data_6N8P
# 
_entry.id   6N8P 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6N8P         
WWPDB D_1000238170 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6N8P 
_pdbx_database_status.recvd_initial_deposition_date   2018-11-30 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Almagor, L.' 1 0000-0002-5175-7420 
'Weis, W.I.'  2 0000-0002-5583-6150 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            116 
_citation.language                  ? 
_citation.page_first                10804 
_citation.page_last                 10812 
_citation.title                     
'Structural insights into the aPKC regulatory switch mechanism of the human cell polarity protein lethal giant larvae 2.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1821514116 
_citation.pdbx_database_id_PubMed   31088962 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Almagor, L.'    1 ? 
primary 'Ufimtsev, I.S.' 2 ? 
primary 'Ayer, A.'       3 ? 
primary 'Li, J.'         4 ? 
primary 'Weis, W.I.'     5 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6N8P 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     78.699 
_cell.length_a_esd                 ? 
_cell.length_b                     118.489 
_cell.length_b_esd                 ? 
_cell.length_c                     126.639 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6N8P 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Lethal(2) giant larvae protein homolog 2' 109275.109 1 ? ? ? ? 
2 non-polymer syn 'CHLORIDE ION'                             35.453     1 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        HGL 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MRERLKRDLFQFNKTVEHGFPHQPSALGYSPSLRILAIGTRSGAIKLYGAPGVEFMGLHQENNAVTQIHLLPGQCQLVTL
LDDNSLHLWSLKVKGGASELQEDESFTLRGPPGAAPSATQITVVLPHSSCELLYLGTESGNVFVVQLPAFRALEDRTISS
DAVLQRLPEEARHRRVFEMVEALQEHPRDPNQILIGYSRGLVVIWDLQGSRVLYHFLSSQQLENIWWQRDGRLLVSCHSD
GSYCQWPVSSEAQQPEPLRSLVPYGPFPCKAITRILWLTTRQGLPFTIFQGGMPRASYGDRHCISVIHDGQQTAFDFTSR
VIGFTVLTEADPAATFDDPYALVVLAEEELVVIDLQTAGWPPVQLPYLASLHCSAITCSHHVSNIPLKLWERIIAAGSRQ
NAHFSTMEWPIDGGTSLTPAPPQRDLLLTGHEDGTVRFWDASGVCLRLLYKLSTVRVFLTDTDPNENFSAQGEDEWPPLR
KVGSFDPYSDDPRLGIQKIFLCKYSGYLAVAGTAGQVLVLELNDEAAEQAVEQVEADLLQDQEGYRWKGHERLAARSGPV
RFEPGFQPFVLVQCQPPAVVTSLALHSEWRLVAFGTSHGFGLFDHQQRRQVFVKCTLHPSDQLALEGPLSRVKSLKKSLR
QSFRRMRRSRVSSRKRHPAGPPGEAQEGSAKAERPGLQNMELAPVQRKIEARSAEDSFTGFVRTLYFADTYLKDSSRHCP
SLWAGTNGGTIYAFSLRVPPAERRMDEPVRAEQAKEIQLMHRAPVVGILVLDGHSVPLPEPLEVAHDLSKSPDMQGSHQL
LVVSEEQFKVFTLPKVSAKLKLKLTALEGSRVRRVSVAHFGSRRAEDYGEHHLAVLTNLGDIQVVSLPLLKPQVRYSCIR
REDVSGIASCVFTKYGQGFYLISPSEFERFSLSTKWLVEPRCLVDSAETKNHRPGNGAGPKKAPSRARNSGTQSDGEEKQ
PGLVMEREFTTASENLYFQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MRERLKRDLFQFNKTVEHGFPHQPSALGYSPSLRILAIGTRSGAIKLYGAPGVEFMGLHQENNAVTQIHLLPGQCQLVTL
LDDNSLHLWSLKVKGGASELQEDESFTLRGPPGAAPSATQITVVLPHSSCELLYLGTESGNVFVVQLPAFRALEDRTISS
DAVLQRLPEEARHRRVFEMVEALQEHPRDPNQILIGYSRGLVVIWDLQGSRVLYHFLSSQQLENIWWQRDGRLLVSCHSD
GSYCQWPVSSEAQQPEPLRSLVPYGPFPCKAITRILWLTTRQGLPFTIFQGGMPRASYGDRHCISVIHDGQQTAFDFTSR
VIGFTVLTEADPAATFDDPYALVVLAEEELVVIDLQTAGWPPVQLPYLASLHCSAITCSHHVSNIPLKLWERIIAAGSRQ
NAHFSTMEWPIDGGTSLTPAPPQRDLLLTGHEDGTVRFWDASGVCLRLLYKLSTVRVFLTDTDPNENFSAQGEDEWPPLR
KVGSFDPYSDDPRLGIQKIFLCKYSGYLAVAGTAGQVLVLELNDEAAEQAVEQVEADLLQDQEGYRWKGHERLAARSGPV
RFEPGFQPFVLVQCQPPAVVTSLALHSEWRLVAFGTSHGFGLFDHQQRRQVFVKCTLHPSDQLALEGPLSRVKSLKKSLR
QSFRRMRRSRVSSRKRHPAGPPGEAQEGSAKAERPGLQNMELAPVQRKIEARSAEDSFTGFVRTLYFADTYLKDSSRHCP
SLWAGTNGGTIYAFSLRVPPAERRMDEPVRAEQAKEIQLMHRAPVVGILVLDGHSVPLPEPLEVAHDLSKSPDMQGSHQL
LVVSEEQFKVFTLPKVSAKLKLKLTALEGSRVRRVSVAHFGSRRAEDYGEHHLAVLTNLGDIQVVSLPLLKPQVRYSCIR
REDVSGIASCVFTKYGQGFYLISPSEFERFSLSTKWLVEPRCLVDSAETKNHRPGNGAGPKKAPSRARNSGTQSDGEEKQ
PGLVMEREFTTASENLYFQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ARG n 
1 3   GLU n 
1 4   ARG n 
1 5   LEU n 
1 6   LYS n 
1 7   ARG n 
1 8   ASP n 
1 9   LEU n 
1 10  PHE n 
1 11  GLN n 
1 12  PHE n 
1 13  ASN n 
1 14  LYS n 
1 15  THR n 
1 16  VAL n 
1 17  GLU n 
1 18  HIS n 
1 19  GLY n 
1 20  PHE n 
1 21  PRO n 
1 22  HIS n 
1 23  GLN n 
1 24  PRO n 
1 25  SER n 
1 26  ALA n 
1 27  LEU n 
1 28  GLY n 
1 29  TYR n 
1 30  SER n 
1 31  PRO n 
1 32  SER n 
1 33  LEU n 
1 34  ARG n 
1 35  ILE n 
1 36  LEU n 
1 37  ALA n 
1 38  ILE n 
1 39  GLY n 
1 40  THR n 
1 41  ARG n 
1 42  SER n 
1 43  GLY n 
1 44  ALA n 
1 45  ILE n 
1 46  LYS n 
1 47  LEU n 
1 48  TYR n 
1 49  GLY n 
1 50  ALA n 
1 51  PRO n 
1 52  GLY n 
1 53  VAL n 
1 54  GLU n 
1 55  PHE n 
1 56  MET n 
1 57  GLY n 
1 58  LEU n 
1 59  HIS n 
1 60  GLN n 
1 61  GLU n 
1 62  ASN n 
1 63  ASN n 
1 64  ALA n 
1 65  VAL n 
1 66  THR n 
1 67  GLN n 
1 68  ILE n 
1 69  HIS n 
1 70  LEU n 
1 71  LEU n 
1 72  PRO n 
1 73  GLY n 
1 74  GLN n 
1 75  CYS n 
1 76  GLN n 
1 77  LEU n 
1 78  VAL n 
1 79  THR n 
1 80  LEU n 
1 81  LEU n 
1 82  ASP n 
1 83  ASP n 
1 84  ASN n 
1 85  SER n 
1 86  LEU n 
1 87  HIS n 
1 88  LEU n 
1 89  TRP n 
1 90  SER n 
1 91  LEU n 
1 92  LYS n 
1 93  VAL n 
1 94  LYS n 
1 95  GLY n 
1 96  GLY n 
1 97  ALA n 
1 98  SER n 
1 99  GLU n 
1 100 LEU n 
1 101 GLN n 
1 102 GLU n 
1 103 ASP n 
1 104 GLU n 
1 105 SER n 
1 106 PHE n 
1 107 THR n 
1 108 LEU n 
1 109 ARG n 
1 110 GLY n 
1 111 PRO n 
1 112 PRO n 
1 113 GLY n 
1 114 ALA n 
1 115 ALA n 
1 116 PRO n 
1 117 SER n 
1 118 ALA n 
1 119 THR n 
1 120 GLN n 
1 121 ILE n 
1 122 THR n 
1 123 VAL n 
1 124 VAL n 
1 125 LEU n 
1 126 PRO n 
1 127 HIS n 
1 128 SER n 
1 129 SER n 
1 130 CYS n 
1 131 GLU n 
1 132 LEU n 
1 133 LEU n 
1 134 TYR n 
1 135 LEU n 
1 136 GLY n 
1 137 THR n 
1 138 GLU n 
1 139 SER n 
1 140 GLY n 
1 141 ASN n 
1 142 VAL n 
1 143 PHE n 
1 144 VAL n 
1 145 VAL n 
1 146 GLN n 
1 147 LEU n 
1 148 PRO n 
1 149 ALA n 
1 150 PHE n 
1 151 ARG n 
1 152 ALA n 
1 153 LEU n 
1 154 GLU n 
1 155 ASP n 
1 156 ARG n 
1 157 THR n 
1 158 ILE n 
1 159 SER n 
1 160 SER n 
1 161 ASP n 
1 162 ALA n 
1 163 VAL n 
1 164 LEU n 
1 165 GLN n 
1 166 ARG n 
1 167 LEU n 
1 168 PRO n 
1 169 GLU n 
1 170 GLU n 
1 171 ALA n 
1 172 ARG n 
1 173 HIS n 
1 174 ARG n 
1 175 ARG n 
1 176 VAL n 
1 177 PHE n 
1 178 GLU n 
1 179 MET n 
1 180 VAL n 
1 181 GLU n 
1 182 ALA n 
1 183 LEU n 
1 184 GLN n 
1 185 GLU n 
1 186 HIS n 
1 187 PRO n 
1 188 ARG n 
1 189 ASP n 
1 190 PRO n 
1 191 ASN n 
1 192 GLN n 
1 193 ILE n 
1 194 LEU n 
1 195 ILE n 
1 196 GLY n 
1 197 TYR n 
1 198 SER n 
1 199 ARG n 
1 200 GLY n 
1 201 LEU n 
1 202 VAL n 
1 203 VAL n 
1 204 ILE n 
1 205 TRP n 
1 206 ASP n 
1 207 LEU n 
1 208 GLN n 
1 209 GLY n 
1 210 SER n 
1 211 ARG n 
1 212 VAL n 
1 213 LEU n 
1 214 TYR n 
1 215 HIS n 
1 216 PHE n 
1 217 LEU n 
1 218 SER n 
1 219 SER n 
1 220 GLN n 
1 221 GLN n 
1 222 LEU n 
1 223 GLU n 
1 224 ASN n 
1 225 ILE n 
1 226 TRP n 
1 227 TRP n 
1 228 GLN n 
1 229 ARG n 
1 230 ASP n 
1 231 GLY n 
1 232 ARG n 
1 233 LEU n 
1 234 LEU n 
1 235 VAL n 
1 236 SER n 
1 237 CYS n 
1 238 HIS n 
1 239 SER n 
1 240 ASP n 
1 241 GLY n 
1 242 SER n 
1 243 TYR n 
1 244 CYS n 
1 245 GLN n 
1 246 TRP n 
1 247 PRO n 
1 248 VAL n 
1 249 SER n 
1 250 SER n 
1 251 GLU n 
1 252 ALA n 
1 253 GLN n 
1 254 GLN n 
1 255 PRO n 
1 256 GLU n 
1 257 PRO n 
1 258 LEU n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 VAL n 
1 263 PRO n 
1 264 TYR n 
1 265 GLY n 
1 266 PRO n 
1 267 PHE n 
1 268 PRO n 
1 269 CYS n 
1 270 LYS n 
1 271 ALA n 
1 272 ILE n 
1 273 THR n 
1 274 ARG n 
1 275 ILE n 
1 276 LEU n 
1 277 TRP n 
1 278 LEU n 
1 279 THR n 
1 280 THR n 
1 281 ARG n 
1 282 GLN n 
1 283 GLY n 
1 284 LEU n 
1 285 PRO n 
1 286 PHE n 
1 287 THR n 
1 288 ILE n 
1 289 PHE n 
1 290 GLN n 
1 291 GLY n 
1 292 GLY n 
1 293 MET n 
1 294 PRO n 
1 295 ARG n 
1 296 ALA n 
1 297 SER n 
1 298 TYR n 
1 299 GLY n 
1 300 ASP n 
1 301 ARG n 
1 302 HIS n 
1 303 CYS n 
1 304 ILE n 
1 305 SER n 
1 306 VAL n 
1 307 ILE n 
1 308 HIS n 
1 309 ASP n 
1 310 GLY n 
1 311 GLN n 
1 312 GLN n 
1 313 THR n 
1 314 ALA n 
1 315 PHE n 
1 316 ASP n 
1 317 PHE n 
1 318 THR n 
1 319 SER n 
1 320 ARG n 
1 321 VAL n 
1 322 ILE n 
1 323 GLY n 
1 324 PHE n 
1 325 THR n 
1 326 VAL n 
1 327 LEU n 
1 328 THR n 
1 329 GLU n 
1 330 ALA n 
1 331 ASP n 
1 332 PRO n 
1 333 ALA n 
1 334 ALA n 
1 335 THR n 
1 336 PHE n 
1 337 ASP n 
1 338 ASP n 
1 339 PRO n 
1 340 TYR n 
1 341 ALA n 
1 342 LEU n 
1 343 VAL n 
1 344 VAL n 
1 345 LEU n 
1 346 ALA n 
1 347 GLU n 
1 348 GLU n 
1 349 GLU n 
1 350 LEU n 
1 351 VAL n 
1 352 VAL n 
1 353 ILE n 
1 354 ASP n 
1 355 LEU n 
1 356 GLN n 
1 357 THR n 
1 358 ALA n 
1 359 GLY n 
1 360 TRP n 
1 361 PRO n 
1 362 PRO n 
1 363 VAL n 
1 364 GLN n 
1 365 LEU n 
1 366 PRO n 
1 367 TYR n 
1 368 LEU n 
1 369 ALA n 
1 370 SER n 
1 371 LEU n 
1 372 HIS n 
1 373 CYS n 
1 374 SER n 
1 375 ALA n 
1 376 ILE n 
1 377 THR n 
1 378 CYS n 
1 379 SER n 
1 380 HIS n 
1 381 HIS n 
1 382 VAL n 
1 383 SER n 
1 384 ASN n 
1 385 ILE n 
1 386 PRO n 
1 387 LEU n 
1 388 LYS n 
1 389 LEU n 
1 390 TRP n 
1 391 GLU n 
1 392 ARG n 
1 393 ILE n 
1 394 ILE n 
1 395 ALA n 
1 396 ALA n 
1 397 GLY n 
1 398 SER n 
1 399 ARG n 
1 400 GLN n 
1 401 ASN n 
1 402 ALA n 
1 403 HIS n 
1 404 PHE n 
1 405 SER n 
1 406 THR n 
1 407 MET n 
1 408 GLU n 
1 409 TRP n 
1 410 PRO n 
1 411 ILE n 
1 412 ASP n 
1 413 GLY n 
1 414 GLY n 
1 415 THR n 
1 416 SER n 
1 417 LEU n 
1 418 THR n 
1 419 PRO n 
1 420 ALA n 
1 421 PRO n 
1 422 PRO n 
1 423 GLN n 
1 424 ARG n 
1 425 ASP n 
1 426 LEU n 
1 427 LEU n 
1 428 LEU n 
1 429 THR n 
1 430 GLY n 
1 431 HIS n 
1 432 GLU n 
1 433 ASP n 
1 434 GLY n 
1 435 THR n 
1 436 VAL n 
1 437 ARG n 
1 438 PHE n 
1 439 TRP n 
1 440 ASP n 
1 441 ALA n 
1 442 SER n 
1 443 GLY n 
1 444 VAL n 
1 445 CYS n 
1 446 LEU n 
1 447 ARG n 
1 448 LEU n 
1 449 LEU n 
1 450 TYR n 
1 451 LYS n 
1 452 LEU n 
1 453 SER n 
1 454 THR n 
1 455 VAL n 
1 456 ARG n 
1 457 VAL n 
1 458 PHE n 
1 459 LEU n 
1 460 THR n 
1 461 ASP n 
1 462 THR n 
1 463 ASP n 
1 464 PRO n 
1 465 ASN n 
1 466 GLU n 
1 467 ASN n 
1 468 PHE n 
1 469 SER n 
1 470 ALA n 
1 471 GLN n 
1 472 GLY n 
1 473 GLU n 
1 474 ASP n 
1 475 GLU n 
1 476 TRP n 
1 477 PRO n 
1 478 PRO n 
1 479 LEU n 
1 480 ARG n 
1 481 LYS n 
1 482 VAL n 
1 483 GLY n 
1 484 SER n 
1 485 PHE n 
1 486 ASP n 
1 487 PRO n 
1 488 TYR n 
1 489 SER n 
1 490 ASP n 
1 491 ASP n 
1 492 PRO n 
1 493 ARG n 
1 494 LEU n 
1 495 GLY n 
1 496 ILE n 
1 497 GLN n 
1 498 LYS n 
1 499 ILE n 
1 500 PHE n 
1 501 LEU n 
1 502 CYS n 
1 503 LYS n 
1 504 TYR n 
1 505 SER n 
1 506 GLY n 
1 507 TYR n 
1 508 LEU n 
1 509 ALA n 
1 510 VAL n 
1 511 ALA n 
1 512 GLY n 
1 513 THR n 
1 514 ALA n 
1 515 GLY n 
1 516 GLN n 
1 517 VAL n 
1 518 LEU n 
1 519 VAL n 
1 520 LEU n 
1 521 GLU n 
1 522 LEU n 
1 523 ASN n 
1 524 ASP n 
1 525 GLU n 
1 526 ALA n 
1 527 ALA n 
1 528 GLU n 
1 529 GLN n 
1 530 ALA n 
1 531 VAL n 
1 532 GLU n 
1 533 GLN n 
1 534 VAL n 
1 535 GLU n 
1 536 ALA n 
1 537 ASP n 
1 538 LEU n 
1 539 LEU n 
1 540 GLN n 
1 541 ASP n 
1 542 GLN n 
1 543 GLU n 
1 544 GLY n 
1 545 TYR n 
1 546 ARG n 
1 547 TRP n 
1 548 LYS n 
1 549 GLY n 
1 550 HIS n 
1 551 GLU n 
1 552 ARG n 
1 553 LEU n 
1 554 ALA n 
1 555 ALA n 
1 556 ARG n 
1 557 SER n 
1 558 GLY n 
1 559 PRO n 
1 560 VAL n 
1 561 ARG n 
1 562 PHE n 
1 563 GLU n 
1 564 PRO n 
1 565 GLY n 
1 566 PHE n 
1 567 GLN n 
1 568 PRO n 
1 569 PHE n 
1 570 VAL n 
1 571 LEU n 
1 572 VAL n 
1 573 GLN n 
1 574 CYS n 
1 575 GLN n 
1 576 PRO n 
1 577 PRO n 
1 578 ALA n 
1 579 VAL n 
1 580 VAL n 
1 581 THR n 
1 582 SER n 
1 583 LEU n 
1 584 ALA n 
1 585 LEU n 
1 586 HIS n 
1 587 SER n 
1 588 GLU n 
1 589 TRP n 
1 590 ARG n 
1 591 LEU n 
1 592 VAL n 
1 593 ALA n 
1 594 PHE n 
1 595 GLY n 
1 596 THR n 
1 597 SER n 
1 598 HIS n 
1 599 GLY n 
1 600 PHE n 
1 601 GLY n 
1 602 LEU n 
1 603 PHE n 
1 604 ASP n 
1 605 HIS n 
1 606 GLN n 
1 607 GLN n 
1 608 ARG n 
1 609 ARG n 
1 610 GLN n 
1 611 VAL n 
1 612 PHE n 
1 613 VAL n 
1 614 LYS n 
1 615 CYS n 
1 616 THR n 
1 617 LEU n 
1 618 HIS n 
1 619 PRO n 
1 620 SER n 
1 621 ASP n 
1 622 GLN n 
1 623 LEU n 
1 624 ALA n 
1 625 LEU n 
1 626 GLU n 
1 627 GLY n 
1 628 PRO n 
1 629 LEU n 
1 630 SER n 
1 631 ARG n 
1 632 VAL n 
1 633 LYS n 
1 634 SER n 
1 635 LEU n 
1 636 LYS n 
1 637 LYS n 
1 638 SER n 
1 639 LEU n 
1 640 ARG n 
1 641 GLN n 
1 642 SER n 
1 643 PHE n 
1 644 ARG n 
1 645 ARG n 
1 646 MET n 
1 647 ARG n 
1 648 ARG n 
1 649 SER n 
1 650 ARG n 
1 651 VAL n 
1 652 SER n 
1 653 SER n 
1 654 ARG n 
1 655 LYS n 
1 656 ARG n 
1 657 HIS n 
1 658 PRO n 
1 659 ALA n 
1 660 GLY n 
1 661 PRO n 
1 662 PRO n 
1 663 GLY n 
1 664 GLU n 
1 665 ALA n 
1 666 GLN n 
1 667 GLU n 
1 668 GLY n 
1 669 SER n 
1 670 ALA n 
1 671 LYS n 
1 672 ALA n 
1 673 GLU n 
1 674 ARG n 
1 675 PRO n 
1 676 GLY n 
1 677 LEU n 
1 678 GLN n 
1 679 ASN n 
1 680 MET n 
1 681 GLU n 
1 682 LEU n 
1 683 ALA n 
1 684 PRO n 
1 685 VAL n 
1 686 GLN n 
1 687 ARG n 
1 688 LYS n 
1 689 ILE n 
1 690 GLU n 
1 691 ALA n 
1 692 ARG n 
1 693 SER n 
1 694 ALA n 
1 695 GLU n 
1 696 ASP n 
1 697 SER n 
1 698 PHE n 
1 699 THR n 
1 700 GLY n 
1 701 PHE n 
1 702 VAL n 
1 703 ARG n 
1 704 THR n 
1 705 LEU n 
1 706 TYR n 
1 707 PHE n 
1 708 ALA n 
1 709 ASP n 
1 710 THR n 
1 711 TYR n 
1 712 LEU n 
1 713 LYS n 
1 714 ASP n 
1 715 SER n 
1 716 SER n 
1 717 ARG n 
1 718 HIS n 
1 719 CYS n 
1 720 PRO n 
1 721 SER n 
1 722 LEU n 
1 723 TRP n 
1 724 ALA n 
1 725 GLY n 
1 726 THR n 
1 727 ASN n 
1 728 GLY n 
1 729 GLY n 
1 730 THR n 
1 731 ILE n 
1 732 TYR n 
1 733 ALA n 
1 734 PHE n 
1 735 SER n 
1 736 LEU n 
1 737 ARG n 
1 738 VAL n 
1 739 PRO n 
1 740 PRO n 
1 741 ALA n 
1 742 GLU n 
1 743 ARG n 
1 744 ARG n 
1 745 MET n 
1 746 ASP n 
1 747 GLU n 
1 748 PRO n 
1 749 VAL n 
1 750 ARG n 
1 751 ALA n 
1 752 GLU n 
1 753 GLN n 
1 754 ALA n 
1 755 LYS n 
1 756 GLU n 
1 757 ILE n 
1 758 GLN n 
1 759 LEU n 
1 760 MET n 
1 761 HIS n 
1 762 ARG n 
1 763 ALA n 
1 764 PRO n 
1 765 VAL n 
1 766 VAL n 
1 767 GLY n 
1 768 ILE n 
1 769 LEU n 
1 770 VAL n 
1 771 LEU n 
1 772 ASP n 
1 773 GLY n 
1 774 HIS n 
1 775 SER n 
1 776 VAL n 
1 777 PRO n 
1 778 LEU n 
1 779 PRO n 
1 780 GLU n 
1 781 PRO n 
1 782 LEU n 
1 783 GLU n 
1 784 VAL n 
1 785 ALA n 
1 786 HIS n 
1 787 ASP n 
1 788 LEU n 
1 789 SER n 
1 790 LYS n 
1 791 SER n 
1 792 PRO n 
1 793 ASP n 
1 794 MET n 
1 795 GLN n 
1 796 GLY n 
1 797 SER n 
1 798 HIS n 
1 799 GLN n 
1 800 LEU n 
1 801 LEU n 
1 802 VAL n 
1 803 VAL n 
1 804 SER n 
1 805 GLU n 
1 806 GLU n 
1 807 GLN n 
1 808 PHE n 
1 809 LYS n 
1 810 VAL n 
1 811 PHE n 
1 812 THR n 
1 813 LEU n 
1 814 PRO n 
1 815 LYS n 
1 816 VAL n 
1 817 SER n 
1 818 ALA n 
1 819 LYS n 
1 820 LEU n 
1 821 LYS n 
1 822 LEU n 
1 823 LYS n 
1 824 LEU n 
1 825 THR n 
1 826 ALA n 
1 827 LEU n 
1 828 GLU n 
1 829 GLY n 
1 830 SER n 
1 831 ARG n 
1 832 VAL n 
1 833 ARG n 
1 834 ARG n 
1 835 VAL n 
1 836 SER n 
1 837 VAL n 
1 838 ALA n 
1 839 HIS n 
1 840 PHE n 
1 841 GLY n 
1 842 SER n 
1 843 ARG n 
1 844 ARG n 
1 845 ALA n 
1 846 GLU n 
1 847 ASP n 
1 848 TYR n 
1 849 GLY n 
1 850 GLU n 
1 851 HIS n 
1 852 HIS n 
1 853 LEU n 
1 854 ALA n 
1 855 VAL n 
1 856 LEU n 
1 857 THR n 
1 858 ASN n 
1 859 LEU n 
1 860 GLY n 
1 861 ASP n 
1 862 ILE n 
1 863 GLN n 
1 864 VAL n 
1 865 VAL n 
1 866 SER n 
1 867 LEU n 
1 868 PRO n 
1 869 LEU n 
1 870 LEU n 
1 871 LYS n 
1 872 PRO n 
1 873 GLN n 
1 874 VAL n 
1 875 ARG n 
1 876 TYR n 
1 877 SER n 
1 878 CYS n 
1 879 ILE n 
1 880 ARG n 
1 881 ARG n 
1 882 GLU n 
1 883 ASP n 
1 884 VAL n 
1 885 SER n 
1 886 GLY n 
1 887 ILE n 
1 888 ALA n 
1 889 SER n 
1 890 CYS n 
1 891 VAL n 
1 892 PHE n 
1 893 THR n 
1 894 LYS n 
1 895 TYR n 
1 896 GLY n 
1 897 GLN n 
1 898 GLY n 
1 899 PHE n 
1 900 TYR n 
1 901 LEU n 
1 902 ILE n 
1 903 SER n 
1 904 PRO n 
1 905 SER n 
1 906 GLU n 
1 907 PHE n 
1 908 GLU n 
1 909 ARG n 
1 910 PHE n 
1 911 SER n 
1 912 LEU n 
1 913 SER n 
1 914 THR n 
1 915 LYS n 
1 916 TRP n 
1 917 LEU n 
1 918 VAL n 
1 919 GLU n 
1 920 PRO n 
1 921 ARG n 
1 922 CYS n 
1 923 LEU n 
1 924 VAL n 
1 925 ASP n 
1 926 SER n 
1 927 ALA n 
1 928 GLU n 
1 929 THR n 
1 930 LYS n 
1 931 ASN n 
1 932 HIS n 
1 933 ARG n 
1 934 PRO n 
1 935 GLY n 
1 936 ASN n 
1 937 GLY n 
1 938 ALA n 
1 939 GLY n 
1 940 PRO n 
1 941 LYS n 
1 942 LYS n 
1 943 ALA n 
1 944 PRO n 
1 945 SER n 
1 946 ARG n 
1 947 ALA n 
1 948 ARG n 
1 949 ASN n 
1 950 SER n 
1 951 GLY n 
1 952 THR n 
1 953 GLN n 
1 954 SER n 
1 955 ASP n 
1 956 GLY n 
1 957 GLU n 
1 958 GLU n 
1 959 LYS n 
1 960 GLN n 
1 961 PRO n 
1 962 GLY n 
1 963 LEU n 
1 964 VAL n 
1 965 MET n 
1 966 GLU n 
1 967 ARG n 
1 968 GLU n 
1 969 PHE n 
1 970 THR n 
1 971 THR n 
1 972 ALA n 
1 973 SER n 
1 974 GLU n 
1 975 ASN n 
1 976 LEU n 
1 977 TYR n 
1 978 PHE n 
1 979 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   979 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 LLGL2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            SF9 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    L2GL2_HUMAN 
_struct_ref.pdbx_db_accession          Q6P1M3 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RERLKRDLFQFNKTVEHGFPHQPSALGYSPSLRILAIGTRSGAIKLYGAPGVEFMGLHQENNAVTQIHLLPGQCQLVTLL
DDNSLHLWSLKVKGGASELQEDESFTLRGPPGAAPSATQITVVLPHSSCELLYLGTESGNVFVVQLPAFRALEDRTISSD
AVLQRLPEEARHRRVFEMVEALQEHPRDPNQILIGYSRGLVVIWDLQGSRVLYHFLSSQQLENIWWQRDGRLLVSCHSDG
SYCQWPVSSEAQQPEPLRSLVPYGPFPCKAITRILWLTTRQGLPFTIFQGGMPRASYGDRHCISVIHDGQQTAFDFTSRV
IGFTVLTEADPAATFDDPYALVVLAEEELVVIDLQTAGWPPVQLPYLASLHCSAITCSHHVSNIPLKLWERIIAAGSRQN
AHFSTMEWPIDGGTSLTPAPPQRDLLLTGHEDGTVRFWDASGVCLRLLYKLSTVRVFLTDTDPNENFSAQGEDEWPPLRK
VGSFDPYSDDPRLGIQKIFLCKYSGYLAVAGTAGQVLVLELNDEAAEQAVEQVEADLLQDQEGYRWKGHERLAARSGPVR
FEPGFQPFVLVQCQPPAVVTSLALHSEWRLVAFGTSHGFGLFDHQQRRQVFVKCTLHPSDQLALEGPLSRVKSLKKSLRQ
SFRRMRRSRVSSRKRHPAGPPGEAQEGSAKAERPGLQNMELAPVQRKIEARSAEDSFTGFVRTLYFADTYLKDSSRHCPS
LWAGTNGGTIYAFSLRVPPAERRMDEPVRAEQAKEIQLMHRAPVVGILVLDGHSVPLPEPLEVAHDLSKSPDMQGSHQLL
VVSEEQFKVFTLPKVSAKLKLKLTALEGSRVRRVSVAHFGSRRAEDYGEHHLAVLTNLGDIQVVSLPLLKPQVRYSCIRR
EDVSGIASCVFTKYGQGFYLISPSEFERFSLSTKWLVEPRCLVDSAETKNHRPGNGAGPKKAPSRARNSGTQSDGEEKQP
GLVMER
;
_struct_ref.pdbx_align_begin           13 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6N8P 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 967 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q6P1M3 
_struct_ref_seq.db_align_beg                  13 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  978 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       13 
_struct_ref_seq.pdbx_auth_seq_align_end       978 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6N8P MET A 1   ? UNP Q6P1M3 ? ? 'initiating methionine' 12  1  
1 6N8P GLU A 968 ? UNP Q6P1M3 ? ? 'expression tag'        979 2  
1 6N8P PHE A 969 ? UNP Q6P1M3 ? ? 'expression tag'        980 3  
1 6N8P THR A 970 ? UNP Q6P1M3 ? ? 'expression tag'        981 4  
1 6N8P THR A 971 ? UNP Q6P1M3 ? ? 'expression tag'        982 5  
1 6N8P ALA A 972 ? UNP Q6P1M3 ? ? 'expression tag'        983 6  
1 6N8P SER A 973 ? UNP Q6P1M3 ? ? 'expression tag'        984 7  
1 6N8P GLU A 974 ? UNP Q6P1M3 ? ? 'expression tag'        985 8  
1 6N8P ASN A 975 ? UNP Q6P1M3 ? ? 'expression tag'        986 9  
1 6N8P LEU A 976 ? UNP Q6P1M3 ? ? 'expression tag'        987 10 
1 6N8P TYR A 977 ? UNP Q6P1M3 ? ? 'expression tag'        988 11 
1 6N8P PHE A 978 ? UNP Q6P1M3 ? ? 'expression tag'        989 12 
1 6N8P GLN A 979 ? UNP Q6P1M3 ? ? 'expression tag'        990 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6N8P 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.70 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         54.47 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '19.8 % PEG 3350, 0.29 M Na2SO4, 0.1 M bis-tris propane pH 7.5, 3% methanol' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-07-25 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0055 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRL BEAMLINE BL12-2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0055 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL12-2 
_diffrn_source.pdbx_synchrotron_site       SSRL 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6N8P 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                3.19 
_reflns.d_resolution_low                 39.35 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       20282 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.8 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.5 
_reflns.pdbx_Rmerge_I_obs                0.419 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            5.9 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  ? 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.972 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  3.19 
_reflns_shell.d_res_low                   3.41 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         1.7 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           3625 
_reflns_shell.percent_possible_all        99.5 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                2.097 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             6.8 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.495 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6N8P 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            3.193 
_refine.ls_d_res_low                             39.349 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     20221 
_refine.ls_number_reflns_R_free                  1989 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.66 
_refine.ls_percent_reflns_R_free                 9.84 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2081 
_refine.ls_R_factor_R_free                       0.2497 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2036 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.33 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 25.21 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.46 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6452 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               6453 
_refine_hist.d_res_high                       3.193 
_refine_hist.d_res_low                        39.349 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.002  ? 6624 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.479  ? 9030 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 11.126 ? 3921 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.042  ? 1009 ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004  ? 1173 ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 3.1934 3.2732  . . 141 1269 98.00  . . . 0.3834 . 0.3266 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2732 3.3617  . . 137 1267 100.00 . . . 0.3304 . 0.2673 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3617 3.4605  . . 147 1291 100.00 . . . 0.3166 . 0.2581 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4605 3.5722  . . 123 1295 100.00 . . . 0.3198 . 0.2473 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5722 3.6997  . . 155 1266 100.00 . . . 0.2616 . 0.2354 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6997 3.8478  . . 132 1299 100.00 . . . 0.3168 . 0.2217 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8478 4.0227  . . 150 1276 100.00 . . . 0.2740 . 0.2144 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0227 4.2346  . . 139 1305 100.00 . . . 0.2255 . 0.1902 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2346 4.4995  . . 149 1278 100.00 . . . 0.2094 . 0.1672 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.4995 4.8464  . . 131 1309 100.00 . . . 0.1923 . 0.1627 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.8464 5.3330  . . 146 1315 100.00 . . . 0.2331 . 0.1628 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.3330 6.1022  . . 138 1324 100.00 . . . 0.2425 . 0.1935 . . . . . . . . . . 
'X-RAY DIFFRACTION' 6.1022 7.6788  . . 141 1332 100.00 . . . 0.2565 . 0.2091 . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.6788 39.3525 . . 160 1406 99.00  . . . 0.2019 . 0.1882 . . . . . . . . . . 
# 
_struct.entry_id                     6N8P 
_struct.title                        
'Crystal structure of the human cell polarity protein Lethal Giant Larvae 2 (Lgl2). Unphosphorylated, crystal form 1.' 
_struct.pdbx_descriptor              'Lethal(2) giant larvae protein homolog 2' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6N8P 
_struct_keywords.text            'Lgl, Polarity, beta propeller, LIPID BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'LIPID BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ALA A 115 ? THR A 119 ? ALA A 126 THR A 130 5 ? 5  
HELX_P HELX_P2  AA2 SER A 159 ? GLN A 165 ? SER A 170 GLN A 176 1 ? 7  
HELX_P HELX_P3  AA3 ARG A 166 ? LEU A 167 ? ARG A 177 LEU A 178 5 ? 2  
HELX_P HELX_P4  AA4 PRO A 168 ? ARG A 172 ? PRO A 179 ARG A 183 5 ? 5  
HELX_P HELX_P5  AA5 SER A 297 ? ARG A 301 ? SER A 308 ARG A 312 5 ? 5  
HELX_P HELX_P6  AA6 PRO A 386 ? GLN A 400 ? PRO A 397 GLN A 411 1 ? 15 
HELX_P HELX_P7  AA7 VAL A 455 ? PHE A 458 ? VAL A 466 PHE A 469 5 ? 4  
HELX_P HELX_P8  AA8 ASP A 491 ? LEU A 494 ? ASP A 502 LEU A 505 5 ? 4  
HELX_P HELX_P9  AA9 PRO A 740 ? ARG A 744 ? PRO A 751 ARG A 755 5 ? 5  
HELX_P HELX_P10 AB1 ASP A 787 ? SER A 791 ? ASP A 798 SER A 802 5 ? 5  
HELX_P HELX_P11 AB2 LEU A 824 ? GLY A 829 ? LEU A 835 GLY A 840 1 ? 6  
HELX_P HELX_P12 AB3 ASP A 883 ? SER A 889 ? ASP A 894 SER A 900 1 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 147 A . ? LEU 158 A PRO 148 A ? PRO 159 A 1 -2.36 
2 TRP 476 A . ? TRP 487 A PRO 477 A ? PRO 488 A 1 -1.23 
3 GLN 575 A . ? GLN 586 A PRO 576 A ? PRO 587 A 1 2.15  
4 LEU 813 A . ? LEU 824 A PRO 814 A ? PRO 825 A 1 2.82  
5 LEU 867 A . ? LEU 878 A PRO 868 A ? PRO 879 A 1 -3.07 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 4 ? 
AA4 ? 4 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
AA7 ? 5 ? 
AA8 ? 3 ? 
AA9 ? 4 ? 
AB1 ? 2 ? 
AB2 ? 5 ? 
AB3 ? 2 ? 
AB4 ? 4 ? 
AB5 ? 4 ? 
AB6 ? 4 ? 
AB7 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA4 3 4 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA7 4 5 ? parallel      
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB2 4 5 ? parallel      
AB3 1 2 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
AB7 1 2 ? anti-parallel 
AB7 2 3 ? anti-parallel 
AB7 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ASN A 13  ? GLY A 19  ? ASN A 24  GLY A 30  
AA1 2 GLU A 906 ? SER A 911 ? GLU A 917 SER A 922 
AA1 3 GLN A 897 ? SER A 903 ? GLN A 908 SER A 914 
AA1 4 CYS A 890 ? PHE A 892 ? CYS A 901 PHE A 903 
AA2 1 PRO A 24  ? SER A 30  ? PRO A 35  SER A 41  
AA2 2 ILE A 35  ? THR A 40  ? ILE A 46  THR A 51  
AA2 3 ALA A 44  ? TYR A 48  ? ALA A 55  TYR A 59  
AA2 4 GLU A 54  ? LEU A 58  ? GLU A 65  LEU A 69  
AA3 1 VAL A 65  ? LEU A 70  ? VAL A 76  LEU A 81  
AA3 2 GLN A 76  ? LEU A 81  ? GLN A 87  LEU A 92  
AA3 3 SER A 85  ? VAL A 93  ? SER A 96  VAL A 104 
AA3 4 SER A 98  ? THR A 107 ? SER A 109 THR A 118 
AA4 1 ILE A 121 ? PRO A 126 ? ILE A 132 PRO A 137 
AA4 2 LEU A 132 ? THR A 137 ? LEU A 143 THR A 148 
AA4 3 VAL A 142 ? GLN A 146 ? VAL A 153 GLN A 157 
AA4 4 ARG A 151 ? ILE A 158 ? ARG A 162 ILE A 169 
AA5 1 VAL A 180 ? HIS A 186 ? VAL A 191 HIS A 197 
AA5 2 ASP A 189 ? TYR A 197 ? ASP A 200 TYR A 208 
AA5 3 LEU A 201 ? ASP A 206 ? LEU A 212 ASP A 217 
AA5 4 ARG A 211 ? LEU A 217 ? ARG A 222 LEU A 228 
AA6 1 LEU A 222 ? TRP A 227 ? LEU A 233 TRP A 238 
AA6 2 LEU A 233 ? HIS A 238 ? LEU A 244 HIS A 249 
AA6 3 TYR A 243 ? PRO A 247 ? TYR A 254 PRO A 258 
AA6 4 ARG A 259 ? LEU A 261 ? ARG A 270 LEU A 272 
AA7 1 ILE A 272 ? LEU A 278 ? ILE A 283 LEU A 289 
AA7 2 PHE A 286 ? GLY A 291 ? PHE A 297 GLY A 302 
AA7 3 HIS A 302 ? HIS A 308 ? HIS A 313 HIS A 319 
AA7 4 GLN A 311 ? PHE A 317 ? GLN A 322 PHE A 328 
AA7 5 LEU A 479 ? LYS A 481 ? LEU A 490 LYS A 492 
AA8 1 VAL A 321 ? THR A 328 ? VAL A 332 THR A 339 
AA8 2 PRO A 339 ? ALA A 346 ? PRO A 350 ALA A 357 
AA8 3 LEU A 350 ? ASP A 354 ? LEU A 361 ASP A 365 
AA9 1 ILE A 376 ? VAL A 382 ? ILE A 387 VAL A 393 
AA9 2 LEU A 426 ? HIS A 431 ? LEU A 437 HIS A 442 
AA9 3 THR A 435 ? ASP A 440 ? THR A 446 ASP A 451 
AA9 4 ARG A 447 ? SER A 453 ? ARG A 458 SER A 464 
AB1 1 THR A 415 ? SER A 416 ? THR A 426 SER A 427 
AB1 2 CYS A 922 ? LEU A 923 ? CYS A 933 LEU A 934 
AB2 1 ILE A 496 ? LEU A 501 ? ILE A 507 LEU A 512 
AB2 2 TYR A 507 ? GLY A 512 ? TYR A 518 GLY A 523 
AB2 3 GLN A 516 ? ASN A 523 ? GLN A 527 ASN A 534 
AB2 4 GLY A 565 ? GLN A 575 ? GLY A 576 GLN A 586 
AB2 5 GLU A 532 ? ASP A 537 ? GLU A 543 ASP A 548 
AB3 1 ALA A 527 ? GLN A 529 ? ALA A 538 GLN A 540 
AB3 2 VAL A 560 ? PHE A 562 ? VAL A 571 PHE A 573 
AB4 1 SER A 582 ? HIS A 586 ? SER A 593 HIS A 597 
AB4 2 LEU A 591 ? GLY A 595 ? LEU A 602 GLY A 606 
AB4 3 GLY A 599 ? ASP A 604 ? GLY A 610 ASP A 615 
AB4 4 ARG A 609 ? CYS A 615 ? ARG A 620 CYS A 626 
AB5 1 VAL A 702 ? THR A 710 ? VAL A 713 THR A 721 
AB5 2 CYS A 719 ? THR A 726 ? CYS A 730 THR A 737 
AB5 3 THR A 730 ? ARG A 737 ? THR A 741 ARG A 748 
AB5 4 ARG A 750 ? GLN A 758 ? ARG A 761 GLN A 769 
AB6 1 VAL A 765 ? LEU A 771 ? VAL A 776 LEU A 782 
AB6 2 GLN A 799 ? SER A 804 ? GLN A 810 SER A 815 
AB6 3 GLN A 807 ? THR A 812 ? GLN A 818 THR A 823 
AB6 4 SER A 817 ? LYS A 823 ? SER A 828 LYS A 834 
AB7 1 VAL A 832 ? HIS A 839 ? VAL A 843 HIS A 850 
AB7 2 HIS A 851 ? THR A 857 ? HIS A 862 THR A 868 
AB7 3 ILE A 862 ? SER A 866 ? ILE A 873 SER A 877 
AB7 4 PRO A 872 ? ARG A 875 ? PRO A 883 ARG A 886 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N HIS A 18  ? N HIS A 29  O PHE A 907 ? O PHE A 918 
AA1 2 3 O GLU A 908 ? O GLU A 919 N TYR A 900 ? N TYR A 911 
AA1 3 4 O PHE A 899 ? O PHE A 910 N VAL A 891 ? N VAL A 902 
AA2 1 2 N GLY A 28  ? N GLY A 39  O ALA A 37  ? O ALA A 48  
AA2 2 3 N LEU A 36  ? N LEU A 47  O TYR A 48  ? O TYR A 59  
AA2 3 4 N LEU A 47  ? N LEU A 58  O PHE A 55  ? O PHE A 66  
AA3 1 2 N THR A 66  ? N THR A 77  O LEU A 80  ? O LEU A 91  
AA3 2 3 N LEU A 77  ? N LEU A 88  O TRP A 89  ? O TRP A 100 
AA3 3 4 N LEU A 86  ? N LEU A 97  O PHE A 106 ? O PHE A 117 
AA4 1 2 N THR A 122 ? N THR A 133 O GLY A 136 ? O GLY A 147 
AA4 2 3 N LEU A 135 ? N LEU A 146 O PHE A 143 ? O PHE A 154 
AA4 3 4 N VAL A 142 ? N VAL A 153 O ILE A 158 ? O ILE A 169 
AA5 1 2 N GLN A 184 ? N GLN A 195 O LEU A 194 ? O LEU A 205 
AA5 2 3 N ILE A 193 ? N ILE A 204 O TRP A 205 ? O TRP A 216 
AA5 3 4 N ASP A 206 ? N ASP A 217 O ARG A 211 ? O ARG A 222 
AA6 1 2 N GLU A 223 ? N GLU A 234 O CYS A 237 ? O CYS A 248 
AA6 2 3 N LEU A 234 ? N LEU A 245 O TRP A 246 ? O TRP A 257 
AA6 3 4 N TYR A 243 ? N TYR A 254 O LEU A 261 ? O LEU A 272 
AA7 1 2 N LEU A 278 ? N LEU A 289 O PHE A 286 ? O PHE A 297 
AA7 2 3 N PHE A 289 ? N PHE A 300 O SER A 305 ? O SER A 316 
AA7 3 4 N HIS A 302 ? N HIS A 313 O PHE A 317 ? O PHE A 328 
AA7 4 5 N ASP A 316 ? N ASP A 327 O ARG A 480 ? O ARG A 491 
AA8 1 2 N THR A 325 ? N THR A 336 O VAL A 343 ? O VAL A 354 
AA8 2 3 N VAL A 344 ? N VAL A 355 O VAL A 351 ? O VAL A 362 
AA9 1 2 N HIS A 380 ? N HIS A 391 O LEU A 428 ? O LEU A 439 
AA9 2 3 N LEU A 427 ? N LEU A 438 O TRP A 439 ? O TRP A 450 
AA9 3 4 N VAL A 436 ? N VAL A 447 O LEU A 452 ? O LEU A 463 
AB1 1 2 N THR A 415 ? N THR A 426 O LEU A 923 ? O LEU A 934 
AB2 1 2 N GLN A 497 ? N GLN A 508 O ALA A 511 ? O ALA A 522 
AB2 2 3 N LEU A 508 ? N LEU A 519 O LEU A 520 ? O LEU A 531 
AB2 3 4 N GLU A 521 ? N GLU A 532 O GLN A 567 ? O GLN A 578 
AB2 4 5 O LEU A 571 ? O LEU A 582 N GLU A 532 ? N GLU A 543 
AB3 1 2 N ALA A 527 ? N ALA A 538 O PHE A 562 ? O PHE A 573 
AB4 1 2 N ALA A 584 ? N ALA A 595 O ALA A 593 ? O ALA A 604 
AB4 2 3 N VAL A 592 ? N VAL A 603 O PHE A 603 ? O PHE A 614 
AB4 3 4 N ASP A 604 ? N ASP A 615 O ARG A 609 ? O ARG A 620 
AB5 1 2 N ARG A 703 ? N ARG A 714 O GLY A 725 ? O GLY A 736 
AB5 2 3 N ALA A 724 ? N ALA A 735 O TYR A 732 ? O TYR A 743 
AB5 3 4 N ALA A 733 ? N ALA A 744 O ALA A 754 ? O ALA A 765 
AB6 1 2 N LEU A 769 ? N LEU A 780 O LEU A 801 ? O LEU A 812 
AB6 2 3 N LEU A 800 ? N LEU A 811 O PHE A 811 ? O PHE A 822 
AB6 3 4 N PHE A 808 ? N PHE A 819 O LEU A 822 ? O LEU A 833 
AB7 1 2 N ARG A 833 ? N ARG A 844 O LEU A 856 ? O LEU A 867 
AB7 2 3 N VAL A 855 ? N VAL A 866 O GLN A 863 ? O GLN A 874 
AB7 3 4 N VAL A 864 ? N VAL A 875 O GLN A 873 ? O GLN A 884 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    A 
_struct_site.pdbx_auth_comp_id    CL 
_struct_site.pdbx_auth_seq_id     1001 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    3 
_struct_site.details              'binding site for residue CL A 1001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 3 LYS A 503 ? LYS A 514 . ? 1_555 ? 
2 AC1 3 LYS A 790 ? LYS A 801 . ? 1_555 ? 
3 AC1 3 TYR A 895 ? TYR A 906 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6N8P 
_atom_sites.fract_transf_matrix[1][1]   0.012707 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008440 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007896 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . ARG A 1 7   ? -13.268 40.770  30.117  1.00 104.04 ? 18   ARG A N   1 
ATOM   2    C  CA  . ARG A 1 7   ? -13.263 40.259  31.483  1.00 100.92 ? 18   ARG A CA  1 
ATOM   3    C  C   . ARG A 1 7   ? -11.838 40.144  32.021  1.00 93.13  ? 18   ARG A C   1 
ATOM   4    O  O   . ARG A 1 7   ? -11.437 40.902  32.904  1.00 99.26  ? 18   ARG A O   1 
ATOM   5    C  CB  . ARG A 1 7   ? -13.967 38.901  31.550  1.00 93.98  ? 18   ARG A CB  1 
ATOM   6    N  N   . ASP A 1 8   ? -11.078 39.191  31.478  1.00 150.97 ? 19   ASP A N   1 
ATOM   7    C  CA  . ASP A 1 8   ? -9.701  38.949  31.889  1.00 130.54 ? 19   ASP A CA  1 
ATOM   8    C  C   . ASP A 1 8   ? -8.702  39.845  31.163  1.00 118.19 ? 19   ASP A C   1 
ATOM   9    O  O   . ASP A 1 8   ? -7.524  39.486  31.057  1.00 96.52  ? 19   ASP A O   1 
ATOM   10   C  CB  . ASP A 1 8   ? -9.338  37.477  31.677  1.00 116.28 ? 19   ASP A CB  1 
ATOM   11   N  N   . LEU A 1 9   ? -9.146  40.994  30.655  1.00 129.82 ? 20   LEU A N   1 
ATOM   12   C  CA  . LEU A 1 9   ? -8.232  41.935  30.020  1.00 129.76 ? 20   LEU A CA  1 
ATOM   13   C  C   . LEU A 1 9   ? -8.653  43.388  30.188  1.00 134.93 ? 20   LEU A C   1 
ATOM   14   O  O   . LEU A 1 9   ? -7.968  44.268  29.659  1.00 128.91 ? 20   LEU A O   1 
ATOM   15   C  CB  . LEU A 1 9   ? -8.078  41.595  28.524  1.00 115.62 ? 20   LEU A CB  1 
ATOM   16   C  CG  . LEU A 1 9   ? -9.332  41.554  27.648  1.00 90.63  ? 20   LEU A CG  1 
ATOM   17   C  CD1 . LEU A 1 9   ? -9.454  42.831  26.846  1.00 85.28  ? 20   LEU A CD1 1 
ATOM   18   C  CD2 . LEU A 1 9   ? -9.312  40.344  26.726  1.00 77.84  ? 20   LEU A CD2 1 
ATOM   19   N  N   . PHE A 1 10  ? -9.738  43.674  30.906  1.00 139.59 ? 21   PHE A N   1 
ATOM   20   C  CA  . PHE A 1 10  ? -10.177 45.032  31.198  1.00 139.27 ? 21   PHE A CA  1 
ATOM   21   C  C   . PHE A 1 10  ? -10.337 45.182  32.703  1.00 136.54 ? 21   PHE A C   1 
ATOM   22   O  O   . PHE A 1 10  ? -11.000 44.358  33.342  1.00 136.54 ? 21   PHE A O   1 
ATOM   23   C  CB  . PHE A 1 10  ? -11.504 45.355  30.500  1.00 140.78 ? 21   PHE A CB  1 
ATOM   24   C  CG  . PHE A 1 10  ? -11.393 45.489  29.009  1.00 138.03 ? 21   PHE A CG  1 
ATOM   25   C  CD1 . PHE A 1 10  ? -10.365 46.219  28.438  1.00 133.46 ? 21   PHE A CD1 1 
ATOM   26   C  CD2 . PHE A 1 10  ? -12.321 44.885  28.178  1.00 134.53 ? 21   PHE A CD2 1 
ATOM   27   C  CE1 . PHE A 1 10  ? -10.266 46.344  27.067  1.00 128.11 ? 21   PHE A CE1 1 
ATOM   28   C  CE2 . PHE A 1 10  ? -12.226 45.005  26.807  1.00 131.42 ? 21   PHE A CE2 1 
ATOM   29   C  CZ  . PHE A 1 10  ? -11.198 45.735  26.250  1.00 129.12 ? 21   PHE A CZ  1 
ATOM   30   N  N   . GLN A 1 11  ? -9.738  46.233  33.264  1.00 135.20 ? 22   GLN A N   1 
ATOM   31   C  CA  . GLN A 1 11  ? -9.862  46.512  34.691  1.00 128.42 ? 22   GLN A CA  1 
ATOM   32   C  C   . GLN A 1 11  ? -9.397  47.928  35.009  1.00 129.11 ? 22   GLN A C   1 
ATOM   33   O  O   . GLN A 1 11  ? -8.258  48.296  34.704  1.00 136.58 ? 22   GLN A O   1 
ATOM   34   C  CB  . GLN A 1 11  ? -9.060  45.500  35.512  1.00 131.75 ? 22   GLN A CB  1 
ATOM   35   C  CG  . GLN A 1 11  ? -9.441  45.457  36.982  1.00 129.16 ? 22   GLN A CG  1 
ATOM   36   C  CD  . GLN A 1 11  ? -8.567  44.512  37.781  1.00 125.49 ? 22   GLN A CD  1 
ATOM   37   O  OE1 . GLN A 1 11  ? -7.348  44.492  37.620  1.00 124.51 ? 22   GLN A OE1 1 
ATOM   38   N  NE2 . GLN A 1 11  ? -9.188  43.717  38.645  1.00 119.50 ? 22   GLN A NE2 1 
ATOM   39   N  N   . PHE A 1 12  ? -10.265 48.725  35.626  1.00 122.66 ? 23   PHE A N   1 
ATOM   40   C  CA  . PHE A 1 12  ? -9.960  50.107  35.976  1.00 122.44 ? 23   PHE A CA  1 
ATOM   41   C  C   . PHE A 1 12  ? -9.857  50.235  37.489  1.00 128.65 ? 23   PHE A C   1 
ATOM   42   O  O   . PHE A 1 12  ? -10.796 49.885  38.211  1.00 132.58 ? 23   PHE A O   1 
ATOM   43   C  CB  . PHE A 1 12  ? -11.024 51.059  35.433  1.00 116.00 ? 23   PHE A CB  1 
ATOM   44   C  CG  . PHE A 1 12  ? -11.019 52.409  36.091  1.00 113.40 ? 23   PHE A CG  1 
ATOM   45   C  CD1 . PHE A 1 12  ? -9.972  53.291  35.883  1.00 116.18 ? 23   PHE A CD1 1 
ATOM   46   C  CD2 . PHE A 1 12  ? -12.061 52.796  36.916  1.00 116.20 ? 23   PHE A CD2 1 
ATOM   47   C  CE1 . PHE A 1 12  ? -9.962  54.532  36.490  1.00 116.31 ? 23   PHE A CE1 1 
ATOM   48   C  CE2 . PHE A 1 12  ? -12.059 54.037  37.524  1.00 120.56 ? 23   PHE A CE2 1 
ATOM   49   C  CZ  . PHE A 1 12  ? -11.008 54.906  37.309  1.00 117.52 ? 23   PHE A CZ  1 
ATOM   50   N  N   . ASN A 1 13  ? -8.718  50.741  37.960  1.00 131.35 ? 24   ASN A N   1 
ATOM   51   C  CA  . ASN A 1 13  ? -8.499  50.990  39.376  1.00 135.06 ? 24   ASN A CA  1 
ATOM   52   C  C   . ASN A 1 13  ? -7.663  52.251  39.534  1.00 127.55 ? 24   ASN A C   1 
ATOM   53   O  O   . ASN A 1 13  ? -6.900  52.625  38.639  1.00 106.39 ? 24   ASN A O   1 
ATOM   54   C  CB  . ASN A 1 13  ? -7.801  49.809  40.065  1.00 134.82 ? 24   ASN A CB  1 
ATOM   55   C  CG  . ASN A 1 13  ? -8.531  48.497  39.858  1.00 138.73 ? 24   ASN A CG  1 
ATOM   56   O  OD1 . ASN A 1 13  ? -8.239  47.753  38.922  1.00 138.32 ? 24   ASN A OD1 1 
ATOM   57   N  ND2 . ASN A 1 13  ? -9.489  48.207  40.731  1.00 137.29 ? 24   ASN A ND2 1 
ATOM   58   N  N   . LYS A 1 14  ? -7.818  52.905  40.681  1.00 145.14 ? 25   LYS A N   1 
ATOM   59   C  CA  . LYS A 1 14  ? -7.041  54.101  40.972  1.00 142.63 ? 25   LYS A CA  1 
ATOM   60   C  C   . LYS A 1 14  ? -5.582  53.742  41.234  1.00 130.73 ? 25   LYS A C   1 
ATOM   61   O  O   . LYS A 1 14  ? -5.266  52.678  41.774  1.00 129.79 ? 25   LYS A O   1 
ATOM   62   C  CB  . LYS A 1 14  ? -7.622  54.835  42.181  1.00 143.31 ? 25   LYS A CB  1 
ATOM   63   C  CG  . LYS A 1 14  ? -8.999  55.434  41.950  1.00 129.30 ? 25   LYS A CG  1 
ATOM   64   C  CD  . LYS A 1 14  ? -8.936  56.598  40.976  1.00 110.53 ? 25   LYS A CD  1 
ATOM   65   C  CE  . LYS A 1 14  ? -10.296 57.252  40.809  1.00 96.39  ? 25   LYS A CE  1 
ATOM   66   N  NZ  . LYS A 1 14  ? -10.217 58.486  39.980  1.00 89.96  ? 25   LYS A NZ  1 
ATOM   67   N  N   . THR A 1 15  ? -4.686  54.646  40.840  1.00 115.03 ? 26   THR A N   1 
ATOM   68   C  CA  . THR A 1 15  ? -3.263  54.456  41.095  1.00 111.67 ? 26   THR A CA  1 
ATOM   69   C  C   . THR A 1 15  ? -2.721  55.588  41.959  1.00 101.55 ? 26   THR A C   1 
ATOM   70   O  O   . THR A 1 15  ? -3.304  55.919  42.996  1.00 102.16 ? 26   THR A O   1 
ATOM   71   C  CB  . THR A 1 15  ? -2.473  54.368  39.787  1.00 114.58 ? 26   THR A CB  1 
ATOM   72   O  OG1 . THR A 1 15  ? -2.423  55.660  39.171  1.00 122.93 ? 26   THR A OG1 1 
ATOM   73   C  CG2 . THR A 1 15  ? -3.123  53.377  38.831  1.00 120.00 ? 26   THR A CG2 1 
ATOM   74   N  N   . VAL A 1 16  ? -1.614  56.191  41.537  1.00 93.17  ? 27   VAL A N   1 
ATOM   75   C  CA  . VAL A 1 16  ? -0.944  57.221  42.314  1.00 96.34  ? 27   VAL A CA  1 
ATOM   76   C  C   . VAL A 1 16  ? -1.008  58.548  41.564  1.00 78.21  ? 27   VAL A C   1 
ATOM   77   O  O   . VAL A 1 16  ? -1.477  58.630  40.428  1.00 72.19  ? 27   VAL A O   1 
ATOM   78   C  CB  . VAL A 1 16  ? 0.512   56.842  42.640  1.00 105.17 ? 27   VAL A CB  1 
ATOM   79   C  CG1 . VAL A 1 16  ? 0.551   55.584  43.489  1.00 114.21 ? 27   VAL A CG1 1 
ATOM   80   C  CG2 . VAL A 1 16  ? 1.303   56.654  41.358  1.00 94.06  ? 27   VAL A CG2 1 
ATOM   81   N  N   . GLU A 1 17  ? -0.519  59.597  42.219  1.00 65.95  ? 28   GLU A N   1 
ATOM   82   C  CA  . GLU A 1 17  ? -0.529  60.949  41.686  1.00 60.28  ? 28   GLU A CA  1 
ATOM   83   C  C   . GLU A 1 17  ? 0.902   61.434  41.488  1.00 65.36  ? 28   GLU A C   1 
ATOM   84   O  O   . GLU A 1 17  ? 1.824   61.000  42.186  1.00 61.80  ? 28   GLU A O   1 
ATOM   85   C  CB  . GLU A 1 17  ? -1.286  61.898  42.622  1.00 65.56  ? 28   GLU A CB  1 
ATOM   86   C  CG  . GLU A 1 17  ? -2.683  61.411  42.980  1.00 76.11  ? 28   GLU A CG  1 
ATOM   87   C  CD  . GLU A 1 17  ? -3.281  62.151  44.160  1.00 94.20  ? 28   GLU A CD  1 
ATOM   88   O  OE1 . GLU A 1 17  ? -2.556  62.943  44.799  1.00 99.77  ? 28   GLU A OE1 1 
ATOM   89   O  OE2 . GLU A 1 17  ? -4.477  61.938  44.452  1.00 97.08  ? 28   GLU A OE2 1 
ATOM   90   N  N   . HIS A 1 18  ? 1.079   62.339  40.529  1.00 62.14  ? 29   HIS A N   1 
ATOM   91   C  CA  . HIS A 1 18  ? 2.392   62.843  40.153  1.00 51.82  ? 29   HIS A CA  1 
ATOM   92   C  C   . HIS A 1 18  ? 2.420   64.360  40.254  1.00 53.29  ? 29   HIS A C   1 
ATOM   93   O  O   . HIS A 1 18  ? 1.423   65.030  39.966  1.00 63.61  ? 29   HIS A O   1 
ATOM   94   C  CB  . HIS A 1 18  ? 2.756   62.419  38.728  1.00 60.72  ? 29   HIS A CB  1 
ATOM   95   C  CG  . HIS A 1 18  ? 2.720   60.940  38.510  1.00 72.87  ? 29   HIS A CG  1 
ATOM   96   N  ND1 . HIS A 1 18  ? 2.992   60.035  39.513  1.00 76.74  ? 29   HIS A ND1 1 
ATOM   97   C  CD2 . HIS A 1 18  ? 2.438   60.208  37.407  1.00 73.79  ? 29   HIS A CD2 1 
ATOM   98   C  CE1 . HIS A 1 18  ? 2.880   58.808  39.036  1.00 76.69  ? 29   HIS A CE1 1 
ATOM   99   N  NE2 . HIS A 1 18  ? 2.547   58.885  37.761  1.00 73.71  ? 29   HIS A NE2 1 
ATOM   100  N  N   . GLY A 1 19  ? 3.562   64.896  40.656  1.00 53.50  ? 30   GLY A N   1 
ATOM   101  C  CA  . GLY A 1 19  ? 3.776   66.324  40.695  1.00 52.81  ? 30   GLY A CA  1 
ATOM   102  C  C   . GLY A 1 19  ? 3.798   66.881  42.105  1.00 57.98  ? 30   GLY A C   1 
ATOM   103  O  O   . GLY A 1 19  ? 3.958   66.163  43.096  1.00 57.56  ? 30   GLY A O   1 
ATOM   104  N  N   . PHE A 1 20  ? 3.631   68.198  42.184  1.00 60.68  ? 31   PHE A N   1 
ATOM   105  C  CA  . PHE A 1 20  ? 3.669   68.951  43.433  1.00 68.58  ? 31   PHE A CA  1 
ATOM   106  C  C   . PHE A 1 20  ? 2.268   69.044  44.028  1.00 64.02  ? 31   PHE A C   1 
ATOM   107  O  O   . PHE A 1 20  ? 1.320   69.378  43.308  1.00 60.47  ? 31   PHE A O   1 
ATOM   108  C  CB  . PHE A 1 20  ? 4.229   70.346  43.194  1.00 59.17  ? 31   PHE A CB  1 
ATOM   109  C  CG  . PHE A 1 20  ? 4.457   71.134  44.447  1.00 46.33  ? 31   PHE A CG  1 
ATOM   110  C  CD1 . PHE A 1 20  ? 5.509   70.825  45.291  1.00 45.18  ? 31   PHE A CD1 1 
ATOM   111  C  CD2 . PHE A 1 20  ? 3.629   72.193  44.775  1.00 46.90  ? 31   PHE A CD2 1 
ATOM   112  C  CE1 . PHE A 1 20  ? 5.725   71.551  46.443  1.00 54.27  ? 31   PHE A CE1 1 
ATOM   113  C  CE2 . PHE A 1 20  ? 3.841   72.923  45.926  1.00 46.28  ? 31   PHE A CE2 1 
ATOM   114  C  CZ  . PHE A 1 20  ? 4.890   72.602  46.760  1.00 61.98  ? 31   PHE A CZ  1 
ATOM   115  N  N   . PRO A 1 21  ? 2.100   68.760  45.321  1.00 62.21  ? 32   PRO A N   1 
ATOM   116  C  CA  . PRO A 1 21  ? 0.754   68.756  45.908  1.00 55.51  ? 32   PRO A CA  1 
ATOM   117  C  C   . PRO A 1 21  ? 0.094   70.125  45.828  1.00 54.43  ? 32   PRO A C   1 
ATOM   118  O  O   . PRO A 1 21  ? 0.749   71.165  45.921  1.00 49.73  ? 32   PRO A O   1 
ATOM   119  C  CB  . PRO A 1 21  ? 1.002   68.341  47.364  1.00 50.43  ? 32   PRO A CB  1 
ATOM   120  C  CG  . PRO A 1 21  ? 2.320   67.634  47.340  1.00 54.18  ? 32   PRO A CG  1 
ATOM   121  C  CD  . PRO A 1 21  ? 3.125   68.337  46.289  1.00 61.85  ? 32   PRO A CD  1 
ATOM   122  N  N   . HIS A 1 22  ? -1.226  70.109  45.656  1.00 56.30  ? 33   HIS A N   1 
ATOM   123  C  CA  . HIS A 1 22  ? -1.993  71.337  45.495  1.00 53.75  ? 33   HIS A CA  1 
ATOM   124  C  C   . HIS A 1 22  ? -2.300  71.953  46.854  1.00 52.45  ? 33   HIS A C   1 
ATOM   125  O  O   . HIS A 1 22  ? -2.778  71.267  47.763  1.00 50.48  ? 33   HIS A O   1 
ATOM   126  C  CB  . HIS A 1 22  ? -3.290  71.057  44.737  1.00 62.45  ? 33   HIS A CB  1 
ATOM   127  C  CG  . HIS A 1 22  ? -4.145  72.268  44.532  1.00 57.84  ? 33   HIS A CG  1 
ATOM   128  N  ND1 . HIS A 1 22  ? -3.794  73.291  43.677  1.00 57.75  ? 33   HIS A ND1 1 
ATOM   129  C  CD2 . HIS A 1 22  ? -5.336  72.620  45.071  1.00 53.27  ? 33   HIS A CD2 1 
ATOM   130  C  CE1 . HIS A 1 22  ? -4.733  74.220  43.698  1.00 54.62  ? 33   HIS A CE1 1 
ATOM   131  N  NE2 . HIS A 1 22  ? -5.679  73.838  44.536  1.00 56.13  ? 33   HIS A NE2 1 
ATOM   132  N  N   . GLN A 1 23  ? -2.024  73.253  46.983  1.00 48.75  ? 34   GLN A N   1 
ATOM   133  C  CA  . GLN A 1 23  ? -2.276  74.033  48.190  1.00 48.54  ? 34   GLN A CA  1 
ATOM   134  C  C   . GLN A 1 23  ? -1.647  73.395  49.423  1.00 56.41  ? 34   GLN A C   1 
ATOM   135  O  O   . GLN A 1 23  ? -2.371  72.889  50.290  1.00 53.44  ? 34   GLN A O   1 
ATOM   136  C  CB  . GLN A 1 23  ? -3.779  74.207  48.416  1.00 55.07  ? 34   GLN A CB  1 
ATOM   137  C  CG  . GLN A 1 23  ? -4.461  75.162  47.456  1.00 51.79  ? 34   GLN A CG  1 
ATOM   138  C  CD  . GLN A 1 23  ? -5.940  75.310  47.749  1.00 67.70  ? 34   GLN A CD  1 
ATOM   139  O  OE1 . GLN A 1 23  ? -6.542  74.457  48.403  1.00 62.93  ? 34   GLN A OE1 1 
ATOM   140  N  NE2 . GLN A 1 23  ? -6.533  76.398  47.273  1.00 80.58  ? 34   GLN A NE2 1 
ATOM   141  N  N   . PRO A 1 24  ? -0.324  73.397  49.548  1.00 58.80  ? 35   PRO A N   1 
ATOM   142  C  CA  . PRO A 1 24  ? 0.299   72.887  50.772  1.00 46.89  ? 35   PRO A CA  1 
ATOM   143  C  C   . PRO A 1 24  ? 0.144   73.883  51.911  1.00 44.38  ? 35   PRO A C   1 
ATOM   144  O  O   . PRO A 1 24  ? -0.174  75.057  51.712  1.00 52.51  ? 35   PRO A O   1 
ATOM   145  C  CB  . PRO A 1 24  ? 1.775   72.712  50.384  1.00 49.38  ? 35   PRO A CB  1 
ATOM   146  C  CG  . PRO A 1 24  ? 1.840   72.955  48.890  1.00 44.75  ? 35   PRO A CG  1 
ATOM   147  C  CD  . PRO A 1 24  ? 0.682   73.837  48.570  1.00 50.75  ? 35   PRO A CD  1 
ATOM   148  N  N   . SER A 1 25  ? 0.373   73.392  53.129  1.00 47.72  ? 36   SER A N   1 
ATOM   149  C  CA  . SER A 1 25  ? 0.173   74.233  54.303  1.00 62.40  ? 36   SER A CA  1 
ATOM   150  C  C   . SER A 1 25  ? 1.060   73.819  55.472  1.00 42.22  ? 36   SER A C   1 
ATOM   151  O  O   . SER A 1 25  ? 1.098   74.508  56.497  1.00 42.22  ? 36   SER A O   1 
ATOM   152  C  CB  . SER A 1 25  ? -1.296  74.202  54.729  1.00 63.70  ? 36   SER A CB  1 
ATOM   153  O  OG  . SER A 1 25  ? -1.699  72.888  55.075  1.00 59.59  ? 36   SER A OG  1 
ATOM   154  N  N   . ALA A 1 26  ? 1.774   72.705  55.336  1.00 41.35  ? 37   ALA A N   1 
ATOM   155  C  CA  . ALA A 1 26  ? 2.604   72.212  56.424  1.00 40.40  ? 37   ALA A CA  1 
ATOM   156  C  C   . ALA A 1 26  ? 3.788   71.445  55.858  1.00 63.61  ? 37   ALA A C   1 
ATOM   157  O  O   . ALA A 1 26  ? 3.686   70.794  54.814  1.00 66.41  ? 37   ALA A O   1 
ATOM   158  C  CB  . ALA A 1 26  ? 1.807   71.317  57.381  1.00 40.26  ? 37   ALA A CB  1 
ATOM   159  N  N   . LEU A 1 27  ? 4.915   71.526  56.563  1.00 50.58  ? 38   LEU A N   1 
ATOM   160  C  CA  . LEU A 1 27  ? 6.123   70.798  56.206  1.00 43.94  ? 38   LEU A CA  1 
ATOM   161  C  C   . LEU A 1 27  ? 6.600   69.989  57.402  1.00 43.54  ? 38   LEU A C   1 
ATOM   162  O  O   . LEU A 1 27  ? 6.616   70.483  58.533  1.00 46.07  ? 38   LEU A O   1 
ATOM   163  C  CB  . LEU A 1 27  ? 7.236   71.745  55.740  1.00 46.99  ? 38   LEU A CB  1 
ATOM   164  C  CG  . LEU A 1 27  ? 8.565   71.072  55.390  1.00 42.77  ? 38   LEU A CG  1 
ATOM   165  C  CD1 . LEU A 1 27  ? 8.354   69.994  54.342  1.00 38.90  ? 38   LEU A CD1 1 
ATOM   166  C  CD2 . LEU A 1 27  ? 9.583   72.092  54.911  1.00 39.51  ? 38   LEU A CD2 1 
ATOM   167  N  N   . GLY A 1 28  ? 6.981   68.740  57.143  1.00 37.88  ? 39   GLY A N   1 
ATOM   168  C  CA  . GLY A 1 28  ? 7.526   67.885  58.175  1.00 37.52  ? 39   GLY A CA  1 
ATOM   169  C  C   . GLY A 1 28  ? 8.652   67.041  57.615  1.00 46.91  ? 39   GLY A C   1 
ATOM   170  O  O   . GLY A 1 28  ? 8.732   66.790  56.410  1.00 55.26  ? 39   GLY A O   1 
ATOM   171  N  N   . TYR A 1 29  ? 9.529   66.602  58.516  1.00 44.47  ? 40   TYR A N   1 
ATOM   172  C  CA  . TYR A 1 29  ? 10.700  65.837  58.108  1.00 49.69  ? 40   TYR A CA  1 
ATOM   173  C  C   . TYR A 1 29  ? 11.248  65.079  59.307  1.00 52.75  ? 40   TYR A C   1 
ATOM   174  O  O   . TYR A 1 29  ? 11.405  65.654  60.387  1.00 63.96  ? 40   TYR A O   1 
ATOM   175  C  CB  . TYR A 1 29  ? 11.772  66.757  57.514  1.00 37.76  ? 40   TYR A CB  1 
ATOM   176  C  CG  . TYR A 1 29  ? 13.107  66.089  57.285  1.00 45.35  ? 40   TYR A CG  1 
ATOM   177  C  CD1 . TYR A 1 29  ? 13.282  65.169  56.260  1.00 38.34  ? 40   TYR A CD1 1 
ATOM   178  C  CD2 . TYR A 1 29  ? 14.199  66.390  58.088  1.00 58.41  ? 40   TYR A CD2 1 
ATOM   179  C  CE1 . TYR A 1 29  ? 14.505  64.560  56.048  1.00 57.22  ? 40   TYR A CE1 1 
ATOM   180  C  CE2 . TYR A 1 29  ? 15.424  65.789  57.883  1.00 68.03  ? 40   TYR A CE2 1 
ATOM   181  C  CZ  . TYR A 1 29  ? 15.572  64.875  56.863  1.00 65.15  ? 40   TYR A CZ  1 
ATOM   182  O  OH  . TYR A 1 29  ? 16.795  64.278  56.663  1.00 71.52  ? 40   TYR A OH  1 
ATOM   183  N  N   . SER A 1 30  ? 11.532  63.791  59.111  1.00 42.10  ? 41   SER A N   1 
ATOM   184  C  CA  . SER A 1 30  ? 12.141  62.972  60.145  1.00 48.32  ? 41   SER A CA  1 
ATOM   185  C  C   . SER A 1 30  ? 13.640  62.905  59.899  1.00 43.60  ? 41   SER A C   1 
ATOM   186  O  O   . SER A 1 30  ? 14.067  62.263  58.928  1.00 38.58  ? 41   SER A O   1 
ATOM   187  C  CB  . SER A 1 30  ? 11.538  61.569  60.148  1.00 50.23  ? 41   SER A CB  1 
ATOM   188  O  OG  . SER A 1 30  ? 12.080  60.777  61.192  1.00 52.22  ? 41   SER A OG  1 
ATOM   189  N  N   . PRO A 1 31  ? 14.470  63.550  60.722  1.00 38.58  ? 42   PRO A N   1 
ATOM   190  C  CA  . PRO A 1 31  ? 15.923  63.472  60.498  1.00 41.65  ? 42   PRO A CA  1 
ATOM   191  C  C   . PRO A 1 31  ? 16.469  62.059  60.575  1.00 54.38  ? 42   PRO A C   1 
ATOM   192  O  O   . PRO A 1 31  ? 17.469  61.752  59.915  1.00 57.02  ? 42   PRO A O   1 
ATOM   193  C  CB  . PRO A 1 31  ? 16.495  64.361  61.611  1.00 43.96  ? 42   PRO A CB  1 
ATOM   194  C  CG  . PRO A 1 31  ? 15.372  65.275  61.985  1.00 38.90  ? 42   PRO A CG  1 
ATOM   195  C  CD  . PRO A 1 31  ? 14.125  64.459  61.826  1.00 38.42  ? 42   PRO A CD  1 
ATOM   196  N  N   . SER A 1 32  ? 15.839  61.186  61.363  1.00 52.35  ? 43   SER A N   1 
ATOM   197  C  CA  . SER A 1 32  ? 16.286  59.801  61.455  1.00 51.99  ? 43   SER A CA  1 
ATOM   198  C  C   . SER A 1 32  ? 15.830  58.992  60.247  1.00 53.83  ? 43   SER A C   1 
ATOM   199  O  O   . SER A 1 32  ? 16.646  58.351  59.576  1.00 63.59  ? 43   SER A O   1 
ATOM   200  C  CB  . SER A 1 32  ? 15.768  59.173  62.749  1.00 56.35  ? 43   SER A CB  1 
ATOM   201  O  OG  . SER A 1 32  ? 14.363  59.320  62.853  1.00 70.03  ? 43   SER A OG  1 
ATOM   202  N  N   . LEU A 1 33  ? 14.528  59.013  59.956  1.00 61.01  ? 44   LEU A N   1 
ATOM   203  C  CA  . LEU A 1 33  ? 13.998  58.242  58.838  1.00 57.96  ? 44   LEU A CA  1 
ATOM   204  C  C   . LEU A 1 33  ? 14.337  58.860  57.488  1.00 58.37  ? 44   LEU A C   1 
ATOM   205  O  O   . LEU A 1 33  ? 14.263  58.161  56.472  1.00 44.49  ? 44   LEU A O   1 
ATOM   206  C  CB  . LEU A 1 33  ? 12.480  58.093  58.969  1.00 51.02  ? 44   LEU A CB  1 
ATOM   207  C  CG  . LEU A 1 33  ? 11.932  56.941  59.816  1.00 44.99  ? 44   LEU A CG  1 
ATOM   208  C  CD1 . LEU A 1 33  ? 12.344  57.067  61.275  1.00 46.92  ? 44   LEU A CD1 1 
ATOM   209  C  CD2 . LEU A 1 33  ? 10.418  56.872  59.692  1.00 54.89  ? 44   LEU A CD2 1 
ATOM   210  N  N   . ARG A 1 34  ? 14.705  60.142  57.457  1.00 60.82  ? 45   ARG A N   1 
ATOM   211  C  CA  . ARG A 1 34  ? 14.987  60.866  56.216  1.00 49.02  ? 45   ARG A CA  1 
ATOM   212  C  C   . ARG A 1 34  ? 13.794  60.784  55.260  1.00 49.90  ? 45   ARG A C   1 
ATOM   213  O  O   . ARG A 1 34  ? 13.896  60.316  54.124  1.00 60.26  ? 45   ARG A O   1 
ATOM   214  C  CB  . ARG A 1 34  ? 16.274  60.351  55.560  1.00 57.72  ? 45   ARG A CB  1 
ATOM   215  C  CG  . ARG A 1 34  ? 17.372  61.399  55.463  1.00 67.74  ? 45   ARG A CG  1 
ATOM   216  C  CD  . ARG A 1 34  ? 18.731  60.791  55.145  1.00 74.83  ? 45   ARG A CD  1 
ATOM   217  N  NE  . ARG A 1 34  ? 19.264  60.009  56.256  1.00 80.71  ? 45   ARG A NE  1 
ATOM   218  C  CZ  . ARG A 1 34  ? 19.288  58.681  56.292  1.00 76.90  ? 45   ARG A CZ  1 
ATOM   219  N  NH1 . ARG A 1 34  ? 18.813  57.980  55.272  1.00 67.24  ? 45   ARG A NH1 1 
ATOM   220  N  NH2 . ARG A 1 34  ? 19.793  58.054  57.346  1.00 73.09  ? 45   ARG A NH2 1 
ATOM   221  N  N   . ILE A 1 35  ? 12.649  61.253  55.752  1.00 47.26  ? 46   ILE A N   1 
ATOM   222  C  CA  . ILE A 1 35  ? 11.386  61.209  55.023  1.00 45.92  ? 46   ILE A CA  1 
ATOM   223  C  C   . ILE A 1 35  ? 10.731  62.581  55.106  1.00 50.90  ? 46   ILE A C   1 
ATOM   224  O  O   . ILE A 1 35  ? 10.563  63.128  56.201  1.00 42.28  ? 46   ILE A O   1 
ATOM   225  C  CB  . ILE A 1 35  ? 10.444  60.124  55.579  1.00 44.88  ? 46   ILE A CB  1 
ATOM   226  C  CG1 . ILE A 1 35  ? 10.903  58.736  55.129  1.00 38.77  ? 46   ILE A CG1 1 
ATOM   227  C  CG2 . ILE A 1 35  ? 9.005   60.386  55.156  1.00 38.16  ? 46   ILE A CG2 1 
ATOM   228  C  CD1 . ILE A 1 35  ? 10.003  57.614  55.599  1.00 38.98  ? 46   ILE A CD1 1 
ATOM   229  N  N   . LEU A 1 36  ? 10.360  63.130  53.951  1.00 54.33  ? 47   LEU A N   1 
ATOM   230  C  CA  . LEU A 1 36  ? 9.720   64.435  53.878  1.00 38.12  ? 47   LEU A CA  1 
ATOM   231  C  C   . LEU A 1 36  ? 8.204   64.284  53.914  1.00 45.75  ? 47   LEU A C   1 
ATOM   232  O  O   . LEU A 1 36  ? 7.640   63.406  53.256  1.00 59.03  ? 47   LEU A O   1 
ATOM   233  C  CB  . LEU A 1 36  ? 10.139  65.166  52.602  1.00 38.65  ? 47   LEU A CB  1 
ATOM   234  C  CG  . LEU A 1 36  ? 9.775   66.648  52.511  1.00 52.04  ? 47   LEU A CG  1 
ATOM   235  C  CD1 . LEU A 1 36  ? 10.760  67.486  53.312  1.00 52.80  ? 47   LEU A CD1 1 
ATOM   236  C  CD2 . LEU A 1 36  ? 9.721   67.106  51.062  1.00 49.72  ? 47   LEU A CD2 1 
ATOM   237  N  N   . ALA A 1 37  ? 7.549   65.152  54.681  1.00 45.56  ? 48   ALA A N   1 
ATOM   238  C  CA  . ALA A 1 37  ? 6.101   65.131  54.838  1.00 50.48  ? 48   ALA A CA  1 
ATOM   239  C  C   . ALA A 1 37  ? 5.516   66.485  54.463  1.00 39.19  ? 48   ALA A C   1 
ATOM   240  O  O   . ALA A 1 37  ? 6.039   67.531  54.863  1.00 38.35  ? 48   ALA A O   1 
ATOM   241  C  CB  . ALA A 1 37  ? 5.703   64.767  56.272  1.00 37.88  ? 48   ALA A CB  1 
ATOM   242  N  N   . ILE A 1 38  ? 4.426   66.461  53.697  1.00 49.20  ? 49   ILE A N   1 
ATOM   243  C  CA  . ILE A 1 38  ? 3.747   67.666  53.240  1.00 48.99  ? 49   ILE A CA  1 
ATOM   244  C  C   . ILE A 1 38  ? 2.266   67.548  53.570  1.00 57.22  ? 49   ILE A C   1 
ATOM   245  O  O   . ILE A 1 38  ? 1.652   66.500  53.341  1.00 70.06  ? 49   ILE A O   1 
ATOM   246  C  CB  . ILE A 1 38  ? 3.948   67.897  51.727  1.00 40.14  ? 49   ILE A CB  1 
ATOM   247  C  CG1 . ILE A 1 38  ? 5.437   68.003  51.390  1.00 40.06  ? 49   ILE A CG1 1 
ATOM   248  C  CG2 . ILE A 1 38  ? 3.216   69.150  51.271  1.00 40.99  ? 49   ILE A CG2 1 
ATOM   249  C  CD1 . ILE A 1 38  ? 5.713   68.247  49.922  1.00 40.69  ? 49   ILE A CD1 1 
ATOM   250  N  N   . GLY A 1 39  ? 1.696   68.618  54.111  1.00 50.82  ? 50   GLY A N   1 
ATOM   251  C  CA  . GLY A 1 39  ? 0.271   68.693  54.400  1.00 53.39  ? 50   GLY A CA  1 
ATOM   252  C  C   . GLY A 1 39  ? -0.391  69.735  53.516  1.00 55.52  ? 50   GLY A C   1 
ATOM   253  O  O   . GLY A 1 39  ? 0.205   70.770  53.209  1.00 53.88  ? 50   GLY A O   1 
ATOM   254  N  N   . THR A 1 40  ? -1.624  69.458  53.114  1.00 52.20  ? 51   THR A N   1 
ATOM   255  C  CA  . THR A 1 40  ? -2.376  70.329  52.222  1.00 57.73  ? 51   THR A CA  1 
ATOM   256  C  C   . THR A 1 40  ? -3.571  70.935  52.948  1.00 57.15  ? 51   THR A C   1 
ATOM   257  O  O   . THR A 1 40  ? -3.930  70.535  54.058  1.00 64.28  ? 51   THR A O   1 
ATOM   258  C  CB  . THR A 1 40  ? -2.850  69.568  50.977  1.00 60.73  ? 51   THR A CB  1 
ATOM   259  O  OG1 . THR A 1 40  ? -3.774  68.543  51.364  1.00 58.35  ? 51   THR A OG1 1 
ATOM   260  C  CG2 . THR A 1 40  ? -1.670  68.935  50.258  1.00 71.04  ? 51   THR A CG2 1 
ATOM   261  N  N   . ARG A 1 41  ? -4.193  71.919  52.295  1.00 50.22  ? 52   ARG A N   1 
ATOM   262  C  CA  . ARG A 1 41  ? -5.385  72.555  52.840  1.00 55.09  ? 52   ARG A CA  1 
ATOM   263  C  C   . ARG A 1 41  ? -6.632  71.691  52.705  1.00 62.70  ? 52   ARG A C   1 
ATOM   264  O  O   . ARG A 1 41  ? -7.682  72.064  53.239  1.00 69.97  ? 52   ARG A O   1 
ATOM   265  C  CB  . ARG A 1 41  ? -5.618  73.910  52.165  1.00 62.15  ? 52   ARG A CB  1 
