OP2   . DT  J 6 17  ? 116.137 147.963 103.651 1.00 247.59 -1 -57 DT  J OP2   1 
ATOM 9295  O "O5'" . DT  J 6 17  ? 117.233 146.532 105.359 1.00 247.59 ?  -57 DT  J "O5'" 1 
ATOM 9296  C "C5'" . DT  J 6 17  ? 116.330 146.359 106.432 1.00 247.59 ?  -57 DT  J "C5'" 1 
ATOM 9297  C "C4'" . DT  J 6 17  ? 114.942 146.007 105.928 1.00 247.59 ?  -57 DT  J "C4'" 1 
ATOM 9298  O "O4'" . DT  J 6 17  ? 114.203 147.200 105.624 1.00 247.59 ?  -57 DT  J "O4'" 1 
ATOM 9299  C "C3'" . DT  J 6 17  ? 114.898 145.163 104.652 1.00 247.59 ?  -57 DT  J "C3'" 1 
ATOM 9300  O "O3'" . DT  J 6 17  ? 114.501 143.848 104.977 1.00 247.59 ?  -57 DT  J "O3'" 1 
ATOM 9301  C "C2'" . DT  J 6 17  ? 113.859 145.875 103.756 1.00 247.59 ?  -57 DT  J "C2'" 1 
ATOM 9302  C "C1'" . DT  J 6 17  ? 113.193 146.841 104.727 1.00 247.59 ?  -57 DT  J "C1'" 1 
ATOM 9303  N N1    . DT  J 6 17  ? 112.650 148.079 104.102 1.00 247.59 ?  -57 DT  J N1    1 
ATOM 9304  C C2    . DT  J 6 17  ? 111.495 148.622 104.603 1.00 247.59 ?  -57 DT  J C2    1 
ATOM 9305  O O2    . DT  J 6 17  ? 110.882 148.139 105.533 1.00 247.59 ?  -57 DT  J O2    1 
ATOM 9306  N N3    . DT  J 6 17  ? 111.081 149.762 103.980 1.00 247.59 ?  -57 DT  J N3    1 
ATOM 9307  C C4    . DT  J 6 17  ? 111.688 150.403 102.928 1.00 247.59 ?  -57 DT  J C4    1 
ATOM 9308  O O4    . DT  J 6 17  ? 111.228 151.424 102.430 1.00 247.59 ?  -57 DT  J O4    1 
ATOM 9309  C C5    . DT  J 6 17  ? 112.896 149.783 102.445 1.00 247.59 ?  -57 DT  J C5    1 
ATOM 9310  C C7    . DT  J 6 17  ? 113.647 150.390 101.298 1.00 247.59 ?  -57 DT  J C7    1 
ATOM 9311  C C6    . DT  J 6 17  ? 113.316 148.663 103.051 1.00 247.59 ?  -57 DT  J C6    1 
ATOM 9312  P P     . DA  J 6 18  ? 114.443 142.712 103.849 1.00 235.86 ?  -56 DA  J P     1 
ATOM 9313  O OP1   . DA  J 6 18  ? 114.776 141.426 104.498 1.00 235.86 ?  -56 DA  J OP1   1 
ATOM 9314  O OP2   . DA  J 6 18  ? 115.222 143.181 102.685 1.00 235.86 -1 -56 DA  J OP2   1 
ATOM 9315  O "O5'" . DA  J 6 18  ? 112.905 142.686 103.440 1.00 235.86 ?  -56 DA  J "O5'" 1 
ATOM 9316  C "C5'" . DA  J 6 18  ? 111.918 142.795 104.443 1.00 235.86 ?  -56 DA  J "C5'" 1 
ATOM 9317  C "C4'" . DA  J 6 18  ? 110.609 143.248 103.845 1.00 235.86 ?  -56 DA  J "C4'" 1 
ATOM 9318  O "O4'" . DA  J 6 18  ? 110.691 144.643 103.487 1.00 235.86 ?  -56 DA  J "O4'" 1 
ATOM 9319  C "C3'" . DA  J 6 18  ? 110.217 142.515 102.568 1.00 235.86 ?  -56 DA  J "C3'" 1 
ATOM 9320  O "O3'" . DA  J 6 18  ? 109.083 141.748 102.806 1.00 235.86 ?  -56 DA  J "O3'" 1 
ATOM 9321  C "C2'" . DA  J 6 18  ? 109.936 143.630 101.548 1.00 235.86 ?  -56 DA  J "C2'" 1 
ATOM 9322  C "C1'" . DA  J 6 18  ? 109.812 144.863 102.420 1.00 235.86 ?  -56 DA  J "C1'" 1 
ATOM 9323  N N9    . DA  J 6 18  ? 110.194 146.092 101.735 1.00 235.86 ?  -56 DA  J N9    1 
ATOM 9324  C C8    . DA  J 6 18  ? 111.380 146.355 101.117 1.00 235.86 ?  -56 DA  J C8    1 
ATOM 9325  N N7    . DA  J 6 18  ? 111.441 147.545 100.575 1.00 235.86 ?  -56 DA  J N7    1 
ATOM 9326  C C5    . DA  J 6 18  ? 110.209 148.099 100.858 1.00 235.86 ?  -56 DA  J C5    1 
ATOM 9327  C C6    . DA  J 6 18  ? 109.640 149.349 100.558 1.00 235.86 ?  -56 DA  J C6    1 
ATOM 9328  N N6    . DA  J 6 18  ? 110.281 150.304 99.880  1.00 235.86 ?  -56 DA  J N6    1 
ATOM 9329  N N1    . DA  J 6 18  ? 108.385 149.585 100.989 1.00 235.86 ?  -56 DA  J N1    1 
ATOM 9330  C C2    . DA  J 6 18  ? 107.748 148.631 101.674 1.00 235.86 ?  -56 DA  J C2    1 
ATOM 9331  N N3    . DA  J 6 18  ? 108.178 147.418 102.006 1.00 235.86 ?  -56 DA  J N3    1 
ATOM 9332  C C4    . DA  J 6 18  ? 109.427 147.216 101.569 1.00 235.86 ?  -56 DA  J C4    1 
ATOM 9333  P P     . DA  J 6 19  ? 108.382 140.960 101.602 1.00 228.51 ?  -55 DA  J P     1 
ATOM 9334  O OP1   . DA  J 6 19  ? 107.875 139.702 102.179 1.00 228.51 ?  -55 DA  J OP1   1 
ATOM 9335  O OP2   . DA  J 6 19  ? 109.303 140.915 100.447 1.00 228.51 -1 -55 DA  J OP2   1 
ATOM 9336  O "O5'" . DA  J 6 19  ? 107.151 141.893 101.225 1.00 228.51 ?  -55 DA  J "O5'" 1 
ATOM 9337  C "C5'" . DA  J 6 19  ? 106.391 142.470 102.257 1.00 228.51 ?  -55 DA  J "C5'" 1 
ATOM 9338  C "C4'" . DA  J 6 19  ? 105.544 143.597 101.727 1.00 228.51 ?  -55 DA  J "C4'" 1 
ATOM 9339  O "O4'" . DA  J 6 19  ? 106.398 144.671 101.274 1.00 228.51 ?  -55 DA  J "O4'" 1 
ATOM 9340  C "C3'" . DA  J 6 19  ? 104.648 143.234 100.539 1.00 228.51 ?  -55 DA  J "C3'" 1 
ATOM 9341  O "O3'" . DA  J 6 19  ? 103.331 143.680 100.784 1.00 228.51 ?  -55 DA  J "O3'" 1 
ATOM 9342  C "C2'" . DA  J 6 19  ? 105.278 143.994 99.377  1.00 228.51 ?  -55 DA  J "C2'" 1 
ATOM 9343  C "C1'" . DA  J 6 19  ? 105.854 145.193 100.097 1.00 228.51 ?  -55 DA  J "C1'" 1 
ATOM 9344  N N9    . DA  J 6 19  ? 106.904 145.875 99.359  1.00 228.51 ?  -55 DA  J N9    1 
ATOM 9345  C C8    . DA  J 6 19  ? 108.142 145.397 99.047  1.00 228.51 ?  -55 DA  J C8    1 
ATOM 9346  N N7    . DA  J 6 19  ? 108.876 146.240 98.367  1.00 228.51 ?  -55 DA  J N7    1 
ATOM 9347  C C5    . DA  J 6 19  ? 108.058 147.342 98.226  1.00 228.51 ?  -55 DA  J C5    1 
ATOM 9348  C C6    . DA  J 6 19  ? 108.243 148.585 97.603  1.00 228.51 ?  -55 DA  J C6    1 
ATOM 9349  N N6    . DA  J 6 19  ? 109.369 148.928 96.974  1.00 228.51 ?  -55 DA  J N6    1 
ATOM 9350  N N1    . DA  J 6 19  ? 107.222 149.465 97.644  1.00 228.51 ?  -55 DA  J N1    1 
ATOM 9351  C C2    . DA  J 6 19  ? 106.097 149.119 98.277  1.00 228.51 ?  -55 DA  J C2    1 
ATOM 9352  N N3    . DA  J 6 19  ? 105.807 147.981 98.893  1.00 228.51 ?  -55 DA  J N3    1 
ATOM 9353  C C4    . DA  J 6 19  ? 106.838 147.128 98.826  1.00 228.51 ?  -55 DA  J C4    1 
ATOM 9354  P P     . DA  J 6 20  ? 102.159 143.330 99.747  1.00 234.15 ?  -54 DA  J P     1 
ATOM 9355  O OP1   . DA  J 6 20  ? 100.993 142.868 100.524 1.00 234.15 ?  -54 DA  J OP1   1 
ATOM 9356  O OP2   . DA  J 6 20  ? 102.728 142.489 98.678  1.00 234.15 -1 -54 DA  J OP2   1 
ATOM 9357  O "O5'" . DA  J 6 20  ? 101.782 144.736 99.104  1.00 234.15 ?  -54 DA  J "O5'" 1 
ATOM 9358  C "C5'" . DA  J 6 20  ? 100.764 145.521 99.690  1.00 234.15 ?  -54 DA  J "C5'" 1 
ATOM 9359  C "C4'" . DA  J 6 20  ? 100.452 146.734 98.835  1.00 234.15 ?  -54 DA  J "C4'" 1 
ATOM 9360  O "O4'" . DA  J 6 20  ? 101.686 147.332 98.366  1.00 234.15 ?  -54 DA  J "O4'" 1 
ATOM 9361  C "C3'" . DA  J 6 20  ? 99.621  146.455 97.592  1.00 234.15 ?  -54 DA  J "C3'" 1 
ATOM 9362  O "O3'" . DA  J 6 20  ? 98.745  147.534 97.359  1.00 234.15 ?  -54 DA  J "O3'" 1 
ATOM 9363  C "C2'" . DA  J 6 20  ? 100.670 146.339 96.492  1.00 234.15 ?  -54 DA  J "C2'" 1 
ATOM 9364  C "C1'" . DA  J 6 20  ? 101.728 147.330 96.954  1.00 234.15 ?  -54 DA  J "C1'" 1 
ATOM 9365  N N9    . DA  J 6 20  ? 103.079 146.959 96.556  1.00 234.15 ?  -54 DA  J N9    1 
ATOM 9366  C C8    . DA  J 6 20  ? 103.679 145.749 96.737  1.00 234.15 ?  -54 DA  J C8    1 
ATOM 9367  N N7    . DA  J 6 20  ? 104.909 145.697 96.292  1.00 234.15 ?  -54 DA  J N7    1 
ATOM 9368  C C5    . DA  J 6 20  ? 105.132 146.961 95.788  1.00 234.15 ?  -54 DA  J C5    1 
ATOM 9369  C C6    . DA  J 6 20  ? 106.248 147.548 95.170  1.00 234.15 ?  -54 DA  J C6    1 
ATOM 9370  N N6    . DA  J 6 20  ? 107.394 146.901 94.958  1.00 234.15 ?  -54 DA  J N6    1 
ATOM 9371  N N1    . DA  J 6 20  ? 106.145 148.836 94.784  1.00 234.15 ?  -54 DA  J N1    1 
ATOM 9372  C C2    . DA  J 6 20  ? 104.997 149.487 95.004  1.00 234.15 ?  -54 DA  J C2    1 
ATOM 9373  N N3    . DA  J 6 20  ? 103.877 149.035 95.570  1.00 234.15 ?  -54 DA  J N3    1 
ATOM 9374  C C4    . DA  J 6 20  ? 104.014 147.754 95.943  1.00 234.15 ?  -54 DA  J C4    1 
ATOM 9375  P P     . DA  J 6 21  ? 97.546  147.390 96.303  1.00 253.61 ?  -53 DA  J P     1 
ATOM 9376  O OP1   . DA  J 6 21  ? 96.293  147.716 97.016  1.00 253.61 ?  -53 DA  J OP1   1 
ATOM 9377  O OP2   . DA  J 6 21  ? 97.688  146.090 95.616  1.00 253.61 -1 -53 DA  J OP2   1 
ATOM 9378  O "O5'" . DA  J 6 21  ? 97.847  148.539 95.238  1.00 253.61 ?  -53 DA  J "O5'" 1 
ATOM 9379  C "C5'" . DA  J 6 21  ? 98.020  149.876 95.682  1.00 253.61 ?  -53 DA  J "C5'" 1 
ATOM 9380  C "C4'" . DA  J 6 21  ? 98.713  150.716 94.625  1.00 253.61 ?  -53 DA  J "C4'" 1 
ATOM 9381  O "O4'" . DA  J 6 21  ? 100.087 150.282 94.479  1.00 253.61 ?  -53 DA  J "O4'" 1 
ATOM 9382  C "C3'" . DA  J 6 21  ? 98.090  150.648 93.231  1.00 253.61 ?  -53 DA  J "C3'" 1 
ATOM 9383  O "O3'" . DA  J 6 21  ? 97.971  151.956 92.699  1.00 253.61 ?  -53 DA  J "O3'" 1 
ATOM 9384  C "C2'" . DA  J 6 21  ? 99.083  149.802 92.435  1.00 253.61 ?  -53 DA  J "C2'" 1 
ATOM 9385  C "C1'" . DA  J 6 21  ? 100.393 150.150 93.115  1.00 253.61 ?  -53 DA  J "C1'" 1 
ATOM 9386  N N9    . DA  J 6 21  ? 101.407 149.119 92.980  1.00 253.61 ?  -53 DA  J N9    1 
ATOM 9387  C C8    . DA  J 6 21  ? 101.322 147.824 93.395  1.00 253.61 ?  -53 DA  J C8    1 
ATOM 9388  N N7    . DA  J 6 21  ? 102.397 147.117 93.148  1.00 253.61 ?  -53 DA  J N7    1 
ATOM 9389  C C5    . DA  J 6 21  ? 103.241 148.012 92.524  1.00 253.61 ?  -53 DA  J C5    1 
ATOM 9390  C C6    . DA  J 6 21  ? 104.546 147.890 92.017  1.00 253.61 ?  -53 DA  J C6    1 
ATOM 9391  N N6    . DA  J 6 21  ? 105.241 146.752 92.049  1.00 253.61 ?  -53 DA  J N6    1 
ATOM 9392  N N1    . DA  J 6 21  ? 105.105 148.984 91.456  1.00 253.61 ?  -53 DA  J N1    1 
ATOM 9393  C C2    . DA  J 6 21  ? 104.404 150.123 91.425  1.00 253.61 ?  -53 DA  J C2    1 
ATOM 9394  N N3    . DA  J 6 21  ? 103.174 150.358 91.873  1.00 253.61 ?  -53 DA  J N3    1 
ATOM 9395  C C4    . DA  J 6 21  ? 102.647 149.253 92.419  1.00 253.61 ?  -53 DA  J C4    1 
ATOM 9396  P P     . DG  J 6 22  ? 97.150  152.206 91.343  1.00 271.49 ?  -52 DG  J P     1 
ATOM 9397  O OP1   . DG  J 6 22  ? 96.591  153.573 91.403  1.00 271.49 ?  -52 DG  J OP1   1 
ATOM 9398  O OP2   . DG  J 6 22  ? 96.249  151.052 91.141  1.00 271.49 -1 -52 DG  J OP2   1 
ATOM 9399  O "O5'" . DG  J 6 22  ? 98.275  152.168 90.214  1.00 271.49 ?  -52 DG  J "O5'" 1 
ATOM 9400  C "C5'" . DG  J 6 22  ? 99.476  152.887 90.407  1.00 271.49 ?  -52 DG  J "C5'" 1 
ATOM 9401  C "C4'" . DG  J 6 22  ? 100.388 152.739 89.210  1.00 271.49 ?  -52 DG  J "C4'" 1 
ATOM 9402  O "O4'" . DG  J 6 22  ? 101.365 151.698 89.459  1.00 271.49 ?  -52 DG  J "O4'" 1 
ATOM 9403  C "C3'" . DG  J 6 22  ? 99.686  152.361 87.904  1.00 271.49 ?  -52 DG  J "C3'" 1 
ATOM 9404  O "O3'" . DG  J 6 22  ? 100.179 153.176 86.863  1.00 271.49 ?  -52 DG  J "O3'" 1 
ATOM 9405  C "C2'" . DG  J 6 22  ? 100.092 150.902 87.708  1.00 271.49 ?  -52 DG  J "C2'" 1 
ATOM 9406  C "C1'" . DG  J 6 22  ? 101.484 150.916 88.301  1.00 271.49 ?  -52 DG  J "C1'" 1 
ATOM 9407  N N9    . DG  J 6 22  ? 101.988 149.601 88.676  1.00 271.49 ?  -52 DG  J N9    1 
ATOM 9408  C C8    . DG  J 6 22  ? 101.327 148.629 89.384  1.00 271.49 ?  -52 DG  J C8    1 
ATOM 9409  N N7    . DG  J 6 22  ? 102.037 147.553 89.573  1.00 271.49 ?  -52 DG  J N7    1 
ATOM 9410  C C5    . DG  J 6 22  ? 103.246 147.831 88.951  1.00 271.49 ?  -52 DG  J C5    1 
ATOM 9411  C C6    . DG  J 6 22  ? 104.411 147.039 88.830  1.00 271.49 ?  -52 DG  J C6    1 
ATOM 9412  O O6    . DG  J 6 22  ? 104.608 145.896 89.259  1.00 271.49 ?  -52 DG  J O6    1 
ATOM 9413  N N1    . DG  J 6 22  ? 105.412 147.699 88.125  1.00 271.49 ?  -52 DG  J N1    1 
ATOM 9414  C C2    . DG  J 6 22  ? 105.300 148.964 87.606  1.00 271.49 ?  -52 DG  J C2    1 
ATOM 9415  N N2    . DG  J 6 22  ? 106.370 149.435 86.956  1.00 271.49 ?  -52 DG  J N2    1 
ATOM 9416  N N3    . DG  J 6 22  ? 104.215 149.717 87.714  1.00 271.49 ?  -52 DG  J N3    1 
ATOM 9417  C C4    . DG  J 6 22  ? 103.231 149.087 88.397  1.00 271.49 ?  -52 DG  J C4    1 
ATOM 9418  P P     . DG  J 6 23  ? 99.408  153.272 85.458  1.00 283.60 ?  -51 DG  J P     1 
ATOM 9419  O OP1   . DG  J 6 23  ? 98.490  154.430 85.529  1.00 283.60 ?  -51 DG  J OP1   1 
ATOM 9420  O OP2   . DG  J 6 23  ? 98.888  151.932 85.114  1.00 283.60 -1 -51 DG  J OP2   1 
ATOM 9421  O "O5'" . DG  J 6 23  ? 100.578 153.605 84.428  1.00 283.60 ?  -51 DG  J "O5'" 1 
ATOM 9422  C "C5'" . DG  J 6 23  ? 101.927 153.389 84.814  1.00 283.60 ?  -51 DG  J "C5'" 1 
ATOM 9423  C "C4'" . DG  J 6 23  ? 102.584 152.352 83.926  1.00 283.60 ?  -51 DG  J "C4'" 1 
ATOM 9424  O "O4'" . DG  J 6 23  ? 102.901 151.165 84.697  1.00 283.60 ?  -51 DG  J "O4'" 1 
ATOM 9425  C "C3'" . DG  J 6 23  ? 101.734 151.873 82.740  1.00 283.60 ?  -51 DG  J "C3'" 1 
ATOM 9426  O "O3'" . DG  J 6 23  ? 102.485 151.993 81.548  1.00 283.60 ?  -51 DG  J "O3'" 1 
ATOM 9427  C "C2'" . DG  J 6 23  ? 101.452 150.407 83.073  1.00 283.60 ?  -51 DG  J "C2'" 1 
ATOM 9428  C "C1'" . DG  J 6 23  ? 102.688 150.053 83.873  1.00 283.60 ?  -51 DG  J "C1'" 1 
ATOM 9429  N N9    . DG  J 6 23  ? 102.542 148.858 84.695  1.00 283.60 ?  -51 DG  J N9    1 
ATOM 9430  C C8    . DG  J 6 23  ? 101.507 148.545 85.538  1.00 283.60 ?  -51 DG  J C8    1 
ATOM 9431  N N7    . DG  J 6 23  ? 101.653 147.395 86.135  1.00 283.60 ?  -51 DG  J N7    1 
ATOM 9432  C C5    . DG  J 6 23  ? 102.862 146.916 85.652  1.00 283.60 ?  -51 DG  J C5    1 
ATOM 9433  C C6    . DG  J 6 23  ? 103.544 145.711 85.932  1.00 283.60 ?  -51 DG  J C6    1 
ATOM 9434  O O6    . DG  J 6 23  ? 103.207 144.801 86.700  1.00 283.60 ?  -51 DG  J O6    1 
ATOM 9435  N N1    . DG  J 6 23  ? 104.741 145.620 85.229  1.00 283.60 ?  -51 DG  J N1    1 
ATOM 9436  C C2    . DG  J 6 23  ? 105.211 146.569 84.357  1.00 283.60 ?  -51 DG  J C2    1 
ATOM 9437  N N2    . DG  J 6 23  ? 106.380 146.305 83.763  1.00 283.60 ?  -51 DG  J N2    1 
ATOM 9438  N N3    . DG  J 6 23  ? 104.579 147.699 84.082  1.00 283.60 ?  -51 DG  J N3    1 
ATOM 9439  C C4    . DG  J 6 23  ? 103.416 147.804 84.762  1.00 283.60 ?  -51 DG  J C4    1 
