data_6MXO
# 
_entry.id   6MXO 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6MXO         
WWPDB D_1000237699 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 4DL2 unspecified 
PDB . 4DL3 unspecified 
PDB . 4DL4 unspecified 
PDB . 4DL5 unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6MXO 
_pdbx_database_status.recvd_initial_deposition_date   2018-10-31 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Ouzon-Shubeita, H.' 1 ? 
'Lee, S.'            2 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   UK 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Biochem. J.' 
_citation.journal_id_ASTM           BIJOAK 
_citation.journal_id_CSD            0043 
_citation.journal_id_ISSN           1470-8728 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            476 
_citation.language                  ? 
_citation.page_first                747 
_citation.page_last                 758 
_citation.title                     
'Structural basis for the bypass of the major oxaliplatin-DNA adducts by human DNA polymerase eta.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1042/BCJ20180848 
_citation.pdbx_database_id_PubMed   30709915 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Ouzon-Shubeita, H.' 1 ? 
primary 'Baker, M.'          2 ? 
primary 'Koag, M.C.'         3 ? 
primary 'Lee, S.'            4 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6MXO 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     98.560 
_cell.length_a_esd                 ? 
_cell.length_b                     98.560 
_cell.length_b_esd                 ? 
_cell.length_c                     81.713 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        6 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6MXO 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                169 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 61' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA polymerase eta'                                                                        49466.598 1   
2.7.7.7 ? ? ? 
2 polymer     syn 
;DNA (5'-D(*AP*CP*GP*GP*CP*TP*CP*AP*CP*AP*CP*T)-3')
;
3607.369  1   ?       ? ? ? 
3 polymer     syn 
;DNA (5'-D(*TP*AP*GP*TP*GP*TP*GP*AP*G)-3')
;
2810.858  1   ?       ? ? ? 
4 non-polymer syn "2'-deoxy-5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]cytidine" 466.172   1   ? ? ? 
? 
5 non-polymer syn 'MAGNESIUM ION'                                                                             24.305    2   ? ? ? 
? 
6 non-polymer syn GLYCEROL                                                                                    92.094    3   ? ? ? 
? 
7 non-polymer syn '(cyclohex-1-ene-1,2-diamine)platinum(2+)'                                                  307.251   1   ? ? ? 
? 
8 water       nat water                                                                                       18.015    110 ? ? ? 
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RAD30 homolog A,Xeroderma pigmentosum variant type protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MAHHHHHHGTGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCP
DLLLAQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQG
PTTAEETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPN
RQTLVSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPR
QLPKTIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAH
KMSHDAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSASAPS
;
;MAHHHHHHGTGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCP
DLLLAQVRESRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQG
PTTAEETVQKEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPN
RQTLVSHGSVPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPR
QLPKTIGCSKNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAH
KMSHDAFTVIKNCNTSGIQTEWSPPLTMLFLCATKFSASAPS
;
A ? 
2 polydeoxyribonucleotide no no '(DA)(DC)(DG)(DG)(DC)(DT)(DC)(DA)(DC)(DA)(DC)(DT)' ACGGCTCACACT T ? 
3 polydeoxyribonucleotide no no '(DT)(DA)(DG)(DT)(DG)(DT)(DG)(DA)(DG)' TAGTGTGAG P ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   HIS n 
1 4   HIS n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   GLY n 
1 10  THR n 
1 11  GLY n 
1 12  GLN n 
1 13  ASP n 
1 14  ARG n 
1 15  VAL n 
1 16  VAL n 
1 17  ALA n 
1 18  LEU n 
1 19  VAL n 
1 20  ASP n 
1 21  MET n 
1 22  ASP n 
1 23  CYS n 
1 24  PHE n 
1 25  PHE n 
1 26  VAL n 
1 27  GLN n 
1 28  VAL n 
1 29  GLU n 
1 30  GLN n 
1 31  ARG n 
1 32  GLN n 
1 33  ASN n 
1 34  PRO n 
1 35  HIS n 
1 36  LEU n 
1 37  ARG n 
1 38  ASN n 
1 39  LYS n 
1 40  PRO n 
1 41  CYS n 
1 42  ALA n 
1 43  VAL n 
1 44  VAL n 
1 45  GLN n 
1 46  TYR n 
1 47  LYS n 
1 48  SER n 
1 49  TRP n 
1 50  LYS n 
1 51  GLY n 
1 52  GLY n 
1 53  GLY n 
1 54  ILE n 
1 55  ILE n 
1 56  ALA n 
1 57  VAL n 
1 58  SER n 
1 59  TYR n 
1 60  GLU n 
1 61  ALA n 
1 62  ARG n 
1 63  ALA n 
1 64  PHE n 
1 65  GLY n 
1 66  VAL n 
1 67  THR n 
1 68  ARG n 
1 69  SER n 
1 70  MET n 
1 71  TRP n 
1 72  ALA n 
1 73  ASP n 
1 74  ASP n 
1 75  ALA n 
1 76  LYS n 
1 77  LYS n 
1 78  LEU n 
1 79  CYS n 
1 80  PRO n 
1 81  ASP n 
1 82  LEU n 
1 83  LEU n 
1 84  LEU n 
1 85  ALA n 
1 86  GLN n 
1 87  VAL n 
1 88  ARG n 
1 89  GLU n 
1 90  SER n 
1 91  ARG n 
1 92  GLY n 
1 93  LYS n 
1 94  ALA n 
1 95  ASN n 
1 96  LEU n 
1 97  THR n 
1 98  LYS n 
1 99  TYR n 
1 100 ARG n 
1 101 GLU n 
1 102 ALA n 
1 103 SER n 
1 104 VAL n 
1 105 GLU n 
1 106 VAL n 
1 107 MET n 
1 108 GLU n 
1 109 ILE n 
1 110 MET n 
1 111 SER n 
1 112 ARG n 
1 113 PHE n 
1 114 ALA n 
1 115 VAL n 
1 116 ILE n 
1 117 GLU n 
1 118 ARG n 
1 119 ALA n 
1 120 SER n 
1 121 ILE n 
1 122 ASP n 
1 123 GLU n 
1 124 ALA n 
1 125 TYR n 
1 126 VAL n 
1 127 ASP n 
1 128 LEU n 
1 129 THR n 
1 130 SER n 
1 131 ALA n 
1 132 VAL n 
1 133 GLN n 
1 134 GLU n 
1 135 ARG n 
1 136 LEU n 
1 137 GLN n 
1 138 LYS n 
1 139 LEU n 
1 140 GLN n 
1 141 GLY n 
1 142 GLN n 
1 143 PRO n 
1 144 ILE n 
1 145 SER n 
1 146 ALA n 
1 147 ASP n 
1 148 LEU n 
1 149 LEU n 
1 150 PRO n 
1 151 SER n 
1 152 THR n 
1 153 TYR n 
1 154 ILE n 
1 155 GLU n 
1 156 GLY n 
1 157 LEU n 
1 158 PRO n 
1 159 GLN n 
1 160 GLY n 
1 161 PRO n 
1 162 THR n 
1 163 THR n 
1 164 ALA n 
1 165 GLU n 
1 166 GLU n 
1 167 THR n 
1 168 VAL n 
1 169 GLN n 
1 170 LYS n 
1 171 GLU n 
1 172 GLY n 
1 173 MET n 
1 174 ARG n 
1 175 LYS n 
1 176 GLN n 
1 177 GLY n 
1 178 LEU n 
1 179 PHE n 
1 180 GLN n 
1 181 TRP n 
1 182 LEU n 
1 183 ASP n 
1 184 SER n 
1 185 LEU n 
1 186 GLN n 
1 187 ILE n 
1 188 ASP n 
1 189 ASN n 
1 190 LEU n 
1 191 THR n 
1 192 SER n 
1 193 PRO n 
1 194 ASP n 
1 195 LEU n 
1 196 GLN n 
1 197 LEU n 
1 198 THR n 
1 199 VAL n 
1 200 GLY n 
1 201 ALA n 
1 202 VAL n 
1 203 ILE n 
1 204 VAL n 
1 205 GLU n 
1 206 GLU n 
1 207 MET n 
1 208 ARG n 
1 209 ALA n 
1 210 ALA n 
1 211 ILE n 
1 212 GLU n 
1 213 ARG n 
1 214 GLU n 
1 215 THR n 
1 216 GLY n 
1 217 PHE n 
1 218 GLN n 
1 219 CYS n 
1 220 SER n 
1 221 ALA n 
1 222 GLY n 
1 223 ILE n 
1 224 SER n 
1 225 HIS n 
1 226 ASN n 
1 227 LYS n 
1 228 VAL n 
1 229 LEU n 
1 230 ALA n 
1 231 LYS n 
1 232 LEU n 
1 233 ALA n 
1 234 CYS n 
1 235 GLY n 
1 236 LEU n 
1 237 ASN n 
1 238 LYS n 
1 239 PRO n 
1 240 ASN n 
1 241 ARG n 
1 242 GLN n 
1 243 THR n 
1 244 LEU n 
1 245 VAL n 
1 246 SER n 
1 247 HIS n 
1 248 GLY n 
1 249 SER n 
1 250 VAL n 
1 251 PRO n 
1 252 GLN n 
1 253 LEU n 
1 254 PHE n 
1 255 SER n 
1 256 GLN n 
1 257 MET n 
1 258 PRO n 
1 259 ILE n 
1 260 ARG n 
1 261 LYS n 
1 262 ILE n 
1 263 ARG n 
1 264 SER n 
1 265 LEU n 
1 266 GLY n 
1 267 GLY n 
1 268 LYS n 
1 269 LEU n 
1 270 GLY n 
1 271 ALA n 
1 272 SER n 
1 273 VAL n 
1 274 ILE n 
1 275 GLU n 
1 276 ILE n 
1 277 LEU n 
1 278 GLY n 
1 279 ILE n 
1 280 GLU n 
1 281 TYR n 
1 282 MET n 
1 283 GLY n 
1 284 GLU n 
1 285 LEU n 
1 286 THR n 
1 287 GLN n 
1 288 PHE n 
1 289 THR n 
1 290 GLU n 
1 291 SER n 
1 292 GLN n 
1 293 LEU n 
1 294 GLN n 
1 295 SER n 
1 296 HIS n 
1 297 PHE n 
1 298 GLY n 
1 299 GLU n 
1 300 LYS n 
1 301 ASN n 
1 302 GLY n 
1 303 SER n 
1 304 TRP n 
1 305 LEU n 
1 306 TYR n 
1 307 ALA n 
1 308 MET n 
1 309 CYS n 
1 310 ARG n 
1 311 GLY n 
1 312 ILE n 
1 313 GLU n 
1 314 HIS n 
1 315 ASP n 
1 316 PRO n 
1 317 VAL n 
1 318 LYS n 
1 319 PRO n 
1 320 ARG n 
1 321 GLN n 
1 322 LEU n 
1 323 PRO n 
1 324 LYS n 
1 325 THR n 
1 326 ILE n 
1 327 GLY n 
1 328 CYS n 
1 329 SER n 
1 330 LYS n 
1 331 ASN n 
1 332 PHE n 
1 333 PRO n 
1 334 GLY n 
1 335 LYS n 
1 336 THR n 
1 337 ALA n 
1 338 LEU n 
1 339 ALA n 
1 340 THR n 
1 341 ARG n 
1 342 GLU n 
1 343 GLN n 
1 344 VAL n 
1 345 GLN n 
1 346 TRP n 
1 347 TRP n 
1 348 LEU n 
1 349 LEU n 
1 350 GLN n 
1 351 LEU n 
1 352 ALA n 
1 353 GLN n 
1 354 GLU n 
1 355 LEU n 
1 356 GLU n 
1 357 GLU n 
1 358 ARG n 
1 359 LEU n 
1 360 THR n 
1 361 LYS n 
1 362 ASP n 
1 363 ARG n 
1 364 ASN n 
1 365 ASP n 
1 366 ASN n 
1 367 ASP n 
1 368 ARG n 
1 369 VAL n 
1 370 ALA n 
1 371 THR n 
1 372 GLN n 
1 373 LEU n 
1 374 VAL n 
1 375 VAL n 
1 376 SER n 
1 377 ILE n 
1 378 ARG n 
1 379 VAL n 
1 380 GLN n 
1 381 GLY n 
1 382 ASP n 
1 383 LYS n 
1 384 ARG n 
1 385 LEU n 
1 386 SER n 
1 387 SER n 
1 388 LEU n 
1 389 ARG n 
1 390 ARG n 
1 391 CYS n 
1 392 CYS n 
1 393 ALA n 
1 394 LEU n 
1 395 THR n 
1 396 ARG n 
1 397 TYR n 
1 398 ASP n 
1 399 ALA n 
1 400 HIS n 
1 401 LYS n 
1 402 MET n 
1 403 SER n 
1 404 HIS n 
1 405 ASP n 
1 406 ALA n 
1 407 PHE n 
1 408 THR n 
1 409 VAL n 
1 410 ILE n 
1 411 LYS n 
1 412 ASN n 
1 413 CYS n 
1 414 ASN n 
1 415 THR n 
1 416 SER n 
1 417 GLY n 
1 418 ILE n 
1 419 GLN n 
1 420 THR n 
1 421 GLU n 
1 422 TRP n 
1 423 SER n 
1 424 PRO n 
1 425 PRO n 
1 426 LEU n 
1 427 THR n 
1 428 MET n 
1 429 LEU n 
1 430 PHE n 
1 431 LEU n 
1 432 CYS n 
1 433 ALA n 
1 434 THR n 
1 435 LYS n 
1 436 PHE n 
1 437 SER n 
1 438 ALA n 
1 439 SER n 
1 440 ALA n 
1 441 PRO n 
1 442 SER n 
2 1   DA  n 
2 2   DC  n 
2 3   DG  n 
2 4   DG  n 
2 5   DC  n 
2 6   DT  n 
2 7   DC  n 
2 8   DA  n 
2 9   DC  n 
2 10  DA  n 
2 11  DC  n 
2 12  DT  n 
3 1   DT  n 
3 2   DA  n 
3 3   DG  n 
3 4   DT  n 
3 5   DG  n 
3 6   DT  n 
3 7   DG  n 
3 8   DA  n 
3 9   DG  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   442 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'POLH, RAD30, RAD30A, XPV' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 12 'Homo sapiens' human 9606 ? 
3 1 sample 1 9  'Homo sapiens' human 9606 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP POLH_HUMAN Q9Y253 ? 1 
;TGQDRVVALVDMDCFFVQVEQRQNPHLRNKPCAVVQYKSWKGGGIIAVSYEARAFGVTRSMWADDAKKLCPDLLLAQVRE
SRGKANLTKYREASVEVMEIMSRFAVIERASIDEAYVDLTSAVQERLQKLQGQPISADLLPSTYIEGLPQGPTTAEETVQ
KEGMRKQGLFQWLDSLQIDNLTSPDLQLTVGAVIVEEMRAAIERETGFQCSAGISHNKVLAKLACGLNKPNRQTLVSHGS
VPQLFSQMPIRKIRSLGGKLGASVIEILGIEYMGELTQFTESQLQSHFGEKNGSWLYAMCRGIEHDPVKPRQLPKTIGCS
KNFPGKTALATREQVQWWLLQLAQELEERLTKDRNDNDRVATQLVVSIRVQGDKRLSSLRRCCALTRYDAHKMSHDAFTV
IKNCNTSGIQTEWSPPLTMLFLCATKFSASAPS
;
3 
2 PDB 6MXO       6MXO   ? 2 ? 1 
3 PDB 6MXO       6MXO   ? 3 ? 1 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6MXO A 10 ? 442 ? Q9Y253 3 ? 435 ? 3 435 
2 2 6MXO T 1  ? 12  ? 6MXO   1 ? 12  ? 1 12  
3 3 6MXO P 1  ? 9   ? 6MXO   1 ? 9   ? 1 9   
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6MXO MET A 1 ? UNP Q9Y253 ? ? 'initiating methionine' -6 1 
1 6MXO ALA A 2 ? UNP Q9Y253 ? ? 'expression tag'        -5 2 
1 6MXO HIS A 3 ? UNP Q9Y253 ? ? 'expression tag'        -4 3 
1 6MXO HIS A 4 ? UNP Q9Y253 ? ? 'expression tag'        -3 4 
1 6MXO HIS A 5 ? UNP Q9Y253 ? ? 'expression tag'        -2 5 
1 6MXO HIS A 6 ? UNP Q9Y253 ? ? 'expression tag'        -1 6 
1 6MXO HIS A 7 ? UNP Q9Y253 ? ? 'expression tag'        0  7 
1 6MXO HIS A 8 ? UNP Q9Y253 ? ? 'expression tag'        1  8 
1 6MXO GLY A 9 ? UNP Q9Y253 ? ? 'expression tag'        2  9 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
0KX non-polymer         . "2'-deoxy-5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]cytidine" ? 
'C9 H17 N4 O12 P3' 466.172 
9RD non-polymer         . '(cyclohex-1-ene-1,2-diamine)platinum(2+)'                                                  ? 
'C6 H12 N2 Pt 2'   307.251 
ALA 'L-peptide linking' y ALANINE                                                                                     ? 
'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                                                                    ? 
'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                  ? 
'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                             ? 
'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                    ? 
'C3 H7 N O2 S'     121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE"                                                        ? 
'C10 H14 N5 O6 P'  331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"                                                         ? 
'C9 H14 N3 O7 P'   307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE"                                                        ? 
'C10 H14 N5 O7 P'  347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"                                                                ? 
'C10 H15 N2 O8 P'  322.208 
GLN 'L-peptide linking' y GLUTAMINE                                                                                   ? 
'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                             ? 
'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                                                                     ? 
'C2 H5 N O2'       75.067  
GOL non-polymer         . GLYCEROL                                                                                    
'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'         92.094  
HIS 'L-peptide linking' y HISTIDINE                                                                                   ? 
'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                                                                       ? 'H2 O' 
18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                  ? 
'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                     ? 
'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                                                                      ? 
'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                                                                  ? 
'C5 H11 N O2 S'    149.211 
MG  non-polymer         . 'MAGNESIUM ION'                                                                             ? 'Mg 2' 
24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                                                               ? 
'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                                                                     ? 
'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                                                                      ? 
'C3 H7 N O3'       105.093 
THR 'L-peptide linking' y THREONINE                                                                                   ? 
'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                  ? 
'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                    ? 
'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                                                                      ? 
'C5 H11 N O2'      117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6MXO 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.04 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         39.84 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1M MES, 5mM MgCl2, 15-20%PEG2K-MME' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2015-05-10 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97648 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'ALS BEAMLINE 5.0.3' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.97648 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   5.0.3 
_diffrn_source.pdbx_synchrotron_site       ALS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6MXO 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.04 
_reflns.d_resolution_low                 50 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       28856 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.2 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  11.3 
_reflns.pdbx_Rmerge_I_obs                0.133 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            19.54 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.04 
_reflns_shell.d_res_low                   2.08 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         3 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        98.3 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                ? 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             9.7 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                ? 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            -0.04 
_refine.aniso_B[1][2]                            -0.04 
_refine.aniso_B[1][3]                            -0.00 
_refine.aniso_B[2][2]                            -0.04 
_refine.aniso_B[2][3]                            -0.00 
_refine.aniso_B[3][3]                            0.13 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               24.097 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               0.947 
_refine.correlation_coeff_Fo_to_Fc_free          0.910 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6MXO 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.04 
_refine.ls_d_res_low                             37.86 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     25945 
_refine.ls_number_reflns_R_free                  1399 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    94.88 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.17744 
_refine.ls_R_factor_R_free                       0.22999 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.17469 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4DL2 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       0.232 
_refine.pdbx_overall_ESU_R_Free                  0.190 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             4.199 
_refine.overall_SU_ML                            0.116 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         1 
_refine_hist.pdbx_number_atoms_protein        3346 
_refine_hist.pdbx_number_atoms_nucleic_acid   382 
_refine_hist.pdbx_number_atoms_ligand         48 
_refine_hist.number_atoms_solvent             110 
_refine_hist.number_atoms_total               3886 
_refine_hist.d_res_high                       2.04 
_refine_hist.d_res_low                        37.86 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.018  0.018  3978 ? r_bond_refined_d             ? ? 
'X-RAY DIFFRACTION' ? 0.002  0.020  3609 ? r_bond_other_d               ? ? 
'X-RAY DIFFRACTION' ? 1.898  1.861  5465 ? r_angle_refined_deg          ? ? 
'X-RAY DIFFRACTION' ? 0.956  3.002  8317 ? r_angle_other_deg            ? ? 
'X-RAY DIFFRACTION' ? 6.573  5.000  426  ? r_dihedral_angle_1_deg       ? ? 
'X-RAY DIFFRACTION' ? 40.186 24.013 152  ? r_dihedral_angle_2_deg       ? ? 
'X-RAY DIFFRACTION' ? 15.326 15.000 623  ? r_dihedral_angle_3_deg       ? ? 
'X-RAY DIFFRACTION' ? 17.445 15.000 28   ? r_dihedral_angle_4_deg       ? ? 
'X-RAY DIFFRACTION' ? 0.206  0.200  595  ? r_chiral_restr               ? ? 
'X-RAY DIFFRACTION' ? 0.009  0.020  4138 ? r_gen_planes_refined         ? ? 
'X-RAY DIFFRACTION' ? 0.001  0.020  895  ? r_gen_planes_other           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_refined                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbd_other                  ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_refined              ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_nbtor_other                ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_refined        ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_xyhbond_nbd_other          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_refined          ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_metal_ion_other            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_refined       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_vdw_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_refined     ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_hbond_other       ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_refined ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_symmetry_metal_ion_other   ? ? 
'X-RAY DIFFRACTION' ? 2.119  2.212  1710 ? r_mcbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 2.119  2.211  1709 ? r_mcbond_other               ? ? 
'X-RAY DIFFRACTION' ? 3.235  3.302  2134 ? r_mcangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 3.235  3.304  2135 ? r_mcangle_other              ? ? 
'X-RAY DIFFRACTION' ? 2.687  2.560  2268 ? r_scbond_it                  ? ? 
'X-RAY DIFFRACTION' ? 2.686  2.559  2269 ? r_scbond_other               ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_scangle_it                 ? ? 
'X-RAY DIFFRACTION' ? 4.032  3.733  3332 ? r_scangle_other              ? ? 
'X-RAY DIFFRACTION' ? 5.428  18.799 4608 ? r_long_range_B_refined       ? ? 
'X-RAY DIFFRACTION' ? 5.421  18.805 4597 ? r_long_range_B_other         ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_rigid_bond_restr           ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_free            ? ? 
'X-RAY DIFFRACTION' ? ?      ?      ?    ? r_sphericity_bonded          ? ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.d_res_high                       2.040 
_refine_ls_shell.d_res_low                        2.092 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.number_reflns_R_free             86 
_refine_ls_shell.number_reflns_R_work             1732 
_refine_ls_shell.percent_reflns_obs               85.15 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_obs                     ? 
_refine_ls_shell.R_factor_R_free                  0.298 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.R_factor_R_work                  0.231 
_refine_ls_shell.redundancy_reflns_all            ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.wR_factor_all                    ? 
_refine_ls_shell.wR_factor_obs                    ? 
_refine_ls_shell.wR_factor_R_free                 ? 
_refine_ls_shell.wR_factor_R_work                 ? 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.pdbx_phase_error                 ? 
_refine_ls_shell.pdbx_fsc_work                    ? 
_refine_ls_shell.pdbx_fsc_free                    ? 
# 
_struct.entry_id                     6MXO 
_struct.title                        'Structure of HPoleta incorporating dCTP opposite the 3-prime Pt(DACH)-GG' 
_struct.pdbx_descriptor              'DNA polymerase eta/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6MXO 
_struct_keywords.text            
'Y-family DNA polymerase, Pt(DACH)-GG, TRANSFERASE-DNA-INHIBITOR complex, NUCLEAR PROTEIN, NUCLEAR PROTEIN-DNA complex' 
_struct_keywords.pdbx_keywords   'NUCLEAR PROTEIN/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 5 ? 
F N N 5 ? 
G N N 6 ? 
H N N 6 ? 
I N N 6 ? 
J N N 7 ? 
K N N 8 ? 
L N N 8 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 CYS A 23  ? ASN A 33  ? CYS A 16  ASN A 26  1 ? 11 
HELX_P HELX_P2  AA2 PRO A 34  ? ARG A 37  ? PRO A 27  ARG A 30  5 ? 4  
HELX_P HELX_P3  AA3 SER A 58  ? ALA A 63  ? SER A 51  ALA A 56  1 ? 6  
HELX_P HELX_P4  AA4 TRP A 71  ? CYS A 79  ? TRP A 64  CYS A 72  1 ? 9  
HELX_P HELX_P5  AA5 LEU A 96  ? ALA A 114 ? LEU A 89  ALA A 107 1 ? 19 
HELX_P HELX_P6  AA6 LEU A 128 ? LEU A 139 ? LEU A 121 LEU A 132 1 ? 12 
HELX_P HELX_P7  AA7 SER A 145 ? LEU A 149 ? SER A 138 LEU A 142 5 ? 5  
HELX_P HELX_P8  AA8 GLU A 165 ? VAL A 168 ? GLU A 158 VAL A 161 5 ? 4  
HELX_P HELX_P9  AA9 GLN A 169 ? LEU A 185 ? GLN A 162 LEU A 178 1 ? 17 
HELX_P HELX_P10 AB1 SER A 192 ? GLY A 216 ? SER A 185 GLY A 209 1 ? 25 
HELX_P HELX_P11 AB2 ASN A 226 ? GLY A 235 ? ASN A 219 GLY A 228 1 ? 10 
HELX_P HELX_P12 AB3 SER A 246 ? GLY A 248 ? SER A 239 GLY A 241 5 ? 3  
HELX_P HELX_P13 AB4 SER A 249 ? GLN A 256 ? SER A 242 GLN A 249 1 ? 8  
HELX_P HELX_P14 AB5 MET A 257 ? ILE A 262 ? MET A 250 ILE A 255 5 ? 6  
HELX_P HELX_P15 AB6 GLY A 267 ? GLY A 278 ? GLY A 260 GLY A 271 1 ? 12 
HELX_P HELX_P16 AB7 TYR A 281 ? PHE A 288 ? TYR A 274 PHE A 281 5 ? 8  
HELX_P HELX_P17 AB8 THR A 289 ? GLY A 298 ? THR A 282 GLY A 291 1 ? 10 
HELX_P HELX_P18 AB9 GLY A 298 ? CYS A 309 ? GLY A 291 CYS A 302 1 ? 12 
HELX_P HELX_P19 AC1 PRO A 333 ? ALA A 337 ? PRO A 326 ALA A 330 5 ? 5  
HELX_P HELX_P20 AC2 ARG A 341 ? ASP A 367 ? ARG A 334 ASP A 360 1 ? 27 
HELX_P HELX_P21 AC3 ASP A 398 ? LYS A 411 ? ASP A 391 LYS A 404 1 ? 14 
HELX_P HELX_P22 AC4 ASN A 412 ? ASN A 414 ? ASN A 405 ASN A 407 5 ? 3  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A ASP 20  OD1   ? ? ? 1_555 E MG  . MG ? ? A ASP 13  A MG  502 1_555 ? ? ? ? ? ? ?            1.992 ? 
metalc2  metalc ? ? A ASP 20  OD2   ? ? ? 1_555 F MG  . MG ? ? A ASP 13  A MG  503 1_555 ? ? ? ? ? ? ?            2.064 ? 
metalc3  metalc ? ? A MET 21  O     ? ? ? 1_555 E MG  . MG ? ? A MET 14  A MG  502 1_555 ? ? ? ? ? ? ?            2.168 ? 
metalc4  metalc ? ? A ASP 122 OD1   ? ? ? 1_555 F MG  . MG ? ? A ASP 115 A MG  503 1_555 ? ? ? ? ? ? ?            2.162 ? 
metalc5  metalc ? ? A ASP 122 OD2   ? ? ? 1_555 E MG  . MG ? ? A ASP 115 A MG  502 1_555 ? ? ? ? ? ? ?            2.080 ? 
metalc6  metalc ? ? A GLU 123 OE2   ? ? ? 1_555 F MG  . MG ? ? A GLU 116 A MG  503 1_555 ? ? ? ? ? ? ?            2.064 ? 
metalc7  metalc ? ? B DG  3   N7    A ? ? 1_555 J 9RD . PT ? ? T DG  3   T 9RD 101 1_555 ? ? ? ? ? ? ?            1.908 ? 
metalc8  metalc ? ? B DG  3   N7    B ? ? 1_555 J 9RD . PT ? ? T DG  3   T 9RD 101 1_555 ? ? ? ? ? ? ?            1.990 ? 
metalc9  metalc ? ? B DG  4   N7    A ? ? 1_555 J 9RD . PT ? ? T DG  4   T 9RD 101 1_555 ? ? ? ? ? ? ?            1.933 ? 
metalc10 metalc ? ? B DG  4   N7    B ? ? 1_555 J 9RD . PT ? ? T DG  4   T 9RD 101 1_555 ? ? ? ? ? ? ?            1.899 ? 
metalc11 metalc ? ? C DG  9   "O3'" ? ? ? 1_555 F MG  . MG ? ? P DG  9   A MG  503 1_555 ? ? ? ? ? ? ?            2.204 ? 
metalc12 metalc ? ? D 0KX .   O1G   ? ? ? 1_555 E MG  . MG ? ? A 0KX 501 A MG  502 1_555 ? ? ? ? ? ? ?            2.137 ? 
metalc13 metalc ? ? D 0KX .   O1B   ? ? ? 1_555 E MG  . MG ? ? A 0KX 501 A MG  502 1_555 ? ? ? ? ? ? ?            2.080 ? 
metalc14 metalc ? ? D 0KX .   O2A   ? ? ? 1_555 E MG  . MG ? ? A 0KX 501 A MG  502 1_555 ? ? ? ? ? ? ?            2.090 ? 
metalc15 metalc ? ? D 0KX .   O2A   ? ? ? 1_555 F MG  . MG ? ? A 0KX 501 A MG  503 1_555 ? ? ? ? ? ? ?            2.268 ? 
metalc16 metalc ? ? F MG  .   MG    ? ? ? 1_555 K HOH . O  ? ? A MG  503 A HOH 674 1_555 ? ? ? ? ? ? ?            2.267 ? 
hydrog1  hydrog ? ? B DC  5   N3    ? ? ? 1_555 C DG  9 N1 ? ? T DC  5   P DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DC  5   N4    ? ? ? 1_555 C DG  9 O6 ? ? T DC  5   P DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DC  5   O2    ? ? ? 1_555 C DG  9 N2 ? ? T DC  5   P DG  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DT  6   N3    ? ? ? 1_555 C DA  8 N1 ? ? T DT  6   P DA  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DT  6   O4    ? ? ? 1_555 C DA  8 N6 ? ? T DT  6   P DA  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DC  7   N3    ? ? ? 1_555 C DG  7 N1 ? ? T DC  7   P DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DC  7   N4    ? ? ? 1_555 C DG  7 O6 ? ? T DC  7   P DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DC  7   O2    ? ? ? 1_555 C DG  7 N2 ? ? T DC  7   P DG  7   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DA  8   N1    ? ? ? 1_555 C DT  6 N3 ? ? T DA  8   P DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DA  8   N6    ? ? ? 1_555 C DT  6 O4 ? ? T DA  8   P DT  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DC  9   N3    ? ? ? 1_555 C DG  5 N1 ? ? T DC  9   P DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DC  9   N4    ? ? ? 1_555 C DG  5 O6 ? ? T DC  9   P DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DC  9   O2    ? ? ? 1_555 C DG  5 N2 ? ? T DC  9   P DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DA  10  N1    ? ? ? 1_555 C DT  4 N3 ? ? T DA  10  P DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DA  10  N6    ? ? ? 1_555 C DT  4 O4 ? ? T DA  10  P DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  11  N3    ? ? ? 1_555 C DG  3 N1 ? ? T DC  11  P DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DC  11  N4    ? ? ? 1_555 C DG  3 O6 ? ? T DC  11  P DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  11  O2    ? ? ? 1_555 C DG  3 N2 ? ? T DC  11  P DG  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DT  12  N3    ? ? ? 1_555 C DA  2 N1 ? ? T DT  12  P DA  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DT  12  O4    ? ? ? 1_555 C DA  2 N6 ? ? T DT  12  P DA  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 157 A . ? LEU 150 A PRO 158 A ? PRO 151 A 1 1.48  
2 LYS 238 A . ? LYS 231 A PRO 239 A ? PRO 232 A 1 2.10  
3 SER 423 A . ? SER 416 A PRO 424 A ? PRO 417 A 1 -6.84 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 6 ? 
AA2 ? 3 ? 
AA3 ? 2 ? 
AA4 ? 3 ? 
AA5 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA1 4 5 ? parallel      
AA1 5 6 ? parallel      
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA3 1 2 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ILE A 116 ? SER A 120 ? ILE A 109 SER A 113 
AA1 2 GLU A 123 ? ASP A 127 ? GLU A 116 ASP A 120 
AA1 3 VAL A 16  ? MET A 21  ? VAL A 9   MET A 14  
AA1 4 CYS A 219 ? SER A 224 ? CYS A 212 SER A 217 
AA1 5 GLN A 242 ? LEU A 244 ? GLN A 235 LEU A 237 
AA1 6 THR A 152 ? ILE A 154 ? THR A 145 ILE A 147 
AA2 1 GLY A 53  ? VAL A 57  ? GLY A 46  VAL A 50  
AA2 2 CYS A 41  ? GLN A 45  ? CYS A 34  GLN A 38  
AA2 3 LEU A 83  ? GLN A 86  ? LEU A 76  GLN A 79  
AA3 1 GLU A 89  ? SER A 90  ? GLU A 82  SER A 83  
AA3 2 LYS A 93  ? ALA A 94  ? LYS A 86  ALA A 87  
AA4 1 ILE A 326 ? ASN A 331 ? ILE A 319 ASN A 324 
AA4 2 GLU A 421 ? ALA A 438 ? GLU A 414 ALA A 431 
AA4 3 LEU A 338 ? THR A 340 ? LEU A 331 THR A 333 
AA5 1 ILE A 326 ? ASN A 331 ? ILE A 319 ASN A 324 
AA5 2 GLU A 421 ? ALA A 438 ? GLU A 414 ALA A 431 
AA5 3 ARG A 368 ? VAL A 379 ? ARG A 361 VAL A 372 
AA5 4 LEU A 388 ? ALA A 393 ? LEU A 381 ALA A 386 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 117 ? N GLU A 110 O TYR A 125 ? O TYR A 118 
AA1 2 3 O VAL A 126 ? O VAL A 119 N ALA A 17  ? N ALA A 10  
AA1 3 4 N VAL A 16  ? N VAL A 9   O SER A 224 ? O SER A 217 
AA1 4 5 N ILE A 223 ? N ILE A 216 O THR A 243 ? O THR A 236 
AA1 5 6 O LEU A 244 ? O LEU A 237 N TYR A 153 ? N TYR A 146 
AA2 1 2 O ILE A 55  ? O ILE A 48  N VAL A 43  ? N VAL A 36  
AA2 2 3 N VAL A 44  ? N VAL A 37  O ALA A 85  ? O ALA A 78  
AA3 1 2 N SER A 90  ? N SER A 83  O LYS A 93  ? O LYS A 86  
AA4 1 2 N ILE A 326 ? N ILE A 319 O ALA A 433 ? O ALA A 426 
AA4 2 3 O LEU A 426 ? O LEU A 419 N LEU A 338 ? N LEU A 331 
AA5 1 2 N ILE A 326 ? N ILE A 319 O ALA A 433 ? O ALA A 426 
AA5 2 3 O CYS A 432 ? O CYS A 425 N VAL A 374 ? N VAL A 367 
AA5 3 4 N LEU A 373 ? N LEU A 366 O CYS A 392 ? O CYS A 385 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A 0KX 501 ? 21 'binding site for residue 0KX A 501' 
AC2 Software A MG  502 ? 5  'binding site for residue MG A 502'  
AC3 Software A MG  503 ? 7  'binding site for residue MG A 503'  
AC4 Software A GOL 504 ? 10 'binding site for residue GOL A 504' 
AC5 Software A GOL 505 ? 3  'binding site for residue GOL A 505' 
AC6 Software A GOL 506 ? 7  'binding site for residue GOL A 506' 
AC7 Software T 9RD 101 ? 5  'binding site for residue 9RD T 101' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 21 ASP A 20  ? ASP A 13  . ? 1_555 ? 
2  AC1 21 MET A 21  ? MET A 14  . ? 1_555 ? 
3  AC1 21 ASP A 22  ? ASP A 15  . ? 1_555 ? 
4  AC1 21 CYS A 23  ? CYS A 16  . ? 1_555 ? 
5  AC1 21 PHE A 24  ? PHE A 17  . ? 1_555 ? 
6  AC1 21 PHE A 25  ? PHE A 18  . ? 1_555 ? 
7  AC1 21 ILE A 55  ? ILE A 48  . ? 1_555 ? 
8  AC1 21 ALA A 56  ? ALA A 49  . ? 1_555 ? 
9  AC1 21 TYR A 59  ? TYR A 52  . ? 1_555 ? 
10 AC1 21 ARG A 62  ? ARG A 55  . ? 1_555 ? 
11 AC1 21 ARG A 68  ? ARG A 61  . ? 1_555 ? 
12 AC1 21 ASP A 122 ? ASP A 115 . ? 1_555 ? 
13 AC1 21 LYS A 238 ? LYS A 231 . ? 1_555 ? 
14 AC1 21 MG  E .   ? MG  A 502 . ? 1_555 ? 
15 AC1 21 MG  F .   ? MG  A 503 . ? 1_555 ? 
16 AC1 21 HOH K .   ? HOH A 620 . ? 1_555 ? 
17 AC1 21 HOH K .   ? HOH A 630 . ? 1_555 ? 
18 AC1 21 HOH K .   ? HOH A 666 . ? 1_555 ? 
19 AC1 21 HOH K .   ? HOH A 674 . ? 1_555 ? 
20 AC1 21 DG  C 9   ? DG  P 9   . ? 1_555 ? 
21 AC1 21 DG  B 4   ? DG  T 4   . ? 1_555 ? 
22 AC2 5  ASP A 20  ? ASP A 13  . ? 1_555 ? 
23 AC2 5  MET A 21  ? MET A 14  . ? 1_555 ? 
24 AC2 5  ASP A 122 ? ASP A 115 . ? 1_555 ? 
25 AC2 5  0KX D .   ? 0KX A 501 . ? 1_555 ? 
26 AC2 5  MG  F .   ? MG  A 503 . ? 1_555 ? 
27 AC3 7  ASP A 20  ? ASP A 13  . ? 1_555 ? 
28 AC3 7  ASP A 122 ? ASP A 115 . ? 1_555 ? 
29 AC3 7  GLU A 123 ? GLU A 116 . ? 1_555 ? 
30 AC3 7  0KX D .   ? 0KX A 501 . ? 1_555 ? 
31 AC3 7  MG  E .   ? MG  A 502 . ? 1_555 ? 
32 AC3 7  HOH K .   ? HOH A 674 . ? 1_555 ? 
33 AC3 7  DG  C 9   ? DG  P 9   . ? 1_555 ? 
34 AC4 10 ARG A 31  ? ARG A 24  . ? 5_554 ? 
35 AC4 10 GLN A 32  ? GLN A 25  . ? 5_554 ? 
36 AC4 10 PRO A 251 ? PRO A 244 . ? 1_555 ? 
37 AC4 10 PHE A 254 ? PHE A 247 . ? 1_555 ? 
38 AC4 10 SER A 255 ? SER A 248 . ? 1_555 ? 
39 AC4 10 GLY A 283 ? GLY A 276 . ? 1_555 ? 
40 AC4 10 GLU A 284 ? GLU A 277 . ? 1_555 ? 
41 AC4 10 HOH K .   ? HOH A 608 . ? 1_555 ? 
42 AC4 10 HOH K .   ? HOH A 617 . ? 1_555 ? 
43 AC4 10 HOH K .   ? HOH A 621 . ? 1_555 ? 
44 AC5 3  GLN A 27  ? GLN A 20  . ? 1_555 ? 
45 AC5 3  ARG A 37  ? ARG A 30  . ? 1_555 ? 
46 AC5 3  GLY A 216 ? GLY A 209 . ? 1_555 ? 
47 AC6 7  ASN A 33  ? ASN A 26  . ? 1_555 ? 
48 AC6 7  HIS A 35  ? HIS A 28  . ? 1_555 ? 
49 AC6 7  GLY A 278 ? GLY A 271 . ? 6_555 ? 
50 AC6 7  ILE A 279 ? ILE A 272 . ? 6_555 ? 
51 AC6 7  GLU A 280 ? GLU A 273 . ? 6_555 ? 
52 AC6 7  TYR A 281 ? TYR A 274 . ? 6_555 ? 
53 AC6 7  GLU A 284 ? GLU A 277 . ? 6_555 ? 
54 AC7 5  DA  C 8   ? DA  P 8   . ? 1_555 ? 
55 AC7 5  DG  C 9   ? DG  P 9   . ? 1_555 ? 
56 AC7 5  DG  B 3   ? DG  T 3   . ? 1_555 ? 
57 AC7 5  DG  B 4   ? DG  T 4   . ? 1_555 ? 
58 AC7 5  DC  B 5   ? DC  T 5   . ? 1_555 ? 
# 
_atom_sites.entry_id                    6MXO 
_atom_sites.fract_transf_matrix[1][1]   0.010146 
_atom_sites.fract_transf_matrix[1][2]   0.005858 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   -0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011716 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   -0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012238 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
PT 
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . GLY A 1 9   ? -35.189 24.628  8.221   1.00 46.13 ? 2   GLY A N     1 
ATOM   2    C  CA    . GLY A 1 9   ? -36.345 24.989  7.353   1.00 41.41 ? 2   GLY A CA    1 
ATOM   3    C  C     . GLY A 1 9   ? -35.940 25.181  5.901   1.00 37.57 ? 2   GLY A C     1 
ATOM   4    O  O     . GLY A 1 9   ? -36.666 25.805  5.144   1.00 34.81 ? 2   GLY A O     1 
ATOM   5    N  N     . THR A 1 10  ? -34.777 24.672  5.511   1.00 33.64 ? 3   THR A N     1 
ATOM   6    C  CA    . THR A 1 10  ? -34.596 24.315  4.117   1.00 32.69 ? 3   THR A CA    1 
ATOM   7    C  C     . THR A 1 10  ? -34.966 22.864  3.963   1.00 26.19 ? 3   THR A C     1 
ATOM   8    O  O     . THR A 1 10  ? -34.628 22.248  2.980   1.00 33.80 ? 3   THR A O     1 
ATOM   9    C  CB    . THR A 1 10  ? -33.177 24.582  3.590   1.00 32.44 ? 3   THR A CB    1 
ATOM   10   O  OG1   . THR A 1 10  ? -32.251 23.821  4.363   1.00 38.04 ? 3   THR A OG1   1 
ATOM   11   C  CG2   . THR A 1 10  ? -32.828 26.145  3.587   1.00 32.66 ? 3   THR A CG2   1 
ATOM   12   N  N     . GLY A 1 11  ? -35.669 22.310  4.939   1.00 25.71 ? 4   GLY A N     1 
ATOM   13   C  CA    . GLY A 1 11  ? -36.199 20.964  4.826   1.00 23.75 ? 4   GLY A CA    1 
ATOM   14   C  C     . GLY A 1 11  ? -35.133 19.898  4.728   1.00 22.55 ? 4   GLY A C     1 
ATOM   15   O  O     . GLY A 1 11  ? -35.241 18.948  3.923   1.00 19.47 ? 4   GLY A O     1 
ATOM   16   N  N     . GLN A 1 12  ? -34.103 20.097  5.547   1.00 21.56 ? 5   GLN A N     1 
ATOM   17   C  CA    . GLN A 1 12  ? -32.896 19.304  5.570   1.00 20.48 ? 5   GLN A CA    1 
ATOM   18   C  C     . GLN A 1 12  ? -32.537 18.788  6.979   1.00 21.19 ? 5   GLN A C     1 
ATOM   19   O  O     . GLN A 1 12  ? -31.420 18.381  7.221   1.00 19.66 ? 5   GLN A O     1 
ATOM   20   C  CB    . GLN A 1 12  ? -31.778 20.176  5.069   1.00 21.14 ? 5   GLN A CB    1 
ATOM   21   C  CG    . GLN A 1 12  ? -31.817 20.345  3.565   1.00 23.57 ? 5   GLN A CG    1 
ATOM   22   C  CD    . GLN A 1 12  ? -30.653 21.186  3.141   1.00 23.19 ? 5   GLN A CD    1 
ATOM   23   O  OE1   . GLN A 1 12  ? -30.666 22.392  3.336   1.00 27.05 ? 5   GLN A OE1   1 
ATOM   24   N  NE2   . GLN A 1 12  ? -29.644 20.569  2.598   1.00 23.99 ? 5   GLN A NE2   1 
ATOM   25   N  N     . ASP A 1 13  ? -33.509 18.818  7.882   1.00 23.82 ? 6   ASP A N     1 
ATOM   26   C  CA    . ASP A 1 13  ? -33.357 18.426  9.292   1.00 24.41 ? 6   ASP A CA    1 
ATOM   27   C  C     . ASP A 1 13  ? -33.406 16.907  9.624   1.00 23.38 ? 6   ASP A C     1 
ATOM   28   O  O     . ASP A 1 13  ? -32.975 16.485  10.684  1.00 23.16 ? 6   ASP A O     1 
ATOM   29   C  CB    . ASP A 1 13  ? -34.516 19.115  10.091  1.00 25.23 ? 6   ASP A CB    1 
ATOM   30   C  CG    . ASP A 1 13  ? -35.906 18.992  9.399   1.00 28.04 ? 6   ASP A CG    1 
ATOM   31   O  OD1   . ASP A 1 13  ? -36.122 19.412  8.243   1.00 29.44 ? 6   ASP A OD1   1 
ATOM   32   O  OD2   . ASP A 1 13  ? -36.840 18.490  10.040  1.00 31.84 ? 6   ASP A OD2   1 
ATOM   33   N  N     . ARG A 1 14  ? -33.989 16.106  8.742   1.00 17.88 ? 7   ARG A N     1 
ATOM   34   C  CA    . ARG A 1 14  ? -34.188 14.695  9.013   1.00 15.84 ? 7   ARG A CA    1 
ATOM   35   C  C     . ARG A 1 14  ? -33.562 13.911  7.869   1.00 15.01 ? 7   ARG A C     1 
ATOM   36   O  O     . ARG A 1 14  ? -33.418 14.440  6.750   1.00 13.25 ? 7   ARG A O     1 
ATOM   37   C  CB    . ARG A 1 14  ? -35.673 14.398  9.012   1.00 15.66 ? 7   ARG A CB    1 
ATOM   38   C  CG    . ARG A 1 14  ? -36.416 15.041  10.173  1.00 15.24 ? 7   ARG A CG    1 
ATOM   39   C  CD    . ARG A 1 14  ? -37.863 14.611  10.059  1.00 15.71 ? 7   ARG A CD    1 
ATOM   40   N  NE    . ARG A 1 14  ? -38.548 15.295  8.959   1.00 16.22 ? 7   ARG A NE    1 
ATOM   41   C  CZ    . ARG A 1 14  ? -39.647 14.878  8.350   1.00 16.08 ? 7   ARG A CZ    1 
ATOM   42   N  NH1   . ARG A 1 14  ? -40.169 15.629  7.362   1.00 16.09 ? 7   ARG A NH1   1 
ATOM   43   N  NH2   . ARG A 1 14  ? -40.276 13.782  8.768   1.00 17.48 ? 7   ARG A NH2   1 
ATOM   44   N  N     . VAL A 1 15  ? -33.292 12.646  8.153   1.00 13.73 ? 8   VAL A N     1 
ATOM   45   C  CA    . VAL A 1 15  ? -33.012 11.646  7.141   1.00 13.01 ? 8   VAL A CA    1 
ATOM   46   C  C     . VAL A 1 15  ? -34.134 10.640  7.217   1.00 13.69 ? 8   VAL A C     1 
ATOM   47   O  O     . VAL A 1 15  ? -34.343 9.969   8.288   1.00 14.59 ? 8   VAL A O     1 
ATOM   48   C  CB    . VAL A 1 15  ? -31.651 10.945  7.396   1.00 12.86 ? 8   VAL A CB    1 
ATOM   49   C  CG1   . VAL A 1 15  ? -31.343 9.874   6.316   1.00 12.47 ? 8   VAL A CG1   1 
ATOM   50   C  CG2   . VAL A 1 15  ? -30.543 11.960  7.587   1.00 12.65 ? 8   VAL A CG2   1 
ATOM   51   N  N     . VAL A 1 16  ? -34.818 10.465  6.094   1.00 13.02 ? 9   VAL A N     1 
ATOM   52   C  CA    . VAL A 1 16  ? -35.996 9.589   6.042   1.00 13.36 ? 9   VAL A CA    1 
ATOM   53   C  C     . VAL A 1 16  ? -35.816 8.665   4.893   1.00 12.57 ? 9   VAL A C     1 
ATOM   54   O  O     . VAL A 1 16  ? -35.347 9.095   3.804   1.00 12.24 ? 9   VAL A O     1 
ATOM   55   C  CB    . VAL A 1 16  ? -37.265 10.430  5.864   1.00 14.46 ? 9   VAL A CB    1 
ATOM   56   C  CG1   . VAL A 1 16  ? -38.507 9.624   5.530   1.00 14.30 ? 9   VAL A CG1   1 
ATOM   57   C  CG2   . VAL A 1 16  ? -37.460 11.243  7.140   1.00 15.11 ? 9   VAL A CG2   1 
ATOM   58   N  N     . ALA A 1 17  ? -36.123 7.383   5.113   1.00 11.41 ? 10  ALA A N     1 
ATOM   59   C  CA    . ALA A 1 17  ? -36.071 6.419   4.009   1.00 10.82 ? 10  ALA A CA    1 
ATOM   60   C  C     . ALA A 1 17  ? -37.444 5.859   3.772   1.00 12.31 ? 10  ALA A C     1 
ATOM   61   O  O     . ALA A 1 17  ? -38.297 5.840   4.706   1.00 11.81 ? 10  ALA A O     1 
ATOM   62   C  CB    . ALA A 1 17  ? -35.088 5.342   4.277   1.00 10.00 ? 10  ALA A CB    1 
ATOM   63   N  N     . LEU A 1 18  ? -37.685 5.446   2.536   1.00 11.12 ? 11  LEU A N     1 
ATOM   64   C  CA    . LEU A 1 18  ? -38.871 4.658   2.209   1.00 11.29 ? 11  LEU A CA    1 
ATOM   65   C  C     . LEU A 1 18  ? -38.345 3.396   1.544   1.00 11.96 ? 11  LEU A C     1 
ATOM   66   O  O     . LEU A 1 18  ? -37.626 3.500   0.516   1.00 10.19 ? 11  LEU A O     1 
ATOM   67   C  CB    . LEU A 1 18  ? -39.820 5.392   1.253   1.00 11.99 ? 11  LEU A CB    1 
ATOM   68   C  CG    . LEU A 1 18  ? -41.178 4.762   0.844   1.00 13.64 ? 11  LEU A CG    1 
ATOM   69   C  CD1   . LEU A 1 18  ? -41.083 3.805   -0.349  1.00 13.78 ? 11  LEU A CD1   1 
ATOM   70   C  CD2   . LEU A 1 18  ? -41.897 4.006   1.989   1.00 12.95 ? 11  LEU A CD2   1 
ATOM   71   N  N     . VAL A 1 19  ? -38.655 2.236   2.176   1.00 12.23 ? 12  VAL A N     1 
ATOM   72   C  CA    . VAL A 1 19  ? -38.303 0.923   1.661   1.00 12.29 ? 12  VAL A CA    1 
ATOM   73   C  C     . VAL A 1 19  ? -39.562 0.260   1.108   1.00 11.35 ? 12  VAL A C     1 
ATOM   74   O  O     . VAL A 1 19  ? -40.509 0.101   1.822   1.00 10.57 ? 12  VAL A O     1 
ATOM   75   C  CB    . VAL A 1 19  ? -37.686 0.041   2.741   1.00 12.99 ? 12  VAL A CB    1 
ATOM   76   C  CG1   . VAL A 1 19  ? -37.329 -1.317  2.150   1.00 14.05 ? 12  VAL A CG1   1 
ATOM   77   C  CG2   . VAL A 1 19  ? -36.431 0.743   3.277   1.00 14.05 ? 12  VAL A CG2   1 
ATOM   78   N  N     . ASP A 1 20  ? -39.537 -0.116  -0.184  1.00 11.41 ? 13  ASP A N     1 
ATOM   79   C  CA    . ASP A 1 20  ? -40.611 -0.828  -0.845  1.00 11.54 ? 13  ASP A CA    1 
ATOM   80   C  C     . ASP A 1 20  ? -40.238 -2.131  -1.556  1.00 11.36 ? 13  ASP A C     1 
ATOM   81   O  O     . ASP A 1 20  ? -39.374 -2.153  -2.445  1.00 10.59 ? 13  ASP A O     1 
ATOM   82   C  CB    . ASP A 1 20  ? -41.220 0.127   -1.873  1.00 12.88 ? 13  ASP A CB    1 
ATOM   83   C  CG    . ASP A 1 20  ? -42.500 -0.403  -2.450  1.00 13.26 ? 13  ASP A CG    1 
ATOM   84   O  OD1   . ASP A 1 20  ? -42.440 -1.262  -3.355  1.00 12.32 ? 13  ASP A OD1   1 
ATOM   85   O  OD2   . ASP A 1 20  ? -43.592 0.039   -1.991  1.00 17.47 ? 13  ASP A OD2   1 
ATOM   86   N  N     . MET A 1 21  ? -40.925 -3.224  -1.205  1.00 10.77 ? 14  MET A N     1 
ATOM   87   C  CA    . MET A 1 21  ? -40.575 -4.510  -1.726  1.00 11.10 ? 14  MET A CA    1 
ATOM   88   C  C     . MET A 1 21  ? -40.840 -4.514  -3.238  1.00 11.01 ? 14  MET A C     1 
ATOM   89   O  O     . MET A 1 21  ? -41.811 -3.936  -3.728  1.00 10.34 ? 14  MET A O     1 
ATOM   90   C  CB    . MET A 1 21  ? -41.435 -5.601  -1.068  1.00 12.44 ? 14  MET A CB    1 
ATOM   91   C  CG    . MET A 1 21  ? -41.383 -5.629  0.460   1.00 12.30 ? 14  MET A CG    1 
ATOM   92   S  SD    . MET A 1 21  ? -39.736 -5.652  1.137   1.00 13.31 ? 14  MET A SD    1 
ATOM   93   C  CE    . MET A 1 21  ? -39.094 -7.090  0.334   1.00 13.62 ? 14  MET A CE    1 
ATOM   94   N  N     . ASP A 1 22  ? -39.945 -5.168  -3.957  1.00 10.90 ? 15  ASP A N     1 
ATOM   95   C  CA    . ASP A 1 22  ? -40.090 -5.355  -5.402  1.00 11.04 ? 15  ASP A CA    1 
ATOM   96   C  C     . ASP A 1 22  ? -41.159 -6.424  -5.654  1.00 11.59 ? 15  ASP A C     1 
ATOM   97   O  O     . ASP A 1 22  ? -41.148 -7.506  -4.967  1.00 10.62 ? 15  ASP A O     1 
ATOM   98   C  CB    . ASP A 1 22  ? -38.739 -5.746  -6.020  1.00 10.68 ? 15  ASP A CB    1 
ATOM   99   C  CG    . ASP A 1 22  ? -37.661 -4.599  -5.937  1.00 10.31 ? 15  ASP A CG    1 
ATOM   100  O  OD1   . ASP A 1 22  ? -38.022 -3.401  -5.806  1.00 9.81  ? 15  ASP A OD1   1 
ATOM   101  O  OD2   . ASP A 1 22  ? -36.446 -4.908  -6.006  1.00 10.20 ? 15  ASP A OD2   1 
ATOM   102  N  N     . CYS A 1 23  ? -42.045 -6.115  -6.624  1.00 10.24 ? 16  CYS A N     1 
ATOM   103  C  CA    . CYS A 1 23  ? -43.162 -6.961  -7.072  1.00 12.00 ? 16  CYS A CA    1 
ATOM   104  C  C     . CYS A 1 23  ? -43.640 -7.917  -5.968  1.00 11.27 ? 16  CYS A C     1 
ATOM   105  O  O     . CYS A 1 23  ? -43.503 -9.145  -6.050  1.00 11.82 ? 16  CYS A O     1 
ATOM   106  C  CB    . CYS A 1 23  ? -42.792 -7.669  -8.382  1.00 12.40 ? 16  CYS A CB    1 
ATOM   107  S  SG    . CYS A 1 23  ? -41.295 -8.641  -8.404  1.00 14.48 ? 16  CYS A SG    1 
ATOM   108  N  N     . PHE A 1 24  ? -44.032 -7.328  -4.861  1.00 11.58 ? 17  PHE A N     1 
ATOM   109  C  CA    . PHE A 1 24  ? -44.049 -8.088  -3.579  1.00 11.28 ? 17  PHE A CA    1 
ATOM   110  C  C     . PHE A 1 24  ? -44.815 -9.405  -3.585  1.00 10.75 ? 17  PHE A C     1 
ATOM   111  O  O     . PHE A 1 24  ? -44.259 -10.439 -3.172  1.00 10.94 ? 17  PHE A O     1 
ATOM   112  C  CB    . PHE A 1 24  ? -44.588 -7.163  -2.446  1.00 10.82 ? 17  PHE A CB    1 
ATOM   113  C  CG    . PHE A 1 24  ? -44.505 -7.775  -1.093  1.00 10.68 ? 17  PHE A CG    1 
ATOM   114  C  CD1   . PHE A 1 24  ? -43.354 -8.442  -0.694  1.00 10.12 ? 17  PHE A CD1   1 
ATOM   115  C  CD2   . PHE A 1 24  ? -45.618 -7.796  -0.253  1.00 10.44 ? 17  PHE A CD2   1 
ATOM   116  C  CE1   . PHE A 1 24  ? -43.287 -9.065  0.545   1.00 10.63 ? 17  PHE A CE1   1 
ATOM   117  C  CE2   . PHE A 1 24  ? -45.547 -8.384  0.998   1.00 10.11 ? 17  PHE A CE2   1 
ATOM   118  C  CZ    . PHE A 1 24  ? -44.387 -9.042  1.384   1.00 10.78 ? 17  PHE A CZ    1 
ATOM   119  N  N     . PHE A 1 25  ? -46.080 -9.431  -4.027  1.00 11.02 ? 18  PHE A N     1 
ATOM   120  C  CA    . PHE A 1 25  ? -46.827 -10.649 -3.943  1.00 10.98 ? 18  PHE A CA    1 
ATOM   121  C  C     . PHE A 1 25  ? -46.148 -11.701 -4.855  1.00 11.13 ? 18  PHE A C     1 
ATOM   122  O  O     . PHE A 1 25  ? -46.111 -12.863 -4.516  1.00 10.48 ? 18  PHE A O     1 
ATOM   123  C  CB    . PHE A 1 25  ? -48.332 -10.561 -4.221  1.00 11.42 ? 18  PHE A CB    1 
ATOM   124  C  CG    . PHE A 1 25  ? -49.169 -9.789  -3.207  1.00 12.12 ? 18  PHE A CG    1 
ATOM   125  C  CD1   . PHE A 1 25  ? -48.625 -9.053  -2.141  1.00 13.21 ? 18  PHE A CD1   1 
ATOM   126  C  CD2   . PHE A 1 25  ? -50.542 -9.770  -3.352  1.00 13.36 ? 18  PHE A CD2   1 
ATOM   127  C  CE1   . PHE A 1 25  ? -49.422 -8.341  -1.269  1.00 13.43 ? 18  PHE A CE1   1 
ATOM   128  C  CE2   . PHE A 1 25  ? -51.377 -9.061  -2.468  1.00 13.72 ? 18  PHE A CE2   1 
ATOM   129  C  CZ    . PHE A 1 25  ? -50.835 -8.322  -1.437  1.00 13.82 ? 18  PHE A CZ    1 
ATOM   130  N  N     . VAL A 1 26  ? -45.602 -11.298 -5.994  1.00 10.85 ? 19  VAL A N     1 
ATOM   131  C  CA    . VAL A 1 26  ? -44.901 -12.225 -6.857  1.00 10.98 ? 19  VAL A CA    1 
ATOM   132  C  C     . VAL A 1 26  ? -43.702 -12.894 -6.119  1.00 10.37 ? 19  VAL A C     1 
ATOM   133  O  O     . VAL A 1 26  ? -43.500 -14.166 -6.168  1.00 9.73  ? 19  VAL A O     1 
ATOM   134  C  CB    . VAL A 1 26  ? -44.432 -11.485 -8.124  1.00 11.24 ? 19  VAL A CB    1 
ATOM   135  C  CG1   . VAL A 1 26  ? -43.487 -12.345 -8.911  1.00 12.04 ? 19  VAL A CG1   1 
ATOM   136  C  CG2   . VAL A 1 26  ? -45.626 -11.232 -9.006  1.00 12.44 ? 19  VAL A CG2   1 
ATOM   137  N  N     . GLN A 1 27  ? -42.917 -12.072 -5.412  1.00 9.69  ? 20  GLN A N     1 
ATOM   138  C  CA    . GLN A 1 27  ? -41.772 -12.602 -4.706  1.00 10.26 ? 20  GLN A CA    1 
ATOM   139  C  C     . GLN A 1 27  ? -42.171 -13.565 -3.613  1.00 10.17 ? 20  GLN A C     1 
ATOM   140  O  O     . GLN A 1 27  ? -41.485 -14.586 -3.396  1.00 9.83  ? 20  GLN A O     1 
ATOM   141  C  CB    . GLN A 1 27  ? -40.931 -11.486 -4.079  1.00 11.42 ? 20  GLN A CB    1 
ATOM   142  C  CG    . GLN A 1 27  ? -40.041 -10.749 -5.043  1.00 12.70 ? 20  GLN A CG    1 
ATOM   143  C  CD    . GLN A 1 27  ? -38.902 -10.100 -4.316  1.00 14.70 ? 20  GLN A CD    1 
ATOM   144  O  OE1   . GLN A 1 27  ? -37.874 -10.736 -4.072  1.00 16.10 ? 20  GLN A OE1   1 
ATOM   145  N  NE2   . GLN A 1 27  ? -39.106 -8.855  -3.861  1.00 16.21 ? 20  GLN A NE2   1 
ATOM   146  N  N     . VAL A 1 28  ? -43.264 -13.263 -2.896  1.00 9.88  ? 21  VAL A N     1 
ATOM   147  C  CA    . VAL A 1 28  ? -43.750 -14.201 -1.886  1.00 10.57 ? 21  VAL A CA    1 
ATOM   148  C  C     . VAL A 1 28  ? -44.031 -15.618 -2.510  1.00 10.90 ? 21  VAL A C     1 
ATOM   149  O  O     . VAL A 1 28  ? -43.657 -16.655 -1.989  1.00 9.63  ? 21  VAL A O     1 
ATOM   150  C  CB    . VAL A 1 28  ? -45.037 -13.655 -1.233  1.00 10.52 ? 21  VAL A CB    1 
ATOM   151  C  CG1   . VAL A 1 28  ? -45.642 -14.682 -0.299  1.00 10.84 ? 21  VAL A CG1   1 
ATOM   152  C  CG2   . VAL A 1 28  ? -44.715 -12.424 -0.396  1.00 10.72 ? 21  VAL A CG2   1 
ATOM   153  N  N     . GLU A 1 29  ? -44.653 -15.610 -3.686  1.00 10.89 ? 22  GLU A N     1 
ATOM   154  C  CA    . GLU A 1 29  ? -44.962 -16.861 -4.374  1.00 11.03 ? 22  GLU A CA    1 
ATOM   155  C  C     . GLU A 1 29  ? -43.755 -17.545 -5.007  1.00 11.35 ? 22  GLU A C     1 
ATOM   156  O  O     . GLU A 1 29  ? -43.710 -18.847 -5.146  1.00 10.30 ? 22  GLU A O     1 
ATOM   157  C  CB    . GLU A 1 29  ? -46.015 -16.602 -5.467  1.00 10.28 ? 22  GLU A CB    1 
ATOM   158  C  CG    . GLU A 1 29  ? -47.318 -16.137 -4.919  1.00 11.50 ? 22  GLU A CG    1 
ATOM   159  C  CD    . GLU A 1 29  ? -48.077 -17.167 -4.038  1.00 12.89 ? 22  GLU A CD    1 
ATOM   160  O  OE1   . GLU A 1 29  ? -47.802 -18.377 -4.086  1.00 14.55 ? 22  GLU A OE1   1 
ATOM   161  O  OE2   . GLU A 1 29  ? -48.964 -16.752 -3.258  1.00 14.19 ? 22  GLU A OE2   1 
ATOM   162  N  N     . GLN A 1 30  ? -42.818 -16.706 -5.456  1.00 11.85 ? 23  GLN A N     1 
ATOM   163  C  CA    . GLN A 1 30  ? -41.559 -17.235 -6.053  1.00 12.23 ? 23  GLN A CA    1 
ATOM   164  C  C     . GLN A 1 30  ? -40.599 -17.858 -5.010  1.00 11.91 ? 23  GLN A C     1 
ATOM   165  O  O     . GLN A 1 30  ? -39.858 -18.847 -5.313  1.00 11.56 ? 23  GLN A O     1 
ATOM   166  C  CB    . GLN A 1 30  ? -40.751 -16.189 -6.783  1.00 12.36 ? 23  GLN A CB    1 
ATOM   167  C  CG    . GLN A 1 30  ? -41.455 -15.644 -8.007  1.00 14.17 ? 23  GLN A CG    1 
ATOM   168  C  CD    . GLN A 1 30  ? -40.705 -14.482 -8.645  1.00 15.06 ? 23  GLN A CD    1 
ATOM   169  O  OE1   . GLN A 1 30  ? -40.358 -13.495 -7.980  1.00 13.80 ? 23  GLN A OE1   1 
ATOM   170  N  NE2   . GLN A 1 30  ? -40.448 -14.609 -9.970  1.00 17.64 ? 23  GLN A NE2   1 
ATOM   171  N  N     . ARG A 1 31  ? -40.579 -17.248 -3.841  1.00 11.53 ? 24  ARG A N     1 
ATOM   172  C  CA    . ARG A 1 31  ? -39.866 -17.855 -2.760  1.00 11.95 ? 24  ARG A CA    1 
ATOM   173  C  C     . ARG A 1 31  ? -40.403 -19.251 -2.455  1.00 11.67 ? 24  ARG A C     1 
ATOM   174  O  O     . ARG A 1 31  ? -39.603 -20.196 -2.291  1.00 10.98 ? 24  ARG A O     1 
ATOM   175  C  CB    . ARG A 1 31  ? -39.883 -16.974 -1.517  1.00 12.11 ? 24  ARG A CB    1 
ATOM   176  C  CG    . ARG A 1 31  ? -39.109 -17.667 -0.361  1.00 12.84 ? 24  ARG A CG    1 
ATOM   177  C  CD    . ARG A 1 31  ? -39.072 -16.838 0.893   1.00 12.24 ? 24  ARG A CD    1 
ATOM   178  N  NE    . ARG A 1 31  ? -40.363 -16.788 1.544   1.00 12.51 ? 24  ARG A NE    1 
ATOM   179  C  CZ    . ARG A 1 31  ? -40.623 -16.118 2.680   1.00 14.06 ? 24  ARG A CZ    1 
ATOM   180  N  NH1   . ARG A 1 31  ? -39.653 -15.451 3.312   1.00 13.18 ? 24  ARG A NH1   1 
ATOM   181  N  NH2   . ARG A 1 31  ? -41.842 -16.111 3.216   1.00 14.04 ? 24  ARG A NH2   1 
ATOM   182  N  N     . GLN A 1 32  ? -41.729 -19.370 -2.322  1.00 12.43 ? 25  GLN A N     1 
ATOM   183  C  CA    . GLN A 1 32  ? -42.379 -20.631 -2.046  1.00 13.86 ? 25  GLN A CA    1 
ATOM   184  C  C     . GLN A 1 32  ? -42.295 -21.631 -3.201  1.00 13.26 ? 25  GLN A C     1 
ATOM   185  O  O     . GLN A 1 32  ? -42.184 -22.841 -2.945  1.00 11.78 ? 25  GLN A O     1 
ATOM   186  C  CB    . GLN A 1 32  ? -43.847 -20.399 -1.653  1.00 17.16 ? 25  GLN A CB    1 
ATOM   187  C  CG    . GLN A 1 32  ? -44.715 -21.631 -1.472  1.00 18.88 ? 25  GLN A CG    1 
ATOM   188  C  CD    . GLN A 1 32  ? -46.201 -21.247 -1.461  1.00 22.10 ? 25  GLN A CD    1 
ATOM   189  O  OE1   . GLN A 1 32  ? -46.591 -20.286 -0.803  1.00 24.62 ? 25  GLN A OE1   1 
ATOM   190  N  NE2   . GLN A 1 32  ? -47.016 -21.981 -2.200  1.00 22.13 ? 25  GLN A NE2   1 
ATOM   191  N  N     . ASN A 1 33  ? -42.429 -21.179 -4.442  1.00 12.80 ? 26  ASN A N     1 
ATOM   192  C  CA    . ASN A 1 33  ? -42.333 -22.085 -5.563  1.00 13.52 ? 26  ASN A CA    1 
ATOM   193  C  C     . ASN A 1 33  ? -41.165 -21.734 -6.485  1.00 13.53 ? 26  ASN A C     1 
ATOM   194  O  O     . ASN A 1 33  ? -41.261 -20.861 -7.327  1.00 10.59 ? 26  ASN A O     1 
ATOM   195  C  CB    . ASN A 1 33  ? -43.665 -22.147 -6.298  1.00 14.99 ? 26  ASN A CB    1 
ATOM   196  C  CG    . ASN A 1 33  ? -43.634 -23.127 -7.512  1.00 15.98 ? 26  ASN A CG    1 
ATOM   197  O  OD1   . ASN A 1 33  ? -42.603 -23.714 -7.898  1.00 15.17 ? 26  ASN A OD1   1 
ATOM   198  N  ND2   . ASN A 1 33  ? -44.794 -23.283 -8.122  1.00 17.46 ? 26  ASN A ND2   1 
ATOM   199  N  N     . PRO A 1 34  ? -40.008 -22.400 -6.300  1.00 14.57 ? 27  PRO A N     1 
ATOM   200  C  CA    . PRO A 1 34  ? -38.795 -22.044 -7.058  1.00 14.25 ? 27  PRO A CA    1 
ATOM   201  C  C     . PRO A 1 34  ? -38.975 -22.137 -8.573  1.00 15.75 ? 27  PRO A C     1 
ATOM   202  O  O     . PRO A 1 34  ? -38.238 -21.471 -9.293  1.00 16.16 ? 27  PRO A O     1 
ATOM   203  C  CB    . PRO A 1 34  ? -37.813 -23.133 -6.639  1.00 16.20 ? 27  PRO A CB    1 
ATOM   204  C  CG    . PRO A 1 34  ? -38.234 -23.499 -5.257  1.00 15.83 ? 27  PRO A CG    1 
ATOM   205  C  CD    . PRO A 1 34  ? -39.696 -23.197 -5.113  1.00 15.34 ? 27  PRO A CD    1 
ATOM   206  N  N     . HIS A 1 35  ? -39.948 -22.921 -9.067  1.00 16.34 ? 28  HIS A N     1 
ATOM   207  C  CA    . HIS A 1 35  ? -40.199 -22.959 -10.497 1.00 19.41 ? 28  HIS A CA    1 
ATOM   208  C  C     . HIS A 1 35  ? -40.626 -21.592 -11.050 1.00 19.41 ? 28  HIS A C     1 
ATOM   209  O  O     . HIS A 1 35  ? -40.566 -21.434 -12.232 1.00 20.29 ? 28  HIS A O     1 
ATOM   210  C  CB    . HIS A 1 35  ? -41.266 -24.003 -10.898 1.00 23.46 ? 28  HIS A CB    1 