ATOM   266  C  CG  . ARG A 1 41  ? -4.595  74.969  52.546  1.00 72.89  ? 52   ARG A CG  1 
ATOM   267  C  CD  . ARG A 1 41  ? -4.953  76.332  51.974  1.00 85.65  ? 52   ARG A CD  1 
ATOM   268  N  NE  . ARG A 1 41  ? -4.092  77.383  52.509  1.00 102.83 ? 52   ARG A NE  1 
ATOM   269  C  CZ  . ARG A 1 41  ? -2.937  77.754  51.965  1.00 117.95 ? 52   ARG A CZ  1 
ATOM   270  N  NH1 . ARG A 1 41  ? -2.499  77.160  50.863  1.00 128.02 ? 52   ARG A NH1 1 
ATOM   271  N  NH2 . ARG A 1 41  ? -2.219  78.720  52.523  1.00 110.91 ? 52   ARG A NH2 1 
ATOM   272  N  N   . SER A 1 42  ? -6.543  70.558  52.013  1.00 62.75  ? 53   SER A N   1 
ATOM   273  C  CA  . SER A 1 42  ? -7.657  69.630  51.887  1.00 58.17  ? 53   SER A CA  1 
ATOM   274  C  C   . SER A 1 42  ? -7.622  68.521  52.930  1.00 65.52  ? 53   SER A C   1 
ATOM   275  O  O   . SER A 1 42  ? -8.489  67.641  52.907  1.00 71.60  ? 53   SER A O   1 
ATOM   276  C  CB  . SER A 1 42  ? -7.673  69.013  50.484  1.00 62.68  ? 53   SER A CB  1 
ATOM   277  O  OG  . SER A 1 42  ? -6.501  68.251  50.250  1.00 70.46  ? 53   SER A OG  1 
ATOM   278  N  N   . GLY A 1 43  ? -6.648  68.541  53.838  1.00 65.59  ? 54   GLY A N   1 
ATOM   279  C  CA  . GLY A 1 43  ? -6.539  67.536  54.872  1.00 68.43  ? 54   GLY A CA  1 
ATOM   280  C  C   . GLY A 1 43  ? -5.630  66.373  54.549  1.00 61.12  ? 54   GLY A C   1 
ATOM   281  O  O   . GLY A 1 43  ? -5.522  65.448  55.366  1.00 45.60  ? 54   GLY A O   1 
ATOM   282  N  N   . ALA A 1 44  ? -4.972  66.385  53.395  1.00 57.94  ? 55   ALA A N   1 
ATOM   283  C  CA  . ALA A 1 44  ? -4.115  65.284  52.988  1.00 69.62  ? 55   ALA A CA  1 
ATOM   284  C  C   . ALA A 1 44  ? -2.694  65.497  53.490  1.00 65.73  ? 55   ALA A C   1 
ATOM   285  O  O   . ALA A 1 44  ? -2.165  66.611  53.448  1.00 51.30  ? 55   ALA A O   1 
ATOM   286  C  CB  . ALA A 1 44  ? -4.113  65.137  51.466  1.00 69.02  ? 55   ALA A CB  1 
ATOM   287  N  N   . ILE A 1 45  ? -2.084  64.418  53.975  1.00 73.37  ? 56   ILE A N   1 
ATOM   288  C  CA  . ILE A 1 45  ? -0.673  64.398  54.341  1.00 69.83  ? 56   ILE A CA  1 
ATOM   289  C  C   . ILE A 1 45  ? 0.031   63.406  53.428  1.00 65.16  ? 56   ILE A C   1 
ATOM   290  O  O   . ILE A 1 45  ? -0.431  62.271  53.259  1.00 56.13  ? 56   ILE A O   1 
ATOM   291  C  CB  . ILE A 1 45  ? -0.463  64.036  55.824  1.00 70.07  ? 56   ILE A CB  1 
ATOM   292  C  CG1 . ILE A 1 45  ? -1.222  62.760  56.190  1.00 64.83  ? 56   ILE A CG1 1 
ATOM   293  C  CG2 . ILE A 1 45  ? -0.892  65.189  56.720  1.00 81.39  ? 56   ILE A CG2 1 
ATOM   294  C  CD1 . ILE A 1 45  ? -0.918  62.257  57.579  1.00 69.95  ? 56   ILE A CD1 1 
ATOM   295  N  N   . LYS A 1 46  ? 1.135   63.839  52.828  1.00 63.50  ? 57   LYS A N   1 
ATOM   296  C  CA  . LYS A 1 46  ? 1.888   63.023  51.885  1.00 50.03  ? 57   LYS A CA  1 
ATOM   297  C  C   . LYS A 1 46  ? 3.309   62.858  52.400  1.00 54.20  ? 57   LYS A C   1 
ATOM   298  O  O   . LYS A 1 46  ? 4.006   63.849  52.639  1.00 57.48  ? 57   LYS A O   1 
ATOM   299  C  CB  . LYS A 1 46  ? 1.884   63.652  50.489  1.00 50.62  ? 57   LYS A CB  1 
ATOM   300  C  CG  . LYS A 1 46  ? 0.515   63.670  49.825  1.00 56.55  ? 57   LYS A CG  1 
ATOM   301  C  CD  . LYS A 1 46  ? 0.607   64.139  48.384  1.00 53.35  ? 57   LYS A CD  1 
ATOM   302  C  CE  . LYS A 1 46  ? -0.712  63.956  47.653  1.00 56.17  ? 57   LYS A CE  1 
ATOM   303  N  NZ  . LYS A 1 46  ? -0.592  64.271  46.203  1.00 54.90  ? 57   LYS A NZ  1 
ATOM   304  N  N   . LEU A 1 47  ? 3.728   61.609  52.575  1.00 53.03  ? 58   LEU A N   1 
ATOM   305  C  CA  . LEU A 1 47  ? 5.073   61.283  53.027  1.00 40.42  ? 58   LEU A CA  1 
ATOM   306  C  C   . LEU A 1 47  ? 5.937   60.945  51.819  1.00 45.00  ? 58   LEU A C   1 
ATOM   307  O  O   . LEU A 1 47  ? 5.518   60.179  50.945  1.00 47.37  ? 58   LEU A O   1 
ATOM   308  C  CB  . LEU A 1 47  ? 5.055   60.111  54.010  1.00 39.22  ? 58   LEU A CB  1 
ATOM   309  C  CG  . LEU A 1 47  ? 4.708   60.389  55.476  1.00 47.17  ? 58   LEU A CG  1 
ATOM   310  C  CD1 . LEU A 1 47  ? 3.286   60.904  55.641  1.00 66.13  ? 58   LEU A CD1 1 
ATOM   311  C  CD2 . LEU A 1 47  ? 4.921   59.135  56.309  1.00 48.84  ? 58   LEU A CD2 1 
ATOM   312  N  N   . TYR A 1 48  ? 7.137   61.518  51.772  1.00 39.21  ? 59   TYR A N   1 
ATOM   313  C  CA  . TYR A 1 48  ? 8.053   61.324  50.655  1.00 44.14  ? 59   TYR A CA  1 
ATOM   314  C  C   . TYR A 1 48  ? 9.404   60.878  51.189  1.00 55.09  ? 59   TYR A C   1 
ATOM   315  O  O   . TYR A 1 48  ? 10.013  61.575  52.007  1.00 55.30  ? 59   TYR A O   1 
ATOM   316  C  CB  . TYR A 1 48  ? 8.199   62.605  49.831  1.00 44.98  ? 59   TYR A CB  1 
ATOM   317  C  CG  . TYR A 1 48  ? 6.939   63.003  49.103  1.00 46.35  ? 59   TYR A CG  1 
ATOM   318  C  CD1 . TYR A 1 48  ? 6.591   62.400  47.902  1.00 50.60  ? 59   TYR A CD1 1 
ATOM   319  C  CD2 . TYR A 1 48  ? 6.098   63.981  49.614  1.00 46.48  ? 59   TYR A CD2 1 
ATOM   320  C  CE1 . TYR A 1 48  ? 5.442   62.758  47.231  1.00 60.45  ? 59   TYR A CE1 1 
ATOM   321  C  CE2 . TYR A 1 48  ? 4.945   64.347  48.948  1.00 61.06  ? 59   TYR A CE2 1 
ATOM   322  C  CZ  . TYR A 1 48  ? 4.621   63.729  47.759  1.00 71.75  ? 59   TYR A CZ  1 
ATOM   323  O  OH  . TYR A 1 48  ? 3.477   64.088  47.087  1.00 92.78  ? 59   TYR A OH  1 
ATOM   324  N  N   . GLY A 1 49  ? 9.867   59.720  50.726  1.00 51.43  ? 60   GLY A N   1 
ATOM   325  C  CA  . GLY A 1 49  ? 11.187  59.235  51.073  1.00 46.27  ? 60   GLY A CA  1 
ATOM   326  C  C   . GLY A 1 49  ? 12.053  59.063  49.844  1.00 50.93  ? 60   GLY A C   1 
ATOM   327  O  O   . GLY A 1 49  ? 12.157  59.976  49.020  1.00 65.43  ? 60   GLY A O   1 
ATOM   328  N  N   . ALA A 1 50  ? 12.679  57.897  49.707  1.00 57.04  ? 61   ALA A N   1 
ATOM   329  C  CA  . ALA A 1 50  ? 13.448  57.602  48.513  1.00 55.79  ? 61   ALA A CA  1 
ATOM   330  C  C   . ALA A 1 50  ? 12.520  57.519  47.304  1.00 68.02  ? 61   ALA A C   1 
ATOM   331  O  O   . ALA A 1 50  ? 11.318  57.279  47.449  1.00 78.68  ? 61   ALA A O   1 
ATOM   332  C  CB  . ALA A 1 50  ? 14.214  56.292  48.684  1.00 42.41  ? 61   ALA A CB  1 
ATOM   333  N  N   . PRO A 1 51  ? 13.051  57.745  46.093  1.00 62.34  ? 62   PRO A N   1 
ATOM   334  C  CA  . PRO A 1 51  ? 12.232  57.573  44.885  1.00 59.24  ? 62   PRO A CA  1 
ATOM   335  C  C   . PRO A 1 51  ? 11.572  56.205  44.827  1.00 43.54  ? 62   PRO A C   1 
ATOM   336  O  O   . PRO A 1 51  ? 12.252  55.174  44.819  1.00 44.03  ? 62   PRO A O   1 
ATOM   337  C  CB  . PRO A 1 51  ? 13.243  57.766  43.750  1.00 52.52  ? 62   PRO A CB  1 
ATOM   338  C  CG  . PRO A 1 51  ? 14.260  58.690  44.328  1.00 44.59  ? 62   PRO A CG  1 
ATOM   339  C  CD  . PRO A 1 51  ? 14.376  58.314  45.783  1.00 59.07  ? 62   PRO A CD  1 
ATOM   340  N  N   . GLY A 1 52  ? 10.240  56.191  44.799  1.00 49.86  ? 63   GLY A N   1 
ATOM   341  C  CA  . GLY A 1 52  ? 9.463   54.977  44.884  1.00 47.86  ? 63   GLY A CA  1 
ATOM   342  C  C   . GLY A 1 52  ? 8.801   54.755  46.228  1.00 61.39  ? 63   GLY A C   1 
ATOM   343  O  O   . GLY A 1 52  ? 7.893   53.921  46.327  1.00 64.07  ? 63   GLY A O   1 
ATOM   344  N  N   . VAL A 1 53  ? 9.231   55.476  47.259  1.00 71.73  ? 64   VAL A N   1 
ATOM   345  C  CA  . VAL A 1 53  ? 8.662   55.375  48.598  1.00 59.40  ? 64   VAL A CA  1 
ATOM   346  C  C   . VAL A 1 53  ? 7.761   56.584  48.807  1.00 55.70  ? 64   VAL A C   1 
ATOM   347  O  O   . VAL A 1 53  ? 8.243   57.713  48.951  1.00 48.47  ? 64   VAL A O   1 
ATOM   348  C  CB  . VAL A 1 53  ? 9.755   55.304  49.673  1.00 56.12  ? 64   VAL A CB  1 
ATOM   349  C  CG1 . VAL A 1 53  ? 9.131   55.270  51.060  1.00 48.51  ? 64   VAL A CG1 1 
ATOM   350  C  CG2 . VAL A 1 53  ? 10.643  54.089  49.450  1.00 62.59  ? 64   VAL A CG2 1 
ATOM   351  N  N   . GLU A 1 54  ? 6.450   56.354  48.829  1.00 58.52  ? 65   GLU A N   1 
ATOM   352  C  CA  . GLU A 1 54  ? 5.488   57.433  48.989  1.00 53.53  ? 65   GLU A CA  1 
ATOM   353  C  C   . GLU A 1 54  ? 4.276   56.915  49.749  1.00 49.53  ? 65   GLU A C   1 
ATOM   354  O  O   . GLU A 1 54  ? 3.838   55.782  49.536  1.00 46.34  ? 65   GLU A O   1 
ATOM   355  C  CB  . GLU A 1 54  ? 5.064   58.006  47.630  1.00 59.18  ? 65   GLU A CB  1 
ATOM   356  C  CG  . GLU A 1 54  ? 4.166   59.231  47.715  1.00 67.36  ? 65   GLU A CG  1 
ATOM   357  C  CD  . GLU A 1 54  ? 3.918   59.867  46.360  1.00 82.06  ? 65   GLU A CD  1 
ATOM   358  O  OE1 . GLU A 1 54  ? 4.597   59.479  45.385  1.00 79.42  ? 65   GLU A OE1 1 
ATOM   359  O  OE2 . GLU A 1 54  ? 3.046   60.757  46.269  1.00 84.70  ? 65   GLU A OE2 1 
ATOM   360  N  N   . PHE A 1 55  ? 3.749   57.752  50.639  1.00 52.23  ? 66   PHE A N   1 
ATOM   361  C  CA  . PHE A 1 55  ? 2.551   57.446  51.405  1.00 48.37  ? 66   PHE A CA  1 
ATOM   362  C  C   . PHE A 1 55  ? 1.594   58.626  51.328  1.00 64.48  ? 66   PHE A C   1 
ATOM   363  O  O   . PHE A 1 55  ? 2.016   59.781  51.226  1.00 75.07  ? 66   PHE A O   1 
ATOM   364  C  CB  . PHE A 1 55  ? 2.873   57.142  52.876  1.00 46.71  ? 66   PHE A CB  1 
ATOM   365  C  CG  . PHE A 1 55  ? 3.792   55.970  53.071  1.00 40.77  ? 66   PHE A CG  1 
ATOM   366  C  CD1 . PHE A 1 55  ? 3.283   54.712  53.347  1.00 41.52  ? 66   PHE A CD1 1 
ATOM   367  C  CD2 . PHE A 1 55  ? 5.166   56.127  52.991  1.00 44.53  ? 66   PHE A CD2 1 
ATOM   368  C  CE1 . PHE A 1 55  ? 4.125   53.633  53.534  1.00 42.77  ? 66   PHE A CE1 1 
ATOM   369  C  CE2 . PHE A 1 55  ? 6.014   55.051  53.174  1.00 40.87  ? 66   PHE A CE2 1 
ATOM   370  C  CZ  . PHE A 1 55  ? 5.493   53.804  53.448  1.00 41.23  ? 66   PHE A CZ  1 
ATOM   371  N  N   . MET A 1 56  ? 0.298   58.328  51.377  1.00 68.65  ? 67   MET A N   1 
ATOM   372  C  CA  . MET A 1 56  ? -0.724  59.363  51.368  1.00 59.12  ? 67   MET A CA  1 
ATOM   373  C  C   . MET A 1 56  ? -1.810  59.011  52.372  1.00 55.91  ? 67   MET A C   1 
ATOM   374  O  O   . MET A 1 56  ? -2.193  57.845  52.501  1.00 58.53  ? 67   MET A O   1 
ATOM   375  C  CB  . MET A 1 56  ? -1.335  59.546  49.971  1.00 60.01  ? 67   MET A CB  1 
ATOM   376  C  CG  . MET A 1 56  ? -2.294  60.724  49.871  1.00 75.11  ? 67   MET A CG  1 
ATOM   377  S  SD  . MET A 1 56  ? -2.885  61.035  48.196  1.00 81.63  ? 67   MET A SD  1 
ATOM   378  C  CE  . MET A 1 56  ? -3.961  62.440  48.476  1.00 60.09  ? 67   MET A CE  1 
ATOM   379  N  N   . GLY A 1 57  ? -2.295  60.026  53.084  1.00 52.72  ? 68   GLY A N   1 
ATOM   380  C  CA  . GLY A 1 57  ? -3.359  59.833  54.045  1.00 44.10  ? 68   GLY A CA  1 
ATOM   381  C  C   . GLY A 1 57  ? -4.353  60.974  53.975  1.00 64.61  ? 68   GLY A C   1 
ATOM   382  O  O   . GLY A 1 57  ? -4.061  62.053  53.454  1.00 60.07  ? 68   GLY A O   1 
ATOM   383  N  N   . LEU A 1 58  ? -5.543  60.715  54.512  1.00 64.81  ? 69   LEU A N   1 
ATOM   384  C  CA  . LEU A 1 58  ? -6.630  61.687  54.518  1.00 56.26  ? 69   LEU A CA  1 
ATOM   385  C  C   . LEU A 1 58  ? -7.268  61.716  55.897  1.00 55.24  ? 69   LEU A C   1 
ATOM   386  O  O   . LEU A 1 58  ? -7.703  60.677  56.404  1.00 60.76  ? 69   LEU A O   1 
ATOM   387  C  CB  . LEU A 1 58  ? -7.682  61.352  53.457  1.00 55.68  ? 69   LEU A CB  1 
ATOM   388  C  CG  . LEU A 1 58  ? -7.454  61.886  52.043  1.00 50.88  ? 69   LEU A CG  1 
ATOM   389  C  CD1 . LEU A 1 58  ? -8.570  61.432  51.117  1.00 50.29  ? 69   LEU A CD1 1 
ATOM   390  C  CD2 . LEU A 1 58  ? -7.359  63.402  52.062  1.00 63.15  ? 69   LEU A CD2 1 
ATOM   391  N  N   . HIS A 1 59  ? -7.319  62.899  56.502  1.00 47.78  ? 70   HIS A N   1 
ATOM   392  C  CA  . HIS A 1 59  ? -8.119  63.080  57.703  1.00 63.54  ? 70   HIS A CA  1 
ATOM   393  C  C   . HIS A 1 59  ? -9.596  63.068  57.332  1.00 73.69  ? 70   HIS A C   1 
ATOM   394  O  O   . HIS A 1 59  ? -9.993  63.603  56.293  1.00 75.69  ? 70   HIS A O   1 
ATOM   395  C  CB  . HIS A 1 59  ? -7.761  64.393  58.398  1.00 63.38  ? 70   HIS A CB  1 
ATOM   396  C  CG  . HIS A 1 59  ? -6.308  64.523  58.736  1.00 58.62  ? 70   HIS A CG  1 
ATOM   397  N  ND1 . HIS A 1 59  ? -5.387  65.067  57.867  1.00 45.30  ? 70   HIS A ND1 1 
ATOM   398  C  CD2 . HIS A 1 59  ? -5.617  64.180  59.849  1.00 60.67  ? 70   HIS A CD2 1 
ATOM   399  C  CE1 . HIS A 1 59  ? -4.192  65.054  58.429  1.00 62.06  ? 70   HIS A CE1 1 
ATOM   400  N  NE2 . HIS A 1 59  ? -4.304  64.520  59.632  1.00 50.90  ? 70   HIS A NE2 1 
ATOM   401  N  N   . GLN A 1 60  ? -10.414 62.445  58.184  1.00 73.49  ? 71   GLN A N   1 
ATOM   402  C  CA  . GLN A 1 60  ? -11.836 62.333  57.878  1.00 66.04  ? 71   GLN A CA  1 
ATOM   403  C  C   . GLN A 1 60  ? -12.514 63.694  57.784  1.00 56.46  ? 71   GLN A C   1 
ATOM   404  O  O   . GLN A 1 60  ? -13.543 63.815  57.111  1.00 72.99  ? 71   GLN A O   1 
ATOM   405  C  CB  . GLN A 1 60  ? -12.544 61.466  58.923  1.00 71.23  ? 71   GLN A CB  1 
ATOM   406  C  CG  . GLN A 1 60  ? -12.712 62.120  60.283  1.00 83.40  ? 71   GLN A CG  1 
ATOM   407  C  CD  . GLN A 1 60  ? -13.783 61.445  61.120  1.00 104.35 ? 71   GLN A CD  1 
ATOM   408  O  OE1 . GLN A 1 60  ? -14.355 60.432  60.717  1.00 114.54 ? 71   GLN A OE1 1 
ATOM   409  N  NE2 . GLN A 1 60  ? -14.064 62.008  62.290  1.00 101.63 ? 71   GLN A NE2 1 
ATOM   410  N  N   . GLU A 1 61  ? -11.961 64.715  58.431  1.00 62.02  ? 72   GLU A N   1 
ATOM   411  C  CA  . GLU A 1 61  ? -12.482 66.070  58.343  1.00 81.76  ? 72   GLU A CA  1 
ATOM   412  C  C   . GLU A 1 61  ? -11.688 66.864  57.313  1.00 85.59  ? 72   GLU A C   1 
ATOM   413  O  O   . GLU A 1 61  ? -10.463 66.739  57.224  1.00 82.96  ? 72   GLU A O   1 
ATOM   414  C  CB  . GLU A 1 61  ? -12.434 66.771  59.705  1.00 95.85  ? 72   GLU A CB  1 
ATOM   415  C  CG  . GLU A 1 61  ? -11.047 66.875  60.332  1.00 95.46  ? 72   GLU A CG  1 
ATOM   416  C  CD  . GLU A 1 61  ? -10.869 65.953  61.526  1.00 89.68  ? 72   GLU A CD  1 
ATOM   417  O  OE1 . GLU A 1 61  ? -11.022 64.725  61.364  1.00 90.08  ? 72   GLU A OE1 1 
ATOM   418  O  OE2 . GLU A 1 61  ? -10.583 66.461  62.632  1.00 83.35  ? 72   GLU A OE2 1 
ATOM   419  N  N   . ASN A 1 62  ? -12.396 67.672  56.528  1.00 96.04  ? 73   ASN A N   1 
ATOM   420  C  CA  . ASN A 1 62  ? -11.776 68.502  55.496  1.00 94.95  ? 73   ASN A CA  1 
ATOM   421  C  C   . ASN A 1 62  ? -11.259 69.774  56.154  1.00 89.76  ? 73   ASN A C   1 
ATOM   422  O  O   . ASN A 1 62  ? -11.960 70.783  56.250  1.00 100.20 ? 73   ASN A O   1 
ATOM   423  C  CB  . ASN A 1 62  ? -12.770 68.810  54.384  1.00 108.51 ? 73   ASN A CB  1 
ATOM   424  C  CG  . ASN A 1 62  ? -12.210 69.766  53.350  1.00 112.65 ? 73   ASN A CG  1 
ATOM   425  O  OD1 . ASN A 1 62  ? -11.004 69.798  53.105  1.00 114.67 ? 73   ASN A OD1 1 
ATOM   426  N  ND2 . ASN A 1 62  ? -13.086 70.556  52.740  1.00 114.45 ? 73   ASN A ND2 1 
ATOM   427  N  N   . ASN A 1 63  ? -10.011 69.727  56.613  1.00 71.51  ? 74   ASN A N   1 
ATOM   428  C  CA  . ASN A 1 63  ? -9.403  70.860  57.294  1.00 68.37  ? 74   ASN A CA  1 
ATOM   429  C  C   . ASN A 1 63  ? -7.913  70.887  56.994  1.00 62.52  ? 74   ASN A C   1 
ATOM   430  O  O   . ASN A 1 63  ? -7.270  69.842  56.869  1.00 76.87  ? 74   ASN A O   1 
ATOM   431  C  CB  . ASN A 1 63  ? -9.647  70.800  58.805  1.00 65.57  ? 74   ASN A CB  1 
ATOM   432  C  CG  . ASN A 1 63  ? -11.032 71.282  59.189  1.00 83.39  ? 74   ASN A CG  1 
ATOM   433  O  OD1 . ASN A 1 63  ? -11.537 72.260  58.636  1.00 85.83  ? 74   ASN A OD1 1 
ATOM   434  N  ND2 . ASN A 1 63  ? -11.657 70.594  60.137  1.00 93.84  ? 74   ASN A ND2 1 
ATOM   435  N  N   . ALA A 1 64  ? -7.372  72.098  56.890  1.00 64.97  ? 75   ALA A N   1 
ATOM   436  C  CA  . ALA A 1 64  ? -5.981  72.274  56.494  1.00 58.28  ? 75   ALA A CA  1 
ATOM   437  C  C   . ALA A 1 64  ? -5.032  71.721  57.550  1.00 59.62  ? 75   ALA A C   1 
ATOM   438  O  O   . ALA A 1 64  ? -5.249  71.886  58.753  1.00 46.07  ? 75   ALA A O   1 
ATOM   439  C  CB  . ALA A 1 64  ? -5.685  73.753  56.253  1.00 47.70  ? 75   ALA A CB  1 
ATOM   440  N  N   . VAL A 1 65  ? -3.973  71.063  57.089  1.00 57.92  ? 76   VAL A N   1 
ATOM   441  C  CA  . VAL A 1 65  ? -2.921  70.576  57.976  1.00 47.45  ? 76   VAL A CA  1 
ATOM   442  C  C   . VAL A 1 65  ? -1.959  71.725  58.249  1.00 52.55  ? 76   VAL A C   1 
ATOM   443  O  O   . VAL A 1 65  ? -1.345  72.265  57.323  1.00 42.70  ? 76   VAL A O   1 
ATOM   444  C  CB  . VAL A 1 65  ? -2.189  69.375  57.362  1.00 42.54  ? 76   VAL A CB  1 
ATOM   445  C  CG1 . VAL A 1 65  ? -1.283  68.722  58.394  1.00 41.58  ? 76   VAL A CG1 1 
ATOM   446  C  CG2 . VAL A 1 65  ? -3.185  68.372  56.801  1.00 58.97  ? 76   VAL A CG2 1 
ATOM   447  N  N   . THR A 1 66  ? -1.826  72.101  59.519  1.00 42.76  ? 77   THR A N   1 
ATOM   448  C  CA  . THR A 1 66  ? -1.024  73.258  59.901  1.00 42.48  ? 77   THR A CA  1 
ATOM   449  C  C   . THR A 1 66  ? 0.378   72.893  60.367  1.00 51.49  ? 77   THR A C   1 
ATOM   450  O  O   . THR A 1 66  ? 1.327   73.631  60.086  1.00 55.84  ? 77   THR A O   1 
ATOM   451  C  CB  . THR A 1 66  ? -1.730  74.052  61.004  1.00 43.31  ? 77   THR A CB  1 
ATOM   452  O  OG1 . THR A 1 66  ? -1.673  73.320  62.234  1.00 45.95  ? 77   THR A OG1 1 
ATOM   453  C  CG2 . THR A 1 66  ? -3.185  74.294  60.632  1.00 44.72  ? 77   THR A CG2 1 
ATOM   454  N  N   . GLN A 1 67  ? 0.537   71.778  61.080  1.00 40.84  ? 78   GLN A N   1 
ATOM   455  C  CA  . GLN A 1 67  ? 1.837   71.366  61.589  1.00 39.94  ? 78   GLN A CA  1 
ATOM   456  C  C   . GLN A 1 67  ? 1.997   69.862  61.439  1.00 42.25  ? 78   GLN A C   1 
ATOM   457  O  O   . GLN A 1 67  ? 1.040   69.105  61.625  1.00 44.13  ? 78   GLN A O   1 
ATOM   458  C  CB  . GLN A 1 67  ? 2.022   71.763  63.060  1.00 40.05  ? 78   GLN A CB  1 
ATOM   459  C  CG  . GLN A 1 67  ? 2.034   73.264  63.308  1.00 49.19  ? 78   GLN A CG  1 
ATOM   460  C  CD  . GLN A 1 67  ? 2.382   73.616  64.741  1.00 65.06  ? 78   GLN A CD  1 
ATOM   461  O  OE1 . GLN A 1 67  ? 2.967   72.812  65.467  1.00 73.78  ? 78   GLN A OE1 1 
ATOM   462  N  NE2 . GLN A 1 67  ? 2.023   74.825  65.156  1.00 71.67  ? 78   GLN A NE2 1 
ATOM   463  N  N   . ILE A 1 68  ? 3.213   69.437  61.103  1.00 44.74  ? 79   ILE A N   1 
ATOM   464  C  CA  . ILE A 1 68  ? 3.560   68.026  60.973  1.00 42.56  ? 79   ILE A CA  1 
ATOM   465  C  C   . ILE A 1 68  ? 4.812   67.780  61.801  1.00 47.58  ? 79   ILE A C   1 
ATOM   466  O  O   . ILE A 1 68  ? 5.845   68.420  61.574  1.00 74.60  ? 79   ILE A O   1 
ATOM   467  C  CB  . ILE A 1 68  ? 3.792   67.618  59.508  1.00 42.58  ? 79   ILE A CB  1 
ATOM   468  C  CG1 . ILE A 1 68  ? 2.521   67.828  58.683  1.00 38.98  ? 79   ILE A CG1 1 
ATOM   469  C  CG2 . ILE A 1 68  ? 4.250   66.169  59.426  1.00 49.42  ? 79   ILE A CG2 1 
ATOM   470  C  CD1 . ILE A 1 68  ? 2.689   67.512  57.212  1.00 38.99  ? 79   ILE A CD1 1 
ATOM   471  N  N   . HIS A 1 69  ? 4.722   66.858  62.758  1.00 44.38  ? 80   HIS A N   1 
ATOM   472  C  CA  . HIS A 1 69  ? 5.827   66.544  63.663  1.00 45.68  ? 80   HIS A CA  1 
ATOM   473  C  C   . HIS A 1 69  ? 6.056   65.037  63.647  1.00 39.96  ? 80   HIS A C   1 
ATOM   474  O  O   . HIS A 1 69  ? 5.302   64.284  64.271  1.00 47.61  ? 80   HIS A O   1 
ATOM   475  C  CB  . HIS A 1 69  ? 5.537   67.037  65.079  1.00 43.40  ? 80   HIS A CB  1 
ATOM   476  C  CG  . HIS A 1 69  ? 5.370   68.520  65.183  1.00 51.38  ? 80   HIS A CG  1 
ATOM   477  N  ND1 . HIS A 1 69  ? 6.434   69.378  65.365  1.00 50.14  ? 80   HIS A ND1 1 
ATOM   478  C  CD2 . HIS A 1 69  ? 4.263   69.298  65.136  1.00 42.79  ? 80   HIS A CD2 1 
ATOM   479  C  CE1 . HIS A 1 69  ? 5.989   70.620  65.422  1.00 57.61  ? 80   HIS A CE1 1 
ATOM   480  N  NE2 . HIS A 1 69  ? 4.675   70.600  65.286  1.00 47.35  ? 80   HIS A NE2 1 
ATOM   481  N  N   . LEU A 1 70  ? 7.094   64.596  62.940  1.00 40.93  ? 81   LEU A N   1 
ATOM   482  C  CA  . LEU A 1 70  ? 7.479   63.191  62.962  1.00 48.03  ? 81   LEU A CA  1 
ATOM   483  C  C   . LEU A 1 70  ? 8.277   62.917  64.230  1.00 40.65  ? 81   LEU A C   1 
ATOM   484  O  O   . LEU A 1 70  ? 9.300   63.565  64.479  1.00 44.96  ? 81   LEU A O   1 
ATOM   485  C  CB  . LEU A 1 70  ? 8.284   62.826  61.716  1.00 47.17  ? 81   LEU A CB  1 
ATOM   486  C  CG  . LEU A 1 70  ? 7.489   62.771  60.408  1.00 52.21  ? 81   LEU A CG  1 
ATOM   487  C  CD1 . LEU A 1 70  ? 7.489   64.120  59.700  1.00 64.88  ? 81   LEU A CD1 1 
ATOM   488  C  CD2 . LEU A 1 70  ? 8.008   61.673  59.492  1.00 37.77  ? 81   LEU A CD2 1 
ATOM   489  N  N   . LEU A 1 71  ? 7.805   61.965  65.030  1.00 44.73  ? 82   LEU A N   1 
ATOM   490  C  CA  . LEU A 1 71  ? 8.404   61.708  66.330  1.00 54.10  ? 82   LEU A CA  1 
ATOM   491  C  C   . LEU A 1 71  ? 9.843   61.218  66.166  1.00 62.17  ? 82   LEU A C   1 
ATOM   492  O  O   . LEU A 1 71  ? 10.168  60.535  65.189  1.00 72.68  ? 82   LEU A O   1 
ATOM   493  C  CB  . LEU A 1 71  ? 7.573   60.683  67.099  1.00 62.49  ? 82   LEU A CB  1 
ATOM   494  C  CG  . LEU A 1 71  ? 6.076   60.995  67.192  1.00 40.71  ? 82   LEU A CG  1 
ATOM   495  C  CD1 . LEU A 1 71  ? 5.373   60.004  68.108  1.00 56.59  ? 82   LEU A CD1 1 
ATOM   496  C  CD2 . LEU A 1 71  ? 5.836   62.426  67.657  1.00 40.46  ? 82   LEU A CD2 1 
ATOM   497  N  N   . PRO A 1 72  ? 10.726  61.560  67.105  1.00 59.36  ? 83   PRO A N   1 
ATOM   498  C  CA  . PRO A 1 72  ? 12.157  61.259  66.932  1.00 45.01  ? 83   PRO A CA  1 
ATOM   499  C  C   . PRO A 1 72  ? 12.427  59.764  66.867  1.00 47.80  ? 83   PRO A C   1 
ATOM   500  O  O   . PRO A 1 72  ? 12.103  59.013  67.790  1.00 50.94  ? 83   PRO A O   1 
ATOM   501  C  CB  . PRO A 1 72  ? 12.802  61.895  68.170  1.00 46.78  ? 83   PRO A CB  1 
ATOM   502  C  CG  . PRO A 1 72  ? 11.821  62.919  68.636  1.00 65.01  ? 83   PRO A CG  1 
ATOM   503  C  CD  . PRO A 1 72  ? 10.472  62.348  68.322  1.00 71.56  ? 83   PRO A CD  1 
ATOM   504  N  N   . GLY A 1 73  ? 13.031  59.337  65.760  1.00 54.72  ? 84   GLY A N   1 
ATOM   505  C  CA  . GLY A 1 73  ? 13.475  57.960  65.620  1.00 61.90  ? 84   GLY A CA  1 
ATOM   506  C  C   . GLY A 1 73  ? 12.368  56.931  65.638  1.00 67.21  ? 84   GLY A C   1 
ATOM   507  O  O   . GLY A 1 73  ? 12.604  55.786  66.039  1.00 66.24  ? 84   GLY A O   1 
ATOM   508  N  N   . GLN A 1 74  ? 11.163  57.302  65.213  1.00 70.50  ? 85   GLN A N   1 
ATOM   509  C  CA  . GLN A 1 74  ? 10.036  56.383  65.206  1.00 67.56  ? 85   GLN A CA  1 
ATOM   510  C  C   . GLN A 1 74  ? 9.206   56.598  63.950  1.00 61.64  ? 85   GLN A C   1 
ATOM   511  O  O   . GLN A 1 74  ? 9.209   57.682  63.361  1.00 63.55  ? 85   GLN A O   1 
ATOM   512  C  CB  . GLN A 1 74  ? 9.159   56.555  66.454  1.00 80.95  ? 85   GLN A CB  1 
ATOM   513  C  CG  . GLN A 1 74  ? 9.824   56.109  67.746  1.00 94.33  ? 85   GLN A CG  1 
ATOM   514  C  CD  . GLN A 1 74  ? 8.907   56.227  68.946  1.00 117.67 ? 85   GLN A CD  1 
ATOM   515  O  OE1 . GLN A 1 74  ? 7.880   56.904  68.894  1.00 129.54 ? 85   GLN A OE1 1 
ATOM   516  N  NE2 . GLN A 1 74  ? 9.271   55.562  70.036  1.00 120.28 ? 85   GLN A NE2 1 
ATOM   517  N  N   . CYS A 1 75  ? 8.495   55.549  63.548  1.00 55.01  ? 86   CYS A N   1 
ATOM   518  C  CA  . CYS A 1 75  ? 7.605   55.599  62.388  1.00 59.87  ? 86   CYS A CA  1 
ATOM   519  C  C   . CYS A 1 75  ? 6.225   56.127  62.771  1.00 58.92  ? 86   CYS A C   1 
ATOM   520  O  O   . CYS A 1 75  ? 5.194   55.523  62.478  1.00 41.72  ? 86   CYS A O   1 
ATOM   521  C  CB  . CYS A 1 75  ? 7.507   54.220  61.749  1.00 71.00  ? 86   CYS A CB  1 
ATOM   522  S  SG  . CYS A 1 75  ? 9.099   53.500  61.290  1.00 64.64  ? 86   CYS A SG  1 
ATOM   523  N  N   . GLN A 1 76  ? 6.209   57.272  63.449  1.00 40.76  ? 87   GLN A N   1 
ATOM   524  C  CA  . GLN A 1 76  ? 4.977   57.914  63.876  1.00 52.56  ? 87   GLN A CA  1 
ATOM   525  C  C   . GLN A 1 76  ? 5.094   59.412  63.641  1.00 51.28  ? 87   GLN A C   1 
ATOM   526  O  O   . GLN A 1 76  ? 6.193   59.961  63.534  1.00 50.42  ? 87   GLN A O   1 
ATOM   527  C  CB  . GLN A 1 76  ? 4.672   57.634  65.354  1.00 59.74  ? 87   GLN A CB  1 
ATOM   528  C  CG  . GLN A 1 76  ? 4.370   56.179  65.671  1.00 61.54  ? 87   GLN A CG  1 
ATOM   529  C  CD  . GLN A 1 76  ? 4.229   55.929  67.160  1.00 63.64  ? 87   GLN A CD  1 
ATOM   530  O  OE1 . GLN A 1 76  ? 5.137   56.221  67.938  1.00 69.39  ? 87   GLN A OE1 1 
ATOM   531  N  NE2 . GLN A 1 76  ? 3.084   55.392  67.564  1.00 55.92  ? 87   GLN A NE2 1 
ATOM   532  N  N   . LEU A 1 77  ? 3.942   60.074  63.562  1.00 56.23  ? 88   LEU A N   1 
ATOM   533  C  CA  . LEU A 1 77  ? 3.913   61.516  63.376  1.00 53.89  ? 88   LEU A CA  1 
ATOM   534  C  C   . LEU A 1 77  ? 2.612   62.071  63.936  1.00 55.53  ? 88   LEU A C   1 
ATOM   535  O  O   . LEU A 1 77  ? 1.592   61.377  63.989  1.00 50.99  ? 88   LEU A O   1 
ATOM   536  C  CB  . LEU A 1 77  ? 4.079   61.898  61.898  1.00 47.09  ? 88   LEU A CB  1 
ATOM   537  C  CG  . LEU A 1 77  ? 3.106   61.309  60.874  1.00 49.24  ? 88   LEU A CG  1 
ATOM   538  C  CD1 . LEU A 1 77  ? 1.971   62.277  60.580  1.00 52.30  ? 88   LEU A CD1 1 
ATOM   539  C  CD2 . LEU A 1 77  ? 3.838   60.935  59.594  1.00 47.29  ? 88   LEU A CD2 1 
ATOM   540  N  N   . VAL A 1 78  ? 2.664   63.330  64.361  1.00 49.62  ? 89   VAL A N   1 
ATOM   541  C  CA  . VAL A 1 78  ? 1.520   64.032  64.929  1.00 40.77  ? 89   VAL A CA  1 
ATOM   542  C  C   . VAL A 1 78  ? 1.201   65.221  64.035  1.00 44.82  ? 89   VAL A C   1 
ATOM   543  O  O   . VAL A 1 78  ? 2.094   66.005  63.695  1.00 47.32  ? 89   VAL A O   1 
ATOM   544  C  CB  . VAL A 1 78  ? 1.795   64.489  66.373  1.00 41.09  ? 89   VAL A CB  1 
ATOM   545  C  CG1 . VAL A 1 78  ? 0.624   65.300  66.908  1.00 54.73  ? 89   VAL A CG1 1 
ATOM   546  C  CG2 . VAL A 1 78  ? 2.071   63.289  67.265  1.00 41.68  ? 89   VAL A CG2 1 
ATOM   547  N  N   . THR A 1 79  ? -0.066  65.349  63.652  1.00 51.53  ? 90   THR A N   1 
ATOM   548  C  CA  . THR A 1 79  ? -0.524  66.438  62.805  1.00 53.48  ? 90   THR A CA  1 
ATOM   549  C  C   . THR A 1 79  ? -1.440  67.366  63.590  1.00 50.81  ? 90   THR A C   1 
ATOM   550  O  O   . THR A 1 79  ? -2.111  66.951  64.539  1.00 59.19  ? 90   THR A O   1 
ATOM   551  C  CB  . THR A 1 79  ? -1.268  65.912  61.573  1.00 69.56  ? 90   THR A CB  1 
ATOM   552  O  OG1 . THR A 1 79  ? -2.404  65.143  61.989  1.00 77.93  ? 90   THR A OG1 1 
ATOM   553  C  CG2 . THR A 1 79  ? -0.353  65.042  60.729  1.00 73.24  ? 90   THR A CG2 1 
ATOM   554  N  N   . LEU A 1 80  ? -1.460  68.633  63.182  1.00 42.06  ? 91   LEU A N   1 
ATOM   555  C  CA  . LEU A 1 80  ? -2.336  69.637  63.772  1.00 49.18  ? 91   LEU A CA  1 
ATOM   556  C  C   . LEU A 1 80  ? -3.118  70.307  62.655  1.00 57.55  ? 91   LEU A C   1 
ATOM   557  O  O   . LEU A 1 80  ? -2.524  70.868  61.728  1.00 50.75  ? 91   LEU A O   1 
ATOM   558  C  CB  . LEU A 1 80  ? -1.539  70.671  64.573  1.00 42.64  ? 91   LEU A CB  1 
ATOM   559  C  CG  . LEU A 1 80  ? -2.338  71.823  65.188  1.00 56.32  ? 91   LEU A CG  1 
ATOM   560  C  CD1 . LEU A 1 80  ? -3.442  71.297  66.093  1.00 65.45  ? 91   LEU A CD1 1 
ATOM   561  C  CD2 . LEU A 1 80  ? -1.422  72.764  65.953  1.00 43.28  ? 91   LEU A CD2 1 
ATOM   562  N  N   . LEU A 1 81  ? -4.441  70.238  62.735  1.00 44.99  ? 92   LEU A N   1 
ATOM   563  C  CA  . LEU A 1 81  ? -5.320  70.877  61.769  1.00 45.94  ? 92   LEU A CA  1 
ATOM   564  C  C   . LEU A 1 81  ? -5.830  72.201  62.327  1.00 46.90  ? 92   LEU A C   1 
ATOM   565  O  O   . LEU A 1 81  ? -5.753  72.466  63.529  1.00 47.05  ? 92   LEU A O   1 
ATOM   566  C  CB  . LEU A 1 81  ? -6.494  69.961  61.413  1.00 47.12  ? 92   LEU A CB  1 
ATOM   567  C  CG  . LEU A 1 81  ? -6.160  68.511  61.054  1.00 54.78  ? 92   LEU A CG  1 
ATOM   568  C  CD1 . LEU A 1 81  ? -7.432  67.709  60.832  1.00 48.00  ? 92   LEU A CD1 1 
ATOM   569  C  CD2 . LEU A 1 81  ? -5.265  68.446  59.828  1.00 45.34  ? 92   LEU A CD2 1 
ATOM   570  N  N   . ASP A 1 82  ? -6.363  73.036  61.431  1.00 54.37  ? 93   ASP A N   1 
ATOM   571  C  CA  . ASP A 1 82  ? -6.809  74.371  61.820  1.00 48.74  ? 93   ASP A CA  1 
ATOM   572  C  C   . ASP A 1 82  ? -7.974  74.348  62.803  1.00 53.91  ? 93   ASP A C   1 
ATOM   573  O  O   . ASP A 1 82  ? -8.303  75.396  63.369  1.00 51.24  ? 93   ASP A O   1 
ATOM   574  C  CB  . ASP A 1 82  ? -7.183  75.184  60.576  1.00 49.54  ? 93   ASP A CB  1 
ATOM   575  C  CG  . ASP A 1 82  ? -8.160  74.460  59.670  1.00 58.90  ? 93   ASP A CG  1 
ATOM   576  O  OD1 . ASP A 1 82  ? -8.812  73.501  60.131  1.00 74.03  ? 93   ASP A OD1 1 
ATOM   577  O  OD2 . ASP A 1 82  ? -8.271  74.848  58.488  1.00 70.77  ? 93   ASP A OD2 1 
ATOM   578  N  N   . ASP A 1 83  ? -8.603  73.192  63.017  1.00 65.08  ? 94   ASP A N   1 
ATOM   579  C  CA  . ASP A 1 83  ? -9.625  73.033  64.041  1.00 68.79  ? 94   ASP A CA  1 
ATOM   580  C  C   . ASP A 1 83  ? -9.040  72.610  65.385  1.00 51.84  ? 94   ASP A C   1 
ATOM   581  O  O   . ASP A 1 83  ? -9.774  72.090  66.234  1.00 65.67  ? 94   ASP A O   1 
ATOM   582  C  CB  . ASP A 1 83  ? -10.683 72.027  63.580  1.00 71.44  ? 94   ASP A CB  1 
ATOM   583  C  CG  . ASP A 1 83  ? -10.090 70.682  63.202  1.00 71.34  ? 94   ASP A CG  1 
ATOM   584  O  OD1 . ASP A 1 83  ? -8.862  70.511  63.332  1.00 66.39  ? 94   ASP A OD1 1 
ATOM   585  O  OD2 . ASP A 1 83  ? -10.855 69.793  62.774  1.00 75.75  ? 94   ASP A OD2 1 
ATOM   586  N  N   . ASN A 1 84  ? -7.735  72.811  65.583  1.00 50.12  ? 95   ASN A N   1 
ATOM   587  C  CA  . ASN A 1 84  ? -7.047  72.500  66.838  1.00 50.46  ? 95   ASN A CA  1 
ATOM   588  C  C   . ASN A 1 84  ? -7.104  71.010  67.168  1.00 54.86  ? 95   ASN A C   1 
ATOM   589  O  O   . ASN A 1 84  ? -7.152  70.625  68.339  1.00 63.16  ? 95   ASN A O   1 
ATOM   590  C  CB  . ASN A 1 84  ? -7.607  73.325  68.000  1.00 50.93  ? 95   ASN A CB  1 
ATOM   591  C  CG  . ASN A 1 84  ? -6.519  73.904  68.879  1.00 73.75  ? 95   ASN A CG  1 
ATOM   592  O  OD1 . ASN A 1 84  ? -5.445  74.268  68.399  1.00 80.07  ? 95   ASN A OD1 1 
ATOM   593  N  ND2 . ASN A 1 84  ? -6.789  73.990  70.176  1.00 72.28  ? 95   ASN A ND2 1 
ATOM   594  N  N   . SER A 1 85  ? -7.087  70.161  66.145  1.00 52.06  ? 96   SER A N   1 
ATOM   595  C  CA  . SER A 1 85  ? -7.154  68.718  66.324  1.00 52.59  ? 96   SER A CA  1 
ATOM   596  C  C   . SER A 1 85  ? -5.771  68.099  66.169  1.00 69.99  ? 96   SER A C   1 
ATOM   597  O  O   . SER A 1 85  ? -4.989  68.508  65.306  1.00 76.03  ? 96   SER A O   1 
ATOM   598  C  CB  . SER A 1 85  ? -8.117  68.086  65.318  1.00 51.87  ? 96   SER A CB  1 
ATOM   599  O  OG  . SER A 1 85  ? -9.414  68.641  65.433  1.00 87.71  ? 96   SER A OG  1 
ATOM   600  N  N   . LEU A 1 86  ? -5.478  67.112  67.009  1.00 69.16  ? 97   LEU A N   1 
ATOM   601  C  CA  . LEU A 1 86  ? -4.249  66.340  66.924  1.00 63.22  ? 97   LEU A CA  1 
ATOM   602  C  C   . LEU A 1 86  ? -4.563  64.925  66.458  1.00 60.28  ? 97   LEU A C   1 
ATOM   603  O  O   . LEU A 1 86  ? -5.607  64.360  66.796  1.00 70.12  ? 97   LEU A O   1 
ATOM   604  C  CB  . LEU A 1 86  ? -3.523  66.300  68.272  1.00 66.78  ? 97   LEU A CB  1 
ATOM   605  C  CG  . LEU A 1 86  ? -2.966  67.630  68.783  1.00 53.26  ? 97   LEU A CG  1 
ATOM   606  C  CD1 . LEU A 1 86  ? -2.212  67.430  70.088  1.00 62.88  ? 97   LEU A CD1 1 
ATOM   607  C  CD2 . LEU A 1 86  ? -2.070  68.272  67.738  1.00 44.15  ? 97   LEU A CD2 1 
ATOM   608  N  N   . HIS A 1 87  ? -3.652  64.358  65.670  1.00 48.94  ? 98   HIS A N   1 
ATOM   609  C  CA  . HIS A 1 87  ? -3.849  63.035  65.093  1.00 50.82  ? 98   HIS A CA  1 
ATOM   610  C  C   . HIS A 1 87  ? -2.530  62.280  65.091  1.00 56.11  ? 98   HIS A C   1 
ATOM   611  O  O   . HIS A 1 87  ? -1.509  62.812  64.647  1.00 58.44  ? 98   HIS A O   1 
ATOM   612  C  CB  . HIS A 1 87  ? -4.405  63.134  63.667  1.00 46.64  ? 98   HIS A CB  1 
ATOM   613  C  CG  . HIS A 1 87  ? -5.651  63.957  63.560  1.00 60.08  ? 98   HIS A CG  1 
ATOM   614  N  ND1 . HIS A 1 87  ? -6.914  63.408  63.625  1.00 57.00  ? 98   HIS A ND1 1 
ATOM   615  C  CD2 . HIS A 1 87  ? -5.829  65.290  63.398  1.00 59.27  ? 98   HIS A CD2 1 
ATOM   616  C  CE1 . HIS A 1 87  ? -7.815  64.366  63.504  1.00 60.47  ? 98   HIS A CE1 1 
ATOM   617  N  NE2 . HIS A 1 87  ? -7.183  65.517  63.365  1.00 56.28  ? 98   HIS A NE2 1 
ATOM   618  N  N   . LEU A 1 88  ? -2.556  61.044  65.583  1.00 53.57  ? 99   LEU A N   1 
ATOM   619  C  CA  . LEU A 1 88  ? -1.376  60.190  65.631  1.00 53.99  ? 99   LEU A CA  1 
ATOM   620  C  C   . LEU A 1 88  ? -1.406  59.230  64.449  1.00 63.75  ? 99   LEU A C   1 
ATOM   621  O  O   . LEU A 1 88  ? -2.305  58.387  64.352  1.00 79.88  ? 99   LEU A O   1 
ATOM   622  C  CB  . LEU A 1 88  ? -1.312  59.416  66.947  1.00 45.61  ? 99   LEU A CB  1 
ATOM   623  C  CG  . LEU A 1 88  ? -0.081  58.535  67.161  1.00 56.85  ? 99   LEU A CG  1 
ATOM   624  C  CD1 . LEU A 1 88  ? 1.187   59.375  67.143  1.00 78.13  ? 99   LEU A CD1 1 
ATOM   625  C  CD2 . LEU A 1 88  ? -0.197  57.762  68.464  1.00 57.39  ? 99   LEU A CD2 1 
ATOM   626  N  N   . TRP A 1 89  ? -0.428  59.357  63.560  1.00 68.65  ? 100  TRP A N   1 
ATOM   627  C  CA  . TRP A 1 89  ? -0.302  58.495  62.396  1.00 69.32  ? 100  TRP A CA  1 
ATOM   628  C  C   . TRP A 1 89  ? 0.881   57.553  62.572  1.00 72.01  ? 100  TRP A C   1 
ATOM   629  O  O   . TRP A 1 89  ? 1.858   57.878  63.252  1.00 66.50  ? 100  TRP A O   1 
ATOM   630  C  CB  . TRP A 1 89  ? -0.130  59.320  61.118  1.00 62.09  ? 100  TRP A CB  1 
ATOM   631  C  CG  . TRP A 1 89  ? -1.316  60.177  60.795  1.00 59.31  ? 100  TRP A CG  1 
ATOM   632  C  CD1 . TRP A 1 89  ? -1.670  61.348  61.399  1.00 57.62  ? 100  TRP A CD1 1 
ATOM   633  C  CD2 . TRP A 1 89  ? -2.302  59.932  59.785  1.00 61.70  ? 100  TRP A CD2 1 
ATOM   634  N  NE1 . TRP A 1 89  ? -2.817  61.846  60.830  1.00 60.58  ? 100  TRP A NE1 1 
ATOM   635  C  CE2 . TRP A 1 89  ? -3.225  60.995  59.836  1.00 57.75  ? 100  TRP A CE2 1 
ATOM   636  C  CE3 . TRP A 1 89  ? -2.494  58.917  58.843  1.00 48.22  ? 100  TRP A CE3 1 
ATOM   637  C  CZ2 . TRP A 1 89  ? -4.322  61.072  58.982  1.00 50.82  ? 100  TRP A CZ2 1 
ATOM   638  C  CZ3 . TRP A 1 89  ? -3.583  58.995  57.996  1.00 44.62  ? 100  TRP A CZ3 1 
ATOM   639  C  CH2 . TRP A 1 89  ? -4.483  60.064  58.071  1.00 52.32  ? 100  TRP A CH2 1 
ATOM   640  N  N   . SER A 1 90  ? 0.785   56.378  61.953  1.00 63.48  ? 101  SER A N   1 
ATOM   641  C  CA  . SER A 1 90  ? 1.819   55.360  62.059  1.00 61.41  ? 101  SER A CA  1 
ATOM   642  C  C   . SER A 1 90  ? 2.088   54.766  60.684  1.00 57.81  ? 101  SER A C   1 
ATOM   643  O  O   . SER A 1 90  ? 1.323   54.958  59.735  1.00 44.96  ? 101  SER A O   1 
ATOM   644  C  CB  . SER A 1 90  ? 1.425   54.256  63.048  1.00 67.12  ? 101  SER A CB  1 
ATOM   645  O  OG  . SER A 1 90  ? 1.222   54.781  64.347  1.00 83.49  ? 101  SER A OG  1 
ATOM   646  N  N   . LEU A 1 91  ? 3.196   54.034  60.588  1.00 53.59  ? 102  LEU A N   1 
ATOM   647  C  CA  . LEU A 1 91  ? 3.587   53.315  59.376  1.00 51.21  ? 102  LEU A CA  1 
ATOM   648  C  C   . LEU A 1 91  ? 3.578   51.825  59.699  1.00 63.36  ? 102  LEU A C   1 
ATOM   649  O  O   . LEU A 1 91  ? 4.618   51.225  59.979  1.00 77.78  ? 102  LEU A O   1 
ATOM   650  C  CB  . LEU A 1 91  ? 4.959   53.783  58.869  1.00 56.03  ? 102  LEU A CB  1 
ATOM   651  C  CG  . LEU A 1 91  ? 4.943   54.731  57.667  1.00 55.54  ? 102  LEU A CG  1 
ATOM   652  C  CD1 . LEU A 1 91  ? 4.073   55.943  57.949  1.00 63.09  ? 102  LEU A CD1 1 
ATOM   653  C  CD2 . LEU A 1 91  ? 6.355   55.159  57.296  1.00 47.68  ? 102  LEU A CD2 1 
ATOM   654  N  N   . LYS A 1 92  ? 2.388   51.230  59.663  1.00 82.70  ? 103  LYS A N   1 
ATOM   655  C  CA  . LYS A 1 92  ? 2.233   49.810  59.948  1.00 92.60  ? 103  LYS A CA  1 
ATOM   656  C  C   . LYS A 1 92  ? 2.640   48.982  58.736  1.00 92.35  ? 103  LYS A C   1 
ATOM   657  O  O   . LYS A 1 92  ? 2.181   49.234  57.617  1.00 92.94  ? 103  LYS A O   1 
ATOM   658  C  CB  . LYS A 1 92  ? 0.788   49.501  60.337  1.00 94.95  ? 103  LYS A CB  1 
ATOM   659  C  CG  . LYS A 1 92  ? 0.420   49.890  61.759  1.00 91.29  ? 103  LYS A CG  1 
ATOM   660  C  CD  . LYS A 1 92  ? 0.577   48.714  62.709  1.00 102.58 ? 103  LYS A CD  1 
ATOM   661  C  CE  . LYS A 1 92  ? -0.009  49.027  64.077  1.00 106.83 ? 103  LYS A CE  1 
ATOM   662  N  NZ  . LYS A 1 92  ? -0.013  47.833  64.968  1.00 101.64 ? 103  LYS A NZ  1 
ATOM   663  N  N   . VAL A 1 93  ? 3.499   47.991  58.963  1.00 89.62  ? 104  VAL A N   1 
ATOM   664  C  CA  . VAL A 1 93  ? 3.955   47.094  57.907  1.00 85.68  ? 104  VAL A CA  1 
ATOM   665  C  C   . VAL A 1 93  ? 2.954   45.946  57.829  1.00 84.09  ? 104  VAL A C   1 
ATOM   666  O  O   . VAL A 1 93  ? 2.971   45.031  58.653  1.00 83.25  ? 104  VAL A O   1 
ATOM   667  C  CB  . VAL A 1 93  ? 5.377   46.593  58.162  1.00 77.32  ? 104  VAL A CB  1 
ATOM   668  C  CG1 . VAL A 1 93  ? 5.826   45.680  57.031  1.00 66.92  ? 104  VAL A CG1 1 
ATOM   669  C  CG2 . VAL A 1 93  ? 6.332   47.768  58.320  1.00 84.88  ? 104  VAL A CG2 1 
ATOM   670  N  N   . LYS A 1 94  ? 2.075   45.997  56.833  1.00 88.94  ? 105  LYS A N   1 
ATOM   671  C  CA  . LYS A 1 94  ? 1.033   44.993  56.638  1.00 88.66  ? 105  LYS A CA  1 
ATOM   672  C  C   . LYS A 1 94  ? 1.326   44.246  55.340  1.00 91.39  ? 105  LYS A C   1 
ATOM   673  O  O   . LYS A 1 94  ? 1.018   44.733  54.249  1.00 90.41  ? 105  LYS A O   1 
ATOM   674  C  CB  . LYS A 1 94  ? -0.349  45.640  56.612  1.00 82.33  ? 105  LYS A CB  1 
ATOM   675  N  N   . GLY A 1 95  ? 1.923   43.063  55.464  1.00 92.71  ? 106  GLY A N   1 
ATOM   676  C  CA  . GLY A 1 95  ? 2.197   42.226  54.313  1.00 91.87  ? 106  GLY A CA  1 
ATOM   677  C  C   . GLY A 1 95  ? 3.490   42.560  53.601  1.00 92.80  ? 106  GLY A C   1 
ATOM   678  O  O   . GLY A 1 95  ? 3.504   42.740  52.379  1.00 94.54  ? 106  GLY A O   1 
ATOM   679  N  N   . GLY A 1 96  ? 4.586   42.649  54.352  1.00 94.51  ? 107  GLY A N   1 
ATOM   680  C  CA  . GLY A 1 96  ? 5.885   42.930  53.777  1.00 92.72  ? 107  GLY A CA  1 
ATOM   681  C  C   . GLY A 1 96  ? 6.072   44.331  53.238  1.00 91.28  ? 107  GLY A C   1 
ATOM   682  O  O   . GLY A 1 96  ? 7.167   44.648  52.760  1.00 92.54  ? 107  GLY A O   1 
ATOM   683  N  N   . ALA A 1 97  ? 5.046   45.178  53.293  1.00 91.98  ? 108  ALA A N   1 
ATOM   684  C  CA  . ALA A 1 97  ? 5.139   46.553  52.822  1.00 93.72  ? 108  ALA A CA  1 
ATOM   685  C  C   . ALA A 1 97  ? 4.375   47.450  53.781  1.00 81.26  ? 108  ALA A C   1 
ATOM   686  O  O   . ALA A 1 97  ? 3.251   47.125  54.175  1.00 81.53  ? 108  ALA A O   1 
ATOM   687  C  CB  . ALA A 1 97  ? 4.585   46.696  51.400  1.00 101.38 ? 108  ALA A CB  1 
ATOM   688  N  N   . SER A 1 98  ? 4.983   48.571  54.152  1.00 71.95  ? 109  SER A N   1 
ATOM   689  C  CA  . SER A 1 98  ? 4.382   49.469  55.125  1.00 67.85  ? 109  SER A CA  1 
ATOM   690  C  C   . SER A 1 98  ? 3.295   50.323  54.482  1.00 61.62  ? 109  SER A C   1 
ATOM   691  O  O   . SER A 1 98  ? 3.307   50.585  53.276  1.00 44.01  ? 109  SER A O   1 
ATOM   692  C  CB  . SER A 1 98  ? 5.449   50.364  55.758  1.00 55.69  ? 109  SER A CB  1 
ATOM   693  O  OG  . SER A 1 98  ? 6.255   50.982  54.769  1.00 54.07  ? 109  SER A OG  1 
ATOM   694  N  N   . GLU A 1 99  ? 2.340   50.748  55.308  1.00 67.89  ? 110  GLU A N   1 
ATOM   695  C  CA  . GLU A 1 99  ? 1.268   51.631  54.876  1.00 77.92  ? 110  GLU A CA  1 
ATOM   696  C  C   . GLU A 1 99  ? 0.992   52.646  55.977  1.00 78.15  ? 110  GLU A C   1 
ATOM   697  O  O   . GLU A 1 99  ? 1.398   52.470  57.128  1.00 80.91  ? 110  GLU A O   1 
ATOM   698  C  CB  . GLU A 1 99  ? -0.009  50.852  54.531  1.00 96.28  ? 110  GLU A CB  1 
ATOM   699  C  CG  . GLU A 1 99  ? -0.679  50.190  55.723  1.00 115.32 ? 110  GLU A CG  1 
ATOM   700  C  CD  . GLU A 1 99  ? -1.912  49.399  55.331  1.00 128.01 ? 110  GLU A CD  1 
ATOM   701  O  OE1 . GLU A 1 99  ? -1.973  48.924  54.177  1.00 131.20 ? 110  GLU A OE1 1 
ATOM   702  O  OE2 . GLU A 1 99  ? -2.823  49.258  56.174  1.00 130.61 ? 110  GLU A OE2 1 
ATOM   703  N  N   . LEU A 1 100 ? 0.292   53.713  55.608  1.00 68.56  ? 111  LEU A N   1 
ATOM   704  C  CA  . LEU A 1 100 ? 0.017   54.826  56.508  1.00 54.54  ? 111  LEU A CA  1 
ATOM   705  C  C   . LEU A 1 100 ? -1.399  54.708  57.058  1.00 52.24  ? 111  LEU A C   1 
ATOM   706  O  O   . LEU A 1 100 ? -2.345  54.470  56.300  1.00 67.46  ? 111  LEU A O   1 
ATOM   707  C  CB  . LEU A 1 100 ? 0.200   56.159  55.780  1.00 51.72  ? 111  LEU A CB  1 
ATOM   708  C  CG  . LEU A 1 100 ? -0.072  57.457  56.542  1.00 48.86  ? 111  LEU A CG  1 
ATOM   709  C  CD1 . LEU A 1 100 ? 0.794   57.552  57.786  1.00 41.60  ? 111  LEU A CD1 1 
ATOM   710  C  CD2 . LEU A 1 100 ? 0.165   58.653  55.634  1.00 54.06  ? 111  LEU A CD2 1 
ATOM   711  N  N   . GLN A 1 101 ? -1.540  54.874  58.372  1.00 50.38  ? 112  GLN A N   1 
ATOM   712  C  CA  . GLN A 1 101 ? -2.842  54.787  59.015  1.00 57.17  ? 112  GLN A CA  1 
ATOM   713  C  C   . GLN A 1 101 ? -2.891  55.751  60.191  1.00 55.66  ? 112  GLN A C   1 
ATOM   714  O  O   . GLN A 1 101 ? -1.869  56.047  60.815  1.00 61.72  ? 112  GLN A O   1 
ATOM   715  C  CB  . GLN A 1 101 ? -3.146  53.358  59.485  1.00 65.81  ? 112  GLN A CB  1 
ATOM   716  C  CG  . GLN A 1 101 ? -2.235  52.854  60.592  1.00 82.30  ? 112  GLN A CG  1 
ATOM   717  C  CD  . GLN A 1 101 ? -2.561  51.434  61.012  1.00 90.61  ? 112  GLN A CD  1 
ATOM   718  O  OE1 . GLN A 1 101 ? -2.530  51.102  62.197  1.00 90.87  ? 112  GLN A OE1 1 
ATOM   719  N  NE2 . GLN A 1 101 ? -2.871  50.586  60.038  1.00 98.79  ? 112  GLN A NE2 1 
ATOM   720  N  N   . GLU A 1 102 ? -4.094  56.240  60.483  1.00 60.70  ? 113  GLU A N   1 
ATOM   721  C  CA  . GLU A 1 102 ? -4.331  57.163  61.585  1.00 54.59  ? 113  GLU A CA  1 
ATOM   722  C  C   . GLU A 1 102 ? -4.857  56.375  62.779  1.00 58.27  ? 113  GLU A C   1 
ATOM   723  O  O   . GLU A 1 102 ? -5.941  55.785  62.709  1.00 65.52  ? 113  GLU A O   1 
ATOM   724  C  CB  . GLU A 1 102 ? -5.319  58.256  61.175  1.00 53.39  ? 113  GLU A CB  1 
ATOM   725  C  CG  . GLU A 1 102 ? -5.690  59.222  62.287  1.00 61.34  ? 113  GLU A CG  1 
ATOM   726  C  CD  . GLU A 1 102 ? -6.649  60.301  61.820  1.00 72.60  ? 113  GLU A CD  1 
ATOM   727  O  OE1 . GLU A 1 102 ? -6.884  61.261  62.583  1.00 71.31  ? 113  GLU A OE1 1 
ATOM   728  O  OE2 . GLU A 1 102 ? -7.167  60.191  60.688  1.00 72.48  ? 113  GLU A OE2 1 
ATOM   729  N  N   . ASP A 1 103 ? -4.091  56.369  63.870  1.00 65.87  ? 114  ASP A N   1 
ATOM   730  C  CA  . ASP A 1 103 ? -4.421  55.522  65.012  1.00 76.92  ? 114  ASP A CA  1 
ATOM   731  C  C   . ASP A 1 103 ? -5.473  56.168  65.908  1.00 80.43  ? 114  ASP A C   1 
ATOM   732  O  O   . ASP A 1 103 ? -6.570  55.627  66.085  1.00 91.38  ? 114  ASP A O   1 
ATOM   733  C  CB  . ASP A 1 103 ? -3.154  55.205  65.809  1.00 74.26  ? 114  ASP A CB  1 
ATOM   734  C  CG  . ASP A 1 103 ? -2.127  54.447  64.992  1.00 81.54  ? 114  ASP A CG  1 
ATOM   735  O  OD1 . ASP A 1 103 ? -2.530  53.708  64.068  1.00 83.64  ? 114  ASP A OD1 1 
ATOM   736  O  OD2 . ASP A 1 103 ? -0.919  54.589  65.273  1.00 92.70  ? 114  ASP A OD2 1 
ATOM   737  N  N   . GLU A 1 104 ? -5.156  57.323  66.486  1.00 66.35  ? 115  GLU A N   1 
ATOM   738  C  CA  . GLU A 1 104 ? -6.032  57.982  67.443  1.00 77.51  ? 115  GLU A CA  1 
ATOM   739  C  C   . GLU A 1 104 ? -6.134  59.466  67.115  1.00 67.85  ? 115  GLU A C   1 
ATOM   740  O  O   . GLU A 1 104 ? -5.453  59.981  66.224  1.00 65.06  ? 115  GLU A O   1 
ATOM   741  C  CB  . GLU A 1 104 ? -5.532  57.779  68.879  1.00 81.57  ? 115  GLU A CB  1 
ATOM   742  C  CG  . GLU A 1 104 ? -5.572  56.332  69.348  1.00 95.65  ? 115  GLU A CG  1 
ATOM   743  C  CD  . GLU A 1 104 ? -4.296  55.908  70.050  1.00 101.41 ? 115  GLU A CD  1 
ATOM   744  O  OE1 . GLU A 1 104 ? -3.318  56.686  70.038  1.00 99.42  ? 115  GLU A OE1 1 
ATOM   745  O  OE2 . GLU A 1 104 ? -4.270  54.794  70.612  1.00 107.36 ? 115  GLU A OE2 1 
ATOM   746  N  N   . SER A 1 105 ? -7.002  60.155  67.853  1.00 78.49  ? 116  SER A N   1 
ATOM   747  C  CA  . SER A 1 105 ? -7.226  61.579  67.651  1.00 81.12  ? 116  SER A CA  1 
ATOM   748  C  C   . SER A 1 105 ? -7.583  62.221  68.985  1.00 70.43  ? 116  SER A C   1 
ATOM   749  O  O   . SER A 1 105 ? -7.980  61.544  69.937  1.00 77.99  ? 116  SER A O   1 
ATOM   750  C  CB  . SER A 1 105 ? -8.328  61.835  66.616  1.00 91.31  ? 116  SER A CB  1 
ATOM   751  O  OG  . SER A 1 105 ? -9.552  61.247  67.018  1.00 99.17  ? 116  SER A OG  1 
ATOM   752  N  N   . PHE A 1 106 ? -7.442  63.545  69.037  1.00 51.99  ? 117  PHE A N   1 
ATOM   753  C  CA  . PHE A 1 106 ? -7.644  64.296  70.269  1.00 52.88  ? 117  PHE A CA  1 
ATOM   754  C  C   . PHE A 1 106 ? -7.787  65.773  69.936  1.00 58.54  ? 117  PHE A C   1 
ATOM   755  O  O   . PHE A 1 106 ? -7.078  66.287  69.068  1.00 72.58  ? 117  PHE A O   1 
ATOM   756  C  CB  . PHE A 1 106 ? -6.474  64.077  71.239  1.00 68.78  ? 117  PHE A CB  1 
ATOM   757  C  CG  . PHE A 1 106 ? -6.405  65.083  72.352  1.00 70.43  ? 117  PHE A CG  1 
ATOM   758  C  CD1 . PHE A 1 106 ? -7.207  64.954  73.473  1.00 65.57  ? 117  PHE A CD1 1 
ATOM   759  C  CD2 . PHE A 1 106 ? -5.521  66.149  72.285  1.00 67.66  ? 117  PHE A CD2 1 
ATOM   760  C  CE1 . PHE A 1 106 ? -7.139  65.876  74.501  1.00 65.63  ? 117  PHE A CE1 1 
ATOM   761  C  CE2 . PHE A 1 106 ? -5.448  67.074  73.309  1.00 71.71  ? 117  PHE A CE2 1 
ATOM   762  C  CZ  . PHE A 1 106 ? -6.258  66.937  74.419  1.00 66.40  ? 117  PHE A CZ  1 
ATOM   763  N  N   . THR A 1 107 ? -8.697  66.447  70.636  1.00 56.98  ? 118  THR A N   1 
ATOM   764  C  CA  . THR A 1 107 ? -8.926  67.877  70.463  1.00 67.08  ? 118  THR A CA  1 
ATOM   765  C  C   . THR A 1 107 ? -8.835  68.556  71.821  1.00 68.52  ? 118  THR A C   1 
ATOM   766  O  O   . THR A 1 107 ? -9.564  68.190  72.749  1.00 68.33  ? 118  THR A O   1 
ATOM   767  C  CB  . THR A 1 107 ? -10.290 68.149  69.821  1.00 65.13  ? 118  THR A CB  1 
ATOM   768  O  OG1 . THR A 1 107 ? -10.323 67.590  68.502  1.00 68.48  ? 118  THR A OG1 1 
ATOM   769  C  CG2 . THR A 1 107 ? -10.547 69.646  69.736  1.00 57.23  ? 118  THR A CG2 1 
ATOM   770  N  N   . LEU A 1 108 ? -7.945  69.539  71.936  1.00 62.48  ? 119  LEU A N   1 
ATOM   771  C  CA  . LEU A 1 108 ? -7.796  70.268  73.189  1.00 65.26  ? 119  LEU A CA  1 
ATOM   772  C  C   . LEU A 1 108 ? -9.023  71.139  73.433  1.00 73.59  ? 119  LEU A C   1 
ATOM   773  O  O   . LEU A 1 108 ? -9.431  71.910  72.559  1.00 77.76  ? 119  LEU A O   1 
ATOM   774  C  CB  . LEU A 1 108 ? -6.530  71.121  73.155  1.00 57.27  ? 119  LEU A CB  1 
ATOM   775  C  CG  . LEU A 1 108 ? -5.981  71.582  74.505  1.00 62.90  ? 119  LEU A CG  1 
ATOM   776  C  CD1 . LEU A 1 108 ? -5.571  70.386  75.352  1.00 52.89  ? 119  LEU A CD1 1 
ATOM   777  C  CD2 . LEU A 1 108 ? -4.810  72.532  74.318  1.00 62.02  ? 119  LEU A CD2 1 
ATOM   778  N  N   . ARG A 1 109 ? -9.618  71.012  74.620  1.00 68.88  ? 120  ARG A N   1 
ATOM   779  C  CA  . ARG A 1 109 ? -10.885 71.685  74.878  1.00 75.54  ? 120  ARG A CA  1 
ATOM   780  C  C   . ARG A 1 109 ? -10.714 72.891  75.788  1.00 66.81  ? 120  ARG A C   1 
ATOM   781  O  O   . ARG A 1 109 ? -10.835 74.037  75.349  1.00 69.18  ? 120  ARG A O   1 
ATOM   782  C  CB  . ARG A 1 109 ? -11.890 70.720  75.507  1.00 93.11  ? 120  ARG A CB  1 
ATOM   783  C  CG  . ARG A 1 109 ? -12.255 69.523  74.646  1.00 94.27  ? 120  ARG A CG  1 
ATOM   784  C  CD  . ARG A 1 109 ? -12.944 69.958  73.360  1.00 85.61  ? 120  ARG A CD  1 
ATOM   785  N  NE  . ARG A 1 109 ? -13.346 68.823  72.532  1.00 87.81  ? 120  ARG A NE  1 
ATOM   786  C  CZ  . ARG A 1 109 ? -13.907 68.933  71.331  1.00 88.49  ? 120  ARG A CZ  1 
ATOM   787  N  NH1 . ARG A 1 109 ? -14.134 70.132  70.810  1.00 88.76  ? 120  ARG A NH1 1 
ATOM   788  N  NH2 . ARG A 1 109 ? -14.239 67.845  70.648  1.00 84.31  ? 120  ARG A NH2 1 
ATOM   789  N  N   . GLY A 1 110 ? -10.441 72.632  77.061  1.00 61.34  ? 121  GLY A N   1 
ATOM   790  C  CA  . GLY A 1 110 ? -10.402 73.657  78.074  1.00 62.26  ? 121  GLY A CA  1 
ATOM   791  C  C   . GLY A 1 110 ? -11.682 73.654  78.884  1.00 70.29  ? 121  GLY A C   1 
ATOM   792  O  O   . GLY A 1 110 ? -12.632 72.930  78.568  1.00 78.51  ? 121  GLY A O   1 
ATOM   793  N  N   . PRO A 1 111 ? -11.736 74.463  79.941  1.00 73.73  ? 122  PRO A N   1 
ATOM   794  C  CA  . PRO A 1 111 ? -12.943 74.504  80.759  1.00 69.57  ? 122  PRO A CA  1 
ATOM   795  C  C   . PRO A 1 111 ? -14.135 74.939  79.934  1.00 89.23  ? 122  PRO A C   1 
ATOM   796  O  O   . PRO A 1 111 ? -13.989 75.650  78.921  1.00 114.73 ? 122  PRO A O   1 
ATOM   797  C  CB  . PRO A 1 111 ? -12.598 75.535  81.844  1.00 70.20  ? 122  PRO A CB  1 
ATOM   798  C  CG  . PRO A 1 111 ? -11.113 75.528  81.908  1.00 88.65  ? 122  PRO A CG  1 
ATOM   799  C  CD  . PRO A 1 111 ? -10.665 75.310  80.493  1.00 65.27  ? 122  PRO A CD  1 
ATOM   800  N  N   . PRO A 1 112 ? -15.344 74.529  80.326  1.00 86.88  ? 123  PRO A N   1 
ATOM   801  C  CA  . PRO A 1 112 ? -16.538 74.864  79.538  1.00 93.72  ? 123  PRO A CA  1 
ATOM   802  C  C   . PRO A 1 112 ? -16.739 76.358  79.345  1.00 95.30  ? 123  PRO A C   1 
ATOM   803  O  O   . PRO A 1 112 ? -16.894 76.823  78.211  1.00 98.43  ? 123  PRO A O   1 
ATOM   804  C  CB  . PRO A 1 112 ? -17.677 74.244  80.359  1.00 104.64 ? 123  PRO A CB  1 
ATOM   805  C  CG  . PRO A 1 112 ? -17.025 73.150  81.135  1.00 99.40  ? 123  PRO A CG  1 
ATOM   806  C  CD  . PRO A 1 112 ? -15.672 73.682  81.485  1.00 94.67  ? 123  PRO A CD  1 
ATOM   807  N  N   . GLY A 1 113 ? -16.720 77.123  80.434  1.00 96.60  ? 124  GLY A N   1 
ATOM   808  C  CA  . GLY A 1 113 ? -17.021 78.536  80.357  1.00 77.78  ? 124  GLY A CA  1 
ATOM   809  C  C   . GLY A 1 113 ? -15.825 79.362  79.942  1.00 88.17  ? 124  GLY A C   1 
ATOM   810  O  O   . GLY A 1 113 ? -15.851 80.589  80.057  1.00 75.56  ? 124  GLY A O   1 
ATOM   811  N  N   . ALA A 1 114 ? -14.773 78.709  79.463  1.00 85.33  ? 125  ALA A N   1 
ATOM   812  C  CA  . ALA A 1 114 ? -13.557 79.400  79.069  1.00 69.68  ? 125  ALA A CA  1 
ATOM   813  C  C   . ALA A 1 114 ? -13.659 79.880  77.625  1.00 77.78  ? 125  ALA A C   1 
ATOM   814  O  O   . ALA A 1 114 ? -14.535 79.468  76.860  1.00 94.66  ? 125  ALA A O   1 
ATOM   815  C  CB  . ALA A 1 114 ? -12.337 78.493  79.238  1.00 67.35  ? 125  ALA A CB  1 
ATOM   816  N  N   . ALA A 1 115 ? -12.748 80.776  77.264  1.00 77.35  ? 126  ALA A N   1 
ATOM   817  C  CA  . ALA A 1 115 ? -12.703 81.298  75.910  1.00 66.18  ? 126  ALA A CA  1 
ATOM   818  C  C   . ALA A 1 115 ? -12.220 80.218  74.942  1.00 79.65  ? 126  ALA A C   1 
ATOM   819  O  O   . ALA A 1 115 ? -11.375 79.390  75.293  1.00 79.45  ? 126  ALA A O   1 
ATOM   820  C  CB  . ALA A 1 115 ? -11.781 82.512  75.842  1.00 65.12  ? 126  ALA A CB  1 
ATOM   821  N  N   . PRO A 1 116 ? -12.743 80.206  73.712  1.00 82.39  ? 127  PRO A N   1 
ATOM   822  C  CA  . PRO A 1 116 ? -12.343 79.144  72.774  1.00 75.53  ? 127  PRO A CA  1 
ATOM   823  C  C   . PRO A 1 116 ? -10.903 79.263  72.312  1.00 70.86  ? 127  PRO A C   1 
ATOM   824  O  O   . PRO A 1 116 ? -10.223 78.241  72.156  1.00 65.32  ? 127  PRO A O   1 
ATOM   825  C  CB  . PRO A 1 116 ? -13.335 79.316  71.616  1.00 63.69  ? 127  PRO A CB  1 
ATOM   826  C  CG  . PRO A 1 116 ? -13.703 80.759  71.660  1.00 70.03  ? 127  PRO A CG  1 
ATOM   827  C  CD  . PRO A 1 116 ? -13.718 81.137  73.116  1.00 77.99  ? 127  PRO A CD  1 
ATOM   828  N  N   . SER A 1 117 ? -10.412 80.483  72.089  1.00 65.91  ? 128  SER A N   1 
ATOM   829  C  CA  . SER A 1 117 ? -9.042  80.677  71.634  1.00 59.06  ? 128  SER A CA  1 
ATOM   830  C  C   . SER A 1 117 ? -8.020  80.529  72.751  1.00 60.50  ? 128  SER A C   1 
ATOM   831  O  O   . SER A 1 117 ? -6.817  80.543  72.473  1.00 66.00  ? 128  SER A O   1 
ATOM   832  C  CB  . SER A 1 117 ? -8.889  82.056  70.988  1.00 60.84  ? 128  SER A CB  1 
ATOM   833  O  OG  . SER A 1 117 ? -9.207  83.090  71.904  1.00 75.07  ? 128  SER A OG  1 
ATOM   834  N  N   . ALA A 1 118 ? -8.463  80.388  74.001  1.00 62.23  ? 129  ALA A N   1 
ATOM   835  C  CA  . ALA A 1 118 ? -7.520  80.235  75.102  1.00 62.63  ? 129  ALA A CA  1 
ATOM   836  C  C   . ALA A 1 118 ? -6.752  78.928  75.004  1.00 55.26  ? 129  ALA A C   1 
ATOM   837  O  O   . ALA A 1 118 ? -5.642  78.822  75.540  1.00 75.87  ? 129  ALA A O   1 
ATOM   838  C  CB  . ALA A 1 118 ? -8.252  80.329  76.443  1.00 76.12  ? 129  ALA A CB  1 
ATOM   839  N  N   . THR A 1 119 ? -7.318  77.927  74.329  1.00 63.08  ? 130  THR A N   1 
ATOM   840  C  CA  . THR A 1 119 ? -6.674  76.633  74.154  1.00 56.26  ? 130  THR A CA  1 
ATOM   841  C  C   . THR A 1 119 ? -6.370  76.349  72.685  1.00 54.47  ? 130  THR A C   1 
ATOM   842  O  O   . THR A 1 119 ? -6.278  75.190  72.276  1.00 62.20  ? 130  THR A O   1 
ATOM   843  C  CB  . THR A 1 119 ? -7.531  75.518  74.750  1.00 62.44  ? 130  THR A CB  1 
ATOM   844  O  OG1 . THR A 1 119 ? -8.847  75.572  74.189  1.00 74.42  ? 130  THR A OG1 1 
ATOM   845  C  CG2 . THR A 1 119 ? -7.619  75.670  76.263  1.00 76.83  ? 130  THR A CG2 1 
ATOM   846  N  N   . GLN A 1 120 ? -6.221  77.398  71.879  1.00 52.10  ? 131  GLN A N   1 
ATOM   847  C  CA  . GLN A 1 120 ? -5.790  77.241  70.495  1.00 62.03  ? 131  GLN A CA  1 
ATOM   848  C  C   . GLN A 1 120 ? -4.292  76.959  70.466  1.00 48.96  ? 131  GLN A C   1 
ATOM   849  O  O   . GLN A 1 120 ? -3.489  77.800  70.883  1.00 57.87  ? 131  GLN A O   1 
ATOM   850  C  CB  . GLN A 1 120 ? -6.124  78.490  69.682  1.00 73.42  ? 131  GLN A CB  1 
ATOM   851  C  CG  . GLN A 1 120 ? -7.514  78.479  69.067  1.00 85.75  ? 131  GLN A CG  1 
ATOM   852  C  CD  . GLN A 1 120 ? -7.591  77.613  67.825  1.00 84.07  ? 131  GLN A CD  1 
ATOM   853  O  OE1 . GLN A 1 120 ? -6.581  77.360  67.168  1.00 80.42  ? 131  GLN A OE1 1 
ATOM   854  N  NE2 . GLN A 1 120 ? -8.793  77.153  67.496  1.00 80.84  ? 131  GLN A NE2 1 
ATOM   855  N  N   . ILE A 1 121 ? -3.919  75.778  69.972  1.00 47.94  ? 132  ILE A N   1 
ATOM   856  C  CA  . ILE A 1 121 ? -2.530  75.336  70.030  1.00 52.62  ? 132  ILE A CA  1 
ATOM   857  C  C   . ILE A 1 121 ? -1.680  76.169  69.080  1.00 50.02  ? 132  ILE A C   1 
ATOM   858  O  O   . ILE A 1 121 ? -2.020  76.341  67.903  1.00 59.54  ? 132  ILE A O   1 
ATOM   859  C  CB  . ILE A 1 121 ? -2.430  73.841  69.696  1.00 51.19  ? 132  ILE A CB  1 
ATOM   860  C  CG1 . ILE A 1 121 ? -3.260  73.019  70.684  1.00 51.36  ? 132  ILE A CG1 1 
ATOM   861  C  CG2 . ILE A 1 121 ? -0.980  73.386  69.705  1.00 44.42  ? 132  ILE A CG2 1 
ATOM   862  C  CD1 . ILE A 1 121 ? -3.383  71.561  70.306  1.00 46.76  ? 132  ILE A CD1 1 
ATOM   863  N  N   . THR A 1 122 ? -0.563  76.686  69.591  1.00 44.93  ? 133  THR A N   1 
ATOM   864  C  CA  . THR A 1 122 ? 0.398   77.435  68.789  1.00 44.20  ? 133  THR A CA  1 
ATOM   865  C  C   . THR A 1 122 ? 1.651   76.625  68.482  1.00 42.93  ? 133  THR A C   1 
ATOM   866  O  O   . THR A 1 122 ? 2.069   76.543  67.323  1.00 47.70  ? 133  THR A O   1 
ATOM   867  C  CB  . THR A 1 122 ? 0.788   78.736  69.502  1.00 57.90  ? 133  THR A CB  1 
ATOM   868  O  OG1 . THR A 1 122 ? 1.479   78.428  70.720  1.00 56.25  ? 133  THR A OG1 1 
ATOM   869  C  CG2 . THR A 1 122 ? -0.448  79.561  69.819  1.00 57.42  ? 133  THR A CG2 1 
ATOM   870  N  N   . VAL A 1 123 ? 2.262   76.024  69.500  1.00 42.70  ? 134  VAL A N   1 
ATOM   871  C  CA  . VAL A 1 123 ? 3.478   75.237  69.346  1.00 41.75  ? 134  VAL A CA  1 
ATOM   872  C  C   . VAL A 1 123 ? 3.221   73.833  69.871  1.00 56.73  ? 134  VAL A C   1 
ATOM   873  O  O   . VAL A 1 123 ? 2.573   73.656  70.908  1.00 69.54  ? 134  VAL A O   1 
ATOM   874  C  CB  . VAL A 1 123 ? 4.672   75.881  70.082  1.00 41.70  ? 134  VAL A CB  1 
ATOM   875  C  CG1 . VAL A 1 123 ? 5.967   75.175  69.712  1.00 40.89  ? 134  VAL A CG1 1 
ATOM   876  C  CG2 . VAL A 1 123 ? 4.757   77.367  69.772  1.00 83.53  ? 134  VAL A CG2 1 
ATOM   877  N  N   . VAL A 1 124 ? 3.730   72.836  69.152  1.00 49.21  ? 135  VAL A N   1 
ATOM   878  C  CA  . VAL A 1 124 ? 3.656   71.438  69.561  1.00 45.06  ? 135  VAL A CA  1 
ATOM   879  C  C   . VAL A 1 124 ? 5.079   70.947  69.779  1.00 48.28  ? 135  VAL A C   1 
ATOM   880  O  O   . VAL A 1 124 ? 5.893   70.957  68.848  1.00 55.44  ? 135  VAL A O   1 
ATOM   881  C  CB  . VAL A 1 124 ? 2.930   70.572  68.520  1.00 40.86  ? 135  VAL A CB  1 
ATOM   882  C  CG1 . VAL A 1 124 ? 2.734   69.158  69.049  1.00 41.19  ? 135  VAL A CG1 1 
ATOM   883  C  CG2 . VAL A 1 124 ? 1.598   71.200  68.141  1.00 41.53  ? 135  VAL A CG2 1 
ATOM   884  N  N   . LEU A 1 125 ? 5.379   70.519  71.004  1.00 54.10  ? 136  LEU A N   1 
ATOM   885  C  CA  . LEU A 1 125 ? 6.719   70.060  71.353  1.00 40.79  ? 136  LEU A CA  1 
ATOM   886  C  C   . LEU A 1 125 ? 6.706   68.564  71.633  1.00 41.06  ? 136  LEU A C   1 
ATOM   887  O  O   . LEU A 1 125 ? 6.301   68.141  72.728  1.00 45.22  ? 136  LEU A O   1 
ATOM   888  C  CB  . LEU A 1 125 ? 7.254   70.826  72.567  1.00 41.38  ? 136  LEU A CB  1 