ATOM 9440  P P     . DC  J 6 24  ? 101.769 151.913 80.112  1.00 286.05 ?  -50 DC  J P     1 
ATOM 9441  O OP1   . DC  J 6 24  ? 101.171 153.234 79.831  1.00 286.05 ?  -50 DC  J OP1   1 
ATOM 9442  O OP2   . DC  J 6 24  ? 100.927 150.698 80.072  1.00 286.05 -1 -50 DC  J OP2   1 
ATOM 9443  O "O5'" . DC  J 6 24  ? 102.991 151.694 79.114  1.00 286.05 ?  -50 DC  J "O5'" 1 
ATOM 9444  C "C5'" . DC  J 6 24  ? 104.215 151.178 79.615  1.00 286.05 ?  -50 DC  J "C5'" 1 
ATOM 9445  C "C4'" . DC  J 6 24  ? 104.447 149.763 79.121  1.00 286.05 ?  -50 DC  J "C4'" 1 
ATOM 9446  O "O4'" . DC  J 6 24  ? 104.217 148.809 80.197  1.00 286.05 ?  -50 DC  J "O4'" 1 
ATOM 9447  C "C3'" . DC  J 6 24  ? 103.536 149.318 77.973  1.00 286.05 ?  -50 DC  J "C3'" 1 
ATOM 9448  O "O3'" . DC  J 6 24  ? 104.286 148.548 77.067  1.00 286.05 ?  -50 DC  J "O3'" 1 
ATOM 9449  C "C2'" . DC  J 6 24  ? 102.515 148.448 78.691  1.00 286.05 ?  -50 DC  J "C2'" 1 
ATOM 9450  C "C1'" . DC  J 6 24  ? 103.432 147.764 79.681  1.00 286.05 ?  -50 DC  J "C1'" 1 
ATOM 9451  N N1    . DC  J 6 24  ? 102.735 147.060 80.794  1.00 286.05 ?  -50 DC  J N1    1 
ATOM 9452  C C2    . DC  J 6 24  ? 103.427 146.102 81.533  1.00 286.05 ?  -50 DC  J C2    1 
ATOM 9453  O O2    . DC  J 6 24  ? 104.608 145.873 81.261  1.00 286.05 ?  -50 DC  J O2    1 
ATOM 9454  N N3    . DC  J 6 24  ? 102.787 145.461 82.539  1.00 286.05 ?  -50 DC  J N3    1 
ATOM 9455  C C4    . DC  J 6 24  ? 101.514 145.742 82.803  1.00 286.05 ?  -50 DC  J C4    1 
ATOM 9456  N N4    . DC  J 6 24  ? 100.924 145.085 83.804  1.00 286.05 ?  -50 DC  J N4    1 
ATOM 9457  C C5    . DC  J 6 24  ? 100.788 146.709 82.054  1.00 286.05 ?  -50 DC  J C5    1 
ATOM 9458  C C6    . DC  J 6 24  ? 101.430 147.336 81.066  1.00 286.05 ?  -50 DC  J C6    1 
ATOM 9459  P P     . DA  J 6 25  ? 104.307 148.905 75.505  1.00 284.35 ?  -49 DA  J P     1 
ATOM 9460  O OP1   . DA  J 6 25  ? 104.148 150.368 75.373  1.00 284.35 ?  -49 DA  J OP1   1 
ATOM 9461  O OP2   . DA  J 6 25  ? 103.359 147.993 74.828  1.00 284.35 -1 -49 DA  J OP2   1 
ATOM 9462  O "O5'" . DA  J 6 25  ? 105.784 148.497 75.057  1.00 284.35 ?  -49 DA  J "O5'" 1 
ATOM 9463  C "C5'" . DA  J 6 25  ? 106.819 148.430 76.029  1.00 284.35 ?  -49 DA  J "C5'" 1 
ATOM 9464  C "C4'" . DA  J 6 25  ? 107.176 146.988 76.354  1.00 284.35 ?  -49 DA  J "C4'" 1 
ATOM 9465  O "O4'" . DA  J 6 25  ? 106.239 146.443 77.320  1.00 284.35 ?  -49 DA  J "O4'" 1 
ATOM 9466  C "C3'" . DA  J 6 25  ? 107.172 146.026 75.170  1.00 284.35 ?  -49 DA  J "C3'" 1 
ATOM 9467  O "O3'" . DA  J 6 25  ? 108.297 145.178 75.264  1.00 284.35 ?  -49 DA  J "O3'" 1 
ATOM 9468  C "C2'" . DA  J 6 25  ? 105.867 145.249 75.353  1.00 284.35 ?  -49 DA  J "C2'" 1 
ATOM 9469  C "C1'" . DA  J 6 25  ? 105.764 145.195 76.865  1.00 284.35 ?  -49 DA  J "C1'" 1 
ATOM 9470  N N9    . DA  J 6 25  ? 104.400 145.029 77.352  1.00 284.35 ?  -49 DA  J N9    1 
ATOM 9471  C C8    . DA  J 6 25  ? 103.271 145.598 76.841  1.00 284.35 ?  -49 DA  J C8    1 
ATOM 9472  N N7    . DA  J 6 25  ? 102.177 145.285 77.493  1.00 284.35 ?  -49 DA  J N7    1 
ATOM 9473  C C5    . DA  J 6 25  ? 102.621 144.453 78.502  1.00 284.35 ?  -49 DA  J C5    1 
ATOM 9474  C C6    . DA  J 6 25  ? 101.951 143.778 79.537  1.00 284.35 ?  -49 DA  J C6    1 
ATOM 9475  N N6    . DA  J 6 25  ? 100.631 143.846 79.723  1.00 284.35 ?  -49 DA  J N6    1 
ATOM 9476  N N1    . DA  J 6 25  ? 102.689 143.021 80.372  1.00 284.35 ?  -49 DA  J N1    1 
ATOM 9477  C C2    . DA  J 6 25  ? 104.010 142.947 80.179  1.00 284.35 ?  -49 DA  J C2    1 
ATOM 9478  N N3    . DA  J 6 25  ? 104.752 143.541 79.247  1.00 284.35 ?  -49 DA  J N3    1 
ATOM 9479  C C4    . DA  J 6 25  ? 103.989 144.282 78.431  1.00 284.35 ?  -49 DA  J C4    1 
ATOM 9480  P P     . DA  J 6 26  ? 108.745 144.270 74.019  1.00 283.62 ?  -48 DA  J P     1 
ATOM 9481  O OP1   . DA  J 6 26  ? 110.044 144.780 73.532  1.00 283.62 ?  -48 DA  J OP1   1 
ATOM 9482  O OP2   . DA  J 6 26  ? 107.601 144.153 73.089  1.00 283.62 -1 -48 DA  J OP2   1 
ATOM 9483  O "O5'" . DA  J 6 26  ? 108.972 142.832 74.678  1.00 283.62 ?  -48 DA  J "O5'" 1 
ATOM 9484  C "C5'" . DA  J 6 26  ? 108.194 142.438 75.802  1.00 283.62 ?  -48 DA  J "C5'" 1 
ATOM 9485  C "C4'" . DA  J 6 26  ? 107.259 141.300 75.444  1.00 283.62 ?  -48 DA  J "C4'" 1 
ATOM 9486  O "O4'" . DA  J 6 26  ? 105.942 141.558 75.988  1.00 283.62 ?  -48 DA  J "O4'" 1 
ATOM 9487  C "C3'" . DA  J 6 26  ? 107.062 141.068 73.941  1.00 283.62 ?  -48 DA  J "C3'" 1 
ATOM 9488  O "O3'" . DA  J 6 26  ? 107.385 139.732 73.610  1.00 283.62 ?  -48 DA  J "O3'" 1 
ATOM 9489  C "C2'" . DA  J 6 26  ? 105.578 141.363 73.712  1.00 283.62 ?  -48 DA  J "C2'" 1 
ATOM 9490  C "C1'" . DA  J 6 26  ? 104.994 141.071 75.081  1.00 283.62 ?  -48 DA  J "C1'" 1 
ATOM 9491  N N9    . DA  J 6 26  ? 103.725 141.741 75.319  1.00 283.62 ?  -48 DA  J N9    1 
ATOM 9492  C C8    . DA  J 6 26  ? 103.226 142.815 74.641  1.00 283.62 ?  -48 DA  J C8    1 
ATOM 9493  N N7    . DA  J 6 26  ? 102.049 143.205 75.063  1.00 283.62 ?  -48 DA  J N7    1 
ATOM 9494  C C5    . DA  J 6 26  ? 101.756 142.324 76.086  1.00 283.62 ?  -48 DA  J C5    1 
ATOM 9495  C C6    . DA  J 6 26  ? 100.649 142.203 76.940  1.00 283.62 ?  -48 DA  J C6    1 
ATOM 9496  N N6    . DA  J 6 26  ? 99.594  143.019 76.890  1.00 283.62 ?  -48 DA  J N6    1 
ATOM 9497  N N1    . DA  J 6 26  ? 100.670 141.216 77.859  1.00 283.62 ?  -48 DA  J N1    1 
ATOM 9498  C C2    . DA  J 6 26  ? 101.731 140.405 77.911  1.00 283.62 ?  -48 DA  J C2    1 
ATOM 9499  N N3    . DA  J 6 26  ? 102.828 140.417 77.156  1.00 283.62 ?  -48 DA  J N3    1 
ATOM 9500  C C4    . DA  J 6 26  ? 102.777 141.413 76.258  1.00 283.62 ?  -48 DA  J C4    1 
ATOM 9501  P P     . DA  J 6 27  ? 108.776 139.396 72.881  1.00 276.59 ?  -47 DA  J P     1 
ATOM 9502  O OP1   . DA  J 6 27  ? 109.673 140.561 73.041  1.00 276.59 ?  -47 DA  J OP1   1 
ATOM 9503  O OP2   . DA  J 6 27  ? 108.461 138.890 71.526  1.00 276.59 -1 -47 DA  J OP2   1 
ATOM 9504  O "O5'" . DA  J 6 27  ? 109.368 138.182 73.735  1.00 276.59 ?  -47 DA  J "O5'" 1 
ATOM 9505  C "C5'" . DA  J 6 27  ? 109.267 138.197 75.149  1.00 276.59 ?  -47 DA  J "C5'" 1 
ATOM 9506  C "C4'" . DA  J 6 27  ? 108.284 137.145 75.618  1.00 276.59 ?  -47 DA  J "C4'" 1 
ATOM 9507  O "O4'" . DA  J 6 27  ? 106.938 137.682 75.599  1.00 276.59 ?  -47 DA  J "O4'" 1 
ATOM 9508  C "C3'" . DA  J 6 27  ? 108.253 135.879 74.761  1.00 276.59 ?  -47 DA  J "C3'" 1 
ATOM 9509  O "O3'" . DA  J 6 27  ? 108.451 134.746 75.587  1.00 276.59 ?  -47 DA  J "O3'" 1 
ATOM 9510  C "C2'" . DA  J 6 27  ? 106.859 135.897 74.125  1.00 276.59 ?  -47 DA  J "C2'" 1 
ATOM 9511  C "C1'" . DA  J 6 27  ? 106.060 136.688 75.140  1.00 276.59 ?  -47 DA  J "C1'" 1 
ATOM 9512  N N9    . DA  J 6 27  ? 104.879 137.330 74.575  1.00 276.59 ?  -47 DA  J N9    1 
ATOM 9513  C C8    . DA  J 6 27  ? 104.785 137.956 73.368  1.00 276.59 ?  -47 DA  J C8    1 
ATOM 9514  N N7    . DA  J 6 27  ? 103.595 138.446 73.118  1.00 276.59 ?  -47 DA  J N7    1 
ATOM 9515  C C5    . DA  J 6 27  ? 102.858 138.111 74.237  1.00 276.59 ?  -47 DA  J C5    1 
ATOM 9516  C C6    . DA  J 6 27  ? 101.519 138.338 74.591  1.00 276.59 ?  -47 DA  J C6    1 
ATOM 9517  N N6    . DA  J 6 27  ? 100.656 138.987 73.812  1.00 276.59 ?  -47 DA  J N6    1 
ATOM 9518  N N1    . DA  J 6 27  ? 101.097 137.869 75.779  1.00 276.59 ?  -47 DA  J N1    1 
ATOM 9519  C C2    . DA  J 6 27  ? 101.964 137.216 76.558  1.00 276.59 ?  -47 DA  J C2    1 
ATOM 9520  N N3    . DA  J 6 27  ? 103.245 136.941 76.333  1.00 276.59 ?  -47 DA  J N3    1 
ATOM 9521  C C4    . DA  J 6 27  ? 103.633 137.421 75.144  1.00 276.59 ?  -47 DA  J C4    1 
ATOM 9522  P P     . DC  J 6 28  ? 108.262 133.262 75.006  1.00 263.84 ?  -46 DC  J P     1 
ATOM 9523  O OP1   . DC  J 6 28  ? 109.209 132.389 75.731  1.00 263.84 ?  -46 DC  J OP1   1 
ATOM 9524  O OP2   . DC  J 6 28  ? 108.313 133.314 73.530  1.00 263.84 -1 -46 DC  J OP2   1 
ATOM 9525  O "O5'" . DC  J 6 28  ? 106.778 132.886 75.450  1.00 263.84 ?  -46 DC  J "O5'" 1 
ATOM 9526  C "C5'" . DC  J 6 28  ? 106.303 133.313 76.715  1.00 263.84 ?  -46 DC  J "C5'" 1 
ATOM 9527  C "C4'" . DC  J 6 28  ? 104.854 132.928 76.901  1.00 263.84 ?  -46 DC  J "C4'" 1 
ATOM 9528  O "O4'" . DC  J 6 28  ? 104.001 133.887 76.254  1.00 263.84 ?  -46 DC  J "O4'" 1 
ATOM 9529  C "C3'" . DC  J 6 28  ? 104.476 131.578 76.303  1.00 263.84 ?  -46 DC  J "C3'" 1 
ATOM 9530  O "O3'" . DC  J 6 28  ? 104.323 130.634 77.343  1.00 263.84 ?  -46 DC  J "O3'" 1 
ATOM 9531  C "C2'" . DC  J 6 28  ? 103.152 131.843 75.559  1.00 263.84 ?  -46 DC  J "C2'" 1 
ATOM 9532  C "C1'" . DC  J 6 28  ? 102.783 133.252 75.997  1.00 263.84 ?  -46 DC  J "C1'" 1 
ATOM 9533  N N1    . DC  J 6 28  ? 102.052 134.028 74.966  1.00 263.84 ?  -46 DC  J N1    1 
ATOM 9534  C C2    . DC  J 6 28  ? 100.716 134.372 75.177  1.00 263.84 ?  -46 DC  J C2    1 
ATOM 9535  O O2    . DC  J 6 28  ? 100.167 134.029 76.223  1.00 263.84 ?  -46 DC  J O2    1 
ATOM 9536  N N3    . DC  J 6 28  ? 100.065 135.085 74.235  1.00 263.84 ?  -46 DC  J N3    1 
ATOM 9537  C C4    . DC  J 6 28  ? 100.692 135.440 73.122  1.00 263.84 ?  -46 DC  J C4    1 
ATOM 9538  N N4    . DC  J 6 28  ? 100.006 136.141 72.219  1.00 263.84 ?  -46 DC  J N4    1 
ATOM 9539  C C5    . DC  J 6 28  ? 102.053 135.096 72.883  1.00 263.84 ?  -46 DC  J C5    1 
ATOM 9540  C C6    . DC  J 6 28  ? 102.688 134.398 73.825  1.00 263.84 ?  -46 DC  J C6    1 
ATOM 9541  P P     . DG  J 6 29  ? 103.797 129.153 77.031  1.00 251.58 ?  -45 DG  J P     1 
ATOM 9542  O OP1   . DG  J 6 29  ? 104.456 128.243 77.990  1.00 251.58 ?  -45 DG  J OP1   1 
ATOM 9543  O OP2   . DG  J 6 29  ? 103.934 128.901 75.583  1.00 251.58 -1 -45 DG  J OP2   1 
ATOM 9544  O "O5'" . DG  J 6 29  ? 102.245 129.239 77.378  1.00 251.58 ?  -45 DG  J "O5'" 1 
ATOM 9545  C "C5'" . DG  J 6 29  ? 101.827 130.019 78.480  1.00 251.58 ?  -45 DG  J "C5'" 1 
ATOM 9546  C "C4'" . DG  J 6 29  ? 100.376 130.414 78.338  1.00 251.58 ?  -45 DG  J "C4'" 1 
ATOM 9547  O "O4'" . DG  J 6 29  ? 100.212 131.285 77.191  1.00 251.58 ?  -45 DG  J "O4'" 1 
ATOM 9548  C "C3'" . DG  J 6 29  ? 99.414  129.247 78.121  1.00 251.58 ?  -45 DG  J "C3'" 1 
ATOM 9549  O "O3'" . DG  J 6 29  ? 98.330  129.367 79.002  1.00 251.58 ?  -45 DG  J "O3'" 1 
ATOM 9550  C "C2'" . DG  J 6 29  ? 98.971  129.420 76.670  1.00 251.58 ?  -45 DG  J "C2'" 1 
ATOM 9551  C "C1'" . DG  J 6 29  ? 99.025  130.926 76.537  1.00 251.58 ?  -45 DG  J "C1'" 1 
ATOM 9552  N N9    . DG  J 6 29  ? 99.077  131.404 75.157  1.00 251.58 ?  -45 DG  J N9    1 
ATOM 9553  C C8    . DG  J 6 29  ? 100.024 131.108 74.216  1.00 251.58 ?  -45 DG  J C8    1 
ATOM 9554  N N7    . DG  J 6 29  ? 99.815  131.685 73.068  1.00 251.58 ?  -45 DG  J N7    1 
ATOM 9555  C C5    . DG  J 6 29  ? 98.649  132.404 73.257  1.00 251.58 ?  -45 DG  J C5    1 
ATOM 9556  C C6    . DG  J 6 29  ? 97.939  133.228 72.364  1.00 251.58 ?  -45 DG  J C6    1 
ATOM 9557  O O6    . DG  J 6 29  ? 98.205  133.485 71.186  1.00 251.58 ?  -45 DG  J O6    1 
ATOM 9558  N N1    . DG  J 6 29  ? 96.812  133.775 72.954  1.00 251.58 ?  -45 DG  J N1    1 
ATOM 9559  C C2    . DG  J 6 29  ? 96.425  133.557 74.246  1.00 251.58 ?  -45 DG  J C2    1 
ATOM 9560  N N2    . DG  J 6 29  ? 95.308  134.177 74.639  1.00 251.58 ?  -45 DG  J N2    1 
ATOM 9561  N N3    . DG  J 6 29  ? 97.083  132.789 75.098  1.00 251.58 ?  -45 DG  J N3    1 
ATOM 9562  C C4    . DG  J 6 29  ? 98.182  132.247 74.536  1.00 251.58 ?  -45 DG  J C4    1 
ATOM 9563  P P     . DG  J 6 30  ? 97.315  128.144 79.192  1.00 237.95 ?  -44 DG  J P     1 
ATOM 9564  O OP1   . DG  J 6 30  ? 97.322  127.792 80.623  1.00 237.95 ?  -44 DG  J OP1   1 
ATOM 9565  O OP2   . DG  J 6 30  ? 97.629  127.114 78.184  1.00 237.95 -1 -44 DG  J OP2   1 
ATOM 9566  O "O5'" . DG  J 6 30  ? 95.900  128.777 78.833  1.00 237.95 ?  -44 DG  J "O5'" 1 
ATOM 9567  C "C5'" . DG  J 6 30  ? 95.211  129.538 79.804  1.00 237.95 ?  -44 DG  J "C5'" 1 
ATOM 9568  C "C4'" . DG  J 6 30  ? 94.084  130.333 79.177  1.00 237.95 ?  -44 DG  J "C4'" 1 
ATOM 9569  O "O4'" . DG  J 6 30  ? 94.537  130.906 77.930  1.00 237.95 ?  -44 DG  J "O4'" 1 
ATOM 9570  C "C3'" . DG  J 6 30  ? 92.834  129.534 78.836  1.00 237.95 ?  -44 DG  J "C3'" 1 
ATOM 9571  O "O3'" . DG  J 6 30  ? 91.697  130.347 79.020  1.00 237.95 ?  -44 DG  J "O3'" 1 
ATOM 9572  C "C2'" . DG  J 6 30  ? 93.043  129.194 77.368  1.00 237.95 ?  -44 DG  J "C2'" 1 
ATOM 9573  C "C1'" . DG  J 6 30  ? 93.725  130.454 76.871  1.00 237.95 ?  -44 DG  J "C1'" 1 
ATOM 9574  N N9    . DG  J 6 30  ? 94.580  130.235 75.719  1.00 237.95 ?  -44 DG  J N9    1 
ATOM 9575  C C8    . DG  J 6 30  ? 95.665  129.406 75.649  1.00 237.95 ?  -44 DG  J C8    1 
ATOM 9576  N N7    . DG  J 6 30  ? 96.254  129.420 74.487  1.00 237.95 ?  -44 DG  J N7    1 
ATOM 9577  C C5    . DG  J 6 30  ? 95.506  130.315 73.742  1.00 237.95 ?  -44 DG  J C5    1 
ATOM 9578  C C6    . DG  J 6 30  ? 95.664  130.737 72.411  1.00 237.95 ?  -44 DG  J C6    1 
ATOM 9579  O O6    . DG  J 6 30  ? 96.524  130.389 71.598  1.00 237.95 ?  -44 DG  J O6    1 
ATOM 9580  N N1    . DG  J 6 30  ? 94.694  131.657 72.044  1.00 237.95 ?  -44 DG  J N1    1 
ATOM 9581  C C2    . DG  J 6 30  ? 93.695  132.110 72.865  1.00 237.95 ?  -44 DG  J C2    1 
ATOM 9582  N N2    . DG  J 6 30  ? 92.849  133.000 72.334  1.00 237.95 ?  -44 DG  J N2    1 
ATOM 9583  N N3    . DG  J 6 30  ? 93.538  131.727 74.119  1.00 237.95 ?  -44 DG  J N3    1 
ATOM 9584  C C4    . DG  J 6 30  ? 94.476  130.829 74.488  1.00 237.95 ?  -44 DG  J C4    1 