ATOM   211  C  CG    . HIS A 1 35  ? -40.787 -25.417 -10.843 1.00 29.97 ? 28  HIS A CG    1 
ATOM   212  N  ND1   . HIS A 1 35  ? -41.532 -26.441 -10.281 1.00 33.12 ? 28  HIS A ND1   1 
ATOM   213  C  CD2   . HIS A 1 35  ? -39.620 -25.979 -11.249 1.00 30.72 ? 28  HIS A CD2   1 
ATOM   214  C  CE1   . HIS A 1 35  ? -40.852 -27.570 -10.361 1.00 34.15 ? 28  HIS A CE1   1 
ATOM   215  N  NE2   . HIS A 1 35  ? -39.686 -27.315 -10.938 1.00 33.65 ? 28  HIS A NE2   1 
ATOM   216  N  N     . LEU A 1 36  ? -41.120 -20.640 -10.239 1.00 16.67 ? 29  LEU A N     1 
ATOM   217  C  CA    . LEU A 1 36  ? -41.511 -19.343 -10.756 1.00 16.03 ? 29  LEU A CA    1 
ATOM   218  C  C     . LEU A 1 36  ? -40.425 -18.255 -10.784 1.00 16.09 ? 29  LEU A C     1 
ATOM   219  O  O     . LEU A 1 36  ? -40.664 -17.170 -11.359 1.00 15.44 ? 29  LEU A O     1 
ATOM   220  C  CB    . LEU A 1 36  ? -42.666 -18.764 -9.889  1.00 16.95 ? 29  LEU A CB    1 
ATOM   221  C  CG    . LEU A 1 36  ? -43.845 -19.693 -9.700  1.00 16.50 ? 29  LEU A CG    1 
ATOM   222  C  CD1   . LEU A 1 36  ? -44.914 -19.083 -8.811  1.00 16.74 ? 29  LEU A CD1   1 
ATOM   223  C  CD2   . LEU A 1 36  ? -44.445 -20.193 -11.004 1.00 15.75 ? 29  LEU A CD2   1 
ATOM   224  N  N     . ARG A 1 37  ? -39.277 -18.523 -10.135 1.00 13.83 ? 30  ARG A N     1 
ATOM   225  C  CA    . ARG A 1 37  ? -38.224 -17.571 -9.986  1.00 15.52 ? 30  ARG A CA    1 
ATOM   226  C  C     . ARG A 1 37  ? -37.610 -17.232 -11.311 1.00 15.51 ? 30  ARG A C     1 
ATOM   227  O  O     . ARG A 1 37  ? -37.470 -18.099 -12.154 1.00 14.43 ? 30  ARG A O     1 
ATOM   228  C  CB    . ARG A 1 37  ? -37.092 -18.059 -9.025  1.00 15.45 ? 30  ARG A CB    1 
ATOM   229  C  CG    . ARG A 1 37  ? -37.630 -18.429 -7.647  1.00 15.79 ? 30  ARG A CG    1 
ATOM   230  C  CD    . ARG A 1 37  ? -36.559 -18.909 -6.692  1.00 15.58 ? 30  ARG A CD    1 
ATOM   231  N  NE    . ARG A 1 37  ? -37.110 -19.265 -5.358  1.00 15.30 ? 30  ARG A NE    1 
ATOM   232  C  CZ    . ARG A 1 37  ? -36.351 -19.691 -4.339  1.00 17.38 ? 30  ARG A CZ    1 
ATOM   233  N  NH1   . ARG A 1 37  ? -35.074 -19.844 -4.555  1.00 18.07 ? 30  ARG A NH1   1 
ATOM   234  N  NH2   . ARG A 1 37  ? -36.850 -20.050 -3.115  1.00 16.85 ? 30  ARG A NH2   1 
ATOM   235  N  N     . ASN A 1 38  ? -37.272 -15.953 -11.467 1.00 15.64 ? 31  ASN A N     1 
ATOM   236  C  CA    . ASN A 1 38  ? -36.579 -15.447 -12.659 1.00 18.27 ? 31  ASN A CA    1 
ATOM   237  C  C     . ASN A 1 38  ? -37.329 -15.704 -13.949 1.00 18.11 ? 31  ASN A C     1 
ATOM   238  O  O     . ASN A 1 38  ? -36.735 -15.997 -14.994 1.00 19.53 ? 31  ASN A O     1 
ATOM   239  C  CB    . ASN A 1 38  ? -35.154 -16.025 -12.715 1.00 21.11 ? 31  ASN A CB    1 
ATOM   240  C  CG    . ASN A 1 38  ? -34.365 -15.708 -11.438 1.00 22.91 ? 31  ASN A CG    1 
ATOM   241  O  OD1   . ASN A 1 38  ? -34.226 -14.566 -11.045 1.00 25.26 ? 31  ASN A OD1   1 
ATOM   242  N  ND2   . ASN A 1 38  ? -33.901 -16.726 -10.774 1.00 24.36 ? 31  ASN A ND2   1 
ATOM   243  N  N     . LYS A 1 39  ? -38.649 -15.622 -13.856 1.00 16.75 ? 32  LYS A N     1 
ATOM   244  C  CA    . LYS A 1 39  ? -39.549 -15.822 -14.969 1.00 16.97 ? 32  LYS A CA    1 
ATOM   245  C  C     . LYS A 1 39  ? -40.651 -14.781 -15.010 1.00 16.00 ? 32  LYS A C     1 
ATOM   246  O  O     . LYS A 1 39  ? -41.059 -14.253 -13.965 1.00 15.60 ? 32  LYS A O     1 
ATOM   247  C  CB    . LYS A 1 39  ? -40.235 -17.181 -14.801 1.00 21.86 ? 32  LYS A CB    1 
ATOM   248  C  CG    . LYS A 1 39  ? -39.355 -18.418 -15.071 1.00 25.89 ? 32  LYS A CG    1 
ATOM   249  C  CD    . LYS A 1 39  ? -39.669 -18.997 -16.450 1.00 30.17 ? 32  LYS A CD    1 
ATOM   250  C  CE    . LYS A 1 39  ? -38.575 -19.942 -16.997 1.00 34.34 ? 32  LYS A CE    1 
ATOM   251  N  NZ    . LYS A 1 39  ? -38.060 -20.911 -15.993 1.00 34.42 ? 32  LYS A NZ    1 
ATOM   252  N  N     . PRO A 1 40  ? -41.216 -14.534 -16.210 1.00 15.18 ? 33  PRO A N     1 
ATOM   253  C  CA    . PRO A 1 40  ? -42.448 -13.788 -16.316 1.00 13.95 ? 33  PRO A CA    1 
ATOM   254  C  C     . PRO A 1 40  ? -43.613 -14.512 -15.547 1.00 12.56 ? 33  PRO A C     1 
ATOM   255  O  O     . PRO A 1 40  ? -44.086 -15.596 -15.968 1.00 11.13 ? 33  PRO A O     1 
ATOM   256  C  CB    . PRO A 1 40  ? -42.683 -13.693 -17.835 1.00 14.76 ? 33  PRO A CB    1 
ATOM   257  C  CG    . PRO A 1 40  ? -41.973 -14.891 -18.412 1.00 15.56 ? 33  PRO A CG    1 
ATOM   258  C  CD    . PRO A 1 40  ? -40.849 -15.200 -17.489 1.00 15.85 ? 33  PRO A CD    1 
ATOM   259  N  N     . CYS A 1 41  ? -44.101 -13.845 -14.490 1.00 11.46 ? 34  CYS A N     1 
ATOM   260  C  CA    . CYS A 1 41  ? -44.947 -14.435 -13.433 0.60 11.12 ? 34  CYS A CA    1 
ATOM   261  C  C     . CYS A 1 41  ? -45.894 -13.305 -12.986 1.00 9.94  ? 34  CYS A C     1 
ATOM   262  O  O     . CYS A 1 41  ? -45.491 -12.181 -12.966 1.00 11.15 ? 34  CYS A O     1 
ATOM   263  C  CB    . CYS A 1 41  ? -44.097 -14.897 -12.181 0.60 12.03 ? 34  CYS A CB    1 
ATOM   264  S  SG    . CYS A 1 41  ? -45.204 -15.816 -11.055 0.60 17.45 ? 34  CYS A SG    1 
ATOM   265  N  N     . ALA A 1 42  ? -47.154 -13.580 -12.696 1.00 10.14 ? 35  ALA A N     1 
ATOM   266  C  CA    . ALA A 1 42  ? -48.099 -12.686 -12.072 1.00 10.22 ? 35  ALA A CA    1 
ATOM   267  C  C     . ALA A 1 42  ? -48.881 -13.422 -11.029 1.00 10.63 ? 35  ALA A C     1 
ATOM   268  O  O     . ALA A 1 42  ? -49.024 -14.680 -11.054 1.00 11.08 ? 35  ALA A O     1 
ATOM   269  C  CB    . ALA A 1 42  ? -49.042 -12.023 -13.090 1.00 11.25 ? 35  ALA A CB    1 
ATOM   270  N  N     . VAL A 1 43  ? -49.402 -12.626 -10.090 1.00 11.37 ? 36  VAL A N     1 
ATOM   271  C  CA    . VAL A 1 43  ? -50.306 -13.102 -9.114  1.00 11.17 ? 36  VAL A CA    1 
ATOM   272  C  C     . VAL A 1 43  ? -51.725 -12.638 -9.450  1.00 12.02 ? 36  VAL A C     1 
ATOM   273  O  O     . VAL A 1 43  ? -51.975 -11.476 -9.749  1.00 13.54 ? 36  VAL A O     1 
ATOM   274  C  CB    . VAL A 1 43  ? -49.852 -12.647 -7.678  1.00 10.38 ? 36  VAL A CB    1 
ATOM   275  C  CG1   . VAL A 1 43  ? -50.884 -12.990 -6.606  1.00 10.54 ? 36  VAL A CG1   1 
ATOM   276  C  CG2   . VAL A 1 43  ? -48.536 -13.284 -7.312  1.00 10.05 ? 36  VAL A CG2   1 
ATOM   277  N  N     . VAL A 1 44  ? -52.669 -13.574 -9.397  1.00 13.32 ? 37  VAL A N     1 
ATOM   278  C  CA    . VAL A 1 44  ? -54.083 -13.386 -9.822  1.00 13.39 ? 37  VAL A CA    1 
ATOM   279  C  C     . VAL A 1 44  ? -55.008 -13.771 -8.689  1.00 13.80 ? 37  VAL A C     1 
ATOM   280  O  O     . VAL A 1 44  ? -54.644 -14.609 -7.851  1.00 14.45 ? 37  VAL A O     1 
ATOM   281  C  CB    . VAL A 1 44  ? -54.523 -14.310 -11.021 1.00 14.01 ? 37  VAL A CB    1 
ATOM   282  C  CG1   . VAL A 1 44  ? -53.799 -13.882 -12.338 1.00 14.21 ? 37  VAL A CG1   1 
ATOM   283  C  CG2   . VAL A 1 44  ? -54.241 -15.790 -10.738 1.00 14.05 ? 37  VAL A CG2   1 
ATOM   284  N  N     . GLN A 1 45  ? -56.176 -13.135 -8.653  1.00 15.02 ? 38  GLN A N     1 
ATOM   285  C  CA    . GLN A 1 45  ? -57.304 -13.629 -7.844  1.00 16.08 ? 38  GLN A CA    1 
ATOM   286  C  C     . GLN A 1 45  ? -58.558 -13.890 -8.673  1.00 16.49 ? 38  GLN A C     1 
ATOM   287  O  O     . GLN A 1 45  ? -58.874 -13.161 -9.678  1.00 14.92 ? 38  GLN A O     1 
ATOM   288  C  CB    . GLN A 1 45  ? -57.646 -12.654 -6.693  1.00 17.51 ? 38  GLN A CB    1 
ATOM   289  C  CG    . GLN A 1 45  ? -57.912 -11.257 -7.154  1.00 19.04 ? 38  GLN A CG    1 
ATOM   290  C  CD    . GLN A 1 45  ? -57.888 -10.251 -6.039  1.00 20.88 ? 38  GLN A CD    1 
ATOM   291  O  OE1   . GLN A 1 45  ? -57.426 -10.518 -4.908  1.00 20.98 ? 38  GLN A OE1   1 
ATOM   292  N  NE2   . GLN A 1 45  ? -58.350 -9.056  -6.364  1.00 19.28 ? 38  GLN A NE2   1 
ATOM   293  N  N     . TYR A 1 46  ? -59.322 -14.889 -8.207  1.00 15.96 ? 39  TYR A N     1 
ATOM   294  C  CA    . TYR A 1 46  ? -60.599 -15.328 -8.830  1.00 17.04 ? 39  TYR A CA    1 
ATOM   295  C  C     . TYR A 1 46  ? -60.342 -15.939 -10.217 1.00 19.98 ? 39  TYR A C     1 
ATOM   296  O  O     . TYR A 1 46  ? -60.768 -15.457 -11.268 1.00 22.25 ? 39  TYR A O     1 
ATOM   297  C  CB    . TYR A 1 46  ? -61.608 -14.215 -8.877  1.00 17.14 ? 39  TYR A CB    1 
ATOM   298  C  CG    . TYR A 1 46  ? -62.007 -13.702 -7.464  1.00 18.28 ? 39  TYR A CG    1 
ATOM   299  C  CD1   . TYR A 1 46  ? -62.537 -14.562 -6.506  1.00 17.85 ? 39  TYR A CD1   1 
ATOM   300  C  CD2   . TYR A 1 46  ? -61.832 -12.356 -7.096  1.00 16.58 ? 39  TYR A CD2   1 
ATOM   301  C  CE1   . TYR A 1 46  ? -62.828 -14.117 -5.198  1.00 18.51 ? 39  TYR A CE1   1 
ATOM   302  C  CE2   . TYR A 1 46  ? -62.160 -11.930 -5.820  1.00 17.08 ? 39  TYR A CE2   1 
ATOM   303  C  CZ    . TYR A 1 46  ? -62.676 -12.799 -4.873  1.00 17.77 ? 39  TYR A CZ    1 
ATOM   304  O  OH    . TYR A 1 46  ? -63.031 -12.333 -3.585  1.00 19.73 ? 39  TYR A OH    1 
ATOM   305  N  N     . LYS A 1 47  ? -59.601 -17.010 -10.226 1.00 22.46 ? 40  LYS A N     1 
ATOM   306  C  CA    . LYS A 1 47  ? -59.237 -17.675 -11.493 1.00 25.47 ? 40  LYS A CA    1 
ATOM   307  C  C     . LYS A 1 47  ? -60.374 -17.880 -12.522 1.00 27.03 ? 40  LYS A C     1 
ATOM   308  O  O     . LYS A 1 47  ? -60.131 -17.905 -13.760 1.00 25.38 ? 40  LYS A O     1 
ATOM   309  C  CB    . LYS A 1 47  ? -58.510 -19.006 -11.192 1.00 26.88 ? 40  LYS A CB    1 
ATOM   310  C  CG    . LYS A 1 47  ? -57.631 -19.496 -12.378 1.00 29.63 ? 40  LYS A CG    1 
ATOM   311  C  CD    . LYS A 1 47  ? -56.285 -18.854 -12.335 1.00 30.09 ? 40  LYS A CD    1 
ATOM   312  C  CE    . LYS A 1 47  ? -55.389 -19.243 -13.496 1.00 31.71 ? 40  LYS A CE    1 
ATOM   313  N  NZ    . LYS A 1 47  ? -55.943 -18.812 -14.781 1.00 28.54 ? 40  LYS A NZ    1 
ATOM   314  N  N     . SER A 1 48  ? -61.624 -17.985 -12.077 1.00 28.85 ? 41  SER A N     1 
ATOM   315  C  CA    . SER A 1 48  ? -62.665 -18.375 -13.057 1.00 28.34 ? 41  SER A CA    1 
ATOM   316  C  C     . SER A 1 48  ? -63.163 -17.259 -13.972 1.00 29.32 ? 41  SER A C     1 
ATOM   317  O  O     . SER A 1 48  ? -63.791 -17.552 -14.995 1.00 28.27 ? 41  SER A O     1 
ATOM   318  C  CB    . SER A 1 48  ? -63.815 -19.116 -12.399 1.00 29.21 ? 41  SER A CB    1 
ATOM   319  O  OG    . SER A 1 48  ? -64.462 -18.276 -11.461 1.00 33.67 ? 41  SER A OG    1 
ATOM   320  N  N     . TRP A 1 49  ? -62.888 -15.991 -13.673 1.00 29.97 ? 42  TRP A N     1 
ATOM   321  C  CA    . TRP A 1 49  ? -63.356 -14.910 -14.579 1.00 30.27 ? 42  TRP A CA    1 
ATOM   322  C  C     . TRP A 1 49  ? -62.143 -14.356 -15.349 1.00 27.15 ? 42  TRP A C     1 
ATOM   323  O  O     . TRP A 1 49  ? -61.273 -13.649 -14.784 1.00 22.54 ? 42  TRP A O     1 
ATOM   324  C  CB    . TRP A 1 49  ? -64.116 -13.779 -13.849 1.00 33.65 ? 42  TRP A CB    1 
ATOM   325  C  CG    . TRP A 1 49  ? -64.653 -12.671 -14.770 1.00 37.82 ? 42  TRP A CG    1 
ATOM   326  C  CD1   . TRP A 1 49  ? -64.011 -11.515 -15.121 1.00 41.67 ? 42  TRP A CD1   1 
ATOM   327  C  CD2   . TRP A 1 49  ? -65.905 -12.639 -15.451 1.00 41.09 ? 42  TRP A CD2   1 
ATOM   328  N  NE1   . TRP A 1 49  ? -64.777 -10.779 -15.981 1.00 41.97 ? 42  TRP A NE1   1 
ATOM   329  C  CE2   . TRP A 1 49  ? -65.951 -11.439 -16.191 1.00 44.60 ? 42  TRP A CE2   1 
ATOM   330  C  CE3   . TRP A 1 49  ? -67.000 -13.507 -15.507 1.00 47.37 ? 42  TRP A CE3   1 
ATOM   331  C  CZ2   . TRP A 1 49  ? -67.045 -11.077 -16.963 1.00 50.45 ? 42  TRP A CZ2   1 
ATOM   332  C  CZ3   . TRP A 1 49  ? -68.089 -13.145 -16.278 1.00 48.69 ? 42  TRP A CZ3   1 
ATOM   333  C  CH2   . TRP A 1 49  ? -68.105 -11.945 -16.995 1.00 48.93 ? 42  TRP A CH2   1 
ATOM   334  N  N     . LYS A 1 50  ? -62.071 -14.727 -16.630 1.00 24.82 ? 43  LYS A N     1 
ATOM   335  C  CA    . LYS A 1 50  ? -61.044 -14.232 -17.566 1.00 23.91 ? 43  LYS A CA    1 
ATOM   336  C  C     . LYS A 1 50  ? -59.664 -14.546 -17.054 1.00 21.72 ? 43  LYS A C     1 
ATOM   337  O  O     . LYS A 1 50  ? -58.718 -13.761 -17.219 1.00 24.63 ? 43  LYS A O     1 
ATOM   338  C  CB    . LYS A 1 50  ? -61.188 -12.737 -17.788 1.00 25.90 ? 43  LYS A CB    1 
ATOM   339  C  CG    . LYS A 1 50  ? -62.549 -12.344 -18.324 1.00 33.18 ? 43  LYS A CG    1 
ATOM   340  C  CD    . LYS A 1 50  ? -62.504 -10.954 -18.898 1.00 38.50 ? 43  LYS A CD    1 
ATOM   341  C  CE    . LYS A 1 50  ? -63.668 -10.701 -19.814 1.00 43.65 ? 43  LYS A CE    1 
ATOM   342  N  NZ    . LYS A 1 50  ? -63.459 -9.337  -20.360 1.00 48.65 ? 43  LYS A NZ    1 
ATOM   343  N  N     . GLY A 1 51  ? -59.561 -15.718 -16.440 1.00 19.27 ? 44  GLY A N     1 
ATOM   344  C  CA    . GLY A 1 51  ? -58.350 -16.272 -15.952 1.00 18.29 ? 44  GLY A CA    1 
ATOM   345  C  C     . GLY A 1 51  ? -57.916 -15.661 -14.622 1.00 18.04 ? 44  GLY A C     1 
ATOM   346  O  O     . GLY A 1 51  ? -56.814 -15.993 -14.112 1.00 17.37 ? 44  GLY A O     1 
ATOM   347  N  N     . GLY A 1 52  ? -58.682 -14.701 -14.123 1.00 19.12 ? 45  GLY A N     1 
ATOM   348  C  CA    . GLY A 1 52  ? -58.301 -13.984 -12.902 1.00 19.96 ? 45  GLY A CA    1 
ATOM   349  C  C     . GLY A 1 52  ? -57.835 -12.560 -13.126 1.00 21.03 ? 45  GLY A C     1 
ATOM   350  O  O     . GLY A 1 52  ? -57.309 -12.213 -14.185 1.00 19.78 ? 45  GLY A O     1 
ATOM   351  N  N     . GLY A 1 53  ? -58.005 -11.737 -12.088 1.00 20.00 ? 46  GLY A N     1 
ATOM   352  C  CA    . GLY A 1 53  ? -57.464 -10.399 -12.094 1.00 17.99 ? 46  GLY A CA    1 
ATOM   353  C  C     . GLY A 1 53  ? -56.054 -10.349 -11.581 1.00 16.09 ? 46  GLY A C     1 
ATOM   354  O  O     . GLY A 1 53  ? -55.753 -10.836 -10.449 1.00 17.43 ? 46  GLY A O     1 
ATOM   355  N  N     . ILE A 1 54  ? -55.169 -9.787  -12.389 1.00 15.30 ? 47  ILE A N     1 
ATOM   356  C  CA    . ILE A 1 54  ? -53.782 -9.683  -12.003 1.00 15.92 ? 47  ILE A CA    1 
ATOM   357  C  C     . ILE A 1 54  ? -53.605 -8.618  -10.887 1.00 16.27 ? 47  ILE A C     1 
ATOM   358  O  O     . ILE A 1 54  ? -54.022 -7.467  -11.023 1.00 14.45 ? 47  ILE A O     1 
ATOM   359  C  CB    . ILE A 1 54  ? -52.849 -9.382  -13.195 1.00 16.33 ? 47  ILE A CB    1 
ATOM   360  C  CG1   . ILE A 1 54  ? -52.763 -10.578 -14.146 1.00 16.71 ? 47  ILE A CG1   1 
ATOM   361  C  CG2   . ILE A 1 54  ? -51.439 -9.083  -12.696 1.00 15.45 ? 47  ILE A CG2   1 
ATOM   362  C  CD1   . ILE A 1 54  ? -51.812 -10.314 -15.292 1.00 17.16 ? 47  ILE A CD1   1 
ATOM   363  N  N     . ILE A 1 55  ? -52.996 -8.999  -9.754  1.00 16.12 ? 48  ILE A N     1 
ATOM   364  C  CA    . ILE A 1 55  ? -52.649 -7.949  -8.758  1.00 15.46 ? 48  ILE A CA    1 
ATOM   365  C  C     . ILE A 1 55  ? -51.166 -7.647  -8.563  1.00 14.42 ? 48  ILE A C     1 
ATOM   366  O  O     . ILE A 1 55  ? -50.789 -6.601  -8.014  1.00 15.34 ? 48  ILE A O     1 
ATOM   367  C  CB    . ILE A 1 55  ? -53.354 -8.173  -7.425  1.00 15.67 ? 48  ILE A CB    1 
ATOM   368  C  CG1   . ILE A 1 55  ? -52.992 -9.539  -6.871  1.00 15.92 ? 48  ILE A CG1   1 
ATOM   369  C  CG2   . ILE A 1 55  ? -54.855 -7.991  -7.623  1.00 15.92 ? 48  ILE A CG2   1 
ATOM   370  C  CD1   . ILE A 1 55  ? -53.483 -9.730  -5.466  1.00 17.20 ? 48  ILE A CD1   1 
ATOM   371  N  N     . ALA A 1 56  ? -50.294 -8.485  -9.066  1.00 14.87 ? 49  ALA A N     1 
ATOM   372  C  CA    . ALA A 1 56  ? -48.838 -8.159  -9.027  1.00 12.27 ? 49  ALA A CA    1 
ATOM   373  C  C     . ALA A 1 56  ? -48.125 -8.815  -10.204 1.00 11.71 ? 49  ALA A C     1 
ATOM   374  O  O     . ALA A 1 56  ? -48.505 -9.904  -10.602 1.00 10.52 ? 49  ALA A O     1 
ATOM   375  C  CB    . ALA A 1 56  ? -48.248 -8.630  -7.723  1.00 12.58 ? 49  ALA A CB    1 
ATOM   376  N  N     . VAL A 1 57  ? -47.069 -8.180  -10.715 1.00 11.98 ? 50  VAL A N     1 
ATOM   377  C  CA    . VAL A 1 57  ? -46.430 -8.620  -11.956 1.00 12.18 ? 50  VAL A CA    1 
ATOM   378  C  C     . VAL A 1 57  ? -44.911 -8.582  -11.791 1.00 12.11 ? 50  VAL A C     1 
ATOM   379  O  O     . VAL A 1 57  ? -44.373 -7.602  -11.356 1.00 13.48 ? 50  VAL A O     1 
ATOM   380  C  CB    . VAL A 1 57  ? -46.837 -7.713  -13.130 1.00 12.66 ? 50  VAL A CB    1 
ATOM   381  C  CG1   . VAL A 1 57  ? -46.425 -8.296  -14.482 1.00 12.31 ? 50  VAL A CG1   1 
ATOM   382  C  CG2   . VAL A 1 57  ? -48.313 -7.464  -13.107 1.00 13.33 ? 50  VAL A CG2   1 
ATOM   383  N  N     . SER A 1 58  ? -44.223 -9.665  -12.141 1.00 13.04 ? 51  SER A N     1 
ATOM   384  C  CA    . SER A 1 58  ? -42.752 -9.728  -12.123 1.00 13.11 ? 51  SER A CA    1 
ATOM   385  C  C     . SER A 1 58  ? -42.181 -8.722  -13.184 1.00 13.03 ? 51  SER A C     1 
ATOM   386  O  O     . SER A 1 58  ? -42.819 -8.424  -14.172 1.00 12.88 ? 51  SER A O     1 
ATOM   387  C  CB    . SER A 1 58  ? -42.230 -11.150 -12.361 1.00 12.86 ? 51  SER A CB    1 
ATOM   388  O  OG    . SER A 1 58  ? -42.126 -11.539 -13.742 1.00 14.27 ? 51  SER A OG    1 
ATOM   389  N  N     . TYR A 1 59  ? -40.981 -8.278  -12.945 1.00 12.55 ? 52  TYR A N     1 
ATOM   390  C  CA    . TYR A 1 59  ? -40.248 -7.397  -13.892 1.00 14.51 ? 52  TYR A CA    1 
ATOM   391  C  C     . TYR A 1 59  ? -40.041 -8.105  -15.249 1.00 14.86 ? 52  TYR A C     1 
ATOM   392  O  O     . TYR A 1 59  ? -40.176 -7.469  -16.321 1.00 15.24 ? 52  TYR A O     1 
ATOM   393  C  CB    . TYR A 1 59  ? -38.928 -6.902  -13.245 1.00 14.36 ? 52  TYR A CB    1 
ATOM   394  C  CG    . TYR A 1 59  ? -39.261 -5.778  -12.270 1.00 15.99 ? 52  TYR A CG    1 
ATOM   395  C  CD1   . TYR A 1 59  ? -39.636 -6.067  -10.969 1.00 14.30 ? 52  TYR A CD1   1 
ATOM   396  C  CD2   . TYR A 1 59  ? -39.348 -4.440  -12.712 1.00 15.58 ? 52  TYR A CD2   1 
ATOM   397  C  CE1   . TYR A 1 59  ? -39.992 -5.080  -10.090 1.00 15.28 ? 52  TYR A CE1   1 
ATOM   398  C  CE2   . TYR A 1 59  ? -39.718 -3.418  -11.844 1.00 15.09 ? 52  TYR A CE2   1 
ATOM   399  C  CZ    . TYR A 1 59  ? -40.002 -3.734  -10.496 1.00 15.48 ? 52  TYR A CZ    1 
ATOM   400  O  OH    . TYR A 1 59  ? -40.431 -2.742  -9.571  1.00 15.29 ? 52  TYR A OH    1 
ATOM   401  N  N     . GLU A 1 60  ? -39.902 -9.429  -15.226 1.00 15.09 ? 53  GLU A N     1 
ATOM   402  C  CA    . GLU A 1 60  ? -39.766 -10.155 -16.463 1.00 17.62 ? 53  GLU A CA    1 
ATOM   403  C  C     . GLU A 1 60  ? -41.069 -10.061 -17.242 1.00 17.94 ? 53  GLU A C     1 
ATOM   404  O  O     . GLU A 1 60  ? -41.007 -9.961  -18.434 1.00 16.01 ? 53  GLU A O     1 
ATOM   405  C  CB    . GLU A 1 60  ? -39.371 -11.648 -16.264 1.00 19.67 ? 53  GLU A CB    1 
ATOM   406  C  CG    . GLU A 1 60  ? -37.992 -11.882 -15.651 1.00 20.14 ? 53  GLU A CG    1 
ATOM   407  C  CD    . GLU A 1 60  ? -37.965 -11.770 -14.124 1.00 22.16 ? 53  GLU A CD    1 
ATOM   408  O  OE1   . GLU A 1 60  ? -38.924 -11.304 -13.467 1.00 18.64 ? 53  GLU A OE1   1 
ATOM   409  O  OE2   . GLU A 1 60  ? -36.962 -12.206 -13.547 1.00 26.59 ? 53  GLU A OE2   1 
ATOM   410  N  N     . ALA A 1 61  ? -42.243 -10.141 -16.577 1.00 16.05 ? 54  ALA A N     1 
ATOM   411  C  CA    . ALA A 1 61  ? -43.521 -9.949  -17.252 1.00 15.43 ? 54  ALA A CA    1 
ATOM   412  C  C     . ALA A 1 61  ? -43.817 -8.506  -17.649 1.00 15.54 ? 54  ALA A C     1 
ATOM   413  O  O     . ALA A 1 61  ? -44.383 -8.309  -18.744 1.00 15.10 ? 54  ALA A O     1 
ATOM   414  C  CB    . ALA A 1 61  ? -44.714 -10.524 -16.461 1.00 15.39 ? 54  ALA A CB    1 
ATOM   415  N  N     . ARG A 1 62  ? -43.381 -7.513  -16.848 1.00 14.28 ? 55  ARG A N     1 
ATOM   416  C  CA    . ARG A 1 62  ? -43.574 -6.113  -17.225 1.00 12.91 ? 55  ARG A CA    1 
ATOM   417  C  C     . ARG A 1 62  ? -42.871 -5.762  -18.559 1.00 14.91 ? 55  ARG A C     1 
ATOM   418  O  O     . ARG A 1 62  ? -43.361 -4.924  -19.331 1.00 12.79 ? 55  ARG A O     1 
ATOM   419  C  CB    . ARG A 1 62  ? -43.112 -5.178  -16.175 1.00 13.31 ? 55  ARG A CB    1 
ATOM   420  C  CG    . ARG A 1 62  ? -43.791 -5.381  -14.829 1.00 12.88 ? 55  ARG A CG    1 
ATOM   421  C  CD    . ARG A 1 62  ? -43.341 -4.424  -13.723 1.00 13.10 ? 55  ARG A CD    1 
ATOM   422  N  NE    . ARG A 1 62  ? -43.659 -4.900  -12.357 1.00 12.44 ? 55  ARG A NE    1 
ATOM   423  C  CZ    . ARG A 1 62  ? -43.593 -4.164  -11.236 1.00 14.05 ? 55  ARG A CZ    1 
ATOM   424  N  NH1   . ARG A 1 62  ? -43.231 -2.884  -11.235 1.00 13.14 ? 55  ARG A NH1   1 
ATOM   425  N  NH2   . ARG A 1 62  ? -43.910 -4.713  -10.061 1.00 12.62 ? 55  ARG A NH2   1 
ATOM   426  N  N     . ALA A 1 63  ? -41.770 -6.423  -18.858 1.00 14.13 ? 56  ALA A N     1 
ATOM   427  C  CA    . ALA A 1 63  ? -41.023 -6.109  -20.074 1.00 15.98 ? 56  ALA A CA    1 
ATOM   428  C  C     . ALA A 1 63  ? -41.859 -6.541  -21.341 1.00 17.05 ? 56  ALA A C     1 
ATOM   429  O  O     . ALA A 1 63  ? -41.550 -6.070  -22.399 1.00 16.60 ? 56  ALA A O     1 
ATOM   430  C  CB    . ALA A 1 63  ? -39.646 -6.792  -20.051 1.00 15.40 ? 56  ALA A CB    1 
ATOM   431  N  N     . PHE A 1 64  ? -42.904 -7.391  -21.185 1.00 16.26 ? 57  PHE A N     1 
ATOM   432  C  CA    . PHE A 1 64  ? -43.892 -7.742  -22.250 1.00 16.85 ? 57  PHE A CA    1 
ATOM   433  C  C     . PHE A 1 64  ? -45.140 -6.875  -22.251 1.00 16.40 ? 57  PHE A C     1 
ATOM   434  O  O     . PHE A 1 64  ? -46.074 -7.085  -23.061 1.00 16.03 ? 57  PHE A O     1 
ATOM   435  C  CB    . PHE A 1 64  ? -44.341 -9.235  -22.151 1.00 17.12 ? 57  PHE A CB    1 
ATOM   436  C  CG    . PHE A 1 64  ? -43.274 -10.269 -22.533 1.00 19.53 ? 57  PHE A CG    1 
ATOM   437  C  CD1   . PHE A 1 64  ? -42.321 -10.707 -21.585 1.00 21.26 ? 57  PHE A CD1   1 
ATOM   438  C  CD2   . PHE A 1 64  ? -43.250 -10.848 -23.823 1.00 21.29 ? 57  PHE A CD2   1 
ATOM   439  C  CE1   . PHE A 1 64  ? -41.373 -11.678 -21.904 1.00 22.16 ? 57  PHE A CE1   1 
ATOM   440  C  CE2   . PHE A 1 64  ? -42.281 -11.814 -24.163 1.00 25.29 ? 57  PHE A CE2   1 
ATOM   441  C  CZ    . PHE A 1 64  ? -41.337 -12.244 -23.193 1.00 23.90 ? 57  PHE A CZ    1 
ATOM   442  N  N     . GLY A 1 65  ? -45.180 -5.862  -21.382 1.00 16.20 ? 58  GLY A N     1 
ATOM   443  C  CA    . GLY A 1 65  ? -46.369 -5.007  -21.279 1.00 16.44 ? 58  GLY A CA    1 
ATOM   444  C  C     . GLY A 1 65  ? -47.435 -5.442  -20.277 1.00 15.65 ? 58  GLY A C     1 
ATOM   445  O  O     . GLY A 1 65  ? -48.511 -4.857  -20.221 1.00 16.72 ? 58  GLY A O     1 
ATOM   446  N  N     . VAL A 1 66  ? -47.161 -6.468  -19.467 1.00 15.65 ? 59  VAL A N     1 
ATOM   447  C  CA    . VAL A 1 66  ? -48.220 -7.030  -18.587 1.00 14.49 ? 59  VAL A CA    1 
ATOM   448  C  C     . VAL A 1 66  ? -48.312 -5.994  -17.439 1.00 13.98 ? 59  VAL A C     1 
ATOM   449  O  O     . VAL A 1 66  ? -47.278 -5.602  -16.939 1.00 13.60 ? 59  VAL A O     1 
ATOM   450  C  CB    . VAL A 1 66  ? -47.878 -8.460  -18.032 1.00 12.98 ? 59  VAL A CB    1 
ATOM   451  C  CG1   . VAL A 1 66  ? -48.899 -8.879  -17.035 1.00 13.30 ? 59  VAL A CG1   1 
ATOM   452  C  CG2   . VAL A 1 66  ? -47.858 -9.547  -19.113 1.00 14.20 ? 59  VAL A CG2   1 
ATOM   453  N  N     . THR A 1 67  ? -49.505 -5.613  -17.059 1.00 14.39 ? 60  THR A N     1 
ATOM   454  C  CA    . THR A 1 67  ? -49.739 -4.703  -15.946 1.00 15.63 ? 60  THR A CA    1 
ATOM   455  C  C     . THR A 1 67  ? -50.746 -5.190  -14.928 1.00 16.55 ? 60  THR A C     1 
ATOM   456  O  O     . THR A 1 67  ? -51.546 -6.043  -15.236 1.00 19.53 ? 60  THR A O     1 
ATOM   457  C  CB    . THR A 1 67  ? -50.289 -3.358  -16.424 1.00 15.97 ? 60  THR A CB    1 
ATOM   458  O  OG1   . THR A 1 67  ? -51.615 -3.524  -16.882 1.00 14.71 ? 60  THR A OG1   1 
ATOM   459  C  CG2   . THR A 1 67  ? -49.461 -2.783  -17.510 1.00 16.59 ? 60  THR A CG2   1 
ATOM   460  N  N     . ARG A 1 68  ? -50.726 -4.580  -13.750 1.00 17.95 ? 61  ARG A N     1 
ATOM   461  C  CA    . ARG A 1 68  ? -51.766 -4.763  -12.752 0.50 20.78 ? 61  ARG A CA    1 
ATOM   462  C  C     . ARG A 1 68  ? -53.166 -4.505  -13.278 1.00 25.66 ? 61  ARG A C     1 
ATOM   463  O  O     . ARG A 1 68  ? -53.344 -3.661  -14.073 1.00 20.97 ? 61  ARG A O     1 
ATOM   464  C  CB    . ARG A 1 68  ? -51.558 -3.772  -11.642 0.50 21.91 ? 61  ARG A CB    1 
ATOM   465  C  CG    . ARG A 1 68  ? -51.023 -4.349  -10.373 0.50 24.15 ? 61  ARG A CG    1 
ATOM   466  C  CD    . ARG A 1 68  ? -51.283 -3.449  -9.182  0.50 24.91 ? 61  ARG A CD    1 
ATOM   467  N  NE    . ARG A 1 68  ? -52.639 -2.998  -9.261  0.50 27.35 ? 61  ARG A NE    1 
ATOM   468  C  CZ    . ARG A 1 68  ? -53.678 -3.758  -8.964  0.50 28.60 ? 61  ARG A CZ    1 
ATOM   469  N  NH1   . ARG A 1 68  ? -54.900 -3.297  -9.073  0.50 27.98 ? 61  ARG A NH1   1 
ATOM   470  N  NH2   . ARG A 1 68  ? -53.494 -4.991  -8.546  0.50 30.54 ? 61  ARG A NH2   1 
ATOM   471  N  N     . SER A 1 69  ? -54.147 -5.225  -12.799 1.00 29.02 ? 62  SER A N     1 
ATOM   472  C  CA    . SER A 1 69  ? -55.495 -5.057  -13.268 1.00 33.17 ? 62  SER A CA    1 
ATOM   473  C  C     . SER A 1 69  ? -55.763 -5.468  -14.713 1.00 30.37 ? 62  SER A C     1 
ATOM   474  O  O     . SER A 1 69  ? -56.791 -5.143  -15.200 1.00 29.97 ? 62  SER A O     1 
ATOM   475  C  CB    . SER A 1 69  ? -55.914 -3.596  -13.134 1.00 39.54 ? 62  SER A CB    1 
ATOM   476  O  OG    . SER A 1 69  ? -55.124 -2.756  -13.967 1.00 46.29 ? 62  SER A OG    1 
ATOM   477  N  N     . MET A 1 70  ? -54.836 -6.091  -15.396 1.00 23.71 ? 63  MET A N     1 
ATOM   478  C  CA    . MET A 1 70  ? -55.173 -6.798  -16.598 1.00 21.24 ? 63  MET A CA    1 
ATOM   479  C  C     . MET A 1 70  ? -55.848 -8.090  -16.150 1.00 18.89 ? 63  MET A C     1 
ATOM   480  O  O     . MET A 1 70  ? -55.509 -8.624  -15.142 1.00 16.73 ? 63  MET A O     1 
ATOM   481  C  CB    . MET A 1 70  ? -53.926 -7.163  -17.361 1.00 20.22 ? 63  MET A CB    1 
ATOM   482  C  CG    . MET A 1 70  ? -53.306 -6.094  -18.185 1.00 21.38 ? 63  MET A CG    1 
ATOM   483  S  SD    . MET A 1 70  ? -52.042 -6.724  -19.247 1.00 21.02 ? 63  MET A SD    1 
ATOM   484  C  CE    . MET A 1 70  ? -52.102 -5.593  -20.566 1.00 24.10 ? 63  MET A CE    1 
ATOM   485  N  N     . TRP A 1 71  ? -56.781 -8.590  -16.918 1.00 16.87 ? 64  TRP A N     1 
ATOM   486  C  CA    . TRP A 1 71  ? -57.218 -9.960  -16.773 1.00 17.66 ? 64  TRP A CA    1 
ATOM   487  C  C     . TRP A 1 71  ? -56.086 -10.914 -17.256 1.00 16.25 ? 64  TRP A C     1 
ATOM   488  O  O     . TRP A 1 71  ? -55.441 -10.637 -18.202 1.00 15.47 ? 64  TRP A O     1 
ATOM   489  C  CB    . TRP A 1 71  ? -58.477 -10.239 -17.577 1.00 18.85 ? 64  TRP A CB    1 
ATOM   490  C  CG    . TRP A 1 71  ? -59.627 -9.451  -17.223 1.00 19.93 ? 64  TRP A CG    1 
ATOM   491  C  CD1   . TRP A 1 71  ? -60.252 -8.582  -17.979 1.00 22.24 ? 64  TRP A CD1   1 
ATOM   492  C  CD2   . TRP A 1 71  ? -60.305 -9.470  -15.973 1.00 20.30 ? 64  TRP A CD2   1 
ATOM   493  N  NE1   . TRP A 1 71  ? -61.302 -8.036  -17.317 1.00 22.68 ? 64  TRP A NE1   1 
ATOM   494  C  CE2   . TRP A 1 71  ? -61.362 -8.579  -16.072 1.00 21.21 ? 64  TRP A CE2   1 
ATOM   495  C  CE3   . TRP A 1 71  ? -60.125 -10.175 -14.776 1.00 18.22 ? 64  TRP A CE3   1 
ATOM   496  C  CZ2   . TRP A 1 71  ? -62.232 -8.353  -15.021 1.00 22.08 ? 64  TRP A CZ2   1 
ATOM   497  C  CZ3   . TRP A 1 71  ? -60.979 -9.954  -13.755 1.00 18.08 ? 64  TRP A CZ3   1 
ATOM   498  C  CH2   . TRP A 1 71  ? -62.021 -9.065  -13.875 1.00 20.35 ? 64  TRP A CH2   1 
ATOM   499  N  N     . ALA A 1 72  ? -55.843 -12.002 -16.573 1.00 13.90 ? 65  ALA A N     1 
ATOM   500  C  CA    . ALA A 1 72  ? -54.810 -12.963 -16.992 1.00 15.07 ? 65  ALA A CA    1 
ATOM   501  C  C     . ALA A 1 72  ? -54.988 -13.426 -18.426 1.00 15.03 ? 65  ALA A C     1 
ATOM   502  O  O     . ALA A 1 72  ? -54.016 -13.517 -19.166 1.00 16.53 ? 65  ALA A O     1 
ATOM   503  C  CB    . ALA A 1 72  ? -54.767 -14.164 -16.037 1.00 14.46 ? 65  ALA A CB    1 
ATOM   504  N  N     . ASP A 1 73  ? -56.233 -13.626 -18.859 1.00 16.36 ? 66  ASP A N     1 
ATOM   505  C  CA    . ASP A 1 73  ? -56.483 -14.068 -20.261 1.00 17.30 ? 66  ASP A CA    1 
ATOM   506  C  C     . ASP A 1 73  ? -55.874 -13.078 -21.231 1.00 16.59 ? 66  ASP A C     1 
ATOM   507  O  O     . ASP A 1 73  ? -55.175 -13.455 -22.196 1.00 17.27 ? 66  ASP A O     1 
ATOM   508  C  CB    . ASP A 1 73  ? -57.962 -14.226 -20.541 1.00 18.13 ? 66  ASP A CB    1 
ATOM   509  C  CG    . ASP A 1 73  ? -58.550 -15.502 -19.911 1.00 19.11 ? 66  ASP A CG    1 
ATOM   510  O  OD1   . ASP A 1 73  ? -57.854 -16.407 -19.378 1.00 20.69 ? 66  ASP A OD1   1 
ATOM   511  O  OD2   . ASP A 1 73  ? -59.730 -15.615 -20.019 1.00 20.69 ? 66  ASP A OD2   1 
ATOM   512  N  N     . ASP A 1 74  ? -56.025 -11.826 -20.900 1.00 15.50 ? 67  ASP A N     1 
ATOM   513  C  CA    . ASP A 1 74  ? -55.486 -10.757 -21.714 1.00 16.66 ? 67  ASP A CA    1 
ATOM   514  C  C     . ASP A 1 74  ? -53.973 -10.671 -21.609 1.00 14.89 ? 67  ASP A C     1 
ATOM   515  O  O     . ASP A 1 74  ? -53.290 -10.536 -22.592 1.00 13.94 ? 67  ASP A O     1 
ATOM   516  C  CB    . ASP A 1 74  ? -56.164 -9.446  -21.321 1.00 18.00 ? 67  ASP A CB    1 
ATOM   517  C  CG    . ASP A 1 74  ? -57.648 -9.401  -21.732 1.00 20.77 ? 67  ASP A CG    1 
ATOM   518  O  OD1   . ASP A 1 74  ? -58.101 -10.174 -22.615 1.00 21.36 ? 67  ASP A OD1   1 
ATOM   519  O  OD2   . ASP A 1 74  ? -58.350 -8.577  -21.142 1.00 21.38 ? 67  ASP A OD2   1 
ATOM   520  N  N     . ALA A 1 75  ? -53.450 -10.726 -20.385 1.00 14.05 ? 68  ALA A N     1 
ATOM   521  C  CA    . ALA A 1 75  ? -52.004 -10.678 -20.184 1.00 14.55 ? 68  ALA A CA    1 
ATOM   522  C  C     . ALA A 1 75  ? -51.307 -11.811 -20.984 1.00 14.33 ? 68  ALA A C     1 
ATOM   523  O  O     . ALA A 1 75  ? -50.207 -11.635 -21.493 1.00 14.21 ? 68  ALA A O     1 
ATOM   524  C  CB    . ALA A 1 75  ? -51.684 -10.841 -18.681 1.00 14.50 ? 68  ALA A CB    1 
ATOM   525  N  N     . LYS A 1 76  ? -51.965 -12.966 -21.080 1.00 15.93 ? 69  LYS A N     1 
ATOM   526  C  CA    . LYS A 1 76  ? -51.461 -14.132 -21.836 1.00 16.94 ? 69  LYS A CA    1 
ATOM   527  C  C     . LYS A 1 76  ? -51.313 -13.836 -23.367 1.00 17.51 ? 69  LYS A C     1 
ATOM   528  O  O     . LYS A 1 76  ? -50.504 -14.424 -24.056 1.00 14.55 ? 69  LYS A O     1 
ATOM   529  C  CB    . LYS A 1 76  ? -52.358 -15.375 -21.602 1.00 19.23 ? 69  LYS A CB    1 
ATOM   530  C  CG    . LYS A 1 76  ? -52.052 -16.229 -20.307 1.00 23.08 ? 69  LYS A CG    1 
ATOM   531  C  CD    . LYS A 1 76  ? -50.747 -17.038 -20.527 1.00 24.41 ? 69  LYS A CD    1 
ATOM   532  C  CE    . LYS A 1 76  ? -50.548 -18.263 -19.624 1.00 24.47 ? 69  LYS A CE    1 
ATOM   533  N  NZ    . LYS A 1 76  ? -49.216 -18.949 -19.867 1.00 22.35 ? 69  LYS A NZ    1 
ATOM   534  N  N     . LYS A 1 77  ? -52.114 -12.899 -23.878 1.00 18.04 ? 70  LYS A N     1 
ATOM   535  C  CA    . LYS A 1 77  ? -52.027 -12.459 -25.276 1.00 17.68 ? 70  LYS A CA    1 
ATOM   536  C  C     . LYS A 1 77  ? -50.714 -11.661 -25.493 1.00 18.03 ? 70  LYS A C     1 
ATOM   537  O  O     . LYS A 1 77  ? -50.125 -11.725 -26.556 1.00 18.95 ? 70  LYS A O     1 
ATOM   538  C  CB    . LYS A 1 77  ? -53.278 -11.624 -25.631 1.00 16.19 ? 70  LYS A CB    1 
ATOM   539  C  CG    . LYS A 1 77  ? -54.632 -12.294 -25.342 1.00 15.19 ? 70  LYS A CG    1 
ATOM   540  C  CD    . LYS A 1 77  ? -55.843 -11.386 -25.670 1.00 15.87 ? 70  LYS A CD    1 
ATOM   541  C  CE    . LYS A 1 77  ? -57.122 -12.160 -25.353 1.00 16.09 ? 70  LYS A CE    1 
ATOM   542  N  NZ    . LYS A 1 77  ? -58.286 -11.291 -25.209 1.00 16.82 ? 70  LYS A NZ    1 
ATOM   543  N  N     . LEU A 1 78  ? -50.224 -10.916 -24.484 1.00 16.22 ? 71  LEU A N     1 
ATOM   544  C  CA    . LEU A 1 78  ? -48.927 -10.218 -24.599 1.00 14.76 ? 71  LEU A CA    1 
ATOM   545  C  C     . LEU A 1 78  ? -47.736 -11.101 -24.287 1.00 14.95 ? 71  LEU A C     1 
ATOM   546  O  O     . LEU A 1 78  ? -46.630 -10.941 -24.813 1.00 15.39 ? 71  LEU A O     1 
ATOM   547  C  CB    . LEU A 1 78  ? -48.888 -9.041  -23.632 1.00 14.82 ? 71  LEU A CB    1 
ATOM   548  C  CG    . LEU A 1 78  ? -50.002 -8.013  -23.811 1.00 15.43 ? 71  LEU A CG    1 
ATOM   549  C  CD1   . LEU A 1 78  ? -49.812 -6.930  -22.766 1.00 16.47 ? 71  LEU A CD1   1 
ATOM   550  C  CD2   . LEU A 1 78  ? -49.819 -7.360  -25.164 1.00 16.62 ? 71  LEU A CD2   1 
ATOM   551  N  N     . CYS A 1 79  ? -47.944 -12.018 -23.370 1.00 16.49 ? 72  CYS A N     1 
ATOM   552  C  CA    . CYS A 1 79  ? -46.911 -12.906 -22.846 1.00 16.84 ? 72  CYS A CA    1 
ATOM   553  C  C     . CYS A 1 79  ? -47.456 -14.365 -22.730 1.00 18.11 ? 72  CYS A C     1 
ATOM   554  O  O     . CYS A 1 79  ? -47.970 -14.789 -21.682 1.00 16.65 ? 72  CYS A O     1 
ATOM   555  C  CB    . CYS A 1 79  ? -46.506 -12.345 -21.499 1.00 18.34 ? 72  CYS A CB    1 
ATOM   556  S  SG    . CYS A 1 79  ? -45.195 -13.269 -20.681 1.00 19.91 ? 72  CYS A SG    1 
ATOM   557  N  N     . PRO A 1 80  ? -47.351 -15.160 -23.817 1.00 19.73 ? 73  PRO A N     1 
ATOM   558  C  CA    . PRO A 1 80  ? -48.006 -16.499 -23.768 1.00 18.40 ? 73  PRO A CA    1 
ATOM   559  C  C     . PRO A 1 80  ? -47.381 -17.477 -22.766 1.00 18.16 ? 73  PRO A C     1 
ATOM   560  O  O     . PRO A 1 80  ? -48.044 -18.387 -22.293 1.00 21.11 ? 73  PRO A O     1 
ATOM   561  C  CB    . PRO A 1 80  ? -47.825 -17.021 -25.189 1.00 20.81 ? 73  PRO A CB    1 
ATOM   562  C  CG    . PRO A 1 80  ? -47.427 -15.804 -26.049 1.00 21.62 ? 73  PRO A CG    1 
ATOM   563  C  CD    . PRO A 1 80  ? -46.752 -14.853 -25.130 1.00 20.89 ? 73  PRO A CD    1 
ATOM   564  N  N     . ASP A 1 81  ? -46.109 -17.293 -22.467 1.00 19.56 ? 74  ASP A N     1 
ATOM   565  C  CA    . ASP A 1 81  ? -45.405 -18.062 -21.400 1.00 21.55 ? 74  ASP A CA    1 
ATOM   566  C  C     . ASP A 1 81  ? -45.587 -17.560 -19.954 1.00 19.13 ? 74  ASP A C     1 
ATOM   567  O  O     . ASP A 1 81  ? -44.896 -18.014 -19.048 1.00 18.86 ? 74  ASP A O     1 
ATOM   568  C  CB    . ASP A 1 81  ? -43.919 -18.059 -21.724 1.00 23.42 ? 74  ASP A CB    1 
ATOM   569  C  CG    . ASP A 1 81  ? -43.616 -18.977 -22.906 1.00 28.71 ? 74  ASP A CG    1 
ATOM   570  O  OD1   . ASP A 1 81  ? -44.328 -19.976 -22.975 1.00 30.74 ? 74  ASP A OD1   1 
ATOM   571  O  OD2   . ASP A 1 81  ? -42.730 -18.685 -23.720 1.00 31.04 ? 74  ASP A OD2   1 
ATOM   572  N  N     . LEU A 1 82  ? -46.522 -16.649 -19.734 1.00 16.76 ? 75  LEU A N     1 
ATOM   573  C  CA    . LEU A 1 82  ? -46.623 -16.006 -18.407 1.00 14.53 ? 75  LEU A CA    1 
ATOM   574  C  C     . LEU A 1 82  ? -47.058 -17.096 -17.425 1.00 13.49 ? 75  LEU A C     1 
ATOM   575  O  O     . LEU A 1 82  ? -48.013 -17.879 -17.656 1.00 11.67 ? 75  LEU A O     1 
ATOM   576  C  CB    . LEU A 1 82  ? -47.704 -14.900 -18.467 1.00 14.30 ? 75  LEU A CB    1 
ATOM   577  C  CG    . LEU A 1 82  ? -48.095 -14.205 -17.200 1.00 13.35 ? 75  LEU A CG    1 
ATOM   578  C  CD1   . LEU A 1 82  ? -46.943 -13.331 -16.711 1.00 12.62 ? 75  LEU A CD1   1 
ATOM   579  C  CD2   . LEU A 1 82  ? -49.369 -13.410 -17.426 1.00 14.05 ? 75  LEU A CD2   1 
ATOM   580  N  N     . LEU A 1 83  ? -46.367 -17.169 -16.319 1.00 13.36 ? 76  LEU A N     1 
ATOM   581  C  CA    . LEU A 1 83  ? -46.784 -18.076 -15.280 1.00 13.13 ? 76  LEU A CA    1 
ATOM   582  C  C     . LEU A 1 83  ? -47.605 -17.352 -14.242 1.00 13.80 ? 76  LEU A C     1 
ATOM   583  O  O     . LEU A 1 83  ? -47.393 -16.181 -14.031 1.00 12.62 ? 76  LEU A O     1 
ATOM   584  C  CB    . LEU A 1 83  ? -45.564 -18.676 -14.635 1.00 13.17 ? 76  LEU A CB    1 
ATOM   585  C  CG    . LEU A 1 83  ? -44.654 -19.443 -15.618 1.00 13.92 ? 76  LEU A CG    1 
ATOM   586  C  CD1   . LEU A 1 83  ? -43.375 -19.919 -14.929 1.00 15.01 ? 76  LEU A CD1   1 
ATOM   587  C  CD2   . LEU A 1 83  ? -45.368 -20.609 -16.207 1.00 14.62 ? 76  LEU A CD2   1 
ATOM   588  N  N     . LEU A 1 84  ? -48.526 -18.074 -13.594 1.00 13.78 ? 77  LEU A N     1 
ATOM   589  C  CA    . LEU A 1 84  ? -49.468 -17.503 -12.631 1.00 14.53 ? 77  LEU A CA    1 
ATOM   590  C  C     . LEU A 1 84  ? -49.453 -18.271 -11.289 1.00 14.70 ? 77  LEU A C     1 
ATOM   591  O  O     . LEU A 1 84  ? -49.202 -19.488 -11.250 1.00 14.26 ? 77  LEU A O     1 
ATOM   592  C  CB    . LEU A 1 84  ? -50.873 -17.517 -13.167 1.00 15.08 ? 77  LEU A CB    1 
ATOM   593  C  CG    . LEU A 1 84  ? -51.068 -16.847 -14.486 1.00 16.80 ? 77  LEU A CG    1 
ATOM   594  C  CD1   . LEU A 1 84  ? -52.413 -17.215 -15.092 1.00 17.78 ? 77  LEU A CD1   1 
ATOM   595  C  CD2   . LEU A 1 84  ? -50.875 -15.301 -14.354 1.00 17.21 ? 77  LEU A CD2   1 
ATOM   596  N  N     . ALA A 1 85  ? -49.600 -17.518 -10.200 1.00 14.43 ? 78  ALA A N     1 
ATOM   597  C  CA    . ALA A 1 85  ? -49.853 -18.043 -8.895  1.00 14.11 ? 78  ALA A CA    1 
ATOM   598  C  C     . ALA A 1 85  ? -51.163 -17.400 -8.448  1.00 14.81 ? 78  ALA A C     1 
ATOM   599  O  O     . ALA A 1 85  ? -51.400 -16.249 -8.683  1.00 13.28 ? 78  ALA A O     1 
ATOM   600  C  CB    . ALA A 1 85  ? -48.727 -17.737 -7.926  1.00 14.41 ? 78  ALA A CB    1 
ATOM   601  N  N     . GLN A 1 86  ? -52.031 -18.196 -7.820  1.00 17.01 ? 79  GLN A N     1 
ATOM   602  C  CA    . GLN A 1 86  ? -53.360 -17.752 -7.417  1.00 18.97 ? 79  GLN A CA    1 
ATOM   603  C  C     . GLN A 1 86  ? -53.407 -17.361 -5.950  1.00 17.40 ? 79  GLN A C     1 
ATOM   604  O  O     . GLN A 1 86  ? -52.952 -18.110 -5.097  1.00 13.50 ? 79  GLN A O     1 
ATOM   605  C  CB    . GLN A 1 86  ? -54.399 -18.845 -7.589  1.00 22.77 ? 79  GLN A CB    1 
ATOM   606  C  CG    . GLN A 1 86  ? -54.902 -19.021 -8.968  1.00 28.60 ? 79  GLN A CG    1 
ATOM   607  C  CD    . GLN A 1 86  ? -55.342 -20.467 -9.199  1.00 33.23 ? 79  GLN A CD    1 
ATOM   608  O  OE1   . GLN A 1 86  ? -55.006 -21.034 -10.215 1.00 39.14 ? 79  GLN A OE1   1 
ATOM   609  N  NE2   . GLN A 1 86  ? -56.059 -21.071 -8.223  1.00 33.30 ? 79  GLN A NE2   1 
ATOM   610  N  N     . VAL A 1 87  ? -54.016 -16.212 -5.654  1.00 18.29 ? 80  VAL A N     1 
ATOM   611  C  CA    . VAL A 1 87  ? -54.285 -15.865 -4.264  1.00 18.99 ? 80  VAL A CA    1 
ATOM   612  C  C     . VAL A 1 87  ? -55.169 -16.981 -3.648  1.00 19.31 ? 80  VAL A C     1 
ATOM   613  O  O     . VAL A 1 87  ? -56.123 -17.505 -4.261  1.00 14.30 ? 80  VAL A O     1 
ATOM   614  C  CB    . VAL A 1 87  ? -55.012 -14.516 -4.131  1.00 19.53 ? 80  VAL A CB    1 
ATOM   615  C  CG1   . VAL A 1 87  ? -55.487 -14.306 -2.730  1.00 20.47 ? 80  VAL A CG1   1 
ATOM   616  C  CG2   . VAL A 1 87  ? -54.121 -13.361 -4.530  1.00 20.77 ? 80  VAL A CG2   1 
ATOM   617  N  N     . ARG A 1 88  ? -54.895 -17.263 -2.395  1.00 18.67 ? 81  ARG A N     1 
ATOM   618  C  CA    . ARG A 1 88  ? -55.697 -18.211 -1.671  1.00 21.74 ? 81  ARG A CA    1 
ATOM   619  C  C     . ARG A 1 88  ? -57.163 -17.780 -1.599  1.00 21.17 ? 81  ARG A C     1 
ATOM   620  O  O     . ARG A 1 88  ? -57.477 -16.621 -1.433  1.00 18.68 ? 81  ARG A O     1 
ATOM   621  C  CB    . ARG A 1 88  ? -55.143 -18.358 -0.267  1.00 24.03 ? 81  ARG A CB    1 
ATOM   622  C  CG    . ARG A 1 88  ? -55.934 -19.327 0.586   1.00 29.18 ? 81  ARG A CG    1 
ATOM   623  C  CD    . ARG A 1 88  ? -55.276 -19.341 1.929   1.00 35.62 ? 81  ARG A CD    1 
ATOM   624  N  NE    . ARG A 1 88  ? -55.892 -20.268 2.850   1.00 43.50 ? 81  ARG A NE    1 
ATOM   625  C  CZ    . ARG A 1 88  ? -55.569 -20.335 4.146   1.00 47.21 ? 81  ARG A CZ    1 
ATOM   626  N  NH1   . ARG A 1 88  ? -54.624 -19.518 4.664   1.00 41.85 ? 81  ARG A NH1   1 
ATOM   627  N  NH2   . ARG A 1 88  ? -56.188 -21.224 4.922   1.00 48.31 ? 81  ARG A NH2   1 
ATOM   628  N  N     . GLU A 1 89  ? -58.066 -18.743 -1.697  1.00 23.33 ? 82  GLU A N     1 
ATOM   629  C  CA    . GLU A 1 89  ? -59.503 -18.446 -1.589  1.00 26.74 ? 82  GLU A CA    1 
ATOM   630  C  C     . GLU A 1 89  ? -60.018 -19.188 -0.391  1.00 22.85 ? 82  GLU A C     1 
ATOM   631  O  O     . GLU A 1 89  ? -59.686 -20.327 -0.231  1.00 22.63 ? 82  GLU A O     1 
ATOM   632  C  CB    . GLU A 1 89  ? -60.254 -18.907 -2.822  1.00 30.29 ? 82  GLU A CB    1 
ATOM   633  C  CG    . GLU A 1 89  ? -60.813 -17.792 -3.654  1.00 35.21 ? 82  GLU A CG    1 
ATOM   634  C  CD    . GLU A 1 89  ? -61.899 -18.298 -4.608  1.00 41.22 ? 82  GLU A CD    1 
ATOM   635  O  OE1   . GLU A 1 89  ? -62.982 -18.826 -4.209  1.00 44.71 ? 82  GLU A OE1   1 
ATOM   636  O  OE2   . GLU A 1 89  ? -61.670 -18.146 -5.805  1.00 50.36 ? 82  GLU A OE2   1 
ATOM   637  N  N     . SER A 1 90  ? -60.796 -18.505 0.427   1.00 21.28 ? 83  SER A N     1 
ATOM   638  C  CA    . SER A 1 90  ? -61.406 -19.018 1.655   1.00 23.99 ? 83  SER A CA    1 
ATOM   639  C  C     . SER A 1 90  ? -62.765 -18.386 1.850   1.00 23.30 ? 83  SER A C     1 
ATOM   640  O  O     . SER A 1 90  ? -62.919 -17.149 1.778   1.00 23.76 ? 83  SER A O     1 
ATOM   641  C  CB    . SER A 1 90  ? -60.587 -18.679 2.899   1.00 25.83 ? 83  SER A CB    1 
ATOM   642  O  OG    . SER A 1 90  ? -59.498 -19.544 2.937   1.00 35.53 ? 83  SER A OG    1 
ATOM   643  N  N     . ARG A 1 91  ? -63.741 -19.247 2.095   1.00 23.86 ? 84  ARG A N     1 
ATOM   644  C  CA    . ARG A 1 91  ? -65.115 -18.861 2.219   1.00 23.41 ? 84  ARG A CA    1 
ATOM   645  C  C     . ARG A 1 91  ? -65.618 -18.044 1.067   1.00 23.96 ? 84  ARG A C     1 
ATOM   646  O  O     . ARG A 1 91  ? -66.396 -17.110 1.279   1.00 27.08 ? 84  ARG A O     1 
ATOM   647  C  CB    . ARG A 1 91  ? -65.282 -18.061 3.497   1.00 26.41 ? 84  ARG A CB    1 
ATOM   648  C  CG    . ARG A 1 91  ? -64.825 -18.858 4.704   1.00 29.83 ? 84  ARG A CG    1 
ATOM   649  C  CD    . ARG A 1 91  ? -65.329 -18.249 5.999   1.00 33.61 ? 84  ARG A CD    1 
ATOM   650  N  NE    . ARG A 1 91  ? -64.496 -18.665 7.114   1.00 34.25 ? 84  ARG A NE    1 
ATOM   651  C  CZ    . ARG A 1 91  ? -63.258 -18.213 7.300   1.00 37.75 ? 84  ARG A CZ    1 
ATOM   652  N  NH1   . ARG A 1 91  ? -62.685 -17.377 6.425   1.00 43.19 ? 84  ARG A NH1   1 
ATOM   653  N  NH2   . ARG A 1 91  ? -62.543 -18.652 8.313   1.00 41.47 ? 84  ARG A NH2   1 
ATOM   654  N  N     . GLY A 1 92  ? -65.152 -18.357 -0.131  1.00 23.41 ? 85  GLY A N     1 
ATOM   655  C  CA    . GLY A 1 92  ? -65.532 -17.683 -1.370  1.00 20.42 ? 85  GLY A CA    1 
ATOM   656  C  C     . GLY A 1 92  ? -64.931 -16.318 -1.605  1.00 22.31 ? 85  GLY A C     1 
ATOM   657  O  O     . GLY A 1 92  ? -65.394 -15.518 -2.483  1.00 20.93 ? 85  GLY A O     1 
ATOM   658  N  N     . LYS A 1 93  ? -63.871 -16.024 -0.867  1.00 19.76 ? 86  LYS A N     1 
ATOM   659  C  CA    . LYS A 1 93  ? -63.188 -14.806 -1.112  1.00 18.68 ? 86  LYS A CA    1 
ATOM   660  C  C     . LYS A 1 93  ? -61.685 -14.936 -1.066  1.00 17.84 ? 86  LYS A C     1 
ATOM   661  O  O     . LYS A 1 93  ? -61.120 -15.848 -0.384  1.00 15.40 ? 86  LYS A O     1 
ATOM   662  C  CB    . LYS A 1 93  ? -63.629 -13.739 -0.119  1.00 20.16 ? 86  LYS A CB    1 
ATOM   663  C  CG    . LYS A 1 93  ? -63.206 -13.950 1.310   1.00 22.08 ? 86  LYS A CG    1 
ATOM   664  C  CD    . LYS A 1 93  ? -63.671 -12.771 2.155   1.00 24.56 ? 86  LYS A CD    1 
ATOM   665  C  CE    . LYS A 1 93  ? -62.946 -11.487 1.889   1.00 23.20 ? 86  LYS A CE    1 
ATOM   666  N  NZ    . LYS A 1 93  ? -61.468 -11.504 2.209   1.00 22.61 ? 86  LYS A NZ    1 
ATOM   667  N  N     . ALA A 1 94  ? -61.054 -13.988 -1.766  1.00 16.50 ? 87  ALA A N     1 
ATOM   668  C  CA    . ALA A 1 94  ? -59.622 -13.851 -1.761  1.00 17.79 ? 87  ALA A CA    1 
ATOM   669  C  C     . ALA A 1 94  ? -59.190 -13.611 -0.322  1.00 19.56 ? 87  ALA A C     1 
ATOM   670  O  O     . ALA A 1 94  ? -59.873 -12.901 0.435   1.00 19.16 ? 87  ALA A O     1 
ATOM   671  C  CB    . ALA A 1 94  ? -59.224 -12.716 -2.661  1.00 19.22 ? 87  ALA A CB    1 
ATOM   672  N  N     . ASN A 1 95  ? -58.143 -14.318 0.082   1.00 19.65 ? 88  ASN A N     1 
ATOM   673  C  CA    . ASN A 1 95  ? -57.591 -14.258 1.430   1.00 20.05 ? 88  ASN A CA    1 
ATOM   674  C  C     . ASN A 1 95  ? -56.095 -13.924 1.331   1.00 17.35 ? 88  ASN A C     1 
ATOM   675  O  O     . ASN A 1 95  ? -55.290 -14.660 0.747   1.00 16.53 ? 88  ASN A O     1 
ATOM   676  C  CB    . ASN A 1 95  ? -57.874 -15.595 2.114   1.00 23.39 ? 88  ASN A CB    1 
ATOM   677  C  CG    . ASN A 1 95  ? -56.993 -15.876 3.347   1.00 27.90 ? 88  ASN A CG    1 
ATOM   678  O  OD1   . ASN A 1 95  ? -56.376 -15.018 3.938   1.00 22.51 ? 88  ASN A OD1   1 
ATOM   679  N  ND2   . ASN A 1 95  ? -56.934 -17.149 3.707   1.00 35.08 ? 88  ASN A ND2   1 
ATOM   680  N  N     . LEU A 1 96  ? -55.727 -12.807 1.913   1.00 16.12 ? 89  LEU A N     1 
ATOM   681  C  CA    . LEU A 1 96  ? -54.401 -12.229 1.717   1.00 15.33 ? 89  LEU A CA    1 
ATOM   682  C  C     . LEU A 1 96  ? -53.431 -12.612 2.822   1.00 14.39 ? 89  LEU A C     1 
ATOM   683  O  O     . LEU A 1 96  ? -52.377 -11.988 2.967   1.00 12.20 ? 89  LEU A O     1 
ATOM   684  C  CB    . LEU A 1 96  ? -54.506 -10.713 1.618   1.00 15.12 ? 89  LEU A CB    1 
ATOM   685  C  CG    . LEU A 1 96  ? -55.390 -10.206 0.493   1.00 16.57 ? 89  LEU A CG    1 
ATOM   686  C  CD1   . LEU A 1 96  ? -55.309 -8.686  0.487   1.00 19.61 ? 89  LEU A CD1   1 
ATOM   687  C  CD2   . LEU A 1 96  ? -54.989 -10.729 -0.829  1.00 16.37 ? 89  LEU A CD2   1 
ATOM   688  N  N     . THR A 1 97  ? -53.777 -13.634 3.602   1.00 15.53 ? 90  THR A N     1 
ATOM   689  C  CA    . THR A 1 97  ? -52.989 -13.984 4.815   1.00 14.96 ? 90  THR A CA    1 
ATOM   690  C  C     . THR A 1 97  ? -51.518 -14.233 4.543   1.00 13.80 ? 90  THR A C     1 
ATOM   691  O  O     . THR A 1 97  ? -50.673 -13.767 5.320   1.00 11.90 ? 90  THR A O     1 
ATOM   692  C  CB    . THR A 1 97  ? -53.629 -15.195 5.585   1.00 16.57 ? 90  THR A CB    1 
ATOM   693  O  OG1   . THR A 1 97  ? -54.970 -14.852 5.934   1.00 16.99 ? 90  THR A OG1   1 
ATOM   694  C  CG2   . THR A 1 97  ? -52.881 -15.519 6.900   1.00 17.20 ? 90  THR A CG2   1 
ATOM   695  N  N     . LYS A 1 98  ? -51.174 -14.955 3.481   1.00 12.32 ? 91  LYS A N     1 
ATOM   696  C  CA    . LYS A 1 98  ? -49.792 -15.288 3.222   1.00 13.61 ? 91  LYS A CA    1 
ATOM   697  C  C     . LYS A 1 98  ? -48.967 -13.996 2.992   1.00 13.73 ? 91  LYS A C     1 
ATOM   698  O  O     . LYS A 1 98  ? -47.842 -13.971 3.354   1.00 14.70 ? 91  LYS A O     1 
ATOM   699  C  CB    . LYS A 1 98  ? -49.644 -16.192 1.979   1.00 16.14 ? 91  LYS A CB    1 
ATOM   700  C  CG    . LYS A 1 98  ? -48.289 -16.910 1.782   1.00 16.82 ? 91  LYS A CG    1 
ATOM   701  C  CD    . LYS A 1 98  ? -48.119 -17.483 0.322   1.00 17.51 ? 91  LYS A CD    1 
ATOM   702  C  CE    . LYS A 1 98  ? -49.234 -18.362 -0.168  1.00 18.10 ? 91  LYS A CE    1 
ATOM   703  N  NZ    . LYS A 1 98  ? -48.946 -19.066 -1.437  1.00 16.46 ? 91  LYS A NZ    1 
ATOM   704  N  N     . TYR A 1 99  ? -49.549 -12.940 2.428   1.00 12.47 ? 92  TYR A N     1 
ATOM   705  C  CA    . TYR A 1 99  ? -48.838 -11.698 2.118   1.00 13.12 ? 92  TYR A CA    1 
ATOM   706  C  C     . TYR A 1 99  ? -48.751 -10.805 3.343   1.00 14.07 ? 92  TYR A C     1 
ATOM   707  O  O     . TYR A 1 99  ? -47.726 -10.085 3.519   1.00 13.52 ? 92  TYR A O     1 
ATOM   708  C  CB    . TYR A 1 99  ? -49.453 -10.939 0.909   1.00 14.12 ? 92  TYR A CB    1 
ATOM   709  C  CG    . TYR A 1 99  ? -49.815 -11.881 -0.219  1.00 13.73 ? 92  TYR A CG    1 
ATOM   710  C  CD1   . TYR A 1 99  ? -48.839 -12.552 -0.933  1.00 14.91 ? 92  TYR A CD1   1 
ATOM   711  C  CD2   . TYR A 1 99  ? -51.128 -12.194 -0.485  1.00 14.93 ? 92  TYR A CD2   1 
ATOM   712  C  CE1   . TYR A 1 99  ? -49.156 -13.489 -1.911  1.00 14.38 ? 92  TYR A CE1   1 
ATOM   713  C  CE2   . TYR A 1 99  ? -51.460 -13.142 -1.452  1.00 15.59 ? 92  TYR A CE2   1 
ATOM   714  C  CZ    . TYR A 1 99  ? -50.455 -13.805 -2.135  1.00 15.38 ? 92  TYR A CZ    1 
ATOM   715  O  OH    . TYR A 1 99  ? -50.788 -14.729 -3.065  1.00 16.70 ? 92  TYR A OH    1 
ATOM   716  N  N     . ARG A 1 100 ? -49.768 -10.842 4.216   1.00 14.13 ? 93  ARG A N     1 
ATOM   717  C  CA    . ARG A 1 100 ? -49.641 -10.102 5.494   1.00 15.44 ? 93  ARG A CA    1 
ATOM   718  C  C     . ARG A 1 100 ? -48.524 -10.702 6.395   1.00 14.98 ? 93  ARG A C     1 
ATOM   719  O  O     . ARG A 1 100 ? -47.740 -10.014 7.060   1.00 13.92 ? 93  ARG A O     1 
ATOM   720  C  CB    . ARG A 1 100 ? -50.995 -10.116 6.237   1.00 16.73 ? 93  ARG A CB    1 
ATOM   721  C  CG    . ARG A 1 100 ? -52.139 -9.421  5.480   1.00 17.68 ? 93  ARG A CG    1 
ATOM   722  C  CD    . ARG A 1 100 ? -53.342 -9.133  6.412   1.00 21.67 ? 93  ARG A CD    1 
ATOM   723  N  NE    . ARG A 1 100 ? -54.407 -8.464  5.642   1.00 25.50 ? 93  ARG A NE    1 
ATOM   724  C  CZ    . ARG A 1 100 ? -55.480 -9.070  5.095   1.00 25.72 ? 93  ARG A CZ    1 
ATOM   725  N  NH1   . ARG A 1 100 ? -56.359 -8.341  4.411   1.00 27.09 ? 93  ARG A NH1   1 
ATOM   726  N  NH2   . ARG A 1 100 ? -55.694 -10.380 5.211   1.00 24.17 ? 93  ARG A NH2   1 
ATOM   727  N  N     . GLU A 1 101 ? -48.440 -12.015 6.411   1.00 16.40 ? 94  GLU A N     1 
ATOM   728  C  CA    . GLU A 1 101 ? -47.400 -12.702 7.219   1.00 16.37 ? 94  GLU A CA    1 
ATOM   729  C  C     . GLU A 1 101 ? -46.051 -12.419 6.667   1.00 15.55 ? 94  GLU A C     1 
ATOM   730  O  O     . GLU A 1 101 ? -45.136 -12.128 7.443   1.00 14.14 ? 94  GLU A O     1 
ATOM   731  C  CB    . GLU A 1 101 ? -47.648 -14.181 7.256   1.00 18.39 ? 94  GLU A CB    1 
ATOM   732  C  CG    . GLU A 1 101 ? -48.879 -14.488 8.119   1.00 21.69 ? 94  GLU A CG    1 
ATOM   733  C  CD    . GLU A 1 101 ? -49.204 -15.973 8.200   1.00 28.68 ? 94  GLU A CD    1 
ATOM   734  O  OE1   . GLU A 1 101 ? -48.951 -16.688 7.185   1.00 30.68 ? 94  GLU A OE1   1 
ATOM   735  O  OE2   . GLU A 1 101 ? -49.751 -16.407 9.261   1.00 35.34 ? 94  GLU A OE2   1 
ATOM   736  N  N     . ALA A 1 102 ? -45.921 -12.490 5.335   1.00 13.18 ? 95  ALA A N     1 
ATOM   737  C  CA    . ALA A 1 102 ? -44.653 -12.174 4.725   1.00 13.75 ? 95  ALA A CA    1 
ATOM   738  C  C     . ALA A 1 102 ? -44.249 -10.712 5.037   1.00 13.03 ? 95  ALA A C     1 
ATOM   739  O  O     . ALA A 1 102 ? -43.086 -10.410 5.226   1.00 12.12 ? 95  ALA A O     1 
ATOM   740  C  CB    . ALA A 1 102 ? -44.720 -12.432 3.210   1.00 12.61 ? 95  ALA A CB    1 
ATOM   741  N  N     . SER A 1 103 ? -45.235 -9.816  5.024   1.00 13.51 ? 96  SER A N     1 
ATOM   742  C  CA    . SER A 1 103 ? -45.051 -8.396  5.396   1.00 13.31 ? 96  SER A CA    1 
ATOM   743  C  C     . SER A 1 103 ? -44.467 -8.268  6.800   1.00 14.25 ? 96  SER A C     1 
ATOM   744  O  O     . SER A 1 103 ? -43.516 -7.491  7.059   1.00 10.83 ? 96  SER A O     1 
ATOM   745  C  CB    . SER A 1 103 ? -46.391 -7.712  5.363   1.00 14.63 ? 96  SER A CB    1 
ATOM   746  O  OG    . SER A 1 103 ? -46.324 -6.320  5.579   1.00 14.06 ? 96  SER A OG    1 
ATOM   747  N  N     . VAL A 1 104 ? -45.038 -9.045  7.728   1.00 17.07 ? 97  VAL A N     1 
ATOM   748  C  CA    . VAL A 1 104 ? -44.542 -9.027  9.110   1.00 17.00 ? 97  VAL A CA    1 
ATOM   749  C  C     . VAL A 1 104 ? -43.086 -9.425  9.149   1.00 16.61 ? 97  VAL A C     1 
ATOM   750  O  O     . VAL A 1 104 ? -42.280 -8.820  9.880   1.00 16.08 ? 97  VAL A O     1 
ATOM   751  C  CB    . VAL A 1 104 ? -45.407 -9.905  10.026  1.00 19.11 ? 97  VAL A CB    1 
ATOM   752  C  CG1   . VAL A 1 104 ? -44.705 -10.147 11.362  1.00 20.28 ? 97  VAL A CG1   1 
ATOM   753  C  CG2   . VAL A 1 104 ? -46.761 -9.215  10.239  1.00 21.40 ? 97  VAL A CG2   1 
ATOM   754  N  N     . GLU A 1 105 ? -42.689 -10.399 8.333   1.00 16.44 ? 98  GLU A N     1 
ATOM   755  C  CA    . GLU A 1 105 ? -41.291 -10.753 8.297   1.00 16.26 ? 98  GLU A CA    1 
ATOM   756  C  C     . GLU A 1 105 ? -40.403 -9.537  7.989   1.00 16.16 ? 98  GLU A C     1 
ATOM   757  O  O     . GLU A 1 105 ? -39.358 -9.299  8.602   1.00 15.79 ? 98  GLU A O     1 
ATOM   758  C  CB    . GLU A 1 105 ? -41.011 -11.838 7.279   1.00 16.93 ? 98  GLU A CB    1 
ATOM   759  C  CG    . GLU A 1 105 ? -41.638 -13.213 7.561   1.00 16.69 ? 98  GLU A CG    1 
ATOM   760  C  CD    . GLU A 1 105 ? -41.293 -14.143 6.400   1.00 16.89 ? 98  GLU A CD    1 
ATOM   761  O  OE1   . GLU A 1 105 ? -40.080 -14.352 6.087   1.00 16.44 ? 98  GLU A OE1   1 
ATOM   762  O  OE2   . GLU A 1 105 ? -42.246 -14.515 5.693   1.00 19.07 ? 98  GLU A OE2   1 
ATOM   763  N  N     . VAL A 1 106 ? -40.856 -8.749  7.052   1.00 14.88 ? 99  VAL A N     1 
ATOM   764  C  CA    . VAL A 1 106 ? -40.053 -7.626  6.548   1.00 15.19 ? 99  VAL A CA    1 
ATOM   765  C  C     . VAL A 1 106 ? -40.022 -6.474  7.573   1.00 15.11 ? 99  VAL A C     1 
ATOM   766  O  O     . VAL A 1 106 ? -38.970 -5.889  7.866   1.00 16.60 ? 99  VAL A O     1 
ATOM   767  C  CB    . VAL A 1 106 ? -40.611 -7.154  5.223   1.00 14.81 ? 99  VAL A CB    1 
ATOM   768  C  CG1   . VAL A 1 106 ? -39.986 -5.867  4.886   1.00 18.98 ? 99  VAL A CG1   1 
ATOM   769  C  CG2   . VAL A 1 106 ? -40.306 -8.216  4.162   1.00 16.44 ? 99  VAL A CG2   1 
ATOM   770  N  N     . MET A 1 107 ? -41.171 -6.204  8.140   1.00 13.91 ? 100 MET A N     1 
ATOM   771  C  CA    . MET A 1 107 ? -41.327 -5.058  9.058   1.00 15.27 ? 100 MET A CA    1 
ATOM   772  C  C     . MET A 1 107 ? -40.556 -5.285  10.331  1.00 14.74 ? 100 MET A C     1 
ATOM   773  O  O     . MET A 1 107 ? -39.925 -4.353  10.838  1.00 16.27 ? 100 MET A O     1 
ATOM   774  C  CB    . MET A 1 107 ? -42.794 -4.822  9.410   1.00 14.76 ? 100 MET A CB    1 
ATOM   775  C  CG    . MET A 1 107 ? -43.681 -4.566  8.202   1.00 16.73 ? 100 MET A CG    1 
ATOM   776  S  SD    . MET A 1 107 ? -43.375 -2.973  7.408   1.00 18.18 ? 100 MET A SD    1 
ATOM   777  C  CE    . MET A 1 107 ? -44.246 -3.130  5.848   1.00 20.12 ? 100 MET A CE    1 
ATOM   778  N  N     . GLU A 1 108 ? -40.542 -6.520  10.804  1.00 14.76 ? 101 GLU A N     1 
ATOM   779  C  CA    . GLU A 1 108 ? -39.785 -6.868  12.004  1.00 16.20 ? 101 GLU A CA    1 
ATOM   780  C  C     . GLU A 1 108 ? -38.290 -6.641  11.829  1.00 16.66 ? 101 GLU A C     1 
ATOM   781  O  O     . GLU A 1 108 ? -37.600 -6.112  12.741  1.00 18.79 ? 101 GLU A O     1 
ATOM   782  C  CB    . GLU A 1 108 ? -40.131 -8.322  12.398  1.00 18.72 ? 101 GLU A CB    1 
ATOM   783  C  CG    . GLU A 1 108 ? -41.565 -8.312  12.946  1.00 20.77 ? 101 GLU A CG    1 
ATOM   784  C  CD    . GLU A 1 108 ? -41.990 -9.544  13.709  1.00 24.89 ? 101 GLU A CD    1 
ATOM   785  O  OE1   . GLU A 1 108 ? -41.362 -10.620 13.577  1.00 27.13 ? 101 GLU A OE1   1 
ATOM   786  O  OE2   . GLU A 1 108 ? -43.041 -9.419  14.389  1.00 28.83 ? 101 GLU A OE2   1 
ATOM   787  N  N     . ILE A 1 109 ? -37.758 -7.003  10.665  1.00 15.16 ? 102 ILE A N     1 
ATOM   788  C  CA    . ILE A 1 109 ? -36.317 -6.691  10.343  1.00 14.55 ? 102 ILE A CA    1 
ATOM   789  C  C     . ILE A 1 109 ? -36.044 -5.214  10.321  1.00 13.44 ? 102 ILE A C     1 
ATOM   790  O  O     . ILE A 1 109 ? -35.169 -4.765  11.042  1.00 16.86 ? 102 ILE A O     1 
ATOM   791  C  CB    . ILE A 1 109 ? -35.844 -7.372  9.014   1.00 16.71 ? 102 ILE A CB    1 
ATOM   792  C  CG1   . ILE A 1 109 ? -35.876 -8.906  9.181   1.00 17.45 ? 102 ILE A CG1   1 
ATOM   793  C  CG2   . ILE A 1 109 ? -34.441 -6.919  8.595   1.00 16.71 ? 102 ILE A CG2   1 
ATOM   794  C  CD1   . ILE A 1 109 ? -36.051 -9.616  7.851   1.00 19.74 ? 102 ILE A CD1   1 
ATOM   795  N  N     . MET A 1 110 ? -36.815 -4.406  9.590   1.00 12.97 ? 103 MET A N     1 