ATOM   889  C  CG  . LEU A 1 125 ? 8.624   70.379  73.082  1.00 48.22  ? 136  LEU A CG  1 
ATOM   890  C  CD1 . LEU A 1 125 ? 9.664   70.442  71.973  1.00 43.48  ? 136  LEU A CD1 1 
ATOM   891  C  CD2 . LEU A 1 125 ? 9.055   71.220  74.274  1.00 42.22  ? 136  LEU A CD2 1 
ATOM   892  N  N   . PRO A 1 126 ? 7.120   67.725  70.687  1.00 40.49  ? 137  PRO A N   1 
ATOM   893  C  CA  . PRO A 1 126 ? 7.294   66.300  70.996  1.00 40.89  ? 137  PRO A CA  1 
ATOM   894  C  C   . PRO A 1 126 ? 8.487   66.076  71.907  1.00 58.99  ? 137  PRO A C   1 
ATOM   895  O  O   . PRO A 1 126 ? 9.628   66.333  71.512  1.00 67.42  ? 137  PRO A O   1 
ATOM   896  C  CB  . PRO A 1 126 ? 7.509   65.659  69.617  1.00 40.17  ? 137  PRO A CB  1 
ATOM   897  C  CG  . PRO A 1 126 ? 7.025   66.679  68.627  1.00 47.21  ? 137  PRO A CG  1 
ATOM   898  C  CD  . PRO A 1 126 ? 7.299   68.006  69.255  1.00 39.65  ? 137  PRO A CD  1 
ATOM   899  N  N   . HIS A 1 127 ? 8.241   65.611  73.129  1.00 56.69  ? 138  HIS A N   1 
ATOM   900  C  CA  . HIS A 1 127 ? 9.335   65.354  74.053  1.00 50.96  ? 138  HIS A CA  1 
ATOM   901  C  C   . HIS A 1 127 ? 10.215  64.226  73.523  1.00 61.81  ? 138  HIS A C   1 
ATOM   902  O  O   . HIS A 1 127 ? 9.756   63.337  72.801  1.00 55.40  ? 138  HIS A O   1 
ATOM   903  C  CB  . HIS A 1 127 ? 8.794   65.007  75.441  1.00 50.53  ? 138  HIS A CB  1 
ATOM   904  C  CG  . HIS A 1 127 ? 9.841   64.997  76.511  1.00 53.13  ? 138  HIS A CG  1 
ATOM   905  N  ND1 . HIS A 1 127 ? 10.292  63.836  77.102  1.00 53.59  ? 138  HIS A ND1 1 
ATOM   906  C  CD2 . HIS A 1 127 ? 10.529  66.007  77.095  1.00 54.88  ? 138  HIS A CD2 1 
ATOM   907  C  CE1 . HIS A 1 127 ? 11.210  64.131  78.005  1.00 55.94  ? 138  HIS A CE1 1 
ATOM   908  N  NE2 . HIS A 1 127 ? 11.373  65.441  78.021  1.00 51.50  ? 138  HIS A NE2 1 
ATOM   909  N  N   . SER A 1 128 ? 11.500  64.277  73.886  1.00 71.41  ? 139  SER A N   1 
ATOM   910  C  CA  . SER A 1 128 ? 12.461  63.314  73.357  1.00 60.61  ? 139  SER A CA  1 
ATOM   911  C  C   . SER A 1 128 ? 12.124  61.886  73.767  1.00 66.69  ? 139  SER A C   1 
ATOM   912  O  O   . SER A 1 128 ? 12.505  60.936  73.074  1.00 67.01  ? 139  SER A O   1 
ATOM   913  C  CB  . SER A 1 128 ? 13.872  63.675  73.818  1.00 48.84  ? 139  SER A CB  1 
ATOM   914  O  OG  . SER A 1 128 ? 13.962  63.664  75.232  1.00 45.14  ? 139  SER A OG  1 
ATOM   915  N  N   . SER A 1 129 ? 11.415  61.712  74.883  1.00 65.50  ? 140  SER A N   1 
ATOM   916  C  CA  . SER A 1 129 ? 11.054  60.378  75.344  1.00 64.04  ? 140  SER A CA  1 
ATOM   917  C  C   . SER A 1 129 ? 9.966   59.729  74.497  1.00 63.49  ? 140  SER A C   1 
ATOM   918  O  O   . SER A 1 129 ? 9.674   58.546  74.705  1.00 63.00  ? 140  SER A O   1 
ATOM   919  C  CB  . SER A 1 129 ? 10.598  60.438  76.803  1.00 64.27  ? 140  SER A CB  1 
ATOM   920  O  OG  . SER A 1 129 ? 9.464   61.276  76.947  1.00 60.11  ? 140  SER A OG  1 
ATOM   921  N  N   . CYS A 1 130 ? 9.370   60.467  73.554  1.00 71.31  ? 141  CYS A N   1 
ATOM   922  C  CA  . CYS A 1 130 ? 8.210   60.006  72.786  1.00 70.50  ? 141  CYS A CA  1 
ATOM   923  C  C   . CYS A 1 130 ? 7.074   59.561  73.701  1.00 76.99  ? 141  CYS A C   1 
ATOM   924  O  O   . CYS A 1 130 ? 6.296   58.668  73.358  1.00 89.41  ? 141  CYS A O   1 
ATOM   925  C  CB  . CYS A 1 130 ? 8.583   58.885  71.813  1.00 75.30  ? 141  CYS A CB  1 
ATOM   926  S  SG  . CYS A 1 130 ? 9.581   59.425  70.413  1.00 86.31  ? 141  CYS A SG  1 
ATOM   927  N  N   . GLU A 1 131 ? 6.978   60.185  74.876  1.00 68.01  ? 142  GLU A N   1 
ATOM   928  C  CA  . GLU A 1 131 ? 5.935   59.893  75.845  1.00 60.45  ? 142  GLU A CA  1 
ATOM   929  C  C   . GLU A 1 131 ? 5.016   61.070  76.128  1.00 60.14  ? 142  GLU A C   1 
ATOM   930  O  O   . GLU A 1 131 ? 3.907   60.854  76.628  1.00 49.24  ? 142  GLU A O   1 
ATOM   931  C  CB  . GLU A 1 131 ? 6.549   59.428  77.177  1.00 59.43  ? 142  GLU A CB  1 
ATOM   932  C  CG  . GLU A 1 131 ? 7.151   58.032  77.145  1.00 74.45  ? 142  GLU A CG  1 
ATOM   933  C  CD  . GLU A 1 131 ? 7.889   57.688  78.427  1.00 92.00  ? 142  GLU A CD  1 
ATOM   934  O  OE1 . GLU A 1 131 ? 9.110   57.944  78.500  1.00 95.90  ? 142  GLU A OE1 1 
ATOM   935  O  OE2 . GLU A 1 131 ? 7.248   57.168  79.365  1.00 99.45  ? 142  GLU A OE2 1 
ATOM   936  N  N   . LEU A 1 132 ? 5.437   62.295  75.826  1.00 46.87  ? 143  LEU A N   1 
ATOM   937  C  CA  . LEU A 1 132 ? 4.671   63.486  76.150  1.00 47.32  ? 143  LEU A CA  1 
ATOM   938  C  C   . LEU A 1 132 ? 4.619   64.423  74.954  1.00 57.51  ? 143  LEU A C   1 
ATOM   939  O  O   . LEU A 1 132 ? 5.537   64.462  74.129  1.00 51.84  ? 143  LEU A O   1 
ATOM   940  C  CB  . LEU A 1 132 ? 5.271   64.230  77.352  1.00 47.51  ? 143  LEU A CB  1 
ATOM   941  C  CG  . LEU A 1 132 ? 5.336   63.474  78.678  1.00 49.29  ? 143  LEU A CG  1 
ATOM   942  C  CD1 . LEU A 1 132 ? 6.011   64.324  79.742  1.00 61.65  ? 143  LEU A CD1 1 
ATOM   943  C  CD2 . LEU A 1 132 ? 3.945   63.057  79.124  1.00 50.70  ? 143  LEU A CD2 1 
ATOM   944  N  N   . LEU A 1 133 ? 3.525   65.176  74.871  1.00 45.57  ? 144  LEU A N   1 
ATOM   945  C  CA  . LEU A 1 133 ? 3.381   66.283  73.934  1.00 48.24  ? 144  LEU A CA  1 
ATOM   946  C  C   . LEU A 1 133 ? 3.160   67.554  74.739  1.00 51.97  ? 144  LEU A C   1 
ATOM   947  O  O   . LEU A 1 133 ? 2.213   67.634  75.529  1.00 53.30  ? 144  LEU A O   1 
ATOM   948  C  CB  . LEU A 1 133 ? 2.216   66.055  72.967  1.00 54.94  ? 144  LEU A CB  1 
ATOM   949  C  CG  . LEU A 1 133 ? 2.461   65.205  71.720  1.00 53.40  ? 144  LEU A CG  1 
ATOM   950  C  CD1 . LEU A 1 133 ? 1.234   65.214  70.821  1.00 62.22  ? 144  LEU A CD1 1 
ATOM   951  C  CD2 . LEU A 1 133 ? 3.684   65.693  70.964  1.00 56.56  ? 144  LEU A CD2 1 
ATOM   952  N  N   . TYR A 1 134 ? 4.035   68.536  74.549  1.00 47.85  ? 145  TYR A N   1 
ATOM   953  C  CA  . TYR A 1 134 ? 3.914   69.829  75.209  1.00 46.01  ? 145  TYR A CA  1 
ATOM   954  C  C   . TYR A 1 134 ? 3.281   70.813  74.234  1.00 45.16  ? 145  TYR A C   1 
ATOM   955  O  O   . TYR A 1 134 ? 3.841   71.086  73.167  1.00 45.11  ? 145  TYR A O   1 
ATOM   956  C  CB  . TYR A 1 134 ? 5.275   70.321  75.698  1.00 47.97  ? 145  TYR A CB  1 
ATOM   957  C  CG  . TYR A 1 134 ? 5.778   69.555  76.901  1.00 45.27  ? 145  TYR A CG  1 
ATOM   958  C  CD1 . TYR A 1 134 ? 5.626   70.062  78.185  1.00 47.91  ? 145  TYR A CD1 1 
ATOM   959  C  CD2 . TYR A 1 134 ? 6.385   68.314  76.755  1.00 50.75  ? 145  TYR A CD2 1 
ATOM   960  C  CE1 . TYR A 1 134 ? 6.077   69.362  79.288  1.00 47.44  ? 145  TYR A CE1 1 
ATOM   961  C  CE2 . TYR A 1 134 ? 6.838   67.606  77.852  1.00 50.98  ? 145  TYR A CE2 1 
ATOM   962  C  CZ  . TYR A 1 134 ? 6.681   68.135  79.116  1.00 47.37  ? 145  TYR A CZ  1 
ATOM   963  O  OH  . TYR A 1 134 ? 7.130   67.434  80.211  1.00 48.64  ? 145  TYR A OH  1 
ATOM   964  N  N   . LEU A 1 135 ? 2.113   71.333  74.601  1.00 49.46  ? 146  LEU A N   1 
ATOM   965  C  CA  . LEU A 1 135 ? 1.266   72.113  73.705  1.00 44.89  ? 146  LEU A CA  1 
ATOM   966  C  C   . LEU A 1 135 ? 1.202   73.549  74.207  1.00 45.39  ? 146  LEU A C   1 
ATOM   967  O  O   . LEU A 1 135 ? 0.631   73.816  75.270  1.00 46.95  ? 146  LEU A O   1 
ATOM   968  C  CB  . LEU A 1 135 ? -0.134  71.505  73.622  1.00 57.67  ? 146  LEU A CB  1 
ATOM   969  C  CG  . LEU A 1 135 ? -0.440  70.370  72.638  1.00 61.20  ? 146  LEU A CG  1 
ATOM   970  C  CD1 . LEU A 1 135 ? 0.643   69.305  72.623  1.00 57.77  ? 146  LEU A CD1 1 
ATOM   971  C  CD2 . LEU A 1 135 ? -1.783  69.746  72.984  1.00 64.31  ? 146  LEU A CD2 1 
ATOM   972  N  N   . GLY A 1 136 ? 1.780   74.472  73.442  1.00 44.61  ? 147  GLY A N   1 
ATOM   973  C  CA  . GLY A 1 136 ? 1.651   75.888  73.733  1.00 46.52  ? 147  GLY A CA  1 
ATOM   974  C  C   . GLY A 1 136 ? 0.380   76.449  73.114  1.00 46.74  ? 147  GLY A C   1 
ATOM   975  O  O   . GLY A 1 136 ? 0.004   76.087  72.001  1.00 50.41  ? 147  GLY A O   1 
ATOM   976  N  N   . THR A 1 137 ? -0.277  77.335  73.851  1.00 47.06  ? 148  THR A N   1 
ATOM   977  C  CA  . THR A 1 137 ? -1.546  77.917  73.433  1.00 55.88  ? 148  THR A CA  1 
ATOM   978  C  C   . THR A 1 137 ? -1.437  79.439  73.389  1.00 58.73  ? 148  THR A C   1 
ATOM   979  O  O   . THR A 1 137 ? -0.421  80.026  73.768  1.00 77.52  ? 148  THR A O   1 
ATOM   980  C  CB  . THR A 1 137 ? -2.681  77.482  74.364  1.00 60.67  ? 148  THR A CB  1 
ATOM   981  O  OG1 . THR A 1 137 ? -2.338  77.797  75.719  1.00 75.36  ? 148  THR A OG1 1 
ATOM   982  C  CG2 . THR A 1 137 ? -2.927  75.985  74.239  1.00 58.92  ? 148  THR A CG2 1 
ATOM   983  N  N   . GLU A 1 138 ? -2.510  80.078  72.915  1.00 49.60  ? 149  GLU A N   1 
ATOM   984  C  CA  . GLU A 1 138 ? -2.528  81.532  72.807  1.00 59.57  ? 149  GLU A CA  1 
ATOM   985  C  C   . GLU A 1 138 ? -2.678  82.216  74.159  1.00 68.38  ? 149  GLU A C   1 
ATOM   986  O  O   . GLU A 1 138 ? -2.322  83.393  74.285  1.00 76.42  ? 149  GLU A O   1 
ATOM   987  C  CB  . GLU A 1 138 ? -3.657  81.980  71.876  1.00 64.43  ? 149  GLU A CB  1 
ATOM   988  C  CG  . GLU A 1 138 ? -3.604  81.360  70.493  1.00 66.82  ? 149  GLU A CG  1 
ATOM   989  C  CD  . GLU A 1 138 ? -4.661  81.923  69.565  1.00 69.00  ? 149  GLU A CD  1 
ATOM   990  O  OE1 . GLU A 1 138 ? -5.228  82.990  69.883  1.00 72.91  ? 149  GLU A OE1 1 
ATOM   991  O  OE2 . GLU A 1 138 ? -4.926  81.297  68.518  1.00 64.80  ? 149  GLU A OE2 1 
ATOM   992  N  N   . SER A 1 139 ? -3.198  81.512  75.168  1.00 62.81  ? 150  SER A N   1 
ATOM   993  C  CA  . SER A 1 139 ? -3.342  82.088  76.499  1.00 62.80  ? 150  SER A CA  1 
ATOM   994  C  C   . SER A 1 139 ? -2.016  82.203  77.238  1.00 56.09  ? 150  SER A C   1 
ATOM   995  O  O   . SER A 1 139 ? -1.892  83.043  78.135  1.00 53.80  ? 150  SER A O   1 
ATOM   996  C  CB  . SER A 1 139 ? -4.312  81.250  77.334  1.00 63.73  ? 150  SER A CB  1 
ATOM   997  O  OG  . SER A 1 139 ? -3.831  79.926  77.501  1.00 59.69  ? 150  SER A OG  1 
ATOM   998  N  N   . GLY A 1 140 ? -1.028  81.387  76.882  1.00 53.04  ? 151  GLY A N   1 
ATOM   999  C  CA  . GLY A 1 140 ? 0.228   81.318  77.600  1.00 50.70  ? 151  GLY A CA  1 
ATOM   1000 C  C   . GLY A 1 140 ? 0.426   80.036  78.371  1.00 50.61  ? 151  GLY A C   1 
ATOM   1001 O  O   . GLY A 1 140 ? 1.531   79.796  78.875  1.00 56.76  ? 151  GLY A O   1 
ATOM   1002 N  N   . ASN A 1 141 ? -0.607  79.206  78.476  1.00 51.26  ? 152  ASN A N   1 
ATOM   1003 C  CA  . ASN A 1 141 ? -0.514  77.953  79.207  1.00 62.02  ? 152  ASN A CA  1 
ATOM   1004 C  C   . ASN A 1 141 ? 0.049   76.859  78.312  1.00 58.25  ? 152  ASN A C   1 
ATOM   1005 O  O   . ASN A 1 141 ? -0.237  76.808  77.113  1.00 49.19  ? 152  ASN A O   1 
ATOM   1006 C  CB  . ASN A 1 141 ? -1.889  77.546  79.736  1.00 62.03  ? 152  ASN A CB  1 
ATOM   1007 C  CG  . ASN A 1 141 ? -2.552  78.645  80.545  1.00 78.90  ? 152  ASN A CG  1 
ATOM   1008 O  OD1 . ASN A 1 141 ? -1.895  79.356  81.305  1.00 77.90  ? 152  ASN A OD1 1 
ATOM   1009 N  ND2 . ASN A 1 141 ? -3.862  78.790  80.381  1.00 88.89  ? 152  ASN A ND2 1 
ATOM   1010 N  N   . VAL A 1 142 ? 0.858   75.986  78.902  1.00 56.69  ? 153  VAL A N   1 
ATOM   1011 C  CA  . VAL A 1 142 ? 1.457   74.857  78.202  1.00 59.04  ? 153  VAL A CA  1 
ATOM   1012 C  C   . VAL A 1 142 ? 0.851   73.588  78.784  1.00 62.29  ? 153  VAL A C   1 
ATOM   1013 O  O   . VAL A 1 142 ? 1.104   73.243  79.946  1.00 63.53  ? 153  VAL A O   1 
ATOM   1014 C  CB  . VAL A 1 142 ? 2.987   74.854  78.324  1.00 47.63  ? 153  VAL A CB  1 
ATOM   1015 C  CG1 . VAL A 1 142 ? 3.573   73.659  77.588  1.00 46.57  ? 153  VAL A CG1 1 
ATOM   1016 C  CG2 . VAL A 1 142 ? 3.563   76.155  77.785  1.00 47.01  ? 153  VAL A CG2 1 
ATOM   1017 N  N   . PHE A 1 143 ? 0.048   72.896  77.984  1.00 58.17  ? 154  PHE A N   1 
ATOM   1018 C  CA  . PHE A 1 143 ? -0.601  71.669  78.418  1.00 53.59  ? 154  PHE A CA  1 
ATOM   1019 C  C   . PHE A 1 143 ? 0.228   70.457  78.012  1.00 61.98  ? 154  PHE A C   1 
ATOM   1020 O  O   . PHE A 1 143 ? 0.951   70.478  77.012  1.00 61.44  ? 154  PHE A O   1 
ATOM   1021 C  CB  . PHE A 1 143 ? -2.009  71.566  77.830  1.00 51.08  ? 154  PHE A CB  1 
ATOM   1022 C  CG  . PHE A 1 143 ? -2.931  72.663  78.280  1.00 59.75  ? 154  PHE A CG  1 
ATOM   1023 C  CD1 . PHE A 1 143 ? -3.649  72.541  79.459  1.00 63.89  ? 154  PHE A CD1 1 
ATOM   1024 C  CD2 . PHE A 1 143 ? -3.077  73.817  77.529  1.00 51.85  ? 154  PHE A CD2 1 
ATOM   1025 C  CE1 . PHE A 1 143 ? -4.496  73.549  79.879  1.00 57.68  ? 154  PHE A CE1 1 
ATOM   1026 C  CE2 . PHE A 1 143 ? -3.924  74.829  77.943  1.00 53.22  ? 154  PHE A CE2 1 
ATOM   1027 C  CZ  . PHE A 1 143 ? -4.634  74.694  79.120  1.00 57.81  ? 154  PHE A CZ  1 
ATOM   1028 N  N   . VAL A 1 144 ? 0.116   69.394  78.805  1.00 65.59  ? 155  VAL A N   1 
ATOM   1029 C  CA  . VAL A 1 144 ? 0.898   68.177  78.620  1.00 66.16  ? 155  VAL A CA  1 
ATOM   1030 C  C   . VAL A 1 144 ? -0.049  67.056  78.220  1.00 62.12  ? 155  VAL A C   1 
ATOM   1031 O  O   . VAL A 1 144 ? -1.003  66.749  78.945  1.00 52.37  ? 155  VAL A O   1 
ATOM   1032 C  CB  . VAL A 1 144 ? 1.681   67.811  79.889  1.00 78.85  ? 155  VAL A CB  1 
ATOM   1033 C  CG1 . VAL A 1 144 ? 2.429   66.503  79.693  1.00 88.62  ? 155  VAL A CG1 1 
ATOM   1034 C  CG2 . VAL A 1 144 ? 2.642   68.931  80.255  1.00 89.13  ? 155  VAL A CG2 1 
ATOM   1035 N  N   . VAL A 1 145 ? 0.216   66.443  77.069  1.00 56.80  ? 156  VAL A N   1 
ATOM   1036 C  CA  . VAL A 1 145 ? -0.582  65.341  76.547  1.00 51.93  ? 156  VAL A CA  1 
ATOM   1037 C  C   . VAL A 1 145 ? 0.308   64.111  76.446  1.00 56.20  ? 156  VAL A C   1 
ATOM   1038 O  O   . VAL A 1 145 ? 1.385   64.165  75.841  1.00 55.04  ? 156  VAL A O   1 
ATOM   1039 C  CB  . VAL A 1 145 ? -1.201  65.682  75.180  1.00 49.09  ? 156  VAL A CB  1 
ATOM   1040 C  CG1 . VAL A 1 145 ? -1.899  64.465  74.594  1.00 51.69  ? 156  VAL A CG1 1 
ATOM   1041 C  CG2 . VAL A 1 145 ? -2.171  66.845  75.315  1.00 55.73  ? 156  VAL A CG2 1 
ATOM   1042 N  N   . GLN A 1 146 ? -0.142  63.008  77.038  1.00 59.21  ? 157  GLN A N   1 
ATOM   1043 C  CA  . GLN A 1 146 ? 0.597   61.754  77.014  1.00 62.77  ? 157  GLN A CA  1 
ATOM   1044 C  C   . GLN A 1 146 ? 0.159   60.925  75.814  1.00 56.73  ? 157  GLN A C   1 
ATOM   1045 O  O   . GLN A 1 146 ? -1.040  60.747  75.580  1.00 67.24  ? 157  GLN A O   1 
ATOM   1046 C  CB  . GLN A 1 146 ? 0.370   60.976  78.311  1.00 69.18  ? 157  GLN A CB  1 
ATOM   1047 C  CG  . GLN A 1 146 ? 1.126   59.661  78.399  1.00 83.59  ? 157  GLN A CG  1 
ATOM   1048 C  CD  . GLN A 1 146 ? 0.924   58.966  79.732  1.00 90.23  ? 157  GLN A CD  1 
ATOM   1049 O  OE1 . GLN A 1 146 ? 0.067   59.357  80.525  1.00 89.92  ? 157  GLN A OE1 1 
ATOM   1050 N  NE2 . GLN A 1 146 ? 1.718   57.933  79.988  1.00 89.72  ? 157  GLN A NE2 1 
ATOM   1051 N  N   . LEU A 1 147 ? 1.133   60.425  75.052  1.00 65.06  ? 158  LEU A N   1 
ATOM   1052 C  CA  . LEU A 1 147 ? 0.828   59.615  73.886  1.00 74.04  ? 158  LEU A CA  1 
ATOM   1053 C  C   . LEU A 1 147 ? 1.376   58.202  74.060  1.00 77.20  ? 158  LEU A C   1 
ATOM   1054 O  O   . LEU A 1 147 ? 2.468   58.027  74.612  1.00 79.39  ? 158  LEU A O   1 
ATOM   1055 C  CB  . LEU A 1 147 ? 1.403   60.245  72.603  1.00 75.14  ? 158  LEU A CB  1 
ATOM   1056 C  CG  . LEU A 1 147 ? 2.915   60.438  72.458  1.00 78.94  ? 158  LEU A CG  1 
ATOM   1057 C  CD1 . LEU A 1 147 ? 3.564   59.251  71.759  1.00 99.41  ? 158  LEU A CD1 1 
ATOM   1058 C  CD2 . LEU A 1 147 ? 3.210   61.720  71.704  1.00 66.15  ? 158  LEU A CD2 1 
ATOM   1059 N  N   . PRO A 1 148 ? 0.643   57.171  73.608  1.00 71.20  ? 159  PRO A N   1 
ATOM   1060 C  CA  . PRO A 1 148 ? -0.687  57.270  72.991  1.00 83.13  ? 159  PRO A CA  1 
ATOM   1061 C  C   . PRO A 1 148 ? -1.811  57.491  74.004  1.00 100.99 ? 159  PRO A C   1 
ATOM   1062 O  O   . PRO A 1 148 ? -1.553  57.990  75.101  1.00 126.71 ? 159  PRO A O   1 
ATOM   1063 C  CB  . PRO A 1 148 ? -0.856  55.911  72.294  1.00 73.65  ? 159  PRO A CB  1 
ATOM   1064 C  CG  . PRO A 1 148 ? 0.515   55.299  72.267  1.00 63.11  ? 159  PRO A CG  1 
ATOM   1065 C  CD  . PRO A 1 148 ? 1.189   55.811  73.494  1.00 59.26  ? 159  PRO A CD  1 
ATOM   1066 N  N   . ALA A 1 149 ? -3.037  57.128  73.613  1.00 93.11  ? 160  ALA A N   1 
ATOM   1067 C  CA  . ALA A 1 149 ? -4.255  57.290  74.407  1.00 106.10 ? 160  ALA A CA  1 
ATOM   1068 C  C   . ALA A 1 149 ? -4.687  58.751  74.497  1.00 104.30 ? 160  ALA A C   1 
ATOM   1069 O  O   . ALA A 1 149 ? -5.869  59.034  74.720  1.00 126.46 ? 160  ALA A O   1 
ATOM   1070 C  CB  . ALA A 1 149 ? -4.088  56.696  75.811  1.00 115.90 ? 160  ALA A CB  1 
ATOM   1071 N  N   . PHE A 1 150 ? -3.743  59.680  74.324  1.00 78.71  ? 161  PHE A N   1 
ATOM   1072 C  CA  . PHE A 1 150 ? -4.031  61.115  74.282  1.00 69.80  ? 161  PHE A CA  1 
ATOM   1073 C  C   . PHE A 1 150 ? -4.767  61.581  75.538  1.00 80.99  ? 161  PHE A C   1 
ATOM   1074 O  O   . PHE A 1 150 ? -5.802  62.247  75.471  1.00 95.44  ? 161  PHE A O   1 
ATOM   1075 C  CB  . PHE A 1 150 ? -4.820  61.477  73.023  1.00 77.10  ? 161  PHE A CB  1 
ATOM   1076 C  CG  . PHE A 1 150 ? -3.998  61.471  71.770  1.00 95.99  ? 161  PHE A CG  1 
ATOM   1077 C  CD1 . PHE A 1 150 ? -3.297  62.601  71.381  1.00 96.92  ? 161  PHE A CD1 1 
ATOM   1078 C  CD2 . PHE A 1 150 ? -3.928  60.339  70.977  1.00 105.92 ? 161  PHE A CD2 1 
ATOM   1079 C  CE1 . PHE A 1 150 ? -2.542  62.602  70.227  1.00 88.61  ? 161  PHE A CE1 1 
ATOM   1080 C  CE2 . PHE A 1 150 ? -3.174  60.335  69.821  1.00 106.52 ? 161  PHE A CE2 1 
ATOM   1081 C  CZ  . PHE A 1 150 ? -2.480  61.469  69.446  1.00 92.78  ? 161  PHE A CZ  1 
ATOM   1082 N  N   . ARG A 1 151 ? -4.218  61.226  76.696  1.00 78.53  ? 162  ARG A N   1 
ATOM   1083 C  CA  . ARG A 1 151 ? -4.779  61.634  77.979  1.00 84.49  ? 162  ARG A CA  1 
ATOM   1084 C  C   . ARG A 1 151 ? -4.156  62.967  78.380  1.00 91.29  ? 162  ARG A C   1 
ATOM   1085 O  O   . ARG A 1 151 ? -2.987  63.019  78.776  1.00 99.79  ? 162  ARG A O   1 
ATOM   1086 C  CB  . ARG A 1 151 ? -4.531  60.566  79.041  1.00 83.15  ? 162  ARG A CB  1 
ATOM   1087 N  N   . ALA A 1 152 ? -4.933  64.042  78.273  1.00 87.39  ? 163  ALA A N   1 
ATOM   1088 C  CA  . ALA A 1 152 ? -4.468  65.376  78.647  1.00 77.26  ? 163  ALA A CA  1 
ATOM   1089 C  C   . ALA A 1 152 ? -4.239  65.415  80.153  1.00 74.76  ? 163  ALA A C   1 
ATOM   1090 O  O   . ALA A 1 152 ? -5.180  65.560  80.936  1.00 73.87  ? 163  ALA A O   1 
ATOM   1091 C  CB  . ALA A 1 152 ? -5.475  66.436  78.215  1.00 74.01  ? 163  ALA A CB  1 
ATOM   1092 N  N   . LEU A 1 153 ? -2.980  65.286  80.562  1.00 74.97  ? 164  LEU A N   1 
ATOM   1093 C  CA  . LEU A 1 153 ? -2.620  65.254  81.978  1.00 69.51  ? 164  LEU A CA  1 
ATOM   1094 C  C   . LEU A 1 153 ? -2.743  66.658  82.555  1.00 77.55  ? 164  LEU A C   1 
ATOM   1095 O  O   . LEU A 1 153 ? -1.850  67.493  82.392  1.00 74.99  ? 164  LEU A O   1 
ATOM   1096 C  CB  . LEU A 1 153 ? -1.208  64.707  82.149  1.00 57.42  ? 164  LEU A CB  1 
ATOM   1097 C  CG  . LEU A 1 153 ? -0.927  63.386  81.429  1.00 64.03  ? 164  LEU A CG  1 
ATOM   1098 C  CD1 . LEU A 1 153 ? 0.516   62.953  81.631  1.00 56.22  ? 164  LEU A CD1 1 
ATOM   1099 C  CD2 . LEU A 1 153 ? -1.887  62.299  81.893  1.00 59.21  ? 164  LEU A CD2 1 
ATOM   1100 N  N   . GLU A 1 154 ? -3.859  66.926  83.236  1.00 79.95  ? 165  GLU A N   1 
ATOM   1101 C  CA  . GLU A 1 154 ? -4.069  68.227  83.857  1.00 84.64  ? 165  GLU A CA  1 
ATOM   1102 C  C   . GLU A 1 154 ? -3.128  68.472  85.030  1.00 87.15  ? 165  GLU A C   1 
ATOM   1103 O  O   . GLU A 1 154 ? -3.003  69.618  85.474  1.00 80.15  ? 165  GLU A O   1 
ATOM   1104 C  CB  . GLU A 1 154 ? -5.521  68.357  84.325  1.00 89.61  ? 165  GLU A CB  1 
ATOM   1105 C  CG  . GLU A 1 154 ? -6.560  67.822  83.341  1.00 94.76  ? 165  GLU A CG  1 
ATOM   1106 C  CD  . GLU A 1 154 ? -6.812  68.752  82.166  1.00 94.55  ? 165  GLU A CD  1 
ATOM   1107 O  OE1 . GLU A 1 154 ? -6.194  69.836  82.112  1.00 93.62  ? 165  GLU A OE1 1 
ATOM   1108 O  OE2 . GLU A 1 154 ? -7.635  68.398  81.294  1.00 92.13  ? 165  GLU A OE2 1 
ATOM   1109 N  N   . ASP A 1 155 ? -2.469  67.427  85.537  1.00 95.65  ? 166  ASP A N   1 
ATOM   1110 C  CA  . ASP A 1 155 ? -1.544  67.595  86.652  1.00 106.15 ? 166  ASP A CA  1 
ATOM   1111 C  C   . ASP A 1 155 ? -0.251  68.272  86.214  1.00 103.14 ? 166  ASP A C   1 
ATOM   1112 O  O   . ASP A 1 155 ? 0.330   69.048  86.982  1.00 107.83 ? 166  ASP A O   1 
ATOM   1113 C  CB  . ASP A 1 155 ? -1.258  66.233  87.290  1.00 120.33 ? 166  ASP A CB  1 
ATOM   1114 C  CG  . ASP A 1 155 ? -0.227  66.305  88.405  1.00 128.08 ? 166  ASP A CG  1 
ATOM   1115 O  OD1 . ASP A 1 155 ? 0.977   66.458  88.107  1.00 128.88 ? 166  ASP A OD1 1 
ATOM   1116 O  OD2 . ASP A 1 155 ? -0.623  66.205  89.586  1.00 127.22 ? 166  ASP A OD2 1 
ATOM   1117 N  N   . ARG A 1 156 ? 0.210   68.002  84.995  1.00 89.67  ? 167  ARG A N   1 
ATOM   1118 C  CA  . ARG A 1 156 ? 1.481   68.516  84.504  1.00 81.56  ? 167  ARG A CA  1 
ATOM   1119 C  C   . ARG A 1 156 ? 1.347   69.847  83.771  1.00 75.02  ? 167  ARG A C   1 
ATOM   1120 O  O   . ARG A 1 156 ? 2.332   70.322  83.197  1.00 72.96  ? 167  ARG A O   1 
ATOM   1121 C  CB  . ARG A 1 156 ? 2.141   67.489  83.580  1.00 81.66  ? 167  ARG A CB  1 
ATOM   1122 C  CG  . ARG A 1 156 ? 2.485   66.164  84.243  1.00 85.16  ? 167  ARG A CG  1 
ATOM   1123 C  CD  . ARG A 1 156 ? 2.933   65.147  83.204  1.00 85.18  ? 167  ARG A CD  1 
ATOM   1124 N  NE  . ARG A 1 156 ? 3.258   63.850  83.792  1.00 90.49  ? 167  ARG A NE  1 
ATOM   1125 C  CZ  . ARG A 1 156 ? 4.495   63.392  83.954  1.00 92.94  ? 167  ARG A CZ  1 
ATOM   1126 N  NH1 . ARG A 1 156 ? 5.532   64.123  83.568  1.00 99.78  ? 167  ARG A NH1 1 
ATOM   1127 N  NH2 . ARG A 1 156 ? 4.696   62.199  84.498  1.00 82.84  ? 167  ARG A NH2 1 
ATOM   1128 N  N   . THR A 1 157 ? 0.163   70.455  83.775  1.00 77.15  ? 168  THR A N   1 
ATOM   1129 C  CA  . THR A 1 157 ? -0.047  71.694  83.037  1.00 76.61  ? 168  THR A CA  1 
ATOM   1130 C  C   . THR A 1 157 ? 0.785   72.823  83.636  1.00 61.57  ? 168  THR A C   1 
ATOM   1131 O  O   . THR A 1 157 ? 0.810   73.013  84.856  1.00 56.34  ? 168  THR A O   1 
ATOM   1132 C  CB  . THR A 1 157 ? -1.529  72.068  83.039  1.00 79.93  ? 168  THR A CB  1 
ATOM   1133 O  OG1 . THR A 1 157 ? -2.276  71.070  82.331  1.00 86.71  ? 168  THR A OG1 1 
ATOM   1134 C  CG2 . THR A 1 157 ? -1.745  73.422  82.373  1.00 63.33  ? 168  THR A CG2 1 
ATOM   1135 N  N   . ILE A 1 158 ? 1.471   73.566  82.773  1.00 53.20  ? 169  ILE A N   1 
ATOM   1136 C  CA  . ILE A 1 158 ? 2.286   74.706  83.177  1.00 53.04  ? 169  ILE A CA  1 
ATOM   1137 C  C   . ILE A 1 158 ? 1.478   75.960  82.862  1.00 59.16  ? 169  ILE A C   1 
ATOM   1138 O  O   . ILE A 1 158 ? 1.466   76.438  81.725  1.00 65.30  ? 169  ILE A O   1 
ATOM   1139 C  CB  . ILE A 1 158 ? 3.644   74.711  82.470  1.00 51.39  ? 169  ILE A CB  1 
ATOM   1140 C  CG1 . ILE A 1 158 ? 4.351   73.368  82.664  1.00 63.85  ? 169  ILE A CG1 1 
ATOM   1141 C  CG2 . ILE A 1 158 ? 4.514   75.843  82.993  1.00 51.54  ? 169  ILE A CG2 1 
ATOM   1142 C  CD1 . ILE A 1 158 ? 5.682   73.272  81.952  1.00 70.47  ? 169  ILE A CD1 1 
ATOM   1143 N  N   . SER A 1 159 ? 0.799   76.495  83.874  1.00 55.00  ? 170  SER A N   1 
ATOM   1144 C  CA  . SER A 1 159 ? -0.034  77.672  83.686  1.00 65.46  ? 170  SER A CA  1 
ATOM   1145 C  C   . SER A 1 159 ? 0.828   78.908  83.432  1.00 66.07  ? 170  SER A C   1 
ATOM   1146 O  O   . SER A 1 159 ? 2.046   78.910  83.636  1.00 54.12  ? 170  SER A O   1 
ATOM   1147 C  CB  . SER A 1 159 ? -0.932  77.891  84.903  1.00 66.24  ? 170  SER A CB  1 
ATOM   1148 O  OG  . SER A 1 159 ? -1.716  79.062  84.754  1.00 81.66  ? 170  SER A OG  1 
ATOM   1149 N  N   . SER A 1 160 ? 0.173   79.978  82.979  1.00 77.87  ? 171  SER A N   1 
ATOM   1150 C  CA  . SER A 1 160 ? 0.886   81.215  82.680  1.00 85.71  ? 171  SER A CA  1 
ATOM   1151 C  C   . SER A 1 160 ? 1.295   81.934  83.960  1.00 87.46  ? 171  SER A C   1 
ATOM   1152 O  O   . SER A 1 160 ? 2.480   82.212  84.179  1.00 88.11  ? 171  SER A O   1 
ATOM   1153 C  CB  . SER A 1 160 ? 0.022   82.120  81.800  1.00 89.29  ? 171  SER A CB  1 
ATOM   1154 O  OG  . SER A 1 160 ? 0.693   83.332  81.503  1.00 87.82  ? 171  SER A OG  1 
ATOM   1155 N  N   . ASP A 1 161 ? 0.324   82.244  84.823  1.00 84.43  ? 172  ASP A N   1 
ATOM   1156 C  CA  . ASP A 1 161 ? 0.646   82.890  86.090  1.00 84.37  ? 172  ASP A CA  1 
ATOM   1157 C  C   . ASP A 1 161 ? 1.437   81.975  87.016  1.00 75.76  ? 172  ASP A C   1 
ATOM   1158 O  O   . ASP A 1 161 ? 2.074   82.465  87.953  1.00 79.39  ? 172  ASP A O   1 
ATOM   1159 C  CB  . ASP A 1 161 ? -0.629  83.373  86.786  1.00 90.78  ? 172  ASP A CB  1 
ATOM   1160 C  CG  . ASP A 1 161 ? -1.617  82.254  87.042  1.00 95.92  ? 172  ASP A CG  1 
ATOM   1161 O  OD1 . ASP A 1 161 ? -1.678  81.313  86.222  1.00 102.32 ? 172  ASP A OD1 1 
ATOM   1162 O  OD2 . ASP A 1 161 ? -2.336  82.317  88.062  1.00 82.68  ? 172  ASP A OD2 1 
ATOM   1163 N  N   . ALA A 1 162 ? 1.412   80.661  86.776  1.00 62.32  ? 173  ALA A N   1 
ATOM   1164 C  CA  . ALA A 1 162 ? 2.276   79.759  87.530  1.00 63.86  ? 173  ALA A CA  1 
ATOM   1165 C  C   . ALA A 1 162 ? 3.745   80.004  87.214  1.00 70.31  ? 173  ALA A C   1 
ATOM   1166 O  O   . ALA A 1 162 ? 4.608   79.781  88.071  1.00 73.42  ? 173  ALA A O   1 
ATOM   1167 C  CB  . ALA A 1 162 ? 1.905   78.305  87.238  1.00 56.78  ? 173  ALA A CB  1 
ATOM   1168 N  N   . VAL A 1 163 ? 4.047   80.459  85.997  1.00 70.56  ? 174  VAL A N   1 
ATOM   1169 C  CA  . VAL A 1 163 ? 5.417   80.817  85.648  1.00 68.73  ? 174  VAL A CA  1 
ATOM   1170 C  C   . VAL A 1 163 ? 5.774   82.186  86.215  1.00 75.73  ? 174  VAL A C   1 
ATOM   1171 O  O   . VAL A 1 163 ? 6.902   82.408  86.670  1.00 91.89  ? 174  VAL A O   1 
ATOM   1172 C  CB  . VAL A 1 163 ? 5.602   80.768  84.120  1.00 55.54  ? 174  VAL A CB  1 
ATOM   1173 C  CG1 . VAL A 1 163 ? 6.962   81.319  83.721  1.00 48.73  ? 174  VAL A CG1 1 
ATOM   1174 C  CG2 . VAL A 1 163 ? 5.436   79.346  83.614  1.00 57.62  ? 174  VAL A CG2 1 
ATOM   1175 N  N   . LEU A 1 164 ? 4.818   83.116  86.214  1.00 66.62  ? 175  LEU A N   1 
ATOM   1176 C  CA  . LEU A 1 164 ? 5.091   84.475  86.668  1.00 75.89  ? 175  LEU A CA  1 
ATOM   1177 C  C   . LEU A 1 164 ? 5.306   84.563  88.173  1.00 72.56  ? 175  LEU A C   1 
ATOM   1178 O  O   . LEU A 1 164 ? 5.917   85.529  88.640  1.00 77.72  ? 175  LEU A O   1 
ATOM   1179 C  CB  . LEU A 1 164 ? 3.952   85.406  86.258  1.00 80.95  ? 175  LEU A CB  1 
ATOM   1180 C  CG  . LEU A 1 164 ? 4.066   86.085  84.893  1.00 91.71  ? 175  LEU A CG  1 
ATOM   1181 C  CD1 . LEU A 1 164 ? 4.013   85.083  83.747  1.00 89.09  ? 175  LEU A CD1 1 
ATOM   1182 C  CD2 . LEU A 1 164 ? 2.968   87.112  84.758  1.00 94.28  ? 175  LEU A CD2 1 
ATOM   1183 N  N   . GLN A 1 165 ? 4.815   83.589  88.942  1.00 78.51  ? 176  GLN A N   1 
ATOM   1184 C  CA  . GLN A 1 165 ? 5.027   83.615  90.385  1.00 84.95  ? 176  GLN A CA  1 
ATOM   1185 C  C   . GLN A 1 165 ? 6.475   83.332  90.761  1.00 87.96  ? 176  GLN A C   1 
ATOM   1186 O  O   . GLN A 1 165 ? 6.905   83.723  91.851  1.00 89.83  ? 176  GLN A O   1 
ATOM   1187 C  CB  . GLN A 1 165 ? 4.098   82.614  91.073  1.00 99.08  ? 176  GLN A CB  1 
ATOM   1188 C  CG  . GLN A 1 165 ? 2.630   83.012  91.033  1.00 109.62 ? 176  GLN A CG  1 
ATOM   1189 C  CD  . GLN A 1 165 ? 1.717   81.945  91.604  1.00 112.93 ? 176  GLN A CD  1 
ATOM   1190 O  OE1 . GLN A 1 165 ? 2.169   81.021  92.281  1.00 112.98 ? 176  GLN A OE1 1 
ATOM   1191 N  NE2 . GLN A 1 165 ? 0.424   82.066  91.330  1.00 112.61 ? 176  GLN A NE2 1 
ATOM   1192 N  N   . ARG A 1 166 ? 7.232   82.671  89.888  1.00 83.20  ? 177  ARG A N   1 
ATOM   1193 C  CA  . ARG A 1 166 ? 8.645   82.410  90.127  1.00 78.04  ? 177  ARG A CA  1 
ATOM   1194 C  C   . ARG A 1 166 ? 9.545   83.544  89.654  1.00 82.30  ? 177  ARG A C   1 
ATOM   1195 O  O   . ARG A 1 166 ? 10.757  83.493  89.892  1.00 87.41  ? 177  ARG A O   1 
ATOM   1196 C  CB  . ARG A 1 166 ? 9.073   81.107  89.438  1.00 70.21  ? 177  ARG A CB  1 
ATOM   1197 C  CG  . ARG A 1 166 ? 8.678   79.826  90.165  1.00 60.64  ? 177  ARG A CG  1 
ATOM   1198 C  CD  . ARG A 1 166 ? 7.198   79.517  90.015  1.00 60.43  ? 177  ARG A CD  1 
ATOM   1199 N  NE  . ARG A 1 166 ? 6.849   78.215  90.576  1.00 72.06  ? 177  ARG A NE  1 
ATOM   1200 C  CZ  . ARG A 1 166 ? 5.605   77.762  90.691  1.00 78.82  ? 177  ARG A CZ  1 
ATOM   1201 N  NH1 . ARG A 1 166 ? 4.586   78.508  90.288  1.00 87.16  ? 177  ARG A NH1 1 
ATOM   1202 N  NH2 . ARG A 1 166 ? 5.378   76.564  91.213  1.00 62.57  ? 177  ARG A NH2 1 
ATOM   1203 N  N   . LEU A 1 167 ? 8.989   84.555  88.998  1.00 74.59  ? 178  LEU A N   1 
ATOM   1204 C  CA  . LEU A 1 167 ? 9.734   85.679  88.457  1.00 81.00  ? 178  LEU A CA  1 
ATOM   1205 C  C   . LEU A 1 167 ? 9.703   86.858  89.417  1.00 89.27  ? 178  LEU A C   1 
ATOM   1206 O  O   . LEU A 1 167 ? 8.808   86.966  90.260  1.00 94.15  ? 178  LEU A O   1 
ATOM   1207 C  CB  . LEU A 1 167 ? 9.148   86.101  87.106  1.00 82.11  ? 178  LEU A CB  1 
ATOM   1208 C  CG  . LEU A 1 167 ? 9.106   85.046  86.000  1.00 71.99  ? 178  LEU A CG  1 
ATOM   1209 C  CD1 . LEU A 1 167 ? 8.331   85.569  84.803  1.00 71.82  ? 178  LEU A CD1 1 
ATOM   1210 C  CD2 . LEU A 1 167 ? 10.512  84.638  85.593  1.00 56.74  ? 178  LEU A CD2 1 
ATOM   1211 N  N   . PRO A 1 168 ? 10.676  87.764  89.323  1.00 86.99  ? 179  PRO A N   1 
ATOM   1212 C  CA  . PRO A 1 168 ? 10.614  89.001  90.110  1.00 105.34 ? 179  PRO A CA  1 
ATOM   1213 C  C   . PRO A 1 168 ? 9.401   89.837  89.727  1.00 116.77 ? 179  PRO A C   1 
ATOM   1214 O  O   . PRO A 1 168 ? 8.732   89.603  88.719  1.00 115.39 ? 179  PRO A O   1 
ATOM   1215 C  CB  . PRO A 1 168 ? 11.925  89.714  89.762  1.00 97.72  ? 179  PRO A CB  1 
ATOM   1216 C  CG  . PRO A 1 168 ? 12.840  88.621  89.318  1.00 89.70  ? 179  PRO A CG  1 
ATOM   1217 C  CD  . PRO A 1 168 ? 11.963  87.624  88.619  1.00 82.98  ? 179  PRO A CD  1 
ATOM   1218 N  N   . GLU A 1 169 ? 9.123   90.842  90.560  1.00 130.28 ? 180  GLU A N   1 
ATOM   1219 C  CA  . GLU A 1 169 ? 7.919   91.646  90.374  1.00 133.34 ? 180  GLU A CA  1 
ATOM   1220 C  C   . GLU A 1 169 ? 7.989   92.476  89.097  1.00 129.80 ? 180  GLU A C   1 
ATOM   1221 O  O   . GLU A 1 169 ? 6.977   92.646  88.406  1.00 130.29 ? 180  GLU A O   1 
ATOM   1222 C  CB  . GLU A 1 169 ? 7.696   92.551  91.587  1.00 144.41 ? 180  GLU A CB  1 
ATOM   1223 C  CG  . GLU A 1 169 ? 7.470   91.810  92.900  1.00 149.34 ? 180  GLU A CG  1 
ATOM   1224 C  CD  . GLU A 1 169 ? 8.760   91.327  93.536  1.00 149.04 ? 180  GLU A CD  1 
ATOM   1225 O  OE1 . GLU A 1 169 ? 9.845   91.686  93.032  1.00 147.02 ? 180  GLU A OE1 1 
ATOM   1226 O  OE2 . GLU A 1 169 ? 8.689   90.587  94.539  1.00 150.37 ? 180  GLU A OE2 1 
ATOM   1227 N  N   . GLU A 1 170 ? 9.170   92.996  88.766  1.00 126.38 ? 181  GLU A N   1 
ATOM   1228 C  CA  . GLU A 1 170 ? 9.331   93.858  87.601  1.00 124.31 ? 181  GLU A CA  1 
ATOM   1229 C  C   . GLU A 1 170 ? 9.316   93.095  86.282  1.00 118.97 ? 181  GLU A C   1 
ATOM   1230 O  O   . GLU A 1 170 ? 9.345   93.728  85.221  1.00 118.26 ? 181  GLU A O   1 
ATOM   1231 C  CB  . GLU A 1 170 ? 10.627  94.661  87.725  1.00 119.45 ? 181  GLU A CB  1 
ATOM   1232 C  CG  . GLU A 1 170 ? 10.631  95.638  88.892  1.00 128.35 ? 181  GLU A CG  1 
ATOM   1233 C  CD  . GLU A 1 170 ? 11.955  96.356  89.053  1.00 128.22 ? 181  GLU A CD  1 
ATOM   1234 O  OE1 . GLU A 1 170 ? 12.944  95.933  88.418  1.00 125.75 ? 181  GLU A OE1 1 
ATOM   1235 O  OE2 . GLU A 1 170 ? 12.008  97.346  89.815  1.00 126.44 ? 181  GLU A OE2 1 
ATOM   1236 N  N   . ALA A 1 171 ? 9.270   91.764  86.318  1.00 122.65 ? 182  ALA A N   1 
ATOM   1237 C  CA  . ALA A 1 171 ? 9.180   90.943  85.116  1.00 121.64 ? 182  ALA A CA  1 
ATOM   1238 C  C   . ALA A 1 171 ? 7.870   90.161  85.078  1.00 122.17 ? 182  ALA A C   1 
ATOM   1239 O  O   . ALA A 1 171 ? 7.820   89.043  84.561  1.00 115.28 ? 182  ALA A O   1 
ATOM   1240 C  CB  . ALA A 1 171 ? 10.375  89.997  85.014  1.00 117.55 ? 182  ALA A CB  1 
ATOM   1241 N  N   . ARG A 1 172 ? 6.801   90.745  85.622  1.00 126.89 ? 183  ARG A N   1 
ATOM   1242 C  CA  . ARG A 1 172 ? 5.502   90.087  85.705  1.00 120.55 ? 183  ARG A CA  1 
ATOM   1243 C  C   . ARG A 1 172 ? 4.428   90.781  84.874  1.00 127.09 ? 183  ARG A C   1 
ATOM   1244 O  O   . ARG A 1 172 ? 3.258   90.385  84.944  1.00 137.76 ? 183  ARG A O   1 
ATOM   1245 C  CB  . ARG A 1 172 ? 5.043   90.002  87.164  1.00 111.14 ? 183  ARG A CB  1 
ATOM   1246 C  CG  . ARG A 1 172 ? 5.681   88.886  87.973  1.00 108.22 ? 183  ARG A CG  1 
ATOM   1247 C  CD  . ARG A 1 172 ? 5.360   89.051  89.451  1.00 117.34 ? 183  ARG A CD  1 
ATOM   1248 N  NE  . ARG A 1 172 ? 4.964   87.795  90.081  1.00 126.76 ? 183  ARG A NE  1 
ATOM   1249 C  CZ  . ARG A 1 172 ? 4.547   87.694  91.339  1.00 137.88 ? 183  ARG A CZ  1 
ATOM   1250 N  NH1 . ARG A 1 172 ? 4.471   88.776  92.102  1.00 140.56 ? 183  ARG A NH1 1 
ATOM   1251 N  NH2 . ARG A 1 172 ? 4.203   86.513  91.835  1.00 139.66 ? 183  ARG A NH2 1 
ATOM   1252 N  N   . HIS A 1 173 ? 4.783   91.803  84.101  1.00 124.42 ? 184  HIS A N   1 
ATOM   1253 C  CA  . HIS A 1 173 ? 3.809   92.532  83.289  1.00 120.17 ? 184  HIS A CA  1 
ATOM   1254 C  C   . HIS A 1 173 ? 3.291   91.613  82.191  1.00 124.36 ? 184  HIS A C   1 
ATOM   1255 O  O   . HIS A 1 173 ? 3.927   91.445  81.150  1.00 122.53 ? 184  HIS A O   1 
ATOM   1256 C  CB  . HIS A 1 173 ? 4.436   93.794  82.708  1.00 109.08 ? 184  HIS A CB  1 
ATOM   1257 C  CG  . HIS A 1 173 ? 4.680   94.865  83.724  1.00 104.64 ? 184  HIS A CG  1 
ATOM   1258 N  ND1 . HIS A 1 173 ? 5.121   96.126  83.387  1.00 106.62 ? 184  HIS A ND1 1 
ATOM   1259 C  CD2 . HIS A 1 173 ? 4.541   94.862  85.071  1.00 99.80  ? 184  HIS A CD2 1 
ATOM   1260 C  CE1 . HIS A 1 173 ? 5.244   96.854  84.482  1.00 103.17 ? 184  HIS A CE1 1 
ATOM   1261 N  NE2 . HIS A 1 173 ? 4.898   96.111  85.518  1.00 103.32 ? 184  HIS A NE2 1 
ATOM   1262 N  N   . ARG A 1 174 ? 2.117   91.030  82.416  1.00 125.97 ? 185  ARG A N   1 
ATOM   1263 C  CA  . ARG A 1 174 ? 1.569   89.980  81.569  1.00 124.08 ? 185  ARG A CA  1 
ATOM   1264 C  C   . ARG A 1 174 ? 0.440   90.528  80.710  1.00 122.87 ? 185  ARG A C   1 
ATOM   1265 O  O   . ARG A 1 174 ? -0.433  91.248  81.207  1.00 118.97 ? 185  ARG A O   1 
ATOM   1266 C  CB  . ARG A 1 174 ? 1.059   88.820  82.427  1.00 113.36 ? 185  ARG A CB  1 
ATOM   1267 C  CG  . ARG A 1 174 ? 0.341   87.717  81.674  1.00 105.08 ? 185  ARG A CG  1 
ATOM   1268 C  CD  . ARG A 1 174 ? -0.232  86.703  82.653  1.00 102.82 ? 185  ARG A CD  1 
ATOM   1269 N  NE  . ARG A 1 174 ? -1.146  85.760  82.017  1.00 108.16 ? 185  ARG A NE  1 
ATOM   1270 C  CZ  . ARG A 1 174 ? -1.872  84.867  82.681  1.00 118.46 ? 185  ARG A CZ  1 
ATOM   1271 N  NH1 . ARG A 1 174 ? -1.789  84.796  84.003  1.00 120.95 ? 185  ARG A NH1 1 
ATOM   1272 N  NH2 . ARG A 1 174 ? -2.681  84.045  82.027  1.00 122.08 ? 185  ARG A NH2 1 
ATOM   1273 N  N   . ARG A 1 175 ? 0.461   90.186  79.425  1.00 128.87 ? 186  ARG A N   1 
ATOM   1274 C  CA  . ARG A 1 175 ? -0.658  90.474  78.543  1.00 133.65 ? 186  ARG A CA  1 
ATOM   1275 C  C   . ARG A 1 175 ? -1.762  89.447  78.765  1.00 138.48 ? 186  ARG A C   1 
ATOM   1276 O  O   . ARG A 1 175 ? -1.507  88.319  79.196  1.00 143.88 ? 186  ARG A O   1 
ATOM   1277 C  CB  . ARG A 1 175 ? -0.205  90.460  77.082  1.00 132.84 ? 186  ARG A CB  1 
ATOM   1278 C  CG  . ARG A 1 175 ? -1.193  91.064  76.097  1.00 133.00 ? 186  ARG A CG  1 
ATOM   1279 C  CD  . ARG A 1 175 ? -0.749  90.801  74.669  1.00 127.99 ? 186  ARG A CD  1 
ATOM   1280 N  NE  . ARG A 1 175 ? 0.628   91.229  74.444  1.00 123.96 ? 186  ARG A NE  1 
ATOM   1281 C  CZ  . ARG A 1 175 ? 1.373   90.840  73.414  1.00 119.39 ? 186  ARG A CZ  1 
ATOM   1282 N  NH1 . ARG A 1 175 ? 0.877   90.004  72.513  1.00 119.10 ? 186  ARG A NH1 1 
ATOM   1283 N  NH2 . ARG A 1 175 ? 2.617   91.281  73.290  1.00 108.99 ? 186  ARG A NH2 1 
ATOM   1284 N  N   . VAL A 1 176 ? -3.002  89.853  78.475  1.00 135.42 ? 187  VAL A N   1 
ATOM   1285 C  CA  . VAL A 1 176 ? -4.144  88.962  78.676  1.00 125.60 ? 187  VAL A CA  1 
ATOM   1286 C  C   . VAL A 1 176 ? -3.946  87.656  77.915  1.00 134.36 ? 187  VAL A C   1 
ATOM   1287 O  O   . VAL A 1 176 ? -4.208  86.567  78.442  1.00 135.61 ? 187  VAL A O   1 
ATOM   1288 C  CB  . VAL A 1 176 ? -5.451  89.666  78.270  1.00 96.61  ? 187  VAL A CB  1 
ATOM   1289 C  CG1 . VAL A 1 176 ? -6.609  88.681  78.271  1.00 83.32  ? 187  VAL A CG1 1 
ATOM   1290 C  CG2 . VAL A 1 176 ? -5.739  90.826  79.211  1.00 92.78  ? 187  VAL A CG2 1 
ATOM   1291 N  N   . PHE A 1 177 ? -3.470  87.740  76.675  1.00 144.54 ? 188  PHE A N   1 
ATOM   1292 C  CA  . PHE A 1 177 ? -3.118  86.567  75.876  1.00 144.40 ? 188  PHE A CA  1 
ATOM   1293 C  C   . PHE A 1 177 ? -1.616  86.615  75.610  1.00 142.92 ? 188  PHE A C   1 
ATOM   1294 O  O   . PHE A 1 177 ? -1.165  87.037  74.543  1.00 148.53 ? 188  PHE A O   1 
ATOM   1295 C  CB  . PHE A 1 177 ? -3.927  86.505  74.578  1.00 137.60 ? 188  PHE A CB  1 
ATOM   1296 C  CG  . PHE A 1 177 ? -5.205  85.724  74.702  1.00 134.09 ? 188  PHE A CG  1 
ATOM   1297 C  CD1 . PHE A 1 177 ? -5.584  85.183  75.921  1.00 138.23 ? 188  PHE A CD1 1 
ATOM   1298 C  CD2 . PHE A 1 177 ? -6.016  85.515  73.601  1.00 130.89 ? 188  PHE A CD2 1 
ATOM   1299 C  CE1 . PHE A 1 177 ? -6.755  84.460  76.041  1.00 134.14 ? 188  PHE A CE1 1 
ATOM   1300 C  CE2 . PHE A 1 177 ? -7.188  84.790  73.714  1.00 130.66 ? 188  PHE A CE2 1 
ATOM   1301 C  CZ  . PHE A 1 177 ? -7.558  84.262  74.936  1.00 131.84 ? 188  PHE A CZ  1 
ATOM   1302 N  N   . GLU A 1 178 ? -0.842  86.176  76.602  1.00 131.05 ? 189  GLU A N   1 
ATOM   1303 C  CA  . GLU A 1 178 ? 0.615   86.102  76.505  1.00 112.13 ? 189  GLU A CA  1 
ATOM   1304 C  C   . GLU A 1 178 ? 0.967   84.877  75.665  1.00 106.13 ? 189  GLU A C   1 
ATOM   1305 O  O   . GLU A 1 178 ? 1.362   83.825  76.173  1.00 118.97 ? 189  GLU A O   1 
ATOM   1306 C  CB  . GLU A 1 178 ? 1.228   86.030  77.898  1.00 105.90 ? 189  GLU A CB  1 
ATOM   1307 C  CG  . GLU A 1 178 ? 2.545   86.759  78.070  1.00 99.15  ? 189  GLU A CG  1 
ATOM   1308 C  CD  . GLU A 1 178 ? 3.109   86.585  79.468  1.00 100.17 ? 189  GLU A CD  1 
ATOM   1309 O  OE1 . GLU A 1 178 ? 2.585   85.735  80.218  1.00 101.49 ? 189  GLU A OE1 1 
ATOM   1310 O  OE2 . GLU A 1 178 ? 4.072   87.294  79.819  1.00 101.41 ? 189  GLU A OE2 1 
ATOM   1311 N  N   . MET A 1 179 ? 0.819   85.026  74.347  1.00 91.81  ? 190  MET A N   1 
ATOM   1312 C  CA  . MET A 1 179 ? 0.914   83.889  73.436  1.00 75.71  ? 190  MET A CA  1 
ATOM   1313 C  C   . MET A 1 179 ? 2.260   83.186  73.549  1.00 59.18  ? 190  MET A C   1 
ATOM   1314 O  O   . MET A 1 179 ? 3.315   83.826  73.530  1.00 68.13  ? 190  MET A O   1 
ATOM   1315 C  CB  . MET A 1 179 ? 0.696   84.344  71.993  1.00 75.79  ? 190  MET A CB  1 
ATOM   1316 C  CG  . MET A 1 179 ? -0.731  84.716  71.646  1.00 90.32  ? 190  MET A CG  1 
ATOM   1317 S  SD  . MET A 1 179 ? -0.965  84.776  69.860  1.00 96.64  ? 190  MET A SD  1 
ATOM   1318 C  CE  . MET A 1 179 ? 0.426   85.794  69.370  1.00 81.47  ? 190  MET A CE  1 
ATOM   1319 N  N   . VAL A 1 180 ? 2.216   81.861  73.658  1.00 39.70  ? 191  VAL A N   1 
ATOM   1320 C  CA  . VAL A 1 180 ? 3.422   81.040  73.641  1.00 48.04  ? 191  VAL A CA  1 
ATOM   1321 C  C   . VAL A 1 180 ? 3.878   80.915  72.191  1.00 50.76  ? 191  VAL A C   1 
ATOM   1322 O  O   . VAL A 1 180 ? 3.265   80.197  71.397  1.00 49.57  ? 191  VAL A O   1 
ATOM   1323 C  CB  . VAL A 1 180 ? 3.178   79.662  74.268  1.00 43.85  ? 191  VAL A CB  1 
ATOM   1324 C  CG1 . VAL A 1 180 ? 4.365   78.745  74.022  1.00 49.25  ? 191  VAL A CG1 1 
ATOM   1325 C  CG2 . VAL A 1 180 ? 2.917   79.796  75.759  1.00 56.59  ? 191  VAL A CG2 1 
ATOM   1326 N  N   . GLU A 1 181 ? 4.944   81.632  71.837  1.00 41.50  ? 192  GLU A N   1 
ATOM   1327 C  CA  . GLU A 1 181 ? 5.500   81.575  70.493  1.00 45.41  ? 192  GLU A CA  1 
ATOM   1328 C  C   . GLU A 1 181 ? 6.750   80.717  70.405  1.00 49.15  ? 192  GLU A C   1 
ATOM   1329 O  O   . GLU A 1 181 ? 7.249   80.485  69.299  1.00 58.20  ? 192  GLU A O   1 
ATOM   1330 C  CB  . GLU A 1 181 ? 5.813   82.986  69.981  1.00 38.22  ? 192  GLU A CB  1 
ATOM   1331 C  CG  . GLU A 1 181 ? 4.575   83.817  69.712  1.00 51.26  ? 192  GLU A CG  1 
ATOM   1332 C  CD  . GLU A 1 181 ? 4.614   84.507  68.364  1.00 68.58  ? 192  GLU A CD  1 
ATOM   1333 O  OE1 . GLU A 1 181 ? 5.018   85.687  68.308  1.00 71.52  ? 192  GLU A OE1 1 
ATOM   1334 O  OE2 . GLU A 1 181 ? 4.244   83.867  67.357  1.00 75.27  ? 192  GLU A OE2 1 
ATOM   1335 N  N   . ALA A 1 182 ? 7.267   80.246  71.535  1.00 54.10  ? 193  ALA A N   1 
ATOM   1336 C  CA  . ALA A 1 182 ? 8.414   79.355  71.551  1.00 50.40  ? 193  ALA A CA  1 
ATOM   1337 C  C   . ALA A 1 182 ? 8.198   78.289  72.611  1.00 51.85  ? 193  ALA A C   1 
ATOM   1338 O  O   . ALA A 1 182 ? 7.690   78.579  73.700  1.00 61.59  ? 193  ALA A O   1 
ATOM   1339 C  CB  . ALA A 1 182 ? 9.714   80.120  71.822  1.00 35.38  ? 193  ALA A CB  1 
ATOM   1340 N  N   . LEU A 1 183 ? 8.589   77.056  72.281  1.00 52.74  ? 194  LEU A N   1 
ATOM   1341 C  CA  . LEU A 1 183 ? 8.455   75.932  73.203  1.00 48.48  ? 194  LEU A CA  1 
ATOM   1342 C  C   . LEU A 1 183 ? 9.385   74.798  72.777  1.00 47.23  ? 194  LEU A C   1 
ATOM   1343 O  O   . LEU A 1 183 ? 9.020   73.971  71.935  1.00 42.73  ? 194  LEU A O   1 
ATOM   1344 C  CB  . LEU A 1 183 ? 7.007   75.447  73.258  1.00 35.15  ? 194  LEU A CB  1 
ATOM   1345 C  CG  . LEU A 1 183 ? 6.656   74.391  74.296  1.00 57.23  ? 194  LEU A CG  1 
ATOM   1346 C  CD1 . LEU A 1 183 ? 7.045   74.860  75.689  1.00 67.29  ? 194  LEU A CD1 1 
ATOM   1347 C  CD2 . LEU A 1 183 ? 5.171   74.079  74.224  1.00 63.91  ? 194  LEU A CD2 1 
ATOM   1348 N  N   . GLN A 1 184 ? 10.587  74.745  73.349  1.00 50.16  ? 195  GLN A N   1 
ATOM   1349 C  CA  . GLN A 1 184 ? 11.625  73.833  72.886  1.00 48.03  ? 195  GLN A CA  1 
ATOM   1350 C  C   . GLN A 1 184 ? 12.226  73.071  74.060  1.00 38.00  ? 195  GLN A C   1 
ATOM   1351 O  O   . GLN A 1 184 ? 12.174  73.511  75.211  1.00 37.55  ? 195  GLN A O   1 
ATOM   1352 C  CB  . GLN A 1 184 ? 12.724  74.592  72.127  1.00 35.90  ? 195  GLN A CB  1 
ATOM   1353 C  CG  . GLN A 1 184 ? 12.220  75.356  70.907  1.00 39.53  ? 195  GLN A CG  1 
ATOM   1354 C  CD  . GLN A 1 184 ? 13.140  76.491  70.501  1.00 46.15  ? 195  GLN A CD  1 
ATOM   1355 O  OE1 . GLN A 1 184 ? 14.213  76.669  71.074  1.00 54.64  ? 195  GLN A OE1 1 
ATOM   1356 N  NE2 . GLN A 1 184 ? 12.717  77.271  69.510  1.00 60.51  ? 195  GLN A NE2 1 
ATOM   1357 N  N   . GLU A 1 185 ? 12.804  71.916  73.749  1.00 41.85  ? 196  GLU A N   1 
ATOM   1358 C  CA  . GLU A 1 185 ? 13.436  71.078  74.753  1.00 36.91  ? 196  GLU A CA  1 
ATOM   1359 C  C   . GLU A 1 185 ? 14.931  71.368  74.806  1.00 43.48  ? 196  GLU A C   1 
ATOM   1360 O  O   . GLU A 1 185 ? 15.554  71.663  73.783  1.00 48.47  ? 196  GLU A O   1 
ATOM   1361 C  CB  . GLU A 1 185 ? 13.186  69.600  74.447  1.00 37.78  ? 196  GLU A CB  1 
ATOM   1362 C  CG  . GLU A 1 185 ? 13.899  68.632  75.371  1.00 46.19  ? 196  GLU A CG  1 
ATOM   1363 C  CD  . GLU A 1 185 ? 13.697  67.186  74.967  1.00 53.09  ? 196  GLU A CD  1 
ATOM   1364 O  OE1 . GLU A 1 185 ? 12.841  66.919  74.096  1.00 56.15  ? 196  GLU A OE1 1 
ATOM   1365 O  OE2 . GLU A 1 185 ? 14.397  66.316  75.523  1.00 62.45  ? 196  GLU A OE2 1 
ATOM   1366 N  N   . HIS A 1 186 ? 15.495  71.308  76.009  1.00 44.14  ? 197  HIS A N   1 
ATOM   1367 C  CA  . HIS A 1 186 ? 16.931  71.488  76.167  1.00 38.86  ? 197  HIS A CA  1 
ATOM   1368 C  C   . HIS A 1 186 ? 17.667  70.390  75.405  1.00 44.15  ? 197  HIS A C   1 
ATOM   1369 O  O   . HIS A 1 186 ? 17.346  69.205  75.571  1.00 49.87  ? 197  HIS A O   1 
ATOM   1370 C  CB  . HIS A 1 186 ? 17.311  71.464  77.646  1.00 45.92  ? 197  HIS A CB  1 
ATOM   1371 C  CG  . HIS A 1 186 ? 18.722  71.882  77.919  1.00 56.49  ? 197  HIS A CG  1 
ATOM   1372 N  ND1 . HIS A 1 186 ? 19.800  71.051  77.705  1.00 51.40  ? 197  HIS A ND1 1 
ATOM   1373 C  CD2 . HIS A 1 186 ? 19.231  73.042  78.398  1.00 57.29  ? 197  HIS A CD2 1 
ATOM   1374 C  CE1 . HIS A 1 186 ? 20.913  71.682  78.035  1.00 51.54  ? 197  HIS A CE1 1 
ATOM   1375 N  NE2 . HIS A 1 186 ? 20.595  72.892  78.459  1.00 52.70  ? 197  HIS A NE2 1 
ATOM   1376 N  N   . PRO A 1 187 ? 18.644  70.734  74.560  1.00 38.80  ? 198  PRO A N   1 
ATOM   1377 C  CA  . PRO A 1 187 ? 19.293  69.712  73.722  1.00 39.37  ? 198  PRO A CA  1 
ATOM   1378 C  C   . PRO A 1 187 ? 20.125  68.706  74.500  1.00 51.22  ? 198  PRO A C   1 
ATOM   1379 O  O   . PRO A 1 187 ? 20.516  67.684  73.922  1.00 62.04  ? 198  PRO A O   1 
ATOM   1380 C  CB  . PRO A 1 187 ? 20.176  70.541  72.779  1.00 38.57  ? 198  PRO A CB  1 
ATOM   1381 C  CG  . PRO A 1 187 ? 19.620  71.934  72.843  1.00 37.18  ? 198  PRO A CG  1 
ATOM   1382 C  CD  . PRO A 1 187 ? 19.111  72.091  74.238  1.00 37.86  ? 198  PRO A CD  1 
ATOM   1383 N  N   . ARG A 1 188 ? 20.412  68.958  75.780  1.00 54.44  ? 199  ARG A N   1 
ATOM   1384 C  CA  . ARG A 1 188 ? 21.192  68.037  76.596  1.00 52.52  ? 199  ARG A CA  1 
ATOM   1385 C  C   . ARG A 1 188 ? 20.536  67.746  77.942  1.00 48.35  ? 199  ARG A C   1 
ATOM   1386 O  O   . ARG A 1 188 ? 21.173  67.130  78.805  1.00 51.38  ? 199  ARG A O   1 
ATOM   1387 C  CB  . ARG A 1 188 ? 22.609  68.582  76.825  1.00 64.36  ? 199  ARG A CB  1 
ATOM   1388 C  CG  . ARG A 1 188 ? 23.349  68.992  75.559  1.00 58.04  ? 199  ARG A CG  1 
ATOM   1389 C  CD  . ARG A 1 188 ? 23.646  67.799  74.663  1.00 49.37  ? 199  ARG A CD  1 
ATOM   1390 N  NE  . ARG A 1 188 ? 24.248  68.213  73.398  1.00 52.94  ? 199  ARG A NE  1 
ATOM   1391 C  CZ  . ARG A 1 188 ? 24.586  67.380  72.420  1.00 54.98  ? 199  ARG A CZ  1 
ATOM   1392 N  NH1 . ARG A 1 188 ? 24.384  66.076  72.555  1.00 46.98  ? 199  ARG A NH1 1 
ATOM   1393 N  NH2 . ARG A 1 188 ? 25.128  67.850  71.305  1.00 50.57  ? 199  ARG A NH2 1 
ATOM   1394 N  N   . ASP A 1 189 ? 19.288  68.168  78.149  1.00 48.46  ? 200  ASP A N   1 
ATOM   1395 C  CA  . ASP A 1 189 ? 18.610  67.998  79.434  1.00 53.14  ? 200  ASP A CA  1 
ATOM   1396 C  C   . ASP A 1 189 ? 17.121  67.819  79.174  1.00 62.41  ? 200  ASP A C   1 
ATOM   1397 O  O   . ASP A 1 189 ? 16.385  68.805  79.020  1.00 69.45  ? 200  ASP A O   1 
ATOM   1398 C  CB  . ASP A 1 189 ? 18.858  69.184  80.362  1.00 61.36  ? 200  ASP A CB  1 
ATOM   1399 C  CG  . ASP A 1 189 ? 18.594  68.853  81.820  1.00 68.32  ? 200  ASP A CG  1 
ATOM   1400 O  OD1 . ASP A 1 189 ? 19.404  69.260  82.679  1.00 77.56  ? 200  ASP A OD1 1 
ATOM   1401 O  OD2 . ASP A 1 189 ? 17.589  68.170  82.106  1.00 71.56  ? 200  ASP A OD2 1 
ATOM   1402 N  N   . PRO A 1 190 ? 16.634  66.576  79.128  1.00 58.02  ? 201  PRO A N   1 
ATOM   1403 C  CA  . PRO A 1 190 ? 15.192  66.359  78.922  1.00 47.76  ? 201  PRO A CA  1 
ATOM   1404 C  C   . PRO A 1 190 ? 14.319  66.899  80.046  1.00 51.80  ? 201  PRO A C   1 
ATOM   1405 O  O   . PRO A 1 190 ? 13.097  66.977  79.867  1.00 63.59  ? 201  PRO A O   1 
ATOM   1406 C  CB  . PRO A 1 190 ? 15.076  64.831  78.817  1.00 49.88  ? 201  PRO A CB  1 
ATOM   1407 C  CG  . PRO A 1 190 ? 16.445  64.372  78.425  1.00 58.42  ? 201  PRO A CG  1 
ATOM   1408 C  CD  . PRO A 1 190 ? 17.391  65.314  79.107  1.00 63.80  ? 201  PRO A CD  1 
ATOM   1409 N  N   . ASN A 1 191 ? 14.898  67.271  81.190  1.00 47.10  ? 202  ASN A N   1 
ATOM   1410 C  CA  . ASN A 1 191 ? 14.117  67.820  82.290  1.00 47.86  ? 202  ASN A CA  1 
ATOM   1411 C  C   . ASN A 1 191 ? 13.821  69.304  82.119  1.00 46.39  ? 202  ASN A C   1 
ATOM   1412 O  O   . ASN A 1 191 ? 12.850  69.799  82.701  1.00 58.13  ? 202  ASN A O   1 
ATOM   1413 C  CB  . ASN A 1 191 ? 14.845  67.591  83.618  1.00 57.11  ? 202  ASN A CB  1 
ATOM   1414 C  CG  . ASN A 1 191 ? 14.041  68.062  84.816  1.00 62.43  ? 202  ASN A CG  1 
ATOM   1415 O  OD1 . ASN A 1 191 ? 12.829  67.856  84.886  1.00 62.82  ? 202  ASN A OD1 1 
ATOM   1416 N  ND2 . ASN A 1 191 ? 14.713  68.709  85.760  1.00 69.93  ? 202  ASN A ND2 1 
ATOM   1417 N  N   . GLN A 1 192 ? 14.625  70.021  81.340  1.00 45.05  ? 203  GLN A N   1 
ATOM   1418 C  CA  . GLN A 1 192 ? 14.436  71.448  81.124  1.00 43.86  ? 203  GLN A CA  1 
ATOM   1419 C  C   . GLN A 1 192 ? 13.734  71.690  79.795  1.00 47.50  ? 203  GLN A C   1 
ATOM   1420 O  O   . GLN A 1 192 ? 14.049  71.049  78.788  1.00 60.91  ? 203  GLN A O   1 
ATOM   1421 C  CB  . GLN A 1 192 ? 15.775  72.188  81.138  1.00 44.01  ? 203  GLN A CB  1 
ATOM   1422 C  CG  . GLN A 1 192 ? 16.597  71.979  82.398  1.00 51.82  ? 203  GLN A CG  1 
ATOM   1423 C  CD  . GLN A 1 192 ? 17.922  72.714  82.352  1.00 54.46  ? 203  GLN A CD  1 
ATOM   1424 O  OE1 . GLN A 1 192 ? 17.993  73.866  81.922  1.00 58.81  ? 203  GLN A OE1 1 
ATOM   1425 N  NE2 . GLN A 1 192 ? 18.984  72.047  82.788  1.00 48.47  ? 203  GLN A NE2 1 
ATOM   1426 N  N   . ILE A 1 193 ? 12.777  72.616  79.799  1.00 41.20  ? 204  ILE A N   1 
ATOM   1427 C  CA  . ILE A 1 193 ? 12.124  73.070  78.580  1.00 39.47  ? 204  ILE A CA  1 
ATOM   1428 C  C   . ILE A 1 193 ? 12.124  74.591  78.570  1.00 45.56  ? 204  ILE A C   1 
ATOM   1429 O  O   . ILE A 1 193 ? 12.118  75.241  79.620  1.00 41.91  ? 204  ILE A O   1 
ATOM   1430 C  CB  . ILE A 1 193 ? 10.682  72.532  78.434  1.00 55.38  ? 204  ILE A CB  1 
ATOM   1431 C  CG1 . ILE A 1 193 ? 9.783   73.085  79.543  1.00 67.08  ? 204  ILE A CG1 1 
ATOM   1432 C  CG2 . ILE A 1 193 ? 10.673  71.011  78.427  1.00 55.03  ? 204  ILE A CG2 1 
ATOM   1433 C  CD1 . ILE A 1 193 ? 8.306   72.875  79.287  1.00 74.32  ? 204  ILE A CD1 1 
ATOM   1434 N  N   . LEU A 1 194 ? 12.136  75.157  77.369  1.00 45.94  ? 205  LEU A N   1 
ATOM   1435 C  CA  . LEU A 1 194 ? 12.085  76.598  77.180  1.00 45.65  ? 205  LEU A CA  1 
ATOM   1436 C  C   . LEU A 1 194 ? 10.678  77.013  76.778  1.00 54.16  ? 205  LEU A C   1 
ATOM   1437 O  O   . LEU A 1 194 ? 10.027  76.339  75.974  1.00 67.23  ? 205  LEU A O   1 
ATOM   1438 C  CB  . LEU A 1 194 ? 13.091  77.045  76.116  1.00 49.98  ? 205  LEU A CB  1 
ATOM   1439 C  CG  . LEU A 1 194 ? 13.057  78.509  75.672  1.00 50.86  ? 205  LEU A CG  1 
ATOM   1440 C  CD1 . LEU A 1 194 ? 14.467  79.022  75.478  1.00 53.86  ? 205  LEU A CD1 1 
ATOM   1441 C  CD2 . LEU A 1 194 ? 12.258  78.676  74.386  1.00 49.24  ? 205  LEU A CD2 1 
ATOM   1442 N  N   . ILE A 1 195 ? 10.213  78.123  77.342  1.00 48.32  ? 206  ILE A N   1 
ATOM   1443 C  CA  . ILE A 1 195 ? 8.920   78.703  77.003  1.00 43.50  ? 206  ILE A CA  1 
ATOM   1444 C  C   . ILE A 1 195 ? 9.152   80.139  76.558  1.00 47.00  ? 206  ILE A C   1 
ATOM   1445 O  O   . ILE A 1 195 ? 9.868   80.893  77.228  1.00 57.99  ? 206  ILE A O   1 
ATOM   1446 C  CB  . ILE A 1 195 ? 7.938   78.644  78.188  1.00 39.38  ? 206  ILE A CB  1 
ATOM   1447 C  CG1 . ILE A 1 195 ? 7.868   77.222  78.750  1.00 39.69  ? 206  ILE A CG1 1 
ATOM   1448 C  CG2 . ILE A 1 195 ? 6.557   79.104  77.752  1.00 39.37  ? 206  ILE A CG2 1 
ATOM   1449 C  CD1 . ILE A 1 195 ? 6.947   77.078  79.941  1.00 43.88  ? 206  ILE A CD1 1 
ATOM   1450 N  N   . GLY A 1 196 ? 8.560   80.510  75.426  1.00 40.16  ? 207  GLY A N   1 
ATOM   1451 C  CA  . GLY A 1 196 ? 8.720   81.849  74.894  1.00 36.23  ? 207  GLY A CA  1 
ATOM   1452 C  C   . GLY A 1 196 ? 7.399   82.546  74.646  1.00 44.78  ? 207  GLY A C   1 
ATOM   1453 O  O   . GLY A 1 196 ? 6.524   82.006  73.963  1.00 48.91  ? 207  GLY A O   1 
ATOM   1454 N  N   . TYR A 1 197 ? 7.246   83.748  75.191  1.00 43.93  ? 208  TYR A N   1 
ATOM   1455 C  CA  . TYR A 1 197 ? 6.008   84.504  75.093  1.00 42.73  ? 208  TYR A CA  1 
ATOM   1456 C  C   . TYR A 1 197 ? 6.184   85.684  74.145  1.00 52.81  ? 208  TYR A C   1 
ATOM   1457 O  O   . TYR A 1 197 ? 7.296   86.165  73.914  1.00 61.97  ? 208  TYR A O   1 
ATOM   1458 C  CB  . TYR A 1 197 ? 5.556   84.985  76.476  1.00 44.41  ? 208  TYR A CB  1 
ATOM   1459 C  CG  . TYR A 1 197 ? 5.386   83.858  77.472  1.00 42.48  ? 208  TYR A CG  1 
ATOM   1460 C  CD1 . TYR A 1 197 ? 4.189   83.161  77.565  1.00 45.28  ? 208  TYR A CD1 1 
ATOM   1461 C  CD2 . TYR A 1 197 ? 6.427   83.485  78.313  1.00 51.21  ? 208  TYR A CD2 1 
ATOM   1462 C  CE1 . TYR A 1 197 ? 4.030   82.128  78.470  1.00 47.78  ? 208  TYR A CE1 1 
ATOM   1463 C  CE2 . TYR A 1 197 ? 6.278   82.453  79.221  1.00 53.60  ? 208  TYR A CE2 1 
ATOM   1464 C  CZ  . TYR A 1 197 ? 5.077   81.779  79.296  1.00 52.12  ? 208  TYR A CZ  1 
ATOM   1465 O  OH  . TYR A 1 197 ? 4.925   80.751  80.197  1.00 55.17  ? 208  TYR A OH  1 
ATOM   1466 N  N   . SER A 1 198 ? 5.056   86.145  73.596  1.00 45.39  ? 209  SER A N   1 
ATOM   1467 C  CA  . SER A 1 198 ? 5.093   87.158  72.544  1.00 47.17  ? 209  SER A CA  1 
ATOM   1468 C  C   . SER A 1 198 ? 5.718   88.457  73.037  1.00 54.00  ? 209  SER A C   1 
ATOM   1469 O  O   . SER A 1 198 ? 6.596   89.024  72.377  1.00 54.01  ? 209  SER A O   1 
ATOM   1470 C  CB  . SER A 1 198 ? 3.682   87.413  72.012  1.00 53.85  ? 209  SER A CB  1 
ATOM   1471 O  OG  . SER A 1 198 ? 3.178   86.277  71.335  1.00 69.65  ? 209  SER A OG  1 
ATOM   1472 N  N   . ARG A 1 199 ? 5.284   88.940  74.204  1.00 51.89  ? 210  ARG A N   1 
ATOM   1473 C  CA  . ARG A 1 199 ? 5.717   90.252  74.674  1.00 47.66  ? 210  ARG A CA  1 
ATOM   1474 C  C   . ARG A 1 199 ? 7.222   90.333  74.894  1.00 56.30  ? 210  ARG A C   1 
ATOM   1475 O  O   . ARG A 1 199 ? 7.770   91.439  74.936  1.00 70.27  ? 210  ARG A O   1 
ATOM   1476 C  CB  . ARG A 1 199 ? 4.983   90.617  75.963  1.00 52.10  ? 210  ARG A CB  1 
ATOM   1477 C  CG  . ARG A 1 199 ? 5.261   89.678  77.117  1.00 70.46  ? 210  ARG A CG  1 
ATOM   1478 C  CD  . ARG A 1 199 ? 4.604   90.179  78.386  1.00 73.86  ? 210  ARG A CD  1 
ATOM   1479 N  NE  . ARG A 1 199 ? 4.953   89.364  79.544  1.00 73.22  ? 210  ARG A NE  1 
ATOM   1480 C  CZ  . ARG A 1 199 ? 6.042   89.544  80.285  1.00 78.53  ? 210  ARG A CZ  1 
ATOM   1481 N  NH1 . ARG A 1 199 ? 6.893   90.516  79.989  1.00 80.71  ? 210  ARG A NH1 1 
ATOM   1482 N  NH2 . ARG A 1 199 ? 6.277   88.753  81.323  1.00 83.99  ? 210  ARG A NH2 1 
ATOM   1483 N  N   . GLY A 1 200 ? 7.902   89.197  75.037  1.00 56.52  ? 211  GLY A N   1 
ATOM   1484 C  CA  . GLY A 1 200 ? 9.348   89.210  75.133  1.00 54.28  ? 211  GLY A CA  1 
ATOM   1485 C  C   . GLY A 1 200 ? 9.921   88.335  76.228  1.00 54.50  ? 211  GLY A C   1 
ATOM   1486 O  O   . GLY A 1 200 ? 11.143  88.216  76.355  1.00 58.93  ? 211  GLY A O   1 
ATOM   1487 N  N   . LEU A 1 201 ? 9.055   87.717  77.026  1.00 61.46  ? 212  LEU A N   1 
ATOM   1488 C  CA  . LEU A 1 201 ? 9.509   86.877  78.125  1.00 60.33  ? 212  LEU A CA  1 
ATOM   1489 C  C   . LEU A 1 201 ? 9.919   85.503  77.609  1.00 53.98  ? 212  LEU A C   1 
ATOM   1490 O  O   . LEU A 1 201 ? 9.151   84.838  76.906  1.00 50.86  ? 212  LEU A O   1 
ATOM   1491 C  CB  . LEU A 1 201 ? 8.414   86.741  79.182  1.00 54.67  ? 212  LEU A CB  1 
ATOM   1492 C  CG  . LEU A 1 201 ? 8.737   85.821  80.362  1.00 54.09  ? 212  LEU A CG  1 
ATOM   1493 C  CD1 . LEU A 1 201 ? 9.891   86.377  81.183  1.00 47.45  ? 212  LEU A CD1 1 
ATOM   1494 C  CD2 . LEU A 1 201 ? 7.507   85.603  81.229  1.00 56.96  ? 212  LEU A CD2 1 
ATOM   1495 N  N   . VAL A 1 202 ? 11.133  85.084  77.956  1.00 50.26  ? 213  VAL A N   1 
ATOM   1496 C  CA  . VAL A 1 202 ? 11.647  83.758  77.632  1.00 42.05  ? 213  VAL A CA  1 
ATOM   1497 C  C   . VAL A 1 202 ? 12.116  83.114  78.927  1.00 45.89  ? 213  VAL A C   1 
ATOM   1498 O  O   . VAL A 1 202 ? 12.840  83.742  79.707  1.00 42.61  ? 213  VAL A O   1 
ATOM   1499 C  CB  . VAL A 1 202 ? 12.796  83.821  76.607  1.00 39.83  ? 213  VAL A CB  1 
ATOM   1500 C  CG1 . VAL A 1 202 ? 13.350  82.431  76.340  1.00 48.04  ? 213  VAL A CG1 1 
ATOM   1501 C  CG2 . VAL A 1 202 ? 12.323  84.468  75.316  1.00 40.43  ? 213  VAL A CG2 1 
ATOM   1502 N  N   . VAL A 1 203 ? 11.707  81.868  79.156  1.00 47.25  ? 214  VAL A N   1 
ATOM   1503 C  CA  . VAL A 1 203 ? 11.908  81.202  80.438  1.00 42.25  ? 214  VAL A CA  1 
ATOM   1504 C  C   . VAL A 1 203 ? 12.284  79.746  80.201  1.00 51.55  ? 214  VAL A C   1 
ATOM   1505 O  O   . VAL A 1 203 ? 11.680  79.065  79.366  1.00 67.78  ? 214  VAL A O   1 
ATOM   1506 C  CB  . VAL A 1 203 ? 10.644  81.308  81.320  1.00 45.13  ? 214  VAL A CB  1 
ATOM   1507 C  CG1 . VAL A 1 203 ? 10.622  80.218  82.380  1.00 59.05  ? 214  VAL A CG1 1 
ATOM   1508 C  CG2 . VAL A 1 203 ? 10.560  82.683  81.966  1.00 45.61  ? 214  VAL A CG2 1 
ATOM   1509 N  N   . ILE A 1 204 ? 13.292  79.273  80.934  1.00 51.32  ? 215  ILE A N   1 
ATOM   1510 C  CA  . ILE A 1 204 ? 13.638  77.857  80.995  1.00 57.19  ? 215  ILE A CA  1 
ATOM   1511 C  C   . ILE A 1 204 ? 13.018  77.276  82.258  1.00 53.50  ? 215  ILE A C   1 
ATOM   1512 O  O   . ILE A 1 204 ? 13.216  77.808  83.358  1.00 57.85  ? 215  ILE A O   1 