ATOM 9585  P P     . DA  J 6 31  ? 90.227  129.726 78.866  1.00 240.12 ?  -43 DA  J P     1 
ATOM 9586  O OP1   . DA  J 6 31  ? 89.330  130.503 79.748  1.00 240.12 ?  -43 DA  J OP1   1 
ATOM 9587  O OP2   . DA  J 6 31  ? 90.328  128.260 79.023  1.00 240.12 -1 -43 DA  J OP2   1 
ATOM 9588  O "O5'" . DA  J 6 31  ? 89.849  130.035 77.347  1.00 240.12 ?  -43 DA  J "O5'" 1 
ATOM 9589  C "C5'" . DA  J 6 31  ? 90.102  131.320 76.815  1.00 240.12 ?  -43 DA  J "C5'" 1 
ATOM 9590  C "C4'" . DA  J 6 31  ? 89.391  131.508 75.494  1.00 240.12 ?  -43 DA  J "C4'" 1 
ATOM 9591  O "O4'" . DA  J 6 31  ? 90.350  131.453 74.408  1.00 240.12 ?  -43 DA  J "O4'" 1 
ATOM 9592  C "C3'" . DA  J 6 31  ? 88.327  130.461 75.172  1.00 240.12 ?  -43 DA  J "C3'" 1 
ATOM 9593  O "O3'" . DA  J 6 31  ? 87.210  131.110 74.618  1.00 240.12 ?  -43 DA  J "O3'" 1 
ATOM 9594  C "C2'" . DA  J 6 31  ? 89.024  129.578 74.142  1.00 240.12 ?  -43 DA  J "C2'" 1 
ATOM 9595  C "C1'" . DA  J 6 31  ? 89.851  130.610 73.406  1.00 240.12 ?  -43 DA  J "C1'" 1 
ATOM 9596  N N9    . DA  J 6 31  ? 90.976  130.059 72.666  1.00 240.12 ?  -43 DA  J N9    1 
ATOM 9597  C C8    . DA  J 6 31  ? 91.926  129.199 73.128  1.00 240.12 ?  -43 DA  J C8    1 
ATOM 9598  N N7    . DA  J 6 31  ? 92.831  128.884 72.236  1.00 240.12 ?  -43 DA  J N7    1 
ATOM 9599  C C5    . DA  J 6 31  ? 92.435  129.576 71.110  1.00 240.12 ?  -43 DA  J C5    1 
ATOM 9600  C C6    . DA  J 6 31  ? 92.974  129.668 69.817  1.00 240.12 ?  -43 DA  J C6    1 
ATOM 9601  N N6    . DA  J 6 31  ? 94.072  129.018 69.434  1.00 240.12 ?  -43 DA  J N6    1 
ATOM 9602  N N1    . DA  J 6 31  ? 92.338  130.456 68.927  1.00 240.12 ?  -43 DA  J N1    1 
ATOM 9603  C C2    . DA  J 6 31  ? 91.241  131.112 69.316  1.00 240.12 ?  -43 DA  J C2    1 
ATOM 9604  N N3    . DA  J 6 31  ? 90.641  131.101 70.503  1.00 240.12 ?  -43 DA  J N3    1 
ATOM 9605  C C4    . DA  J 6 31  ? 91.300  130.313 71.362  1.00 240.12 ?  -43 DA  J C4    1 
ATOM 9606  P P     . DA  J 6 32  ? 85.839  130.318 74.374  1.00 253.16 ?  -42 DA  J P     1 
ATOM 9607  O OP1   . DA  J 6 32  ? 84.792  130.999 75.163  1.00 253.16 ?  -42 DA  J OP1   1 
ATOM 9608  O OP2   . DA  J 6 32  ? 86.091  128.878 74.587  1.00 253.16 -1 -42 DA  J OP2   1 
ATOM 9609  O "O5'" . DA  J 6 32  ? 85.549  130.557 72.823  1.00 253.16 ?  -42 DA  J "O5'" 1 
ATOM 9610  C "C5'" . DA  J 6 32  ? 85.613  131.872 72.291  1.00 253.16 ?  -42 DA  J "C5'" 1 
ATOM 9611  C "C4'" . DA  J 6 32  ? 85.560  131.849 70.776  1.00 253.16 ?  -42 DA  J "C4'" 1 
ATOM 9612  O "O4'" . DA  J 6 32  ? 86.842  131.435 70.252  1.00 253.16 ?  -42 DA  J "O4'" 1 
ATOM 9613  C "C3'" . DA  J 6 32  ? 84.518  130.907 70.187  1.00 253.16 ?  -42 DA  J "C3'" 1 
ATOM 9614  O "O3'" . DA  J 6 32  ? 83.804  131.555 69.156  1.00 253.16 ?  -42 DA  J "O3'" 1 
ATOM 9615  C "C2'" . DA  J 6 32  ? 85.333  129.730 69.655  1.00 253.16 ?  -42 DA  J "C2'" 1 
ATOM 9616  C "C1'" . DA  J 6 32  ? 86.690  130.352 69.368  1.00 253.16 ?  -42 DA  J "C1'" 1 
ATOM 9617  N N9    . DA  J 6 32  ? 87.791  129.434 69.609  1.00 253.16 ?  -42 DA  J N9    1 
ATOM 9618  C C8    . DA  J 6 32  ? 88.138  128.874 70.800  1.00 253.16 ?  -42 DA  J C8    1 
ATOM 9619  N N7    . DA  J 6 32  ? 89.175  128.079 70.729  1.00 253.16 ?  -42 DA  J N7    1 
ATOM 9620  C C5    . DA  J 6 32  ? 89.535  128.127 69.400  1.00 253.16 ?  -42 DA  J C5    1 
ATOM 9621  C C6    . DA  J 6 32  ? 90.566  127.506 68.675  1.00 253.16 ?  -42 DA  J C6    1 
ATOM 9622  N N6    . DA  J 6 32  ? 91.454  126.677 69.226  1.00 253.16 ?  -42 DA  J N6    1 
ATOM 9623  N N1    . DA  J 6 32  ? 90.646  127.763 67.354  1.00 253.16 ?  -42 DA  J N1    1 
ATOM 9624  C C2    . DA  J 6 32  ? 89.756  128.593 66.803  1.00 253.16 ?  -42 DA  J C2    1 
ATOM 9625  N N3    . DA  J 6 32  ? 88.744  129.235 67.383  1.00 253.16 ?  -42 DA  J N3    1 
ATOM 9626  C C4    . DA  J 6 32  ? 88.689  128.955 68.692  1.00 253.16 ?  -42 DA  J C4    1 
ATOM 9627  P P     . DG  J 6 33  ? 82.380  130.980 68.687  1.00 258.10 ?  -41 DG  J P     1 
ATOM 9628  O OP1   . DG  J 6 33  ? 81.516  132.131 68.345  1.00 258.10 ?  -41 DG  J OP1   1 
ATOM 9629  O OP2   . DG  J 6 33  ? 81.939  129.999 69.700  1.00 258.10 -1 -41 DG  J OP2   1 
ATOM 9630  O "O5'" . DG  J 6 33  ? 82.722  130.176 67.353  1.00 258.10 ?  -41 DG  J "O5'" 1 
ATOM 9631  C "C5'" . DG  J 6 33  ? 83.403  130.829 66.303  1.00 258.10 ?  -41 DG  J "C5'" 1 
ATOM 9632  C "C4'" . DG  J 6 33  ? 83.980  129.826 65.329  1.00 258.10 ?  -41 DG  J "C4'" 1 
ATOM 9633  O "O4'" . DG  J 6 33  ? 85.143  129.196 65.907  1.00 258.10 ?  -41 DG  J "O4'" 1 
ATOM 9634  C "C3'" . DG  J 6 33  ? 83.033  128.690 64.933  1.00 258.10 ?  -41 DG  J "C3'" 1 
ATOM 9635  O "O3'" . DG  J 6 33  ? 82.801  128.731 63.535  1.00 258.10 ?  -41 DG  J "O3'" 1 
ATOM 9636  C "C2'" . DG  J 6 33  ? 83.779  127.415 65.350  1.00 258.10 ?  -41 DG  J "C2'" 1 
ATOM 9637  C "C1'" . DG  J 6 33  ? 85.218  127.891 65.413  1.00 258.10 ?  -41 DG  J "C1'" 1 
ATOM 9638  N N9    . DG  J 6 33  ? 86.059  127.100 66.304  1.00 258.10 ?  -41 DG  J N9    1 
ATOM 9639  C C8    . DG  J 6 33  ? 85.841  126.835 67.631  1.00 258.10 ?  -41 DG  J C8    1 
ATOM 9640  N N7    . DG  J 6 33  ? 86.766  126.094 68.171  1.00 258.10 ?  -41 DG  J N7    1 
ATOM 9641  C C5    . DG  J 6 33  ? 87.654  125.855 67.135  1.00 258.10 ?  -41 DG  J C5    1 
ATOM 9642  C C6    . DG  J 6 33  ? 88.849  125.107 67.119  1.00 258.10 ?  -41 DG  J C6    1 
ATOM 9643  O O6    . DG  J 6 33  ? 89.383  124.498 68.052  1.00 258.10 ?  -41 DG  J O6    1 
ATOM 9644  N N1    . DG  J 6 33  ? 89.447  125.117 65.866  1.00 258.10 ?  -41 DG  J N1    1 
ATOM 9645  C C2    . DG  J 6 33  ? 88.947  125.764 64.766  1.00 258.10 ?  -41 DG  J C2    1 
ATOM 9646  N N2    . DG  J 6 33  ? 89.662  125.656 63.640  1.00 258.10 ?  -41 DG  J N2    1 
ATOM 9647  N N3    . DG  J 6 33  ? 87.823  126.464 64.765  1.00 258.10 ?  -41 DG  J N3    1 
ATOM 9648  C C4    . DG  J 6 33  ? 87.233  126.467 65.980  1.00 258.10 ?  -41 DG  J C4    1 
ATOM 9649  P P     . DC  J 6 34  ? 81.863  127.634 62.831  1.00 262.05 ?  -40 DC  J P     1 
ATOM 9650  O OP1   . DC  J 6 34  ? 81.201  128.282 61.679  1.00 262.05 ?  -40 DC  J OP1   1 
ATOM 9651  O OP2   . DC  J 6 34  ? 81.057  126.979 63.881  1.00 262.05 -1 -40 DC  J OP2   1 
ATOM 9652  O "O5'" . DC  J 6 34  ? 82.898  126.556 62.279  1.00 262.05 ?  -40 DC  J "O5'" 1 
ATOM 9653  C "C5'" . DC  J 6 34  ? 84.091  126.989 61.657  1.00 262.05 ?  -40 DC  J "C5'" 1 
ATOM 9654  C "C4'" . DC  J 6 34  ? 85.072  125.844 61.538  1.00 262.05 ?  -40 DC  J "C4'" 1 
ATOM 9655  O "O4'" . DC  J 6 34  ? 85.606  125.529 62.836  1.00 262.05 ?  -40 DC  J "O4'" 1 
ATOM 9656  C "C3'" . DC  J 6 34  ? 84.468  124.544 61.015  1.00 262.05 ?  -40 DC  J "C3'" 1 
ATOM 9657  O "O3'" . DC  J 6 34  ? 84.893  124.320 59.685  1.00 262.05 ?  -40 DC  J "O3'" 1 
ATOM 9658  C "C2'" . DC  J 6 34  ? 84.987  123.454 61.971  1.00 262.05 ?  -40 DC  J "C2'" 1 
ATOM 9659  C "C1'" . DC  J 6 34  ? 86.013  124.191 62.824  1.00 262.05 ?  -40 DC  J "C1'" 1 
ATOM 9660  N N1    . DC  J 6 34  ? 86.082  123.706 64.230  1.00 262.05 ?  -40 DC  J N1    1 
ATOM 9661  C C2    . DC  J 6 34  ? 87.170  122.934 64.641  1.00 262.05 ?  -40 DC  J C2    1 
ATOM 9662  O O2    . DC  J 6 34  ? 88.055  122.666 63.826  1.00 262.05 ?  -40 DC  J O2    1 
ATOM 9663  N N3    . DC  J 6 34  ? 87.223  122.503 65.921  1.00 262.05 ?  -40 DC  J N3    1 
ATOM 9664  C C4    . DC  J 6 34  ? 86.245  122.816 66.768  1.00 262.05 ?  -40 DC  J C4    1 
ATOM 9665  N N4    . DC  J 6 34  ? 86.340  122.370 68.022  1.00 262.05 ?  -40 DC  J N4    1 
ATOM 9666  C C5    . DC  J 6 34  ? 85.127  123.603 66.371  1.00 262.05 ?  -40 DC  J C5    1 
ATOM 9667  C C6    . DC  J 6 34  ? 85.084  124.018 65.103  1.00 262.05 ?  -40 DC  J C6    1 
ATOM 9668  P P     . DA  J 6 35  ? 84.223  123.153 58.810  1.00 255.46 ?  -39 DA  J P     1 
ATOM 9669  O OP1   . DA  J 6 35  ? 84.287  123.568 57.393  1.00 255.46 ?  -39 DA  J OP1   1 
ATOM 9670  O OP2   . DA  J 6 35  ? 82.923  122.805 59.425  1.00 255.46 -1 -39 DA  J OP2   1 
ATOM 9671  O "O5'" . DA  J 6 35  ? 85.206  121.918 59.023  1.00 255.46 ?  -39 DA  J "O5'" 1 
ATOM 9672  C "C5'" . DA  J 6 35  ? 86.596  122.086 58.817  1.00 255.46 ?  -39 DA  J "C5'" 1 
ATOM 9673  C "C4'" . DA  J 6 35  ? 87.328  120.788 59.069  1.00 255.46 ?  -39 DA  J "C4'" 1 
ATOM 9674  O "O4'" . DA  J 6 35  ? 87.648  120.681 60.477  1.00 255.46 ?  -39 DA  J "O4'" 1 
ATOM 9675  C "C3'" . DA  J 6 35  ? 86.537  119.534 58.706  1.00 255.46 ?  -39 DA  J "C3'" 1 
ATOM 9676  O "O3'" . DA  J 6 35  ? 87.347  118.649 57.963  1.00 255.46 ?  -39 DA  J "O3'" 1 
ATOM 9677  C "C2'" . DA  J 6 35  ? 86.147  118.941 60.059  1.00 255.46 ?  -39 DA  J "C2'" 1 
ATOM 9678  C "C1'" . DA  J 6 35  ? 87.282  119.409 60.952  1.00 255.46 ?  -39 DA  J "C1'" 1 
ATOM 9679  N N9    . DA  J 6 35  ? 86.899  119.542 62.354  1.00 255.46 ?  -39 DA  J N9    1 
ATOM 9680  C C8    . DA  J 6 35  ? 85.770  120.132 62.846  1.00 255.46 ?  -39 DA  J C8    1 
ATOM 9681  N N7    . DA  J 6 35  ? 85.686  120.110 64.153  1.00 255.46 ?  -39 DA  J N7    1 
ATOM 9682  C C5    . DA  J 6 35  ? 86.843  119.469 64.544  1.00 255.46 ?  -39 DA  J C5    1 
ATOM 9683  C C6    . DA  J 6 35  ? 87.352  119.135 65.804  1.00 255.46 ?  -39 DA  J C6    1 
ATOM 9684  N N6    . DA  J 6 35  ? 86.722  119.419 66.944  1.00 255.46 ?  -39 DA  J N6    1 
ATOM 9685  N N1    . DA  J 6 35  ? 88.539  118.494 65.852  1.00 255.46 ?  -39 DA  J N1    1 
ATOM 9686  C C2    . DA  J 6 35  ? 89.168  118.211 64.706  1.00 255.46 ?  -39 DA  J C2    1 
ATOM 9687  N N3    . DA  J 6 35  ? 88.786  118.476 63.460  1.00 255.46 ?  -39 DA  J N3    1 
ATOM 9688  C C4    . DA  J 6 35  ? 87.604  119.112 63.450  1.00 255.46 ?  -39 DA  J C4    1 
ATOM 9689  P P     . DT  J 6 36  ? 86.721  117.294 57.373  1.00 243.56 ?  -38 DT  J P     1 
ATOM 9690  O OP1   . DT  J 6 36  ? 87.369  117.030 56.071  1.00 243.56 ?  -38 DT  J OP1   1 
ATOM 9691  O OP2   . DT  J 6 36  ? 85.249  117.399 57.463  1.00 243.56 -1 -38 DT  J OP2   1 
ATOM 9692  O "O5'" . DT  J 6 36  ? 87.196  116.181 58.410  1.00 243.56 ?  -38 DT  J "O5'" 1 
ATOM 9693  C "C5'" . DT  J 6 36  ? 88.574  116.031 58.678  1.00 243.56 ?  -38 DT  J "C5'" 1 
ATOM 9694  C "C4'" . DT  J 6 36  ? 88.794  115.286 59.977  1.00 243.56 ?  -38 DT  J "C4'" 1 
ATOM 9695  O "O4'" . DT  J 6 36  ? 88.140  115.982 61.056  1.00 243.56 ?  -38 DT  J "O4'" 1 
ATOM 9696  C "C3'" . DT  J 6 36  ? 88.244  113.858 60.008  1.00 243.56 ?  -38 DT  J "C3'" 1 
ATOM 9697  O "O3'" . DT  J 6 36  ? 89.323  112.941 60.074  1.00 243.56 ?  -38 DT  J "O3'" 1 
ATOM 9698  C "C2'" . DT  J 6 36  ? 87.373  113.810 61.275  1.00 243.56 ?  -38 DT  J "C2'" 1 
ATOM 9699  C "C1'" . DT  J 6 36  ? 87.832  115.039 62.040  1.00 243.56 ?  -38 DT  J "C1'" 1 
ATOM 9700  N N1    . DT  J 6 36  ? 86.798  115.608 62.938  1.00 243.56 ?  -38 DT  J N1    1 
ATOM 9701  C C2    . DT  J 6 36  ? 86.965  115.503 64.293  1.00 243.56 ?  -38 DT  J C2    1 
ATOM 9702  O O2    . DT  J 6 36  ? 87.925  114.960 64.802  1.00 243.56 ?  -38 DT  J O2    1 
ATOM 9703  N N3    . DT  J 6 36  ? 85.964  116.056 65.038  1.00 243.56 ?  -38 DT  J N3    1 
ATOM 9704  C C4    . DT  J 6 36  ? 84.835  116.693 64.572  1.00 243.56 ?  -38 DT  J C4    1 
ATOM 9705  O O4    . DT  J 6 36  ? 83.988  117.161 65.323  1.00 243.56 ?  -38 DT  J O4    1 
ATOM 9706  C C5    . DT  J 6 36  ? 84.719  116.771 63.138  1.00 243.56 ?  -38 DT  J C5    1 
ATOM 9707  C C7    . DT  J 6 36  ? 83.530  117.438 62.515  1.00 243.56 ?  -38 DT  J C7    1 
ATOM 9708  C C6    . DT  J 6 36  ? 85.698  116.234 62.398  1.00 243.56 ?  -38 DT  J C6    1 
ATOM 9709  P P     . DT  J 6 37  ? 89.052  111.368 60.240  1.00 234.14 ?  -37 DT  J P     1 
ATOM 9710  O OP1   . DT  J 6 37  ? 90.135  110.660 59.523  1.00 234.14 ?  -37 DT  J OP1   1 
ATOM 9711  O OP2   . DT  J 6 37  ? 87.641  111.095 59.892  1.00 234.14 -1 -37 DT  J OP2   1 
ATOM 9712  O "O5'" . DT  J 6 37  ? 89.230  111.126 61.807  1.00 234.14 ?  -37 DT  J "O5'" 1 
ATOM 9713  C "C5'" . DT  J 6 37  ? 90.276  111.787 62.503  1.00 234.14 ?  -37 DT  J "C5'" 1 
ATOM 9714  C "C4'" . DT  J 6 37  ? 90.186  111.520 63.991  1.00 234.14 ?  -37 DT  J "C4'" 1 
ATOM 9715  O "O4'" . DT  J 6 37  ? 88.999  112.156 64.528  1.00 234.14 ?  -37 DT  J "O4'" 1 
ATOM 9716  C "C3'" . DT  J 6 37  ? 90.085  110.040 64.372  1.00 234.14 ?  -37 DT  J "C3'" 1 
ATOM 9717  O "O3'" . DT  J 6 37  ? 90.991  109.749 65.427  1.00 234.14 ?  -37 DT  J "O3'" 1 
ATOM 9718  C "C2'" . DT  J 6 37  ? 88.630  109.892 64.819  1.00 234.14 ?  -37 DT  J "C2'" 1 
ATOM 9719  C "C1'" . DT  J 6 37  ? 88.373  111.261 65.407  1.00 234.14 ?  -37 DT  J "C1'" 1 
ATOM 9720  N N1    . DT  J 6 37  ? 86.941  111.605 65.504  1.00 234.14 ?  -37 DT  J N1    1 
ATOM 9721  C C2    . DT  J 6 37  ? 86.290  111.397 66.690  1.00 234.14 ?  -37 DT  J C2    1 
ATOM 9722  O O2    . DT  J 6 37  ? 86.830  110.927 67.673  1.00 234.14 ?  -37 DT  J O2    1 
ATOM 9723  N N3    . DT  J 6 37  ? 84.970  111.741 66.685  1.00 234.14 ?  -37 DT  J N3    1 
ATOM 9724  C C4    . DT  J 6 37  ? 84.255  112.270 65.634  1.00 234.14 ?  -37 DT  J C4    1 
ATOM 9725  O O4    . DT  J 6 37  ? 83.070  112.555 65.727  1.00 234.14 ?  -37 DT  J O4    1 
ATOM 9726  C C5    . DT  J 6 37  ? 84.997  112.472 64.423  1.00 234.14 ?  -37 DT  J C5    1 
ATOM 9727  C C7    . DT  J 6 37  ? 84.315  113.039 63.220  1.00 234.14 ?  -37 DT  J C7    1 
ATOM 9728  C C6    . DT  J 6 37  ? 86.292  112.133 64.412  1.00 234.14 ?  -37 DT  J C6    1 
ATOM 9729  P P     . DC  J 6 38  ? 91.466  108.238 65.687  1.00 233.74 ?  -36 DC  J P     1 
ATOM 9730  O OP1   . DC  J 6 38  ? 92.624  108.254 66.606  1.00 233.74 ?  -36 DC  J OP1   1 