ATOM   796  C  CA    . MET A 1 110 ? -36.579 -2.957  9.557   0.50 10.38 ? 103 MET A CA    1 
ATOM   797  C  C     . MET A 1 110 ? -36.667 -2.332  10.952  1.00 12.19 ? 103 MET A C     1 
ATOM   798  O  O     . MET A 1 110 ? -35.948 -1.345  11.273  1.00 11.82 ? 103 MET A O     1 
ATOM   799  C  CB    . MET A 1 110 ? -37.594 -2.259  8.658   0.50 9.11  ? 103 MET A CB    1 
ATOM   800  C  CG    . MET A 1 110 ? -37.552 -2.764  7.213   0.50 8.40  ? 103 MET A CG    1 
ATOM   801  S  SD    . MET A 1 110 ? -38.481 -1.747  6.087   0.50 7.40  ? 103 MET A SD    1 
ATOM   802  C  CE    . MET A 1 110 ? -39.984 -2.580  5.884   0.50 7.97  ? 103 MET A CE    1 
ATOM   803  N  N     . SER A 1 111 ? -37.583 -2.830  11.790  1.00 13.47 ? 104 SER A N     1 
ATOM   804  C  CA    . SER A 1 111 ? -37.828 -2.211  13.064  0.50 14.59 ? 104 SER A CA    1 
ATOM   805  C  C     . SER A 1 111 ? -36.658 -2.492  13.992  1.00 16.25 ? 104 SER A C     1 
ATOM   806  O  O     . SER A 1 111 ? -36.545 -1.821  15.002  1.00 17.90 ? 104 SER A O     1 
ATOM   807  C  CB    . SER A 1 111 ? -39.162 -2.654  13.653  0.50 14.53 ? 104 SER A CB    1 
ATOM   808  O  OG    . SER A 1 111 ? -39.035 -3.970  14.065  0.50 15.63 ? 104 SER A OG    1 
ATOM   809  N  N     . ARG A 1 112 ? -35.731 -3.382  13.634  1.00 18.25 ? 105 ARG A N     1 
ATOM   810  C  CA    . ARG A 1 112 ? -34.432 -3.504  14.384  1.00 20.86 ? 105 ARG A CA    1 
ATOM   811  C  C     . ARG A 1 112 ? -33.522 -2.269  14.219  1.00 23.03 ? 105 ARG A C     1 
ATOM   812  O  O     . ARG A 1 112 ? -32.780 -1.883  15.120  1.00 24.24 ? 105 ARG A O     1 
ATOM   813  C  CB    . ARG A 1 112 ? -33.622 -4.721  13.892  1.00 22.71 ? 105 ARG A CB    1 
ATOM   814  C  CG    . ARG A 1 112 ? -34.321 -6.066  14.037  1.00 22.96 ? 105 ARG A CG    1 
ATOM   815  C  CD    . ARG A 1 112 ? -33.278 -7.138  14.214  1.00 23.78 ? 105 ARG A CD    1 
ATOM   816  N  NE    . ARG A 1 112 ? -32.291 -7.217  13.124  1.00 21.08 ? 105 ARG A NE    1 
ATOM   817  C  CZ    . ARG A 1 112 ? -32.308 -8.140  12.152  1.00 20.65 ? 105 ARG A CZ    1 
ATOM   818  N  NH1   . ARG A 1 112 ? -31.370 -8.163  11.254  1.00 20.91 ? 105 ARG A NH1   1 
ATOM   819  N  NH2   . ARG A 1 112 ? -33.251 -9.057  12.087  1.00 21.48 ? 105 ARG A NH2   1 
ATOM   820  N  N     . PHE A 1 113 ? -33.616 -1.635  13.067  1.00 22.00 ? 106 PHE A N     1 
ATOM   821  C  CA    . PHE A 1 113 ? -32.798 -0.455  12.765  1.00 23.22 ? 106 PHE A CA    1 
ATOM   822  C  C     . PHE A 1 113 ? -33.305 0.854   13.356  1.00 21.66 ? 106 PHE A C     1 
ATOM   823  O  O     . PHE A 1 113 ? -32.524 1.655   13.790  1.00 20.70 ? 106 PHE A O     1 
ATOM   824  C  CB    . PHE A 1 113 ? -32.604 -0.337  11.259  1.00 20.16 ? 106 PHE A CB    1 
ATOM   825  C  CG    . PHE A 1 113 ? -31.815 -1.478  10.698  1.00 19.22 ? 106 PHE A CG    1 
ATOM   826  C  CD1   . PHE A 1 113 ? -32.430 -2.642  10.316  1.00 18.24 ? 106 PHE A CD1   1 
ATOM   827  C  CD2   . PHE A 1 113 ? -30.443 -1.380  10.549  1.00 19.77 ? 106 PHE A CD2   1 
ATOM   828  C  CE1   . PHE A 1 113 ? -31.700 -3.665  9.775   1.00 18.23 ? 106 PHE A CE1   1 
ATOM   829  C  CE2   . PHE A 1 113 ? -29.706 -2.408  10.042  1.00 17.97 ? 106 PHE A CE2   1 
ATOM   830  C  CZ    . PHE A 1 113 ? -30.329 -3.549  9.637   1.00 19.42 ? 106 PHE A CZ    1 
ATOM   831  N  N     . ALA A 1 114 ? -34.611 1.048   13.430  1.00 23.99 ? 107 ALA A N     1 
ATOM   832  C  CA    . ALA A 1 114 ? -35.147 2.383   13.671  1.00 23.00 ? 107 ALA A CA    1 
ATOM   833  C  C     . ALA A 1 114 ? -36.613 2.319   13.825  1.00 24.47 ? 107 ALA A C     1 
ATOM   834  O  O     . ALA A 1 114 ? -37.210 1.300   13.570  1.00 27.57 ? 107 ALA A O     1 
ATOM   835  C  CB    . ALA A 1 114 ? -34.808 3.281   12.491  1.00 23.85 ? 107 ALA A CB    1 
ATOM   836  N  N     . VAL A 1 115 ? -37.211 3.422   14.222  1.00 28.88 ? 108 VAL A N     1 
ATOM   837  C  CA    . VAL A 1 115 ? -38.667 3.523   14.197  1.00 32.75 ? 108 VAL A CA    1 
ATOM   838  C  C     . VAL A 1 115 ? -39.200 3.568   12.748  1.00 27.74 ? 108 VAL A C     1 
ATOM   839  O  O     . VAL A 1 115 ? -38.648 4.281   11.881  1.00 27.55 ? 108 VAL A O     1 
ATOM   840  C  CB    . VAL A 1 115 ? -39.182 4.674   15.093  1.00 37.86 ? 108 VAL A CB    1 
ATOM   841  C  CG1   . VAL A 1 115 ? -40.367 5.407   14.459  1.00 38.47 ? 108 VAL A CG1   1 
ATOM   842  C  CG2   . VAL A 1 115 ? -39.566 4.075   16.451  1.00 40.64 ? 108 VAL A CG2   1 
ATOM   843  N  N     . ILE A 1 116 ? -40.191 2.709   12.490  1.00 27.01 ? 109 ILE A N     1 
ATOM   844  C  CA    . ILE A 1 116 ? -40.889 2.637   11.182  1.00 23.45 ? 109 ILE A CA    1 
ATOM   845  C  C     . ILE A 1 116 ? -42.338 2.988   11.307  1.00 20.20 ? 109 ILE A C     1 
ATOM   846  O  O     . ILE A 1 116 ? -42.955 2.801   12.366  1.00 17.57 ? 109 ILE A O     1 
ATOM   847  C  CB    . ILE A 1 116 ? -40.773 1.236   10.521  1.00 24.69 ? 109 ILE A CB    1 
ATOM   848  C  CG1   . ILE A 1 116 ? -41.755 0.228   11.105  1.00 25.37 ? 109 ILE A CG1   1 
ATOM   849  C  CG2   . ILE A 1 116 ? -39.324 0.760   10.655  1.00 25.11 ? 109 ILE A CG2   1 
ATOM   850  C  CD1   . ILE A 1 116 ? -41.816 -1.118  10.398  1.00 28.12 ? 109 ILE A CD1   1 
ATOM   851  N  N     . GLU A 1 117 ? -42.850 3.521   10.197  1.00 17.08 ? 110 GLU A N     1 
ATOM   852  C  CA    . GLU A 1 117 ? -44.228 3.765   9.955   1.00 16.24 ? 110 GLU A CA    1 
ATOM   853  C  C     . GLU A 1 117 ? -44.553 2.795   8.835   1.00 17.02 ? 110 GLU A C     1 
ATOM   854  O  O     . GLU A 1 117 ? -44.029 2.948   7.717   1.00 13.17 ? 110 GLU A O     1 
ATOM   855  C  CB    . GLU A 1 117 ? -44.470 5.203   9.441   1.00 17.24 ? 110 GLU A CB    1 
ATOM   856  C  CG    . GLU A 1 117 ? -45.924 5.474   9.063   1.00 16.96 ? 110 GLU A CG    1 
ATOM   857  C  CD    . GLU A 1 117 ? -46.170 6.892   8.551   1.00 17.90 ? 110 GLU A CD    1 
ATOM   858  O  OE1   . GLU A 1 117 ? -47.142 7.029   7.859   1.00 19.26 ? 110 GLU A OE1   1 
ATOM   859  O  OE2   . GLU A 1 117 ? -45.421 7.872   8.831   1.00 16.87 ? 110 GLU A OE2   1 
ATOM   860  N  N     . ARG A 1 118 ? -45.341 1.776   9.171   1.00 18.69 ? 111 ARG A N     1 
ATOM   861  C  CA    . ARG A 1 118 ? -45.879 0.838   8.170   1.00 21.38 ? 111 ARG A CA    1 
ATOM   862  C  C     . ARG A 1 118 ? -46.809 1.608   7.284   1.00 19.44 ? 111 ARG A C     1 
ATOM   863  O  O     . ARG A 1 118 ? -47.854 2.067   7.736   1.00 20.89 ? 111 ARG A O     1 
ATOM   864  C  CB    . ARG A 1 118 ? -46.600 -0.359  8.810   1.00 22.61 ? 111 ARG A CB    1 
ATOM   865  C  CG    . ARG A 1 118 ? -47.356 -1.288  7.801   1.00 24.40 ? 111 ARG A CG    1 
ATOM   866  C  CD    . ARG A 1 118 ? -48.690 -1.844  8.310   1.00 26.05 ? 111 ARG A CD    1 
ATOM   867  N  NE    . ARG A 1 118 ? -49.174 -3.037  7.558   1.00 26.97 ? 111 ARG A NE    1 
ATOM   868  C  CZ    . ARG A 1 118 ? -50.104 -3.091  6.583   1.00 26.39 ? 111 ARG A CZ    1 
ATOM   869  N  NH1   . ARG A 1 118 ? -50.694 -2.023  6.093   1.00 26.95 ? 111 ARG A NH1   1 
ATOM   870  N  NH2   . ARG A 1 118 ? -50.408 -4.276  6.044   1.00 27.87 ? 111 ARG A NH2   1 
ATOM   871  N  N     . ALA A 1 119 ? -46.442 1.790   6.023   1.00 18.47 ? 112 ALA A N     1 
ATOM   872  C  CA    . ALA A 1 119 ? -47.269 2.586   5.107   1.00 17.08 ? 112 ALA A CA    1 
ATOM   873  C  C     . ALA A 1 119 ? -48.151 1.785   4.204   1.00 16.57 ? 112 ALA A C     1 
ATOM   874  O  O     . ALA A 1 119 ? -49.025 2.341   3.587   1.00 14.97 ? 112 ALA A O     1 
ATOM   875  C  CB    . ALA A 1 119 ? -46.400 3.496   4.223   1.00 19.12 ? 112 ALA A CB    1 
ATOM   876  N  N     . SER A 1 120 ? -47.821 0.519   3.998   1.00 16.14 ? 113 SER A N     1 
ATOM   877  C  CA    . SER A 1 120 ? -48.629 -0.386  3.213   1.00 16.64 ? 113 SER A CA    1 
ATOM   878  C  C     . SER A 1 120 ? -48.205 -1.803  3.583   1.00 14.98 ? 113 SER A C     1 
ATOM   879  O  O     . SER A 1 120 ? -47.329 -1.995  4.408   1.00 13.49 ? 113 SER A O     1 
ATOM   880  C  CB    . SER A 1 120 ? -48.444 -0.135  1.673   1.00 17.66 ? 113 SER A CB    1 
ATOM   881  O  OG    . SER A 1 120 ? -47.299 -0.822  1.088   1.00 16.38 ? 113 SER A OG    1 
ATOM   882  N  N     . ILE A 1 121 ? -48.835 -2.796  2.978   1.00 14.86 ? 114 ILE A N     1 
ATOM   883  C  CA    . ILE A 1 121 ? -48.382 -4.169  3.159   1.00 14.40 ? 114 ILE A CA    1 
ATOM   884  C  C     . ILE A 1 121 ? -46.944 -4.386  2.740   1.00 13.68 ? 114 ILE A C     1 
ATOM   885  O  O     . ILE A 1 121 ? -46.319 -5.344  3.256   1.00 12.22 ? 114 ILE A O     1 
ATOM   886  C  CB    . ILE A 1 121 ? -49.291 -5.126  2.396   1.00 15.57 ? 114 ILE A CB    1 
ATOM   887  C  CG1   . ILE A 1 121 ? -49.148 -6.536  2.944   1.00 15.28 ? 114 ILE A CG1   1 
ATOM   888  C  CG2   . ILE A 1 121 ? -49.129 -5.027  0.876   1.00 15.30 ? 114 ILE A CG2   1 
ATOM   889  C  CD1   . ILE A 1 121 ? -50.389 -7.394  2.599   1.00 16.30 ? 114 ILE A CD1   1 
ATOM   890  N  N     . ASP A 1 122 ? -46.399 -3.542  1.818   1.00 12.99 ? 115 ASP A N     1 
ATOM   891  C  CA    . ASP A 1 122 ? -45.044 -3.797  1.336   1.00 13.65 ? 115 ASP A CA    1 
ATOM   892  C  C     . ASP A 1 122 ? -44.051 -2.645  1.457   1.00 14.33 ? 115 ASP A C     1 
ATOM   893  O  O     . ASP A 1 122 ? -42.994 -2.701  0.802   1.00 14.62 ? 115 ASP A O     1 
ATOM   894  C  CB    . ASP A 1 122 ? -45.055 -4.340  -0.110  1.00 12.71 ? 115 ASP A CB    1 
ATOM   895  C  CG    . ASP A 1 122 ? -44.899 -3.248  -1.147  1.00 13.23 ? 115 ASP A CG    1 
ATOM   896  O  OD1   . ASP A 1 122 ? -45.553 -2.152  -0.921  1.00 13.53 ? 115 ASP A OD1   1 
ATOM   897  O  OD2   . ASP A 1 122 ? -44.176 -3.461  -2.159  1.00 10.96 ? 115 ASP A OD2   1 
ATOM   898  N  N     . GLU A 1 123 ? -44.365 -1.635  2.271   1.00 12.81 ? 116 GLU A N     1 
ATOM   899  C  CA    . GLU A 1 123 ? -43.453 -0.546  2.488   1.00 13.82 ? 116 GLU A CA    1 
ATOM   900  C  C     . GLU A 1 123 ? -43.620 0.152   3.833   1.00 14.35 ? 116 GLU A C     1 
ATOM   901  O  O     . GLU A 1 123 ? -44.716 0.171   4.421   1.00 13.65 ? 116 GLU A O     1 
ATOM   902  C  CB    . GLU A 1 123 ? -43.559 0.501   1.373   1.00 14.37 ? 116 GLU A CB    1 
ATOM   903  C  CG    . GLU A 1 123 ? -44.803 1.358   1.423   1.00 14.63 ? 116 GLU A CG    1 
ATOM   904  C  CD    . GLU A 1 123 ? -45.354 1.690   0.046   1.00 16.58 ? 116 GLU A CD    1 
ATOM   905  O  OE1   . GLU A 1 123 ? -45.130 2.858   -0.457  1.00 17.14 ? 116 GLU A OE1   1 
ATOM   906  O  OE2   . GLU A 1 123 ? -45.960 0.759   -0.569  1.00 15.03 ? 116 GLU A OE2   1 
ATOM   907  N  N     . ALA A 1 124 ? -42.512 0.755   4.235   1.00 14.78 ? 117 ALA A N     1 
ATOM   908  C  CA    . ALA A 1 124 ? -42.350 1.409   5.513   1.00 14.96 ? 117 ALA A CA    1 
ATOM   909  C  C     . ALA A 1 124 ? -41.402 2.590   5.354   1.00 14.85 ? 117 ALA A C     1 
ATOM   910  O  O     . ALA A 1 124 ? -40.425 2.507   4.629   1.00 15.56 ? 117 ALA A O     1 
ATOM   911  C  CB    . ALA A 1 124 ? -41.786 0.421   6.525   1.00 13.11 ? 117 ALA A CB    1 
ATOM   912  N  N     . TYR A 1 125 ? -41.705 3.666   6.053   1.00 14.65 ? 118 TYR A N     1 
ATOM   913  C  CA    . TYR A 1 125 ? -40.815 4.757   6.203   1.00 14.50 ? 118 TYR A CA    1 
ATOM   914  C  C     . TYR A 1 125 ? -40.011 4.539   7.461   1.00 15.58 ? 118 TYR A C     1 
ATOM   915  O  O     . TYR A 1 125 ? -40.499 4.005   8.484   1.00 13.26 ? 118 TYR A O     1 
ATOM   916  C  CB    . TYR A 1 125 ? -41.595 6.066   6.332   1.00 14.77 ? 118 TYR A CB    1 
ATOM   917  C  CG    . TYR A 1 125 ? -42.364 6.436   5.050   1.00 13.93 ? 118 TYR A CG    1 
ATOM   918  C  CD1   . TYR A 1 125 ? -41.710 7.080   3.980   1.00 14.89 ? 118 TYR A CD1   1 
ATOM   919  C  CD2   . TYR A 1 125 ? -43.720 6.128   4.909   1.00 13.53 ? 118 TYR A CD2   1 
ATOM   920  C  CE1   . TYR A 1 125 ? -42.385 7.380   2.821   1.00 15.30 ? 118 TYR A CE1   1 
ATOM   921  C  CE2   . TYR A 1 125 ? -44.415 6.457   3.771   1.00 14.71 ? 118 TYR A CE2   1 
ATOM   922  C  CZ    . TYR A 1 125 ? -43.749 7.048   2.707   1.00 15.19 ? 118 TYR A CZ    1 
ATOM   923  O  OH    . TYR A 1 125 ? -44.446 7.383   1.571   1.00 16.37 ? 118 TYR A OH    1 
ATOM   924  N  N     . VAL A 1 126 ? -38.803 5.068   7.401   1.00 16.37 ? 119 VAL A N     1 
ATOM   925  C  CA    . VAL A 1 126 ? -37.800 4.919   8.455   1.00 17.97 ? 119 VAL A CA    1 
ATOM   926  C  C     . VAL A 1 126 ? -37.302 6.304   8.750   1.00 16.76 ? 119 VAL A C     1 
ATOM   927  O  O     . VAL A 1 126 ? -36.808 6.987   7.849   1.00 14.31 ? 119 VAL A O     1 
ATOM   928  C  CB    . VAL A 1 126 ? -36.628 4.076   7.937   1.00 19.43 ? 119 VAL A CB    1 
ATOM   929  C  CG1   . VAL A 1 126 ? -35.826 3.537   9.095   1.00 21.00 ? 119 VAL A CG1   1 
ATOM   930  C  CG2   . VAL A 1 126 ? -37.150 2.927   7.067   1.00 22.53 ? 119 VAL A CG2   1 
ATOM   931  N  N     . ASP A 1 127 ? -37.419 6.748   10.000  1.00 17.87 ? 120 ASP A N     1 
ATOM   932  C  CA    . ASP A 1 127 ? -36.705 7.912   10.424  1.00 16.79 ? 120 ASP A CA    1 
ATOM   933  C  C     . ASP A 1 127 ? -35.280 7.536   10.907  1.00 16.58 ? 120 ASP A C     1 
ATOM   934  O  O     . ASP A 1 127 ? -35.078 7.045   12.024  1.00 14.75 ? 120 ASP A O     1 
ATOM   935  C  CB    . ASP A 1 127 ? -37.454 8.699   11.496  1.00 19.84 ? 120 ASP A CB    1 
ATOM   936  C  CG    . ASP A 1 127 ? -36.877 10.099  11.660  1.00 23.31 ? 120 ASP A CG    1 
ATOM   937  O  OD1   . ASP A 1 127 ? -35.650 10.170  11.754  1.00 23.23 ? 120 ASP A OD1   1 
ATOM   938  O  OD2   . ASP A 1 127 ? -37.593 11.146  11.602  1.00 27.54 ? 120 ASP A OD2   1 
ATOM   939  N  N     . LEU A 1 128 ? -34.280 7.860   10.100  1.00 14.96 ? 121 LEU A N     1 
ATOM   940  C  CA    . LEU A 1 128 ? -32.897 7.482   10.399  1.00 15.15 ? 121 LEU A CA    1 
ATOM   941  C  C     . LEU A 1 128 ? -32.062 8.585   11.067  1.00 14.08 ? 121 LEU A C     1 
ATOM   942  O  O     . LEU A 1 128 ? -30.830 8.401   11.259  1.00 15.03 ? 121 LEU A O     1 
ATOM   943  C  CB    . LEU A 1 128 ? -32.211 7.022   9.142   1.00 15.18 ? 121 LEU A CB    1 
ATOM   944  C  CG    . LEU A 1 128 ? -32.802 5.716   8.582   1.00 17.05 ? 121 LEU A CG    1 
ATOM   945  C  CD1   . LEU A 1 128 ? -32.340 5.395   7.173   1.00 18.33 ? 121 LEU A CD1   1 
ATOM   946  C  CD2   . LEU A 1 128 ? -32.394 4.588   9.452   1.00 17.47 ? 121 LEU A CD2   1 
ATOM   947  N  N     . THR A 1 129 ? -32.695 9.708   11.369  1.00 13.59 ? 122 THR A N     1 
ATOM   948  C  CA    . THR A 1 129 ? -31.947 10.900  11.826  1.00 15.56 ? 122 THR A CA    1 
ATOM   949  C  C     . THR A 1 129 ? -31.024 10.513  13.001  1.00 16.51 ? 122 THR A C     1 
ATOM   950  O  O     . THR A 1 129 ? -29.868 10.815  12.972  1.00 17.14 ? 122 THR A O     1 
ATOM   951  C  CB    . THR A 1 129 ? -32.920 12.032  12.239  1.00 15.68 ? 122 THR A CB    1 
ATOM   952  O  OG1   . THR A 1 129 ? -33.847 12.306  11.176  1.00 15.01 ? 122 THR A OG1   1 
ATOM   953  C  CG2   . THR A 1 129 ? -32.159 13.314  12.668  1.00 15.28 ? 122 THR A CG2   1 
ATOM   954  N  N     . SER A 1 130 ? -31.535 9.825   14.025  1.00 19.11 ? 123 SER A N     1 
ATOM   955  C  CA    . SER A 1 130 ? -30.656 9.419   15.178  1.00 20.95 ? 123 SER A CA    1 
ATOM   956  C  C     . SER A 1 130 ? -29.637 8.394   14.780  1.00 21.16 ? 123 SER A C     1 
ATOM   957  O  O     . SER A 1 130 ? -28.449 8.483   15.144  1.00 23.58 ? 123 SER A O     1 
ATOM   958  C  CB    . SER A 1 130 ? -31.516 8.778   16.269  1.00 22.92 ? 123 SER A CB    1 
ATOM   959  O  OG    . SER A 1 130 ? -32.369 9.779   16.754  1.00 28.57 ? 123 SER A OG    1 
ATOM   960  N  N     . ALA A 1 131 ? -30.087 7.352   14.066  1.00 19.11 ? 124 ALA A N     1 
ATOM   961  C  CA    . ALA A 1 131 ? -29.161 6.292   13.677  1.00 18.02 ? 124 ALA A CA    1 
ATOM   962  C  C     . ALA A 1 131 ? -27.982 6.912   12.910  1.00 19.11 ? 124 ALA A C     1 
ATOM   963  O  O     . ALA A 1 131 ? -26.820 6.501   13.070  1.00 18.74 ? 124 ALA A O     1 
ATOM   964  C  CB    . ALA A 1 131 ? -29.878 5.216   12.871  1.00 16.96 ? 124 ALA A CB    1 
ATOM   965  N  N     . VAL A 1 132 ? -28.248 7.978   12.136  1.00 17.74 ? 125 VAL A N     1 
ATOM   966  C  CA    . VAL A 1 132 ? -27.175 8.652   11.426  1.00 18.25 ? 125 VAL A CA    1 
ATOM   967  C  C     . VAL A 1 132 ? -26.198 9.411   12.386  1.00 19.90 ? 125 VAL A C     1 
ATOM   968  O  O     . VAL A 1 132 ? -24.976 9.332   12.197  1.00 18.00 ? 125 VAL A O     1 
ATOM   969  C  CB    . VAL A 1 132 ? -27.734 9.640   10.382  1.00 16.89 ? 125 VAL A CB    1 
ATOM   970  C  CG1   . VAL A 1 132 ? -26.632 10.594  9.930   1.00 15.47 ? 125 VAL A CG1   1 
ATOM   971  C  CG2   . VAL A 1 132 ? -28.315 8.831   9.198   1.00 16.76 ? 125 VAL A CG2   1 
ATOM   972  N  N     . GLN A 1 133 ? -26.729 10.134  13.370  1.00 23.19 ? 126 GLN A N     1 
ATOM   973  C  CA    . GLN A 1 133 ? -25.859 10.900  14.283  1.00 29.51 ? 126 GLN A CA    1 
ATOM   974  C  C     . GLN A 1 133 ? -24.933 9.900   14.931  1.00 31.20 ? 126 GLN A C     1 
ATOM   975  O  O     . GLN A 1 133 ? -23.736 10.108  14.959  1.00 31.01 ? 126 GLN A O     1 
ATOM   976  C  CB    . GLN A 1 133 ? -26.584 11.636  15.394  1.00 33.18 ? 126 GLN A CB    1 
ATOM   977  C  CG    . GLN A 1 133 ? -27.897 12.304  15.053  1.00 39.34 ? 126 GLN A CG    1 
ATOM   978  C  CD    . GLN A 1 133 ? -27.728 13.645  14.377  1.00 48.24 ? 126 GLN A CD    1 
ATOM   979  O  OE1   . GLN A 1 133 ? -26.657 13.971  13.845  1.00 56.64 ? 126 GLN A OE1   1 
ATOM   980  N  NE2   . GLN A 1 133 ? -28.796 14.447  14.398  1.00 54.13 ? 126 GLN A NE2   1 
ATOM   981  N  N     . GLU A 1 134 ? -25.507 8.787   15.404  1.00 35.42 ? 127 GLU A N     1 
ATOM   982  C  CA    . GLU A 1 134 ? -24.745 7.738   16.088  1.00 38.79 ? 127 GLU A CA    1 
ATOM   983  C  C     . GLU A 1 134 ? -23.720 7.055   15.173  1.00 37.27 ? 127 GLU A C     1 
ATOM   984  O  O     . GLU A 1 134 ? -22.712 6.564   15.637  1.00 31.14 ? 127 GLU A O     1 
ATOM   985  C  CB    . GLU A 1 134 ? -25.685 6.643   16.648  1.00 44.54 ? 127 GLU A CB    1 
ATOM   986  C  CG    . GLU A 1 134 ? -26.569 7.061   17.818  1.00 49.79 ? 127 GLU A CG    1 
ATOM   987  C  CD    . GLU A 1 134 ? -27.066 5.870   18.627  1.00 55.32 ? 127 GLU A CD    1 
ATOM   988  O  OE1   . GLU A 1 134 ? -28.263 5.843   19.003  1.00 58.26 ? 127 GLU A OE1   1 
ATOM   989  O  OE2   . GLU A 1 134 ? -26.252 4.957   18.894  1.00 57.58 ? 127 GLU A OE2   1 
ATOM   990  N  N     . ARG A 1 135 ? -24.021 6.936   13.885  1.00 33.55 ? 128 ARG A N     1 
ATOM   991  C  CA    . ARG A 1 135 ? -23.111 6.255   12.995  1.00 32.12 ? 128 ARG A CA    1 
ATOM   992  C  C     . ARG A 1 135 ? -21.993 7.254   12.656  1.00 34.28 ? 128 ARG A C     1 
ATOM   993  O  O     . ARG A 1 135 ? -20.834 6.851   12.575  1.00 34.47 ? 128 ARG A O     1 
ATOM   994  C  CB    . ARG A 1 135 ? -23.843 5.677   11.770  1.00 32.31 ? 128 ARG A CB    1 
ATOM   995  C  CG    . ARG A 1 135 ? -22.942 5.117   10.666  1.00 35.97 ? 128 ARG A CG    1 
ATOM   996  C  CD    . ARG A 1 135 ? -22.103 3.913   11.108  1.00 38.38 ? 128 ARG A CD    1 
ATOM   997  N  NE    . ARG A 1 135 ? -23.034 2.832   11.355  1.00 40.04 ? 128 ARG A NE    1 
ATOM   998  C  CZ    . ARG A 1 135 ? -23.542 2.023   10.418  1.00 39.31 ? 128 ARG A CZ    1 
ATOM   999  N  NH1   . ARG A 1 135 ? -23.146 2.068   9.154   1.00 36.05 ? 128 ARG A NH1   1 
ATOM   1000 N  NH2   . ARG A 1 135 ? -24.428 1.111   10.773  1.00 41.00 ? 128 ARG A NH2   1 
ATOM   1001 N  N     . LEU A 1 136 ? -22.329 8.544   12.485  1.00 32.09 ? 129 LEU A N     1 
ATOM   1002 C  CA    . LEU A 1 136 ? -21.333 9.624   12.287  1.00 33.14 ? 129 LEU A CA    1 
ATOM   1003 C  C     . LEU A 1 136 ? -20.351 9.793   13.459  1.00 41.35 ? 129 LEU A C     1 
ATOM   1004 O  O     . LEU A 1 136 ? -19.263 10.283  13.261  1.00 44.93 ? 129 LEU A O     1 
ATOM   1005 C  CB    . LEU A 1 136 ? -22.016 10.997  12.042  1.00 32.46 ? 129 LEU A CB    1 
ATOM   1006 C  CG    . LEU A 1 136 ? -22.492 11.317  10.598  1.00 31.25 ? 129 LEU A CG    1 
ATOM   1007 C  CD1   . LEU A 1 136 ? -23.452 12.507  10.546  1.00 27.41 ? 129 LEU A CD1   1 
ATOM   1008 C  CD2   . LEU A 1 136 ? -21.264 11.526  9.681   1.00 29.58 ? 129 LEU A CD2   1 
ATOM   1009 N  N     . GLN A 1 137 ? -20.753 9.451   14.681  1.00 51.40 ? 130 GLN A N     1 
ATOM   1010 C  CA    . GLN A 1 137 ? -19.839 9.489   15.832  1.00 53.34 ? 130 GLN A CA    1 
ATOM   1011 C  C     . GLN A 1 137 ? -18.963 8.231   15.871  1.00 58.30 ? 130 GLN A C     1 
ATOM   1012 O  O     . GLN A 1 137 ? -17.863 8.276   16.411  1.00 58.33 ? 130 GLN A O     1 
ATOM   1013 C  CB    . GLN A 1 137 ? -20.605 9.626   17.147  1.00 56.06 ? 130 GLN A CB    1 
ATOM   1014 C  CG    . GLN A 1 137 ? -20.964 11.060  17.496  1.00 59.75 ? 130 GLN A CG    1 
ATOM   1015 C  CD    . GLN A 1 137 ? -22.112 11.158  18.486  1.00 65.56 ? 130 GLN A CD    1 
ATOM   1016 O  OE1   . GLN A 1 137 ? -22.481 10.179  19.137  1.00 74.58 ? 130 GLN A OE1   1 
ATOM   1017 N  NE2   . GLN A 1 137 ? -22.691 12.348  18.604  1.00 66.78 ? 130 GLN A NE2   1 
ATOM   1018 N  N     . LYS A 1 138 ? -19.447 7.124   15.301  1.00 58.63 ? 131 LYS A N     1 
ATOM   1019 C  CA    . LYS A 1 138 ? -18.709 5.854   15.314  1.00 60.82 ? 131 LYS A CA    1 
ATOM   1020 C  C     . LYS A 1 138 ? -17.543 5.841   14.347  1.00 63.96 ? 131 LYS A C     1 
ATOM   1021 O  O     . LYS A 1 138 ? -16.474 5.378   14.715  1.00 65.89 ? 131 LYS A O     1 
ATOM   1022 C  CB    . LYS A 1 138 ? -19.593 4.670   14.943  1.00 64.52 ? 131 LYS A CB    1 
ATOM   1023 C  CG    . LYS A 1 138 ? -20.278 3.965   16.095  1.00 68.87 ? 131 LYS A CG    1 
ATOM   1024 C  CD    . LYS A 1 138 ? -20.494 2.486   15.768  1.00 68.30 ? 131 LYS A CD    1 
ATOM   1025 C  CE    . LYS A 1 138 ? -20.932 2.258   14.326  1.00 68.05 ? 131 LYS A CE    1 
ATOM   1026 N  NZ    . LYS A 1 138 ? -21.706 0.999   14.205  1.00 68.42 ? 131 LYS A NZ    1 
ATOM   1027 N  N     . LEU A 1 139 ? -17.762 6.256   13.094  1.00 66.57 ? 132 LEU A N     1 
ATOM   1028 C  CA    . LEU A 1 139 ? -16.647 6.495   12.189  1.00 71.04 ? 132 LEU A CA    1 
ATOM   1029 C  C     . LEU A 1 139 ? -16.286 7.929   12.473  1.00 74.03 ? 132 LEU A C     1 
ATOM   1030 O  O     . LEU A 1 139 ? -17.017 8.839   12.078  1.00 80.40 ? 132 LEU A O     1 
ATOM   1031 C  CB    . LEU A 1 139 ? -16.960 6.323   10.672  1.00 73.83 ? 132 LEU A CB    1 
ATOM   1032 C  CG    . LEU A 1 139 ? -18.159 5.624   10.001  1.00 71.88 ? 132 LEU A CG    1 
ATOM   1033 C  CD1   . LEU A 1 139 ? -19.303 6.606   9.769   1.00 70.64 ? 132 LEU A CD1   1 
ATOM   1034 C  CD2   . LEU A 1 139 ? -17.749 5.000   8.666   1.00 70.12 ? 132 LEU A CD2   1 
ATOM   1035 N  N     . GLN A 1 140 ? -15.192 8.139   13.191  1.00 78.07 ? 133 GLN A N     1 
ATOM   1036 C  CA    . GLN A 1 140 ? -14.732 9.491   13.462  1.00 76.77 ? 133 GLN A CA    1 
ATOM   1037 C  C     . GLN A 1 140 ? -13.939 9.977   12.248  1.00 70.87 ? 133 GLN A C     1 
ATOM   1038 O  O     . GLN A 1 140 ? -12.962 9.345   11.873  1.00 72.99 ? 133 GLN A O     1 
ATOM   1039 C  CB    . GLN A 1 140 ? -13.908 9.544   14.759  1.00 77.88 ? 133 GLN A CB    1 
ATOM   1040 C  CG    . GLN A 1 140 ? -14.736 9.459   16.043  1.00 79.03 ? 133 GLN A CG    1 
ATOM   1041 C  CD    . GLN A 1 140 ? -15.637 10.688  16.298  1.00 83.22 ? 133 GLN A CD    1 
ATOM   1042 O  OE1   . GLN A 1 140 ? -16.537 11.024  15.507  1.00 83.56 ? 133 GLN A OE1   1 
ATOM   1043 N  NE2   . GLN A 1 140 ? -15.411 11.343  17.425  1.00 77.60 ? 133 GLN A NE2   1 
ATOM   1044 N  N     . GLY A 1 141 ? -14.416 11.057  11.613  1.00 65.96 ? 134 GLY A N     1 
ATOM   1045 C  CA    . GLY A 1 141 ? -13.751 11.735  10.464  1.00 64.45 ? 134 GLY A CA    1 
ATOM   1046 C  C     . GLY A 1 141 ? -13.313 10.881  9.272   1.00 60.69 ? 134 GLY A C     1 
ATOM   1047 O  O     . GLY A 1 141 ? -12.642 11.368  8.356   1.00 53.97 ? 134 GLY A O     1 
ATOM   1048 N  N     . GLN A 1 142 ? -13.738 9.620   9.285   1.00 59.88 ? 135 GLN A N     1 
ATOM   1049 C  CA    . GLN A 1 142 ? -13.197 8.552   8.453   1.00 58.03 ? 135 GLN A CA    1 
ATOM   1050 C  C     . GLN A 1 142 ? -14.110 8.386   7.231   1.00 54.85 ? 135 GLN A C     1 
ATOM   1051 O  O     . GLN A 1 142 ? -15.338 8.282   7.389   1.00 52.83 ? 135 GLN A O     1 
ATOM   1052 C  CB    . GLN A 1 142 ? -13.174 7.284   9.310   1.00 62.25 ? 135 GLN A CB    1 
ATOM   1053 C  CG    . GLN A 1 142 ? -12.998 5.954   8.599   1.00 65.67 ? 135 GLN A CG    1 
ATOM   1054 C  CD    . GLN A 1 142 ? -13.500 4.787   9.448   1.00 69.40 ? 135 GLN A CD    1 
ATOM   1055 O  OE1   . GLN A 1 142 ? -13.960 3.760   8.919   1.00 66.32 ? 135 GLN A OE1   1 
ATOM   1056 N  NE2   . GLN A 1 142 ? -13.441 4.952   10.774  1.00 65.28 ? 135 GLN A NE2   1 
ATOM   1057 N  N     . PRO A 1 143 ? -13.528 8.350   6.016   1.00 47.70 ? 136 PRO A N     1 
ATOM   1058 C  CA    . PRO A 1 143 ? -14.329 8.621   4.838   1.00 45.49 ? 136 PRO A CA    1 
ATOM   1059 C  C     . PRO A 1 143 ? -15.206 7.447   4.454   1.00 41.49 ? 136 PRO A C     1 
ATOM   1060 O  O     . PRO A 1 143 ? -15.149 6.364   5.071   1.00 35.33 ? 136 PRO A O     1 
ATOM   1061 C  CB    . PRO A 1 143 ? -13.286 8.894   3.748   1.00 47.22 ? 136 PRO A CB    1 
ATOM   1062 C  CG    . PRO A 1 143 ? -11.960 8.528   4.344   1.00 47.06 ? 136 PRO A CG    1 
ATOM   1063 C  CD    . PRO A 1 143 ? -12.218 7.813   5.630   1.00 49.66 ? 136 PRO A CD    1 
ATOM   1064 N  N     . ILE A 1 144 ? -16.036 7.692   3.450   1.00 36.94 ? 137 ILE A N     1 
ATOM   1065 C  CA    . ILE A 1 144 ? -17.022 6.731   3.028   1.00 29.96 ? 137 ILE A CA    1 
ATOM   1066 C  C     . ILE A 1 144 ? -16.693 6.276   1.664   1.00 26.39 ? 137 ILE A C     1 
ATOM   1067 O  O     . ILE A 1 144 ? -16.817 7.033   0.691   1.00 27.42 ? 137 ILE A O     1 
ATOM   1068 C  CB    . ILE A 1 144 ? -18.435 7.309   3.099   1.00 30.97 ? 137 ILE A CB    1 
ATOM   1069 C  CG1   . ILE A 1 144 ? -18.730 7.646   4.560   1.00 34.19 ? 137 ILE A CG1   1 
ATOM   1070 C  CG2   . ILE A 1 144 ? -19.454 6.284   2.622   1.00 28.70 ? 137 ILE A CG2   1 
ATOM   1071 C  CD1   . ILE A 1 144 ? -19.777 8.691   4.769   1.00 31.28 ? 137 ILE A CD1   1 
ATOM   1072 N  N     . SER A 1 145 ? -16.270 5.017   1.621   1.00 23.22 ? 138 SER A N     1 
ATOM   1073 C  CA    . SER A 1 145 ? -15.943 4.272   0.438   0.65 19.58 ? 138 SER A CA    1 
ATOM   1074 C  C     . SER A 1 145 ? -17.203 3.949   -0.424  1.00 20.12 ? 138 SER A C     1 
ATOM   1075 O  O     . SER A 1 145 ? -18.294 3.684   0.076   1.00 20.01 ? 138 SER A O     1 
ATOM   1076 C  CB    . SER A 1 145 ? -15.231 2.996   0.904   0.65 19.16 ? 138 SER A CB    1 
ATOM   1077 O  OG    . SER A 1 145 ? -15.465 1.905   0.048   0.65 21.24 ? 138 SER A OG    1 
ATOM   1078 N  N     . ALA A 1 146 ? -17.036 3.936   -1.733  1.00 19.59 ? 139 ALA A N     1 
ATOM   1079 C  CA    . ALA A 1 146 ? -18.084 3.522   -2.612  1.00 20.50 ? 139 ALA A CA    1 
ATOM   1080 C  C     . ALA A 1 146 ? -18.587 2.088   -2.327  1.00 23.18 ? 139 ALA A C     1 
ATOM   1081 O  O     . ALA A 1 146 ? -19.755 1.764   -2.665  1.00 16.58 ? 139 ALA A O     1 
ATOM   1082 C  CB    . ALA A 1 146 ? -17.626 3.636   -4.069  1.00 20.78 ? 139 ALA A CB    1 
ATOM   1083 N  N     . ASP A 1 147 ? -17.685 1.249   -1.768  1.00 22.30 ? 140 ASP A N     1 
ATOM   1084 C  CA    . ASP A 1 147 ? -17.958 -0.138  -1.456  1.00 24.31 ? 140 ASP A CA    1 
ATOM   1085 C  C     . ASP A 1 147 ? -19.088 -0.256  -0.405  1.00 22.50 ? 140 ASP A C     1 
ATOM   1086 O  O     . ASP A 1 147 ? -19.777 -1.290  -0.354  1.00 18.90 ? 140 ASP A O     1 
ATOM   1087 C  CB    . ASP A 1 147 ? -16.712 -0.859  -0.873  1.00 29.55 ? 140 ASP A CB    1 
ATOM   1088 C  CG    . ASP A 1 147 ? -15.527 -0.965  -1.871  1.00 35.35 ? 140 ASP A CG    1 
ATOM   1089 O  OD1   . ASP A 1 147 ? -15.788 -1.068  -3.097  1.00 40.30 ? 140 ASP A OD1   1 
ATOM   1090 O  OD2   . ASP A 1 147 ? -14.340 -0.945  -1.400  1.00 34.67 ? 140 ASP A OD2   1 
ATOM   1091 N  N     . LEU A 1 148 ? -19.246 0.766   0.444   1.00 18.55 ? 141 LEU A N     1 
ATOM   1092 C  CA    . LEU A 1 148 ? -20.375 0.789   1.389   1.00 20.30 ? 141 LEU A CA    1 
ATOM   1093 C  C     . LEU A 1 148 ? -21.749 1.139   0.738   1.00 17.92 ? 141 LEU A C     1 
ATOM   1094 O  O     . LEU A 1 148 ? -22.824 1.003   1.376   1.00 18.02 ? 141 LEU A O     1 
ATOM   1095 C  CB    . LEU A 1 148 ? -20.068 1.713   2.546   1.00 21.69 ? 141 LEU A CB    1 
ATOM   1096 C  CG    . LEU A 1 148 ? -18.741 1.412   3.296   1.00 23.51 ? 141 LEU A CG    1 
ATOM   1097 C  CD1   . LEU A 1 148 ? -18.417 2.558   4.248   1.00 23.41 ? 141 LEU A CD1   1 
ATOM   1098 C  CD2   . LEU A 1 148 ? -18.794 0.069   4.032   1.00 25.21 ? 141 LEU A CD2   1 
ATOM   1099 N  N     . LEU A 1 149 ? -21.727 1.466   -0.560  1.00 17.57 ? 142 LEU A N     1 
ATOM   1100 C  CA    . LEU A 1 149 ? -22.964 1.915   -1.273  1.00 15.71 ? 142 LEU A CA    1 
ATOM   1101 C  C     . LEU A 1 149 ? -23.110 1.182   -2.609  1.00 16.18 ? 142 LEU A C     1 
ATOM   1102 O  O     . LEU A 1 149 ? -23.243 1.809   -3.694  1.00 14.84 ? 142 LEU A O     1 
ATOM   1103 C  CB    . LEU A 1 149 ? -22.897 3.436   -1.458  1.00 15.97 ? 142 LEU A CB    1 
ATOM   1104 C  CG    . LEU A 1 149 ? -22.890 4.242   -0.138  1.00 15.74 ? 142 LEU A CG    1 
ATOM   1105 C  CD1   . LEU A 1 149 ? -22.411 5.705   -0.340  1.00 15.79 ? 142 LEU A CD1   1 
ATOM   1106 C  CD2   . LEU A 1 149 ? -24.235 4.239   0.571   1.00 14.85 ? 142 LEU A CD2   1 
ATOM   1107 N  N     . PRO A 1 150 ? -23.068 -0.175  -2.541  1.00 15.89 ? 143 PRO A N     1 
ATOM   1108 C  CA    . PRO A 1 150 ? -22.929 -0.981  -3.761  1.00 14.57 ? 143 PRO A CA    1 
ATOM   1109 C  C     . PRO A 1 150 ? -24.159 -0.959  -4.615  1.00 16.02 ? 143 PRO A C     1 
ATOM   1110 O  O     . PRO A 1 150 ? -24.067 -1.356  -5.784  1.00 14.58 ? 143 PRO A O     1 
ATOM   1111 C  CB    . PRO A 1 150 ? -22.659 -2.386  -3.205  1.00 14.97 ? 143 PRO A CB    1 
ATOM   1112 C  CG    . PRO A 1 150 ? -23.465 -2.423  -1.929  1.00 14.69 ? 143 PRO A CG    1 
ATOM   1113 C  CD    . PRO A 1 150 ? -23.212 -1.034  -1.342  1.00 15.16 ? 143 PRO A CD    1 
ATOM   1114 N  N     . SER A 1 151 ? -25.308 -0.433  -4.099  1.00 14.14 ? 144 SER A N     1 
ATOM   1115 C  CA    . SER A 1 151 ? -26.509 -0.392  -4.904  1.00 12.61 ? 144 SER A CA    1 
ATOM   1116 C  C     . SER A 1 151 ? -27.217 0.964   -4.961  1.00 12.53 ? 144 SER A C     1 
ATOM   1117 O  O     . SER A 1 151 ? -28.399 1.063   -5.367  1.00 11.71 ? 144 SER A O     1 
ATOM   1118 C  CB    . SER A 1 151 ? -27.480 -1.515  -4.456  1.00 12.74 ? 144 SER A CB    1 
ATOM   1119 O  OG    . SER A 1 151 ? -28.014 -1.289  -3.156  1.00 11.44 ? 144 SER A OG    1 
ATOM   1120 N  N     . THR A 1 152 ? -26.489 2.009   -4.586  1.00 13.26 ? 145 THR A N     1 
ATOM   1121 C  CA    . THR A 1 152 ? -27.046 3.322   -4.445  1.00 13.37 ? 145 THR A CA    1 
ATOM   1122 C  C     . THR A 1 152 ? -26.827 4.127   -5.725  1.00 14.35 ? 145 THR A C     1 
ATOM   1123 O  O     . THR A 1 152 ? -25.721 4.141   -6.272  1.00 16.33 ? 145 THR A O     1 
ATOM   1124 C  CB    . THR A 1 152 ? -26.347 4.027   -3.242  1.00 12.47 ? 145 THR A CB    1 
ATOM   1125 O  OG1   . THR A 1 152 ? -26.711 3.343   -2.044  1.00 11.46 ? 145 THR A OG1   1 
ATOM   1126 C  CG2   . THR A 1 152 ? -26.705 5.487   -3.176  1.00 12.01 ? 145 THR A CG2   1 
ATOM   1127 N  N     . TYR A 1 153 ? -27.889 4.800   -6.168  1.00 14.89 ? 146 TYR A N     1 
ATOM   1128 C  CA    . TYR A 1 153 ? -27.852 5.854   -7.236  1.00 15.85 ? 146 TYR A CA    1 
ATOM   1129 C  C     . TYR A 1 153 ? -27.971 7.218   -6.603  1.00 13.33 ? 146 TYR A C     1 
ATOM   1130 O  O     . TYR A 1 153 ? -28.778 7.381   -5.665  1.00 12.60 ? 146 TYR A O     1 
ATOM   1131 C  CB    . TYR A 1 153 ? -29.086 5.752   -8.118  1.00 14.90 ? 146 TYR A CB    1 
ATOM   1132 C  CG    . TYR A 1 153 ? -28.875 4.674   -9.136  1.00 16.86 ? 146 TYR A CG    1 
ATOM   1133 C  CD1   . TYR A 1 153 ? -29.012 3.302   -8.798  1.00 16.99 ? 146 TYR A CD1   1 
ATOM   1134 C  CD2   . TYR A 1 153 ? -28.514 5.042   -10.429 1.00 16.33 ? 146 TYR A CD2   1 
ATOM   1135 C  CE1   . TYR A 1 153 ? -28.784 2.298   -9.783  1.00 18.47 ? 146 TYR A CE1   1 
ATOM   1136 C  CE2   . TYR A 1 153 ? -28.323 4.089   -11.419 1.00 18.68 ? 146 TYR A CE2   1 
ATOM   1137 C  CZ    . TYR A 1 153 ? -28.441 2.734   -11.130 1.00 19.71 ? 146 TYR A CZ    1 
ATOM   1138 O  OH    . TYR A 1 153 ? -28.208 1.885   -12.232 1.00 21.94 ? 146 TYR A OH    1 
ATOM   1139 N  N     . ILE A 1 154 ? -27.175 8.151   -7.054  1.00 12.47 ? 147 ILE A N     1 
ATOM   1140 C  CA    . ILE A 1 154 ? -27.299 9.560   -6.582  1.00 12.60 ? 147 ILE A CA    1 
ATOM   1141 C  C     . ILE A 1 154 ? -28.063 10.284  -7.683  1.00 13.16 ? 147 ILE A C     1 
ATOM   1142 O  O     . ILE A 1 154 ? -27.552 10.447  -8.835  1.00 11.57 ? 147 ILE A O     1 
ATOM   1143 C  CB    . ILE A 1 154 ? -25.974 10.249  -6.327  1.00 12.32 ? 147 ILE A CB    1 
ATOM   1144 C  CG1   . ILE A 1 154 ? -25.045 9.404   -5.442  1.00 13.84 ? 147 ILE A CG1   1 
ATOM   1145 C  CG2   . ILE A 1 154 ? -26.177 11.616  -5.657  1.00 13.05 ? 147 ILE A CG2   1 
ATOM   1146 C  CD1   . ILE A 1 154 ? -25.587 9.162   -4.024  1.00 14.76 ? 147 ILE A CD1   1 
ATOM   1147 N  N     . GLU A 1 155 ? -29.286 10.701  -7.340  1.00 12.73 ? 148 GLU A N     1 
ATOM   1148 C  CA    . GLU A 1 155 ? -30.149 11.288  -8.338  1.00 13.82 ? 148 GLU A CA    1 
ATOM   1149 C  C     . GLU A 1 155 ? -29.546 12.626  -8.815  1.00 14.44 ? 148 GLU A C     1 
ATOM   1150 O  O     . GLU A 1 155 ? -29.102 13.411  -7.978  1.00 12.08 ? 148 GLU A O     1 
ATOM   1151 C  CB    . GLU A 1 155 ? -31.535 11.546  -7.792  1.00 14.19 ? 148 GLU A CB    1 
ATOM   1152 C  CG    . GLU A 1 155 ? -32.466 12.309  -8.725  1.00 14.79 ? 148 GLU A CG    1 
ATOM   1153 C  CD    . GLU A 1 155 ? -32.676 11.649  -10.056 1.00 16.61 ? 148 GLU A CD    1 
ATOM   1154 O  OE1   . GLU A 1 155 ? -33.073 12.377  -11.036 1.00 15.92 ? 148 GLU A OE1   1 
ATOM   1155 O  OE2   . GLU A 1 155 ? -32.511 10.387  -10.099 1.00 17.15 ? 148 GLU A OE2   1 
ATOM   1156 N  N     . GLY A 1 156 ? -29.495 12.801  -10.164 1.00 14.51 ? 149 GLY A N     1 
ATOM   1157 C  CA    . GLY A 1 156 ? -28.955 14.023  -10.817 1.00 15.36 ? 149 GLY A CA    1 
ATOM   1158 C  C     . GLY A 1 156 ? -27.458 13.900  -11.134 1.00 16.74 ? 149 GLY A C     1 
ATOM   1159 O  O     . GLY A 1 156 ? -26.878 14.766  -11.760 1.00 17.20 ? 149 GLY A O     1 
ATOM   1160 N  N     . LEU A 1 157 ? -26.821 12.819  -10.720 1.00 16.05 ? 150 LEU A N     1 
ATOM   1161 C  CA    . LEU A 1 157 ? -25.427 12.524  -11.111 1.00 15.97 ? 150 LEU A CA    1 
ATOM   1162 C  C     . LEU A 1 157 ? -25.336 11.248  -11.908 1.00 17.87 ? 150 LEU A C     1 
ATOM   1163 O  O     . LEU A 1 157 ? -26.224 10.426  -11.795 1.00 17.61 ? 150 LEU A O     1 
ATOM   1164 C  CB    . LEU A 1 157 ? -24.510 12.462  -9.883  1.00 17.02 ? 150 LEU A CB    1 
ATOM   1165 C  CG    . LEU A 1 157 ? -24.413 13.778  -9.059  1.00 18.04 ? 150 LEU A CG    1 
ATOM   1166 C  CD1   . LEU A 1 157 ? -23.504 13.518  -7.906  1.00 17.18 ? 150 LEU A CD1   1 
ATOM   1167 C  CD2   . LEU A 1 157 ? -23.897 15.023  -9.845  1.00 19.10 ? 150 LEU A CD2   1 
ATOM   1168 N  N     . PRO A 1 158 ? -24.289 11.086  -12.764 1.00 18.69 ? 151 PRO A N     1 
ATOM   1169 C  CA    . PRO A 1 158 ? -23.222 12.056  -12.944 1.00 20.03 ? 151 PRO A CA    1 
ATOM   1170 C  C     . PRO A 1 158 ? -23.622 13.219  -13.846 1.00 21.86 ? 151 PRO A C     1 
ATOM   1171 O  O     . PRO A 1 158 ? -24.598 13.144  -14.573 1.00 18.59 ? 151 PRO A O     1 
ATOM   1172 C  CB    . PRO A 1 158 ? -22.102 11.253  -13.611 1.00 20.29 ? 151 PRO A CB    1 
ATOM   1173 C  CG    . PRO A 1 158 ? -22.859 10.289  -14.468 1.00 20.85 ? 151 PRO A CG    1 
ATOM   1174 C  CD    . PRO A 1 158 ? -24.144 9.962   -13.711 1.00 19.49 ? 151 PRO A CD    1 
ATOM   1175 N  N     . GLN A 1 159 ? -22.850 14.285  -13.755 1.00 23.41 ? 152 GLN A N     1 
ATOM   1176 C  CA    . GLN A 1 159 ? -23.084 15.445  -14.561 1.00 31.68 ? 152 GLN A CA    1 
ATOM   1177 C  C     . GLN A 1 159 ? -21.710 15.883  -14.998 1.00 32.64 ? 152 GLN A C     1 
ATOM   1178 O  O     . GLN A 1 159 ? -20.712 15.465  -14.392 1.00 28.61 ? 152 GLN A O     1 
ATOM   1179 C  CB    . GLN A 1 159 ? -23.793 16.527  -13.765 1.00 35.61 ? 152 GLN A CB    1 
ATOM   1180 C  CG    . GLN A 1 159 ? -23.235 17.897  -14.015 1.00 40.98 ? 152 GLN A CG    1 
ATOM   1181 C  CD    . GLN A 1 159 ? -23.481 18.816  -12.864 1.00 45.51 ? 152 GLN A CD    1 
ATOM   1182 O  OE1   . GLN A 1 159 ? -24.632 19.115  -12.532 1.00 47.46 ? 152 GLN A OE1   1 
ATOM   1183 N  NE2   . GLN A 1 159 ? -22.405 19.276  -12.241 1.00 42.96 ? 152 GLN A NE2   1 
ATOM   1184 N  N     . GLY A 1 160 ? -21.674 16.635  -16.101 1.00 35.46 ? 153 GLY A N     1 
ATOM   1185 C  CA    . GLY A 1 160 ? -20.510 17.434  -16.485 1.00 40.29 ? 153 GLY A CA    1 
ATOM   1186 C  C     . GLY A 1 160 ? -19.572 16.632  -17.353 1.00 46.64 ? 153 GLY A C     1 
ATOM   1187 O  O     . GLY A 1 160 ? -20.002 15.699  -17.988 1.00 43.52 ? 153 GLY A O     1 
ATOM   1188 N  N     . PRO A 1 161 ? -18.284 17.030  -17.413 1.00 58.40 ? 154 PRO A N     1 
ATOM   1189 C  CA    . PRO A 1 161 ? -17.259 16.196  -18.017 1.00 60.32 ? 154 PRO A CA    1 
ATOM   1190 C  C     . PRO A 1 161 ? -16.339 15.585  -16.952 1.00 64.69 ? 154 PRO A C     1 
ATOM   1191 O  O     . PRO A 1 161 ? -16.521 14.427  -16.571 1.00 59.04 ? 154 PRO A O     1 
ATOM   1192 C  CB    . PRO A 1 161 ? -16.499 17.188  -18.908 1.00 63.30 ? 154 PRO A CB    1 
ATOM   1193 C  CG    . PRO A 1 161 ? -16.893 18.574  -18.423 1.00 63.59 ? 154 PRO A CG    1 
ATOM   1194 C  CD    . PRO A 1 161 ? -17.786 18.407  -17.228 1.00 58.86 ? 154 PRO A CD    1 
ATOM   1195 N  N     . GLU A 1 165 ? -16.564 4.995   -22.981 1.00 54.33 ? 158 GLU A N     1 
ATOM   1196 C  CA    . GLU A 1 165 ? -17.092 3.716   -22.531 1.00 58.54 ? 158 GLU A CA    1 
ATOM   1197 C  C     . GLU A 1 165 ? -17.975 3.839   -21.242 1.00 56.24 ? 158 GLU A C     1 
ATOM   1198 O  O     . GLU A 1 165 ? -19.053 4.422   -21.320 1.00 57.35 ? 158 GLU A O     1 
ATOM   1199 C  CB    . GLU A 1 165 ? -15.936 2.697   -22.380 1.00 56.45 ? 158 GLU A CB    1 
ATOM   1200 N  N     . GLU A 1 166 ? -17.475 3.358   -20.087 1.00 54.35 ? 159 GLU A N     1 
ATOM   1201 C  CA    . GLU A 1 166 ? -18.255 2.992   -18.861 1.00 48.80 ? 159 GLU A CA    1 
ATOM   1202 C  C     . GLU A 1 166 ? -19.713 3.432   -18.816 1.00 49.01 ? 159 GLU A C     1 
ATOM   1203 O  O     . GLU A 1 166 ? -20.631 2.567   -18.804 1.00 43.89 ? 159 GLU A O     1 
ATOM   1204 C  CB    . GLU A 1 166 ? -17.542 3.453   -17.585 1.00 48.39 ? 159 GLU A CB    1 
ATOM   1205 N  N     . THR A 1 167 ? -19.923 4.757   -18.849 1.00 48.60 ? 160 THR A N     1 
ATOM   1206 C  CA    . THR A 1 167 ? -21.282 5.365   -18.845 1.00 48.83 ? 160 THR A CA    1 
ATOM   1207 C  C     . THR A 1 167 ? -22.240 5.003   -20.026 1.00 44.60 ? 160 THR A C     1 
ATOM   1208 O  O     . THR A 1 167 ? -23.377 5.503   -20.077 1.00 49.82 ? 160 THR A O     1 
ATOM   1209 C  CB    . THR A 1 167 ? -21.250 6.912   -18.693 1.00 46.48 ? 160 THR A CB    1 
ATOM   1210 O  OG1   . THR A 1 167 ? -20.332 7.466   -19.632 1.00 42.85 ? 160 THR A OG1   1 
ATOM   1211 C  CG2   . THR A 1 167 ? -20.886 7.344   -17.233 1.00 47.74 ? 160 THR A CG2   1 
ATOM   1212 N  N     . VAL A 1 168 ? -21.849 4.133   -20.953 1.00 38.08 ? 161 VAL A N     1 
ATOM   1213 C  CA    . VAL A 1 168 ? -22.886 3.594   -21.844 1.00 34.85 ? 161 VAL A CA    1 
ATOM   1214 C  C     . VAL A 1 168 ? -23.710 2.458   -21.166 1.00 37.84 ? 161 VAL A C     1 
ATOM   1215 O  O     . VAL A 1 168 ? -24.819 2.105   -21.642 1.00 36.57 ? 161 VAL A O     1 
ATOM   1216 C  CB    . VAL A 1 168 ? -22.306 3.175   -23.213 1.00 35.79 ? 161 VAL A CB    1 
ATOM   1217 C  CG1   . VAL A 1 168 ? -21.565 4.379   -23.864 1.00 33.84 ? 161 VAL A CG1   1 
ATOM   1218 C  CG2   . VAL A 1 168 ? -21.435 1.922   -23.080 1.00 35.51 ? 161 VAL A CG2   1 
ATOM   1219 N  N     . GLN A 1 169 ? -23.171 1.896   -20.074 1.00 37.94 ? 162 GLN A N     1 
ATOM   1220 C  CA    . GLN A 1 169 ? -23.865 0.868   -19.236 1.00 40.80 ? 162 GLN A CA    1 
ATOM   1221 C  C     . GLN A 1 169 ? -24.440 1.498   -17.943 1.00 35.70 ? 162 GLN A C     1 
ATOM   1222 O  O     . GLN A 1 169 ? -23.884 2.497   -17.414 1.00 33.48 ? 162 GLN A O     1 
ATOM   1223 C  CB    . GLN A 1 169 ? -22.922 -0.250  -18.831 1.00 42.07 ? 162 GLN A CB    1 
ATOM   1224 C  CG    . GLN A 1 169 ? -21.959 -0.696  -19.910 1.00 47.52 ? 162 GLN A CG    1 
ATOM   1225 C  CD    . GLN A 1 169 ? -22.590 -1.705  -20.830 1.00 55.68 ? 162 GLN A CD    1 
ATOM   1226 O  OE1   . GLN A 1 169 ? -23.355 -1.348  -21.744 1.00 60.01 ? 162 GLN A OE1   1 
ATOM   1227 N  NE2   . GLN A 1 169 ? -22.290 -2.994  -20.587 1.00 54.86 ? 162 GLN A NE2   1 
ATOM   1228 N  N     . LYS A 1 170 ? -25.537 0.913   -17.454 1.00 28.84 ? 163 LYS A N     1 
ATOM   1229 C  CA    . LYS A 1 170 ? -26.278 1.496   -16.364 1.00 28.79 ? 163 LYS A CA    1 
ATOM   1230 C  C     . LYS A 1 170 ? -25.393 1.441   -15.108 1.00 24.34 ? 163 LYS A C     1 
ATOM   1231 O  O     . LYS A 1 170 ? -25.286 2.407   -14.365 1.00 23.75 ? 163 LYS A O     1 
ATOM   1232 C  CB    . LYS A 1 170 ? -27.697 0.870   -16.204 1.00 29.93 ? 163 LYS A CB    1 
ATOM   1233 C  CG    . LYS A 1 170 ? -28.743 1.937   -15.828 1.00 33.87 ? 163 LYS A CG    1 
ATOM   1234 C  CD    . LYS A 1 170 ? -30.024 1.460   -15.099 1.00 33.13 ? 163 LYS A CD    1 
ATOM   1235 C  CE    . LYS A 1 170 ? -30.692 2.637   -14.399 1.00 31.85 ? 163 LYS A CE    1 
ATOM   1236 N  NZ    . LYS A 1 170 ? -31.650 2.242   -13.307 1.00 35.09 ? 163 LYS A NZ    1 
ATOM   1237 N  N     . GLU A 1 171 ? -24.668 0.347   -14.919 1.00 25.79 ? 164 GLU A N     1 
ATOM   1238 C  CA    . GLU A 1 171 ? -23.816 0.219   -13.732 1.00 24.98 ? 164 GLU A CA    1 
ATOM   1239 C  C     . GLU A 1 171 ? -22.618 1.185   -13.813 1.00 23.64 ? 164 GLU A C     1 
ATOM   1240 O  O     . GLU A 1 171 ? -22.156 1.688   -12.796 1.00 22.24 ? 164 GLU A O     1 
ATOM   1241 C  CB    . GLU A 1 171 ? -23.398 -1.262  -13.513 1.00 26.35 ? 164 GLU A CB    1 
ATOM   1242 C  CG    . GLU A 1 171 ? -22.485 -1.551  -12.336 1.00 25.53 ? 164 GLU A CG    1 
ATOM   1243 C  CD    . GLU A 1 171 ? -23.053 -1.089  -10.978 1.00 26.13 ? 164 GLU A CD    1 
ATOM   1244 O  OE1   . GLU A 1 171 ? -22.234 -0.901  -10.055 1.00 26.91 ? 164 GLU A OE1   1 
ATOM   1245 O  OE2   . GLU A 1 171 ? -24.279 -0.882  -10.840 1.00 23.69 ? 164 GLU A OE2   1 
ATOM   1246 N  N     . GLY A 1 172 ? -22.103 1.440   -15.017 1.00 23.31 ? 165 GLY A N     1 
ATOM   1247 C  CA    . GLY A 1 172 ? -21.084 2.490   -15.207 1.00 21.41 ? 165 GLY A CA    1 
ATOM   1248 C  C     . GLY A 1 172 ? -21.559 3.889   -14.839 1.00 20.28 ? 165 GLY A C     1 
ATOM   1249 O  O     . GLY A 1 172 ? -20.882 4.565   -14.077 1.00 20.23 ? 165 GLY A O     1 
ATOM   1250 N  N     . MET A 1 173 ? -22.738 4.322   -15.328 1.00 20.65 ? 166 MET A N     1 
ATOM   1251 C  CA    . MET A 1 173 ? -23.349 5.624   -14.881 1.00 22.38 ? 166 MET A CA    1 
ATOM   1252 C  C     . MET A 1 173 ? -23.527 5.635   -13.354 1.00 19.28 ? 166 MET A C     1 
ATOM   1253 O  O     . MET A 1 173 ? -23.136 6.618   -12.676 1.00 17.62 ? 166 MET A O     1 
ATOM   1254 C  CB    . MET A 1 173 ? -24.725 5.879   -15.524 1.00 28.20 ? 166 MET A CB    1 
ATOM   1255 C  CG    . MET A 1 173 ? -24.712 6.369   -16.972 1.00 36.74 ? 166 MET A CG    1 
ATOM   1256 S  SD    . MET A 1 173 ? -24.456 8.170   -17.139 1.00 38.22 ? 166 MET A SD    1 
ATOM   1257 C  CE    . MET A 1 173 ? -26.041 8.823   -16.626 1.00 43.84 ? 166 MET A CE    1 
ATOM   1258 N  N     . ARG A 1 174 ? -24.114 4.559   -12.795 1.00 16.27 ? 167 ARG A N     1 
ATOM   1259 C  CA    . ARG A 1 174 ? -24.381 4.558   -11.339 1.00 15.38 ? 167 ARG A CA    1 
ATOM   1260 C  C     . ARG A 1 174 ? -23.103 4.910   -10.634 1.00 16.80 ? 167 ARG A C     1 
ATOM   1261 O  O     . ARG A 1 174 ? -23.092 5.804   -9.825  1.00 15.79 ? 167 ARG A O     1 
ATOM   1262 C  CB    . ARG A 1 174 ? -24.829 3.187   -10.815 1.00 16.13 ? 167 ARG A CB    1 
ATOM   1263 C  CG    . ARG A 1 174 ? -25.337 3.209   -9.371  1.00 15.00 ? 167 ARG A CG    1 
ATOM   1264 C  CD    . ARG A 1 174 ? -25.523 1.772   -8.881  1.00 16.16 ? 167 ARG A CD    1 
ATOM   1265 N  NE    . ARG A 1 174 ? -24.204 1.135   -8.698  1.00 15.72 ? 167 ARG A NE    1 
ATOM   1266 C  CZ    . ARG A 1 174 ? -23.392 1.329   -7.676  1.00 16.71 ? 167 ARG A CZ    1 
ATOM   1267 N  NH1   . ARG A 1 174 ? -23.704 2.098   -6.654  1.00 16.10 ? 167 ARG A NH1   1 
ATOM   1268 N  NH2   . ARG A 1 174 ? -22.261 0.669   -7.630  1.00 18.69 ? 167 ARG A NH2   1 
ATOM   1269 N  N     . LYS A 1 175 ? -22.025 4.187   -10.963 1.00 18.36 ? 168 LYS A N     1 
ATOM   1270 C  CA    . LYS A 1 175 ? -20.718 4.360   -10.297 1.00 22.46 ? 168 LYS A CA    1 
ATOM   1271 C  C     . LYS A 1 175 ? -20.145 5.764   -10.462 1.00 21.55 ? 168 LYS A C     1 
ATOM   1272 O  O     . LYS A 1 175 ? -19.633 6.352   -9.507  1.00 18.50 ? 168 LYS A O     1 
ATOM   1273 C  CB    . LYS A 1 175 ? -19.666 3.431   -10.881 1.00 27.87 ? 168 LYS A CB    1 
ATOM   1274 C  CG    . LYS A 1 175 ? -19.670 1.985   -10.452 1.00 34.29 ? 168 LYS A CG    1 
ATOM   1275 C  CD    . LYS A 1 175 ? -18.405 1.316   -11.035 1.00 36.81 ? 168 LYS A CD    1 
ATOM   1276 C  CE    . LYS A 1 175 ? -18.659 -0.095  -11.566 1.00 44.26 ? 168 LYS A CE    1 
ATOM   1277 N  NZ    . LYS A 1 175 ? -19.057 -1.020  -10.460 1.00 50.11 ? 168 LYS A NZ    1 
ATOM   1278 N  N     . GLN A 1 176 ? -20.169 6.281   -11.687 1.00 21.53 ? 169 GLN A N     1 
ATOM   1279 C  CA    . GLN A 1 176 ? -19.568 7.602   -11.932 1.00 22.40 ? 169 GLN A CA    1 
ATOM   1280 C  C     . GLN A 1 176 ? -20.289 8.627   -11.096 1.00 20.01 ? 169 GLN A C     1 
ATOM   1281 O  O     . GLN A 1 176 ? -19.687 9.516   -10.591 1.00 17.40 ? 169 GLN A O     1 
ATOM   1282 C  CB    . GLN A 1 176 ? -19.602 8.033   -13.402 1.00 24.74 ? 169 GLN A CB    1 
ATOM   1283 C  CG    . GLN A 1 176 ? -18.642 7.261   -14.304 1.00 34.44 ? 169 GLN A CG    1 
ATOM   1284 C  CD    . GLN A 1 176 ? -17.155 7.486   -13.973 1.00 40.36 ? 169 GLN A CD    1 
ATOM   1285 O  OE1   . GLN A 1 176 ? -16.566 8.504   -14.365 1.00 52.83 ? 169 GLN A OE1   1 
ATOM   1286 N  NE2   . GLN A 1 176 ? -16.546 6.534   -13.262 1.00 41.63 ? 169 GLN A NE2   1 
ATOM   1287 N  N     . GLY A 1 177 ? -21.605 8.497   -10.960 1.00 19.01 ? 170 GLY A N     1 
ATOM   1288 C  CA    . GLY A 1 177 ? -22.373 9.473   -10.178 1.00 17.96 ? 170 GLY A CA    1 
ATOM   1289 C  C     . GLY A 1 177 ? -22.034 9.379   -8.719  1.00 16.83 ? 170 GLY A C     1 
ATOM   1290 O  O     . GLY A 1 177 ? -21.798 10.380  -8.047  1.00 18.70 ? 170 GLY A O     1 
ATOM   1291 N  N     . LEU A 1 178 ? -21.962 8.153   -8.233  1.00 17.23 ? 171 LEU A N     1 
ATOM   1292 C  CA    . LEU A 1 178 ? -21.606 7.903   -6.864  1.00 16.28 ? 171 LEU A CA    1 
ATOM   1293 C  C     . LEU A 1 178 ? -20.186 8.436   -6.575  1.00 17.26 ? 171 LEU A C     1 
ATOM   1294 O  O     . LEU A 1 178 ? -19.906 9.135   -5.553  1.00 15.19 ? 171 LEU A O     1 
ATOM   1295 C  CB    . LEU A 1 178 ? -21.702 6.374   -6.626  1.00 15.59 ? 171 LEU A CB    1 
ATOM   1296 C  CG    . LEU A 1 178 ? -21.362 5.902   -5.242  1.00 14.96 ? 171 LEU A CG    1 
ATOM   1297 C  CD1   . LEU A 1 178 ? -22.234 6.620   -4.200  1.00 14.22 ? 171 LEU A CD1   1 
ATOM   1298 C  CD2   . LEU A 1 178 ? -21.486 4.398   -5.140  1.00 14.61 ? 171 LEU A CD2   1 
ATOM   1299 N  N     . PHE A 1 179 ? -19.277 8.152   -7.492  1.00 18.40 ? 172 PHE A N     1 
ATOM   1300 C  CA    . PHE A 1 179 ? -17.927 8.675   -7.351  1.00 20.78 ? 172 PHE A CA    1 
ATOM   1301 C  C     . PHE A 1 179 ? -17.962 10.214  -7.307  1.00 20.80 ? 172 PHE A C     1 
ATOM   1302 O  O     . PHE A 1 179 ? -17.389 10.831  -6.410  1.00 24.68 ? 172 PHE A O     1 
ATOM   1303 C  CB    . PHE A 1 179 ? -17.002 8.199   -8.490  1.00 22.72 ? 172 PHE A CB    1 
ATOM   1304 C  CG    . PHE A 1 179 ? -16.676 6.709   -8.484  1.00 26.60 ? 172 PHE A CG    1 
ATOM   1305 C  CD1   . PHE A 1 179 ? -16.843 5.909   -7.351  1.00 31.40 ? 172 PHE A CD1   1 
ATOM   1306 C  CD2   . PHE A 1 179 ? -16.141 6.109   -9.646  1.00 30.11 ? 172 PHE A CD2   1 
ATOM   1307 C  CE1   . PHE A 1 179 ? -16.519 4.536   -7.385  1.00 32.49 ? 172 PHE A CE1   1 
ATOM   1308 C  CE2   . PHE A 1 179 ? -15.775 4.745   -9.671  1.00 33.05 ? 172 PHE A CE2   1 
ATOM   1309 C  CZ    . PHE A 1 179 ? -15.980 3.953   -8.536  1.00 32.40 ? 172 PHE A CZ    1 
ATOM   1310 N  N     . GLN A 1 180 ? -18.642 10.863  -8.249  1.00 21.16 ? 173 GLN A N     1 
ATOM   1311 C  CA    . GLN A 1 180 ? -18.677 12.333  -8.200  1.00 19.95 ? 173 GLN A CA    1 
ATOM   1312 C  C     . GLN A 1 180 ? -19.246 12.745  -6.871  1.00 18.76 ? 173 GLN A C     1 
ATOM   1313 O  O     . GLN A 1 180 ? -18.776 13.699  -6.275  1.00 19.83 ? 173 GLN A O     1 
ATOM   1314 C  CB    . GLN A 1 180 ? -19.486 12.966  -9.335  1.00 21.38 ? 173 GLN A CB    1 
ATOM   1315 C  CG    . GLN A 1 180 ? -18.952 12.672  -10.725 1.00 23.78 ? 173 GLN A CG    1 
ATOM   1316 C  CD    . GLN A 1 180 ? -19.813 13.315  -11.836 1.00 26.57 ? 173 GLN A CD    1 
ATOM   1317 O  OE1   . GLN A 1 180 ? -20.899 13.853  -11.590 1.00 23.96 ? 173 GLN A OE1   1 
ATOM   1318 N  NE2   . GLN A 1 180 ? -19.314 13.254  -13.071 1.00 29.04 ? 173 GLN A NE2   1 
ATOM   1319 N  N     . TRP A 1 181 ? -20.270 12.045  -6.367  1.00 16.83 ? 174 TRP A N     1 
ATOM   1320 C  CA    . TRP A 1 181 ? -20.886 12.505  -5.103  1.00 15.46 ? 174 TRP A CA    1 
ATOM   1321 C  C     . TRP A 1 181 ? -19.910 12.372  -3.938  1.00 14.79 ? 174 TRP A C     1 
ATOM   1322 O  O     . TRP A 1 181 ? -19.697 13.312  -3.148  1.00 13.62 ? 174 TRP A O     1 
ATOM   1323 C  CB    . TRP A 1 181 ? -22.162 11.706  -4.832  1.00 15.43 ? 174 TRP A CB    1 
ATOM   1324 C  CG    . TRP A 1 181 ? -22.790 11.857  -3.523  1.00 15.50 ? 174 TRP A CG    1 
ATOM   1325 C  CD1   . TRP A 1 181 ? -22.675 11.007  -2.474  1.00 16.87 ? 174 TRP A CD1   1 
ATOM   1326 C  CD2   . TRP A 1 181 ? -23.715 12.885  -3.117  1.00 14.91 ? 174 TRP A CD2   1 
ATOM   1327 N  NE1   . TRP A 1 181 ? -23.441 11.443  -1.422  1.00 18.77 ? 174 TRP A NE1   1 
ATOM   1328 C  CE2   . TRP A 1 181 ? -24.122 12.579  -1.803  1.00 16.41 ? 174 TRP A CE2   1 
ATOM   1329 C  CE3   . TRP A 1 181 ? -24.242 14.021  -3.744  1.00 15.81 ? 174 TRP A CE3   1 
ATOM   1330 C  CZ2   . TRP A 1 181 ? -25.000 13.379  -1.084  1.00 15.62 ? 174 TRP A CZ2   1 
ATOM   1331 C  CZ3   . TRP A 1 181 ? -25.141 14.827  -3.043  1.00 15.22 ? 174 TRP A CZ3   1 
ATOM   1332 C  CH2   . TRP A 1 181 ? -25.510 14.501  -1.729  1.00 17.23 ? 174 TRP A CH2   1 
ATOM   1333 N  N     . LEU A 1 182 ? -19.282 11.228  -3.853  1.00 16.54 ? 175 LEU A N     1 
ATOM   1334 C  CA    . LEU A 1 182 ? -18.373 10.991  -2.738  1.00 19.50 ? 175 LEU A CA    1 
ATOM   1335 C  C     . LEU A 1 182 ? -17.145 11.904  -2.826  1.00 22.63 ? 175 LEU A C     1 
ATOM   1336 O  O     . LEU A 1 182 ? -16.724 12.473  -1.812  1.00 22.46 ? 175 LEU A O     1 
ATOM   1337 C  CB    . LEU A 1 182 ? -17.948 9.530   -2.703  1.00 19.13 ? 175 LEU A CB    1 
ATOM   1338 C  CG    . LEU A 1 182 ? -19.096 8.582   -2.323  1.00 20.17 ? 175 LEU A CG    1 
ATOM   1339 C  CD1   . LEU A 1 182 ? -18.659 7.141   -2.541  1.00 20.98 ? 175 LEU A CD1   1 
ATOM   1340 C  CD2   . LEU A 1 182 ? -19.523 8.796   -0.890  1.00 19.35 ? 175 LEU A CD2   1 
ATOM   1341 N  N     . ASP A 1 183 ? -16.597 12.064  -4.030  1.00 23.92 ? 176 ASP A N     1 
ATOM   1342 C  CA    . ASP A 1 183 ? -15.392 12.903  -4.195  1.00 27.19 ? 176 ASP A CA    1 
ATOM   1343 C  C     . ASP A 1 183 ? -15.688 14.260  -3.647  1.00 29.43 ? 176 ASP A C     1 
ATOM   1344 O  O     . ASP A 1 183 ? -14.809 14.884  -3.080  1.00 28.29 ? 176 ASP A O     1 
ATOM   1345 C  CB    . ASP A 1 183 ? -14.945 13.038  -5.651  1.00 31.77 ? 176 ASP A CB    1 
ATOM   1346 C  CG    . ASP A 1 183 ? -14.122 11.868  -6.114  1.00 35.42 ? 176 ASP A CG    1 
ATOM   1347 O  OD1   . ASP A 1 183 ? -13.479 11.228  -5.262  1.00 43.88 ? 176 ASP A OD1   1 
ATOM   1348 O  OD2   . ASP A 1 183 ? -14.098 11.577  -7.333  1.00 41.70 ? 176 ASP A OD2   1 
ATOM   1349 N  N     . SER A 1 184 ? -16.926 14.730  -3.782  1.00 29.93 ? 177 SER A N     1 
ATOM   1350 C  CA    . SER A 1 184 ? -17.188 16.068  -3.343  1.00 30.91 ? 177 SER A CA    1 
ATOM   1351 C  C     . SER A 1 184 ? -17.766 16.177  -1.927  1.00 33.22 ? 177 SER A C     1 
ATOM   1352 O  O     . SER A 1 184 ? -18.005 17.275  -1.473  1.00 33.70 ? 177 SER A O     1 
ATOM   1353 C  CB    . SER A 1 184 ? -18.049 16.794  -4.380  1.00 32.92 ? 177 SER A CB    1 
ATOM   1354 O  OG    . SER A 1 184 ? -19.356 16.301  -4.351  1.00 36.71 ? 177 SER A OG    1 
ATOM   1355 N  N     . LEU A 1 185 ? -18.009 15.079  -1.217  1.00 32.40 ? 178 LEU A N     1 
ATOM   1356 C  CA    . LEU A 1 185 ? -18.514 15.198  0.166   1.00 36.17 ? 178 LEU A CA    1 
ATOM   1357 C  C     . LEU A 1 185 ? -17.578 15.824  1.232   1.00 38.52 ? 178 LEU A C     1 
ATOM   1358 O  O     . LEU A 1 185 ? -16.456 15.361  1.396   1.00 37.58 ? 178 LEU A O     1 
ATOM   1359 C  CB    . LEU A 1 185 ? -18.835 13.807  0.716   1.00 42.06 ? 178 LEU A CB    1 
ATOM   1360 C  CG    . LEU A 1 185 ? -20.233 13.275  0.537   1.00 44.52 ? 178 LEU A CG    1 
ATOM   1361 C  CD1   . LEU A 1 185 ? -20.277 11.876  1.166   1.00 42.80 ? 178 LEU A CD1   1 
ATOM   1362 C  CD2   . LEU A 1 185 ? -21.280 14.237  1.163   1.00 43.96 ? 178 LEU A CD2   1 
ATOM   1363 N  N     . GLN A 1 186 ? -18.102 16.757  2.030   1.00 41.58 ? 179 GLN A N     1 
ATOM   1364 C  CA    . GLN A 1 186 ? -17.384 17.360  3.174   1.00 51.37 ? 179 GLN A CA    1 
ATOM   1365 C  C     . GLN A 1 186 ? -17.549 16.543  4.487   1.00 55.78 ? 179 GLN A C     1 
ATOM   1366 O  O     . GLN A 1 186 ? -18.353 16.929  5.352   1.00 53.73 ? 179 GLN A O     1 
ATOM   1367 C  CB    . GLN A 1 186 ? -17.875 18.817  3.388   1.00 54.26 ? 179 GLN A CB    1 
ATOM   1368 C  CG    . GLN A 1 186 ? -16.923 19.736  4.159   1.00 59.27 ? 179 GLN A CG    1 
ATOM   1369 C  CD    . GLN A 1 186 ? -15.532 19.835  3.517   1.00 63.62 ? 179 GLN A CD    1 
ATOM   1370 O  OE1   . GLN A 1 186 ? -14.599 19.101  3.891   1.00 60.21 ? 179 GLN A OE1   1 
ATOM   1371 N  NE2   . GLN A 1 186 ? -15.392 20.733  2.543   1.00 63.29 ? 179 GLN A NE2   1 
ATOM   1372 N  N     . ILE A 1 187 ? -16.758 15.458  4.624   1.00 58.21 ? 180 ILE A N     1 
ATOM   1373 C  CA    . ILE A 1 187 ? -16.842 14.480  5.750   1.00 58.99 ? 180 ILE A CA    1 
ATOM   1374 C  C     . ILE A 1 187 ? -16.373 14.947  7.140   1.00 58.76 ? 180 ILE A C     1 
ATOM   1375 O  O     . ILE A 1 187 ? -16.725 14.337  8.155   1.00 58.36 ? 180 ILE A O     1 
ATOM   1376 C  CB    . ILE A 1 187 ? -16.074 13.151  5.465   1.00 60.28 ? 180 ILE A CB    1 
ATOM   1377 C  CG1   . ILE A 1 187 ? -14.693 13.416  4.827   1.00 62.20 ? 180 ILE A CG1   1 
ATOM   1378 C  CG2   . ILE A 1 187 ? -16.935 12.206  4.637   1.00 58.62 ? 180 ILE A CG2   1 
ATOM   1379 C  CD1   . ILE A 1 187 ? -13.634 12.410  5.240   1.00 61.42 ? 180 ILE A CD1   1 
ATOM   1380 N  N     . ASP A 1 188 ? -15.569 16.006  7.177   1.00 63.01 ? 181 ASP A N     1 