ATOM   1513 C  CB  . ILE A 1 204 ? 15.162  77.648  80.977  1.00 53.39  ? 215  ILE A CB  1 
ATOM   1514 C  CG1 . ILE A 1 204 ? 15.767  78.257  79.710  1.00 43.64  ? 215  ILE A CG1 1 
ATOM   1515 C  CG2 . ILE A 1 204 ? 15.500  76.167  81.070  1.00 42.82  ? 215  ILE A CG2 1 
ATOM   1516 C  CD1 . ILE A 1 204 ? 17.265  78.074  79.600  1.00 41.42  ? 215  ILE A CD1 1 
ATOM   1517 N  N   . TRP A 1 205 ? 12.271  76.187  82.105  1.00 48.89  ? 216  TRP A N   1 
ATOM   1518 C  CA  . TRP A 1 205 ? 11.441  75.642  83.170  1.00 50.20  ? 216  TRP A CA  1 
ATOM   1519 C  C   . TRP A 1 205 ? 11.983  74.300  83.644  1.00 49.22  ? 216  TRP A C   1 
ATOM   1520 O  O   . TRP A 1 205 ? 12.377  73.456  82.834  1.00 50.46  ? 216  TRP A O   1 
ATOM   1521 C  CB  . TRP A 1 205 ? 9.995   75.482  82.690  1.00 51.42  ? 216  TRP A CB  1 
ATOM   1522 C  CG  . TRP A 1 205 ? 9.041   74.991  83.736  1.00 50.82  ? 216  TRP A CG  1 
ATOM   1523 C  CD1 . TRP A 1 205 ? 8.645   73.701  83.944  1.00 54.82  ? 216  TRP A CD1 1 
ATOM   1524 C  CD2 . TRP A 1 205 ? 8.350   75.784  84.708  1.00 60.28  ? 216  TRP A CD2 1 
ATOM   1525 N  NE1 . TRP A 1 205 ? 7.755   73.642  84.989  1.00 60.78  ? 216  TRP A NE1 1 
ATOM   1526 C  CE2 . TRP A 1 205 ? 7.557   74.908  85.475  1.00 64.32  ? 216  TRP A CE2 1 
ATOM   1527 C  CE3 . TRP A 1 205 ? 8.327   77.150  85.006  1.00 68.94  ? 216  TRP A CE3 1 
ATOM   1528 C  CZ2 . TRP A 1 205 ? 6.750   75.353  86.519  1.00 65.03  ? 216  TRP A CZ2 1 
ATOM   1529 C  CZ3 . TRP A 1 205 ? 7.526   77.589  86.045  1.00 70.23  ? 216  TRP A CZ3 1 
ATOM   1530 C  CH2 . TRP A 1 205 ? 6.749   76.693  86.789  1.00 66.65  ? 216  TRP A CH2 1 
ATOM   1531 N  N   . ASP A 1 206 ? 11.998  74.113  84.961  1.00 48.61  ? 217  ASP A N   1 
ATOM   1532 C  CA  . ASP A 1 206 ? 12.369  72.840  85.572  1.00 51.82  ? 217  ASP A CA  1 
ATOM   1533 C  C   . ASP A 1 206 ? 11.100  72.010  85.736  1.00 56.99  ? 217  ASP A C   1 
ATOM   1534 O  O   . ASP A 1 206 ? 10.258  72.314  86.587  1.00 86.02  ? 217  ASP A O   1 
ATOM   1535 C  CB  . ASP A 1 206 ? 13.062  73.069  86.912  1.00 61.53  ? 217  ASP A CB  1 
ATOM   1536 C  CG  . ASP A 1 206 ? 13.571  71.785  87.536  1.00 68.64  ? 217  ASP A CG  1 
ATOM   1537 O  OD1 . ASP A 1 206 ? 14.740  71.423  87.286  1.00 82.84  ? 217  ASP A OD1 1 
ATOM   1538 O  OD2 . ASP A 1 206 ? 12.803  71.138  88.277  1.00 72.04  ? 217  ASP A OD2 1 
ATOM   1539 N  N   . LEU A 1 207 ? 10.962  70.965  84.918  1.00 49.37  ? 218  LEU A N   1 
ATOM   1540 C  CA  . LEU A 1 207 ? 9.718   70.199  84.894  1.00 60.78  ? 218  LEU A CA  1 
ATOM   1541 C  C   . LEU A 1 207 ? 9.486   69.470  86.213  1.00 65.53  ? 218  LEU A C   1 
ATOM   1542 O  O   . LEU A 1 207 ? 8.422   69.607  86.829  1.00 70.99  ? 218  LEU A O   1 
ATOM   1543 C  CB  . LEU A 1 207 ? 9.734   69.215  83.725  1.00 69.90  ? 218  LEU A CB  1 
ATOM   1544 C  CG  . LEU A 1 207 ? 9.673   69.841  82.329  1.00 65.48  ? 218  LEU A CG  1 
ATOM   1545 C  CD1 . LEU A 1 207 ? 9.885   68.783  81.259  1.00 58.25  ? 218  LEU A CD1 1 
ATOM   1546 C  CD2 . LEU A 1 207 ? 8.350   70.562  82.122  1.00 45.52  ? 218  LEU A CD2 1 
ATOM   1547 N  N   . GLN A 1 208 ? 10.467  68.686  86.662  1.00 68.39  ? 219  GLN A N   1 
ATOM   1548 C  CA  . GLN A 1 208 ? 10.350  67.950  87.922  1.00 72.15  ? 219  GLN A CA  1 
ATOM   1549 C  C   . GLN A 1 208 ? 10.885  68.831  89.048  1.00 81.00  ? 219  GLN A C   1 
ATOM   1550 O  O   . GLN A 1 208 ? 12.013  68.684  89.524  1.00 104.35 ? 219  GLN A O   1 
ATOM   1551 C  CB  . GLN A 1 208 ? 11.092  66.623  87.843  1.00 71.51  ? 219  GLN A CB  1 
ATOM   1552 C  CG  . GLN A 1 208 ? 10.875  65.726  89.052  1.00 74.62  ? 219  GLN A CG  1 
ATOM   1553 C  CD  . GLN A 1 208 ? 11.973  64.697  89.219  1.00 82.67  ? 219  GLN A CD  1 
ATOM   1554 O  OE1 . GLN A 1 208 ? 13.058  64.834  88.653  1.00 86.98  ? 219  GLN A OE1 1 
ATOM   1555 N  NE2 . GLN A 1 208 ? 11.698  63.660  90.000  1.00 94.53  ? 219  GLN A NE2 1 
ATOM   1556 N  N   . GLY A 1 209 ? 10.046  69.768  89.479  1.00 62.09  ? 220  GLY A N   1 
ATOM   1557 C  CA  . GLY A 1 209 ? 10.425  70.706  90.516  1.00 60.34  ? 220  GLY A CA  1 
ATOM   1558 C  C   . GLY A 1 209 ? 9.639   71.997  90.438  1.00 78.20  ? 220  GLY A C   1 
ATOM   1559 O  O   . GLY A 1 209 ? 9.418   72.663  91.455  1.00 91.13  ? 220  GLY A O   1 
ATOM   1560 N  N   . SER A 1 210 ? 9.217   72.357  89.225  1.00 65.31  ? 221  SER A N   1 
ATOM   1561 C  CA  . SER A 1 210 ? 8.365   73.520  88.978  1.00 63.53  ? 221  SER A CA  1 
ATOM   1562 C  C   . SER A 1 210 ? 9.026   74.809  89.472  1.00 77.62  ? 221  SER A C   1 
ATOM   1563 O  O   . SER A 1 210 ? 8.523   75.503  90.359  1.00 88.86  ? 221  SER A O   1 
ATOM   1564 C  CB  . SER A 1 210 ? 6.982   73.326  89.611  1.00 66.13  ? 221  SER A CB  1 
ATOM   1565 O  OG  . SER A 1 210 ? 6.358   72.153  89.119  1.00 60.26  ? 221  SER A OG  1 
ATOM   1566 N  N   . ARG A 1 211 ? 10.172  75.122  88.871  1.00 68.34  ? 222  ARG A N   1 
ATOM   1567 C  CA  . ARG A 1 211 ? 10.905  76.339  89.183  1.00 66.17  ? 222  ARG A CA  1 
ATOM   1568 C  C   . ARG A 1 211 ? 11.534  76.886  87.910  1.00 59.23  ? 222  ARG A C   1 
ATOM   1569 O  O   . ARG A 1 211 ? 11.877  76.133  86.995  1.00 60.24  ? 222  ARG A O   1 
ATOM   1570 C  CB  . ARG A 1 211 ? 11.984  76.096  90.249  1.00 65.82  ? 222  ARG A CB  1 
ATOM   1571 C  CG  . ARG A 1 211 ? 12.906  74.927  89.949  1.00 58.91  ? 222  ARG A CG  1 
ATOM   1572 C  CD  . ARG A 1 211 ? 14.116  74.920  90.868  1.00 76.08  ? 222  ARG A CD  1 
ATOM   1573 N  NE  . ARG A 1 211 ? 15.061  73.865  90.513  1.00 80.84  ? 222  ARG A NE  1 
ATOM   1574 C  CZ  . ARG A 1 211 ? 16.292  73.768  91.004  1.00 86.50  ? 222  ARG A CZ  1 
ATOM   1575 N  NH1 . ARG A 1 211 ? 16.736  74.668  91.871  1.00 91.93  ? 222  ARG A NH1 1 
ATOM   1576 N  NH2 . ARG A 1 211 ? 17.083  72.773  90.624  1.00 90.75  ? 222  ARG A NH2 1 
ATOM   1577 N  N   . VAL A 1 212 ? 11.675  78.206  87.859  1.00 54.68  ? 223  VAL A N   1 
ATOM   1578 C  CA  . VAL A 1 212 ? 12.256  78.886  86.707  1.00 52.56  ? 223  VAL A CA  1 
ATOM   1579 C  C   . VAL A 1 212 ? 13.761  78.994  86.917  1.00 55.54  ? 223  VAL A C   1 
ATOM   1580 O  O   . VAL A 1 212 ? 14.220  79.636  87.868  1.00 65.70  ? 223  VAL A O   1 
ATOM   1581 C  CB  . VAL A 1 212 ? 11.626  80.271  86.500  1.00 58.69  ? 223  VAL A CB  1 
ATOM   1582 C  CG1 . VAL A 1 212 ? 12.401  81.054  85.453  1.00 68.65  ? 223  VAL A CG1 1 
ATOM   1583 C  CG2 . VAL A 1 212 ? 10.167  80.132  86.092  1.00 51.78  ? 223  VAL A CG2 1 
ATOM   1584 N  N   . LEU A 1 213 ? 14.528  78.369  86.026  1.00 51.54  ? 224  LEU A N   1 
ATOM   1585 C  CA  . LEU A 1 213 ? 15.980  78.348  86.130  1.00 63.32  ? 224  LEU A CA  1 
ATOM   1586 C  C   . LEU A 1 213 ? 16.654  79.487  85.378  1.00 65.27  ? 224  LEU A C   1 
ATOM   1587 O  O   . LEU A 1 213 ? 17.852  79.715  85.577  1.00 69.38  ? 224  LEU A O   1 
ATOM   1588 C  CB  . LEU A 1 213 ? 16.527  77.015  85.604  1.00 64.87  ? 224  LEU A CB  1 
ATOM   1589 C  CG  . LEU A 1 213 ? 15.890  75.729  86.133  1.00 51.91  ? 224  LEU A CG  1 
ATOM   1590 C  CD1 . LEU A 1 213 ? 16.474  74.516  85.423  1.00 50.87  ? 224  LEU A CD1 1 
ATOM   1591 C  CD2 . LEU A 1 213 ? 16.076  75.613  87.636  1.00 55.10  ? 224  LEU A CD2 1 
ATOM   1592 N  N   . TYR A 1 214 ? 15.920  80.206  84.532  1.00 65.71  ? 225  TYR A N   1 
ATOM   1593 C  CA  . TYR A 1 214 ? 16.513  81.175  83.622  1.00 60.63  ? 225  TYR A CA  1 
ATOM   1594 C  C   . TYR A 1 214 ? 15.396  81.994  82.994  1.00 57.76  ? 225  TYR A C   1 
ATOM   1595 O  O   . TYR A 1 214 ? 14.337  81.450  82.672  1.00 56.29  ? 225  TYR A O   1 
ATOM   1596 C  CB  . TYR A 1 214 ? 17.336  80.459  82.541  1.00 46.83  ? 225  TYR A CB  1 
ATOM   1597 C  CG  . TYR A 1 214 ? 17.937  81.353  81.480  1.00 53.30  ? 225  TYR A CG  1 
ATOM   1598 C  CD1 . TYR A 1 214 ? 19.183  81.936  81.661  1.00 64.13  ? 225  TYR A CD1 1 
ATOM   1599 C  CD2 . TYR A 1 214 ? 17.269  81.589  80.286  1.00 59.22  ? 225  TYR A CD2 1 
ATOM   1600 C  CE1 . TYR A 1 214 ? 19.741  82.743  80.688  1.00 70.96  ? 225  TYR A CE1 1 
ATOM   1601 C  CE2 . TYR A 1 214 ? 17.818  82.395  79.308  1.00 64.66  ? 225  TYR A CE2 1 
ATOM   1602 C  CZ  . TYR A 1 214 ? 19.053  82.970  79.514  1.00 67.41  ? 225  TYR A CZ  1 
ATOM   1603 O  OH  . TYR A 1 214 ? 19.601  83.774  78.541  1.00 54.85  ? 225  TYR A OH  1 
ATOM   1604 N  N   . HIS A 1 215 ? 15.633  83.294  82.828  1.00 55.13  ? 226  HIS A N   1 
ATOM   1605 C  CA  . HIS A 1 215 ? 14.627  84.156  82.224  1.00 48.08  ? 226  HIS A CA  1 
ATOM   1606 C  C   . HIS A 1 215 ? 15.276  85.445  81.746  1.00 47.76  ? 226  HIS A C   1 
ATOM   1607 O  O   . HIS A 1 215 ? 16.294  85.883  82.288  1.00 56.68  ? 226  HIS A O   1 
ATOM   1608 C  CB  . HIS A 1 215 ? 13.491  84.469  83.206  1.00 52.40  ? 226  HIS A CB  1 
ATOM   1609 C  CG  . HIS A 1 215 ? 13.720  85.700  84.028  1.00 65.17  ? 226  HIS A CG  1 
ATOM   1610 N  ND1 . HIS A 1 215 ? 13.286  86.948  83.635  1.00 68.20  ? 226  HIS A ND1 1 
ATOM   1611 C  CD2 . HIS A 1 215 ? 14.335  85.875  85.221  1.00 72.98  ? 226  HIS A CD2 1 
ATOM   1612 C  CE1 . HIS A 1 215 ? 13.624  87.838  84.550  1.00 74.98  ? 226  HIS A CE1 1 
ATOM   1613 N  NE2 . HIS A 1 215 ? 14.262  87.213  85.523  1.00 77.94  ? 226  HIS A NE2 1 
ATOM   1614 N  N   . PHE A 1 216 ? 14.673  86.042  80.720  1.00 46.35  ? 227  PHE A N   1 
ATOM   1615 C  CA  . PHE A 1 216 ? 15.056  87.373  80.272  1.00 53.70  ? 227  PHE A CA  1 
ATOM   1616 C  C   . PHE A 1 216 ? 13.876  88.005  79.549  1.00 57.83  ? 227  PHE A C   1 
ATOM   1617 O  O   . PHE A 1 216 ? 13.074  87.312  78.918  1.00 58.52  ? 227  PHE A O   1 
ATOM   1618 C  CB  . PHE A 1 216 ? 16.298  87.348  79.366  1.00 45.79  ? 227  PHE A CB  1 
ATOM   1619 C  CG  . PHE A 1 216 ? 16.110  86.600  78.068  1.00 57.25  ? 227  PHE A CG  1 
ATOM   1620 C  CD1 . PHE A 1 216 ? 15.553  87.222  76.960  1.00 57.74  ? 227  PHE A CD1 1 
ATOM   1621 C  CD2 . PHE A 1 216 ? 16.524  85.284  77.948  1.00 60.18  ? 227  PHE A CD2 1 
ATOM   1622 C  CE1 . PHE A 1 216 ? 15.389  86.539  75.769  1.00 39.56  ? 227  PHE A CE1 1 
ATOM   1623 C  CE2 . PHE A 1 216 ? 16.366  84.597  76.757  1.00 53.45  ? 227  PHE A CE2 1 
ATOM   1624 C  CZ  . PHE A 1 216 ? 15.800  85.227  75.666  1.00 38.49  ? 227  PHE A CZ  1 
ATOM   1625 N  N   . LEU A 1 217 ? 13.777  89.326  79.658  1.00 57.11  ? 228  LEU A N   1 
ATOM   1626 C  CA  . LEU A 1 217 ? 12.779  90.102  78.938  1.00 58.71  ? 228  LEU A CA  1 
ATOM   1627 C  C   . LEU A 1 217 ? 13.400  90.685  77.677  1.00 55.80  ? 228  LEU A C   1 
ATOM   1628 O  O   . LEU A 1 217 ? 14.533  91.173  77.700  1.00 71.30  ? 228  LEU A O   1 
ATOM   1629 C  CB  . LEU A 1 217 ? 12.218  91.226  79.811  1.00 71.50  ? 228  LEU A CB  1 
ATOM   1630 C  CG  . LEU A 1 217 ? 11.407  90.813  81.040  1.00 82.81  ? 228  LEU A CG  1 
ATOM   1631 C  CD1 . LEU A 1 217 ? 10.969  92.039  81.827  1.00 84.08  ? 228  LEU A CD1 1 
ATOM   1632 C  CD2 . LEU A 1 217 ? 10.205  89.980  80.627  1.00 79.80  ? 228  LEU A CD2 1 
ATOM   1633 N  N   . SER A 1 218 ? 12.655  90.628  76.579  1.00 44.86  ? 229  SER A N   1 
ATOM   1634 C  CA  . SER A 1 218 ? 13.119  91.140  75.298  1.00 43.78  ? 229  SER A CA  1 
ATOM   1635 C  C   . SER A 1 218 ? 12.614  92.560  75.090  1.00 45.52  ? 229  SER A C   1 
ATOM   1636 O  O   . SER A 1 218 ? 11.444  92.859  75.349  1.00 50.52  ? 229  SER A O   1 
ATOM   1637 C  CB  . SER A 1 218 ? 12.649  90.246  74.149  1.00 44.72  ? 229  SER A CB  1 
ATOM   1638 O  OG  . SER A 1 218 ? 13.056  88.904  74.348  1.00 57.61  ? 229  SER A OG  1 
ATOM   1639 N  N   . SER A 1 219 ? 13.508  93.435  74.624  1.00 52.91  ? 230  SER A N   1 
ATOM   1640 C  CA  . SER A 1 219 ? 13.119  94.807  74.322  1.00 55.54  ? 230  SER A CA  1 
ATOM   1641 C  C   . SER A 1 219 ? 12.140  94.883  73.158  1.00 55.21  ? 230  SER A C   1 
ATOM   1642 O  O   . SER A 1 219 ? 11.419  95.879  73.035  1.00 48.51  ? 230  SER A O   1 
ATOM   1643 C  CB  . SER A 1 219 ? 14.360  95.649  74.020  1.00 55.51  ? 230  SER A CB  1 
ATOM   1644 O  OG  . SER A 1 219 ? 15.140  95.055  72.997  1.00 67.07  ? 230  SER A OG  1 
ATOM   1645 N  N   . GLN A 1 220 ? 12.095  93.857  72.311  1.00 52.76  ? 231  GLN A N   1 
ATOM   1646 C  CA  . GLN A 1 220 ? 11.175  93.795  71.188  1.00 43.25  ? 231  GLN A CA  1 
ATOM   1647 C  C   . GLN A 1 220 ? 10.346  92.520  71.266  1.00 41.77  ? 231  GLN A C   1 
ATOM   1648 O  O   . GLN A 1 220 ? 10.710  91.557  71.947  1.00 40.99  ? 231  GLN A O   1 
ATOM   1649 C  CB  . GLN A 1 220 ? 11.920  93.860  69.849  1.00 53.15  ? 231  GLN A CB  1 
ATOM   1650 C  CG  . GLN A 1 220 ? 12.297  95.269  69.426  1.00 65.89  ? 231  GLN A CG  1 
ATOM   1651 C  CD  . GLN A 1 220 ? 11.092  96.092  69.011  1.00 78.28  ? 231  GLN A CD  1 
ATOM   1652 O  OE1 . GLN A 1 220 ? 10.019  95.550  68.739  1.00 82.74  ? 231  GLN A OE1 1 
ATOM   1653 N  NE2 . GLN A 1 220 ? 11.263  97.407  68.960  1.00 77.76  ? 231  GLN A NE2 1 
ATOM   1654 N  N   . GLN A 1 221 ? 9.220   92.532  70.555  1.00 43.38  ? 232  GLN A N   1 
ATOM   1655 C  CA  . GLN A 1 221 ? 8.300   91.403  70.576  1.00 43.35  ? 232  GLN A CA  1 
ATOM   1656 C  C   . GLN A 1 221 ? 8.978   90.148  70.039  1.00 38.40  ? 232  GLN A C   1 
ATOM   1657 O  O   . GLN A 1 221 ? 9.738   90.199  69.069  1.00 43.06  ? 232  GLN A O   1 
ATOM   1658 C  CB  . GLN A 1 221 ? 7.054   91.733  69.751  1.00 56.53  ? 232  GLN A CB  1 
ATOM   1659 C  CG  . GLN A 1 221 ? 5.956   90.687  69.817  1.00 63.63  ? 232  GLN A CG  1 
ATOM   1660 C  CD  . GLN A 1 221 ? 4.676   91.147  69.153  1.00 66.06  ? 232  GLN A CD  1 
ATOM   1661 O  OE1 . GLN A 1 221 ? 4.599   92.260  68.632  1.00 66.11  ? 232  GLN A OE1 1 
ATOM   1662 N  NE2 . GLN A 1 221 ? 3.661   90.292  69.169  1.00 74.79  ? 232  GLN A NE2 1 
ATOM   1663 N  N   . LEU A 1 222 ? 8.698   89.016  70.678  1.00 37.79  ? 233  LEU A N   1 
ATOM   1664 C  CA  . LEU A 1 222 ? 9.353   87.756  70.351  1.00 42.73  ? 233  LEU A CA  1 
ATOM   1665 C  C   . LEU A 1 222 ? 8.629   87.061  69.205  1.00 40.34  ? 233  LEU A C   1 
ATOM   1666 O  O   . LEU A 1 222 ? 7.402   86.916  69.233  1.00 49.34  ? 233  LEU A O   1 
ATOM   1667 C  CB  . LEU A 1 222 ? 9.399   86.842  71.576  1.00 36.14  ? 233  LEU A CB  1 
ATOM   1668 C  CG  . LEU A 1 222 ? 10.152  85.522  71.415  1.00 45.49  ? 233  LEU A CG  1 
ATOM   1669 C  CD1 . LEU A 1 222 ? 11.647  85.771  71.266  1.00 34.38  ? 233  LEU A CD1 1 
ATOM   1670 C  CD2 . LEU A 1 222 ? 9.867   84.598  72.588  1.00 43.28  ? 233  LEU A CD2 1 
ATOM   1671 N  N   . GLU A 1 223 ? 9.393   86.629  68.203  1.00 40.59  ? 234  GLU A N   1 
ATOM   1672 C  CA  . GLU A 1 223 ? 8.866   85.899  67.057  1.00 52.36  ? 234  GLU A CA  1 
ATOM   1673 C  C   . GLU A 1 223 ? 9.204   84.417  67.100  1.00 47.28  ? 234  GLU A C   1 
ATOM   1674 O  O   . GLU A 1 223 ? 8.328   83.575  66.882  1.00 62.70  ? 234  GLU A O   1 
ATOM   1675 C  CB  . GLU A 1 223 ? 9.395   86.513  65.752  1.00 56.27  ? 234  GLU A CB  1 
ATOM   1676 C  CG  . GLU A 1 223 ? 8.754   87.839  65.379  1.00 69.42  ? 234  GLU A CG  1 
ATOM   1677 C  CD  . GLU A 1 223 ? 7.310   87.686  64.941  1.00 68.70  ? 234  GLU A CD  1 
ATOM   1678 O  OE1 . GLU A 1 223 ? 6.930   86.575  64.513  1.00 64.90  ? 234  GLU A OE1 1 
ATOM   1679 O  OE2 . GLU A 1 223 ? 6.556   88.678  65.027  1.00 64.97  ? 234  GLU A OE2 1 
ATOM   1680 N  N   . ASN A 1 224 ? 10.460  84.078  67.375  1.00 31.56  ? 235  ASN A N   1 
ATOM   1681 C  CA  . ASN A 1 224 ? 10.899  82.691  67.468  1.00 30.92  ? 235  ASN A CA  1 
ATOM   1682 C  C   . ASN A 1 224 ? 12.247  82.680  68.178  1.00 48.57  ? 235  ASN A C   1 
ATOM   1683 O  O   . ASN A 1 224 ? 12.801  83.730  68.513  1.00 47.40  ? 235  ASN A O   1 
ATOM   1684 C  CB  . ASN A 1 224 ? 10.969  82.041  66.083  1.00 47.42  ? 235  ASN A CB  1 
ATOM   1685 C  CG  . ASN A 1 224 ? 10.931  80.529  66.146  1.00 64.74  ? 235  ASN A CG  1 
ATOM   1686 O  OD1 . ASN A 1 224 ? 11.929  79.860  65.878  1.00 92.15  ? 235  ASN A OD1 1 
ATOM   1687 N  ND2 . ASN A 1 224 ? 9.777   79.982  66.507  1.00 44.61  ? 235  ASN A ND2 1 
ATOM   1688 N  N   . ILE A 1 225 ? 12.774  81.478  68.411  1.00 55.38  ? 236  ILE A N   1 
ATOM   1689 C  CA  . ILE A 1 225 ? 14.044  81.317  69.111  1.00 61.58  ? 236  ILE A CA  1 
ATOM   1690 C  C   . ILE A 1 225 ? 14.651  79.986  68.691  1.00 58.62  ? 236  ILE A C   1 
ATOM   1691 O  O   . ILE A 1 225 ? 13.956  79.099  68.192  1.00 58.13  ? 236  ILE A O   1 
ATOM   1692 C  CB  . ILE A 1 225 ? 13.849  81.401  70.647  1.00 56.86  ? 236  ILE A CB  1 
ATOM   1693 C  CG1 . ILE A 1 225 ? 15.151  81.814  71.337  1.00 62.30  ? 236  ILE A CG1 1 
ATOM   1694 C  CG2 . ILE A 1 225 ? 13.354  80.076  71.198  1.00 50.66  ? 236  ILE A CG2 1 
ATOM   1695 C  CD1 . ILE A 1 225 ? 14.998  82.066  72.820  1.00 69.56  ? 236  ILE A CD1 1 
ATOM   1696 N  N   . TRP A 1 226 ? 15.962  79.852  68.882  1.00 40.48  ? 237  TRP A N   1 
ATOM   1697 C  CA  . TRP A 1 226 ? 16.673  78.625  68.556  1.00 36.43  ? 237  TRP A CA  1 
ATOM   1698 C  C   . TRP A 1 226 ? 17.702  78.341  69.639  1.00 42.99  ? 237  TRP A C   1 
ATOM   1699 O  O   . TRP A 1 226 ? 18.318  79.263  70.180  1.00 50.41  ? 237  TRP A O   1 
ATOM   1700 C  CB  . TRP A 1 226 ? 17.358  78.717  67.186  1.00 49.72  ? 237  TRP A CB  1 
ATOM   1701 C  CG  . TRP A 1 226 ? 17.864  77.399  66.682  1.00 51.74  ? 237  TRP A CG  1 
ATOM   1702 C  CD1 . TRP A 1 226 ? 19.129  76.904  66.806  1.00 40.35  ? 237  TRP A CD1 1 
ATOM   1703 C  CD2 . TRP A 1 226 ? 17.110  76.404  65.979  1.00 44.20  ? 237  TRP A CD2 1 
ATOM   1704 N  NE1 . TRP A 1 226 ? 19.211  75.664  66.220  1.00 36.75  ? 237  TRP A NE1 1 
ATOM   1705 C  CE2 . TRP A 1 226 ? 17.985  75.334  65.706  1.00 53.57  ? 237  TRP A CE2 1 
ATOM   1706 C  CE3 . TRP A 1 226 ? 15.782  76.315  65.552  1.00 40.49  ? 237  TRP A CE3 1 
ATOM   1707 C  CZ2 . TRP A 1 226 ? 17.574  74.189  65.026  1.00 56.34  ? 237  TRP A CZ2 1 
ATOM   1708 C  CZ3 . TRP A 1 226 ? 15.376  75.178  64.878  1.00 30.81  ? 237  TRP A CZ3 1 
ATOM   1709 C  CH2 . TRP A 1 226 ? 16.269  74.131  64.621  1.00 31.56  ? 237  TRP A CH2 1 
ATOM   1710 N  N   . TRP A 1 227 ? 17.881  77.061  69.949  1.00 41.89  ? 238  TRP A N   1 
ATOM   1711 C  CA  . TRP A 1 227 ? 18.766  76.615  71.017  1.00 35.88  ? 238  TRP A CA  1 
ATOM   1712 C  C   . TRP A 1 227 ? 20.006  75.975  70.409  1.00 47.66  ? 238  TRP A C   1 
ATOM   1713 O  O   . TRP A 1 227 ? 19.898  75.150  69.495  1.00 56.14  ? 238  TRP A O   1 
ATOM   1714 C  CB  . TRP A 1 227 ? 18.042  75.624  71.931  1.00 35.16  ? 238  TRP A CB  1 
ATOM   1715 C  CG  . TRP A 1 227 ? 18.339  75.801  73.388  1.00 46.36  ? 238  TRP A CG  1 
ATOM   1716 C  CD1 . TRP A 1 227 ? 19.466  76.337  73.937  1.00 55.75  ? 238  TRP A CD1 1 
ATOM   1717 C  CD2 . TRP A 1 227 ? 17.485  75.451  74.485  1.00 55.15  ? 238  TRP A CD2 1 
ATOM   1718 N  NE1 . TRP A 1 227 ? 19.370  76.338  75.308  1.00 55.08  ? 238  TRP A NE1 1 
ATOM   1719 C  CE2 . TRP A 1 227 ? 18.164  75.798  75.670  1.00 46.47  ? 238  TRP A CE2 1 
ATOM   1720 C  CE3 . TRP A 1 227 ? 16.214  74.875  74.580  1.00 55.88  ? 238  TRP A CE3 1 
ATOM   1721 C  CZ2 . TRP A 1 227 ? 17.615  75.590  76.933  1.00 46.27  ? 238  TRP A CZ2 1 
ATOM   1722 C  CZ3 . TRP A 1 227 ? 15.671  74.670  75.835  1.00 45.83  ? 238  TRP A CZ3 1 
ATOM   1723 C  CH2 . TRP A 1 227 ? 16.371  75.024  76.994  1.00 52.03  ? 238  TRP A CH2 1 
ATOM   1724 N  N   . GLN A 1 228 ? 21.179  76.353  70.914  1.00 34.70  ? 239  GLN A N   1 
ATOM   1725 C  CA  . GLN A 1 228 ? 22.420  75.795  70.397  1.00 43.55  ? 239  GLN A CA  1 
ATOM   1726 C  C   . GLN A 1 228 ? 22.579  74.342  70.846  1.00 45.31  ? 239  GLN A C   1 
ATOM   1727 O  O   . GLN A 1 228 ? 21.896  73.868  71.757  1.00 49.41  ? 239  GLN A O   1 
ATOM   1728 C  CB  . GLN A 1 228 ? 23.620  76.631  70.849  1.00 39.95  ? 239  GLN A CB  1 
ATOM   1729 C  CG  . GLN A 1 228 ? 24.867  76.446  69.986  1.00 58.76  ? 239  GLN A CG  1 
ATOM   1730 C  CD  . GLN A 1 228 ? 26.032  77.311  70.425  1.00 54.83  ? 239  GLN A CD  1 
ATOM   1731 O  OE1 . GLN A 1 228 ? 25.909  78.117  71.342  1.00 53.56  ? 239  GLN A OE1 1 
ATOM   1732 N  NE2 . GLN A 1 228 ? 27.172  77.145  69.766  1.00 55.12  ? 239  GLN A NE2 1 
ATOM   1733 N  N   . ARG A 1 229 ? 23.498  73.636  70.178  1.00 37.40  ? 240  ARG A N   1 
ATOM   1734 C  CA  . ARG A 1 229 ? 23.706  72.211  70.426  1.00 45.68  ? 240  ARG A CA  1 
ATOM   1735 C  C   . ARG A 1 229 ? 23.917  71.916  71.905  1.00 49.93  ? 240  ARG A C   1 
ATOM   1736 O  O   . ARG A 1 229 ? 23.300  71.002  72.464  1.00 40.57  ? 240  ARG A O   1 
ATOM   1737 C  CB  . ARG A 1 229 ? 24.904  71.716  69.615  1.00 64.37  ? 240  ARG A CB  1 
ATOM   1738 C  CG  . ARG A 1 229 ? 24.692  71.743  68.119  1.00 52.40  ? 240  ARG A CG  1 
ATOM   1739 C  CD  . ARG A 1 229 ? 23.700  70.681  67.702  1.00 40.77  ? 240  ARG A CD  1 
ATOM   1740 N  NE  . ARG A 1 229 ? 24.186  69.336  67.989  1.00 40.76  ? 240  ARG A NE  1 
ATOM   1741 C  CZ  . ARG A 1 229 ? 23.614  68.227  67.534  1.00 41.37  ? 240  ARG A CZ  1 
ATOM   1742 N  NH1 . ARG A 1 229 ? 22.537  68.303  66.765  1.00 40.20  ? 240  ARG A NH1 1 
ATOM   1743 N  NH2 . ARG A 1 229 ? 24.120  67.043  67.844  1.00 50.13  ? 240  ARG A NH2 1 
ATOM   1744 N  N   . ASP A 1 230 ? 24.797  72.675  72.554  1.00 55.23  ? 241  ASP A N   1 
ATOM   1745 C  CA  . ASP A 1 230 ? 25.077  72.465  73.967  1.00 57.41  ? 241  ASP A CA  1 
ATOM   1746 C  C   . ASP A 1 230 ? 24.050  73.119  74.880  1.00 57.28  ? 241  ASP A C   1 
ATOM   1747 O  O   . ASP A 1 230 ? 24.099  72.901  76.096  1.00 49.35  ? 241  ASP A O   1 
ATOM   1748 C  CB  . ASP A 1 230 ? 26.475  72.987  74.306  1.00 63.15  ? 241  ASP A CB  1 
ATOM   1749 C  CG  . ASP A 1 230 ? 26.699  74.407  73.825  1.00 66.74  ? 241  ASP A CG  1 
ATOM   1750 O  OD1 . ASP A 1 230 ? 25.821  74.943  73.115  1.00 65.67  ? 241  ASP A OD1 1 
ATOM   1751 O  OD2 . ASP A 1 230 ? 27.754  74.988  74.156  1.00 72.50  ? 241  ASP A OD2 1 
ATOM   1752 N  N   . GLY A 1 231 ? 23.127  73.904  74.331  1.00 60.82  ? 242  GLY A N   1 
ATOM   1753 C  CA  . GLY A 1 231 ? 22.142  74.589  75.138  1.00 53.99  ? 242  GLY A CA  1 
ATOM   1754 C  C   . GLY A 1 231 ? 22.659  75.785  75.902  1.00 40.63  ? 242  GLY A C   1 
ATOM   1755 O  O   . GLY A 1 231 ? 21.933  76.319  76.748  1.00 40.86  ? 242  GLY A O   1 
ATOM   1756 N  N   . ARG A 1 232 ? 23.885  76.227  75.631  1.00 41.42  ? 243  ARG A N   1 
ATOM   1757 C  CA  . ARG A 1 232 ? 24.501  77.325  76.361  1.00 42.78  ? 243  ARG A CA  1 
ATOM   1758 C  C   . ARG A 1 232 ? 24.371  78.662  75.643  1.00 41.69  ? 243  ARG A C   1 
ATOM   1759 O  O   . ARG A 1 232 ? 25.037  79.627  76.029  1.00 42.96  ? 243  ARG A O   1 
ATOM   1760 C  CB  . ARG A 1 232 ? 25.974  77.012  76.633  1.00 44.89  ? 243  ARG A CB  1 
ATOM   1761 C  CG  . ARG A 1 232 ? 26.187  75.753  77.459  1.00 46.49  ? 243  ARG A CG  1 
ATOM   1762 C  CD  . ARG A 1 232 ? 27.652  75.543  77.800  1.00 49.00  ? 243  ARG A CD  1 
ATOM   1763 N  NE  . ARG A 1 232 ? 27.858  74.332  78.588  1.00 50.81  ? 243  ARG A NE  1 
ATOM   1764 C  CZ  . ARG A 1 232 ? 27.796  74.284  79.916  1.00 52.73  ? 243  ARG A CZ  1 
ATOM   1765 N  NH1 . ARG A 1 232 ? 27.531  75.382  80.609  1.00 53.15  ? 243  ARG A NH1 1 
ATOM   1766 N  NH2 . ARG A 1 232 ? 27.998  73.137  80.551  1.00 54.50  ? 243  ARG A NH2 1 
ATOM   1767 N  N   . LEU A 1 233 ? 23.532  78.744  74.614  1.00 47.56  ? 244  LEU A N   1 
ATOM   1768 C  CA  . LEU A 1 233 ? 23.299  80.005  73.925  1.00 38.73  ? 244  LEU A CA  1 
ATOM   1769 C  C   . LEU A 1 233 ? 21.935  79.959  73.254  1.00 61.17  ? 244  LEU A C   1 
ATOM   1770 O  O   . LEU A 1 233 ? 21.571  78.953  72.640  1.00 69.09  ? 244  LEU A O   1 
ATOM   1771 C  CB  . LEU A 1 233 ? 24.386  80.293  72.884  1.00 38.75  ? 244  LEU A CB  1 
ATOM   1772 C  CG  . LEU A 1 233 ? 24.233  81.581  72.071  1.00 38.01  ? 244  LEU A CG  1 
ATOM   1773 C  CD1 . LEU A 1 233 ? 24.850  82.766  72.802  1.00 39.71  ? 244  LEU A CD1 1 
ATOM   1774 C  CD2 . LEU A 1 233 ? 24.828  81.425  70.679  1.00 37.34  ? 244  LEU A CD2 1 
ATOM   1775 N  N   . LEU A 1 234 ? 21.190  81.053  73.378  1.00 47.56  ? 245  LEU A N   1 
ATOM   1776 C  CA  . LEU A 1 234 ? 19.894  81.210  72.736  1.00 40.34  ? 245  LEU A CA  1 
ATOM   1777 C  C   . LEU A 1 234 ? 19.968  82.318  71.697  1.00 35.23  ? 245  LEU A C   1 
ATOM   1778 O  O   . LEU A 1 234 ? 20.592  83.358  71.931  1.00 35.51  ? 245  LEU A O   1 
ATOM   1779 C  CB  . LEU A 1 234 ? 18.806  81.535  73.761  1.00 35.61  ? 245  LEU A CB  1 
ATOM   1780 C  CG  . LEU A 1 234 ? 18.416  80.412  74.719  1.00 36.14  ? 245  LEU A CG  1 
ATOM   1781 C  CD1 . LEU A 1 234 ? 17.496  80.940  75.805  1.00 38.10  ? 245  LEU A CD1 1 
ATOM   1782 C  CD2 . LEU A 1 234 ? 17.759  79.278  73.957  1.00 34.89  ? 245  LEU A CD2 1 
ATOM   1783 N  N   . VAL A 1 235 ? 19.331  82.092  70.553  1.00 33.21  ? 246  VAL A N   1 
ATOM   1784 C  CA  . VAL A 1 235 ? 19.263  83.071  69.474  1.00 32.72  ? 246  VAL A CA  1 
ATOM   1785 C  C   . VAL A 1 235 ? 17.792  83.346  69.205  1.00 39.69  ? 246  VAL A C   1 
ATOM   1786 O  O   . VAL A 1 235 ? 17.088  82.498  68.640  1.00 56.41  ? 246  VAL A O   1 
ATOM   1787 C  CB  . VAL A 1 235 ? 19.976  82.587  68.205  1.00 32.16  ? 246  VAL A CB  1 
ATOM   1788 C  CG1 . VAL A 1 235 ? 19.923  83.662  67.133  1.00 33.13  ? 246  VAL A CG1 1 
ATOM   1789 C  CG2 . VAL A 1 235 ? 21.415  82.210  68.514  1.00 52.69  ? 246  VAL A CG2 1 
ATOM   1790 N  N   . SER A 1 236 ? 17.325  84.524  69.606  1.00 42.75  ? 247  SER A N   1 
ATOM   1791 C  CA  . SER A 1 236 ? 15.934  84.919  69.442  1.00 51.68  ? 247  SER A CA  1 
ATOM   1792 C  C   . SER A 1 236 ? 15.813  85.948  68.327  1.00 46.22  ? 247  SER A C   1 
ATOM   1793 O  O   . SER A 1 236 ? 16.643  86.854  68.214  1.00 52.51  ? 247  SER A O   1 
ATOM   1794 C  CB  . SER A 1 236 ? 15.368  85.495  70.745  1.00 54.53  ? 247  SER A CB  1 
ATOM   1795 O  OG  . SER A 1 236 ? 16.056  86.674  71.128  1.00 34.88  ? 247  SER A OG  1 
ATOM   1796 N  N   . CYS A 1 237 ? 14.779  85.799  67.505  1.00 45.29  ? 248  CYS A N   1 
ATOM   1797 C  CA  . CYS A 1 237 ? 14.444  86.763  66.468  1.00 36.33  ? 248  CYS A CA  1 
ATOM   1798 C  C   . CYS A 1 237 ? 13.156  87.482  66.845  1.00 36.72  ? 248  CYS A C   1 
ATOM   1799 O  O   . CYS A 1 237 ? 12.276  86.912  67.496  1.00 43.61  ? 248  CYS A O   1 
ATOM   1800 C  CB  . CYS A 1 237 ? 14.295  86.082  65.107  1.00 31.08  ? 248  CYS A CB  1 
ATOM   1801 S  SG  . CYS A 1 237 ? 13.179  84.666  65.100  1.00 33.98  ? 248  CYS A SG  1 
ATOM   1802 N  N   . HIS A 1 238 ? 13.048  88.742  66.431  1.00 50.85  ? 249  HIS A N   1 
ATOM   1803 C  CA  . HIS A 1 238 ? 12.016  89.628  66.947  1.00 52.51  ? 249  HIS A CA  1 
ATOM   1804 C  C   . HIS A 1 238 ? 11.266  90.308  65.809  1.00 40.83  ? 249  HIS A C   1 
ATOM   1805 O  O   . HIS A 1 238 ? 11.669  90.257  64.644  1.00 35.96  ? 249  HIS A O   1 
ATOM   1806 C  CB  . HIS A 1 238 ? 12.626  90.662  67.901  1.00 52.04  ? 249  HIS A CB  1 
ATOM   1807 C  CG  . HIS A 1 238 ? 13.383  90.046  69.035  1.00 55.80  ? 249  HIS A CG  1 
ATOM   1808 N  ND1 . HIS A 1 238 ? 12.765  89.589  70.180  1.00 57.86  ? 249  HIS A ND1 1 
ATOM   1809 C  CD2 . HIS A 1 238 ? 14.703  89.789  69.192  1.00 51.26  ? 249  HIS A CD2 1 
ATOM   1810 C  CE1 . HIS A 1 238 ? 13.674  89.087  70.997  1.00 55.31  ? 249  HIS A CE1 1 
ATOM   1811 N  NE2 . HIS A 1 238 ? 14.858  89.196  70.422  1.00 50.40  ? 249  HIS A NE2 1 
ATOM   1812 N  N   . SER A 1 239 ? 10.155  90.957  66.173  1.00 36.60  ? 250  SER A N   1 
ATOM   1813 C  CA  . SER A 1 239 ? 9.237   91.511  65.183  1.00 40.99  ? 250  SER A CA  1 
ATOM   1814 C  C   . SER A 1 239 ? 9.805   92.724  64.462  1.00 43.04  ? 250  SER A C   1 
ATOM   1815 O  O   . SER A 1 239 ? 9.278   93.105  63.411  1.00 44.57  ? 250  SER A O   1 
ATOM   1816 C  CB  . SER A 1 239 ? 7.909   91.884  65.845  1.00 38.82  ? 250  SER A CB  1 
ATOM   1817 O  OG  . SER A 1 239 ? 7.230   90.734  66.318  1.00 38.13  ? 250  SER A OG  1 
ATOM   1818 N  N   . ASP A 1 240 ? 10.856  93.340  64.994  1.00 44.14  ? 251  ASP A N   1 
ATOM   1819 C  CA  . ASP A 1 240 ? 11.470  94.502  64.371  1.00 39.84  ? 251  ASP A CA  1 
ATOM   1820 C  C   . ASP A 1 240 ? 12.497  94.130  63.310  1.00 38.67  ? 251  ASP A C   1 
ATOM   1821 O  O   . ASP A 1 240 ? 13.187  95.014  62.795  1.00 39.57  ? 251  ASP A O   1 
ATOM   1822 C  CB  . ASP A 1 240 ? 12.123  95.386  65.434  1.00 50.88  ? 251  ASP A CB  1 
ATOM   1823 C  CG  . ASP A 1 240 ? 13.273  94.696  66.136  1.00 75.40  ? 251  ASP A CG  1 
ATOM   1824 O  OD1 . ASP A 1 240 ? 13.277  93.448  66.193  1.00 82.89  ? 251  ASP A OD1 1 
ATOM   1825 O  OD2 . ASP A 1 240 ? 14.174  95.403  66.633  1.00 94.76  ? 251  ASP A OD2 1 
ATOM   1826 N  N   . GLY A 1 241 ? 12.613  92.850  62.970  1.00 36.94  ? 252  GLY A N   1 
ATOM   1827 C  CA  . GLY A 1 241 ? 13.592  92.429  61.992  1.00 40.17  ? 252  GLY A CA  1 
ATOM   1828 C  C   . GLY A 1 241 ? 14.973  92.197  62.547  1.00 53.38  ? 252  GLY A C   1 
ATOM   1829 O  O   . GLY A 1 241 ? 15.933  92.110  61.776  1.00 55.20  ? 252  GLY A O   1 
ATOM   1830 N  N   . SER A 1 242 ? 15.106  92.090  63.864  1.00 45.56  ? 253  SER A N   1 
ATOM   1831 C  CA  . SER A 1 242 ? 16.392  91.897  64.508  1.00 44.49  ? 253  SER A CA  1 
ATOM   1832 C  C   . SER A 1 242 ? 16.457  90.521  65.155  1.00 41.85  ? 253  SER A C   1 
ATOM   1833 O  O   . SER A 1 242 ? 15.434  89.889  65.434  1.00 39.46  ? 253  SER A O   1 
ATOM   1834 C  CB  . SER A 1 242 ? 16.642  92.978  65.565  1.00 48.68  ? 253  SER A CB  1 
ATOM   1835 O  OG  . SER A 1 242 ? 15.722  92.864  66.637  1.00 42.34  ? 253  SER A OG  1 
ATOM   1836 N  N   . TYR A 1 243 ? 17.683  90.061  65.383  1.00 39.49  ? 254  TYR A N   1 
ATOM   1837 C  CA  . TYR A 1 243 ? 17.925  88.872  66.184  1.00 44.55  ? 254  TYR A CA  1 
ATOM   1838 C  C   . TYR A 1 243 ? 19.124  89.126  67.083  1.00 49.70  ? 254  TYR A C   1 
ATOM   1839 O  O   . TYR A 1 243 ? 20.071  89.819  66.700  1.00 56.04  ? 254  TYR A O   1 
ATOM   1840 C  CB  . TYR A 1 243 ? 18.154  87.621  65.317  1.00 46.57  ? 254  TYR A CB  1 
ATOM   1841 C  CG  . TYR A 1 243 ? 19.487  87.562  64.598  1.00 57.94  ? 254  TYR A CG  1 
ATOM   1842 C  CD1 . TYR A 1 243 ? 20.598  86.976  65.195  1.00 60.70  ? 254  TYR A CD1 1 
ATOM   1843 C  CD2 . TYR A 1 243 ? 19.627  88.067  63.313  1.00 63.49  ? 254  TYR A CD2 1 
ATOM   1844 C  CE1 . TYR A 1 243 ? 21.814  86.914  64.540  1.00 62.68  ? 254  TYR A CE1 1 
ATOM   1845 C  CE2 . TYR A 1 243 ? 20.839  88.007  62.650  1.00 72.23  ? 254  TYR A CE2 1 
ATOM   1846 C  CZ  . TYR A 1 243 ? 21.928  87.430  63.267  1.00 63.68  ? 254  TYR A CZ  1 
ATOM   1847 O  OH  . TYR A 1 243 ? 23.134  87.372  62.606  1.00 49.38  ? 254  TYR A OH  1 
ATOM   1848 N  N   . CYS A 1 244 ? 19.070  88.566  68.289  1.00 48.19  ? 255  CYS A N   1 
ATOM   1849 C  CA  . CYS A 1 244 ? 20.146  88.725  69.254  1.00 53.93  ? 255  CYS A CA  1 
ATOM   1850 C  C   . CYS A 1 244 ? 20.458  87.382  69.897  1.00 50.95  ? 255  CYS A C   1 
ATOM   1851 O  O   . CYS A 1 244 ? 19.660  86.443  69.850  1.00 34.90  ? 255  CYS A O   1 
ATOM   1852 C  CB  . CYS A 1 244 ? 19.798  89.766  70.328  1.00 58.20  ? 255  CYS A CB  1 
ATOM   1853 S  SG  . CYS A 1 244 ? 18.285  89.425  71.245  1.00 76.81  ? 255  CYS A SG  1 
ATOM   1854 N  N   . GLN A 1 245 ? 21.640  87.307  70.500  1.00 47.04  ? 256  GLN A N   1 
ATOM   1855 C  CA  . GLN A 1 245 ? 22.136  86.093  71.130  1.00 37.30  ? 256  GLN A CA  1 
ATOM   1856 C  C   . GLN A 1 245 ? 22.140  86.260  72.644  1.00 40.00  ? 256  GLN A C   1 
ATOM   1857 O  O   . GLN A 1 245 ? 22.488  87.326  73.160  1.00 40.61  ? 256  GLN A O   1 
ATOM   1858 C  CB  . GLN A 1 245 ? 23.544  85.762  70.632  1.00 37.77  ? 256  GLN A CB  1 
ATOM   1859 C  CG  . GLN A 1 245 ? 23.645  85.650  69.120  1.00 54.24  ? 256  GLN A CG  1 
ATOM   1860 C  CD  . GLN A 1 245 ? 25.080  85.623  68.631  1.00 58.09  ? 256  GLN A CD  1 
ATOM   1861 O  OE1 . GLN A 1 245 ? 26.006  85.955  69.371  1.00 68.96  ? 256  GLN A OE1 1 
ATOM   1862 N  NE2 . GLN A 1 245 ? 25.271  85.225  67.379  1.00 59.46  ? 256  GLN A NE2 1 
ATOM   1863 N  N   . TRP A 1 246 ? 21.749  85.200  73.352  1.00 39.73  ? 257  TRP A N   1 
ATOM   1864 C  CA  . TRP A 1 246 ? 21.650  85.225  74.803  1.00 41.29  ? 257  TRP A CA  1 
ATOM   1865 C  C   . TRP A 1 246 ? 22.455  84.067  75.382  1.00 52.63  ? 257  TRP A C   1 
ATOM   1866 O  O   . TRP A 1 246 ? 22.287  82.916  74.943  1.00 58.75  ? 257  TRP A O   1 
ATOM   1867 C  CB  . TRP A 1 246 ? 20.188  85.128  75.261  1.00 45.86  ? 257  TRP A CB  1 
ATOM   1868 C  CG  . TRP A 1 246 ? 19.292  86.173  74.673  1.00 46.34  ? 257  TRP A CG  1 
ATOM   1869 C  CD1 . TRP A 1 246 ? 18.744  86.173  73.424  1.00 44.54  ? 257  TRP A CD1 1 
ATOM   1870 C  CD2 . TRP A 1 246 ? 18.825  87.365  75.317  1.00 51.82  ? 257  TRP A CD2 1 
ATOM   1871 N  NE1 . TRP A 1 246 ? 17.972  87.295  73.246  1.00 47.89  ? 257  TRP A NE1 1 
ATOM   1872 C  CE2 . TRP A 1 246 ? 18.005  88.043  74.393  1.00 61.07  ? 257  TRP A CE2 1 
ATOM   1873 C  CE3 . TRP A 1 246 ? 19.024  87.926  76.581  1.00 52.39  ? 257  TRP A CE3 1 
ATOM   1874 C  CZ2 . TRP A 1 246 ? 17.383  89.253  74.695  1.00 60.57  ? 257  TRP A CZ2 1 
ATOM   1875 C  CZ3 . TRP A 1 246 ? 18.407  89.127  76.879  1.00 50.60  ? 257  TRP A CZ3 1 
ATOM   1876 C  CH2 . TRP A 1 246 ? 17.597  89.778  75.940  1.00 51.51  ? 257  TRP A CH2 1 
ATOM   1877 N  N   . PRO A 1 247 ? 23.330  84.318  76.353  1.00 64.17  ? 258  PRO A N   1 
ATOM   1878 C  CA  . PRO A 1 247 ? 24.034  83.212  77.011  1.00 55.03  ? 258  PRO A CA  1 
ATOM   1879 C  C   . PRO A 1 247 ? 23.149  82.525  78.040  1.00 58.42  ? 258  PRO A C   1 
ATOM   1880 O  O   . PRO A 1 247 ? 22.360  83.165  78.740  1.00 66.58  ? 258  PRO A O   1 
ATOM   1881 C  CB  . PRO A 1 247 ? 25.228  83.905  77.678  1.00 46.98  ? 258  PRO A CB  1 
ATOM   1882 C  CG  . PRO A 1 247 ? 24.736  85.286  77.955  1.00 51.38  ? 258  PRO A CG  1 
ATOM   1883 C  CD  . PRO A 1 247 ? 23.798  85.634  76.824  1.00 76.11  ? 258  PRO A CD  1 
ATOM   1884 N  N   . VAL A 1 248 ? 23.284  81.204  78.122  1.00 49.58  ? 259  VAL A N   1 
ATOM   1885 C  CA  . VAL A 1 248 ? 22.536  80.386  79.070  1.00 44.83  ? 259  VAL A CA  1 
ATOM   1886 C  C   . VAL A 1 248 ? 23.540  79.740  80.012  1.00 59.86  ? 259  VAL A C   1 
ATOM   1887 O  O   . VAL A 1 248 ? 24.338  78.891  79.594  1.00 61.47  ? 259  VAL A O   1 
ATOM   1888 C  CB  . VAL A 1 248 ? 21.677  79.326  78.370  1.00 49.30  ? 259  VAL A CB  1 
ATOM   1889 C  CG1 . VAL A 1 248 ? 21.029  78.412  79.396  1.00 48.04  ? 259  VAL A CG1 1 
ATOM   1890 C  CG2 . VAL A 1 248 ? 20.621  79.993  77.516  1.00 62.72  ? 259  VAL A CG2 1 
ATOM   1891 N  N   . SER A 1 249 ? 23.500  80.136  81.281  1.00 57.32  ? 260  SER A N   1 
ATOM   1892 C  CA  . SER A 1 249 ? 24.422  79.613  82.277  1.00 67.09  ? 260  SER A CA  1 
ATOM   1893 C  C   . SER A 1 249 ? 23.737  79.607  83.634  1.00 66.67  ? 260  SER A C   1 
ATOM   1894 O  O   . SER A 1 249 ? 23.026  80.553  83.982  1.00 69.06  ? 260  SER A O   1 
ATOM   1895 C  CB  . SER A 1 249 ? 25.709  80.444  82.340  1.00 70.36  ? 260  SER A CB  1 
ATOM   1896 O  OG  . SER A 1 249 ? 26.546  80.004  83.395  1.00 79.48  ? 260  SER A OG  1 
ATOM   1897 N  N   . SER A 1 250 ? 23.959  78.534  84.394  1.00 69.67  ? 261  SER A N   1 
ATOM   1898 C  CA  . SER A 1 250 ? 23.427  78.447  85.748  1.00 62.39  ? 261  SER A CA  1 
ATOM   1899 C  C   . SER A 1 250 ? 24.078  79.442  86.699  1.00 68.76  ? 261  SER A C   1 
ATOM   1900 O  O   . SER A 1 250 ? 23.555  79.653  87.798  1.00 76.35  ? 261  SER A O   1 
ATOM   1901 C  CB  . SER A 1 250 ? 23.596  77.025  86.284  1.00 74.87  ? 261  SER A CB  1 
ATOM   1902 O  OG  . SER A 1 250 ? 24.930  76.576  86.123  1.00 95.38  ? 261  SER A OG  1 
ATOM   1903 N  N   . GLU A 1 251 ? 25.198  80.053  86.307  1.00 79.60  ? 262  GLU A N   1 
ATOM   1904 C  CA  . GLU A 1 251 ? 25.839  81.058  87.146  1.00 96.00  ? 262  GLU A CA  1 
ATOM   1905 C  C   . GLU A 1 251 ? 25.181  82.425  87.002  1.00 102.89 ? 262  GLU A C   1 
ATOM   1906 O  O   . GLU A 1 251 ? 25.178  83.210  87.957  1.00 109.91 ? 262  GLU A O   1 
ATOM   1907 C  CB  . GLU A 1 251 ? 27.328  81.157  86.805  1.00 102.42 ? 262  GLU A CB  1 
ATOM   1908 C  CG  . GLU A 1 251 ? 28.076  79.829  86.839  1.00 105.60 ? 262  GLU A CG  1 
ATOM   1909 C  CD  . GLU A 1 251 ? 28.346  79.335  88.248  1.00 114.53 ? 262  GLU A CD  1 
ATOM   1910 O  OE1 . GLU A 1 251 ? 28.126  80.104  89.207  1.00 119.27 ? 262  GLU A OE1 1 
ATOM   1911 O  OE2 . GLU A 1 251 ? 28.784  78.174  88.396  1.00 114.17 ? 262  GLU A OE2 1 
ATOM   1912 N  N   . ALA A 1 252 ? 24.625  82.727  85.825  1.00 105.01 ? 263  ALA A N   1 
ATOM   1913 C  CA  . ALA A 1 252 ? 23.949  83.999  85.554  1.00 111.51 ? 263  ALA A CA  1 
ATOM   1914 C  C   . ALA A 1 252 ? 22.562  83.677  85.001  1.00 97.45  ? 263  ALA A C   1 
ATOM   1915 O  O   . ALA A 1 252 ? 22.354  83.640  83.785  1.00 88.59  ? 263  ALA A O   1 
ATOM   1916 C  CB  . ALA A 1 252 ? 24.765  84.862  84.591  1.00 117.94 ? 263  ALA A CB  1 
ATOM   1917 N  N   . GLN A 1 253 ? 21.608  83.447  85.904  1.00 92.98  ? 264  GLN A N   1 
ATOM   1918 C  CA  . GLN A 1 253 ? 20.255  83.077  85.509  1.00 84.13  ? 264  GLN A CA  1 
ATOM   1919 C  C   . GLN A 1 253 ? 19.441  84.250  84.977  1.00 87.11  ? 264  GLN A C   1 
ATOM   1920 O  O   . GLN A 1 253 ? 18.326  84.034  84.490  1.00 88.28  ? 264  GLN A O   1 
ATOM   1921 C  CB  . GLN A 1 253 ? 19.513  82.440  86.689  1.00 87.37  ? 264  GLN A CB  1 
ATOM   1922 C  CG  . GLN A 1 253 ? 20.164  81.180  87.243  1.00 85.25  ? 264  GLN A CG  1 
ATOM   1923 C  CD  . GLN A 1 253 ? 21.057  81.456  88.437  1.00 101.92 ? 264  GLN A CD  1 
ATOM   1924 O  OE1 . GLN A 1 253 ? 21.325  82.609  88.775  1.00 102.20 ? 264  GLN A OE1 1 
ATOM   1925 N  NE2 . GLN A 1 253 ? 21.518  80.394  89.088  1.00 115.22 ? 264  GLN A NE2 1 
ATOM   1926 N  N   . GLN A 1 254 ? 19.959  85.476  85.057  1.00 82.36  ? 265  GLN A N   1 
ATOM   1927 C  CA  . GLN A 1 254 ? 19.245  86.662  84.586  1.00 86.73  ? 265  GLN A CA  1 
ATOM   1928 C  C   . GLN A 1 254 ? 20.214  87.547  83.816  1.00 76.80  ? 265  GLN A C   1 
ATOM   1929 O  O   . GLN A 1 254 ? 20.807  88.479  84.374  1.00 76.84  ? 265  GLN A O   1 
ATOM   1930 C  CB  . GLN A 1 254 ? 18.608  87.425  85.749  1.00 92.48  ? 265  GLN A CB  1 
ATOM   1931 C  CG  . GLN A 1 254 ? 17.522  86.647  86.478  1.00 102.07 ? 265  GLN A CG  1 
ATOM   1932 C  CD  . GLN A 1 254 ? 17.144  87.269  87.807  1.00 109.12 ? 265  GLN A CD  1 
ATOM   1933 O  OE1 . GLN A 1 254 ? 17.540  86.783  88.867  1.00 116.40 ? 265  GLN A OE1 1 
ATOM   1934 N  NE2 . GLN A 1 254 ? 16.371  88.348  87.759  1.00 104.64 ? 265  GLN A NE2 1 
ATOM   1935 N  N   . PRO A 1 255 ? 20.405  87.279  82.521  1.00 78.28  ? 266  PRO A N   1 
ATOM   1936 C  CA  . PRO A 1 255 ? 21.390  88.044  81.749  1.00 86.33  ? 266  PRO A CA  1 
ATOM   1937 C  C   . PRO A 1 255 ? 20.775  89.125  80.874  1.00 94.88  ? 266  PRO A C   1 
ATOM   1938 O  O   . PRO A 1 255 ? 19.551  89.258  80.788  1.00 97.88  ? 266  PRO A O   1 
ATOM   1939 C  CB  . PRO A 1 255 ? 22.048  86.960  80.893  1.00 82.76  ? 266  PRO A CB  1 
ATOM   1940 C  CG  . PRO A 1 255 ? 20.899  86.034  80.588  1.00 69.48  ? 266  PRO A CG  1 
ATOM   1941 C  CD  . PRO A 1 255 ? 19.952  86.087  81.784  1.00 68.36  ? 266  PRO A CD  1 
ATOM   1942 N  N   . GLU A 1 256 ? 21.633  89.899  80.221  1.00 101.79 ? 267  GLU A N   1 
ATOM   1943 C  CA  . GLU A 1 256 ? 21.271  90.851  79.186  1.00 101.19 ? 267  GLU A CA  1 
ATOM   1944 C  C   . GLU A 1 256 ? 21.830  90.373  77.848  1.00 100.78 ? 267  GLU A C   1 
ATOM   1945 O  O   . GLU A 1 256 ? 22.718  89.514  77.818  1.00 105.70 ? 267  GLU A O   1 
ATOM   1946 C  CB  . GLU A 1 256 ? 21.809  92.252  79.525  1.00 97.82  ? 267  GLU A CB  1 
ATOM   1947 C  CG  . GLU A 1 256 ? 23.277  92.470  79.205  1.00 102.37 ? 267  GLU A CG  1 
ATOM   1948 C  CD  . GLU A 1 256 ? 24.200  91.949  80.287  1.00 115.80 ? 267  GLU A CD  1 
ATOM   1949 O  OE1 . GLU A 1 256 ? 23.710  91.295  81.231  1.00 121.03 ? 267  GLU A OE1 1 
ATOM   1950 O  OE2 . GLU A 1 256 ? 25.420  92.200  80.196  1.00 122.18 ? 267  GLU A OE2 1 
ATOM   1951 N  N   . PRO A 1 257 ? 21.325  90.885  76.720  1.00 83.50  ? 268  PRO A N   1 
ATOM   1952 C  CA  . PRO A 1 257 ? 21.726  90.322  75.423  1.00 75.80  ? 268  PRO A CA  1 
ATOM   1953 C  C   . PRO A 1 257 ? 23.223  90.436  75.174  1.00 78.66  ? 268  PRO A C   1 
ATOM   1954 O  O   . PRO A 1 257 ? 23.892  91.355  75.652  1.00 79.66  ? 268  PRO A O   1 
ATOM   1955 C  CB  . PRO A 1 257 ? 20.927  91.153  74.411  1.00 69.39  ? 268  PRO A CB  1 
ATOM   1956 C  CG  . PRO A 1 257 ? 20.583  92.406  75.132  1.00 75.28  ? 268  PRO A CG  1 
ATOM   1957 C  CD  . PRO A 1 257 ? 20.358  91.983  76.549  1.00 81.11  ? 268  PRO A CD  1 
ATOM   1958 N  N   . LEU A 1 258 ? 23.743  89.473  74.413  1.00 75.42  ? 269  LEU A N   1 
ATOM   1959 C  CA  . LEU A 1 258 ? 25.164  89.402  74.098  1.00 73.07  ? 269  LEU A CA  1 
ATOM   1960 C  C   . LEU A 1 258 ? 25.523  90.160  72.828  1.00 79.64  ? 269  LEU A C   1 
ATOM   1961 O  O   . LEU A 1 258 ? 26.610  90.746  72.753  1.00 82.29  ? 269  LEU A O   1 
ATOM   1962 C  CB  . LEU A 1 258 ? 25.589  87.934  73.970  1.00 61.60  ? 269  LEU A CB  1 
ATOM   1963 C  CG  . LEU A 1 258 ? 27.066  87.547  73.860  1.00 72.05  ? 269  LEU A CG  1 
ATOM   1964 C  CD1 . LEU A 1 258 ? 27.278  86.172  74.471  1.00 67.46  ? 269  LEU A CD1 1 
ATOM   1965 C  CD2 . LEU A 1 258 ? 27.544  87.553  72.414  1.00 80.94  ? 269  LEU A CD2 1 
ATOM   1966 N  N   . ARG A 1 259 ? 24.635  90.165  71.832  1.00 84.36  ? 270  ARG A N   1 
ATOM   1967 C  CA  . ARG A 1 259 ? 24.907  90.795  70.545  1.00 87.41  ? 270  ARG A CA  1 
ATOM   1968 C  C   . ARG A 1 259 ? 23.624  90.916  69.734  1.00 87.71  ? 270  ARG A C   1 
ATOM   1969 O  O   . ARG A 1 259 ? 23.001  89.903  69.407  1.00 99.92  ? 270  ARG A O   1 
ATOM   1970 C  CB  . ARG A 1 259 ? 25.949  89.988  69.767  1.00 100.60 ? 270  ARG A CB  1 
ATOM   1971 C  CG  . ARG A 1 259 ? 26.404  90.626  68.468  1.00 108.46 ? 270  ARG A CG  1 
ATOM   1972 C  CD  . ARG A 1 259 ? 27.316  89.681  67.703  1.00 109.01 ? 270  ARG A CD  1 
ATOM   1973 N  NE  . ARG A 1 259 ? 28.221  88.965  68.598  1.00 112.08 ? 270  ARG A NE  1 
ATOM   1974 C  CZ  . ARG A 1 259 ? 29.410  89.417  68.980  1.00 116.65 ? 270  ARG A CZ  1 
ATOM   1975 N  NH1 . ARG A 1 259 ? 29.848  90.591  68.544  1.00 119.77 ? 270  ARG A NH1 1 
ATOM   1976 N  NH2 . ARG A 1 259 ? 30.163  88.696  69.800  1.00 114.12 ? 270  ARG A NH2 1 
ATOM   1977 N  N   . SER A 1 260 ? 23.223  92.139  69.397  1.00 77.69  ? 271  SER A N   1 
ATOM   1978 C  CA  . SER A 1 260 ? 21.976  92.389  68.687  1.00 64.38  ? 271  SER A CA  1 
ATOM   1979 C  C   . SER A 1 260 ? 22.248  93.148  67.395  1.00 62.77  ? 271  SER A C   1 
ATOM   1980 O  O   . SER A 1 260 ? 23.143  93.997  67.340  1.00 79.28  ? 271  SER A O   1 
ATOM   1981 C  CB  . SER A 1 260 ? 20.997  93.183  69.561  1.00 65.46  ? 271  SER A CB  1 
ATOM   1982 O  OG  . SER A 1 260 ? 19.767  93.393  68.888  1.00 74.89  ? 271  SER A OG  1 
ATOM   1983 N  N   . LEU A 1 261 ? 21.468  92.840  66.360  1.00 53.74  ? 272  LEU A N   1 
ATOM   1984 C  CA  . LEU A 1 261 ? 21.611  93.511  65.074  1.00 55.27  ? 272  LEU A CA  1 
ATOM   1985 C  C   . LEU A 1 261 ? 20.363  93.273  64.237  1.00 55.78  ? 272  LEU A C   1 
ATOM   1986 O  O   . LEU A 1 261 ? 19.639  92.292  64.429  1.00 48.43  ? 272  LEU A O   1 
ATOM   1987 C  CB  . LEU A 1 261 ? 22.849  93.023  64.310  1.00 49.93  ? 272  LEU A CB  1 
ATOM   1988 C  CG  . LEU A 1 261 ? 22.710  91.672  63.601  1.00 46.85  ? 272  LEU A CG  1 
ATOM   1989 C  CD1 . LEU A 1 261 ? 23.618  91.601  62.383  1.00 37.67  ? 272  LEU A CD1 1 
ATOM   1990 C  CD2 . LEU A 1 261 ? 23.004  90.522  64.553  1.00 47.57  ? 272  LEU A CD2 1 
ATOM   1991 N  N   . VAL A 1 262 ? 20.125  94.193  63.306  1.00 52.24  ? 273  VAL A N   1 
ATOM   1992 C  CA  . VAL A 1 262 ? 19.141  94.015  62.242  1.00 47.73  ? 273  VAL A CA  1 
ATOM   1993 C  C   . VAL A 1 262 ? 19.913  93.691  60.965  1.00 57.03  ? 273  VAL A C   1 
ATOM   1994 O  O   . VAL A 1 262 ? 20.664  94.552  60.475  1.00 71.70  ? 273  VAL A O   1 
ATOM   1995 C  CB  . VAL A 1 262 ? 18.265  95.261  62.063  1.00 39.55  ? 273  VAL A CB  1 
ATOM   1996 C  CG1 . VAL A 1 262 ? 17.171  94.996  61.042  1.00 42.86  ? 273  VAL A CG1 1 
ATOM   1997 C  CG2 . VAL A 1 262 ? 17.669  95.689  63.393  1.00 40.46  ? 273  VAL A CG2 1 
ATOM   1998 N  N   . PRO A 1 263 ? 19.765  92.491  60.395  1.00 52.10  ? 274  PRO A N   1 
ATOM   1999 C  CA  . PRO A 1 263 ? 20.697  92.047  59.345  1.00 53.89  ? 274  PRO A CA  1 
ATOM   2000 C  C   . PRO A 1 263 ? 20.627  92.839  58.049  1.00 58.07  ? 274  PRO A C   1 
ATOM   2001 O  O   . PRO A 1 263 ? 21.521  92.675  57.209  1.00 59.32  ? 274  PRO A O   1 
ATOM   2002 C  CB  . PRO A 1 263 ? 20.290  90.585  59.108  1.00 50.29  ? 274  PRO A CB  1 
ATOM   2003 C  CG  . PRO A 1 263 ? 19.487  90.196  60.306  1.00 44.96  ? 274  PRO A CG  1 
ATOM   2004 C  CD  . PRO A 1 263 ? 18.800  91.442  60.756  1.00 49.00  ? 274  PRO A CD  1 
ATOM   2005 N  N   . TYR A 1 264 ? 19.617  93.682  57.845  1.00 57.29  ? 275  TYR A N   1 
ATOM   2006 C  CA  . TYR A 1 264 ? 19.416  94.341  56.554  1.00 66.44  ? 275  TYR A CA  1 
ATOM   2007 C  C   . TYR A 1 264 ? 19.168  95.835  56.743  1.00 65.17  ? 275  TYR A C   1 
ATOM   2008 O  O   . TYR A 1 264 ? 18.040  96.256  57.013  1.00 42.50  ? 275  TYR A O   1 
ATOM   2009 C  CB  . TYR A 1 264 ? 18.272  93.683  55.790  1.00 59.01  ? 275  TYR A CB  1 
ATOM   2010 C  CG  . TYR A 1 264 ? 18.620  92.300  55.296  1.00 52.91  ? 275  TYR A CG  1 
ATOM   2011 C  CD1 . TYR A 1 264 ? 19.628  92.116  54.361  1.00 48.86  ? 275  TYR A CD1 1 
ATOM   2012 C  CD2 . TYR A 1 264 ? 17.949  91.179  55.765  1.00 52.34  ? 275  TYR A CD2 1 
ATOM   2013 C  CE1 . TYR A 1 264 ? 19.960  90.859  53.905  1.00 44.72  ? 275  TYR A CE1 1 
ATOM   2014 C  CE2 . TYR A 1 264 ? 18.273  89.913  55.312  1.00 47.33  ? 275  TYR A CE2 1 
ATOM   2015 C  CZ  . TYR A 1 264 ? 19.280  89.762  54.382  1.00 46.96  ? 275  TYR A CZ  1 
ATOM   2016 O  OH  . TYR A 1 264 ? 19.617  88.512  53.920  1.00 56.73  ? 275  TYR A OH  1 
ATOM   2017 N  N   . GLY A 1 265 ? 20.224  96.630  56.588  1.00 75.81  ? 276  GLY A N   1 
ATOM   2018 C  CA  . GLY A 1 265 ? 20.107  98.066  56.510  1.00 72.48  ? 276  GLY A CA  1 
ATOM   2019 C  C   . GLY A 1 265 ? 19.660  98.729  57.797  1.00 67.09  ? 276  GLY A C   1 
ATOM   2020 O  O   . GLY A 1 265 ? 19.195  98.078  58.738  1.00 64.89  ? 276  GLY A O   1 
ATOM   2021 N  N   . PRO A 1 266 ? 19.814  100.054 57.864  1.00 46.93  ? 277  PRO A N   1 
ATOM   2022 C  CA  . PRO A 1 266 ? 19.316  100.810 59.018  1.00 48.23  ? 277  PRO A CA  1 
ATOM   2023 C  C   . PRO A 1 266 ? 17.857  101.224 58.913  1.00 62.13  ? 277  PRO A C   1 
ATOM   2024 O  O   . PRO A 1 266 ? 17.319  101.772 59.885  1.00 83.06  ? 277  PRO A O   1 
ATOM   2025 C  CB  . PRO A 1 266 ? 20.228  102.056 59.035  1.00 63.76  ? 277  PRO A CB  1 
ATOM   2026 C  CG  . PRO A 1 266 ? 21.295  101.805 57.987  1.00 77.19  ? 277  PRO A CG  1 
ATOM   2027 C  CD  . PRO A 1 266 ? 20.675  100.877 57.004  1.00 48.65  ? 277  PRO A CD  1 
ATOM   2028 N  N   . PHE A 1 267 ? 17.212  100.989 57.775  1.00 57.49  ? 278  PHE A N   1 
ATOM   2029 C  CA  . PHE A 1 267 ? 15.813  101.337 57.594  1.00 56.93  ? 278  PHE A CA  1 
ATOM   2030 C  C   . PHE A 1 267 ? 14.915  100.292 58.253  1.00 72.34  ? 278  PHE A C   1 
ATOM   2031 O  O   . PHE A 1 267 ? 15.366  99.190  58.575  1.00 63.71  ? 278  PHE A O   1 
ATOM   2032 C  CB  . PHE A 1 267 ? 15.501  101.459 56.104  1.00 52.47  ? 278  PHE A CB  1 
ATOM   2033 C  CG  . PHE A 1 267 ? 16.173  102.627 55.439  1.00 60.00  ? 278  PHE A CG  1 
ATOM   2034 C  CD1 . PHE A 1 267 ? 15.661  103.907 55.576  1.00 70.51  ? 278  PHE A CD1 1 
ATOM   2035 C  CD2 . PHE A 1 267 ? 17.314  102.447 54.676  1.00 75.16  ? 278  PHE A CD2 1 
ATOM   2036 C  CE1 . PHE A 1 267 ? 16.276  104.985 54.966  1.00 72.93  ? 278  PHE A CE1 1 
ATOM   2037 C  CE2 . PHE A 1 267 ? 17.933  103.522 54.062  1.00 53.92  ? 278  PHE A CE2 1 
ATOM   2038 C  CZ  . PHE A 1 267 ? 17.413  104.792 54.209  1.00 62.21  ? 278  PHE A CZ  1 
ATOM   2039 N  N   . PRO A 1 268 ? 13.641  100.623 58.490  1.00 48.24  ? 279  PRO A N   1 
ATOM   2040 C  CA  . PRO A 1 268 ? 12.731  99.648  59.106  1.00 46.76  ? 279  PRO A CA  1 
ATOM   2041 C  C   . PRO A 1 268 ? 12.644  98.362  58.296  1.00 44.66  ? 279  PRO A C   1 
ATOM   2042 O  O   . PRO A 1 268 ? 12.774  98.361  57.071  1.00 44.83  ? 279  PRO A O   1 
ATOM   2043 C  CB  . PRO A 1 268 ? 11.388  100.384 59.130  1.00 81.44  ? 279  PRO A CB  1 
ATOM   2044 C  CG  . PRO A 1 268 ? 11.761  101.822 59.186  1.00 51.32  ? 279  PRO A CG  1 
ATOM   2045 C  CD  . PRO A 1 268 ? 13.014  101.952 58.367  1.00 51.03  ? 279  PRO A CD  1 
ATOM   2046 N  N   . CYS A 1 269 ? 12.420  97.256  59.004  1.00 42.91  ? 280  CYS A N   1 
ATOM   2047 C  CA  . CYS A 1 269 ? 12.407  95.933  58.399  1.00 41.04  ? 280  CYS A CA  1 
ATOM   2048 C  C   . CYS A 1 269 ? 11.187  95.147  58.852  1.00 55.88  ? 280  CYS A C   1 
ATOM   2049 O  O   . CYS A 1 269 ? 10.621  95.399  59.919  1.00 72.67  ? 280  CYS A O   1 
ATOM   2050 C  CB  . CYS A 1 269 ? 13.669  95.139  58.752  1.00 39.46  ? 280  CYS A CB  1 
ATOM   2051 S  SG  . CYS A 1 269 ? 15.177  95.777  58.015  1.00 53.70  ? 280  CYS A SG  1 
ATOM   2052 N  N   . LYS A 1 270 ? 10.793  94.184  58.022  1.00 49.94  ? 281  LYS A N   1 
ATOM   2053 C  CA  . LYS A 1 270 ? 9.764   93.232  58.399  1.00 54.75  ? 281  LYS A CA  1 
ATOM   2054 C  C   . LYS A 1 270 ? 10.302  92.288  59.473  1.00 49.83  ? 281  LYS A C   1 
ATOM   2055 O  O   . LYS A 1 270 ? 11.507  92.208  59.723  1.00 36.59  ? 281  LYS A O   1 
ATOM   2056 C  CB  . LYS A 1 270 ? 9.295   92.441  57.178  1.00 38.84  ? 281  LYS A CB  1 
ATOM   2057 C  CG  . LYS A 1 270 ? 9.015   93.295  55.951  1.00 40.55  ? 281  LYS A CG  1 
ATOM   2058 C  CD  . LYS A 1 270 ? 7.598   93.841  55.948  1.00 42.32  ? 281  LYS A CD  1 
ATOM   2059 C  CE  . LYS A 1 270 ? 6.586   92.735  55.696  1.00 60.26  ? 281  LYS A CE  1 
ATOM   2060 N  NZ  . LYS A 1 270 ? 5.202   93.265  55.553  1.00 68.04  ? 281  LYS A NZ  1 
ATOM   2061 N  N   . ALA A 1 271 ? 9.391   91.558  60.106  1.00 42.09  ? 282  ALA A N   1 
ATOM   2062 C  CA  . ALA A 1 271 ? 9.773   90.669  61.192  1.00 39.85  ? 282  ALA A CA  1 
ATOM   2063 C  C   . ALA A 1 271 ? 10.574  89.477  60.673  1.00 48.79  ? 282  ALA A C   1 
ATOM   2064 O  O   . ALA A 1 271 ? 10.474  89.079  59.510  1.00 60.74  ? 282  ALA A O   1 
ATOM   2065 C  CB  . ALA A 1 271 ? 8.535   90.173  61.938  1.00 35.97  ? 282  ALA A CB  1 
ATOM   2066 N  N   . ILE A 1 272 ? 11.382  88.907  61.563  1.00 42.06  ? 283  ILE A N   1 
ATOM   2067 C  CA  . ILE A 1 272 ? 12.084  87.654  61.310  1.00 32.23  ? 283  ILE A CA  1 
ATOM   2068 C  C   . ILE A 1 272 ? 11.253  86.555  61.960  1.00 60.21  ? 283  ILE A C   1 
ATOM   2069 O  O   . ILE A 1 272 ? 11.262  86.393  63.183  1.00 64.82  ? 283  ILE A O   1 
ATOM   2070 C  CB  . ILE A 1 272 ? 13.514  87.675  61.852  1.00 45.55  ? 283  ILE A CB  1 
ATOM   2071 C  CG1 . ILE A 1 272 ? 14.298  88.841  61.251  1.00 50.85  ? 283  ILE A CG1 1 
ATOM   2072 C  CG2 . ILE A 1 272 ? 14.205  86.357  61.551  1.00 52.63  ? 283  ILE A CG2 1 
ATOM   2073 C  CD1 . ILE A 1 272 ? 15.756  88.863  61.651  1.00 32.43  ? 283  ILE A CD1 1 
ATOM   2074 N  N   . THR A 1 273 ? 10.536  85.787  61.137  1.00 57.41  ? 284  THR A N   1 
ATOM   2075 C  CA  . THR A 1 273 ? 9.569   84.832  61.669  1.00 47.80  ? 284  THR A CA  1 
ATOM   2076 C  C   . THR A 1 273 ? 10.254  83.624  62.299  1.00 50.08  ? 284  THR A C   1 
ATOM   2077 O  O   . THR A 1 273 ? 9.769   83.083  63.299  1.00 55.25  ? 284  THR A O   1 
ATOM   2078 C  CB  . THR A 1 273 ? 8.610   84.389  60.564  1.00 48.24  ? 284  THR A CB  1 
ATOM   2079 O  OG1 . THR A 1 273 ? 9.352   83.801  59.488  1.00 47.50  ? 284  THR A OG1 1 
ATOM   2080 C  CG2 . THR A 1 273 ? 7.823   85.580  60.038  1.00 57.78  ? 284  THR A CG2 1 
ATOM   2081 N  N   . ARG A 1 274 ? 11.375  83.183  61.732  1.00 42.42  ? 285  ARG A N   1 
ATOM   2082 C  CA  . ARG A 1 274 ? 12.069  82.007  62.233  1.00 37.29  ? 285  ARG A CA  1 
ATOM   2083 C  C   . ARG A 1 274 ? 13.566  82.207  62.047  1.00 44.38  ? 285  ARG A C   1 
ATOM   2084 O  O   . ARG A 1 274 ? 14.005  82.991  61.202  1.00 49.33  ? 285  ARG A O   1 
ATOM   2085 C  CB  . ARG A 1 274 ? 11.595  80.733  61.520  1.00 30.18  ? 285  ARG A CB  1 
ATOM   2086 C  CG  . ARG A 1 274 ? 11.982  79.436  62.211  1.00 32.57  ? 285  ARG A CG  1 
ATOM   2087 C  CD  . ARG A 1 274 ? 11.629  78.233  61.354  1.00 30.59  ? 285  ARG A CD  1 
ATOM   2088 N  NE  . ARG A 1 274 ? 12.095  76.984  61.948  1.00 31.12  ? 285  ARG A NE  1 
ATOM   2089 C  CZ  . ARG A 1 274 ? 12.114  75.817  61.312  1.00 32.15  ? 285  ARG A CZ  1 
ATOM   2090 N  NH1 . ARG A 1 274 ? 11.697  75.738  60.056  1.00 36.48  ? 285  ARG A NH1 1 
ATOM   2091 N  NH2 . ARG A 1 274 ? 12.555  74.730  61.929  1.00 31.72  ? 285  ARG A NH2 1 
ATOM   2092 N  N   . ILE A 1 275 ? 14.351  81.491  62.853  1.00 48.28  ? 286  ILE A N   1 
ATOM   2093 C  CA  . ILE A 1 275 ? 15.804  81.586  62.788  1.00 38.59  ? 286  ILE A CA  1 
ATOM   2094 C  C   . ILE A 1 275 ? 16.407  80.276  63.279  1.00 50.93  ? 286  ILE A C   1 
ATOM   2095 O  O   . ILE A 1 275 ? 15.840  79.589  64.132  1.00 45.51  ? 286  ILE A O   1 
ATOM   2096 C  CB  . ILE A 1 275 ? 16.331  82.792  63.604  1.00 29.64  ? 286  ILE A CB  1 
ATOM   2097 C  CG1 . ILE A 1 275 ? 17.801  83.058  63.280  1.00 29.95  ? 286  ILE A CG1 1 
ATOM   2098 C  CG2 . ILE A 1 275 ? 16.144  82.561  65.096  1.00 29.76  ? 286  ILE A CG2 1 
ATOM   2099 C  CD1 . ILE A 1 275 ? 18.347  84.303  63.926  1.00 36.98  ? 286  ILE A CD1 1 
ATOM   2100 N  N   . LEU A 1 276 ? 17.561  79.925  62.711  1.00 46.90  ? 287  LEU A N   1 
ATOM   2101 C  CA  . LEU A 1 276 ? 18.330  78.760  63.119  1.00 40.64  ? 287  LEU A CA  1 
ATOM   2102 C  C   . LEU A 1 276 ? 19.769  79.174  63.390  1.00 41.99  ? 287  LEU A C   1 
ATOM   2103 O  O   . LEU A 1 276 ? 20.293  80.101  62.766  1.00 61.36  ? 287  LEU A O   1 
ATOM   2104 C  CB  . LEU A 1 276 ? 18.312  77.648  62.054  1.00 35.69  ? 287  LEU A CB  1 
ATOM   2105 C  CG  . LEU A 1 276 ? 17.084  76.738  61.953  1.00 47.36  ? 287  LEU A CG  1 
ATOM   2106 C  CD1 . LEU A 1 276 ? 15.911  77.447  61.291  1.00 49.06  ? 287  LEU A CD1 1 
ATOM   2107 C  CD2 . LEU A 1 276 ? 17.432  75.456  61.208  1.00 37.44  ? 287  LEU A CD2 1 
ATOM   2108 N  N   . TRP A 1 277 ? 20.404  78.476  64.331  1.00 39.25  ? 288  TRP A N   1 
ATOM   2109 C  CA  . TRP A 1 277 ? 21.807  78.698  64.684  1.00 31.95  ? 288  TRP A CA  1 
ATOM   2110 C  C   . TRP A 1 277 ? 22.491  77.333  64.691  1.00 57.41  ? 288  TRP A C   1 
ATOM   2111 O  O   . TRP A 1 277 ? 22.476  76.624  65.700  1.00 65.66  ? 288  TRP A O   1 
ATOM   2112 C  CB  . TRP A 1 277 ? 21.937  79.410  66.028  1.00 32.22  ? 288  TRP A CB  1 
ATOM   2113 C  CG  . TRP A 1 277 ? 23.356  79.591  66.474  1.00 46.05  ? 288  TRP A CG  1 
ATOM   2114 C  CD1 . TRP A 1 277 ? 24.056  78.786  67.325  1.00 48.26  ? 288  TRP A CD1 1 
ATOM   2115 C  CD2 . TRP A 1 277 ? 24.251  80.640  66.087  1.00 47.89  ? 288  TRP A CD2 1 
ATOM   2116 N  NE1 . TRP A 1 277 ? 25.331  79.270  67.494  1.00 46.12  ? 288  TRP A NE1 1 
ATOM   2117 C  CE2 . TRP A 1 277 ? 25.476  80.408  66.744  1.00 43.48  ? 288  TRP A CE2 1 
ATOM   2118 C  CE3 . TRP A 1 277 ? 24.136  81.754  65.249  1.00 55.50  ? 288  TRP A CE3 1 
ATOM   2119 C  CZ2 . TRP A 1 277 ? 26.577  81.247  66.590  1.00 41.93  ? 288  TRP A CZ2 1 
ATOM   2120 C  CZ3 . TRP A 1 277 ? 25.230  82.586  65.098  1.00 61.89  ? 288  TRP A CZ3 1 
ATOM   2121 C  CH2 . TRP A 1 277 ? 26.434  82.329  65.765  1.00 47.17  ? 288  TRP A CH2 1 
ATOM   2122 N  N   . LEU A 1 278 ? 23.089  76.970  63.561  1.00 33.32  ? 289  LEU A N   1 
ATOM   2123 C  CA  . LEU A 1 278 ? 23.713  75.668  63.385  1.00 55.01  ? 289  LEU A CA  1 
ATOM   2124 C  C   . LEU A 1 278 ? 25.228  75.797  63.452  1.00 56.38  ? 289  LEU A C   1 
ATOM   2125 O  O   . LEU A 1 278 ? 25.806  76.747  62.916  1.00 50.58  ? 289  LEU A O   1 
ATOM   2126 C  CB  . LEU A 1 278 ? 23.297  75.050  62.050  1.00 34.61  ? 289  LEU A CB  1 
ATOM   2127 C  CG  . LEU A 1 278 ? 21.793  75.081  61.773  1.00 33.58  ? 289  LEU A CG  1 
ATOM   2128 C  CD1 . LEU A 1 278 ? 21.504  74.573  60.378  1.00 51.62  ? 289  LEU A CD1 1 
ATOM   2129 C  CD2 . LEU A 1 278 ? 21.032  74.269  62.809  1.00 33.48  ? 289  LEU A CD2 1 
ATOM   2130 N  N   . THR A 1 279 ? 25.867  74.834  64.108  1.00 37.02  ? 290  THR A N   1 
ATOM   2131 C  CA  . THR A 1 279 ? 27.308  74.840  64.302  1.00 38.65  ? 290  THR A CA  1 
ATOM   2132 C  C   . THR A 1 279 ? 27.979  73.840  63.369  1.00 54.18  ? 290  THR A C   1 
ATOM   2133 O  O   . THR A 1 279 ? 27.425  72.783  63.057  1.00 67.90  ? 290  THR A O   1 
ATOM   2134 C  CB  . THR A 1 279 ? 27.666  74.508  65.752  1.00 39.56  ? 290  THR A CB  1 
ATOM   2135 O  OG1 . THR A 1 279 ? 27.349  73.137  66.020  1.00 40.22  ? 290  THR A OG1 1 