ATOM 9731  O OP2   . DC  J 6 38  ? 91.590  107.591 64.364  1.00 233.74 -1 -36 DC  J OP2   1 
ATOM 9732  O "O5'" . DC  J 6 38  ? 90.228  107.578 66.447  1.00 233.74 ?  -36 DC  J "O5'" 1 
ATOM 9733  C "C5'" . DC  J 6 38  ? 90.447  106.759 67.568  1.00 233.74 ?  -36 DC  J "C5'" 1 
ATOM 9734  C "C4'" . DC  J 6 38  ? 89.409  107.030 68.634  1.00 233.74 ?  -36 DC  J "C4'" 1 
ATOM 9735  O "O4'" . DC  J 6 38  ? 88.332  107.827 68.089  1.00 233.74 ?  -36 DC  J "O4'" 1 
ATOM 9736  C "C3'" . DC  J 6 38  ? 88.749  105.779 69.220  1.00 233.74 ?  -36 DC  J "C3'" 1 
ATOM 9737  O "O3'" . DC  J 6 38  ? 88.987  105.720 70.607  1.00 233.74 ?  -36 DC  J "O3'" 1 
ATOM 9738  C "C2'" . DC  J 6 38  ? 87.260  105.965 68.914  1.00 233.74 ?  -36 DC  J "C2'" 1 
ATOM 9739  C "C1'" . DC  J 6 38  ? 87.163  107.466 68.766  1.00 233.74 ?  -36 DC  J "C1'" 1 
ATOM 9740  N N1    . DC  J 6 38  ? 85.996  107.906 67.984  1.00 233.74 ?  -36 DC  J N1    1 
ATOM 9741  C C2    . DC  J 6 38  ? 84.813  108.231 68.647  1.00 233.74 ?  -36 DC  J C2    1 
ATOM 9742  O O2    . DC  J 6 38  ? 84.771  108.145 69.877  1.00 233.74 ?  -36 DC  J O2    1 
ATOM 9743  N N3    . DC  J 6 38  ? 83.745  108.636 67.923  1.00 233.74 ?  -36 DC  J N3    1 
ATOM 9744  C C4    . DC  J 6 38  ? 83.833  108.714 66.597  1.00 233.74 ?  -36 DC  J C4    1 
ATOM 9745  N N4    . DC  J 6 38  ? 82.752  109.117 65.923  1.00 233.74 ?  -36 DC  J N4    1 
ATOM 9746  C C5    . DC  J 6 38  ? 85.031  108.378 65.901  1.00 233.74 ?  -36 DC  J C5    1 
ATOM 9747  C C6    . DC  J 6 38  ? 86.078  107.984 66.629  1.00 233.74 ?  -36 DC  J C6    1 
ATOM 9748  P P     . DT  J 6 39  ? 90.148  104.772 71.176  1.00 239.21 ?  -35 DT  J P     1 
ATOM 9749  O OP1   . DT  J 6 39  ? 91.443  105.324 70.724  1.00 239.21 ?  -35 DT  J OP1   1 
ATOM 9750  O OP2   . DT  J 6 39  ? 89.786  103.379 70.847  1.00 239.21 -1 -35 DT  J OP2   1 
ATOM 9751  O "O5'" . DT  J 6 39  ? 90.037  104.944 72.755  1.00 239.21 ?  -35 DT  J "O5'" 1 
ATOM 9752  C "C5'" . DT  J 6 39  ? 90.122  106.229 73.321  1.00 239.21 ?  -35 DT  J "C5'" 1 
ATOM 9753  C "C4'" . DT  J 6 39  ? 88.855  106.561 74.077  1.00 239.21 ?  -35 DT  J "C4'" 1 
ATOM 9754  O "O4'" . DT  J 6 39  ? 87.747  106.637 73.155  1.00 239.21 ?  -35 DT  J "O4'" 1 
ATOM 9755  C "C3'" . DT  J 6 39  ? 88.457  105.541 75.143  1.00 239.21 ?  -35 DT  J "C3'" 1 
ATOM 9756  O "O3'" . DT  J 6 39  ? 88.270  106.189 76.376  1.00 239.21 ?  -35 DT  J "O3'" 1 
ATOM 9757  C "C2'" . DT  J 6 39  ? 87.148  104.947 74.622  1.00 239.21 ?  -35 DT  J "C2'" 1 
ATOM 9758  C "C1'" . DT  J 6 39  ? 86.616  106.071 73.756  1.00 239.21 ?  -35 DT  J "C1'" 1 
ATOM 9759  N N1    . DT  J 6 39  ? 85.708  105.607 72.682  1.00 239.21 ?  -35 DT  J N1    1 
ATOM 9760  C C2    . DT  J 6 39  ? 84.559  106.307 72.421  1.00 239.21 ?  -35 DT  J C2    1 
ATOM 9761  O O2    . DT  J 6 39  ? 84.236  107.308 73.029  1.00 239.21 ?  -35 DT  J O2    1 
ATOM 9762  N N3    . DT  J 6 39  ? 83.795  105.796 71.412  1.00 239.21 ?  -35 DT  J N3    1 
ATOM 9763  C C4    . DT  J 6 39  ? 84.063  104.677 70.654  1.00 239.21 ?  -35 DT  J C4    1 
ATOM 9764  O O4    . DT  J 6 39  ? 83.311  104.290 69.769  1.00 239.21 ?  -35 DT  J O4    1 
ATOM 9765  C C5    . DT  J 6 39  ? 85.280  103.984 70.987  1.00 239.21 ?  -35 DT  J C5    1 
ATOM 9766  C C7    . DT  J 6 39  ? 85.677  102.753 70.232  1.00 239.21 ?  -35 DT  J C7    1 
ATOM 9767  C C6    . DT  J 6 39  ? 86.037  104.480 71.970  1.00 239.21 ?  -35 DT  J C6    1 
ATOM 9768  P P     . DC  J 6 40  ? 88.051  105.326 77.707  1.00 235.77 ?  -34 DC  J P     1 
ATOM 9769  O OP1   . DC  J 6 40  ? 88.658  106.061 78.839  1.00 235.77 ?  -34 DC  J OP1   1 
ATOM 9770  O OP2   . DC  J 6 40  ? 88.488  103.951 77.399  1.00 235.77 -1 -34 DC  J OP2   1 
ATOM 9771  O "O5'" . DC  J 6 40  ? 86.469  105.297 77.878  1.00 235.77 ?  -34 DC  J "O5'" 1 
ATOM 9772  C "C5'" . DC  J 6 40  ? 85.736  106.490 77.740  1.00 235.77 ?  -34 DC  J "C5'" 1 
ATOM 9773  C "C4'" . DC  J 6 40  ? 84.254  106.204 77.659  1.00 235.77 ?  -34 DC  J "C4'" 1 
ATOM 9774  O "O4'" . DC  J 6 40  ? 83.930  105.657 76.355  1.00 235.77 ?  -34 DC  J "O4'" 1 
ATOM 9775  C "C3'" . DC  J 6 40  ? 83.729  105.191 78.682  1.00 235.77 ?  -34 DC  J "C3'" 1 
ATOM 9776  O "O3'" . DC  J 6 40  ? 82.537  105.683 79.265  1.00 235.77 ?  -34 DC  J "O3'" 1 
ATOM 9777  C "C2'" . DC  J 6 40  ? 83.455  103.954 77.831  1.00 235.77 ?  -34 DC  J "C2'" 1 
ATOM 9778  C "C1'" . DC  J 6 40  ? 83.018  104.608 76.539  1.00 235.77 ?  -34 DC  J "C1'" 1 
ATOM 9779  N N1    . DC  J 6 40  ? 83.051  103.714 75.345  1.00 235.77 ?  -34 DC  J N1    1 
ATOM 9780  C C2    . DC  J 6 40  ? 82.500  104.158 74.144  1.00 235.77 ?  -34 DC  J C2    1 
ATOM 9781  O O2    . DC  J 6 40  ? 82.001  105.283 74.091  1.00 235.77 ?  -34 DC  J O2    1 
ATOM 9782  N N3    . DC  J 6 40  ? 82.528  103.345 73.071  1.00 235.77 ?  -34 DC  J N3    1 
ATOM 9783  C C4    . DC  J 6 40  ? 83.077  102.141 73.163  1.00 235.77 ?  -34 DC  J C4    1 
ATOM 9784  N N4    . DC  J 6 40  ? 83.084  101.378 72.072  1.00 235.77 ?  -34 DC  J N4    1 
ATOM 9785  C C5    . DC  J 6 40  ? 83.642  101.663 74.378  1.00 235.77 ?  -34 DC  J C5    1 
ATOM 9786  C C6    . DC  J 6 40  ? 83.605  102.474 75.435  1.00 235.77 ?  -34 DC  J C6    1 
ATOM 9787  P P     . DA  J 6 41  ? 81.956  105.014 80.601  1.00 234.79 ?  -33 DA  J P     1 
ATOM 9788  O OP1   . DA  J 6 41  ? 82.230  105.942 81.713  1.00 234.79 ?  -33 DA  J OP1   1 
ATOM 9789  O OP2   . DA  J 6 41  ? 82.421  103.615 80.668  1.00 234.79 -1 -33 DA  J OP2   1 
ATOM 9790  O "O5'" . DA  J 6 41  ? 80.385  104.987 80.363  1.00 234.79 ?  -33 DA  J "O5'" 1 
ATOM 9791  C "C5'" . DA  J 6 41  ? 79.615  106.156 80.589  1.00 234.79 ?  -33 DA  J "C5'" 1 
ATOM 9792  C "C4'" . DA  J 6 41  ? 78.402  106.207 79.674  1.00 234.79 ?  -33 DA  J "C4'" 1 
ATOM 9793  O "O4'" . DA  J 6 41  ? 78.750  105.670 78.374  1.00 234.79 ?  -33 DA  J "O4'" 1 
ATOM 9794  C "C3'" . DA  J 6 41  ? 77.200  105.392 80.133  1.00 234.79 ?  -33 DA  J "C3'" 1 
ATOM 9795  O "O3'" . DA  J 6 41  ? 76.007  105.979 79.634  1.00 234.79 ?  -33 DA  J "O3'" 1 
ATOM 9796  C "C2'" . DA  J 6 41  ? 77.461  104.056 79.465  1.00 234.79 ?  -33 DA  J "C2'" 1 
ATOM 9797  C "C1'" . DA  J 6 41  ? 77.966  104.525 78.112  1.00 234.79 ?  -33 DA  J "C1'" 1 
ATOM 9798  N N9    . DA  J 6 41  ? 78.806  103.551 77.442  1.00 234.79 ?  -33 DA  J N9    1 
ATOM 9799  C C8    . DA  J 6 41  ? 80.047  103.146 77.822  1.00 234.79 ?  -33 DA  J C8    1 
ATOM 9800  N N7    . DA  J 6 41  ? 80.582  102.257 77.024  1.00 234.79 ?  -33 DA  J N7    1 
ATOM 9801  C C5    . DA  J 6 41  ? 79.622  102.068 76.056  1.00 234.79 ?  -33 DA  J C5    1 
ATOM 9802  C C6    . DA  J 6 41  ? 79.579  101.252 74.921  1.00 234.79 ?  -33 DA  J C6    1 
ATOM 9803  N N6    . DA  J 6 41  ? 80.572  100.434 74.572  1.00 234.79 ?  -33 DA  J N6    1 
ATOM 9804  N N1    . DA  J 6 41  ? 78.468  101.296 74.159  1.00 234.79 ?  -33 DA  J N1    1 
ATOM 9805  C C2    . DA  J 6 41  ? 77.473  102.117 74.515  1.00 234.79 ?  -33 DA  J C2    1 
ATOM 9806  N N3    . DA  J 6 41  ? 77.403  102.933 75.562  1.00 234.79 ?  -33 DA  J N3    1 
ATOM 9807  C C4    . DA  J 6 41  ? 78.520  102.862 76.295  1.00 234.79 ?  -33 DA  J C4    1 
ATOM 9808  P P     . DG  J 6 42  ? 74.586  105.573 80.262  1.00 248.86 ?  -32 DG  J P     1 
ATOM 9809  O OP1   . DG  J 6 42  ? 74.029  106.783 80.902  1.00 248.86 ?  -32 DG  J OP1   1 
ATOM 9810  O OP2   . DG  J 6 42  ? 74.790  104.349 81.062  1.00 248.86 -1 -32 DG  J OP2   1 
ATOM 9811  O "O5'" . DG  J 6 42  ? 73.684  105.188 78.994  1.00 248.86 ?  -32 DG  J "O5'" 1 
ATOM 9812  C "C5'" . DG  J 6 42  ? 74.175  104.276 78.018  1.00 248.86 ?  -32 DG  J "C5'" 1 
ATOM 9813  C "C4'" . DG  J 6 42  ? 73.049  103.514 77.352  1.00 248.86 ?  -32 DG  J "C4'" 1 
ATOM 9814  O "O4'" . DG  J 6 42  ? 73.608  102.514 76.473  1.00 248.86 ?  -32 DG  J "O4'" 1 
ATOM 9815  C "C3'" . DG  J 6 42  ? 72.157  102.739 78.295  1.00 248.86 ?  -32 DG  J "C3'" 1 
ATOM 9816  O "O3'" . DG  J 6 42  ? 70.900  102.526 77.687  1.00 248.86 ?  -32 DG  J "O3'" 1 
ATOM 9817  C "C2'" . DG  J 6 42  ? 72.925  101.434 78.472  1.00 248.86 ?  -32 DG  J "C2'" 1 
ATOM 9818  C "C1'" . DG  J 6 42  ? 73.608  101.253 77.117  1.00 248.86 ?  -32 DG  J "C1'" 1 
ATOM 9819  N N9    . DG  J 6 42  ? 74.989  100.789 77.228  1.00 248.86 ?  -32 DG  J N9    1 
ATOM 9820  C C8    . DG  J 6 42  ? 75.926  101.202 78.141  1.00 248.86 ?  -32 DG  J C8    1 
ATOM 9821  N N7    . DG  J 6 42  ? 77.080  100.613 78.007  1.00 248.86 ?  -32 DG  J N7    1 
ATOM 9822  C C5    . DG  J 6 42  ? 76.898  99.754  76.937  1.00 248.86 ?  -32 DG  J C5    1 
ATOM 9823  C C6    . DG  J 6 42  ? 77.801  98.855  76.332  1.00 248.86 ?  -32 DG  J C6    1 
ATOM 9824  O O6    . DG  J 6 42  ? 78.981  98.641  76.630  1.00 248.86 ?  -32 DG  J O6    1 
ATOM 9825  N N1    . DG  J 6 42  ? 77.217  98.172  75.273  1.00 248.86 ?  -32 DG  J N1    1 
ATOM 9826  C C2    . DG  J 6 42  ? 75.922  98.341  74.850  1.00 248.86 ?  -32 DG  J C2    1 
ATOM 9827  N N2    . DG  J 6 42  ? 75.532  97.587  73.813  1.00 248.86 ?  -32 DG  J N2    1 
ATOM 9828  N N3    . DG  J 6 42  ? 75.060  99.173  75.416  1.00 248.86 ?  -32 DG  J N3    1 
ATOM 9829  C C4    . DG  J 6 42  ? 75.618  99.851  76.444  1.00 248.86 ?  -32 DG  J C4    1 
ATOM 9830  P P     . DA  J 6 43  ? 69.791  101.618 78.409  1.00 251.20 ?  -31 DA  J P     1 
ATOM 9831  O OP1   . DA  J 6 43  ? 68.472  102.218 78.116  1.00 251.20 ?  -31 DA  J OP1   1 
ATOM 9832  O OP2   . DA  J 6 43  ? 70.198  101.411 79.815  1.00 251.20 -1 -31 DA  J OP2   1 
ATOM 9833  O "O5'" . DA  J 6 43  ? 69.898  100.222 77.642  1.00 251.20 ?  -31 DA  J "O5'" 1 
ATOM 9834  C "C5'" . DA  J 6 43  ? 69.762  100.192 76.232  1.00 251.20 ?  -31 DA  J "C5'" 1 
ATOM 9835  C "C4'" . DA  J 6 43  ? 70.067  98.815  75.679  1.00 251.20 ?  -31 DA  J "C4'" 1 
ATOM 9836  O "O4'" . DA  J 6 43  ? 71.488  98.537  75.796  1.00 251.20 ?  -31 DA  J "O4'" 1 
ATOM 9837  C "C3'" . DA  J 6 43  ? 69.353  97.658  76.380  1.00 251.20 ?  -31 DA  J "C3'" 1 
ATOM 9838  O "O3'" . DA  J 6 43  ? 68.835  96.768  75.410  1.00 251.20 ?  -31 DA  J "O3'" 1 
ATOM 9839  C "C2'" . DA  J 6 43  ? 70.471  97.009  77.189  1.00 251.20 ?  -31 DA  J "C2'" 1 
ATOM 9840  C "C1'" . DA  J 6 43  ? 71.643  97.220  76.254  1.00 251.20 ?  -31 DA  J "C1'" 1 
ATOM 9841  N N9    . DA  J 6 43  ? 72.951  97.090  76.887  1.00 251.20 ?  -31 DA  J N9    1 
ATOM 9842  C C8    . DA  J 6 43  ? 73.422  97.788  77.959  1.00 251.20 ?  -31 DA  J C8    1 
ATOM 9843  N N7    . DA  J 6 43  ? 74.642  97.461  78.308  1.00 251.20 ?  -31 DA  J N7    1 
ATOM 9844  C C5    . DA  J 6 43  ? 74.995  96.484  77.400  1.00 251.20 ?  -31 DA  J C5    1 
ATOM 9845  C C6    . DA  J 6 43  ? 76.169  95.737  77.224  1.00 251.20 ?  -31 DA  J C6    1 
ATOM 9846  N N6    . DA  J 6 43  ? 77.240  95.862  78.007  1.00 251.20 ?  -31 DA  J N6    1 
ATOM 9847  N N1    . DA  J 6 43  ? 76.198  94.839  76.218  1.00 251.20 ?  -31 DA  J N1    1 
ATOM 9848  C C2    . DA  J 6 43  ? 75.123  94.713  75.436  1.00 251.20 ?  -31 DA  J C2    1 
ATOM 9849  N N3    . DA  J 6 43  ? 73.965  95.364  75.502  1.00 251.20 ?  -31 DA  J N3    1 
ATOM 9850  C C4    . DA  J 6 43  ? 73.968  96.244  76.514  1.00 251.20 ?  -31 DA  J C4    1 
ATOM 9851  P P     . DA  J 6 44  ? 67.938  95.518  75.864  1.00 253.59 ?  -30 DA  J P     1 
ATOM 9852  O OP1   . DA  J 6 44  ? 66.756  95.472  74.978  1.00 253.59 ?  -30 DA  J OP1   1 
ATOM 9853  O OP2   . DA  J 6 44  ? 67.756  95.606  77.327  1.00 253.59 -1 -30 DA  J OP2   1 
ATOM 9854  O "O5'" . DA  J 6 44  ? 68.858  94.249  75.557  1.00 253.59 ?  -30 DA  J "O5'" 1 
ATOM 9855  C "C5'" . DA  J 6 44  ? 68.906  93.715  74.244  1.00 253.59 ?  -30 DA  J "C5'" 1 
ATOM 9856  C "C4'" . DA  J 6 44  ? 69.910  92.581  74.152  1.00 253.59 ?  -30 DA  J "C4'" 1 
ATOM 9857  O "O4'" . DA  J 6 44  ? 71.148  92.974  74.793  1.00 253.59 ?  -30 DA  J "O4'" 1 
ATOM 9858  C "C3'" . DA  J 6 44  ? 69.485  91.275  74.818  1.00 253.59 ?  -30 DA  J "C3'" 1 
ATOM 9859  O "O3'" . DA  J 6 44  ? 69.909  90.180  74.025  1.00 253.59 ?  -30 DA  J "O3'" 1 
ATOM 9860  C "C2'" . DA  J 6 44  ? 70.219  91.312  76.155  1.00 253.59 ?  -30 DA  J "C2'" 1 
ATOM 9861  C "C1'" . DA  J 6 44  ? 71.505  92.024  75.773  1.00 253.59 ?  -30 DA  J "C1'" 1 
ATOM 9862  N N9    . DA  J 6 44  ? 72.124  92.738  76.878  1.00 253.59 ?  -30 DA  J N9    1 
ATOM 9863  C C8    . DA  J 6 44  ? 71.582  93.765  77.588  1.00 253.59 ?  -30 DA  J C8    1 
ATOM 9864  N N7    . DA  J 6 44  ? 72.367  94.233  78.526  1.00 253.59 ?  -30 DA  J N7    1 
ATOM 9865  C C5    . DA  J 6 44  ? 73.507  93.461  78.417  1.00 253.59 ?  -30 DA  J C5    1 
ATOM 9866  C C6    . DA  J 6 44  ? 74.720  93.453  79.131  1.00 253.59 ?  -30 DA  J C6    1 
ATOM 9867  N N6    . DA  J 6 44  ? 74.986  94.295  80.134  1.00 253.59 ?  -30 DA  J N6    1 
ATOM 9868  N N1    . DA  J 6 44  ? 75.657  92.550  78.768  1.00 253.59 ?  -30 DA  J N1    1 
ATOM 9869  C C2    . DA  J 6 44  ? 75.389  91.712  77.760  1.00 253.59 ?  -30 DA  J C2    1 
ATOM 9870  N N3    . DA  J 6 44  ? 74.285  91.624  77.019  1.00 253.59 ?  -30 DA  J N3    1 
ATOM 9871  C C4    . DA  J 6 44  ? 73.376  92.533  77.404  1.00 253.59 ?  -30 DA  J C4    1 
ATOM 9872  P P     . DT  J 6 45  ? 69.449  88.688  74.394  1.00 254.36 ?  -29 DT  J P     1 
ATOM 9873  O OP1   . DT  J 6 45  ? 69.353  87.921  73.135  1.00 254.36 ?  -29 DT  J OP1   1 
ATOM 9874  O OP2   . DT  J 6 45  ? 68.280  88.788  75.294  1.00 254.36 -1 -29 DT  J OP2   1 
ATOM 9875  O "O5'" . DT  J 6 45  ? 70.669  88.112  75.243  1.00 254.36 ?  -29 DT  J "O5'" 1 
ATOM 9876  C "C5'" . DT  J 6 45  ? 71.929  87.924  74.625  1.00 254.36 ?  -29 DT  J "C5'" 1 