ATOM   1381 C  CA    . ASP A 1 188 ? -15.085 16.587  8.426   1.00 66.10 ? 181 ASP A CA    1 
ATOM   1382 C  C     . ASP A 1 188 ? -16.129 17.525  9.057   1.00 66.52 ? 181 ASP A C     1 
ATOM   1383 O  O     . ASP A 1 188 ? -15.852 18.212  10.046  1.00 63.22 ? 181 ASP A O     1 
ATOM   1384 C  CB    . ASP A 1 188 ? -13.785 17.355  8.156   1.00 72.01 ? 181 ASP A CB    1 
ATOM   1385 C  CG    . ASP A 1 188 ? -13.998 18.546  7.230   1.00 71.72 ? 181 ASP A CG    1 
ATOM   1386 O  OD1   . ASP A 1 188 ? -14.644 18.373  6.174   1.00 75.49 ? 181 ASP A OD1   1 
ATOM   1387 O  OD2   . ASP A 1 188 ? -13.538 19.654  7.562   1.00 65.47 ? 181 ASP A OD2   1 
ATOM   1388 N  N     . ASN A 1 189 ? -17.330 17.548  8.481   1.00 63.18 ? 182 ASN A N     1 
ATOM   1389 C  CA    . ASN A 1 189 ? -18.402 18.418  8.931   1.00 53.63 ? 182 ASN A CA    1 
ATOM   1390 C  C     . ASN A 1 189 ? -19.661 17.599  9.188   1.00 49.87 ? 182 ASN A C     1 
ATOM   1391 O  O     . ASN A 1 189 ? -20.431 17.335  8.260   1.00 49.38 ? 182 ASN A O     1 
ATOM   1392 C  CB    . ASN A 1 189 ? -18.652 19.490  7.864   1.00 56.36 ? 182 ASN A CB    1 
ATOM   1393 C  CG    . ASN A 1 189 ? -19.753 20.458  8.246   1.00 51.50 ? 182 ASN A CG    1 
ATOM   1394 O  OD1   . ASN A 1 189 ? -20.294 20.418  9.363   1.00 54.49 ? 182 ASN A OD1   1 
ATOM   1395 N  ND2   . ASN A 1 189 ? -20.109 21.324  7.309   1.00 53.48 ? 182 ASN A ND2   1 
ATOM   1396 N  N     . LEU A 1 190 ? -19.864 17.216  10.453  1.00 50.33 ? 183 LEU A N     1 
ATOM   1397 C  CA    . LEU A 1 190 ? -20.954 16.302  10.877  1.00 52.87 ? 183 LEU A CA    1 
ATOM   1398 C  C     . LEU A 1 190 ? -22.399 16.849  10.754  1.00 47.06 ? 183 LEU A C     1 
ATOM   1399 O  O     . LEU A 1 190 ? -23.369 16.087  10.822  1.00 48.33 ? 183 LEU A O     1 
ATOM   1400 C  CB    . LEU A 1 190 ? -20.697 15.807  12.309  1.00 54.79 ? 183 LEU A CB    1 
ATOM   1401 C  CG    . LEU A 1 190 ? -19.816 14.547  12.432  1.00 58.08 ? 183 LEU A CG    1 
ATOM   1402 C  CD1   . LEU A 1 190 ? -18.492 14.690  11.679  1.00 57.22 ? 183 LEU A CD1   1 
ATOM   1403 C  CD2   . LEU A 1 190 ? -19.585 14.163  13.900  1.00 56.56 ? 183 LEU A CD2   1 
ATOM   1404 N  N     . THR A 1 191 ? -22.541 18.162  10.574  1.00 46.02 ? 184 THR A N     1 
ATOM   1405 C  CA    . THR A 1 191 ? -23.864 18.779  10.371  1.00 41.14 ? 184 THR A CA    1 
ATOM   1406 C  C     . THR A 1 191 ? -24.328 18.872  8.888   1.00 30.59 ? 184 THR A C     1 
ATOM   1407 O  O     . THR A 1 191 ? -25.471 19.216  8.655   1.00 31.71 ? 184 THR A O     1 
ATOM   1408 C  CB    . THR A 1 191 ? -23.966 20.186  11.051  1.00 41.32 ? 184 THR A CB    1 
ATOM   1409 O  OG1   . THR A 1 191 ? -23.237 21.169  10.303  1.00 42.20 ? 184 THR A OG1   1 
ATOM   1410 C  CG2   . THR A 1 191 ? -23.418 20.161  12.495  1.00 45.31 ? 184 THR A CG2   1 
ATOM   1411 N  N     . SER A 1 192 ? -23.487 18.599  7.905   1.00 25.04 ? 185 SER A N     1 
ATOM   1412 C  CA    . SER A 1 192 ? -23.929 18.733  6.458   1.00 19.92 ? 185 SER A CA    1 
ATOM   1413 C  C     . SER A 1 192 ? -25.104 17.787  6.159   1.00 17.87 ? 185 SER A C     1 
ATOM   1414 O  O     . SER A 1 192 ? -24.969 16.604  6.332   1.00 13.49 ? 185 SER A O     1 
ATOM   1415 C  CB    . SER A 1 192 ? -22.815 18.370  5.495   1.00 19.95 ? 185 SER A CB    1 
ATOM   1416 O  OG    . SER A 1 192 ? -23.256 18.035  4.119   1.00 17.23 ? 185 SER A OG    1 
ATOM   1417 N  N     . PRO A 1 193 ? -26.232 18.325  5.634   1.00 16.81 ? 186 PRO A N     1 
ATOM   1418 C  CA    . PRO A 1 193 ? -27.356 17.485  5.242   1.00 15.50 ? 186 PRO A CA    1 
ATOM   1419 C  C     . PRO A 1 193 ? -26.957 16.369  4.254   1.00 16.03 ? 186 PRO A C     1 
ATOM   1420 O  O     . PRO A 1 193 ? -27.498 15.282  4.343   1.00 14.58 ? 186 PRO A O     1 
ATOM   1421 C  CB    . PRO A 1 193 ? -28.318 18.490  4.623   1.00 15.92 ? 186 PRO A CB    1 
ATOM   1422 C  CG    . PRO A 1 193 ? -28.089 19.759  5.500   1.00 16.12 ? 186 PRO A CG    1 
ATOM   1423 C  CD    . PRO A 1 193 ? -26.587 19.763  5.638   1.00 16.49 ? 186 PRO A CD    1 
ATOM   1424 N  N     . ASP A 1 194 ? -26.067 16.672  3.309   1.00 15.53 ? 187 ASP A N     1 
ATOM   1425 C  CA    . ASP A 1 194 ? -25.630 15.725  2.295   1.00 15.84 ? 187 ASP A CA    1 
ATOM   1426 C  C     . ASP A 1 194 ? -24.858 14.554  2.897   1.00 16.40 ? 187 ASP A C     1 
ATOM   1427 O  O     . ASP A 1 194 ? -25.029 13.388  2.488   1.00 15.09 ? 187 ASP A O     1 
ATOM   1428 C  CB    . ASP A 1 194 ? -24.708 16.392  1.263   1.00 16.59 ? 187 ASP A CB    1 
ATOM   1429 C  CG    . ASP A 1 194 ? -25.445 17.311  0.288   1.00 18.69 ? 187 ASP A CG    1 
ATOM   1430 O  OD1   . ASP A 1 194 ? -26.678 17.285  0.230   1.00 13.82 ? 187 ASP A OD1   1 
ATOM   1431 O  OD2   . ASP A 1 194 ? -24.706 18.043  -0.422  1.00 21.51 ? 187 ASP A OD2   1 
ATOM   1432 N  N     . LEU A 1 195 ? -23.981 14.873  3.848   1.00 14.63 ? 188 LEU A N     1 
ATOM   1433 C  CA    . LEU A 1 195 ? -23.284 13.848  4.529   1.00 16.18 ? 188 LEU A CA    1 
ATOM   1434 C  C     . LEU A 1 195 ? -24.275 12.941  5.304   1.00 15.62 ? 188 LEU A C     1 
ATOM   1435 O  O     . LEU A 1 195 ? -24.134 11.728  5.302   1.00 15.60 ? 188 LEU A O     1 
ATOM   1436 C  CB    . LEU A 1 195 ? -22.226 14.452  5.479   1.00 17.33 ? 188 LEU A CB    1 
ATOM   1437 C  CG    . LEU A 1 195 ? -21.515 13.427  6.349   1.00 19.34 ? 188 LEU A CG    1 
ATOM   1438 C  CD1   . LEU A 1 195 ? -20.765 12.415  5.492   1.00 20.95 ? 188 LEU A CD1   1 
ATOM   1439 C  CD2   . LEU A 1 195 ? -20.520 14.162  7.245   1.00 22.58 ? 188 LEU A CD2   1 
ATOM   1440 N  N     . GLN A 1 196 ? -25.212 13.539  6.026   1.00 14.92 ? 189 GLN A N     1 
ATOM   1441 C  CA    . GLN A 1 196 ? -26.239 12.787  6.770   1.00 14.59 ? 189 GLN A CA    1 
ATOM   1442 C  C     . GLN A 1 196 ? -27.008 11.800  5.863   1.00 13.89 ? 189 GLN A C     1 
ATOM   1443 O  O     . GLN A 1 196 ? -27.119 10.612  6.210   1.00 13.39 ? 189 GLN A O     1 
ATOM   1444 C  CB    . GLN A 1 196 ? -27.168 13.741  7.466   1.00 15.82 ? 189 GLN A CB    1 
ATOM   1445 C  CG    . GLN A 1 196 ? -26.492 14.452  8.642   1.00 19.56 ? 189 GLN A CG    1 
ATOM   1446 C  CD    . GLN A 1 196 ? -27.248 15.633  9.167   1.00 24.36 ? 189 GLN A CD    1 
ATOM   1447 O  OE1   . GLN A 1 196 ? -28.196 16.126  8.550   1.00 29.28 ? 189 GLN A OE1   1 
ATOM   1448 N  NE2   . GLN A 1 196 ? -26.783 16.149  10.298  1.00 30.02 ? 189 GLN A NE2   1 
ATOM   1449 N  N     . LEU A 1 197 ? -27.458 12.287  4.690   1.00 12.37 ? 190 LEU A N     1 
ATOM   1450 C  CA    . LEU A 1 197 ? -28.069 11.449  3.677   1.00 12.04 ? 190 LEU A CA    1 
ATOM   1451 C  C     . LEU A 1 197 ? -27.177 10.289  3.253   1.00 12.37 ? 190 LEU A C     1 
ATOM   1452 O  O     . LEU A 1 197 ? -27.661 9.173   3.115   1.00 13.63 ? 190 LEU A O     1 
ATOM   1453 C  CB    . LEU A 1 197 ? -28.415 12.274  2.446   1.00 12.60 ? 190 LEU A CB    1 
ATOM   1454 C  CG    . LEU A 1 197 ? -29.527 13.326  2.608   1.00 11.47 ? 190 LEU A CG    1 
ATOM   1455 C  CD1   . LEU A 1 197 ? -29.807 13.883  1.255   1.00 11.40 ? 190 LEU A CD1   1 
ATOM   1456 C  CD2   . LEU A 1 197 ? -30.808 12.774  3.209   1.00 11.24 ? 190 LEU A CD2   1 
ATOM   1457 N  N     . THR A 1 198 ? -25.876 10.540  3.063   1.00 11.78 ? 191 THR A N     1 
ATOM   1458 C  CA    . THR A 1 198 ? -24.925 9.520   2.632   1.00 11.79 ? 191 THR A CA    1 
ATOM   1459 C  C     . THR A 1 198 ? -24.847 8.425   3.694   1.00 12.57 ? 191 THR A C     1 
ATOM   1460 O  O     . THR A 1 198 ? -24.992 7.250   3.364   1.00 12.64 ? 191 THR A O     1 
ATOM   1461 C  CB    . THR A 1 198 ? -23.593 10.103  2.367   1.00 11.68 ? 191 THR A CB    1 
ATOM   1462 O  OG1   . THR A 1 198 ? -23.789 11.193  1.492   1.00 12.47 ? 191 THR A OG1   1 
ATOM   1463 C  CG2   . THR A 1 198 ? -22.651 9.064   1.721   1.00 13.55 ? 191 THR A CG2   1 
ATOM   1464 N  N     . VAL A 1 199 ? -24.788 8.828   4.959   1.00 13.26 ? 192 VAL A N     1 
ATOM   1465 C  CA    . VAL A 1 199 ? -24.683 7.845   6.018   1.00 13.24 ? 192 VAL A CA    1 
ATOM   1466 C  C     . VAL A 1 199 ? -26.027 7.151   6.099   1.00 12.78 ? 192 VAL A C     1 
ATOM   1467 O  O     . VAL A 1 199 ? -26.093 5.953   6.345   1.00 13.23 ? 192 VAL A O     1 
ATOM   1468 C  CB    . VAL A 1 199 ? -24.282 8.490   7.328   1.00 12.77 ? 192 VAL A CB    1 
ATOM   1469 C  CG1   . VAL A 1 199 ? -24.407 7.505   8.496   1.00 12.06 ? 192 VAL A CG1   1 
ATOM   1470 C  CG2   . VAL A 1 199 ? -22.882 9.045   7.209   1.00 13.70 ? 192 VAL A CG2   1 
ATOM   1471 N  N     . GLY A 1 200 ? -27.105 7.902   5.903   1.00 12.83 ? 193 GLY A N     1 
ATOM   1472 C  CA    . GLY A 1 200 ? -28.460 7.264   5.813   1.00 11.46 ? 193 GLY A CA    1 
ATOM   1473 C  C     . GLY A 1 200 ? -28.438 6.169   4.802   1.00 11.70 ? 193 GLY A C     1 
ATOM   1474 O  O     . GLY A 1 200 ? -29.003 5.101   5.029   1.00 12.34 ? 193 GLY A O     1 
ATOM   1475 N  N     . ALA A 1 201 ? -27.807 6.407   3.642   1.00 11.55 ? 194 ALA A N     1 
ATOM   1476 C  CA    . ALA A 1 201 ? -27.849 5.426   2.555   1.00 11.48 ? 194 ALA A CA    1 
ATOM   1477 C  C     . ALA A 1 201 ? -27.043 4.163   2.899   1.00 11.83 ? 194 ALA A C     1 
ATOM   1478 O  O     . ALA A 1 201 ? -27.368 3.060   2.491   1.00 13.05 ? 194 ALA A O     1 
ATOM   1479 C  CB    . ALA A 1 201 ? -27.333 6.050   1.260   1.00 11.30 ? 194 ALA A CB    1 
ATOM   1480 N  N     . VAL A 1 202 ? -25.955 4.365   3.590   1.00 12.19 ? 195 VAL A N     1 
ATOM   1481 C  CA    . VAL A 1 202 ? -25.116 3.270   4.090   1.00 12.33 ? 195 VAL A CA    1 
ATOM   1482 C  C     . VAL A 1 202 ? -25.993 2.396   4.943   1.00 11.66 ? 195 VAL A C     1 
ATOM   1483 O  O     . VAL A 1 202 ? -26.021 1.179   4.746   1.00 11.40 ? 195 VAL A O     1 
ATOM   1484 C  CB    . VAL A 1 202 ? -23.942 3.785   4.875   1.00 12.54 ? 195 VAL A CB    1 
ATOM   1485 C  CG1   . VAL A 1 202 ? -23.153 2.629   5.571   1.00 13.36 ? 195 VAL A CG1   1 
ATOM   1486 C  CG2   . VAL A 1 202 ? -22.976 4.487   3.919   1.00 14.22 ? 195 VAL A CG2   1 
ATOM   1487 N  N     . ILE A 1 203 ? -26.743 3.021   5.853   1.00 11.65 ? 196 ILE A N     1 
ATOM   1488 C  CA    . ILE A 1 203 ? -27.598 2.237   6.771   1.00 12.14 ? 196 ILE A CA    1 
ATOM   1489 C  C     . ILE A 1 203 ? -28.678 1.451   5.982   1.00 12.83 ? 196 ILE A C     1 
ATOM   1490 O  O     . ILE A 1 203 ? -29.010 0.291   6.273   1.00 12.96 ? 196 ILE A O     1 
ATOM   1491 C  CB    . ILE A 1 203 ? -28.219 3.146   7.823   1.00 11.79 ? 196 ILE A CB    1 
ATOM   1492 C  CG1   . ILE A 1 203 ? -27.077 3.652   8.727   1.00 11.99 ? 196 ILE A CG1   1 
ATOM   1493 C  CG2   . ILE A 1 203 ? -29.158 2.343   8.689   1.00 11.68 ? 196 ILE A CG2   1 
ATOM   1494 C  CD1   . ILE A 1 203 ? -27.530 4.665   9.734   1.00 13.17 ? 196 ILE A CD1   1 
ATOM   1495 N  N     . VAL A 1 204 ? -29.208 2.090   4.941   1.00 12.28 ? 197 VAL A N     1 
ATOM   1496 C  CA    . VAL A 1 204 ? -30.270 1.461   4.160   1.00 11.83 ? 197 VAL A CA    1 
ATOM   1497 C  C     . VAL A 1 204 ? -29.777 0.306   3.311   1.00 11.37 ? 197 VAL A C     1 
ATOM   1498 O  O     . VAL A 1 204 ? -30.521 -0.687  3.126   1.00 10.89 ? 197 VAL A O     1 
ATOM   1499 C  CB    . VAL A 1 204 ? -31.026 2.469   3.321   1.00 10.84 ? 197 VAL A CB    1 
ATOM   1500 C  CG1   . VAL A 1 204 ? -32.076 1.744   2.491   1.00 11.24 ? 197 VAL A CG1   1 
ATOM   1501 C  CG2   . VAL A 1 204 ? -31.749 3.395   4.266   1.00 11.40 ? 197 VAL A CG2   1 
ATOM   1502 N  N     . GLU A 1 205 ? -28.545 0.407   2.846   1.00 12.16 ? 198 GLU A N     1 
ATOM   1503 C  CA    . GLU A 1 205 ? -27.835 -0.788  2.271   1.00 13.75 ? 198 GLU A CA    1 
ATOM   1504 C  C     . GLU A 1 205 ? -27.824 -2.012  3.223   1.00 14.01 ? 198 GLU A C     1 
ATOM   1505 O  O     . GLU A 1 205 ? -28.180 -3.141  2.832   1.00 12.93 ? 198 GLU A O     1 
ATOM   1506 C  CB    . GLU A 1 205 ? -26.389 -0.435  1.812   1.00 13.96 ? 198 GLU A CB    1 
ATOM   1507 C  CG    . GLU A 1 205 ? -26.292 0.582   0.652   1.00 13.88 ? 198 GLU A CG    1 
ATOM   1508 C  CD    . GLU A 1 205 ? -26.379 0.037   -0.759  1.00 14.99 ? 198 GLU A CD    1 
ATOM   1509 O  OE1   . GLU A 1 205 ? -26.772 -1.129  -0.938  1.00 15.11 ? 198 GLU A OE1   1 
ATOM   1510 O  OE2   . GLU A 1 205 ? -26.043 0.779   -1.734  1.00 14.14 ? 198 GLU A OE2   1 
ATOM   1511 N  N     . GLU A 1 206 ? -27.464 -1.752  4.463   1.00 14.13 ? 199 GLU A N     1 
ATOM   1512 C  CA    . GLU A 1 206 ? -27.389 -2.781  5.507   1.00 15.16 ? 199 GLU A CA    1 
ATOM   1513 C  C     . GLU A 1 206 ? -28.795 -3.362  5.790   1.00 13.65 ? 199 GLU A C     1 
ATOM   1514 O  O     . GLU A 1 206 ? -28.946 -4.551  5.900   1.00 12.72 ? 199 GLU A O     1 
ATOM   1515 C  CB    . GLU A 1 206 ? -26.725 -2.210  6.809   1.00 15.92 ? 199 GLU A CB    1 
ATOM   1516 C  CG    . GLU A 1 206 ? -25.208 -1.898  6.722   1.00 17.20 ? 199 GLU A CG    1 
ATOM   1517 C  CD    . GLU A 1 206 ? -24.738 -0.828  7.767   1.00 19.35 ? 199 GLU A CD    1 
ATOM   1518 O  OE1   . GLU A 1 206 ? -23.609 -0.333  7.671   1.00 21.56 ? 199 GLU A OE1   1 
ATOM   1519 O  OE2   . GLU A 1 206 ? -25.488 -0.439  8.699   1.00 18.45 ? 199 GLU A OE2   1 
ATOM   1520 N  N     . MET A 1 207 ? -29.824 -2.495  5.865   1.00 14.81 ? 200 MET A N     1 
ATOM   1521 C  CA    . MET A 1 207 ? -31.216 -2.858  6.058   0.50 13.21 ? 200 MET A CA    1 
ATOM   1522 C  C     . MET A 1 207 ? -31.700 -3.666  4.876   1.00 13.30 ? 200 MET A C     1 
ATOM   1523 O  O     . MET A 1 207 ? -32.321 -4.733  5.059   1.00 13.84 ? 200 MET A O     1 
ATOM   1524 C  CB    . MET A 1 207 ? -32.048 -1.555  6.209   0.50 13.45 ? 200 MET A CB    1 
ATOM   1525 C  CG    . MET A 1 207 ? -33.477 -1.715  6.668   0.50 14.18 ? 200 MET A CG    1 
ATOM   1526 S  SD    . MET A 1 207 ? -34.180 -0.179  7.368   0.50 16.94 ? 200 MET A SD    1 
ATOM   1527 C  CE    . MET A 1 207 ? -32.720 0.744   7.602   0.50 12.60 ? 200 MET A CE    1 
ATOM   1528 N  N     . ARG A 1 208 ? -31.412 -3.226  3.649   1.00 13.24 ? 201 ARG A N     1 
ATOM   1529 C  CA    . ARG A 1 208 ? -31.823 -3.989  2.457   1.00 14.13 ? 201 ARG A CA    1 
ATOM   1530 C  C     . ARG A 1 208 ? -31.113 -5.344  2.378   1.00 14.22 ? 201 ARG A C     1 
ATOM   1531 O  O     . ARG A 1 208 ? -31.730 -6.362  2.050   1.00 14.79 ? 201 ARG A O     1 
ATOM   1532 C  CB    . ARG A 1 208 ? -31.670 -3.140  1.156   1.00 13.70 ? 201 ARG A CB    1 
ATOM   1533 C  CG    . ARG A 1 208 ? -32.650 -1.958  1.193   1.00 13.10 ? 201 ARG A CG    1 
ATOM   1534 C  CD    . ARG A 1 208 ? -32.666 -1.149  -0.059  1.00 13.06 ? 201 ARG A CD    1 
ATOM   1535 N  NE    . ARG A 1 208 ? -32.596 -1.932  -1.236  1.00 13.10 ? 201 ARG A NE    1 
ATOM   1536 C  CZ    . ARG A 1 208 ? -31.503 -2.139  -1.963  1.00 14.67 ? 201 ARG A CZ    1 
ATOM   1537 N  NH1   . ARG A 1 208 ? -31.575 -2.963  -2.990  1.00 14.26 ? 201 ARG A NH1   1 
ATOM   1538 N  NH2   . ARG A 1 208 ? -30.350 -1.499  -1.713  1.00 16.86 ? 201 ARG A NH2   1 
ATOM   1539 N  N     . ALA A 1 209 ? -29.834 -5.394  2.770   1.00 16.09 ? 202 ALA A N     1 
ATOM   1540 C  CA    . ALA A 1 209 ? -29.076 -6.638  2.812   1.00 14.69 ? 202 ALA A CA    1 
ATOM   1541 C  C     . ALA A 1 209 ? -29.638 -7.647  3.835   1.00 14.39 ? 202 ALA A C     1 
ATOM   1542 O  O     . ALA A 1 209 ? -29.791 -8.856  3.537   1.00 14.39 ? 202 ALA A O     1 
ATOM   1543 C  CB    . ALA A 1 209 ? -27.601 -6.350  3.111   1.00 16.21 ? 202 ALA A CB    1 
ATOM   1544 N  N     . ALA A 1 210 ? -30.014 -7.139  4.994   1.00 12.54 ? 203 ALA A N     1 
ATOM   1545 C  CA    . ALA A 1 210 ? -30.626 -7.970  6.042   1.00 13.12 ? 203 ALA A CA    1 
ATOM   1546 C  C     . ALA A 1 210 ? -32.031 -8.541  5.601   1.00 12.88 ? 203 ALA A C     1 
ATOM   1547 O  O     . ALA A 1 210 ? -32.349 -9.714  5.778   1.00 13.05 ? 203 ALA A O     1 
ATOM   1548 C  CB    . ALA A 1 210 ? -30.759 -7.162  7.305   1.00 13.10 ? 203 ALA A CB    1 
ATOM   1549 N  N     . ILE A 1 211 ? -32.815 -7.705  4.951   1.00 12.58 ? 204 ILE A N     1 
ATOM   1550 C  CA    . ILE A 1 211 ? -34.094 -8.098  4.456   1.00 12.82 ? 204 ILE A CA    1 
ATOM   1551 C  C     . ILE A 1 211 ? -33.852 -9.228  3.493   1.00 13.16 ? 204 ILE A C     1 
ATOM   1552 O  O     . ILE A 1 211 ? -34.468 -10.288 3.625   1.00 12.87 ? 204 ILE A O     1 
ATOM   1553 C  CB    . ILE A 1 211 ? -34.881 -6.946  3.749   1.00 12.37 ? 204 ILE A CB    1 
ATOM   1554 C  CG1   . ILE A 1 211 ? -35.327 -5.948  4.793   1.00 13.12 ? 204 ILE A CG1   1 
ATOM   1555 C  CG2   . ILE A 1 211 ? -36.102 -7.551  3.031   1.00 11.90 ? 204 ILE A CG2   1 
ATOM   1556 C  CD1   . ILE A 1 211 ? -35.947 -4.628  4.267   1.00 13.42 ? 204 ILE A CD1   1 
ATOM   1557 N  N     . GLU A 1 212 ? -32.995 -9.007  2.511   1.00 12.97 ? 205 GLU A N     1 
ATOM   1558 C  CA    . GLU A 1 212 ? -32.824 -10.060 1.501   1.00 13.87 ? 205 GLU A CA    1 
ATOM   1559 C  C     . GLU A 1 212 ? -32.236 -11.308 2.135   1.00 14.78 ? 205 GLU A C     1 
ATOM   1560 O  O     . GLU A 1 212 ? -32.611 -12.412 1.768   1.00 16.69 ? 205 GLU A O     1 
ATOM   1561 C  CB    . GLU A 1 212 ? -31.926 -9.636  0.346   1.00 14.49 ? 205 GLU A CB    1 
ATOM   1562 C  CG    . GLU A 1 212 ? -31.712 -10.786 -0.674  1.00 17.03 ? 205 GLU A CG    1 
ATOM   1563 C  CD    . GLU A 1 212 ? -31.042 -10.307 -1.968  1.00 19.37 ? 205 GLU A CD    1 
ATOM   1564 O  OE1   . GLU A 1 212 ? -31.063 -11.012 -3.006  1.00 22.69 ? 205 GLU A OE1   1 
ATOM   1565 O  OE2   . GLU A 1 212 ? -30.500 -9.194  -1.962  1.00 18.65 ? 205 GLU A OE2   1 
ATOM   1566 N  N     . ARG A 1 213 ? -31.341 -11.161 3.109   1.00 15.04 ? 206 ARG A N     1 
ATOM   1567 C  CA    . ARG A 1 213 ? -30.630 -12.320 3.689   1.00 15.23 ? 206 ARG A CA    1 
ATOM   1568 C  C     . ARG A 1 213 ? -31.584 -13.138 4.488   1.00 14.11 ? 206 ARG A C     1 
ATOM   1569 O  O     . ARG A 1 213 ? -31.548 -14.358 4.413   1.00 14.65 ? 206 ARG A O     1 
ATOM   1570 C  CB    . ARG A 1 213 ? -29.423 -11.947 4.599   1.00 18.10 ? 206 ARG A CB    1 
ATOM   1571 C  CG    . ARG A 1 213 ? -28.710 -13.204 5.186   1.00 22.64 ? 206 ARG A CG    1 
ATOM   1572 C  CD    . ARG A 1 213 ? -27.575 -13.002 6.230   1.00 29.10 ? 206 ARG A CD    1 
ATOM   1573 N  NE    . ARG A 1 213 ? -28.005 -12.681 7.618   1.00 31.26 ? 206 ARG A NE    1 
ATOM   1574 C  CZ    . ARG A 1 213 ? -28.538 -13.538 8.492   1.00 30.45 ? 206 ARG A CZ    1 
ATOM   1575 N  NH1   . ARG A 1 213 ? -28.912 -13.112 9.714   1.00 29.80 ? 206 ARG A NH1   1 
ATOM   1576 N  NH2   . ARG A 1 213 ? -28.714 -14.791 8.151   1.00 28.24 ? 206 ARG A NH2   1 
ATOM   1577 N  N     . GLU A 1 214 ? -32.443 -12.459 5.233   1.00 12.75 ? 207 GLU A N     1 
ATOM   1578 C  CA    . GLU A 1 214 ? -33.337 -13.089 6.173   1.00 11.24 ? 207 GLU A CA    1 
ATOM   1579 C  C     . GLU A 1 214 ? -34.692 -13.556 5.596   1.00 11.08 ? 207 GLU A C     1 
ATOM   1580 O  O     . GLU A 1 214 ? -35.430 -14.308 6.272   1.00 9.77  ? 207 GLU A O     1 
ATOM   1581 C  CB    . GLU A 1 214 ? -33.481 -12.193 7.380   1.00 11.65 ? 207 GLU A CB    1 
ATOM   1582 C  CG    . GLU A 1 214 ? -32.152 -12.014 8.098   1.00 12.97 ? 207 GLU A CG    1 
ATOM   1583 C  CD    . GLU A 1 214 ? -32.207 -11.061 9.284   1.00 15.70 ? 207 GLU A CD    1 
ATOM   1584 O  OE1   . GLU A 1 214 ? -33.217 -11.034 9.998   1.00 16.75 ? 207 GLU A OE1   1 
ATOM   1585 O  OE2   . GLU A 1 214 ? -31.208 -10.334 9.504   1.00 15.42 ? 207 GLU A OE2   1 
ATOM   1586 N  N     . THR A 1 215 ? -35.065 -13.017 4.416   1.00 10.59 ? 208 THR A N     1 
ATOM   1587 C  CA    . THR A 1 215 ? -36.339 -13.353 3.821   1.00 10.19 ? 208 THR A CA    1 
ATOM   1588 C  C     . THR A 1 215 ? -36.305 -13.918 2.452   1.00 11.43 ? 208 THR A C     1 
ATOM   1589 O  O     . THR A 1 215 ? -37.235 -14.623 2.096   1.00 12.76 ? 208 THR A O     1 
ATOM   1590 C  CB    . THR A 1 215 ? -37.324 -12.193 3.875   1.00 9.84  ? 208 THR A CB    1 
ATOM   1591 O  OG1   . THR A 1 215 ? -36.985 -11.194 2.911   1.00 8.59  ? 208 THR A OG1   1 
ATOM   1592 C  CG2   . THR A 1 215 ? -37.318 -11.650 5.291   1.00 9.82  ? 208 THR A CG2   1 
ATOM   1593 N  N     . GLY A 1 216 ? -35.217 -13.717 1.741   1.00 13.32 ? 209 GLY A N     1 
ATOM   1594 C  CA    . GLY A 1 216 ? -35.130 -13.991 0.303   1.00 14.52 ? 209 GLY A CA    1 
ATOM   1595 C  C     . GLY A 1 216 ? -35.804 -12.918 -0.554  1.00 14.68 ? 209 GLY A C     1 
ATOM   1596 O  O     . GLY A 1 216 ? -35.877 -13.077 -1.735  1.00 16.03 ? 209 GLY A O     1 
ATOM   1597 N  N     . PHE A 1 217 ? -36.313 -11.843 0.046   1.00 13.64 ? 210 PHE A N     1 
ATOM   1598 C  CA    . PHE A 1 217 ? -37.060 -10.810 -0.720  1.00 12.73 ? 210 PHE A CA    1 
ATOM   1599 C  C     . PHE A 1 217 ? -36.127 -9.668  -1.004  1.00 13.00 ? 210 PHE A C     1 
ATOM   1600 O  O     . PHE A 1 217 ? -35.384 -9.284  -0.125  1.00 14.21 ? 210 PHE A O     1 
ATOM   1601 C  CB    . PHE A 1 217 ? -38.280 -10.264 0.023   1.00 12.52 ? 210 PHE A CB    1 
ATOM   1602 C  CG    . PHE A 1 217 ? -39.304 -11.317 0.413   1.00 12.00 ? 210 PHE A CG    1 
ATOM   1603 C  CD1   . PHE A 1 217 ? -39.640 -12.351 -0.470  1.00 12.26 ? 210 PHE A CD1   1 
ATOM   1604 C  CD2   . PHE A 1 217 ? -39.971 -11.238 1.643   1.00 11.46 ? 210 PHE A CD2   1 
ATOM   1605 C  CE1   . PHE A 1 217 ? -40.582 -13.292 -0.110  1.00 12.88 ? 210 PHE A CE1   1 
ATOM   1606 C  CE2   . PHE A 1 217 ? -40.918 -12.174 1.990   1.00 11.81 ? 210 PHE A CE2   1 
ATOM   1607 C  CZ    . PHE A 1 217 ? -41.212 -13.214 1.139   1.00 11.88 ? 210 PHE A CZ    1 
ATOM   1608 N  N     . GLN A 1 218 ? -36.114 -9.232  -2.269  1.00 11.96 ? 211 GLN A N     1 
ATOM   1609 C  CA    . GLN A 1 218 ? -35.487 -7.978  -2.728  1.00 11.92 ? 211 GLN A CA    1 
ATOM   1610 C  C     . GLN A 1 218 ? -36.444 -6.757  -2.648  1.00 10.93 ? 211 GLN A C     1 
ATOM   1611 O  O     . GLN A 1 218 ? -37.709 -6.892  -2.751  1.00 11.02 ? 211 GLN A O     1 
ATOM   1612 C  CB    . GLN A 1 218 ? -35.006 -8.165  -4.173  1.00 13.02 ? 211 GLN A CB    1 
ATOM   1613 C  CG    . GLN A 1 218 ? -33.700 -8.959  -4.196  1.00 13.70 ? 211 GLN A CG    1 
ATOM   1614 C  CD    . GLN A 1 218 ? -33.164 -9.182  -5.605  1.00 15.34 ? 211 GLN A CD    1 
ATOM   1615 O  OE1   . GLN A 1 218 ? -33.796 -8.831  -6.581  1.00 18.37 ? 211 GLN A OE1   1 
ATOM   1616 N  NE2   . GLN A 1 218 ? -32.010 -9.787  -5.691  1.00 16.33 ? 211 GLN A NE2   1 
ATOM   1617 N  N     . CYS A 1 219 ? -35.867 -5.610  -2.374  1.00 11.27 ? 212 CYS A N     1 
ATOM   1618 C  CA    . CYS A 1 219 ? -36.570 -4.330  -2.348  1.00 11.64 ? 212 CYS A CA    1 
ATOM   1619 C  C     . CYS A 1 219 ? -35.705 -3.214  -2.841  1.00 11.61 ? 212 CYS A C     1 
ATOM   1620 O  O     . CYS A 1 219 ? -34.481 -3.375  -3.030  1.00 12.10 ? 212 CYS A O     1 
ATOM   1621 C  CB    . CYS A 1 219 ? -36.976 -4.008  -0.929  1.00 13.11 ? 212 CYS A CB    1 
ATOM   1622 S  SG    . CYS A 1 219 ? -35.594 -4.036  0.218   1.00 15.19 ? 212 CYS A SG    1 
ATOM   1623 N  N     . SER A 1 220 ? -36.345 -2.065  -2.985  1.00 11.59 ? 213 SER A N     1 
ATOM   1624 C  CA    . SER A 1 220 ? -35.748 -0.810  -3.364  1.00 11.63 ? 213 SER A CA    1 
ATOM   1625 C  C     . SER A 1 220 ? -35.991 0.168   -2.234  1.00 11.50 ? 213 SER A C     1 
ATOM   1626 O  O     . SER A 1 220 ? -36.875 -0.084  -1.399  1.00 11.40 ? 213 SER A O     1 
ATOM   1627 C  CB    . SER A 1 220 ? -36.369 -0.337  -4.676  1.00 11.83 ? 213 SER A CB    1 
ATOM   1628 O  OG    . SER A 1 220 ? -36.105 -1.322  -5.686  1.00 11.86 ? 213 SER A OG    1 
ATOM   1629 N  N     . ALA A 1 221 ? -35.243 1.261   -2.196  1.00 11.16 ? 214 ALA A N     1 
ATOM   1630 C  CA    . ALA A 1 221 ? -35.510 2.344   -1.251  1.00 10.62 ? 214 ALA A CA    1 
ATOM   1631 C  C     . ALA A 1 221 ? -35.135 3.676   -1.793  1.00 11.76 ? 214 ALA A C     1 
ATOM   1632 O  O     . ALA A 1 221 ? -34.311 3.787   -2.702  1.00 11.63 ? 214 ALA A O     1 
ATOM   1633 C  CB    . ALA A 1 221 ? -34.790 2.174   0.073   1.00 11.18 ? 214 ALA A CB    1 
ATOM   1634 N  N     . GLY A 1 222 ? -35.783 4.693   -1.219  1.00 11.36 ? 215 GLY A N     1 
ATOM   1635 C  CA    . GLY A 1 222 ? -35.387 6.065   -1.412  1.00 11.27 ? 215 GLY A CA    1 
ATOM   1636 C  C     . GLY A 1 222 ? -34.846 6.588   -0.089  1.00 11.63 ? 215 GLY A C     1 
ATOM   1637 O  O     . GLY A 1 222 ? -35.402 6.283   1.012   1.00 10.21 ? 215 GLY A O     1 
ATOM   1638 N  N     . ILE A 1 223 ? -33.813 7.414   -0.180  1.00 11.18 ? 216 ILE A N     1 
ATOM   1639 C  CA    . ILE A 1 223 ? -33.295 8.148   0.982   1.00 10.71 ? 216 ILE A CA    1 
ATOM   1640 C  C     . ILE A 1 223 ? -33.318 9.597   0.722   1.00 10.42 ? 216 ILE A C     1 
ATOM   1641 O  O     . ILE A 1 223 ? -32.750 10.067  -0.258  1.00 9.52  ? 216 ILE A O     1 
ATOM   1642 C  CB    . ILE A 1 223 ? -31.879 7.694   1.351   1.00 12.33 ? 216 ILE A CB    1 
ATOM   1643 C  CG1   . ILE A 1 223 ? -31.842 6.158   1.476   1.00 13.73 ? 216 ILE A CG1   1 
ATOM   1644 C  CG2   . ILE A 1 223 ? -31.424 8.447   2.621   1.00 12.92 ? 216 ILE A CG2   1 
ATOM   1645 C  CD1   . ILE A 1 223 ? -31.441 5.401   0.186   1.00 13.52 ? 216 ILE A CD1   1 
ATOM   1646 N  N     . SER A 1 224 ? -33.989 10.356  1.576   1.00 10.91 ? 217 SER A N     1 
ATOM   1647 C  CA    . SER A 1 224 ? -34.021 11.792  1.405   1.00 11.18 ? 217 SER A CA    1 
ATOM   1648 C  C     . SER A 1 224 ? -34.329 12.490  2.741   1.00 11.77 ? 217 SER A C     1 
ATOM   1649 O  O     . SER A 1 224 ? -34.049 11.904  3.815   1.00 11.31 ? 217 SER A O     1 
ATOM   1650 C  CB    . SER A 1 224 ? -35.009 12.131  0.312   1.00 11.67 ? 217 SER A CB    1 
ATOM   1651 O  OG    . SER A 1 224 ? -34.920 13.470  -0.041  1.00 11.40 ? 217 SER A OG    1 
ATOM   1652 N  N     . HIS A 1 225 ? -34.808 13.747  2.697   1.00 11.15 ? 218 HIS A N     1 
ATOM   1653 C  CA    . HIS A 1 225 ? -35.073 14.511  3.911   1.00 11.14 ? 218 HIS A CA    1 
ATOM   1654 C  C     . HIS A 1 225 ? -36.531 14.409  4.433   1.00 10.72 ? 218 HIS A C     1 
ATOM   1655 O  O     . HIS A 1 225 ? -36.855 14.891  5.478   1.00 10.02 ? 218 HIS A O     1 
ATOM   1656 C  CB    . HIS A 1 225 ? -34.669 15.976  3.763   1.00 11.02 ? 218 HIS A CB    1 
ATOM   1657 C  CG    . HIS A 1 225 ? -33.190 16.172  3.685   1.00 11.67 ? 218 HIS A CG    1 
ATOM   1658 N  ND1   . HIS A 1 225 ? -32.343 15.809  4.710   1.00 11.25 ? 218 HIS A ND1   1 
ATOM   1659 C  CD2   . HIS A 1 225 ? -32.401 16.673  2.697   1.00 11.84 ? 218 HIS A CD2   1 
ATOM   1660 C  CE1   . HIS A 1 225 ? -31.101 16.054  4.357   1.00 12.08 ? 218 HIS A CE1   1 
ATOM   1661 N  NE2   . HIS A 1 225 ? -31.112 16.606  3.146   1.00 12.62 ? 218 HIS A NE2   1 
ATOM   1662 N  N     . ASN A 1 226 ? -37.425 13.786  3.674   1.00 10.50 ? 219 ASN A N     1 
ATOM   1663 C  CA    . ASN A 1 226 ? -38.811 13.704  4.069   1.00 11.03 ? 219 ASN A CA    1 
ATOM   1664 C  C     . ASN A 1 226 ? -39.480 12.529  3.326   1.00 11.56 ? 219 ASN A C     1 
ATOM   1665 O  O     . ASN A 1 226 ? -38.868 11.901  2.433   1.00 13.02 ? 219 ASN A O     1 
ATOM   1666 C  CB    . ASN A 1 226 ? -39.542 15.034  3.781   1.00 11.27 ? 219 ASN A CB    1 
ATOM   1667 C  CG    . ASN A 1 226 ? -39.473 15.448  2.308   1.00 11.92 ? 219 ASN A CG    1 
ATOM   1668 O  OD1   . ASN A 1 226 ? -40.010 14.753  1.427   1.00 11.52 ? 219 ASN A OD1   1 
ATOM   1669 N  ND2   . ASN A 1 226 ? -38.834 16.607  2.036   1.00 12.62 ? 219 ASN A ND2   1 
ATOM   1670 N  N     . LYS A 1 227 ? -40.684 12.197  3.727   1.00 11.86 ? 220 LYS A N     1 
ATOM   1671 C  CA    . LYS A 1 227 ? -41.395 11.063  3.187   1.00 12.84 ? 220 LYS A CA    1 
ATOM   1672 C  C     . LYS A 1 227 ? -41.655 11.179  1.712   1.00 12.97 ? 220 LYS A C     1 
ATOM   1673 O  O     . LYS A 1 227 ? -41.470 10.202  0.978   1.00 14.73 ? 220 LYS A O     1 
ATOM   1674 C  CB    . LYS A 1 227 ? -42.752 10.844  3.960   1.00 13.25 ? 220 LYS A CB    1 
ATOM   1675 C  CG    . LYS A 1 227 ? -42.457 10.544  5.437   1.00 14.57 ? 220 LYS A CG    1 
ATOM   1676 C  CD    . LYS A 1 227 ? -43.622 9.948   6.220   1.00 17.37 ? 220 LYS A CD    1 
ATOM   1677 C  CE    . LYS A 1 227 ? -44.862 10.741  6.232   1.00 17.06 ? 220 LYS A CE    1 
ATOM   1678 N  NZ    . LYS A 1 227 ? -45.877 9.912   6.996   1.00 18.12 ? 220 LYS A NZ    1 
ATOM   1679 N  N     . VAL A 1 228 ? -42.242 12.298  1.287   1.00 13.78 ? 221 VAL A N     1 
ATOM   1680 C  CA    . VAL A 1 228 ? -42.610 12.471  -0.112  1.00 13.08 ? 221 VAL A CA    1 
ATOM   1681 C  C     . VAL A 1 228 ? -41.393 12.248  -1.054  1.00 12.95 ? 221 VAL A C     1 
ATOM   1682 O  O     . VAL A 1 228 ? -41.461 11.433  -1.986  1.00 14.94 ? 221 VAL A O     1 
ATOM   1683 C  CB    . VAL A 1 228 ? -43.270 13.832  -0.363  1.00 13.72 ? 221 VAL A CB    1 
ATOM   1684 C  CG1   . VAL A 1 228 ? -43.336 14.127  -1.833  1.00 14.03 ? 221 VAL A CG1   1 
ATOM   1685 C  CG2   . VAL A 1 228 ? -44.697 13.837  0.227   1.00 14.61 ? 221 VAL A CG2   1 
ATOM   1686 N  N     . LEU A 1 229 ? -40.281 12.885  -0.756  1.00 12.30 ? 222 LEU A N     1 
ATOM   1687 C  CA    . LEU A 1 229 ? -39.038 12.683  -1.528  1.00 12.28 ? 222 LEU A CA    1 
ATOM   1688 C  C     . LEU A 1 229 ? -38.480 11.285  -1.449  1.00 11.50 ? 222 LEU A C     1 
ATOM   1689 O  O     . LEU A 1 229 ? -38.006 10.769  -2.462  1.00 10.30 ? 222 LEU A O     1 
ATOM   1690 C  CB    . LEU A 1 229 ? -37.933 13.676  -1.197  1.00 12.92 ? 222 LEU A CB    1 
ATOM   1691 C  CG    . LEU A 1 229 ? -38.192 15.124  -1.655  1.00 13.75 ? 222 LEU A CG    1 
ATOM   1692 C  CD1   . LEU A 1 229 ? -37.020 15.985  -1.284  1.00 14.95 ? 222 LEU A CD1   1 
ATOM   1693 C  CD2   . LEU A 1 229 ? -38.445 15.321  -3.137  1.00 14.86 ? 222 LEU A CD2   1 
ATOM   1694 N  N     . ALA A 1 230 ? -38.529 10.689  -0.258  1.00 10.78 ? 223 ALA A N     1 
ATOM   1695 C  CA    . ALA A 1 230 ? -38.106 9.334   -0.076  1.00 10.78 ? 223 ALA A CA    1 
ATOM   1696 C  C     . ALA A 1 230 ? -38.916 8.374   -0.946  1.00 11.06 ? 223 ALA A C     1 
ATOM   1697 O  O     . ALA A 1 230 ? -38.337 7.526   -1.613  1.00 11.83 ? 223 ALA A O     1 
ATOM   1698 C  CB    . ALA A 1 230 ? -38.202 8.953   1.384   1.00 10.88 ? 223 ALA A CB    1 
ATOM   1699 N  N     . LYS A 1 231 ? -40.223 8.510   -0.950  1.00 11.27 ? 224 LYS A N     1 
ATOM   1700 C  CA    . LYS A 1 231 ? -41.115 7.693   -1.799  1.00 12.56 ? 224 LYS A CA    1 
ATOM   1701 C  C     . LYS A 1 231 ? -40.836 7.923   -3.302  1.00 13.21 ? 224 LYS A C     1 
ATOM   1702 O  O     . LYS A 1 231 ? -40.683 6.993   -4.051  1.00 13.37 ? 224 LYS A O     1 
ATOM   1703 C  CB    . LYS A 1 231 ? -42.582 8.026   -1.468  1.00 12.71 ? 224 LYS A CB    1 
ATOM   1704 C  CG    . LYS A 1 231 ? -43.640 7.304   -2.288  1.00 14.81 ? 224 LYS A CG    1 
ATOM   1705 C  CD    . LYS A 1 231 ? -43.513 5.780   -2.262  1.00 16.93 ? 224 LYS A CD    1 
ATOM   1706 C  CE    . LYS A 1 231 ? -44.676 5.084   -2.986  1.00 19.85 ? 224 LYS A CE    1 
ATOM   1707 N  NZ    . LYS A 1 231 ? -44.609 3.586   -3.012  1.00 20.66 ? 224 LYS A NZ    1 
ATOM   1708 N  N     . LEU A 1 232 ? -40.703 9.180   -3.722  1.00 14.26 ? 225 LEU A N     1 
ATOM   1709 C  CA    . LEU A 1 232 ? -40.367 9.456   -5.108  1.00 13.20 ? 225 LEU A CA    1 
ATOM   1710 C  C     . LEU A 1 232 ? -39.055 8.829   -5.498  1.00 12.74 ? 225 LEU A C     1 
ATOM   1711 O  O     . LEU A 1 232 ? -38.963 8.163   -6.497  1.00 12.71 ? 225 LEU A O     1 
ATOM   1712 C  CB    . LEU A 1 232 ? -40.286 10.967  -5.304  1.00 13.29 ? 225 LEU A CB    1 
ATOM   1713 C  CG    . LEU A 1 232 ? -40.193 11.451  -6.717  1.00 13.42 ? 225 LEU A CG    1 
ATOM   1714 C  CD1   . LEU A 1 232 ? -41.410 10.972  -7.484  1.00 13.04 ? 225 LEU A CD1   1 
ATOM   1715 C  CD2   . LEU A 1 232 ? -39.977 12.968  -6.777  1.00 13.27 ? 225 LEU A CD2   1 
ATOM   1716 N  N     . ALA A 1 233 ? -38.038 9.008   -4.674  1.00 11.68 ? 226 ALA A N     1 
ATOM   1717 C  CA    . ALA A 1 233 ? -36.696 8.440   -4.936  1.00 11.18 ? 226 ALA A CA    1 
ATOM   1718 C  C     . ALA A 1 233 ? -36.659 6.920   -5.121  1.00 11.48 ? 226 ALA A C     1 
ATOM   1719 O  O     . ALA A 1 233 ? -35.940 6.346   -6.033  1.00 10.04 ? 226 ALA A O     1 
ATOM   1720 C  CB    . ALA A 1 233 ? -35.755 8.839   -3.824  1.00 10.30 ? 226 ALA A CB    1 
ATOM   1721 N  N     . CYS A 1 234 ? -37.444 6.271   -4.274  1.00 11.74 ? 227 CYS A N     1 
ATOM   1722 C  CA    . CYS A 1 234 ? -37.516 4.804   -4.295  1.00 13.20 ? 227 CYS A CA    1 
ATOM   1723 C  C     . CYS A 1 234 ? -37.834 4.261   -5.687  1.00 12.55 ? 227 CYS A C     1 
ATOM   1724 O  O     . CYS A 1 234 ? -37.178 3.323   -6.225  1.00 15.38 ? 227 CYS A O     1 
ATOM   1725 C  CB    . CYS A 1 234 ? -38.614 4.351   -3.331  1.00 12.50 ? 227 CYS A CB    1 
ATOM   1726 S  SG    . CYS A 1 234 ? -38.671 2.565   -3.123  1.00 13.83 ? 227 CYS A SG    1 
ATOM   1727 N  N     . GLY A 1 235 ? -38.827 4.858   -6.285  1.00 12.50 ? 228 GLY A N     1 
ATOM   1728 C  CA    . GLY A 1 235 ? -39.275 4.404   -7.572  1.00 13.58 ? 228 GLY A CA    1 
ATOM   1729 C  C     . GLY A 1 235 ? -38.368 4.831   -8.709  1.00 14.30 ? 228 GLY A C     1 
ATOM   1730 O  O     . GLY A 1 235 ? -38.600 4.411   -9.814  1.00 14.15 ? 228 GLY A O     1 
ATOM   1731 N  N     . LEU A 1 236 ? -37.336 5.645   -8.481  1.00 14.40 ? 229 LEU A N     1 
ATOM   1732 C  CA    . LEU A 1 236 ? -36.513 6.097   -9.619  1.00 13.44 ? 229 LEU A CA    1 
ATOM   1733 C  C     . LEU A 1 236 ? -35.651 4.981   -10.219 1.00 14.85 ? 229 LEU A C     1 
ATOM   1734 O  O     . LEU A 1 236 ? -35.355 5.014   -11.410 1.00 13.78 ? 229 LEU A O     1 
ATOM   1735 C  CB    . LEU A 1 236 ? -35.646 7.273   -9.239  1.00 14.08 ? 229 LEU A CB    1 
ATOM   1736 C  CG    . LEU A 1 236 ? -36.430 8.517   -8.816  1.00 13.95 ? 229 LEU A CG    1 
ATOM   1737 C  CD1   . LEU A 1 236 ? -35.485 9.584   -8.379  1.00 13.92 ? 229 LEU A CD1   1 
ATOM   1738 C  CD2   . LEU A 1 236 ? -37.314 8.949   -9.964  1.00 14.69 ? 229 LEU A CD2   1 
ATOM   1739 N  N     . ASN A 1 237 ? -35.241 4.000   -9.429  1.00 13.76 ? 230 ASN A N     1 
ATOM   1740 C  CA    . ASN A 1 237 ? -34.341 2.942   -9.920  1.00 15.62 ? 230 ASN A CA    1 
ATOM   1741 C  C     . ASN A 1 237 ? -34.745 1.548   -9.438  1.00 17.67 ? 230 ASN A C     1 
ATOM   1742 O  O     . ASN A 1 237 ? -33.923 0.684   -9.242  1.00 20.60 ? 230 ASN A O     1 
ATOM   1743 C  CB    . ASN A 1 237 ? -32.881 3.253   -9.521  1.00 13.66 ? 230 ASN A CB    1 
ATOM   1744 C  CG    . ASN A 1 237 ? -32.352 4.496   -10.208 1.00 14.43 ? 230 ASN A CG    1 
ATOM   1745 O  OD1   . ASN A 1 237 ? -31.947 4.422   -11.410 1.00 12.77 ? 230 ASN A OD1   1 
ATOM   1746 N  ND2   . ASN A 1 237 ? -32.296 5.645   -9.463  1.00 13.51 ? 230 ASN A ND2   1 
ATOM   1747 N  N     . LYS A 1 238 ? -36.018 1.297   -9.368  1.00 21.30 ? 231 LYS A N     1 
ATOM   1748 C  CA    . LYS A 1 238 ? -36.522 -0.063  -9.172  1.00 21.91 ? 231 LYS A CA    1 
ATOM   1749 C  C     . LYS A 1 238 ? -36.138 -0.929  -10.332 1.00 19.65 ? 231 LYS A C     1 
ATOM   1750 O  O     . LYS A 1 238 ? -36.162 -0.478  -11.403 1.00 21.51 ? 231 LYS A O     1 
ATOM   1751 C  CB    . LYS A 1 238 ? -38.050 -0.041  -9.084  1.00 24.15 ? 231 LYS A CB    1 
ATOM   1752 C  CG    . LYS A 1 238 ? -38.583 0.332   -7.720  1.00 25.48 ? 231 LYS A CG    1 
ATOM   1753 C  CD    . LYS A 1 238 ? -40.065 -0.044  -7.527  1.00 23.04 ? 231 LYS A CD    1 
ATOM   1754 C  CE    . LYS A 1 238 ? -40.363 -0.187  -6.015  1.00 21.48 ? 231 LYS A CE    1 
ATOM   1755 N  NZ    . LYS A 1 238 ? -40.126 -1.500  -5.355  1.00 19.16 ? 231 LYS A NZ    1 
ATOM   1756 N  N     . PRO A 1 239 ? -35.899 -2.223  -10.139 1.00 18.06 ? 232 PRO A N     1 
ATOM   1757 C  CA    . PRO A 1 239 ? -35.981 -3.026  -8.935  1.00 17.00 ? 232 PRO A CA    1 
ATOM   1758 C  C     . PRO A 1 239 ? -34.594 -3.156  -8.318  1.00 15.44 ? 232 PRO A C     1 
ATOM   1759 O  O     . PRO A 1 239 ? -33.612 -2.896  -8.969  1.00 14.18 ? 232 PRO A O     1 
ATOM   1760 C  CB    . PRO A 1 239 ? -36.438 -4.402  -9.503  1.00 17.61 ? 232 PRO A CB    1 
ATOM   1761 C  CG    . PRO A 1 239 ? -35.727 -4.471  -10.792 1.00 18.89 ? 232 PRO A CG    1 
ATOM   1762 C  CD    . PRO A 1 239 ? -35.905 -3.078  -11.342 1.00 19.27 ? 232 PRO A CD    1 
ATOM   1763 N  N     . ASN A 1 240 ? -34.546 -3.537  -7.050  1.00 14.82 ? 233 ASN A N     1 
ATOM   1764 C  CA    . ASN A 1 240 ? -33.339 -3.915  -6.364  1.00 13.88 ? 233 ASN A CA    1 
ATOM   1765 C  C     . ASN A 1 240 ? -32.199 -2.925  -6.280  1.00 14.14 ? 233 ASN A C     1 
ATOM   1766 O  O     . ASN A 1 240 ? -31.048 -3.335  -6.400  1.00 15.43 ? 233 ASN A O     1 
ATOM   1767 C  CB    . ASN A 1 240 ? -32.809 -5.241  -6.957  1.00 15.29 ? 233 ASN A CB    1 
ATOM   1768 C  CG    . ASN A 1 240 ? -31.860 -5.933  -6.034  1.00 16.21 ? 233 ASN A CG    1 
ATOM   1769 O  OD1   . ASN A 1 240 ? -32.022 -5.897  -4.809  1.00 16.13 ? 233 ASN A OD1   1 
ATOM   1770 N  ND2   . ASN A 1 240 ? -30.809 -6.474  -6.598  1.00 18.09 ? 233 ASN A ND2   1 
ATOM   1771 N  N     . ARG A 1 241 ? -32.532 -1.639  -6.151  1.00 14.36 ? 234 ARG A N     1 
ATOM   1772 C  CA    . ARG A 1 241 ? -31.618 -0.510  -6.083  1.00 14.32 ? 234 ARG A CA    1 
ATOM   1773 C  C     . ARG A 1 241 ? -32.183 0.562   -5.158  1.00 12.91 ? 234 ARG A C     1 
ATOM   1774 O  O     . ARG A 1 241 ? -33.375 0.601   -4.884  1.00 12.43 ? 234 ARG A O     1 
ATOM   1775 C  CB    . ARG A 1 241 ? -31.338 0.117   -7.487  1.00 16.74 ? 234 ARG A CB    1 
ATOM   1776 C  CG    . ARG A 1 241 ? -30.729 -0.843  -8.528  1.00 17.39 ? 234 ARG A CG    1 
ATOM   1777 C  CD    . ARG A 1 241 ? -29.282 -1.072  -8.119  1.00 21.11 ? 234 ARG A CD    1 
ATOM   1778 N  NE    . ARG A 1 241 ? -28.490 -1.861  -9.056  1.00 23.57 ? 234 ARG A NE    1 
ATOM   1779 C  CZ    . ARG A 1 241 ? -28.483 -3.191  -9.103  1.00 26.82 ? 234 ARG A CZ    1 
ATOM   1780 N  NH1   . ARG A 1 241 ? -29.229 -3.914  -8.272  1.00 25.81 ? 234 ARG A NH1   1 
ATOM   1781 N  NH2   . ARG A 1 241 ? -27.714 -3.802  -9.989  1.00 28.79 ? 234 ARG A NH2   1 
ATOM   1782 N  N     . GLN A 1 242 ? -31.330 1.451   -4.673  1.00 12.13 ? 235 GLN A N     1 
ATOM   1783 C  CA    . GLN A 1 242 ? -31.776 2.505   -3.779  1.00 12.13 ? 235 GLN A CA    1 
ATOM   1784 C  C     . GLN A 1 242 ? -31.285 3.812   -4.321  1.00 12.23 ? 235 GLN A C     1 
ATOM   1785 O  O     . GLN A 1 242 ? -30.291 3.825   -5.000  1.00 12.68 ? 235 GLN A O     1 
ATOM   1786 C  CB    . GLN A 1 242 ? -31.305 2.303   -2.347  1.00 11.57 ? 235 GLN A CB    1 
ATOM   1787 C  CG    . GLN A 1 242 ? -29.807 2.123   -2.139  1.00 11.80 ? 235 GLN A CG    1 
ATOM   1788 C  CD    . GLN A 1 242 ? -29.500 1.787   -0.691  1.00 11.61 ? 235 GLN A CD    1 
ATOM   1789 O  OE1   . GLN A 1 242 ? -29.936 0.737   -0.139  1.00 12.43 ? 235 GLN A OE1   1 
ATOM   1790 N  NE2   . GLN A 1 242 ? -28.785 2.646   -0.062  1.00 11.50 ? 235 GLN A NE2   1 
ATOM   1791 N  N     . THR A 1 243 ? -32.061 4.875   -4.052  1.00 12.53 ? 236 THR A N     1 
ATOM   1792 C  CA    . THR A 1 243 ? -31.820 6.150   -4.625  1.00 11.98 ? 236 THR A CA    1 
ATOM   1793 C  C     . THR A 1 243 ? -31.782 7.239   -3.599  1.00 11.50 ? 236 THR A C     1 
ATOM   1794 O  O     . THR A 1 243 ? -32.741 7.407   -2.843  1.00 11.38 ? 236 THR A O     1 
ATOM   1795 C  CB    . THR A 1 243 ? -32.875 6.445   -5.677  1.00 12.04 ? 236 THR A CB    1 
ATOM   1796 O  OG1   . THR A 1 243 ? -32.813 5.396   -6.638  1.00 11.95 ? 236 THR A OG1   1 
ATOM   1797 C  CG2   . THR A 1 243 ? -32.569 7.711   -6.368  1.00 11.83 ? 236 THR A CG2   1 
ATOM   1798 N  N     . LEU A 1 244 ? -30.680 8.003   -3.630  1.00 10.27 ? 237 LEU A N     1 
ATOM   1799 C  CA    . LEU A 1 244 ? -30.485 9.172   -2.796  1.00 11.00 ? 237 LEU A CA    1 
ATOM   1800 C  C     . LEU A 1 244 ? -30.833 10.462  -3.521  1.00 11.69 ? 237 LEU A C     1 
ATOM   1801 O  O     . LEU A 1 244 ? -30.186 10.788  -4.564  1.00 12.55 ? 237 LEU A O     1 
ATOM   1802 C  CB    . LEU A 1 244 ? -29.077 9.187   -2.249  1.00 10.64 ? 237 LEU A CB    1 
ATOM   1803 C  CG    . LEU A 1 244 ? -28.682 10.301  -1.271  1.00 10.88 ? 237 LEU A CG    1 
ATOM   1804 C  CD1   . LEU A 1 244 ? -27.408 9.819   -0.589  1.00 9.99  ? 237 LEU A CD1   1 
ATOM   1805 C  CD2   . LEU A 1 244 ? -28.551 11.708  -1.829  1.00 10.48 ? 237 LEU A CD2   1 
ATOM   1806 N  N     . VAL A 1 245 ? -31.896 11.140  -3.006  1.00 11.75 ? 238 VAL A N     1 
ATOM   1807 C  CA    . VAL A 1 245 ? -32.379 12.430  -3.504  1.00 11.90 ? 238 VAL A CA    1 
ATOM   1808 C  C     . VAL A 1 245 ? -32.011 13.522  -2.507  1.00 12.67 ? 238 VAL A C     1 
ATOM   1809 O  O     . VAL A 1 245 ? -32.623 13.647  -1.443  1.00 11.78 ? 238 VAL A O     1 
ATOM   1810 C  CB    . VAL A 1 245 ? -33.871 12.409  -3.830  1.00 12.14 ? 238 VAL A CB    1 
ATOM   1811 C  CG1   . VAL A 1 245 ? -34.444 13.781  -4.047  1.00 11.63 ? 238 VAL A CG1   1 
ATOM   1812 C  CG2   . VAL A 1 245 ? -34.101 11.603  -5.085  1.00 11.96 ? 238 VAL A CG2   1 
ATOM   1813 N  N     . SER A 1 246 ? -30.941 14.264  -2.829  1.00 12.20 ? 239 SER A N     1 
ATOM   1814 C  CA    . SER A 1 246 ? -30.403 15.332  -1.909  1.00 12.05 ? 239 SER A CA    1 
ATOM   1815 C  C     . SER A 1 246 ? -31.280 16.551  -2.053  1.00 11.47 ? 239 SER A C     1 
ATOM   1816 O  O     . SER A 1 246 ? -32.045 16.654  -3.045  1.00 10.82 ? 239 SER A O     1 
ATOM   1817 C  CB    . SER A 1 246 ? -29.000 15.732  -2.340  1.00 12.68 ? 239 SER A CB    1 
ATOM   1818 O  OG    . SER A 1 246 ? -29.053 16.269  -3.639  1.00 12.67 ? 239 SER A OG    1 
ATOM   1819 N  N     . HIS A 1 247 ? -31.133 17.514  -1.143  1.00 11.75 ? 240 HIS A N     1 
ATOM   1820 C  CA    . HIS A 1 247 ? -31.914 18.770  -1.245  1.00 12.47 ? 240 HIS A CA    1 
ATOM   1821 C  C     . HIS A 1 247 ? -31.551 19.533  -2.545  1.00 12.57 ? 240 HIS A C     1 
ATOM   1822 O  O     . HIS A 1 247 ? -32.414 20.039  -3.283  1.00 10.74 ? 240 HIS A O     1 
ATOM   1823 C  CB    . HIS A 1 247 ? -31.780 19.643  0.019   1.00 13.61 ? 240 HIS A CB    1 
ATOM   1824 C  CG    . HIS A 1 247 ? -32.539 20.929  -0.057  1.00 15.29 ? 240 HIS A CG    1 
ATOM   1825 N  ND1   . HIS A 1 247 ? -33.893 20.998  0.169   1.00 18.29 ? 240 HIS A ND1   1 
ATOM   1826 C  CD2   . HIS A 1 247 ? -32.145 22.190  -0.367  1.00 17.65 ? 240 HIS A CD2   1 
ATOM   1827 C  CE1   . HIS A 1 247 ? -34.315 22.237  -0.044  1.00 20.29 ? 240 HIS A CE1   1 
ATOM   1828 N  NE2   . HIS A 1 247 ? -33.267 22.994  -0.305  1.00 18.25 ? 240 HIS A NE2   1 
ATOM   1829 N  N     . GLY A 1 248 ? -30.268 19.508  -2.864  1.00 12.08 ? 241 GLY A N     1 
ATOM   1830 C  CA    . GLY A 1 248 ? -29.801 20.129  -4.097  1.00 11.82 ? 241 GLY A CA    1 
ATOM   1831 C  C     . GLY A 1 248 ? -30.326 19.582  -5.423  1.00 11.74 ? 241 GLY A C     1 
ATOM   1832 O  O     . GLY A 1 248 ? -30.384 20.344  -6.433  1.00 12.55 ? 241 GLY A O     1 
ATOM   1833 N  N     . SER A 1 249 ? -30.657 18.278  -5.478  1.00 10.50 ? 242 SER A N     1 
ATOM   1834 C  CA    . SER A 1 249 ? -31.187 17.659  -6.684  1.00 10.77 ? 242 SER A CA    1 
ATOM   1835 C  C     . SER A 1 249 ? -32.560 18.110  -7.050  1.00 11.24 ? 242 SER A C     1 
ATOM   1836 O  O     . SER A 1 249 ? -33.013 17.818  -8.159  1.00 10.94 ? 242 SER A O     1 
ATOM   1837 C  CB    . SER A 1 249 ? -31.275 16.128  -6.546  1.00 11.03 ? 242 SER A CB    1 
ATOM   1838 O  OG    . SER A 1 249 ? -32.274 15.694  -5.591  1.00 10.69 ? 242 SER A OG    1 
ATOM   1839 N  N     . VAL A 1 250 ? -33.277 18.715  -6.095  1.00 11.40 ? 243 VAL A N     1 
ATOM   1840 C  CA    . VAL A 1 250 ? -34.714 19.009  -6.272  1.00 11.80 ? 243 VAL A CA    1 
ATOM   1841 C  C     . VAL A 1 250 ? -35.113 19.956  -7.459  1.00 11.70 ? 243 VAL A C     1 
ATOM   1842 O  O     . VAL A 1 250 ? -35.984 19.607  -8.280  1.00 10.65 ? 243 VAL A O     1 
ATOM   1843 C  CB    . VAL A 1 250 ? -35.355 19.478  -4.931  1.00 11.95 ? 243 VAL A CB    1 
ATOM   1844 C  CG1   . VAL A 1 250 ? -36.818 19.953  -5.154  1.00 11.41 ? 243 VAL A CG1   1 
ATOM   1845 C  CG2   . VAL A 1 250 ? -35.330 18.345  -3.908  1.00 12.43 ? 243 VAL A CG2   1 
ATOM   1846 N  N     . PRO A 1 251 ? -34.416 21.095  -7.623  1.00 12.69 ? 244 PRO A N     1 
ATOM   1847 C  CA    . PRO A 1 251 ? -34.794 21.963  -8.748  1.00 12.08 ? 244 PRO A CA    1 
ATOM   1848 C  C     . PRO A 1 251 ? -34.754 21.286  -10.107 1.00 12.51 ? 244 PRO A C     1 
ATOM   1849 O  O     . PRO A 1 251 ? -35.736 21.387  -10.845 1.00 12.07 ? 244 PRO A O     1 
ATOM   1850 C  CB    . PRO A 1 251 ? -33.845 23.142  -8.648  1.00 12.12 ? 244 PRO A CB    1 
ATOM   1851 C  CG    . PRO A 1 251 ? -33.504 23.205  -7.201  1.00 13.47 ? 244 PRO A CG    1 
ATOM   1852 C  CD    . PRO A 1 251 ? -33.400 21.719  -6.773  1.00 12.57 ? 244 PRO A CD    1 
ATOM   1853 N  N     . GLN A 1 252 ? -33.698 20.547  -10.414 1.00 14.11 ? 245 GLN A N     1 
ATOM   1854 C  CA    . GLN A 1 252 ? -33.630 19.886  -11.715 1.00 14.95 ? 245 GLN A CA    1 
ATOM   1855 C  C     . GLN A 1 252 ? -34.666 18.741  -11.718 1.00 13.81 ? 245 GLN A C     1 
ATOM   1856 O  O     . GLN A 1 252 ? -35.407 18.551  -12.698 1.00 13.49 ? 245 GLN A O     1 
ATOM   1857 C  CB    . GLN A 1 252 ? -32.208 19.371  -12.005 1.00 18.29 ? 245 GLN A CB    1 
ATOM   1858 C  CG    . GLN A 1 252 ? -31.133 20.466  -12.274 1.00 22.35 ? 245 GLN A CG    1 
ATOM   1859 C  CD    . GLN A 1 252 ? -29.798 19.908  -12.940 1.00 27.69 ? 245 GLN A CD    1 
ATOM   1860 O  OE1   . GLN A 1 252 ? -29.861 19.247  -13.950 1.00 31.91 ? 245 GLN A OE1   1 
ATOM   1861 N  NE2   . GLN A 1 252 ? -28.620 20.198  -12.365 1.00 26.87 ? 245 GLN A NE2   1 
ATOM   1862 N  N     . LEU A 1 253 ? -34.724 17.957  -10.634 1.00 11.72 ? 246 LEU A N     1 
ATOM   1863 C  CA    . LEU A 1 253 ? -35.660 16.833  -10.605 1.00 11.74 ? 246 LEU A CA    1 
ATOM   1864 C  C     . LEU A 1 253 ? -37.091 17.274  -10.783 1.00 10.91 ? 246 LEU A C     1 
ATOM   1865 O  O     . LEU A 1 253 ? -37.835 16.664  -11.531 1.00 10.30 ? 246 LEU A O     1 
ATOM   1866 C  CB    . LEU A 1 253 ? -35.542 16.058  -9.288  1.00 11.52 ? 246 LEU A CB    1 
ATOM   1867 C  CG    . LEU A 1 253 ? -36.491 14.895  -9.047  1.00 11.19 ? 246 LEU A CG    1 
ATOM   1868 C  CD1   . LEU A 1 253 ? -36.243 13.710  -9.971  1.00 10.97 ? 246 LEU A CD1   1 
ATOM   1869 C  CD2   . LEU A 1 253 ? -36.347 14.470  -7.578  1.00 11.81 ? 246 LEU A CD2   1 
ATOM   1870 N  N     . PHE A 1 254 ? -37.470 18.355  -10.098 1.00 11.15 ? 247 PHE A N     1 
ATOM   1871 C  CA    . PHE A 1 254 ? -38.858 18.840  -10.120 1.00 11.56 ? 247 PHE A CA    1 
ATOM   1872 C  C     . PHE A 1 254 ? -39.224 19.586  -11.432 1.00 11.83 ? 247 PHE A C     1 
ATOM   1873 O  O     . PHE A 1 254 ? -40.388 19.687  -11.804 1.00 11.74 ? 247 PHE A O     1 
ATOM   1874 C  CB    . PHE A 1 254 ? -39.126 19.685  -8.863  1.00 11.73 ? 247 PHE A CB    1 
ATOM   1875 C  CG    . PHE A 1 254 ? -39.588 18.856  -7.643  1.00 12.04 ? 247 PHE A CG    1 
ATOM   1876 C  CD1   . PHE A 1 254 ? -39.452 17.484  -7.595  1.00 11.56 ? 247 PHE A CD1   1 
ATOM   1877 C  CD2   . PHE A 1 254 ? -40.078 19.489  -6.525  1.00 12.74 ? 247 PHE A CD2   1 
ATOM   1878 C  CE1   . PHE A 1 254 ? -39.862 16.740  -6.501  1.00 11.82 ? 247 PHE A CE1   1 
ATOM   1879 C  CE2   . PHE A 1 254 ? -40.494 18.777  -5.418  1.00 12.63 ? 247 PHE A CE2   1 
ATOM   1880 C  CZ    . PHE A 1 254 ? -40.422 17.375  -5.403  1.00 12.26 ? 247 PHE A CZ    1 
ATOM   1881 N  N     . SER A 1 255 ? -38.198 20.017  -12.169 1.00 11.34 ? 248 SER A N     1 
ATOM   1882 C  CA    . SER A 1 255 ? -38.408 20.859  -13.320 1.00 10.65 ? 248 SER A CA    1 
ATOM   1883 C  C     . SER A 1 255 ? -39.186 20.156  -14.437 1.00 11.70 ? 248 SER A C     1 
ATOM   1884 O  O     . SER A 1 255 ? -39.879 20.834  -15.189 1.00 10.23 ? 248 SER A O     1 
ATOM   1885 C  CB    . SER A 1 255 ? -37.061 21.394  -13.831 1.00 10.16 ? 248 SER A CB    1 
ATOM   1886 O  OG    . SER A 1 255 ? -36.326 20.396  -14.575 1.00 8.94  ? 248 SER A OG    1 
ATOM   1887 N  N     . GLN A 1 256 ? -39.077 18.805  -14.523 1.00 12.47 ? 249 GLN A N     1 
ATOM   1888 C  CA    . GLN A 1 256 ? -39.793 18.013  -15.497 1.00 13.88 ? 249 GLN A CA    1 
ATOM   1889 C  C     . GLN A 1 256 ? -40.609 16.883  -14.853 1.00 13.52 ? 249 GLN A C     1 
ATOM   1890 O  O     . GLN A 1 256 ? -40.964 15.943  -15.542 1.00 13.92 ? 249 GLN A O     1 
ATOM   1891 C  CB    . GLN A 1 256 ? -38.863 17.367  -16.545 1.00 14.81 ? 249 GLN A CB    1 
ATOM   1892 C  CG    . GLN A 1 256 ? -38.022 18.340  -17.334 1.00 17.16 ? 249 GLN A CG    1 
ATOM   1893 C  CD    . GLN A 1 256 ? -37.151 17.680  -18.374 1.00 17.87 ? 249 GLN A CD    1 
ATOM   1894 O  OE1   . GLN A 1 256 ? -36.037 17.298  -18.099 1.00 23.59 ? 249 GLN A OE1   1 
ATOM   1895 N  NE2   . GLN A 1 256 ? -37.627 17.619  -19.563 1.00 18.23 ? 249 GLN A NE2   1 
ATOM   1896 N  N     . MET A 1 257 ? -40.962 17.018  -13.586 1.00 12.41 ? 250 MET A N     1 
ATOM   1897 C  CA    . MET A 1 257 ? -41.631 15.964  -12.862 1.00 12.54 ? 250 MET A CA    1 
ATOM   1898 C  C     . MET A 1 257 ? -43.121 16.264  -12.903 1.00 12.93 ? 250 MET A C     1 
ATOM   1899 O  O     . MET A 1 257 ? -43.548 17.267  -12.302 1.00 14.23 ? 250 MET A O     1 
ATOM   1900 C  CB    . MET A 1 257 ? -41.145 15.948  -11.400 1.00 12.94 ? 250 MET A CB    1 
ATOM   1901 C  CG    . MET A 1 257 ? -41.801 14.840  -10.557 1.00 15.14 ? 250 MET A CG    1 
ATOM   1902 S  SD    . MET A 1 257 ? -41.320 13.245  -11.215 1.00 16.90 ? 250 MET A SD    1 
ATOM   1903 C  CE    . MET A 1 257 ? -39.566 13.075  -10.814 1.00 16.45 ? 250 MET A CE    1 
ATOM   1904 N  N     . PRO A 1 258 ? -43.937 15.425  -13.609 1.00 13.20 ? 251 PRO A N     1 
ATOM   1905 C  CA    . PRO A 1 258 ? -45.408 15.670  -13.564 1.00 13.07 ? 251 PRO A CA    1 
ATOM   1906 C  C     . PRO A 1 258 ? -45.921 15.756  -12.124 1.00 13.22 ? 251 PRO A C     1 
ATOM   1907 O  O     . PRO A 1 258 ? -45.463 15.038  -11.222 1.00 13.74 ? 251 PRO A O     1 
ATOM   1908 C  CB    . PRO A 1 258 ? -46.008 14.511  -14.311 1.00 12.67 ? 251 PRO A CB    1 
ATOM   1909 C  CG    . PRO A 1 258 ? -44.899 14.066  -15.220 1.00 12.92 ? 251 PRO A CG    1 
ATOM   1910 C  CD    . PRO A 1 258 ? -43.631 14.230  -14.390 1.00 12.87 ? 251 PRO A CD    1 
ATOM   1911 N  N     . ILE A 1 259 ? -46.819 16.701  -11.918 1.00 13.07 ? 252 ILE A N     1 
ATOM   1912 C  CA    . ILE A 1 259 ? -47.454 16.904  -10.650 1.00 13.18 ? 252 ILE A CA    1 
ATOM   1913 C  C     . ILE A 1 259 ? -48.019 15.587  -10.089 1.00 14.40 ? 252 ILE A C     1 
ATOM   1914 O  O     . ILE A 1 259 ? -47.917 15.335  -8.864  1.00 14.18 ? 252 ILE A O     1 
ATOM   1915 C  CB    . ILE A 1 259 ? -48.459 18.058  -10.821 1.00 15.58 ? 252 ILE A CB    1 
ATOM   1916 C  CG1   . ILE A 1 259 ? -47.647 19.393  -10.805 1.00 16.69 ? 252 ILE A CG1   1 
ATOM   1917 C  CG2   . ILE A 1 259 ? -49.495 18.101  -9.711  1.00 16.45 ? 252 ILE A CG2   1 
ATOM   1918 C  CD1   . ILE A 1 259 ? -48.349 20.611  -11.311 1.00 18.26 ? 252 ILE A CD1   1 
ATOM   1919 N  N     . ARG A 1 260 ? -48.655 14.771  -10.948 1.00 13.82 ? 253 ARG A N     1 
ATOM   1920 C  CA    . ARG A 1 260 ? -49.330 13.585  -10.495 1.00 15.42 ? 253 ARG A CA    1 
ATOM   1921 C  C     . ARG A 1 260 ? -48.425 12.552  -9.889  1.00 15.34 ? 253 ARG A C     1 
ATOM   1922 O  O     . ARG A 1 260 ? -48.928 11.667  -9.220  1.00 13.96 ? 253 ARG A O     1 
ATOM   1923 C  CB    . ARG A 1 260 ? -50.142 12.928  -11.619 1.00 16.99 ? 253 ARG A CB    1 
ATOM   1924 C  CG    . ARG A 1 260 ? -49.278 12.325  -12.729 1.00 18.87 ? 253 ARG A CG    1 
ATOM   1925 C  CD    . ARG A 1 260 ? -50.127 11.721  -13.849 1.00 21.09 ? 253 ARG A CD    1 
ATOM   1926 N  NE    . ARG A 1 260 ? -49.254 11.262  -14.944 1.00 24.93 ? 253 ARG A NE    1 
ATOM   1927 C  CZ    . ARG A 1 260 ? -48.776 12.023  -15.925 1.00 27.82 ? 253 ARG A CZ    1 
ATOM   1928 N  NH1   . ARG A 1 260 ? -49.057 13.326  -15.974 1.00 26.74 ? 253 ARG A NH1   1 
ATOM   1929 N  NH2   . ARG A 1 260 ? -47.982 11.483  -16.848 1.00 32.76 ? 253 ARG A NH2   1 
ATOM   1930 N  N     . LYS A 1 261 ? -47.102 12.663  -10.088 1.00 14.22 ? 254 LYS A N     1 
ATOM   1931 C  CA    . LYS A 1 261 ? -46.172 11.677  -9.533  1.00 15.98 ? 254 LYS A CA    1 
ATOM   1932 C  C     . LYS A 1 261 ? -45.877 11.834  -8.068  1.00 14.95 ? 254 LYS A C     1 
ATOM   1933 O  O     . LYS A 1 261 ? -45.257 10.925  -7.462  1.00 13.55 ? 254 LYS A O     1 
ATOM   1934 C  CB    . LYS A 1 261 ? -44.817 11.701  -10.262 1.00 15.64 ? 254 LYS A CB    1 
ATOM   1935 C  CG    . LYS A 1 261 ? -44.981 11.458  -11.697 1.00 18.14 ? 254 LYS A CG    1 
ATOM   1936 C  CD    . LYS A 1 261 ? -45.569 10.110  -12.076 1.00 20.12 ? 254 LYS A CD    1 
ATOM   1937 C  CE    . LYS A 1 261 ? -45.640 10.118  -13.611 1.00 23.00 ? 254 LYS A CE    1 
ATOM   1938 N  NZ    . LYS A 1 261 ? -46.342 8.900   -14.084 1.00 25.02 ? 254 LYS A NZ    1 
ATOM   1939 N  N     . ILE A 1 262 ? -46.292 12.967  -7.498  1.00 13.97 ? 255 ILE A N     1 
ATOM   1940 C  CA    . ILE A 1 262 ? -45.965 13.257  -6.108  1.00 15.07 ? 255 ILE A CA    1 
ATOM   1941 C  C     . ILE A 1 262 ? -47.084 12.714  -5.245  1.00 14.46 ? 255 ILE A C     1 
ATOM   1942 O  O     . ILE A 1 262 ? -48.271 12.957  -5.559  1.00 11.34 ? 255 ILE A O     1 
ATOM   1943 C  CB    . ILE A 1 262 ? -45.835 14.778  -5.911  1.00 16.94 ? 255 ILE A CB    1 
ATOM   1944 C  CG1   . ILE A 1 262 ? -44.606 15.324  -6.694  1.00 19.03 ? 255 ILE A CG1   1 
ATOM   1945 C  CG2   . ILE A 1 262 ? -45.893 15.179  -4.437  1.00 17.67 ? 255 ILE A CG2   1 
ATOM   1946 C  CD1   . ILE A 1 262 ? -43.350 14.459  -6.710  1.00 20.04 ? 255 ILE A CD1   1 
ATOM   1947 N  N     . ARG A 1 263 ? -46.708 12.030  -4.154  1.00 14.97 ? 256 ARG A N     1 
ATOM   1948 C  CA    . ARG A 1 263 ? -47.680 11.378  -3.282  1.00 17.15 ? 256 ARG A CA    1 
ATOM   1949 C  C     . ARG A 1 263 ? -48.738 12.420  -2.773  1.00 16.67 ? 256 ARG A C     1 
ATOM   1950 O  O     . ARG A 1 263 ? -48.345 13.506  -2.280  1.00 16.73 ? 256 ARG A O     1 
ATOM   1951 C  CB    . ARG A 1 263 ? -46.974 10.750  -2.076  1.00 20.72 ? 256 ARG A CB    1 
ATOM   1952 C  CG    . ARG A 1 263 ? -47.894 9.871   -1.224  1.00 26.21 ? 256 ARG A CG    1 
ATOM   1953 C  CD    . ARG A 1 263 ? -47.360 9.528   0.168   1.00 33.29 ? 256 ARG A CD    1 
ATOM   1954 N  NE    . ARG A 1 263 ? -47.363 10.739  1.010   1.00 43.30 ? 256 ARG A NE    1 
ATOM   1955 C  CZ    . ARG A 1 263 ? -46.973 10.802  2.290   1.00 50.85 ? 256 ARG A CZ    1 
ATOM   1956 N  NH1   . ARG A 1 263 ? -46.990 11.981  2.935   1.00 59.28 ? 256 ARG A NH1   1 
ATOM   1957 N  NH2   . ARG A 1 263 ? -46.529 9.720   2.925   1.00 41.57 ? 256 ARG A NH2   1 
ATOM   1958 N  N     . SER A 1 264 ? -50.016 12.065  -2.987  1.00 16.61 ? 257 SER A N     1 
ATOM   1959 C  CA    . SER A 1 264 ? -51.280 12.817  -2.608  1.00 17.65 ? 257 SER A CA    1 
ATOM   1960 C  C     . SER A 1 264 ? -51.786 13.663  -3.739  1.00 18.27 ? 257 SER A C     1 
ATOM   1961 O  O     . SER A 1 264 ? -52.913 14.159  -3.694  1.00 17.24 ? 257 SER A O     1 
ATOM   1962 C  CB    . SER A 1 264 ? -51.162 13.667  -1.348  1.00 17.17 ? 257 SER A CB    1 
ATOM   1963 O  OG    . SER A 1 264 ? -50.465 14.893  -1.612  1.00 19.29 ? 257 SER A OG    1 
ATOM   1964 N  N     . LEU A 1 265 ? -50.978 13.817  -4.787  1.00 16.59 ? 258 LEU A N     1 
ATOM   1965 C  CA    . LEU A 1 265 ? -51.409 14.611  -5.947  1.00 16.78 ? 258 LEU A CA    1 
ATOM   1966 C  C     . LEU A 1 265 ? -51.810 13.799  -7.176  1.00 17.36 ? 258 LEU A C     1 