ATOM   2136 C  CG2 . THR A 1 279 ? 26.883  75.394  66.707  1.00 51.55  ? 290  THR A CG2 1 
ATOM   2137 N  N   . THR A 1 280 ? 29.186  74.184  62.929  1.00 62.05  ? 291  THR A N   1 
ATOM   2138 C  CA  . THR A 1 280 ? 29.989  73.319  62.080  1.00 59.91  ? 291  THR A CA  1 
ATOM   2139 C  C   . THR A 1 280 ? 31.294  72.976  62.784  1.00 59.18  ? 291  THR A C   1 
ATOM   2140 O  O   . THR A 1 280 ? 31.754  73.698  63.674  1.00 51.02  ? 291  THR A O   1 
ATOM   2141 C  CB  . THR A 1 280 ? 30.286  73.975  60.724  1.00 66.73  ? 291  THR A CB  1 
ATOM   2142 O  OG1 . THR A 1 280 ? 31.030  75.184  60.926  1.00 49.49  ? 291  THR A OG1 1 
ATOM   2143 C  CG2 . THR A 1 280 ? 28.992  74.294  59.993  1.00 71.26  ? 291  THR A CG2 1 
ATOM   2144 N  N   . ARG A 1 281 ? 31.894  71.857  62.370  1.00 60.33  ? 292  ARG A N   1 
ATOM   2145 C  CA  . ARG A 1 281 ? 33.140  71.413  62.984  1.00 49.94  ? 292  ARG A CA  1 
ATOM   2146 C  C   . ARG A 1 281 ? 34.295  72.363  62.700  1.00 61.93  ? 292  ARG A C   1 
ATOM   2147 O  O   . ARG A 1 281 ? 35.296  72.332  63.423  1.00 72.90  ? 292  ARG A O   1 
ATOM   2148 C  CB  . ARG A 1 281 ? 33.496  70.006  62.504  1.00 52.17  ? 292  ARG A CB  1 
ATOM   2149 C  CG  . ARG A 1 281 ? 33.949  69.940  61.057  1.00 68.34  ? 292  ARG A CG  1 
ATOM   2150 C  CD  . ARG A 1 281 ? 34.414  68.542  60.684  1.00 84.58  ? 292  ARG A CD  1 
ATOM   2151 N  NE  . ARG A 1 281 ? 33.313  67.584  60.663  1.00 96.68  ? 292  ARG A NE  1 
ATOM   2152 C  CZ  . ARG A 1 281 ? 32.592  67.302  59.583  1.00 100.93 ? 292  ARG A CZ  1 
ATOM   2153 N  NH1 . ARG A 1 281 ? 32.855  67.905  58.432  1.00 97.85  ? 292  ARG A NH1 1 
ATOM   2154 N  NH2 . ARG A 1 281 ? 31.606  66.417  59.654  1.00 97.46  ? 292  ARG A NH2 1 
ATOM   2155 N  N   . GLN A 1 282 ? 34.183  73.202  61.670  1.00 65.20  ? 293  GLN A N   1 
ATOM   2156 C  CA  . GLN A 1 282 ? 35.219  74.179  61.362  1.00 51.08  ? 293  GLN A CA  1 
ATOM   2157 C  C   . GLN A 1 282 ? 35.113  75.439  62.209  1.00 68.70  ? 293  GLN A C   1 
ATOM   2158 O  O   . GLN A 1 282 ? 35.936  76.346  62.045  1.00 91.36  ? 293  GLN A O   1 
ATOM   2159 C  CB  . GLN A 1 282 ? 35.170  74.555  59.877  1.00 50.85  ? 293  GLN A CB  1 
ATOM   2160 C  CG  . GLN A 1 282 ? 35.132  73.368  58.927  1.00 52.07  ? 293  GLN A CG  1 
ATOM   2161 C  CD  . GLN A 1 282 ? 33.719  72.984  58.532  1.00 87.61  ? 293  GLN A CD  1 
ATOM   2162 O  OE1 . GLN A 1 282 ? 32.819  73.823  58.511  1.00 97.03  ? 293  GLN A OE1 1 
ATOM   2163 N  NE2 . GLN A 1 282 ? 33.518  71.710  58.216  1.00 82.28  ? 293  GLN A NE2 1 
ATOM   2164 N  N   . GLY A 1 283 ? 34.130  75.520  63.103  1.00 48.17  ? 294  GLY A N   1 
ATOM   2165 C  CA  . GLY A 1 283 ? 33.947  76.697  63.923  1.00 47.30  ? 294  GLY A CA  1 
ATOM   2166 C  C   . GLY A 1 283 ? 33.218  77.838  63.253  1.00 52.98  ? 294  GLY A C   1 
ATOM   2167 O  O   . GLY A 1 283 ? 33.182  78.941  63.810  1.00 45.04  ? 294  GLY A O   1 
ATOM   2168 N  N   . LEU A 1 284 ? 32.635  77.610  62.077  1.00 47.87  ? 295  LEU A N   1 
ATOM   2169 C  CA  . LEU A 1 284 ? 31.932  78.651  61.335  1.00 59.41  ? 295  LEU A CA  1 
ATOM   2170 C  C   . LEU A 1 284 ? 30.435  78.377  61.378  1.00 62.58  ? 295  LEU A C   1 
ATOM   2171 O  O   . LEU A 1 284 ? 29.938  77.526  60.625  1.00 65.97  ? 295  LEU A O   1 
ATOM   2172 C  CB  . LEU A 1 284 ? 32.431  78.702  59.889  1.00 74.43  ? 295  LEU A CB  1 
ATOM   2173 C  CG  . LEU A 1 284 ? 33.954  78.729  59.753  1.00 46.12  ? 295  LEU A CG  1 
ATOM   2174 C  CD1 . LEU A 1 284 ? 34.372  78.603  58.299  1.00 47.15  ? 295  LEU A CD1 1 
ATOM   2175 C  CD2 . LEU A 1 284 ? 34.523  79.995  60.373  1.00 46.62  ? 295  LEU A CD2 1 
ATOM   2176 N  N   . PRO A 1 285 ? 29.677  79.061  62.229  1.00 46.65  ? 296  PRO A N   1 
ATOM   2177 C  CA  . PRO A 1 285 ? 28.257  78.736  62.382  1.00 51.76  ? 296  PRO A CA  1 
ATOM   2178 C  C   . PRO A 1 285 ? 27.406  79.243  61.229  1.00 46.84  ? 296  PRO A C   1 
ATOM   2179 O  O   . PRO A 1 285 ? 27.676  80.283  60.625  1.00 50.92  ? 296  PRO A O   1 
ATOM   2180 C  CB  . PRO A 1 285 ? 27.879  79.443  63.689  1.00 37.26  ? 296  PRO A CB  1 
ATOM   2181 C  CG  . PRO A 1 285 ? 28.815  80.598  63.761  1.00 38.25  ? 296  PRO A CG  1 
ATOM   2182 C  CD  . PRO A 1 285 ? 30.108  80.119  63.159  1.00 39.91  ? 296  PRO A CD  1 
ATOM   2183 N  N   . PHE A 1 286 ? 26.358  78.476  60.933  1.00 43.91  ? 297  PHE A N   1 
ATOM   2184 C  CA  . PHE A 1 286 ? 25.342  78.870  59.967  1.00 34.84  ? 297  PHE A CA  1 
ATOM   2185 C  C   . PHE A 1 286 ? 24.247  79.657  60.676  1.00 34.23  ? 297  PHE A C   1 
ATOM   2186 O  O   . PHE A 1 286 ? 23.692  79.194  61.677  1.00 44.37  ? 297  PHE A O   1 
ATOM   2187 C  CB  . PHE A 1 286 ? 24.733  77.646  59.281  1.00 41.35  ? 297  PHE A CB  1 
ATOM   2188 C  CG  . PHE A 1 286 ? 25.513  77.150  58.097  1.00 36.38  ? 297  PHE A CG  1 
ATOM   2189 C  CD1 . PHE A 1 286 ? 26.584  76.288  58.265  1.00 63.01  ? 297  PHE A CD1 1 
ATOM   2190 C  CD2 . PHE A 1 286 ? 25.160  77.529  56.813  1.00 36.50  ? 297  PHE A CD2 1 
ATOM   2191 C  CE1 . PHE A 1 286 ? 27.295  75.820  57.174  1.00 50.30  ? 297  PHE A CE1 1 
ATOM   2192 C  CE2 . PHE A 1 286 ? 25.867  77.067  55.719  1.00 59.60  ? 297  PHE A CE2 1 
ATOM   2193 C  CZ  . PHE A 1 286 ? 26.937  76.212  55.901  1.00 62.68  ? 297  PHE A CZ  1 
ATOM   2194 N  N   . THR A 1 287 ? 23.940  80.841  60.156  1.00 39.62  ? 298  THR A N   1 
ATOM   2195 C  CA  . THR A 1 287 ? 22.824  81.649  60.635  1.00 36.89  ? 298  THR A CA  1 
ATOM   2196 C  C   . THR A 1 287 ? 21.789  81.710  59.519  1.00 31.81  ? 298  THR A C   1 
ATOM   2197 O  O   . THR A 1 287 ? 22.024  82.337  58.480  1.00 35.51  ? 298  THR A O   1 
ATOM   2198 C  CB  . THR A 1 287 ? 23.280  83.049  61.041  1.00 51.72  ? 298  THR A CB  1 
ATOM   2199 O  OG1 . THR A 1 287 ? 24.306  82.949  62.036  1.00 61.44  ? 298  THR A OG1 1 
ATOM   2200 C  CG2 . THR A 1 287 ? 22.111  83.841  61.607  1.00 39.12  ? 298  THR A CG2 1 
ATOM   2201 N  N   . ILE A 1 288 ? 20.653  81.052  59.731  1.00 51.74  ? 299  ILE A N   1 
ATOM   2202 C  CA  . ILE A 1 288 ? 19.599  80.939  58.730  1.00 44.22  ? 299  ILE A CA  1 
ATOM   2203 C  C   . ILE A 1 288 ? 18.319  81.502  59.327  1.00 47.31  ? 299  ILE A C   1 
ATOM   2204 O  O   . ILE A 1 288 ? 17.793  80.956  60.304  1.00 58.55  ? 299  ILE A O   1 
ATOM   2205 C  CB  . ILE A 1 288 ? 19.400  79.483  58.280  1.00 31.54  ? 299  ILE A CB  1 
ATOM   2206 C  CG1 . ILE A 1 288 ? 20.732  78.883  57.826  1.00 37.02  ? 299  ILE A CG1 1 
ATOM   2207 C  CG2 . ILE A 1 288 ? 18.368  79.405  57.167  1.00 35.12  ? 299  ILE A CG2 1 
ATOM   2208 C  CD1 . ILE A 1 288 ? 20.672  77.400  57.547  1.00 45.38  ? 299  ILE A CD1 1 
ATOM   2209 N  N   . PHE A 1 289 ? 17.817  82.590  58.743  1.00 41.99  ? 300  PHE A N   1 
ATOM   2210 C  CA  . PHE A 1 289 ? 16.598  83.227  59.217  1.00 47.90  ? 300  PHE A CA  1 
ATOM   2211 C  C   . PHE A 1 289 ? 15.687  83.561  58.045  1.00 43.53  ? 300  PHE A C   1 
ATOM   2212 O  O   . PHE A 1 289 ? 16.147  83.872  56.943  1.00 48.02  ? 300  PHE A O   1 
ATOM   2213 C  CB  . PHE A 1 289 ? 16.900  84.498  60.031  1.00 42.78  ? 300  PHE A CB  1 
ATOM   2214 C  CG  . PHE A 1 289 ? 17.608  85.574  59.254  1.00 37.83  ? 300  PHE A CG  1 
ATOM   2215 C  CD1 . PHE A 1 289 ? 16.890  86.560  58.596  1.00 33.06  ? 300  PHE A CD1 1 
ATOM   2216 C  CD2 . PHE A 1 289 ? 18.991  85.613  59.202  1.00 31.34  ? 300  PHE A CD2 1 
ATOM   2217 C  CE1 . PHE A 1 289 ? 17.539  87.555  57.888  1.00 36.10  ? 300  PHE A CE1 1 
ATOM   2218 C  CE2 . PHE A 1 289 ? 19.645  86.607  58.496  1.00 36.22  ? 300  PHE A CE2 1 
ATOM   2219 C  CZ  . PHE A 1 289 ? 18.918  87.580  57.841  1.00 36.37  ? 300  PHE A CZ  1 
ATOM   2220 N  N   . GLN A 1 290 ? 14.383  83.490  58.302  1.00 44.21  ? 301  GLN A N   1 
ATOM   2221 C  CA  . GLN A 1 290 ? 13.361  83.791  57.310  1.00 44.66  ? 301  GLN A CA  1 
ATOM   2222 C  C   . GLN A 1 290 ? 12.799  85.181  57.565  1.00 31.94  ? 301  GLN A C   1 
ATOM   2223 O  O   . GLN A 1 290 ? 12.448  85.518  58.700  1.00 31.66  ? 301  GLN A O   1 
ATOM   2224 C  CB  . GLN A 1 290 ? 12.232  82.759  57.348  1.00 43.88  ? 301  GLN A CB  1 
ATOM   2225 C  CG  . GLN A 1 290 ? 11.032  83.114  56.482  1.00 48.86  ? 301  GLN A CG  1 
ATOM   2226 C  CD  . GLN A 1 290 ? 9.860   82.175  56.697  1.00 62.30  ? 301  GLN A CD  1 
ATOM   2227 O  OE1 . GLN A 1 290 ? 9.961   81.196  57.437  1.00 73.29  ? 301  GLN A OE1 1 
ATOM   2228 N  NE2 . GLN A 1 290 ? 8.737   82.473  56.053  1.00 62.49  ? 301  GLN A NE2 1 
ATOM   2229 N  N   . GLY A 1 291 ? 12.709  85.980  56.508  1.00 39.62  ? 302  GLY A N   1 
ATOM   2230 C  CA  . GLY A 1 291 ? 12.181  87.321  56.641  1.00 48.21  ? 302  GLY A CA  1 
ATOM   2231 C  C   . GLY A 1 291 ? 13.247  88.363  56.888  1.00 42.24  ? 302  GLY A C   1 
ATOM   2232 O  O   . GLY A 1 291 ? 14.308  88.326  56.265  1.00 43.38  ? 302  GLY A O   1 
ATOM   2233 N  N   . GLY A 1 292 ? 12.976  89.300  57.792  1.00 47.25  ? 303  GLY A N   1 
ATOM   2234 C  CA  . GLY A 1 292 ? 13.877  90.397  58.063  1.00 54.01  ? 303  GLY A CA  1 
ATOM   2235 C  C   . GLY A 1 292 ? 14.131  91.332  56.899  1.00 49.68  ? 303  GLY A C   1 
ATOM   2236 O  O   . GLY A 1 292 ? 14.982  92.218  57.019  1.00 48.30  ? 303  GLY A O   1 
ATOM   2237 N  N   . MET A 1 293 ? 13.425  91.180  55.778  1.00 44.48  ? 304  MET A N   1 
ATOM   2238 C  CA  . MET A 1 293 ? 13.657  92.064  54.644  1.00 61.85  ? 304  MET A CA  1 
ATOM   2239 C  C   . MET A 1 293 ? 13.185  93.487  54.956  1.00 60.14  ? 304  MET A C   1 
ATOM   2240 O  O   . MET A 1 293 ? 12.249  93.684  55.739  1.00 68.58  ? 304  MET A O   1 
ATOM   2241 C  CB  . MET A 1 293 ? 12.939  91.543  53.403  1.00 65.84  ? 304  MET A CB  1 
ATOM   2242 C  CG  . MET A 1 293 ? 13.314  90.133  53.018  1.00 69.81  ? 304  MET A CG  1 
ATOM   2243 S  SD  . MET A 1 293 ? 15.079  89.979  52.703  1.00 77.51  ? 304  MET A SD  1 
ATOM   2244 C  CE  . MET A 1 293 ? 15.280  91.167  51.379  1.00 71.05  ? 304  MET A CE  1 
ATOM   2245 N  N   . PRO A 1 294 ? 13.817  94.498  54.354  1.00 55.78  ? 305  PRO A N   1 
ATOM   2246 C  CA  . PRO A 1 294 ? 13.393  95.881  54.608  1.00 62.05  ? 305  PRO A CA  1 
ATOM   2247 C  C   . PRO A 1 294 ? 12.001  96.147  54.056  1.00 68.11  ? 305  PRO A C   1 
ATOM   2248 O  O   . PRO A 1 294 ? 11.649  95.693  52.965  1.00 72.68  ? 305  PRO A O   1 
ATOM   2249 C  CB  . PRO A 1 294 ? 14.451  96.721  53.880  1.00 50.02  ? 305  PRO A CB  1 
ATOM   2250 C  CG  . PRO A 1 294 ? 15.622  95.804  53.693  1.00 48.67  ? 305  PRO A CG  1 
ATOM   2251 C  CD  . PRO A 1 294 ? 15.029  94.437  53.516  1.00 47.46  ? 305  PRO A CD  1 
ATOM   2252 N  N   . ARG A 1 295 ? 11.202  96.891  54.827  1.00 67.73  ? 306  ARG A N   1 
ATOM   2253 C  CA  . ARG A 1 295 ? 9.886   97.298  54.344  1.00 64.44  ? 306  ARG A CA  1 
ATOM   2254 C  C   . ARG A 1 295 ? 9.981   98.322  53.222  1.00 81.32  ? 306  ARG A C   1 
ATOM   2255 O  O   . ARG A 1 295 ? 8.983   98.566  52.535  1.00 82.87  ? 306  ARG A O   1 
ATOM   2256 C  CB  . ARG A 1 295 ? 9.045   97.885  55.480  1.00 59.41  ? 306  ARG A CB  1 
ATOM   2257 C  CG  . ARG A 1 295 ? 9.200   97.200  56.826  1.00 58.07  ? 306  ARG A CG  1 
ATOM   2258 C  CD  . ARG A 1 295 ? 8.132   97.691  57.793  1.00 52.76  ? 306  ARG A CD  1 
ATOM   2259 N  NE  . ARG A 1 295 ? 8.430   97.350  59.181  1.00 58.07  ? 306  ARG A NE  1 
ATOM   2260 C  CZ  . ARG A 1 295 ? 7.534   97.374  60.162  1.00 67.94  ? 306  ARG A CZ  1 
ATOM   2261 N  NH1 . ARG A 1 295 ? 6.277   97.713  59.906  1.00 63.42  ? 306  ARG A NH1 1 
ATOM   2262 N  NH2 . ARG A 1 295 ? 7.891   97.052  61.398  1.00 77.45  ? 306  ARG A NH2 1 
ATOM   2263 N  N   . ALA A 1 296 ? 11.158  98.921  53.025  1.00 95.21  ? 307  ALA A N   1 
ATOM   2264 C  CA  . ALA A 1 296 ? 11.283  100.044 52.102  1.00 96.83  ? 307  ALA A CA  1 
ATOM   2265 C  C   . ALA A 1 296 ? 10.979  99.632  50.668  1.00 100.72 ? 307  ALA A C   1 
ATOM   2266 O  O   . ALA A 1 296 ? 10.324  100.375 49.928  1.00 127.43 ? 307  ALA A O   1 
ATOM   2267 C  CB  . ALA A 1 296 ? 12.684  100.648 52.201  1.00 111.80 ? 307  ALA A CB  1 
ATOM   2268 N  N   . SER A 1 297 ? 11.441  98.454  50.253  1.00 53.95  ? 308  SER A N   1 
ATOM   2269 C  CA  . SER A 1 297 ? 11.223  98.024  48.877  1.00 87.80  ? 308  SER A CA  1 
ATOM   2270 C  C   . SER A 1 297 ? 11.116  96.509  48.773  1.00 90.49  ? 308  SER A C   1 
ATOM   2271 O  O   . SER A 1 297 ? 10.238  95.988  48.078  1.00 84.06  ? 308  SER A O   1 
ATOM   2272 C  CB  . SER A 1 297 ? 12.347  98.540  47.977  1.00 77.86  ? 308  SER A CB  1 
ATOM   2273 O  OG  . SER A 1 297 ? 12.079  98.259  46.615  1.00 79.06  ? 308  SER A OG  1 
ATOM   2274 N  N   . TYR A 1 298 ? 12.005  95.791  49.462  1.00 89.85  ? 309  TYR A N   1 
ATOM   2275 C  CA  . TYR A 1 298 ? 12.055  94.336  49.402  1.00 95.07  ? 309  TYR A CA  1 
ATOM   2276 C  C   . TYR A 1 298 ? 11.132  93.673  50.421  1.00 107.86 ? 309  TYR A C   1 
ATOM   2277 O  O   . TYR A 1 298 ? 11.379  92.527  50.820  1.00 113.88 ? 309  TYR A O   1 
ATOM   2278 C  CB  . TYR A 1 298 ? 13.496  93.858  49.596  1.00 88.66  ? 309  TYR A CB  1 
ATOM   2279 C  CG  . TYR A 1 298 ? 14.521  94.650  48.809  1.00 98.21  ? 309  TYR A CG  1 
ATOM   2280 C  CD1 . TYR A 1 298 ? 15.157  95.751  49.369  1.00 112.17 ? 309  TYR A CD1 1 
ATOM   2281 C  CD2 . TYR A 1 298 ? 14.852  94.296  47.507  1.00 102.39 ? 309  TYR A CD2 1 
ATOM   2282 C  CE1 . TYR A 1 298 ? 16.093  96.478  48.654  1.00 122.02 ? 309  TYR A CE1 1 
ATOM   2283 C  CE2 . TYR A 1 298 ? 15.788  95.017  46.785  1.00 109.72 ? 309  TYR A CE2 1 
ATOM   2284 C  CZ  . TYR A 1 298 ? 16.405  96.106  47.363  1.00 120.08 ? 309  TYR A CZ  1 
ATOM   2285 O  OH  . TYR A 1 298 ? 17.336  96.827  46.650  1.00 124.50 ? 309  TYR A OH  1 
ATOM   2286 N  N   . GLY A 1 299 ? 10.067  94.359  50.845  1.00 109.23 ? 310  GLY A N   1 
ATOM   2287 C  CA  . GLY A 1 299 ? 9.234   93.842  51.918  1.00 108.02 ? 310  GLY A CA  1 
ATOM   2288 C  C   . GLY A 1 299 ? 8.188   92.841  51.478  1.00 101.05 ? 310  GLY A C   1 
ATOM   2289 O  O   . GLY A 1 299 ? 7.850   91.926  52.236  1.00 96.41  ? 310  GLY A O   1 
ATOM   2290 N  N   . ASP A 1 300 ? 7.655   92.994  50.268  1.00 107.60 ? 311  ASP A N   1 
ATOM   2291 C  CA  . ASP A 1 300 ? 6.654   92.073  49.746  1.00 99.13  ? 311  ASP A CA  1 
ATOM   2292 C  C   . ASP A 1 300 ? 7.266   90.813  49.149  1.00 91.56  ? 311  ASP A C   1 
ATOM   2293 O  O   . ASP A 1 300 ? 6.618   90.149  48.332  1.00 83.42  ? 311  ASP A O   1 
ATOM   2294 C  CB  . ASP A 1 300 ? 5.781   92.778  48.704  1.00 92.40  ? 311  ASP A CB  1 
ATOM   2295 C  CG  . ASP A 1 300 ? 6.554   93.161  47.456  1.00 92.16  ? 311  ASP A CG  1 
ATOM   2296 O  OD1 . ASP A 1 300 ? 7.781   93.373  47.552  1.00 92.99  ? 311  ASP A OD1 1 
ATOM   2297 O  OD2 . ASP A 1 300 ? 5.930   93.252  46.378  1.00 91.53  ? 311  ASP A OD2 1 
ATOM   2298 N  N   . ARG A 1 301 ? 8.490   90.470  49.542  1.00 89.97  ? 312  ARG A N   1 
ATOM   2299 C  CA  . ARG A 1 301 ? 9.214   89.338  48.986  1.00 79.95  ? 312  ARG A CA  1 
ATOM   2300 C  C   . ARG A 1 301 ? 9.418   88.274  50.055  1.00 64.79  ? 312  ARG A C   1 
ATOM   2301 O  O   . ARG A 1 301 ? 9.708   88.590  51.214  1.00 62.29  ? 312  ARG A O   1 
ATOM   2302 C  CB  . ARG A 1 301 ? 10.566  89.784  48.424  1.00 83.07  ? 312  ARG A CB  1 
ATOM   2303 C  CG  . ARG A 1 301 ? 10.478  90.982  47.492  1.00 88.44  ? 312  ARG A CG  1 
ATOM   2304 C  CD  . ARG A 1 301 ? 11.846  91.382  46.963  1.00 94.73  ? 312  ARG A CD  1 
ATOM   2305 N  NE  . ARG A 1 301 ? 12.411  90.366  46.081  1.00 102.37 ? 312  ARG A NE  1 
ATOM   2306 C  CZ  . ARG A 1 301 ? 12.227  90.334  44.765  1.00 109.65 ? 312  ARG A CZ  1 
ATOM   2307 N  NH1 . ARG A 1 301 ? 11.489  91.264  44.174  1.00 112.90 ? 312  ARG A NH1 1 
ATOM   2308 N  NH2 . ARG A 1 301 ? 12.781  89.373  44.039  1.00 112.45 ? 312  ARG A NH2 1 
ATOM   2309 N  N   . HIS A 1 302 ? 9.262   87.012  49.660  1.00 56.75  ? 313  HIS A N   1 
ATOM   2310 C  CA  . HIS A 1 302 ? 9.434   85.879  50.562  1.00 66.67  ? 313  HIS A CA  1 
ATOM   2311 C  C   . HIS A 1 302 ? 10.889  85.430  50.492  1.00 67.22  ? 313  HIS A C   1 
ATOM   2312 O  O   . HIS A 1 302 ? 11.331  84.894  49.470  1.00 69.41  ? 313  HIS A O   1 
ATOM   2313 C  CB  . HIS A 1 302 ? 8.484   84.746  50.183  1.00 59.73  ? 313  HIS A CB  1 
ATOM   2314 C  CG  . HIS A 1 302 ? 7.147   85.219  49.704  1.00 59.99  ? 313  HIS A CG  1 
ATOM   2315 N  ND1 . HIS A 1 302 ? 6.069   85.383  50.547  1.00 61.66  ? 313  HIS A ND1 1 
ATOM   2316 C  CD2 . HIS A 1 302 ? 6.716   85.569  48.470  1.00 60.45  ? 313  HIS A CD2 1 
ATOM   2317 C  CE1 . HIS A 1 302 ? 5.031   85.812  49.852  1.00 64.31  ? 313  HIS A CE1 1 
ATOM   2318 N  NE2 . HIS A 1 302 ? 5.396   85.933  48.589  1.00 52.36  ? 313  HIS A NE2 1 
ATOM   2319 N  N   . CYS A 1 303 ? 11.634  85.646  51.574  1.00 53.08  ? 314  CYS A N   1 
ATOM   2320 C  CA  . CYS A 1 303 ? 13.071  85.422  51.575  1.00 56.16  ? 314  CYS A CA  1 
ATOM   2321 C  C   . CYS A 1 303 ? 13.487  84.546  52.747  1.00 49.76  ? 314  CYS A C   1 
ATOM   2322 O  O   . CYS A 1 303 ? 12.853  84.545  53.806  1.00 46.16  ? 314  CYS A O   1 
ATOM   2323 C  CB  . CYS A 1 303 ? 13.844  86.745  51.635  1.00 57.41  ? 314  CYS A CB  1 
ATOM   2324 S  SG  . CYS A 1 303 ? 13.605  87.814  50.204  1.00 71.27  ? 314  CYS A SG  1 
ATOM   2325 N  N   . ILE A 1 304 ? 14.568  83.800  52.536  1.00 55.92  ? 315  ILE A N   1 
ATOM   2326 C  CA  . ILE A 1 304 ? 15.240  83.034  53.577  1.00 51.58  ? 315  ILE A CA  1 
ATOM   2327 C  C   . ILE A 1 304 ? 16.732  83.288  53.427  1.00 48.96  ? 315  ILE A C   1 
ATOM   2328 O  O   . ILE A 1 304 ? 17.328  82.920  52.407  1.00 44.53  ? 315  ILE A O   1 
ATOM   2329 C  CB  . ILE A 1 304 ? 14.935  81.529  53.489  1.00 48.86  ? 315  ILE A CB  1 
ATOM   2330 C  CG1 . ILE A 1 304 ? 13.459  81.260  53.788  1.00 39.34  ? 315  ILE A CG1 1 
ATOM   2331 C  CG2 . ILE A 1 304 ? 15.832  80.749  54.440  1.00 38.87  ? 315  ILE A CG2 1 
ATOM   2332 C  CD1 . ILE A 1 304 ? 13.081  79.798  53.715  1.00 39.02  ? 315  ILE A CD1 1 
ATOM   2333 N  N   . SER A 1 305 ? 17.332  83.918  54.430  1.00 55.72  ? 316  SER A N   1 
ATOM   2334 C  CA  . SER A 1 305 ? 18.731  84.315  54.376  1.00 43.89  ? 316  SER A CA  1 
ATOM   2335 C  C   . SER A 1 305 ? 19.605  83.289  55.082  1.00 42.14  ? 316  SER A C   1 
ATOM   2336 O  O   . SER A 1 305 ? 19.230  82.752  56.127  1.00 39.24  ? 316  SER A O   1 
ATOM   2337 C  CB  . SER A 1 305 ? 18.928  85.688  55.015  1.00 40.52  ? 316  SER A CB  1 
ATOM   2338 O  OG  . SER A 1 305 ? 18.079  86.654  54.421  1.00 59.54  ? 316  SER A OG  1 
ATOM   2339 N  N   . VAL A 1 306 ? 20.775  83.026  54.504  1.00 39.74  ? 317  VAL A N   1 
ATOM   2340 C  CA  . VAL A 1 306 ? 21.762  82.118  55.076  1.00 39.55  ? 317  VAL A CA  1 
ATOM   2341 C  C   . VAL A 1 306 ? 23.075  82.874  55.219  1.00 45.94  ? 317  VAL A C   1 
ATOM   2342 O  O   . VAL A 1 306 ? 23.545  83.497  54.260  1.00 40.57  ? 317  VAL A O   1 
ATOM   2343 C  CB  . VAL A 1 306 ? 21.947  80.857  54.212  1.00 39.44  ? 317  VAL A CB  1 
ATOM   2344 C  CG1 . VAL A 1 306 ? 22.934  79.905  54.868  1.00 39.42  ? 317  VAL A CG1 1 
ATOM   2345 C  CG2 . VAL A 1 306 ? 20.611  80.169  53.981  1.00 39.07  ? 317  VAL A CG2 1 
ATOM   2346 N  N   . ILE A 1 307 ? 23.659  82.823  56.414  1.00 42.18  ? 318  ILE A N   1 
ATOM   2347 C  CA  . ILE A 1 307 ? 24.923  83.487  56.714  1.00 40.43  ? 318  ILE A CA  1 
ATOM   2348 C  C   . ILE A 1 307 ? 25.916  82.422  57.157  1.00 40.41  ? 318  ILE A C   1 
ATOM   2349 O  O   . ILE A 1 307 ? 25.662  81.699  58.128  1.00 57.11  ? 318  ILE A O   1 
ATOM   2350 C  CB  . ILE A 1 307 ? 24.763  84.562  57.801  1.00 40.48  ? 318  ILE A CB  1 
ATOM   2351 C  CG1 . ILE A 1 307 ? 23.565  85.462  57.499  1.00 40.55  ? 318  ILE A CG1 1 
ATOM   2352 C  CG2 . ILE A 1 307 ? 26.029  85.392  57.918  1.00 41.13  ? 318  ILE A CG2 1 
ATOM   2353 C  CD1 . ILE A 1 307 ? 23.341  86.537  58.539  1.00 40.73  ? 318  ILE A CD1 1 
ATOM   2354 N  N   . HIS A 1 308 ? 27.043  82.327  56.453  1.00 41.00  ? 319  HIS A N   1 
ATOM   2355 C  CA  . HIS A 1 308 ? 28.079  81.366  56.827  1.00 46.93  ? 319  HIS A CA  1 
ATOM   2356 C  C   . HIS A 1 308 ? 29.411  81.805  56.244  1.00 42.14  ? 319  HIS A C   1 
ATOM   2357 O  O   . HIS A 1 308 ? 29.525  81.978  55.026  1.00 55.65  ? 319  HIS A O   1 
ATOM   2358 C  CB  . HIS A 1 308 ? 27.728  79.962  56.345  1.00 44.99  ? 319  HIS A CB  1 
ATOM   2359 C  CG  . HIS A 1 308 ? 28.787  78.947  56.641  1.00 43.07  ? 319  HIS A CG  1 
ATOM   2360 N  ND1 . HIS A 1 308 ? 29.562  78.369  55.659  1.00 55.93  ? 319  HIS A ND1 1 
ATOM   2361 C  CD2 . HIS A 1 308 ? 29.210  78.418  57.813  1.00 47.18  ? 319  HIS A CD2 1 
ATOM   2362 C  CE1 . HIS A 1 308 ? 30.410  77.521  56.212  1.00 54.53  ? 319  HIS A CE1 1 
ATOM   2363 N  NE2 . HIS A 1 308 ? 30.217  77.531  57.518  1.00 47.50  ? 319  HIS A NE2 1 
ATOM   2364 N  N   . ASP A 1 309 ? 30.412  81.967  57.110  1.00 42.50  ? 320  ASP A N   1 
ATOM   2365 C  CA  . ASP A 1 309 ? 31.789  82.248  56.703  1.00 55.52  ? 320  ASP A CA  1 
ATOM   2366 C  C   . ASP A 1 309 ? 31.862  83.481  55.803  1.00 54.19  ? 320  ASP A C   1 
ATOM   2367 O  O   . ASP A 1 309 ? 32.411  83.449  54.699  1.00 48.99  ? 320  ASP A O   1 
ATOM   2368 C  CB  . ASP A 1 309 ? 32.413  81.030  56.019  1.00 61.09  ? 320  ASP A CB  1 
ATOM   2369 C  CG  . ASP A 1 309 ? 33.926  81.111  55.952  1.00 76.60  ? 320  ASP A CG  1 
ATOM   2370 O  OD1 . ASP A 1 309 ? 34.513  81.917  56.705  1.00 82.33  ? 320  ASP A OD1 1 
ATOM   2371 O  OD2 . ASP A 1 309 ? 34.528  80.371  55.146  1.00 82.57  ? 320  ASP A OD2 1 
ATOM   2372 N  N   . GLY A 1 310 ? 31.294  84.582  56.289  1.00 51.81  ? 321  GLY A N   1 
ATOM   2373 C  CA  . GLY A 1 310 ? 31.310  85.821  55.539  1.00 60.06  ? 321  GLY A CA  1 
ATOM   2374 C  C   . GLY A 1 310 ? 30.522  85.809  54.251  1.00 51.80  ? 321  GLY A C   1 
ATOM   2375 O  O   . GLY A 1 310 ? 30.695  86.714  53.429  1.00 56.23  ? 321  GLY A O   1 
ATOM   2376 N  N   . GLN A 1 311 ? 29.663  84.816  54.045  1.00 50.51  ? 322  GLN A N   1 
ATOM   2377 C  CA  . GLN A 1 311 ? 28.847  84.709  52.844  1.00 50.32  ? 322  GLN A CA  1 
ATOM   2378 C  C   . GLN A 1 311 ? 27.378  84.845  53.221  1.00 62.27  ? 322  GLN A C   1 
ATOM   2379 O  O   . GLN A 1 311 ? 26.887  84.117  54.091  1.00 62.62  ? 322  GLN A O   1 
ATOM   2380 C  CB  . GLN A 1 311 ? 29.089  83.376  52.132  1.00 51.06  ? 322  GLN A CB  1 
ATOM   2381 C  CG  . GLN A 1 311 ? 30.550  83.090  51.818  1.00 66.94  ? 322  GLN A CG  1 
ATOM   2382 C  CD  . GLN A 1 311 ? 31.135  84.062  50.811  1.00 89.48  ? 322  GLN A CD  1 
ATOM   2383 O  OE1 . GLN A 1 311 ? 30.515  84.369  49.793  1.00 100.79 ? 322  GLN A OE1 1 
ATOM   2384 N  NE2 . GLN A 1 311 ? 32.337  84.553  51.093  1.00 90.66  ? 322  GLN A NE2 1 
ATOM   2385 N  N   . GLN A 1 312 ? 26.686  85.778  52.573  1.00 57.60  ? 323  GLN A N   1 
ATOM   2386 C  CA  . GLN A 1 312 ? 25.259  85.983  52.771  1.00 42.59  ? 323  GLN A CA  1 
ATOM   2387 C  C   . GLN A 1 312 ? 24.528  85.817  51.448  1.00 42.70  ? 323  GLN A C   1 
ATOM   2388 O  O   . GLN A 1 312 ? 24.997  86.282  50.404  1.00 49.48  ? 323  GLN A O   1 
ATOM   2389 C  CB  . GLN A 1 312 ? 24.959  87.369  53.350  1.00 42.98  ? 323  GLN A CB  1 
ATOM   2390 C  CG  . GLN A 1 312 ? 25.080  87.463  54.859  1.00 55.78  ? 323  GLN A CG  1 
ATOM   2391 C  CD  . GLN A 1 312 ? 23.972  88.296  55.475  1.00 61.55  ? 323  GLN A CD  1 
ATOM   2392 O  OE1 . GLN A 1 312 ? 22.797  88.125  55.147  1.00 53.19  ? 323  GLN A OE1 1 
ATOM   2393 N  NE2 . GLN A 1 312 ? 24.340  89.206  56.370  1.00 65.97  ? 323  GLN A NE2 1 
ATOM   2394 N  N   . THR A 1 313 ? 23.376  85.155  51.500  1.00 41.97  ? 324  THR A N   1 
ATOM   2395 C  CA  . THR A 1 313 ? 22.530  84.986  50.323  1.00 42.02  ? 324  THR A CA  1 
ATOM   2396 C  C   . THR A 1 313 ? 21.079  84.982  50.772  1.00 47.06  ? 324  THR A C   1 
ATOM   2397 O  O   . THR A 1 313 ? 20.671  84.109  51.544  1.00 47.45  ? 324  THR A O   1 
ATOM   2398 C  CB  . THR A 1 313 ? 22.862  83.695  49.574  1.00 41.80  ? 324  THR A CB  1 
ATOM   2399 O  OG1 . THR A 1 313 ? 24.163  83.802  48.983  1.00 58.55  ? 324  THR A OG1 1 
ATOM   2400 C  CG2 . THR A 1 313 ? 21.834  83.436  48.483  1.00 41.73  ? 324  THR A CG2 1 
ATOM   2401 N  N   . ALA A 1 314 ? 20.309  85.958  50.296  1.00 53.97  ? 325  ALA A N   1 
ATOM   2402 C  CA  . ALA A 1 314 ? 18.879  86.032  50.584  1.00 41.74  ? 325  ALA A CA  1 
ATOM   2403 C  C   . ALA A 1 314 ? 18.148  85.276  49.484  1.00 46.46  ? 325  ALA A C   1 
ATOM   2404 O  O   . ALA A 1 314 ? 17.839  85.821  48.423  1.00 50.35  ? 325  ALA A O   1 
ATOM   2405 C  CB  . ALA A 1 314 ? 18.420  87.481  50.681  1.00 42.53  ? 325  ALA A CB  1 
ATOM   2406 N  N   . PHE A 1 315 ? 17.879  83.997  49.734  1.00 44.38  ? 326  PHE A N   1 
ATOM   2407 C  CA  . PHE A 1 315 ? 17.161  83.175  48.769  1.00 43.86  ? 326  PHE A CA  1 
ATOM   2408 C  C   . PHE A 1 315 ? 15.721  83.659  48.653  1.00 52.24  ? 326  PHE A C   1 
ATOM   2409 O  O   . PHE A 1 315 ? 14.950  83.574  49.615  1.00 53.83  ? 326  PHE A O   1 
ATOM   2410 C  CB  . PHE A 1 315 ? 17.206  81.707  49.182  1.00 39.94  ? 326  PHE A CB  1 
ATOM   2411 C  CG  . PHE A 1 315 ? 18.566  81.084  49.059  1.00 39.92  ? 326  PHE A CG  1 
ATOM   2412 C  CD1 . PHE A 1 315 ? 19.033  80.651  47.829  1.00 40.17  ? 326  PHE A CD1 1 
ATOM   2413 C  CD2 . PHE A 1 315 ? 19.377  80.928  50.170  1.00 42.59  ? 326  PHE A CD2 1 
ATOM   2414 C  CE1 . PHE A 1 315 ? 20.283  80.076  47.709  1.00 49.65  ? 326  PHE A CE1 1 
ATOM   2415 C  CE2 . PHE A 1 315 ? 20.629  80.353  50.058  1.00 44.56  ? 326  PHE A CE2 1 
ATOM   2416 C  CZ  . PHE A 1 315 ? 21.083  79.926  48.825  1.00 49.61  ? 326  PHE A CZ  1 
ATOM   2417 N  N   . ASP A 1 316 ? 15.362  84.168  47.479  1.00 57.33  ? 327  ASP A N   1 
ATOM   2418 C  CA  . ASP A 1 316 ? 14.046  84.740  47.233  1.00 49.63  ? 327  ASP A CA  1 
ATOM   2419 C  C   . ASP A 1 316 ? 13.222  83.781  46.386  1.00 47.30  ? 327  ASP A C   1 
ATOM   2420 O  O   . ASP A 1 316 ? 13.711  83.254  45.381  1.00 48.06  ? 327  ASP A O   1 
ATOM   2421 C  CB  . ASP A 1 316 ? 14.166  86.102  46.546  1.00 42.83  ? 327  ASP A CB  1 
ATOM   2422 C  CG  . ASP A 1 316 ? 12.826  86.777  46.353  1.00 77.75  ? 327  ASP A CG  1 
ATOM   2423 O  OD1 . ASP A 1 316 ? 12.285  86.726  45.229  1.00 76.52  ? 327  ASP A OD1 1 
ATOM   2424 O  OD2 . ASP A 1 316 ? 12.302  87.343  47.333  1.00 89.08  ? 327  ASP A OD2 1 
ATOM   2425 N  N   . PHE A 1 317 ? 11.977  83.558  46.796  1.00 45.11  ? 328  PHE A N   1 
ATOM   2426 C  CA  . PHE A 1 317 ? 11.074  82.629  46.137  1.00 47.73  ? 328  PHE A CA  1 
ATOM   2427 C  C   . PHE A 1 317 ? 9.924   83.385  45.485  1.00 49.06  ? 328  PHE A C   1 
ATOM   2428 O  O   . PHE A 1 317 ? 9.573   84.498  45.887  1.00 52.88  ? 328  PHE A O   1 
ATOM   2429 C  CB  . PHE A 1 317 ? 10.528  81.600  47.134  1.00 52.57  ? 328  PHE A CB  1 
ATOM   2430 C  CG  . PHE A 1 317 ? 11.588  80.958  47.984  1.00 60.78  ? 328  PHE A CG  1 
ATOM   2431 C  CD1 . PHE A 1 317 ? 12.190  79.775  47.590  1.00 61.94  ? 328  PHE A CD1 1 
ATOM   2432 C  CD2 . PHE A 1 317 ? 11.985  81.540  49.178  1.00 67.57  ? 328  PHE A CD2 1 
ATOM   2433 C  CE1 . PHE A 1 317 ? 13.166  79.184  48.371  1.00 54.09  ? 328  PHE A CE1 1 
ATOM   2434 C  CE2 . PHE A 1 317 ? 12.961  80.955  49.961  1.00 64.87  ? 328  PHE A CE2 1 
ATOM   2435 C  CZ  . PHE A 1 317 ? 13.553  79.777  49.556  1.00 57.89  ? 328  PHE A CZ  1 
ATOM   2436 N  N   . THR A 1 318 ? 9.336   82.763  44.466  1.00 53.98  ? 329  THR A N   1 
ATOM   2437 C  CA  . THR A 1 318 ? 8.226   83.355  43.729  1.00 57.41  ? 329  THR A CA  1 
ATOM   2438 C  C   . THR A 1 318 ? 6.876   83.101  44.385  1.00 48.67  ? 329  THR A C   1 
ATOM   2439 O  O   . THR A 1 318 ? 5.850   83.525  43.842  1.00 46.19  ? 329  THR A O   1 
ATOM   2440 C  CB  . THR A 1 318 ? 8.201   82.824  42.293  1.00 52.16  ? 329  THR A CB  1 
ATOM   2441 O  OG1 . THR A 1 318 ? 7.731   81.471  42.292  1.00 60.21  ? 329  THR A OG1 1 
ATOM   2442 C  CG2 . THR A 1 318 ? 9.595   82.865  41.691  1.00 50.27  ? 329  THR A CG2 1 
ATOM   2443 N  N   . SER A 1 319 ? 6.849   82.421  45.528  1.00 47.27  ? 330  SER A N   1 
ATOM   2444 C  CA  . SER A 1 319 ? 5.609   82.142  46.235  1.00 47.97  ? 330  SER A CA  1 
ATOM   2445 C  C   . SER A 1 319 ? 5.897   82.123  47.730  1.00 54.99  ? 330  SER A C   1 
ATOM   2446 O  O   . SER A 1 319 ? 7.051   82.190  48.161  1.00 56.64  ? 330  SER A O   1 
ATOM   2447 C  CB  . SER A 1 319 ? 4.986   80.822  45.768  1.00 46.37  ? 330  SER A CB  1 
ATOM   2448 O  OG  . SER A 1 319 ? 5.974   79.820  45.601  1.00 41.52  ? 330  SER A OG  1 
ATOM   2449 N  N   . ARG A 1 320 ? 4.828   82.036  48.520  1.00 56.56  ? 331  ARG A N   1 
ATOM   2450 C  CA  . ARG A 1 320 ? 4.963   82.056  49.970  1.00 62.62  ? 331  ARG A CA  1 
ATOM   2451 C  C   . ARG A 1 320 ? 5.818   80.890  50.451  1.00 60.53  ? 331  ARG A C   1 
ATOM   2452 O  O   . ARG A 1 320 ? 5.867   79.825  49.830  1.00 57.85  ? 331  ARG A O   1 
ATOM   2453 C  CB  . ARG A 1 320 ? 3.592   81.986  50.644  1.00 74.72  ? 331  ARG A CB  1 
ATOM   2454 C  CG  . ARG A 1 320 ? 2.625   83.096  50.278  1.00 89.33  ? 331  ARG A CG  1 
ATOM   2455 C  CD  . ARG A 1 320 ? 1.300   82.879  50.992  1.00 101.28 ? 331  ARG A CD  1 
ATOM   2456 N  NE  . ARG A 1 320 ? 0.239   83.746  50.490  1.00 118.95 ? 331  ARG A NE  1 
ATOM   2457 C  CZ  . ARG A 1 320 ? -1.039  83.633  50.837  1.00 131.68 ? 331  ARG A CZ  1 
ATOM   2458 N  NH1 . ARG A 1 320 ? -1.414  82.686  51.686  1.00 136.44 ? 331  ARG A NH1 1 
ATOM   2459 N  NH2 . ARG A 1 320 ? -1.942  84.462  50.333  1.00 135.40 ? 331  ARG A NH2 1 
ATOM   2460 N  N   . VAL A 1 321 ? 6.497   81.100  51.573  1.00 57.91  ? 332  VAL A N   1 
ATOM   2461 C  CA  . VAL A 1 321 ? 7.250   80.052  52.248  1.00 48.85  ? 332  VAL A CA  1 
ATOM   2462 C  C   . VAL A 1 321 ? 6.364   79.508  53.361  1.00 47.10  ? 332  VAL A C   1 
ATOM   2463 O  O   . VAL A 1 321 ? 6.138   80.180  54.373  1.00 56.84  ? 332  VAL A O   1 
ATOM   2464 C  CB  . VAL A 1 321 ? 8.584   80.571  52.798  1.00 40.52  ? 332  VAL A CB  1 
ATOM   2465 C  CG1 . VAL A 1 321 ? 9.371   79.432  53.426  1.00 39.93  ? 332  VAL A CG1 1 
ATOM   2466 C  CG2 . VAL A 1 321 ? 9.390   81.239  51.696  1.00 40.46  ? 332  VAL A CG2 1 
ATOM   2467 N  N   . ILE A 1 322 ? 5.853   78.294  53.174  1.00 43.25  ? 333  ILE A N   1 
ATOM   2468 C  CA  . ILE A 1 322 ? 4.947   77.689  54.142  1.00 58.94  ? 333  ILE A CA  1 
ATOM   2469 C  C   . ILE A 1 322 ? 5.684   76.602  54.912  1.00 65.66  ? 333  ILE A C   1 
ATOM   2470 O  O   . ILE A 1 322 ? 5.089   75.596  55.314  1.00 77.46  ? 333  ILE A O   1 
ATOM   2471 C  CB  . ILE A 1 322 ? 3.690   77.131  53.452  1.00 59.04  ? 333  ILE A CB  1 
ATOM   2472 C  CG1 . ILE A 1 322 ? 4.086   76.162  52.339  1.00 59.15  ? 333  ILE A CG1 1 
ATOM   2473 C  CG2 . ILE A 1 322 ? 2.841   78.265  52.898  1.00 71.78  ? 333  ILE A CG2 1 
ATOM   2474 C  CD1 . ILE A 1 322 ? 2.963   75.833  51.404  1.00 54.57  ? 333  ILE A CD1 1 
ATOM   2475 N  N   . GLY A 1 323 ? 6.976   76.800  55.121  1.00 59.35  ? 334  GLY A N   1 
ATOM   2476 C  CA  . GLY A 1 323 ? 7.794   75.869  55.879  1.00 47.83  ? 334  GLY A CA  1 
ATOM   2477 C  C   . GLY A 1 323 ? 9.138   75.630  55.221  1.00 39.67  ? 334  GLY A C   1 
ATOM   2478 O  O   . GLY A 1 323 ? 9.274   75.630  53.997  1.00 47.77  ? 334  GLY A O   1 
ATOM   2479 N  N   . PHE A 1 324 ? 10.158  75.428  56.050  1.00 47.76  ? 335  PHE A N   1 
ATOM   2480 C  CA  . PHE A 1 324 ? 11.490  75.102  55.563  1.00 40.85  ? 335  PHE A CA  1 
ATOM   2481 C  C   . PHE A 1 324 ? 12.243  74.385  56.672  1.00 43.12  ? 335  PHE A C   1 
ATOM   2482 O  O   . PHE A 1 324 ? 11.932  74.534  57.856  1.00 46.17  ? 335  PHE A O   1 
ATOM   2483 C  CB  . PHE A 1 324 ? 12.252  76.351  55.103  1.00 47.04  ? 335  PHE A CB  1 
ATOM   2484 C  CG  . PHE A 1 324 ? 12.754  77.210  56.230  1.00 38.77  ? 335  PHE A CG  1 
ATOM   2485 C  CD1 . PHE A 1 324 ? 14.076  77.138  56.637  1.00 38.55  ? 335  PHE A CD1 1 
ATOM   2486 C  CD2 . PHE A 1 324 ? 11.906  78.092  56.878  1.00 39.11  ? 335  PHE A CD2 1 
ATOM   2487 C  CE1 . PHE A 1 324 ? 14.542  77.926  57.671  1.00 41.69  ? 335  PHE A CE1 1 
ATOM   2488 C  CE2 . PHE A 1 324 ? 12.366  78.883  57.912  1.00 43.63  ? 335  PHE A CE2 1 
ATOM   2489 C  CZ  . PHE A 1 324 ? 13.686  78.800  58.310  1.00 48.35  ? 335  PHE A CZ  1 
ATOM   2490 N  N   . THR A 1 325 ? 13.237  73.599  56.270  1.00 44.37  ? 336  THR A N   1 
ATOM   2491 C  CA  . THR A 1 325 ? 14.066  72.872  57.218  1.00 38.93  ? 336  THR A CA  1 
ATOM   2492 C  C   . THR A 1 325 ? 15.484  72.802  56.673  1.00 38.73  ? 336  THR A C   1 
ATOM   2493 O  O   . THR A 1 325 ? 15.737  73.090  55.501  1.00 70.64  ? 336  THR A O   1 
ATOM   2494 C  CB  . THR A 1 325 ? 13.521  71.466  57.486  1.00 39.37  ? 336  THR A CB  1 
ATOM   2495 O  OG1 . THR A 1 325 ? 14.197  70.898  58.615  1.00 39.91  ? 336  THR A OG1 1 
ATOM   2496 C  CG2 . THR A 1 325 ? 13.739  70.574  56.275  1.00 39.38  ? 336  THR A CG2 1 
ATOM   2497 N  N   . VAL A 1 326 ? 16.414  72.419  57.543  1.00 46.93  ? 337  VAL A N   1 
ATOM   2498 C  CA  . VAL A 1 326 ? 17.819  72.280  57.184  1.00 63.93  ? 337  VAL A CA  1 
ATOM   2499 C  C   . VAL A 1 326 ? 18.270  70.880  57.569  1.00 39.35  ? 337  VAL A C   1 
ATOM   2500 O  O   . VAL A 1 326 ? 18.209  70.506  58.746  1.00 45.64  ? 337  VAL A O   1 
ATOM   2501 C  CB  . VAL A 1 326 ? 18.702  73.338  57.867  1.00 38.75  ? 337  VAL A CB  1 
ATOM   2502 C  CG1 . VAL A 1 326 ? 20.135  73.196  57.397  1.00 38.92  ? 337  VAL A CG1 1 
ATOM   2503 C  CG2 . VAL A 1 326 ? 18.179  74.735  57.576  1.00 38.46  ? 337  VAL A CG2 1 
ATOM   2504 N  N   . LEU A 1 327 ? 18.719  70.110  56.583  1.00 41.98  ? 338  LEU A N   1 
ATOM   2505 C  CA  . LEU A 1 327 ? 19.216  68.765  56.833  1.00 48.00  ? 338  LEU A CA  1 
ATOM   2506 C  C   . LEU A 1 327 ? 20.627  68.833  57.402  1.00 54.82  ? 338  LEU A C   1 
ATOM   2507 O  O   . LEU A 1 327 ? 21.505  69.489  56.834  1.00 57.90  ? 338  LEU A O   1 
ATOM   2508 C  CB  . LEU A 1 327 ? 19.197  67.940  55.546  1.00 41.05  ? 338  LEU A CB  1 
ATOM   2509 C  CG  . LEU A 1 327 ? 17.915  67.175  55.197  1.00 51.72  ? 338  LEU A CG  1 
ATOM   2510 C  CD1 . LEU A 1 327 ? 16.687  68.072  55.231  1.00 53.09  ? 338  LEU A CD1 1 
ATOM   2511 C  CD2 . LEU A 1 327 ? 18.050  66.518  53.834  1.00 42.56  ? 338  LEU A CD2 1 
ATOM   2512 N  N   . THR A 1 328 ? 20.841  68.160  58.528  1.00 54.44  ? 339  THR A N   1 
ATOM   2513 C  CA  . THR A 1 328 ? 22.122  68.166  59.217  1.00 52.00  ? 339  THR A CA  1 
ATOM   2514 C  C   . THR A 1 328 ? 22.659  66.747  59.331  1.00 55.36  ? 339  THR A C   1 
ATOM   2515 O  O   . THR A 1 328 ? 21.898  65.787  59.483  1.00 62.81  ? 339  THR A O   1 
ATOM   2516 C  CB  . THR A 1 328 ? 22.003  68.783  60.618  1.00 57.33  ? 339  THR A CB  1 
ATOM   2517 O  OG1 . THR A 1 328 ? 21.086  68.012  61.405  1.00 73.04  ? 339  THR A OG1 1 
ATOM   2518 C  CG2 . THR A 1 328 ? 21.507  70.219  60.531  1.00 46.31  ? 339  THR A CG2 1 
ATOM   2519 N  N   . GLU A 1 329 ? 23.987  66.624  59.263  1.00 42.80  ? 340  GLU A N   1 
ATOM   2520 C  CA  . GLU A 1 329 ? 24.643  65.332  59.428  1.00 43.91  ? 340  GLU A CA  1 
ATOM   2521 C  C   . GLU A 1 329 ? 24.527  64.787  60.844  1.00 44.47  ? 340  GLU A C   1 
ATOM   2522 O  O   . GLU A 1 329 ? 24.925  63.641  61.081  1.00 53.85  ? 340  GLU A O   1 
ATOM   2523 C  CB  . GLU A 1 329 ? 26.125  65.435  59.062  1.00 64.25  ? 340  GLU A CB  1 
ATOM   2524 C  CG  . GLU A 1 329 ? 26.412  65.838  57.628  1.00 78.63  ? 340  GLU A CG  1 
ATOM   2525 C  CD  . GLU A 1 329 ? 27.899  65.862  57.326  1.00 79.64  ? 340  GLU A CD  1 
ATOM   2526 O  OE1 . GLU A 1 329 ? 28.694  65.492  58.217  1.00 78.23  ? 340  GLU A OE1 1 
ATOM   2527 O  OE2 . GLU A 1 329 ? 28.274  66.250  56.200  1.00 79.23  ? 340  GLU A OE2 1 
ATOM   2528 N  N   . ALA A 1 330 ? 23.993  65.567  61.776  1.00 47.36  ? 341  ALA A N   1 
ATOM   2529 C  CA  . ALA A 1 330 ? 24.061  65.259  63.194  1.00 56.10  ? 341  ALA A CA  1 
ATOM   2530 C  C   . ALA A 1 330 ? 22.813  64.537  63.684  1.00 65.31  ? 341  ALA A C   1 
ATOM   2531 O  O   . ALA A 1 330 ? 21.715  64.705  63.147  1.00 71.64  ? 341  ALA A O   1 
ATOM   2532 C  CB  . ALA A 1 330 ? 24.250  66.539  64.008  1.00 43.73  ? 341  ALA A CB  1 
ATOM   2533 N  N   . ASP A 1 331 ? 23.004  63.727  64.712  1.00 60.82  ? 342  ASP A N   1 
ATOM   2534 C  CA  . ASP A 1 331 ? 21.948  63.207  65.562  1.00 52.72  ? 342  ASP A CA  1 
ATOM   2535 C  C   . ASP A 1 331 ? 21.898  64.021  66.848  1.00 66.66  ? 342  ASP A C   1 
ATOM   2536 O  O   . ASP A 1 331 ? 22.804  64.809  67.130  1.00 69.84  ? 342  ASP A O   1 
ATOM   2537 C  CB  . ASP A 1 331 ? 22.196  61.723  65.854  1.00 50.07  ? 342  ASP A CB  1 
ATOM   2538 C  CG  . ASP A 1 331 ? 23.311  61.499  66.855  1.00 70.41  ? 342  ASP A CG  1 
ATOM   2539 O  OD1 . ASP A 1 331 ? 24.341  62.198  66.771  1.00 86.95  ? 342  ASP A OD1 1 
ATOM   2540 O  OD2 . ASP A 1 331 ? 23.155  60.620  67.729  1.00 81.91  ? 342  ASP A OD2 1 
ATOM   2541 N  N   . PRO A 1 332 ? 20.831  63.875  67.658  1.00 60.42  ? 343  PRO A N   1 
ATOM   2542 C  CA  . PRO A 1 332 ? 20.731  64.678  68.888  1.00 58.66  ? 343  PRO A CA  1 
ATOM   2543 C  C   . PRO A 1 332 ? 21.930  64.569  69.824  1.00 52.13  ? 343  PRO A C   1 
ATOM   2544 O  O   . PRO A 1 332 ? 22.101  65.414  70.708  1.00 49.97  ? 343  PRO A O   1 
ATOM   2545 C  CB  . PRO A 1 332 ? 19.464  64.128  69.553  1.00 46.80  ? 343  PRO A CB  1 
ATOM   2546 C  CG  . PRO A 1 332 ? 18.627  63.689  68.416  1.00 46.69  ? 343  PRO A CG  1 
ATOM   2547 C  CD  . PRO A 1 332 ? 19.579  63.143  67.387  1.00 62.69  ? 343  PRO A CD  1 
ATOM   2548 N  N   . ALA A 1 333 ? 22.768  63.551  69.640  1.00 47.58  ? 344  ALA A N   1 
ATOM   2549 C  CA  . ALA A 1 333 ? 23.923  63.330  70.499  1.00 54.68  ? 344  ALA A CA  1 
ATOM   2550 C  C   . ALA A 1 333 ? 25.237  63.784  69.876  1.00 59.60  ? 344  ALA A C   1 
ATOM   2551 O  O   . ALA A 1 333 ? 26.273  63.725  70.545  1.00 65.32  ? 344  ALA A O   1 
ATOM   2552 C  CB  . ALA A 1 333 ? 24.019  61.849  70.878  1.00 56.92  ? 344  ALA A CB  1 
ATOM   2553 N  N   . ALA A 1 334 ? 25.227  64.234  68.623  1.00 61.15  ? 345  ALA A N   1 
ATOM   2554 C  CA  . ALA A 1 334 ? 26.460  64.641  67.966  1.00 53.66  ? 345  ALA A CA  1 
ATOM   2555 C  C   . ALA A 1 334 ? 26.954  65.977  68.515  1.00 47.15  ? 345  ALA A C   1 
ATOM   2556 O  O   . ALA A 1 334 ? 26.213  66.739  69.142  1.00 51.58  ? 345  ALA A O   1 
ATOM   2557 C  CB  . ALA A 1 334 ? 26.259  64.740  66.455  1.00 46.36  ? 345  ALA A CB  1 
ATOM   2558 N  N   . THR A 1 335 ? 28.233  66.260  68.259  1.00 46.33  ? 346  THR A N   1 
ATOM   2559 C  CA  . THR A 1 335 ? 28.843  67.481  68.776  1.00 45.76  ? 346  THR A CA  1 
ATOM   2560 C  C   . THR A 1 335 ? 28.446  68.698  67.950  1.00 44.54  ? 346  THR A C   1 
ATOM   2561 O  O   . THR A 1 335 ? 28.063  69.735  68.504  1.00 63.27  ? 346  THR A O   1 
ATOM   2562 C  CB  . THR A 1 335 ? 30.365  67.335  68.816  1.00 46.59  ? 346  THR A CB  1 
ATOM   2563 O  OG1 . THR A 1 335 ? 30.722  66.258  69.692  1.00 47.84  ? 346  THR A OG1 1 
ATOM   2564 C  CG2 . THR A 1 335 ? 31.010  68.616  69.319  1.00 56.36  ? 346  THR A CG2 1 
ATOM   2565 N  N   . PHE A 1 336 ? 28.526  68.593  66.626  1.00 45.35  ? 347  PHE A N   1 
ATOM   2566 C  CA  . PHE A 1 336 ? 28.244  69.708  65.736  1.00 60.36  ? 347  PHE A CA  1 
ATOM   2567 C  C   . PHE A 1 336 ? 27.085  69.366  64.810  1.00 56.38  ? 347  PHE A C   1 
ATOM   2568 O  O   . PHE A 1 336 ? 26.847  68.198  64.491  1.00 63.62  ? 347  PHE A O   1 
ATOM   2569 C  CB  . PHE A 1 336 ? 29.476  70.078  64.902  1.00 43.72  ? 347  PHE A CB  1 
ATOM   2570 C  CG  . PHE A 1 336 ? 30.731  70.237  65.710  1.00 64.73  ? 347  PHE A CG  1 
ATOM   2571 C  CD1 . PHE A 1 336 ? 30.887  71.312  66.570  1.00 66.16  ? 347  PHE A CD1 1 
ATOM   2572 C  CD2 . PHE A 1 336 ? 31.760  69.316  65.603  1.00 51.61  ? 347  PHE A CD2 1 
ATOM   2573 C  CE1 . PHE A 1 336 ? 32.042  71.461  67.312  1.00 60.90  ? 347  PHE A CE1 1 
ATOM   2574 C  CE2 . PHE A 1 336 ? 32.918  69.462  66.342  1.00 46.21  ? 347  PHE A CE2 1 
ATOM   2575 C  CZ  . PHE A 1 336 ? 33.060  70.536  67.197  1.00 45.70  ? 347  PHE A CZ  1 
ATOM   2576 N  N   . ASP A 1 337 ? 26.370  70.406  64.375  1.00 54.73  ? 348  ASP A N   1 
ATOM   2577 C  CA  . ASP A 1 337 ? 25.245  70.223  63.461  1.00 41.72  ? 348  ASP A CA  1 
ATOM   2578 C  C   . ASP A 1 337 ? 25.718  69.744  62.093  1.00 53.83  ? 348  ASP A C   1 
ATOM   2579 O  O   . ASP A 1 337 ? 25.283  68.695  61.603  1.00 53.52  ? 348  ASP A O   1 
ATOM   2580 C  CB  . ASP A 1 337 ? 24.462  71.532  63.328  1.00 40.86  ? 348  ASP A CB  1 
ATOM   2581 C  CG  . ASP A 1 337 ? 23.558  71.796  64.513  1.00 59.61  ? 348  ASP A CG  1 
ATOM   2582 O  OD1 . ASP A 1 337 ? 22.667  70.961  64.777  1.00 57.97  ? 348  ASP A OD1 1 
ATOM   2583 O  OD2 . ASP A 1 337 ? 23.742  72.834  65.184  1.00 57.68  ? 348  ASP A OD2 1 
ATOM   2584 N  N   . ASP A 1 338 ? 26.609  70.512  61.460  1.00 59.92  ? 349  ASP A N   1 
ATOM   2585 C  CA  . ASP A 1 338 ? 27.123  70.249  60.120  1.00 57.19  ? 349  ASP A CA  1 
ATOM   2586 C  C   . ASP A 1 338 ? 25.983  70.110  59.117  1.00 49.71  ? 349  ASP A C   1 
ATOM   2587 O  O   . ASP A 1 338 ? 25.672  68.995  58.680  1.00 45.11  ? 349  ASP A O   1 
ATOM   2588 C  CB  . ASP A 1 338 ? 27.998  68.993  60.110  1.00 59.19  ? 349  ASP A CB  1 
ATOM   2589 C  CG  . ASP A 1 338 ? 29.363  69.231  60.722  1.00 58.54  ? 349  ASP A CG  1 
ATOM   2590 O  OD1 . ASP A 1 338 ? 29.917  70.334  60.528  1.00 58.82  ? 349  ASP A OD1 1 
ATOM   2591 O  OD2 . ASP A 1 338 ? 29.882  68.315  61.395  1.00 57.14  ? 349  ASP A OD2 1 
ATOM   2592 N  N   . PRO A 1 339 ? 25.339  71.208  58.730  1.00 49.40  ? 350  PRO A N   1 
ATOM   2593 C  CA  . PRO A 1 339 ? 24.275  71.126  57.726  1.00 53.94  ? 350  PRO A CA  1 
ATOM   2594 C  C   . PRO A 1 339 ? 24.850  70.877  56.341  1.00 53.84  ? 350  PRO A C   1 
ATOM   2595 O  O   . PRO A 1 339 ? 26.057  70.966  56.107  1.00 63.87  ? 350  PRO A O   1 
ATOM   2596 C  CB  . PRO A 1 339 ? 23.599  72.495  57.816  1.00 54.04  ? 350  PRO A CB  1 
ATOM   2597 C  CG  . PRO A 1 339 ? 24.679  73.403  58.278  1.00 42.11  ? 350  PRO A CG  1 
ATOM   2598 C  CD  . PRO A 1 339 ? 25.548  72.589  59.201  1.00 54.69  ? 350  PRO A CD  1 
ATOM   2599 N  N   . TYR A 1 340 ? 23.954  70.560  55.407  1.00 48.66  ? 351  TYR A N   1 
ATOM   2600 C  CA  . TYR A 1 340 ? 24.378  70.282  54.040  1.00 46.65  ? 351  TYR A CA  1 
ATOM   2601 C  C   . TYR A 1 340 ? 23.250  70.496  53.039  1.00 44.27  ? 351  TYR A C   1 
ATOM   2602 O  O   . TYR A 1 340 ? 23.477  70.443  51.826  1.00 57.69  ? 351  TYR A O   1 
ATOM   2603 C  CB  . TYR A 1 340 ? 24.920  68.854  53.930  1.00 46.34  ? 351  TYR A CB  1 
ATOM   2604 C  CG  . TYR A 1 340 ? 23.911  67.762  54.212  1.00 45.55  ? 351  TYR A CG  1 
ATOM   2605 C  CD1 . TYR A 1 340 ? 23.207  67.159  53.178  1.00 45.09  ? 351  TYR A CD1 1 
ATOM   2606 C  CD2 . TYR A 1 340 ? 23.676  67.322  55.509  1.00 45.28  ? 351  TYR A CD2 1 
ATOM   2607 C  CE1 . TYR A 1 340 ? 22.289  66.157  53.426  1.00 43.94  ? 351  TYR A CE1 1 
ATOM   2608 C  CE2 . TYR A 1 340 ? 22.759  66.319  55.767  1.00 48.17  ? 351  TYR A CE2 1 
ATOM   2609 C  CZ  . TYR A 1 340 ? 22.069  65.740  54.721  1.00 47.62  ? 351  TYR A CZ  1 
ATOM   2610 O  OH  . TYR A 1 340 ? 21.156  64.741  54.968  1.00 42.56  ? 351  TYR A OH  1 
ATOM   2611 N  N   . ALA A 1 341 ? 22.036  70.742  53.526  1.00 44.73  ? 352  ALA A N   1 
ATOM   2612 C  CA  . ALA A 1 341 ? 20.893  70.910  52.641  1.00 48.45  ? 352  ALA A CA  1 
ATOM   2613 C  C   . ALA A 1 341 ? 19.876  71.839  53.283  1.00 56.79  ? 352  ALA A C   1 
ATOM   2614 O  O   . ALA A 1 341 ? 19.670  71.802  54.499  1.00 63.97  ? 352  ALA A O   1 
ATOM   2615 C  CB  . ALA A 1 341 ? 20.239  69.564  52.310  1.00 45.55  ? 352  ALA A CB  1 
ATOM   2616 N  N   . LEU A 1 342 ? 19.243  72.667  52.455  1.00 56.42  ? 353  LEU A N   1 
ATOM   2617 C  CA  . LEU A 1 342 ? 18.158  73.548  52.875  1.00 41.52  ? 353  LEU A CA  1 
ATOM   2618 C  C   . LEU A 1 342 ? 16.928  73.203  52.047  1.00 38.50  ? 353  LEU A C   1 
ATOM   2619 O  O   . LEU A 1 342 ? 16.868  73.520  50.854  1.00 54.01  ? 353  LEU A O   1 
ATOM   2620 C  CB  . LEU A 1 342 ? 18.540  75.018  52.706  1.00 38.50  ? 353  LEU A CB  1 
ATOM   2621 C  CG  . LEU A 1 342 ? 17.403  76.029  52.879  1.00 42.28  ? 353  LEU A CG  1 
ATOM   2622 C  CD1 . LEU A 1 342 ? 16.822  75.962  54.283  1.00 38.28  ? 353  LEU A CD1 1 
ATOM   2623 C  CD2 . LEU A 1 342 ? 17.875  77.438  52.553  1.00 44.58  ? 353  LEU A CD2 1 
ATOM   2624 N  N   . VAL A 1 343 ? 15.954  72.551  52.675  1.00 43.99  ? 354  VAL A N   1 
ATOM   2625 C  CA  . VAL A 1 343 ? 14.708  72.169  52.022  1.00 41.05  ? 354  VAL A CA  1 
ATOM   2626 C  C   . VAL A 1 343 ? 13.669  73.239  52.322  1.00 41.37  ? 354  VAL A C   1 
ATOM   2627 O  O   . VAL A 1 343 ? 13.350  73.494  53.489  1.00 46.66  ? 354  VAL A O   1 
ATOM   2628 C  CB  . VAL A 1 343 ? 14.230  70.786  52.491  1.00 38.86  ? 354  VAL A CB  1 
ATOM   2629 C  CG1 . VAL A 1 343 ? 12.922  70.415  51.810  1.00 38.97  ? 354  VAL A CG1 1 
ATOM   2630 C  CG2 . VAL A 1 343 ? 15.297  69.739  52.219  1.00 40.47  ? 354  VAL A CG2 1 
ATOM   2631 N  N   . VAL A 1 344 ? 13.143  73.869  51.275  1.00 38.47  ? 355  VAL A N   1 
ATOM   2632 C  CA  . VAL A 1 344 ? 12.148  74.928  51.408  1.00 41.77  ? 355  VAL A CA  1 
ATOM   2633 C  C   . VAL A 1 344 ? 10.899  74.510  50.648  1.00 38.78  ? 355  VAL A C   1 
ATOM   2634 O  O   . VAL A 1 344 ? 10.936  74.345  49.423  1.00 46.49  ? 355  VAL A O   1 
ATOM   2635 C  CB  . VAL A 1 344 ? 12.670  76.277  50.892  1.00 53.09  ? 355  VAL A CB  1 
ATOM   2636 C  CG1 . VAL A 1 344 ? 11.581  77.331  51.007  1.00 53.93  ? 355  VAL A CG1 1 
ATOM   2637 C  CG2 . VAL A 1 344 ? 13.910  76.696  51.663  1.00 55.82  ? 355  VAL A CG2 1 
ATOM   2638 N  N   . LEU A 1 345 ? 9.795   74.349  51.373  1.00 39.06  ? 356  LEU A N   1 
ATOM   2639 C  CA  . LEU A 1 345 ? 8.504   74.020  50.774  1.00 51.11  ? 356  LEU A CA  1 
ATOM   2640 C  C   . LEU A 1 345 ? 7.766   75.323  50.493  1.00 50.20  ? 356  LEU A C   1 
ATOM   2641 O  O   . LEU A 1 345 ? 7.112   75.884  51.375  1.00 42.87  ? 356  LEU A O   1 
ATOM   2642 C  CB  . LEU A 1 345 ? 7.697   73.110  51.693  1.00 39.77  ? 356  LEU A CB  1 
ATOM   2643 C  CG  . LEU A 1 345 ? 6.273   72.784  51.240  1.00 40.28  ? 356  LEU A CG  1 
ATOM   2644 C  CD1 . LEU A 1 345 ? 6.291   71.956  49.968  1.00 40.15  ? 356  LEU A CD1 1 
ATOM   2645 C  CD2 . LEU A 1 345 ? 5.506   72.072  52.343  1.00 41.42  ? 356  LEU A CD2 1 
ATOM   2646 N  N   . ALA A 1 346 ? 7.881   75.816  49.264  1.00 55.10  ? 357  ALA A N   1 
ATOM   2647 C  CA  . ALA A 1 346 ? 7.145   77.005  48.876  1.00 50.38  ? 357  ALA A CA  1 
ATOM   2648 C  C   . ALA A 1 346 ? 5.686   76.652  48.596  1.00 63.86  ? 357  ALA A C   1 
ATOM   2649 O  O   . ALA A 1 346 ? 5.310   75.483  48.479  1.00 68.94  ? 357  ALA A O   1 
ATOM   2650 C  CB  . ALA A 1 346 ? 7.785   77.662  47.654  1.00 57.35  ? 357  ALA A CB  1 
ATOM   2651 N  N   . GLU A 1 347 ? 4.854   77.690  48.490  1.00 67.58  ? 358  GLU A N   1 
ATOM   2652 C  CA  . GLU A 1 347 ? 3.435   77.481  48.230  1.00 57.72  ? 358  GLU A CA  1 
ATOM   2653 C  C   . GLU A 1 347 ? 3.189   76.862  46.860  1.00 49.41  ? 358  GLU A C   1 
ATOM   2654 O  O   . GLU A 1 347 ? 2.128   76.266  46.641  1.00 52.91  ? 358  GLU A O   1 
ATOM   2655 C  CB  . GLU A 1 347 ? 2.682   78.808  48.367  1.00 60.20  ? 358  GLU A CB  1 
ATOM   2656 C  CG  . GLU A 1 347 ? 1.166   78.700  48.280  1.00 73.02  ? 358  GLU A CG  1 
ATOM   2657 C  CD  . GLU A 1 347 ? 0.463   79.944  48.790  1.00 90.68  ? 358  GLU A CD  1 
ATOM   2658 O  OE1 . GLU A 1 347 ? 0.059   79.957  49.973  1.00 93.94  ? 358  GLU A OE1 1 
ATOM   2659 O  OE2 . GLU A 1 347 ? 0.323   80.911  48.013  1.00 89.83  ? 358  GLU A OE2 1 
ATOM   2660 N  N   . GLU A 1 348 ? 4.151   76.968  45.943  1.00 54.96  ? 359  GLU A N   1 
ATOM   2661 C  CA  . GLU A 1 348 ? 3.994   76.448  44.594  1.00 55.70  ? 359  GLU A CA  1 
ATOM   2662 C  C   . GLU A 1 348 ? 5.075   75.463  44.172  1.00 56.07  ? 359  GLU A C   1 
ATOM   2663 O  O   . GLU A 1 348 ? 4.908   74.805  43.139  1.00 68.34  ? 359  GLU A O   1 
ATOM   2664 C  CB  . GLU A 1 348 ? 3.955   77.603  43.579  1.00 52.86  ? 359  GLU A CB  1 
ATOM   2665 C  CG  . GLU A 1 348 ? 2.826   78.598  43.805  1.00 52.07  ? 359  GLU A CG  1 
ATOM   2666 C  CD  . GLU A 1 348 ? 1.457   78.005  43.531  1.00 60.09  ? 359  GLU A CD  1 
ATOM   2667 O  OE1 . GLU A 1 348 ? 1.368   77.053  42.727  1.00 53.95  ? 359  GLU A OE1 1 
ATOM   2668 O  OE2 . GLU A 1 348 ? 0.469   78.492  44.122  1.00 61.06  ? 359  GLU A OE2 1 
ATOM   2669 N  N   . GLU A 1 349 ? 6.164   75.332  44.926  1.00 60.14  ? 360  GLU A N   1 
ATOM   2670 C  CA  . GLU A 1 349 ? 7.262   74.469  44.508  1.00 49.86  ? 360  GLU A CA  1 
ATOM   2671 C  C   . GLU A 1 349 ? 8.072   74.049  45.726  1.00 46.52  ? 360  GLU A C   1 
ATOM   2672 O  O   . GLU A 1 349 ? 7.865   74.537  46.838  1.00 52.94  ? 360  GLU A O   1 
ATOM   2673 C  CB  . GLU A 1 349 ? 8.151   75.168  43.475  1.00 53.62  ? 360  GLU A CB  1 
ATOM   2674 C  CG  . GLU A 1 349 ? 8.675   76.522  43.923  1.00 61.16  ? 360  GLU A CG  1 
ATOM   2675 C  CD  . GLU A 1 349 ? 9.426   77.248  42.825  1.00 74.28  ? 360  GLU A CD  1 
ATOM   2676 O  OE1 . GLU A 1 349 ? 9.720   76.617  41.788  1.00 76.02  ? 360  GLU A OE1 1 
ATOM   2677 O  OE2 . GLU A 1 349 ? 9.719   78.450  42.997  1.00 80.06  ? 360  GLU A OE2 1 
ATOM   2678 N  N   . LEU A 1 350 ? 9.002   73.124  45.494  1.00 43.46  ? 361  LEU A N   1 
ATOM   2679 C  CA  . LEU A 1 350 ? 9.933   72.652  46.510  1.00 40.90  ? 361  LEU A CA  1 
ATOM   2680 C  C   . LEU A 1 350 ? 11.354  72.922  46.037  1.00 45.95  ? 361  LEU A C   1 
ATOM   2681 O  O   . LEU A 1 350 ? 11.719  72.554  44.916  1.00 53.78  ? 361  LEU A O   1 
ATOM   2682 C  CB  . LEU A 1 350 ? 9.741   71.160  46.789  1.00 39.02  ? 361  LEU A CB  1 
ATOM   2683 C  CG  . LEU A 1 350 ? 10.662  70.567  47.857  1.00 42.53  ? 361  LEU A CG  1 
ATOM   2684 C  CD1 . LEU A 1 350 ? 10.330  71.135  49.227  1.00 39.43  ? 361  LEU A CD1 1 
ATOM   2685 C  CD2 . LEU A 1 350 ? 10.580  69.052  47.866  1.00 48.87  ? 361  LEU A CD2 1 
ATOM   2686 N  N   . VAL A 1 351 ? 12.150  73.562  46.890  1.00 38.66  ? 362  VAL A N   1 
ATOM   2687 C  CA  . VAL A 1 351 ? 13.513  73.958  46.558  1.00 52.20  ? 362  VAL A CA  1 
ATOM   2688 C  C   . VAL A 1 351 ? 14.470  73.317  47.552  1.00 54.68  ? 362  VAL A C   1 
ATOM   2689 O  O   . VAL A 1 351 ? 14.211  73.309  48.761  1.00 44.70  ? 362  VAL A O   1 
ATOM   2690 C  CB  . VAL A 1 351 ? 13.670  75.494  46.559  1.00 43.98  ? 362  VAL A CB  1 
ATOM   2691 C  CG1 . VAL A 1 351 ? 15.082  75.890  46.149  1.00 38.92  ? 362  VAL A CG1 1 
ATOM   2692 C  CG2 . VAL A 1 351 ? 12.642  76.134  45.638  1.00 39.00  ? 362  VAL A CG2 1 
ATOM   2693 N  N   . VAL A 1 352 ? 15.573  72.776  47.039  1.00 38.72  ? 363  VAL A N   1 
ATOM   2694 C  CA  . VAL A 1 352 ? 16.628  72.186  47.856  1.00 38.81  ? 363  VAL A CA  1 
ATOM   2695 C  C   . VAL A 1 352 ? 17.950  72.816  47.438  1.00 54.68  ? 363  VAL A C   1 
ATOM   2696 O  O   . VAL A 1 352 ? 18.310  72.784  46.255  1.00 50.28  ? 363  VAL A O   1 
ATOM   2697 C  CB  . VAL A 1 352 ? 16.688  70.656  47.713  1.00 39.04  ? 363  VAL A CB  1 
ATOM   2698 C  CG1 . VAL A 1 352 ? 17.811  70.089  48.567  1.00 44.55  ? 363  VAL A CG1 1 
ATOM   2699 C  CG2 . VAL A 1 352 ? 15.355  70.033  48.100  1.00 38.97  ? 363  VAL A CG2 1 
ATOM   2700 N  N   . ILE A 1 353 ? 18.670  73.384  48.403  1.00 44.82  ? 364  ILE A N   1 
ATOM   2701 C  CA  . ILE A 1 353 ? 19.925  74.086  48.156  1.00 39.36  ? 364  ILE A CA  1 
ATOM   2702 C  C   . ILE A 1 353 ? 21.054  73.317  48.829  1.00 54.51  ? 364  ILE A C   1 
ATOM   2703 O  O   . ILE A 1 353 ? 20.954  72.962  50.009  1.00 55.99  ? 364  ILE A O   1 
ATOM   2704 C  CB  . ILE A 1 353 ? 19.868  75.537  48.665  1.00 39.26  ? 364  ILE A CB  1 
ATOM   2705 C  CG1 . ILE A 1 353 ? 18.741  76.303  47.969  1.00 58.16  ? 364  ILE A CG1 1 
ATOM   2706 C  CG2 . ILE A 1 353 ? 21.201  76.236  48.445  1.00 39.74  ? 364  ILE A CG2 1 
ATOM   2707 C  CD1 . ILE A 1 353 ? 18.914  76.416  46.470  1.00 52.88  ? 364  ILE A CD1 1 
ATOM   2708 N  N   . ASP A 1 354 ? 22.125  73.065  48.078  1.00 47.19  ? 365  ASP A N   1 
ATOM   2709 C  CA  . ASP A 1 354 ? 23.297  72.366  48.597  1.00 40.70  ? 365  ASP A CA  1 
ATOM   2710 C  C   . ASP A 1 354 ? 24.124  73.343  49.425  1.00 49.83  ? 365  ASP A C   1 
ATOM   2711 O  O   . ASP A 1 354 ? 24.764  74.245  48.876  1.00 50.10  ? 365  ASP A O   1 
ATOM   2712 C  CB  . ASP A 1 354 ? 24.112  71.782  47.446  1.00 54.12  ? 365  ASP A CB  1 
ATOM   2713 C  CG  . ASP A 1 354 ? 25.290  70.942  47.917  1.00 70.11  ? 365  ASP A CG  1 
ATOM   2714 O  OD1 . ASP A 1 354 ? 25.548  70.880  49.138  1.00 81.19  ? 365  ASP A OD1 1 
ATOM   2715 O  OD2 . ASP A 1 354 ? 25.960  70.335  47.056  1.00 73.32  ? 365  ASP A OD2 1 
ATOM   2716 N  N   . LEU A 1 355 ? 24.125  73.158  50.745  1.00 50.08  ? 366  LEU A N   1 
ATOM   2717 C  CA  . LEU A 1 355 ? 24.856  74.049  51.636  1.00 40.64  ? 366  LEU A CA  1 
ATOM   2718 C  C   . LEU A 1 355 ? 26.330  73.688  51.773  1.00 41.41  ? 366  LEU A C   1 
ATOM   2719 O  O   . LEU A 1 355 ? 27.090  74.480  52.340  1.00 52.21  ? 366  LEU A O   1 
ATOM   2720 C  CB  . LEU A 1 355 ? 24.204  74.059  53.021  1.00 40.13  ? 366  LEU A CB  1 
ATOM   2721 C  CG  . LEU A 1 355 ? 22.798  74.658  53.094  1.00 50.65  ? 366  LEU A CG  1 
ATOM   2722 C  CD1 . LEU A 1 355 ? 22.254  74.580  54.511  1.00 66.51  ? 366  LEU A CD1 1 
ATOM   2723 C  CD2 . LEU A 1 355 ? 22.806  76.096  52.599  1.00 39.50  ? 366  LEU A CD2 1 
ATOM   2724 N  N   . GLN A 1 356 ? 26.753  72.526  51.274  1.00 51.05  ? 367  GLN A N   1 
ATOM   2725 C  CA  . GLN A 1 356 ? 28.150  72.117  51.378  1.00 58.79  ? 367  GLN A CA  1 
ATOM   2726 C  C   . GLN A 1 356 ? 28.977  72.579  50.183  1.00 64.33  ? 367  GLN A C   1 
ATOM   2727 O  O   . GLN A 1 356 ? 30.083  73.100  50.357  1.00 67.97  ? 367  GLN A O   1 
ATOM   2728 C  CB  . GLN A 1 356 ? 28.248  70.596  51.529  1.00 57.34  ? 367  GLN A CB  1 
ATOM   2729 C  CG  . GLN A 1 356 ? 28.126  70.108  52.962  1.00 67.89  ? 367  GLN A CG  1 
ATOM   2730 C  CD  . GLN A 1 356 ? 28.261  68.602  53.080  1.00 78.22  ? 367  GLN A CD  1 
ATOM   2731 O  OE1 . GLN A 1 356 ? 28.327  67.892  52.076  1.00 84.80  ? 367  GLN A OE1 1 
ATOM   2732 N  NE2 . GLN A 1 356 ? 28.304  68.107  54.312  1.00 67.53  ? 367  GLN A NE2 1 
ATOM   2733 N  N   . THR A 1 357 ? 28.463  72.390  48.970  1.00 65.50  ? 368  THR A N   1 
ATOM   2734 C  CA  . THR A 1 357 ? 29.192  72.795  47.775  1.00 64.89  ? 368  THR A CA  1 
ATOM   2735 C  C   . THR A 1 357 ? 29.295  74.314  47.711  1.00 66.58  ? 368  THR A C   1 
ATOM   2736 O  O   . THR A 1 357 ? 28.302  75.023  47.903  1.00 64.92  ? 368  THR A O   1 
ATOM   2737 C  CB  . THR A 1 357 ? 28.501  72.257  46.522  1.00 66.66  ? 368  THR A CB  1 
ATOM   2738 O  OG1 . THR A 1 357 ? 28.445  70.826  46.581  1.00 67.20  ? 368  THR A OG1 1 
ATOM   2739 C  CG2 . THR A 1 357 ? 29.258  72.676  45.270  1.00 66.57  ? 368  THR A CG2 1 
ATOM   2740 N  N   . ALA A 1 358 ? 30.503  74.811  47.448  1.00 69.88  ? 369  ALA A N   1 
ATOM   2741 C  CA  . ALA A 1 358 ? 30.725  76.249  47.365  1.00 58.00  ? 369  ALA A CA  1 
ATOM   2742 C  C   . ALA A 1 358 ? 29.894  76.852  46.240  1.00 57.51  ? 369  ALA A C   1 
ATOM   2743 O  O   . ALA A 1 358 ? 29.902  76.358  45.109  1.00 72.28  ? 369  ALA A O   1 
ATOM   2744 C  CB  . ALA A 1 358 ? 32.208  76.543  47.148  1.00 64.34  ? 369  ALA A CB  1 
ATOM   2745 N  N   . GLY A 1 359 ? 29.175  77.927  46.557  1.00 44.75  ? 370  GLY A N   1 
ATOM   2746 C  CA  . GLY A 1 359 ? 28.249  78.544  45.635  1.00 60.34  ? 370  GLY A CA  1 
ATOM   2747 C  C   . GLY A 1 359 ? 26.792  78.260  45.928  1.00 68.45  ? 370  GLY A C   1 
ATOM   2748 O  O   . GLY A 1 359 ? 25.922  78.946  45.376  1.00 73.90  ? 370  GLY A O   1 
ATOM   2749 N  N   . TRP A 1 360 ? 26.506  77.273  46.781  1.00 67.06  ? 371  TRP A N   1 
ATOM   2750 C  CA  . TRP A 1 360 ? 25.158  76.888  47.186  1.00 48.66  ? 371  TRP A CA  1 
ATOM   2751 C  C   . TRP A 1 360 ? 24.275  76.629  45.970  1.00 42.50  ? 371  TRP A C   1 
ATOM   2752 O  O   . TRP A 1 360 ? 23.333  77.389  45.714  1.00 52.47  ? 371  TRP A O   1 
ATOM   2753 C  CB  . TRP A 1 360 ? 24.551  77.965  48.088  1.00 49.79  ? 371  TRP A CB  1 
ATOM   2754 C  CG  . TRP A 1 360 ? 25.246  78.074  49.417  1.00 48.79  ? 371  TRP A CG  1 
ATOM   2755 C  CD1 . TRP A 1 360 ? 26.081  77.153  49.979  1.00 41.52  ? 371  TRP A CD1 1 
ATOM   2756 C  CD2 . TRP A 1 360 ? 25.173  79.166  50.344  1.00 41.18  ? 371  TRP A CD2 1 
ATOM   2757 N  NE1 . TRP A 1 360 ? 26.529  77.599  51.198  1.00 41.68  ? 371  TRP A NE1 1 
ATOM   2758 C  CE2 . TRP A 1 360 ? 25.987  78.833  51.446  1.00 41.21  ? 371  TRP A CE2 1 
ATOM   2759 C  CE3 . TRP A 1 360 ? 24.498  80.390  50.350  1.00 51.75  ? 371  TRP A CE3 1 