ATOM 9877  C "C4'" . DT  J 6 45  ? 72.871  87.163  75.539  1.00 254.36 ?  -29 DT  J "C4'" 1 
ATOM 9878  O "O4'" . DT  J 6 45  ? 73.502  88.080  76.471  1.00 254.36 ?  -29 DT  J "O4'" 1 
ATOM 9879  C "C3'" . DT  J 6 45  ? 72.211  86.081  76.397  1.00 254.36 ?  -29 DT  J "C3'" 1 
ATOM 9880  O "O3'" . DT  J 6 45  ? 73.023  84.918  76.408  1.00 254.36 ?  -29 DT  J "O3'" 1 
ATOM 9881  C "C2'" . DT  J 6 45  ? 72.160  86.728  77.778  1.00 254.36 ?  -29 DT  J "C2'" 1 
ATOM 9882  C "C1'" . DT  J 6 45  ? 73.452  87.518  77.757  1.00 254.36 ?  -29 DT  J "C1'" 1 
ATOM 9883  N N1    . DT  J 6 45  ? 73.511  88.610  78.761  1.00 254.36 ?  -29 DT  J N1    1 
ATOM 9884  C C2    . DT  J 6 45  ? 74.666  88.795  79.482  1.00 254.36 ?  -29 DT  J C2    1 
ATOM 9885  O O2    . DT  J 6 45  ? 75.656  88.105  79.341  1.00 254.36 ?  -29 DT  J O2    1 
ATOM 9886  N N3    . DT  J 6 45  ? 74.622  89.822  80.379  1.00 254.36 ?  -29 DT  J N3    1 
ATOM 9887  C C4    . DT  J 6 45  ? 73.559  90.666  80.623  1.00 254.36 ?  -29 DT  J C4    1 
ATOM 9888  O O4    . DT  J 6 45  ? 73.615  91.565  81.452  1.00 254.36 ?  -29 DT  J O4    1 
ATOM 9889  C C5    . DT  J 6 45  ? 72.379  90.419  79.835  1.00 254.36 ?  -29 DT  J C5    1 
ATOM 9890  C C7    . DT  J 6 45  ? 71.162  91.271  80.018  1.00 254.36 ?  -29 DT  J C7    1 
ATOM 9891  C C6    . DT  J 6 45  ? 72.411  89.414  78.952  1.00 254.36 ?  -29 DT  J C6    1 
ATOM 9892  P P     . DA  J 6 46  ? 72.377  83.492  76.758  1.00 251.71 ?  -28 DA  J P     1 
ATOM 9893  O OP1   . DA  J 6 46  ? 71.871  82.905  75.500  1.00 251.71 ?  -28 DA  J OP1   1 
ATOM 9894  O OP2   . DA  J 6 46  ? 71.468  83.689  77.908  1.00 251.71 -1 -28 DA  J OP2   1 
ATOM 9895  O "O5'" . DA  J 6 46  ? 73.612  82.623  77.271  1.00 251.71 ?  -28 DA  J "O5'" 1 
ATOM 9896  C "C5'" . DA  J 6 46  ? 74.737  82.420  76.435  1.00 251.71 ?  -28 DA  J "C5'" 1 
ATOM 9897  C "C4'" . DA  J 6 46  ? 76.034  82.585  77.211  1.00 251.71 ?  -28 DA  J "C4'" 1 
ATOM 9898  O "O4'" . DA  J 6 46  ? 75.993  83.816  77.971  1.00 251.71 ?  -28 DA  J "O4'" 1 
ATOM 9899  C "C3'" . DA  J 6 46  ? 76.349  81.484  78.216  1.00 251.71 ?  -28 DA  J "C3'" 1 
ATOM 9900  O "O3'" . DA  J 6 46  ? 77.749  81.268  78.261  1.00 251.71 ?  -28 DA  J "O3'" 1 
ATOM 9901  C "C2'" . DA  J 6 46  ? 75.835  82.056  79.533  1.00 251.71 ?  -28 DA  J "C2'" 1 
ATOM 9902  C "C1'" . DA  J 6 46  ? 76.101  83.545  79.354  1.00 251.71 ?  -28 DA  J "C1'" 1 
ATOM 9903  N N9    . DA  J 6 46  ? 75.138  84.393  80.039  1.00 251.71 ?  -28 DA  J N9    1 
ATOM 9904  C C8    . DA  J 6 46  ? 73.787  84.397  79.863  1.00 251.71 ?  -28 DA  J C8    1 
ATOM 9905  N N7    . DA  J 6 46  ? 73.161  85.275  80.604  1.00 251.71 ?  -28 DA  J N7    1 
ATOM 9906  C C5    . DA  J 6 46  ? 74.173  85.906  81.297  1.00 251.71 ?  -28 DA  J C5    1 
ATOM 9907  C C6    . DA  J 6 46  ? 74.161  86.928  82.253  1.00 251.71 ?  -28 DA  J C6    1 
ATOM 9908  N N6    . DA  J 6 46  ? 73.044  87.529  82.663  1.00 251.71 ?  -28 DA  J N6    1 
ATOM 9909  N N1    . DA  J 6 46  ? 75.345  87.322  82.764  1.00 251.71 ?  -28 DA  J N1    1 
ATOM 9910  C C2    . DA  J 6 46  ? 76.463  86.718  82.345  1.00 251.71 ?  -28 DA  J C2    1 
ATOM 9911  N N3    . DA  J 6 46  ? 76.596  85.736  81.457  1.00 251.71 ?  -28 DA  J N3    1 
ATOM 9912  C C4    . DA  J 6 46  ? 75.401  85.371  80.969  1.00 251.71 ?  -28 DA  J C4    1 
ATOM 9913  P P     . DT  J 6 47  ? 78.339  79.960  78.978  1.00 241.44 ?  -27 DT  J P     1 
ATOM 9914  O OP1   . DT  J 6 47  ? 79.649  79.655  78.364  1.00 241.44 ?  -27 DT  J OP1   1 
ATOM 9915  O OP2   . DT  J 6 47  ? 77.264  78.944  78.974  1.00 241.44 -1 -27 DT  J OP2   1 
ATOM 9916  O "O5'" . DT  J 6 47  ? 78.563  80.420  80.493  1.00 241.44 ?  -27 DT  J "O5'" 1 
ATOM 9917  C "C5'" . DT  J 6 47  ? 79.345  81.571  80.779  1.00 241.44 ?  -27 DT  J "C5'" 1 
ATOM 9918  C "C4'" . DT  J 6 47  ? 79.338  81.876  82.266  1.00 241.44 ?  -27 DT  J "C4'" 1 
ATOM 9919  O "O4'" . DT  J 6 47  ? 78.274  82.819  82.575  1.00 241.44 ?  -27 DT  J "O4'" 1 
ATOM 9920  C "C3'" . DT  J 6 47  ? 79.106  80.667  83.177  1.00 241.44 ?  -27 DT  J "C3'" 1 
ATOM 9921  O "O3'" . DT  J 6 47  ? 79.989  80.729  84.273  1.00 241.44 ?  -27 DT  J "O3'" 1 
ATOM 9922  C "C2'" . DT  J 6 47  ? 77.664  80.863  83.630  1.00 241.44 ?  -27 DT  J "C2'" 1 
ATOM 9923  C "C1'" . DT  J 6 47  ? 77.618  82.371  83.732  1.00 241.44 ?  -27 DT  J "C1'" 1 
ATOM 9924  N N1    . DT  J 6 47  ? 76.247  82.934  83.768  1.00 241.44 ?  -27 DT  J N1    1 
ATOM 9925  C C2    . DT  J 6 47  ? 76.018  84.076  84.488  1.00 241.44 ?  -27 DT  J C2    1 
ATOM 9926  O O2    . DT  J 6 47  ? 76.890  84.666  85.092  1.00 241.44 ?  -27 DT  J O2    1 
ATOM 9927  N N3    . DT  J 6 47  ? 74.726  84.516  84.469  1.00 241.44 ?  -27 DT  J N3    1 
ATOM 9928  C C4    . DT  J 6 47  ? 73.657  83.927  83.830  1.00 241.44 ?  -27 DT  J C4    1 
ATOM 9929  O O4    . DT  J 6 47  ? 72.529  84.403  83.868  1.00 241.44 ?  -27 DT  J O4    1 
ATOM 9930  C C5    . DT  J 6 47  ? 73.966  82.730  83.091  1.00 241.44 ?  -27 DT  J C5    1 
ATOM 9931  C C7    . DT  J 6 47  ? 72.886  82.005  82.348  1.00 241.44 ?  -27 DT  J C7    1 
ATOM 9932  C C6    . DT  J 6 47  ? 75.231  82.292  83.101  1.00 241.44 ?  -27 DT  J C6    1 
ATOM 9933  P P     . DT  J 6 48  ? 81.144  79.631  84.446  1.00 240.79 ?  -26 DT  J P     1 
ATOM 9934  O OP1   . DT  J 6 48  ? 81.925  79.618  83.191  1.00 240.79 ?  -26 DT  J OP1   1 
ATOM 9935  O OP2   . DT  J 6 48  ? 80.511  78.386  84.930  1.00 240.79 -1 -26 DT  J OP2   1 
ATOM 9936  O "O5'" . DT  J 6 48  ? 82.056  80.224  85.618  1.00 240.79 ?  -26 DT  J "O5'" 1 
ATOM 9937  C "C5'" . DT  J 6 48  ? 82.916  81.327  85.356  1.00 240.79 ?  -26 DT  J "C5'" 1 
ATOM 9938  C "C4'" . DT  J 6 48  ? 82.839  82.366  86.464  1.00 240.79 ?  -26 DT  J "C4'" 1 
ATOM 9939  O "O4'" . DT  J 6 48  ? 81.469  82.810  86.625  1.00 240.79 ?  -26 DT  J "O4'" 1 
ATOM 9940  C "C3'" . DT  J 6 48  ? 83.295  81.892  87.843  1.00 240.79 ?  -26 DT  J "C3'" 1 
ATOM 9941  O "O3'" . DT  J 6 48  ? 84.070  82.904  88.460  1.00 240.79 ?  -26 DT  J "O3'" 1 
ATOM 9942  C "C2'" . DT  J 6 48  ? 81.983  81.671  88.585  1.00 240.79 ?  -26 DT  J "C2'" 1 
ATOM 9943  C "C1'" . DT  J 6 48  ? 81.120  82.763  87.985  1.00 240.79 ?  -26 DT  J "C1'" 1 
ATOM 9944  N N1    . DT  J 6 48  ? 79.669  82.495  88.081  1.00 240.79 ?  -26 DT  J N1    1 
ATOM 9945  C C2    . DT  J 6 48  ? 78.853  83.434  88.652  1.00 240.79 ?  -26 DT  J C2    1 
ATOM 9946  O O2    . DT  J 6 48  ? 79.263  84.490  89.095  1.00 240.79 ?  -26 DT  J O2    1 
ATOM 9947  N N3    . DT  J 6 48  ? 77.530  83.096  88.690  1.00 240.79 ?  -26 DT  J N3    1 
ATOM 9948  C C4    . DT  J 6 48  ? 76.955  81.935  88.219  1.00 240.79 ?  -26 DT  J C4    1 
ATOM 9949  O O4    . DT  J 6 48  ? 75.753  81.721  88.298  1.00 240.79 ?  -26 DT  J O4    1 
ATOM 9950  C C5    . DT  J 6 48  ? 77.867  80.992  87.632  1.00 240.79 ?  -26 DT  J C5    1 
ATOM 9951  C C7    . DT  J 6 48  ? 77.357  79.695  87.092  1.00 240.79 ?  -26 DT  J C7    1 
ATOM 9952  C C6    . DT  J 6 48  ? 79.166  81.313  87.589  1.00 240.79 ?  -26 DT  J C6    1 
ATOM 9953  P P     . DC  J 6 49  ? 84.885  82.588  89.806  1.00 237.29 ?  -25 DC  J P     1 
ATOM 9954  O OP1   . DC  J 6 49  ? 86.054  83.492  89.850  1.00 237.29 ?  -25 DC  J OP1   1 
ATOM 9955  O OP2   . DC  J 6 49  ? 85.075  81.125  89.880  1.00 237.29 -1 -25 DC  J OP2   1 
ATOM 9956  O "O5'" . DC  J 6 49  ? 83.881  83.021  90.967  1.00 237.29 ?  -25 DC  J "O5'" 1 
ATOM 9957  C "C5'" . DC  J 6 49  ? 83.553  84.382  91.124  1.00 237.29 ?  -25 DC  J "C5'" 1 
ATOM 9958  C "C4'" . DC  J 6 49  ? 82.389  84.552  92.075  1.00 237.29 ?  -25 DC  J "C4'" 1 
ATOM 9959  O "O4'" . DC  J 6 49  ? 81.210  83.902  91.534  1.00 237.29 ?  -25 DC  J "O4'" 1 
ATOM 9960  C "C3'" . DC  J 6 49  ? 82.590  83.960  93.474  1.00 237.29 ?  -25 DC  J "C3'" 1 
ATOM 9961  O "O3'" . DC  J 6 49  ? 82.159  84.895  94.436  1.00 237.29 ?  -25 DC  J "O3'" 1 
ATOM 9962  C "C2'" . DC  J 6 49  ? 81.684  82.730  93.461  1.00 237.29 ?  -25 DC  J "C2'" 1 
ATOM 9963  C "C1'" . DC  J 6 49  ? 80.561  83.231  92.581  1.00 237.29 ?  -25 DC  J "C1'" 1 
ATOM 9964  N N1    . DC  J 6 49  ? 79.705  82.163  92.013  1.00 237.29 ?  -25 DC  J N1    1 
ATOM 9965  C C2    . DC  J 6 49  ? 78.343  82.399  91.847  1.00 237.29 ?  -25 DC  J C2    1 
ATOM 9966  O O2    . DC  J 6 49  ? 77.881  83.492  92.179  1.00 237.29 ?  -25 DC  J O2    1 
ATOM 9967  N N3    . DC  J 6 49  ? 77.566  81.425  91.328  1.00 237.29 ?  -25 DC  J N3    1 
ATOM 9968  C C4    . DC  J 6 49  ? 78.106  80.262  90.979  1.00 237.29 ?  -25 DC  J C4    1 
ATOM 9969  N N4    . DC  J 6 49  ? 77.299  79.328  90.473  1.00 237.29 ?  -25 DC  J N4    1 
ATOM 9970  C C5    . DC  J 6 49  ? 79.496  79.999  91.142  1.00 237.29 ?  -25 DC  J C5    1 
ATOM 9971  C C6    . DC  J 6 49  ? 80.251  80.969  91.660  1.00 237.29 ?  -25 DC  J C6    1 
ATOM 9972  P P     . DT  J 6 50  ? 82.482  84.672  95.989  1.00 226.53 ?  -24 DT  J P     1 
ATOM 9973  O OP1   . DT  J 6 50  ? 83.939  84.835  96.158  1.00 226.53 ?  -24 DT  J OP1   1 
ATOM 9974  O OP2   . DT  J 6 50  ? 81.820  83.433  96.428  1.00 226.53 -1 -24 DT  J OP2   1 
ATOM 9975  O "O5'" . DT  J 6 50  ? 81.726  85.876  96.705  1.00 226.53 ?  -24 DT  J "O5'" 1 
ATOM 9976  C "C5'" . DT  J 6 50  ? 80.606  86.471  96.080  1.00 226.53 ?  -24 DT  J "C5'" 1 
ATOM 9977  C "C4'" . DT  J 6 50  ? 79.334  86.221  96.866  1.00 226.53 ?  -24 DT  J "C4'" 1 
ATOM 9978  O "O4'" . DT  J 6 50  ? 78.527  85.240  96.172  1.00 226.53 ?  -24 DT  J "O4'" 1 
ATOM 9979  C "C3'" . DT  J 6 50  ? 79.525  85.684  98.280  1.00 226.53 ?  -24 DT  J "C3'" 1 
ATOM 9980  O "O3'" . DT  J 6 50  ? 78.535  86.228  99.130  1.00 226.53 ?  -24 DT  J "O3'" 1 
ATOM 9981  C "C2'" . DT  J 6 50  ? 79.323  84.185  98.095  1.00 226.53 ?  -24 DT  J "C2'" 1 
ATOM 9982  C "C1'" . DT  J 6 50  ? 78.235  84.165  97.035  1.00 226.53 ?  -24 DT  J "C1'" 1 
ATOM 9983  N N1    . DT  J 6 50  ? 78.190  82.910  96.217  1.00 226.53 ?  -24 DT  J N1    1 
ATOM 9984  C C2    . DT  J 6 50  ? 77.104  82.679  95.411  1.00 226.53 ?  -24 DT  J C2    1 
ATOM 9985  O O2    . DT  J 6 50  ? 76.161  83.440  95.331  1.00 226.53 ?  -24 DT  J O2    1 
ATOM 9986  N N3    . DT  J 6 50  ? 77.156  81.517  94.700  1.00 226.53 ?  -24 DT  J N3    1 
ATOM 9987  C C4    . DT  J 6 50  ? 78.167  80.582  94.707  1.00 226.53 ?  -24 DT  J C4    1 
ATOM 9988  O O4    . DT  J 6 50  ? 78.122  79.565  94.031  1.00 226.53 ?  -24 DT  J O4    1 
ATOM 9989  C C5    . DT  J 6 50  ? 79.278  80.882  95.568  1.00 226.53 ?  -24 DT  J C5    1 
ATOM 9990  C C7    . DT  J 6 50  ? 80.434  79.933  95.659  1.00 226.53 ?  -24 DT  J C7    1 
ATOM 9991  C C6    . DT  J 6 50  ? 79.238  82.019  96.273  1.00 226.53 ?  -24 DT  J C6    1 
ATOM 9992  P P     . DT  J 6 51  ? 78.840  86.474  100.686 1.00 229.18 ?  -23 DT  J P     1 
ATOM 9993  O OP1   . DT  J 6 51  ? 79.593  87.728  100.855 1.00 229.18 ?  -23 DT  J OP1   1 
ATOM 9994  O OP2   . DT  J 6 51  ? 79.398  85.225  101.229 1.00 229.18 -1 -23 DT  J OP2   1 
ATOM 9995  O "O5'" . DT  J 6 51  ? 77.398  86.697  101.313 1.00 229.18 ?  -23 DT  J "O5'" 1 
ATOM 9996  C "C5'" . DT  J 6 51  ? 76.494  87.568  100.679 1.00 229.18 ?  -23 DT  J "C5'" 1 
ATOM 9997  C "C4'" . DT  J 6 51  ? 75.173  86.875  100.436 1.00 229.18 ?  -23 DT  J "C4'" 1 
ATOM 9998  O "O4'" . DT  J 6 51  ? 75.370  85.770  99.523  1.00 229.18 ?  -23 DT  J "O4'" 1 
ATOM 9999  C "C3'" . DT  J 6 51  ? 74.522  86.287  101.684 1.00 229.18 ?  -23 DT  J "C3'" 1 
ATOM 10000 O "O3'" . DT  J 6 51  ? 73.180  86.696  101.760 1.00 229.18 ?  -23 DT  J "O3'" 1 
ATOM 10001 C "C2'" . DT  J 6 51  ? 74.641  84.776  101.486 1.00 229.18 ?  -23 DT  J "C2'" 1 
ATOM 10002 C "C1'" . DT  J 6 51  ? 74.642  84.661  99.977  1.00 229.18 ?  -23 DT  J "C1'" 1 
ATOM 10003 N N1    . DT  J 6 51  ? 75.304  83.431  99.467  1.00 229.18 ?  -23 DT  J N1    1 
ATOM 10004 C C2    . DT  J 6 51  ? 74.777  82.796  98.377  1.00 229.18 ?  -23 DT  J C2    1 
ATOM 10005 O O2    . DT  J 6 51  ? 73.779  83.181  97.804  1.00 229.18 ?  -23 DT  J O2    1 
ATOM 10006 N N3    . DT  J 6 51  ? 75.457  81.684  97.977  1.00 229.18 ?  -23 DT  J N3    1 
ATOM 10007 C C4    . DT  J 6 51  ? 76.594  81.158  98.544  1.00 229.18 ?  -23 DT  J C4    1 
ATOM 10008 O O4    . DT  J 6 51  ? 77.136  80.153  98.109  1.00 229.18 ?  -23 DT  J O4    1 
ATOM 10009 C C5    . DT  J 6 51  ? 77.099  81.872  99.683  1.00 229.18 ?  -23 DT  J C5    1 
ATOM 10010 C C7    . DT  J 6 51  ? 78.337  81.393  100.380 1.00 229.18 ?  -23 DT  J C7    1 
ATOM 10011 C C6    . DT  J 6 51  ? 76.438  82.965  100.085 1.00 229.18 ?  -23 DT  J C6    1 
ATOM 10012 P P     . DT  J 6 52  ? 72.510  86.955  103.192 1.00 237.26 ?  -22 DT  J P     1 
ATOM 10013 O OP1   . DT  J 6 52  ? 71.625  88.130  103.060 1.00 237.26 ?  -22 DT  J OP1   1 
ATOM 10014 O OP2   . DT  J 6 52  ? 73.593  86.965  104.195 1.00 237.26 -1 -22 DT  J OP2   1 
ATOM 10015 O "O5'" . DT  J 6 52  ? 71.628  85.648  103.443 1.00 237.26 ?  -22 DT  J "O5'" 1 
ATOM 10016 C "C5'" . DT  J 6 52  ? 70.442  85.451  102.695 1.00 237.26 ?  -22 DT  J "C5'" 1 
ATOM 10017 C "C4'" . DT  J 6 52  ? 69.941  84.028  102.835 1.00 237.26 ?  -22 DT  J "C4'" 1 
ATOM 10018 O "O4'" . DT  J 6 52  ? 70.842  83.127  102.153 1.00 237.26 ?  -22 DT  J "O4'" 1 
ATOM 10019 C "C3'" . DT  J 6 52  ? 69.830  83.515  104.271 1.00 237.26 ?  -22 DT  J "C3'" 1 
ATOM 10020 O "O3'" . DT  J 6 52  ? 68.568  82.912  104.462 1.00 237.26 ?  -22 DT  J "O3'" 1 
ATOM 10021 C "C2'" . DT  J 6 52  ? 70.958  82.490  104.375 1.00 237.26 ?  -22 DT  J "C2'" 1 