ATOM   1967 O  O     . LEU A 1 265 ? -51.964 14.360  -8.298  1.00 15.22 ? 258 LEU A O     1 
ATOM   1968 C  CB    . LEU A 1 265 ? -50.280 15.599  -6.329  1.00 18.22 ? 258 LEU A CB    1 
ATOM   1969 C  CG    . LEU A 1 265 ? -49.873 16.645  -5.294  1.00 20.30 ? 258 LEU A CG    1 
ATOM   1970 C  CD1   . LEU A 1 265 ? -48.861 17.605  -5.892  1.00 18.88 ? 258 LEU A CD1   1 
ATOM   1971 C  CD2   . LEU A 1 265 ? -51.103 17.442  -4.815  1.00 20.58 ? 258 LEU A CD2   1 
ATOM   1972 N  N     . GLY A 1 266 ? -51.878 12.465  -7.038  1.00 17.93 ? 259 GLY A N     1 
ATOM   1973 C  CA    . GLY A 1 266 ? -52.314 11.603  -8.141  1.00 17.11 ? 259 GLY A CA    1 
ATOM   1974 C  C     . GLY A 1 266 ? -53.812 11.687  -8.486  1.00 20.20 ? 259 GLY A C     1 
ATOM   1975 O  O     . GLY A 1 266 ? -54.236 11.069  -9.424  1.00 16.44 ? 259 GLY A O     1 
ATOM   1976 N  N     . GLY A 1 267 ? -54.630 12.455  -7.742  1.00 18.98 ? 260 GLY A N     1 
ATOM   1977 C  CA    . GLY A 1 267 ? -56.091 12.380  -7.933  1.00 20.18 ? 260 GLY A CA    1 
ATOM   1978 C  C     . GLY A 1 267 ? -56.623 13.729  -8.315  1.00 20.37 ? 260 GLY A C     1 
ATOM   1979 O  O     . GLY A 1 267 ? -55.939 14.460  -9.051  1.00 19.69 ? 260 GLY A O     1 
ATOM   1980 N  N     . LYS A 1 268 ? -57.807 14.064  -7.812  1.00 19.28 ? 261 LYS A N     1 
ATOM   1981 C  CA    . LYS A 1 268 ? -58.491 15.323  -8.155  1.00 22.16 ? 261 LYS A CA    1 
ATOM   1982 C  C     . LYS A 1 268 ? -57.715 16.630  -7.746  1.00 20.34 ? 261 LYS A C     1 
ATOM   1983 O  O     . LYS A 1 268 ? -57.684 17.574  -8.512  1.00 19.31 ? 261 LYS A O     1 
ATOM   1984 C  CB    . LYS A 1 268 ? -59.906 15.374  -7.517  1.00 22.88 ? 261 LYS A CB    1 
ATOM   1985 C  CG    . LYS A 1 268 ? -60.860 14.262  -7.987  1.00 28.70 ? 261 LYS A CG    1 
ATOM   1986 C  CD    . LYS A 1 268 ? -62.081 14.093  -7.037  1.00 32.25 ? 261 LYS A CD    1 
ATOM   1987 C  CE    . LYS A 1 268 ? -63.201 13.240  -7.625  1.00 35.07 ? 261 LYS A CE    1 
ATOM   1988 N  NZ    . LYS A 1 268 ? -64.538 13.796  -7.241  1.00 35.58 ? 261 LYS A NZ    1 
ATOM   1989 N  N     . LEU A 1 269 ? -57.186 16.693  -6.515  1.00 18.61 ? 262 LEU A N     1 
ATOM   1990 C  CA    . LEU A 1 269 ? -56.352 17.819  -6.087  1.00 17.81 ? 262 LEU A CA    1 
ATOM   1991 C  C     . LEU A 1 269 ? -55.248 18.103  -7.124  1.00 17.14 ? 262 LEU A C     1 
ATOM   1992 O  O     . LEU A 1 269 ? -55.098 19.204  -7.584  1.00 17.11 ? 262 LEU A O     1 
ATOM   1993 C  CB    . LEU A 1 269 ? -55.711 17.528  -4.764  1.00 18.01 ? 262 LEU A CB    1 
ATOM   1994 C  CG    . LEU A 1 269 ? -54.837 18.653  -4.209  1.00 20.45 ? 262 LEU A CG    1 
ATOM   1995 C  CD1   . LEU A 1 269 ? -55.617 19.965  -4.073  1.00 19.45 ? 262 LEU A CD1   1 
ATOM   1996 C  CD2   . LEU A 1 269 ? -54.223 18.231  -2.880  1.00 20.01 ? 262 LEU A CD2   1 
ATOM   1997 N  N     . GLY A 1 270 ? -54.565 17.062  -7.560  1.00 17.51 ? 263 GLY A N     1 
ATOM   1998 C  CA    . GLY A 1 270 ? -53.423 17.232  -8.470  1.00 18.05 ? 263 GLY A CA    1 
ATOM   1999 C  C     . GLY A 1 270 ? -53.923 17.744  -9.783  1.00 18.11 ? 263 GLY A C     1 
ATOM   2000 O  O     . GLY A 1 270 ? -53.289 18.600  -10.411 1.00 18.52 ? 263 GLY A O     1 
ATOM   2001 N  N     . ALA A 1 271 ? -55.095 17.259  -10.164 1.00 18.73 ? 264 ALA A N     1 
ATOM   2002 C  CA    . ALA A 1 271 ? -55.703 17.683  -11.383 1.00 20.22 ? 264 ALA A CA    1 
ATOM   2003 C  C     . ALA A 1 271 ? -56.148 19.152  -11.323 1.00 18.98 ? 264 ALA A C     1 
ATOM   2004 O  O     . ALA A 1 271 ? -55.936 19.835  -12.318 1.00 20.94 ? 264 ALA A O     1 
ATOM   2005 C  CB    . ALA A 1 271 ? -56.880 16.755  -11.785 1.00 22.30 ? 264 ALA A CB    1 
ATOM   2006 N  N     . SER A 1 272 ? -56.700 19.633  -10.197 1.00 16.96 ? 265 SER A N     1 
ATOM   2007 C  CA    . SER A 1 272 ? -57.067 21.039  -10.008 0.45 15.02 ? 265 SER A CA    1 
ATOM   2008 C  C     . SER A 1 272 ? -55.847 21.888  -10.058 1.00 16.00 ? 265 SER A C     1 
ATOM   2009 O  O     . SER A 1 272 ? -55.918 23.040  -10.483 1.00 14.43 ? 265 SER A O     1 
ATOM   2010 C  CB    . SER A 1 272 ? -57.640 21.360  -8.610  0.45 14.54 ? 265 SER A CB    1 
ATOM   2011 O  OG    . SER A 1 272 ? -58.491 20.395  -8.162  0.45 15.11 ? 265 SER A OG    1 
ATOM   2012 N  N     . VAL A 1 273 ? -54.732 21.387  -9.489  1.00 15.21 ? 266 VAL A N     1 
ATOM   2013 C  CA    . VAL A 1 273 ? -53.537 22.192  -9.469  1.00 14.27 ? 266 VAL A CA    1 
ATOM   2014 C  C     . VAL A 1 273 ? -53.151 22.473  -10.945 1.00 15.26 ? 266 VAL A C     1 
ATOM   2015 O  O     . VAL A 1 273 ? -52.851 23.634  -11.336 1.00 16.34 ? 266 VAL A O     1 
ATOM   2016 C  CB    . VAL A 1 273 ? -52.374 21.503  -8.702  1.00 14.83 ? 266 VAL A CB    1 
ATOM   2017 C  CG1   . VAL A 1 273 ? -51.038 22.220  -8.928  1.00 14.33 ? 266 VAL A CG1   1 
ATOM   2018 C  CG2   . VAL A 1 273 ? -52.658 21.412  -7.203  1.00 14.71 ? 266 VAL A CG2   1 
ATOM   2019 N  N     . ILE A 1 274 ? -53.121 21.417  -11.746 1.00 14.97 ? 267 ILE A N     1 
ATOM   2020 C  CA    . ILE A 1 274 ? -52.714 21.529  -13.131 1.00 15.93 ? 267 ILE A CA    1 
ATOM   2021 C  C     . ILE A 1 274 ? -53.706 22.429  -13.870 1.00 17.44 ? 267 ILE A C     1 
ATOM   2022 O  O     . ILE A 1 274 ? -53.291 23.300  -14.636 1.00 19.43 ? 267 ILE A O     1 
ATOM   2023 C  CB    . ILE A 1 274 ? -52.694 20.142  -13.754 1.00 17.76 ? 267 ILE A CB    1 
ATOM   2024 C  CG1   . ILE A 1 274 ? -51.498 19.340  -13.190 1.00 18.64 ? 267 ILE A CG1   1 
ATOM   2025 C  CG2   . ILE A 1 274 ? -52.772 20.175  -15.270 1.00 18.55 ? 267 ILE A CG2   1 
ATOM   2026 C  CD1   . ILE A 1 274 ? -51.645 17.854  -13.458 1.00 20.16 ? 267 ILE A CD1   1 
ATOM   2027 N  N     . GLU A 1 275 ? -54.994 22.159  -13.717 1.00 19.26 ? 268 GLU A N     1 
ATOM   2028 C  CA    . GLU A 1 275 ? -56.056 22.894  -14.464 1.00 25.11 ? 268 GLU A CA    1 
ATOM   2029 C  C     . GLU A 1 275 ? -56.170 24.341  -14.044 1.00 21.99 ? 268 GLU A C     1 
ATOM   2030 O  O     . GLU A 1 275 ? -56.201 25.206  -14.875 1.00 22.28 ? 268 GLU A O     1 
ATOM   2031 C  CB    . GLU A 1 275 ? -57.452 22.230  -14.334 1.00 30.80 ? 268 GLU A CB    1 
ATOM   2032 C  CG    . GLU A 1 275 ? -58.625 23.116  -14.809 1.00 38.53 ? 268 GLU A CG    1 
ATOM   2033 C  CD    . GLU A 1 275 ? -59.117 22.853  -16.262 1.00 46.16 ? 268 GLU A CD    1 
ATOM   2034 O  OE1   . GLU A 1 275 ? -60.352 22.839  -16.455 1.00 56.21 ? 268 GLU A OE1   1 
ATOM   2035 O  OE2   . GLU A 1 275 ? -58.317 22.658  -17.207 1.00 48.32 ? 268 GLU A OE2   1 
ATOM   2036 N  N     . ILE A 1 276 ? -56.229 24.620  -12.750 1.00 21.60 ? 269 ILE A N     1 
ATOM   2037 C  CA    . ILE A 1 276 ? -56.399 25.971  -12.324 1.00 21.26 ? 269 ILE A CA    1 
ATOM   2038 C  C     . ILE A 1 276 ? -55.131 26.818  -12.609 1.00 20.14 ? 269 ILE A C     1 
ATOM   2039 O  O     . ILE A 1 276 ? -55.213 27.951  -13.016 1.00 19.57 ? 269 ILE A O     1 
ATOM   2040 C  CB    . ILE A 1 276 ? -56.737 26.033  -10.829 1.00 22.82 ? 269 ILE A CB    1 
ATOM   2041 C  CG1   . ILE A 1 276 ? -58.097 25.343  -10.568 1.00 23.47 ? 269 ILE A CG1   1 
ATOM   2042 C  CG2   . ILE A 1 276 ? -56.799 27.508  -10.351 1.00 22.59 ? 269 ILE A CG2   1 
ATOM   2043 C  CD1   . ILE A 1 276 ? -58.532 25.326  -9.093  1.00 25.53 ? 269 ILE A CD1   1 
ATOM   2044 N  N     . LEU A 1 277 ? -53.952 26.270  -12.395 1.00 19.89 ? 270 LEU A N     1 
ATOM   2045 C  CA    . LEU A 1 277 ? -52.744 27.100  -12.460 1.00 18.60 ? 270 LEU A CA    1 
ATOM   2046 C  C     . LEU A 1 277 ? -52.201 27.080  -13.857 1.00 17.31 ? 270 LEU A C     1 
ATOM   2047 O  O     . LEU A 1 277 ? -51.411 27.964  -14.237 1.00 15.51 ? 270 LEU A O     1 
ATOM   2048 C  CB    . LEU A 1 277 ? -51.666 26.599  -11.487 1.00 19.05 ? 270 LEU A CB    1 
ATOM   2049 C  CG    . LEU A 1 277 ? -51.984 26.672  -9.984  1.00 19.35 ? 270 LEU A CG    1 
ATOM   2050 C  CD1   . LEU A 1 277 ? -50.739 26.403  -9.141  1.00 18.50 ? 270 LEU A CD1   1 
ATOM   2051 C  CD2   . LEU A 1 277 ? -52.447 28.063  -9.633  1.00 21.87 ? 270 LEU A CD2   1 
ATOM   2052 N  N     . GLY A 1 278 ? -52.587 26.072  -14.647 1.00 16.82 ? 271 GLY A N     1 
ATOM   2053 C  CA    . GLY A 1 278 ? -52.127 26.075  -16.025 1.00 16.41 ? 271 GLY A CA    1 
ATOM   2054 C  C     . GLY A 1 278 ? -50.664 25.663  -16.050 1.00 18.34 ? 271 GLY A C     1 
ATOM   2055 O  O     . GLY A 1 278 ? -49.886 26.211  -16.851 1.00 19.53 ? 271 GLY A O     1 
ATOM   2056 N  N     . ILE A 1 279 ? -50.285 24.686  -15.202 1.00 15.84 ? 272 ILE A N     1 
ATOM   2057 C  CA    . ILE A 1 279 ? -48.914 24.113  -15.210 1.00 16.59 ? 272 ILE A CA    1 
ATOM   2058 C  C     . ILE A 1 279 ? -48.911 22.593  -15.396 1.00 18.16 ? 272 ILE A C     1 
ATOM   2059 O  O     . ILE A 1 279 ? -49.955 21.974  -15.375 1.00 18.57 ? 272 ILE A O     1 
ATOM   2060 C  CB    . ILE A 1 279 ? -48.162 24.498  -13.918 1.00 16.39 ? 272 ILE A CB    1 
ATOM   2061 C  CG1   . ILE A 1 279 ? -48.910 24.002  -12.668 1.00 16.08 ? 272 ILE A CG1   1 
ATOM   2062 C  CG2   . ILE A 1 279 ? -48.110 26.026  -13.823 1.00 16.33 ? 272 ILE A CG2   1 
ATOM   2063 C  CD1   . ILE A 1 279 ? -48.206 24.338  -11.388 1.00 17.11 ? 272 ILE A CD1   1 
ATOM   2064 N  N     . GLU A 1 280 ? -47.746 21.994  -15.637 1.00 18.02 ? 273 GLU A N     1 
ATOM   2065 C  CA    . GLU A 1 280 ? -47.617 20.527  -15.758 1.00 20.16 ? 273 GLU A CA    1 
ATOM   2066 C  C     . GLU A 1 280 ? -46.656 19.959  -14.699 1.00 18.02 ? 273 GLU A C     1 
ATOM   2067 O  O     . GLU A 1 280 ? -46.814 18.776  -14.293 1.00 18.08 ? 273 GLU A O     1 
ATOM   2068 C  CB    . GLU A 1 280 ? -47.046 20.108  -17.115 1.00 24.98 ? 273 GLU A CB    1 
ATOM   2069 C  CG    . GLU A 1 280 ? -47.967 20.303  -18.308 1.00 32.23 ? 273 GLU A CG    1 
ATOM   2070 C  CD    . GLU A 1 280 ? -47.229 20.010  -19.612 1.00 38.17 ? 273 GLU A CD    1 
ATOM   2071 O  OE1   . GLU A 1 280 ? -46.855 20.962  -20.315 1.00 51.29 ? 273 GLU A OE1   1 
ATOM   2072 O  OE2   . GLU A 1 280 ? -46.989 18.812  -19.929 1.00 49.67 ? 273 GLU A OE2   1 
ATOM   2073 N  N     . TYR A 1 281 ? -45.689 20.767  -14.242 1.00 15.94 ? 274 TYR A N     1 
ATOM   2074 C  CA    . TYR A 1 281 ? -44.536 20.208  -13.471 1.00 15.32 ? 274 TYR A CA    1 
ATOM   2075 C  C     . TYR A 1 281 ? -44.436 20.770  -12.080 1.00 14.61 ? 274 TYR A C     1 
ATOM   2076 O  O     . TYR A 1 281 ? -44.805 21.920  -11.829 1.00 14.05 ? 274 TYR A O     1 
ATOM   2077 C  CB    . TYR A 1 281 ? -43.211 20.414  -14.191 1.00 16.03 ? 274 TYR A CB    1 
ATOM   2078 C  CG    . TYR A 1 281 ? -43.167 19.882  -15.597 1.00 16.26 ? 274 TYR A CG    1 
ATOM   2079 C  CD1   . TYR A 1 281 ? -43.420 18.544  -15.855 1.00 16.91 ? 274 TYR A CD1   1 
ATOM   2080 C  CD2   . TYR A 1 281 ? -42.873 20.714  -16.674 1.00 17.28 ? 274 TYR A CD2   1 
ATOM   2081 C  CE1   . TYR A 1 281 ? -43.386 18.040  -17.113 1.00 16.37 ? 274 TYR A CE1   1 
ATOM   2082 C  CE2   . TYR A 1 281 ? -42.822 20.211  -17.975 1.00 18.33 ? 274 TYR A CE2   1 
ATOM   2083 C  CZ    . TYR A 1 281 ? -43.082 18.846  -18.175 1.00 18.41 ? 274 TYR A CZ    1 
ATOM   2084 O  OH    . TYR A 1 281 ? -43.045 18.276  -19.429 1.00 16.88 ? 274 TYR A OH    1 
ATOM   2085 N  N     . MET A 1 282 ? -43.889 19.950  -11.190 1.00 13.74 ? 275 MET A N     1 
ATOM   2086 C  CA    . MET A 1 282 ? -43.840 20.278  -9.777  1.00 14.75 ? 275 MET A CA    1 
ATOM   2087 C  C     . MET A 1 282 ? -43.053 21.576  -9.565  1.00 14.41 ? 275 MET A C     1 
ATOM   2088 O  O     . MET A 1 282 ? -43.459 22.441  -8.805  1.00 12.92 ? 275 MET A O     1 
ATOM   2089 C  CB    . MET A 1 282 ? -43.284 19.092  -8.980  1.00 14.97 ? 275 MET A CB    1 
ATOM   2090 C  CG    . MET A 1 282 ? -43.649 19.162  -7.565  1.00 19.98 ? 275 MET A CG    1 
ATOM   2091 S  SD    . MET A 1 282 ? -45.388 18.856  -7.258  1.00 18.69 ? 275 MET A SD    1 
ATOM   2092 C  CE    . MET A 1 282 ? -45.245 19.381  -5.555  1.00 19.99 ? 275 MET A CE    1 
ATOM   2093 N  N     . GLY A 1 283 ? -41.986 21.754  -10.303 1.00 14.60 ? 276 GLY A N     1 
ATOM   2094 C  CA    . GLY A 1 283 ? -41.215 22.983  -10.193 1.00 16.03 ? 276 GLY A CA    1 
ATOM   2095 C  C     . GLY A 1 283 ? -41.903 24.310  -10.541 1.00 15.77 ? 276 GLY A C     1 
ATOM   2096 O  O     . GLY A 1 283 ? -41.646 25.330  -9.931  1.00 15.42 ? 276 GLY A O     1 
ATOM   2097 N  N     . GLU A 1 284 ? -42.812 24.291  -11.505 1.00 15.52 ? 277 GLU A N     1 
ATOM   2098 C  CA    . GLU A 1 284 ? -43.567 25.465  -11.853 1.00 14.01 ? 277 GLU A CA    1 
ATOM   2099 C  C     . GLU A 1 284 ? -44.388 25.986  -10.681 1.00 14.23 ? 277 GLU A C     1 
ATOM   2100 O  O     . GLU A 1 284 ? -44.773 27.143  -10.665 1.00 13.22 ? 277 GLU A O     1 
ATOM   2101 C  CB    . GLU A 1 284 ? -44.537 25.159  -13.012 1.00 14.84 ? 277 GLU A CB    1 
ATOM   2102 C  CG    . GLU A 1 284 ? -43.856 24.587  -14.256 1.00 14.44 ? 277 GLU A CG    1 
ATOM   2103 C  CD    . GLU A 1 284 ? -44.809 24.356  -15.406 1.00 15.49 ? 277 GLU A CD    1 
ATOM   2104 O  OE1   . GLU A 1 284 ? -45.233 23.228  -15.625 1.00 15.03 ? 277 GLU A OE1   1 
ATOM   2105 O  OE2   . GLU A 1 284 ? -45.134 25.311  -16.104 1.00 16.24 ? 277 GLU A OE2   1 
ATOM   2106 N  N     . LEU A 1 285 ? -44.669 25.150  -9.680  1.00 12.40 ? 278 LEU A N     1 
ATOM   2107 C  CA    . LEU A 1 285 ? -45.291 25.686  -8.492  1.00 13.11 ? 278 LEU A CA    1 
ATOM   2108 C  C     . LEU A 1 285 ? -44.510 26.795  -7.765  1.00 13.96 ? 278 LEU A C     1 
ATOM   2109 O  O     . LEU A 1 285 ? -45.131 27.605  -7.088  1.00 12.97 ? 278 LEU A O     1 
ATOM   2110 C  CB    . LEU A 1 285 ? -45.643 24.566  -7.521  1.00 13.73 ? 278 LEU A CB    1 
ATOM   2111 C  CG    . LEU A 1 285 ? -46.896 23.732  -7.901  1.00 15.24 ? 278 LEU A CG    1 
ATOM   2112 C  CD1   . LEU A 1 285 ? -46.763 22.426  -7.093  1.00 16.45 ? 278 LEU A CD1   1 
ATOM   2113 C  CD2   . LEU A 1 285 ? -48.190 24.505  -7.586  1.00 14.24 ? 278 LEU A CD2   1 
ATOM   2114 N  N     . THR A 1 286 ? -43.187 26.878  -7.942  1.00 14.62 ? 279 THR A N     1 
ATOM   2115 C  CA    . THR A 1 286 ? -42.375 27.881  -7.166  1.00 16.07 ? 279 THR A CA    1 
ATOM   2116 C  C     . THR A 1 286 ? -42.745 29.338  -7.540  1.00 16.82 ? 279 THR A C     1 
ATOM   2117 O  O     . THR A 1 286 ? -42.406 30.267  -6.822  1.00 15.32 ? 279 THR A O     1 
ATOM   2118 C  CB    . THR A 1 286 ? -40.877 27.715  -7.385  1.00 15.18 ? 279 THR A CB    1 
ATOM   2119 O  OG1   . THR A 1 286 ? -40.624 27.814  -8.782  1.00 14.99 ? 279 THR A OG1   1 
ATOM   2120 C  CG2   . THR A 1 286 ? -40.413 26.333  -6.900  1.00 14.70 ? 279 THR A CG2   1 
ATOM   2121 N  N     . GLN A 1 287 ? -43.439 29.530  -8.659  1.00 16.85 ? 280 GLN A N     1 
ATOM   2122 C  CA    . GLN A 1 287 ? -43.688 30.882  -9.062  1.00 20.00 ? 280 GLN A CA    1 
ATOM   2123 C  C     . GLN A 1 287 ? -44.833 31.550  -8.275  1.00 19.33 ? 280 GLN A C     1 
ATOM   2124 O  O     . GLN A 1 287 ? -44.950 32.784  -8.371  1.00 20.00 ? 280 GLN A O     1 
ATOM   2125 C  CB    . GLN A 1 287 ? -44.072 31.024  -10.536 1.00 21.80 ? 280 GLN A CB    1 
ATOM   2126 C  CG    . GLN A 1 287 ? -43.325 30.207  -11.505 1.00 23.27 ? 280 GLN A CG    1 
ATOM   2127 C  CD    . GLN A 1 287 ? -44.150 30.047  -12.790 1.00 26.29 ? 280 GLN A CD    1 
ATOM   2128 O  OE1   . GLN A 1 287 ? -44.252 31.003  -13.598 1.00 28.81 ? 280 GLN A OE1   1 
ATOM   2129 N  NE2   . GLN A 1 287 ? -44.729 28.845  -12.998 1.00 22.47 ? 280 GLN A NE2   1 
ATOM   2130 N  N     . PHE A 1 288 ? -45.629 30.769  -7.531  1.00 16.32 ? 281 PHE A N     1 
ATOM   2131 C  CA    . PHE A 1 288 ? -46.847 31.289  -6.889  1.00 16.45 ? 281 PHE A CA    1 
ATOM   2132 C  C     . PHE A 1 288 ? -46.572 31.586  -5.428  1.00 16.02 ? 281 PHE A C     1 
ATOM   2133 O  O     . PHE A 1 288 ? -45.704 30.919  -4.818  1.00 17.03 ? 281 PHE A O     1 
ATOM   2134 C  CB    . PHE A 1 288 ? -47.986 30.313  -7.094  1.00 15.94 ? 281 PHE A CB    1 
ATOM   2135 C  CG    . PHE A 1 288 ? -48.289 30.044  -8.548  1.00 17.18 ? 281 PHE A CG    1 
ATOM   2136 C  CD1   . PHE A 1 288 ? -49.112 30.918  -9.296  1.00 18.58 ? 281 PHE A CD1   1 
ATOM   2137 C  CD2   . PHE A 1 288 ? -47.737 28.967  -9.185  1.00 16.35 ? 281 PHE A CD2   1 
ATOM   2138 C  CE1   . PHE A 1 288 ? -49.419 30.674  -10.628 1.00 17.40 ? 281 PHE A CE1   1 
ATOM   2139 C  CE2   . PHE A 1 288 ? -48.012 28.730  -10.519 1.00 18.16 ? 281 PHE A CE2   1 
ATOM   2140 C  CZ    . PHE A 1 288 ? -48.862 29.593  -11.257 1.00 17.58 ? 281 PHE A CZ    1 
ATOM   2141 N  N     . THR A 1 289 ? -47.276 32.575  -4.853  1.00 15.34 ? 282 THR A N     1 
ATOM   2142 C  CA    . THR A 1 289 ? -46.986 32.936  -3.452  1.00 15.19 ? 282 THR A CA    1 
ATOM   2143 C  C     . THR A 1 289 ? -47.757 31.900  -2.643  1.00 15.13 ? 282 THR A C     1 
ATOM   2144 O  O     . THR A 1 289 ? -48.661 31.281  -3.156  1.00 14.23 ? 282 THR A O     1 
ATOM   2145 C  CB    . THR A 1 289 ? -47.472 34.337  -3.039  1.00 14.51 ? 282 THR A CB    1 
ATOM   2146 O  OG1   . THR A 1 289 ? -48.867 34.369  -3.257  1.00 13.92 ? 282 THR A OG1   1 
ATOM   2147 C  CG2   . THR A 1 289 ? -46.733 35.485  -3.841  1.00 15.87 ? 282 THR A CG2   1 
ATOM   2148 N  N     . GLU A 1 290 ? -47.363 31.689  -1.403  1.00 16.19 ? 283 GLU A N     1 
ATOM   2149 C  CA    . GLU A 1 290 ? -48.112 30.836  -0.503  1.00 16.35 ? 283 GLU A CA    1 
ATOM   2150 C  C     . GLU A 1 290 ? -49.580 31.283  -0.455  1.00 17.64 ? 283 GLU A C     1 
ATOM   2151 O  O     . GLU A 1 290 ? -50.483 30.471  -0.578  1.00 15.74 ? 283 GLU A O     1 
ATOM   2152 C  CB    . GLU A 1 290 ? -47.509 30.886  0.907   1.00 16.88 ? 283 GLU A CB    1 
ATOM   2153 C  CG    . GLU A 1 290 ? -47.983 29.723  1.741   1.00 18.86 ? 283 GLU A CG    1 
ATOM   2154 C  CD    . GLU A 1 290 ? -47.285 29.564  3.062   1.00 20.95 ? 283 GLU A CD    1 
ATOM   2155 O  OE1   . GLU A 1 290 ? -46.354 30.296  3.312   1.00 25.61 ? 283 GLU A OE1   1 
ATOM   2156 O  OE2   . GLU A 1 290 ? -47.683 28.702  3.863   1.00 24.18 ? 283 GLU A OE2   1 
ATOM   2157 N  N     . SER A 1 291 ? -49.835 32.578  -0.312  1.00 18.34 ? 284 SER A N     1 
ATOM   2158 C  CA    . SER A 1 291 ? -51.234 33.028  -0.250  1.00 19.87 ? 284 SER A CA    1 
ATOM   2159 C  C     . SER A 1 291 ? -52.013 32.644  -1.487  1.00 19.75 ? 284 SER A C     1 
ATOM   2160 O  O     . SER A 1 291 ? -53.186 32.283  -1.369  1.00 18.21 ? 284 SER A O     1 
ATOM   2161 C  CB    . SER A 1 291 ? -51.319 34.546  -0.072  1.00 20.15 ? 284 SER A CB    1 
ATOM   2162 O  OG    . SER A 1 291 ? -50.758 34.890  1.171   1.00 24.20 ? 284 SER A OG    1 
ATOM   2163 N  N     . GLN A 1 292 ? -51.371 32.717  -2.656  1.00 18.46 ? 285 GLN A N     1 
ATOM   2164 C  CA    . GLN A 1 292 ? -52.042 32.385  -3.920  1.00 18.78 ? 285 GLN A CA    1 
ATOM   2165 C  C     . GLN A 1 292 ? -52.389 30.895  -3.947  1.00 17.91 ? 285 GLN A C     1 
ATOM   2166 O  O     . GLN A 1 292 ? -53.529 30.501  -4.272  1.00 18.72 ? 285 GLN A O     1 
ATOM   2167 C  CB    . GLN A 1 292 ? -51.175 32.724  -5.125  1.00 19.62 ? 285 GLN A CB    1 
ATOM   2168 C  CG    . GLN A 1 292 ? -51.079 34.156  -5.550  1.00 20.78 ? 285 GLN A CG    1 
ATOM   2169 C  CD    . GLN A 1 292 ? -50.055 34.346  -6.683  1.00 24.99 ? 285 GLN A CD    1 
ATOM   2170 O  OE1   . GLN A 1 292 ? -48.937 33.762  -6.686  1.00 21.27 ? 285 GLN A OE1   1 
ATOM   2171 N  NE2   . GLN A 1 292 ? -50.456 35.098  -7.690  1.00 25.96 ? 285 GLN A NE2   1 
ATOM   2172 N  N     . LEU A 1 293 ? -51.470 30.050  -3.474  1.00 16.82 ? 286 LEU A N     1 
ATOM   2173 C  CA    . LEU A 1 293 ? -51.786 28.587  -3.456  1.00 16.86 ? 286 LEU A CA    1 
ATOM   2174 C  C     . LEU A 1 293 ? -52.928 28.322  -2.451  1.00 17.08 ? 286 LEU A C     1 
ATOM   2175 O  O     . LEU A 1 293 ? -53.944 27.646  -2.766  1.00 17.73 ? 286 LEU A O     1 
ATOM   2176 C  CB    . LEU A 1 293 ? -50.535 27.713  -3.149  1.00 15.81 ? 286 LEU A CB    1 
ATOM   2177 C  CG    . LEU A 1 293 ? -49.382 27.901  -4.178  1.00 15.73 ? 286 LEU A CG    1 
ATOM   2178 C  CD1   . LEU A 1 293 ? -48.178 27.043  -3.834  1.00 15.09 ? 286 LEU A CD1   1 
ATOM   2179 C  CD2   . LEU A 1 293 ? -49.844 27.499  -5.548  1.00 16.46 ? 286 LEU A CD2   1 
ATOM   2180 N  N     . GLN A 1 294 ? -52.797 28.905  -1.283  1.00 17.01 ? 287 GLN A N     1 
ATOM   2181 C  CA    . GLN A 1 294 ? -53.877 28.805  -0.312  1.00 19.26 ? 287 GLN A CA    1 
ATOM   2182 C  C     . GLN A 1 294 ? -55.239 29.317  -0.829  1.00 21.10 ? 287 GLN A C     1 
ATOM   2183 O  O     . GLN A 1 294 ? -56.275 28.690  -0.553  1.00 22.59 ? 287 GLN A O     1 
ATOM   2184 C  CB    . GLN A 1 294 ? -53.508 29.530  0.949   1.00 18.76 ? 287 GLN A CB    1 
ATOM   2185 C  CG    . GLN A 1 294 ? -52.370 28.878  1.686   1.00 19.41 ? 287 GLN A CG    1 
ATOM   2186 C  CD    . GLN A 1 294 ? -52.048 29.693  2.924   1.00 20.67 ? 287 GLN A CD    1 
ATOM   2187 O  OE1   . GLN A 1 294 ? -51.901 30.882  2.831   1.00 21.10 ? 287 GLN A OE1   1 
ATOM   2188 N  NE2   . GLN A 1 294 ? -51.968 29.057  4.078   1.00 20.85 ? 287 GLN A NE2   1 
ATOM   2189 N  N     . SER A 1 295 ? -55.243 30.362  -1.654  1.00 20.89 ? 288 SER A N     1 
ATOM   2190 C  CA    . SER A 1 295 ? -56.505 30.847  -2.223  1.00 22.92 ? 288 SER A CA    1 
ATOM   2191 C  C     . SER A 1 295 ? -57.190 29.783  -3.044  1.00 22.33 ? 288 SER A C     1 
ATOM   2192 O  O     . SER A 1 295 ? -58.391 29.704  -3.040  1.00 25.17 ? 288 SER A O     1 
ATOM   2193 C  CB    . SER A 1 295 ? -56.361 32.138  -3.077  1.00 23.64 ? 288 SER A CB    1 
ATOM   2194 O  OG    . SER A 1 295 ? -55.641 31.934  -4.322  1.00 30.11 ? 288 SER A OG    1 
ATOM   2195 N  N     . HIS A 1 296 ? -56.441 29.003  -3.795  1.00 20.94 ? 289 HIS A N     1 
ATOM   2196 C  CA    . HIS A 1 296 ? -57.043 28.052  -4.697  1.00 20.34 ? 289 HIS A CA    1 
ATOM   2197 C  C     . HIS A 1 296 ? -57.304 26.742  -4.011  1.00 20.16 ? 289 HIS A C     1 
ATOM   2198 O  O     . HIS A 1 296 ? -58.280 26.080  -4.282  1.00 22.37 ? 289 HIS A O     1 
ATOM   2199 C  CB    . HIS A 1 296 ? -56.138 27.811  -5.894  1.00 20.94 ? 289 HIS A CB    1 
ATOM   2200 C  CG    . HIS A 1 296 ? -56.022 28.980  -6.827  1.00 21.56 ? 289 HIS A CG    1 
ATOM   2201 N  ND1   . HIS A 1 296 ? -57.103 29.516  -7.490  1.00 22.99 ? 289 HIS A ND1   1 
ATOM   2202 C  CD2   . HIS A 1 296 ? -54.945 29.685  -7.240  1.00 24.97 ? 289 HIS A CD2   1 
ATOM   2203 C  CE1   . HIS A 1 296 ? -56.705 30.504  -8.269  1.00 23.68 ? 289 HIS A CE1   1 
ATOM   2204 N  NE2   . HIS A 1 296 ? -55.394 30.608  -8.163  1.00 26.02 ? 289 HIS A NE2   1 
ATOM   2205 N  N     . PHE A 1 297 ? -56.399 26.324  -3.152  1.00 18.66 ? 290 PHE A N     1 
ATOM   2206 C  CA    . PHE A 1 297 ? -56.422 24.917  -2.701  1.00 18.17 ? 290 PHE A CA    1 
ATOM   2207 C  C     . PHE A 1 297 ? -56.656 24.756  -1.205  1.00 18.42 ? 290 PHE A C     1 
ATOM   2208 O  O     . PHE A 1 297 ? -56.652 23.639  -0.682  1.00 19.35 ? 290 PHE A O     1 
ATOM   2209 C  CB    . PHE A 1 297 ? -55.125 24.223  -3.149  1.00 16.84 ? 290 PHE A CB    1 
ATOM   2210 C  CG    . PHE A 1 297 ? -54.816 24.428  -4.612  1.00 16.62 ? 290 PHE A CG    1 
ATOM   2211 C  CD1   . PHE A 1 297 ? -55.626 23.896  -5.574  1.00 18.27 ? 290 PHE A CD1   1 
ATOM   2212 C  CD2   . PHE A 1 297 ? -53.728 25.195  -5.008  1.00 16.83 ? 290 PHE A CD2   1 
ATOM   2213 C  CE1   . PHE A 1 297 ? -55.363 24.098  -6.918  1.00 18.94 ? 290 PHE A CE1   1 
ATOM   2214 C  CE2   . PHE A 1 297 ? -53.477 25.456  -6.332  1.00 16.64 ? 290 PHE A CE2   1 
ATOM   2215 C  CZ    . PHE A 1 297 ? -54.284 24.895  -7.289  1.00 18.72 ? 290 PHE A CZ    1 
ATOM   2216 N  N     . GLY A 1 298 ? -56.835 25.875  -0.524  1.00 18.55 ? 291 GLY A N     1 
ATOM   2217 C  CA    . GLY A 1 298 ? -57.077 25.902  0.930   1.00 18.42 ? 291 GLY A CA    1 
ATOM   2218 C  C     . GLY A 1 298 ? -55.812 26.114  1.712   1.00 17.62 ? 291 GLY A C     1 
ATOM   2219 O  O     . GLY A 1 298 ? -54.713 25.933  1.214   1.00 17.53 ? 291 GLY A O     1 
ATOM   2220 N  N     . GLU A 1 299 ? -55.986 26.465  2.966   1.00 18.65 ? 292 GLU A N     1 
ATOM   2221 C  CA    . GLU A 1 299 ? -54.911 26.924  3.809   1.00 21.29 ? 292 GLU A CA    1 
ATOM   2222 C  C     . GLU A 1 299 ? -53.853 25.800  3.950   1.00 19.57 ? 292 GLU A C     1 
ATOM   2223 O  O     . GLU A 1 299 ? -52.699 26.047  3.721   1.00 17.90 ? 292 GLU A O     1 
ATOM   2224 C  CB    . GLU A 1 299 ? -55.483 27.322  5.167   1.00 23.19 ? 292 GLU A CB    1 
ATOM   2225 C  CG    . GLU A 1 299 ? -54.469 27.719  6.198   1.00 30.26 ? 292 GLU A CG    1 
ATOM   2226 C  CD    . GLU A 1 299 ? -55.067 27.997  7.592   1.00 36.42 ? 292 GLU A CD    1 
ATOM   2227 O  OE1   . GLU A 1 299 ? -54.601 27.383  8.599   1.00 40.84 ? 292 GLU A OE1   1 
ATOM   2228 O  OE2   . GLU A 1 299 ? -55.987 28.818  7.679   1.00 35.46 ? 292 GLU A OE2   1 
ATOM   2229 N  N     . LYS A 1 300 ? -54.283 24.582  4.260   1.00 18.53 ? 293 LYS A N     1 
ATOM   2230 C  CA    . LYS A 1 300 ? -53.371 23.429  4.466   1.00 20.36 ? 293 LYS A CA    1 
ATOM   2231 C  C     . LYS A 1 300 ? -52.713 22.935  3.162   1.00 18.87 ? 293 LYS A C     1 
ATOM   2232 O  O     . LYS A 1 300 ? -51.508 22.747  3.070   1.00 18.03 ? 293 LYS A O     1 
ATOM   2233 C  CB    . LYS A 1 300 ? -54.137 22.254  5.093   1.00 22.87 ? 293 LYS A CB    1 
ATOM   2234 C  CG    . LYS A 1 300 ? -53.334 20.971  5.273   1.00 26.94 ? 293 LYS A CG    1 
ATOM   2235 C  CD    . LYS A 1 300 ? -54.012 20.038  6.295   1.00 33.89 ? 293 LYS A CD    1 
ATOM   2236 C  CE    . LYS A 1 300 ? -53.421 18.627  6.267   1.00 38.00 ? 293 LYS A CE    1 
ATOM   2237 N  NZ    . LYS A 1 300 ? -54.249 17.813  5.312   1.00 41.55 ? 293 LYS A NZ    1 
ATOM   2238 N  N     . ASN A 1 301 ? -53.508 22.675  2.164   1.00 17.94 ? 294 ASN A N     1 
ATOM   2239 C  CA    . ASN A 1 301 ? -52.945 22.248  0.900   1.00 16.35 ? 294 ASN A CA    1 
ATOM   2240 C  C     . ASN A 1 301 ? -52.038 23.317  0.272   1.00 15.72 ? 294 ASN A C     1 
ATOM   2241 O  O     . ASN A 1 301 ? -51.034 22.973  -0.341  1.00 15.86 ? 294 ASN A O     1 
ATOM   2242 C  CB    . ASN A 1 301 ? -54.046 21.978  -0.103  1.00 17.96 ? 294 ASN A CB    1 
ATOM   2243 C  CG    . ASN A 1 301 ? -54.849 20.709  0.173   1.00 17.79 ? 294 ASN A CG    1 
ATOM   2244 O  OD1   . ASN A 1 301 ? -54.383 19.806  0.835   1.00 21.20 ? 294 ASN A OD1   1 
ATOM   2245 N  ND2   . ASN A 1 301 ? -56.108 20.671  -0.314  1.00 16.45 ? 294 ASN A ND2   1 
ATOM   2246 N  N     . GLY A 1 302 ? -52.412 24.603  0.370   1.00 15.80 ? 295 GLY A N     1 
ATOM   2247 C  CA    . GLY A 1 302 ? -51.628 25.694  -0.229  1.00 13.77 ? 295 GLY A CA    1 
ATOM   2248 C  C     . GLY A 1 302 ? -50.243 25.772  0.464   1.00 13.73 ? 295 GLY A C     1 
ATOM   2249 O  O     . GLY A 1 302 ? -49.207 25.892  -0.186  1.00 12.88 ? 295 GLY A O     1 
ATOM   2250 N  N     . SER A 1 303 ? -50.229 25.658  1.792   1.00 13.46 ? 296 SER A N     1 
ATOM   2251 C  CA    . SER A 1 303 ? -49.001 25.687  2.561   1.00 14.28 ? 296 SER A CA    1 
ATOM   2252 C  C     . SER A 1 303 ? -48.148 24.486  2.230   1.00 14.66 ? 296 SER A C     1 
ATOM   2253 O  O     . SER A 1 303 ? -46.922 24.591  2.032   1.00 12.08 ? 296 SER A O     1 
ATOM   2254 C  CB    . SER A 1 303 ? -49.303 25.727  4.064   1.00 17.04 ? 296 SER A CB    1 
ATOM   2255 O  OG    . SER A 1 303 ? -49.592 27.073  4.414   1.00 20.17 ? 296 SER A OG    1 
ATOM   2256 N  N     . TRP A 1 304 ? -48.808 23.320  2.170   1.00 14.12 ? 297 TRP A N     1 
ATOM   2257 C  CA    . TRP A 1 304 ? -48.117 22.113  1.820   1.00 15.24 ? 297 TRP A CA    1 
ATOM   2258 C  C     . TRP A 1 304 ? -47.439 22.214  0.412   1.00 14.28 ? 297 TRP A C     1 
ATOM   2259 O  O     . TRP A 1 304 ? -46.313 21.834  0.238   1.00 12.02 ? 297 TRP A O     1 
ATOM   2260 C  CB    . TRP A 1 304 ? -49.100 20.970  1.839   1.00 16.75 ? 297 TRP A CB    1 
ATOM   2261 C  CG    . TRP A 1 304 ? -48.402 19.703  1.694   1.00 17.69 ? 297 TRP A CG    1 
ATOM   2262 C  CD1   . TRP A 1 304 ? -47.796 19.006  2.688   1.00 18.18 ? 297 TRP A CD1   1 
ATOM   2263 C  CD2   . TRP A 1 304 ? -48.320 18.902  0.508   1.00 17.31 ? 297 TRP A CD2   1 
ATOM   2264 N  NE1   . TRP A 1 304 ? -47.268 17.823  2.162   1.00 20.03 ? 297 TRP A NE1   1 
ATOM   2265 C  CE2   . TRP A 1 304 ? -47.584 17.738  0.837   1.00 18.18 ? 297 TRP A CE2   1 
ATOM   2266 C  CE3   . TRP A 1 304 ? -48.730 19.080  -0.804  1.00 17.58 ? 297 TRP A CE3   1 
ATOM   2267 C  CZ2   . TRP A 1 304 ? -47.276 16.760  -0.093  1.00 17.44 ? 297 TRP A CZ2   1 
ATOM   2268 C  CZ3   . TRP A 1 304 ? -48.422 18.118  -1.724  1.00 18.45 ? 297 TRP A CZ3   1 
ATOM   2269 C  CH2   . TRP A 1 304 ? -47.683 16.962  -1.363  1.00 17.22 ? 297 TRP A CH2   1 
ATOM   2270 N  N     . LEU A 1 305 ? -48.172 22.718  -0.560  1.00 14.19 ? 298 LEU A N     1 
ATOM   2271 C  CA    . LEU A 1 305 ? -47.667 22.819  -1.937  1.00 14.89 ? 298 LEU A CA    1 
ATOM   2272 C  C     . LEU A 1 305 ? -46.508 23.738  -2.015  1.00 13.88 ? 298 LEU A C     1 
ATOM   2273 O  O     . LEU A 1 305 ? -45.507 23.458  -2.729  1.00 13.90 ? 298 LEU A O     1 
ATOM   2274 C  CB    . LEU A 1 305 ? -48.784 23.268  -2.923  1.00 13.84 ? 298 LEU A CB    1 
ATOM   2275 C  CG    . LEU A 1 305 ? -49.788 22.161  -3.222  1.00 15.38 ? 298 LEU A CG    1 
ATOM   2276 C  CD1   . LEU A 1 305 ? -51.090 22.731  -3.807  1.00 15.00 ? 298 LEU A CD1   1 
ATOM   2277 C  CD2   . LEU A 1 305 ? -49.231 21.143  -4.215  1.00 14.70 ? 298 LEU A CD2   1 
ATOM   2278 N  N     . TYR A 1 306 ? -46.616 24.855  -1.297  1.00 13.93 ? 299 TYR A N     1 
ATOM   2279 C  CA    . TYR A 1 306 ? -45.596 25.895  -1.373  1.00 14.03 ? 299 TYR A CA    1 
ATOM   2280 C  C     . TYR A 1 306 ? -44.264 25.343  -0.861  1.00 13.40 ? 299 TYR A C     1 
ATOM   2281 O  O     . TYR A 1 306 ? -43.242 25.562  -1.484  1.00 11.60 ? 299 TYR A O     1 
ATOM   2282 C  CB    . TYR A 1 306 ? -46.011 27.157  -0.567  1.00 17.46 ? 299 TYR A CB    1 
ATOM   2283 C  CG    . TYR A 1 306 ? -44.995 28.277  -0.514  1.00 16.96 ? 299 TYR A CG    1 
ATOM   2284 C  CD1   . TYR A 1 306 ? -44.017 28.343  0.503   1.00 19.64 ? 299 TYR A CD1   1 
ATOM   2285 C  CD2   . TYR A 1 306 ? -45.011 29.282  -1.469  1.00 19.02 ? 299 TYR A CD2   1 
ATOM   2286 C  CE1   . TYR A 1 306 ? -43.055 29.365  0.508   1.00 19.55 ? 299 TYR A CE1   1 
ATOM   2287 C  CE2   . TYR A 1 306 ? -44.063 30.308  -1.456  1.00 19.42 ? 299 TYR A CE2   1 
ATOM   2288 C  CZ    . TYR A 1 306 ? -43.126 30.348  -0.472  1.00 20.07 ? 299 TYR A CZ    1 
ATOM   2289 O  OH    . TYR A 1 306 ? -42.206 31.373  -0.527  1.00 24.40 ? 299 TYR A OH    1 
ATOM   2290 N  N     . ALA A 1 307 ? -44.281 24.672  0.290   1.00 12.34 ? 300 ALA A N     1 
ATOM   2291 C  CA    . ALA A 1 307 ? -43.108 23.983  0.828   1.00 12.27 ? 300 ALA A CA    1 
ATOM   2292 C  C     . ALA A 1 307 ? -42.656 22.848  -0.110  1.00 11.67 ? 300 ALA A C     1 
ATOM   2293 O  O     . ALA A 1 307 ? -41.496 22.754  -0.528  1.00 10.75 ? 300 ALA A O     1 
ATOM   2294 C  CB    . ALA A 1 307 ? -43.421 23.443  2.271   1.00 12.35 ? 300 ALA A CB    1 
ATOM   2295 N  N     . MET A 1 308 ? -43.590 22.022  -0.483  1.00 11.42 ? 301 MET A N     1 
ATOM   2296 C  CA    . MET A 1 308 ? -43.237 20.775  -1.188  1.00 13.30 ? 301 MET A CA    1 
ATOM   2297 C  C     . MET A 1 308 ? -42.584 20.992  -2.548  1.00 13.35 ? 301 MET A C     1 
ATOM   2298 O  O     . MET A 1 308 ? -41.661 20.277  -2.906  1.00 13.93 ? 301 MET A O     1 
ATOM   2299 C  CB    . MET A 1 308 ? -44.463 19.933  -1.388  1.00 13.33 ? 301 MET A CB    1 
ATOM   2300 C  CG    . MET A 1 308 ? -44.184 18.513  -1.849  1.00 14.44 ? 301 MET A CG    1 
ATOM   2301 S  SD    . MET A 1 308 ? -43.372 17.493  -0.613  1.00 14.99 ? 301 MET A SD    1 
ATOM   2302 C  CE    . MET A 1 308 ? -41.662 17.277  -1.113  1.00 13.99 ? 301 MET A CE    1 
ATOM   2303 N  N     . CYS A 1 309 ? -43.047 21.984  -3.300  1.00 13.68 ? 302 CYS A N     1 
ATOM   2304 C  CA    . CYS A 1 309 ? -42.440 22.270  -4.622  1.00 14.39 ? 302 CYS A CA    1 
ATOM   2305 C  C     . CYS A 1 309 ? -40.952 22.754  -4.482  1.00 13.43 ? 302 CYS A C     1 
ATOM   2306 O  O     . CYS A 1 309 ? -40.211 22.806  -5.472  1.00 13.50 ? 302 CYS A O     1 
ATOM   2307 C  CB    . CYS A 1 309 ? -43.297 23.277  -5.427  1.00 13.29 ? 302 CYS A CB    1 
ATOM   2308 S  SG    . CYS A 1 309 ? -43.130 24.972  -4.861  1.00 12.97 ? 302 CYS A SG    1 
ATOM   2309 N  N     . ARG A 1 310 ? -40.554 23.123  -3.273  1.00 13.03 ? 303 ARG A N     1 
ATOM   2310 C  CA    . ARG A 1 310 ? -39.170 23.480  -2.949  1.00 14.12 ? 303 ARG A CA    1 
ATOM   2311 C  C     . ARG A 1 310 ? -38.464 22.287  -2.225  1.00 13.28 ? 303 ARG A C     1 
ATOM   2312 O  O     . ARG A 1 310 ? -37.367 22.427  -1.756  1.00 11.77 ? 303 ARG A O     1 
ATOM   2313 C  CB    . ARG A 1 310 ? -39.141 24.751  -2.051  1.00 15.09 ? 303 ARG A CB    1 
ATOM   2314 C  CG    . ARG A 1 310 ? -39.582 26.050  -2.720  1.00 17.15 ? 303 ARG A CG    1 
ATOM   2315 C  CD    . ARG A 1 310 ? -40.065 27.103  -1.703  1.00 18.70 ? 303 ARG A CD    1 
ATOM   2316 N  NE    . ARG A 1 310 ? -40.275 28.370  -2.403  1.00 18.17 ? 303 ARG A NE    1 
ATOM   2317 C  CZ    . ARG A 1 310 ? -41.326 28.668  -3.163  1.00 17.95 ? 303 ARG A CZ    1 
ATOM   2318 N  NH1   . ARG A 1 310 ? -41.393 29.845  -3.832  1.00 15.56 ? 303 ARG A NH1   1 
ATOM   2319 N  NH2   . ARG A 1 310 ? -42.344 27.826  -3.223  1.00 19.75 ? 303 ARG A NH2   1 
ATOM   2320 N  N     . GLY A 1 311 ? -39.082 21.118  -2.177  1.00 12.90 ? 304 GLY A N     1 
ATOM   2321 C  CA    . GLY A 1 311 ? -38.424 19.893  -1.633  1.00 12.86 ? 304 GLY A CA    1 
ATOM   2322 C  C     . GLY A 1 311 ? -38.625 19.768  -0.110  1.00 13.46 ? 304 GLY A C     1 
ATOM   2323 O  O     . GLY A 1 311 ? -37.976 18.952  0.565   1.00 12.28 ? 304 GLY A O     1 
ATOM   2324 N  N     . ILE A 1 312 ? -39.507 20.590  0.430   1.00 12.99 ? 305 ILE A N     1 
ATOM   2325 C  CA    . ILE A 1 312 ? -39.656 20.678  1.888   1.00 14.86 ? 305 ILE A CA    1 
ATOM   2326 C  C     . ILE A 1 312 ? -41.014 20.129  2.285   1.00 14.03 ? 305 ILE A C     1 
ATOM   2327 O  O     . ILE A 1 312 ? -42.052 20.567  1.749   1.00 13.30 ? 305 ILE A O     1 
ATOM   2328 C  CB    . ILE A 1 312 ? -39.566 22.131  2.340   1.00 14.49 ? 305 ILE A CB    1 
ATOM   2329 C  CG1   . ILE A 1 312 ? -38.200 22.680  1.946   1.00 15.29 ? 305 ILE A CG1   1 
ATOM   2330 C  CG2   . ILE A 1 312 ? -39.827 22.263  3.841   1.00 15.01 ? 305 ILE A CG2   1 
ATOM   2331 C  CD1   . ILE A 1 312 ? -38.081 24.181  2.180   1.00 18.72 ? 305 ILE A CD1   1 
ATOM   2332 N  N     . GLU A 1 313 ? -41.007 19.184  3.219   1.00 15.19 ? 306 GLU A N     1 
ATOM   2333 C  CA    . GLU A 1 313 ? -42.220 18.607  3.815   1.00 17.74 ? 306 GLU A CA    1 
ATOM   2334 C  C     . GLU A 1 313 ? -41.939 18.170  5.301   1.00 18.49 ? 306 GLU A C     1 
ATOM   2335 O  O     . GLU A 1 313 ? -40.834 17.721  5.622   1.00 15.62 ? 306 GLU A O     1 
ATOM   2336 C  CB    . GLU A 1 313 ? -42.569 17.363  2.997   1.00 21.47 ? 306 GLU A CB    1 
ATOM   2337 C  CG    . GLU A 1 313 ? -44.025 17.052  2.924   1.00 23.17 ? 306 GLU A CG    1 
ATOM   2338 C  CD    . GLU A 1 313 ? -44.369 15.686  3.414   1.00 26.92 ? 306 GLU A CD    1 
ATOM   2339 O  OE1   . GLU A 1 313 ? -43.465 14.807  3.654   1.00 23.13 ? 306 GLU A OE1   1 
ATOM   2340 O  OE2   . GLU A 1 313 ? -45.594 15.523  3.530   1.00 32.85 ? 306 GLU A OE2   1 
ATOM   2341 N  N     . HIS A 1 314 ? -42.914 18.289  6.198   1.00 19.79 ? 307 HIS A N     1 
ATOM   2342 C  CA    . HIS A 1 314 ? -42.668 18.024  7.616   1.00 21.59 ? 307 HIS A CA    1 
ATOM   2343 C  C     . HIS A 1 314 ? -43.520 16.910  8.180   1.00 20.92 ? 307 HIS A C     1 
ATOM   2344 O  O     . HIS A 1 314 ? -43.468 16.692  9.382   1.00 20.43 ? 307 HIS A O     1 
ATOM   2345 C  CB    . HIS A 1 314 ? -42.824 19.313  8.507   1.00 23.09 ? 307 HIS A CB    1 
ATOM   2346 C  CG    . HIS A 1 314 ? -41.922 20.420  8.072   1.00 26.58 ? 307 HIS A CG    1 
ATOM   2347 N  ND1   . HIS A 1 314 ? -40.559 20.247  7.931   1.00 26.27 ? 307 HIS A ND1   1 
ATOM   2348 C  CD2   . HIS A 1 314 ? -42.193 21.665  7.621   1.00 27.64 ? 307 HIS A CD2   1 
ATOM   2349 C  CE1   . HIS A 1 314 ? -40.025 21.345  7.440   1.00 28.15 ? 307 HIS A CE1   1 
ATOM   2350 N  NE2   . HIS A 1 314 ? -40.996 22.230  7.264   1.00 27.46 ? 307 HIS A NE2   1 
ATOM   2351 N  N     . ASP A 1 315 ? -44.306 16.232  7.366   1.00 18.71 ? 308 ASP A N     1 
ATOM   2352 C  CA    . ASP A 1 315 ? -45.141 15.159  7.859   1.00 19.79 ? 308 ASP A CA    1 
ATOM   2353 C  C     . ASP A 1 315 ? -44.202 14.142  8.602   1.00 18.77 ? 308 ASP A C     1 
ATOM   2354 O  O     . ASP A 1 315 ? -43.226 13.703  8.052   1.00 16.31 ? 308 ASP A O     1 
ATOM   2355 C  CB    . ASP A 1 315 ? -45.910 14.512  6.693   1.00 22.83 ? 308 ASP A CB    1 
ATOM   2356 C  CG    . ASP A 1 315 ? -46.797 13.324  7.137   1.00 26.19 ? 308 ASP A CG    1 
ATOM   2357 O  OD1   . ASP A 1 315 ? -47.489 13.405  8.163   1.00 30.75 ? 308 ASP A OD1   1 
ATOM   2358 O  OD2   . ASP A 1 315 ? -46.784 12.276  6.484   1.00 27.57 ? 308 ASP A OD2   1 
ATOM   2359 N  N     . PRO A 1 316 ? -44.506 13.778  9.860   1.00 17.85 ? 309 PRO A N     1 
ATOM   2360 C  CA    . PRO A 1 316 ? -43.547 12.863  10.529  1.00 17.59 ? 309 PRO A CA    1 
ATOM   2361 C  C     . PRO A 1 316 ? -43.691 11.410  10.142  1.00 15.99 ? 309 PRO A C     1 
ATOM   2362 O  O     . PRO A 1 316 ? -44.756 10.967  9.766   1.00 16.05 ? 309 PRO A O     1 
ATOM   2363 C  CB    . PRO A 1 316 ? -43.854 13.020  12.045  1.00 17.46 ? 309 PRO A CB    1 
ATOM   2364 C  CG    . PRO A 1 316 ? -45.283 13.584  12.089  1.00 18.95 ? 309 PRO A CG    1 
ATOM   2365 C  CD    . PRO A 1 316 ? -45.577 14.261  10.764  1.00 18.49 ? 309 PRO A CD    1 
ATOM   2366 N  N     . VAL A 1 317 ? -42.596 10.670  10.245  1.00 16.87 ? 310 VAL A N     1 
ATOM   2367 C  CA    . VAL A 1 317 ? -42.629 9.223   10.220  1.00 17.69 ? 310 VAL A CA    1 
ATOM   2368 C  C     . VAL A 1 317 ? -43.302 8.840   11.566  1.00 18.79 ? 310 VAL A C     1 
ATOM   2369 O  O     . VAL A 1 317 ? -42.681 8.969   12.656  1.00 17.74 ? 310 VAL A O     1 
ATOM   2370 C  CB    . VAL A 1 317 ? -41.186 8.621   10.204  1.00 18.05 ? 310 VAL A CB    1 
ATOM   2371 C  CG1   . VAL A 1 317 ? -41.244 7.130   10.393  1.00 17.07 ? 310 VAL A CG1   1 
ATOM   2372 C  CG2   . VAL A 1 317 ? -40.415 9.028   8.916   1.00 17.73 ? 310 VAL A CG2   1 
ATOM   2373 N  N     . LYS A 1 318 ? -44.539 8.388   11.486  1.00 18.40 ? 311 LYS A N     1 
ATOM   2374 C  CA    . LYS A 1 318 ? -45.309 8.009   12.691  1.00 19.44 ? 311 LYS A CA    1 
ATOM   2375 C  C     . LYS A 1 318 ? -44.889 6.647   13.229  1.00 17.41 ? 311 LYS A C     1 
ATOM   2376 O  O     . LYS A 1 318 ? -44.649 5.725   12.454  1.00 16.77 ? 311 LYS A O     1 
ATOM   2377 C  CB    . LYS A 1 318 ? -46.778 7.959   12.330  1.00 20.45 ? 311 LYS A CB    1 
ATOM   2378 C  CG    . LYS A 1 318 ? -47.338 9.321   12.068  1.00 23.30 ? 311 LYS A CG    1 
ATOM   2379 C  CD    . LYS A 1 318 ? -48.573 9.183   11.219  1.00 27.17 ? 311 LYS A CD    1 
ATOM   2380 C  CE    . LYS A 1 318 ? -49.132 10.542  10.796  1.00 30.94 ? 311 LYS A CE    1 
ATOM   2381 N  NZ    . LYS A 1 318 ? -48.050 11.552  10.573  1.00 33.19 ? 311 LYS A NZ    1 
ATOM   2382 N  N     . PRO A 1 319 ? -44.715 6.531   14.535  1.00 18.28 ? 312 PRO A N     1 
ATOM   2383 C  CA    . PRO A 1 319 ? -44.324 5.285   15.154  1.00 18.46 ? 312 PRO A CA    1 
ATOM   2384 C  C     . PRO A 1 319 ? -45.525 4.337   15.237  1.00 21.55 ? 312 PRO A C     1 
ATOM   2385 O  O     . PRO A 1 319 ? -46.252 4.320   16.259  1.00 19.64 ? 312 PRO A O     1 
ATOM   2386 C  CB    . PRO A 1 319 ? -43.913 5.714   16.545  1.00 20.35 ? 312 PRO A CB    1 
ATOM   2387 C  CG    . PRO A 1 319 ? -44.824 6.916   16.815  1.00 19.51 ? 312 PRO A CG    1 
ATOM   2388 C  CD    . PRO A 1 319 ? -44.781 7.641   15.516  1.00 20.22 ? 312 PRO A CD    1 
ATOM   2389 N  N     . ARG A 1 320 ? -45.729 3.565   14.172  1.00 20.50 ? 313 ARG A N     1 
ATOM   2390 C  CA    . ARG A 1 320 ? -46.896 2.707   14.005  1.00 21.85 ? 313 ARG A CA    1 
ATOM   2391 C  C     . ARG A 1 320 ? -46.496 1.586   13.060  1.00 20.99 ? 313 ARG A C     1 
ATOM   2392 O  O     . ARG A 1 320 ? -46.221 1.811   11.884  1.00 19.61 ? 313 ARG A O     1 
ATOM   2393 C  CB    . ARG A 1 320 ? -48.028 3.497   13.363  1.00 26.70 ? 313 ARG A CB    1 
ATOM   2394 C  CG    . ARG A 1 320 ? -49.430 2.851   13.389  1.00 28.71 ? 313 ARG A CG    1 
ATOM   2395 C  CD    . ARG A 1 320 ? -50.417 3.762   12.637  1.00 31.27 ? 313 ARG A CD    1 
ATOM   2396 N  NE    . ARG A 1 320 ? -50.180 3.585   11.204  1.00 38.27 ? 313 ARG A NE    1 
ATOM   2397 C  CZ    . ARG A 1 320 ? -50.000 4.524   10.271  1.00 45.14 ? 313 ARG A CZ    1 
ATOM   2398 N  NH1   . ARG A 1 320 ? -49.755 4.125   9.011   1.00 38.21 ? 313 ARG A NH1   1 
ATOM   2399 N  NH2   . ARG A 1 320 ? -50.106 5.838   10.560  1.00 45.05 ? 313 ARG A NH2   1 
ATOM   2400 N  N     . GLN A 1 321 ? -46.431 0.387   13.559  1.00 21.55 ? 314 GLN A N     1 
ATOM   2401 C  CA    . GLN A 1 321 ? -46.075 -0.767  12.751  1.00 26.21 ? 314 GLN A CA    1 
ATOM   2402 C  C     . GLN A 1 321 ? -47.336 -1.565  12.459  1.00 27.88 ? 314 GLN A C     1 
ATOM   2403 O  O     . GLN A 1 321 ? -47.403 -2.269  11.505  1.00 31.81 ? 314 GLN A O     1 
ATOM   2404 C  CB    . GLN A 1 321 ? -45.035 -1.594  13.493  1.00 30.32 ? 314 GLN A CB    1 
ATOM   2405 C  CG    . GLN A 1 321 ? -43.928 -0.716  14.122  1.00 37.71 ? 314 GLN A CG    1 
ATOM   2406 C  CD    . GLN A 1 321 ? -42.624 -1.461  14.401  1.00 42.67 ? 314 GLN A CD    1 
ATOM   2407 O  OE1   . GLN A 1 321 ? -41.571 -0.835  14.608  1.00 45.63 ? 314 GLN A OE1   1 
ATOM   2408 N  NE2   . GLN A 1 321 ? -42.689 -2.798  14.402  1.00 40.05 ? 314 GLN A NE2   1 
ATOM   2409 N  N     . LEU A 1 322 ? -48.367 -1.379  13.247  1.00 28.27 ? 315 LEU A N     1 
ATOM   2410 C  CA    . LEU A 1 322 ? -49.593 -2.144  13.116  1.00 29.80 ? 315 LEU A CA    1 
ATOM   2411 C  C     . LEU A 1 322 ? -50.665 -1.356  12.364  1.00 30.19 ? 315 LEU A C     1 
ATOM   2412 O  O     . LEU A 1 322 ? -50.834 -0.197  12.606  1.00 30.41 ? 315 LEU A O     1 
ATOM   2413 C  CB    . LEU A 1 322 ? -50.120 -2.467  14.535  1.00 26.82 ? 315 LEU A CB    1 
ATOM   2414 C  CG    . LEU A 1 322 ? -49.192 -3.310  15.438  1.00 26.93 ? 315 LEU A CG    1 
ATOM   2415 C  CD1   . LEU A 1 322 ? -49.875 -3.536  16.797  1.00 25.88 ? 315 LEU A CD1   1 
ATOM   2416 C  CD2   . LEU A 1 322 ? -48.858 -4.649  14.803  1.00 28.55 ? 315 LEU A CD2   1 
ATOM   2417 N  N     . PRO A 1 323 ? -51.443 -2.022  11.494  1.00 33.52 ? 316 PRO A N     1 
ATOM   2418 C  CA    . PRO A 1 323 ? -52.679 -1.350  11.044  1.00 33.10 ? 316 PRO A CA    1 
ATOM   2419 C  C     . PRO A 1 323 ? -53.578 -0.945  12.214  1.00 29.85 ? 316 PRO A C     1 
ATOM   2420 O  O     . PRO A 1 323 ? -53.589 -1.635  13.214  1.00 30.21 ? 316 PRO A O     1 
ATOM   2421 C  CB    . PRO A 1 323 ? -53.401 -2.440  10.215  1.00 33.15 ? 316 PRO A CB    1 
ATOM   2422 C  CG    . PRO A 1 323 ? -52.367 -3.503  9.928   1.00 32.88 ? 316 PRO A CG    1 
ATOM   2423 C  CD    . PRO A 1 323 ? -51.333 -3.421  11.007  1.00 31.89 ? 316 PRO A CD    1 
ATOM   2424 N  N     . LYS A 1 324 ? -54.356 0.122   12.029  1.00 27.90 ? 317 LYS A N     1 
ATOM   2425 C  CA    . LYS A 1 324 ? -55.358 0.652   12.961  1.00 27.21 ? 317 LYS A CA    1 
ATOM   2426 C  C     . LYS A 1 324 ? -56.798 0.132   12.759  1.00 27.68 ? 317 LYS A C     1 
ATOM   2427 O  O     . LYS A 1 324 ? -57.737 0.455   13.549  1.00 25.32 ? 317 LYS A O     1 
ATOM   2428 C  CB    . LYS A 1 324 ? -55.464 2.169   12.760  1.00 31.17 ? 317 LYS A CB    1 
ATOM   2429 C  CG    . LYS A 1 324 ? -54.144 2.906   12.674  1.00 34.06 ? 317 LYS A CG    1 
ATOM   2430 C  CD    . LYS A 1 324 ? -54.380 4.372   12.359  1.00 38.27 ? 317 LYS A CD    1 
ATOM   2431 C  CE    . LYS A 1 324 ? -54.952 5.141   13.547  1.00 40.02 ? 317 LYS A CE    1 
ATOM   2432 N  NZ    . LYS A 1 324 ? -54.277 6.471   13.582  1.00 40.57 ? 317 LYS A NZ    1 
ATOM   2433 N  N     . THR A 1 325 ? -57.004 -0.579  11.643  1.00 22.69 ? 318 THR A N     1 
ATOM   2434 C  CA    . THR A 1 325 ? -58.282 -1.153  11.304  1.00 21.06 ? 318 THR A CA    1 
ATOM   2435 C  C     . THR A 1 325 ? -58.001 -2.488  10.685  1.00 19.31 ? 318 THR A C     1 
ATOM   2436 O  O     . THR A 1 325 ? -56.905 -2.720  10.217  1.00 20.31 ? 318 THR A O     1 
ATOM   2437 C  CB    . THR A 1 325 ? -59.056 -0.294  10.244  1.00 20.58 ? 318 THR A CB    1 
ATOM   2438 O  OG1   . THR A 1 325 ? -58.268 -0.164  9.058   1.00 20.11 ? 318 THR A OG1   1 
ATOM   2439 C  CG2   . THR A 1 325 ? -59.344 1.066   10.762  1.00 21.81 ? 318 THR A CG2   1 
ATOM   2440 N  N     . ILE A 1 326 ? -58.973 -3.380  10.711  1.00 19.95 ? 319 ILE A N     1 
ATOM   2441 C  CA    . ILE A 1 326 ? -58.845 -4.756  10.147  1.00 20.61 ? 319 ILE A CA    1 
ATOM   2442 C  C     . ILE A 1 326 ? -60.159 -4.975  9.434   1.00 19.91 ? 319 ILE A C     1 
ATOM   2443 O  O     . ILE A 1 326 ? -61.229 -4.982  10.082  1.00 22.00 ? 319 ILE A O     1 
ATOM   2444 C  CB    . ILE A 1 326 ? -58.661 -5.834  11.245  1.00 22.85 ? 319 ILE A CB    1 
ATOM   2445 C  CG1   . ILE A 1 326 ? -57.359 -5.597  11.995  1.00 22.78 ? 319 ILE A CG1   1 
ATOM   2446 C  CG2   . ILE A 1 326 ? -58.670 -7.270  10.638  1.00 22.64 ? 319 ILE A CG2   1 
ATOM   2447 C  CD1   . ILE A 1 326 ? -56.930 -6.803  12.852  1.00 26.17 ? 319 ILE A CD1   1 
ATOM   2448 N  N     . GLY A 1 327 ? -60.078 -5.081  8.117   1.00 20.61 ? 320 GLY A N     1 
ATOM   2449 C  CA    . GLY A 1 327 ? -61.236 -5.118  7.240   1.00 21.85 ? 320 GLY A CA    1 
ATOM   2450 C  C     . GLY A 1 327 ? -61.372 -6.361  6.400   1.00 20.12 ? 320 GLY A C     1 
ATOM   2451 O  O     . GLY A 1 327 ? -60.380 -6.948  6.090   1.00 20.37 ? 320 GLY A O     1 
ATOM   2452 N  N     . CYS A 1 328 ? -62.617 -6.740  6.032   1.00 18.52 ? 321 CYS A N     1 
ATOM   2453 C  CA    . CYS A 1 328 ? -62.896 -7.868  5.142   0.60 17.92 ? 321 CYS A CA    1 
ATOM   2454 C  C     . CYS A 1 328 ? -63.958 -7.377  4.213   1.00 17.31 ? 321 CYS A C     1 
ATOM   2455 O  O     . CYS A 1 328 ? -65.035 -6.878  4.668   1.00 16.33 ? 321 CYS A O     1 
ATOM   2456 C  CB    . CYS A 1 328 ? -63.461 -9.093  5.881   0.60 17.86 ? 321 CYS A CB    1 
ATOM   2457 S  SG    . CYS A 1 328 ? -62.353 -9.790  7.083   0.60 22.45 ? 321 CYS A SG    1 
ATOM   2458 N  N     . SER A 1 329 ? -63.706 -7.438  2.905   1.00 17.21 ? 322 SER A N     1 
ATOM   2459 C  CA    . SER A 1 329 ? -64.734 -6.966  1.995   1.00 18.37 ? 322 SER A CA    1 
ATOM   2460 C  C     . SER A 1 329 ? -64.898 -7.824  0.761   1.00 18.36 ? 322 SER A C     1 
ATOM   2461 O  O     . SER A 1 329 ? -63.994 -8.551  0.392   1.00 18.84 ? 322 SER A O     1 
ATOM   2462 C  CB    . SER A 1 329 ? -64.536 -5.487  1.666   1.00 18.62 ? 322 SER A CB    1 
ATOM   2463 O  OG    . SER A 1 329 ? -63.562 -5.277  0.727   1.00 20.49 ? 322 SER A OG    1 
ATOM   2464 N  N     . LYS A 1 330 ? -66.074 -7.740  0.148   1.00 20.12 ? 323 LYS A N     1 
ATOM   2465 C  CA    . LYS A 1 330 ? -66.348 -8.474  -1.102  1.00 20.00 ? 323 LYS A CA    1 
ATOM   2466 C  C     . LYS A 1 330 ? -67.301 -7.746  -2.037  1.00 19.97 ? 323 LYS A C     1 
ATOM   2467 O  O     . LYS A 1 330 ? -68.359 -7.314  -1.605  1.00 18.14 ? 323 LYS A O     1 
ATOM   2468 C  CB    . LYS A 1 330 ? -66.904 -9.898  -0.825  1.00 20.55 ? 323 LYS A CB    1 
ATOM   2469 C  CG    . LYS A 1 330 ? -67.025 -10.713 -2.120  1.00 21.36 ? 323 LYS A CG    1 
ATOM   2470 C  CD    . LYS A 1 330 ? -66.942 -12.205 -1.930  1.00 22.23 ? 323 LYS A CD    1 
ATOM   2471 C  CE    . LYS A 1 330 ? -67.270 -12.936 -3.208  1.00 22.07 ? 323 LYS A CE    1 
ATOM   2472 N  NZ    . LYS A 1 330 ? -66.058 -12.838 -4.015  1.00 23.54 ? 323 LYS A NZ    1 
ATOM   2473 N  N     . ASN A 1 331 ? -66.897 -7.633  -3.314  1.00 20.69 ? 324 ASN A N     1 
ATOM   2474 C  CA    . ASN A 1 331 ? -67.741 -7.079  -4.358  1.00 22.08 ? 324 ASN A CA    1 
ATOM   2475 C  C     . ASN A 1 331 ? -68.665 -8.196  -4.971  1.00 20.12 ? 324 ASN A C     1 
ATOM   2476 O  O     . ASN A 1 331 ? -68.304 -9.353  -5.006  1.00 18.78 ? 324 ASN A O     1 
ATOM   2477 C  CB    . ASN A 1 331 ? -66.904 -6.456  -5.457  1.00 25.63 ? 324 ASN A CB    1 
ATOM   2478 C  CG    . ASN A 1 331 ? -66.374 -5.044  -5.141  1.00 30.95 ? 324 ASN A CG    1 
ATOM   2479 O  OD1   . ASN A 1 331 ? -66.625 -4.423  -4.112  1.00 28.97 ? 324 ASN A OD1   1 
ATOM   2480 N  ND2   . ASN A 1 331 ? -65.645 -4.514  -6.113  1.00 34.91 ? 324 ASN A ND2   1 
ATOM   2481 N  N     . PHE A 1 332 ? -69.881 -7.818  -5.378  1.00 20.81 ? 325 PHE A N     1 
ATOM   2482 C  CA    . PHE A 1 332 ? -70.815 -8.704  -6.076  1.00 22.24 ? 325 PHE A CA    1 
ATOM   2483 C  C     . PHE A 1 332 ? -71.312 -7.980  -7.324  1.00 24.72 ? 325 PHE A C     1 
ATOM   2484 O  O     . PHE A 1 332 ? -72.434 -7.542  -7.378  1.00 27.07 ? 325 PHE A O     1 
ATOM   2485 C  CB    . PHE A 1 332 ? -71.928 -9.056  -5.124  1.00 22.41 ? 325 PHE A CB    1 
ATOM   2486 C  CG    . PHE A 1 332 ? -71.410 -9.648  -3.825  1.00 23.76 ? 325 PHE A CG    1 
ATOM   2487 C  CD1   . PHE A 1 332 ? -71.105 -10.995 -3.745  1.00 22.48 ? 325 PHE A CD1   1 
ATOM   2488 C  CD2   . PHE A 1 332 ? -71.133 -8.832  -2.719  1.00 23.93 ? 325 PHE A CD2   1 
ATOM   2489 C  CE1   . PHE A 1 332 ? -70.606 -11.548 -2.585  1.00 23.57 ? 325 PHE A CE1   1 
ATOM   2490 C  CE2   . PHE A 1 332 ? -70.667 -9.380  -1.539  1.00 23.68 ? 325 PHE A CE2   1 
ATOM   2491 C  CZ    . PHE A 1 332 ? -70.388 -10.739 -1.456  1.00 24.11 ? 325 PHE A CZ    1 
ATOM   2492 N  N     . PRO A 1 333 ? -70.423 -7.800  -8.313  1.00 25.87 ? 326 PRO A N     1 
ATOM   2493 C  CA    . PRO A 1 333 ? -70.694 -6.981  -9.491  1.00 27.91 ? 326 PRO A CA    1 
ATOM   2494 C  C     . PRO A 1 333 ? -71.866 -7.466  -10.350 1.00 29.34 ? 326 PRO A C     1 
ATOM   2495 O  O     . PRO A 1 333 ? -72.180 -8.661  -10.347 1.00 28.82 ? 326 PRO A O     1 
ATOM   2496 C  CB    . PRO A 1 333 ? -69.389 -7.102  -10.294 1.00 27.10 ? 326 PRO A CB    1 
ATOM   2497 C  CG    . PRO A 1 333 ? -68.746 -8.370  -9.795  1.00 25.35 ? 326 PRO A CG    1 
ATOM   2498 C  CD    . PRO A 1 333 ? -69.044 -8.337  -8.337  1.00 24.45 ? 326 PRO A CD    1 
ATOM   2499 N  N     . GLY A 1 334 ? -72.521 -6.522  -11.032 1.00 36.32 ? 327 GLY A N     1 
ATOM   2500 C  CA    . GLY A 1 334 ? -73.468 -6.816  -12.136 1.00 33.29 ? 327 GLY A CA    1 
ATOM   2501 C  C     . GLY A 1 334 ? -74.543 -7.797  -11.750 1.00 33.94 ? 327 GLY A C     1 
ATOM   2502 O  O     . GLY A 1 334 ? -75.320 -7.537  -10.837 1.00 33.22 ? 327 GLY A O     1 
ATOM   2503 N  N     . LYS A 1 335 ? -74.552 -8.949  -12.413 1.00 38.35 ? 328 LYS A N     1 
ATOM   2504 C  CA    . LYS A 1 335 ? -75.626 -9.951  -12.219 1.00 42.00 ? 328 LYS A CA    1 
ATOM   2505 C  C     . LYS A 1 335 ? -75.524 -10.665 -10.872 1.00 35.25 ? 328 LYS A C     1 
ATOM   2506 O  O     . LYS A 1 335 ? -76.507 -11.208 -10.389 1.00 35.12 ? 328 LYS A O     1 
ATOM   2507 C  CB    . LYS A 1 335 ? -75.633 -10.995 -13.365 1.00 45.44 ? 328 LYS A CB    1 
ATOM   2508 C  CG    . LYS A 1 335 ? -76.835 -11.940 -13.335 1.00 54.58 ? 328 LYS A CG    1 
ATOM   2509 C  CD    . LYS A 1 335 ? -76.656 -13.247 -14.120 1.00 60.99 ? 328 LYS A CD    1 
ATOM   2510 C  CE    . LYS A 1 335 ? -77.412 -14.419 -13.461 1.00 62.25 ? 328 LYS A CE    1 
ATOM   2511 N  NZ    . LYS A 1 335 ? -76.665 -15.019 -12.309 1.00 61.75 ? 328 LYS A NZ    1 
ATOM   2512 N  N     . THR A 1 336 ? -74.342 -10.659 -10.266 1.00 33.27 ? 329 THR A N     1 
ATOM   2513 C  CA    . THR A 1 336 ? -74.113 -11.385 -9.024  1.00 29.79 ? 329 THR A CA    1 
ATOM   2514 C  C     . THR A 1 336 ? -74.520 -10.588 -7.761  1.00 28.01 ? 329 THR A C     1 
ATOM   2515 O  O     . THR A 1 336 ? -74.402 -11.075 -6.665  1.00 23.32 ? 329 THR A O     1 
ATOM   2516 C  CB    . THR A 1 336 ? -72.644 -11.851 -8.919  1.00 31.14 ? 329 THR A CB    1 
ATOM   2517 O  OG1   . THR A 1 336 ? -71.789 -10.755 -8.559  1.00 29.00 ? 329 THR A OG1   1 
ATOM   2518 C  CG2   . THR A 1 336 ? -72.203 -12.479 -10.259 1.00 31.53 ? 329 THR A CG2   1 
ATOM   2519 N  N     . ALA A 1 337 ? -74.995 -9.358  -7.932  1.00 28.21 ? 330 ALA A N     1 
ATOM   2520 C  CA    . ALA A 1 337 ? -75.410 -8.544  -6.823  1.00 24.54 ? 330 ALA A CA    1 
ATOM   2521 C  C     . ALA A 1 337 ? -76.358 -9.324  -5.928  1.00 29.36 ? 330 ALA A C     1 
ATOM   2522 O  O     . ALA A 1 337 ? -77.156 -10.121 -6.415  1.00 33.85 ? 330 ALA A O     1 
ATOM   2523 C  CB    . ALA A 1 337 ? -76.038 -7.259  -7.336  1.00 26.28 ? 330 ALA A CB    1 
ATOM   2524 N  N     . LEU A 1 338 ? -76.280 -9.117  -4.610  1.00 28.95 ? 331 LEU A N     1 
ATOM   2525 C  CA    . LEU A 1 338 ? -77.059 -9.934  -3.677  1.00 30.26 ? 331 LEU A CA    1 
ATOM   2526 C  C     . LEU A 1 338 ? -78.516 -9.437  -3.579  1.00 31.58 ? 331 LEU A C     1 
ATOM   2527 O  O     . LEU A 1 338 ? -78.775 -8.240  -3.420  1.00 33.51 ? 331 LEU A O     1 
ATOM   2528 C  CB    . LEU A 1 338 ? -76.414 -9.984  -2.265  1.00 29.62 ? 331 LEU A CB    1 
ATOM   2529 C  CG    . LEU A 1 338 ? -74.907 -10.244 -2.226  1.00 27.62 ? 331 LEU A CG    1 
ATOM   2530 C  CD1   . LEU A 1 338 ? -74.383 -10.437 -0.799  1.00 28.33 ? 331 LEU A CD1   1 
ATOM   2531 C  CD2   . LEU A 1 338 ? -74.602 -11.439 -3.104  1.00 28.19 ? 331 LEU A CD2   1 
ATOM   2532 N  N     . ALA A 1 339 ? -79.463 -10.365 -3.665  1.00 33.86 ? 332 ALA A N     1 
ATOM   2533 C  CA    . ALA A 1 339 ? -80.870 -9.958  -3.876  1.00 37.18 ? 332 ALA A CA    1 
ATOM   2534 C  C     . ALA A 1 339 ? -81.831 -10.645 -2.982  1.00 35.04 ? 332 ALA A C     1 
ATOM   2535 O  O     . ALA A 1 339 ? -83.008 -10.442 -3.136  1.00 37.07 ? 332 ALA A O     1 
ATOM   2536 C  CB    . ALA A 1 339 ? -81.284 -10.189 -5.313  1.00 37.31 ? 332 ALA A CB    1 
ATOM   2537 N  N     . THR A 1 340 ? -81.348 -11.457 -2.058  1.00 37.75 ? 333 THR A N     1 
ATOM   2538 C  CA    . THR A 1 340 ? -82.212 -12.027 -1.031  1.00 39.73 ? 333 THR A CA    1 
ATOM   2539 C  C     . THR A 1 340 ? -81.645 -11.714 0.333   1.00 42.50 ? 333 THR A C     1 
ATOM   2540 O  O     . THR A 1 340 ? -80.436 -11.487 0.460   1.00 39.88 ? 333 THR A O     1 
ATOM   2541 C  CB    . THR A 1 340 ? -82.371 -13.534 -1.202  1.00 40.44 ? 333 THR A CB    1 
ATOM   2542 O  OG1   . THR A 1 340 ? -81.218 -14.223 -0.726  1.00 39.70 ? 333 THR A OG1   1 
ATOM   2543 C  CG2   . THR A 1 340 ? -82.593 -13.866 -2.683  1.00 44.09 ? 333 THR A CG2   1 
ATOM   2544 N  N     . ARG A 1 341 ? -82.522 -11.708 1.334   1.00 37.57 ? 334 ARG A N     1 
ATOM   2545 C  CA    . ARG A 1 341 ? -82.147 -11.493 2.711   1.00 40.26 ? 334 ARG A CA    1 
ATOM   2546 C  C     . ARG A 1 341 ? -81.231 -12.607 3.152   1.00 37.14 ? 334 ARG A C     1 
ATOM   2547 O  O     . ARG A 1 341 ? -80.235 -12.364 3.840   1.00 39.35 ? 334 ARG A O     1 
ATOM   2548 C  CB    . ARG A 1 341 ? -83.402 -11.482 3.615   1.00 44.43 ? 334 ARG A CB    1 
ATOM   2549 C  CG    . ARG A 1 341 ? -83.187 -10.993 5.041   1.00 52.60 ? 334 ARG A CG    1 
ATOM   2550 C  CD    . ARG A 1 341 ? -84.428 -11.131 5.960   1.00 59.98 ? 334 ARG A CD    1 
ATOM   2551 N  NE    . ARG A 1 341 ? -85.321 -12.225 5.552   1.00 66.73 ? 334 ARG A NE    1 