ATOM   2760 C  CZ2 . TRP A 1 360 ? 26.144  79.679  52.542  1.00 41.11  ? 371  TRP A CZ2 1 
ATOM   2761 C  CZ3 . TRP A 1 360 ? 24.656  81.229  51.441  1.00 56.61  ? 371  TRP A CZ3 1 
ATOM   2762 C  CH2 . TRP A 1 360 ? 25.473  80.870  52.521  1.00 48.60  ? 371  TRP A CH2 1 
ATOM   2763 N  N   . PRO A 1 361 ? 24.538  75.570  45.208  1.00 42.06  ? 372  PRO A N   1 
ATOM   2764 C  CA  . PRO A 1 361 ? 23.784  75.334  43.978  1.00 42.05  ? 372  PRO A CA  1 
ATOM   2765 C  C   . PRO A 1 361 ? 22.490  74.595  44.262  1.00 52.94  ? 372  PRO A C   1 
ATOM   2766 O  O   . PRO A 1 361 ? 22.371  73.901  45.283  1.00 54.81  ? 372  PRO A O   1 
ATOM   2767 C  CB  . PRO A 1 361 ? 24.744  74.474  43.147  1.00 42.84  ? 372  PRO A CB  1 
ATOM   2768 C  CG  . PRO A 1 361 ? 25.471  73.677  44.178  1.00 42.93  ? 372  PRO A CG  1 
ATOM   2769 C  CD  . PRO A 1 361 ? 25.592  74.558  45.405  1.00 53.34  ? 372  PRO A CD  1 
ATOM   2770 N  N   . PRO A 1 362 ? 21.497  74.717  43.384  1.00 47.91  ? 373  PRO A N   1 
ATOM   2771 C  CA  . PRO A 1 362 ? 20.245  73.980  43.582  1.00 40.48  ? 373  PRO A CA  1 
ATOM   2772 C  C   . PRO A 1 362 ? 20.436  72.489  43.360  1.00 40.62  ? 373  PRO A C   1 
ATOM   2773 O  O   . PRO A 1 362 ? 21.253  72.055  42.544  1.00 57.26  ? 373  PRO A O   1 
ATOM   2774 C  CB  . PRO A 1 362 ? 19.305  74.580  42.528  1.00 40.47  ? 373  PRO A CB  1 
ATOM   2775 C  CG  . PRO A 1 362 ? 19.951  75.869  42.107  1.00 42.78  ? 373  PRO A CG  1 
ATOM   2776 C  CD  . PRO A 1 362 ? 21.420  75.636  42.237  1.00 41.52  ? 373  PRO A CD  1 
ATOM   2777 N  N   . VAL A 1 363 ? 19.663  71.701  44.102  1.00 40.20  ? 374  VAL A N   1 
ATOM   2778 C  CA  . VAL A 1 363 ? 19.682  70.246  43.998  1.00 43.39  ? 374  VAL A CA  1 
ATOM   2779 C  C   . VAL A 1 363 ? 18.513  69.810  43.127  1.00 53.01  ? 374  VAL A C   1 
ATOM   2780 O  O   . VAL A 1 363 ? 17.374  70.247  43.337  1.00 64.72  ? 374  VAL A O   1 
ATOM   2781 C  CB  . VAL A 1 363 ? 19.615  69.587  45.387  1.00 42.74  ? 374  VAL A CB  1 
ATOM   2782 C  CG1 . VAL A 1 363 ? 19.496  68.076  45.256  1.00 47.23  ? 374  VAL A CG1 1 
ATOM   2783 C  CG2 . VAL A 1 363 ? 20.842  69.957  46.205  1.00 53.88  ? 374  VAL A CG2 1 
ATOM   2784 N  N   . GLN A 1 364 ? 18.793  68.953  42.149  1.00 53.44  ? 375  GLN A N   1 
ATOM   2785 C  CA  . GLN A 1 364 ? 17.755  68.489  41.239  1.00 41.03  ? 375  GLN A CA  1 
ATOM   2786 C  C   . GLN A 1 364 ? 16.782  67.568  41.963  1.00 51.56  ? 375  GLN A C   1 
ATOM   2787 O  O   . GLN A 1 364 ? 17.182  66.710  42.756  1.00 47.85  ? 375  GLN A O   1 
ATOM   2788 C  CB  . GLN A 1 364 ? 18.381  67.767  40.046  1.00 50.11  ? 375  GLN A CB  1 
ATOM   2789 C  CG  . GLN A 1 364 ? 17.416  67.491  38.906  1.00 59.67  ? 375  GLN A CG  1 
ATOM   2790 C  CD  . GLN A 1 364 ? 18.080  66.781  37.744  1.00 68.94  ? 375  GLN A CD  1 
ATOM   2791 O  OE1 . GLN A 1 364 ? 19.227  66.345  37.843  1.00 76.79  ? 375  GLN A OE1 1 
ATOM   2792 N  NE2 . GLN A 1 364 ? 17.362  66.662  36.633  1.00 75.56  ? 375  GLN A NE2 1 
ATOM   2793 N  N   . LEU A 1 365 ? 15.492  67.748  41.681  1.00 40.02  ? 376  LEU A N   1 
ATOM   2794 C  CA  . LEU A 1 365 ? 14.443  66.989  42.356  1.00 41.37  ? 376  LEU A CA  1 
ATOM   2795 C  C   . LEU A 1 365 ? 14.183  65.678  41.623  1.00 47.38  ? 376  LEU A C   1 
ATOM   2796 O  O   . LEU A 1 365 ? 13.970  65.689  40.405  1.00 52.43  ? 376  LEU A O   1 
ATOM   2797 C  CB  . LEU A 1 365 ? 13.154  67.795  42.425  1.00 40.26  ? 376  LEU A CB  1 
ATOM   2798 C  CG  . LEU A 1 365 ? 13.224  69.190  43.049  1.00 50.57  ? 376  LEU A CG  1 
ATOM   2799 C  CD1 . LEU A 1 365 ? 11.854  69.851  43.027  1.00 39.10  ? 376  LEU A CD1 1 
ATOM   2800 C  CD2 . LEU A 1 365 ? 13.770  69.122  44.467  1.00 61.05  ? 376  LEU A CD2 1 
ATOM   2801 N  N   . PRO A 1 366 ? 14.195  64.538  42.322  1.00 42.41  ? 377  PRO A N   1 
ATOM   2802 C  CA  . PRO A 1 366 ? 13.780  63.282  41.682  1.00 46.95  ? 377  PRO A CA  1 
ATOM   2803 C  C   . PRO A 1 366 ? 12.275  63.114  41.627  1.00 55.44  ? 377  PRO A C   1 
ATOM   2804 O  O   . PRO A 1 366 ? 11.782  62.345  40.790  1.00 56.81  ? 377  PRO A O   1 
ATOM   2805 C  CB  . PRO A 1 366 ? 14.421  62.212  42.572  1.00 55.16  ? 377  PRO A CB  1 
ATOM   2806 C  CG  . PRO A 1 366 ? 14.424  62.844  43.930  1.00 41.44  ? 377  PRO A CG  1 
ATOM   2807 C  CD  . PRO A 1 366 ? 14.621  64.332  43.717  1.00 40.79  ? 377  PRO A CD  1 
ATOM   2808 N  N   . TYR A 1 367 ? 11.540  63.799  42.498  1.00 59.78  ? 378  TYR A N   1 
ATOM   2809 C  CA  . TYR A 1 367 ? 10.086  63.804  42.503  1.00 40.66  ? 378  TYR A CA  1 
ATOM   2810 C  C   . TYR A 1 367 ? 9.636   65.198  42.926  1.00 48.08  ? 378  TYR A C   1 
ATOM   2811 O  O   . TYR A 1 367 ? 10.446  66.124  43.027  1.00 50.74  ? 378  TYR A O   1 
ATOM   2812 C  CB  . TYR A 1 367 ? 9.542   62.704  43.424  1.00 41.21  ? 378  TYR A CB  1 
ATOM   2813 C  CG  . TYR A 1 367 ? 10.257  62.614  44.754  1.00 41.33  ? 378  TYR A CG  1 
ATOM   2814 C  CD1 . TYR A 1 367 ? 10.007  63.532  45.764  1.00 41.01  ? 378  TYR A CD1 1 
ATOM   2815 C  CD2 . TYR A 1 367 ? 11.183  61.608  44.998  1.00 61.86  ? 378  TYR A CD2 1 
ATOM   2816 C  CE1 . TYR A 1 367 ? 10.660  63.454  46.979  1.00 41.14  ? 378  TYR A CE1 1 
ATOM   2817 C  CE2 . TYR A 1 367 ? 11.840  61.521  46.210  1.00 55.03  ? 378  TYR A CE2 1 
ATOM   2818 C  CZ  . TYR A 1 367 ? 11.575  62.447  47.196  1.00 44.67  ? 378  TYR A CZ  1 
ATOM   2819 O  OH  . TYR A 1 367 ? 12.227  62.364  48.405  1.00 48.67  ? 378  TYR A OH  1 
ATOM   2820 N  N   . LEU A 1 368 ? 8.335   65.350  43.170  1.00 48.28  ? 379  LEU A N   1 
ATOM   2821 C  CA  . LEU A 1 368 ? 7.742   66.605  43.633  1.00 48.41  ? 379  LEU A CA  1 
ATOM   2822 C  C   . LEU A 1 368 ? 8.038   67.776  42.702  1.00 49.76  ? 379  LEU A C   1 
ATOM   2823 O  O   . LEU A 1 368 ? 7.979   68.937  43.122  1.00 47.49  ? 379  LEU A O   1 
ATOM   2824 C  CB  . LEU A 1 368 ? 8.196   66.941  45.058  1.00 39.95  ? 379  LEU A CB  1 
ATOM   2825 C  CG  . LEU A 1 368 ? 7.553   66.089  46.150  1.00 52.55  ? 379  LEU A CG  1 
ATOM   2826 C  CD1 . LEU A 1 368 ? 8.056   66.491  47.523  1.00 40.35  ? 379  LEU A CD1 1 
ATOM   2827 C  CD2 . LEU A 1 368 ? 6.047   66.222  46.068  1.00 52.51  ? 379  LEU A CD2 1 
ATOM   2828 N  N   . ALA A 1 369 ? 8.361   67.497  41.442  1.00 59.67  ? 380  ALA A N   1 
ATOM   2829 C  CA  . ALA A 1 369 ? 8.610   68.563  40.483  1.00 57.25  ? 380  ALA A CA  1 
ATOM   2830 C  C   . ALA A 1 369 ? 7.304   69.265  40.141  1.00 54.19  ? 380  ALA A C   1 
ATOM   2831 O  O   . ALA A 1 369 ? 6.315   68.619  39.780  1.00 48.64  ? 380  ALA A O   1 
ATOM   2832 C  CB  . ALA A 1 369 ? 9.263   68.003  39.220  1.00 66.70  ? 380  ALA A CB  1 
ATOM   2833 N  N   . SER A 1 370 ? 7.298   70.588  40.265  1.00 64.14  ? 381  SER A N   1 
ATOM   2834 C  CA  . SER A 1 370 ? 6.100   71.380  39.998  1.00 68.43  ? 381  SER A CA  1 
ATOM   2835 C  C   . SER A 1 370 ? 5.792   71.324  38.509  1.00 64.04  ? 381  SER A C   1 
ATOM   2836 O  O   . SER A 1 370 ? 6.377   72.058  37.710  1.00 49.52  ? 381  SER A O   1 
ATOM   2837 C  CB  . SER A 1 370 ? 6.295   72.815  40.471  1.00 71.82  ? 381  SER A CB  1 
ATOM   2838 O  OG  . SER A 1 370 ? 6.482   72.858  41.873  1.00 79.43  ? 381  SER A OG  1 
ATOM   2839 N  N   . LEU A 1 371 ? 4.861   70.445  38.132  1.00 70.04  ? 382  LEU A N   1 
ATOM   2840 C  CA  . LEU A 1 371 ? 4.441   70.326  36.742  1.00 54.30  ? 382  LEU A CA  1 
ATOM   2841 C  C   . LEU A 1 371 ? 3.842   71.615  36.198  1.00 50.37  ? 382  LEU A C   1 
ATOM   2842 O  O   . LEU A 1 371 ? 3.692   71.741  34.978  1.00 48.98  ? 382  LEU A O   1 
ATOM   2843 C  CB  . LEU A 1 371 ? 3.424   69.191  36.600  1.00 59.20  ? 382  LEU A CB  1 
ATOM   2844 C  CG  . LEU A 1 371 ? 3.798   67.833  37.198  1.00 72.23  ? 382  LEU A CG  1 
ATOM   2845 C  CD1 . LEU A 1 371 ? 2.577   66.933  37.278  1.00 79.08  ? 382  LEU A CD1 1 
ATOM   2846 C  CD2 . LEU A 1 371 ? 4.892   67.169  36.386  1.00 74.76  ? 382  LEU A CD2 1 
ATOM   2847 N  N   . HIS A 1 372 ? 3.502   72.569  37.066  1.00 54.95  ? 383  HIS A N   1 
ATOM   2848 C  CA  . HIS A 1 372 ? 2.868   73.817  36.665  1.00 56.02  ? 383  HIS A CA  1 
ATOM   2849 C  C   . HIS A 1 372 ? 3.791   75.020  36.840  1.00 62.30  ? 383  HIS A C   1 
ATOM   2850 O  O   . HIS A 1 372 ? 3.316   76.143  37.030  1.00 64.63  ? 383  HIS A O   1 
ATOM   2851 C  CB  . HIS A 1 372 ? 1.576   74.037  37.448  1.00 60.18  ? 383  HIS A CB  1 
ATOM   2852 C  CG  . HIS A 1 372 ? 1.793   74.378  38.889  1.00 45.27  ? 383  HIS A CG  1 
ATOM   2853 N  ND1 . HIS A 1 372 ? 2.776   73.789  39.654  1.00 44.25  ? 383  HIS A ND1 1 
ATOM   2854 C  CD2 . HIS A 1 372 ? 1.161   75.259  39.701  1.00 47.99  ? 383  HIS A CD2 1 
ATOM   2855 C  CE1 . HIS A 1 372 ? 2.736   74.286  40.878  1.00 45.88  ? 383  HIS A CE1 1 
ATOM   2856 N  NE2 . HIS A 1 372 ? 1.765   75.180  40.932  1.00 45.79  ? 383  HIS A NE2 1 
ATOM   2857 N  N   . CYS A 1 373 ? 5.110   74.803  36.787  1.00 60.59  ? 384  CYS A N   1 
ATOM   2858 C  CA  . CYS A 1 373 ? 6.035   75.933  36.786  1.00 59.42  ? 384  CYS A CA  1 
ATOM   2859 C  C   . CYS A 1 373 ? 5.693   76.908  35.670  1.00 50.54  ? 384  CYS A C   1 
ATOM   2860 O  O   . CYS A 1 373 ? 5.910   78.118  35.805  1.00 42.49  ? 384  CYS A O   1 
ATOM   2861 C  CB  . CYS A 1 373 ? 7.477   75.441  36.653  1.00 77.72  ? 384  CYS A CB  1 
ATOM   2862 S  SG  . CYS A 1 373 ? 7.800   74.461  35.176  1.00 94.33  ? 384  CYS A SG  1 
ATOM   2863 N  N   . SER A 1 374 ? 5.162   76.396  34.564  1.00 52.56  ? 385  SER A N   1 
ATOM   2864 C  CA  . SER A 1 374 ? 4.408   77.175  33.597  1.00 54.66  ? 385  SER A CA  1 
ATOM   2865 C  C   . SER A 1 374 ? 3.099   76.445  33.331  1.00 62.55  ? 385  SER A C   1 
ATOM   2866 O  O   . SER A 1 374 ? 3.041   75.214  33.383  1.00 77.83  ? 385  SER A O   1 
ATOM   2867 C  CB  . SER A 1 374 ? 5.184   77.379  32.293  1.00 58.68  ? 385  SER A CB  1 
ATOM   2868 O  OG  . SER A 1 374 ? 4.492   78.257  31.422  1.00 70.44  ? 385  SER A OG  1 
ATOM   2869 N  N   . ALA A 1 375 ? 2.046   77.215  33.060  1.00 59.30  ? 386  ALA A N   1 
ATOM   2870 C  CA  . ALA A 1 375 ? 0.708   76.649  32.932  1.00 58.30  ? 386  ALA A CA  1 
ATOM   2871 C  C   . ALA A 1 375 ? 0.665   75.597  31.830  1.00 58.43  ? 386  ALA A C   1 
ATOM   2872 O  O   . ALA A 1 375 ? 1.005   75.878  30.677  1.00 63.16  ? 386  ALA A O   1 
ATOM   2873 C  CB  . ALA A 1 375 ? -0.304  77.758  32.650  1.00 58.10  ? 386  ALA A CB  1 
ATOM   2874 N  N   . ILE A 1 376 ? 0.245   74.383  32.191  1.00 56.20  ? 387  ILE A N   1 
ATOM   2875 C  CA  . ILE A 1 376 ? 0.166   73.293  31.226  1.00 53.33  ? 387  ILE A CA  1 
ATOM   2876 C  C   . ILE A 1 376 ? -0.962  73.568  30.243  1.00 44.11  ? 387  ILE A C   1 
ATOM   2877 O  O   . ILE A 1 376 ? -2.110  73.811  30.639  1.00 44.66  ? 387  ILE A O   1 
ATOM   2878 C  CB  . ILE A 1 376 ? -0.043  71.950  31.942  1.00 42.91  ? 387  ILE A CB  1 
ATOM   2879 C  CG1 . ILE A 1 376 ? 1.035   71.733  33.003  1.00 52.41  ? 387  ILE A CG1 1 
ATOM   2880 C  CG2 . ILE A 1 376 ? -0.033  70.808  30.939  1.00 42.79  ? 387  ILE A CG2 1 
ATOM   2881 C  CD1 . ILE A 1 376 ? 0.882   70.434  33.763  1.00 62.57  ? 387  ILE A CD1 1 
ATOM   2882 N  N   . THR A 1 377 ? -0.641  73.528  28.950  1.00 51.71  ? 388  THR A N   1 
ATOM   2883 C  CA  . THR A 1 377 ? -1.624  73.754  27.899  1.00 59.96  ? 388  THR A CA  1 
ATOM   2884 C  C   . THR A 1 377 ? -1.959  72.505  27.099  1.00 57.80  ? 388  THR A C   1 
ATOM   2885 O  O   . THR A 1 377 ? -3.058  72.420  26.547  1.00 55.72  ? 388  THR A O   1 
ATOM   2886 C  CB  . THR A 1 377 ? -1.136  74.843  26.936  1.00 57.61  ? 388  THR A CB  1 
ATOM   2887 O  OG1 . THR A 1 377 ? 0.079   74.418  26.307  1.00 57.30  ? 388  THR A OG1 1 
ATOM   2888 C  CG2 . THR A 1 377 ? -0.884  76.143  27.687  1.00 45.90  ? 388  THR A CG2 1 
ATOM   2889 N  N   . CYS A 1 378 ? -1.046  71.540  27.023  1.00 51.38  ? 389  CYS A N   1 
ATOM   2890 C  CA  . CYS A 1 378 ? -1.313  70.285  26.336  1.00 59.88  ? 389  CYS A CA  1 
ATOM   2891 C  C   . CYS A 1 378 ? -0.365  69.223  26.871  1.00 55.67  ? 389  CYS A C   1 
ATOM   2892 O  O   . CYS A 1 378 ? 0.673   69.531  27.464  1.00 48.13  ? 389  CYS A O   1 
ATOM   2893 C  CB  . CYS A 1 378 ? -1.162  70.426  24.817  1.00 57.52  ? 389  CYS A CB  1 
ATOM   2894 S  SG  . CYS A 1 378 ? 0.526   70.743  24.257  1.00 63.37  ? 389  CYS A SG  1 
ATOM   2895 N  N   . SER A 1 379 ? -0.739  67.964  26.656  1.00 60.49  ? 390  SER A N   1 
ATOM   2896 C  CA  . SER A 1 379 ? 0.072   66.837  27.090  1.00 50.60  ? 390  SER A CA  1 
ATOM   2897 C  C   . SER A 1 379 ? -0.063  65.710  26.077  1.00 44.75  ? 390  SER A C   1 
ATOM   2898 O  O   . SER A 1 379 ? -1.166  65.417  25.607  1.00 54.25  ? 390  SER A O   1 
ATOM   2899 C  CB  . SER A 1 379 ? -0.332  66.360  28.491  1.00 42.71  ? 390  SER A CB  1 
ATOM   2900 O  OG  . SER A 1 379 ? -1.733  66.175  28.587  1.00 52.53  ? 390  SER A OG  1 
ATOM   2901 N  N   . HIS A 1 380 ? 1.065   65.086  25.745  1.00 42.80  ? 391  HIS A N   1 
ATOM   2902 C  CA  . HIS A 1 380 ? 1.127   64.042  24.730  1.00 46.13  ? 391  HIS A CA  1 
ATOM   2903 C  C   . HIS A 1 380 ? 1.945   62.877  25.264  1.00 55.95  ? 391  HIS A C   1 
ATOM   2904 O  O   . HIS A 1 380 ? 3.062   63.073  25.753  1.00 74.19  ? 391  HIS A O   1 
ATOM   2905 C  CB  . HIS A 1 380 ? 1.740   64.583  23.432  1.00 62.09  ? 391  HIS A CB  1 
ATOM   2906 C  CG  . HIS A 1 380 ? 1.914   63.548  22.364  1.00 78.30  ? 391  HIS A CG  1 
ATOM   2907 N  ND1 . HIS A 1 380 ? 0.854   62.866  21.807  1.00 86.17  ? 391  HIS A ND1 1 
ATOM   2908 C  CD2 . HIS A 1 380 ? 3.025   63.086  21.745  1.00 79.42  ? 391  HIS A CD2 1 
ATOM   2909 C  CE1 . HIS A 1 380 ? 1.305   62.025  20.893  1.00 86.60  ? 391  HIS A CE1 1 
ATOM   2910 N  NE2 . HIS A 1 380 ? 2.620   62.139  20.836  1.00 76.92  ? 391  HIS A NE2 1 
ATOM   2911 N  N   . HIS A 1 381 ? 1.394   61.670  25.167  1.00 52.82  ? 392  HIS A N   1 
ATOM   2912 C  CA  . HIS A 1 381 ? 2.026   60.467  25.693  1.00 58.61  ? 392  HIS A CA  1 
ATOM   2913 C  C   . HIS A 1 381 ? 2.481   59.580  24.542  1.00 53.93  ? 392  HIS A C   1 
ATOM   2914 O  O   . HIS A 1 381 ? 1.707   59.313  23.616  1.00 64.21  ? 392  HIS A O   1 
ATOM   2915 C  CB  . HIS A 1 381 ? 1.065   59.700  26.604  1.00 56.55  ? 392  HIS A CB  1 
ATOM   2916 C  CG  . HIS A 1 381 ? 1.730   58.651  27.440  1.00 54.85  ? 392  HIS A CG  1 
ATOM   2917 N  ND1 . HIS A 1 381 ? 2.128   57.434  26.932  1.00 48.11  ? 392  HIS A ND1 1 
ATOM   2918 C  CD2 . HIS A 1 381 ? 2.064   58.638  28.752  1.00 56.14  ? 392  HIS A CD2 1 
ATOM   2919 C  CE1 . HIS A 1 381 ? 2.680   56.716  27.894  1.00 55.27  ? 392  HIS A CE1 1 
ATOM   2920 N  NE2 . HIS A 1 381 ? 2.652   57.424  29.009  1.00 51.36  ? 392  HIS A NE2 1 
ATOM   2921 N  N   . VAL A 1 382 ? 3.731   59.127  24.603  1.00 43.70  ? 393  VAL A N   1 
ATOM   2922 C  CA  . VAL A 1 382 ? 4.313   58.249  23.593  1.00 44.18  ? 393  VAL A CA  1 
ATOM   2923 C  C   . VAL A 1 382 ? 4.779   56.979  24.294  1.00 57.27  ? 393  VAL A C   1 
ATOM   2924 O  O   . VAL A 1 382 ? 5.652   57.032  25.169  1.00 54.74  ? 393  VAL A O   1 
ATOM   2925 C  CB  . VAL A 1 382 ? 5.476   58.923  22.847  1.00 44.22  ? 393  VAL A CB  1 
ATOM   2926 C  CG1 . VAL A 1 382 ? 5.855   58.114  21.617  1.00 59.66  ? 393  VAL A CG1 1 
ATOM   2927 C  CG2 . VAL A 1 382 ? 5.109   60.347  22.462  1.00 43.89  ? 393  VAL A CG2 1 
ATOM   2928 N  N   . SER A 1 383 ? 4.205   55.843  23.905  1.00 60.15  ? 394  SER A N   1 
ATOM   2929 C  CA  . SER A 1 383 ? 4.463   54.576  24.577  1.00 63.06  ? 394  SER A CA  1 
ATOM   2930 C  C   . SER A 1 383 ? 5.612   53.827  23.914  1.00 75.13  ? 394  SER A C   1 
ATOM   2931 O  O   . SER A 1 383 ? 5.761   53.851  22.689  1.00 97.17  ? 394  SER A O   1 
ATOM   2932 C  CB  . SER A 1 383 ? 3.209   53.701  24.574  1.00 60.53  ? 394  SER A CB  1 
ATOM   2933 O  OG  . SER A 1 383 ? 2.120   54.364  25.192  1.00 81.14  ? 394  SER A OG  1 
ATOM   2934 N  N   . ASN A 1 384 ? 6.420   53.160  24.742  1.00 57.47  ? 395  ASN A N   1 
ATOM   2935 C  CA  . ASN A 1 384 ? 7.492   52.280  24.288  1.00 56.49  ? 395  ASN A CA  1 
ATOM   2936 C  C   . ASN A 1 384 ? 8.480   53.006  23.384  1.00 69.61  ? 395  ASN A C   1 
ATOM   2937 O  O   . ASN A 1 384 ? 8.377   52.930  22.155  1.00 83.16  ? 395  ASN A O   1 
ATOM   2938 C  CB  . ASN A 1 384 ? 6.909   51.063  23.564  1.00 48.45  ? 395  ASN A CB  1 
ATOM   2939 C  CG  . ASN A 1 384 ? 7.871   49.892  23.521  1.00 49.60  ? 395  ASN A CG  1 
ATOM   2940 O  OD1 . ASN A 1 384 ? 9.076   50.053  23.720  1.00 51.70  ? 395  ASN A OD1 1 
ATOM   2941 N  ND2 . ASN A 1 384 ? 7.341   48.703  23.259  1.00 50.47  ? 395  ASN A ND2 1 
ATOM   2942 N  N   . ILE A 1 385 ? 9.447   53.698  23.979  1.00 72.17  ? 396  ILE A N   1 
ATOM   2943 C  CA  . ILE A 1 385 ? 10.440  54.455  23.220  1.00 47.34  ? 396  ILE A CA  1 
ATOM   2944 C  C   . ILE A 1 385 ? 11.626  53.551  22.909  1.00 59.66  ? 396  ILE A C   1 
ATOM   2945 O  O   . ILE A 1 385 ? 12.098  52.826  23.798  1.00 55.50  ? 396  ILE A O   1 
ATOM   2946 C  CB  . ILE A 1 385 ? 10.892  55.707  23.988  1.00 46.63  ? 396  ILE A CB  1 
ATOM   2947 C  CG1 . ILE A 1 385 ? 9.682   56.470  24.531  1.00 45.69  ? 396  ILE A CG1 1 
ATOM   2948 C  CG2 . ILE A 1 385 ? 11.735  56.606  23.096  1.00 52.36  ? 396  ILE A CG2 1 
ATOM   2949 C  CD1 . ILE A 1 385 ? 8.714   56.917  23.466  1.00 45.45  ? 396  ILE A CD1 1 
ATOM   2950 N  N   . PRO A 1 386 ? 12.129  53.545  21.674  1.00 62.61  ? 397  PRO A N   1 
ATOM   2951 C  CA  . PRO A 1 386 ? 13.359  52.799  21.385  1.00 64.44  ? 397  PRO A CA  1 
ATOM   2952 C  C   . PRO A 1 386 ? 14.516  53.305  22.232  1.00 63.44  ? 397  PRO A C   1 
ATOM   2953 O  O   . PRO A 1 386 ? 14.557  54.468  22.637  1.00 61.52  ? 397  PRO A O   1 
ATOM   2954 C  CB  . PRO A 1 386 ? 13.595  53.064  19.894  1.00 60.07  ? 397  PRO A CB  1 
ATOM   2955 C  CG  . PRO A 1 386 ? 12.240  53.378  19.354  1.00 64.95  ? 397  PRO A CG  1 
ATOM   2956 C  CD  . PRO A 1 386 ? 11.523  54.107  20.455  1.00 48.78  ? 397  PRO A CD  1 
ATOM   2957 N  N   . LEU A 1 387 ? 15.469  52.407  22.497  1.00 71.47  ? 398  LEU A N   1 
ATOM   2958 C  CA  . LEU A 1 387 ? 16.550  52.739  23.418  1.00 72.98  ? 398  LEU A CA  1 
ATOM   2959 C  C   . LEU A 1 387 ? 17.507  53.769  22.829  1.00 51.84  ? 398  LEU A C   1 
ATOM   2960 O  O   . LEU A 1 387 ? 18.087  54.566  23.575  1.00 51.48  ? 398  LEU A O   1 
ATOM   2961 C  CB  . LEU A 1 387 ? 17.309  51.474  23.818  1.00 53.05  ? 398  LEU A CB  1 
ATOM   2962 C  CG  . LEU A 1 387 ? 18.248  51.624  25.016  1.00 53.28  ? 398  LEU A CG  1 
ATOM   2963 C  CD1 . LEU A 1 387 ? 17.502  52.222  26.197  1.00 51.93  ? 398  LEU A CD1 1 
ATOM   2964 C  CD2 . LEU A 1 387 ? 18.859  50.285  25.393  1.00 54.79  ? 398  LEU A CD2 1 
ATOM   2965 N  N   . LYS A 1 388 ? 17.683  53.775  21.505  1.00 52.46  ? 399  LYS A N   1 
ATOM   2966 C  CA  . LYS A 1 388 ? 18.587  54.744  20.892  1.00 55.88  ? 399  LYS A CA  1 
ATOM   2967 C  C   . LYS A 1 388 ? 18.077  56.169  21.075  1.00 58.25  ? 399  LYS A C   1 
ATOM   2968 O  O   . LYS A 1 388 ? 18.868  57.095  21.288  1.00 58.83  ? 399  LYS A O   1 
ATOM   2969 C  CB  . LYS A 1 388 ? 18.785  54.423  19.409  1.00 58.94  ? 399  LYS A CB  1 
ATOM   2970 C  CG  . LYS A 1 388 ? 17.507  54.379  18.589  1.00 74.02  ? 399  LYS A CG  1 
ATOM   2971 C  CD  . LYS A 1 388 ? 17.809  54.134  17.120  1.00 82.80  ? 399  LYS A CD  1 
ATOM   2972 C  CE  . LYS A 1 388 ? 16.534  54.088  16.294  1.00 90.69  ? 399  LYS A CE  1 
ATOM   2973 N  NZ  . LYS A 1 388 ? 16.812  53.792  14.862  1.00 87.07  ? 399  LYS A NZ  1 
ATOM   2974 N  N   . LEU A 1 389 ? 16.758  56.365  21.004  1.00 54.64  ? 400  LEU A N   1 
ATOM   2975 C  CA  . LEU A 1 389 ? 16.194  57.682  21.267  1.00 49.39  ? 400  LEU A CA  1 
ATOM   2976 C  C   . LEU A 1 389 ? 16.084  57.958  22.759  1.00 58.64  ? 400  LEU A C   1 
ATOM   2977 O  O   . LEU A 1 389 ? 16.210  59.112  23.183  1.00 54.02  ? 400  LEU A O   1 
ATOM   2978 C  CB  . LEU A 1 389 ? 14.817  57.812  20.613  1.00 62.82  ? 400  LEU A CB  1 
ATOM   2979 C  CG  . LEU A 1 389 ? 14.235  59.225  20.540  1.00 47.90  ? 400  LEU A CG  1 
ATOM   2980 C  CD1 . LEU A 1 389 ? 14.782  59.963  19.330  1.00 63.74  ? 400  LEU A CD1 1 
ATOM   2981 C  CD2 . LEU A 1 389 ? 12.717  59.194  20.513  1.00 47.11  ? 400  LEU A CD2 1 
ATOM   2982 N  N   . TRP A 1 390 ? 15.855  56.917  23.562  1.00 55.83  ? 401  TRP A N   1 
ATOM   2983 C  CA  . TRP A 1 390 ? 15.710  57.097  25.003  1.00 57.39  ? 401  TRP A CA  1 
ATOM   2984 C  C   . TRP A 1 390 ? 17.007  57.600  25.625  1.00 64.49  ? 401  TRP A C   1 
ATOM   2985 O  O   . TRP A 1 390 ? 17.028  58.635  26.301  1.00 58.20  ? 401  TRP A O   1 
ATOM   2986 C  CB  . TRP A 1 390 ? 15.270  55.782  25.649  1.00 65.96  ? 401  TRP A CB  1 
ATOM   2987 C  CG  . TRP A 1 390 ? 15.052  55.887  27.125  1.00 68.68  ? 401  TRP A CG  1 
ATOM   2988 C  CD1 . TRP A 1 390 ? 15.922  55.523  28.111  1.00 69.07  ? 401  TRP A CD1 1 
ATOM   2989 C  CD2 . TRP A 1 390 ? 13.889  56.398  27.785  1.00 61.62  ? 401  TRP A CD2 1 
ATOM   2990 N  NE1 . TRP A 1 390 ? 15.371  55.773  29.344  1.00 63.31  ? 401  TRP A NE1 1 
ATOM   2991 C  CE2 . TRP A 1 390 ? 14.123  56.311  29.171  1.00 63.52  ? 401  TRP A CE2 1 
ATOM   2992 C  CE3 . TRP A 1 390 ? 12.671  56.921  27.338  1.00 64.89  ? 401  TRP A CE3 1 
ATOM   2993 C  CZ2 . TRP A 1 390 ? 13.185  56.725  30.113  1.00 65.81  ? 401  TRP A CZ2 1 
ATOM   2994 C  CZ3 . TRP A 1 390 ? 11.742  57.332  28.274  1.00 55.54  ? 401  TRP A CZ3 1 
ATOM   2995 C  CH2 . TRP A 1 390 ? 12.004  57.232  29.645  1.00 56.72  ? 401  TRP A CH2 1 
ATOM   2996 N  N   . GLU A 1 391 ? 18.106  56.876  25.402  1.00 63.57  ? 402  GLU A N   1 
ATOM   2997 C  CA  . GLU A 1 391 ? 19.396  57.308  25.927  1.00 58.08  ? 402  GLU A CA  1 
ATOM   2998 C  C   . GLU A 1 391 ? 19.865  58.613  25.300  1.00 59.66  ? 402  GLU A C   1 
ATOM   2999 O  O   . GLU A 1 391 ? 20.725  59.290  25.874  1.00 68.03  ? 402  GLU A O   1 
ATOM   3000 C  CB  . GLU A 1 391 ? 20.448  56.218  25.714  1.00 55.81  ? 402  GLU A CB  1 
ATOM   3001 C  CG  . GLU A 1 391 ? 20.328  55.043  26.670  1.00 60.71  ? 402  GLU A CG  1 
ATOM   3002 C  CD  . GLU A 1 391 ? 21.463  54.051  26.519  1.00 73.62  ? 402  GLU A CD  1 
ATOM   3003 O  OE1 . GLU A 1 391 ? 22.089  54.023  25.438  1.00 76.43  ? 402  GLU A OE1 1 
ATOM   3004 O  OE2 . GLU A 1 391 ? 21.734  53.303  27.482  1.00 77.41  ? 402  GLU A OE2 1 
ATOM   3005 N  N   . ARG A 1 392 ? 19.320  58.983  24.140  1.00 56.13  ? 403  ARG A N   1 
ATOM   3006 C  CA  . ARG A 1 392 ? 19.688  60.246  23.511  1.00 59.11  ? 403  ARG A CA  1 
ATOM   3007 C  C   . ARG A 1 392 ? 19.017  61.430  24.197  1.00 69.86  ? 403  ARG A C   1 
ATOM   3008 O  O   . ARG A 1 392 ? 19.631  62.492  24.349  1.00 69.31  ? 403  ARG A O   1 
ATOM   3009 C  CB  . ARG A 1 392 ? 19.324  60.215  22.028  1.00 55.93  ? 403  ARG A CB  1 
ATOM   3010 C  CG  . ARG A 1 392 ? 20.508  60.330  21.087  1.00 51.79  ? 403  ARG A CG  1 
ATOM   3011 C  CD  . ARG A 1 392 ? 20.056  60.177  19.646  1.00 63.86  ? 403  ARG A CD  1 
ATOM   3012 N  NE  . ARG A 1 392 ? 20.533  61.264  18.797  1.00 78.29  ? 403  ARG A NE  1 
ATOM   3013 C  CZ  . ARG A 1 392 ? 20.105  61.481  17.558  1.00 92.19  ? 403  ARG A CZ  1 
ATOM   3014 N  NH1 . ARG A 1 392 ? 19.185  60.688  17.024  1.00 87.21  ? 403  ARG A NH1 1 
ATOM   3015 N  NH2 . ARG A 1 392 ? 20.592  62.493  16.853  1.00 108.36 ? 403  ARG A NH2 1 
ATOM   3016 N  N   . ILE A 1 393 ? 17.758  61.268  24.612  1.00 67.15  ? 404  ILE A N   1 
ATOM   3017 C  CA  . ILE A 1 393 ? 17.052  62.360  25.274  1.00 54.08  ? 404  ILE A CA  1 
ATOM   3018 C  C   . ILE A 1 393 ? 17.610  62.585  26.675  1.00 61.10  ? 404  ILE A C   1 
ATOM   3019 O  O   . ILE A 1 393 ? 17.787  63.729  27.109  1.00 59.61  ? 404  ILE A O   1 
ATOM   3020 C  CB  . ILE A 1 393 ? 15.539  62.079  25.299  1.00 45.81  ? 404  ILE A CB  1 
ATOM   3021 C  CG1 . ILE A 1 393 ? 14.992  61.996  23.873  1.00 46.12  ? 404  ILE A CG1 1 
ATOM   3022 C  CG2 . ILE A 1 393 ? 14.805  63.155  26.086  1.00 44.87  ? 404  ILE A CG2 1 
ATOM   3023 C  CD1 . ILE A 1 393 ? 13.509  61.705  23.802  1.00 45.47  ? 404  ILE A CD1 1 
ATOM   3024 N  N   . ILE A 1 394 ? 17.904  61.502  27.401  1.00 61.40  ? 405  ILE A N   1 
ATOM   3025 C  CA  . ILE A 1 394 ? 18.488  61.644  28.729  1.00 55.44  ? 405  ILE A CA  1 
ATOM   3026 C  C   . ILE A 1 394 ? 19.907  62.190  28.656  1.00 61.00  ? 405  ILE A C   1 
ATOM   3027 O  O   . ILE A 1 394 ? 20.394  62.775  29.631  1.00 75.31  ? 405  ILE A O   1 
ATOM   3028 C  CB  . ILE A 1 394 ? 18.463  60.304  29.490  1.00 46.60  ? 405  ILE A CB  1 
ATOM   3029 C  CG1 . ILE A 1 394 ? 19.522  59.347  28.939  1.00 63.70  ? 405  ILE A CG1 1 
ATOM   3030 C  CG2 . ILE A 1 394 ? 17.087  59.669  29.406  1.00 46.09  ? 405  ILE A CG2 1 
ATOM   3031 C  CD1 . ILE A 1 394 ? 19.597  58.027  29.678  1.00 68.50  ? 405  ILE A CD1 1 
ATOM   3032 N  N   . ALA A 1 395 ? 20.587  62.020  27.520  1.00 53.88  ? 406  ALA A N   1 
ATOM   3033 C  CA  . ALA A 1 395 ? 21.927  62.573  27.359  1.00 49.09  ? 406  ALA A CA  1 
ATOM   3034 C  C   . ALA A 1 395 ? 21.873  64.065  27.060  1.00 62.23  ? 406  ALA A C   1 
ATOM   3035 O  O   . ALA A 1 395 ? 22.598  64.856  27.675  1.00 69.91  ? 406  ALA A O   1 
ATOM   3036 C  CB  . ALA A 1 395 ? 22.674  61.828  26.252  1.00 58.41  ? 406  ALA A CB  1 
ATOM   3037 N  N   . ALA A 1 396 ? 21.020  64.468  26.114  1.00 60.64  ? 407  ALA A N   1 
ATOM   3038 C  CA  . ALA A 1 396 ? 20.858  65.888  25.825  1.00 67.61  ? 407  ALA A CA  1 
ATOM   3039 C  C   . ALA A 1 396 ? 20.256  66.631  27.010  1.00 71.28  ? 407  ALA A C   1 
ATOM   3040 O  O   . ALA A 1 396 ? 20.504  67.830  27.183  1.00 67.71  ? 407  ALA A O   1 
ATOM   3041 C  CB  . ALA A 1 396 ? 19.990  66.076  24.581  1.00 74.78  ? 407  ALA A CB  1 
ATOM   3042 N  N   . GLY A 1 397 ? 19.469  65.938  27.835  1.00 70.71  ? 408  GLY A N   1 
ATOM   3043 C  CA  . GLY A 1 397 ? 18.893  66.529  29.027  1.00 71.28  ? 408  GLY A CA  1 
ATOM   3044 C  C   . GLY A 1 397 ? 19.819  66.603  30.224  1.00 72.92  ? 408  GLY A C   1 
ATOM   3045 O  O   . GLY A 1 397 ? 19.458  67.234  31.222  1.00 91.26  ? 408  GLY A O   1 
ATOM   3046 N  N   . SER A 1 398 ? 20.992  65.966  30.153  1.00 64.93  ? 409  SER A N   1 
ATOM   3047 C  CA  . SER A 1 398 ? 21.981  66.061  31.221  1.00 59.39  ? 409  SER A CA  1 
ATOM   3048 C  C   . SER A 1 398 ? 22.874  67.287  31.087  1.00 65.52  ? 409  SER A C   1 
ATOM   3049 O  O   . SER A 1 398 ? 23.291  67.854  32.104  1.00 67.61  ? 409  SER A O   1 
ATOM   3050 C  CB  . SER A 1 398 ? 22.853  64.803  31.250  1.00 60.11  ? 409  SER A CB  1 
ATOM   3051 O  OG  . SER A 1 398 ? 23.679  64.717  30.099  1.00 66.73  ? 409  SER A OG  1 
ATOM   3052 N  N   . ARG A 1 399 ? 23.177  67.708  29.857  1.00 63.46  ? 410  ARG A N   1 
ATOM   3053 C  CA  . ARG A 1 399 ? 24.010  68.890  29.660  1.00 58.07  ? 410  ARG A CA  1 
ATOM   3054 C  C   . ARG A 1 399 ? 23.321  70.155  30.154  1.00 69.28  ? 410  ARG A C   1 
ATOM   3055 O  O   . ARG A 1 399 ? 23.992  71.078  30.631  1.00 77.06  ? 410  ARG A O   1 
ATOM   3056 C  CB  . ARG A 1 399 ? 24.379  69.038  28.183  1.00 58.65  ? 410  ARG A CB  1 
ATOM   3057 C  CG  . ARG A 1 399 ? 25.173  67.874  27.617  1.00 70.64  ? 410  ARG A CG  1 
ATOM   3058 C  CD  . ARG A 1 399 ? 25.510  68.101  26.152  1.00 90.13  ? 410  ARG A CD  1 
ATOM   3059 N  NE  . ARG A 1 399 ? 26.246  69.346  25.949  1.00 103.52 ? 410  ARG A NE  1 
ATOM   3060 C  CZ  . ARG A 1 399 ? 27.572  69.435  25.917  1.00 100.99 ? 410  ARG A CZ  1 
ATOM   3061 N  NH1 . ARG A 1 399 ? 28.315  68.348  26.073  1.00 102.75 ? 410  ARG A NH1 1 
ATOM   3062 N  NH2 . ARG A 1 399 ? 28.155  70.610  25.728  1.00 93.68  ? 410  ARG A NH2 1 
ATOM   3063 N  N   . GLN A 1 400 ? 21.992  70.220  30.049  1.00 65.01  ? 411  GLN A N   1 
ATOM   3064 C  CA  . GLN A 1 400 ? 21.271  71.409  30.485  1.00 64.74  ? 411  GLN A CA  1 
ATOM   3065 C  C   . GLN A 1 400 ? 21.187  71.513  32.002  1.00 68.78  ? 411  GLN A C   1 
ATOM   3066 O  O   . GLN A 1 400 ? 20.892  72.595  32.520  1.00 72.53  ? 411  GLN A O   1 
ATOM   3067 C  CB  . GLN A 1 400 ? 19.866  71.424  29.879  1.00 59.78  ? 411  GLN A CB  1 
ATOM   3068 C  CG  . GLN A 1 400 ? 19.014  70.223  30.252  1.00 70.35  ? 411  GLN A CG  1 
ATOM   3069 C  CD  . GLN A 1 400 ? 17.608  70.304  29.687  1.00 68.57  ? 411  GLN A CD  1 
ATOM   3070 O  OE1 . GLN A 1 400 ? 16.653  69.825  30.300  1.00 79.84  ? 411  GLN A OE1 1 
ATOM   3071 N  NE2 . GLN A 1 400 ? 17.474  70.908  28.512  1.00 47.86  ? 411  GLN A NE2 1 
ATOM   3072 N  N   . ASN A 1 401 ? 21.441  70.422  32.722  1.00 78.60  ? 412  ASN A N   1 
ATOM   3073 C  CA  . ASN A 1 401 ? 21.425  70.413  34.184  1.00 87.40  ? 412  ASN A CA  1 
ATOM   3074 C  C   . ASN A 1 401 ? 22.833  70.409  34.766  1.00 82.71  ? 412  ASN A C   1 
ATOM   3075 O  O   . ASN A 1 401 ? 23.116  69.688  35.726  1.00 99.45  ? 412  ASN A O   1 
ATOM   3076 C  CB  . ASN A 1 401 ? 20.630  69.215  34.697  1.00 99.02  ? 412  ASN A CB  1 
ATOM   3077 C  CG  . ASN A 1 401 ? 19.172  69.261  34.283  1.00 101.78 ? 412  ASN A CG  1 
ATOM   3078 O  OD1 . ASN A 1 401 ? 18.596  70.336  34.111  1.00 101.58 ? 412  ASN A OD1 1 
ATOM   3079 N  ND2 . ASN A 1 401 ? 18.565  68.090  34.122  1.00 92.58  ? 412  ASN A ND2 1 
ATOM   3080 N  N   . ALA A 1 402 ? 23.737  71.210  34.200  1.00 72.22  ? 413  ALA A N   1 
ATOM   3081 C  CA  . ALA A 1 402 ? 25.115  71.227  34.678  1.00 73.19  ? 413  ALA A CA  1 
ATOM   3082 C  C   . ALA A 1 402 ? 25.265  72.064  35.942  1.00 61.95  ? 413  ALA A C   1 
ATOM   3083 O  O   . ALA A 1 402 ? 26.032  71.702  36.841  1.00 68.66  ? 413  ALA A O   1 
ATOM   3084 C  CB  . ALA A 1 402 ? 26.044  71.750  33.582  1.00 75.83  ? 413  ALA A CB  1 
ATOM   3085 N  N   . HIS A 1 403 ? 24.538  73.180  36.032  1.00 62.82  ? 414  HIS A N   1 
ATOM   3086 C  CA  . HIS A 1 403 ? 24.651  74.079  37.174  1.00 61.37  ? 414  HIS A CA  1 
ATOM   3087 C  C   . HIS A 1 403 ? 24.138  73.466  38.471  1.00 48.08  ? 414  HIS A C   1 
ATOM   3088 O  O   . HIS A 1 403 ? 24.376  74.039  39.540  1.00 47.14  ? 414  HIS A O   1 
ATOM   3089 C  CB  . HIS A 1 403 ? 23.898  75.380  36.890  1.00 70.21  ? 414  HIS A CB  1 
ATOM   3090 C  CG  . HIS A 1 403 ? 22.417  75.204  36.766  1.00 71.88  ? 414  HIS A CG  1 
ATOM   3091 N  ND1 . HIS A 1 403 ? 21.840  74.415  35.793  1.00 74.64  ? 414  HIS A ND1 1 
ATOM   3092 C  CD2 . HIS A 1 403 ? 21.394  75.716  37.490  1.00 71.20  ? 414  HIS A CD2 1 
ATOM   3093 C  CE1 . HIS A 1 403 ? 20.526  74.448  35.925  1.00 76.79  ? 414  HIS A CE1 1 
ATOM   3094 N  NE2 . HIS A 1 403 ? 20.229  75.231  36.947  1.00 76.43  ? 414  HIS A NE2 1 
ATOM   3095 N  N   . PHE A 1 404 ? 23.445  72.332  38.408  1.00 43.83  ? 415  PHE A N   1 
ATOM   3096 C  CA  . PHE A 1 404 ? 22.929  71.706  39.613  1.00 44.38  ? 415  PHE A CA  1 
ATOM   3097 C  C   . PHE A 1 404 ? 24.056  71.069  40.421  1.00 48.90  ? 415  PHE A C   1 
ATOM   3098 O  O   . PHE A 1 404 ? 25.172  70.862  39.935  1.00 44.45  ? 415  PHE A O   1 
ATOM   3099 C  CB  . PHE A 1 404 ? 21.874  70.655  39.266  1.00 48.34  ? 415  PHE A CB  1 
ATOM   3100 C  CG  . PHE A 1 404 ? 20.535  71.235  38.910  1.00 63.53  ? 415  PHE A CG  1 
ATOM   3101 C  CD1 . PHE A 1 404 ? 20.179  72.502  39.340  1.00 68.47  ? 415  PHE A CD1 1 
ATOM   3102 C  CD2 . PHE A 1 404 ? 19.632  70.512  38.150  1.00 65.20  ? 415  PHE A CD2 1 
ATOM   3103 C  CE1 . PHE A 1 404 ? 18.948  73.039  39.017  1.00 66.25  ? 415  PHE A CE1 1 
ATOM   3104 C  CE2 . PHE A 1 404 ? 18.398  71.043  37.823  1.00 70.68  ? 415  PHE A CE2 1 
ATOM   3105 C  CZ  . PHE A 1 404 ? 18.056  72.309  38.257  1.00 68.04  ? 415  PHE A CZ  1 
ATOM   3106 N  N   . SER A 1 405 ? 23.744  70.756  41.675  1.00 49.27  ? 416  SER A N   1 
ATOM   3107 C  CA  . SER A 1 405 ? 24.719  70.163  42.574  1.00 43.34  ? 416  SER A CA  1 
ATOM   3108 C  C   . SER A 1 405 ? 24.999  68.712  42.194  1.00 62.02  ? 416  SER A C   1 
ATOM   3109 O  O   . SER A 1 405 ? 24.182  68.031  41.569  1.00 76.95  ? 416  SER A O   1 
ATOM   3110 C  CB  . SER A 1 405 ? 24.224  70.235  44.019  1.00 42.60  ? 416  SER A CB  1 
ATOM   3111 O  OG  . SER A 1 405 ? 25.044  69.465  44.878  1.00 51.53  ? 416  SER A OG  1 
ATOM   3112 N  N   . THR A 1 406 ? 26.183  68.244  42.580  1.00 53.45  ? 417  THR A N   1 
ATOM   3113 C  CA  . THR A 1 406 ? 26.561  66.846  42.430  1.00 59.35  ? 417  THR A CA  1 
ATOM   3114 C  C   . THR A 1 406 ? 26.133  65.995  43.618  1.00 66.11  ? 417  THR A C   1 
ATOM   3115 O  O   . THR A 1 406 ? 26.419  64.793  43.639  1.00 64.66  ? 417  THR A O   1 
ATOM   3116 C  CB  . THR A 1 406 ? 28.077  66.725  42.233  1.00 48.40  ? 417  THR A CB  1 
ATOM   3117 O  OG1 . THR A 1 406 ? 28.755  67.375  43.315  1.00 46.88  ? 417  THR A OG1 1 
ATOM   3118 C  CG2 . THR A 1 406 ? 28.497  67.365  40.920  1.00 50.24  ? 417  THR A CG2 1 
ATOM   3119 N  N   . MET A 1 407 ? 25.458  66.589  44.598  1.00 61.35  ? 418  MET A N   1 
ATOM   3120 C  CA  . MET A 1 407 ? 25.049  65.862  45.792  1.00 51.18  ? 418  MET A CA  1 
ATOM   3121 C  C   . MET A 1 407 ? 23.924  64.887  45.468  1.00 51.99  ? 418  MET A C   1 
ATOM   3122 O  O   . MET A 1 407 ? 22.941  65.251  44.816  1.00 66.83  ? 418  MET A O   1 
ATOM   3123 C  CB  . MET A 1 407 ? 24.604  66.848  46.871  1.00 43.25  ? 418  MET A CB  1 
ATOM   3124 C  CG  . MET A 1 407 ? 23.814  66.226  48.008  1.00 49.44  ? 418  MET A CG  1 
ATOM   3125 S  SD  . MET A 1 407 ? 23.174  67.450  49.167  1.00 47.97  ? 418  MET A SD  1 
ATOM   3126 C  CE  . MET A 1 407 ? 24.680  67.948  49.995  1.00 70.82  ? 418  MET A CE  1 
ATOM   3127 N  N   . GLU A 1 408 ? 24.073  63.645  45.921  1.00 44.64  ? 419  GLU A N   1 
ATOM   3128 C  CA  . GLU A 1 408 ? 23.007  62.666  45.777  1.00 60.59  ? 419  GLU A CA  1 
ATOM   3129 C  C   . GLU A 1 408 ? 21.796  63.082  46.604  1.00 64.05  ? 419  GLU A C   1 
ATOM   3130 O  O   . GLU A 1 408 ? 21.919  63.774  47.618  1.00 71.77  ? 419  GLU A O   1 
ATOM   3131 C  CB  . GLU A 1 408 ? 23.489  61.280  46.207  1.00 72.68  ? 419  GLU A CB  1 
ATOM   3132 C  CG  . GLU A 1 408 ? 24.606  60.714  45.342  1.00 88.56  ? 419  GLU A CG  1 
ATOM   3133 C  CD  . GLU A 1 408 ? 24.152  60.408  43.926  1.00 107.81 ? 419  GLU A CD  1 
ATOM   3134 O  OE1 . GLU A 1 408 ? 22.946  60.147  43.729  1.00 111.53 ? 419  GLU A OE1 1 
ATOM   3135 O  OE2 . GLU A 1 408 ? 25.001  60.430  43.010  1.00 105.87 ? 419  GLU A OE2 1 
ATOM   3136 N  N   . TRP A 1 409 ? 20.619  62.654  46.159  1.00 58.22  ? 420  TRP A N   1 
ATOM   3137 C  CA  . TRP A 1 409 ? 19.369  63.065  46.787  1.00 42.63  ? 420  TRP A CA  1 
ATOM   3138 C  C   . TRP A 1 409 ? 19.371  62.698  48.267  1.00 42.85  ? 420  TRP A C   1 
ATOM   3139 O  O   . TRP A 1 409 ? 19.409  61.505  48.604  1.00 43.65  ? 420  TRP A O   1 
ATOM   3140 C  CB  . TRP A 1 409 ? 18.177  62.425  46.087  1.00 42.60  ? 420  TRP A CB  1 
ATOM   3141 C  CG  . TRP A 1 409 ? 16.864  62.836  46.671  1.00 54.85  ? 420  TRP A CG  1 
ATOM   3142 C  CD1 . TRP A 1 409 ? 15.960  62.032  47.301  1.00 57.88  ? 420  TRP A CD1 1 
ATOM   3143 C  CD2 . TRP A 1 409 ? 16.313  64.159  46.697  1.00 60.21  ? 420  TRP A CD2 1 
ATOM   3144 N  NE1 . TRP A 1 409 ? 14.875  62.770  47.708  1.00 55.49  ? 420  TRP A NE1 1 
ATOM   3145 C  CE2 . TRP A 1 409 ? 15.067  64.078  47.350  1.00 60.55  ? 420  TRP A CE2 1 
ATOM   3146 C  CE3 . TRP A 1 409 ? 16.749  65.402  46.226  1.00 57.99  ? 420  TRP A CE3 1 
ATOM   3147 C  CZ2 . TRP A 1 409 ? 14.253  65.192  47.545  1.00 55.84  ? 420  TRP A CZ2 1 
ATOM   3148 C  CZ3 . TRP A 1 409 ? 15.939  66.507  46.420  1.00 56.59  ? 420  TRP A CZ3 1 
ATOM   3149 C  CH2 . TRP A 1 409 ? 14.706  66.394  47.075  1.00 58.11  ? 420  TRP A CH2 1 
ATOM   3150 N  N   . PRO A 1 410 ? 19.331  63.677  49.175  1.00 50.58  ? 421  PRO A N   1 
ATOM   3151 C  CA  . PRO A 1 410 ? 19.510  63.364  50.600  1.00 48.28  ? 421  PRO A CA  1 
ATOM   3152 C  C   . PRO A 1 410 ? 18.303  62.713  51.248  1.00 46.01  ? 421  PRO A C   1 
ATOM   3153 O  O   . PRO A 1 410 ? 18.467  62.046  52.276  1.00 72.98  ? 421  PRO A O   1 
ATOM   3154 C  CB  . PRO A 1 410 ? 19.803  64.735  51.223  1.00 50.08  ? 421  PRO A CB  1 
ATOM   3155 C  CG  . PRO A 1 410 ? 19.087  65.696  50.331  1.00 51.58  ? 421  PRO A CG  1 
ATOM   3156 C  CD  . PRO A 1 410 ? 19.178  65.123  48.939  1.00 51.80  ? 421  PRO A CD  1 
ATOM   3157 N  N   . ILE A 1 411 ? 17.101  62.885  50.701  1.00 43.06  ? 422  ILE A N   1 
ATOM   3158 C  CA  . ILE A 1 411 ? 15.916  62.257  51.275  1.00 47.49  ? 422  ILE A CA  1 
ATOM   3159 C  C   . ILE A 1 411 ? 15.795  60.847  50.711  1.00 48.68  ? 422  ILE A C   1 
ATOM   3160 O  O   . ILE A 1 411 ? 14.930  60.569  49.873  1.00 58.20  ? 422  ILE A O   1 
ATOM   3161 C  CB  . ILE A 1 411 ? 14.651  63.090  51.001  1.00 42.17  ? 422  ILE A CB  1 
ATOM   3162 C  CG1 . ILE A 1 411 ? 14.907  64.563  51.324  1.00 44.41  ? 422  ILE A CG1 1 
ATOM   3163 C  CG2 . ILE A 1 411 ? 13.484  62.580  51.830  1.00 48.05  ? 422  ILE A CG2 1 
ATOM   3164 C  CD1 . ILE A 1 411 ? 13.687  65.445  51.168  1.00 49.87  ? 422  ILE A CD1 1 
ATOM   3165 N  N   . ASP A 1 412 ? 16.673  59.950  51.162  1.00 44.33  ? 423  ASP A N   1 
ATOM   3166 C  CA  . ASP A 1 412 ? 16.730  58.581  50.670  1.00 45.37  ? 423  ASP A CA  1 
ATOM   3167 C  C   . ASP A 1 412 ? 16.083  57.587  51.626  1.00 64.43  ? 423  ASP A C   1 
ATOM   3168 O  O   . ASP A 1 412 ? 16.360  56.385  51.541  1.00 76.55  ? 423  ASP A O   1 
ATOM   3169 C  CB  . ASP A 1 412 ? 18.181  58.176  50.401  1.00 68.39  ? 423  ASP A CB  1 
ATOM   3170 C  CG  . ASP A 1 412 ? 19.058  58.295  51.634  1.00 70.92  ? 423  ASP A CG  1 
ATOM   3171 O  OD1 . ASP A 1 412 ? 19.347  59.434  52.055  1.00 78.80  ? 423  ASP A OD1 1 
ATOM   3172 O  OD2 . ASP A 1 412 ? 19.449  57.248  52.191  1.00 71.03  ? 423  ASP A OD2 1 
ATOM   3173 N  N   . GLY A 1 413 ? 15.231  58.059  52.531  1.00 54.01  ? 424  GLY A N   1 
ATOM   3174 C  CA  . GLY A 1 413 ? 14.633  57.168  53.513  1.00 57.70  ? 424  GLY A CA  1 
ATOM   3175 C  C   . GLY A 1 413 ? 13.651  56.210  52.865  1.00 53.70  ? 424  GLY A C   1 
ATOM   3176 O  O   . GLY A 1 413 ? 12.824  56.608  52.035  1.00 61.05  ? 424  GLY A O   1 
ATOM   3177 N  N   . GLY A 1 414 ? 13.738  54.939  53.239  1.00 50.26  ? 425  GLY A N   1 
ATOM   3178 C  CA  . GLY A 1 414 ? 12.834  53.922  52.747  1.00 51.76  ? 425  GLY A CA  1 
ATOM   3179 C  C   . GLY A 1 414 ? 13.472  53.042  51.685  1.00 57.02  ? 425  GLY A C   1 
ATOM   3180 O  O   . GLY A 1 414 ? 14.550  53.319  51.152  1.00 52.61  ? 425  GLY A O   1 
ATOM   3181 N  N   . THR A 1 415 ? 12.772  51.950  51.381  1.00 66.07  ? 426  THR A N   1 
ATOM   3182 C  CA  . THR A 1 415 ? 13.200  50.982  50.376  1.00 52.55  ? 426  THR A CA  1 
ATOM   3183 C  C   . THR A 1 415 ? 12.008  50.677  49.480  1.00 62.61  ? 426  THR A C   1 
ATOM   3184 O  O   . THR A 1 415 ? 11.025  50.081  49.933  1.00 53.38  ? 426  THR A O   1 
ATOM   3185 C  CB  . THR A 1 415 ? 13.733  49.704  51.026  1.00 54.43  ? 426  THR A CB  1 
ATOM   3186 O  OG1 . THR A 1 415 ? 14.672  50.042  52.054  1.00 58.28  ? 426  THR A OG1 1 
ATOM   3187 C  CG2 . THR A 1 415 ? 14.422  48.830  49.990  1.00 56.89  ? 426  THR A CG2 1 
ATOM   3188 N  N   . SER A 1 416 ? 12.091  51.086  48.217  1.00 66.22  ? 427  SER A N   1 
ATOM   3189 C  CA  . SER A 1 416 ? 10.995  50.888  47.276  1.00 60.60  ? 427  SER A CA  1 
ATOM   3190 C  C   . SER A 1 416 ? 10.974  49.438  46.807  1.00 60.07  ? 427  SER A C   1 
ATOM   3191 O  O   . SER A 1 416 ? 11.969  48.937  46.274  1.00 72.87  ? 427  SER A O   1 
ATOM   3192 C  CB  . SER A 1 416 ? 11.133  51.838  46.089  1.00 50.07  ? 427  SER A CB  1 
ATOM   3193 O  OG  . SER A 1 416 ? 10.103  51.620  45.140  1.00 55.47  ? 427  SER A OG  1 
ATOM   3194 N  N   . LEU A 1 417 ? 9.841   48.768  47.004  1.00 56.63  ? 428  LEU A N   1 
ATOM   3195 C  CA  . LEU A 1 417 ? 9.672   47.386  46.577  1.00 65.90  ? 428  LEU A CA  1 
ATOM   3196 C  C   . LEU A 1 417 ? 9.112   47.261  45.167  1.00 80.13  ? 428  LEU A C   1 
ATOM   3197 O  O   . LEU A 1 417 ? 9.040   46.144  44.644  1.00 88.06  ? 428  LEU A O   1 
ATOM   3198 C  CB  . LEU A 1 417 ? 8.757   46.635  47.552  1.00 66.04  ? 428  LEU A CB  1 
ATOM   3199 C  CG  . LEU A 1 417 ? 9.397   45.939  48.756  1.00 59.82  ? 428  LEU A CG  1 
ATOM   3200 C  CD1 . LEU A 1 417 ? 10.135  46.925  49.648  1.00 64.40  ? 428  LEU A CD1 1 
ATOM   3201 C  CD2 . LEU A 1 417 ? 8.342   45.184  49.550  1.00 62.54  ? 428  LEU A CD2 1 
ATOM   3202 N  N   . THR A 1 418 ? 8.715   48.366  44.548  1.00 78.77  ? 429  THR A N   1 
ATOM   3203 C  CA  . THR A 1 418 ? 8.155   48.309  43.204  1.00 78.62  ? 429  THR A CA  1 
ATOM   3204 C  C   . THR A 1 418 ? 9.234   47.882  42.215  1.00 86.88  ? 429  THR A C   1 
ATOM   3205 O  O   . THR A 1 418 ? 10.316  48.479  42.190  1.00 89.91  ? 429  THR A O   1 
ATOM   3206 C  CB  . THR A 1 418 ? 7.581   49.667  42.805  1.00 89.47  ? 429  THR A CB  1 
ATOM   3207 O  OG1 . THR A 1 418 ? 6.899   50.247  43.924  1.00 103.93 ? 429  THR A OG1 1 
ATOM   3208 C  CG2 . THR A 1 418 ? 6.599   49.511  41.654  1.00 88.28  ? 429  THR A CG2 1 
ATOM   3209 N  N   . PRO A 1 419 ? 8.987   46.859  41.392  1.00 79.90  ? 430  PRO A N   1 
ATOM   3210 C  CA  . PRO A 1 419 ? 10.018  46.404  40.449  1.00 73.67  ? 430  PRO A CA  1 
ATOM   3211 C  C   . PRO A 1 419 ? 10.272  47.397  39.325  1.00 77.84  ? 430  PRO A C   1 
ATOM   3212 O  O   . PRO A 1 419 ? 9.587   48.419  39.218  1.00 76.41  ? 430  PRO A O   1 
ATOM   3213 C  CB  . PRO A 1 419 ? 9.444   45.085  39.915  1.00 57.20  ? 430  PRO A CB  1 
ATOM   3214 C  CG  . PRO A 1 419 ? 7.970   45.233  40.067  1.00 63.97  ? 430  PRO A CG  1 
ATOM   3215 C  CD  . PRO A 1 419 ? 7.766   46.038  41.320  1.00 80.50  ? 430  PRO A CD  1 
ATOM   3216 N  N   . ALA A 1 420 ? 11.261  47.095  38.482  1.00 91.97  ? 431  ALA A N   1 
ATOM   3217 C  CA  . ALA A 1 420 ? 11.621  47.974  37.383  1.00 98.93  ? 431  ALA A CA  1 
ATOM   3218 C  C   . ALA A 1 420 ? 10.472  48.076  36.380  1.00 95.12  ? 431  ALA A C   1 
ATOM   3219 O  O   . ALA A 1 420 ? 9.639   47.171  36.281  1.00 95.47  ? 431  ALA A O   1 
ATOM   3220 C  CB  . ALA A 1 420 ? 12.886  47.463  36.694  1.00 110.65 ? 431  ALA A CB  1 
ATOM   3221 N  N   . PRO A 1 421 ? 10.402  49.178  35.628  1.00 92.41  ? 432  PRO A N   1 
ATOM   3222 C  CA  . PRO A 1 421 ? 9.323   49.322  34.654  1.00 92.56  ? 432  PRO A CA  1 
ATOM   3223 C  C   . PRO A 1 421 ? 9.494   48.343  33.507  1.00 88.73  ? 432  PRO A C   1 
ATOM   3224 O  O   . PRO A 1 421 ? 10.626  47.974  33.149  1.00 79.32  ? 432  PRO A O   1 
ATOM   3225 C  CB  . PRO A 1 421 ? 9.470   50.778  34.176  1.00 90.21  ? 432  PRO A CB  1 
ATOM   3226 C  CG  . PRO A 1 421 ? 10.903  51.104  34.416  1.00 83.97  ? 432  PRO A CG  1 
ATOM   3227 C  CD  . PRO A 1 421 ? 11.266  50.371  35.674  1.00 89.11  ? 432  PRO A CD  1 
ATOM   3228 N  N   . PRO A 1 422 ? 8.395   47.888  32.902  1.00 86.22  ? 433  PRO A N   1 
ATOM   3229 C  CA  . PRO A 1 422 ? 8.508   46.969  31.761  1.00 81.93  ? 433  PRO A CA  1 
ATOM   3230 C  C   . PRO A 1 422 ? 9.064   47.647  30.518  1.00 85.55  ? 433  PRO A C   1 
ATOM   3231 O  O   . PRO A 1 422 ? 10.051  47.182  29.939  1.00 89.05  ? 433  PRO A O   1 
ATOM   3232 C  CB  . PRO A 1 422 ? 7.065   46.493  31.548  1.00 76.61  ? 433  PRO A CB  1 
ATOM   3233 C  CG  . PRO A 1 422 ? 6.217   47.577  32.130  1.00 71.31  ? 433  PRO A CG  1 
ATOM   3234 C  CD  . PRO A 1 422 ? 6.994   48.132  33.288  1.00 75.02  ? 433  PRO A CD  1 
ATOM   3235 N  N   . GLN A 1 423 ? 8.443   48.747  30.103  1.00 77.72  ? 434  GLN A N   1 
ATOM   3236 C  CA  . GLN A 1 423 ? 8.850   49.492  28.922  1.00 71.38  ? 434  GLN A CA  1 
ATOM   3237 C  C   . GLN A 1 423 ? 9.187   50.928  29.306  1.00 65.10  ? 434  GLN A C   1 
ATOM   3238 O  O   . GLN A 1 423 ? 8.961   51.367  30.437  1.00 48.18  ? 434  GLN A O   1 
ATOM   3239 C  CB  . GLN A 1 423 ? 7.751   49.470  27.852  1.00 74.76  ? 434  GLN A CB  1 
ATOM   3240 C  CG  . GLN A 1 423 ? 6.428   50.065  28.309  1.00 79.61  ? 434  GLN A CG  1 
ATOM   3241 C  CD  . GLN A 1 423 ? 5.367   50.035  27.225  1.00 85.91  ? 434  GLN A CD  1 
ATOM   3242 O  OE1 . GLN A 1 423 ? 5.569   49.454  26.159  1.00 87.67  ? 434  GLN A OE1 1 
ATOM   3243 N  NE2 . GLN A 1 423 ? 4.229   50.665  27.493  1.00 87.99  ? 434  GLN A NE2 1 
ATOM   3244 N  N   . ARG A 1 424 ? 9.738   51.662  28.342  1.00 66.24  ? 435  ARG A N   1 
ATOM   3245 C  CA  . ARG A 1 424 ? 10.090  53.069  28.522  1.00 59.86  ? 435  ARG A CA  1 
ATOM   3246 C  C   . ARG A 1 424 ? 8.988   53.926  27.908  1.00 54.15  ? 435  ARG A C   1 
ATOM   3247 O  O   . ARG A 1 424 ? 8.963   54.149  26.695  1.00 58.07  ? 435  ARG A O   1 
ATOM   3248 C  CB  . ARG A 1 424 ? 11.444  53.386  27.896  1.00 58.59  ? 435  ARG A CB  1 
ATOM   3249 C  CG  . ARG A 1 424 ? 12.645  52.973  28.731  1.00 74.90  ? 435  ARG A CG  1 
ATOM   3250 C  CD  . ARG A 1 424 ? 13.202  51.634  28.283  1.00 90.24  ? 435  ARG A CD  1 
ATOM   3251 N  NE  . ARG A 1 424 ? 13.427  51.599  26.841  1.00 95.98  ? 435  ARG A NE  1 
ATOM   3252 C  CZ  . ARG A 1 424 ? 14.091  50.636  26.211  1.00 103.96 ? 435  ARG A CZ  1 
ATOM   3253 N  NH1 . ARG A 1 424 ? 14.609  49.627  26.897  1.00 104.37 ? 435  ARG A NH1 1 
ATOM   3254 N  NH2 . ARG A 1 424 ? 14.243  50.685  24.895  1.00 106.70 ? 435  ARG A NH2 1 
ATOM   3255 N  N   . ASP A 1 425 ? 8.076   54.404  28.746  1.00 49.56  ? 436  ASP A N   1 
ATOM   3256 C  CA  . ASP A 1 425 ? 7.074   55.361  28.307  1.00 52.43  ? 436  ASP A CA  1 
ATOM   3257 C  C   . ASP A 1 425 ? 7.588   56.785  28.500  1.00 45.63  ? 436  ASP A C   1 
ATOM   3258 O  O   . ASP A 1 425 ? 8.534   57.036  29.252  1.00 44.29  ? 436  ASP A O   1 
ATOM   3259 C  CB  . ASP A 1 425 ? 5.760   55.165  29.064  1.00 52.87  ? 436  ASP A CB  1 
ATOM   3260 C  CG  . ASP A 1 425 ? 5.128   53.815  28.793  1.00 64.23  ? 436  ASP A CG  1 
ATOM   3261 O  OD1 . ASP A 1 425 ? 5.394   53.240  27.717  1.00 71.18  ? 436  ASP A OD1 1 
ATOM   3262 O  OD2 . ASP A 1 425 ? 4.364   53.332  29.656  1.00 65.49  ? 436  ASP A OD2 1 
ATOM   3263 N  N   . LEU A 1 426 ? 6.946   57.722  27.806  1.00 43.91  ? 437  LEU A N   1 
ATOM   3264 C  CA  . LEU A 1 426 ? 7.401   59.107  27.772  1.00 49.24  ? 437  LEU A CA  1 
ATOM   3265 C  C   . LEU A 1 426 ? 6.187   60.020  27.725  1.00 42.95  ? 437  LEU A C   1 
ATOM   3266 O  O   . LEU A 1 426 ? 5.351   59.892  26.826  1.00 43.10  ? 437  LEU A O   1 
ATOM   3267 C  CB  . LEU A 1 426 ? 8.305   59.350  26.559  1.00 54.82  ? 437  LEU A CB  1 
ATOM   3268 C  CG  . LEU A 1 426 ? 9.155   60.621  26.520  1.00 43.41  ? 437  LEU A CG  1 
ATOM   3269 C  CD1 . LEU A 1 426 ? 10.241  60.579  27.582  1.00 43.42  ? 437  LEU A CD1 1 
ATOM   3270 C  CD2 . LEU A 1 426 ? 9.762   60.800  25.140  1.00 57.25  ? 437  LEU A CD2 1 
ATOM   3271 N  N   . LEU A 1 427 ? 6.092   60.934  28.686  1.00 42.50  ? 438  LEU A N   1 
ATOM   3272 C  CA  . LEU A 1 427 ? 5.025   61.924  28.730  1.00 42.22  ? 438  LEU A CA  1 
ATOM   3273 C  C   . LEU A 1 427 ? 5.598   63.296  28.404  1.00 59.92  ? 438  LEU A C   1 
ATOM   3274 O  O   . LEU A 1 427 ? 6.568   63.734  29.030  1.00 59.11  ? 438  LEU A O   1 
ATOM   3275 C  CB  . LEU A 1 427 ? 4.345   61.950  30.100  1.00 45.13  ? 438  LEU A CB  1 
ATOM   3276 C  CG  . LEU A 1 427 ? 3.201   62.961  30.229  1.00 41.97  ? 438  LEU A CG  1 
ATOM   3277 C  CD1 . LEU A 1 427 ? 2.062   62.607  29.284  1.00 42.33  ? 438  LEU A CD1 1 
ATOM   3278 C  CD2 . LEU A 1 427 ? 2.708   63.048  31.663  1.00 41.91  ? 438  LEU A CD2 1 
ATOM   3279 N  N   . LEU A 1 428 ? 4.999   63.965  27.424  1.00 56.66  ? 439  LEU A N   1 
ATOM   3280 C  CA  . LEU A 1 428 ? 5.390   65.307  27.024  1.00 57.76  ? 439  LEU A CA  1 
ATOM   3281 C  C   . LEU A 1 428 ? 4.304   66.291  27.436  1.00 64.25  ? 439  LEU A C   1 
ATOM   3282 O  O   . LEU A 1 428 ? 3.112   65.983  27.346  1.00 66.93  ? 439  LEU A O   1 
ATOM   3283 C  CB  . LEU A 1 428 ? 5.628   65.391  25.513  1.00 49.97  ? 439  LEU A CB  1 
ATOM   3284 C  CG  . LEU A 1 428 ? 6.943   64.846  24.946  1.00 52.66  ? 439  LEU A CG  1 
ATOM   3285 C  CD1 . LEU A 1 428 ? 7.047   63.334  25.087  1.00 60.63  ? 439  LEU A CD1 1 
ATOM   3286 C  CD2 . LEU A 1 428 ? 7.094   65.254  23.491  1.00 48.91  ? 439  LEU A CD2 1 
ATOM   3287 N  N   . THR A 1 429 ? 4.718   67.470  27.895  1.00 64.42  ? 440  THR A N   1 
ATOM   3288 C  CA  . THR A 1 429 ? 3.790   68.500  28.350  1.00 60.01  ? 440  THR A CA  1 
ATOM   3289 C  C   . THR A 1 429 ? 4.146   69.821  27.688  1.00 54.13  ? 440  THR A C   1 
ATOM   3290 O  O   . THR A 1 429 ? 5.282   70.292  27.809  1.00 51.22  ? 440  THR A O   1 
ATOM   3291 C  CB  . THR A 1 429 ? 3.821   68.649  29.875  1.00 57.33  ? 440  THR A CB  1 
ATOM   3292 O  OG1 . THR A 1 429 ? 5.149   68.982  30.300  1.00 61.42  ? 440  THR A OG1 1 
ATOM   3293 C  CG2 . THR A 1 429 ? 3.382   67.359  30.552  1.00 60.52  ? 440  THR A CG2 1 
ATOM   3294 N  N   . GLY A 1 430 ? 3.180   70.411  26.989  1.00 58.34  ? 441  GLY A N   1 
ATOM   3295 C  CA  . GLY A 1 430 ? 3.330   71.757  26.477  1.00 66.22  ? 441  GLY A CA  1 
ATOM   3296 C  C   . GLY A 1 430 ? 2.800   72.775  27.470  1.00 59.98  ? 441  GLY A C   1 
ATOM   3297 O  O   . GLY A 1 430 ? 1.828   72.530  28.179  1.00 58.04  ? 441  GLY A O   1 
ATOM   3298 N  N   . HIS A 1 431 ? 3.454   73.932  27.518  1.00 53.43  ? 442  HIS A N   1 
ATOM   3299 C  CA  . HIS A 1 431 ? 3.162   74.930  28.534  1.00 50.27  ? 442  HIS A CA  1 
ATOM   3300 C  C   . HIS A 1 431 ? 2.892   76.281  27.887  1.00 63.96  ? 442  HIS A C   1 
ATOM   3301 O  O   . HIS A 1 431 ? 3.085   76.476  26.683  1.00 74.84  ? 442  HIS A O   1 
ATOM   3302 C  CB  . HIS A 1 431 ? 4.308   75.026  29.549  1.00 43.27  ? 442  HIS A CB  1 
ATOM   3303 C  CG  . HIS A 1 431 ? 4.599   73.733  30.244  1.00 42.51  ? 442  HIS A CG  1 
ATOM   3304 N  ND1 . HIS A 1 431 ? 4.040   73.399  31.459  1.00 55.02  ? 442  HIS A ND1 1 
ATOM   3305 C  CD2 . HIS A 1 431 ? 5.377   72.684  29.887  1.00 43.64  ? 442  HIS A CD2 1 
ATOM   3306 C  CE1 . HIS A 1 431 ? 4.469   72.204  31.825  1.00 45.94  ? 442  HIS A CE1 1 
ATOM   3307 N  NE2 . HIS A 1 431 ? 5.281   71.748  30.888  1.00 43.98  ? 442  HIS A NE2 1 
ATOM   3308 N  N   . GLU A 1 432 ? 2.433   77.222  28.717  1.00 54.98  ? 443  GLU A N   1 
ATOM   3309 C  CA  . GLU A 1 432 ? 2.008   78.524  28.215  1.00 52.56  ? 443  GLU A CA  1 
ATOM   3310 C  C   . GLU A 1 432 ? 3.190   79.385  27.788  1.00 58.85  ? 443  GLU A C   1 
ATOM   3311 O  O   . GLU A 1 432 ? 3.062   80.193  26.861  1.00 66.40  ? 443  GLU A O   1 
ATOM   3312 C  CB  . GLU A 1 432 ? 1.184   79.247  29.282  1.00 53.76  ? 443  GLU A CB  1 
ATOM   3313 C  CG  . GLU A 1 432 ? 0.529   80.533  28.809  1.00 79.16  ? 443  GLU A CG  1 
ATOM   3314 C  CD  . GLU A 1 432 ? -0.075  81.332  29.947  1.00 92.19  ? 443  GLU A CD  1 
ATOM   3315 O  OE1 . GLU A 1 432 ? 0.429   81.221  31.085  1.00 101.70 ? 443  GLU A OE1 1 
ATOM   3316 O  OE2 . GLU A 1 432 ? -1.054  82.068  29.706  1.00 99.69  ? 443  GLU A OE2 1 
ATOM   3317 N  N   . ASP A 1 433 ? 4.338   79.233  28.441  1.00 56.43  ? 444  ASP A N   1 
ATOM   3318 C  CA  . ASP A 1 433 ? 5.508   80.050  28.145  1.00 56.79  ? 444  ASP A CA  1 
ATOM   3319 C  C   . ASP A 1 433 ? 6.329   79.512  26.978  1.00 52.07  ? 444  ASP A C   1 
ATOM   3320 O  O   . ASP A 1 433 ? 7.419   80.032  26.716  1.00 46.98  ? 444  ASP A O   1 
ATOM   3321 C  CB  . ASP A 1 433 ? 6.386   80.172  29.393  1.00 63.28  ? 444  ASP A CB  1 
ATOM   3322 C  CG  . ASP A 1 433 ? 7.185   78.916  29.666  1.00 73.85  ? 444  ASP A CG  1 
ATOM   3323 O  OD1 . ASP A 1 433 ? 8.389   79.034  29.980  1.00 86.19  ? 444  ASP A OD1 1 
ATOM   3324 O  OD2 . ASP A 1 433 ? 6.618   77.812  29.543  1.00 76.92  ? 444  ASP A OD2 1 
ATOM   3325 N  N   . GLY A 1 434 ? 5.840   78.491  26.280  1.00 54.99  ? 445  GLY A N   1 
ATOM   3326 C  CA  . GLY A 1 434 ? 6.523   77.963  25.117  1.00 56.42  ? 445  GLY A CA  1 
ATOM   3327 C  C   . GLY A 1 434 ? 7.459   76.806  25.374  1.00 55.19  ? 445  GLY A C   1 
ATOM   3328 O  O   . GLY A 1 434 ? 8.206   76.426  24.465  1.00 55.28  ? 445  GLY A O   1 
ATOM   3329 N  N   . THR A 1 435 ? 7.445   76.232  26.571  1.00 52.80  ? 446  THR A N   1 
ATOM   3330 C  CA  . THR A 1 435 ? 8.344   75.143  26.917  1.00 57.39  ? 446  THR A CA  1 
ATOM   3331 C  C   . THR A 1 435 ? 7.646   73.796  26.777  1.00 56.04  ? 446  THR A C   1 
ATOM   3332 O  O   . THR A 1 435 ? 6.442   73.668  27.014  1.00 60.65  ? 446  THR A O   1 
ATOM   3333 C  CB  . THR A 1 435 ? 8.876   75.300  28.344  1.00 58.51  ? 446  THR A CB  1 
ATOM   3334 O  OG1 . THR A 1 435 ? 7.780   75.452  29.253  1.00 67.30  ? 446  THR A OG1 1 
ATOM   3335 C  CG2 . THR A 1 435 ? 9.788   76.512  28.442  1.00 74.89  ? 446  THR A CG2 1 
ATOM   3336 N  N   . VAL A 1 436 ? 8.422   72.792  26.377  1.00 49.13  ? 447  VAL A N   1 
ATOM   3337 C  CA  . VAL A 1 436 ? 7.971   71.409  26.304  1.00 50.19  ? 447  VAL A CA  1 
ATOM   3338 C  C   . VAL A 1 436 ? 8.902   70.572  27.169  1.00 57.09  ? 447  VAL A C   1 
ATOM   3339 O  O   . VAL A 1 436 ? 10.128  70.694  27.065  1.00 42.86  ? 447  VAL A O   1 
ATOM   3340 C  CB  . VAL A 1 436 ? 7.948   70.888  24.855  1.00 43.50  ? 447  VAL A CB  1 
ATOM   3341 C  CG1 . VAL A 1 436 ? 7.506   69.434  24.821  1.00 43.15  ? 447  VAL A CG1 1 
ATOM   3342 C  CG2 . VAL A 1 436 ? 7.032   71.745  23.998  1.00 44.03  ? 447  VAL A CG2 1 
ATOM   3343 N  N   . ARG A 1 437 ? 8.323   69.733  28.023  1.00 58.25  ? 448  ARG A N   1 
ATOM   3344 C  CA  . ARG A 1 437 ? 9.083   68.935  28.973  1.00 57.47  ? 448  ARG A CA  1 
ATOM   3345 C  C   . ARG A 1 437 ? 8.855   67.452  28.718  1.00 53.80  ? 448  ARG A C   1 
ATOM   3346 O  O   . ARG A 1 437 ? 7.730   67.023  28.445  1.00 53.16  ? 448  ARG A O   1 
ATOM   3347 C  CB  . ARG A 1 437 ? 8.706   69.297  30.412  1.00 53.29  ? 448  ARG A CB  1 
ATOM   3348 C  CG  . ARG A 1 437 ? 9.271   70.635  30.850  1.00 51.89  ? 448  ARG A CG  1 
ATOM   3349 C  CD  . ARG A 1 437 ? 8.719   71.090  32.186  1.00 41.03  ? 448  ARG A CD  1 
ATOM   3350 N  NE  . ARG A 1 437 ? 9.400   72.295  32.653  1.00 44.48  ? 448  ARG A NE  1 
ATOM   3351 C  CZ  . ARG A 1 437 ? 9.103   73.526  32.250  1.00 53.19  ? 448  ARG A CZ  1 
ATOM   3352 N  NH1 . ARG A 1 437 ? 8.130   73.725  31.372  1.00 41.86  ? 448  ARG A NH1 1 
ATOM   3353 N  NH2 . ARG A 1 437 ? 9.778   74.563  32.729  1.00 72.67  ? 448  ARG A NH2 1 
ATOM   3354 N  N   . PHE A 1 438 ? 9.933   66.677  28.812  1.00 47.15  ? 449  PHE A N   1 
ATOM   3355 C  CA  . PHE A 1 438 ? 9.924   65.245  28.531  1.00 54.35  ? 449  PHE A CA  1 
ATOM   3356 C  C   . PHE A 1 438 ? 10.010  64.500  29.858  1.00 58.76  ? 449  PHE A C   1 
ATOM   3357 O  O   . PHE A 1 438 ? 11.039  64.552  30.540  1.00 62.42  ? 449  PHE A O   1 
ATOM   3358 C  CB  . PHE A 1 438 ? 11.078  64.865  27.603  1.00 47.52  ? 449  PHE A CB  1 
ATOM   3359 C  CG  . PHE A 1 438 ? 10.925  65.380  26.195  1.00 52.31  ? 449  PHE A CG  1 
ATOM   3360 C  CD1 . PHE A 1 438 ? 10.717  64.502  25.143  1.00 54.76  ? 449  PHE A CD1 1 
ATOM   3361 C  CD2 . PHE A 1 438 ? 10.987  66.738  25.923  1.00 43.12  ? 449  PHE A CD2 1 
ATOM   3362 C  CE1 . PHE A 1 438 ? 10.579  64.969  23.848  1.00 43.85  ? 449  PHE A CE1 1 
ATOM   3363 C  CE2 . PHE A 1 438 ? 10.845  67.210  24.632  1.00 43.61  ? 449  PHE A CE2 1 
ATOM   3364 C  CZ  . PHE A 1 438 ? 10.640  66.324  23.593  1.00 43.95  ? 449  PHE A CZ  1 
ATOM   3365 N  N   . TRP A 1 439 ? 8.934   63.808  30.219  1.00 48.98  ? 450  TRP A N   1 
ATOM   3366 C  CA  . TRP A 1 439 ? 8.831   63.125  31.499  1.00 43.95  ? 450  TRP A CA  1 
ATOM   3367 C  C   . TRP A 1 439 ? 8.966   61.618  31.318  1.00 55.38  ? 450  TRP A C   1 
ATOM   3368 O  O   . TRP A 1 439 ? 8.571   61.059  30.291  1.00 65.32  ? 450  TRP A O   1 
ATOM   3369 C  CB  . TRP A 1 439 ? 7.501   63.449  32.183  1.00 47.11  ? 450  TRP A CB  1 
ATOM   3370 C  CG  . TRP A 1 439 ? 7.279   64.913  32.395  1.00 51.87  ? 450  TRP A CG  1 
ATOM   3371 C  CD1 . TRP A 1 439 ? 6.641   65.775  31.552  1.00 51.75  ? 450  TRP A CD1 1 
ATOM   3372 C  CD2 . TRP A 1 439 ? 7.698   65.690  33.523  1.00 49.96  ? 450  TRP A CD2 1 
ATOM   3373 N  NE1 . TRP A 1 439 ? 6.634   67.041  32.087  1.00 45.39  ? 450  TRP A NE1 1 
ATOM   3374 C  CE2 . TRP A 1 439 ? 7.278   67.015  33.296  1.00 54.93  ? 450  TRP A CE2 1 
ATOM   3375 C  CE3 . TRP A 1 439 ? 8.387   65.393  34.703  1.00 53.43  ? 450  TRP A CE3 1 
ATOM   3376 C  CZ2 . TRP A 1 439 ? 7.525   68.042  34.204  1.00 62.46  ? 450  TRP A CZ2 1 
ATOM   3377 C  CZ3 . TRP A 1 439 ? 8.630   66.413  35.603  1.00 59.01  ? 450  TRP A CZ3 1 
ATOM   3378 C  CH2 . TRP A 1 439 ? 8.201   67.721  35.349  1.00 60.07  ? 450  TRP A CH2 1 
ATOM   3379 N  N   . ASP A 1 440 ? 9.523   60.965  32.339  1.00 53.84  ? 451  ASP A N   1 
ATOM   3380 C  CA  . ASP A 1 440 ? 9.754   59.521  32.321  1.00 55.34  ? 451  ASP A CA  1 
ATOM   3381 C  C   . ASP A 1 440 ? 8.565   58.828  32.982  1.00 68.23  ? 451  ASP A C   1 
ATOM   3382 O  O   . ASP A 1 440 ? 8.609   58.411  34.139  1.00 80.58  ? 451  ASP A O   1 