ATOM 10022 C "C1'" . DT  J 6 52  ? 71.031  81.990  102.948 1.00 237.26 ?  -22 DT  J "C1'" 1 
ATOM 10023 N N1    . DT  J 6 52  ? 72.331  81.378  102.587 1.00 237.26 ?  -22 DT  J N1    1 
ATOM 10024 C C2    . DT  J 6 52  ? 72.346  80.352  101.683 1.00 237.26 ?  -22 DT  J C2    1 
ATOM 10025 O O2    . DT  J 6 52  ? 71.341  79.914  101.159 1.00 237.26 ?  -22 DT  J O2    1 
ATOM 10026 N N3    . DT  J 6 52  ? 73.584  79.851  101.407 1.00 237.26 ?  -22 DT  J N3    1 
ATOM 10027 C C4    . DT  J 6 52  ? 74.785  80.267  101.933 1.00 237.26 ?  -22 DT  J C4    1 
ATOM 10028 O O4    . DT  J 6 52  ? 75.845  79.747  101.627 1.00 237.26 ?  -22 DT  J O4    1 
ATOM 10029 C C5    . DT  J 6 52  ? 74.704  81.347  102.877 1.00 237.26 ?  -22 DT  J C5    1 
ATOM 10030 C C7    . DT  J 6 52  ? 75.950  81.875  103.517 1.00 237.26 ?  -22 DT  J C7    1 
ATOM 10031 C C6    . DT  J 6 52  ? 73.492  81.849  103.157 1.00 237.26 ?  -22 DT  J C6    1 
ATOM 10032 P P     . DG  J 6 53  ? 68.020  82.642  105.944 1.00 258.82 ?  -21 DG  J P     1 
ATOM 10033 O OP1   . DG  J 6 53  ? 66.605  83.070  105.984 1.00 258.82 ?  -21 DG  J OP1   1 
ATOM 10034 O OP2   . DG  J 6 53  ? 68.991  83.220  106.896 1.00 258.82 -1 -21 DG  J OP2   1 
ATOM 10035 O "O5'" . DG  J 6 53  ? 68.074  81.054  106.083 1.00 258.82 ?  -21 DG  J "O5'" 1 
ATOM 10036 C "C5'" . DG  J 6 53  ? 67.218  80.252  105.292 1.00 258.82 ?  -21 DG  J "C5'" 1 
ATOM 10037 C "C4'" . DG  J 6 53  ? 67.741  78.835  105.205 1.00 258.82 ?  -21 DG  J "C4'" 1 
ATOM 10038 O "O4'" . DG  J 6 53  ? 69.003  78.831  104.517 1.00 258.82 ?  -21 DG  J "O4'" 1 
ATOM 10039 C "C3'" . DG  J 6 53  ? 68.008  78.165  106.554 1.00 258.82 ?  -21 DG  J "C3'" 1 
ATOM 10040 O "O3'" . DG  J 6 53  ? 67.047  77.153  106.793 1.00 258.82 ?  -21 DG  J "O3'" 1 
ATOM 10041 C "C2'" . DG  J 6 53  ? 69.421  77.577  106.425 1.00 258.82 ?  -21 DG  J "C2'" 1 
ATOM 10042 C "C1'" . DG  J 6 53  ? 69.716  77.710  104.939 1.00 258.82 ?  -21 DG  J "C1'" 1 
ATOM 10043 N N9    . DG  J 6 53  ? 71.126  77.918  104.646 1.00 258.82 ?  -21 DG  J N9    1 
ATOM 10044 C C8    . DG  J 6 53  ? 71.873  79.037  104.910 1.00 258.82 ?  -21 DG  J C8    1 
ATOM 10045 N N7    . DG  J 6 53  ? 73.116  78.927  104.537 1.00 258.82 ?  -21 DG  J N7    1 
ATOM 10046 C C5    . DG  J 6 53  ? 73.192  77.658  103.985 1.00 258.82 ?  -21 DG  J C5    1 
ATOM 10047 C C6    . DG  J 6 53  ? 74.290  76.978  103.413 1.00 258.82 ?  -21 DG  J C6    1 
ATOM 10048 O O6    . DG  J 6 53  ? 75.451  77.379  103.271 1.00 258.82 ?  -21 DG  J O6    1 
ATOM 10049 N N1    . DG  J 6 53  ? 73.939  75.705  102.981 1.00 258.82 ?  -21 DG  J N1    1 
ATOM 10050 C C2    . DG  J 6 53  ? 72.684  75.160  103.088 1.00 258.82 ?  -21 DG  J C2    1 
ATOM 10051 N N2    . DG  J 6 53  ? 72.533  73.918  102.612 1.00 258.82 ?  -21 DG  J N2    1 
ATOM 10052 N N3    . DG  J 6 53  ? 71.649  75.787  103.624 1.00 258.82 ?  -21 DG  J N3    1 
ATOM 10053 C C4    . DG  J 6 53  ? 71.976  77.027  104.048 1.00 258.82 ?  -21 DG  J C4    1 
ATOM 10054 P P     . DT  J 6 54  ? 66.943  76.477  108.245 1.00 261.21 ?  -20 DT  J P     1 
ATOM 10055 O OP1   . DT  J 6 54  ? 65.529  76.114  108.482 1.00 261.21 ?  -20 DT  J OP1   1 
ATOM 10056 O OP2   . DT  J 6 54  ? 67.655  77.358  109.195 1.00 261.21 -1 -20 DT  J OP2   1 
ATOM 10057 O "O5'" . DT  J 6 54  ? 67.803  75.141  108.108 1.00 261.21 ?  -20 DT  J "O5'" 1 
ATOM 10058 C "C5'" . DT  J 6 54  ? 67.304  74.049  107.354 1.00 261.21 ?  -20 DT  J "C5'" 1 
ATOM 10059 C "C4'" . DT  J 6 54  ? 68.284  72.889  107.370 1.00 261.21 ?  -20 DT  J "C4'" 1 
ATOM 10060 O "O4'" . DT  J 6 54  ? 69.517  73.292  106.730 1.00 261.21 ?  -20 DT  J "O4'" 1 
ATOM 10061 C "C3'" . DT  J 6 54  ? 68.663  72.378  108.758 1.00 261.21 ?  -20 DT  J "C3'" 1 
ATOM 10062 O "O3'" . DT  J 6 54  ? 68.698  70.963  108.759 1.00 261.21 ?  -20 DT  J "O3'" 1 
ATOM 10063 C "C2'" . DT  J 6 54  ? 70.048  72.971  108.999 1.00 261.21 ?  -20 DT  J "C2'" 1 
ATOM 10064 C "C1'" . DT  J 6 54  ? 70.611  73.065  107.589 1.00 261.21 ?  -20 DT  J "C1'" 1 
ATOM 10065 N N1    . DT  J 6 54  ? 71.568  74.186  107.406 1.00 261.21 ?  -20 DT  J N1    1 
ATOM 10066 C C2    . DT  J 6 54  ? 72.497  74.111  106.403 1.00 261.21 ?  -20 DT  J C2    1 
ATOM 10067 O O2    . DT  J 6 54  ? 72.584  73.161  105.650 1.00 261.21 ?  -20 DT  J O2    1 
ATOM 10068 N N3    . DT  J 6 54  ? 73.327  75.192  106.309 1.00 261.21 ?  -20 DT  J N3    1 
ATOM 10069 C C4    . DT  J 6 54  ? 73.311  76.322  107.097 1.00 261.21 ?  -20 DT  J C4    1 
ATOM 10070 O O4    . DT  J 6 54  ? 74.103  77.244  106.939 1.00 261.21 ?  -20 DT  J O4    1 
ATOM 10071 C C5    . DT  J 6 54  ? 72.309  76.335  108.132 1.00 261.21 ?  -20 DT  J C5    1 
ATOM 10072 C C7    . DT  J 6 54  ? 72.198  77.506  109.058 1.00 261.21 ?  -20 DT  J C7    1 
ATOM 10073 C C6    . DT  J 6 54  ? 71.495  75.280  108.234 1.00 261.21 ?  -20 DT  J C6    1 
ATOM 10074 P P     . DG  J 6 55  ? 67.823  70.142  109.825 1.00 272.35 ?  -19 DG  J P     1 
ATOM 10075 O OP1   . DG  J 6 55  ? 66.913  69.254  109.069 1.00 272.35 ?  -19 DG  J OP1   1 
ATOM 10076 O OP2   . DG  J 6 55  ? 67.277  71.113  110.797 1.00 272.35 -1 -19 DG  J OP2   1 
ATOM 10077 O "O5'" . DG  J 6 55  ? 68.897  69.242  110.586 1.00 272.35 ?  -19 DG  J "O5'" 1 
ATOM 10078 C "C5'" . DG  J 6 55  ? 69.611  68.253  109.874 1.00 272.35 ?  -19 DG  J "C5'" 1 
ATOM 10079 C "C4'" . DG  J 6 55  ? 71.039  68.157  110.369 1.00 272.35 ?  -19 DG  J "C4'" 1 
ATOM 10080 O "O4'" . DG  J 6 55  ? 71.791  69.326  109.949 1.00 272.35 ?  -19 DG  J "O4'" 1 
ATOM 10081 C "C3'" . DG  J 6 55  ? 71.205  68.080  111.891 1.00 272.35 ?  -19 DG  J "C3'" 1 
ATOM 10082 O "O3'" . DG  J 6 55  ? 72.176  67.103  112.199 1.00 272.35 ?  -19 DG  J "O3'" 1 
ATOM 10083 C "C2'" . DG  J 6 55  ? 71.710  69.476  112.245 1.00 272.35 ?  -19 DG  J "C2'" 1 
ATOM 10084 C "C1'" . DG  J 6 55  ? 72.572  69.753  111.034 1.00 272.35 ?  -19 DG  J "C1'" 1 
ATOM 10085 N N9    . DG  J 6 55  ? 72.923  71.154  110.851 1.00 272.35 ?  -19 DG  J N9    1 
ATOM 10086 C C8    . DG  J 6 55  ? 72.396  72.235  111.506 1.00 272.35 ?  -19 DG  J C8    1 
ATOM 10087 N N7    . DG  J 6 55  ? 72.914  73.370  111.128 1.00 272.35 ?  -19 DG  J N7    1 
ATOM 10088 C C5    . DG  J 6 55  ? 73.841  73.014  110.163 1.00 272.35 ?  -19 DG  J C5    1 
ATOM 10089 C C6    . DG  J 6 55  ? 74.717  73.818  109.404 1.00 272.35 ?  -19 DG  J C6    1 
ATOM 10090 O O6    . DG  J 6 55  ? 74.845  75.045  109.432 1.00 272.35 ?  -19 DG  J O6    1 
ATOM 10091 N N1    . DG  J 6 55  ? 75.499  73.056  108.545 1.00 272.35 ?  -19 DG  J N1    1 
ATOM 10092 C C2    . DG  J 6 55  ? 75.441  71.687  108.438 1.00 272.35 ?  -19 DG  J C2    1 
ATOM 10093 N N2    . DG  J 6 55  ? 76.274  71.123  107.554 1.00 272.35 ?  -19 DG  J N2    1 
ATOM 10094 N N3    . DG  J 6 55  ? 74.629  70.924  109.150 1.00 272.35 ?  -19 DG  J N3    1 
ATOM 10095 C C4    . DG  J 6 55  ? 73.864  71.653  109.990 1.00 272.35 ?  -19 DG  J C4    1 
ATOM 10096 P P     . DA  J 6 56  ? 72.231  66.435  113.656 1.00 272.26 ?  -18 DA  J P     1 
ATOM 10097 O OP1   . DA  J 6 56  ? 70.905  65.837  113.918 1.00 272.26 ?  -18 DA  J OP1   1 
ATOM 10098 O OP2   . DA  J 6 56  ? 72.790  67.421  114.601 1.00 272.26 -1 -18 DA  J OP2   1 
ATOM 10099 O "O5'" . DA  J 6 56  ? 73.306  65.270  113.484 1.00 272.26 ?  -18 DA  J "O5'" 1 
ATOM 10100 C "C5'" . DA  J 6 56  ? 73.925  65.068  112.223 1.00 272.26 ?  -18 DA  J "C5'" 1 
ATOM 10101 C "C4'" . DA  J 6 56  ? 75.286  65.729  112.182 1.00 272.26 ?  -18 DA  J "C4'" 1 
ATOM 10102 O "O4'" . DA  J 6 56  ? 75.132  67.165  112.044 1.00 272.26 ?  -18 DA  J "O4'" 1 
ATOM 10103 C "C3'" . DA  J 6 56  ? 76.141  65.513  113.434 1.00 272.26 ?  -18 DA  J "C3'" 1 
ATOM 10104 O "O3'" . DA  J 6 56  ? 77.429  65.052  113.067 1.00 272.26 ?  -18 DA  J "O3'" 1 
ATOM 10105 C "C2'" . DA  J 6 56  ? 76.204  66.900  114.074 1.00 272.26 ?  -18 DA  J "C2'" 1 
ATOM 10106 C "C1'" . DA  J 6 56  ? 76.088  67.793  112.856 1.00 272.26 ?  -18 DA  J "C1'" 1 
ATOM 10107 N N9    . DA  J 6 56  ? 75.634  69.142  113.169 1.00 272.26 ?  -18 DA  J N9    1 
ATOM 10108 C C8    . DA  J 6 56  ? 74.682  69.495  114.076 1.00 272.26 ?  -18 DA  J C8    1 
ATOM 10109 N N7    . DA  J 6 56  ? 74.473  70.783  114.152 1.00 272.26 ?  -18 DA  J N7    1 
ATOM 10110 C C5    . DA  J 6 56  ? 75.364  71.315  113.243 1.00 272.26 ?  -18 DA  J C5    1 
ATOM 10111 C C6    . DA  J 6 56  ? 75.648  72.634  112.862 1.00 272.26 ?  -18 DA  J C6    1 
ATOM 10112 N N6    . DA  J 6 56  ? 75.018  73.692  113.371 1.00 272.26 ?  -18 DA  J N6    1 
ATOM 10113 N N1    . DA  J 6 56  ? 76.592  72.826  111.919 1.00 272.26 ?  -18 DA  J N1    1 
ATOM 10114 C C2    . DA  J 6 56  ? 77.217  71.762  111.407 1.00 272.26 ?  -18 DA  J C2    1 
ATOM 10115 N N3    . DA  J 6 56  ? 77.040  70.474  111.692 1.00 272.26 ?  -18 DA  J N3    1 
ATOM 10116 C C4    . DA  J 6 56  ? 76.091  70.320  112.628 1.00 272.26 ?  -18 DA  J C4    1 
ATOM 10117 P P     . DT  J 6 57  ? 78.328  64.249  114.129 1.00 265.76 ?  -17 DT  J P     1 
ATOM 10118 O OP1   . DT  J 6 57  ? 79.363  63.509  113.375 1.00 265.76 ?  -17 DT  J OP1   1 
ATOM 10119 O OP2   . DT  J 6 57  ? 77.408  63.522  115.029 1.00 265.76 -1 -17 DT  J OP2   1 
ATOM 10120 O "O5'" . DT  J 6 57  ? 79.035  65.399  114.983 1.00 265.76 ?  -17 DT  J "O5'" 1 
ATOM 10121 C "C5'" . DT  J 6 57  ? 79.874  66.343  114.339 1.00 265.76 ?  -17 DT  J "C5'" 1 
ATOM 10122 C "C4'" . DT  J 6 57  ? 80.561  67.230  115.357 1.00 265.76 ?  -17 DT  J "C4'" 1 
ATOM 10123 O "O4'" . DT  J 6 57  ? 80.020  68.574  115.280 1.00 265.76 ?  -17 DT  J "O4'" 1 
ATOM 10124 C "C3'" . DT  J 6 57  ? 80.400  66.787  116.813 1.00 265.76 ?  -17 DT  J "C3'" 1 
ATOM 10125 O "O3'" . DT  J 6 57  ? 81.626  66.952  117.499 1.00 265.76 ?  -17 DT  J "O3'" 1 
ATOM 10126 C "C2'" . DT  J 6 57  ? 79.339  67.748  117.343 1.00 265.76 ?  -17 DT  J "C2'" 1 
ATOM 10127 C "C1'" . DT  J 6 57  ? 79.694  69.011  116.576 1.00 265.76 ?  -17 DT  J "C1'" 1 
ATOM 10128 N N1    . DT  J 6 57  ? 78.586  70.008  116.480 1.00 265.76 ?  -17 DT  J N1    1 
ATOM 10129 C C2    . DT  J 6 57  ? 78.819  71.203  115.848 1.00 265.76 ?  -17 DT  J C2    1 
ATOM 10130 O O2    . DT  J 6 57  ? 79.891  71.498  115.355 1.00 265.76 ?  -17 DT  J O2    1 
ATOM 10131 N N3    . DT  J 6 57  ? 77.748  72.050  115.811 1.00 265.76 ?  -17 DT  J N3    1 
ATOM 10132 C C4    . DT  J 6 57  ? 76.494  71.828  116.339 1.00 265.76 ?  -17 DT  J C4    1 
ATOM 10133 O O4    . DT  J 6 57  ? 75.590  72.651  116.251 1.00 265.76 ?  -17 DT  J O4    1 
ATOM 10134 C C5    . DT  J 6 57  ? 76.313  70.553  116.984 1.00 265.76 ?  -17 DT  J C5    1 
ATOM 10135 C C7    . DT  J 6 57  ? 74.991  70.198  117.591 1.00 265.76 ?  -17 DT  J C7    1 
ATOM 10136 C C6    . DT  J 6 57  ? 77.355  69.716  117.026 1.00 265.76 ?  -17 DT  J C6    1 
ATOM 10137 P P     . DG  J 6 58  ? 82.618  65.707  117.709 1.00 265.19 ?  -16 DG  J P     1 
ATOM 10138 O OP1   . DG  J 6 58  ? 82.481  64.796  116.552 1.00 265.19 ?  -16 DG  J OP1   1 
ATOM 10139 O OP2   . DG  J 6 58  ? 82.396  65.192  119.076 1.00 265.19 -1 -16 DG  J OP2   1 
ATOM 10140 O "O5'" . DG  J 6 58  ? 84.069  66.374  117.674 1.00 265.19 ?  -16 DG  J "O5'" 1 
ATOM 10141 C "C5'" . DG  J 6 58  ? 84.235  67.679  117.135 1.00 265.19 ?  -16 DG  J "C5'" 1 
ATOM 10142 C "C4'" . DG  J 6 58  ? 84.430  68.695  118.244 1.00 265.19 ?  -16 DG  J "C4'" 1 
ATOM 10143 O "O4'" . DG  J 6 58  ? 83.232  69.496  118.397 1.00 265.19 ?  -16 DG  J "O4'" 1 
ATOM 10144 C "C3'" . DG  J 6 58  ? 84.723  68.093  119.622 1.00 265.19 ?  -16 DG  J "C3'" 1 
ATOM 10145 O "O3'" . DG  J 6 58  ? 85.906  68.653  120.145 1.00 265.19 ?  -16 DG  J "O3'" 1 
ATOM 10146 C "C2'" . DG  J 6 58  ? 83.502  68.484  120.463 1.00 265.19 ?  -16 DG  J "C2'" 1 
ATOM 10147 C "C1'" . DG  J 6 58  ? 83.033  69.745  119.762 1.00 265.19 ?  -16 DG  J "C1'" 1 
ATOM 10148 N N9    . DG  J 6 58  ? 81.626  70.043  119.983 1.00 265.19 ?  -16 DG  J N9    1 
ATOM 10149 C C8    . DG  J 6 58  ? 80.686  69.214  120.537 1.00 265.19 ?  -16 DG  J C8    1 
ATOM 10150 N N7    . DG  J 6 58  ? 79.503  69.749  120.610 1.00 265.19 ?  -16 DG  J N7    1 
ATOM 10151 C C5    . DG  J 6 58  ? 79.670  71.014  120.072 1.00 265.19 ?  -16 DG  J C5    1 
ATOM 10152 C C6    . DG  J 6 58  ? 78.733  72.053  119.889 1.00 265.19 ?  -16 DG  J C6    1 
ATOM 10153 O O6    . DG  J 6 58  ? 77.531  72.059  120.175 1.00 265.19 ?  -16 DG  J O6    1 
ATOM 10154 N N1    . DG  J 6 58  ? 79.313  73.172  119.310 1.00 265.19 ?  -16 DG  J N1    1 
ATOM 10155 C C2    . DG  J 6 58  ? 80.631  73.273  118.952 1.00 265.19 ?  -16 DG  J C2    1 
ATOM 10156 N N2    . DG  J 6 58  ? 81.006  74.435  118.404 1.00 265.19 ?  -16 DG  J N2    1 
ATOM 10157 N N3    . DG  J 6 58  ? 81.522  72.306  119.120 1.00 265.19 ?  -16 DG  J N3    1 
ATOM 10158 C C4    . DG  J 6 58  ? 80.971  71.211  119.683 1.00 265.19 ?  -16 DG  J C4    1 
ATOM 10159 P P     . DA  J 6 59  ? 87.304  67.878  120.007 1.00 248.65 ?  -15 DA  J P     1 
ATOM 10160 O OP1   . DA  J 6 59  ? 87.211  66.972  118.841 1.00 248.65 ?  -15 DA  J OP1   1 
ATOM 10161 O OP2   . DA  J 6 59  ? 87.648  67.325  121.335 1.00 248.65 -1 -15 DA  J OP2   1 
ATOM 10162 O "O5'" . DA  J 6 59  ? 88.341  69.048  119.676 1.00 248.65 ?  -15 DA  J "O5'" 1 
ATOM 10163 C "C5'" . DA  J 6 59  ? 88.268  69.716  118.427 1.00 248.65 ?  -15 DA  J "C5'" 1 
ATOM 10164 C "C4'" . DA  J 6 59  ? 87.930  71.185  118.608 1.00 248.65 ?  -15 DA  J "C4'" 1 
ATOM 10165 O "O4'" . DA  J 6 59  ? 86.606  71.325  119.186 1.00 248.65 ?  -15 DA  J "O4'" 1 
ATOM 10166 C "C3'" . DA  J 6 59  ? 88.879  71.967  119.520 1.00 248.65 ?  -15 DA  J "C3'" 1 
ATOM 10167 O "O3'" . DA  J 6 59  ? 89.278  73.164  118.867 1.00 248.65 ?  -15 DA  J "O3'" 1 