ATOM   2552 C  CZ    . ARG A 1 341 ? -85.112 -13.524 5.778   1.00 73.46 ? 334 ARG A CZ    1 
ATOM   2553 N  NH1   . ARG A 1 341 ? -84.037 -13.941 6.449   1.00 75.20 ? 334 ARG A NH1   1 
ATOM   2554 N  NH2   . ARG A 1 341 ? -85.989 -14.417 5.323   1.00 72.51 ? 334 ARG A NH2   1 
ATOM   2555 N  N     . GLU A 1 342 ? -81.566 -13.832 2.785   1.00 33.11 ? 335 GLU A N     1 
ATOM   2556 C  CA    . GLU A 1 342 ? -80.808 -15.021 3.191   1.00 34.55 ? 335 GLU A CA    1 
ATOM   2557 C  C     . GLU A 1 342 ? -79.335 -15.024 2.697   1.00 33.59 ? 335 GLU A C     1 
ATOM   2558 O  O     . GLU A 1 342 ? -78.407 -15.521 3.365   1.00 31.93 ? 335 GLU A O     1 
ATOM   2559 C  CB    . GLU A 1 342 ? -81.474 -16.238 2.588   1.00 41.14 ? 335 GLU A CB    1 
ATOM   2560 C  CG    . GLU A 1 342 ? -82.923 -16.448 3.003   1.00 46.58 ? 335 GLU A CG    1 
ATOM   2561 C  CD    . GLU A 1 342 ? -82.990 -17.315 4.233   1.00 51.06 ? 335 GLU A CD    1 
ATOM   2562 O  OE1   . GLU A 1 342 ? -82.535 -16.838 5.281   1.00 48.37 ? 335 GLU A OE1   1 
ATOM   2563 O  OE2   . GLU A 1 342 ? -83.463 -18.481 4.140   1.00 58.12 ? 335 GLU A OE2   1 
ATOM   2564 N  N     . GLN A 1 343 ? -79.178 -14.474 1.514   1.00 28.40 ? 336 GLN A N     1 
ATOM   2565 C  CA    . GLN A 1 343 ? -77.950 -14.501 0.758   1.00 30.74 ? 336 GLN A CA    1 
ATOM   2566 C  C     . GLN A 1 343 ? -77.036 -13.403 1.366   1.00 28.22 ? 336 GLN A C     1 
ATOM   2567 O  O     . GLN A 1 343 ? -75.876 -13.642 1.611   1.00 26.27 ? 336 GLN A O     1 
ATOM   2568 C  CB    . GLN A 1 343 ? -78.297 -14.193 -0.697  1.00 29.54 ? 336 GLN A CB    1 
ATOM   2569 C  CG    . GLN A 1 343 ? -77.281 -14.543 -1.756  1.00 35.03 ? 336 GLN A CG    1 
ATOM   2570 C  CD    . GLN A 1 343 ? -77.730 -14.035 -3.126  1.00 33.50 ? 336 GLN A CD    1 
ATOM   2571 O  OE1   . GLN A 1 343 ? -78.780 -13.412 -3.252  1.00 32.59 ? 336 GLN A OE1   1 
ATOM   2572 N  NE2   . GLN A 1 343 ? -76.905 -14.253 -4.139  1.00 29.96 ? 336 GLN A NE2   1 
ATOM   2573 N  N     . VAL A 1 344 ? -77.605 -12.232 1.610   1.00 27.79 ? 337 VAL A N     1 
ATOM   2574 C  CA    . VAL A 1 344 ? -76.922 -11.162 2.304   1.00 28.05 ? 337 VAL A CA    1 
ATOM   2575 C  C     . VAL A 1 344 ? -76.385 -11.650 3.648   1.00 28.42 ? 337 VAL A C     1 
ATOM   2576 O  O     . VAL A 1 344 ? -75.264 -11.330 4.012   1.00 29.90 ? 337 VAL A O     1 
ATOM   2577 C  CB    . VAL A 1 344 ? -77.844 -9.950  2.505   1.00 27.70 ? 337 VAL A CB    1 
ATOM   2578 C  CG1   . VAL A 1 344 ? -77.290 -8.976  3.546   1.00 26.70 ? 337 VAL A CG1   1 
ATOM   2579 C  CG2   . VAL A 1 344 ? -78.067 -9.206  1.199   1.00 27.18 ? 337 VAL A CG2   1 
ATOM   2580 N  N     . GLN A 1 345 ? -77.195 -12.402 4.388   1.00 30.16 ? 338 GLN A N     1 
ATOM   2581 C  CA    . GLN A 1 345 ? -76.853 -12.892 5.714   1.00 29.71 ? 338 GLN A CA    1 
ATOM   2582 C  C     . GLN A 1 345 ? -75.698 -13.858 5.615   1.00 30.49 ? 338 GLN A C     1 
ATOM   2583 O  O     . GLN A 1 345 ? -74.772 -13.793 6.432   1.00 28.72 ? 338 GLN A O     1 
ATOM   2584 C  CB    . GLN A 1 345 ? -78.057 -13.600 6.434   1.00 30.96 ? 338 GLN A CB    1 
ATOM   2585 C  CG    . GLN A 1 345 ? -79.042 -12.657 7.132   1.00 34.44 ? 338 GLN A CG    1 
ATOM   2586 C  CD    . GLN A 1 345 ? -80.383 -13.263 7.626   1.00 38.97 ? 338 GLN A CD    1 
ATOM   2587 O  OE1   . GLN A 1 345 ? -80.787 -14.373 7.284   1.00 44.19 ? 338 GLN A OE1   1 
ATOM   2588 N  NE2   . GLN A 1 345 ? -81.092 -12.481 8.423   1.00 44.94 ? 338 GLN A NE2   1 
ATOM   2589 N  N     . TRP A 1 346 ? -75.766 -14.762 4.630   1.00 27.97 ? 339 TRP A N     1 
ATOM   2590 C  CA    . TRP A 1 346 ? -74.736 -15.810 4.468   1.00 27.34 ? 339 TRP A CA    1 
ATOM   2591 C  C     . TRP A 1 346 ? -73.357 -15.172 4.198   1.00 23.15 ? 339 TRP A C     1 
ATOM   2592 O  O     . TRP A 1 346 ? -72.342 -15.600 4.741   1.00 24.14 ? 339 TRP A O     1 
ATOM   2593 C  CB    . TRP A 1 346 ? -75.070 -16.760 3.285   1.00 24.35 ? 339 TRP A CB    1 
ATOM   2594 C  CG    . TRP A 1 346 ? -74.141 -17.941 3.235   1.00 23.82 ? 339 TRP A CG    1 
ATOM   2595 C  CD1   . TRP A 1 346 ? -74.179 -19.053 4.062   1.00 24.18 ? 339 TRP A CD1   1 
ATOM   2596 C  CD2   . TRP A 1 346 ? -73.048 -18.150 2.350   1.00 22.68 ? 339 TRP A CD2   1 
ATOM   2597 N  NE1   . TRP A 1 346 ? -73.188 -19.912 3.731   1.00 23.93 ? 339 TRP A NE1   1 
ATOM   2598 C  CE2   . TRP A 1 346 ? -72.484 -19.397 2.679   1.00 22.30 ? 339 TRP A CE2   1 
ATOM   2599 C  CE3   . TRP A 1 346 ? -72.455 -17.378 1.336   1.00 24.48 ? 339 TRP A CE3   1 
ATOM   2600 C  CZ2   . TRP A 1 346 ? -71.386 -19.910 2.034   1.00 23.47 ? 339 TRP A CZ2   1 
ATOM   2601 C  CZ3   . TRP A 1 346 ? -71.340 -17.885 0.687   1.00 25.84 ? 339 TRP A CZ3   1 
ATOM   2602 C  CH2   . TRP A 1 346 ? -70.813 -19.151 1.045   1.00 24.17 ? 339 TRP A CH2   1 
ATOM   2603 N  N     . TRP A 1 347 ? -73.328 -14.196 3.317   1.00 22.01 ? 340 TRP A N     1 
ATOM   2604 C  CA    . TRP A 1 347 ? -72.061 -13.519 2.994   1.00 21.63 ? 340 TRP A CA    1 
ATOM   2605 C  C     . TRP A 1 347 ? -71.572 -12.689 4.202   1.00 21.40 ? 340 TRP A C     1 
ATOM   2606 O  O     . TRP A 1 347 ? -70.404 -12.709 4.535   1.00 19.53 ? 340 TRP A O     1 
ATOM   2607 C  CB    . TRP A 1 347 ? -72.217 -12.622 1.754   1.00 22.81 ? 340 TRP A CB    1 
ATOM   2608 C  CG    . TRP A 1 347 ? -72.184 -13.443 0.497   1.00 23.36 ? 340 TRP A CG    1 
ATOM   2609 C  CD1   . TRP A 1 347 ? -73.221 -13.700 -0.344  1.00 25.15 ? 340 TRP A CD1   1 
ATOM   2610 C  CD2   . TRP A 1 347 ? -71.057 -14.154 -0.018  1.00 23.59 ? 340 TRP A CD2   1 
ATOM   2611 N  NE1   . TRP A 1 347 ? -72.802 -14.546 -1.364  1.00 23.93 ? 340 TRP A NE1   1 
ATOM   2612 C  CE2   . TRP A 1 347 ? -71.469 -14.803 -1.202  1.00 26.82 ? 340 TRP A CE2   1 
ATOM   2613 C  CE3   . TRP A 1 347 ? -69.734 -14.236 0.355   1.00 23.19 ? 340 TRP A CE3   1 
ATOM   2614 C  CZ2   . TRP A 1 347 ? -70.586 -15.574 -1.996  1.00 28.00 ? 340 TRP A CZ2   1 
ATOM   2615 C  CZ3   . TRP A 1 347 ? -68.872 -14.959 -0.417  1.00 27.15 ? 340 TRP A CZ3   1 
ATOM   2616 C  CH2   . TRP A 1 347 ? -69.304 -15.666 -1.574  1.00 26.56 ? 340 TRP A CH2   1 
ATOM   2617 N  N     . LEU A 1 348 ? -72.489 -12.005 4.875   1.00 21.54 ? 341 LEU A N     1 
ATOM   2618 C  CA    . LEU A 1 348 ? -72.094 -11.258 6.098   1.00 21.11 ? 341 LEU A CA    1 
ATOM   2619 C  C     . LEU A 1 348 ? -71.403 -12.208 7.052   1.00 20.58 ? 341 LEU A C     1 
ATOM   2620 O  O     . LEU A 1 348 ? -70.345 -11.878 7.630   1.00 18.87 ? 341 LEU A O     1 
ATOM   2621 C  CB    . LEU A 1 348 ? -73.281 -10.547 6.737   1.00 20.37 ? 341 LEU A CB    1 
ATOM   2622 C  CG    . LEU A 1 348 ? -73.736 -9.245  6.101   1.00 20.16 ? 341 LEU A CG    1 
ATOM   2623 C  CD1   . LEU A 1 348 ? -75.027 -8.796  6.767   1.00 20.13 ? 341 LEU A CD1   1 
ATOM   2624 C  CD2   . LEU A 1 348 ? -72.724 -8.107  6.123   1.00 21.98 ? 341 LEU A CD2   1 
ATOM   2625 N  N     . LEU A 1 349 ? -71.945 -13.416 7.156   1.00 20.48 ? 342 LEU A N     1 
ATOM   2626 C  CA    . LEU A 1 349 ? -71.343 -14.456 7.954   1.00 22.44 ? 342 LEU A CA    1 
ATOM   2627 C  C     . LEU A 1 349 ? -69.937 -14.927 7.470   1.00 20.85 ? 342 LEU A C     1 
ATOM   2628 O  O     . LEU A 1 349 ? -69.034 -15.122 8.278   1.00 19.64 ? 342 LEU A O     1 
ATOM   2629 C  CB    . LEU A 1 349 ? -72.293 -15.662 8.067   1.00 23.09 ? 342 LEU A CB    1 
ATOM   2630 C  CG    . LEU A 1 349 ? -71.693 -16.802 8.905   1.00 26.21 ? 342 LEU A CG    1 
ATOM   2631 C  CD1   . LEU A 1 349 ? -71.490 -16.361 10.355  1.00 27.28 ? 342 LEU A CD1   1 
ATOM   2632 C  CD2   . LEU A 1 349 ? -72.487 -18.131 8.824   1.00 27.74 ? 342 LEU A CD2   1 
ATOM   2633 N  N     . GLN A 1 350 ? -69.758 -15.117 6.164   1.00 20.19 ? 343 GLN A N     1 
ATOM   2634 C  CA    . GLN A 1 350 ? -68.420 -15.488 5.648   1.00 18.74 ? 343 GLN A CA    1 
ATOM   2635 C  C     . GLN A 1 350 ? -67.401 -14.369 6.035   1.00 17.72 ? 343 GLN A C     1 
ATOM   2636 O  O     . GLN A 1 350 ? -66.331 -14.653 6.528   1.00 14.51 ? 343 GLN A O     1 
ATOM   2637 C  CB    . GLN A 1 350 ? -68.447 -15.671 4.110   1.00 17.06 ? 343 GLN A CB    1 
ATOM   2638 C  CG    . GLN A 1 350 ? -69.496 -16.705 3.612   1.00 17.44 ? 343 GLN A CG    1 
ATOM   2639 C  CD    . GLN A 1 350 ? -69.481 -17.996 4.397   1.00 16.71 ? 343 GLN A CD    1 
ATOM   2640 O  OE1   . GLN A 1 350 ? -68.455 -18.665 4.489   1.00 17.82 ? 343 GLN A OE1   1 
ATOM   2641 N  NE2   . GLN A 1 350 ? -70.599 -18.315 5.037   1.00 18.08 ? 343 GLN A NE2   1 
ATOM   2642 N  N     . LEU A 1 351 ? -67.786 -13.119 5.771   1.00 18.40 ? 344 LEU A N     1 
ATOM   2643 C  CA    . LEU A 1 351 ? -66.924 -11.973 6.116   1.00 20.49 ? 344 LEU A CA    1 
ATOM   2644 C  C     . LEU A 1 351 ? -66.621 -11.955 7.611   1.00 18.58 ? 344 LEU A C     1 
ATOM   2645 O  O     . LEU A 1 351 ? -65.494 -11.733 8.003   1.00 17.44 ? 344 LEU A O     1 
ATOM   2646 C  CB    . LEU A 1 351 ? -67.545 -10.626 5.709   1.00 19.63 ? 344 LEU A CB    1 
ATOM   2647 C  CG    . LEU A 1 351 ? -67.735 -10.509 4.206   1.00 20.17 ? 344 LEU A CG    1 
ATOM   2648 C  CD1   . LEU A 1 351 ? -68.417 -9.197  3.856   1.00 19.82 ? 344 LEU A CD1   1 
ATOM   2649 C  CD2   . LEU A 1 351 ? -66.390 -10.665 3.554   1.00 21.10 ? 344 LEU A CD2   1 
ATOM   2650 N  N     . ALA A 1 352 ? -67.641 -12.218 8.411   1.00 16.19 ? 345 ALA A N     1 
ATOM   2651 C  CA    . ALA A 1 352 ? -67.490 -12.189 9.856   1.00 16.68 ? 345 ALA A CA    1 
ATOM   2652 C  C     . ALA A 1 352 ? -66.605 -13.283 10.376  1.00 17.68 ? 345 ALA A C     1 
ATOM   2653 O  O     . ALA A 1 352 ? -65.850 -13.080 11.313  1.00 16.56 ? 345 ALA A O     1 
ATOM   2654 C  CB    . ALA A 1 352 ? -68.856 -12.204 10.547  1.00 15.09 ? 345 ALA A CB    1 
ATOM   2655 N  N     . GLN A 1 353 ? -66.658 -14.451 9.752   1.00 16.61 ? 346 GLN A N     1 
ATOM   2656 C  CA    . GLN A 1 353 ? -65.766 -15.522 10.127  1.00 17.67 ? 346 GLN A CA    1 
ATOM   2657 C  C     . GLN A 1 353 ? -64.294 -15.247 9.832   1.00 16.95 ? 346 GLN A C     1 
ATOM   2658 O  O     . GLN A 1 353 ? -63.392 -15.656 10.574  1.00 14.21 ? 346 GLN A O     1 
ATOM   2659 C  CB    . GLN A 1 353 ? -66.180 -16.796 9.402   1.00 19.36 ? 346 GLN A CB    1 
ATOM   2660 C  CG    . GLN A 1 353 ? -67.406 -17.433 10.080  1.00 22.60 ? 346 GLN A CG    1 
ATOM   2661 C  CD    . GLN A 1 353 ? -67.914 -18.684 9.360   1.00 25.03 ? 346 GLN A CD    1 
ATOM   2662 O  OE1   . GLN A 1 353 ? -67.839 -18.794 8.157   1.00 26.35 ? 346 GLN A OE1   1 
ATOM   2663 N  NE2   . GLN A 1 353 ? -68.494 -19.581 10.110  1.00 25.27 ? 346 GLN A NE2   1 
ATOM   2664 N  N     . GLU A 1 354 ? -64.024 -14.644 8.689   1.00 15.67 ? 347 GLU A N     1 
ATOM   2665 C  CA    . GLU A 1 354 ? -62.582 -14.401 8.375   1.00 17.55 ? 347 GLU A CA    1 
ATOM   2666 C  C     . GLU A 1 354 ? -62.134 -13.344 9.386   1.00 16.15 ? 347 GLU A C     1 
ATOM   2667 O  O     . GLU A 1 354 ? -61.067 -13.446 9.934   1.00 18.54 ? 347 GLU A O     1 
ATOM   2668 C  CB    . GLU A 1 354 ? -62.381 -13.898 6.939   1.00 18.39 ? 347 GLU A CB    1 
ATOM   2669 C  CG    . GLU A 1 354 ? -60.916 -13.650 6.649   1.00 23.05 ? 347 GLU A CG    1 
ATOM   2670 C  CD    . GLU A 1 354 ? -60.632 -13.010 5.277   1.00 24.06 ? 347 GLU A CD    1 
ATOM   2671 O  OE1   . GLU A 1 354 ? -61.476 -13.081 4.383   1.00 25.20 ? 347 GLU A OE1   1 
ATOM   2672 O  OE2   . GLU A 1 354 ? -59.553 -12.394 5.134   1.00 26.73 ? 347 GLU A OE2   1 
ATOM   2673 N  N     . LEU A 1 355 ? -62.990 -12.355 9.627   1.00 15.42 ? 348 LEU A N     1 
ATOM   2674 C  CA    . LEU A 1 355 ? -62.623 -11.188 10.472  1.00 16.67 ? 348 LEU A CA    1 
ATOM   2675 C  C     . LEU A 1 355 ? -62.314 -11.661 11.866  1.00 17.84 ? 348 LEU A C     1 
ATOM   2676 O  O     . LEU A 1 355 ? -61.312 -11.289 12.463  1.00 19.83 ? 348 LEU A O     1 
ATOM   2677 C  CB    . LEU A 1 355 ? -63.776 -10.208 10.527  1.00 16.11 ? 348 LEU A CB    1 
ATOM   2678 C  CG    . LEU A 1 355 ? -63.496 -8.887  11.297  1.00 17.48 ? 348 LEU A CG    1 
ATOM   2679 C  CD1   . LEU A 1 355 ? -62.329 -8.132  10.675  1.00 18.09 ? 348 LEU A CD1   1 
ATOM   2680 C  CD2   . LEU A 1 355 ? -64.748 -8.081  11.373  1.00 17.49 ? 348 LEU A CD2   1 
ATOM   2681 N  N     . GLU A 1 356 ? -63.185 -12.539 12.359  1.00 18.28 ? 349 GLU A N     1 
ATOM   2682 C  CA    . GLU A 1 356 ? -62.998 -13.183 13.654  1.00 19.32 ? 349 GLU A CA    1 
ATOM   2683 C  C     . GLU A 1 356 ? -61.653 -13.869 13.820  1.00 18.47 ? 349 GLU A C     1 
ATOM   2684 O  O     . GLU A 1 356 ? -60.993 -13.698 14.815  1.00 14.72 ? 349 GLU A O     1 
ATOM   2685 C  CB    . GLU A 1 356 ? -64.106 -14.161 13.899  1.00 22.34 ? 349 GLU A CB    1 
ATOM   2686 C  CG    . GLU A 1 356 ? -64.081 -14.667 15.326  1.00 28.70 ? 349 GLU A CG    1 
ATOM   2687 C  CD    . GLU A 1 356 ? -64.592 -16.083 15.404  1.00 38.48 ? 349 GLU A CD    1 
ATOM   2688 O  OE1   . GLU A 1 356 ? -63.763 -16.910 15.816  1.00 52.87 ? 349 GLU A OE1   1 
ATOM   2689 O  OE2   . GLU A 1 356 ? -65.784 -16.359 15.008  1.00 39.85 ? 349 GLU A OE2   1 
ATOM   2690 N  N     . GLU A 1 357 ? -61.263 -14.684 12.843  1.00 18.98 ? 350 GLU A N     1 
ATOM   2691 C  CA    . GLU A 1 357 ? -59.935 -15.299 12.875  1.00 19.87 ? 350 GLU A CA    1 
ATOM   2692 C  C     . GLU A 1 357 ? -58.809 -14.287 12.896  1.00 16.28 ? 350 GLU A C     1 
ATOM   2693 O  O     . GLU A 1 357 ? -57.869 -14.393 13.641  1.00 15.18 ? 350 GLU A O     1 
ATOM   2694 C  CB    . GLU A 1 357 ? -59.699 -16.143 11.632  1.00 24.78 ? 350 GLU A CB    1 
ATOM   2695 C  CG    . GLU A 1 357 ? -60.332 -17.492 11.698  1.00 32.44 ? 350 GLU A CG    1 
ATOM   2696 C  CD    . GLU A 1 357 ? -60.374 -18.181 10.339  1.00 38.28 ? 350 GLU A CD    1 
ATOM   2697 O  OE1   . GLU A 1 357 ? -60.208 -17.525 9.275   1.00 46.37 ? 350 GLU A OE1   1 
ATOM   2698 O  OE2   . GLU A 1 357 ? -60.598 -19.388 10.355  1.00 44.48 ? 350 GLU A OE2   1 
ATOM   2699 N  N     . ARG A 1 358 ? -58.876 -13.324 12.011  1.00 17.39 ? 351 ARG A N     1 
ATOM   2700 C  CA    . ARG A 1 358 ? -57.905 -12.231 12.022  1.00 17.90 ? 351 ARG A CA    1 
ATOM   2701 C  C     . ARG A 1 358 ? -57.924 -11.443 13.329  1.00 16.64 ? 351 ARG A C     1 
ATOM   2702 O  O     . ARG A 1 358 ? -56.868 -11.126 13.845  1.00 18.77 ? 351 ARG A O     1 
ATOM   2703 C  CB    . ARG A 1 358 ? -58.113 -11.312 10.783  1.00 18.84 ? 351 ARG A CB    1 
ATOM   2704 C  CG    . ARG A 1 358 ? -57.706 -12.022 9.496   1.00 20.00 ? 351 ARG A CG    1 
ATOM   2705 C  CD    . ARG A 1 358 ? -58.193 -11.259 8.295   1.00 20.56 ? 351 ARG A CD    1 
ATOM   2706 N  NE    . ARG A 1 358 ? -57.573 -9.971  8.220   1.00 19.98 ? 351 ARG A NE    1 
ATOM   2707 C  CZ    . ARG A 1 358 ? -57.953 -9.078  7.297   1.00 24.58 ? 351 ARG A CZ    1 
ATOM   2708 N  NH1   . ARG A 1 358 ? -58.985 -9.346  6.419   1.00 22.97 ? 351 ARG A NH1   1 
ATOM   2709 N  NH2   . ARG A 1 358 ? -57.352 -7.924  7.258   1.00 19.74 ? 351 ARG A NH2   1 
ATOM   2710 N  N     . LEU A 1 359 ? -59.079 -11.184 13.923  1.00 17.04 ? 352 LEU A N     1 
ATOM   2711 C  CA    . LEU A 1 359 ? -59.080 -10.461 15.216  1.00 16.66 ? 352 LEU A CA    1 
ATOM   2712 C  C     . LEU A 1 359 ? -58.476 -11.244 16.404  1.00 17.81 ? 352 LEU A C     1 
ATOM   2713 O  O     . LEU A 1 359 ? -57.754 -10.691 17.225  1.00 16.42 ? 352 LEU A O     1 
ATOM   2714 C  CB    . LEU A 1 359 ? -60.497 -10.043 15.566  1.00 17.73 ? 352 LEU A CB    1 
ATOM   2715 C  CG    . LEU A 1 359 ? -60.928 -8.905  14.690  1.00 17.42 ? 352 LEU A CG    1 
ATOM   2716 C  CD1   . LEU A 1 359 ? -62.395 -8.742  14.852  1.00 16.48 ? 352 LEU A CD1   1 
ATOM   2717 C  CD2   . LEU A 1 359 ? -60.182 -7.601  14.981  1.00 18.02 ? 352 LEU A CD2   1 
ATOM   2718 N  N     . THR A 1 360 ? -58.812 -12.532 16.521  1.00 19.59 ? 353 THR A N     1 
ATOM   2719 C  CA    . THR A 1 360 ? -58.250 -13.389 17.571  1.00 18.78 ? 353 THR A CA    1 
ATOM   2720 C  C     . THR A 1 360 ? -56.738 -13.462 17.458  1.00 18.49 ? 353 THR A C     1 
ATOM   2721 O  O     . THR A 1 360 ? -56.010 -13.436 18.447  1.00 16.68 ? 353 THR A O     1 
ATOM   2722 C  CB    . THR A 1 360 ? -58.855 -14.812 17.433  1.00 20.52 ? 353 THR A CB    1 
ATOM   2723 O  OG1   . THR A 1 360 ? -60.296 -14.734 17.565  1.00 19.89 ? 353 THR A OG1   1 
ATOM   2724 C  CG2   . THR A 1 360 ? -58.313 -15.722 18.463  1.00 21.00 ? 353 THR A CG2   1 
ATOM   2725 N  N     . LYS A 1 361 ? -56.247 -13.622 16.236  1.00 19.32 ? 354 LYS A N     1 
ATOM   2726 C  CA    . LYS A 1 361 ? -54.807 -13.585 16.013  1.00 23.09 ? 354 LYS A CA    1 
ATOM   2727 C  C     . LYS A 1 361 ? -54.203 -12.224 16.437  1.00 21.80 ? 354 LYS A C     1 
ATOM   2728 O  O     . LYS A 1 361 ? -53.225 -12.167 17.164  1.00 19.16 ? 354 LYS A O     1 
ATOM   2729 C  CB    . LYS A 1 361 ? -54.485 -13.935 14.567  1.00 30.81 ? 354 LYS A CB    1 
ATOM   2730 C  CG    . LYS A 1 361 ? -53.032 -13.737 14.201  1.00 35.92 ? 354 LYS A CG    1 
ATOM   2731 C  CD    . LYS A 1 361 ? -52.493 -14.853 13.324  1.00 40.14 ? 354 LYS A CD    1 
ATOM   2732 C  CE    . LYS A 1 361 ? -51.000 -14.988 13.542  1.00 43.68 ? 354 LYS A CE    1 
ATOM   2733 N  NZ    . LYS A 1 361 ? -50.438 -13.622 13.368  1.00 44.85 ? 354 LYS A NZ    1 
ATOM   2734 N  N     . ASP A 1 362 ? -54.826 -11.146 16.017  1.00 20.72 ? 355 ASP A N     1 
ATOM   2735 C  CA    . ASP A 1 362 ? -54.398 -9.808  16.376  1.00 22.10 ? 355 ASP A CA    1 
ATOM   2736 C  C     . ASP A 1 362 ? -54.368 -9.648  17.905  1.00 23.29 ? 355 ASP A C     1 
ATOM   2737 O  O     . ASP A 1 362 ? -53.374 -9.192  18.456  1.00 21.69 ? 355 ASP A O     1 
ATOM   2738 C  CB    . ASP A 1 362 ? -55.334 -8.760  15.753  1.00 20.88 ? 355 ASP A CB    1 
ATOM   2739 C  CG    . ASP A 1 362 ? -54.895 -7.325  16.062  1.00 21.46 ? 355 ASP A CG    1 
ATOM   2740 O  OD1   . ASP A 1 362 ? -53.900 -6.834  15.458  1.00 21.12 ? 355 ASP A OD1   1 
ATOM   2741 O  OD2   . ASP A 1 362 ? -55.540 -6.689  16.906  1.00 20.77 ? 355 ASP A OD2   1 
ATOM   2742 N  N     . ARG A 1 363 ? -55.436 -10.036 18.583  1.00 21.92 ? 356 ARG A N     1 
ATOM   2743 C  CA    . ARG A 1 363 ? -55.452 -9.982  20.037  1.00 24.10 ? 356 ARG A CA    1 
ATOM   2744 C  C     . ARG A 1 363 ? -54.291 -10.739 20.731  1.00 23.75 ? 356 ARG A C     1 
ATOM   2745 O  O     . ARG A 1 363 ? -53.624 -10.164 21.616  1.00 21.74 ? 356 ARG A O     1 
ATOM   2746 C  CB    . ARG A 1 363 ? -56.825 -10.415 20.584  1.00 27.61 ? 356 ARG A CB    1 
ATOM   2747 C  CG    . ARG A 1 363 ? -57.075 -10.124 22.070  1.00 29.60 ? 356 ARG A CG    1 
ATOM   2748 C  CD    . ARG A 1 363 ? -58.479 -10.546 22.535  1.00 31.76 ? 356 ARG A CD    1 
ATOM   2749 N  NE    . ARG A 1 363 ? -58.708 -11.976 22.307  1.00 35.29 ? 356 ARG A NE    1 
ATOM   2750 C  CZ    . ARG A 1 363 ? -59.900 -12.587 22.216  1.00 37.01 ? 356 ARG A CZ    1 
ATOM   2751 N  NH1   . ARG A 1 363 ? -61.042 -11.908 22.337  1.00 36.20 ? 356 ARG A NH1   1 
ATOM   2752 N  NH2   . ARG A 1 363 ? -59.935 -13.897 21.979  1.00 35.47 ? 356 ARG A NH2   1 
ATOM   2753 N  N     . ASN A 1 364 ? -53.972 -11.963 20.288  1.00 22.72 ? 357 ASN A N     1 
ATOM   2754 C  CA    . ASN A 1 364 ? -52.809 -12.707 20.853  1.00 23.81 ? 357 ASN A CA    1 
ATOM   2755 C  C     . ASN A 1 364 ? -51.447 -12.139 20.480  1.00 26.88 ? 357 ASN A C     1 
ATOM   2756 O  O     . ASN A 1 364 ? -50.495 -12.182 21.284  1.00 24.95 ? 357 ASN A O     1 
ATOM   2757 C  CB    . ASN A 1 364 ? -52.792 -14.161 20.413  1.00 24.21 ? 357 ASN A CB    1 
ATOM   2758 C  CG    . ASN A 1 364 ? -53.954 -14.955 20.985  1.00 24.83 ? 357 ASN A CG    1 
ATOM   2759 O  OD1   . ASN A 1 364 ? -54.191 -14.963 22.166  1.00 26.75 ? 357 ASN A OD1   1 
ATOM   2760 N  ND2   . ASN A 1 364 ? -54.658 -15.632 20.141  1.00 26.45 ? 357 ASN A ND2   1 
ATOM   2761 N  N     . ASP A 1 365 ? -51.349 -11.659 19.239  1.00 24.81 ? 358 ASP A N     1 
ATOM   2762 C  CA    . ASP A 1 365 ? -50.080 -11.176 18.745  1.00 27.54 ? 358 ASP A CA    1 
ATOM   2763 C  C     . ASP A 1 365 ? -49.778 -9.825  19.391  1.00 25.51 ? 358 ASP A C     1 
ATOM   2764 O  O     . ASP A 1 365 ? -48.702 -9.619  19.855  1.00 24.42 ? 358 ASP A O     1 
ATOM   2765 C  CB    . ASP A 1 365 ? -50.075 -11.076 17.192  1.00 25.96 ? 358 ASP A CB    1 
ATOM   2766 C  CG    . ASP A 1 365 ? -49.938 -12.430 16.529  1.00 28.83 ? 358 ASP A CG    1 
ATOM   2767 O  OD1   . ASP A 1 365 ? -49.746 -13.410 17.278  1.00 28.75 ? 358 ASP A OD1   1 
ATOM   2768 O  OD2   . ASP A 1 365 ? -50.000 -12.554 15.278  1.00 26.51 ? 358 ASP A OD2   1 
ATOM   2769 N  N     . ASN A 1 366 ? -50.764 -8.948  19.466  1.00 25.72 ? 359 ASN A N     1 
ATOM   2770 C  CA    . ASN A 1 366 ? -50.505 -7.526  19.567  1.00 27.11 ? 359 ASN A CA    1 
ATOM   2771 C  C     . ASN A 1 366 ? -51.162 -6.935  20.772  1.00 27.22 ? 359 ASN A C     1 
ATOM   2772 O  O     . ASN A 1 366 ? -51.178 -5.756  20.893  1.00 28.21 ? 359 ASN A O     1 
ATOM   2773 C  CB    . ASN A 1 366 ? -50.990 -6.815  18.298  1.00 25.06 ? 359 ASN A CB    1 
ATOM   2774 C  CG    . ASN A 1 366 ? -50.286 -7.329  17.059  1.00 25.24 ? 359 ASN A CG    1 
ATOM   2775 O  OD1   . ASN A 1 366 ? -49.090 -7.511  17.062  1.00 28.47 ? 359 ASN A OD1   1 
ATOM   2776 N  ND2   . ASN A 1 366 ? -51.015 -7.497  15.976  1.00 23.46 ? 359 ASN A ND2   1 
ATOM   2777 N  N     . ASP A 1 367 ? -51.725 -7.741  21.664  1.00 26.02 ? 360 ASP A N     1 
ATOM   2778 C  CA    . ASP A 1 367 ? -52.175 -7.219  22.950  1.00 27.23 ? 360 ASP A CA    1 
ATOM   2779 C  C     . ASP A 1 367 ? -53.100 -6.035  22.839  1.00 28.17 ? 360 ASP A C     1 
ATOM   2780 O  O     . ASP A 1 367 ? -52.939 -5.033  23.520  1.00 26.62 ? 360 ASP A O     1 
ATOM   2781 C  CB    . ASP A 1 367 ? -50.959 -6.874  23.864  1.00 28.66 ? 360 ASP A CB    1 
ATOM   2782 C  CG    . ASP A 1 367 ? -50.160 -8.104  24.218  1.00 31.50 ? 360 ASP A CG    1 
ATOM   2783 O  OD1   . ASP A 1 367 ? -50.775 -9.071  24.677  1.00 31.45 ? 360 ASP A OD1   1 
ATOM   2784 O  OD2   . ASP A 1 367 ? -48.937 -8.137  24.001  1.00 39.02 ? 360 ASP A OD2   1 
ATOM   2785 N  N     . ARG A 1 368 ? -54.155 -6.208  22.042  1.00 28.87 ? 361 ARG A N     1 
ATOM   2786 C  CA    . ARG A 1 368 ? -55.207 -5.226  21.927  1.00 23.26 ? 361 ARG A CA    1 
ATOM   2787 C  C     . ARG A 1 368 ? -56.473 -5.887  21.450  1.00 21.93 ? 361 ARG A C     1 
ATOM   2788 O  O     . ARG A 1 368 ? -56.421 -7.010  20.974  1.00 22.65 ? 361 ARG A O     1 
ATOM   2789 C  CB    . ARG A 1 368 ? -54.770 -4.167  20.950  1.00 23.36 ? 361 ARG A CB    1 
ATOM   2790 C  CG    . ARG A 1 368 ? -54.208 -4.684  19.648  1.00 25.72 ? 361 ARG A CG    1 
ATOM   2791 C  CD    . ARG A 1 368 ? -54.129 -3.592  18.561  1.00 23.96 ? 361 ARG A CD    1 
ATOM   2792 N  NE    . ARG A 1 368 ? -54.047 -4.207  17.230  1.00 24.08 ? 361 ARG A NE    1 
ATOM   2793 C  CZ    . ARG A 1 368 ? -53.998 -3.525  16.082  1.00 25.46 ? 361 ARG A CZ    1 
ATOM   2794 N  NH1   . ARG A 1 368 ? -53.943 -4.148  14.929  1.00 23.14 ? 361 ARG A NH1   1 
ATOM   2795 N  NH2   . ARG A 1 368 ? -53.997 -2.211  16.089  1.00 27.70 ? 361 ARG A NH2   1 
ATOM   2796 N  N     . VAL A 1 369 ? -57.601 -5.192  21.605  1.00 23.00 ? 362 VAL A N     1 
ATOM   2797 C  CA    . VAL A 1 369 ? -58.895 -5.600  21.122  1.00 23.91 ? 362 VAL A CA    1 
ATOM   2798 C  C     . VAL A 1 369 ? -59.574 -4.431  20.430  1.00 23.75 ? 362 VAL A C     1 
ATOM   2799 O  O     . VAL A 1 369 ? -59.477 -3.225  20.877  1.00 20.21 ? 362 VAL A O     1 
ATOM   2800 C  CB    . VAL A 1 369 ? -59.870 -6.013  22.263  1.00 28.79 ? 362 VAL A CB    1 
ATOM   2801 C  CG1   . VAL A 1 369 ? -59.575 -7.417  22.769  1.00 30.33 ? 362 VAL A CG1   1 
ATOM   2802 C  CG2   . VAL A 1 369 ? -59.802 -5.024  23.417  1.00 30.84 ? 362 VAL A CG2   1 
ATOM   2803 N  N     . ALA A 1 370 ? -60.289 -4.776  19.367  1.00 19.89 ? 363 ALA A N     1 
ATOM   2804 C  CA    . ALA A 1 370 ? -61.169 -3.818  18.674  1.00 19.44 ? 363 ALA A CA    1 
ATOM   2805 C  C     . ALA A 1 370 ? -62.463 -3.642  19.462  1.00 20.50 ? 363 ALA A C     1 
ATOM   2806 O  O     . ALA A 1 370 ? -62.984 -4.627  20.018  1.00 20.15 ? 363 ALA A O     1 
ATOM   2807 C  CB    . ALA A 1 370 ? -61.455 -4.313  17.278  1.00 17.88 ? 363 ALA A CB    1 
ATOM   2808 N  N     . THR A 1 371 ? -63.023 -2.425  19.462  1.00 18.58 ? 364 THR A N     1 
ATOM   2809 C  CA    . THR A 1 371 ? -64.230 -2.149  20.170  1.00 19.21 ? 364 THR A CA    1 
ATOM   2810 C  C     . THR A 1 371 ? -65.402 -1.656  19.317  1.00 19.93 ? 364 THR A C     1 
ATOM   2811 O  O     . THR A 1 371 ? -66.534 -1.467  19.847  1.00 19.93 ? 364 THR A O     1 
ATOM   2812 C  CB    . THR A 1 371 ? -63.915 -1.071  21.270  1.00 20.91 ? 364 THR A CB    1 
ATOM   2813 O  OG1   . THR A 1 371 ? -63.457 0.128   20.638  1.00 19.91 ? 364 THR A OG1   1 
ATOM   2814 C  CG2   . THR A 1 371 ? -62.812 -1.568  22.142  1.00 19.51 ? 364 THR A CG2   1 
ATOM   2815 N  N     . GLN A 1 372 ? -65.157 -1.371  18.032  1.00 19.68 ? 365 GLN A N     1 
ATOM   2816 C  CA    . GLN A 1 372 ? -66.237 -0.957  17.140  1.00 21.13 ? 365 GLN A CA    1 
ATOM   2817 C  C     . GLN A 1 372 ? -66.259 -1.737  15.835  1.00 20.09 ? 365 GLN A C     1 
ATOM   2818 O  O     . GLN A 1 372 ? -65.217 -1.997  15.266  1.00 19.85 ? 365 GLN A O     1 
ATOM   2819 C  CB    . GLN A 1 372 ? -66.066 0.497   16.769  1.00 22.93 ? 365 GLN A CB    1 
ATOM   2820 C  CG    . GLN A 1 372 ? -67.191 1.074   15.928  1.00 24.15 ? 365 GLN A CG    1 
ATOM   2821 C  CD    . GLN A 1 372 ? -66.971 2.555   15.668  1.00 27.02 ? 365 GLN A CD    1 
ATOM   2822 O  OE1   . GLN A 1 372 ? -65.929 2.939   15.169  1.00 28.87 ? 365 GLN A OE1   1 
ATOM   2823 N  NE2   . GLN A 1 372 ? -67.936 3.383   16.035  1.00 28.54 ? 365 GLN A NE2   1 
ATOM   2824 N  N     . LEU A 1 373 ? -67.448 -2.058  15.356  1.00 20.38 ? 366 LEU A N     1 
ATOM   2825 C  CA    . LEU A 1 373 ? -67.629 -2.822  14.106  1.00 21.40 ? 366 LEU A CA    1 
ATOM   2826 C  C     . LEU A 1 373 ? -68.269 -1.847  13.113  1.00 19.84 ? 366 LEU A C     1 
ATOM   2827 O  O     . LEU A 1 373 ? -69.255 -1.212  13.423  1.00 21.98 ? 366 LEU A O     1 
ATOM   2828 C  CB    . LEU A 1 373 ? -68.541 -4.069  14.341  1.00 23.34 ? 366 LEU A CB    1 
ATOM   2829 C  CG    . LEU A 1 373 ? -68.851 -4.935  13.091  1.00 24.31 ? 366 LEU A CG    1 
ATOM   2830 C  CD1   . LEU A 1 373 ? -67.583 -5.647  12.640  1.00 25.36 ? 366 LEU A CD1   1 
ATOM   2831 C  CD2   . LEU A 1 373 ? -69.976 -5.934  13.344  1.00 24.15 ? 366 LEU A CD2   1 
ATOM   2832 N  N     . VAL A 1 374 ? -67.649 -1.658  11.961  1.00 18.47 ? 367 VAL A N     1 
ATOM   2833 C  CA    . VAL A 1 374 ? -68.192 -0.815  10.914  1.00 19.25 ? 367 VAL A CA    1 
ATOM   2834 C  C     . VAL A 1 374 ? -68.722 -1.668  9.764   1.00 18.81 ? 367 VAL A C     1 
ATOM   2835 O  O     . VAL A 1 374 ? -68.010 -2.540  9.300   1.00 20.45 ? 367 VAL A O     1 
ATOM   2836 C  CB    . VAL A 1 374 ? -67.084 0.085   10.374  1.00 20.11 ? 367 VAL A CB    1 
ATOM   2837 C  CG1   . VAL A 1 374 ? -67.608 0.896   9.212   1.00 22.17 ? 367 VAL A CG1   1 
ATOM   2838 C  CG2   . VAL A 1 374 ? -66.536 0.943   11.494  1.00 20.21 ? 367 VAL A CG2   1 
ATOM   2839 N  N     . VAL A 1 375 ? -69.961 -1.418  9.314   1.00 19.77 ? 368 VAL A N     1 
ATOM   2840 C  CA    . VAL A 1 375 ? -70.583 -2.135  8.220   1.00 23.42 ? 368 VAL A CA    1 
ATOM   2841 C  C     . VAL A 1 375 ? -70.782 -1.130  7.108   1.00 23.55 ? 368 VAL A C     1 
ATOM   2842 O  O     . VAL A 1 375 ? -71.318 -0.032  7.343   1.00 21.96 ? 368 VAL A O     1 
ATOM   2843 C  CB    . VAL A 1 375 ? -71.999 -2.690  8.529   1.00 25.38 ? 368 VAL A CB    1 
ATOM   2844 C  CG1   . VAL A 1 375 ? -72.365 -3.800  7.552   1.00 26.36 ? 368 VAL A CG1   1 
ATOM   2845 C  CG2   . VAL A 1 375 ? -72.137 -3.162  9.954   1.00 30.01 ? 368 VAL A CG2   1 
ATOM   2846 N  N     . SER A 1 376 ? -70.388 -1.529  5.909   1.00 23.06 ? 369 SER A N     1 
ATOM   2847 C  CA    . SER A 1 376 ? -70.508 -0.726  4.738   1.00 25.43 ? 369 SER A CA    1 
ATOM   2848 C  C     . SER A 1 376 ? -71.100 -1.592  3.617   1.00 26.76 ? 369 SER A C     1 
ATOM   2849 O  O     . SER A 1 376 ? -70.887 -2.819  3.558   1.00 27.75 ? 369 SER A O     1 
ATOM   2850 C  CB    . SER A 1 376 ? -69.144 -0.195  4.338   1.00 26.74 ? 369 SER A CB    1 
ATOM   2851 O  OG    . SER A 1 376 ? -69.272 0.750   3.315   1.00 33.84 ? 369 SER A OG    1 
ATOM   2852 N  N     . ILE A 1 377 ? -71.878 -0.951  2.759   1.00 28.24 ? 370 ILE A N     1 
ATOM   2853 C  CA    . ILE A 1 377 ? -72.499 -1.612  1.617   1.00 30.06 ? 370 ILE A CA    1 
ATOM   2854 C  C     . ILE A 1 377 ? -72.543 -0.720  0.409   1.00 28.78 ? 370 ILE A C     1 
ATOM   2855 O  O     . ILE A 1 377 ? -72.415 0.523   0.498   1.00 26.67 ? 370 ILE A O     1 
ATOM   2856 C  CB    . ILE A 1 377 ? -73.930 -2.095  1.906   1.00 32.87 ? 370 ILE A CB    1 
ATOM   2857 C  CG1   . ILE A 1 377 ? -74.851 -0.901  2.156   1.00 35.24 ? 370 ILE A CG1   1 
ATOM   2858 C  CG2   . ILE A 1 377 ? -73.925 -3.096  3.055   1.00 31.56 ? 370 ILE A CG2   1 
ATOM   2859 C  CD1   . ILE A 1 377 ? -76.235 -1.307  2.591   1.00 37.83 ? 370 ILE A CD1   1 
ATOM   2860 N  N     . ARG A 1 378 ? -72.703 -1.356  -0.750  1.00 29.31 ? 371 ARG A N     1 
ATOM   2861 C  CA    . ARG A 1 378 ? -72.997 -0.592  -1.929  1.00 31.53 ? 371 ARG A CA    1 
ATOM   2862 C  C     . ARG A 1 378 ? -74.245 -1.214  -2.511  1.00 33.70 ? 371 ARG A C     1 
ATOM   2863 O  O     . ARG A 1 378 ? -74.391 -2.461  -2.483  1.00 26.39 ? 371 ARG A O     1 
ATOM   2864 C  CB    . ARG A 1 378 ? -71.815 -0.569  -2.884  1.00 35.44 ? 371 ARG A CB    1 
ATOM   2865 C  CG    . ARG A 1 378 ? -72.167 0.010   -4.239  1.00 38.22 ? 371 ARG A CG    1 
ATOM   2866 C  CD    . ARG A 1 378 ? -71.218 1.057   -4.703  1.00 42.50 ? 371 ARG A CD    1 
ATOM   2867 N  NE    . ARG A 1 378 ? -70.278 0.594   -5.703  1.00 46.07 ? 371 ARG A NE    1 
ATOM   2868 C  CZ    . ARG A 1 378 ? -69.961 1.220   -6.850  1.00 47.46 ? 371 ARG A CZ    1 
ATOM   2869 N  NH1   . ARG A 1 378 ? -69.039 0.679   -7.645  1.00 44.60 ? 371 ARG A NH1   1 
ATOM   2870 N  NH2   . ARG A 1 378 ? -70.526 2.369   -7.222  1.00 52.35 ? 371 ARG A NH2   1 
ATOM   2871 N  N     . VAL A 1 379 ? -75.174 -0.354  -2.969  1.00 33.50 ? 372 VAL A N     1 
ATOM   2872 C  CA    . VAL A 1 379 ? -76.392 -0.831  -3.640  1.00 36.32 ? 372 VAL A CA    1 
ATOM   2873 C  C     . VAL A 1 379 ? -76.201 -0.708  -5.154  1.00 33.98 ? 372 VAL A C     1 
ATOM   2874 O  O     . VAL A 1 379 ? -75.542 0.209   -5.617  1.00 33.33 ? 372 VAL A O     1 
ATOM   2875 C  CB    . VAL A 1 379 ? -77.655 -0.055  -3.203  1.00 39.71 ? 372 VAL A CB    1 
ATOM   2876 C  CG1   . VAL A 1 379 ? -77.717 0.023   -1.693  1.00 40.61 ? 372 VAL A CG1   1 
ATOM   2877 C  CG2   . VAL A 1 379 ? -77.688 1.339   -3.828  1.00 38.83 ? 372 VAL A CG2   1 
ATOM   2878 N  N     . GLN A 1 380 ? -76.765 -1.632  -5.923  1.00 38.53 ? 373 GLN A N     1 
ATOM   2879 C  CA    . GLN A 1 380 ? -76.693 -1.544  -7.389  1.00 41.69 ? 373 GLN A CA    1 
ATOM   2880 C  C     . GLN A 1 380 ? -77.297 -0.220  -7.787  1.00 44.20 ? 373 GLN A C     1 
ATOM   2881 O  O     . GLN A 1 380 ? -78.350 0.149   -7.287  1.00 44.02 ? 373 GLN A O     1 
ATOM   2882 C  CB    . GLN A 1 380 ? -77.488 -2.669  -8.030  1.00 44.19 ? 373 GLN A CB    1 
ATOM   2883 C  CG    . GLN A 1 380 ? -77.087 -3.002  -9.457  1.00 46.85 ? 373 GLN A CG    1 
ATOM   2884 C  CD    . GLN A 1 380 ? -77.318 -4.478  -9.778  1.00 46.90 ? 373 GLN A CD    1 
ATOM   2885 O  OE1   . GLN A 1 380 ? -78.450 -4.961  -9.717  1.00 47.11 ? 373 GLN A OE1   1 
ATOM   2886 N  NE2   . GLN A 1 380 ? -76.239 -5.208  -10.084 1.00 47.13 ? 373 GLN A NE2   1 
ATOM   2887 N  N     . GLY A 1 381 ? -76.632 0.509   -8.666  1.00 49.05 ? 374 GLY A N     1 
ATOM   2888 C  CA    . GLY A 1 381 ? -77.134 1.811   -9.067  1.00 52.23 ? 374 GLY A CA    1 
ATOM   2889 C  C     . GLY A 1 381 ? -76.298 2.959   -8.540  1.00 53.40 ? 374 GLY A C     1 
ATOM   2890 O  O     . GLY A 1 381 ? -76.068 3.929   -9.256  1.00 51.03 ? 374 GLY A O     1 
ATOM   2891 N  N     . ASP A 1 382 ? -75.848 2.859   -7.290  1.00 53.12 ? 375 ASP A N     1 
ATOM   2892 C  CA    . ASP A 1 382 ? -75.019 3.915   -6.686  1.00 51.94 ? 375 ASP A CA    1 
ATOM   2893 C  C     . ASP A 1 382 ? -73.706 4.062   -7.448  1.00 53.30 ? 375 ASP A C     1 
ATOM   2894 O  O     . ASP A 1 382 ? -73.106 3.079   -7.839  1.00 54.99 ? 375 ASP A O     1 
ATOM   2895 C  CB    . ASP A 1 382 ? -74.749 3.599   -5.201  1.00 49.32 ? 375 ASP A CB    1 
ATOM   2896 C  CG    . ASP A 1 382 ? -74.461 4.845   -4.350  1.00 49.72 ? 375 ASP A CG    1 
ATOM   2897 O  OD1   . ASP A 1 382 ? -73.734 5.781   -4.764  1.00 47.82 ? 375 ASP A OD1   1 
ATOM   2898 O  OD2   . ASP A 1 382 ? -74.971 4.865   -3.219  1.00 45.88 ? 375 ASP A OD2   1 
ATOM   2899 N  N     . LYS A 1 383 ? -73.273 5.305   -7.636  1.00 61.54 ? 376 LYS A N     1 
ATOM   2900 C  CA    . LYS A 1 383 ? -72.025 5.655   -8.327  1.00 60.37 ? 376 LYS A CA    1 
ATOM   2901 C  C     . LYS A 1 383 ? -70.830 5.667   -7.365  1.00 62.22 ? 376 LYS A C     1 
ATOM   2902 O  O     . LYS A 1 383 ? -69.667 5.590   -7.783  1.00 62.47 ? 376 LYS A O     1 
ATOM   2903 C  CB    . LYS A 1 383 ? -72.187 7.045   -8.975  1.00 61.54 ? 376 LYS A CB    1 
ATOM   2904 C  CG    . LYS A 1 383 ? -70.900 7.831   -9.265  1.00 67.88 ? 376 LYS A CG    1 
ATOM   2905 C  CD    . LYS A 1 383 ? -70.007 7.159   -10.314 1.00 69.36 ? 376 LYS A CD    1 
ATOM   2906 C  CE    . LYS A 1 383 ? -69.040 8.153   -10.956 1.00 72.28 ? 376 LYS A CE    1 
ATOM   2907 N  NZ    . LYS A 1 383 ? -67.743 7.514   -11.307 1.00 72.56 ? 376 LYS A NZ    1 
ATOM   2908 N  N     . ARG A 1 384 ? -71.121 5.775   -6.075  1.00 59.64 ? 377 ARG A N     1 
ATOM   2909 C  CA    . ARG A 1 384 ? -70.080 5.904   -5.056  1.00 56.41 ? 377 ARG A CA    1 
ATOM   2910 C  C     . ARG A 1 384 ? -69.600 4.522   -4.618  1.00 51.47 ? 377 ARG A C     1 
ATOM   2911 O  O     . ARG A 1 384 ? -70.379 3.576   -4.590  1.00 46.28 ? 377 ARG A O     1 
ATOM   2912 C  CB    . ARG A 1 384 ? -70.620 6.688   -3.868  1.00 51.70 ? 377 ARG A CB    1 
ATOM   2913 C  CG    . ARG A 1 384 ? -71.145 8.046   -4.290  1.00 52.37 ? 377 ARG A CG    1 
ATOM   2914 C  CD    . ARG A 1 384 ? -72.066 8.617   -3.251  1.00 47.77 ? 377 ARG A CD    1 
ATOM   2915 N  NE    . ARG A 1 384 ? -73.276 7.825   -3.137  1.00 44.54 ? 377 ARG A NE    1 
ATOM   2916 C  CZ    . ARG A 1 384 ? -73.942 7.651   -1.999  1.00 44.97 ? 377 ARG A CZ    1 
ATOM   2917 N  NH1   . ARG A 1 384 ? -73.500 8.184   -0.863  1.00 50.61 ? 377 ARG A NH1   1 
ATOM   2918 N  NH2   . ARG A 1 384 ? -75.045 6.930   -1.975  1.00 41.89 ? 377 ARG A NH2   1 
ATOM   2919 N  N     . LEU A 1 385 ? -68.316 4.424   -4.278  1.00 46.86 ? 378 LEU A N     1 
ATOM   2920 C  CA    . LEU A 1 385 ? -67.726 3.171   -3.814  1.00 44.86 ? 378 LEU A CA    1 
ATOM   2921 C  C     . LEU A 1 385 ? -68.504 2.629   -2.627  1.00 41.66 ? 378 LEU A C     1 
ATOM   2922 O  O     . LEU A 1 385 ? -68.656 1.425   -2.472  1.00 40.46 ? 378 LEU A O     1 
ATOM   2923 C  CB    . LEU A 1 385 ? -66.260 3.360   -3.433  1.00 44.90 ? 378 LEU A CB    1 
ATOM   2924 C  CG    . LEU A 1 385 ? -65.272 3.555   -4.589  1.00 47.36 ? 378 LEU A CG    1 
ATOM   2925 C  CD1   . LEU A 1 385 ? -63.874 3.719   -4.003  1.00 50.06 ? 378 LEU A CD1   1 
ATOM   2926 C  CD2   . LEU A 1 385 ? -65.313 2.435   -5.616  1.00 42.62 ? 378 LEU A CD2   1 
ATOM   2927 N  N     . SER A 1 386 ? -69.025 3.520   -1.801  1.00 43.40 ? 379 SER A N     1 
ATOM   2928 C  CA    . SER A 1 386 ? -69.837 3.087   -0.688  1.00 40.58 ? 379 SER A CA    1 
ATOM   2929 C  C     . SER A 1 386 ? -71.132 3.826   -0.790  1.00 43.66 ? 379 SER A C     1 
ATOM   2930 O  O     . SER A 1 386 ? -71.151 5.040   -1.027  1.00 48.73 ? 379 SER A O     1 
ATOM   2931 C  CB    . SER A 1 386 ? -69.134 3.350   0.650   1.00 38.12 ? 379 SER A CB    1 
ATOM   2932 O  OG    . SER A 1 386 ? -70.027 3.139   1.726   1.00 37.52 ? 379 SER A OG    1 
ATOM   2933 N  N     . SER A 1 387 ? -72.223 3.088   -0.656  1.00 42.12 ? 380 SER A N     1 
ATOM   2934 C  CA    . SER A 1 387 ? -73.509 3.688   -0.555  1.00 41.69 ? 380 SER A CA    1 
ATOM   2935 C  C     . SER A 1 387 ? -73.688 4.147   0.870   1.00 44.80 ? 380 SER A C     1 
ATOM   2936 O  O     . SER A 1 387 ? -74.411 5.122   1.097   1.00 48.95 ? 380 SER A O     1 
ATOM   2937 C  CB    . SER A 1 387 ? -74.629 2.708   -0.955  1.00 43.97 ? 380 SER A CB    1 
ATOM   2938 O  OG    . SER A 1 387 ? -74.657 2.506   -2.372  1.00 44.95 ? 380 SER A OG    1 
ATOM   2939 N  N     . LEU A 1 388 ? -73.006 3.512   1.829   1.00 39.35 ? 381 LEU A N     1 
ATOM   2940 C  CA    . LEU A 1 388 ? -73.474 3.610   3.210   1.00 41.51 ? 381 LEU A CA    1 
ATOM   2941 C  C     . LEU A 1 388 ? -72.664 2.868   4.248   1.00 38.41 ? 381 LEU A C     1 
ATOM   2942 O  O     . LEU A 1 388 ? -72.437 1.647   4.123   1.00 32.12 ? 381 LEU A O     1 
ATOM   2943 C  CB    . LEU A 1 388 ? -74.894 3.036   3.325   1.00 40.49 ? 381 LEU A CB    1 
ATOM   2944 C  CG    . LEU A 1 388 ? -75.450 3.135   4.739   1.00 44.53 ? 381 LEU A CG    1 
ATOM   2945 C  CD1   . LEU A 1 388 ? -75.865 4.594   4.953   1.00 49.43 ? 381 LEU A CD1   1 
ATOM   2946 C  CD2   . LEU A 1 388 ? -76.619 2.187   4.996   1.00 42.81 ? 381 LEU A CD2   1 
ATOM   2947 N  N     . ARG A 1 389 ? -72.377 3.595   5.331   1.00 36.98 ? 382 ARG A N     1 
ATOM   2948 C  CA    . ARG A 1 389 ? -71.629 3.094   6.456   1.00 36.67 ? 382 ARG A CA    1 
ATOM   2949 C  C     . ARG A 1 389 ? -72.440 3.273   7.756   1.00 32.64 ? 382 ARG A C     1 
ATOM   2950 O  O     . ARG A 1 389 ? -73.027 4.310   8.010   1.00 31.58 ? 382 ARG A O     1 
ATOM   2951 C  CB    . ARG A 1 389 ? -70.236 3.753   6.502   1.00 38.43 ? 382 ARG A CB    1 
ATOM   2952 C  CG    . ARG A 1 389 ? -69.810 4.137   7.917   1.00 45.87 ? 382 ARG A CG    1 
ATOM   2953 C  CD    . ARG A 1 389 ? -68.304 4.149   8.185   1.00 47.06 ? 382 ARG A CD    1 
ATOM   2954 N  NE    . ARG A 1 389 ? -67.888 4.766   9.481   1.00 53.72 ? 382 ARG A NE    1 
ATOM   2955 C  CZ    . ARG A 1 389 ? -68.641 5.011   10.583  1.00 53.99 ? 382 ARG A CZ    1 
ATOM   2956 N  NH1   . ARG A 1 389 ? -69.937 4.694   10.715  1.00 60.52 ? 382 ARG A NH1   1 
ATOM   2957 N  NH2   . ARG A 1 389 ? -68.069 5.596   11.617  1.00 51.44 ? 382 ARG A NH2   1 
ATOM   2958 N  N     . ARG A 1 390 ? -72.483 2.228   8.557   1.00 29.29 ? 383 ARG A N     1 
ATOM   2959 C  CA    . ARG A 1 390 ? -73.073 2.265   9.883   1.00 30.43 ? 383 ARG A CA    1 
ATOM   2960 C  C     . ARG A 1 390 ? -72.163 1.508   10.869  1.00 28.87 ? 383 ARG A C     1 
ATOM   2961 O  O     . ARG A 1 390 ? -71.291 0.745   10.484  1.00 26.11 ? 383 ARG A O     1 
ATOM   2962 C  CB    . ARG A 1 390 ? -74.428 1.583   9.823   1.00 31.52 ? 383 ARG A CB    1 
ATOM   2963 C  CG    . ARG A 1 390 ? -75.446 2.314   8.993   1.00 32.75 ? 383 ARG A CG    1 
ATOM   2964 C  CD    . ARG A 1 390 ? -76.004 3.444   9.799   1.00 34.67 ? 383 ARG A CD    1 
ATOM   2965 N  NE    . ARG A 1 390 ? -77.118 4.123   9.168   1.00 36.10 ? 383 ARG A NE    1 
ATOM   2966 C  CZ    . ARG A 1 390 ? -77.012 5.086   8.256   1.00 40.15 ? 383 ARG A CZ    1 
ATOM   2967 N  NH1   . ARG A 1 390 ? -75.816 5.456   7.787   1.00 42.25 ? 383 ARG A NH1   1 
ATOM   2968 N  NH2   . ARG A 1 390 ? -78.125 5.670   7.793   1.00 37.71 ? 383 ARG A NH2   1 
ATOM   2969 N  N     . CYS A 1 391 ? -72.351 1.698   12.151  1.00 30.10 ? 384 CYS A N     1 
ATOM   2970 C  CA    . CYS A 1 391 ? -71.399 1.130   13.092  1.00 32.04 ? 384 CYS A CA    1 
ATOM   2971 C  C     . CYS A 1 391 ? -72.096 0.657   14.329  1.00 29.36 ? 384 CYS A C     1 
ATOM   2972 O  O     . CYS A 1 391 ? -73.200 1.051   14.620  1.00 29.41 ? 384 CYS A O     1 
ATOM   2973 C  CB    . CYS A 1 391 ? -70.287 2.142   13.409  1.00 34.54 ? 384 CYS A CB    1 
ATOM   2974 S  SG    . CYS A 1 391 ? -70.890 3.581   14.284  1.00 47.55 ? 384 CYS A SG    1 
ATOM   2975 N  N     . CYS A 1 392 ? -71.482 -0.283  15.012  1.00 31.90 ? 385 CYS A N     1 
ATOM   2976 C  CA    . CYS A 1 392 ? -72.013 -0.733  16.276  1.00 29.43 ? 385 CYS A CA    1 
ATOM   2977 C  C     . CYS A 1 392 ? -70.872 -1.200  17.149  1.00 27.75 ? 385 CYS A C     1 
ATOM   2978 O  O     . CYS A 1 392 ? -69.717 -1.226  16.686  1.00 25.97 ? 385 CYS A O     1 
ATOM   2979 C  CB    . CYS A 1 392 ? -73.045 -1.820  16.048  1.00 29.49 ? 385 CYS A CB    1 
ATOM   2980 S  SG    . CYS A 1 392 ? -72.510 -3.315  15.221  1.00 30.87 ? 385 CYS A SG    1 
ATOM   2981 N  N     . ALA A 1 393 ? -71.207 -1.569  18.386  1.00 25.09 ? 386 ALA A N     1 
ATOM   2982 C  CA    . ALA A 1 393 ? -70.248 -2.038  19.354  1.00 24.42 ? 386 ALA A CA    1 
ATOM   2983 C  C     . ALA A 1 393 ? -69.760 -3.359  18.936  1.00 24.02 ? 386 ALA A C     1 
ATOM   2984 O  O     . ALA A 1 393 ? -70.552 -4.204  18.482  1.00 25.03 ? 386 ALA A O     1 
ATOM   2985 C  CB    . ALA A 1 393 ? -70.845 -2.151  20.763  1.00 24.89 ? 386 ALA A CB    1 
ATOM   2986 N  N     . LEU A 1 394 ? -68.459 -3.565  19.122  1.00 23.59 ? 387 LEU A N     1 
ATOM   2987 C  CA    . LEU A 1 394 ? -67.839 -4.885  18.945  1.00 24.97 ? 387 LEU A CA    1 
ATOM   2988 C  C     . LEU A 1 394 ? -67.425 -5.346  20.324  1.00 26.06 ? 387 LEU A C     1 
ATOM   2989 O  O     . LEU A 1 394 ? -66.353 -4.974  20.833  1.00 22.86 ? 387 LEU A O     1 
ATOM   2990 C  CB    . LEU A 1 394 ? -66.635 -4.818  18.015  1.00 23.41 ? 387 LEU A CB    1 
ATOM   2991 C  CG    . LEU A 1 394 ? -66.207 -6.114  17.302  1.00 24.60 ? 387 LEU A CG    1 
ATOM   2992 C  CD1   . LEU A 1 394 ? -65.173 -5.838  16.205  1.00 23.51 ? 387 LEU A CD1   1 
ATOM   2993 C  CD2   . LEU A 1 394 ? -65.644 -7.200  18.206  1.00 24.94 ? 387 LEU A CD2   1 
ATOM   2994 N  N     . THR A 1 395 ? -68.300 -6.120  20.947  1.00 26.78 ? 388 THR A N     1 
ATOM   2995 C  CA    . THR A 1 395 ? -68.080 -6.561  22.328  1.00 29.13 ? 388 THR A CA    1 
ATOM   2996 C  C     . THR A 1 395 ? -67.515 -7.998  22.462  1.00 31.44 ? 388 THR A C     1 
ATOM   2997 O  O     . THR A 1 395 ? -66.961 -8.356  23.500  1.00 30.98 ? 388 THR A O     1 
ATOM   2998 C  CB    . THR A 1 395 ? -69.376 -6.442  23.103  1.00 30.02 ? 388 THR A CB    1 
ATOM   2999 O  OG1   . THR A 1 395 ? -70.431 -7.111  22.392  1.00 33.80 ? 388 THR A OG1   1 
ATOM   3000 C  CG2   . THR A 1 395 ? -69.758 -5.007  23.200  1.00 32.92 ? 388 THR A CG2   1 
ATOM   3001 N  N     . ARG A 1 396 ? -67.627 -8.795  21.405  1.00 28.76 ? 389 ARG A N     1 
ATOM   3002 C  CA    . ARG A 1 396 ? -67.183 -10.176 21.436  1.00 29.09 ? 389 ARG A CA    1 
ATOM   3003 C  C     . ARG A 1 396 ? -66.723 -10.591 20.025  1.00 24.85 ? 389 ARG A C     1 
ATOM   3004 O  O     . ARG A 1 396 ? -67.364 -10.301 18.997  1.00 24.24 ? 389 ARG A O     1 
ATOM   3005 C  CB    . ARG A 1 396 ? -68.333 -11.064 21.945  1.00 34.82 ? 389 ARG A CB    1 
ATOM   3006 C  CG    . ARG A 1 396 ? -68.494 -10.963 23.441  1.00 40.00 ? 389 ARG A CG    1 
ATOM   3007 C  CD    . ARG A 1 396 ? -68.922 -12.280 24.028  1.00 48.58 ? 389 ARG A CD    1 
ATOM   3008 N  NE    . ARG A 1 396 ? -70.322 -12.507 23.745  1.00 50.45 ? 389 ARG A NE    1 
ATOM   3009 C  CZ    . ARG A 1 396 ? -71.289 -12.491 24.656  1.00 50.80 ? 389 ARG A CZ    1 
ATOM   3010 N  NH1   . ARG A 1 396 ? -71.032 -12.283 25.961  1.00 46.00 ? 389 ARG A NH1   1 
ATOM   3011 N  NH2   . ARG A 1 396 ? -72.530 -12.710 24.238  1.00 49.72 ? 389 ARG A NH2   1 
ATOM   3012 N  N     . TYR A 1 397 ? -65.565 -11.183 19.984  1.00 22.79 ? 390 TYR A N     1 
ATOM   3013 C  CA    . TYR A 1 397 ? -65.003 -11.696 18.762  1.00 22.54 ? 390 TYR A CA    1 
ATOM   3014 C  C     . TYR A 1 397 ? -65.784 -12.970 18.460  1.00 21.16 ? 390 TYR A C     1 
ATOM   3015 O  O     . TYR A 1 397 ? -65.297 -14.082 18.693  1.00 23.50 ? 390 TYR A O     1 
ATOM   3016 C  CB    . TYR A 1 397 ? -63.533 -11.996 18.987  1.00 23.14 ? 390 TYR A CB    1 
ATOM   3017 C  CG    . TYR A 1 397 ? -62.603 -10.799 18.980  1.00 23.12 ? 390 TYR A CG    1 
ATOM   3018 C  CD1   . TYR A 1 397 ? -63.091 -9.485  18.959  1.00 23.32 ? 390 TYR A CD1   1 
ATOM   3019 C  CD2   . TYR A 1 397 ? -61.230 -10.999 18.966  1.00 21.88 ? 390 TYR A CD2   1 
ATOM   3020 C  CE1   . TYR A 1 397 ? -62.239 -8.411  18.934  1.00 24.96 ? 390 TYR A CE1   1 
ATOM   3021 C  CE2   . TYR A 1 397 ? -60.367 -9.942  18.937  1.00 23.15 ? 390 TYR A CE2   1 
ATOM   3022 C  CZ    . TYR A 1 397 ? -60.861 -8.651  18.914  1.00 25.58 ? 390 TYR A CZ    1 
ATOM   3023 O  OH    . TYR A 1 397 ? -59.975 -7.614  18.897  1.00 24.11 ? 390 TYR A OH    1 
ATOM   3024 N  N     . ASP A 1 398 ? -66.992 -12.776 17.933  1.00 22.80 ? 391 ASP A N     1 
ATOM   3025 C  CA    . ASP A 1 398 ? -67.929 -13.839 17.639  1.00 22.57 ? 391 ASP A CA    1 
ATOM   3026 C  C     . ASP A 1 398 ? -68.595 -13.654 16.281  1.00 21.10 ? 391 ASP A C     1 
ATOM   3027 O  O     . ASP A 1 398 ? -69.382 -12.735 16.075  1.00 23.23 ? 391 ASP A O     1 
ATOM   3028 C  CB    . ASP A 1 398 ? -68.975 -14.000 18.748  1.00 24.78 ? 391 ASP A CB    1 
ATOM   3029 C  CG    . ASP A 1 398 ? -69.855 -15.203 18.492  1.00 26.27 ? 391 ASP A CG    1 
ATOM   3030 O  OD1   . ASP A 1 398 ? -70.772 -15.158 17.628  1.00 23.34 ? 391 ASP A OD1   1 
ATOM   3031 O  OD2   . ASP A 1 398 ? -69.498 -16.254 19.031  1.00 34.63 ? 391 ASP A OD2   1 
ATOM   3032 N  N     . ALA A 1 399 ? -68.301 -14.534 15.342  1.00 20.14 ? 392 ALA A N     1 
ATOM   3033 C  CA    . ALA A 1 399 ? -68.693 -14.261 13.983  1.00 21.22 ? 392 ALA A CA    1 
ATOM   3034 C  C     . ALA A 1 399 ? -70.194 -14.187 13.793  1.00 20.94 ? 392 ALA A C     1 
ATOM   3035 O  O     . ALA A 1 399 ? -70.685 -13.350 13.054  1.00 21.20 ? 392 ALA A O     1 
ATOM   3036 C  CB    . ALA A 1 399 ? -68.007 -15.217 12.990  1.00 22.10 ? 392 ALA A CB    1 
ATOM   3037 N  N     . HIS A 1 400 ? -70.961 -15.035 14.467  1.00 24.12 ? 393 HIS A N     1 
ATOM   3038 C  CA    . HIS A 1 400 ? -72.438 -14.990 14.356  1.00 27.56 ? 393 HIS A CA    1 
ATOM   3039 C  C     . HIS A 1 400 ? -72.994 -13.734 14.925  1.00 23.16 ? 393 HIS A C     1 
ATOM   3040 O  O     . HIS A 1 400 ? -73.858 -13.092 14.323  1.00 23.85 ? 393 HIS A O     1 
ATOM   3041 C  CB    . HIS A 1 400 ? -73.085 -16.223 15.011  1.00 31.14 ? 393 HIS A CB    1 
ATOM   3042 C  CG    . HIS A 1 400 ? -72.975 -17.440 14.152  1.00 39.73 ? 393 HIS A CG    1 
ATOM   3043 N  ND1   . HIS A 1 400 ? -71.941 -18.344 14.268  1.00 45.02 ? 393 HIS A ND1   1 
ATOM   3044 C  CD2   . HIS A 1 400 ? -73.738 -17.870 13.119  1.00 41.35 ? 393 HIS A CD2   1 
ATOM   3045 C  CE1   . HIS A 1 400 ? -72.088 -19.296 13.363  1.00 46.26 ? 393 HIS A CE1   1 
ATOM   3046 N  NE2   . HIS A 1 400 ? -73.165 -19.024 12.649  1.00 45.09 ? 393 HIS A NE2   1 
ATOM   3047 N  N     . LYS A 1 401 ? -72.462 -13.328 16.076  1.00 24.42 ? 394 LYS A N     1 
ATOM   3048 C  CA    . LYS A 1 401 ? -72.896 -12.011 16.669  1.00 24.02 ? 394 LYS A CA    1 
ATOM   3049 C  C     . LYS A 1 401 ? -72.566 -10.841 15.733  1.00 22.62 ? 394 LYS A C     1 
ATOM   3050 O  O     . LYS A 1 401 ? -73.422 -9.971  15.401  1.00 21.04 ? 394 LYS A O     1 
ATOM   3051 C  CB    . LYS A 1 401 ? -72.260 -11.777 18.046  1.00 24.57 ? 394 LYS A CB    1 
ATOM   3052 C  CG    . LYS A 1 401 ? -72.793 -10.469 18.639  1.00 25.17 ? 394 LYS A CG    1 
ATOM   3053 C  CD    . LYS A 1 401 ? -72.408 -10.241 20.109  1.00 26.27 ? 394 LYS A CD    1 
ATOM   3054 C  CE    . LYS A 1 401 ? -72.661 -8.770  20.507  1.00 25.24 ? 394 LYS A CE    1 
ATOM   3055 N  NZ    . LYS A 1 401 ? -73.997 -8.202  20.095  1.00 27.00 ? 394 LYS A NZ    1 
ATOM   3056 N  N     . MET A 1 402 ? -71.306 -10.817 15.324  1.00 21.67 ? 395 MET A N     1 
ATOM   3057 C  CA    . MET A 1 402 ? -70.852 -9.781  14.396  1.00 22.99 ? 395 MET A CA    1 
ATOM   3058 C  C     . MET A 1 402 ? -71.701 -9.784  13.146  1.00 22.40 ? 395 MET A C     1 
ATOM   3059 O  O     . MET A 1 402 ? -72.176 -8.703  12.765  1.00 22.09 ? 395 MET A O     1 
ATOM   3060 C  CB    . MET A 1 402 ? -69.347 -9.905  14.047  1.00 22.87 ? 395 MET A CB    1 
ATOM   3061 C  CG    . MET A 1 402 ? -68.466 -9.279  15.138  1.00 24.62 ? 395 MET A CG    1 
ATOM   3062 S  SD    . MET A 1 402 ? -66.678 -9.402  14.822  1.00 28.17 ? 395 MET A SD    1 
ATOM   3063 C  CE    . MET A 1 402 ? -66.539 -11.165 14.793  1.00 28.28 ? 395 MET A CE    1 
ATOM   3064 N  N     . SER A 1 403 ? -71.939 -10.959 12.538  1.00 20.73 ? 396 SER A N     1 
ATOM   3065 C  CA    . SER A 1 403 ? -72.858 -11.017 11.356  1.00 22.62 ? 396 SER A CA    1 
ATOM   3066 C  C     . SER A 1 403 ? -74.309 -10.581 11.635  1.00 25.17 ? 396 SER A C     1 
ATOM   3067 O  O     . SER A 1 403 ? -74.911 -9.808  10.844  1.00 24.28 ? 396 SER A O     1 
ATOM   3068 C  CB    . SER A 1 403 ? -72.872 -12.378 10.649  1.00 23.21 ? 396 SER A CB    1 
ATOM   3069 O  OG    . SER A 1 403 ? -72.887 -13.441 11.550  1.00 28.86 ? 396 SER A OG    1 
ATOM   3070 N  N     . HIS A 1 404 ? -74.885 -11.084 12.720  1.00 27.41 ? 397 HIS A N     1 
ATOM   3071 C  CA    . HIS A 1 404 ? -76.227 -10.647 13.095  1.00 29.39 ? 397 HIS A CA    1 
ATOM   3072 C  C     . HIS A 1 404 ? -76.266 -9.137  13.405  1.00 26.03 ? 397 HIS A C     1 
ATOM   3073 O  O     . HIS A 1 404 ? -77.118 -8.453  12.886  1.00 26.08 ? 397 HIS A O     1 
ATOM   3074 C  CB    . HIS A 1 404 ? -76.750 -11.477 14.262  1.00 38.53 ? 397 HIS A CB    1 
ATOM   3075 C  CG    . HIS A 1 404 ? -78.084 -11.015 14.754  1.00 51.47 ? 397 HIS A CG    1 
ATOM   3076 N  ND1   . HIS A 1 404 ? -78.243 -10.323 15.940  1.00 54.60 ? 397 HIS A ND1   1 
ATOM   3077 C  CD2   . HIS A 1 404 ? -79.314 -11.082 14.185  1.00 54.83 ? 397 HIS A CD2   1 
ATOM   3078 C  CE1   . HIS A 1 404 ? -79.519 -10.023 16.101  1.00 57.83 ? 397 HIS A CE1   1 
ATOM   3079 N  NE2   . HIS A 1 404 ? -80.188 -10.466 15.048  1.00 60.19 ? 397 HIS A NE2   1 
ATOM   3080 N  N     . ASP A 1 405 ? -75.298 -8.587  14.166  1.00 26.26 ? 398 ASP A N     1 
ATOM   3081 C  CA    . ASP A 1 405 ? -75.285 -7.109  14.386  1.00 25.08 ? 398 ASP A CA    1 
ATOM   3082 C  C     . ASP A 1 405 ? -75.172 -6.279  13.108  1.00 25.20 ? 398 ASP A C     1 
ATOM   3083 O  O     . ASP A 1 405 ? -75.856 -5.243  12.961  1.00 21.73 ? 398 ASP A O     1 
ATOM   3084 C  CB    . ASP A 1 405 ? -74.186 -6.687  15.353  1.00 24.61 ? 398 ASP A CB    1 
ATOM   3085 C  CG    . ASP A 1 405 ? -74.391 -7.275  16.716  1.00 25.28 ? 398 ASP A CG    1 
ATOM   3086 O  OD1   . ASP A 1 405 ? -75.402 -7.985  16.931  1.00 23.42 ? 398 ASP A OD1   1 
ATOM   3087 O  OD2   . ASP A 1 405 ? -73.483 -7.137  17.524  1.00 23.50 ? 398 ASP A OD2   1 
ATOM   3088 N  N     . ALA A 1 406 ? -74.309 -6.721  12.183  1.00 23.00 ? 399 ALA A N     1 
ATOM   3089 C  CA    . ALA A 1 406 ? -74.142 -5.997  10.912  1.00 23.22 ? 399 ALA A CA    1 
ATOM   3090 C  C     . ALA A 1 406 ? -75.400 -6.080  10.121  1.00 22.14 ? 399 ALA A C     1 
ATOM   3091 O  O     . ALA A 1 406 ? -75.776 -5.132  9.476   1.00 22.69 ? 399 ALA A O     1 
ATOM   3092 C  CB    . ALA A 1 406 ? -72.998 -6.601  10.103  1.00 24.48 ? 399 ALA A CB    1 
ATOM   3093 N  N     . PHE A 1 407 ? -76.067 -7.226  10.132  1.00 24.64 ? 400 PHE A N     1 
ATOM   3094 C  CA    . PHE A 1 407 ? -77.346 -7.258  9.448   1.00 27.64 ? 400 PHE A CA    1 
ATOM   3095 C  C     . PHE A 1 407 ? -78.375 -6.298  10.131  1.00 27.61 ? 400 PHE A C     1 
ATOM   3096 O  O     . PHE A 1 407 ? -79.054 -5.541  9.479   1.00 26.83 ? 400 PHE A O     1 
ATOM   3097 C  CB    . PHE A 1 407 ? -77.894 -8.656  9.428   1.00 29.45 ? 400 PHE A CB    1 
ATOM   3098 C  CG    . PHE A 1 407 ? -79.177 -8.764  8.657   1.00 35.10 ? 400 PHE A CG    1 
ATOM   3099 C  CD1   . PHE A 1 407 ? -80.405 -8.566  9.289   1.00 38.93 ? 400 PHE A CD1   1 
ATOM   3100 C  CD2   . PHE A 1 407 ? -79.161 -9.067  7.296   1.00 37.04 ? 400 PHE A CD2   1 
ATOM   3101 C  CE1   . PHE A 1 407 ? -81.597 -8.671  8.585   1.00 42.25 ? 400 PHE A CE1   1 
ATOM   3102 C  CE2   . PHE A 1 407 ? -80.347 -9.190  6.584   1.00 41.78 ? 400 PHE A CE2   1 
ATOM   3103 C  CZ    . PHE A 1 407 ? -81.570 -8.986  7.223   1.00 41.73 ? 400 PHE A CZ    1 
ATOM   3104 N  N     . THR A 1 408 ? -78.473 -6.356  11.449  1.00 28.58 ? 401 THR A N     1 
ATOM   3105 C  CA    . THR A 1 408 ? -79.393 -5.471  12.190  1.00 28.74 ? 401 THR A CA    1 
ATOM   3106 C  C     . THR A 1 408 ? -79.224 -4.033  11.804  1.00 30.30 ? 401 THR A C     1 
ATOM   3107 O  O     . THR A 1 408 ? -80.173 -3.357  11.462  1.00 32.22 ? 401 THR A O     1 
ATOM   3108 C  CB    . THR A 1 408 ? -79.154 -5.659  13.673  1.00 27.66 ? 401 THR A CB    1 
ATOM   3109 O  OG1   . THR A 1 408 ? -79.427 -7.026  13.965  1.00 29.93 ? 401 THR A OG1   1 
ATOM   3110 C  CG2   . THR A 1 408 ? -80.025 -4.713  14.536  1.00 28.31 ? 401 THR A CG2   1 
ATOM   3111 N  N     . VAL A 1 409 ? -77.982 -3.602  11.766  1.00 29.16 ? 402 VAL A N     1 
ATOM   3112 C  CA    . VAL A 1 409 ? -77.629 -2.256  11.369  1.00 31.97 ? 402 VAL A CA    1 
ATOM   3113 C  C     . VAL A 1 409 ? -77.962 -1.856  9.892   1.00 35.51 ? 402 VAL A C     1 
ATOM   3114 O  O     . VAL A 1 409 ? -78.090 -0.677  9.587   1.00 33.84 ? 402 VAL A O     1 
ATOM   3115 C  CB    . VAL A 1 409 ? -76.117 -2.098  11.726  1.00 33.51 ? 402 VAL A CB    1 
ATOM   3116 C  CG1   . VAL A 1 409 ? -75.384 -1.158  10.828  1.00 33.78 ? 402 VAL A CG1   1 
ATOM   3117 C  CG2   . VAL A 1 409 ? -75.980 -1.673  13.179  1.00 33.01 ? 402 VAL A CG2   1 
ATOM   3118 N  N     . ILE A 1 410 ? -78.058 -2.796  8.957   1.00 36.82 ? 403 ILE A N     1 
ATOM   3119 C  CA    . ILE A 1 410 ? -78.283 -2.395  7.543   1.00 37.93 ? 403 ILE A CA    1 
ATOM   3120 C  C     . ILE A 1 410 ? -79.642 -2.694  6.980   1.00 41.48 ? 403 ILE A C     1 
ATOM   3121 O  O     . ILE A 1 410 ? -79.974 -2.120  5.950   1.00 41.07 ? 403 ILE A O     1 
ATOM   3122 C  CB    . ILE A 1 410 ? -77.335 -3.089  6.512   1.00 36.85 ? 403 ILE A CB    1 
ATOM   3123 C  CG1   . ILE A 1 410 ? -77.525 -4.597  6.511   1.00 37.69 ? 403 ILE A CG1   1 
ATOM   3124 C  CG2   . ILE A 1 410 ? -75.889 -2.694  6.716   1.00 37.76 ? 403 ILE A CG2   1 
ATOM   3125 C  CD1   . ILE A 1 410 ? -76.527 -5.284  5.596   1.00 38.83 ? 403 ILE A CD1   1 
ATOM   3126 N  N     . LYS A 1 411 ? -80.369 -3.623  7.611   1.00 40.50 ? 404 LYS A N     1 
ATOM   3127 C  CA    . LYS A 1 411 ? -81.598 -4.229  7.078   1.00 43.97 ? 404 LYS A CA    1 
ATOM   3128 C  C     . LYS A 1 411 ? -82.748 -3.309  6.654   1.00 47.09 ? 404 LYS A C     1 
ATOM   3129 O  O     . LYS A 1 411 ? -83.676 -3.772  5.982   1.00 47.62 ? 404 LYS A O     1 
ATOM   3130 C  CB    . LYS A 1 411 ? -82.164 -5.208  8.112   1.00 45.79 ? 404 LYS A CB    1 
ATOM   3131 C  CG    . LYS A 1 411 ? -82.745 -4.513  9.341   1.00 43.97 ? 404 LYS A CG    1 
ATOM   3132 C  CD    . LYS A 1 411 ? -83.013 -5.511  10.439  1.00 44.48 ? 404 LYS A CD    1 
ATOM   3133 C  CE    . LYS A 1 411 ? -83.604 -4.819  11.653  1.00 48.33 ? 404 LYS A CE    1 
ATOM   3134 N  NZ    . LYS A 1 411 ? -83.837 -5.790  12.760  1.00 48.17 ? 404 LYS A NZ    1 
ATOM   3135 N  N     . ASN A 1 412 ? -82.722 -2.044  7.078   1.00 48.53 ? 405 ASN A N     1 
ATOM   3136 C  CA    . ASN A 1 412 ? -83.736 -1.071  6.678   1.00 50.33 ? 405 ASN A CA    1 