ATOM   3383 C  CB  . ASP A 1 440 ? 11.066  59.186  33.021  1.00 57.56  ? 451  ASP A CB  1 
ATOM   3384 C  CG  . ASP A 1 440 ? 11.388  57.699  33.003  1.00 56.78  ? 451  ASP A CG  1 
ATOM   3385 O  OD1 . ASP A 1 440 ? 10.631  56.917  32.391  1.00 60.70  ? 451  ASP A OD1 1 
ATOM   3386 O  OD2 . ASP A 1 440 ? 12.410  57.311  33.608  1.00 57.39  ? 451  ASP A OD2 1 
ATOM   3387 N  N   . ALA A 1 441 ? 7.484   58.695  32.217  1.00 69.99  ? 452  ALA A N   1 
ATOM   3388 C  CA  . ALA A 1 441 ? 6.274   58.020  32.689  1.00 57.55  ? 452  ALA A CA  1 
ATOM   3389 C  C   . ALA A 1 441 ? 6.311   56.521  32.436  1.00 57.76  ? 452  ALA A C   1 
ATOM   3390 O  O   . ALA A 1 441 ? 5.295   55.932  32.059  1.00 67.43  ? 452  ALA A O   1 
ATOM   3391 C  CB  . ALA A 1 441 ? 5.047   58.645  32.034  1.00 43.09  ? 452  ALA A CB  1 
ATOM   3392 N  N   . SER A 1 442 ? 7.465   55.881  32.646  1.00 55.49  ? 453  SER A N   1 
ATOM   3393 C  CA  . SER A 1 442 ? 7.628   54.477  32.278  1.00 68.83  ? 453  SER A CA  1 
ATOM   3394 C  C   . SER A 1 442 ? 6.679   53.582  33.067  1.00 89.25  ? 453  SER A C   1 
ATOM   3395 O  O   . SER A 1 442 ? 5.827   52.895  32.492  1.00 116.34 ? 453  SER A O   1 
ATOM   3396 C  CB  . SER A 1 442 ? 9.080   54.047  32.493  1.00 60.46  ? 453  SER A CB  1 
ATOM   3397 O  OG  . SER A 1 442 ? 9.961   54.812  31.691  1.00 72.45  ? 453  SER A OG  1 
ATOM   3398 N  N   . GLY A 1 443 ? 6.816   53.573  34.389  1.00 75.87  ? 454  GLY A N   1 
ATOM   3399 C  CA  . GLY A 1 443 ? 5.963   52.749  35.221  1.00 80.89  ? 454  GLY A CA  1 
ATOM   3400 C  C   . GLY A 1 443 ? 5.109   53.562  36.169  1.00 94.88  ? 454  GLY A C   1 
ATOM   3401 O  O   . GLY A 1 443 ? 3.886   53.634  36.012  1.00 104.26 ? 454  GLY A O   1 
ATOM   3402 N  N   . VAL A 1 444 ? 5.747   54.181  37.159  1.00 94.36  ? 455  VAL A N   1 
ATOM   3403 C  CA  . VAL A 1 444 ? 5.046   55.001  38.140  1.00 92.92  ? 455  VAL A CA  1 
ATOM   3404 C  C   . VAL A 1 444 ? 5.744   56.347  38.267  1.00 98.32  ? 455  VAL A C   1 
ATOM   3405 O  O   . VAL A 1 444 ? 5.174   57.386  37.918  1.00 105.33 ? 455  VAL A O   1 
ATOM   3406 C  CB  . VAL A 1 444 ? 4.960   54.292  39.505  1.00 81.78  ? 455  VAL A CB  1 
ATOM   3407 C  CG1 . VAL A 1 444 ? 4.530   55.271  40.585  1.00 72.38  ? 455  VAL A CG1 1 
ATOM   3408 C  CG2 . VAL A 1 444 ? 3.992   53.122  39.434  1.00 79.92  ? 455  VAL A CG2 1 
ATOM   3409 N  N   . CYS A 1 445 ? 6.984   56.334  38.756  1.00 112.43 ? 456  CYS A N   1 
ATOM   3410 C  CA  . CYS A 1 445 ? 7.707   57.571  39.026  1.00 124.02 ? 456  CYS A CA  1 
ATOM   3411 C  C   . CYS A 1 445 ? 7.810   58.419  37.765  1.00 125.52 ? 456  CYS A C   1 
ATOM   3412 O  O   . CYS A 1 445 ? 8.176   57.922  36.697  1.00 137.68 ? 456  CYS A O   1 
ATOM   3413 C  CB  . CYS A 1 445 ? 9.099   57.255  39.571  1.00 126.14 ? 456  CYS A CB  1 
ATOM   3414 S  SG  . CYS A 1 445 ? 10.019  58.698  40.153  1.00 124.25 ? 456  CYS A SG  1 
ATOM   3415 N  N   . LEU A 1 446 ? 7.478   59.701  37.894  1.00 108.76 ? 457  LEU A N   1 
ATOM   3416 C  CA  . LEU A 1 446 ? 7.428   60.646  36.778  1.00 87.53  ? 457  LEU A CA  1 
ATOM   3417 C  C   . LEU A 1 446 ? 8.484   61.721  37.018  1.00 80.17  ? 457  LEU A C   1 
ATOM   3418 O  O   . LEU A 1 446 ? 8.223   62.719  37.695  1.00 87.37  ? 457  LEU A O   1 
ATOM   3419 C  CB  . LEU A 1 446 ? 6.030   61.258  36.648  1.00 65.88  ? 457  LEU A CB  1 
ATOM   3420 C  CG  . LEU A 1 446 ? 5.788   62.216  35.480  1.00 51.60  ? 457  LEU A CG  1 
ATOM   3421 C  CD1 . LEU A 1 446 ? 5.380   61.443  34.243  1.00 48.71  ? 457  LEU A CD1 1 
ATOM   3422 C  CD2 . LEU A 1 446 ? 4.741   63.261  35.831  1.00 41.31  ? 457  LEU A CD2 1 
ATOM   3423 N  N   . ARG A 1 447 ? 9.674   61.524  36.458  1.00 74.47  ? 458  ARG A N   1 
ATOM   3424 C  CA  . ARG A 1 447 ? 10.767  62.470  36.619  1.00 70.58  ? 458  ARG A CA  1 
ATOM   3425 C  C   . ARG A 1 447 ? 11.107  63.126  35.287  1.00 53.64  ? 458  ARG A C   1 
ATOM   3426 O  O   . ARG A 1 447 ? 10.892  62.552  34.215  1.00 47.41  ? 458  ARG A O   1 
ATOM   3427 C  CB  . ARG A 1 447 ? 12.013  61.794  37.200  1.00 79.27  ? 458  ARG A CB  1 
ATOM   3428 C  CG  . ARG A 1 447 ? 12.721  60.833  36.262  1.00 86.37  ? 458  ARG A CG  1 
ATOM   3429 C  CD  . ARG A 1 447 ? 13.999  60.332  36.909  1.00 95.71  ? 458  ARG A CD  1 
ATOM   3430 N  NE  . ARG A 1 447 ? 13.734  59.751  38.222  1.00 105.43 ? 458  ARG A NE  1 
ATOM   3431 C  CZ  . ARG A 1 447 ? 14.655  59.577  39.164  1.00 104.53 ? 458  ARG A CZ  1 
ATOM   3432 N  NH1 . ARG A 1 447 ? 15.909  59.946  38.947  1.00 102.91 ? 458  ARG A NH1 1 
ATOM   3433 N  NH2 . ARG A 1 447 ? 14.317  59.040  40.328  1.00 103.12 ? 458  ARG A NH2 1 
ATOM   3434 N  N   . LEU A 1 448 ? 11.644  64.339  35.372  1.00 47.95  ? 459  LEU A N   1 
ATOM   3435 C  CA  . LEU A 1 448 ? 11.960  65.124  34.189  1.00 45.11  ? 459  LEU A CA  1 
ATOM   3436 C  C   . LEU A 1 448 ? 13.233  64.614  33.526  1.00 64.02  ? 459  LEU A C   1 
ATOM   3437 O  O   . LEU A 1 448 ? 14.224  64.310  34.197  1.00 84.49  ? 459  LEU A O   1 
ATOM   3438 C  CB  . LEU A 1 448 ? 12.118  66.598  34.562  1.00 40.80  ? 459  LEU A CB  1 
ATOM   3439 C  CG  . LEU A 1 448 ? 12.364  67.584  33.422  1.00 41.00  ? 459  LEU A CG  1 
ATOM   3440 C  CD1 . LEU A 1 448 ? 11.183  67.593  32.468  1.00 49.83  ? 459  LEU A CD1 1 
ATOM   3441 C  CD2 . LEU A 1 448 ? 12.626  68.976  33.972  1.00 42.46  ? 459  LEU A CD2 1 
ATOM   3442 N  N   . LEU A 1 449 ? 13.200  64.524  32.198  1.00 57.23  ? 460  LEU A N   1 
ATOM   3443 C  CA  . LEU A 1 449 ? 14.339  64.082  31.402  1.00 50.97  ? 460  LEU A CA  1 
ATOM   3444 C  C   . LEU A 1 449 ? 14.977  65.212  30.610  1.00 45.58  ? 460  LEU A C   1 
ATOM   3445 O  O   . LEU A 1 449 ? 16.203  65.356  30.613  1.00 58.29  ? 460  LEU A O   1 
ATOM   3446 C  CB  . LEU A 1 449 ? 13.908  62.962  30.443  1.00 49.36  ? 460  LEU A CB  1 
ATOM   3447 C  CG  . LEU A 1 449 ? 14.248  61.527  30.843  1.00 50.86  ? 460  LEU A CG  1 
ATOM   3448 C  CD1 . LEU A 1 449 ? 13.872  61.268  32.291  1.00 56.08  ? 460  LEU A CD1 1 
ATOM   3449 C  CD2 . LEU A 1 449 ? 13.546  60.544  29.920  1.00 53.02  ? 460  LEU A CD2 1 
ATOM   3450 N  N   . TYR A 1 450 ? 14.170  66.021  29.929  1.00 43.96  ? 461  TYR A N   1 
ATOM   3451 C  CA  . TYR A 1 450 ? 14.681  67.074  29.066  1.00 52.60  ? 461  TYR A CA  1 
ATOM   3452 C  C   . TYR A 1 450 ? 13.636  68.171  28.949  1.00 49.76  ? 461  TYR A C   1 
ATOM   3453 O  O   . TYR A 1 450 ? 12.435  67.891  28.914  1.00 56.52  ? 461  TYR A O   1 
ATOM   3454 C  CB  . TYR A 1 450 ? 15.042  66.523  27.680  1.00 56.16  ? 461  TYR A CB  1 
ATOM   3455 C  CG  . TYR A 1 450 ? 15.282  67.582  26.626  1.00 57.33  ? 461  TYR A CG  1 
ATOM   3456 C  CD1 . TYR A 1 450 ? 16.479  68.283  26.578  1.00 64.59  ? 461  TYR A CD1 1 
ATOM   3457 C  CD2 . TYR A 1 450 ? 14.316  67.869  25.670  1.00 55.65  ? 461  TYR A CD2 1 
ATOM   3458 C  CE1 . TYR A 1 450 ? 16.704  69.249  25.614  1.00 75.54  ? 461  TYR A CE1 1 
ATOM   3459 C  CE2 . TYR A 1 450 ? 14.532  68.832  24.702  1.00 60.25  ? 461  TYR A CE2 1 
ATOM   3460 C  CZ  . TYR A 1 450 ? 15.727  69.518  24.678  1.00 73.92  ? 461  TYR A CZ  1 
ATOM   3461 O  OH  . TYR A 1 450 ? 15.947  70.478  23.717  1.00 75.02  ? 461  TYR A OH  1 
ATOM   3462 N  N   . LYS A 1 451 ? 14.100  69.416  28.897  1.00 49.17  ? 462  LYS A N   1 
ATOM   3463 C  CA  . LYS A 1 451 ? 13.239  70.572  28.701  1.00 47.03  ? 462  LYS A CA  1 
ATOM   3464 C  C   . LYS A 1 451 ? 13.613  71.260  27.396  1.00 46.16  ? 462  LYS A C   1 
ATOM   3465 O  O   . LYS A 1 451 ? 14.798  71.449  27.100  1.00 49.43  ? 462  LYS A O   1 
ATOM   3466 C  CB  . LYS A 1 451 ? 13.354  71.564  29.865  1.00 42.63  ? 462  LYS A CB  1 
ATOM   3467 C  CG  . LYS A 1 451 ? 12.354  72.710  29.798  1.00 49.57  ? 462  LYS A CG  1 
ATOM   3468 C  CD  . LYS A 1 451 ? 12.740  73.850  30.729  1.00 68.53  ? 462  LYS A CD  1 
ATOM   3469 C  CE  . LYS A 1 451 ? 12.855  73.384  32.171  1.00 86.76  ? 462  LYS A CE  1 
ATOM   3470 N  NZ  . LYS A 1 451 ? 13.224  74.502  33.083  1.00 90.50  ? 462  LYS A NZ  1 
ATOM   3471 N  N   . LEU A 1 452 ? 12.600  71.627  26.618  1.00 55.16  ? 463  LEU A N   1 
ATOM   3472 C  CA  . LEU A 1 452 ? 12.783  72.314  25.348  1.00 63.49  ? 463  LEU A CA  1 
ATOM   3473 C  C   . LEU A 1 452 ? 12.131  73.685  25.425  1.00 62.44  ? 463  LEU A C   1 
ATOM   3474 O  O   . LEU A 1 452 ? 10.976  73.803  25.847  1.00 62.77  ? 463  LEU A O   1 
ATOM   3475 C  CB  . LEU A 1 452 ? 12.187  71.508  24.192  1.00 59.00  ? 463  LEU A CB  1 
ATOM   3476 C  CG  . LEU A 1 452 ? 12.107  72.225  22.843  1.00 55.34  ? 463  LEU A CG  1 
ATOM   3477 C  CD1 . LEU A 1 452 ? 13.491  72.632  22.360  1.00 60.68  ? 463  LEU A CD1 1 
ATOM   3478 C  CD2 . LEU A 1 452 ? 11.409  71.350  21.816  1.00 60.26  ? 463  LEU A CD2 1 
ATOM   3479 N  N   . SER A 1 453 ? 12.867  74.714  25.016  1.00 60.21  ? 464  SER A N   1 
ATOM   3480 C  CA  . SER A 1 453 ? 12.385  76.091  25.032  1.00 66.88  ? 464  SER A CA  1 
ATOM   3481 C  C   . SER A 1 453 ? 12.269  76.575  23.592  1.00 69.14  ? 464  SER A C   1 
ATOM   3482 O  O   . SER A 1 453 ? 13.282  76.759  22.909  1.00 77.80  ? 464  SER A O   1 
ATOM   3483 C  CB  . SER A 1 453 ? 13.319  76.984  25.845  1.00 74.37  ? 464  SER A CB  1 
ATOM   3484 O  OG  . SER A 1 453 ? 12.791  78.291  25.970  1.00 85.66  ? 464  SER A OG  1 
ATOM   3485 N  N   . THR A 1 454 ? 11.034  76.779  23.133  1.00 64.62  ? 465  THR A N   1 
ATOM   3486 C  CA  . THR A 1 454 ? 10.790  77.218  21.765  1.00 53.32  ? 465  THR A CA  1 
ATOM   3487 C  C   . THR A 1 454 ? 10.886  78.727  21.596  1.00 59.60  ? 465  THR A C   1 
ATOM   3488 O  O   . THR A 1 454 ? 10.896  79.204  20.456  1.00 58.90  ? 465  THR A O   1 
ATOM   3489 C  CB  . THR A 1 454 ? 9.410   76.747  21.296  1.00 54.43  ? 465  THR A CB  1 
ATOM   3490 O  OG1 . THR A 1 454 ? 8.396   77.350  22.110  1.00 52.04  ? 465  THR A OG1 1 
ATOM   3491 C  CG2 . THR A 1 454 ? 9.299   75.233  21.398  1.00 47.15  ? 465  THR A CG2 1 
ATOM   3492 N  N   . VAL A 1 455 ? 10.958  79.486  22.694  1.00 65.82  ? 466  VAL A N   1 
ATOM   3493 C  CA  . VAL A 1 455 ? 11.014  80.941  22.603  1.00 71.01  ? 466  VAL A CA  1 
ATOM   3494 C  C   . VAL A 1 455 ? 12.291  81.412  21.922  1.00 67.35  ? 466  VAL A C   1 
ATOM   3495 O  O   . VAL A 1 455 ? 12.327  82.521  21.379  1.00 67.45  ? 466  VAL A O   1 
ATOM   3496 C  CB  . VAL A 1 455 ? 10.869  81.567  24.008  1.00 60.93  ? 466  VAL A CB  1 
ATOM   3497 C  CG1 . VAL A 1 455 ? 12.048  81.189  24.887  1.00 56.32  ? 466  VAL A CG1 1 
ATOM   3498 C  CG2 . VAL A 1 455 ? 10.727  83.083  23.919  1.00 51.32  ? 466  VAL A CG2 1 
ATOM   3499 N  N   . ARG A 1 456 ? 13.340  80.584  21.911  1.00 79.63  ? 467  ARG A N   1 
ATOM   3500 C  CA  . ARG A 1 456 ? 14.604  80.982  21.301  1.00 84.58  ? 467  ARG A CA  1 
ATOM   3501 C  C   . ARG A 1 456 ? 14.458  81.342  19.827  1.00 95.11  ? 467  ARG A C   1 
ATOM   3502 O  O   . ARG A 1 456 ? 15.332  82.022  19.279  1.00 105.03 ? 467  ARG A O   1 
ATOM   3503 C  CB  . ARG A 1 456 ? 15.640  79.869  21.462  1.00 79.89  ? 467  ARG A CB  1 
ATOM   3504 C  CG  . ARG A 1 456 ? 16.751  80.202  22.441  1.00 82.91  ? 467  ARG A CG  1 
ATOM   3505 C  CD  . ARG A 1 456 ? 17.780  79.087  22.514  1.00 93.22  ? 467  ARG A CD  1 
ATOM   3506 N  NE  . ARG A 1 456 ? 18.985  79.511  23.220  1.00 110.51 ? 467  ARG A NE  1 
ATOM   3507 C  CZ  . ARG A 1 456 ? 20.017  80.110  22.635  1.00 123.32 ? 467  ARG A CZ  1 
ATOM   3508 N  NH1 . ARG A 1 456 ? 19.990  80.357  21.332  1.00 135.33 ? 467  ARG A NH1 1 
ATOM   3509 N  NH2 . ARG A 1 456 ? 21.076  80.464  23.350  1.00 124.01 ? 467  ARG A NH2 1 
ATOM   3510 N  N   . VAL A 1 457 ? 13.379  80.901  19.175  1.00 91.70  ? 468  VAL A N   1 
ATOM   3511 C  CA  . VAL A 1 457 ? 13.142  81.277  17.788  1.00 87.34  ? 468  VAL A CA  1 
ATOM   3512 C  C   . VAL A 1 457 ? 12.644  82.714  17.680  1.00 86.08  ? 468  VAL A C   1 
ATOM   3513 O  O   . VAL A 1 457 ? 12.764  83.331  16.615  1.00 87.79  ? 468  VAL A O   1 
ATOM   3514 C  CB  . VAL A 1 457 ? 12.149  80.291  17.139  1.00 71.24  ? 468  VAL A CB  1 
ATOM   3515 C  CG1 . VAL A 1 457 ? 12.109  80.471  15.626  1.00 65.95  ? 468  VAL A CG1 1 
ATOM   3516 C  CG2 . VAL A 1 457 ? 12.513  78.857  17.500  1.00 63.82  ? 468  VAL A CG2 1 
ATOM   3517 N  N   . PHE A 1 458 ? 12.112  83.276  18.764  1.00 80.31  ? 469  PHE A N   1 
ATOM   3518 C  CA  . PHE A 1 458 ? 11.501  84.598  18.753  1.00 80.66  ? 469  PHE A CA  1 
ATOM   3519 C  C   . PHE A 1 458 ? 12.248  85.517  19.710  1.00 77.15  ? 469  PHE A C   1 
ATOM   3520 O  O   . PHE A 1 458 ? 12.465  85.165  20.873  1.00 85.86  ? 469  PHE A O   1 
ATOM   3521 C  CB  . PHE A 1 458 ? 10.022  84.509  19.135  1.00 85.42  ? 469  PHE A CB  1 
ATOM   3522 C  CG  . PHE A 1 458 ? 9.321   83.313  18.554  1.00 82.71  ? 469  PHE A CG  1 
ATOM   3523 C  CD1 . PHE A 1 458 ? 8.933   83.296  17.224  1.00 81.35  ? 469  PHE A CD1 1 
ATOM   3524 C  CD2 . PHE A 1 458 ? 9.053   82.202  19.338  1.00 70.03  ? 469  PHE A CD2 1 
ATOM   3525 C  CE1 . PHE A 1 458 ? 8.291   82.194  16.687  1.00 68.65  ? 469  PHE A CE1 1 
ATOM   3526 C  CE2 . PHE A 1 458 ? 8.411   81.099  18.808  1.00 60.98  ? 469  PHE A CE2 1 
ATOM   3527 C  CZ  . PHE A 1 458 ? 8.031   81.094  17.481  1.00 53.67  ? 469  PHE A CZ  1 
ATOM   3528 N  N   . LEU A 1 459 ? 12.633  86.690  19.220  1.00 88.05  ? 470  LEU A N   1 
ATOM   3529 C  CA  . LEU A 1 459 ? 13.390  87.641  20.026  1.00 96.17  ? 470  LEU A CA  1 
ATOM   3530 C  C   . LEU A 1 459 ? 12.507  88.309  21.076  1.00 92.31  ? 470  LEU A C   1 
ATOM   3531 O  O   . LEU A 1 459 ? 12.959  88.604  22.183  1.00 74.17  ? 470  LEU A O   1 
ATOM   3532 C  CB  . LEU A 1 459 ? 14.046  88.695  19.127  1.00 103.04 ? 470  LEU A CB  1 
ATOM   3533 C  CG  . LEU A 1 459 ? 13.175  89.446  18.114  1.00 92.46  ? 470  LEU A CG  1 
ATOM   3534 C  CD1 . LEU A 1 459 ? 12.559  90.702  18.720  1.00 93.83  ? 470  LEU A CD1 1 
ATOM   3535 C  CD2 . LEU A 1 459 ? 13.983  89.788  16.869  1.00 85.37  ? 470  LEU A CD2 1 
ATOM   3536 N  N   . ASP A 1 474 ? 21.367  95.834  41.814  1.00 118.34 ? 485  ASP A N   1 
ATOM   3537 C  CA  . ASP A 1 474 ? 21.848  96.025  43.177  1.00 120.58 ? 485  ASP A CA  1 
ATOM   3538 C  C   . ASP A 1 474 ? 22.726  94.866  43.632  1.00 104.18 ? 485  ASP A C   1 
ATOM   3539 O  O   . ASP A 1 474 ? 22.867  93.860  42.934  1.00 101.68 ? 485  ASP A O   1 
ATOM   3540 C  CB  . ASP A 1 474 ? 20.675  96.193  44.145  1.00 136.74 ? 485  ASP A CB  1 
ATOM   3541 C  CG  . ASP A 1 474 ? 19.938  97.503  43.950  1.00 154.19 ? 485  ASP A CG  1 
ATOM   3542 O  OD1 . ASP A 1 474 ? 20.245  98.223  42.977  1.00 160.19 ? 485  ASP A OD1 1 
ATOM   3543 O  OD2 . ASP A 1 474 ? 19.054  97.813  44.776  1.00 158.21 ? 485  ASP A OD2 1 
ATOM   3544 N  N   . GLU A 1 475 ? 23.319  95.024  44.815  1.00 100.01 ? 486  GLU A N   1 
ATOM   3545 C  CA  . GLU A 1 475 ? 24.118  93.983  45.441  1.00 90.25  ? 486  GLU A CA  1 
ATOM   3546 C  C   . GLU A 1 475 ? 23.657  93.634  46.847  1.00 79.77  ? 486  GLU A C   1 
ATOM   3547 O  O   . GLU A 1 475 ? 23.921  92.517  47.305  1.00 61.87  ? 486  GLU A O   1 
ATOM   3548 C  CB  . GLU A 1 475 ? 25.597  94.402  45.495  1.00 102.86 ? 486  GLU A CB  1 
ATOM   3549 C  CG  . GLU A 1 475 ? 26.568  93.267  45.782  1.00 105.05 ? 486  GLU A CG  1 
ATOM   3550 C  CD  . GLU A 1 475 ? 27.987  93.754  46.002  1.00 113.61 ? 486  GLU A CD  1 
ATOM   3551 O  OE1 . GLU A 1 475 ? 28.161  94.842  46.590  1.00 116.58 ? 486  GLU A OE1 1 
ATOM   3552 O  OE2 . GLU A 1 475 ? 28.929  93.048  45.583  1.00 113.77 ? 486  GLU A OE2 1 
ATOM   3553 N  N   . TRP A 1 476 ? 22.969  94.545  47.536  1.00 80.40  ? 487  TRP A N   1 
ATOM   3554 C  CA  . TRP A 1 476 ? 22.512  94.341  48.901  1.00 64.28  ? 487  TRP A CA  1 
ATOM   3555 C  C   . TRP A 1 476 ? 21.055  94.775  48.996  1.00 61.96  ? 487  TRP A C   1 
ATOM   3556 O  O   . TRP A 1 476 ? 20.706  95.874  48.528  1.00 77.08  ? 487  TRP A O   1 
ATOM   3557 C  CB  . TRP A 1 476 ? 23.380  95.134  49.885  1.00 49.96  ? 487  TRP A CB  1 
ATOM   3558 C  CG  . TRP A 1 476 ? 23.069  94.880  51.325  1.00 59.54  ? 487  TRP A CG  1 
ATOM   3559 C  CD1 . TRP A 1 476 ? 22.327  95.668  52.156  1.00 63.30  ? 487  TRP A CD1 1 
ATOM   3560 C  CD2 . TRP A 1 476 ? 23.502  93.763  52.112  1.00 59.87  ? 487  TRP A CD2 1 
ATOM   3561 N  NE1 . TRP A 1 476 ? 22.269  95.110  53.410  1.00 58.65  ? 487  TRP A NE1 1 
ATOM   3562 C  CE2 . TRP A 1 476 ? 22.982  93.940  53.409  1.00 57.01  ? 487  TRP A CE2 1 
ATOM   3563 C  CE3 . TRP A 1 476 ? 24.278  92.631  51.845  1.00 46.97  ? 487  TRP A CE3 1 
ATOM   3564 C  CZ2 . TRP A 1 476 ? 23.211  93.027  54.436  1.00 52.53  ? 487  TRP A CZ2 1 
ATOM   3565 C  CZ3 . TRP A 1 476 ? 24.504  91.725  52.866  1.00 45.86  ? 487  TRP A CZ3 1 
ATOM   3566 C  CH2 . TRP A 1 476 ? 23.972  91.929  54.145  1.00 45.36  ? 487  TRP A CH2 1 
ATOM   3567 N  N   . PRO A 1 477 ? 20.167  93.956  49.584  1.00 66.31  ? 488  PRO A N   1 
ATOM   3568 C  CA  . PRO A 1 477 ? 20.398  92.624  50.159  1.00 60.61  ? 488  PRO A CA  1 
ATOM   3569 C  C   . PRO A 1 477 ? 20.774  91.575  49.114  1.00 60.79  ? 488  PRO A C   1 
ATOM   3570 O  O   . PRO A 1 477 ? 20.407  91.723  47.949  1.00 58.06  ? 488  PRO A O   1 
ATOM   3571 C  CB  . PRO A 1 477 ? 19.047  92.279  50.800  1.00 46.14  ? 488  PRO A CB  1 
ATOM   3572 C  CG  . PRO A 1 477 ? 18.357  93.586  50.978  1.00 47.22  ? 488  PRO A CG  1 
ATOM   3573 C  CD  . PRO A 1 477 ? 18.786  94.410  49.811  1.00 57.40  ? 488  PRO A CD  1 
ATOM   3574 N  N   . PRO A 1 478 ? 21.496  90.528  49.526  1.00 54.08  ? 489  PRO A N   1 
ATOM   3575 C  CA  . PRO A 1 478 ? 21.940  89.515  48.558  1.00 45.30  ? 489  PRO A CA  1 
ATOM   3576 C  C   . PRO A 1 478 ? 20.797  88.655  48.044  1.00 55.60  ? 489  PRO A C   1 
ATOM   3577 O  O   . PRO A 1 478 ? 20.784  87.438  48.255  1.00 54.41  ? 489  PRO A O   1 
ATOM   3578 C  CB  . PRO A 1 478 ? 22.949  88.687  49.362  1.00 44.66  ? 489  PRO A CB  1 
ATOM   3579 C  CG  . PRO A 1 478 ? 22.484  88.816  50.771  1.00 44.04  ? 489  PRO A CG  1 
ATOM   3580 C  CD  . PRO A 1 478 ? 21.932  90.211  50.897  1.00 44.84  ? 489  PRO A CD  1 
ATOM   3581 N  N   . LEU A 1 479 ? 19.833  89.278  47.369  1.00 49.00  ? 490  LEU A N   1 
ATOM   3582 C  CA  . LEU A 1 479 ? 18.705  88.536  46.827  1.00 50.42  ? 490  LEU A CA  1 
ATOM   3583 C  C   . LEU A 1 479 ? 19.172  87.567  45.749  1.00 46.36  ? 490  LEU A C   1 
ATOM   3584 O  O   . LEU A 1 479 ? 20.140  87.820  45.027  1.00 45.16  ? 490  LEU A O   1 
ATOM   3585 C  CB  . LEU A 1 479 ? 17.658  89.490  46.252  1.00 45.49  ? 490  LEU A CB  1 
ATOM   3586 C  CG  . LEU A 1 479 ? 16.824  90.289  47.252  1.00 52.79  ? 490  LEU A CG  1 
ATOM   3587 C  CD1 . LEU A 1 479 ? 15.713  91.034  46.532  1.00 54.30  ? 490  LEU A CD1 1 
ATOM   3588 C  CD2 . LEU A 1 479 ? 16.253  89.374  48.320  1.00 44.55  ? 490  LEU A CD2 1 
ATOM   3589 N  N   . ARG A 1 480 ? 18.467  86.442  45.646  1.00 43.60  ? 491  ARG A N   1 
ATOM   3590 C  CA  . ARG A 1 480 ? 18.813  85.419  44.664  1.00 49.67  ? 491  ARG A CA  1 
ATOM   3591 C  C   . ARG A 1 480 ? 17.565  84.592  44.388  1.00 51.77  ? 491  ARG A C   1 
ATOM   3592 O  O   . ARG A 1 480 ? 17.115  83.843  45.261  1.00 59.42  ? 491  ARG A O   1 
ATOM   3593 C  CB  . ARG A 1 480 ? 19.956  84.548  45.169  1.00 50.16  ? 491  ARG A CB  1 
ATOM   3594 C  CG  . ARG A 1 480 ? 20.233  83.325  44.315  1.00 42.73  ? 491  ARG A CG  1 
ATOM   3595 C  CD  . ARG A 1 480 ? 21.465  82.591  44.809  1.00 55.65  ? 491  ARG A CD  1 
ATOM   3596 N  NE  . ARG A 1 480 ? 21.433  81.175  44.463  1.00 66.81  ? 491  ARG A NE  1 
ATOM   3597 C  CZ  . ARG A 1 480 ? 22.383  80.306  44.790  1.00 75.19  ? 491  ARG A CZ  1 
ATOM   3598 N  NH1 . ARG A 1 480 ? 23.448  80.711  45.471  1.00 72.78  ? 491  ARG A NH1 1 
ATOM   3599 N  NH2 . ARG A 1 480 ? 22.270  79.033  44.437  1.00 72.43  ? 491  ARG A NH2 1 
ATOM   3600 N  N   . LYS A 1 481 ? 17.011  84.735  43.187  1.00 50.96  ? 492  LYS A N   1 
ATOM   3601 C  CA  . LYS A 1 481 ? 15.834  83.968  42.808  1.00 55.01  ? 492  LYS A CA  1 
ATOM   3602 C  C   . LYS A 1 481 ? 16.185  82.491  42.698  1.00 51.18  ? 492  LYS A C   1 
ATOM   3603 O  O   . LYS A 1 481 ? 17.167  82.120  42.048  1.00 52.10  ? 492  LYS A O   1 
ATOM   3604 C  CB  . LYS A 1 481 ? 15.273  84.475  41.480  1.00 70.71  ? 492  LYS A CB  1 
ATOM   3605 C  CG  . LYS A 1 481 ? 14.808  85.919  41.504  1.00 75.38  ? 492  LYS A CG  1 
ATOM   3606 C  CD  . LYS A 1 481 ? 13.607  86.100  42.414  1.00 78.29  ? 492  LYS A CD  1 
ATOM   3607 C  CE  . LYS A 1 481 ? 12.423  85.270  41.946  1.00 79.70  ? 492  LYS A CE  1 
ATOM   3608 N  NZ  . LYS A 1 481 ? 11.212  85.531  42.773  1.00 90.61  ? 492  LYS A NZ  1 
ATOM   3609 N  N   . VAL A 1 482 ? 15.383  81.646  43.344  1.00 41.33  ? 493  VAL A N   1 
ATOM   3610 C  CA  . VAL A 1 482 ? 15.519  80.201  43.243  1.00 45.93  ? 493  VAL A CA  1 
ATOM   3611 C  C   . VAL A 1 482 ? 14.145  79.612  42.960  1.00 48.89  ? 493  VAL A C   1 
ATOM   3612 O  O   . VAL A 1 482 ? 13.112  80.254  43.166  1.00 64.05  ? 493  VAL A O   1 
ATOM   3613 C  CB  . VAL A 1 482 ? 16.133  79.572  44.512  1.00 47.18  ? 493  VAL A CB  1 
ATOM   3614 C  CG1 . VAL A 1 482 ? 17.586  79.997  44.662  1.00 40.56  ? 493  VAL A CG1 1 
ATOM   3615 C  CG2 . VAL A 1 482 ? 15.330  79.967  45.737  1.00 54.88  ? 493  VAL A CG2 1 
ATOM   3616 N  N   . GLY A 1 483 ? 14.144  78.375  42.481  1.00 43.92  ? 494  GLY A N   1 
ATOM   3617 C  CA  . GLY A 1 483 ? 12.926  77.741  42.030  1.00 53.66  ? 494  GLY A CA  1 
ATOM   3618 C  C   . GLY A 1 483 ? 12.639  78.029  40.566  1.00 57.18  ? 494  GLY A C   1 
ATOM   3619 O  O   . GLY A 1 483 ? 13.199  78.937  39.951  1.00 65.23  ? 494  GLY A O   1 
ATOM   3620 N  N   . SER A 1 484 ? 11.733  77.232  40.005  1.00 56.48  ? 495  SER A N   1 
ATOM   3621 C  CA  . SER A 1 484 ? 11.413  77.302  38.587  1.00 61.46  ? 495  SER A CA  1 
ATOM   3622 C  C   . SER A 1 484 ? 9.997   77.788  38.305  1.00 72.10  ? 495  SER A C   1 
ATOM   3623 O  O   . SER A 1 484 ? 9.599   77.839  37.138  1.00 85.85  ? 495  SER A O   1 
ATOM   3624 C  CB  . SER A 1 484 ? 11.621  75.930  37.935  1.00 68.01  ? 495  SER A CB  1 
ATOM   3625 O  OG  . SER A 1 484 ? 10.867  74.931  38.600  1.00 70.62  ? 495  SER A OG  1 
ATOM   3626 N  N   . PHE A 1 485 ? 9.230   78.152  39.327  1.00 65.82  ? 496  PHE A N   1 
ATOM   3627 C  CA  . PHE A 1 485 ? 7.848   78.572  39.131  1.00 67.34  ? 496  PHE A CA  1 
ATOM   3628 C  C   . PHE A 1 485 ? 7.793   80.051  38.765  1.00 68.02  ? 496  PHE A C   1 
ATOM   3629 O  O   . PHE A 1 485 ? 8.340   80.897  39.480  1.00 65.74  ? 496  PHE A O   1 
ATOM   3630 C  CB  . PHE A 1 485 ? 7.024   78.304  40.391  1.00 52.43  ? 496  PHE A CB  1 
ATOM   3631 C  CG  . PHE A 1 485 ? 5.626   78.845  40.327  1.00 48.39  ? 496  PHE A CG  1 
ATOM   3632 C  CD1 . PHE A 1 485 ? 4.632   78.159  39.651  1.00 53.78  ? 496  PHE A CD1 1 
ATOM   3633 C  CD2 . PHE A 1 485 ? 5.304   80.036  40.953  1.00 50.50  ? 496  PHE A CD2 1 
ATOM   3634 C  CE1 . PHE A 1 485 ? 3.342   78.657  39.597  1.00 56.44  ? 496  PHE A CE1 1 
ATOM   3635 C  CE2 . PHE A 1 485 ? 4.020   80.538  40.903  1.00 48.52  ? 496  PHE A CE2 1 
ATOM   3636 C  CZ  . PHE A 1 485 ? 3.037   79.848  40.224  1.00 43.39  ? 496  PHE A CZ  1 
ATOM   3637 N  N   . ASP A 1 486 ? 7.131   80.359  37.651  1.00 73.92  ? 497  ASP A N   1 
ATOM   3638 C  CA  . ASP A 1 486 ? 6.948   81.741  37.220  1.00 58.69  ? 497  ASP A CA  1 
ATOM   3639 C  C   . ASP A 1 486 ? 5.481   82.119  37.354  1.00 55.86  ? 497  ASP A C   1 
ATOM   3640 O  O   . ASP A 1 486 ? 4.643   81.599  36.601  1.00 54.88  ? 497  ASP A O   1 
ATOM   3641 C  CB  . ASP A 1 486 ? 7.419   81.928  35.777  1.00 44.36  ? 497  ASP A CB  1 
ATOM   3642 C  CG  . ASP A 1 486 ? 7.472   83.388  35.366  1.00 65.12  ? 497  ASP A CG  1 
ATOM   3643 O  OD1 . ASP A 1 486 ? 8.349   84.117  35.874  1.00 76.06  ? 497  ASP A OD1 1 
ATOM   3644 O  OD2 . ASP A 1 486 ? 6.638   83.809  34.537  1.00 74.14  ? 497  ASP A OD2 1 
ATOM   3645 N  N   . PRO A 1 487 ? 5.116   83.003  38.284  1.00 58.99  ? 498  PRO A N   1 
ATOM   3646 C  CA  . PRO A 1 487 ? 3.706   83.365  38.468  1.00 62.27  ? 498  PRO A CA  1 
ATOM   3647 C  C   . PRO A 1 487 ? 3.185   84.410  37.494  1.00 73.66  ? 498  PRO A C   1 
ATOM   3648 O  O   . PRO A 1 487 ? 2.087   84.932  37.710  1.00 71.67  ? 498  PRO A O   1 
ATOM   3649 C  CB  . PRO A 1 487 ? 3.690   83.909  39.904  1.00 65.93  ? 498  PRO A CB  1 
ATOM   3650 C  CG  . PRO A 1 487 ? 5.038   84.508  40.075  1.00 69.38  ? 498  PRO A CG  1 
ATOM   3651 C  CD  . PRO A 1 487 ? 5.986   83.632  39.294  1.00 64.65  ? 498  PRO A CD  1 
ATOM   3652 N  N   . TYR A 1 488 ? 3.926   84.731  36.439  1.00 77.15  ? 499  TYR A N   1 
ATOM   3653 C  CA  . TYR A 1 488 ? 3.510   85.729  35.469  1.00 86.31  ? 499  TYR A CA  1 
ATOM   3654 C  C   . TYR A 1 488 ? 3.351   85.087  34.097  1.00 91.94  ? 499  TYR A C   1 
ATOM   3655 O  O   . TYR A 1 488 ? 3.902   84.019  33.817  1.00 91.97  ? 499  TYR A O   1 
ATOM   3656 C  CB  . TYR A 1 488 ? 4.516   86.887  35.397  1.00 99.61  ? 499  TYR A CB  1 
ATOM   3657 C  CG  . TYR A 1 488 ? 4.782   87.555  36.728  1.00 110.67 ? 499  TYR A CG  1 
ATOM   3658 C  CD1 . TYR A 1 488 ? 5.945   87.289  37.440  1.00 119.79 ? 499  TYR A CD1 1 
ATOM   3659 C  CD2 . TYR A 1 488 ? 3.870   88.449  37.274  1.00 115.98 ? 499  TYR A CD2 1 
ATOM   3660 C  CE1 . TYR A 1 488 ? 6.194   87.896  38.658  1.00 126.51 ? 499  TYR A CE1 1 
ATOM   3661 C  CE2 . TYR A 1 488 ? 4.109   89.061  38.492  1.00 122.33 ? 499  TYR A CE2 1 
ATOM   3662 C  CZ  . TYR A 1 488 ? 5.273   88.781  39.179  1.00 130.83 ? 499  TYR A CZ  1 
ATOM   3663 O  OH  . TYR A 1 488 ? 5.517   89.386  40.391  1.00 133.30 ? 499  TYR A OH  1 
ATOM   3664 N  N   . SER A 1 489 ? 2.584   85.756  33.240  1.00 95.74  ? 500  SER A N   1 
ATOM   3665 C  CA  . SER A 1 489 ? 2.337   85.318  31.868  1.00 99.00  ? 500  SER A CA  1 
ATOM   3666 C  C   . SER A 1 489 ? 2.877   86.401  30.939  1.00 104.91 ? 500  SER A C   1 
ATOM   3667 O  O   . SER A 1 489 ? 2.169   87.351  30.598  1.00 107.72 ? 500  SER A O   1 
ATOM   3668 C  CB  . SER A 1 489 ? 0.852   85.058  31.631  1.00 98.25  ? 500  SER A CB  1 
ATOM   3669 O  OG  . SER A 1 489 ? 0.623   84.594  30.312  1.00 98.60  ? 500  SER A OG  1 
ATOM   3670 N  N   . ASP A 1 490 ? 4.139   86.250  30.531  1.00 108.90 ? 501  ASP A N   1 
ATOM   3671 C  CA  . ASP A 1 490 ? 4.788   87.274  29.718  1.00 116.85 ? 501  ASP A CA  1 
ATOM   3672 C  C   . ASP A 1 490 ? 4.133   87.386  28.346  1.00 96.78  ? 501  ASP A C   1 
ATOM   3673 O  O   . ASP A 1 490 ? 3.857   88.493  27.867  1.00 88.37  ? 501  ASP A O   1 
ATOM   3674 C  CB  . ASP A 1 490 ? 6.279   86.962  29.582  1.00 134.23 ? 501  ASP A CB  1 
ATOM   3675 C  CG  . ASP A 1 490 ? 7.109   88.194  29.272  1.00 147.83 ? 501  ASP A CG  1 
ATOM   3676 O  OD1 . ASP A 1 490 ? 6.538   89.199  28.799  1.00 150.61 ? 501  ASP A OD1 1 
ATOM   3677 O  OD2 . ASP A 1 490 ? 8.337   88.155  29.501  1.00 150.42 ? 501  ASP A OD2 1 
ATOM   3678 N  N   . ASP A 1 491 ? 3.878   86.252  27.698  1.00 92.13  ? 502  ASP A N   1 
ATOM   3679 C  CA  . ASP A 1 491 ? 3.271   86.243  26.374  1.00 83.27  ? 502  ASP A CA  1 
ATOM   3680 C  C   . ASP A 1 491 ? 2.518   84.934  26.165  1.00 87.71  ? 502  ASP A C   1 
ATOM   3681 O  O   . ASP A 1 491 ? 3.141   83.870  26.061  1.00 86.97  ? 502  ASP A O   1 
ATOM   3682 C  CB  . ASP A 1 491 ? 4.336   86.433  25.291  1.00 68.24  ? 502  ASP A CB  1 
ATOM   3683 C  CG  . ASP A 1 491 ? 3.746   86.822  23.945  1.00 71.03  ? 502  ASP A CG  1 
ATOM   3684 O  OD1 . ASP A 1 491 ? 2.532   86.617  23.735  1.00 68.82  ? 502  ASP A OD1 1 
ATOM   3685 O  OD2 . ASP A 1 491 ? 4.502   87.333  23.093  1.00 71.71  ? 502  ASP A OD2 1 
ATOM   3686 N  N   . PRO A 1 492 ? 1.183   84.968  26.100  1.00 86.74  ? 503  PRO A N   1 
ATOM   3687 C  CA  . PRO A 1 492 ? 0.424   83.727  25.886  1.00 78.73  ? 503  PRO A CA  1 
ATOM   3688 C  C   . PRO A 1 492 ? 0.540   83.172  24.477  1.00 84.15  ? 503  PRO A C   1 
ATOM   3689 O  O   . PRO A 1 492 ? 0.165   82.012  24.259  1.00 92.03  ? 503  PRO A O   1 
ATOM   3690 C  CB  . PRO A 1 492 ? -1.017  84.142  26.199  1.00 84.31  ? 503  PRO A CB  1 
ATOM   3691 C  CG  . PRO A 1 492 ? -1.055  85.598  25.874  1.00 86.70  ? 503  PRO A CG  1 
ATOM   3692 C  CD  . PRO A 1 492 ? 0.302   86.140  26.243  1.00 91.09  ? 503  PRO A CD  1 
ATOM   3693 N  N   . ARG A 1 493 ? 1.040   83.957  23.518  1.00 76.12  ? 504  ARG A N   1 
ATOM   3694 C  CA  . ARG A 1 493 ? 1.211   83.462  22.157  1.00 74.99  ? 504  ARG A CA  1 
ATOM   3695 C  C   . ARG A 1 493 ? 2.204   82.311  22.083  1.00 68.39  ? 504  ARG A C   1 
ATOM   3696 O  O   . ARG A 1 493 ? 2.143   81.510  21.143  1.00 70.78  ? 504  ARG A O   1 
ATOM   3697 C  CB  . ARG A 1 493 ? 1.669   84.596  21.240  1.00 84.35  ? 504  ARG A CB  1 
ATOM   3698 C  CG  . ARG A 1 493 ? 0.714   85.775  21.164  1.00 84.62  ? 504  ARG A CG  1 
ATOM   3699 C  CD  . ARG A 1 493 ? 1.305   86.883  20.310  1.00 88.01  ? 504  ARG A CD  1 
ATOM   3700 N  NE  . ARG A 1 493 ? 2.630   87.272  20.783  1.00 95.03  ? 504  ARG A NE  1 
ATOM   3701 C  CZ  . ARG A 1 493 ? 3.437   88.112  20.143  1.00 105.49 ? 504  ARG A CZ  1 
ATOM   3702 N  NH1 . ARG A 1 493 ? 4.626   88.405  20.651  1.00 107.00 ? 504  ARG A NH1 1 
ATOM   3703 N  NH2 . ARG A 1 493 ? 3.058   88.654  18.994  1.00 114.65 ? 504  ARG A NH2 1 
ATOM   3704 N  N   . LEU A 1 494 ? 3.118   82.212  23.049  1.00 55.66  ? 505  LEU A N   1 
ATOM   3705 C  CA  . LEU A 1 494 ? 4.094   81.132  23.077  1.00 59.73  ? 505  LEU A CA  1 
ATOM   3706 C  C   . LEU A 1 494 ? 3.481   79.788  23.447  1.00 66.09  ? 505  LEU A C   1 
ATOM   3707 O  O   . LEU A 1 494 ? 4.133   78.759  23.246  1.00 75.21  ? 505  LEU A O   1 
ATOM   3708 C  CB  . LEU A 1 494 ? 5.216   81.466  24.063  1.00 66.91  ? 505  LEU A CB  1 
ATOM   3709 C  CG  . LEU A 1 494 ? 6.434   82.261  23.584  1.00 76.31  ? 505  LEU A CG  1 
ATOM   3710 C  CD1 . LEU A 1 494 ? 6.040   83.509  22.812  1.00 85.90  ? 505  LEU A CD1 1 
ATOM   3711 C  CD2 . LEU A 1 494 ? 7.293   82.630  24.780  1.00 70.08  ? 505  LEU A CD2 1 
ATOM   3712 N  N   . GLY A 1 495 ? 2.257   79.775  23.973  1.00 68.92  ? 506  GLY A N   1 
ATOM   3713 C  CA  . GLY A 1 495 ? 1.628   78.561  24.460  1.00 68.44  ? 506  GLY A CA  1 
ATOM   3714 C  C   . GLY A 1 495 ? 1.586   77.420  23.466  1.00 64.11  ? 506  GLY A C   1 
ATOM   3715 O  O   . GLY A 1 495 ? 1.127   77.585  22.333  1.00 75.12  ? 506  GLY A O   1 
ATOM   3716 N  N   . ILE A 1 496 ? 2.066   76.254  23.887  1.00 46.45  ? 507  ILE A N   1 
ATOM   3717 C  CA  . ILE A 1 496 ? 2.089   75.075  23.028  1.00 61.20  ? 507  ILE A CA  1 
ATOM   3718 C  C   . ILE A 1 496 ? 0.699   74.454  23.000  1.00 61.69  ? 507  ILE A C   1 
ATOM   3719 O  O   . ILE A 1 496 ? 0.086   74.224  24.049  1.00 65.15  ? 507  ILE A O   1 
ATOM   3720 C  CB  . ILE A 1 496 ? 3.140   74.068  23.520  1.00 56.98  ? 507  ILE A CB  1 
ATOM   3721 C  CG1 . ILE A 1 496 ? 4.534   74.696  23.492  1.00 51.83  ? 507  ILE A CG1 1 
ATOM   3722 C  CG2 . ILE A 1 496 ? 3.110   72.811  22.672  1.00 63.25  ? 507  ILE A CG2 1 
ATOM   3723 C  CD1 . ILE A 1 496 ? 4.992   75.096  22.107  1.00 46.30  ? 507  ILE A CD1 1 
ATOM   3724 N  N   . GLN A 1 497 ? 0.200   74.175  21.798  1.00 62.01  ? 508  GLN A N   1 
ATOM   3725 C  CA  . GLN A 1 497 ? -1.137  73.620  21.612  1.00 71.53  ? 508  GLN A CA  1 
ATOM   3726 C  C   . GLN A 1 497 ? -1.138  72.157  21.200  1.00 57.81  ? 508  GLN A C   1 
ATOM   3727 O  O   . GLN A 1 497 ? -1.930  71.375  21.731  1.00 52.77  ? 508  GLN A O   1 
ATOM   3728 C  CB  . GLN A 1 497 ? -1.906  74.438  20.568  1.00 90.07  ? 508  GLN A CB  1 
ATOM   3729 C  CG  . GLN A 1 497 ? -2.149  75.889  20.962  1.00 91.53  ? 508  GLN A CG  1 
ATOM   3730 C  CD  . GLN A 1 497 ? -3.225  76.041  22.021  1.00 82.99  ? 508  GLN A CD  1 
ATOM   3731 O  OE1 . GLN A 1 497 ? -3.898  75.076  22.385  1.00 89.11  ? 508  GLN A OE1 1 
ATOM   3732 N  NE2 . GLN A 1 497 ? -3.397  77.260  22.517  1.00 78.22  ? 508  GLN A NE2 1 
ATOM   3733 N  N   . LYS A 1 498 ? -0.277  71.762  20.264  1.00 58.63  ? 509  LYS A N   1 
ATOM   3734 C  CA  . LYS A 1 498 ? -0.212  70.387  19.790  1.00 56.80  ? 509  LYS A CA  1 
ATOM   3735 C  C   . LYS A 1 498 ? 1.232   69.909  19.801  1.00 57.98  ? 509  LYS A C   1 
ATOM   3736 O  O   . LYS A 1 498 ? 2.152   70.678  19.509  1.00 59.17  ? 509  LYS A O   1 
ATOM   3737 C  CB  . LYS A 1 498 ? -0.797  70.256  18.378  1.00 47.38  ? 509  LYS A CB  1 
ATOM   3738 C  CG  . LYS A 1 498 ? -2.273  70.610  18.283  1.00 53.94  ? 509  LYS A CG  1 
ATOM   3739 C  CD  . LYS A 1 498 ? -3.119  69.687  19.147  1.00 57.71  ? 509  LYS A CD  1 
ATOM   3740 C  CE  . LYS A 1 498 ? -4.584  70.089  19.115  1.00 59.52  ? 509  LYS A CE  1 
ATOM   3741 N  NZ  . LYS A 1 498 ? -5.432  69.173  19.928  1.00 62.80  ? 509  LYS A NZ  1 
ATOM   3742 N  N   . ILE A 1 499 ? 1.424   68.635  20.139  1.00 48.12  ? 510  ILE A N   1 
ATOM   3743 C  CA  . ILE A 1 499 ? 2.748   68.030  20.228  1.00 44.53  ? 510  ILE A CA  1 
ATOM   3744 C  C   . ILE A 1 499 ? 2.705   66.662  19.564  1.00 49.72  ? 510  ILE A C   1 
ATOM   3745 O  O   . ILE A 1 499 ? 1.814   65.856  19.850  1.00 63.42  ? 510  ILE A O   1 
ATOM   3746 C  CB  . ILE A 1 499 ? 3.224   67.899  21.689  1.00 43.93  ? 510  ILE A CB  1 
ATOM   3747 C  CG1 . ILE A 1 499 ? 3.500   69.275  22.292  1.00 51.46  ? 510  ILE A CG1 1 
ATOM   3748 C  CG2 . ILE A 1 499 ? 4.462   67.024  21.773  1.00 43.75  ? 510  ILE A CG2 1 
ATOM   3749 C  CD1 . ILE A 1 499 ? 3.981   69.226  23.724  1.00 55.40  ? 510  ILE A CD1 1 
ATOM   3750 N  N   . PHE A 1 500 ? 3.665   66.400  18.679  1.00 49.90  ? 511  PHE A N   1 
ATOM   3751 C  CA  . PHE A 1 500 ? 3.817   65.088  18.065  1.00 51.71  ? 511  PHE A CA  1 
ATOM   3752 C  C   . PHE A 1 500 ? 5.295   64.736  18.024  1.00 52.34  ? 511  PHE A C   1 
ATOM   3753 O  O   . PHE A 1 500 ? 6.107   65.514  17.515  1.00 50.38  ? 511  PHE A O   1 
ATOM   3754 C  CB  . PHE A 1 500 ? 3.223   65.052  16.651  1.00 45.49  ? 511  PHE A CB  1 
ATOM   3755 C  CG  . PHE A 1 500 ? 3.130   63.668  16.069  1.00 49.59  ? 511  PHE A CG  1 
ATOM   3756 C  CD1 . PHE A 1 500 ? 1.959   62.937  16.173  1.00 71.06  ? 511  PHE A CD1 1 
ATOM   3757 C  CD2 . PHE A 1 500 ? 4.214   63.096  15.421  1.00 45.98  ? 511  PHE A CD2 1 
ATOM   3758 C  CE1 . PHE A 1 500 ? 1.868   61.665  15.640  1.00 76.18  ? 511  PHE A CE1 1 
ATOM   3759 C  CE2 . PHE A 1 500 ? 4.130   61.825  14.887  1.00 63.84  ? 511  PHE A CE2 1 
ATOM   3760 C  CZ  . PHE A 1 500 ? 2.956   61.108  14.997  1.00 72.59  ? 511  PHE A CZ  1 
ATOM   3761 N  N   . LEU A 1 501 ? 5.637   63.566  18.554  1.00 44.88  ? 512  LEU A N   1 
ATOM   3762 C  CA  . LEU A 1 501 ? 7.009   63.081  18.586  1.00 45.14  ? 512  LEU A CA  1 
ATOM   3763 C  C   . LEU A 1 501 ? 7.079   61.722  17.909  1.00 45.53  ? 512  LEU A C   1 
ATOM   3764 O  O   . LEU A 1 501 ? 6.320   60.810  18.255  1.00 61.11  ? 512  LEU A O   1 
ATOM   3765 C  CB  . LEU A 1 501 ? 7.526   62.976  20.023  1.00 61.99  ? 512  LEU A CB  1 
ATOM   3766 C  CG  . LEU A 1 501 ? 8.876   62.276  20.194  1.00 45.03  ? 512  LEU A CG  1 
ATOM   3767 C  CD1 . LEU A 1 501 ? 9.984   63.050  19.495  1.00 45.61  ? 512  LEU A CD1 1 
ATOM   3768 C  CD2 . LEU A 1 501 ? 9.197   62.079  21.668  1.00 44.58  ? 512  LEU A CD2 1 
ATOM   3769 N  N   . CYS A 1 502 ? 7.988   61.589  16.948  1.00 51.49  ? 513  CYS A N   1 
ATOM   3770 C  CA  . CYS A 1 502 ? 8.239   60.313  16.289  1.00 46.76  ? 513  CYS A CA  1 
ATOM   3771 C  C   . CYS A 1 502 ? 9.341   59.589  17.051  1.00 58.63  ? 513  CYS A C   1 
ATOM   3772 O  O   . CYS A 1 502 ? 10.511  59.980  16.986  1.00 65.12  ? 513  CYS A O   1 
ATOM   3773 C  CB  . CYS A 1 502 ? 8.627   60.516  14.830  1.00 47.55  ? 513  CYS A CB  1 
ATOM   3774 S  SG  . CYS A 1 502 ? 8.844   58.970  13.925  1.00 60.32  ? 513  CYS A SG  1 
ATOM   3775 N  N   . LYS A 1 503 ? 8.968   58.530  17.770  1.00 58.47  ? 514  LYS A N   1 
ATOM   3776 C  CA  . LYS A 1 503 ? 9.928   57.799  18.586  1.00 56.87  ? 514  LYS A CA  1 
ATOM   3777 C  C   . LYS A 1 503 ? 10.953  57.031  17.761  1.00 54.59  ? 514  LYS A C   1 
ATOM   3778 O  O   . LYS A 1 503 ? 11.896  56.482  18.340  1.00 64.93  ? 514  LYS A O   1 
ATOM   3779 C  CB  . LYS A 1 503 ? 9.190   56.838  19.521  1.00 54.20  ? 514  LYS A CB  1 
ATOM   3780 C  CG  . LYS A 1 503 ? 8.228   55.892  18.818  1.00 47.07  ? 514  LYS A CG  1 
ATOM   3781 C  CD  . LYS A 1 503 ? 7.594   54.930  19.810  1.00 55.71  ? 514  LYS A CD  1 
ATOM   3782 C  CE  . LYS A 1 503 ? 6.635   53.968  19.127  1.00 67.02  ? 514  LYS A CE  1 
ATOM   3783 N  NZ  . LYS A 1 503 ? 6.141   52.914  20.058  1.00 56.55  ? 514  LYS A NZ  1 
ATOM   3784 N  N   . TYR A 1 504 ? 10.805  56.987  16.438  1.00 48.61  ? 515  TYR A N   1 
ATOM   3785 C  CA  . TYR A 1 504 ? 11.701  56.209  15.592  1.00 49.74  ? 515  TYR A CA  1 
ATOM   3786 C  C   . TYR A 1 504 ? 12.756  57.047  14.885  1.00 68.58  ? 515  TYR A C   1 
ATOM   3787 O  O   . TYR A 1 504 ? 13.870  56.560  14.667  1.00 75.66  ? 515  TYR A O   1 
ATOM   3788 C  CB  . TYR A 1 504 ? 10.896  55.432  14.544  1.00 50.07  ? 515  TYR A CB  1 
ATOM   3789 C  CG  . TYR A 1 504 ? 9.900   54.459  15.135  1.00 62.49  ? 515  TYR A CG  1 
ATOM   3790 C  CD1 . TYR A 1 504 ? 10.306  53.214  15.595  1.00 57.54  ? 515  TYR A CD1 1 
ATOM   3791 C  CD2 . TYR A 1 504 ? 8.554   54.784  15.228  1.00 48.94  ? 515  TYR A CD2 1 
ATOM   3792 C  CE1 . TYR A 1 504 ? 9.400   52.320  16.133  1.00 58.91  ? 515  TYR A CE1 1 
ATOM   3793 C  CE2 . TYR A 1 504 ? 7.641   53.896  15.765  1.00 48.78  ? 515  TYR A CE2 1 
ATOM   3794 C  CZ  . TYR A 1 504 ? 8.070   52.666  16.216  1.00 49.42  ? 515  TYR A CZ  1 
ATOM   3795 O  OH  . TYR A 1 504 ? 7.164   51.779  16.752  1.00 49.43  ? 515  TYR A OH  1 
ATOM   3796 N  N   . SER A 1 505 ? 12.440  58.292  14.519  1.00 50.01  ? 516  SER A N   1 
ATOM   3797 C  CA  . SER A 1 505 ? 13.372  59.132  13.780  1.00 50.78  ? 516  SER A CA  1 
ATOM   3798 C  C   . SER A 1 505 ? 13.885  60.328  14.567  1.00 50.44  ? 516  SER A C   1 
ATOM   3799 O  O   . SER A 1 505 ? 14.955  60.847  14.236  1.00 67.44  ? 516  SER A O   1 
ATOM   3800 C  CB  . SER A 1 505 ? 12.720  59.642  12.486  1.00 68.91  ? 516  SER A CB  1 
ATOM   3801 O  OG  . SER A 1 505 ? 11.616  60.483  12.769  1.00 70.99  ? 516  SER A OG  1 
ATOM   3802 N  N   . GLY A 1 506 ? 13.160  60.777  15.586  1.00 49.34  ? 517  GLY A N   1 
ATOM   3803 C  CA  . GLY A 1 506 ? 13.573  61.928  16.357  1.00 49.00  ? 517  GLY A CA  1 
ATOM   3804 C  C   . GLY A 1 506 ? 13.042  63.257  15.872  1.00 60.08  ? 517  GLY A C   1 
ATOM   3805 O  O   . GLY A 1 506 ? 13.532  64.300  16.322  1.00 48.87  ? 517  GLY A O   1 
ATOM   3806 N  N   . TYR A 1 507 ? 12.066  63.258  14.968  1.00 54.11  ? 518  TYR A N   1 
ATOM   3807 C  CA  . TYR A 1 507 ? 11.442  64.489  14.504  1.00 53.15  ? 518  TYR A CA  1 
ATOM   3808 C  C   . TYR A 1 507 ? 10.330  64.892  15.465  1.00 57.20  ? 518  TYR A C   1 
ATOM   3809 O  O   . TYR A 1 507 ? 9.475   64.073  15.815  1.00 62.90  ? 518  TYR A O   1 
ATOM   3810 C  CB  . TYR A 1 507 ? 10.881  64.323  13.091  1.00 54.28  ? 518  TYR A CB  1 
ATOM   3811 C  CG  . TYR A 1 507 ? 11.931  64.308  12.001  1.00 64.10  ? 518  TYR A CG  1 
ATOM   3812 C  CD1 . TYR A 1 507 ? 12.683  65.442  11.720  1.00 68.55  ? 518  TYR A CD1 1 
ATOM   3813 C  CD2 . TYR A 1 507 ? 12.157  63.168  11.243  1.00 65.01  ? 518  TYR A CD2 1 
ATOM   3814 C  CE1 . TYR A 1 507 ? 13.639  65.435  10.722  1.00 69.49  ? 518  TYR A CE1 1 
ATOM   3815 C  CE2 . TYR A 1 507 ? 13.110  63.152  10.241  1.00 69.78  ? 518  TYR A CE2 1 
ATOM   3816 C  CZ  . TYR A 1 507 ? 13.848  64.288  9.986   1.00 72.44  ? 518  TYR A CZ  1 
ATOM   3817 O  OH  . TYR A 1 507 ? 14.798  64.277  8.990   1.00 81.28  ? 518  TYR A OH  1 
ATOM   3818 N  N   . LEU A 1 508 ? 10.346  66.154  15.886  1.00 55.21  ? 519  LEU A N   1 
ATOM   3819 C  CA  . LEU A 1 508 ? 9.356   66.693  16.807  1.00 51.02  ? 519  LEU A CA  1 
ATOM   3820 C  C   . LEU A 1 508 ? 8.586   67.807  16.116  1.00 55.20  ? 519  LEU A C   1 
ATOM   3821 O  O   . LEU A 1 508 ? 9.186   68.675  15.473  1.00 59.84  ? 519  LEU A O   1 
ATOM   3822 C  CB  . LEU A 1 508 ? 10.019  67.218  18.083  1.00 46.49  ? 519  LEU A CB  1 
ATOM   3823 C  CG  . LEU A 1 508 ? 9.078   67.728  19.176  1.00 51.61  ? 519  LEU A CG  1 
ATOM   3824 C  CD1 . LEU A 1 508 ? 8.247   66.589  19.740  1.00 45.04  ? 519  LEU A CD1 1 
ATOM   3825 C  CD2 . LEU A 1 508 ? 9.858   68.423  20.280  1.00 59.11  ? 519  LEU A CD2 1 
ATOM   3826 N  N   . ALA A 1 509 ? 7.261   67.780  16.248  1.00 50.51  ? 520  ALA A N   1 
ATOM   3827 C  CA  . ALA A 1 509 ? 6.383   68.790  15.664  1.00 50.41  ? 520  ALA A CA  1 
ATOM   3828 C  C   . ALA A 1 509 ? 5.552   69.407  16.781  1.00 52.74  ? 520  ALA A C   1 
ATOM   3829 O  O   . ALA A 1 509 ? 4.719   68.726  17.389  1.00 53.12  ? 520  ALA A O   1 
ATOM   3830 C  CB  . ALA A 1 509 ? 5.489   68.186  14.583  1.00 47.43  ? 520  ALA A CB  1 
ATOM   3831 N  N   . VAL A 1 510 ? 5.778   70.689  17.050  1.00 46.96  ? 521  VAL A N   1 
ATOM   3832 C  CA  . VAL A 1 510 ? 5.033   71.417  18.068  1.00 46.62  ? 521  VAL A CA  1 
ATOM   3833 C  C   . VAL A 1 510 ? 4.283   72.560  17.399  1.00 47.45  ? 521  VAL A C   1 
ATOM   3834 O  O   . VAL A 1 510 ? 4.724   73.113  16.386  1.00 48.33  ? 521  VAL A O   1 
ATOM   3835 C  CB  . VAL A 1 510 ? 5.948   71.942  19.196  1.00 50.17  ? 521  VAL A CB  1 
ATOM   3836 C  CG1 . VAL A 1 510 ? 6.656   70.784  19.883  1.00 50.60  ? 521  VAL A CG1 1 
ATOM   3837 C  CG2 . VAL A 1 510 ? 6.954   72.939  18.651  1.00 57.94  ? 521  VAL A CG2 1 
ATOM   3838 N  N   . ALA A 1 511 ? 3.134   72.907  17.973  1.00 47.30  ? 522  ALA A N   1 
ATOM   3839 C  CA  . ALA A 1 511 ? 2.266   73.945  17.437  1.00 74.60  ? 522  ALA A CA  1 
ATOM   3840 C  C   . ALA A 1 511 ? 1.879   74.908  18.548  1.00 48.20  ? 522  ALA A C   1 
ATOM   3841 O  O   . ALA A 1 511 ? 1.573   74.488  19.668  1.00 47.43  ? 522  ALA A O   1 
ATOM   3842 C  CB  . ALA A 1 511 ? 1.012   73.343  16.800  1.00 73.90  ? 522  ALA A CB  1 
ATOM   3843 N  N   . GLY A 1 512 ? 1.884   76.203  18.230  1.00 49.20  ? 523  GLY A N   1 
ATOM   3844 C  CA  . GLY A 1 512 ? 1.684   77.246  19.207  1.00 49.42  ? 523  GLY A CA  1 
ATOM   3845 C  C   . GLY A 1 512 ? 0.325   77.923  19.117  1.00 50.22  ? 523  GLY A C   1 
ATOM   3846 O  O   . GLY A 1 512 ? -0.513  77.623  18.270  1.00 58.06  ? 523  GLY A O   1 
ATOM   3847 N  N   . THR A 1 513 ? 0.129   78.873  20.035  1.00 50.53  ? 524  THR A N   1 
ATOM   3848 C  CA  . THR A 1 513 ? -1.134  79.597  20.122  1.00 56.91  ? 524  THR A CA  1 
ATOM   3849 C  C   . THR A 1 513 ? -1.254  80.655  19.031  1.00 58.87  ? 524  THR A C   1 
ATOM   3850 O  O   . THR A 1 513 ? -2.341  80.863  18.481  1.00 62.29  ? 524  THR A O   1 
ATOM   3851 C  CB  . THR A 1 513 ? -1.273  80.240  21.504  1.00 51.35  ? 524  THR A CB  1 
ATOM   3852 O  OG1 . THR A 1 513 ? -1.143  79.234  22.516  1.00 55.99  ? 524  THR A OG1 1 
ATOM   3853 C  CG2 . THR A 1 513 ? -2.625  80.922  21.648  1.00 52.41  ? 524  THR A CG2 1 
ATOM   3854 N  N   . ALA A 1 514 ? -0.153  81.329  18.701  1.00 57.08  ? 525  ALA A N   1 
ATOM   3855 C  CA  . ALA A 1 514 ? -0.158  82.382  17.694  1.00 65.22  ? 525  ALA A CA  1 
ATOM   3856 C  C   . ALA A 1 514 ? -0.075  81.848  16.270  1.00 63.87  ? 525  ALA A C   1 
ATOM   3857 O  O   . ALA A 1 514 ? 0.205   82.624  15.350  1.00 61.92  ? 525  ALA A O   1 
ATOM   3858 C  CB  . ALA A 1 514 ? 0.993   83.359  17.945  1.00 74.08  ? 525  ALA A CB  1 
ATOM   3859 N  N   . GLY A 1 515 ? -0.301  80.554  16.065  1.00 57.49  ? 526  GLY A N   1 
ATOM   3860 C  CA  . GLY A 1 515 ? -0.290  80.003  14.726  1.00 63.49  ? 526  GLY A CA  1 
ATOM   3861 C  C   . GLY A 1 515 ? 1.072   79.625  14.196  1.00 68.52  ? 526  GLY A C   1 
ATOM   3862 O  O   . GLY A 1 515 ? 1.267   79.599  12.977  1.00 65.15  ? 526  GLY A O   1 
ATOM   3863 N  N   . GLN A 1 516 ? 2.025   79.332  15.074  1.00 65.97  ? 527  GLN A N   1 
ATOM   3864 C  CA  . GLN A 1 516 ? 3.349   78.891  14.661  1.00 68.89  ? 527  GLN A CA  1 
ATOM   3865 C  C   . GLN A 1 516 ? 3.431   77.372  14.731  1.00 71.12  ? 527  GLN A C   1 
ATOM   3866 O  O   . GLN A 1 516 ? 2.849   76.746  15.622  1.00 51.04  ? 527  GLN A O   1 
ATOM   3867 C  CB  . GLN A 1 516 ? 4.445   79.522  15.527  1.00 58.37  ? 527  GLN A CB  1 
ATOM   3868 C  CG  . GLN A 1 516 ? 4.457   79.084  16.986  1.00 51.98  ? 527  GLN A CG  1 
ATOM   3869 C  CD  . GLN A 1 516 ? 3.497   79.878  17.849  1.00 66.77  ? 527  GLN A CD  1 
ATOM   3870 O  OE1 . GLN A 1 516 ? 2.547   80.482  17.351  1.00 79.36  ? 527  GLN A OE1 1 
ATOM   3871 N  NE2 . GLN A 1 516 ? 3.746   79.887  19.154  1.00 61.12  ? 527  GLN A NE2 1 
ATOM   3872 N  N   . VAL A 1 517 ? 4.144   76.784  13.774  1.00 69.40  ? 528  VAL A N   1 
ATOM   3873 C  CA  . VAL A 1 517 ? 4.346   75.341  13.701  1.00 55.68  ? 528  VAL A CA  1 
ATOM   3874 C  C   . VAL A 1 517 ? 5.842   75.104  13.549  1.00 52.53  ? 528  VAL A C   1 
ATOM   3875 O  O   . VAL A 1 517 ? 6.435   75.483  12.531  1.00 59.87  ? 528  VAL A O   1 
ATOM   3876 C  CB  . VAL A 1 517 ? 3.570   74.699  12.542  1.00 51.60  ? 528  VAL A CB  1 
ATOM   3877 C  CG1 . VAL A 1 517 ? 3.788   73.194  12.528  1.00 52.19  ? 528  VAL A CG1 1 
ATOM   3878 C  CG2 . VAL A 1 517 ? 2.087   75.028  12.645  1.00 51.71  ? 528  VAL A CG2 1 
ATOM   3879 N  N   . LEU A 1 518 ? 6.452   74.481  14.553  1.00 50.48  ? 529  LEU A N   1 
ATOM   3880 C  CA  . LEU A 1 518 ? 7.883   74.208  14.564  1.00 56.01  ? 529  LEU A CA  1 
ATOM   3881 C  C   . LEU A 1 518 ? 8.124   72.717  14.383  1.00 49.99  ? 529  LEU A C   1 
ATOM   3882 O  O   . LEU A 1 518 ? 7.564   71.898  15.119  1.00 60.20  ? 529  LEU A O   1 
ATOM   3883 C  CB  . LEU A 1 518 ? 8.523   74.684  15.870  1.00 51.70  ? 529  LEU A CB  1 
ATOM   3884 C  CG  . LEU A 1 518 ? 8.818   76.177  16.010  1.00 51.41  ? 529  LEU A CG  1 
ATOM   3885 C  CD1 . LEU A 1 518 ? 9.198   76.511  17.443  1.00 50.39  ? 529  LEU A CD1 1 
ATOM   3886 C  CD2 . LEU A 1 518 ? 9.927   76.583  15.055  1.00 63.52  ? 529  LEU A CD2 1 
ATOM   3887 N  N   . VAL A 1 519 ? 8.957   72.371  13.407  1.00 50.74  ? 530  VAL A N   1 
ATOM   3888 C  CA  . VAL A 1 519 ? 9.402   71.000  13.193  1.00 50.41  ? 530  VAL A CA  1 
ATOM   3889 C  C   . VAL A 1 519 ? 10.870  70.943  13.590  1.00 50.70  ? 530  VAL A C   1 
ATOM   3890 O  O   . VAL A 1 519 ? 11.728  71.536  12.925  1.00 51.84  ? 530  VAL A O   1 
ATOM   3891 C  CB  . VAL A 1 519 ? 9.193   70.545  11.743  1.00 64.92  ? 530  VAL A CB  1 
ATOM   3892 C  CG1 . VAL A 1 519 ? 9.512   69.064  11.603  1.00 70.39  ? 530  VAL A CG1 1 
ATOM   3893 C  CG2 . VAL A 1 519 ? 7.768   70.830  11.298  1.00 57.00  ? 530  VAL A CG2 1 
ATOM   3894 N  N   . LEU A 1 520 ? 11.160  70.240  14.679  1.00 51.00  ? 531  LEU A N   1 
ATOM   3895 C  CA  . LEU A 1 520 ? 12.499  70.165  15.238  1.00 50.02  ? 531  LEU A CA  1 
ATOM   3896 C  C   . LEU A 1 520 ? 13.087  68.777  15.015  1.00 57.17  ? 531  LEU A C   1 
ATOM   3897 O  O   . LEU A 1 520 ? 12.378  67.819  14.695  1.00 63.74  ? 531  LEU A O   1 
ATOM   3898 C  CB  . LEU A 1 520 ? 12.489  70.494  16.737  1.00 58.12  ? 531  LEU A CB  1 
ATOM   3899 C  CG  . LEU A 1 520 ? 11.815  71.795  17.190  1.00 56.81  ? 531  LEU A CG  1 
ATOM   3900 C  CD1 . LEU A 1 520 ? 10.327  71.594  17.455  1.00 56.83  ? 531  LEU A CD1 1 
ATOM   3901 C  CD2 . LEU A 1 520 ? 12.505  72.360  18.421  1.00 60.75  ? 531  LEU A CD2 1 
ATOM   3902 N  N   . GLU A 1 521 ? 14.403  68.682  15.188  1.00 60.08  ? 532  GLU A N   1 
ATOM   3903 C  CA  . GLU A 1 521 ? 15.130  67.431  15.030  1.00 57.65  ? 532  GLU A CA  1 
ATOM   3904 C  C   . GLU A 1 521 ? 16.075  67.250  16.207  1.00 50.76  ? 532  GLU A C   1 
ATOM   3905 O  O   . GLU A 1 521 ? 16.652  68.221  16.705  1.00 50.96  ? 532  GLU A O   1 
ATOM   3906 C  CB  . GLU A 1 521 ? 15.915  67.406  13.711  1.00 70.64  ? 532  GLU A CB  1 
ATOM   3907 C  CG  . GLU A 1 521 ? 16.573  66.071  13.398  1.00 71.35  ? 532  GLU A CG  1 
ATOM   3908 C  CD  . GLU A 1 521 ? 17.285  66.073  12.061  1.00 80.69  ? 532  GLU A CD  1 
ATOM   3909 O  OE1 . GLU A 1 521 ? 17.338  67.141  11.415  1.00 83.16  ? 532  GLU A OE1 1 
ATOM   3910 O  OE2 . GLU A 1 521 ? 17.791  65.006  11.654  1.00 82.31  ? 532  GLU A OE2 1 
ATOM   3911 N  N   . LEU A 1 522 ? 16.227  66.005  16.651  1.00 50.43  ? 533  LEU A N   1 
ATOM   3912 C  CA  . LEU A 1 522 ? 17.074  65.687  17.793  1.00 60.91  ? 533  LEU A CA  1 
ATOM   3913 C  C   . LEU A 1 522 ? 18.469  65.309  17.311  1.00 73.40  ? 533  LEU A C   1 
ATOM   3914 O  O   . LEU A 1 522 ? 18.642  64.298  16.620  1.00 82.89  ? 533  LEU A O   1 
ATOM   3915 C  CB  . LEU A 1 522 ? 16.470  64.553  18.620  1.00 53.85  ? 533  LEU A CB  1 
ATOM   3916 C  CG  . LEU A 1 522 ? 17.377  63.956  19.702  1.00 49.37  ? 533  LEU A CG  1 
ATOM   3917 C  CD1 . LEU A 1 522 ? 17.839  65.025  20.680  1.00 58.31  ? 533  LEU A CD1 1 
ATOM   3918 C  CD2 . LEU A 1 522 ? 16.674  62.829  20.438  1.00 48.61  ? 533  LEU A CD2 1 
ATOM   3919 N  N   . ASN A 1 523 ? 19.458  66.121  17.675  1.00 70.22  ? 534  ASN A N   1 
ATOM   3920 C  CA  . ASN A 1 523 ? 20.858  65.798  17.457  1.00 82.33  ? 534  ASN A CA  1 
ATOM   3921 C  C   . ASN A 1 523 ? 21.591  65.884  18.789  1.00 76.33  ? 534  ASN A C   1 
ATOM   3922 O  O   . ASN A 1 523 ? 21.113  66.502  19.745  1.00 64.41  ? 534  ASN A O   1 
ATOM   3923 C  CB  . ASN A 1 523 ? 21.508  66.728  16.421  1.00 79.18  ? 534  ASN A CB  1 
ATOM   3924 C  CG  . ASN A 1 523 ? 21.691  68.139  16.937  1.00 72.96  ? 534  ASN A CG  1 
ATOM   3925 O  OD1 . ASN A 1 523 ? 20.913  68.617  17.762  1.00 86.04  ? 534  ASN A OD1 1 
ATOM   3926 N  ND2 . ASN A 1 523 ? 22.726  68.815  16.453  1.00 58.10  ? 534  ASN A ND2 1 
ATOM   3927 N  N   . ASP A 1 524 ? 22.763  65.253  18.842  1.00 69.78  ? 535  ASP A N   1 
ATOM   3928 C  CA  . ASP A 1 524 ? 23.497  65.115  20.093  1.00 71.10  ? 535  ASP A CA  1 
ATOM   3929 C  C   . ASP A 1 524 ? 24.373  66.316  20.422  1.00 77.25  ? 535  ASP A C   1 
ATOM   3930 O  O   . ASP A 1 524 ? 24.692  66.525  21.598  1.00 76.26  ? 535  ASP A O   1 
ATOM   3931 C  CB  . ASP A 1 524 ? 24.361  63.853  20.051  1.00 75.59  ? 535  ASP A CB  1 
ATOM   3932 C  CG  . ASP A 1 524 ? 23.539  62.594  19.867  1.00 93.32  ? 535  ASP A CG  1 
ATOM   3933 O  OD1 . ASP A 1 524 ? 22.295  62.695  19.892  1.00 98.41  ? 535  ASP A OD1 1 
ATOM   3934 O  OD2 . ASP A 1 524 ? 24.132  61.507  19.693  1.00 100.71 ? 535  ASP A OD2 1 
ATOM   3935 N  N   . GLU A 1 525 ? 24.765  67.106  19.430  1.00 82.33  ? 536  GLU A N   1 
ATOM   3936 C  CA  . GLU A 1 525 ? 25.655  68.238  19.639  1.00 90.77  ? 536  GLU A CA  1 
ATOM   3937 C  C   . GLU A 1 525 ? 24.942  69.549  19.330  1.00 77.41  ? 536  GLU A C   1 
ATOM   3938 O  O   . GLU A 1 525 ? 23.850  69.577  18.756  1.00 69.64  ? 536  GLU A O   1 
ATOM   3939 C  CB  . GLU A 1 525 ? 26.917  68.101  18.778  1.00 102.58 ? 536  GLU A CB  1 
ATOM   3940 C  CG  . GLU A 1 525 ? 26.646  67.694  17.340  1.00 113.53 ? 536  GLU A CG  1 
ATOM   3941 C  CD  . GLU A 1 525 ? 27.912  67.599  16.512  1.00 126.29 ? 536  GLU A CD  1 
ATOM   3942 O  OE1 . GLU A 1 525 ? 27.853  67.889  15.299  1.00 128.71 ? 536  GLU A OE1 1 
ATOM   3943 O  OE2 . GLU A 1 525 ? 28.966  67.240  17.077  1.00 133.66 ? 536  GLU A OE2 1 
ATOM   3944 N  N   . ALA A 1 526 ? 25.582  70.646  19.730  1.00 69.29  ? 537  ALA A N   1 
ATOM   3945 C  CA  . ALA A 1 526 ? 25.051  71.973  19.468  1.00 66.29  ? 537  ALA A CA  1 
ATOM   3946 C  C   . ALA A 1 526 ? 25.234  72.337  17.996  1.00 68.39  ? 537  ALA A C   1 
ATOM   3947 O  O   . ALA A 1 526 ? 25.946  71.667  17.241  1.00 72.99  ? 537  ALA A O   1 
ATOM   3948 C  CB  . ALA A 1 526 ? 25.733  73.009  20.361  1.00 57.27  ? 537  ALA A CB  1 
ATOM   3949 N  N   . ALA A 1 527 ? 24.579  73.423  17.590  1.00 61.36  ? 538  ALA A N   1 
ATOM   3950 C  CA  . ALA A 1 527 ? 24.650  73.873  16.208  1.00 67.88  ? 538  ALA A CA  1 
ATOM   3951 C  C   . ALA A 1 527 ? 24.200  75.324  16.131  1.00 81.73  ? 538  ALA A C   1 
ATOM   3952 O  O   . ALA A 1 527 ? 23.302  75.742  16.866  1.00 89.52  ? 538  ALA A O   1 
ATOM   3953 C  CB  . ALA A 1 527 ? 23.787  73.001  15.288  1.00 67.46  ? 538  ALA A CB  1 
ATOM   3954 N  N   . GLU A 1 528 ? 24.833  76.080  15.239  1.00 90.07  ? 539  GLU A N   1 
ATOM   3955 C  CA  . GLU A 1 528 ? 24.458  77.461  14.948  1.00 94.62  ? 539  GLU A CA  1 
ATOM   3956 C  C   . GLU A 1 528 ? 23.918  77.484  13.522  1.00 94.24  ? 539  GLU A C   1 
ATOM   3957 O  O   . GLU A 1 528 ? 24.687  77.488  12.557  1.00 99.18  ? 539  GLU A O   1 
ATOM   3958 C  CB  . GLU A 1 528 ? 25.646  78.402  15.125  1.00 100.73 ? 539  GLU A CB  1 
ATOM   3959 C  CG  . GLU A 1 528 ? 25.333  79.861  14.837  1.00 109.24 ? 539  GLU A CG  1 
ATOM   3960 C  CD  . GLU A 1 528 ? 26.453  80.791  15.258  1.00 119.41 ? 539  GLU A CD  1 
ATOM   3961 O  OE1 . GLU A 1 528 ? 27.202  80.437  16.193  1.00 120.38 ? 539  GLU A OE1 1 
ATOM   3962 O  OE2 . GLU A 1 528 ? 26.587  81.875  14.651  1.00 124.73 ? 539  GLU A OE2 1 
ATOM   3963 N  N   . GLN A 1 529 ? 22.593  77.491  13.395  1.00 89.16  ? 540  GLN A N   1 
ATOM   3964 C  CA  . GLN A 1 529 ? 21.938  77.392  12.101  1.00 85.55  ? 540  GLN A CA  1 
ATOM   3965 C  C   . GLN A 1 529 ? 20.750  78.341  12.056  1.00 88.44  ? 540  GLN A C   1 
ATOM   3966 O  O   . GLN A 1 529 ? 20.180  78.699  13.090  1.00 97.84  ? 540  GLN A O   1 
ATOM   3967 C  CB  . GLN A 1 529 ? 21.466  75.959  11.821  1.00 72.10  ? 540  GLN A CB  1 
ATOM   3968 C  CG  . GLN A 1 529 ? 20.338  75.499  12.733  1.00 63.59  ? 540  GLN A CG  1 
ATOM   3969 C  CD  . GLN A 1 529 ? 20.060  74.014  12.622  1.00 70.01  ? 540  GLN A CD  1 
ATOM   3970 O  OE1 . GLN A 1 529 ? 20.930  73.235  12.234  1.00 82.27  ? 540  GLN A OE1 1 
ATOM   3971 N  NE2 . GLN A 1 529 ? 18.841  73.614  12.965  1.00 66.26  ? 540  GLN A NE2 1 
ATOM   3972 N  N   . ALA A 1 530 ? 20.384  78.745  10.845  1.00 77.01  ? 541  ALA A N   1 
ATOM   3973 C  CA  . ALA A 1 530 ? 19.204  79.567  10.634  1.00 68.48  ? 541  ALA A CA  1 
ATOM   3974 C  C   . ALA A 1 530 ? 17.974  78.683  10.472  1.00 71.56  ? 541  ALA A C   1 
ATOM   3975 O  O   . ALA A 1 530 ? 18.041  77.588  9.907   1.00 85.79  ? 541  ALA A O   1 
ATOM   3976 C  CB  . ALA A 1 530 ? 19.374  80.459  9.404   1.00 69.86  ? 541  ALA A CB  1 
ATOM   3977 N  N   . VAL A 1 531 ? 16.848  79.165  10.983  1.00 62.16  ? 542  VAL A N   1 
ATOM   3978 C  CA  . VAL A 1 531 ? 15.580  78.449  10.913  1.00 55.28  ? 542  VAL A CA  1 
ATOM   3979 C  C   . VAL A 1 531 ? 14.782  79.037  9.758   1.00 55.80  ? 542  VAL A C   1 
ATOM   3980 O  O   . VAL A 1 531 ? 14.380  80.205  9.797   1.00 51.38  ? 542  VAL A O   1 
ATOM   3981 C  CB  . VAL A 1 531 ? 14.805  78.538  12.235  1.00 51.37  ? 542  VAL A CB  1 
ATOM   3982 C  CG1 . VAL A 1 531 ? 13.524  77.723  12.154  1.00 49.10  ? 542  VAL A CG1 1 
ATOM   3983 C  CG2 . VAL A 1 531 ? 15.674  78.063  13.389  1.00 50.10  ? 542  VAL A CG2 1 
ATOM   3984 N  N   . GLU A 1 532 ? 14.554  78.231  8.725   1.00 59.26  ? 543  GLU A N   1 
ATOM   3985 C  CA  . GLU A 1 532 ? 13.844  78.707  7.547   1.00 64.16  ? 543  GLU A CA  1 
ATOM   3986 C  C   . GLU A 1 532 ? 12.375  78.946  7.873   1.00 66.54  ? 543  GLU A C   1 
ATOM   3987 O  O   . GLU A 1 532 ? 11.755  78.187  8.622   1.00 82.10  ? 543  GLU A O   1 
ATOM   3988 C  CB  . GLU A 1 532 ? 13.985  77.702  6.405   1.00 72.13  ? 543  GLU A CB  1 
ATOM   3989 C  CG  . GLU A 1 532 ? 13.767  78.294  5.023   1.00 93.26  ? 543  GLU A CG  1 
ATOM   3990 C  CD  . GLU A 1 532 ? 14.570  77.579  3.954   1.00 101.81 ? 543  GLU A CD  1 
ATOM   3991 O  OE1 . GLU A 1 532 ? 15.260  76.593  4.288   1.00 95.29  ? 543  GLU A OE1 1 
ATOM   3992 O  OE2 . GLU A 1 532 ? 14.518  78.006  2.781   1.00 101.70 ? 543  GLU A OE2 1 
ATOM   3993 N  N   . GLN A 1 533 ? 11.820  80.015  7.308   1.00 56.40  ? 544  GLN A N   1 
ATOM   3994 C  CA  . GLN A 1 533 ? 10.456  80.438  7.592   1.00 61.12  ? 544  GLN A CA  1 
ATOM   3995 C  C   . GLN A 1 533 ? 9.626   80.385  6.318   1.00 59.14  ? 544  GLN A C   1 
ATOM   3996 O  O   . GLN A 1 533 ? 10.070  80.846  5.261   1.00 64.30  ? 544  GLN A O   1 
ATOM   3997 C  CB  . GLN A 1 533 ? 10.440  81.848  8.186   1.00 66.61  ? 544  GLN A CB  1 
ATOM   3998 C  CG  . GLN A 1 533 ? 11.209  81.960  9.492   1.00 69.66  ? 544  GLN A CG  1 
ATOM   3999 C  CD  . GLN A 1 533 ? 11.715  83.363  9.755   1.00 84.72  ? 544  GLN A CD  1 
ATOM   4000 O  OE1 . GLN A 1 533 ? 11.205  84.336  9.201   1.00 95.12  ? 544  GLN A OE1 1 
ATOM   4001 N  NE2 . GLN A 1 533 ? 12.734  83.472  10.599  1.00 89.64  ? 544  GLN A NE2 1 
ATOM   4002 N  N   . VAL A 1 534 ? 8.426   79.819  6.421   1.00 61.83  ? 545  VAL A N   1 
ATOM   4003 C  CA  . VAL A 1 534 ? 7.505   79.685  5.298   1.00 70.01  ? 545  VAL A CA  1 
ATOM   4004 C  C   . VAL A 1 534 ? 6.122   80.112  5.769   1.00 74.56  ? 545  VAL A C   1 
ATOM   4005 O  O   . VAL A 1 534 ? 5.590   79.547  6.732   1.00 74.15  ? 545  VAL A O   1 
ATOM   4006 C  CB  . VAL A 1 534 ? 7.469   78.250  4.747   1.00 64.44  ? 545  VAL A CB  1 