ATOM 10168 C "C2'" . DA  J 6 59  ? 88.025  72.254  120.758 1.00 248.65 ?  -15 DA  J "C2'" 1 
ATOM 10169 C "C1'" . DA  J 6 59  ? 86.644  72.351  120.142 1.00 248.65 ?  -15 DA  J "C1'" 1 
ATOM 10170 N N9    . DA  J 6 59  ? 85.553  72.149  121.091 1.00 248.65 ?  -15 DA  J N9    1 
ATOM 10171 C C8    . DA  J 6 59  ? 85.410  71.123  121.977 1.00 248.65 ?  -15 DA  J C8    1 
ATOM 10172 N N7    . DA  J 6 59  ? 84.320  71.198  122.702 1.00 248.65 ?  -15 DA  J N7    1 
ATOM 10173 C C5    . DA  J 6 59  ? 83.709  72.356  122.263 1.00 248.65 ?  -15 DA  J C5    1 
ATOM 10174 C C6    . DA  J 6 59  ? 82.515  73.001  122.635 1.00 248.65 ?  -15 DA  J C6    1 
ATOM 10175 N N6    . DA  J 6 59  ? 81.694  72.542  123.579 1.00 248.65 ?  -15 DA  J N6    1 
ATOM 10176 N N1    . DA  J 6 59  ? 82.195  74.143  121.999 1.00 248.65 ?  -15 DA  J N1    1 
ATOM 10177 C C2    . DA  J 6 59  ? 83.018  74.606  121.054 1.00 248.65 ?  -15 DA  J C2    1 
ATOM 10178 N N3    . DA  J 6 59  ? 84.163  74.087  120.618 1.00 248.65 ?  -15 DA  J N3    1 
ATOM 10179 C C4    . DA  J 6 59  ? 84.455  72.955  121.271 1.00 248.65 ?  -15 DA  J C4    1 
ATOM 10180 P P     . DT  J 6 60  ? 90.322  74.164  119.563 1.00 245.21 ?  -14 DT  J P     1 
ATOM 10181 O OP1   . DT  J 6 60  ? 91.065  74.859  118.492 1.00 245.21 ?  -14 DT  J OP1   1 
ATOM 10182 O OP2   . DT  J 6 60  ? 91.056  73.412  120.600 1.00 245.21 -1 -14 DT  J OP2   1 
ATOM 10183 O "O5'" . DT  J 6 60  ? 89.391  75.228  120.296 1.00 245.21 ?  -14 DT  J "O5'" 1 
ATOM 10184 C "C5'" . DT  J 6 60  ? 88.293  75.786  119.604 1.00 245.21 ?  -14 DT  J "C5'" 1 
ATOM 10185 C "C4'" . DT  J 6 60  ? 87.467  76.654  120.527 1.00 245.21 ?  -14 DT  J "C4'" 1 
ATOM 10186 O "O4'" . DT  J 6 60  ? 86.539  75.831  121.279 1.00 245.21 ?  -14 DT  J "O4'" 1 
ATOM 10187 C "C3'" . DT  J 6 60  ? 88.275  77.437  121.565 1.00 245.21 ?  -14 DT  J "C3'" 1 
ATOM 10188 O "O3'" . DT  J 6 60  ? 87.842  78.779  121.585 1.00 245.21 ?  -14 DT  J "O3'" 1 
ATOM 10189 C "C2'" . DT  J 6 60  ? 87.942  76.729  122.875 1.00 245.21 ?  -14 DT  J "C2'" 1 
ATOM 10190 C "C1'" . DT  J 6 60  ? 86.519  76.285  122.606 1.00 245.21 ?  -14 DT  J "C1'" 1 
ATOM 10191 N N1    . DT  J 6 60  ? 86.058  75.183  123.488 1.00 245.21 ?  -14 DT  J N1    1 
ATOM 10192 C C2    . DT  J 6 60  ? 84.813  75.257  124.061 1.00 245.21 ?  -14 DT  J C2    1 
ATOM 10193 O O2    . DT  J 6 60  ? 84.051  76.184  123.880 1.00 245.21 ?  -14 DT  J O2    1 
ATOM 10194 N N3    . DT  J 6 60  ? 84.488  74.201  124.857 1.00 245.21 ?  -14 DT  J N3    1 
ATOM 10195 C C4    . DT  J 6 60  ? 85.267  73.100  125.136 1.00 245.21 ?  -14 DT  J C4    1 
ATOM 10196 O O4    . DT  J 6 60  ? 84.884  72.195  125.866 1.00 245.21 ?  -14 DT  J O4    1 
ATOM 10197 C C5    . DT  J 6 60  ? 86.562  73.084  124.504 1.00 245.21 ?  -14 DT  J C5    1 
ATOM 10198 C C7    . DT  J 6 60  ? 87.499  71.937  124.734 1.00 245.21 ?  -14 DT  J C7    1 
ATOM 10199 C C6    . DT  J 6 60  ? 86.891  74.116  123.722 1.00 245.21 ?  -14 DT  J C6    1 
ATOM 10200 P P     . DG  J 6 61  ? 88.794  79.924  122.179 1.00 238.26 ?  -13 DG  J P     1 
ATOM 10201 O OP1   . DG  J 6 61  ? 89.335  80.690  121.037 1.00 238.26 ?  -13 DG  J OP1   1 
ATOM 10202 O OP2   . DG  J 6 61  ? 89.714  79.298  123.149 1.00 238.26 -1 -13 DG  J OP2   1 
ATOM 10203 O "O5'" . DG  J 6 61  ? 87.790  80.853  122.991 1.00 238.26 ?  -13 DG  J "O5'" 1 
ATOM 10204 C "C5'" . DG  J 6 61  ? 86.672  81.409  122.334 1.00 238.26 ?  -13 DG  J "C5'" 1 
ATOM 10205 C "C4'" . DG  J 6 61  ? 85.458  81.400  123.235 1.00 238.26 ?  -13 DG  J "C4'" 1 
ATOM 10206 O "O4'" . DG  J 6 61  ? 85.305  80.086  123.826 1.00 238.26 ?  -13 DG  J "O4'" 1 
ATOM 10207 C "C3'" . DG  J 6 61  ? 85.512  82.380  124.406 1.00 238.26 ?  -13 DG  J "C3'" 1 
ATOM 10208 O "O3'" . DG  J 6 61  ? 84.248  82.973  124.581 1.00 238.26 ?  -13 DG  J "O3'" 1 
ATOM 10209 C "C2'" . DG  J 6 61  ? 85.860  81.483  125.584 1.00 238.26 ?  -13 DG  J "C2'" 1 
ATOM 10210 C "C1'" . DG  J 6 61  ? 85.097  80.233  125.207 1.00 238.26 ?  -13 DG  J "C1'" 1 
ATOM 10211 N N9    . DG  J 6 61  ? 85.558  79.027  125.885 1.00 238.26 ?  -13 DG  J N9    1 
ATOM 10212 C C8    . DG  J 6 61  ? 86.744  78.373  125.695 1.00 238.26 ?  -13 DG  J C8    1 
ATOM 10213 N N7    . DG  J 6 61  ? 86.878  77.314  126.440 1.00 238.26 ?  -13 DG  J N7    1 
ATOM 10214 C C5    . DG  J 6 61  ? 85.706  77.268  127.173 1.00 238.26 ?  -13 DG  J C5    1 
ATOM 10215 C C6    . DG  J 6 61  ? 85.282  76.343  128.143 1.00 238.26 ?  -13 DG  J C6    1 
ATOM 10216 O O6    . DG  J 6 61  ? 85.884  75.352  128.568 1.00 238.26 ?  -13 DG  J O6    1 
ATOM 10217 N N1    . DG  J 6 61  ? 84.025  76.660  128.642 1.00 238.26 ?  -13 DG  J N1    1 
ATOM 10218 C C2    . DG  J 6 61  ? 83.274  77.735  128.246 1.00 238.26 ?  -13 DG  J C2    1 
ATOM 10219 N N2    . DG  J 6 61  ? 82.084  77.879  128.840 1.00 238.26 ?  -13 DG  J N2    1 
ATOM 10220 N N3    . DG  J 6 61  ? 83.660  78.608  127.334 1.00 238.26 ?  -13 DG  J N3    1 
ATOM 10221 C C4    . DG  J 6 61  ? 84.882  78.313  126.843 1.00 238.26 ?  -13 DG  J C4    1 
ATOM 10222 P P     . DG  J 6 62  ? 84.082  84.214  125.581 1.00 247.02 ?  -12 DG  J P     1 
ATOM 10223 O OP1   . DG  J 6 62  ? 83.308  85.256  124.877 1.00 247.02 ?  -12 DG  J OP1   1 
ATOM 10224 O OP2   . DG  J 6 62  ? 85.417  84.515  126.131 1.00 247.02 -1 -12 DG  J OP2   1 
ATOM 10225 O "O5'" . DG  J 6 62  ? 83.196  83.639  126.773 1.00 247.02 ?  -12 DG  J "O5'" 1 
ATOM 10226 C "C5'" . DG  J 6 62  ? 81.791  83.826  126.759 1.00 247.02 ?  -12 DG  J "C5'" 1 
ATOM 10227 C "C4'" . DG  J 6 62  ? 81.169  83.478  128.103 1.00 247.02 ?  -12 DG  J "C4'" 1 
ATOM 10228 O "O4'" . DG  J 6 62  ? 81.651  82.190  128.549 1.00 247.02 ?  -12 DG  J "O4'" 1 
ATOM 10229 C "C3'" . DG  J 6 62  ? 81.462  84.453  129.234 1.00 247.02 ?  -12 DG  J "C3'" 1 
ATOM 10230 O "O3'" . DG  J 6 62  ? 80.337  84.558  130.075 1.00 247.02 ?  -12 DG  J "O3'" 1 
ATOM 10231 C "C2'" . DG  J 6 62  ? 82.633  83.806  129.959 1.00 247.02 ?  -12 DG  J "C2'" 1 
ATOM 10232 C "C1'" . DG  J 6 62  ? 82.355  82.321  129.766 1.00 247.02 ?  -12 DG  J "C1'" 1 
ATOM 10233 N N9    . DG  J 6 62  ? 83.568  81.527  129.658 1.00 247.02 ?  -12 DG  J N9    1 
ATOM 10234 C C8    . DG  J 6 62  ? 84.660  81.803  128.879 1.00 247.02 ?  -12 DG  J C8    1 
ATOM 10235 N N7    . DG  J 6 62  ? 85.602  80.910  128.971 1.00 247.02 ?  -12 DG  J N7    1 
ATOM 10236 C C5    . DG  J 6 62  ? 85.103  79.983  129.869 1.00 247.02 ?  -12 DG  J C5    1 
ATOM 10237 C C6    . DG  J 6 62  ? 85.680  78.797  130.355 1.00 247.02 ?  -12 DG  J C6    1 
ATOM 10238 O O6    . DG  J 6 62  ? 86.784  78.317  130.081 1.00 247.02 ?  -12 DG  J O6    1 
ATOM 10239 N N1    . DG  J 6 62  ? 84.840  78.145  131.246 1.00 247.02 ?  -12 DG  J N1    1 
ATOM 10240 C C2    . DG  J 6 62  ? 83.597  78.587  131.617 1.00 247.02 ?  -12 DG  J C2    1 
ATOM 10241 N N2    . DG  J 6 62  ? 82.933  77.823  132.493 1.00 247.02 ?  -12 DG  J N2    1 
ATOM 10242 N N3    . DG  J 6 62  ? 83.043  79.702  131.169 1.00 247.02 ?  -12 DG  J N3    1 
ATOM 10243 C C4    . DG  J 6 62  ? 83.847  80.343  130.297 1.00 247.02 ?  -12 DG  J C4    1 
ATOM 10244 P P     . DA  J 6 63  ? 80.273  85.714  131.184 1.00 252.29 ?  -11 DA  J P     1 
ATOM 10245 O OP1   . DA  J 6 63  ? 78.936  86.337  131.096 1.00 252.29 ?  -11 DA  J OP1   1 
ATOM 10246 O OP2   . DA  J 6 63  ? 81.489  86.541  131.037 1.00 252.29 -1 -11 DA  J OP2   1 
ATOM 10247 O "O5'" . DA  J 6 63  ? 80.385  84.924  132.565 1.00 252.29 ?  -11 DA  J "O5'" 1 
ATOM 10248 C "C5'" . DA  J 6 63  ? 79.358  84.028  132.951 1.00 252.29 ?  -11 DA  J "C5'" 1 
ATOM 10249 C "C4'" . DA  J 6 63  ? 79.859  83.093  134.028 1.00 252.29 ?  -11 DA  J "C4'" 1 
ATOM 10250 O "O4'" . DA  J 6 63  ? 80.921  82.292  133.487 1.00 252.29 ?  -11 DA  J "O4'" 1 
ATOM 10251 C "C3'" . DA  J 6 63  ? 80.447  83.798  135.245 1.00 252.29 ?  -11 DA  J "C3'" 1 
ATOM 10252 O "O3'" . DA  J 6 63  ? 79.558  83.695  136.342 1.00 252.29 ?  -11 DA  J "O3'" 1 
ATOM 10253 C "C2'" . DA  J 6 63  ? 81.773  83.076  135.523 1.00 252.29 ?  -11 DA  J "C2'" 1 
ATOM 10254 C "C1'" . DA  J 6 63  ? 81.798  81.936  134.516 1.00 252.29 ?  -11 DA  J "C1'" 1 
ATOM 10255 N N9    . DA  J 6 63  ? 83.111  81.742  133.930 1.00 252.29 ?  -11 DA  J N9    1 
ATOM 10256 C C8    . DA  J 6 63  ? 83.731  82.557  133.035 1.00 252.29 ?  -11 DA  J C8    1 
ATOM 10257 N N7    . DA  J 6 63  ? 84.919  82.146  132.677 1.00 252.29 ?  -11 DA  J N7    1 
ATOM 10258 C C5    . DA  J 6 63  ? 85.090  80.981  133.394 1.00 252.29 ?  -11 DA  J C5    1 
ATOM 10259 C C6    . DA  J 6 63  ? 86.146  80.059  133.460 1.00 252.29 ?  -11 DA  J C6    1 
ATOM 10260 N N6    . DA  J 6 63  ? 87.276  80.188  132.762 1.00 252.29 ?  -11 DA  J N6    1 
ATOM 10261 N N1    . DA  J 6 63  ? 86.000  78.997  134.278 1.00 252.29 ?  -11 DA  J N1    1 
ATOM 10262 C C2    . DA  J 6 63  ? 84.869  78.873  134.981 1.00 252.29 ?  -11 DA  J C2    1 
ATOM 10263 N N3    . DA  J 6 63  ? 83.807  79.675  134.997 1.00 252.29 ?  -11 DA  J N3    1 
ATOM 10264 C C4    . DA  J 6 63  ? 83.985  80.718  134.175 1.00 252.29 ?  -11 DA  J C4    1 
ATOM 10265 P P     . DG  J 6 64  ? 79.770  84.622  137.637 1.00 250.41 ?  -10 DG  J P     1 
ATOM 10266 O OP1   . DG  J 6 64  ? 78.460  84.765  138.306 1.00 250.41 ?  -10 DG  J OP1   1 
ATOM 10267 O OP2   . DG  J 6 64  ? 80.510  85.826  137.208 1.00 250.41 -1 -10 DG  J OP2   1 
ATOM 10268 O "O5'" . DG  J 6 64  ? 80.735  83.757  138.571 1.00 250.41 ?  -10 DG  J "O5'" 1 
ATOM 10269 C "C5'" . DG  J 6 64  ? 80.399  82.416  138.866 1.00 250.41 ?  -10 DG  J "C5'" 1 
ATOM 10270 C "C4'" . DG  J 6 64  ? 81.599  81.662  139.398 1.00 250.41 ?  -10 DG  J "C4'" 1 
ATOM 10271 O "O4'" . DG  J 6 64  ? 82.571  81.461  138.344 1.00 250.41 ?  -10 DG  J "O4'" 1 
ATOM 10272 C "C3'" . DG  J 6 64  ? 82.352  82.365  140.532 1.00 250.41 ?  -10 DG  J "C3'" 1 
ATOM 10273 O "O3'" . DG  J 6 64  ? 82.318  81.566  141.702 1.00 250.41 ?  -10 DG  J "O3'" 1 
ATOM 10274 C "C2'" . DG  J 6 64  ? 83.779  82.510  139.996 1.00 250.41 ?  -10 DG  J "C2'" 1 
ATOM 10275 C "C1'" . DG  J 6 64  ? 83.830  81.417  138.948 1.00 250.41 ?  -10 DG  J "C1'" 1 
ATOM 10276 N N9    . DG  J 6 64  ? 84.871  81.613  137.944 1.00 250.41 ?  -10 DG  J N9    1 
ATOM 10277 C C8    . DG  J 6 64  ? 84.990  82.655  137.063 1.00 250.41 ?  -10 DG  J C8    1 
ATOM 10278 N N7    . DG  J 6 64  ? 86.035  82.563  136.291 1.00 250.41 ?  -10 DG  J N7    1 
ATOM 10279 C C5    . DG  J 6 64  ? 86.648  81.386  136.690 1.00 250.41 ?  -10 DG  J C5    1 
ATOM 10280 C C6    . DG  J 6 64  ? 87.828  80.771  136.221 1.00 250.41 ?  -10 DG  J C6    1 
ATOM 10281 O O6    . DG  J 6 64  ? 88.581  81.148  135.319 1.00 250.41 ?  -10 DG  J O6    1 
ATOM 10282 N N1    . DG  J 6 64  ? 88.095  79.590  136.894 1.00 250.41 ?  -10 DG  J N1    1 
ATOM 10283 C C2    . DG  J 6 64  ? 87.327  79.075  137.905 1.00 250.41 ?  -10 DG  J C2    1 
ATOM 10284 N N2    . DG  J 6 64  ? 87.749  77.923  138.442 1.00 250.41 ?  -10 DG  J N2    1 
ATOM 10285 N N3    . DG  J 6 64  ? 86.224  79.647  138.361 1.00 250.41 ?  -10 DG  J N3    1 
ATOM 10286 C C4    . DG  J 6 64  ? 85.945  80.793  137.707 1.00 250.41 ?  -10 DG  J C4    1 
ATOM 10287 P P     . DT  J 6 65  ? 82.496  82.249  143.144 1.00 247.19 ?  -9  DT  J P     1 
ATOM 10288 O OP1   . DT  J 6 65  ? 81.450  81.693  144.026 1.00 247.19 ?  -9  DT  J OP1   1 
ATOM 10289 O OP2   . DT  J 6 65  ? 82.605  83.708  142.942 1.00 247.19 -1 -9  DT  J OP2   1 
ATOM 10290 O "O5'" . DT  J 6 65  ? 83.915  81.723  143.650 1.00 247.19 ?  -9  DT  J "O5'" 1 
ATOM 10291 C "C5'" . DT  J 6 65  ? 84.064  80.373  144.033 1.00 247.19 ?  -9  DT  J "C5'" 1 
ATOM 10292 C "C4'" . DT  J 6 65  ? 85.529  79.980  144.071 1.00 247.19 ?  -9  DT  J "C4'" 1 
ATOM 10293 O "O4'" . DT  J 6 65  ? 86.114  80.147  142.757 1.00 247.19 ?  -9  DT  J "O4'" 1 
ATOM 10294 C "C3'" . DT  J 6 65  ? 86.396  80.792  145.031 1.00 247.19 ?  -9  DT  J "C3'" 1 
ATOM 10295 O "O3'" . DT  J 6 65  ? 87.242  79.923  145.751 1.00 247.19 ?  -9  DT  J "O3'" 1 
ATOM 10296 C "C2'" . DT  J 6 65  ? 87.195  81.707  144.105 1.00 247.19 ?  -9  DT  J "C2'" 1 
ATOM 10297 C "C1'" . DT  J 6 65  ? 87.331  80.841  142.867 1.00 247.19 ?  -9  DT  J "C1'" 1 
ATOM 10298 N N1    . DT  J 6 65  ? 87.532  81.613  141.615 1.00 247.19 ?  -9  DT  J N1    1 
ATOM 10299 C C2    . DT  J 6 65  ? 88.233  81.044  140.587 1.00 247.19 ?  -9  DT  J C2    1 
ATOM 10300 O O2    . DT  J 6 65  ? 88.716  79.932  140.649 1.00 247.19 ?  -9  DT  J O2    1 
ATOM 10301 N N3    . DT  J 6 65  ? 88.358  81.827  139.478 1.00 247.19 ?  -9  DT  J N3    1 
ATOM 10302 C C4    . DT  J 6 65  ? 87.854  83.096  139.296 1.00 247.19 ?  -9  DT  J C4    1 
ATOM 10303 O O4    . DT  J 6 65  ? 88.016  83.722  138.258 1.00 247.19 ?  -9  DT  J O4    1 
ATOM 10304 C C5    . DT  J 6 65  ? 87.122  83.633  140.409 1.00 247.19 ?  -9  DT  J C5    1 
ATOM 10305 C C7    . DT  J 6 65  ? 86.530  85.006  140.325 1.00 247.19 ?  -9  DT  J C7    1 
ATOM 10306 C C6    . DT  J 6 65  ? 86.999  82.875  141.504 1.00 247.19 ?  -9  DT  J C6    1 
ATOM 10307 P P     . DT  J 6 66  ? 88.002  80.444  147.063 1.00 244.46 ?  -8  DT  J P     1 
ATOM 10308 O OP1   . DT  J 6 66  ? 87.798  79.435  148.124 1.00 244.46 ?  -8  DT  J OP1   1 
ATOM 10309 O OP2   . DT  J 6 66  ? 87.603  81.851  147.283 1.00 244.46 -1 -8  DT  J OP2   1 
ATOM 10310 O "O5'" . DT  J 6 66  ? 89.537  80.450  146.632 1.00 244.46 ?  -8  DT  J "O5'" 1 
ATOM 10311 C "C5'" . DT  J 6 66  ? 90.110  79.300  146.041 1.00 244.46 ?  -8  DT  J "C5'" 1 
ATOM 10312 C "C4'" . DT  J 6 66  ? 91.450  79.634  145.422 1.00 244.46 ?  -8  DT  J "C4'" 1 
ATOM 10313 O "O4'" . DT  J 6 66  ? 91.249  80.301  144.151 1.00 244.46 ?  -8  DT  J "O4'" 1 