ATOM   3137 C  C     . ASN A 1 412 ? -83.340 -0.309  5.410   1.00 49.07 ? 405 ASN A C     1 
ATOM   3138 O  O     . ASN A 1 412 ? -84.092 0.556   4.929   1.00 38.70 ? 405 ASN A O     1 
ATOM   3139 C  CB    . ASN A 1 412 ? -83.980 -0.077  7.794   1.00 54.79 ? 405 ASN A CB    1 
ATOM   3140 C  CG    . ASN A 1 412 ? -82.919 1.006   7.827   1.00 59.77 ? 405 ASN A CG    1 
ATOM   3141 O  OD1   . ASN A 1 412 ? -81.759 0.735   8.149   1.00 68.19 ? 405 ASN A OD1   1 
ATOM   3142 N  ND2   . ASN A 1 412 ? -83.297 2.226   7.463   1.00 60.62 ? 405 ASN A ND2   1 
ATOM   3143 N  N     . CYS A 1 413 ? -82.159 -0.623  4.867   1.00 47.75 ? 406 CYS A N     1 
ATOM   3144 C  CA    . CYS A 1 413 ? -81.793 -0.183  3.518   1.00 45.05 ? 406 CYS A CA    1 
ATOM   3145 C  C     . CYS A 1 413 ? -82.567 -1.003  2.506   1.00 43.81 ? 406 CYS A C     1 
ATOM   3146 O  O     . CYS A 1 413 ? -82.506 -0.746  1.318   1.00 44.36 ? 406 CYS A O     1 
ATOM   3147 C  CB    . CYS A 1 413 ? -80.318 -0.403  3.253   1.00 47.23 ? 406 CYS A CB    1 
ATOM   3148 S  SG    . CYS A 1 413 ? -79.255 0.563   4.315   1.00 52.03 ? 406 CYS A SG    1 
ATOM   3149 N  N     . ASN A 1 414 ? -83.281 -2.002  2.979   1.00 42.28 ? 407 ASN A N     1 
ATOM   3150 C  CA    . ASN A 1 414 ? -83.999 -2.863  2.109   1.00 45.87 ? 407 ASN A CA    1 
ATOM   3151 C  C     . ASN A 1 414 ? -85.377 -2.276  1.697   1.00 48.69 ? 407 ASN A C     1 
ATOM   3152 O  O     . ASN A 1 414 ? -86.313 -2.336  2.473   1.00 42.46 ? 407 ASN A O     1 
ATOM   3153 C  CB    . ASN A 1 414 ? -84.137 -4.234  2.778   1.00 41.34 ? 407 ASN A CB    1 
ATOM   3154 C  CG    . ASN A 1 414 ? -84.731 -5.239  1.848   1.00 40.68 ? 407 ASN A CG    1 
ATOM   3155 O  OD1   . ASN A 1 414 ? -85.040 -4.900  0.705   1.00 44.44 ? 407 ASN A OD1   1 
ATOM   3156 N  ND2   . ASN A 1 414 ? -84.926 -6.463  2.315   1.00 40.07 ? 407 ASN A ND2   1 
ATOM   3157 N  N     . THR A 1 415 ? -85.458 -1.720  0.474   1.00 60.38 ? 408 THR A N     1 
ATOM   3158 C  CA    . THR A 1 415 ? -86.723 -1.247  -0.181  1.00 63.00 ? 408 THR A CA    1 
ATOM   3159 C  C     . THR A 1 415 ? -87.827 -2.308  -0.377  1.00 68.69 ? 408 THR A C     1 
ATOM   3160 O  O     . THR A 1 415 ? -89.005 -1.953  -0.445  1.00 75.61 ? 408 THR A O     1 
ATOM   3161 C  CB    . THR A 1 415 ? -86.452 -0.662  -1.598  1.00 66.61 ? 408 THR A CB    1 
ATOM   3162 O  OG1   . THR A 1 415 ? -85.802 0.608   -1.506  1.00 61.23 ? 408 THR A OG1   1 
ATOM   3163 C  CG2   . THR A 1 415 ? -87.755 -0.470  -2.418  1.00 72.54 ? 408 THR A CG2   1 
ATOM   3164 N  N     . SER A 1 416 ? -87.470 -3.587  -0.508  1.00 70.80 ? 409 SER A N     1 
ATOM   3165 C  CA    . SER A 1 416 ? -88.475 -4.651  -0.753  1.00 68.42 ? 409 SER A CA    1 
ATOM   3166 C  C     . SER A 1 416 ? -89.349 -4.959  0.466   1.00 74.54 ? 409 SER A C     1 
ATOM   3167 O  O     . SER A 1 416 ? -88.850 -5.403  1.507   1.00 78.53 ? 409 SER A O     1 
ATOM   3168 C  CB    . SER A 1 416 ? -87.811 -5.953  -1.232  1.00 66.95 ? 409 SER A CB    1 
ATOM   3169 O  OG    . SER A 1 416 ? -88.530 -7.118  -0.811  1.00 64.61 ? 409 SER A OG    1 
ATOM   3170 N  N     . GLY A 1 417 ? -90.656 -4.752  0.310   1.00 79.02 ? 410 GLY A N     1 
ATOM   3171 C  CA    . GLY A 1 417 ? -91.649 -5.192  1.289   1.00 73.37 ? 410 GLY A CA    1 
ATOM   3172 C  C     . GLY A 1 417 ? -91.859 -6.700  1.323   1.00 75.90 ? 410 GLY A C     1 
ATOM   3173 O  O     . GLY A 1 417 ? -92.394 -7.206  2.310   1.00 83.04 ? 410 GLY A O     1 
ATOM   3174 N  N     . ILE A 1 418 ? -91.451 -7.425  0.268   1.00 72.80 ? 411 ILE A N     1 
ATOM   3175 C  CA    . ILE A 1 418 ? -91.560 -8.901  0.243   1.00 70.58 ? 411 ILE A CA    1 
ATOM   3176 C  C     . ILE A 1 418 ? -90.769 -9.495  1.411   1.00 74.95 ? 411 ILE A C     1 
ATOM   3177 O  O     . ILE A 1 418 ? -91.130 -10.542 1.961   1.00 70.14 ? 411 ILE A O     1 
ATOM   3178 C  CB    . ILE A 1 418 ? -91.019 -9.549  -1.064  1.00 68.53 ? 411 ILE A CB    1 
ATOM   3179 C  CG1   . ILE A 1 418 ? -91.627 -8.908  -2.327  1.00 68.41 ? 411 ILE A CG1   1 
ATOM   3180 C  CG2   . ILE A 1 418 ? -91.235 -11.066 -1.049  1.00 64.56 ? 411 ILE A CG2   1 
ATOM   3181 C  CD1   . ILE A 1 418 ? -90.638 -8.076  -3.124  1.00 71.12 ? 411 ILE A CD1   1 
ATOM   3182 N  N     . GLN A 1 419 ? -89.664 -8.832  1.749   1.00 79.51 ? 412 GLN A N     1 
ATOM   3183 C  CA    . GLN A 1 419 ? -88.850 -9.146  2.937   1.00 82.32 ? 412 GLN A CA    1 
ATOM   3184 C  C     . GLN A 1 419 ? -87.892 -10.322 2.714   1.00 76.38 ? 412 GLN A C     1 
ATOM   3185 O  O     . GLN A 1 419 ? -86.776 -10.294 3.245   1.00 74.85 ? 412 GLN A O     1 
ATOM   3186 C  CB    . GLN A 1 419 ? -89.717 -9.337  4.203   1.00 85.13 ? 412 GLN A CB    1 
ATOM   3187 C  CG    . GLN A 1 419 ? -89.919 -10.780 4.666   1.00 83.00 ? 412 GLN A CG    1 
ATOM   3188 C  CD    . GLN A 1 419 ? -91.162 -10.962 5.504   1.00 79.66 ? 412 GLN A CD    1 
ATOM   3189 O  OE1   . GLN A 1 419 ? -91.754 -12.046 5.513   1.00 86.27 ? 412 GLN A OE1   1 
ATOM   3190 N  NE2   . GLN A 1 419 ? -91.580 -9.903  6.201   1.00 74.61 ? 412 GLN A NE2   1 
ATOM   3191 N  N     . THR A 1 420 ? -88.328 -11.343 1.963   1.00 69.27 ? 413 THR A N     1 
ATOM   3192 C  CA    . THR A 1 420 ? -87.417 -12.374 1.433   1.00 72.47 ? 413 THR A CA    1 
ATOM   3193 C  C     . THR A 1 420 ? -86.389 -11.759 0.487   1.00 64.24 ? 413 THR A C     1 
ATOM   3194 O  O     . THR A 1 420 ? -85.192 -11.990 0.645   1.00 71.99 ? 413 THR A O     1 
ATOM   3195 C  CB    . THR A 1 420 ? -88.166 -13.461 0.635   1.00 70.97 ? 413 THR A CB    1 
ATOM   3196 O  OG1   . THR A 1 420 ? -89.295 -13.892 1.393   1.00 74.45 ? 413 THR A OG1   1 
ATOM   3197 C  CG2   . THR A 1 420 ? -87.240 -14.658 0.316   1.00 67.75 ? 413 THR A CG2   1 
ATOM   3198 N  N     . GLU A 1 421 ? -86.881 -11.005 -0.499  1.00 54.46 ? 414 GLU A N     1 
ATOM   3199 C  CA    . GLU A 1 421 ? -86.039 -10.282 -1.446  1.00 53.45 ? 414 GLU A CA    1 
ATOM   3200 C  C     . GLU A 1 421 ? -85.400 -9.057  -0.828  1.00 54.30 ? 414 GLU A C     1 
ATOM   3201 O  O     . GLU A 1 421 ? -85.887 -8.491  0.175   1.00 46.82 ? 414 GLU A O     1 
ATOM   3202 C  CB    . GLU A 1 421 ? -86.812 -9.817  -2.699  1.00 50.59 ? 414 GLU A CB    1 
ATOM   3203 C  CG    . GLU A 1 421 ? -87.528 -10.912 -3.475  1.00 52.70 ? 414 GLU A CG    1 
ATOM   3204 C  CD    . GLU A 1 421 ? -86.741 -12.204 -3.591  1.00 50.12 ? 414 GLU A CD    1 
ATOM   3205 O  OE1   . GLU A 1 421 ? -85.834 -12.291 -4.454  1.00 56.91 ? 414 GLU A OE1   1 
ATOM   3206 O  OE2   . GLU A 1 421 ? -87.038 -13.143 -2.816  1.00 48.16 ? 414 GLU A OE2   1 
ATOM   3207 N  N     . TRP A 1 422 ? -84.320 -8.639  -1.489  1.00 48.37 ? 415 TRP A N     1 
ATOM   3208 C  CA    . TRP A 1 422 ? -83.564 -7.500  -1.096  1.00 43.84 ? 415 TRP A CA    1 
ATOM   3209 C  C     . TRP A 1 422 ? -83.388 -6.544  -2.254  1.00 41.91 ? 415 TRP A C     1 
ATOM   3210 O  O     . TRP A 1 422 ? -82.774 -6.879  -3.271  1.00 40.93 ? 415 TRP A O     1 
ATOM   3211 C  CB    . TRP A 1 422 ? -82.194 -7.947  -0.549  1.00 47.25 ? 415 TRP A CB    1 
ATOM   3212 C  CG    . TRP A 1 422 ? -81.541 -6.829  0.077   1.00 43.14 ? 415 TRP A CG    1 
ATOM   3213 C  CD1   . TRP A 1 422 ? -81.124 -5.724  -0.534  1.00 42.29 ? 415 TRP A CD1   1 
ATOM   3214 C  CD2   . TRP A 1 422 ? -81.302 -6.648  1.466   1.00 42.85 ? 415 TRP A CD2   1 
ATOM   3215 N  NE1   . TRP A 1 422 ? -80.618 -4.850  0.366   1.00 44.27 ? 415 TRP A NE1   1 
ATOM   3216 C  CE2   . TRP A 1 422 ? -80.714 -5.394  1.613   1.00 39.54 ? 415 TRP A CE2   1 
ATOM   3217 C  CE3   . TRP A 1 422 ? -81.504 -7.444  2.600   1.00 44.63 ? 415 TRP A CE3   1 
ATOM   3218 C  CZ2   . TRP A 1 422 ? -80.306 -4.892  2.840   1.00 41.69 ? 415 TRP A CZ2   1 
ATOM   3219 C  CZ3   . TRP A 1 422 ? -81.094 -6.953  3.830   1.00 46.89 ? 415 TRP A CZ3   1 
ATOM   3220 C  CH2   . TRP A 1 422 ? -80.498 -5.684  3.936   1.00 43.29 ? 415 TRP A CH2   1 
ATOM   3221 N  N     . SER A 1 423 ? -83.893 -5.325  -2.099  1.00 41.95 ? 416 SER A N     1 
ATOM   3222 C  CA    . SER A 1 423 ? -83.720 -4.326  -3.140  1.00 42.08 ? 416 SER A CA    1 
ATOM   3223 C  C     . SER A 1 423 ? -83.376 -2.968  -2.544  1.00 38.15 ? 416 SER A C     1 
ATOM   3224 O  O     . SER A 1 423 ? -83.857 -2.645  -1.474  1.00 43.07 ? 416 SER A O     1 
ATOM   3225 C  CB    . SER A 1 423 ? -84.976 -4.228  -4.029  1.00 47.24 ? 416 SER A CB    1 
ATOM   3226 O  OG    . SER A 1 423 ? -86.147 -3.915  -3.291  1.00 53.69 ? 416 SER A OG    1 
ATOM   3227 N  N     . PRO A 1 424 ? -82.530 -2.178  -3.235  1.00 38.47 ? 417 PRO A N     1 
ATOM   3228 C  CA    . PRO A 1 424 ? -81.810 -2.600  -4.448  1.00 41.53 ? 417 PRO A CA    1 
ATOM   3229 C  C     . PRO A 1 424 ? -80.815 -3.729  -4.138  1.00 42.65 ? 417 PRO A C     1 
ATOM   3230 O  O     . PRO A 1 424 ? -80.504 -3.956  -2.951  1.00 41.84 ? 417 PRO A O     1 
ATOM   3231 C  CB    . PRO A 1 424 ? -81.095 -1.332  -4.911  1.00 41.39 ? 417 PRO A CB    1 
ATOM   3232 C  CG    . PRO A 1 424 ? -81.813 -0.223  -4.243  1.00 40.69 ? 417 PRO A CG    1 
ATOM   3233 C  CD    . PRO A 1 424 ? -82.253 -0.769  -2.917  1.00 38.64 ? 417 PRO A CD    1 
ATOM   3234 N  N     . PRO A 1 425 ? -80.403 -4.501  -5.174  1.00 37.70 ? 418 PRO A N     1 
ATOM   3235 C  CA    . PRO A 1 425 ? -79.453 -5.566  -4.874  1.00 34.96 ? 418 PRO A CA    1 
ATOM   3236 C  C     . PRO A 1 425 ? -78.129 -4.972  -4.398  1.00 28.23 ? 418 PRO A C     1 
ATOM   3237 O  O     . PRO A 1 425 ? -77.748 -3.873  -4.810  1.00 29.10 ? 418 PRO A O     1 
ATOM   3238 C  CB    . PRO A 1 425 ? -79.290 -6.325  -6.219  1.00 34.76 ? 418 PRO A CB    1 
ATOM   3239 C  CG    . PRO A 1 425 ? -80.354 -5.814  -7.116  1.00 34.83 ? 418 PRO A CG    1 
ATOM   3240 C  CD    . PRO A 1 425 ? -80.801 -4.485  -6.595  1.00 37.88 ? 418 PRO A CD    1 
ATOM   3241 N  N     . LEU A 1 426 ? -77.444 -5.685  -3.518  1.00 27.58 ? 419 LEU A N     1 
ATOM   3242 C  CA    . LEU A 1 426 ? -76.149 -5.233  -2.993  1.00 24.87 ? 419 LEU A CA    1 
ATOM   3243 C  C     . LEU A 1 426 ? -74.969 -5.696  -3.833  1.00 23.81 ? 419 LEU A C     1 
ATOM   3244 O  O     . LEU A 1 426 ? -74.773 -6.913  -4.035  1.00 23.90 ? 419 LEU A O     1 
ATOM   3245 C  CB    . LEU A 1 426 ? -75.993 -5.743  -1.565  1.00 24.97 ? 419 LEU A CB    1 
ATOM   3246 C  CG    . LEU A 1 426 ? -77.138 -5.314  -0.640  1.00 25.76 ? 419 LEU A CG    1 
ATOM   3247 C  CD1   . LEU A 1 426 ? -76.816 -5.700  0.785   1.00 25.77 ? 419 LEU A CD1   1 
ATOM   3248 C  CD2   . LEU A 1 426 ? -77.279 -3.781  -0.736  1.00 26.95 ? 419 LEU A CD2   1 
ATOM   3249 N  N     . THR A 1 427 ? -74.166 -4.733  -4.283  1.00 23.71 ? 420 THR A N     1 
ATOM   3250 C  CA    . THR A 1 427 ? -72.942 -5.016  -5.035  1.00 22.54 ? 420 THR A CA    1 
ATOM   3251 C  C     . THR A 1 427 ? -71.673 -4.980  -4.194  1.00 20.39 ? 420 THR A C     1 
ATOM   3252 O  O     . THR A 1 427 ? -70.627 -5.255  -4.720  1.00 18.01 ? 420 THR A O     1 
ATOM   3253 C  CB    . THR A 1 427 ? -72.751 -4.024  -6.190  1.00 22.65 ? 420 THR A CB    1 
ATOM   3254 O  OG1   . THR A 1 427 ? -72.939 -2.719  -5.675  1.00 24.34 ? 420 THR A OG1   1 
ATOM   3255 C  CG2   . THR A 1 427 ? -73.789 -4.241  -7.317  1.00 23.70 ? 420 THR A CG2   1 
ATOM   3256 N  N     . MET A 1 428 ? -71.756 -4.693  -2.898  1.00 20.72 ? 421 MET A N     1 
ATOM   3257 C  CA    . MET A 1 428 ? -70.582 -4.688  -2.027  1.00 22.10 ? 421 MET A CA    1 
ATOM   3258 C  C     . MET A 1 428 ? -70.996 -4.789  -0.550  1.00 23.19 ? 421 MET A C     1 
ATOM   3259 O  O     . MET A 1 428 ? -71.995 -4.183  -0.123  1.00 23.25 ? 421 MET A O     1 
ATOM   3260 C  CB    . MET A 1 428 ? -69.701 -3.438  -2.277  1.00 22.45 ? 421 MET A CB    1 
ATOM   3261 C  CG    . MET A 1 428 ? -68.326 -3.411  -1.569  1.00 23.70 ? 421 MET A CG    1 
ATOM   3262 S  SD    . MET A 1 428 ? -68.453 -2.892  0.172   1.00 24.75 ? 421 MET A SD    1 
ATOM   3263 C  CE    . MET A 1 428 ? -68.937 -1.179  -0.060  1.00 26.00 ? 421 MET A CE    1 
ATOM   3264 N  N     . LEU A 1 429 ? -70.240 -5.603  0.190   1.00 21.92 ? 422 LEU A N     1 
ATOM   3265 C  CA    . LEU A 1 429 ? -70.320 -5.733  1.624   1.00 20.51 ? 422 LEU A CA    1 
ATOM   3266 C  C     . LEU A 1 429 ? -68.905 -5.553  2.174   1.00 20.25 ? 422 LEU A C     1 
ATOM   3267 O  O     . LEU A 1 429 ? -67.928 -6.069  1.573   1.00 19.73 ? 422 LEU A O     1 
ATOM   3268 C  CB    . LEU A 1 429 ? -70.836 -7.131  2.017   1.00 21.63 ? 422 LEU A CB    1 
ATOM   3269 C  CG    . LEU A 1 429 ? -72.277 -7.615  1.744   1.00 23.33 ? 422 LEU A CG    1 
ATOM   3270 C  CD1   . LEU A 1 429 ? -72.503 -9.044  2.268   1.00 25.65 ? 422 LEU A CD1   1 
ATOM   3271 C  CD2   . LEU A 1 429 ? -73.288 -6.652  2.348   1.00 23.37 ? 422 LEU A CD2   1 
ATOM   3272 N  N     . PHE A 1 430 ? -68.799 -4.893  3.340   1.00 19.78 ? 423 PHE A N     1 
ATOM   3273 C  CA    . PHE A 1 430 ? -67.527 -4.578  3.964   1.00 20.46 ? 423 PHE A CA    1 
ATOM   3274 C  C     . PHE A 1 430 ? -67.796 -4.650  5.459   1.00 20.74 ? 423 PHE A C     1 
ATOM   3275 O  O     . PHE A 1 430 ? -68.792 -4.061  5.929   1.00 24.99 ? 423 PHE A O     1 
ATOM   3276 C  CB    . PHE A 1 430 ? -67.085 -3.153  3.521   1.00 22.74 ? 423 PHE A CB    1 
ATOM   3277 C  CG    . PHE A 1 430 ? -65.894 -2.584  4.257   1.00 26.06 ? 423 PHE A CG    1 
ATOM   3278 C  CD1   . PHE A 1 430 ? -64.604 -3.092  4.040   1.00 29.07 ? 423 PHE A CD1   1 
ATOM   3279 C  CD2   . PHE A 1 430 ? -66.041 -1.543  5.157   1.00 29.63 ? 423 PHE A CD2   1 
ATOM   3280 C  CE1   . PHE A 1 430 ? -63.504 -2.597  4.696   1.00 30.82 ? 423 PHE A CE1   1 
ATOM   3281 C  CE2   . PHE A 1 430 ? -64.942 -1.020  5.813   1.00 29.93 ? 423 PHE A CE2   1 
ATOM   3282 C  CZ    . PHE A 1 430 ? -63.678 -1.540  5.584   1.00 31.19 ? 423 PHE A CZ    1 
ATOM   3283 N  N     . LEU A 1 431 ? -66.972 -5.381  6.185   1.00 18.29 ? 424 LEU A N     1 
ATOM   3284 C  CA    . LEU A 1 431 ? -66.972 -5.360  7.632   1.00 20.72 ? 424 LEU A CA    1 
ATOM   3285 C  C     . LEU A 1 431 ? -65.603 -4.961  8.088   1.00 18.67 ? 424 LEU A C     1 
ATOM   3286 O  O     . LEU A 1 431 ? -64.624 -5.550  7.638   1.00 17.61 ? 424 LEU A O     1 
ATOM   3287 C  CB    . LEU A 1 431 ? -67.232 -6.728  8.240   1.00 20.59 ? 424 LEU A CB    1 
ATOM   3288 C  CG    . LEU A 1 431 ? -68.572 -7.349  8.115   1.00 23.36 ? 424 LEU A CG    1 
ATOM   3289 C  CD1   . LEU A 1 431 ? -68.557 -8.627  8.944   1.00 25.61 ? 424 LEU A CD1   1 
ATOM   3290 C  CD2   . LEU A 1 431 ? -69.701 -6.456  8.557   1.00 25.03 ? 424 LEU A CD2   1 
ATOM   3291 N  N     . CYS A 1 432 ? -65.557 -4.015  9.006   1.00 18.07 ? 425 CYS A N     1 
ATOM   3292 C  CA    . CYS A 1 432 ? -64.270 -3.483  9.529   1.00 20.54 ? 425 CYS A CA    1 
ATOM   3293 C  C     . CYS A 1 432 ? -64.255 -3.332  11.061  1.00 18.96 ? 425 CYS A C     1 
ATOM   3294 O  O     . CYS A 1 432 ? -65.109 -2.643  11.605  1.00 18.12 ? 425 CYS A O     1 
ATOM   3295 C  CB    . CYS A 1 432 ? -63.944 -2.132  8.869   1.00 22.98 ? 425 CYS A CB    1 
ATOM   3296 S  SG    . CYS A 1 432 ? -62.363 -1.414  9.331   1.00 28.64 ? 425 CYS A SG    1 
ATOM   3297 N  N     . ALA A 1 433 ? -63.289 -3.983  11.714  1.00 17.91 ? 426 ALA A N     1 
ATOM   3298 C  CA    . ALA A 1 433 ? -63.013 -3.772  13.124  1.00 20.34 ? 426 ALA A CA    1 
ATOM   3299 C  C     . ALA A 1 433 ? -62.045 -2.564  13.298  1.00 20.54 ? 426 ALA A C     1 
ATOM   3300 O  O     . ALA A 1 433 ? -60.968 -2.466  12.623  1.00 19.54 ? 426 ALA A O     1 
ATOM   3301 C  CB    . ALA A 1 433 ? -62.420 -5.037  13.790  1.00 19.07 ? 426 ALA A CB    1 
ATOM   3302 N  N     . THR A 1 434 ? -62.435 -1.673  14.204  1.00 20.78 ? 427 THR A N     1 
ATOM   3303 C  CA    . THR A 1 434 ? -61.704 -0.406  14.490  1.00 22.92 ? 427 THR A CA    1 
ATOM   3304 C  C     . THR A 1 434 ? -61.779 -0.060  16.026  1.00 20.59 ? 427 THR A C     1 
ATOM   3305 O  O     . THR A 1 434 ? -62.347 -0.816  16.816  1.00 17.96 ? 427 THR A O     1 
ATOM   3306 C  CB    . THR A 1 434 ? -62.326 0.786   13.725  1.00 25.32 ? 427 THR A CB    1 
ATOM   3307 O  OG1   . THR A 1 434 ? -63.714 0.881   14.101  1.00 27.57 ? 427 THR A OG1   1 
ATOM   3308 C  CG2   . THR A 1 434 ? -62.319 0.592   12.234  1.00 30.28 ? 427 THR A CG2   1 
ATOM   3309 N  N     . LYS A 1 435 ? -61.221 1.097   16.404  1.00 20.75 ? 428 LYS A N     1 
ATOM   3310 C  CA    . LYS A 1 435 ? -61.230 1.622   17.790  1.00 22.76 ? 428 LYS A CA    1 
ATOM   3311 C  C     . LYS A 1 435 ? -60.636 0.589   18.746  1.00 22.11 ? 428 LYS A C     1 
ATOM   3312 O  O     . LYS A 1 435 ? -61.301 0.110   19.640  1.00 21.24 ? 428 LYS A O     1 
ATOM   3313 C  CB    . LYS A 1 435 ? -62.606 2.048   18.234  1.00 27.99 ? 428 LYS A CB    1 
ATOM   3314 C  CG    . LYS A 1 435 ? -63.099 3.284   17.507  1.00 33.84 ? 428 LYS A CG    1 
ATOM   3315 C  CD    . LYS A 1 435 ? -64.509 3.620   17.936  1.00 40.62 ? 428 LYS A CD    1 
ATOM   3316 C  CE    . LYS A 1 435 ? -65.069 4.765   17.112  1.00 44.24 ? 428 LYS A CE    1 
ATOM   3317 N  NZ    . LYS A 1 435 ? -64.387 6.035   17.431  1.00 47.75 ? 428 LYS A NZ    1 
ATOM   3318 N  N     . PHE A 1 436 ? -59.370 0.287   18.501  1.00 19.88 ? 429 PHE A N     1 
ATOM   3319 C  CA    . PHE A 1 436 ? -58.613 -0.664  19.265  1.00 23.29 ? 429 PHE A CA    1 
ATOM   3320 C  C     . PHE A 1 436 ? -58.137 -0.038  20.552  1.00 25.73 ? 429 PHE A C     1 
ATOM   3321 O  O     . PHE A 1 436 ? -57.695 1.112   20.512  1.00 21.12 ? 429 PHE A O     1 
ATOM   3322 C  CB    . PHE A 1 436 ? -57.368 -1.074  18.487  1.00 22.72 ? 429 PHE A CB    1 
ATOM   3323 C  CG    . PHE A 1 436 ? -57.636 -2.099  17.423  1.00 25.96 ? 429 PHE A CG    1 
ATOM   3324 C  CD1   . PHE A 1 436 ? -58.006 -1.706  16.137  1.00 30.69 ? 429 PHE A CD1   1 
ATOM   3325 C  CD2   . PHE A 1 436 ? -57.572 -3.451  17.711  1.00 24.84 ? 429 PHE A CD2   1 
ATOM   3326 C  CE1   . PHE A 1 436 ? -58.293 -2.643  15.158  1.00 31.91 ? 429 PHE A CE1   1 
ATOM   3327 C  CE2   . PHE A 1 436 ? -57.841 -4.391  16.730  1.00 26.89 ? 429 PHE A CE2   1 
ATOM   3328 C  CZ    . PHE A 1 436 ? -58.198 -3.986  15.449  1.00 29.04 ? 429 PHE A CZ    1 
ATOM   3329 N  N     . SER A 1 437 ? -58.180 -0.821  21.637  1.00 27.24 ? 430 SER A N     1 
ATOM   3330 C  CA    . SER A 1 437 ? -57.699 -0.460  22.977  1.00 31.40 ? 430 SER A CA    1 
ATOM   3331 C  C     . SER A 1 437 ? -56.787 -1.557  23.562  1.00 31.65 ? 430 SER A C     1 
ATOM   3332 O  O     . SER A 1 437 ? -56.953 -2.725  23.257  1.00 25.99 ? 430 SER A O     1 
ATOM   3333 C  CB    . SER A 1 437 ? -58.906 -0.323  23.907  1.00 36.85 ? 430 SER A CB    1 
ATOM   3334 O  OG    . SER A 1 437 ? -59.797 0.669   23.407  1.00 51.07 ? 430 SER A OG    1 
ATOM   3335 N  N     . ALA A 1 438 ? -55.824 -1.202  24.411  1.00 38.43 ? 431 ALA A N     1 
ATOM   3336 C  CA    . ALA A 1 438 ? -54.851 -2.214  24.923  1.00 38.08 ? 431 ALA A CA    1 
ATOM   3337 C  C     . ALA A 1 438 ? -55.537 -3.326  25.764  1.00 42.02 ? 431 ALA A C     1 
ATOM   3338 O  O     . ALA A 1 438 ? -56.635 -3.132  26.313  1.00 39.86 ? 431 ALA A O     1 
ATOM   3339 C  CB    . ALA A 1 438 ? -53.754 -1.554  25.746  1.00 40.94 ? 431 ALA A CB    1 
ATOM   3340 N  N     . SER A 1 439 ? -54.904 -4.493  25.825  1.00 44.83 ? 432 SER A N     1 
ATOM   3341 C  CA    . SER A 1 439 ? -55.316 -5.565  26.759  1.00 48.53 ? 432 SER A CA    1 
ATOM   3342 C  C     . SER A 1 439 ? -54.312 -6.722  26.734  1.00 49.49 ? 432 SER A C     1 
ATOM   3343 O  O     . SER A 1 439 ? -54.650 -7.876  26.984  1.00 51.50 ? 432 SER A O     1 
ATOM   3344 C  CB    . SER A 1 439 ? -56.712 -6.105  26.413  1.00 50.20 ? 432 SER A CB    1 
ATOM   3345 O  OG    . SER A 1 439 ? -56.761 -6.538  25.062  1.00 48.19 ? 432 SER A OG    1 
ATOM   3346 P  P     A DG  B 2 3   ? -63.532 -0.311  -11.905 0.60 55.38 ? 3   DG  T P     1 
ATOM   3347 P  P     B DG  B 2 3   ? -64.408 -0.964  -12.210 0.40 48.68 ? 3   DG  T P     1 
ATOM   3348 O  OP1   A DG  B 2 3   ? -63.138 -0.384  -10.473 0.60 48.39 ? 3   DG  T OP1   1 
ATOM   3349 O  OP1   B DG  B 2 3   ? -64.075 -1.222  -10.784 0.40 44.18 ? 3   DG  T OP1   1 
ATOM   3350 O  OP2   A DG  B 2 3   ? -62.509 0.021   -12.933 0.60 55.76 ? 3   DG  T OP2   1 
ATOM   3351 O  OP2   B DG  B 2 3   ? -63.721 0.141   -12.930 0.40 46.89 ? 3   DG  T OP2   1 
ATOM   3352 O  "O5'" A DG  B 2 3   ? -64.219 -1.683  -12.345 0.60 56.49 ? 3   DG  T "O5'" 1 
ATOM   3353 O  "O5'" B DG  B 2 3   ? -64.158 -2.289  -13.068 0.40 39.97 ? 3   DG  T "O5'" 1 
ATOM   3354 C  "C5'" A DG  B 2 3   ? -64.142 -2.870  -11.526 0.60 48.41 ? 3   DG  T "C5'" 1 
ATOM   3355 C  "C5'" B DG  B 2 3   ? -64.879 -3.521  -12.827 0.40 30.99 ? 3   DG  T "C5'" 1 
ATOM   3356 C  "C4'" A DG  B 2 3   ? -63.497 -4.010  -12.282 0.60 44.66 ? 3   DG  T "C4'" 1 
ATOM   3357 C  "C4'" B DG  B 2 3   ? -63.922 -4.694  -12.812 0.40 27.01 ? 3   DG  T "C4'" 1 
ATOM   3358 O  "O4'" A DG  B 2 3   ? -62.283 -3.551  -12.931 0.60 43.15 ? 3   DG  T "O4'" 1 
ATOM   3359 O  "O4'" B DG  B 2 3   ? -62.650 -4.289  -13.376 0.40 24.88 ? 3   DG  T "O4'" 1 
ATOM   3360 C  "C3'" A DG  B 2 3   ? -63.050 -5.181  -11.410 0.60 39.13 ? 3   DG  T "C3'" 1 
ATOM   3361 C  "C3'" B DG  B 2 3   ? -63.591 -5.240  -11.422 0.40 24.76 ? 3   DG  T "C3'" 1 
ATOM   3362 O  "O3'" A DG  B 2 3   ? -64.112 -6.100  -11.130 0.60 35.46 ? 3   DG  T "O3'" 1 
ATOM   3363 O  "O3'" B DG  B 2 3   ? -64.493 -6.263  -10.972 0.40 24.99 ? 3   DG  T "O3'" 1 
ATOM   3364 C  "C2'" A DG  B 2 3   ? -61.921 -5.773  -12.229 0.60 37.44 ? 3   DG  T "C2'" 1 
ATOM   3365 C  "C2'" B DG  B 2 3   ? -62.185 -5.788  -11.594 0.40 23.11 ? 3   DG  T "C2'" 1 
ATOM   3366 C  "C1'" A DG  B 2 3   ? -61.246 -4.521  -12.770 0.60 36.90 ? 3   DG  T "C1'" 1 
ATOM   3367 C  "C1'" B DG  B 2 3   ? -61.564 -4.872  -12.638 0.40 22.43 ? 3   DG  T "C1'" 1 
ATOM   3368 N  N9    A DG  B 2 3   ? -60.258 -3.978  -11.846 0.60 34.42 ? 3   DG  T N9    1 
ATOM   3369 N  N9    B DG  B 2 3   ? -60.777 -3.797  -12.038 0.40 19.97 ? 3   DG  T N9    1 
ATOM   3370 C  C8    A DG  B 2 3   ? -60.344 -2.823  -11.109 0.60 33.03 ? 3   DG  T C8    1 
ATOM   3371 C  C8    B DG  B 2 3   ? -60.731 -3.467  -10.703 0.40 19.39 ? 3   DG  T C8    1 
ATOM   3372 N  N7    A DG  B 2 3   ? -59.307 -2.627  -10.342 0.60 30.70 ? 3   DG  T N7    1 
ATOM   3373 N  N7    B DG  B 2 3   ? -59.910 -2.485  -10.446 0.40 19.70 ? 3   DG  T N7    1 
ATOM   3374 C  C5    A DG  B 2 3   ? -58.490 -3.724  -10.578 0.60 33.28 ? 3   DG  T C5    1 
ATOM   3375 C  C5    B DG  B 2 3   ? -59.375 -2.152  -11.686 0.40 18.13 ? 3   DG  T C5    1 
ATOM   3376 C  C6    A DG  B 2 3   ? -57.219 -4.068  -10.032 0.60 32.58 ? 3   DG  T C6    1 
ATOM   3377 C  C6    B DG  B 2 3   ? -58.415 -1.173  -12.036 0.40 17.91 ? 3   DG  T C6    1 
ATOM   3378 O  O6    A DG  B 2 3   ? -56.541 -3.450  -9.203  0.60 35.01 ? 3   DG  T O6    1 
ATOM   3379 O  O6    B DG  B 2 3   ? -57.839 -0.362  -11.303 0.40 17.78 ? 3   DG  T O6    1 
ATOM   3380 N  N1    A DG  B 2 3   ? -56.765 -5.286  -10.524 0.60 33.59 ? 3   DG  T N1    1 
ATOM   3381 N  N1    B DG  B 2 3   ? -58.141 -1.187  -13.399 0.40 17.45 ? 3   DG  T N1    1 
ATOM   3382 C  C2    A DG  B 2 3   ? -57.429 -6.060  -11.449 0.60 32.29 ? 3   DG  T C2    1 
ATOM   3383 C  C2    B DG  B 2 3   ? -58.705 -2.045  -14.307 0.40 18.20 ? 3   DG  T C2    1 
ATOM   3384 N  N2    A DG  B 2 3   ? -56.818 -7.192  -11.826 0.60 32.24 ? 3   DG  T N2    1 
ATOM   3385 N  N2    B DG  B 2 3   ? -58.306 -1.900  -15.578 0.40 17.92 ? 3   DG  T N2    1 
ATOM   3386 N  N3    A DG  B 2 3   ? -58.596 -5.740  -11.979 0.60 28.29 ? 3   DG  T N3    1 
ATOM   3387 N  N3    B DG  B 2 3   ? -59.592 -2.974  -13.993 0.40 18.72 ? 3   DG  T N3    1 
ATOM   3388 C  C4    A DG  B 2 3   ? -59.069 -4.574  -11.496 0.60 33.06 ? 3   DG  T C4    1 
ATOM   3389 C  C4    B DG  B 2 3   ? -59.885 -2.966  -12.675 0.40 18.80 ? 3   DG  T C4    1 
ATOM   3390 P  P     A DG  B 2 4   ? -64.682 -6.208  -9.626  0.60 35.23 ? 4   DG  T P     1 
ATOM   3391 P  P     B DG  B 2 4   ? -64.807 -6.416  -9.389  0.40 25.73 ? 4   DG  T P     1 
ATOM   3392 O  OP1   A DG  B 2 4   ? -65.647 -7.332  -9.555  0.60 33.90 ? 4   DG  T OP1   1 
ATOM   3393 O  OP1   B DG  B 2 4   ? -65.585 -7.656  -9.156  0.40 25.60 ? 4   DG  T OP1   1 
ATOM   3394 O  OP2   A DG  B 2 4   ? -65.086 -4.842  -9.198  0.60 33.90 ? 4   DG  T OP2   1 
ATOM   3395 O  OP2   B DG  B 2 4   ? -65.320 -5.118  -8.889  0.40 25.69 ? 4   DG  T OP2   1 
ATOM   3396 O  "O5'" A DG  B 2 4   ? -63.399 -6.560  -8.757  0.60 27.56 ? 4   DG  T "O5'" 1 
ATOM   3397 O  "O5'" B DG  B 2 4   ? -63.367 -6.604  -8.745  0.40 22.65 ? 4   DG  T "O5'" 1 
ATOM   3398 C  "C5'" A DG  B 2 4   ? -62.806 -7.870  -8.767  0.60 24.96 ? 4   DG  T "C5'" 1 
ATOM   3399 C  "C5'" B DG  B 2 4   ? -62.711 -7.879  -8.782  0.40 21.94 ? 4   DG  T "C5'" 1 
ATOM   3400 C  "C4'" A DG  B 2 4   ? -62.050 -8.080  -7.476  0.60 22.77 ? 4   DG  T "C4'" 1 
ATOM   3401 C  "C4'" B DG  B 2 4   ? -62.014 -8.109  -7.463  0.40 21.08 ? 4   DG  T "C4'" 1 
ATOM   3402 O  "O4'" A DG  B 2 4   ? -60.841 -7.270  -7.469  0.60 19.56 ? 4   DG  T "O4'" 1 
ATOM   3403 O  "O4'" B DG  B 2 4   ? -60.797 -7.321  -7.415  0.40 19.33 ? 4   DG  T "O4'" 1 
ATOM   3404 C  "C3'" A DG  B 2 4   ? -62.832 -7.664  -6.231  0.60 20.21 ? 4   DG  T "C3'" 1 
ATOM   3405 C  "C3'" B DG  B 2 4   ? -62.828 -7.672  -6.248  0.40 19.75 ? 4   DG  T "C3'" 1 
ATOM   3406 O  "O3'" A DG  B 2 4   ? -62.477 -8.585  -5.216  0.60 19.35 ? 4   DG  T "O3'" 1 
ATOM   3407 O  "O3'" B DG  B 2 4   ? -62.463 -8.578  -5.215  0.40 19.33 ? 4   DG  T "O3'" 1 
ATOM   3408 C  "C2'" A DG  B 2 4   ? -62.334 -6.257  -5.974  0.60 19.40 ? 4   DG  T "C2'" 1 
ATOM   3409 C  "C2'" B DG  B 2 4   ? -62.355 -6.248  -6.030  0.40 19.34 ? 4   DG  T "C2'" 1 
ATOM   3410 C  "C1'" A DG  B 2 4   ? -60.878 -6.421  -6.332  0.60 19.86 ? 4   DG  T "C1'" 1 
ATOM   3411 C  "C1'" B DG  B 2 4   ? -60.881 -6.412  -6.326  0.40 19.79 ? 4   DG  T "C1'" 1 
ATOM   3412 N  N9    A DG  B 2 4   ? -60.104 -5.224  -6.636  0.60 20.05 ? 4   DG  T N9    1 
ATOM   3413 N  N9    B DG  B 2 4   ? -60.103 -5.229  -6.671  0.40 20.31 ? 4   DG  T N9    1 
ATOM   3414 C  C8    A DG  B 2 4   ? -60.471 -4.089  -7.325  0.60 20.40 ? 4   DG  T C8    1 
ATOM   3415 C  C8    B DG  B 2 4   ? -60.470 -4.117  -7.397  0.40 20.78 ? 4   DG  T C8    1 
ATOM   3416 N  N7    A DG  B 2 4   ? -59.494 -3.229  -7.455  0.60 22.45 ? 4   DG  T N7    1 
ATOM   3417 N  N7    B DG  B 2 4   ? -59.490 -3.269  -7.564  0.40 22.46 ? 4   DG  T N7    1 
ATOM   3418 C  C5    A DG  B 2 4   ? -58.430 -3.828  -6.794  0.60 21.00 ? 4   DG  T C5    1 
ATOM   3419 C  C5    B DG  B 2 4   ? -58.417 -3.859  -6.911  0.40 21.03 ? 4   DG  T C5    1 
ATOM   3420 C  C6    A DG  B 2 4   ? -57.099 -3.377  -6.588  0.60 21.72 ? 4   DG  T C6    1 
ATOM   3421 C  C6    B DG  B 2 4   ? -57.080 -3.415  -6.748  0.40 21.43 ? 4   DG  T C6    1 
ATOM   3422 O  O6    A DG  B 2 4   ? -56.581 -2.313  -6.942  0.60 21.04 ? 4   DG  T O6    1 
ATOM   3423 O  O6    B DG  B 2 4   ? -56.561 -2.367  -7.147  0.40 21.02 ? 4   DG  T O6    1 
ATOM   3424 N  N1    A DG  B 2 4   ? -56.349 -4.308  -5.875  0.60 19.20 ? 4   DG  T N1    1 
ATOM   3425 N  N1    B DG  B 2 4   ? -56.326 -4.327  -6.016  0.40 19.82 ? 4   DG  T N1    1 
ATOM   3426 C  C2    A DG  B 2 4   ? -56.808 -5.519  -5.426  0.60 19.29 ? 4   DG  T C2    1 
ATOM   3427 C  C2    B DG  B 2 4   ? -56.787 -5.517  -5.518  0.40 19.84 ? 4   DG  T C2    1 
ATOM   3428 N  N2    A DG  B 2 4   ? -55.926 -6.279  -4.752  0.60 17.69 ? 4   DG  T N2    1 
ATOM   3429 N  N2    B DG  B 2 4   ? -55.901 -6.264  -4.838  0.40 18.84 ? 4   DG  T N2    1 
ATOM   3430 N  N3    A DG  B 2 4   ? -58.038 -5.962  -5.630  0.60 20.35 ? 4   DG  T N3    1 
ATOM   3431 N  N3    B DG  B 2 4   ? -58.024 -5.952  -5.679  0.40 20.57 ? 4   DG  T N3    1 
ATOM   3432 C  C4    A DG  B 2 4   ? -58.790 -5.068  -6.305  0.60 19.64 ? 4   DG  T C4    1 
ATOM   3433 C  C4    B DG  B 2 4   ? -58.780 -5.075  -6.371  0.40 20.10 ? 4   DG  T C4    1 
ATOM   3434 P  P     . DC  B 2 5   ? -63.214 -8.595  -3.815  1.00 20.13 ? 5   DC  T P     1 
ATOM   3435 O  OP1   . DC  B 2 5   ? -63.662 -9.955  -3.573  1.00 19.30 ? 5   DC  T OP1   1 
ATOM   3436 O  OP2   . DC  B 2 5   ? -64.157 -7.481  -3.779  1.00 19.42 ? 5   DC  T OP2   1 
ATOM   3437 O  "O5'" . DC  B 2 5   ? -62.039 -8.216  -2.781  1.00 19.43 ? 5   DC  T "O5'" 1 
ATOM   3438 C  "C5'" . DC  B 2 5   ? -60.952 -9.152  -2.556  1.00 19.25 ? 5   DC  T "C5'" 1 
ATOM   3439 C  "C4'" . DC  B 2 5   ? -59.869 -8.665  -1.623  1.00 19.62 ? 5   DC  T "C4'" 1 
ATOM   3440 O  "O4'" . DC  B 2 5   ? -59.145 -7.561  -2.237  1.00 19.86 ? 5   DC  T "O4'" 1 
ATOM   3441 C  "C3'" . DC  B 2 5   ? -60.361 -8.152  -0.269  1.00 19.49 ? 5   DC  T "C3'" 1 
ATOM   3442 O  "O3'" . DC  B 2 5   ? -59.386 -8.345  0.761   1.00 22.46 ? 5   DC  T "O3'" 1 
ATOM   3443 C  "C2'" . DC  B 2 5   ? -60.507 -6.672  -0.535  1.00 21.27 ? 5   DC  T "C2'" 1 
ATOM   3444 C  "C1'" . DC  B 2 5   ? -59.250 -6.424  -1.373  1.00 20.08 ? 5   DC  T "C1'" 1 
ATOM   3445 N  N1    . DC  B 2 5   ? -59.261 -5.183  -2.177  1.00 18.38 ? 5   DC  T N1    1 
ATOM   3446 C  C2    . DC  B 2 5   ? -58.079 -4.442  -2.283  1.00 19.54 ? 5   DC  T C2    1 
ATOM   3447 O  O2    . DC  B 2 5   ? -57.056 -4.875  -1.754  1.00 17.48 ? 5   DC  T O2    1 
ATOM   3448 N  N3    . DC  B 2 5   ? -58.084 -3.273  -2.962  1.00 19.52 ? 5   DC  T N3    1 
ATOM   3449 C  C4    . DC  B 2 5   ? -59.204 -2.855  -3.553  1.00 20.32 ? 5   DC  T C4    1 
ATOM   3450 N  N4    . DC  B 2 5   ? -59.171 -1.689  -4.200  1.00 20.86 ? 5   DC  T N4    1 
ATOM   3451 C  C5    . DC  B 2 5   ? -60.413 -3.611  -3.498  1.00 19.54 ? 5   DC  T C5    1 
ATOM   3452 C  C6    . DC  B 2 5   ? -60.404 -4.742  -2.782  1.00 18.90 ? 5   DC  T C6    1 
ATOM   3453 P  P     . DT  B 2 6   ? -59.813 -8.390  2.314   1.00 23.32 ? 6   DT  T P     1 
ATOM   3454 O  OP1   . DT  B 2 6   ? -58.737 -9.037  3.103   1.00 24.49 ? 6   DT  T OP1   1 
ATOM   3455 O  OP2   . DT  B 2 6   ? -61.174 -8.922  2.404   1.00 31.02 ? 6   DT  T OP2   1 
ATOM   3456 O  "O5'" . DT  B 2 6   ? -59.855 -6.890  2.836   1.00 31.03 ? 6   DT  T "O5'" 1 
ATOM   3457 C  "C5'" . DT  B 2 6   ? -59.363 -5.740  2.140   1.00 34.55 ? 6   DT  T "C5'" 1 
ATOM   3458 C  "C4'" . DT  B 2 6   ? -57.914 -5.421  2.403   1.00 28.99 ? 6   DT  T "C4'" 1 
ATOM   3459 O  "O4'" . DT  B 2 6   ? -57.527 -4.648  1.250   1.00 28.13 ? 6   DT  T "O4'" 1 
ATOM   3460 C  "C3'" . DT  B 2 6   ? -57.679 -4.529  3.614   1.00 28.13 ? 6   DT  T "C3'" 1 
ATOM   3461 O  "O3'" . DT  B 2 6   ? -56.552 -4.926  4.385   1.00 24.50 ? 6   DT  T "O3'" 1 
ATOM   3462 C  "C2'" . DT  B 2 6   ? -57.482 -3.136  3.049   1.00 28.68 ? 6   DT  T "C2'" 1 
ATOM   3463 C  "C1'" . DT  B 2 6   ? -57.246 -3.316  1.570   1.00 26.96 ? 6   DT  T "C1'" 1 
ATOM   3464 N  N1    . DT  B 2 6   ? -58.096 -2.449  0.735   1.00 22.69 ? 6   DT  T N1    1 
ATOM   3465 C  C2    . DT  B 2 6   ? -57.468 -1.364  0.174   1.00 22.41 ? 6   DT  T C2    1 
ATOM   3466 O  O2    . DT  B 2 6   ? -56.276 -1.142  0.312   1.00 23.42 ? 6   DT  T O2    1 
ATOM   3467 N  N3    . DT  B 2 6   ? -58.282 -0.548  -0.562  1.00 20.23 ? 6   DT  T N3    1 
ATOM   3468 C  C4    . DT  B 2 6   ? -59.636 -0.696  -0.784  1.00 22.21 ? 6   DT  T C4    1 
ATOM   3469 O  O4    . DT  B 2 6   ? -60.224 0.095   -1.521  1.00 18.55 ? 6   DT  T O4    1 
ATOM   3470 C  C5    . DT  B 2 6   ? -60.232 -1.871  -0.184  1.00 23.87 ? 6   DT  T C5    1 
ATOM   3471 C  C7    . DT  B 2 6   ? -61.692 -2.125  -0.388  1.00 27.16 ? 6   DT  T C7    1 
ATOM   3472 C  C6    . DT  B 2 6   ? -59.446 -2.673  0.547   1.00 24.06 ? 6   DT  T C6    1 
ATOM   3473 P  P     . DC  B 2 7   ? -56.494 -4.553  5.900   1.00 27.11 ? 7   DC  T P     1 
ATOM   3474 O  OP1   . DC  B 2 7   ? -55.390 -5.329  6.491   1.00 29.33 ? 7   DC  T OP1   1 
ATOM   3475 O  OP2   . DC  B 2 7   ? -57.841 -4.642  6.493   1.00 23.55 ? 7   DC  T OP2   1 
ATOM   3476 O  "O5'" . DC  B 2 7   ? -56.314 -2.972  5.851   1.00 27.54 ? 7   DC  T "O5'" 1 
ATOM   3477 C  "C5'" . DC  B 2 7   ? -55.220 -2.347  6.484   1.00 29.21 ? 7   DC  T "C5'" 1 
ATOM   3478 C  "C4'" . DC  B 2 7   ? -54.979 -0.942  5.975   1.00 26.90 ? 7   DC  T "C4'" 1 
ATOM   3479 O  "O4'" . DC  B 2 7   ? -55.543 -0.695  4.671   1.00 24.90 ? 7   DC  T "O4'" 1 
ATOM   3480 C  "C3'" . DC  B 2 7   ? -55.569 0.123   6.892   1.00 26.43 ? 7   DC  T "C3'" 1 
ATOM   3481 O  "O3'" . DC  B 2 7   ? -54.502 0.642   7.658   1.00 27.21 ? 7   DC  T "O3'" 1 
ATOM   3482 C  "C2'" . DC  B 2 7   ? -56.066 1.208   5.961   1.00 27.12 ? 7   DC  T "C2'" 1 
ATOM   3483 C  "C1'" . DC  B 2 7   ? -55.746 0.703   4.572   1.00 25.28 ? 7   DC  T "C1'" 1 
ATOM   3484 N  N1    . DC  B 2 7   ? -56.871 0.957   3.669   1.00 24.24 ? 7   DC  T N1    1 
ATOM   3485 C  C2    . DC  B 2 7   ? -56.799 2.094   2.874   1.00 22.76 ? 7   DC  T C2    1 
ATOM   3486 O  O2    . DC  B 2 7   ? -55.749 2.755   2.880   1.00 23.05 ? 7   DC  T O2    1 
ATOM   3487 N  N3    . DC  B 2 7   ? -57.832 2.393   2.051   1.00 21.18 ? 7   DC  T N3    1 
ATOM   3488 C  C4    . DC  B 2 7   ? -58.918 1.622   2.043   1.00 21.47 ? 7   DC  T C4    1 
ATOM   3489 N  N4    . DC  B 2 7   ? -59.916 1.960   1.231   1.00 22.09 ? 7   DC  T N4    1 
ATOM   3490 C  C5    . DC  B 2 7   ? -59.049 0.498   2.910   1.00 22.69 ? 7   DC  T C5    1 
ATOM   3491 C  C6    . DC  B 2 7   ? -58.014 0.212   3.707   1.00 21.06 ? 7   DC  T C6    1 
ATOM   3492 P  P     . DA  B 2 8   ? -54.792 1.656   8.783   1.00 30.69 ? 8   DA  T P     1 
ATOM   3493 O  OP1   . DA  B 2 8   ? -53.884 1.400   9.886   1.00 27.93 ? 8   DA  T OP1   1 
ATOM   3494 O  OP2   . DA  B 2 8   ? -56.280 1.717   9.028   1.00 27.88 ? 8   DA  T OP2   1 
ATOM   3495 O  "O5'" . DA  B 2 8   ? -54.446 3.049   8.077   1.00 28.25 ? 8   DA  T "O5'" 1 
ATOM   3496 C  "C5'" . DA  B 2 8   ? -53.195 3.342   7.427   1.00 25.33 ? 8   DA  T "C5'" 1 
ATOM   3497 C  "C4'" . DA  B 2 8   ? -53.210 4.801   7.034   1.00 23.49 ? 8   DA  T "C4'" 1 
ATOM   3498 O  "O4'" . DA  B 2 8   ? -54.092 4.954   5.896   1.00 22.20 ? 8   DA  T "O4'" 1 
ATOM   3499 C  "C3'" . DA  B 2 8   ? -53.765 5.700   8.146   1.00 23.10 ? 8   DA  T "C3'" 1 
ATOM   3500 O  "O3'" . DA  B 2 8   ? -52.912 6.822   8.333   1.00 25.15 ? 8   DA  T "O3'" 1 
ATOM   3501 C  "C2'" . DA  B 2 8   ? -55.166 6.037   7.691   1.00 22.30 ? 8   DA  T "C2'" 1 
ATOM   3502 C  "C1'" . DA  B 2 8   ? -55.086 5.921   6.171   1.00 22.48 ? 8   DA  T "C1'" 1 
ATOM   3503 N  N9    . DA  B 2 8   ? -56.343 5.475   5.573   1.00 20.58 ? 8   DA  T N9    1 
ATOM   3504 C  C8    . DA  B 2 8   ? -57.138 4.419   5.947   1.00 21.86 ? 8   DA  T C8    1 
ATOM   3505 N  N7    . DA  B 2 8   ? -58.234 4.304   5.231   1.00 21.27 ? 8   DA  T N7    1 
ATOM   3506 C  C5    . DA  B 2 8   ? -58.184 5.391   4.370   1.00 19.63 ? 8   DA  T C5    1 
ATOM   3507 C  C6    . DA  B 2 8   ? -59.068 5.859   3.385   1.00 21.26 ? 8   DA  T C6    1 
ATOM   3508 N  N6    . DA  B 2 8   ? -60.225 5.265   3.083   1.00 20.04 ? 8   DA  T N6    1 
ATOM   3509 N  N1    . DA  B 2 8   ? -58.717 6.976   2.703   1.00 20.95 ? 8   DA  T N1    1 
ATOM   3510 C  C2    . DA  B 2 8   ? -57.544 7.552   2.981   1.00 19.93 ? 8   DA  T C2    1 
ATOM   3511 N  N3    . DA  B 2 8   ? -56.649 7.231   3.910   1.00 19.01 ? 8   DA  T N3    1 
ATOM   3512 C  C4    . DA  B 2 8   ? -57.026 6.121   4.570   1.00 20.80 ? 8   DA  T C4    1 
ATOM   3513 P  P     . DC  B 2 9   ? -53.124 7.849   9.535   1.00 28.35 ? 9   DC  T P     1 
ATOM   3514 O  OP1   . DC  B 2 9   ? -51.805 8.427   9.851   1.00 33.93 ? 9   DC  T OP1   1 
ATOM   3515 O  OP2   . DC  B 2 9   ? -53.916 7.229   10.624  1.00 27.00 ? 9   DC  T OP2   1 
ATOM   3516 O  "O5'" . DC  B 2 9   ? -54.067 8.945   8.866   1.00 28.62 ? 9   DC  T "O5'" 1 
ATOM   3517 C  "C5'" . DC  B 2 9   ? -53.559 9.736   7.781   1.00 30.21 ? 9   DC  T "C5'" 1 
ATOM   3518 C  "C4'" . DC  B 2 9   ? -54.679 10.554  7.197   1.00 31.96 ? 9   DC  T "C4'" 1 
ATOM   3519 O  "O4'" . DC  B 2 9   ? -55.700 9.666   6.673   1.00 33.83 ? 9   DC  T "O4'" 1 
ATOM   3520 C  "C3'" . DC  B 2 9   ? -55.366 11.449  8.233   1.00 35.41 ? 9   DC  T "C3'" 1 
ATOM   3521 O  "O3'" . DC  B 2 9   ? -55.349 12.774  7.710   1.00 38.38 ? 9   DC  T "O3'" 1 
ATOM   3522 C  "C2'" . DC  B 2 9   ? -56.759 10.861  8.355   1.00 34.26 ? 9   DC  T "C2'" 1 
ATOM   3523 C  "C1'" . DC  B 2 9   ? -56.937 10.246  6.977   1.00 33.12 ? 9   DC  T "C1'" 1 
ATOM   3524 N  N1    . DC  B 2 9   ? -57.986 9.229   6.824   1.00 28.69 ? 9   DC  T N1    1 
ATOM   3525 C  C2    . DC  B 2 9   ? -58.893 9.396   5.780   1.00 28.28 ? 9   DC  T C2    1 
ATOM   3526 O  O2    . DC  B 2 9   ? -58.731 10.341  5.001   1.00 23.35 ? 9   DC  T O2    1 
ATOM   3527 N  N3    . DC  B 2 9   ? -59.896 8.503   5.620   1.00 27.54 ? 9   DC  T N3    1 
ATOM   3528 C  C4    . DC  B 2 9   ? -60.047 7.509   6.498   1.00 28.88 ? 9   DC  T C4    1 
ATOM   3529 N  N4    . DC  B 2 9   ? -61.061 6.663   6.312   1.00 28.81 ? 9   DC  T N4    1 
ATOM   3530 C  C5    . DC  B 2 9   ? -59.142 7.320   7.586   1.00 29.80 ? 9   DC  T C5    1 
ATOM   3531 C  C6    . DC  B 2 9   ? -58.139 8.202   7.713   1.00 31.84 ? 9   DC  T C6    1 
ATOM   3532 P  P     . DA  B 2 10  ? -55.486 14.023  8.649   1.00 33.77 ? 10  DA  T P     1 
ATOM   3533 O  OP1   . DA  B 2 10  ? -54.153 14.597  8.842   1.00 38.49 ? 10  DA  T OP1   1 
ATOM   3534 O  OP2   . DA  B 2 10  ? -56.292 13.644  9.816   1.00 30.68 ? 10  DA  T OP2   1 
ATOM   3535 O  "O5'" . DA  B 2 10  ? -56.255 15.035  7.704   1.00 31.20 ? 10  DA  T "O5'" 1 
ATOM   3536 C  "C5'" . DA  B 2 10  ? -56.114 14.898  6.278   1.00 29.48 ? 10  DA  T "C5'" 1 
ATOM   3537 C  "C4'" . DA  B 2 10  ? -57.163 15.721  5.566   1.00 29.57 ? 10  DA  T "C4'" 1 
ATOM   3538 O  "O4'" . DA  B 2 10  ? -58.280 14.877  5.206   1.00 27.53 ? 10  DA  T "O4'" 1 
ATOM   3539 C  "C3'" . DA  B 2 10  ? -57.762 16.849  6.401   1.00 29.14 ? 10  DA  T "C3'" 1 
ATOM   3540 O  "O3'" . DA  B 2 10  ? -58.160 17.862  5.477   1.00 31.32 ? 10  DA  T "O3'" 1 
ATOM   3541 C  "C2'" . DA  B 2 10  ? -58.949 16.165  7.066   1.00 28.58 ? 10  DA  T "C2'" 1 
ATOM   3542 C  "C1'" . DA  B 2 10  ? -59.408 15.163  6.012   1.00 24.98 ? 10  DA  T "C1'" 1 
ATOM   3543 N  N9    . DA  B 2 10  ? -59.901 13.902  6.570   1.00 26.62 ? 10  DA  T N9    1 
ATOM   3544 C  C8    . DA  B 2 10  ? -59.412 13.194  7.641   1.00 24.87 ? 10  DA  T C8    1 
ATOM   3545 N  N7    . DA  B 2 10  ? -60.124 12.133  7.942   1.00 23.04 ? 10  DA  T N7    1 
ATOM   3546 C  C5    . DA  B 2 10  ? -61.189 12.184  7.056   1.00 22.48 ? 10  DA  T C5    1 
ATOM   3547 C  C6    . DA  B 2 10  ? -62.311 11.352  6.870   1.00 21.92 ? 10  DA  T C6    1 
ATOM   3548 N  N6    . DA  B 2 10  ? -62.553 10.250  7.588   1.00 22.05 ? 10  DA  T N6    1 
ATOM   3549 N  N1    . DA  B 2 10  ? -63.169 11.672  5.883   1.00 20.15 ? 10  DA  T N1    1 
ATOM   3550 C  C2    . DA  B 2 10  ? -62.923 12.764  5.146   1.00 23.36 ? 10  DA  T C2    1 
ATOM   3551 N  N3    . DA  B 2 10  ? -61.917 13.634  5.236   1.00 23.37 ? 10  DA  T N3    1 
ATOM   3552 C  C4    . DA  B 2 10  ? -61.065 13.270  6.206   1.00 22.26 ? 10  DA  T C4    1 
ATOM   3553 P  P     . DC  B 2 11  ? -58.779 19.245  5.990   1.00 35.85 ? 11  DC  T P     1 
ATOM   3554 O  OP1   . DC  B 2 11  ? -58.376 20.279  5.037   1.00 27.88 ? 11  DC  T OP1   1 
ATOM   3555 O  OP2   . DC  B 2 11  ? -58.463 19.419  7.427   1.00 28.79 ? 11  DC  T OP2   1 
ATOM   3556 O  "O5'" . DC  B 2 11  ? -60.354 19.005  5.897   1.00 34.10 ? 11  DC  T "O5'" 1 
ATOM   3557 C  "C5'" . DC  B 2 11  ? -60.964 18.707  4.640   1.00 29.80 ? 11  DC  T "C5'" 1 
ATOM   3558 C  "C4'" . DC  B 2 11  ? -62.440 18.451  4.824   1.00 27.92 ? 11  DC  T "C4'" 1 
ATOM   3559 O  "O4'" . DC  B 2 11  ? -62.604 17.163  5.424   1.00 26.76 ? 11  DC  T "O4'" 1 
ATOM   3560 C  "C3'" . DC  B 2 11  ? -63.216 19.446  5.709   1.00 27.21 ? 11  DC  T "C3'" 1 
ATOM   3561 O  "O3'" . DC  B 2 11  ? -64.199 20.046  4.840   1.00 26.47 ? 11  DC  T "O3'" 1 
ATOM   3562 C  "C2'" . DC  B 2 11  ? -63.815 18.582  6.806   1.00 24.24 ? 11  DC  T "C2'" 1 
ATOM   3563 C  "C1'" . DC  B 2 11  ? -63.764 17.172  6.219   1.00 26.68 ? 11  DC  T "C1'" 1 
ATOM   3564 N  N1    . DC  B 2 11  ? -63.627 16.079  7.208   1.00 25.51 ? 11  DC  T N1    1 
ATOM   3565 C  C2    . DC  B 2 11  ? -64.548 15.033  7.213   1.00 24.35 ? 11  DC  T C2    1 
ATOM   3566 O  O2    . DC  B 2 11  ? -65.511 15.085  6.439   1.00 25.19 ? 11  DC  T O2    1 
ATOM   3567 N  N3    . DC  B 2 11  ? -64.418 14.039  8.126   1.00 25.53 ? 11  DC  T N3    1 
ATOM   3568 C  C4    . DC  B 2 11  ? -63.400 14.060  8.990   1.00 28.72 ? 11  DC  T C4    1 
ATOM   3569 N  N4    . DC  B 2 11  ? -63.282 13.045  9.858   1.00 27.20 ? 11  DC  T N4    1 
ATOM   3570 C  C5    . DC  B 2 11  ? -62.436 15.108  8.989   1.00 27.24 ? 11  DC  T C5    1 
ATOM   3571 C  C6    . DC  B 2 11  ? -62.571 16.070  8.071   1.00 24.00 ? 11  DC  T C6    1 
ATOM   3572 P  P     . DT  B 2 12  ? -65.091 21.303  5.291   1.00 26.77 ? 12  DT  T P     1 
ATOM   3573 O  OP1   . DT  B 2 12  ? -65.603 21.934  4.058   1.00 21.98 ? 12  DT  T OP1   1 
ATOM   3574 O  OP2   . DT  B 2 12  ? -64.315 22.063  6.274   1.00 24.22 ? 12  DT  T OP2   1 
ATOM   3575 O  "O5'" . DT  B 2 12  ? -66.308 20.621  6.045   1.00 24.55 ? 12  DT  T "O5'" 1 
ATOM   3576 C  "C5'" . DT  B 2 12  ? -67.368 20.018  5.259   1.00 24.23 ? 12  DT  T "C5'" 1 
ATOM   3577 C  "C4'" . DT  B 2 12  ? -68.317 19.298  6.182   1.00 24.97 ? 12  DT  T "C4'" 1 
ATOM   3578 O  "O4'" . DT  B 2 12  ? -67.596 18.226  6.835   1.00 24.46 ? 12  DT  T "O4'" 1 
ATOM   3579 C  "C3'" . DT  B 2 12  ? -68.861 20.190  7.313   1.00 26.13 ? 12  DT  T "C3'" 1 
ATOM   3580 O  "O3'" . DT  B 2 12  ? -70.260 20.495  7.152   1.00 25.55 ? 12  DT  T "O3'" 1 
ATOM   3581 C  "C2'" . DT  B 2 12  ? -68.589 19.392  8.578   1.00 26.70 ? 12  DT  T "C2'" 1 
ATOM   3582 C  "C1'" . DT  B 2 12  ? -68.258 17.995  8.054   1.00 28.39 ? 12  DT  T "C1'" 1 
ATOM   3583 N  N1    . DT  B 2 12  ? -67.379 17.186  8.931   1.00 27.15 ? 12  DT  T N1    1 
ATOM   3584 C  C2    . DT  B 2 12  ? -67.842 15.972  9.386   1.00 27.65 ? 12  DT  T C2    1 
ATOM   3585 O  O2    . DT  B 2 12  ? -68.913 15.489  9.053   1.00 31.40 ? 12  DT  T O2    1 
ATOM   3586 N  N3    . DT  B 2 12  ? -67.011 15.342  10.267  1.00 26.70 ? 12  DT  T N3    1 
ATOM   3587 C  C4    . DT  B 2 12  ? -65.787 15.778  10.715  1.00 27.53 ? 12  DT  T C4    1 
ATOM   3588 O  O4    . DT  B 2 12  ? -65.161 15.097  11.506  1.00 27.83 ? 12  DT  T O4    1 
ATOM   3589 C  C5    . DT  B 2 12  ? -65.377 17.075  10.231  1.00 28.35 ? 12  DT  T C5    1 
ATOM   3590 C  C7    . DT  B 2 12  ? -64.059 17.635  10.670  1.00 27.56 ? 12  DT  T C7    1 
ATOM   3591 C  C6    . DT  B 2 12  ? -66.187 17.708  9.378   1.00 28.32 ? 12  DT  T C6    1 
ATOM   3592 O  "O3'" . DT  C 3 1   ? -69.750 8.003   18.448  1.00 47.75 ? 1   DT  P "O3'" 1 
ATOM   3593 P  P     . DA  C 3 2   ? -69.669 6.922   17.259  1.00 58.34 ? 2   DA  P P     1 
ATOM   3594 O  OP1   . DA  C 3 2   ? -70.464 5.741   17.675  1.00 58.15 ? 2   DA  P OP1   1 
ATOM   3595 O  OP2   . DA  C 3 2   ? -68.239 6.748   16.860  1.00 46.36 ? 2   DA  P OP2   1 
ATOM   3596 O  "O5'" . DA  C 3 2   ? -70.496 7.611   16.085  1.00 44.85 ? 2   DA  P "O5'" 1 
ATOM   3597 C  "C5'" . DA  C 3 2   ? -71.818 8.120   16.353  1.00 43.79 ? 2   DA  P "C5'" 1 
ATOM   3598 C  "C4'" . DA  C 3 2   ? -72.532 8.491   15.074  1.00 40.82 ? 2   DA  P "C4'" 1 
ATOM   3599 O  "O4'" . DA  C 3 2   ? -71.993 9.727   14.540  1.00 37.93 ? 2   DA  P "O4'" 1 
ATOM   3600 C  "C3'" . DA  C 3 2   ? -72.419 7.468   13.942  1.00 37.23 ? 2   DA  P "C3'" 1 
ATOM   3601 O  "O3'" . DA  C 3 2   ? -73.591 7.576   13.143  1.00 39.57 ? 2   DA  P "O3'" 1 
ATOM   3602 C  "C2'" . DA  C 3 2   ? -71.204 7.940   13.176  1.00 36.47 ? 2   DA  P "C2'" 1 
ATOM   3603 C  "C1'" . DA  C 3 2   ? -71.258 9.458   13.349  1.00 38.60 ? 2   DA  P "C1'" 1 
ATOM   3604 N  N9    . DA  C 3 2   ? -69.931 10.059  13.482  1.00 31.77 ? 2   DA  P N9    1 
ATOM   3605 C  C8    . DA  C 3 2   ? -68.916 9.715   14.341  1.00 32.22 ? 2   DA  P C8    1 
ATOM   3606 N  N7    . DA  C 3 2   ? -67.822 10.417  14.174  1.00 29.25 ? 2   DA  P N7    1 
ATOM   3607 C  C5    . DA  C 3 2   ? -68.129 11.264  13.119  1.00 29.81 ? 2   DA  P C5    1 
ATOM   3608 C  C6    . DA  C 3 2   ? -67.395 12.269  12.477  1.00 27.85 ? 2   DA  P C6    1 
ATOM   3609 N  N6    . DA  C 3 2   ? -66.141 12.586  12.810  1.00 28.37 ? 2   DA  P N6    1 
ATOM   3610 N  N1    . DA  C 3 2   ? -67.997 12.950  11.475  1.00 29.26 ? 2   DA  P N1    1 
ATOM   3611 C  C2    . DA  C 3 2   ? -69.269 12.655  11.172  1.00 29.26 ? 2   DA  P C2    1 
ATOM   3612 N  N3    . DA  C 3 2   ? -70.068 11.729  11.711  1.00 32.69 ? 2   DA  P N3    1 
ATOM   3613 C  C4    . DA  C 3 2   ? -69.429 11.065  12.693  1.00 28.79 ? 2   DA  P C4    1 
ATOM   3614 P  P     . DG  C 3 3   ? -73.872 6.544   11.955  1.00 37.62 ? 3   DG  P P     1 
ATOM   3615 O  OP1   . DG  C 3 3   ? -75.344 6.488   11.767  1.00 37.80 ? 3   DG  P OP1   1 
ATOM   3616 O  OP2   . DG  C 3 3   ? -73.066 5.333   12.195  1.00 39.10 ? 3   DG  P OP2   1 
ATOM   3617 O  "O5'" . DG  C 3 3   ? -73.161 7.236   10.699  1.00 37.24 ? 3   DG  P "O5'" 1 
ATOM   3618 C  "C5'" . DG  C 3 3   ? -73.934 8.089   9.860   1.00 32.99 ? 3   DG  P "C5'" 1 
ATOM   3619 C  "C4'" . DG  C 3 3   ? -73.056 8.787   8.852   1.00 28.92 ? 3   DG  P "C4'" 1 
ATOM   3620 O  "O4'" . DG  C 3 3   ? -71.853 9.336   9.436   1.00 28.10 ? 3   DG  P "O4'" 1 
ATOM   3621 C  "C3'" . DG  C 3 3   ? -72.595 7.899   7.694   1.00 26.35 ? 3   DG  P "C3'" 1 
ATOM   3622 O  "O3'" . DG  C 3 3   ? -73.250 8.439   6.573   1.00 25.62 ? 3   DG  P "O3'" 1 
ATOM   3623 C  "C2'" . DG  C 3 3   ? -71.088 8.084   7.655   1.00 26.19 ? 3   DG  P "C2'" 1 
ATOM   3624 C  "C1'" . DG  C 3 3   ? -70.900 9.389   8.400   1.00 27.84 ? 3   DG  P "C1'" 1 
ATOM   3625 N  N9    . DG  C 3 3   ? -69.580 9.545   8.993   1.00 27.17 ? 3   DG  P N9    1 
ATOM   3626 C  C8    . DG  C 3 3   ? -68.970 8.725   9.910   1.00 27.64 ? 3   DG  P C8    1 
ATOM   3627 N  N7    . DG  C 3 3   ? -67.745 9.084   10.183  1.00 25.02 ? 3   DG  P N7    1 
ATOM   3628 C  C5    . DG  C 3 3   ? -67.534 10.209  9.402   1.00 25.52 ? 3   DG  P C5    1 
ATOM   3629 C  C6    . DG  C 3 3   ? -66.402 11.051  9.292   1.00 25.35 ? 3   DG  P C6    1 
ATOM   3630 O  O6    . DG  C 3 3   ? -65.323 10.979  9.895   1.00 23.93 ? 3   DG  P O6    1 
ATOM   3631 N  N1    . DG  C 3 3   ? -66.626 12.091  8.399   1.00 25.00 ? 3   DG  P N1    1 
ATOM   3632 C  C2    . DG  C 3 3   ? -67.777 12.279  7.683   1.00 23.45 ? 3   DG  P C2    1 
ATOM   3633 N  N2    . DG  C 3 3   ? -67.789 13.324  6.853   1.00 23.64 ? 3   DG  P N2    1 
ATOM   3634 N  N3    . DG  C 3 3   ? -68.840 11.504  7.776   1.00 26.04 ? 3   DG  P N3    1 
ATOM   3635 C  C4    . DG  C 3 3   ? -68.653 10.499  8.651   1.00 27.67 ? 3   DG  P C4    1 
ATOM   3636 P  P     . DT  C 3 4   ? -72.927 7.925   5.094   1.00 28.02 ? 4   DT  P P     1 
ATOM   3637 O  OP1   . DT  C 3 4   ? -74.171 8.135   4.374   1.00 25.73 ? 4   DT  P OP1   1 
ATOM   3638 O  OP2   . DT  C 3 4   ? -72.312 6.576   5.221   1.00 26.52 ? 4   DT  P OP2   1 
ATOM   3639 O  "O5'" . DT  C 3 4   ? -71.805 8.936   4.605   1.00 25.43 ? 4   DT  P "O5'" 1 
ATOM   3640 C  "C5'" . DT  C 3 4   ? -72.168 10.311  4.392   1.00 28.71 ? 4   DT  P "C5'" 1 
ATOM   3641 C  "C4'" . DT  C 3 4   ? -71.070 11.018  3.638   1.00 28.83 ? 4   DT  P "C4'" 1 
ATOM   3642 O  "O4'" . DT  C 3 4   ? -69.926 11.017  4.501   1.00 26.44 ? 4   DT  P "O4'" 1 
ATOM   3643 C  "C3'" . DT  C 3 4   ? -70.627 10.363  2.320   1.00 31.12 ? 4   DT  P "C3'" 1 
ATOM   3644 O  "O3'" . DT  C 3 4   ? -70.534 11.327  1.253   1.00 33.81 ? 4   DT  P "O3'" 1 
ATOM   3645 C  "C2'" . DT  C 3 4   ? -69.234 9.833   2.628   1.00 29.22 ? 4   DT  P "C2'" 1 
ATOM   3646 C  "C1'" . DT  C 3 4   ? -68.783 10.766  3.734   1.00 27.65 ? 4   DT  P "C1'" 1 
ATOM   3647 N  N1    . DT  C 3 4   ? -67.784 10.210  4.631   1.00 27.98 ? 4   DT  P N1    1 
ATOM   3648 C  C2    . DT  C 3 4   ? -66.590 10.878  4.758   1.00 24.66 ? 4   DT  P C2    1 
ATOM   3649 O  O2    . DT  C 3 4   ? -66.319 11.886  4.127   1.00 24.12 ? 4   DT  P O2    1 
ATOM   3650 N  N3    . DT  C 3 4   ? -65.697 10.288  5.608   1.00 22.82 ? 4   DT  P N3    1 
ATOM   3651 C  C4    . DT  C 3 4   ? -65.872 9.121   6.322   1.00 25.00 ? 4   DT  P C4    1 
ATOM   3652 O  O4    . DT  C 3 4   ? -64.982 8.725   7.067   1.00 24.48 ? 4   DT  P O4    1 
ATOM   3653 C  C5    . DT  C 3 4   ? -67.159 8.484   6.155   1.00 24.68 ? 4   DT  P C5    1 
ATOM   3654 C  C7    . DT  C 3 4   ? -67.444 7.218   6.895   1.00 25.55 ? 4   DT  P C7    1 
ATOM   3655 C  C6    . DT  C 3 4   ? -68.040 9.054   5.330   1.00 23.94 ? 4   DT  P C6    1 
ATOM   3656 P  P     . DG  C 3 5   ? -70.311 10.829  -0.281  1.00 38.93 ? 5   DG  P P     1 
ATOM   3657 O  OP1   . DG  C 3 5   ? -71.209 11.614  -1.157  1.00 46.00 ? 5   DG  P OP1   1 
ATOM   3658 O  OP2   . DG  C 3 5   ? -70.319 9.340   -0.331  1.00 34.48 ? 5   DG  P OP2   1 
ATOM   3659 O  "O5'" . DG  C 3 5   ? -68.828 11.296  -0.618  1.00 33.29 ? 5   DG  P "O5'" 1 
ATOM   3660 C  "C5'" . DG  C 3 5   ? -68.388 12.637  -0.370  1.00 30.23 ? 5   DG  P "C5'" 1 
ATOM   3661 C  "C4'" . DG  C 3 5   ? -66.880 12.661  -0.444  1.00 29.22 ? 5   DG  P "C4'" 1 
ATOM   3662 O  "O4'" . DG  C 3 5   ? -66.379 11.931  0.694   1.00 28.19 ? 5   DG  P "O4'" 1 
ATOM   3663 C  "C3'" . DG  C 3 5   ? -66.308 11.949  -1.682  1.00 26.70 ? 5   DG  P "C3'" 1 
ATOM   3664 O  "O3'" . DG  C 3 5   ? -65.614 12.932  -2.431  1.00 30.93 ? 5   DG  P "O3'" 1 
ATOM   3665 C  "C2'" . DG  C 3 5   ? -65.440 10.840  -1.105  1.00 24.98 ? 5   DG  P "C2'" 1 
ATOM   3666 C  "C1'" . DG  C 3 5   ? -65.198 11.282  0.319   1.00 24.52 ? 5   DG  P "C1'" 1 
ATOM   3667 N  N9    . DG  C 3 5   ? -64.973 10.203  1.271   1.00 24.94 ? 5   DG  P N9    1 
ATOM   3668 C  C8    . DG  C 3 5   ? -65.828 9.175   1.587   1.00 23.23 ? 5   DG  P C8    1 
ATOM   3669 N  N7    . DG  C 3 5   ? -65.344 8.365   2.488   1.00 25.40 ? 5   DG  P N7    1 
ATOM   3670 C  C5    . DG  C 3 5   ? -64.099 8.899   2.796   1.00 24.43 ? 5   DG  P C5    1 
ATOM   3671 C  C6    . DG  C 3 5   ? -63.085 8.431   3.674   1.00 24.26 ? 5   DG  P C6    1 
ATOM   3672 O  O6    . DG  C 3 5   ? -63.099 7.437   4.409   1.00 23.64 ? 5   DG  P O6    1 
ATOM   3673 N  N1    . DG  C 3 5   ? -61.977 9.270   3.668   1.00 23.06 ? 5   DG  P N1    1 
ATOM   3674 C  C2    . DG  C 3 5   ? -61.854 10.404  2.912   1.00 20.65 ? 5   DG  P C2    1 
ATOM   3675 N  N2    . DG  C 3 5   ? -60.709 11.070  3.034   1.00 22.50 ? 5   DG  P N2    1 
ATOM   3676 N  N3    . DG  C 3 5   ? -62.767 10.823  2.054   1.00 23.02 ? 5   DG  P N3    1 
ATOM   3677 C  C4    . DG  C 3 5   ? -63.855 10.030  2.049   1.00 22.82 ? 5   DG  P C4    1 
ATOM   3678 P  P     . DT  C 3 6   ? -64.691 12.519  -3.704  1.00 34.67 ? 6   DT  P P     1 
ATOM   3679 O  OP1   . DT  C 3 6   ? -64.760 13.652  -4.652  1.00 30.88 ? 6   DT  P OP1   1 
ATOM   3680 O  OP2   . DT  C 3 6   ? -65.014 11.136  -4.102  1.00 31.64 ? 6   DT  P OP2   1 
ATOM   3681 O  "O5'" . DT  C 3 6   ? -63.226 12.391  -3.079  1.00 27.14 ? 6   DT  P "O5'" 1 
ATOM   3682 C  "C5'" . DT  C 3 6   ? -62.637 13.494  -2.366  1.00 25.01 ? 6   DT  P "C5'" 1 
ATOM   3683 C  "C4'" . DT  C 3 6   ? -61.193 13.199  -2.037  1.00 23.45 ? 6   DT  P "C4'" 1 
ATOM   3684 O  "O4'" . DT  C 3 6   ? -61.093 12.180  -1.004  1.00 22.23 ? 6   DT  P "O4'" 1 
ATOM   3685 C  "C3'" . DT  C 3 6   ? -60.369 12.701  -3.229  1.00 22.31 ? 6   DT  P "C3'" 1 
ATOM   3686 O  "O3'" . DT  C 3 6   ? -59.126 13.413  -3.252  1.00 23.67 ? 6   DT  P "O3'" 1 
ATOM   3687 C  "C2'" . DT  C 3 6   ? -60.168 11.219  -2.952  1.00 22.64 ? 6   DT  P "C2'" 1 
ATOM   3688 C  "C1'" . DT  C 3 6   ? -60.220 11.133  -1.431  1.00 23.28 ? 6   DT  P "C1'" 1 
ATOM   3689 N  N1    . DT  C 3 6   ? -60.707 9.849   -0.808  1.00 21.64 ? 6   DT  P N1    1 
ATOM   3690 C  C2    . DT  C 3 6   ? -59.912 9.315   0.182   1.00 22.50 ? 6   DT  P C2    1 
ATOM   3691 O  O2    . DT  C 3 6   ? -58.833 9.789   0.494   1.00 21.38 ? 6   DT  P O2    1 
ATOM   3692 N  N3    . DT  C 3 6   ? -60.416 8.184   0.776   1.00 21.44 ? 6   DT  P N3    1 
ATOM   3693 C  C4    . DT  C 3 6   ? -61.603 7.545   0.476   1.00 22.03 ? 6   DT  P C4    1 
ATOM   3694 O  O4    . DT  C 3 6   ? -61.925 6.539   1.093   1.00 23.43 ? 6   DT  P O4    1 
ATOM   3695 C  C5    . DT  C 3 6   ? -62.384 8.152   -0.575  1.00 23.47 ? 6   DT  P C5    1 
ATOM   3696 C  C7    . DT  C 3 6   ? -63.688 7.524   -0.958  1.00 22.83 ? 6   DT  P C7    1 
ATOM   3697 C  C6    . DT  C 3 6   ? -61.907 9.266   -1.153  1.00 21.21 ? 6   DT  P C6    1 
ATOM   3698 P  P     . DG  C 3 7   ? -58.065 13.170  -4.439  1.00 20.66 ? 7   DG  P P     1 
ATOM   3699 O  OP1   . DG  C 3 7   ? -57.335 14.446  -4.633  1.00 18.29 ? 7   DG  P OP1   1 
ATOM   3700 O  OP2   . DG  C 3 7   ? -58.762 12.575  -5.576  1.00 17.26 ? 7   DG  P OP2   1 
ATOM   3701 O  "O5'" . DG  C 3 7   ? -57.097 12.075  -3.823  1.00 21.82 ? 7   DG  P "O5'" 1 
ATOM   3702 C  "C5'" . DG  C 3 7   ? -56.236 12.357  -2.720  1.00 20.42 ? 7   DG  P "C5'" 1 
ATOM   3703 C  "C4'" . DG  C 3 7   ? -55.448 11.103  -2.455  1.00 22.98 ? 7   DG  P "C4'" 1 
ATOM   3704 O  "O4'" . DG  C 3 7   ? -56.288 10.158  -1.733  1.00 21.32 ? 7   DG  P "O4'" 1 
ATOM   3705 C  "C3'" . DG  C 3 7   ? -54.982 10.389  -3.745  1.00 21.59 ? 7   DG  P "C3'" 1 
ATOM   3706 O  "O3'" . DG  C 3 7   ? -53.557 10.435  -3.706  1.00 21.03 ? 7   DG  P "O3'" 1 
ATOM   3707 C  "C2'" . DG  C 3 7   ? -55.609 9.010   -3.666  1.00 21.48 ? 7   DG  P "C2'" 1 
ATOM   3708 C  "C1'" . DG  C 3 7   ? -55.927 8.863   -2.185  1.00 21.29 ? 7   DG  P "C1'" 1 
ATOM   3709 N  N9    . DG  C 3 7   ? -57.039 7.957   -1.926  1.00 19.15 ? 7   DG  P N9    1 
ATOM   3710 C  C8    . DG  C 3 7   ? -58.234 7.889   -2.596  1.00 18.40 ? 7   DG  P C8    1 
ATOM   3711 N  N7    . DG  C 3 7   ? -59.020 6.957   -2.140  1.00 20.39 ? 7   DG  P N7    1 
ATOM   3712 C  C5    . DG  C 3 7   ? -58.295 6.360   -1.119  1.00 19.10 ? 7   DG  P C5    1 
ATOM   3713 C  C6    . DG  C 3 7   ? -58.612 5.257   -0.294  1.00 22.04 ? 7   DG  P C6    1 
ATOM   3714 O  O6    . DG  C 3 7   ? -59.635 4.564   -0.301  1.00 22.52 ? 7   DG  P O6    1 
ATOM   3715 N  N1    . DG  C 3 7   ? -57.562 4.939   0.568   1.00 21.58 ? 7   DG  P N1    1 
ATOM   3716 C  C2    . DG  C 3 7   ? -56.376 5.622   0.645   1.00 19.33 ? 7   DG  P C2    1 
ATOM   3717 N  N2    . DG  C 3 7   ? -55.501 5.191   1.560   1.00 18.21 ? 7   DG  P N2    1 
ATOM   3718 N  N3    . DG  C 3 7   ? -56.080 6.669   -0.107  1.00 18.56 ? 7   DG  P N3    1 
ATOM   3719 C  C4    . DG  C 3 7   ? -57.059 6.948   -0.993  1.00 20.66 ? 7   DG  P C4    1 
ATOM   3720 P  P     . DA  C 3 8   ? -52.639 9.573   -4.717  1.00 23.74 ? 8   DA  P P     1 
ATOM   3721 O  OP1   . DA  C 3 8   ? -51.348 10.273  -4.847  1.00 22.41 ? 8   DA  P OP1   1 