ATOM 10314 C "C3'" . DT  J 6 66  ? 92.325  80.566  146.259 1.00 244.46 ?  -8  DT  J "C3'" 1 
ATOM 10315 O "O3'" . DT  J 6 66  ? 93.634  80.061  146.319 1.00 244.46 ?  -8  DT  J "O3'" 1 
ATOM 10316 C "C2'" . DT  J 6 66  ? 92.274  81.888  145.498 1.00 244.46 ?  -8  DT  J "C2'" 1 
ATOM 10317 C "C1'" . DT  J 6 66  ? 92.108  81.409  144.069 1.00 244.46 ?  -8  DT  J "C1'" 1 
ATOM 10318 N N1    . DT  J 6 66  ? 91.490  82.418  143.158 1.00 244.46 ?  -8  DT  J N1    1 
ATOM 10319 C C2    . DT  J 6 66  ? 91.342  82.115  141.829 1.00 244.46 ?  -8  DT  J C2    1 
ATOM 10320 O O2    . DT  J 6 66  ? 91.697  81.060  141.343 1.00 244.46 ?  -8  DT  J O2    1 
ATOM 10321 N N3    . DT  J 6 66  ? 90.764  83.095  141.081 1.00 244.46 ?  -8  DT  J N3    1 
ATOM 10322 C C4    . DT  J 6 66  ? 90.324  84.322  141.520 1.00 244.46 ?  -8  DT  J C4    1 
ATOM 10323 O O4    . DT  J 6 66  ? 89.821  85.141  140.767 1.00 244.46 ?  -8  DT  J O4    1 
ATOM 10324 C C5    . DT  J 6 66  ? 90.509  84.580  142.922 1.00 244.46 ?  -8  DT  J C5    1 
ATOM 10325 C C7    . DT  J 6 66  ? 90.070  85.884  143.511 1.00 244.46 ?  -8  DT  J C7    1 
ATOM 10326 C C6    . DT  J 6 66  ? 91.074  83.627  143.665 1.00 244.46 ?  -8  DT  J C6    1 
ATOM 10327 P P     . DT  J 6 67  ? 94.086  79.170  147.573 1.00 234.55 ?  -7  DT  J P     1 
ATOM 10328 O OP1   . DT  J 6 67  ? 93.482  77.831  147.403 1.00 234.55 ?  -7  DT  J OP1   1 
ATOM 10329 O OP2   . DT  J 6 67  ? 93.819  79.955  148.798 1.00 234.55 -1 -7  DT  J OP2   1 
ATOM 10330 O "O5'" . DT  J 6 67  ? 95.665  79.046  147.401 1.00 234.55 ?  -7  DT  J "O5'" 1 
ATOM 10331 C "C5'" . DT  J 6 67  ? 96.202  78.607  146.170 1.00 234.55 ?  -7  DT  J "C5'" 1 
ATOM 10332 C "C4'" . DT  J 6 67  ? 97.053  79.693  145.543 1.00 234.55 ?  -7  DT  J "C4'" 1 
ATOM 10333 O "O4'" . DT  J 6 67  ? 96.203  80.736  145.007 1.00 234.55 ?  -7  DT  J "O4'" 1 
ATOM 10334 C "C3'" . DT  J 6 67  ? 98.028  80.388  146.502 1.00 234.55 ?  -7  DT  J "C3'" 1 
ATOM 10335 O "O3'" . DT  J 6 67  ? 99.329  80.335  145.973 1.00 234.55 ?  -7  DT  J "O3'" 1 
ATOM 10336 C "C2'" . DT  J 6 67  ? 97.517  81.830  146.570 1.00 234.55 ?  -7  DT  J "C2'" 1 
ATOM 10337 C "C1'" . DT  J 6 67  ? 96.829  81.971  145.225 1.00 234.55 ?  -7  DT  J "C1'" 1 
ATOM 10338 N N1    . DT  J 6 67  ? 95.799  83.044  145.176 1.00 234.55 ?  -7  DT  J N1    1 
ATOM 10339 C C2    . DT  J 6 67  ? 95.346  83.471  143.958 1.00 234.55 ?  -7  DT  J C2    1 
ATOM 10340 O O2    . DT  J 6 67  ? 95.744  83.015  142.906 1.00 234.55 ?  -7  DT  J O2    1 
ATOM 10341 N N3    . DT  J 6 67  ? 94.403  84.454  144.010 1.00 234.55 ?  -7  DT  J N3    1 
ATOM 10342 C C4    . DT  J 6 67  ? 93.880  85.045  145.138 1.00 234.55 ?  -7  DT  J C4    1 
ATOM 10343 O O4    . DT  J 6 67  ? 93.031  85.924  145.081 1.00 234.55 ?  -7  DT  J O4    1 
ATOM 10344 C C5    . DT  J 6 67  ? 94.397  84.553  146.387 1.00 234.55 ?  -7  DT  J C5    1 
ATOM 10345 C C7    . DT  J 6 67  ? 93.896  85.116  147.683 1.00 234.55 ?  -7  DT  J C7    1 
ATOM 10346 C C6    . DT  J 6 67  ? 95.321  83.587  146.348 1.00 234.55 ?  -7  DT  J C6    1 
ATOM 10347 P P     . DC  J 6 68  ? 100.581 80.062  146.936 1.00 225.06 ?  -6  DC  J P     1 
ATOM 10348 O OP1   . DC  J 6 68  ? 100.858 78.610  146.902 1.00 225.06 ?  -6  DC  J OP1   1 
ATOM 10349 O OP2   . DC  J 6 68  ? 100.322 80.740  148.224 1.00 225.06 -1 -6  DC  J OP2   1 
ATOM 10350 O "O5'" . DC  J 6 68  ? 101.772 80.825  146.205 1.00 225.06 ?  -6  DC  J "O5'" 1 
ATOM 10351 C "C5'" . DC  J 6 68  ? 101.922 80.693  144.809 1.00 225.06 ?  -6  DC  J "C5'" 1 
ATOM 10352 C "C4'" . DC  J 6 68  ? 101.835 82.043  144.131 1.00 225.06 ?  -6  DC  J "C4'" 1 
ATOM 10353 O "O4'" . DC  J 6 68  ? 100.588 82.684  144.475 1.00 225.06 ?  -6  DC  J "O4'" 1 
ATOM 10354 C "C3'" . DC  J 6 68  ? 102.932 83.037  144.529 1.00 225.06 ?  -6  DC  J "C3'" 1 
ATOM 10355 O "O3'" . DC  J 6 68  ? 103.761 83.319  143.417 1.00 225.06 ?  -6  DC  J "O3'" 1 
ATOM 10356 C "C2'" . DC  J 6 68  ? 102.166 84.285  144.988 1.00 225.06 ?  -6  DC  J "C2'" 1 
ATOM 10357 C "C1'" . DC  J 6 68  ? 100.797 84.060  144.375 1.00 225.06 ?  -6  DC  J "C1'" 1 
ATOM 10358 N N1    . DC  J 6 68  ? 99.694  84.788  145.060 1.00 225.06 ?  -6  DC  J N1    1 
ATOM 10359 C C2    . DC  J 6 68  ? 98.479  84.971  144.400 1.00 225.06 ?  -6  DC  J C2    1 
ATOM 10360 O O2    . DC  J 6 68  ? 98.332  84.500  143.272 1.00 225.06 ?  -6  DC  J O2    1 
ATOM 10361 N N3    . DC  J 6 68  ? 97.489  85.646  145.021 1.00 225.06 ?  -6  DC  J N3    1 
ATOM 10362 C C4    . DC  J 6 68  ? 97.682  86.132  146.240 1.00 225.06 ?  -6  DC  J C4    1 
ATOM 10363 N N4    . DC  J 6 68  ? 96.678  86.794  146.811 1.00 225.06 ?  -6  DC  J N4    1 
ATOM 10364 C C5    . DC  J 6 68  ? 98.915  85.962  146.930 1.00 225.06 ?  -6  DC  J C5    1 
ATOM 10365 C C6    . DC  J 6 68  ? 99.887  85.299  146.304 1.00 225.06 ?  -6  DC  J C6    1 
ATOM 10366 P P     . DA  J 6 69  ? 105.304 83.695  143.647 1.00 222.82 ?  -5  DA  J P     1 
ATOM 10367 O OP1   . DA  J 6 69  ? 106.039 82.439  143.901 1.00 222.82 ?  -5  DA  J OP1   1 
ATOM 10368 O OP2   . DA  J 6 69  ? 105.353 84.795  144.631 1.00 222.82 -1 -5  DA  J OP2   1 
ATOM 10369 O "O5'" . DA  J 6 69  ? 105.770 84.290  142.242 1.00 222.82 ?  -5  DA  J "O5'" 1 
ATOM 10370 C "C5'" . DA  J 6 69  ? 104.917 84.193  141.118 1.00 222.82 ?  -5  DA  J "C5'" 1 
ATOM 10371 C "C4'" . DA  J 6 69  ? 104.243 85.521  140.845 1.00 222.82 ?  -5  DA  J "C4'" 1 
ATOM 10372 O "O4'" . DA  J 6 69  ? 103.365 85.843  141.939 1.00 222.82 ?  -5  DA  J "O4'" 1 
ATOM 10373 C "C3'" . DA  J 6 69  ? 105.199 86.706  140.710 1.00 222.82 ?  -5  DA  J "C3'" 1 
ATOM 10374 O "O3'" . DA  J 6 69  ? 105.188 87.185  139.381 1.00 222.82 ?  -5  DA  J "O3'" 1 
ATOM 10375 C "C2'" . DA  J 6 69  ? 104.664 87.758  141.695 1.00 222.82 ?  -5  DA  J "C2'" 1 
ATOM 10376 C "C1'" . DA  J 6 69  ? 103.278 87.235  142.044 1.00 222.82 ?  -5  DA  J "C1'" 1 
ATOM 10377 N N9    . DA  J 6 69  ? 102.859 87.563  143.399 1.00 222.82 ?  -5  DA  J N9    1 
ATOM 10378 C C8    . DA  J 6 69  ? 103.605 87.460  144.534 1.00 222.82 ?  -5  DA  J C8    1 
ATOM 10379 N N7    . DA  J 6 69  ? 102.967 87.821  145.619 1.00 222.82 ?  -5  DA  J N7    1 
ATOM 10380 C C5    . DA  J 6 69  ? 101.715 88.175  145.163 1.00 222.82 ?  -5  DA  J C5    1 
ATOM 10381 C C6    . DA  J 6 69  ? 100.576 88.667  145.816 1.00 222.82 ?  -5  DA  J C6    1 
ATOM 10382 N N6    . DA  J 6 69  ? 100.514 88.859  147.134 1.00 222.82 ?  -5  DA  J N6    1 
ATOM 10383 N N1    . DA  J 6 69  ? 99.488  88.931  145.068 1.00 222.82 ?  -5  DA  J N1    1 
ATOM 10384 C C2    . DA  J 6 69  ? 99.551  88.735  143.751 1.00 222.82 ?  -5  DA  J C2    1 
ATOM 10385 N N3    . DA  J 6 69  ? 100.571 88.291  143.023 1.00 222.82 ?  -5  DA  J N3    1 
ATOM 10386 C C4    . DA  J 6 69  ? 101.633 88.031  143.797 1.00 222.82 ?  -5  DA  J C4    1 
ATOM 10387 P P     . DC  J 6 70  ? 106.414 88.067  138.840 1.00 212.43 ?  -4  DC  J P     1 
ATOM 10388 O OP1   . DC  J 6 70  ? 106.617 87.730  137.416 1.00 212.43 ?  -4  DC  J OP1   1 
ATOM 10389 O OP2   . DC  J 6 70  ? 107.525 87.917  139.799 1.00 212.43 -1 -4  DC  J OP2   1 
ATOM 10390 O "O5'" . DC  J 6 70  ? 105.882 89.567  138.948 1.00 212.43 ?  -4  DC  J "O5'" 1 
ATOM 10391 C "C5'" . DC  J 6 70  ? 104.853 90.008  138.086 1.00 212.43 ?  -4  DC  J "C5'" 1 
ATOM 10392 C "C4'" . DC  J 6 70  ? 103.934 90.975  138.798 1.00 212.43 ?  -4  DC  J "C4'" 1 
ATOM 10393 O "O4'" . DC  J 6 70  ? 103.714 90.520  140.137 1.00 212.43 ?  -4  DC  J "O4'" 1 
ATOM 10394 C "C3'" . DC  J 6 70  ? 104.479 92.385  138.960 1.00 212.43 ?  -4  DC  J "C3'" 1 
ATOM 10395 O "O3'" . DC  J 6 70  ? 103.990 93.215  137.933 1.00 212.43 ?  -4  DC  J "O3'" 1 
ATOM 10396 C "C2'" . DC  J 6 70  ? 103.946 92.838  140.327 1.00 212.43 ?  -4  DC  J "C2'" 1 
ATOM 10397 C "C1'" . DC  J 6 70  ? 103.229 91.604  140.871 1.00 212.43 ?  -4  DC  J "C1'" 1 
ATOM 10398 N N1    . DC  J 6 70  ? 103.484 91.368  142.308 1.00 212.43 ?  -4  DC  J N1    1 
ATOM 10399 C C2    . DC  J 6 70  ? 102.409 91.259  143.185 1.00 212.43 ?  -4  DC  J C2    1 
ATOM 10400 O O2    . DC  J 6 70  ? 101.262 91.342  142.745 1.00 212.43 ?  -4  DC  J O2    1 
ATOM 10401 N N3    . DC  J 6 70  ? 102.654 91.065  144.494 1.00 212.43 ?  -4  DC  J N3    1 
ATOM 10402 C C4    . DC  J 6 70  ? 103.903 90.972  144.932 1.00 212.43 ?  -4  DC  J C4    1 
ATOM 10403 N N4    . DC  J 6 70  ? 104.092 90.771  146.236 1.00 212.43 ?  -4  DC  J N4    1 
ATOM 10404 C C5    . DC  J 6 70  ? 105.015 91.089  144.056 1.00 212.43 ?  -4  DC  J C5    1 
ATOM 10405 C C6    . DC  J 6 70  ? 104.761 91.287  142.763 1.00 212.43 ?  -4  DC  J C6    1 
ATOM 10406 P P     . DT  J 6 71  ? 104.578 94.697  137.777 1.00 213.59 ?  -3  DT  J P     1 
ATOM 10407 O OP1   . DT  J 6 71  ? 104.534 95.075  136.347 1.00 213.59 ?  -3  DT  J OP1   1 
ATOM 10408 O OP2   . DT  J 6 71  ? 105.852 94.707  138.522 1.00 213.59 -1 -3  DT  J OP2   1 
ATOM 10409 O "O5'" . DT  J 6 71  ? 103.565 95.610  138.606 1.00 213.59 ?  -3  DT  J "O5'" 1 
ATOM 10410 C "C5'" . DT  J 6 71  ? 102.315 95.977  138.048 1.00 213.59 ?  -3  DT  J "C5'" 1 
ATOM 10411 C "C4'" . DT  J 6 71  ? 101.565 96.927  138.969 1.00 213.59 ?  -3  DT  J "C4'" 1 
ATOM 10412 O "O4'" . DT  J 6 71  ? 101.729 96.492  140.346 1.00 213.59 ?  -3  DT  J "O4'" 1 
ATOM 10413 C "C3'" . DT  J 6 71  ? 102.043 98.379  138.939 1.00 213.59 ?  -3  DT  J "C3'" 1 
ATOM 10414 O "O3'" . DT  J 6 71  ? 100.948 99.259  139.146 1.00 213.59 ?  -3  DT  J "O3'" 1 
ATOM 10415 C "C2'" . DT  J 6 71  ? 103.003 98.425  140.115 1.00 213.59 ?  -3  DT  J "C2'" 1 
ATOM 10416 C "C1'" . DT  J 6 71  ? 102.255 97.556  141.109 1.00 213.59 ?  -3  DT  J "C1'" 1 
ATOM 10417 N N1    . DT  J 6 71  ? 103.111 96.995  142.195 1.00 213.59 ?  -3  DT  J N1    1 
ATOM 10418 C C2    . DT  J 6 71  ? 102.777 97.241  143.501 1.00 213.59 ?  -3  DT  J C2    1 
ATOM 10419 O O2    . DT  J 6 71  ? 101.815 97.904  143.827 1.00 213.59 ?  -3  DT  J O2    1 
ATOM 10420 N N3    . DT  J 6 71  ? 103.618 96.688  144.420 1.00 213.59 ?  -3  DT  J N3    1 
ATOM 10421 C C4    . DT  J 6 71  ? 104.730 95.920  144.171 1.00 213.59 ?  -3  DT  J C4    1 
ATOM 10422 O O4    . DT  J 6 71  ? 105.422 95.464  145.065 1.00 213.59 ?  -3  DT  J O4    1 
ATOM 10423 C C5    . DT  J 6 71  ? 105.029 95.699  142.788 1.00 213.59 ?  -3  DT  J C5    1 
ATOM 10424 C C7    . DT  J 6 71  ? 106.223 94.884  142.406 1.00 213.59 ?  -3  DT  J C7    1 
ATOM 10425 C C6    . DT  J 6 71  ? 104.214 96.238  141.871 1.00 213.59 ?  -3  DT  J C6    1 
ATOM 10426 P P     . DC  J 6 72  ? 101.196 100.844 139.192 1.00 222.51 ?  -2  DC  J P     1 
ATOM 10427 O OP1   . DC  J 6 72  ? 99.975  101.509 138.698 1.00 222.51 ?  -2  DC  J OP1   1 
ATOM 10428 O OP2   . DC  J 6 72  ? 102.502 101.102 138.559 1.00 222.51 -1 -2  DC  J OP2   1 
ATOM 10429 O "O5'" . DC  J 6 72  ? 101.365 101.183 140.744 1.00 222.51 ?  -2  DC  J "O5'" 1 
ATOM 10430 C "C5'" . DC  J 6 72  ? 100.224 101.251 141.585 1.00 222.51 ?  -2  DC  J "C5'" 1 
ATOM 10431 C "C4'" . DC  J 6 72  ? 100.579 101.775 142.973 1.00 222.51 ?  -2  DC  J "C4'" 1 
ATOM 10432 O "O4'" . DC  J 6 72  ? 101.487 100.859 143.637 1.00 222.51 ?  -2  DC  J "O4'" 1 
ATOM 10433 C "C3'" . DC  J 6 72  ? 101.261 103.139 143.005 1.00 222.51 ?  -2  DC  J "C3'" 1 
ATOM 10434 O "O3'" . DC  J 6 72  ? 100.741 103.897 144.070 1.00 222.51 ?  -2  DC  J "O3'" 1 
ATOM 10435 C "C2'" . DC  J 6 72  ? 102.725 102.789 143.242 1.00 222.51 ?  -2  DC  J "C2'" 1 
ATOM 10436 C "C1'" . DC  J 6 72  ? 102.594 101.572 144.135 1.00 222.51 ?  -2  DC  J "C1'" 1 
ATOM 10437 N N1    . DC  J 6 72  ? 103.765 100.678 144.090 1.00 222.51 ?  -2  DC  J N1    1 
ATOM 10438 C C2    . DC  J 6 72  ? 104.359 100.251 145.276 1.00 222.51 ?  -2  DC  J C2    1 
ATOM 10439 O O2    . DC  J 6 72  ? 103.898 100.638 146.353 1.00 222.51 ?  -2  DC  J O2    1 
ATOM 10440 N N3    . DC  J 6 72  ? 105.425 99.425  145.213 1.00 222.51 ?  -2  DC  J N3    1 
ATOM 10441 C C4    . DC  J 6 72  ? 105.891 99.033  144.033 1.00 222.51 ?  -2  DC  J C4    1 
ATOM 10442 N N4    . DC  J 6 72  ? 106.947 98.218  144.018 1.00 222.51 ?  -2  DC  J N4    1 
ATOM 10443 C C5    . DC  J 6 72  ? 105.298 99.457  142.815 1.00 222.51 ?  -2  DC  J C5    1 
ATOM 10444 C C6    . DC  J 6 72  ? 104.248 100.273 142.892 1.00 222.51 ?  -2  DC  J C6    1 
ATOM 10445 P P     . DA  J 6 73  ? 100.850 105.495 144.034 1.00 236.85 ?  -1  DA  J P     1 
ATOM 10446 O OP1   . DA  J 6 73  ? 99.472  106.029 144.048 1.00 236.85 ?  -1  DA  J OP1   1 
ATOM 10447 O OP2   . DA  J 6 73  ? 101.773 105.844 142.935 1.00 236.85 -1 -1  DA  J OP2   1 
ATOM 10448 O "O5'" . DA  J 6 73  ? 101.573 105.865 145.410 1.00 236.85 ?  -1  DA  J "O5'" 1 
ATOM 10449 C "C5'" . DA  J 6 73  ? 100.819 105.937 146.608 1.00 236.85 ?  -1  DA  J "C5'" 1 
ATOM 10450 C "C4'" . DA  J 6 73  ? 101.716 105.828 147.829 1.00 236.85 ?  -1  DA  J "C4'" 1 
ATOM 10451 O "O4'" . DA  J 6 73  ? 102.625 104.709 147.671 1.00 236.85 ?  -1  DA  J "O4'" 1 
ATOM 10452 C "C3'" . DA  J 6 73  ? 102.593 107.043 148.111 1.00 236.85 ?  -1  DA  J "C3'" 1 
ATOM 10453 O "O3'" . DA  J 6 73  ? 102.690 107.232 149.504 1.00 236.85 ?  -1  DA  J "O3'" 1 
ATOM 10454 C "C2'" . DA  J 6 73  ? 103.935 106.637 147.519 1.00 236.85 ?  -1  DA  J "C2'" 1 
ATOM 10455 C "C1'" . DA  J 6 73  ? 103.955 105.149 147.826 1.00 236.85 ?  -1  DA  J "C1'" 1 
ATOM 10456 N N9    . DA  J 6 73  ? 104.786 104.382 146.913 1.00 236.85 ?  -1  DA  J N9    1 
ATOM 10457 C C8    . DA  J 6 73  ? 104.768 104.436 145.553 1.00 236.85 ?  -1  DA  J C8    1 
ATOM 10458 N N7    . DA  J 6 73  ? 105.618 103.622 144.979 1.00 236.85 ?  -1  DA  J N7    1 
ATOM 10459 C C5    . DA  J 6 73