ATOM   3722 O  OP2   . DA  C 3 8   ? -53.412 9.256   -5.953  1.00 22.12 ? 8   DA  P OP2   1 
ATOM   3723 O  "O5'" . DA  C 3 8   ? -52.412 8.210   -3.924  1.00 24.62 ? 8   DA  P "O5'" 1 
ATOM   3724 C  "C5'" . DA  C 3 8   ? -51.818 8.246   -2.615  1.00 25.84 ? 8   DA  P "C5'" 1 
ATOM   3725 C  "C4'" . DA  C 3 8   ? -51.558 6.845   -2.112  1.00 27.24 ? 8   DA  P "C4'" 1 
ATOM   3726 O  "O4'" . DA  C 3 8   ? -52.810 6.283   -1.664  1.00 27.15 ? 8   DA  P "O4'" 1 
ATOM   3727 C  "C3'" . DA  C 3 8   ? -51.032 5.866   -3.161  1.00 27.47 ? 8   DA  P "C3'" 1 
ATOM   3728 O  "O3'" . DA  C 3 8   ? -49.615 6.071   -3.437  1.00 29.95 ? 8   DA  P "O3'" 1 
ATOM   3729 C  "C2'" . DA  C 3 8   ? -51.568 4.527   -2.683  1.00 27.16 ? 8   DA  P "C2'" 1 
ATOM   3730 C  "C1'" . DA  C 3 8   ? -52.832 4.885   -1.889  1.00 26.39 ? 8   DA  P "C1'" 1 
ATOM   3731 N  N9    . DA  C 3 8   ? -54.145 4.551   -2.457  1.00 26.53 ? 8   DA  P N9    1 
ATOM   3732 C  C8    . DA  C 3 8   ? -54.843 5.163   -3.469  1.00 23.72 ? 8   DA  P C8    1 
ATOM   3733 N  N7    . DA  C 3 8   ? -56.035 4.653   -3.673  1.00 24.57 ? 8   DA  P N7    1 
ATOM   3734 C  C5    . DA  C 3 8   ? -56.137 3.651   -2.717  1.00 25.00 ? 8   DA  P C5    1 
ATOM   3735 C  C6    . DA  C 3 8   ? -57.152 2.727   -2.419  1.00 24.42 ? 8   DA  P C6    1 
ATOM   3736 N  N6    . DA  C 3 8   ? -58.315 2.671   -3.067  1.00 25.37 ? 8   DA  P N6    1 
ATOM   3737 N  N1    . DA  C 3 8   ? -56.931 1.853   -1.413  1.00 23.63 ? 8   DA  P N1    1 
ATOM   3738 C  C2    . DA  C 3 8   ? -55.768 1.919   -0.751  1.00 24.62 ? 8   DA  P C2    1 
ATOM   3739 N  N3    . DA  C 3 8   ? -54.734 2.736   -0.945  1.00 24.36 ? 8   DA  P N3    1 
ATOM   3740 C  C4    . DA  C 3 8   ? -54.985 3.584   -1.955  1.00 24.71 ? 8   DA  P C4    1 
ATOM   3741 P  P     . DG  C 3 9   ? -48.389 5.334   -2.645  1.00 24.50 ? 9   DG  P P     1 
ATOM   3742 O  OP1   . DG  C 3 9   ? -48.355 5.780   -1.239  1.00 22.62 ? 9   DG  P OP1   1 
ATOM   3743 O  OP2   . DG  C 3 9   ? -47.183 5.546   -3.468  1.00 28.02 ? 9   DG  P OP2   1 
ATOM   3744 O  "O5'" . DG  C 3 9   ? -48.764 3.780   -2.634  1.00 24.57 ? 9   DG  P "O5'" 1 
ATOM   3745 C  "C5'" . DG  C 3 9   ? -48.811 3.024   -1.397  1.00 19.95 ? 9   DG  P "C5'" 1 
ATOM   3746 C  "C4'" . DG  C 3 9   ? -49.250 1.588   -1.605  1.00 18.99 ? 9   DG  P "C4'" 1 
ATOM   3747 O  "O4'" . DG  C 3 9   ? -50.674 1.507   -1.813  1.00 18.51 ? 9   DG  P "O4'" 1 
ATOM   3748 C  "C3'" . DG  C 3 9   ? -48.611 0.824   -2.771  1.00 18.87 ? 9   DG  P "C3'" 1 
ATOM   3749 O  "O3'" . DG  C 3 9   ? -47.787 -0.260  -2.291  1.00 18.37 ? 9   DG  P "O3'" 1 
ATOM   3750 C  "C2'" . DG  C 3 9   ? -49.794 0.256   -3.548  1.00 18.65 ? 9   DG  P "C2'" 1 
ATOM   3751 C  "C1'" . DG  C 3 9   ? -50.936 0.331   -2.547  1.00 18.60 ? 9   DG  P "C1'" 1 
ATOM   3752 N  N9    . DG  C 3 9   ? -52.268 0.449   -3.138  1.00 18.71 ? 9   DG  P N9    1 
ATOM   3753 C  C8    . DG  C 3 9   ? -52.705 1.438   -3.986  1.00 17.50 ? 9   DG  P C8    1 
ATOM   3754 N  N7    . DG  C 3 9   ? -53.945 1.279   -4.360  1.00 17.03 ? 9   DG  P N7    1 
ATOM   3755 C  C5    . DG  C 3 9   ? -54.352 0.114   -3.726  1.00 18.25 ? 9   DG  P C5    1 
ATOM   3756 C  C6    . DG  C 3 9   ? -55.589 -0.585  -3.788  1.00 17.97 ? 9   DG  P C6    1 
ATOM   3757 O  O6    . DG  C 3 9   ? -56.616 -0.278  -4.391  1.00 20.23 ? 9   DG  P O6    1 
ATOM   3758 N  N1    . DG  C 3 9   ? -55.567 -1.734  -3.010  1.00 18.52 ? 9   DG  P N1    1 
ATOM   3759 C  C2    . DG  C 3 9   ? -54.494 -2.166  -2.276  1.00 17.57 ? 9   DG  P C2    1 
ATOM   3760 N  N2    . DG  C 3 9   ? -54.674 -3.305  -1.592  1.00 16.95 ? 9   DG  P N2    1 
ATOM   3761 N  N3    . DG  C 3 9   ? -53.329 -1.539  -2.228  1.00 16.67 ? 9   DG  P N3    1 
ATOM   3762 C  C4    . DG  C 3 9   ? -53.326 -0.421  -2.981  1.00 17.42 ? 9   DG  P C4    1 
HETATM 3763 P  PG    . 0KX D 4 .   ? -42.914 -2.651  -7.225  1.00 12.93 ? 501 0KX A PG    1 
HETATM 3764 O  O1G   . 0KX D 4 .   ? -43.232 -1.899  -5.952  1.00 10.93 ? 501 0KX A O1G   1 
HETATM 3765 O  O2G   . 0KX D 4 .   ? -43.429 -1.968  -8.408  1.00 11.79 ? 501 0KX A O2G   1 
HETATM 3766 O  O3G   . 0KX D 4 .   ? -41.764 -3.603  -7.464  1.00 12.27 ? 501 0KX A O3G   1 
HETATM 3767 P  PB    . 0KX D 4 .   ? -45.239 -4.166  -6.229  1.00 13.01 ? 501 0KX A PB    1 
HETATM 3768 O  O1B   . 0KX D 4 .   ? -44.515 -4.387  -4.900  1.00 11.33 ? 501 0KX A O1B   1 
HETATM 3769 O  O2B   . 0KX D 4 .   ? -45.990 -5.418  -6.763  1.00 12.72 ? 501 0KX A O2B   1 
HETATM 3770 O  O3B   . 0KX D 4 .   ? -44.118 -3.813  -7.330  1.00 11.17 ? 501 0KX A O3B   1 
HETATM 3771 P  PA    . 0KX D 4 .   ? -46.702 -2.008  -4.882  1.00 13.61 ? 501 0KX A PA    1 
HETATM 3772 O  O1A   . 0KX D 4 .   ? -47.559 -0.796  -5.317  1.00 11.89 ? 501 0KX A O1A   1 
HETATM 3773 O  O2A   . 0KX D 4 .   ? -45.464 -1.804  -4.015  1.00 14.30 ? 501 0KX A O2A   1 
HETATM 3774 N  N3A   . 0KX D 4 .   ? -46.333 -2.865  -6.226  1.00 12.23 ? 501 0KX A N3A   1 
HETATM 3775 O  "O5'" . 0KX D 4 .   ? -47.748 -2.899  -4.012  1.00 12.68 ? 501 0KX A "O5'" 1 
HETATM 3776 C  "C5'" . 0KX D 4 .   ? -47.354 -3.900  -3.092  1.00 12.54 ? 501 0KX A "C5'" 1 
HETATM 3777 C  "C4'" . 0KX D 4 .   ? -48.343 -5.081  -3.219  1.00 11.90 ? 501 0KX A "C4'" 1 
HETATM 3778 O  "O4'" . 0KX D 4 .   ? -49.647 -4.550  -2.927  1.00 11.62 ? 501 0KX A "O4'" 1 
HETATM 3779 C  "C3'" . 0KX D 4 .   ? -48.419 -5.638  -4.658  1.00 11.41 ? 501 0KX A "C3'" 1 
HETATM 3780 O  "O3'" . 0KX D 4 .   ? -47.451 -6.699  -4.874  1.00 10.83 ? 501 0KX A "O3'" 1 
HETATM 3781 C  "C2'" . 0KX D 4 .   ? -49.834 -6.209  -4.642  1.00 12.29 ? 501 0KX A "C2'" 1 
HETATM 3782 C  "C1'" . 0KX D 4 .   ? -50.600 -5.342  -3.698  1.00 12.07 ? 501 0KX A "C1'" 1 
HETATM 3783 N  N1    . 0KX D 4 .   ? -51.402 -4.387  -4.450  1.00 14.70 ? 501 0KX A N1    1 
HETATM 3784 C  C2    . 0KX D 4 .   ? -52.680 -4.680  -4.713  1.00 15.15 ? 501 0KX A C2    1 
HETATM 3785 N  N3    . 0KX D 4 .   ? -53.420 -3.703  -5.394  1.00 15.05 ? 501 0KX A N3    1 
HETATM 3786 C  C4    . 0KX D 4 .   ? -52.956 -2.523  -5.845  1.00 14.85 ? 501 0KX A C4    1 
HETATM 3787 C  C5    . 0KX D 4 .   ? -51.595 -2.241  -5.631  1.00 15.15 ? 501 0KX A C5    1 
HETATM 3788 C  C6    . 0KX D 4 .   ? -50.879 -3.178  -4.903  1.00 14.44 ? 501 0KX A C6    1 
HETATM 3789 O  O2    . 0KX D 4 .   ? -53.187 -5.748  -4.365  1.00 13.51 ? 501 0KX A O2    1 
HETATM 3790 N  N4    . 0KX D 4 .   ? -53.754 -1.752  -6.535  1.00 13.61 ? 501 0KX A N4    1 
HETATM 3791 MG MG    . MG  E 5 .   ? -43.596 -2.741  -4.022  1.00 10.11 ? 502 MG  A MG    1 
HETATM 3792 MG MG    . MG  F 5 .   ? -45.590 -0.424  -2.219  1.00 12.39 ? 503 MG  A MG    1 
HETATM 3793 C  C1    . GOL G 6 .   ? -38.348 24.637  -12.307 1.00 20.32 ? 504 GOL A C1    1 
HETATM 3794 O  O1    . GOL G 6 .   ? -39.771 24.843  -12.440 1.00 16.99 ? 504 GOL A O1    1 
HETATM 3795 C  C2    . GOL G 6 .   ? -38.195 24.202  -10.811 1.00 20.89 ? 504 GOL A C2    1 
HETATM 3796 O  O2    . GOL G 6 .   ? -37.882 22.796  -10.777 1.00 18.19 ? 504 GOL A O2    1 
HETATM 3797 C  C3    . GOL G 6 .   ? -37.301 25.144  -10.030 1.00 20.23 ? 504 GOL A C3    1 
HETATM 3798 O  O3    . GOL G 6 .   ? -37.119 24.922  -8.636  1.00 17.87 ? 504 GOL A O3    1 
HETATM 3799 C  C1    . GOL H 6 .   ? -35.849 -13.765 -5.858  1.00 61.44 ? 505 GOL A C1    1 
HETATM 3800 O  O1    . GOL H 6 .   ? -35.964 -12.398 -5.398  1.00 57.87 ? 505 GOL A O1    1 
HETATM 3801 C  C2    . GOL H 6 .   ? -36.930 -14.703 -5.264  1.00 54.70 ? 505 GOL A C2    1 
HETATM 3802 O  O2    . GOL H 6 .   ? -37.836 -13.948 -4.427  1.00 52.35 ? 505 GOL A O2    1 
HETATM 3803 C  C3    . GOL H 6 .   ? -36.305 -15.876 -4.474  1.00 50.17 ? 505 GOL A C3    1 
HETATM 3804 O  O3    . GOL H 6 .   ? -36.311 -15.683 -3.039  1.00 43.36 ? 505 GOL A O3    1 
HETATM 3805 C  C1    . GOL I 6 .   ? -43.828 -28.510 -5.469  1.00 52.90 ? 506 GOL A C1    1 
HETATM 3806 O  O1    . GOL I 6 .   ? -44.980 -28.314 -4.656  1.00 54.05 ? 506 GOL A O1    1 
HETATM 3807 C  C2    . GOL I 6 .   ? -43.420 -27.171 -6.088  1.00 52.08 ? 506 GOL A C2    1 
HETATM 3808 O  O2    . GOL I 6 .   ? -44.256 -26.099 -5.625  1.00 53.17 ? 506 GOL A O2    1 
HETATM 3809 C  C3    . GOL I 6 .   ? -41.980 -26.814 -5.748  1.00 49.62 ? 506 GOL A C3    1 
HETATM 3810 O  O3    . GOL I 6 .   ? -41.364 -26.080 -6.820  1.00 42.05 ? 506 GOL A O3    1 
HETATM 3811 PT PT    . 9RD J 7 .   ? -59.447 -1.724  -8.667  1.00 26.26 ? 101 9RD T PT    1 
HETATM 3812 N  N1    . 9RD J 7 .   ? -59.633 -0.016  -9.330  1.00 35.63 ? 101 9RD T N1    1 
HETATM 3813 N  N2    . 9RD J 7 .   ? -58.830 -0.792  -7.059  1.00 35.86 ? 101 9RD T N2    1 
HETATM 3814 C  C1    . 9RD J 7 .   ? -58.977 1.157   -8.735  1.00 38.03 ? 101 9RD T C1    1 
HETATM 3815 C  C2    . 9RD J 7 .   ? -58.428 0.692   -7.403  1.00 38.56 ? 101 9RD T C2    1 
HETATM 3816 C  C3    . 9RD J 7 .   ? -57.930 1.571   -6.403  1.00 42.51 ? 101 9RD T C3    1 
HETATM 3817 C  C4    . 9RD J 7 .   ? -57.509 2.917   -6.945  1.00 41.18 ? 101 9RD T C4    1 
HETATM 3818 C  C5    . 9RD J 7 .   ? -58.374 3.459   -8.077  1.00 40.45 ? 101 9RD T C5    1 
HETATM 3819 C  C6    . 9RD J 7 .   ? -58.748 2.419   -9.140  1.00 40.81 ? 101 9RD T C6    1 
HETATM 3820 O  O     . HOH K 8 .   ? -48.347 13.764  2.039   1.00 50.65 ? 601 HOH A O     1 
HETATM 3821 O  O     . HOH K 8 .   ? -29.015 -10.173 8.433   1.00 24.99 ? 602 HOH A O     1 
HETATM 3822 O  O     . HOH K 8 .   ? -31.280 6.355   -12.757 1.00 24.48 ? 603 HOH A O     1 
HETATM 3823 O  O     . HOH K 8 .   ? -32.788 -5.784  -2.447  1.00 21.88 ? 604 HOH A O     1 
HETATM 3824 O  O     . HOH K 8 .   ? -42.089 13.974  5.575   1.00 11.66 ? 605 HOH A O     1 
HETATM 3825 O  O     . HOH K 8 .   ? -39.297 -11.317 -8.654  1.00 19.33 ? 606 HOH A O     1 
HETATM 3826 O  O     . HOH K 8 .   ? -56.904 30.477  6.012   1.00 18.43 ? 607 HOH A O     1 
HETATM 3827 O  O     . HOH K 8 .   ? -37.758 23.313  -6.795  1.00 14.38 ? 608 HOH A O     1 
HETATM 3828 O  O     . HOH K 8 .   ? -42.937 -17.318 0.384   1.00 11.98 ? 609 HOH A O     1 
HETATM 3829 O  O     . HOH K 8 .   ? -27.073 -5.920  6.999   1.00 10.83 ? 610 HOH A O     1 
HETATM 3830 O  O     . HOH K 8 .   ? -33.513 11.376  -13.364 1.00 28.98 ? 611 HOH A O     1 
HETATM 3831 O  O     . HOH K 8 .   ? -42.367 2.757   -3.976  1.00 25.01 ? 612 HOH A O     1 
HETATM 3832 O  O     . HOH K 8 .   ? -38.578 -11.393 9.887   1.00 21.24 ? 613 HOH A O     1 
HETATM 3833 O  O     . HOH K 8 .   ? -44.476 -15.544 6.487   1.00 15.79 ? 614 HOH A O     1 
HETATM 3834 O  O     . HOH K 8 .   ? -31.141 8.200   -10.180 1.00 16.04 ? 615 HOH A O     1 
HETATM 3835 O  O     . HOH K 8 .   ? -54.938 -12.072 7.014   1.00 21.80 ? 616 HOH A O     1 
HETATM 3836 O  O     . HOH K 8 .   ? -40.652 23.277  -14.302 1.00 10.76 ? 617 HOH A O     1 
HETATM 3837 O  O     . HOH K 8 .   ? -39.960 12.093  11.117  1.00 9.25  ? 618 HOH A O     1 
HETATM 3838 O  O     . HOH K 8 .   ? -44.428 9.415   -5.516  1.00 14.76 ? 619 HOH A O     1 
HETATM 3839 O  O     . HOH K 8 .   ? -43.749 0.623   -5.545  1.00 15.24 ? 620 HOH A O     1 
HETATM 3840 O  O     . HOH K 8 .   ? -35.508 26.496  -7.314  1.00 13.32 ? 621 HOH A O     1 
HETATM 3841 O  O     . HOH K 8 .   ? -58.244 -9.382  -27.011 1.00 20.67 ? 622 HOH A O     1 
HETATM 3842 O  O     . HOH K 8 .   ? -35.222 18.930  1.092   1.00 13.60 ? 623 HOH A O     1 
HETATM 3843 O  O     . HOH K 8 .   ? -44.876 -13.550 9.644   1.00 16.25 ? 624 HOH A O     1 
HETATM 3844 O  O     . HOH K 8 .   ? -47.200 -5.651  7.973   1.00 29.21 ? 625 HOH A O     1 
HETATM 3845 O  O     . HOH K 8 .   ? -45.168 28.045  -15.473 1.00 26.53 ? 626 HOH A O     1 
HETATM 3846 O  O     . HOH K 8 .   ? -48.266 34.912  0.289   1.00 21.77 ? 627 HOH A O     1 
HETATM 3847 O  O     . HOH K 8 .   ? -27.875 19.002  -1.387  1.00 17.05 ? 628 HOH A O     1 
HETATM 3848 O  O     . HOH K 8 .   ? -63.452 -5.372  -1.915  1.00 18.91 ? 629 HOH A O     1 
HETATM 3849 O  O     . HOH K 8 .   ? -46.669 -5.806  -9.294  1.00 11.95 ? 630 HOH A O     1 
HETATM 3850 O  O     . HOH K 8 .   ? -55.923 1.404   24.883  1.00 28.69 ? 631 HOH A O     1 
HETATM 3851 O  O     . HOH K 8 .   ? -55.133 33.228  0.164   1.00 21.92 ? 632 HOH A O     1 
HETATM 3852 O  O     . HOH K 8 .   ? -54.783 14.254  -5.795  1.00 10.51 ? 633 HOH A O     1 
HETATM 3853 O  O     . HOH K 8 .   ? -34.421 3.319   -6.248  1.00 11.10 ? 634 HOH A O     1 
HETATM 3854 O  O     . HOH K 8 .   ? -23.100 -0.626  3.457   1.00 28.87 ? 635 HOH A O     1 
HETATM 3855 O  O     . HOH K 8 .   ? -50.615 26.416  6.787   1.00 32.55 ? 636 HOH A O     1 
HETATM 3856 O  O     . HOH K 8 .   ? -46.104 -20.181 -5.102  1.00 17.38 ? 637 HOH A O     1 
HETATM 3857 O  O     . HOH K 8 .   ? -31.171 20.518  -8.987  1.00 10.79 ? 638 HOH A O     1 
HETATM 3858 O  O     . HOH K 8 .   ? -35.137 17.085  -15.585 1.00 24.88 ? 639 HOH A O     1 
HETATM 3859 O  O     . HOH K 8 .   ? -44.639 28.356  -4.561  1.00 13.76 ? 640 HOH A O     1 
HETATM 3860 O  O     . HOH K 8 .   ? -49.307 -2.594  -21.425 1.00 21.37 ? 641 HOH A O     1 
HETATM 3861 O  O     . HOH K 8 .   ? -45.981 5.311   0.807   1.00 28.62 ? 642 HOH A O     1 
HETATM 3862 O  O     . HOH K 8 .   ? -40.793 7.263   -8.254  1.00 21.15 ? 643 HOH A O     1 
HETATM 3863 O  O     . HOH K 8 .   ? -29.678 -16.211 3.829   1.00 14.80 ? 644 HOH A O     1 
HETATM 3864 O  O     . HOH K 8 .   ? -38.569 -13.066 -11.454 1.00 26.66 ? 645 HOH A O     1 
HETATM 3865 O  O     . HOH K 8 .   ? -27.317 -3.482  0.286   1.00 21.18 ? 646 HOH A O     1 
HETATM 3866 O  O     . HOH K 8 .   ? -31.389 16.464  -9.853  1.00 13.44 ? 647 HOH A O     1 
HETATM 3867 O  O     . HOH K 8 .   ? -48.412 17.023  -15.630 1.00 18.25 ? 648 HOH A O     1 
HETATM 3868 O  O     . HOH K 8 .   ? -33.110 -12.778 -3.345  1.00 26.66 ? 649 HOH A O     1 
HETATM 3869 O  O     . HOH K 8 .   ? -50.218 36.735  -3.010  1.00 19.31 ? 650 HOH A O     1 
HETATM 3870 O  O     . HOH K 8 .   ? -35.978 -7.317  -7.257  1.00 14.72 ? 651 HOH A O     1 
HETATM 3871 O  O     . HOH K 8 .   ? -50.077 22.097  5.317   1.00 21.38 ? 652 HOH A O     1 
HETATM 3872 O  O     . HOH K 8 .   ? -57.299 -6.958  -19.192 1.00 17.41 ? 653 HOH A O     1 
HETATM 3873 O  O     . HOH K 8 .   ? -25.285 7.329   -9.174  1.00 13.82 ? 654 HOH A O     1 
HETATM 3874 O  O     . HOH K 8 .   ? -29.316 13.374  -5.232  1.00 7.21  ? 655 HOH A O     1 
HETATM 3875 O  O     . HOH K 8 .   ? -36.434 12.970  13.312  1.00 26.38 ? 656 HOH A O     1 
HETATM 3876 O  O     . HOH K 8 .   ? -32.982 25.709  -0.726  1.00 24.50 ? 657 HOH A O     1 
HETATM 3877 O  O     . HOH K 8 .   ? -29.435 17.496  1.040   1.00 14.62 ? 658 HOH A O     1 
HETATM 3878 O  O     . HOH K 8 .   ? -32.835 6.782   13.622  1.00 18.38 ? 659 HOH A O     1 
HETATM 3879 O  O     . HOH K 8 .   ? -34.421 9.450   14.128  1.00 20.81 ? 660 HOH A O     1 
HETATM 3880 O  O     . HOH K 8 .   ? -44.826 20.470  2.136   1.00 15.72 ? 661 HOH A O     1 
HETATM 3881 O  O     . HOH K 8 .   ? -52.916 -15.999 1.590   1.00 15.69 ? 662 HOH A O     1 
HETATM 3882 O  O     . HOH K 8 .   ? -53.569 14.008  -10.547 1.00 21.34 ? 663 HOH A O     1 
HETATM 3883 O  O     . HOH K 8 .   ? -27.625 -16.007 5.887   1.00 16.69 ? 664 HOH A O     1 
HETATM 3884 O  O     . HOH K 8 .   ? -35.923 -14.984 8.935   1.00 9.29  ? 665 HOH A O     1 
HETATM 3885 O  O     . HOH K 8 .   ? -54.101 -7.181  -2.142  1.00 25.64 ? 666 HOH A O     1 
HETATM 3886 O  O     . HOH K 8 .   ? -32.927 22.785  -3.471  1.00 13.45 ? 667 HOH A O     1 
HETATM 3887 O  O     . HOH K 8 .   ? -32.848 15.099  -11.719 1.00 12.84 ? 668 HOH A O     1 
HETATM 3888 O  O     . HOH K 8 .   ? -38.893 31.109  -3.448  1.00 28.39 ? 669 HOH A O     1 
HETATM 3889 O  O     . HOH K 8 .   ? -14.572 5.003   -2.681  1.00 26.12 ? 670 HOH A O     1 
HETATM 3890 O  O     . HOH K 8 .   ? -28.763 8.943   -10.941 1.00 28.38 ? 671 HOH A O     1 
HETATM 3891 O  O     . HOH K 8 .   ? -52.446 -18.958 2.885   1.00 30.25 ? 672 HOH A O     1 
HETATM 3892 O  O     . HOH K 8 .   ? -54.358 15.105  -1.401  1.00 21.74 ? 673 HOH A O     1 
HETATM 3893 O  O     . HOH K 8 .   ? -45.701 1.083   -3.909  1.00 14.95 ? 674 HOH A O     1 
HETATM 3894 O  O     . HOH K 8 .   ? -37.900 17.371  6.960   1.00 21.93 ? 675 HOH A O     1 
HETATM 3895 O  O     . HOH K 8 .   ? -20.441 1.054   -5.392  1.00 15.74 ? 676 HOH A O     1 
HETATM 3896 O  O     . HOH K 8 .   ? -69.464 -8.302  18.881  1.00 22.98 ? 677 HOH A O     1 
HETATM 3897 O  O     . HOH K 8 .   ? -48.819 3.072   16.806  1.00 22.34 ? 678 HOH A O     1 
HETATM 3898 O  O     . HOH K 8 .   ? -44.387 -17.422 2.713   1.00 22.57 ? 679 HOH A O     1 
HETATM 3899 O  O     . HOH K 8 .   ? -29.708 11.358  -12.687 1.00 32.52 ? 680 HOH A O     1 
HETATM 3900 O  O     . HOH K 8 .   ? -52.235 -16.655 -1.319  1.00 14.04 ? 681 HOH A O     1 
HETATM 3901 O  O     . HOH K 8 .   ? -21.902 17.682  -1.219  1.00 31.87 ? 682 HOH A O     1 
HETATM 3902 O  O     . HOH K 8 .   ? -51.210 -2.351  1.299   1.00 17.93 ? 683 HOH A O     1 
HETATM 3903 O  O     . HOH K 8 .   ? -43.942 11.205  -3.574  1.00 14.89 ? 684 HOH A O     1 
HETATM 3904 O  O     . HOH K 8 .   ? -38.193 18.376  4.301   1.00 9.54  ? 685 HOH A O     1 
HETATM 3905 O  O     . HOH K 8 .   ? -39.107 -9.618  -11.037 1.00 12.22 ? 686 HOH A O     1 
HETATM 3906 O  O     . HOH K 8 .   ? -56.465 22.843  2.345   1.00 17.35 ? 687 HOH A O     1 
HETATM 3907 O  O     . HOH K 8 .   ? -25.312 19.552  2.468   1.00 28.64 ? 688 HOH A O     1 
HETATM 3908 O  O     . HOH K 8 .   ? -57.267 -23.802 -8.864  1.00 23.67 ? 689 HOH A O     1 
HETATM 3909 O  O     . HOH K 8 .   ? -47.152 -21.724 -6.964  1.00 16.40 ? 690 HOH A O     1 
HETATM 3910 O  O     . HOH K 8 .   ? -37.473 -14.455 -8.665  1.00 31.79 ? 691 HOH A O     1 
HETATM 3911 O  O     . HOH K 8 .   ? -45.028 33.499  -0.300  1.00 21.95 ? 692 HOH A O     1 
HETATM 3912 O  O     . HOH K 8 .   ? -29.156 -4.658  -4.097  1.00 22.49 ? 693 HOH A O     1 
HETATM 3913 O  O     . HOH K 8 .   ? -51.419 16.794  0.951   1.00 32.27 ? 694 HOH A O     1 
HETATM 3914 O  O     . HOH K 8 .   ? -47.283 -3.484  -10.842 1.00 20.93 ? 695 HOH A O     1 
HETATM 3915 O  O     . HOH K 8 .   ? -70.363 -6.866  26.893  1.00 35.38 ? 696 HOH A O     1 
HETATM 3916 O  O     . HOH L 8 .   ? -57.565 20.038  3.101   1.00 36.20 ? 201 HOH T O     1 
HETATM 3917 O  O     . HOH L 8 .   ? -59.010 -6.818  -13.937 1.00 30.00 ? 202 HOH T O     1 
HETATM 3918 O  O     . HOH L 8 .   ? -62.253 1.133   -2.310  1.00 23.79 ? 203 HOH T O     1 
HETATM 3919 O  O     . HOH L 8 .   ? -57.784 -11.349 3.398   1.00 17.19 ? 204 HOH T O     1 
HETATM 3920 O  O     . HOH L 8 .   ? -56.651 -8.271  -3.209  1.00 18.23 ? 205 HOH T O     1 
HETATM 3921 O  O     . HOH L 8 .   ? -60.131 10.056  9.556   1.00 56.56 ? 206 HOH T O     1 
HETATM 3922 O  O     . HOH L 8 .   ? -63.326 -3.088  -8.265  1.00 27.11 ? 207 HOH T O     1 
HETATM 3923 O  O     . HOH L 8 .   ? -60.123 2.624   6.070   1.00 26.10 ? 208 HOH T O     1 
HETATM 3924 O  O     . HOH L 8 .   ? -57.956 3.892   9.154   1.00 29.41 ? 209 HOH T O     1 
HETATM 3925 O  O     . HOH L 8 .   ? -54.324 8.798   3.984   1.00 29.76 ? 210 HOH T O     1 
HETATM 3926 O  O     . HOH L 8 .   ? -61.533 -0.465  -5.257  1.00 22.27 ? 211 HOH T O     1 
HETATM 3927 O  O     . HOH L 8 .   ? -67.956 -3.839  -8.776  1.00 39.80 ? 212 HOH T O     1 
HETATM 3928 O  O     . HOH L 8 .   ? -60.715 13.014  11.431  1.00 39.88 ? 213 HOH T O     1 
HETATM 3929 O  O     . HOH L 8 .   ? -61.697 2.703   4.051   1.00 38.52 ? 214 HOH T O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -6  ?   ?   ?   A . n 
A 1 2   ALA 2   -5  ?   ?   ?   A . n 
A 1 3   HIS 3   -4  ?   ?   ?   A . n 
A 1 4   HIS 4   -3  ?   ?   ?   A . n 
A 1 5   HIS 5   -2  ?   ?   ?   A . n 
A 1 6   HIS 6   -1  ?   ?   ?   A . n 
A 1 7   HIS 7   0   ?   ?   ?   A . n 
A 1 8   HIS 8   1   ?   ?   ?   A . n 
A 1 9   GLY 9   2   2   GLY GLY A . n 
A 1 10  THR 10  3   3   THR THR A . n 
A 1 11  GLY 11  4   4   GLY GLY A . n 
A 1 12  GLN 12  5   5   GLN GLN A . n 
A 1 13  ASP 13  6   6   ASP ASP A . n 
A 1 14  ARG 14  7   7   ARG ARG A . n 
A 1 15  VAL 15  8   8   VAL VAL A . n 
A 1 16  VAL 16  9   9   VAL VAL A . n 
A 1 17  ALA 17  10  10  ALA ALA A . n 
A 1 18  LEU 18  11  11  LEU LEU A . n 
A 1 19  VAL 19  12  12  VAL VAL A . n 
A 1 20  ASP 20  13  13  ASP ASP A . n 
A 1 21  MET 21  14  14  MET MET A . n 
A 1 22  ASP 22  15  15  ASP ASP A . n 
A 1 23  CYS 23  16  16  CYS CYS A . n 
A 1 24  PHE 24  17  17  PHE PHE A . n 
A 1 25  PHE 25  18  18  PHE PHE A . n 
A 1 26  VAL 26  19  19  VAL VAL A . n 
A 1 27  GLN 27  20  20  GLN GLN A . n 
A 1 28  VAL 28  21  21  VAL VAL A . n 
A 1 29  GLU 29  22  22  GLU GLU A . n 
A 1 30  GLN 30  23  23  GLN GLN A . n 
A 1 31  ARG 31  24  24  ARG ARG A . n 
A 1 32  GLN 32  25  25  GLN GLN A . n 
A 1 33  ASN 33  26  26  ASN ASN A . n 
A 1 34  PRO 34  27  27  PRO PRO A . n 
A 1 35  HIS 35  28  28  HIS HIS A . n 
A 1 36  LEU 36  29  29  LEU LEU A . n 
A 1 37  ARG 37  30  30  ARG ARG A . n 
A 1 38  ASN 38  31  31  ASN ASN A . n 
A 1 39  LYS 39  32  32  LYS LYS A . n 
A 1 40  PRO 40  33  33  PRO PRO A . n 
A 1 41  CYS 41  34  34  CYS CYS A . n 
A 1 42  ALA 42  35  35  ALA ALA A . n 
A 1 43  VAL 43  36  36  VAL VAL A . n 
A 1 44  VAL 44  37  37  VAL VAL A . n 
A 1 45  GLN 45  38  38  GLN GLN A . n 
A 1 46  TYR 46  39  39  TYR TYR A . n 
A 1 47  LYS 47  40  40  LYS LYS A . n 
A 1 48  SER 48  41  41  SER SER A . n 
A 1 49  TRP 49  42  42  TRP TRP A . n 
A 1 50  LYS 50  43  43  LYS LYS A . n 
A 1 51  GLY 51  44  44  GLY GLY A . n 
A 1 52  GLY 52  45  45  GLY GLY A . n 
A 1 53  GLY 53  46  46  GLY GLY A . n 
A 1 54  ILE 54  47  47  ILE ILE A . n 
A 1 55  ILE 55  48  48  ILE ILE A . n 
A 1 56  ALA 56  49  49  ALA ALA A . n 
A 1 57  VAL 57  50  50  VAL VAL A . n 
A 1 58  SER 58  51  51  SER SER A . n 
A 1 59  TYR 59  52  52  TYR TYR A . n 
A 1 60  GLU 60  53  53  GLU GLU A . n 
A 1 61  ALA 61  54  54  ALA ALA A . n 
A 1 62  ARG 62  55  55  ARG ARG A . n 
A 1 63  ALA 63  56  56  ALA ALA A . n 
A 1 64  PHE 64  57  57  PHE PHE A . n 
A 1 65  GLY 65  58  58  GLY GLY A . n 
A 1 66  VAL 66  59  59  VAL VAL A . n 
A 1 67  THR 67  60  60  THR THR A . n 
A 1 68  ARG 68  61  61  ARG ARG A . n 
A 1 69  SER 69  62  62  SER SER A . n 
A 1 70  MET 70  63  63  MET MET A . n 
A 1 71  TRP 71  64  64  TRP TRP A . n 
A 1 72  ALA 72  65  65  ALA ALA A . n 
A 1 73  ASP 73  66  66  ASP ASP A . n 
A 1 74  ASP 74  67  67  ASP ASP A . n 
A 1 75  ALA 75  68  68  ALA ALA A . n 
A 1 76  LYS 76  69  69  LYS LYS A . n 
A 1 77  LYS 77  70  70  LYS LYS A . n 
A 1 78  LEU 78  71  71  LEU LEU A . n 
A 1 79  CYS 79  72  72  CYS CYS A . n 
A 1 80  PRO 80  73  73  PRO PRO A . n 
A 1 81  ASP 81  74  74  ASP ASP A . n 
A 1 82  LEU 82  75  75  LEU LEU A . n 
A 1 83  LEU 83  76  76  LEU LEU A . n 
A 1 84  LEU 84  77  77  LEU LEU A . n 
A 1 85  ALA 85  78  78  ALA ALA A . n 
A 1 86  GLN 86  79  79  GLN GLN A . n 
A 1 87  VAL 87  80  80  VAL VAL A . n 
A 1 88  ARG 88  81  81  ARG ARG A . n 
A 1 89  GLU 89  82  82  GLU GLU A . n 
A 1 90  SER 90  83  83  SER SER A . n 
A 1 91  ARG 91  84  84  ARG ARG A . n 
A 1 92  GLY 92  85  85  GLY GLY A . n 
A 1 93  LYS 93  86  86  LYS LYS A . n 
A 1 94  ALA 94  87  87  ALA ALA A . n 
A 1 95  ASN 95  88  88  ASN ASN A . n 
A 1 96  LEU 96  89  89  LEU LEU A . n 
A 1 97  THR 97  90  90  THR THR A . n 
A 1 98  LYS 98  91  91  LYS LYS A . n 
A 1 99  TYR 99  92  92  TYR TYR A . n 
A 1 100 ARG 100 93  93  ARG ARG A . n 
A 1 101 GLU 101 94  94  GLU GLU A . n 
A 1 102 ALA 102 95  95  ALA ALA A . n 
A 1 103 SER 103 96  96  SER SER A . n 
A 1 104 VAL 104 97  97  VAL VAL A . n 
A 1 105 GLU 105 98  98  GLU GLU A . n 
A 1 106 VAL 106 99  99  VAL VAL A . n 
A 1 107 MET 107 100 100 MET MET A . n 
A 1 108 GLU 108 101 101 GLU GLU A . n 
A 1 109 ILE 109 102 102 ILE ILE A . n 
A 1 110 MET 110 103 103 MET MET A . n 
A 1 111 SER 111 104 104 SER SER A . n 
A 1 112 ARG 112 105 105 ARG ARG A . n 
A 1 113 PHE 113 106 106 PHE PHE A . n 
A 1 114 ALA 114 107 107 ALA ALA A . n 
A 1 115 VAL 115 108 108 VAL VAL A . n 
A 1 116 ILE 116 109 109 ILE ILE A . n 
A 1 117 GLU 117 110 110 GLU GLU A . n 
A 1 118 ARG 118 111 111 ARG ARG A . n 
A 1 119 ALA 119 112 112 ALA ALA A . n 
A 1 120 SER 120 113 113 SER SER A . n 
A 1 121 ILE 121 114 114 ILE ILE A . n 
A 1 122 ASP 122 115 115 ASP ASP A . n 
A 1 123 GLU 123 116 116 GLU GLU A . n 
A 1 124 ALA 124 117 117 ALA ALA A . n 
A 1 125 TYR 125 118 118 TYR TYR A . n 
A 1 126 VAL 126 119 119 VAL VAL A . n 
A 1 127 ASP 127 120 120 ASP ASP A . n 
A 1 128 LEU 128 121 121 LEU LEU A . n 
A 1 129 THR 129 122 122 THR THR A . n 
A 1 130 SER 130 123 123 SER SER A . n 
A 1 131 ALA 131 124 124 ALA ALA A . n 
A 1 132 VAL 132 125 125 VAL VAL A . n 
A 1 133 GLN 133 126 126 GLN GLN A . n 
A 1 134 GLU 134 127 127 GLU GLU A . n 
A 1 135 ARG 135 128 128 ARG ARG A . n 
A 1 136 LEU 136 129 129 LEU LEU A . n 
A 1 137 GLN 137 130 130 GLN GLN A . n 
A 1 138 LYS 138 131 131 LYS LYS A . n 
A 1 139 LEU 139 132 132 LEU LEU A . n 
A 1 140 GLN 140 133 133 GLN GLN A . n 
A 1 141 GLY 141 134 134 GLY GLY A . n 
A 1 142 GLN 142 135 135 GLN GLN A . n 
A 1 143 PRO 143 136 136 PRO PRO A . n 
A 1 144 ILE 144 137 137 ILE ILE A . n 
A 1 145 SER 145 138 138 SER SER A . n 
A 1 146 ALA 146 139 139 ALA ALA A . n 
A 1 147 ASP 147 140 140 ASP ASP A . n 
A 1 148 LEU 148 141 141 LEU LEU A . n 
A 1 149 LEU 149 142 142 LEU LEU A . n 
A 1 150 PRO 150 143 143 PRO PRO A . n 
A 1 151 SER 151 144 144 SER SER A . n 
A 1 152 THR 152 145 145 THR THR A . n 
A 1 153 TYR 153 146 146 TYR TYR A . n 
A 1 154 ILE 154 147 147 ILE ILE A . n 
A 1 155 GLU 155 148 148 GLU GLU A . n 
A 1 156 GLY 156 149 149 GLY GLY A . n 
A 1 157 LEU 157 150 150 LEU LEU A . n 
A 1 158 PRO 158 151 151 PRO PRO A . n 
A 1 159 GLN 159 152 152 GLN GLN A . n 
A 1 160 GLY 160 153 153 GLY GLY A . n 
A 1 161 PRO 161 154 154 PRO PRO A . n 
A 1 162 THR 162 155 ?   ?   ?   A . n 
A 1 163 THR 163 156 ?   ?   ?   A . n 
A 1 164 ALA 164 157 ?   ?   ?   A . n 
A 1 165 GLU 165 158 158 GLU GLU A . n 
A 1 166 GLU 166 159 159 GLU GLU A . n 
A 1 167 THR 167 160 160 THR THR A . n 
A 1 168 VAL 168 161 161 VAL VAL A . n 
A 1 169 GLN 169 162 162 GLN GLN A . n 
A 1 170 LYS 170 163 163 LYS LYS A . n 
A 1 171 GLU 171 164 164 GLU GLU A . n 
A 1 172 GLY 172 165 165 GLY GLY A . n 
A 1 173 MET 173 166 166 MET MET A . n 
A 1 174 ARG 174 167 167 ARG ARG A . n 
A 1 175 LYS 175 168 168 LYS LYS A . n 
A 1 176 GLN 176 169 169 GLN GLN A . n 
A 1 177 GLY 177 170 170 GLY GLY A . n 
A 1 178 LEU 178 171 171 LEU LEU A . n 
A 1 179 PHE 179 172 172 PHE PHE A . n 
A 1 180 GLN 180 173 173 GLN GLN A . n 
A 1 181 TRP 181 174 174 TRP TRP A . n 
A 1 182 LEU 182 175 175 LEU LEU A . n 
A 1 183 ASP 183 176 176 ASP ASP A . n 
A 1 184 SER 184 177 177 SER SER A . n 
A 1 185 LEU 185 178 178 LEU LEU A . n 
A 1 186 GLN 186 179 179 GLN GLN A . n 
A 1 187 ILE 187 180 180 ILE ILE A . n 
A 1 188 ASP 188 181 181 ASP ASP A . n 
A 1 189 ASN 189 182 182 ASN ASN A . n 
A 1 190 LEU 190 183 183 LEU LEU A . n 
A 1 191 THR 191 184 184 THR THR A . n 
A 1 192 SER 192 185 185 SER SER A . n 
A 1 193 PRO 193 186 186 PRO PRO A . n 
A 1 194 ASP 194 187 187 ASP ASP A . n 
A 1 195 LEU 195 188 188 LEU LEU A . n 
A 1 196 GLN 196 189 189 GLN GLN A . n 
A 1 197 LEU 197 190 190 LEU LEU A . n 
A 1 198 THR 198 191 191 THR THR A . n 
A 1 199 VAL 199 192 192 VAL VAL A . n 
A 1 200 GLY 200 193 193 GLY GLY A . n 
A 1 201 ALA 201 194 194 ALA ALA A . n 
A 1 202 VAL 202 195 195 VAL VAL A . n 
A 1 203 ILE 203 196 196 ILE ILE A . n 
A 1 204 VAL 204 197 197 VAL VAL A . n 
A 1 205 GLU 205 198 198 GLU GLU A . n 
A 1 206 GLU 206 199 199 GLU GLU A . n 
A 1 207 MET 207 200 200 MET MET A . n 
A 1 208 ARG 208 201 201 ARG ARG A . n 
A 1 209 ALA 209 202 202 ALA ALA A . n 
A 1 210 ALA 210 203 203 ALA ALA A . n 
A 1 211 ILE 211 204 204 ILE ILE A . n 
A 1 212 GLU 212 205 205 GLU GLU A . n 
A 1 213 ARG 213 206 206 ARG ARG A . n 
A 1 214 GLU 214 207 207 GLU GLU A . n 
A 1 215 THR 215 208 208 THR THR A . n 
A 1 216 GLY 216 209 209 GLY GLY A . n 
A 1 217 PHE 217 210 210 PHE PHE A . n 
A 1 218 GLN 218 211 211 GLN GLN A . n 
A 1 219 CYS 219 212 212 CYS CYS A . n 
A 1 220 SER 220 213 213 SER SER A . n 
A 1 221 ALA 221 214 214 ALA ALA A . n 
A 1 222 GLY 222 215 215 GLY GLY A . n 
A 1 223 ILE 223 216 216 ILE ILE A . n 
A 1 224 SER 224 217 217 SER SER A . n 
A 1 225 HIS 225 218 218 HIS HIS A . n 
A 1 226 ASN 226 219 219 ASN ASN A . n 
A 1 227 LYS 227 220 220 LYS LYS A . n 
A 1 228 VAL 228 221 221 VAL VAL A . n 
A 1 229 LEU 229 222 222 LEU LEU A . n 
A 1 230 ALA 230 223 223 ALA ALA A . n 
A 1 231 LYS 231 224 224 LYS LYS A . n 
A 1 232 LEU 232 225 225 LEU LEU A . n 
A 1 233 ALA 233 226 226 ALA ALA A . n 
A 1 234 CYS 234 227 227 CYS CYS A . n 
A 1 235 GLY 235 228 228 GLY GLY A . n 
A 1 236 LEU 236 229 229 LEU LEU A . n 
A 1 237 ASN 237 230 230 ASN ASN A . n 
A 1 238 LYS 238 231 231 LYS LYS A . n 
A 1 239 PRO 239 232 232 PRO PRO A . n 
A 1 240 ASN 240 233 233 ASN ASN A . n 
A 1 241 ARG 241 234 234 ARG ARG A . n 
A 1 242 GLN 242 235 235 GLN GLN A . n 
A 1 243 THR 243 236 236 THR THR A . n 
A 1 244 LEU 244 237 237 LEU LEU A . n 
A 1 245 VAL 245 238 238 VAL VAL A . n 
A 1 246 SER 246 239 239 SER SER A . n 
A 1 247 HIS 247 240 240 HIS HIS A . n 
A 1 248 GLY 248 241 241 GLY GLY A . n 
A 1 249 SER 249 242 242 SER SER A . n 
A 1 250 VAL 250 243 243 VAL VAL A . n 
A 1 251 PRO 251 244 244 PRO PRO A . n 
A 1 252 GLN 252 245 245 GLN GLN A . n 
A 1 253 LEU 253 246 246 LEU LEU A . n 
A 1 254 PHE 254 247 247 PHE PHE A . n 
A 1 255 SER 255 248 248 SER SER A . n 
A 1 256 GLN 256 249 249 GLN GLN A . n 
A 1 257 MET 257 250 250 MET MET A . n 
A 1 258 PRO 258 251 251 PRO PRO A . n 
A 1 259 ILE 259 252 252 ILE ILE A . n 
A 1 260 ARG 260 253 253 ARG ARG A . n 
A 1 261 LYS 261 254 254 LYS LYS A . n 
A 1 262 ILE 262 255 255 ILE ILE A . n 
A 1 263 ARG 263 256 256 ARG ARG A . n 
A 1 264 SER 264 257 257 SER SER A . n 
A 1 265 LEU 265 258 258 LEU LEU A . n 
A 1 266 GLY 266 259 259 GLY GLY A . n 
A 1 267 GLY 267 260 260 GLY GLY A . n 
A 1 268 LYS 268 261 261 LYS LYS A . n 
A 1 269 LEU 269 262 262 LEU LEU A . n 
A 1 270 GLY 270 263 263 GLY GLY A . n 
A 1 271 ALA 271 264 264 ALA ALA A . n 
A 1 272 SER 272 265 265 SER SER A . n 
A 1 273 VAL 273 266 266 VAL VAL A . n 
A 1 274 ILE 274 267 267 ILE ILE A . n 
A 1 275 GLU 275 268 268 GLU GLU A . n 
A 1 276 ILE 276 269 269 ILE ILE A . n 
A 1 277 LEU 277 270 270 LEU LEU A . n 
A 1 278 GLY 278 271 271 GLY GLY A . n 
A 1 279 ILE 279 272 272 ILE ILE A . n 
A 1 280 GLU 280 273 273 GLU GLU A . n 
A 1 281 TYR 281 274 274 TYR TYR A . n 
A 1 282 MET 282 275 275 MET MET A . n 
A 1 283 GLY 283 276 276 GLY GLY A . n 
A 1 284 GLU 284 277 277 GLU GLU A . n 
A 1 285 LEU 285 278 278 LEU LEU A . n 
A 1 286 THR 286 279 279 THR THR A . n 
A 1 287 GLN 287 280 280 GLN GLN A . n 
A 1 288 PHE 288 281 281 PHE PHE A . n 
A 1 289 THR 289 282 282 THR THR A . n 
A 1 290 GLU 290 283 283 GLU GLU A . n 
A 1 291 SER 291 284 284 SER SER A . n 
A 1 292 GLN 292 285 285 GLN GLN A . n 
A 1 293 LEU 293 286 286 LEU LEU A . n 
A 1 294 GLN 294 287 287 GLN GLN A . n 
A 1 295 SER 295 288 288 SER SER A . n 
A 1 296 HIS 296 289 289 HIS HIS A . n 
A 1 297 PHE 297 290 290 PHE PHE A . n 
A 1 298 GLY 298 291 291 GLY GLY A . n 
A 1 299 GLU 299 292 292 GLU GLU A . n 
A 1 300 LYS 300 293 293 LYS LYS A . n 
A 1 301 ASN 301 294 294 ASN ASN A . n 
A 1 302 GLY 302 295 295 GLY GLY A . n 
A 1 303 SER 303 296 296 SER SER A . n 
A 1 304 TRP 304 297 297 TRP TRP A . n 
A 1 305 LEU 305 298 298 LEU LEU A . n 
A 1 306 TYR 306 299 299 TYR TYR A . n 
A 1 307 ALA 307 300 300 ALA ALA A . n 
A 1 308 MET 308 301 301 MET MET A . n 
A 1 309 CYS 309 302 302 CYS CYS A . n 
A 1 310 ARG 310 303 303 ARG ARG A . n 
A 1 311 GLY 311 304 304 GLY GLY A . n 
A 1 312 ILE 312 305 305 ILE ILE A . n 
A 1 313 GLU 313 306 306 GLU GLU A . n 
A 1 314 HIS 314 307 307 HIS HIS A . n 
A 1 315 ASP 315 308 308 ASP ASP A . n 
A 1 316 PRO 316 309 309 PRO PRO A . n 
A 1 317 VAL 317 310 310 VAL VAL A . n 
A 1 318 LYS 318 311 311 LYS LYS A . n 
A 1 319 PRO 319 312 312 PRO PRO A . n 
A 1 320 ARG 320 313 313 ARG ARG A . n 
A 1 321 GLN 321 314 314 GLN GLN A . n 
A 1 322 LEU 322 315 315 LEU LEU A . n 
A 1 323 PRO 323 316 316 PRO PRO A . n 
A 1 324 LYS 324 317 317 LYS LYS A . n 
A 1 325 THR 325 318 318 THR THR A . n 
A 1 326 ILE 326 319 319 ILE ILE A . n 
A 1 327 GLY 327 320 320 GLY GLY A . n 
A 1 328 CYS 328 321 321 CYS CYS A . n 
A 1 329 SER 329 322 322 SER SER A . n 
A 1 330 LYS 330 323 323 LYS LYS A . n 
A 1 331 ASN 331 324 324 ASN ASN A . n 
A 1 332 PHE 332 325 325 PHE PHE A . n 
A 1 333 PRO 333 326 326 PRO PRO A . n 
A 1 334 GLY 334 327 327 GLY GLY A . n 
A 1 335 LYS 335 328 328 LYS LYS A . n 
A 1 336 THR 336 329 329 THR THR A . n 
A 1 337 ALA 337 330 330 ALA ALA A . n 
A 1 338 LEU 338 331 331 LEU LEU A . n 
A 1 339 ALA 339 332 332 ALA ALA A . n 
A 1 340 THR 340 333 333 THR THR A . n 
A 1 341 ARG 341 334 334 ARG ARG A . n 
A 1 342 GLU 342 335 335 GLU GLU A . n 
A 1 343 GLN 343 336 336 GLN GLN A . n 
A 1 344 VAL 344 337 337 VAL VAL A . n 
A 1 345 GLN 345 338 338 GLN GLN A . n 
A 1 346 TRP 346 339 339 TRP TRP A . n 
A 1 347 TRP 347 340 340 TRP TRP A . n 
A 1 348 LEU 348 341 341 LEU LEU A . n 
A 1 349 LEU 349 342 342 LEU LEU A . n 
A 1 350 GLN 350 343 343 GLN GLN A . n 
A 1 351 LEU 351 344 344 LEU LEU A . n 
A 1 352 ALA 352 345 345 ALA ALA A . n 
A 1 353 GLN 353 346 346 GLN GLN A . n 
A 1 354 GLU 354 347 347 GLU GLU A . n 
A 1 355 LEU 355 348 348 LEU LEU A . n 
A 1 356 GLU 356 349 349 GLU GLU A . n 
A 1 357 GLU 357 350 350 GLU GLU A . n 
A 1 358 ARG 358 351 351 ARG ARG A . n 
A 1 359 LEU 359 352 352 LEU LEU A . n 
A 1 360 THR 360 353 353 THR THR A . n 
A 1 361 LYS 361 354 354 LYS LYS A . n 
A 1 362 ASP 362 355 355 ASP ASP A . n 
A 1 363 ARG 363 356 356 ARG ARG A . n 
A 1 364 ASN 364 357 357 ASN ASN A . n 
A 1 365 ASP 365 358 358 ASP ASP A . n 
A 1 366 ASN 366 359 359 ASN ASN A . n 
A 1 367 ASP 367 360 360 ASP ASP A . n 
A 1 368 ARG 368 361 361 ARG ARG A . n 
A 1 369 VAL 369 362 362 VAL VAL A . n 
A 1 370 ALA 370 363 363 ALA ALA A . n 
A 1 371 THR 371 364 364 THR THR A . n 
A 1 372 GLN 372 365 365 GLN GLN A . n 
A 1 373 LEU 373 366 366 LEU LEU A . n 
A 1 374 VAL 374 367 367 VAL VAL A . n 
A 1 375 VAL 375 368 368 VAL VAL A . n 
A 1 376 SER 376 369 369 SER SER A . n 
A 1 377 ILE 377 370 370 ILE ILE A . n 
A 1 378 ARG 378 371 371 ARG ARG A . n 
A 1 379 VAL 379 372 372 VAL VAL A . n 
A 1 380 GLN 380 373 373 GLN GLN A . n 
A 1 381 GLY 381 374 374 GLY GLY A . n 
A 1 382 ASP 382 375 375 ASP ASP A . n 
A 1 383 LYS 383 376 376 LYS LYS A . n 
A 1 384 ARG 384 377 377 ARG ARG A . n 
A 1 385 LEU 385 378 378 LEU LEU A . n 
A 1 386 SER 386 379 379 SER SER A . n 
A 1 387 SER 387 380 380 SER SER A . n 
A 1 388 LEU 388 381 381 LEU LEU A . n 
A 1 389 ARG 389 382 382 ARG ARG A . n 
A 1 390 ARG 390 383 383 ARG ARG A . n 
A 1 391 CYS 391 384 384 CYS CYS A . n 
A 1 392 CYS 392 385 385 CYS CYS A . n 
A 1 393 ALA 393 386 386 ALA ALA A . n 
A 1 394 LEU 394 387 387 LEU LEU A . n 
A 1 395 THR 395 388 388 THR THR A . n 
A 1 396 ARG 396 389 389 ARG ARG A . n 
A 1 397 TYR 397 390 390 TYR TYR A . n 
A 1 398 ASP 398 391 391 ASP ASP A . n 
A 1 399 ALA 399 392 392 ALA ALA A . n 
A 1 400 HIS 400 393 393 HIS HIS A . n 
A 1 401 LYS 401 394 394 LYS LYS A . n 
A 1 402 MET 402 395 395 MET MET A . n 
A 1 403 SER 403 396 396 SER SER A . n 
A 1 404 HIS 404 397 397 HIS HIS A . n 
A 1 405 ASP 405 398 398 ASP ASP A . n 
A 1 406 ALA 406 399 399 ALA ALA A . n 
A 1 407 PHE 407 400 400 PHE PHE A . n 
A 1 408 THR 408 401 401 THR THR A . n 
A 1 409 VAL 409 402 402 VAL VAL A . n 
A 1 410 ILE 410 403 403 ILE ILE A . n 
A 1 411 LYS 411 404 404 LYS LYS A . n 
A 1 412 ASN 412 405 405 ASN ASN A . n 
A 1 413 CYS 413 406 406 CYS CYS A . n 
A 1 414 ASN 414 407 407 ASN ASN A . n 
A 1 415 THR 415 408 408 THR THR A . n 
A 1 416 SER 416 409 409 SER SER A . n 
A 1 417 GLY 417 410 410 GLY GLY A . n 
A 1 418 ILE 418 411 411 ILE ILE A . n 
A 1 419 GLN 419 412 412 GLN GLN A . n 
A 1 420 THR 420 413 413 THR THR A . n 
A 1 421 GLU 421 414 414 GLU GLU A . n 
A 1 422 TRP 422 415 415 TRP TRP A . n 
A 1 423 SER 423 416 416 SER SER A . n 
A 1 424 PRO 424 417 417 PRO PRO A . n 
A 1 425 PRO 425 418 418 PRO PRO A . n 
A 1 426 LEU 426 419 419 LEU LEU A . n 
A 1 427 THR 427 420 420 THR THR A . n 
A 1 428 MET 428 421 421 MET MET A . n 
A 1 429 LEU 429 422 422 LEU LEU A . n 
A 1 430 PHE 430 423 423 PHE PHE A . n 
A 1 431 LEU 431 424 424 LEU LEU A . n 
A 1 432 CYS 432 425 425 CYS CYS A . n 
A 1 433 ALA 433 426 426 ALA ALA A . n 
A 1 434 THR 434 427 427 THR THR A . n 
A 1 435 LYS 435 428 428 LYS LYS A . n 
A 1 436 PHE 436 429 429 PHE PHE A . n 
A 1 437 SER 437 430 430 SER SER A . n 
A 1 438 ALA 438 431 431 ALA ALA A . n 
A 1 439 SER 439 432 432 SER SER A . n 
A 1 440 ALA 440 433 ?   ?   ?   A . n 
A 1 441 PRO 441 434 ?   ?   ?   A . n 
A 1 442 SER 442 435 ?   ?   ?   A . n 
B 2 1   DA  1   1   ?   ?   ?   T . n 
B 2 2   DC  2   2   ?   ?   ?   T . n 
B 2 3   DG  3   3   3   DG  DG  T . n 
B 2 4   DG  4   4   4   DG  DG  T . n 
B 2 5   DC  5   5   5   DC  DC  T . n 
B 2 6   DT  6   6   6   DT  DT  T . n 
B 2 7   DC  7   7   7   DC  DC  T . n 
B 2 8   DA  8   8   8   DA  DA  T . n 
B 2 9   DC  9   9   9   DC  DC  T . n 
B 2 10  DA  10  10  10  DA  DA  T . n 
B 2 11  DC  11  11  11  DC  DC  T . n 
B 2 12  DT  12  12  12  DT  DT  T . n 
C 3 1   DT  1   1   1   DT  DT  P . n 
C 3 2   DA  2   2   2   DA  DA  P . n 
C 3 3   DG  3   3   3   DG  DG  P . n 
C 3 4   DT  4   4   4   DT  DT  P . n 
C 3 5   DG  5   5   5   DG  DG  P . n 
C 3 6   DT  6   6   6   DT  DT  P . n 
C 3 7   DG  7   7   7   DG  DG  P . n 
C 3 8   DA  8   8   8   DA  DA  P . n 
C 3 9   DG  9   9   9   DG  DG  P . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 4 0KX 1  501 10  0KX 0KX A . 
E 5 MG  1  502 502 MG  MG  A . 
F 5 MG  1  503 503 MG  MG  A . 
G 6 GOL 1  504 504 GOL GOL A . 
H 6 GOL 1  505 505 GOL GOL A . 
I 6 GOL 1  506 506 GOL GOL A . 
J 7 9RD 1  101 101 9RD 1PT T . 
K 8 HOH 1  601 96  HOH HOH A . 
K 8 HOH 2  602 82  HOH HOH A . 
K 8 HOH 3  603 86  HOH HOH A . 
K 8 HOH 4  604 30  HOH HOH A . 
K 8 HOH 5  605 36  HOH HOH A . 
K 8 HOH 6  606 53  HOH HOH A . 
K 8 HOH 7  607 41  HOH HOH A . 
K 8 HOH 8  608 39  HOH HOH A . 
K 8 HOH 9  609 6   HOH HOH A . 
K 8 HOH 10 610 42  HOH HOH A . 
K 8 HOH 11 611 91  HOH HOH A . 
K 8 HOH 12 612 51  HOH HOH A . 
K 8 HOH 13 613 95  HOH HOH A . 
K 8 HOH 14 614 14  HOH HOH A . 
K 8 HOH 15 615 28  HOH HOH A . 
K 8 HOH 16 616 21  HOH HOH A . 
K 8 HOH 17 617 40  HOH HOH A . 
K 8 HOH 18 618 22  HOH HOH A . 
K 8 HOH 19 619 43  HOH HOH A . 
K 8 HOH 20 620 31  HOH HOH A . 
K 8 HOH 21 621 44  HOH HOH A . 
K 8 HOH 22 622 52  HOH HOH A . 
K 8 HOH 23 623 37  HOH HOH A . 
K 8 HOH 24 624 49  HOH HOH A . 
K 8 HOH 25 625 80  HOH HOH A . 
K 8 HOH 26 626 74  HOH HOH A . 
K 8 HOH 27 627 57  HOH HOH A . 
K 8 HOH 28 628 33  HOH HOH A . 
K 8 HOH 29 629 50  HOH HOH A . 
K 8 HOH 30 630 12  HOH HOH A . 
K 8 HOH 31 631 89  HOH HOH A . 
K 8 HOH 32 632 65  HOH HOH A . 
K 8 HOH 33 633 3   HOH HOH A . 
K 8 HOH 34 634 15  HOH HOH A . 
K 8 HOH 35 635 64  HOH HOH A . 
K 8 HOH 36 636 83  HOH HOH A . 
K 8 HOH 37 637 35  HOH HOH A . 
K 8 HOH 38 638 5   HOH HOH A . 
K 8 HOH 39 639 93  HOH HOH A . 
K 8 HOH 40 640 23  HOH HOH A . 
K 8 HOH 41 641 79  HOH HOH A . 
K 8 HOH 42 642 94  HOH HOH A . 
K 8 HOH 43 643 45  HOH HOH A . 
K 8 HOH 44 644 47  HOH HOH A . 
K 8 HOH 45 645 70  HOH HOH A . 
K 8 HOH 46 646 75  HOH HOH A . 
K 8 HOH 47 647 27  HOH HOH A . 
K 8 HOH 48 648 54  HOH HOH A . 
K 8 HOH 49 649 61  HOH HOH A . 
K 8 HOH 50 650 55  HOH HOH A . 
K 8 HOH 51 651 1   HOH HOH A . 
K 8 HOH 52 652 17  HOH HOH A . 
K 8 HOH 53 653 20  HOH HOH A . 
K 8 HOH 54 654 16  HOH HOH A . 
K 8 HOH 55 655 2   HOH HOH A . 
K 8 HOH 56 656 13  HOH HOH A . 
K 8 HOH 57 657 67  HOH HOH A . 
K 8 HOH 58 658 34  HOH HOH A . 
K 8 HOH 59 659 48  HOH HOH A . 
K 8 HOH 60 660 71  HOH HOH A . 
K 8 HOH 61 661 10  HOH HOH A . 
K 8 HOH 62 662 18  HOH HOH A . 
K 8 HOH 63 663 19  HOH HOH A . 
K 8 HOH 64 664 46  HOH HOH A . 
K 8 HOH 65 665 25  HOH HOH A . 
K 8 HOH 66 666 92  HOH HOH A . 
K 8 HOH 67 667 32  HOH HOH A . 
K 8 HOH 68 668 29  HOH HOH A . 
K 8 HOH 69 669 68  HOH HOH A . 
K 8 HOH 70 670 72  HOH HOH A . 
K 8 HOH 71 671 87  HOH HOH A . 
K 8 HOH 72 672 60  HOH HOH A . 
K 8 HOH 73 673 84  HOH HOH A . 
K 8 HOH 74 674 58  HOH HOH A . 
K 8 HOH 75 675 7   HOH HOH A . 
K 8 HOH 76 676 8   HOH HOH A . 
K 8 HOH 77 677 76  HOH HOH A . 
K 8 HOH 78 678 73  HOH HOH A . 
K 8 HOH 79 679 81  HOH HOH A . 
K 8 HOH 80 680 63  HOH HOH A . 
K 8 HOH 81 681 69  HOH HOH A . 
K 8 HOH 82 682 26  HOH HOH A . 
K 8 HOH 83 683 9   HOH HOH A . 
K 8 HOH 84 684 11  HOH HOH A . 
K 8 HOH 85 685 4   HOH HOH A . 
K 8 HOH 86 686 24  HOH HOH A . 
K 8 HOH 87 687 38  HOH HOH A . 
K 8 HOH 88 688 78  HOH HOH A . 
K 8 HOH 89 689 62  HOH HOH A . 
K 8 HOH 90 690 56  HOH HOH A . 
K 8 HOH 91 691 90  HOH HOH A . 
K 8 HOH 92 692 85  HOH HOH A . 
K 8 HOH 93 693 66  HOH HOH A . 
K 8 HOH 94 694 59  HOH HOH A . 
K 8 HOH 95 695 77  HOH HOH A . 
K 8 HOH 96 696 97  HOH HOH A . 
L 8 HOH 1  201 202 HOH HOH T . 
L 8 HOH 2  202 98  HOH HOH T . 
L 8 HOH 3  203 207 HOH HOH T . 
L 8 HOH 4  204 203 HOH HOH T . 
L 8 HOH 5  205 204 HOH HOH T . 
L 8 HOH 6  206 211 HOH HOH T . 
L 8 HOH 7  207 201 HOH HOH T . 
L 8 HOH 8  208 209 HOH HOH T . 
L 8 HOH 9  209 205 HOH HOH T . 
L 8 HOH 10 210 213 HOH HOH T . 
L 8 HOH 11 211 212 HOH HOH T . 
L 8 HOH 12 212 210 HOH HOH T . 
L 8 HOH 13 213 206 HOH HOH T . 
L 8 HOH 14 214 208 HOH HOH T . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   trimeric 
_pdbx_struct_assembly.oligomeric_count     3 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J,K,L 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5090  ? 
1 MORE         -58   ? 
1 'SSA (A^2)'  21620 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  OD1   ? A ASP 20  ? A ASP 13  ? 1_555 MG ? E MG  . ? A MG  502 ? 1_555 O     ? A MET 21  ? A MET 14  ? 1_555 83.5  ? 
2  OD1   ? A ASP 20  ? A ASP 13  ? 1_555 MG ? E MG  . ? A MG  502 ? 1_555 OD2   ? A ASP 122 ? A ASP 115 ? 1_555 96.8  ? 
3  O     ? A MET 21  ? A MET 14  ? 1_555 MG ? E MG  . ? A MG  502 ? 1_555 OD2   ? A ASP 122 ? A ASP 115 ? 1_555 85.3  ? 
4  OD1   ? A ASP 20  ? A ASP 13  ? 1_555 MG ? E MG  . ? A MG  502 ? 1_555 O1G   ? D 0KX .   ? A 0KX 501 ? 1_555 84.9  ? 
5  O     ? A MET 21  ? A MET 14  ? 1_555 MG ? E MG  . ? A MG  502 ? 1_555 O1G   ? D 0KX .   ? A 0KX 501 ? 1_555 101.5 ? 
6  OD2   ? A ASP 122 ? A ASP 115 ? 1_555 MG ? E MG  . ? A MG  502 ? 1_555 O1G   ? D 0KX .   ? A 0KX 501 ? 1_555 173.2 ? 
7  OD1   ? A ASP 20  ? A ASP 13  ? 1_555 MG ? E MG  . ? A MG  502 ? 1_555 O1B   ? D 0KX .   ? A 0KX 501 ? 1_555 170.2 ? 
8  O     ? A MET 21  ? A MET 14  ? 1_555 MG ? E MG  . ? A MG  502 ? 1_555 O1B   ? D 0KX .   ? A 0KX 501 ? 1_555 89.1  ? 
9  OD2   ? A ASP 122 ? A ASP 115 ? 1_555 MG ? E MG  . ? A MG  502 ? 1_555 O1B   ? D 0KX .   ? A 0KX 501 ? 1_555 88.9  ? 
10 O1G   ? D 0KX .   ? A 0KX 501 ? 1_555 MG ? E MG  . ? A MG  502 ? 1_555 O1B   ? D 0KX .   ? A 0KX 501 ? 1_555 90.3  ? 
11 OD1   ? A ASP 20  ? A ASP 13  ? 1_555 MG ? E MG  . ? A MG  502 ? 1_555 O2A   ? D 0KX .   ? A 0KX 501 ? 1_555 100.6 ? 
12 O     ? A MET 21  ? A MET 14  ? 1_555 MG ? E MG  . ? A MG  502 ? 1_555 O2A   ? D 0KX .   ? A 0KX 501 ? 1_555 169.3 ? 
13 OD2   ? A ASP 122 ? A ASP 115 ? 1_555 MG ? E MG  . ? A MG  502 ? 1_555 O2A   ? D 0KX .   ? A 0KX 501 ? 1_555 84.4  ? 
14 O1G   ? D 0KX .   ? A 0KX 501 ? 1_555 MG ? E MG  . ? A MG  502 ? 1_555 O2A   ? D 0KX .   ? A 0KX 501 ? 1_555 88.8  ? 
15 O1B   ? D 0KX .   ? A 0KX 501 ? 1_555 MG ? E MG  . ? A MG  502 ? 1_555 O2A   ? D 0KX .   ? A 0KX 501 ? 1_555 87.8  ? 
16 OD2   ? A ASP 20  ? A ASP 13  ? 1_555 MG ? F MG  . ? A MG  503 ? 1_555 OD1   ? A ASP 122 ? A ASP 115 ? 1_555 95.5  ? 
17 OD2   ? A ASP 20  ? A ASP 13  ? 1_555 MG ? F MG  . ? A MG  503 ? 1_555 OE2   ? A GLU 123 ? A GLU 116 ? 1_555 87.5  ? 
18 OD1   ? A ASP 122 ? A ASP 115 ? 1_555 MG ? F MG  . ? A MG  503 ? 1_555 OE2   ? A GLU 123 ? A GLU 116 ? 1_555 88.9  ? 
19 OD2   ? A ASP 20  ? A ASP 13  ? 1_555 MG ? F MG  . ? A MG  503 ? 1_555 "O3'" ? C DG  9   ? P DG  9   ? 1_555 162.2 ? 
20 OD1   ? A ASP 122 ? A ASP 115 ? 1_555 MG ? F MG  . ? A MG  503 ? 1_555 "O3'" ? C DG  9   ? P DG  9   ? 1_555 95.5  ? 
21 OE2   ? A GLU 123 ? A GLU 116 ? 1_555 MG ? F MG  . ? A MG  503 ? 1_555 "O3'" ? C DG  9   ? P DG  9   ? 1_555 78.7  ? 
22 OD2   ? A ASP 20  ? A ASP 13  ? 1_555 MG ? F MG  . ? A MG  503 ? 1_555 O2A   ? D 0KX .   ? A 0KX 501 ? 1_555 99.8  ? 
23 OD1   ? A ASP 122 ? A ASP 115 ? 1_555 MG ? F MG  . ? A MG  503 ? 1_555 O2A   ? D 0KX .   ? A 0KX 501 ? 1_555 89.3  ? 
24 OE2   ? A GLU 123 ? A GLU 116 ? 1_555 MG ? F MG  . ? A MG  503 ? 1_555 O2A   ? D 0KX .   ? A 0KX 501 ? 1_555 172.6 ? 
25 "O3'" ? C DG  9   ? P DG  9   ? 1_555 MG ? F MG  . ? A MG  503 ? 1_555 O2A   ? D 0KX .   ? A 0KX 501 ? 1_555 94.3  ? 
26 OD2   ? A ASP 20  ? A ASP 13  ? 1_555 MG ? F MG  . ? A MG  503 ? 1_555 O     ? K HOH .   ? A HOH 674 ? 1_555 88.9  ? 
27 OD1   ? A ASP 122 ? A ASP 115 ? 1_555 MG ? F MG  . ? A MG  503 ? 1_555 O     ? K HOH .   ? A HOH 674 ? 1_555 168.5 ? 
28 OE2   ? A GLU 123 ? A GLU 116 ? 1_555 MG ? F MG  . ? A MG  503 ? 1_555 O     ? K HOH .   ? A HOH 674 ? 1_555 101.9 ? 
29 "O3'" ? C DG  9   ? P DG  9   ? 1_555 MG ? F MG  . ? A MG  503 ? 1_555 O     ? K HOH .   ? A HOH 674 ? 1_555 83.0  ? 
30 O2A   ? D 0KX .   ? A 0KX 501 ? 1_555 MG ? F MG  . ? A MG  503 ? 1_555 O     ? K HOH .   ? A HOH 674 ? 1_555 79.4  ? 
31 N7    A B DG  3   ? T DG  3   ? 1_555 PT ? J 9RD . ? T 9RD 101 ? 1_555 N1    ? J 9RD .   ? T 9RD 101 ? 1_555 97.5  ? 
32 N7    A B DG  3   ? T DG  3   ? 1_555 PT ? J 9RD . ? T 9RD 101 ? 1_555 N2    ? J 9RD .   ? T 9RD 101 ? 1_555 157.4 ? 
33 N1    ? J 9RD .   ? T 9RD 101 ? 1_555 PT ? J 9RD . ? T 9RD 101 ? 1_555 N2    ? J 9RD .   ? T 9RD 101 ? 1_555 83.5  ? 
34 N7    A B DG  3   ? T DG  3   ? 1_555 PT ? J 9RD . ? T 9RD 101 ? 1_555 N7    B B DG  3   ? T DG  3   ? 1_555 18.4  ? 
35 N1    ? J 9RD .   ? T 9RD 101 ? 1_555 PT ? J 9RD . ? T 9RD 101 ? 1_555 N7    B B DG  3   ? T DG  3   ? 1_555 90.5  ? 
36 N2    ? J 9RD .   ? T 9RD 101 ? 1_555 PT ? J 9RD . ? T 9RD 101 ? 1_555 N7    B B DG  3   ? T DG  3   ? 1_555 171.7 ? 
37 N7    A B DG  3   ? T DG  3   ? 1_555 PT ? J 9RD . ? T 9RD 101 ? 1_555 N7    A B DG  4   ? T DG  4   ? 1_555 100.6 ? 
38 N1    ? J 9RD .   ? T 9RD 101 ? 1_555 PT ? J 9RD . ? T 9RD 101 ? 1_555 N7    A B DG  4   ? T DG  4   ? 1_555 161.0 ? 
39 N2    ? J 9RD .   ? T 9RD 101 ? 1_555 PT ? J 9RD . ? T 9RD 101 ? 1_555 N7    A B DG  4   ? T DG  4   ? 1_555 82.1  ? 
40 N7    B B DG  3   ? T DG  3   ? 1_555 PT ? J 9RD . ? T 9RD 101 ? 1_555 N7    A B DG  4   ? T DG  4   ? 1_555 104.9 ? 
41 N7    A B DG  3   ? T DG  3   ? 1_555 PT ? J 9RD . ? T 9RD 101 ? 1_555 N7    B B DG  4   ? T DG  4   ? 1_555 97.3  ? 
42 N1    ? J 9RD .   ? T 9RD 101 ? 1_555 PT ? J 9RD . ? T 9RD 101 ? 1_555 N7    B B DG  4   ? T DG  4   ? 1_555 164.0 ? 
43 N2    ? J 9RD .   ? T 9RD 101 ? 1_555 PT ? J 9RD . ? T 9RD 101 ? 1_555 N7    B B DG  4   ? T DG  4   ? 1_555 85.3  ? 
44 N7    B B DG  3   ? T DG  3   ? 1_555 PT ? J 9RD . ? T 9RD 101 ? 1_555 N7    B B DG  4   ? T DG  4   ? 1_555 101.7 ? 
45 N7    A B DG  4   ? T DG  4   ? 1_555 PT ? J 9RD . ? T 9RD 101 ? 1_555 N7    B B DG  4   ? T DG  4   ? 1_555 3.3   ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2019-02-13 
2 'Structure model' 1 1 2019-03-13 
3 'Structure model' 1 2 2019-12-25 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'            
2 2 'Structure model' 'Database references'        
3 3 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation                    
2 2 'Structure model' pdbx_database_proc          
3 2 'Structure model' pdbx_seq_map_depositor_info 
4 3 'Structure model' pdbx_audit_support          
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1 2 'Structure model' '_citation.journal_volume'                         
2 2 'Structure model' '_citation.page_first'                             
3 2 'Structure model' '_citation.page_last'                              
4 2 'Structure model' '_pdbx_seq_map_depositor_info.one_letter_code_mod' 
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? REFMAC   ? ? ? 5.7.0032 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .        2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .        3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? MOLREP   ? ? ? .        4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OP1 
_pdbx_validate_close_contact.auth_asym_id_1   T 
_pdbx_validate_close_contact.auth_comp_id_1   DC 
_pdbx_validate_close_contact.auth_seq_id_1    11 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   T 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    201 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.11 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    OE2 
_pdbx_validate_symm_contact.auth_asym_id_1    A 
_pdbx_validate_symm_contact.auth_comp_id_1    GLU 
_pdbx_validate_symm_contact.auth_seq_id_1     82 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    OP2 
_pdbx_validate_symm_contact.auth_asym_id_2    T 
_pdbx_validate_symm_contact.auth_comp_id_2    DT 
_pdbx_validate_symm_contact.auth_seq_id_2     12 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   5_444 
_pdbx_validate_symm_contact.dist              1.74 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 NE    A ARG 30  ? ? CZ A ARG 30  ? ? NH2 A ARG 30  ? ? 123.81 120.30 3.51  0.50 N 
2 1 CB    A ASP 66  ? ? CG A ASP 66  ? ? OD1 A ASP 66  ? ? 123.87 118.30 5.57  0.90 N 
3 1 NE    A ARG 382 ? ? CZ A ARG 382 ? ? NH1 A ARG 382 ? ? 125.01 120.30 4.71  0.50 N 
4 1 "O5'" T DC  7   ? ? P  T DC  7   ? ? OP2 T DC  7   ? ? 100.11 105.70 -5.59 0.90 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 CYS A 16  ? ? 26.16   58.06   
2 1 TYR A 39  ? ? 66.30   62.28   
3 1 GLU A 159 ? ? -11.72  -62.11  
4 1 THR A 160 ? ? -60.40  2.97    
5 1 SER A 217 ? ? -156.88 -159.34 
6 1 SER A 257 ? ? 94.81   -10.88  
7 1 LEU A 381 ? ? 179.84  132.56  
8 1 GLN A 412 ? ? 81.11   -37.20  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A GLU 158 ? CG    ? A GLU 165 CG    
2  1 Y 1 A GLU 158 ? CD    ? A GLU 165 CD    
3  1 Y 1 A GLU 158 ? OE1   ? A GLU 165 OE1   
4  1 Y 1 A GLU 158 ? OE2   ? A GLU 165 OE2   
5  1 Y 1 A GLU 159 ? CG    ? A GLU 166 CG    
6  1 Y 1 A GLU 159 ? CD    ? A GLU 166 CD    
7  1 Y 1 A GLU 159 ? OE1   ? A GLU 166 OE1   
8  1 Y 1 A GLU 159 ? OE2   ? A GLU 166 OE2   
9  1 Y 1 P DT  1   ? "O5'" ? C DT  1   "O5'" 
10 1 Y 1 P DT  1   ? "C5'" ? C DT  1   "C5'" 
11 1 Y 1 P DT  1   ? "C4'" ? C DT  1   "C4'" 
12 1 Y 1 P DT  1   ? "O4'" ? C DT  1   "O4'" 
13 1 Y 1 P DT  1   ? "C3'" ? C DT  1   "C3'" 
14 1 Y 1 P DT  1   ? "C2'" ? C DT  1   "C2'" 
15 1 Y 1 P DT  1   ? "C1'" ? C DT  1   "C1'" 
16 1 Y 1 P DT  1   ? N1    ? C DT  1   N1    
17 1 Y 1 P DT  1   ? C2    ? C DT  1   C2    
18 1 Y 1 P DT  1   ? O2    ? C DT  1   O2    
19 1 Y 1 P DT  1   ? N3    ? C DT  1   N3    
20 1 Y 1 P DT  1   ? C4    ? C DT  1   C4    
21 1 Y 1 P DT  1   ? O4    ? C DT  1   O4    
22 1 Y 1 P DT  1   ? C5    ? C DT  1   C5    
23 1 Y 1 P DT  1   ? C7    ? C DT  1   C7    
24 1 Y 1 P DT  1   ? C6    ? C DT  1   C6    
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -6  ? A MET 1   
2  1 Y 1 A ALA -5  ? A ALA 2   
3  1 Y 1 A HIS -4  ? A HIS 3   
4  1 Y 1 A HIS -3  ? A HIS 4   
5  1 Y 1 A HIS -2  ? A HIS 5   
6  1 Y 1 A HIS -1  ? A HIS 6   
7  1 Y 1 A HIS 0   ? A HIS 7   
8  1 Y 1 A HIS 1   ? A HIS 8   
9  1 Y 1 A THR 155 ? A THR 162 
10 1 Y 1 A THR 156 ? A THR 163 
11 1 Y 1 A ALA 157 ? A ALA 164 
12 1 Y 1 A ALA 433 ? A ALA 440 
13 1 Y 1 A PRO 434 ? A PRO 441 
14 1 Y 1 A SER 435 ? A SER 442 
15 1 Y 1 T DA  1   ? B DA  1   
16 1 Y 1 T DC  2   ? B DC  2   
# 
_ndb_struct_conf_na.entry_id   6MXO 
_ndb_struct_conf_na.feature    'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DC 5  1_555 C DG 9 1_555 0.212  -0.087 -0.027 1.431  -4.473  -0.699 1 T_DC5:DG9_P  T 5  ? P 9 ? 19 1 
1 B DT 6  1_555 C DA 8 1_555 0.028  0.074  -0.156 -4.262 -15.666 15.796 2 T_DT6:DA8_P  T 6  ? P 8 ? 20 1 
1 B DC 7  1_555 C DG 7 1_555 0.269  -0.089 -0.362 -4.282 -0.090  1.733  3 T_DC7:DG7_P  T 7  ? P 7 ? 19 1 
1 B DA 8  1_555 C DT 6 1_555 0.030  -0.128 -0.179 0.160  -0.412  -0.383 4 T_DA8:DT6_P  T 8  ? P 6 ? 20 1 
1 B DC 9  1_555 C DG 5 1_555 0.262  -0.093 -0.374 13.143 -0.792  -1.263 5 T_DC9:DG5_P  T 9  ? P 5 ? 19 1 
1 B DA 10 1_555 C DT 4 1_555 0.003  -0.079 0.029  8.498  -6.988  -1.084 6 T_DA10:DT4_P T 10 ? P 4 ? 20 1 
1 B DC 11 1_555 C DG 3 1_555 0.176  -0.079 -0.150 9.254  -9.891  -1.403 7 T_DC11:DG3_P T 11 ? P 3 ? 19 1 
1 B DT 12 1_555 C DA 2 1_555 -0.116 -0.059 -0.151 16.009 -3.676  1.081  8 T_DT12:DA2_P T 12 ? P 2 ? 20 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DC 5  1_555 C DG 9 1_555 B DT 6  1_555 C DA 8 1_555 1.245  -1.066 3.503 4.159  4.885  24.991 -3.851 -1.545 3.396 11.056 -9.414 
25.789 1 TT_DC5DT6:DA8DG9_PP   T 5  ? P 9 ? T 6  ? P 8 ? 
1 B DT 6  1_555 C DA 8 1_555 B DC 7  1_555 C DG 7 1_555 -0.550 -0.659 3.447 0.335  5.894  32.380 -2.207 1.031  3.274 10.461 -0.595 
32.899 2 TT_DT6DC7:DG7DA8_PP   T 6  ? P 8 ? T 7  ? P 7 ? 
1 B DC 7  1_555 C DG 7 1_555 B DA 8  1_555 C DT 6 1_555 -0.489 -0.710 3.289 0.528  4.986  30.863 -2.251 1.006  3.130 9.292  -0.984 
31.258 3 TT_DC7DA8:DT6DG7_PP   T 7  ? P 7 ? T 8  ? P 6 ? 
1 B DA 8  1_555 C DT 6 1_555 B DC 9  1_555 C DG 5 1_555 0.493  -0.655 3.185 1.976  0.471  29.856 -1.363 -0.555 3.200 0.914  -3.829 
29.924 4 TT_DA8DC9:DG5DT6_PP   T 8  ? P 6 ? T 9  ? P 5 ? 
1 B DC 9  1_555 C DG 5 1_555 B DA 10 1_555 C DT 4 1_555 -0.716 -0.170 3.628 -3.577 2.278  37.020 -0.604 0.590  3.663 3.573  5.611  
37.254 5 TT_DC9DA10:DT4DG5_PP  T 9  ? P 5 ? T 10 ? P 4 ? 
1 B DA 10 1_555 C DT 4 1_555 B DC 11 1_555 C DG 3 1_555 0.189  -0.921 3.368 0.256  -0.618 33.949 -1.475 -0.281 3.385 -1.059 -0.439 
33.955 6 TT_DA10DC11:DG3DT4_PP T 10 ? P 4 ? T 11 ? P 3 ? 
1 B DC 11 1_555 C DG 3 1_555 B DT 12 1_555 C DA 2 1_555 0.242  -0.835 3.235 -1.922 3.115  26.812 -2.554 -0.990 3.095 6.678  4.121  
27.056 7 TT_DC11DT12:DA2DG3_PP T 11 ? P 3 ? T 12 ? P 2 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 "2'-deoxy-5'-O-[(R)-hydroxy{[(R)-hydroxy(phosphonooxy)phosphoryl]amino}phosphoryl]cytidine" 0KX 
5 'MAGNESIUM ION'                                                                             MG  
6 GLYCEROL                                                                                    GOL 
7 '(cyclohex-1-ene-1,2-diamine)platinum(2+)'                                                  9RD 
8 water                                                                                       HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   cross-linking 
_pdbx_struct_assembly_auth_evidence.details                ? 
#