ATOM   4007 C  CG1 . VAL A 1 534 ? 6.347   78.100  3.730   1.00 79.34  ? 545  VAL A CG1 1 
ATOM   4008 C  CG2 . VAL A 1 534 ? 8.807   77.883  4.123   1.00 63.81  ? 545  VAL A CG2 1 
ATOM   4009 N  N   . GLU A 1 535 ? 5.542   81.102  5.096   1.00 68.18  ? 546  GLU A N   1 
ATOM   4010 C  CA  . GLU A 1 535 ? 4.210   81.575  5.446   1.00 73.09  ? 546  GLU A CA  1 
ATOM   4011 C  C   . GLU A 1 535 ? 3.155   80.689  4.794   1.00 74.88  ? 546  GLU A C   1 
ATOM   4012 O  O   . GLU A 1 535 ? 3.210   80.427  3.589   1.00 80.54  ? 546  GLU A O   1 
ATOM   4013 C  CB  . GLU A 1 535 ? 4.020   83.026  5.008   1.00 71.03  ? 546  GLU A CB  1 
ATOM   4014 C  CG  . GLU A 1 535 ? 2.716   83.647  5.483   1.00 74.81  ? 546  GLU A CG  1 
ATOM   4015 C  CD  . GLU A 1 535 ? 2.259   84.792  4.601   1.00 90.72  ? 546  GLU A CD  1 
ATOM   4016 O  OE1 . GLU A 1 535 ? 2.420   84.692  3.366   1.00 91.93  ? 546  GLU A OE1 1 
ATOM   4017 O  OE2 . GLU A 1 535 ? 1.741   85.792  5.140   1.00 95.46  ? 546  GLU A OE2 1 
ATOM   4018 N  N   . ALA A 1 536 ? 2.196   80.231  5.592   1.00 79.24  ? 547  ALA A N   1 
ATOM   4019 C  CA  . ALA A 1 536 ? 1.104   79.380  5.123   1.00 71.57  ? 547  ALA A CA  1 
ATOM   4020 C  C   . ALA A 1 536 ? -0.183  80.199  5.177   1.00 75.82  ? 547  ALA A C   1 
ATOM   4021 O  O   . ALA A 1 536 ? -0.921  80.161  6.162   1.00 73.42  ? 547  ALA A O   1 
ATOM   4022 C  CB  . ALA A 1 536 ? 0.998   78.109  5.959   1.00 61.68  ? 547  ALA A CB  1 
ATOM   4023 N  N   . ASP A 1 537 ? -0.446  80.943  4.106   1.00 81.47  ? 548  ASP A N   1 
ATOM   4024 C  CA  . ASP A 1 537 ? -1.651  81.764  4.008   1.00 84.83  ? 548  ASP A CA  1 
ATOM   4025 C  C   . ASP A 1 537 ? -2.846  80.848  3.777   1.00 83.71  ? 548  ASP A C   1 
ATOM   4026 O  O   . ASP A 1 537 ? -3.115  80.428  2.650   1.00 88.69  ? 548  ASP A O   1 
ATOM   4027 C  CB  . ASP A 1 537 ? -1.508  82.784  2.884   1.00 93.01  ? 548  ASP A CB  1 
ATOM   4028 C  CG  . ASP A 1 537 ? -2.554  83.886  2.951   1.00 93.14  ? 548  ASP A CG  1 
ATOM   4029 O  OD1 . ASP A 1 537 ? -3.656  83.645  3.488   1.00 91.19  ? 548  ASP A OD1 1 
ATOM   4030 O  OD2 . ASP A 1 537 ? -2.272  84.999  2.461   1.00 96.33  ? 548  ASP A OD2 1 
ATOM   4031 N  N   . LEU A 1 538 ? -3.572  80.535  4.852   1.00 76.99  ? 549  LEU A N   1 
ATOM   4032 C  CA  . LEU A 1 538 ? -4.753  79.689  4.733   1.00 77.49  ? 549  LEU A CA  1 
ATOM   4033 C  C   . LEU A 1 538 ? -5.878  80.371  3.967   1.00 90.37  ? 549  LEU A C   1 
ATOM   4034 O  O   . LEU A 1 538 ? -6.777  79.684  3.470   1.00 95.96  ? 549  LEU A O   1 
ATOM   4035 C  CB  . LEU A 1 538 ? -5.244  79.274  6.120   1.00 72.80  ? 549  LEU A CB  1 
ATOM   4036 C  CG  . LEU A 1 538 ? -4.322  78.339  6.905   1.00 68.53  ? 549  LEU A CG  1 
ATOM   4037 C  CD1 . LEU A 1 538 ? -4.853  78.119  8.309   1.00 71.65  ? 549  LEU A CD1 1 
ATOM   4038 C  CD2 . LEU A 1 538 ? -4.167  77.013  6.178   1.00 63.25  ? 549  LEU A CD2 1 
ATOM   4039 N  N   . LEU A 1 539 ? -5.848  81.698  3.858   1.00 98.09  ? 550  LEU A N   1 
ATOM   4040 C  CA  . LEU A 1 539 ? -6.886  82.436  3.150   1.00 98.90  ? 550  LEU A CA  1 
ATOM   4041 C  C   . LEU A 1 539 ? -6.344  83.000  1.843   1.00 122.26 ? 550  LEU A C   1 
ATOM   4042 O  O   . LEU A 1 539 ? -6.482  84.198  1.572   1.00 139.09 ? 550  LEU A O   1 
ATOM   4043 C  CB  . LEU A 1 539 ? -7.438  83.561  4.030   1.00 80.83  ? 550  LEU A CB  1 
ATOM   4044 C  CG  . LEU A 1 539 ? -8.585  83.259  5.002   1.00 70.44  ? 550  LEU A CG  1 
ATOM   4045 C  CD1 . LEU A 1 539 ? -8.286  82.064  5.897   1.00 66.33  ? 550  LEU A CD1 1 
ATOM   4046 C  CD2 . LEU A 1 539 ? -8.889  84.487  5.846   1.00 63.16  ? 550  LEU A CD2 1 
ATOM   4047 N  N   . GLN A 1 540 ? -5.723  82.146  1.025   1.00 124.23 ? 551  GLN A N   1 
ATOM   4048 C  CA  . GLN A 1 540 ? -5.137  82.614  -0.226  1.00 124.13 ? 551  GLN A CA  1 
ATOM   4049 C  C   . GLN A 1 540 ? -6.179  82.723  -1.333  1.00 121.06 ? 551  GLN A C   1 
ATOM   4050 O  O   . GLN A 1 540 ? -6.104  83.630  -2.170  1.00 119.26 ? 551  GLN A O   1 
ATOM   4051 C  CB  . GLN A 1 540 ? -3.996  81.688  -0.656  1.00 121.38 ? 551  GLN A CB  1 
ATOM   4052 C  CG  . GLN A 1 540 ? -4.419  80.250  -0.916  1.00 124.03 ? 551  GLN A CG  1 
ATOM   4053 C  CD  . GLN A 1 540 ? -3.360  79.452  -1.649  1.00 127.32 ? 551  GLN A CD  1 
ATOM   4054 O  OE1 . GLN A 1 540 ? -2.187  79.824  -1.665  1.00 131.55 ? 551  GLN A OE1 1 
ATOM   4055 N  NE2 . GLN A 1 540 ? -3.770  78.350  -2.267  1.00 125.73 ? 551  GLN A NE2 1 
ATOM   4056 N  N   . ASP A 1 541 ? -7.156  81.817  -1.356  1.00 120.65 ? 552  ASP A N   1 
ATOM   4057 C  CA  . ASP A 1 541 ? -8.189  81.804  -2.382  1.00 122.20 ? 552  ASP A CA  1 
ATOM   4058 C  C   . ASP A 1 541 ? -9.500  82.415  -1.905  1.00 112.90 ? 552  ASP A C   1 
ATOM   4059 O  O   . ASP A 1 541 ? -10.534 82.221  -2.552  1.00 114.13 ? 552  ASP A O   1 
ATOM   4060 C  CB  . ASP A 1 541 ? -8.421  80.376  -2.878  1.00 131.32 ? 552  ASP A CB  1 
ATOM   4061 C  CG  . ASP A 1 541 ? -7.366  79.926  -3.869  1.00 135.44 ? 552  ASP A CG  1 
ATOM   4062 O  OD1 . ASP A 1 541 ? -6.963  80.747  -4.722  1.00 137.82 ? 552  ASP A OD1 1 
ATOM   4063 O  OD2 . ASP A 1 541 ? -6.938  78.755  -3.794  1.00 133.13 ? 552  ASP A OD2 1 
ATOM   4064 N  N   . GLN A 1 542 ? -9.482  83.142  -0.790  1.00 107.49 ? 553  GLN A N   1 
ATOM   4065 C  CA  . GLN A 1 542 ? -10.644 83.887  -0.323  1.00 109.74 ? 553  GLN A CA  1 
ATOM   4066 C  C   . GLN A 1 542 ? -10.179 85.229  0.217   1.00 111.65 ? 553  GLN A C   1 
ATOM   4067 O  O   . GLN A 1 542 ? -9.204  85.294  0.971   1.00 108.73 ? 553  GLN A O   1 
ATOM   4068 C  CB  . GLN A 1 542 ? -11.418 83.121  0.758   1.00 105.02 ? 553  GLN A CB  1 
ATOM   4069 C  CG  . GLN A 1 542 ? -12.276 81.985  0.225   1.00 108.20 ? 553  GLN A CG  1 
ATOM   4070 C  CD  . GLN A 1 542 ? -13.498 81.728  1.085   1.00 111.14 ? 553  GLN A CD  1 
ATOM   4071 O  OE1 . GLN A 1 542 ? -13.702 82.381  2.108   1.00 127.36 ? 553  GLN A OE1 1 
ATOM   4072 N  NE2 . GLN A 1 542 ? -14.324 80.775  0.668   1.00 94.35  ? 553  GLN A NE2 1 
ATOM   4073 N  N   . GLU A 1 543 ? -10.875 86.294  -0.172  1.00 118.66 ? 554  GLU A N   1 
ATOM   4074 C  CA  . GLU A 1 543 ? -10.522 87.647  0.228   1.00 122.64 ? 554  GLU A CA  1 
ATOM   4075 C  C   . GLU A 1 543 ? -11.755 88.369  0.750   1.00 130.47 ? 554  GLU A C   1 
ATOM   4076 O  O   . GLU A 1 543 ? -12.887 88.049  0.377   1.00 127.47 ? 554  GLU A O   1 
ATOM   4077 C  CB  . GLU A 1 543 ? -9.907  88.435  -0.938  1.00 123.70 ? 554  GLU A CB  1 
ATOM   4078 N  N   . GLY A 1 544 ? -11.522 89.351  1.617   1.00 135.23 ? 555  GLY A N   1 
ATOM   4079 C  CA  . GLY A 1 544 ? -12.605 90.123  2.193   1.00 137.70 ? 555  GLY A CA  1 
ATOM   4080 C  C   . GLY A 1 544 ? -12.619 90.087  3.706   1.00 141.05 ? 555  GLY A C   1 
ATOM   4081 O  O   . GLY A 1 544 ? -13.560 90.577  4.338   1.00 145.25 ? 555  GLY A O   1 
ATOM   4082 N  N   . TYR A 1 545 ? -11.578 89.509  4.300   1.00 140.53 ? 556  TYR A N   1 
ATOM   4083 C  CA  . TYR A 1 545 ? -11.463 89.388  5.744   1.00 134.09 ? 556  TYR A CA  1 
ATOM   4084 C  C   . TYR A 1 545 ? -10.157 90.015  6.215   1.00 119.94 ? 556  TYR A C   1 
ATOM   4085 O  O   . TYR A 1 545 ? -9.192  90.139  5.455   1.00 123.09 ? 556  TYR A O   1 
ATOM   4086 C  CB  . TYR A 1 545 ? -11.527 87.920  6.188   1.00 140.50 ? 556  TYR A CB  1 
ATOM   4087 C  CG  . TYR A 1 545 ? -12.446 87.064  5.346   1.00 151.65 ? 556  TYR A CG  1 
ATOM   4088 C  CD1 . TYR A 1 545 ? -11.941 86.260  4.334   1.00 153.99 ? 556  TYR A CD1 1 
ATOM   4089 C  CD2 . TYR A 1 545 ? -13.818 87.062  5.561   1.00 157.58 ? 556  TYR A CD2 1 
ATOM   4090 C  CE1 . TYR A 1 545 ? -12.774 85.476  3.560   1.00 157.53 ? 556  TYR A CE1 1 
ATOM   4091 C  CE2 . TYR A 1 545 ? -14.660 86.281  4.792   1.00 159.53 ? 556  TYR A CE2 1 
ATOM   4092 C  CZ  . TYR A 1 545 ? -14.133 85.490  3.793   1.00 162.46 ? 556  TYR A CZ  1 
ATOM   4093 O  OH  . TYR A 1 545 ? -14.966 84.710  3.024   1.00 167.22 ? 556  TYR A OH  1 
ATOM   4094 N  N   . ARG A 1 546 ? -10.139 90.411  7.487   1.00 110.74 ? 557  ARG A N   1 
ATOM   4095 C  CA  . ARG A 1 546 ? -8.960  91.010  8.098   1.00 110.33 ? 557  ARG A CA  1 
ATOM   4096 C  C   . ARG A 1 546 ? -8.869  90.563  9.548   1.00 118.26 ? 557  ARG A C   1 
ATOM   4097 O  O   . ARG A 1 546 ? -9.859  90.632  10.283  1.00 117.90 ? 557  ARG A O   1 
ATOM   4098 C  CB  . ARG A 1 546 ? -9.005  92.540  8.016   1.00 95.86  ? 557  ARG A CB  1 
ATOM   4099 N  N   . TRP A 1 547 ? -7.683  90.110  9.951   1.00 118.31 ? 558  TRP A N   1 
ATOM   4100 C  CA  . TRP A 1 547 ? -7.474  89.640  11.313  1.00 112.63 ? 558  TRP A CA  1 
ATOM   4101 C  C   . TRP A 1 547 ? -7.635  90.788  12.305  1.00 116.70 ? 558  TRP A C   1 
ATOM   4102 O  O   . TRP A 1 547 ? -7.391  91.955  11.987  1.00 126.63 ? 558  TRP A O   1 
ATOM   4103 C  CB  . TRP A 1 547 ? -6.085  89.009  11.438  1.00 112.00 ? 558  TRP A CB  1 
ATOM   4104 C  CG  . TRP A 1 547 ? -5.833  88.284  12.727  1.00 109.23 ? 558  TRP A CG  1 
ATOM   4105 C  CD1 . TRP A 1 547 ? -4.839  88.538  13.625  1.00 110.82 ? 558  TRP A CD1 1 
ATOM   4106 C  CD2 . TRP A 1 547 ? -6.581  87.182  13.257  1.00 105.04 ? 558  TRP A CD2 1 
ATOM   4107 N  NE1 . TRP A 1 547 ? -4.921  87.665  14.682  1.00 106.08 ? 558  TRP A NE1 1 
ATOM   4108 C  CE2 . TRP A 1 547 ? -5.982  86.822  14.480  1.00 97.52  ? 558  TRP A CE2 1 
ATOM   4109 C  CE3 . TRP A 1 547 ? -7.699  86.466  12.818  1.00 110.14 ? 558  TRP A CE3 1 
ATOM   4110 C  CZ2 . TRP A 1 547 ? -6.464  85.779  15.269  1.00 89.87  ? 558  TRP A CZ2 1 
ATOM   4111 C  CZ3 . TRP A 1 547 ? -8.175  85.430  13.602  1.00 104.15 ? 558  TRP A CZ3 1 
ATOM   4112 C  CH2 . TRP A 1 547 ? -7.558  85.097  14.813  1.00 93.75  ? 558  TRP A CH2 1 
ATOM   4113 N  N   . LYS A 1 548 ? -8.062  90.446  13.521  1.00 108.57 ? 559  LYS A N   1 
ATOM   4114 C  CA  . LYS A 1 548 ? -8.341  91.442  14.557  1.00 107.19 ? 559  LYS A CA  1 
ATOM   4115 C  C   . LYS A 1 548 ? -7.787  90.927  15.882  1.00 99.54  ? 559  LYS A C   1 
ATOM   4116 O  O   . LYS A 1 548 ? -8.404  90.078  16.532  1.00 98.40  ? 559  LYS A O   1 
ATOM   4117 C  CB  . LYS A 1 548 ? -9.834  91.730  14.655  1.00 98.02  ? 559  LYS A CB  1 
ATOM   4118 N  N   . GLY A 1 549 ? -6.633  91.447  16.278  1.00 102.49 ? 560  GLY A N   1 
ATOM   4119 C  CA  . GLY A 1 549 ? -6.021  91.086  17.537  1.00 104.24 ? 560  GLY A CA  1 
ATOM   4120 C  C   . GLY A 1 549 ? -5.224  89.795  17.457  1.00 103.72 ? 560  GLY A C   1 
ATOM   4121 O  O   . GLY A 1 549 ? -5.427  88.948  16.586  1.00 103.80 ? 560  GLY A O   1 
ATOM   4122 N  N   . HIS A 1 550 ? -4.293  89.655  18.404  1.00 108.45 ? 561  HIS A N   1 
ATOM   4123 C  CA  . HIS A 1 550 ? -3.449  88.469  18.537  1.00 108.60 ? 561  HIS A CA  1 
ATOM   4124 C  C   . HIS A 1 550 ? -2.618  88.247  17.270  1.00 108.60 ? 561  HIS A C   1 
ATOM   4125 O  O   . HIS A 1 550 ? -2.663  87.191  16.636  1.00 120.88 ? 561  HIS A O   1 
ATOM   4126 C  CB  . HIS A 1 550 ? -4.289  87.232  18.878  1.00 111.44 ? 561  HIS A CB  1 
ATOM   4127 C  CG  . HIS A 1 550 ? -3.573  86.229  19.728  1.00 115.73 ? 561  HIS A CG  1 
ATOM   4128 N  ND1 . HIS A 1 550 ? -3.598  86.269  21.106  1.00 122.37 ? 561  HIS A ND1 1 
ATOM   4129 C  CD2 . HIS A 1 550 ? -2.814  85.158  19.397  1.00 116.87 ? 561  HIS A CD2 1 
ATOM   4130 C  CE1 . HIS A 1 550 ? -2.885  85.266  21.587  1.00 122.03 ? 561  HIS A CE1 1 
ATOM   4131 N  NE2 . HIS A 1 550 ? -2.398  84.577  20.571  1.00 121.00 ? 561  HIS A NE2 1 
ATOM   4132 N  N   . GLU A 1 551 ? -1.855  89.276  16.910  1.00 101.23 ? 562  GLU A N   1 
ATOM   4133 C  CA  . GLU A 1 551 ? -0.982  89.198  15.750  1.00 99.94  ? 562  GLU A CA  1 
ATOM   4134 C  C   . GLU A 1 551 ? 0.116   88.163  15.980  1.00 104.43 ? 562  GLU A C   1 
ATOM   4135 O  O   . GLU A 1 551 ? 0.423   87.780  17.113  1.00 104.47 ? 562  GLU A O   1 
ATOM   4136 C  CB  . GLU A 1 551 ? -0.369  90.565  15.447  1.00 88.43  ? 562  GLU A CB  1 
ATOM   4137 N  N   . ARG A 1 552 ? 0.715   87.715  14.879  1.00 106.54 ? 563  ARG A N   1 
ATOM   4138 C  CA  . ARG A 1 552 ? 1.685   86.634  14.931  1.00 103.80 ? 563  ARG A CA  1 
ATOM   4139 C  C   . ARG A 1 552 ? 2.940   87.062  15.692  1.00 98.82  ? 563  ARG A C   1 
ATOM   4140 O  O   . ARG A 1 552 ? 3.121   88.227  16.060  1.00 96.83  ? 563  ARG A O   1 
ATOM   4141 C  CB  . ARG A 1 552 ? 2.058   86.177  13.521  1.00 106.60 ? 563  ARG A CB  1 
ATOM   4142 C  CG  . ARG A 1 552 ? 2.686   87.260  12.659  1.00 106.10 ? 563  ARG A CG  1 
ATOM   4143 C  CD  . ARG A 1 552 ? 3.910   86.732  11.927  1.00 116.14 ? 563  ARG A CD  1 
ATOM   4144 N  NE  . ARG A 1 552 ? 4.395   87.669  10.917  1.00 122.42 ? 563  ARG A NE  1 
ATOM   4145 C  CZ  . ARG A 1 552 ? 5.213   88.687  11.169  1.00 112.98 ? 563  ARG A CZ  1 
ATOM   4146 N  NH1 . ARG A 1 552 ? 5.640   88.909  12.404  1.00 114.04 ? 563  ARG A NH1 1 
ATOM   4147 N  NH2 . ARG A 1 552 ? 5.601   89.485  10.184  1.00 100.78 ? 563  ARG A NH2 1 
ATOM   4148 N  N   . LEU A 1 553 ? 3.820   86.088  15.920  1.00 89.54  ? 564  LEU A N   1 
ATOM   4149 C  CA  . LEU A 1 553 ? 5.066   86.323  16.638  1.00 82.81  ? 564  LEU A CA  1 
ATOM   4150 C  C   . LEU A 1 553 ? 6.091   87.013  15.747  1.00 85.32  ? 564  LEU A C   1 
ATOM   4151 O  O   . LEU A 1 553 ? 5.744   87.556  14.693  1.00 91.64  ? 564  LEU A O   1 
ATOM   4152 C  CB  . LEU A 1 553 ? 5.625   85.002  17.172  1.00 70.90  ? 564  LEU A CB  1 
ATOM   4153 C  CG  . LEU A 1 553 ? 4.842   84.365  18.320  1.00 74.15  ? 564  LEU A CG  1 
ATOM   4154 C  CD1 . LEU A 1 553 ? 5.225   82.907  18.497  1.00 83.15  ? 564  LEU A CD1 1 
ATOM   4155 C  CD2 . LEU A 1 553 ? 5.081   85.133  19.606  1.00 66.00  ? 564  LEU A CD2 1 
ATOM   4156 N  N   . ALA A 1 554 ? 7.356   86.997  16.163  1.00 83.50  ? 565  ALA A N   1 
ATOM   4157 C  CA  . ALA A 1 554 ? 8.439   87.634  15.413  1.00 75.75  ? 565  ALA A CA  1 
ATOM   4158 C  C   . ALA A 1 554 ? 9.663   86.729  15.503  1.00 81.33  ? 565  ALA A C   1 
ATOM   4159 O  O   . ALA A 1 554 ? 10.326  86.675  16.543  1.00 89.38  ? 565  ALA A O   1 
ATOM   4160 C  CB  . ALA A 1 554 ? 8.738   89.029  15.948  1.00 74.92  ? 565  ALA A CB  1 
ATOM   4161 N  N   . ALA A 1 555 ? 9.960   86.026  14.414  1.00 75.37  ? 566  ALA A N   1 
ATOM   4162 C  CA  . ALA A 1 555 ? 11.073  85.091  14.396  1.00 73.51  ? 566  ALA A CA  1 
ATOM   4163 C  C   . ALA A 1 555 ? 12.395  85.820  14.185  1.00 76.03  ? 566  ALA A C   1 
ATOM   4164 O  O   . ALA A 1 555 ? 12.465  86.840  13.493  1.00 81.83  ? 566  ALA A O   1 
ATOM   4165 C  CB  . ALA A 1 555 ? 10.879  84.046  13.297  1.00 64.52  ? 566  ALA A CB  1 
ATOM   4166 N  N   . ARG A 1 556 ? 13.449  85.283  14.795  1.00 80.04  ? 567  ARG A N   1 
ATOM   4167 C  CA  . ARG A 1 556 ? 14.784  85.834  14.607  1.00 90.54  ? 567  ARG A CA  1 
ATOM   4168 C  C   . ARG A 1 556 ? 15.244  85.605  13.173  1.00 98.35  ? 567  ARG A C   1 
ATOM   4169 O  O   . ARG A 1 556 ? 15.168  84.486  12.656  1.00 101.20 ? 567  ARG A O   1 
ATOM   4170 C  CB  . ARG A 1 556 ? 15.771  85.199  15.585  1.00 88.44  ? 567  ARG A CB  1 
ATOM   4171 C  CG  . ARG A 1 556 ? 15.554  85.570  17.043  1.00 90.69  ? 567  ARG A CG  1 
ATOM   4172 C  CD  . ARG A 1 556 ? 16.684  85.026  17.904  1.00 95.25  ? 567  ARG A CD  1 
ATOM   4173 N  NE  . ARG A 1 556 ? 16.513  85.334  19.320  1.00 108.73 ? 567  ARG A NE  1 
ATOM   4174 C  CZ  . ARG A 1 556 ? 17.367  84.965  20.269  1.00 126.25 ? 567  ARG A CZ  1 
ATOM   4175 N  NH1 . ARG A 1 556 ? 18.455  84.275  19.953  1.00 132.51 ? 567  ARG A NH1 1 
ATOM   4176 N  NH2 . ARG A 1 556 ? 17.135  85.286  21.535  1.00 129.87 ? 567  ARG A NH2 1 
ATOM   4177 N  N   . SER A 1 557 ? 15.722  86.670  12.528  1.00 109.32 ? 568  SER A N   1 
ATOM   4178 C  CA  . SER A 1 557 ? 16.160  86.559  11.142  1.00 106.87 ? 568  SER A CA  1 
ATOM   4179 C  C   . SER A 1 557 ? 17.555  85.954  11.039  1.00 101.38 ? 568  SER A C   1 
ATOM   4180 O  O   . SER A 1 557 ? 17.824  85.160  10.130  1.00 92.91  ? 568  SER A O   1 
ATOM   4181 C  CB  . SER A 1 557 ? 16.121  87.932  10.469  1.00 100.83 ? 568  SER A CB  1 
ATOM   4182 O  OG  . SER A 1 557 ? 14.808  88.464  10.475  1.00 90.19  ? 568  SER A OG  1 
ATOM   4183 N  N   . GLY A 1 558 ? 18.450  86.311  11.956  1.00 100.32 ? 569  GLY A N   1 
ATOM   4184 C  CA  . GLY A 1 558 ? 19.804  85.812  11.933  1.00 105.05 ? 569  GLY A CA  1 
ATOM   4185 C  C   . GLY A 1 558 ? 19.897  84.359  12.353  1.00 100.39 ? 569  GLY A C   1 
ATOM   4186 O  O   . GLY A 1 558 ? 18.969  83.797  12.943  1.00 95.67  ? 569  GLY A O   1 
ATOM   4187 N  N   . PRO A 1 559 ? 21.025  83.718  12.043  1.00 108.82 ? 570  PRO A N   1 
ATOM   4188 C  CA  . PRO A 1 559 ? 21.226  82.317  12.449  1.00 104.63 ? 570  PRO A CA  1 
ATOM   4189 C  C   . PRO A 1 559 ? 21.339  82.206  13.962  1.00 101.28 ? 570  PRO A C   1 
ATOM   4190 O  O   . PRO A 1 559 ? 22.229  82.799  14.576  1.00 104.90 ? 570  PRO A O   1 
ATOM   4191 C  CB  . PRO A 1 559 ? 22.536  81.928  11.752  1.00 107.91 ? 570  PRO A CB  1 
ATOM   4192 C  CG  . PRO A 1 559 ? 22.712  82.941  10.659  1.00 115.22 ? 570  PRO A CG  1 
ATOM   4193 C  CD  . PRO A 1 559 ? 22.120  84.208  11.192  1.00 117.53 ? 570  PRO A CD  1 
ATOM   4194 N  N   . VAL A 1 560 ? 20.435  81.439  14.560  1.00 97.44  ? 571  VAL A N   1 
ATOM   4195 C  CA  . VAL A 1 560 ? 20.384  81.267  16.006  1.00 90.22  ? 571  VAL A CA  1 
ATOM   4196 C  C   . VAL A 1 560 ? 21.171  80.024  16.392  1.00 85.95  ? 571  VAL A C   1 
ATOM   4197 O  O   . VAL A 1 560 ? 21.099  78.988  15.719  1.00 79.84  ? 571  VAL A O   1 
ATOM   4198 C  CB  . VAL A 1 560 ? 18.925  81.175  16.493  1.00 70.88  ? 571  VAL A CB  1 
ATOM   4199 C  CG1 . VAL A 1 560 ? 18.866  81.161  18.014  1.00 53.96  ? 571  VAL A CG1 1 
ATOM   4200 C  CG2 . VAL A 1 560 ? 18.104  82.323  15.931  1.00 66.91  ? 571  VAL A CG2 1 
ATOM   4201 N  N   . ARG A 1 561 ? 21.933  80.127  17.476  1.00 89.32  ? 572  ARG A N   1 
ATOM   4202 C  CA  . ARG A 1 561 ? 22.651  78.988  18.030  1.00 90.19  ? 572  ARG A CA  1 
ATOM   4203 C  C   . ARG A 1 561 ? 21.728  78.204  18.954  1.00 83.94  ? 572  ARG A C   1 
ATOM   4204 O  O   . ARG A 1 561 ? 20.878  78.780  19.640  1.00 81.95  ? 572  ARG A O   1 
ATOM   4205 C  CB  . ARG A 1 561 ? 23.904  79.441  18.788  1.00 99.93  ? 572  ARG A CB  1 
ATOM   4206 C  CG  . ARG A 1 561 ? 23.644  80.258  20.053  1.00 107.64 ? 572  ARG A CG  1 
ATOM   4207 C  CD  . ARG A 1 561 ? 23.329  81.715  19.741  1.00 117.17 ? 572  ARG A CD  1 
ATOM   4208 N  NE  . ARG A 1 561 ? 22.750  82.411  20.886  1.00 122.81 ? 572  ARG A NE  1 
ATOM   4209 C  CZ  . ARG A 1 561 ? 22.147  83.593  20.813  1.00 120.84 ? 572  ARG A CZ  1 
ATOM   4210 N  NH1 . ARG A 1 561 ? 22.039  84.212  19.645  1.00 119.14 ? 572  ARG A NH1 1 
ATOM   4211 N  NH2 . ARG A 1 561 ? 21.647  84.155  21.905  1.00 118.47 ? 572  ARG A NH2 1 
ATOM   4212 N  N   . PHE A 1 562 ? 21.890  76.883  18.959  1.00 81.62  ? 573  PHE A N   1 
ATOM   4213 C  CA  . PHE A 1 562 ? 21.043  76.001  19.746  1.00 77.59  ? 573  PHE A CA  1 
ATOM   4214 C  C   . PHE A 1 562 ? 21.898  75.025  20.539  1.00 83.08  ? 573  PHE A C   1 
ATOM   4215 O  O   . PHE A 1 562 ? 22.964  74.598  20.089  1.00 98.77  ? 573  PHE A O   1 
ATOM   4216 C  CB  . PHE A 1 562 ? 20.059  75.224  18.859  1.00 81.89  ? 573  PHE A CB  1 
ATOM   4217 C  CG  . PHE A 1 562 ? 19.089  76.098  18.118  1.00 82.20  ? 573  PHE A CG  1 
ATOM   4218 C  CD1 . PHE A 1 562 ? 17.962  76.597  18.751  1.00 85.81  ? 573  PHE A CD1 1 
ATOM   4219 C  CD2 . PHE A 1 562 ? 19.299  76.415  16.787  1.00 81.33  ? 573  PHE A CD2 1 
ATOM   4220 C  CE1 . PHE A 1 562 ? 17.067  77.400  18.072  1.00 87.64  ? 573  PHE A CE1 1 
ATOM   4221 C  CE2 . PHE A 1 562 ? 18.407  77.218  16.101  1.00 84.66  ? 573  PHE A CE2 1 
ATOM   4222 C  CZ  . PHE A 1 562 ? 17.289  77.711  16.745  1.00 86.37  ? 573  PHE A CZ  1 
ATOM   4223 N  N   . GLU A 1 563 ? 21.413  74.678  21.725  1.00 73.89  ? 574  GLU A N   1 
ATOM   4224 C  CA  . GLU A 1 563 ? 22.072  73.705  22.581  1.00 64.77  ? 574  GLU A CA  1 
ATOM   4225 C  C   . GLU A 1 563 ? 21.752  72.295  22.100  1.00 63.01  ? 574  GLU A C   1 
ATOM   4226 O  O   . GLU A 1 563 ? 20.861  72.096  21.271  1.00 71.55  ? 574  GLU A O   1 
ATOM   4227 C  CB  . GLU A 1 563 ? 21.626  73.913  24.027  1.00 77.96  ? 574  GLU A CB  1 
ATOM   4228 C  CG  . GLU A 1 563 ? 20.157  73.615  24.271  1.00 89.49  ? 574  GLU A CG  1 
ATOM   4229 C  CD  . GLU A 1 563 ? 19.773  73.743  25.732  1.00 94.86  ? 574  GLU A CD  1 
ATOM   4230 O  OE1 . GLU A 1 563 ? 20.474  74.465  26.472  1.00 93.70  ? 574  GLU A OE1 1 
ATOM   4231 O  OE2 . GLU A 1 563 ? 18.772  73.118  26.141  1.00 94.59  ? 574  GLU A OE2 1 
ATOM   4232 N  N   . PRO A 1 564 ? 22.482  71.287  22.584  1.00 67.41  ? 575  PRO A N   1 
ATOM   4233 C  CA  . PRO A 1 564 ? 22.141  69.903  22.232  1.00 68.08  ? 575  PRO A CA  1 
ATOM   4234 C  C   . PRO A 1 564 ? 20.719  69.551  22.645  1.00 57.28  ? 575  PRO A C   1 
ATOM   4235 O  O   . PRO A 1 564 ? 20.256  69.914  23.728  1.00 62.45  ? 575  PRO A O   1 
ATOM   4236 C  CB  . PRO A 1 564 ? 23.172  69.077  23.008  1.00 66.82  ? 575  PRO A CB  1 
ATOM   4237 C  CG  . PRO A 1 564 ? 24.339  69.984  23.141  1.00 56.35  ? 575  PRO A CG  1 
ATOM   4238 C  CD  . PRO A 1 564 ? 23.769  71.367  23.300  1.00 68.60  ? 575  PRO A CD  1 
ATOM   4239 N  N   . GLY A 1 565 ? 20.026  68.837  21.761  1.00 51.31  ? 576  GLY A N   1 
ATOM   4240 C  CA  . GLY A 1 565 ? 18.643  68.470  21.995  1.00 71.80  ? 576  GLY A CA  1 
ATOM   4241 C  C   . GLY A 1 565 ? 17.797  68.564  20.742  1.00 80.38  ? 576  GLY A C   1 
ATOM   4242 O  O   . GLY A 1 565 ? 18.227  68.141  19.665  1.00 91.31  ? 576  GLY A O   1 
ATOM   4243 N  N   . PHE A 1 566 ? 16.593  69.117  20.868  1.00 69.75  ? 577  PHE A N   1 
ATOM   4244 C  CA  . PHE A 1 566 ? 15.685  69.278  19.737  1.00 61.44  ? 577  PHE A CA  1 
ATOM   4245 C  C   . PHE A 1 566 ? 15.905  70.654  19.120  1.00 58.22  ? 577  PHE A C   1 
ATOM   4246 O  O   . PHE A 1 566 ? 15.509  71.673  19.696  1.00 48.51  ? 577  PHE A O   1 
ATOM   4247 C  CB  . PHE A 1 566 ? 14.235  69.092  20.174  1.00 53.80  ? 577  PHE A CB  1 
ATOM   4248 C  CG  . PHE A 1 566 ? 13.860  67.661  20.425  1.00 47.94  ? 577  PHE A CG  1 
ATOM   4249 C  CD1 . PHE A 1 566 ? 13.395  66.864  19.392  1.00 46.36  ? 577  PHE A CD1 1 
ATOM   4250 C  CD2 . PHE A 1 566 ? 13.976  67.110  21.690  1.00 54.56  ? 577  PHE A CD2 1 
ATOM   4251 C  CE1 . PHE A 1 566 ? 13.051  65.545  19.616  1.00 47.22  ? 577  PHE A CE1 1 
ATOM   4252 C  CE2 . PHE A 1 566 ? 13.633  65.791  21.920  1.00 46.17  ? 577  PHE A CE2 1 
ATOM   4253 C  CZ  . PHE A 1 566 ? 13.169  65.008  20.882  1.00 45.49  ? 577  PHE A CZ  1 
ATOM   4254 N  N   . GLN A 1 567 ? 16.535  70.682  17.946  1.00 47.90  ? 578  GLN A N   1 
ATOM   4255 C  CA  . GLN A 1 567 ? 16.835  71.924  17.246  1.00 48.33  ? 578  GLN A CA  1 
ATOM   4256 C  C   . GLN A 1 567 ? 15.838  72.144  16.122  1.00 72.56  ? 578  GLN A C   1 
ATOM   4257 O  O   . GLN A 1 567 ? 15.627  71.236  15.304  1.00 72.15  ? 578  GLN A O   1 
ATOM   4258 C  CB  . GLN A 1 567 ? 18.251  71.889  16.680  1.00 60.57  ? 578  GLN A CB  1 
ATOM   4259 C  CG  . GLN A 1 567 ? 19.336  71.689  17.722  1.00 50.17  ? 578  GLN A CG  1 
ATOM   4260 C  CD  . GLN A 1 567 ? 20.705  71.501  17.100  1.00 81.55  ? 578  GLN A CD  1 
ATOM   4261 O  OE1 . GLN A 1 567 ? 20.824  71.209  15.910  1.00 108.43 ? 578  GLN A OE1 1 
ATOM   4262 N  NE2 . GLN A 1 567 ? 21.748  71.663  17.905  1.00 85.08  ? 578  GLN A NE2 1 
ATOM   4263 N  N   . PRO A 1 568 ? 15.209  73.312  16.043  1.00 68.56  ? 579  PRO A N   1 
ATOM   4264 C  CA  . PRO A 1 568 ? 14.278  73.577  14.944  1.00 72.71  ? 579  PRO A CA  1 
ATOM   4265 C  C   . PRO A 1 568 ? 15.007  73.946  13.663  1.00 61.48  ? 579  PRO A C   1 
ATOM   4266 O  O   . PRO A 1 568 ? 16.078  74.556  13.677  1.00 64.00  ? 579  PRO A O   1 
ATOM   4267 C  CB  . PRO A 1 568 ? 13.452  74.758  15.467  1.00 66.46  ? 579  PRO A CB  1 
ATOM   4268 C  CG  . PRO A 1 568 ? 14.398  75.485  16.362  1.00 48.18  ? 579  PRO A CG  1 
ATOM   4269 C  CD  . PRO A 1 568 ? 15.268  74.429  17.003  1.00 48.23  ? 579  PRO A CD  1 
ATOM   4270 N  N   . PHE A 1 569 ? 14.404  73.561  12.538  1.00 59.10  ? 580  PHE A N   1 
ATOM   4271 C  CA  . PHE A 1 569 ? 14.953  73.892  11.229  1.00 48.03  ? 580  PHE A CA  1 
ATOM   4272 C  C   . PHE A 1 569 ? 13.965  74.559  10.284  1.00 48.02  ? 580  PHE A C   1 
ATOM   4273 O  O   . PHE A 1 569 ? 14.406  75.156  9.295   1.00 51.90  ? 580  PHE A O   1 
ATOM   4274 C  CB  . PHE A 1 569 ? 15.525  72.638  10.545  1.00 58.36  ? 580  PHE A CB  1 
ATOM   4275 C  CG  . PHE A 1 569 ? 14.562  71.485  10.467  1.00 47.12  ? 580  PHE A CG  1 
ATOM   4276 C  CD1 . PHE A 1 569 ? 13.700  71.354  9.391   1.00 46.91  ? 580  PHE A CD1 1 
ATOM   4277 C  CD2 . PHE A 1 569 ? 14.536  70.520  11.461  1.00 50.20  ? 580  PHE A CD2 1 
ATOM   4278 C  CE1 . PHE A 1 569 ? 12.820  70.290  9.315   1.00 46.20  ? 580  PHE A CE1 1 
ATOM   4279 C  CE2 . PHE A 1 569 ? 13.659  69.454  11.390  1.00 45.92  ? 580  PHE A CE2 1 
ATOM   4280 C  CZ  . PHE A 1 569 ? 12.801  69.339  10.315  1.00 45.69  ? 580  PHE A CZ  1 
ATOM   4281 N  N   . VAL A 1 570 ? 12.662  74.492  10.546  1.00 47.60  ? 581  VAL A N   1 
ATOM   4282 C  CA  . VAL A 1 570 ? 11.666  75.149  9.707   1.00 51.56  ? 581  VAL A CA  1 
ATOM   4283 C  C   . VAL A 1 570 ? 10.565  75.709  10.599  1.00 60.94  ? 581  VAL A C   1 
ATOM   4284 O  O   . VAL A 1 570 ? 10.208  75.110  11.620  1.00 62.69  ? 581  VAL A O   1 
ATOM   4285 C  CB  . VAL A 1 570 ? 11.094  74.189  8.639   1.00 47.24  ? 581  VAL A CB  1 
ATOM   4286 C  CG1 . VAL A 1 570 ? 10.277  73.076  9.281   1.00 46.50  ? 581  VAL A CG1 1 
ATOM   4287 C  CG2 . VAL A 1 570 ? 10.267  74.956  7.616   1.00 47.75  ? 581  VAL A CG2 1 
ATOM   4288 N  N   . LEU A 1 571 ? 10.044  76.874  10.220  1.00 60.65  ? 582  LEU A N   1 
ATOM   4289 C  CA  . LEU A 1 571 ? 8.956   77.531  10.931  1.00 58.31  ? 582  LEU A CA  1 
ATOM   4290 C  C   . LEU A 1 571 ? 7.858   77.871  9.937   1.00 69.00  ? 582  LEU A C   1 
ATOM   4291 O  O   . LEU A 1 571 ? 8.125   78.487  8.900   1.00 78.83  ? 582  LEU A O   1 
ATOM   4292 C  CB  . LEU A 1 571 ? 9.440   78.800  11.641  1.00 54.83  ? 582  LEU A CB  1 
ATOM   4293 C  CG  . LEU A 1 571 ? 8.352   79.685  12.254  1.00 54.33  ? 582  LEU A CG  1 
ATOM   4294 C  CD1 . LEU A 1 571 ? 7.670   78.986  13.419  1.00 48.44  ? 582  LEU A CD1 1 
ATOM   4295 C  CD2 . LEU A 1 571 ? 8.929   81.021  12.688  1.00 60.23  ? 582  LEU A CD2 1 
ATOM   4296 N  N   . VAL A 1 572 ? 6.629   77.472  10.251  1.00 68.84  ? 583  VAL A N   1 
ATOM   4297 C  CA  . VAL A 1 572 ? 5.480   77.684  9.377   1.00 69.42  ? 583  VAL A CA  1 
ATOM   4298 C  C   . VAL A 1 572 ? 4.477   78.544  10.132  1.00 70.87  ? 583  VAL A C   1 
ATOM   4299 O  O   . VAL A 1 572 ? 3.832   78.074  11.078  1.00 64.81  ? 583  VAL A O   1 
ATOM   4300 C  CB  . VAL A 1 572 ? 4.847   76.361  8.928   1.00 60.02  ? 583  VAL A CB  1 
ATOM   4301 C  CG1 . VAL A 1 572 ? 3.756   76.623  7.906   1.00 67.31  ? 583  VAL A CG1 1 
ATOM   4302 C  CG2 . VAL A 1 572 ? 5.907   75.432  8.356   1.00 47.69  ? 583  VAL A CG2 1 
ATOM   4303 N  N   . GLN A 1 573 ? 4.340   79.800  9.714   1.00 65.25  ? 584  GLN A N   1 
ATOM   4304 C  CA  . GLN A 1 573 ? 3.440   80.751  10.353  1.00 55.61  ? 584  GLN A CA  1 
ATOM   4305 C  C   . GLN A 1 573 ? 2.123   80.790  9.588   1.00 65.21  ? 584  GLN A C   1 
ATOM   4306 O  O   . GLN A 1 573 ? 2.099   81.145  8.405   1.00 80.57  ? 584  GLN A O   1 
ATOM   4307 C  CB  . GLN A 1 573 ? 4.068   82.143  10.410  1.00 51.74  ? 584  GLN A CB  1 
ATOM   4308 C  CG  . GLN A 1 573 ? 3.185   83.189  11.065  1.00 58.61  ? 584  GLN A CG  1 
ATOM   4309 C  CD  . GLN A 1 573 ? 2.864   82.855  12.508  1.00 76.54  ? 584  GLN A CD  1 
ATOM   4310 O  OE1 . GLN A 1 573 ? 3.721   82.957  13.386  1.00 90.56  ? 584  GLN A OE1 1 
ATOM   4311 N  NE2 . GLN A 1 573 ? 1.625   82.451  12.760  1.00 72.98  ? 584  GLN A NE2 1 
ATOM   4312 N  N   . CYS A 1 574 ? 1.035   80.429  10.263  1.00 62.87  ? 585  CYS A N   1 
ATOM   4313 C  CA  . CYS A 1 574 ? -0.282  80.449  9.644   1.00 69.96  ? 585  CYS A CA  1 
ATOM   4314 C  C   . CYS A 1 574 ? -0.828  81.869  9.596   1.00 66.41  ? 585  CYS A C   1 
ATOM   4315 O  O   . CYS A 1 574 ? -0.686  82.639  10.550  1.00 69.82  ? 585  CYS A O   1 
ATOM   4316 C  CB  . CYS A 1 574 ? -1.249  79.547  10.413  1.00 70.72  ? 585  CYS A CB  1 
ATOM   4317 S  SG  . CYS A 1 574 ? -0.743  77.817  10.518  1.00 80.60  ? 585  CYS A SG  1 
ATOM   4318 N  N   . GLN A 1 575 ? -1.453  82.216  8.473   1.00 60.04  ? 586  GLN A N   1 
ATOM   4319 C  CA  . GLN A 1 575 ? -2.104  83.509  8.306   1.00 70.94  ? 586  GLN A CA  1 
ATOM   4320 C  C   . GLN A 1 575 ? -3.562  83.286  7.930   1.00 77.04  ? 586  GLN A C   1 
ATOM   4321 O  O   . GLN A 1 575 ? -3.837  82.704  6.866   1.00 90.02  ? 586  GLN A O   1 
ATOM   4322 C  CB  . GLN A 1 575 ? -1.398  84.356  7.246   1.00 76.62  ? 586  GLN A CB  1 
ATOM   4323 C  CG  . GLN A 1 575 ? -0.104  84.983  7.731   1.00 90.26  ? 586  GLN A CG  1 
ATOM   4324 C  CD  . GLN A 1 575 ? -0.318  85.951  8.880   1.00 99.47  ? 586  GLN A CD  1 
ATOM   4325 O  OE1 . GLN A 1 575 ? -1.374  86.575  8.997   1.00 101.33 ? 586  GLN A OE1 1 
ATOM   4326 N  NE2 . GLN A 1 575 ? 0.687   86.079  9.739   1.00 102.48 ? 586  GLN A NE2 1 
ATOM   4327 N  N   . PRO A 1 576 ? -4.531  83.722  8.752   1.00 74.98  ? 587  PRO A N   1 
ATOM   4328 C  CA  . PRO A 1 576 ? -4.374  84.461  10.013  1.00 68.19  ? 587  PRO A CA  1 
ATOM   4329 C  C   . PRO A 1 576 ? -3.720  83.647  11.131  1.00 78.13  ? 587  PRO A C   1 
ATOM   4330 O  O   . PRO A 1 576 ? -3.816  82.419  11.122  1.00 84.73  ? 587  PRO A O   1 
ATOM   4331 C  CB  . PRO A 1 576 ? -5.816  84.824  10.378  1.00 70.47  ? 587  PRO A CB  1 
ATOM   4332 C  CG  . PRO A 1 576 ? -6.635  83.751  9.749   1.00 67.97  ? 587  PRO A CG  1 
ATOM   4333 C  CD  . PRO A 1 576 ? -5.945  83.434  8.458   1.00 70.51  ? 587  PRO A CD  1 
ATOM   4334 N  N   . PRO A 1 577 ? -3.045  84.333  12.074  1.00 70.81  ? 588  PRO A N   1 
ATOM   4335 C  CA  . PRO A 1 577 ? -2.312  83.668  13.171  1.00 68.03  ? 588  PRO A CA  1 
ATOM   4336 C  C   . PRO A 1 577 ? -3.235  83.090  14.236  1.00 66.17  ? 588  PRO A C   1 
ATOM   4337 O  O   . PRO A 1 577 ? -3.127  83.416  15.423  1.00 54.77  ? 588  PRO A O   1 
ATOM   4338 C  CB  . PRO A 1 577 ? -1.445  84.809  13.729  1.00 68.86  ? 588  PRO A CB  1 
ATOM   4339 C  CG  . PRO A 1 577 ? -1.478  85.918  12.662  1.00 73.34  ? 588  PRO A CG  1 
ATOM   4340 C  CD  . PRO A 1 577 ? -2.837  85.790  12.080  1.00 71.22  ? 588  PRO A CD  1 
ATOM   4341 N  N   . ALA A 1 578 ? -4.166  82.241  13.812  1.00 81.73  ? 589  ALA A N   1 
ATOM   4342 C  CA  . ALA A 1 578 ? -5.119  81.641  14.725  1.00 69.86  ? 589  ALA A CA  1 
ATOM   4343 C  C   . ALA A 1 578 ? -4.476  80.477  15.473  1.00 55.87  ? 589  ALA A C   1 
ATOM   4344 O  O   . ALA A 1 578 ? -3.379  80.013  15.146  1.00 55.73  ? 589  ALA A O   1 
ATOM   4345 C  CB  . ALA A 1 578 ? -6.358  81.178  13.966  1.00 72.66  ? 589  ALA A CB  1 
ATOM   4346 N  N   . VAL A 1 579 ? -5.179  80.009  16.503  1.00 54.96  ? 590  VAL A N   1 
ATOM   4347 C  CA  . VAL A 1 579 ? -4.694  78.894  17.305  1.00 51.22  ? 590  VAL A CA  1 
ATOM   4348 C  C   . VAL A 1 579 ? -4.675  77.631  16.457  1.00 59.59  ? 590  VAL A C   1 
ATOM   4349 O  O   . VAL A 1 579 ? -5.646  77.323  15.753  1.00 74.24  ? 590  VAL A O   1 
ATOM   4350 C  CB  . VAL A 1 579 ? -5.572  78.710  18.552  1.00 51.61  ? 590  VAL A CB  1 
ATOM   4351 C  CG1 . VAL A 1 579 ? -5.073  77.541  19.387  1.00 50.39  ? 590  VAL A CG1 1 
ATOM   4352 C  CG2 . VAL A 1 579 ? -5.608  79.991  19.374  1.00 52.89  ? 590  VAL A CG2 1 
ATOM   4353 N  N   . VAL A 1 580 ? -3.565  76.896  16.512  1.00 54.70  ? 591  VAL A N   1 
ATOM   4354 C  CA  . VAL A 1 580 ? -3.491  75.612  15.829  1.00 56.77  ? 591  VAL A CA  1 
ATOM   4355 C  C   . VAL A 1 580 ? -4.338  74.600  16.587  1.00 69.85  ? 591  VAL A C   1 
ATOM   4356 O  O   . VAL A 1 580 ? -4.236  74.473  17.814  1.00 47.46  ? 591  VAL A O   1 
ATOM   4357 C  CB  . VAL A 1 580 ? -2.034  75.144  15.703  1.00 47.02  ? 591  VAL A CB  1 
ATOM   4358 C  CG1 . VAL A 1 580 ? -1.965  73.851  14.904  1.00 46.17  ? 591  VAL A CG1 1 
ATOM   4359 C  CG2 . VAL A 1 580 ? -1.184  76.223  15.050  1.00 47.53  ? 591  VAL A CG2 1 
ATOM   4360 N  N   . THR A 1 581 ? -5.185  73.874  15.856  1.00 74.51  ? 592  THR A N   1 
ATOM   4361 C  CA  . THR A 1 581 ? -6.171  72.994  16.463  1.00 58.93  ? 592  THR A CA  1 
ATOM   4362 C  C   . THR A 1 581 ? -5.998  71.526  16.107  1.00 46.34  ? 592  THR A C   1 
ATOM   4363 O  O   . THR A 1 581 ? -6.688  70.684  16.692  1.00 63.32  ? 592  THR A O   1 
ATOM   4364 C  CB  . THR A 1 581 ? -7.588  73.436  16.067  1.00 56.16  ? 592  THR A CB  1 
ATOM   4365 O  OG1 . THR A 1 581 ? -7.808  73.150  14.680  1.00 60.21  ? 592  THR A OG1 1 
ATOM   4366 C  CG2 . THR A 1 581 ? -7.747  74.928  16.293  1.00 49.75  ? 592  THR A CG2 1 
ATOM   4367 N  N   . SER A 1 582 ? -5.111  71.193  15.174  1.00 45.76  ? 593  SER A N   1 
ATOM   4368 C  CA  . SER A 1 582 ? -4.870  69.808  14.799  1.00 52.24  ? 593  SER A CA  1 
ATOM   4369 C  C   . SER A 1 582 ? -3.486  69.714  14.178  1.00 51.32  ? 593  SER A C   1 
ATOM   4370 O  O   . SER A 1 582 ? -3.013  70.659  13.542  1.00 44.78  ? 593  SER A O   1 
ATOM   4371 C  CB  . SER A 1 582 ? -5.939  69.293  13.829  1.00 59.78  ? 593  SER A CB  1 
ATOM   4372 O  OG  . SER A 1 582 ? -6.072  70.154  12.711  1.00 73.81  ? 593  SER A OG  1 
ATOM   4373 N  N   . LEU A 1 583 ? -2.841  68.565  14.370  1.00 60.35  ? 594  LEU A N   1 
ATOM   4374 C  CA  . LEU A 1 583 ? -1.470  68.390  13.916  1.00 43.15  ? 594  LEU A CA  1 
ATOM   4375 C  C   . LEU A 1 583 ? -1.211  66.922  13.609  1.00 47.82  ? 594  LEU A C   1 
ATOM   4376 O  O   . LEU A 1 583 ? -1.665  66.036  14.338  1.00 60.97  ? 594  LEU A O   1 
ATOM   4377 C  CB  . LEU A 1 583 ? -0.474  68.896  14.965  1.00 43.06  ? 594  LEU A CB  1 
ATOM   4378 C  CG  . LEU A 1 583 ? 0.998   68.946  14.559  1.00 42.88  ? 594  LEU A CG  1 
ATOM   4379 C  CD1 . LEU A 1 583 ? 1.187   69.840  13.345  1.00 56.22  ? 594  LEU A CD1 1 
ATOM   4380 C  CD2 . LEU A 1 583 ? 1.850   69.428  15.721  1.00 42.94  ? 594  LEU A CD2 1 
ATOM   4381 N  N   . ALA A 1 584 ? -0.479  66.679  12.524  1.00 47.29  ? 595  ALA A N   1 
ATOM   4382 C  CA  . ALA A 1 584 ? -0.071  65.338  12.136  1.00 54.78  ? 595  ALA A CA  1 
ATOM   4383 C  C   . ALA A 1 584 ? 1.304   65.424  11.491  1.00 52.27  ? 595  ALA A C   1 
ATOM   4384 O  O   . ALA A 1 584 ? 1.563   66.326  10.690  1.00 50.17  ? 595  ALA A O   1 
ATOM   4385 C  CB  . ALA A 1 584 ? -1.076  64.697  11.172  1.00 42.26  ? 595  ALA A CB  1 
ATOM   4386 N  N   . LEU A 1 585 ? 2.183   64.488  11.847  1.00 54.76  ? 596  LEU A N   1 
ATOM   4387 C  CA  . LEU A 1 585 ? 3.564   64.484  11.371  1.00 47.97  ? 596  LEU A CA  1 
ATOM   4388 C  C   . LEU A 1 585 ? 3.916   63.094  10.862  1.00 49.70  ? 596  LEU A C   1 
ATOM   4389 O  O   . LEU A 1 585 ? 4.009   62.145  11.648  1.00 54.43  ? 596  LEU A O   1 
ATOM   4390 C  CB  . LEU A 1 585 ? 4.528   64.913  12.476  1.00 42.35  ? 596  LEU A CB  1 
ATOM   4391 C  CG  . LEU A 1 585 ? 6.017   64.747  12.163  1.00 44.06  ? 596  LEU A CG  1 
ATOM   4392 C  CD1 . LEU A 1 585 ? 6.442   65.702  11.059  1.00 60.41  ? 596  LEU A CD1 1 
ATOM   4393 C  CD2 . LEU A 1 585 ? 6.862   64.947  13.413  1.00 44.83  ? 596  LEU A CD2 1 
ATOM   4394 N  N   . HIS A 1 586 ? 4.119   62.976  9.553   1.00 44.77  ? 597  HIS A N   1 
ATOM   4395 C  CA  . HIS A 1 586 ? 4.567   61.736  8.936   1.00 52.25  ? 597  HIS A CA  1 
ATOM   4396 C  C   . HIS A 1 586 ? 6.077   61.815  8.747   1.00 57.60  ? 597  HIS A C   1 
ATOM   4397 O  O   . HIS A 1 586 ? 6.570   62.657  7.989   1.00 60.92  ? 597  HIS A O   1 
ATOM   4398 C  CB  . HIS A 1 586 ? 3.863   61.498  7.601   1.00 49.02  ? 597  HIS A CB  1 
ATOM   4399 C  CG  . HIS A 1 586 ? 3.837   60.061  7.182   1.00 42.75  ? 597  HIS A CG  1 
ATOM   4400 N  ND1 . HIS A 1 586 ? 4.963   59.389  6.761   1.00 43.11  ? 597  HIS A ND1 1 
ATOM   4401 C  CD2 . HIS A 1 586 ? 2.821   59.169  7.123   1.00 47.09  ? 597  HIS A CD2 1 
ATOM   4402 C  CE1 . HIS A 1 586 ? 4.642   58.143  6.459   1.00 47.97  ? 597  HIS A CE1 1 
ATOM   4403 N  NE2 . HIS A 1 586 ? 3.348   57.984  6.668   1.00 49.37  ? 597  HIS A NE2 1 
ATOM   4404 N  N   . SER A 1 587 ? 6.805   60.940  9.440   1.00 58.82  ? 598  SER A N   1 
ATOM   4405 C  CA  . SER A 1 587 ? 8.259   61.038  9.470   1.00 48.29  ? 598  SER A CA  1 
ATOM   4406 C  C   . SER A 1 587 ? 8.894   60.493  8.199   1.00 52.91  ? 598  SER A C   1 
ATOM   4407 O  O   . SER A 1 587 ? 9.908   61.026  7.735   1.00 73.53  ? 598  SER A O   1 
ATOM   4408 C  CB  . SER A 1 587 ? 8.805   60.296  10.687  1.00 59.79  ? 598  SER A CB  1 
ATOM   4409 O  OG  . SER A 1 587 ? 7.953   60.483  11.802  1.00 85.22  ? 598  SER A OG  1 
ATOM   4410 N  N   . GLU A 1 588 ? 8.320   59.434  7.628   1.00 43.70  ? 599  GLU A N   1 
ATOM   4411 C  CA  . GLU A 1 588 ? 8.919   58.814  6.453   1.00 44.45  ? 599  GLU A CA  1 
ATOM   4412 C  C   . GLU A 1 588 ? 8.668   59.644  5.199   1.00 44.86  ? 599  GLU A C   1 
ATOM   4413 O  O   . GLU A 1 588 ? 9.602   59.946  4.447   1.00 64.28  ? 599  GLU A O   1 
ATOM   4414 C  CB  . GLU A 1 588 ? 8.382   57.393  6.282   1.00 44.48  ? 599  GLU A CB  1 
ATOM   4415 C  CG  . GLU A 1 588 ? 9.176   56.551  5.304   1.00 45.41  ? 599  GLU A CG  1 
ATOM   4416 C  CD  . GLU A 1 588 ? 8.777   55.091  5.340   1.00 73.47  ? 599  GLU A CD  1 
ATOM   4417 O  OE1 . GLU A 1 588 ? 9.416   54.282  4.634   1.00 66.77  ? 599  GLU A OE1 1 
ATOM   4418 O  OE2 . GLU A 1 588 ? 7.825   54.751  6.075   1.00 73.50  ? 599  GLU A OE2 1 
ATOM   4419 N  N   . TRP A 1 589 ? 7.413   60.031  4.962   1.00 52.82  ? 600  TRP A N   1 
ATOM   4420 C  CA  . TRP A 1 589 ? 7.100   60.907  3.841   1.00 56.06  ? 600  TRP A CA  1 
ATOM   4421 C  C   . TRP A 1 589 ? 7.637   62.316  4.041   1.00 50.67  ? 600  TRP A C   1 
ATOM   4422 O  O   . TRP A 1 589 ? 7.677   63.087  3.076   1.00 60.45  ? 600  TRP A O   1 
ATOM   4423 C  CB  . TRP A 1 589 ? 5.587   60.971  3.616   1.00 54.63  ? 600  TRP A CB  1 
ATOM   4424 C  CG  . TRP A 1 589 ? 4.921   59.634  3.477   1.00 44.78  ? 600  TRP A CG  1 
ATOM   4425 C  CD1 . TRP A 1 589 ? 5.519   58.441  3.194   1.00 45.10  ? 600  TRP A CD1 1 
ATOM   4426 C  CD2 . TRP A 1 589 ? 3.523   59.357  3.625   1.00 44.50  ? 600  TRP A CD2 1 
ATOM   4427 N  NE1 . TRP A 1 589 ? 4.581   57.439  3.155   1.00 45.01  ? 600  TRP A NE1 1 
ATOM   4428 C  CE2 . TRP A 1 589 ? 3.347   57.975  3.416   1.00 44.63  ? 600  TRP A CE2 1 
ATOM   4429 C  CE3 . TRP A 1 589 ? 2.404   60.143  3.914   1.00 44.28  ? 600  TRP A CE3 1 
ATOM   4430 C  CZ2 . TRP A 1 589 ? 2.098   57.363  3.487   1.00 44.51  ? 600  TRP A CZ2 1 
ATOM   4431 C  CZ3 . TRP A 1 589 ? 1.165   59.533  3.984   1.00 44.20  ? 600  TRP A CZ3 1 
ATOM   4432 C  CH2 . TRP A 1 589 ? 1.023   58.157  3.773   1.00 44.29  ? 600  TRP A CH2 1 
ATOM   4433 N  N   . ARG A 1 590 ? 8.044   62.660  5.264   1.00 53.02  ? 601  ARG A N   1 
ATOM   4434 C  CA  . ARG A 1 590 ? 8.538   63.992  5.609   1.00 54.08  ? 601  ARG A CA  1 
ATOM   4435 C  C   . ARG A 1 590 ? 7.498   65.062  5.273   1.00 53.43  ? 601  ARG A C   1 
ATOM   4436 O  O   . ARG A 1 590 ? 7.756   66.024  4.547   1.00 45.48  ? 601  ARG A O   1 
ATOM   4437 C  CB  . ARG A 1 590 ? 9.882   64.273  4.929   1.00 60.41  ? 601  ARG A CB  1 
ATOM   4438 C  CG  . ARG A 1 590 ? 11.068  63.656  5.653   1.00 74.03  ? 601  ARG A CG  1 
ATOM   4439 C  CD  . ARG A 1 590 ? 11.919  62.811  4.722   1.00 92.41  ? 601  ARG A CD  1 
ATOM   4440 N  NE  . ARG A 1 590 ? 13.080  62.253  5.410   1.00 106.03 ? 601  ARG A NE  1 
ATOM   4441 C  CZ  . ARG A 1 590 ? 13.992  61.479  4.831   1.00 108.34 ? 601  ARG A CZ  1 
ATOM   4442 N  NH1 . ARG A 1 590 ? 13.881  61.166  3.547   1.00 94.57  ? 601  ARG A NH1 1 
ATOM   4443 N  NH2 . ARG A 1 590 ? 15.016  61.018  5.537   1.00 113.52 ? 601  ARG A NH2 1 
ATOM   4444 N  N   . LEU A 1 591 ? 6.303   64.866  5.823   1.00 48.86  ? 602  LEU A N   1 
ATOM   4445 C  CA  . LEU A 1 591 ? 5.198   65.799  5.680   1.00 44.34  ? 602  LEU A CA  1 
ATOM   4446 C  C   . LEU A 1 591 ? 4.643   66.127  7.057   1.00 49.52  ? 602  LEU A C   1 
ATOM   4447 O  O   . LEU A 1 591 ? 4.623   65.279  7.953   1.00 70.05  ? 602  LEU A O   1 
ATOM   4448 C  CB  . LEU A 1 591 ? 4.079   65.222  4.799   1.00 44.75  ? 602  LEU A CB  1 
ATOM   4449 C  CG  . LEU A 1 591 ? 4.455   64.733  3.400   1.00 48.09  ? 602  LEU A CG  1 
ATOM   4450 C  CD1 . LEU A 1 591 ? 3.276   64.020  2.754   1.00 45.49  ? 602  LEU A CD1 1 
ATOM   4451 C  CD2 . LEU A 1 591 ? 4.923   65.891  2.534   1.00 46.57  ? 602  LEU A CD2 1 
ATOM   4452 N  N   . VAL A 1 592 ? 4.196   67.369  7.221   1.00 44.00  ? 603  VAL A N   1 
ATOM   4453 C  CA  . VAL A 1 592 ? 3.542   67.811  8.446   1.00 43.65  ? 603  VAL A CA  1 
ATOM   4454 C  C   . VAL A 1 592 ? 2.249   68.519  8.066   1.00 58.75  ? 603  VAL A C   1 
ATOM   4455 O  O   . VAL A 1 592 ? 2.249   69.409  7.208   1.00 70.26  ? 603  VAL A O   1 
ATOM   4456 C  CB  . VAL A 1 592 ? 4.450   68.726  9.293   1.00 43.70  ? 603  VAL A CB  1 
ATOM   4457 C  CG1 . VAL A 1 592 ? 5.055   69.834  8.445   1.00 44.42  ? 603  VAL A CG1 1 
ATOM   4458 C  CG2 . VAL A 1 592 ? 3.678   69.304  10.472  1.00 43.56  ? 603  VAL A CG2 1 
ATOM   4459 N  N   . ALA A 1 593 ? 1.148   68.107  8.686   1.00 49.78  ? 604  ALA A N   1 
ATOM   4460 C  CA  . ALA A 1 593 ? -0.169  68.672  8.424   1.00 55.05  ? 604  ALA A CA  1 
ATOM   4461 C  C   . ALA A 1 593 ? -0.617  69.456  9.649   1.00 55.24  ? 604  ALA A C   1 
ATOM   4462 O  O   . ALA A 1 593 ? -0.657  68.912  10.758  1.00 61.55  ? 604  ALA A O   1 
ATOM   4463 C  CB  . ALA A 1 593 ? -1.179  67.576  8.081   1.00 52.01  ? 604  ALA A CB  1 
ATOM   4464 N  N   . PHE A 1 594 ? -0.947  70.728  9.446   1.00 54.93  ? 605  PHE A N   1 
ATOM   4465 C  CA  . PHE A 1 594 ? -1.404  71.608  10.509  1.00 61.49  ? 605  PHE A CA  1 
ATOM   4466 C  C   . PHE A 1 594 ? -2.765  72.184  10.147  1.00 65.97  ? 605  PHE A C   1 
ATOM   4467 O  O   . PHE A 1 594 ? -3.100  72.332  8.968   1.00 58.38  ? 605  PHE A O   1 
ATOM   4468 C  CB  . PHE A 1 594 ? -0.404  72.745  10.758  1.00 45.73  ? 605  PHE A CB  1 
ATOM   4469 C  CG  . PHE A 1 594 ? 0.058   73.429  9.502   1.00 53.34  ? 605  PHE A CG  1 
ATOM   4470 C  CD1 . PHE A 1 594 ? -0.679  74.461  8.946   1.00 50.61  ? 605  PHE A CD1 1 
ATOM   4471 C  CD2 . PHE A 1 594 ? 1.230   73.037  8.877   1.00 61.27  ? 605  PHE A CD2 1 
ATOM   4472 C  CE1 . PHE A 1 594 ? -0.257  75.089  7.789   1.00 58.04  ? 605  PHE A CE1 1 
ATOM   4473 C  CE2 . PHE A 1 594 ? 1.658   73.661  7.721   1.00 62.41  ? 605  PHE A CE2 1 
ATOM   4474 C  CZ  . PHE A 1 594 ? 0.913   74.687  7.176   1.00 65.77  ? 605  PHE A CZ  1 
ATOM   4475 N  N   . GLY A 1 595 ? -3.547  72.510  11.173  1.00 73.20  ? 606  GLY A N   1 
ATOM   4476 C  CA  . GLY A 1 595 ? -4.867  73.071  10.963  1.00 73.42  ? 606  GLY A CA  1 
ATOM   4477 C  C   . GLY A 1 595 ? -5.278  74.050  12.043  1.00 70.73  ? 606  GLY A C   1 
ATOM   4478 O  O   . GLY A 1 595 ? -5.030  73.815  13.229  1.00 64.69  ? 606  GLY A O   1 
ATOM   4479 N  N   . THR A 1 596 ? -5.909  75.155  11.646  1.00 71.83  ? 607  THR A N   1 
ATOM   4480 C  CA  . THR A 1 596 ? -6.320  76.175  12.603  1.00 69.95  ? 607  THR A CA  1 
ATOM   4481 C  C   . THR A 1 596 ? -7.837  76.298  12.654  1.00 67.46  ? 607  THR A C   1 
ATOM   4482 O  O   . THR A 1 596 ? -8.558  75.395  12.218  1.00 51.27  ? 607  THR A O   1 
ATOM   4483 C  CB  . THR A 1 596 ? -5.703  77.530  12.252  1.00 75.89  ? 607  THR A CB  1 
ATOM   4484 O  OG1 . THR A 1 596 ? -6.380  78.086  11.118  1.00 72.34  ? 607  THR A OG1 1 
ATOM   4485 C  CG2 . THR A 1 596 ? -4.224  77.376  11.928  1.00 86.33  ? 607  THR A CG2 1 
ATOM   4486 N  N   . SER A 1 597 ? -8.329  77.421  13.181  1.00 82.75  ? 608  SER A N   1 
ATOM   4487 C  CA  . SER A 1 597 ? -9.767  77.621  13.300  1.00 85.46  ? 608  SER A CA  1 
ATOM   4488 C  C   . SER A 1 597 ? -10.438 77.852  11.954  1.00 81.03  ? 608  SER A C   1 
ATOM   4489 O  O   . SER A 1 597 ? -11.658 77.691  11.848  1.00 86.36  ? 608  SER A O   1 
ATOM   4490 C  CB  . SER A 1 597 ? -10.057 78.799  14.231  1.00 92.21  ? 608  SER A CB  1 
ATOM   4491 O  OG  . SER A 1 597 ? -9.430  78.621  15.490  1.00 89.66  ? 608  SER A OG  1 
ATOM   4492 N  N   . HIS A 1 598 ? -9.674  78.217  10.925  1.00 77.72  ? 609  HIS A N   1 
ATOM   4493 C  CA  . HIS A 1 598 ? -10.235 78.575  9.630   1.00 81.11  ? 609  HIS A CA  1 
ATOM   4494 C  C   . HIS A 1 598 ? -9.901  77.592  8.521   1.00 84.45  ? 609  HIS A C   1 
ATOM   4495 O  O   . HIS A 1 598 ? -10.717 77.407  7.615   1.00 89.53  ? 609  HIS A O   1 
ATOM   4496 C  CB  . HIS A 1 598 ? -9.756  79.972  9.218   1.00 78.88  ? 609  HIS A CB  1 
ATOM   4497 C  CG  . HIS A 1 598 ? -9.773  80.967  10.336  1.00 84.99  ? 609  HIS A CG  1 
ATOM   4498 N  ND1 . HIS A 1 598 ? -8.635  81.340  11.018  1.00 87.52  ? 609  HIS A ND1 1 
ATOM   4499 C  CD2 . HIS A 1 598 ? -10.793 81.656  10.901  1.00 87.75  ? 609  HIS A CD2 1 
ATOM   4500 C  CE1 . HIS A 1 598 ? -8.951  82.222  11.949  1.00 87.62  ? 609  HIS A CE1 1 
ATOM   4501 N  NE2 . HIS A 1 598 ? -10.255 82.430  11.900  1.00 83.34  ? 609  HIS A NE2 1 
ATOM   4502 N  N   . GLY A 1 599 ? -8.734  76.961  8.564   1.00 89.03  ? 610  GLY A N   1 
ATOM   4503 C  CA  . GLY A 1 599 ? -8.365  76.019  7.534   1.00 93.78  ? 610  GLY A CA  1 
ATOM   4504 C  C   . GLY A 1 599 ? -7.222  75.133  7.977   1.00 90.09  ? 610  GLY A C   1 
ATOM   4505 O  O   . GLY A 1 599 ? -6.853  75.101  9.152   1.00 87.24  ? 610  GLY A O   1 
ATOM   4506 N  N   . PHE A 1 600 ? -6.665  74.409  7.009   1.00 82.66  ? 611  PHE A N   1 
ATOM   4507 C  CA  . PHE A 1 600 ? -5.547  73.513  7.262   1.00 72.05  ? 611  PHE A CA  1 
ATOM   4508 C  C   . PHE A 1 600 ? -4.657  73.482  6.028   1.00 68.13  ? 611  PHE A C   1 
ATOM   4509 O  O   . PHE A 1 600 ? -5.034  73.953  4.952   1.00 50.90  ? 611  PHE A O   1 
ATOM   4510 C  CB  . PHE A 1 600 ? -6.029  72.106  7.634   1.00 74.92  ? 611  PHE A CB  1 
ATOM   4511 C  CG  . PHE A 1 600 ? -6.802  71.419  6.545   1.00 71.94  ? 611  PHE A CG  1 
ATOM   4512 C  CD1 . PHE A 1 600 ? -6.169  70.552  5.668   1.00 67.99  ? 611  PHE A CD1 1 
ATOM   4513 C  CD2 . PHE A 1 600 ? -8.163  71.634  6.399   1.00 63.72  ? 611  PHE A CD2 1 
ATOM   4514 C  CE1 . PHE A 1 600 ? -6.876  69.917  4.666   1.00 70.99  ? 611  PHE A CE1 1 
ATOM   4515 C  CE2 . PHE A 1 600 ? -8.875  71.001  5.399   1.00 69.27  ? 611  PHE A CE2 1 
ATOM   4516 C  CZ  . PHE A 1 600 ? -8.231  70.142  4.531   1.00 73.55  ? 611  PHE A CZ  1 
ATOM   4517 N  N   . GLY A 1 601 ? -3.464  72.919  6.194   1.00 74.86  ? 612  GLY A N   1 
ATOM   4518 C  CA  . GLY A 1 601 ? -2.510  72.857  5.104   1.00 78.86  ? 612  GLY A CA  1 
ATOM   4519 C  C   . GLY A 1 601 ? -1.504  71.751  5.314   1.00 73.25  ? 612  GLY A C   1 
ATOM   4520 O  O   . GLY A 1 601 ? -1.188  71.383  6.450   1.00 76.71  ? 612  GLY A O   1 
ATOM   4521 N  N   . LEU A 1 602 ? -0.998  71.219  4.206   1.00 64.82  ? 613  LEU A N   1 
ATOM   4522 C  CA  . LEU A 1 602 ? 0.022   70.180  4.211   1.00 61.46  ? 613  LEU A CA  1 
ATOM   4523 C  C   . LEU A 1 602 ? 1.359   70.797  3.827   1.00 56.58  ? 613  LEU A C   1 
ATOM   4524 O  O   . LEU A 1 602 ? 1.449   71.522  2.831   1.00 52.45  ? 613  LEU A O   1 
ATOM   4525 C  CB  . LEU A 1 602 ? -0.338  69.051  3.245   1.00 47.21  ? 613  LEU A CB  1 
ATOM   4526 C  CG  . LEU A 1 602 ? 0.698   67.940  3.076   1.00 66.42  ? 613  LEU A CG  1 
ATOM   4527 C  CD1 . LEU A 1 602 ? 0.937   67.225  4.395   1.00 66.36  ? 613  LEU A CD1 1 
ATOM   4528 C  CD2 . LEU A 1 602 ? 0.263   66.960  1.998   1.00 47.07  ? 613  LEU A CD2 1 
ATOM   4529 N  N   . PHE A 1 603 ? 2.392   70.506  4.612   1.00 58.39  ? 614  PHE A N   1 
ATOM   4530 C  CA  . PHE A 1 603 ? 3.704   71.108  4.434   1.00 56.26  ? 614  PHE A CA  1 
ATOM   4531 C  C   . PHE A 1 603 ? 4.750   70.030  4.193   1.00 52.27  ? 614  PHE A C   1 
ATOM   4532 O  O   . PHE A 1 603 ? 4.684   68.942  4.776   1.00 45.70  ? 614  PHE A O   1 
ATOM   4533 C  CB  . PHE A 1 603 ? 4.085   71.953  5.654   1.00 60.88  ? 614  PHE A CB  1 
ATOM   4534 C  CG  . PHE A 1 603 ? 5.386   72.684  5.504   1.00 69.28  ? 614  PHE A CG  1 
ATOM   4535 C  CD1 . PHE A 1 603 ? 5.497   73.754  4.633   1.00 81.46  ? 614  PHE A CD1 1 
ATOM   4536 C  CD2 . PHE A 1 603 ? 6.495   72.310  6.245   1.00 61.36  ? 614  PHE A CD2 1 
ATOM   4537 C  CE1 . PHE A 1 603 ? 6.692   74.432  4.495   1.00 85.69  ? 614  PHE A CE1 1 
ATOM   4538 C  CE2 . PHE A 1 603 ? 7.692   72.985  6.113   1.00 65.93  ? 614  PHE A CE2 1 
ATOM   4539 C  CZ  . PHE A 1 603 ? 7.790   74.047  5.237   1.00 77.19  ? 614  PHE A CZ  1 
ATOM   4540 N  N   . ASP A 1 604 ? 5.712   70.340  3.327   1.00 47.57  ? 615  ASP A N   1 
ATOM   4541 C  CA  . ASP A 1 604 ? 6.809   69.435  2.986   1.00 52.32  ? 615  ASP A CA  1 
ATOM   4542 C  C   . ASP A 1 604 ? 8.041   69.909  3.751   1.00 50.59  ? 615  ASP A C   1 
ATOM   4543 O  O   . ASP A 1 604 ? 8.850   70.684  3.241   1.00 51.39  ? 615  ASP A O   1 
ATOM   4544 C  CB  . ASP A 1 604 ? 7.038   69.422  1.476   1.00 60.27  ? 615  ASP A CB  1 
ATOM   4545 C  CG  . ASP A 1 604 ? 8.138   68.462  1.048   1.00 55.37  ? 615  ASP A CG  1 
ATOM   4546 O  OD1 . ASP A 1 604 ? 8.745   67.798  1.914   1.00 47.56  ? 615  ASP A OD1 1 
ATOM   4547 O  OD2 . ASP A 1 604 ? 8.393   68.372  -0.172  1.00 55.02  ? 615  ASP A OD2 1 
ATOM   4548 N  N   . HIS A 1 605 ? 8.192   69.427  4.987   1.00 48.34  ? 616  HIS A N   1 
ATOM   4549 C  CA  . HIS A 1 605 ? 9.313   69.866  5.813   1.00 57.69  ? 616  HIS A CA  1 
ATOM   4550 C  C   . HIS A 1 605 ? 10.644  69.254  5.389   1.00 65.05  ? 616  HIS A C   1 
ATOM   4551 O  O   . HIS A 1 605 ? 11.653  69.484  6.066   1.00 82.39  ? 616  HIS A O   1 
ATOM   4552 C  CB  . HIS A 1 605 ? 9.039   69.568  7.292   1.00 56.28  ? 616  HIS A CB  1 
ATOM   4553 C  CG  . HIS A 1 605 ? 9.092   68.115  7.648   1.00 62.87  ? 616  HIS A CG  1 
ATOM   4554 N  ND1 . HIS A 1 605 ? 10.277  67.436  7.835   1.00 63.67  ? 616  HIS A ND1 1 
ATOM   4555 C  CD2 . HIS A 1 605 ? 8.104   67.215  7.871   1.00 55.74  ? 616  HIS A CD2 1 
ATOM   4556 C  CE1 . HIS A 1 605 ? 10.017  66.179  8.147   1.00 60.60  ? 616  HIS A CE1 1 
ATOM   4557 N  NE2 . HIS A 1 605 ? 8.707   66.019  8.177   1.00 57.09  ? 616  HIS A NE2 1 
ATOM   4558 N  N   . GLN A 1 606 ? 10.675  68.486  4.300   1.00 58.79  ? 617  GLN A N   1 
ATOM   4559 C  CA  . GLN A 1 606 ? 11.929  68.039  3.709   1.00 66.10  ? 617  GLN A CA  1 
ATOM   4560 C  C   . GLN A 1 606 ? 12.454  69.036  2.684   1.00 70.10  ? 617  GLN A C   1 
ATOM   4561 O  O   . GLN A 1 606 ? 13.653  69.335  2.666   1.00 64.60  ? 617  GLN A O   1 
ATOM   4562 C  CB  . GLN A 1 606 ? 11.748  66.665  3.057   1.00 81.18  ? 617  GLN A CB  1 
ATOM   4563 C  CG  . GLN A 1 606 ? 12.974  66.141  2.317   1.00 87.86  ? 617  GLN A CG  1 
ATOM   4564 C  CD  . GLN A 1 606 ? 14.031  65.561  3.242   1.00 81.54  ? 617  GLN A CD  1 
ATOM   4565 O  OE1 . GLN A 1 606 ? 14.042  65.826  4.444   1.00 88.61  ? 617  GLN A OE1 1 
ATOM   4566 N  NE2 . GLN A 1 606 ? 14.925  64.755  2.681   1.00 73.41  ? 617  GLN A NE2 1 
ATOM   4567 N  N   . GLN A 1 607 ? 11.574  69.559  1.832   1.00 67.23  ? 618  GLN A N   1 
ATOM   4568 C  CA  . GLN A 1 607 ? 11.923  70.600  0.877   1.00 59.53  ? 618  GLN A CA  1 
ATOM   4569 C  C   . GLN A 1 607 ? 11.576  71.996  1.375   1.00 63.56  ? 618  GLN A C   1 
ATOM   4570 O  O   . GLN A 1 607 ? 11.885  72.976  0.690   1.00 61.59  ? 618  GLN A O   1 
ATOM   4571 C  CB  . GLN A 1 607 ? 11.222  70.350  -0.462  1.00 50.64  ? 618  GLN A CB  1 
ATOM   4572 C  CG  . GLN A 1 607 ? 11.528  69.004  -1.091  1.00 51.46  ? 618  GLN A CG  1 
ATOM   4573 C  CD  . GLN A 1 607 ? 10.844  68.827  -2.432  1.00 67.27  ? 618  GLN A CD  1 
ATOM   4574 O  OE1 . GLN A 1 607 ? 10.298  69.778  -2.993  1.00 71.53  ? 618  GLN A OE1 1 
ATOM   4575 N  NE2 . GLN A 1 607 ? 10.868  67.606  -2.953  1.00 72.34  ? 618  GLN A NE2 1 
ATOM   4576 N  N   . ARG A 1 608 ? 10.946  72.105  2.547   1.00 65.48  ? 619  ARG A N   1 
ATOM   4577 C  CA  . ARG A 1 608 ? 10.497  73.387  3.093   1.00 59.32  ? 619  ARG A CA  1 
ATOM   4578 C  C   . ARG A 1 608 ? 9.614   74.128  2.093   1.00 54.01  ? 619  ARG A C   1 
ATOM   4579 O  O   . ARG A 1 608 ? 9.741   75.337  1.889   1.00 50.77  ? 619  ARG A O   1 
ATOM   4580 C  CB  . ARG A 1 608 ? 11.683  74.245  3.533   1.00 59.73  ? 619  ARG A CB  1 
ATOM   4581 C  CG  . ARG A 1 608 ? 12.391  73.697  4.760   1.00 61.40  ? 619  ARG A CG  1 
ATOM   4582 C  CD  . ARG A 1 608 ? 13.897  73.711  4.589   1.00 71.20  ? 619  ARG A CD  1 
ATOM   4583 N  NE  . ARG A 1 608 ? 14.559  72.896  5.602   1.00 88.81  ? 619  ARG A NE  1 
ATOM   4584 C  CZ  . ARG A 1 608 ? 14.750  71.585  5.492   1.00 103.98 ? 619  ARG A CZ  1 
ATOM   4585 N  NH1 . ARG A 1 608 ? 14.328  70.942  4.412   1.00 106.42 ? 619  ARG A NH1 1 
ATOM   4586 N  NH2 . ARG A 1 608 ? 15.361  70.916  6.460   1.00 104.75 ? 619  ARG A NH2 1 
ATOM   4587 N  N   . ARG A 1 609 ? 8.710   73.386  1.462   1.00 67.60  ? 620  ARG A N   1 
ATOM   4588 C  CA  . ARG A 1 609 ? 7.771   73.928  0.493   1.00 72.22  ? 620  ARG A CA  1 
ATOM   4589 C  C   . ARG A 1 609 ? 6.347   73.627  0.940   1.00 72.73  ? 620  ARG A C   1 
ATOM   4590 O  O   . ARG A 1 609 ? 6.074   72.582  1.538   1.00 77.25  ? 620  ARG A O   1 
ATOM   4591 C  CB  . ARG A 1 609 ? 8.016   73.345  -0.905  1.00 66.69  ? 620  ARG A CB  1 
ATOM   4592 N  N   . GLN A 1 610 ? 5.441   74.556  0.648   1.00 66.75  ? 621  GLN A N   1 
ATOM   4593 C  CA  . GLN A 1 610 ? 4.035   74.383  0.989   1.00 71.35  ? 621  GLN A CA  1 
ATOM   4594 C  C   . GLN A 1 610 ? 3.357   73.538  -0.083  1.00 73.09  ? 621  GLN A C   1 
ATOM   4595 O  O   . GLN A 1 610 ? 3.276   73.950  -1.245  1.00 83.83  ? 621  GLN A O   1 
ATOM   4596 C  CB  . GLN A 1 610 ? 3.347   75.740  1.125   1.00 71.90  ? 621  GLN A CB  1 
ATOM   4597 C  CG  . GLN A 1 610 ? 1.929   75.663  1.667   1.00 78.94  ? 621  GLN A CG  1 
ATOM   4598 C  CD  . GLN A 1 610 ? 1.882   75.165  3.099   1.00 98.31  ? 621  GLN A CD  1 
ATOM   4599 O  OE1 . GLN A 1 610 ? 2.769   75.460  3.900   1.00 101.71 ? 621  GLN A OE1 1 
ATOM   4600 N  NE2 . GLN A 1 610 ? 0.848   74.398  3.427   1.00 104.23 ? 621  GLN A NE2 1 
ATOM   4601 N  N   . VAL A 1 611 ? 2.879   72.355  0.303   1.00 69.06  ? 622  VAL A N   1 
ATOM   4602 C  CA  . VAL A 1 611 ? 2.183   71.489  -0.646  1.00 66.03  ? 622  VAL A CA  1 
ATOM   4603 C  C   . VAL A 1 611 ? 0.859   72.120  -1.062  1.00 65.56  ? 622  VAL A C   1 
ATOM   4604 O  O   . VAL A 1 611 ? 0.612   72.361  -2.249  1.00 77.04  ? 622  VAL A O   1 
ATOM   4605 C  CB  . VAL A 1 611 ? 1.977   70.085  -0.050  1.00 65.08  ? 622  VAL A CB  1 
ATOM   4606 C  CG1 . VAL A 1 611 ? 1.303   69.173  -1.064  1.00 52.68  ? 622  VAL A CG1 1 
ATOM   4607 C  CG2 . VAL A 1 611 ? 3.307   69.500  0.402   1.00 65.30  ? 622  VAL A CG2 1 
ATOM   4608 N  N   . PHE A 1 612 ? -0.007  72.400  -0.090  1.00 54.98  ? 623  PHE A N   1 
ATOM   4609 C  CA  . PHE A 1 612 ? -1.263  73.084  -0.366  1.00 52.25  ? 623  PHE A CA  1 
ATOM   4610 C  C   . PHE A 1 612 ? -1.835  73.626  0.935   1.00 60.09  ? 623  PHE A C   1 
ATOM   4611 O  O   . PHE A 1 612 ? -1.429  73.229  2.030   1.00 62.25  ? 623  PHE A O   1 
ATOM   4612 C  CB  . PHE A 1 612 ? -2.281  72.159  -1.050  1.00 53.95  ? 623  PHE A CB  1 
ATOM   4613 C  CG  . PHE A 1 612 ? -2.894  71.134  -0.133  1.00 58.03  ? 623  PHE A CG  1 
ATOM   4614 C  CD1 . PHE A 1 612 ? -4.072  71.405  0.549   1.00 55.35  ? 623  PHE A CD1 1 
ATOM   4615 C  CD2 . PHE A 1 612 ? -2.302  69.893  0.035   1.00 64.78  ? 623  PHE A CD2 1 
ATOM   4616 C  CE1 . PHE A 1 612 ? -4.638  70.466  1.390   1.00 58.47  ? 623  PHE A CE1 1 
ATOM   4617 C  CE2 . PHE A 1 612 ? -2.867  68.947  0.872   1.00 66.79  ? 623  PHE A CE2 1 
ATOM   4618 C  CZ  . PHE A 1 612 ? -4.035  69.235  1.550   1.00 66.09  ? 623  PHE A CZ  1 
ATOM   4619 N  N   . VAL A 1 613 ? -2.786  74.547  0.790   1.00 62.14  ? 624  VAL A N   1 
ATOM   4620 C  CA  . VAL A 1 613 ? -3.626  75.015  1.884   1.00 54.41  ? 624  VAL A CA  1 
ATOM   4621 C  C   . VAL A 1 613 ? -5.061  75.044  1.381   1.00 58.48  ? 624  VAL A C   1 
ATOM   4622 O  O   . VAL A 1 613 ? -5.313  75.170  0.178   1.00 70.76  ? 624  VAL A O   1 
ATOM   4623 C  CB  . VAL A 1 613 ? -3.208  76.410  2.407   1.00 53.49  ? 624  VAL A CB  1 
ATOM   4624 C  CG1 . VAL A 1 613 ? -1.778  76.388  2.927   1.00 52.31  ? 624  VAL A CG1 1 
ATOM   4625 C  CG2 . VAL A 1 613 ? -3.372  77.458  1.318   1.00 55.15  ? 624  VAL A CG2 1 
ATOM   4626 N  N   . LYS A 1 614 ? -6.008  74.915  2.307   1.00 53.89  ? 625  LYS A N   1 
ATOM   4627 C  CA  . LYS A 1 614 ? -7.424  74.954  1.960   1.00 55.12  ? 625  LYS A CA  1 
ATOM   4628 C  C   . LYS A 1 614 ? -8.180  75.732  3.023   1.00 73.29  ? 625  LYS A C   1 
ATOM   4629 O  O   . LYS A 1 614 ? -8.187  75.341  4.194   1.00 80.91  ? 625  LYS A O   1 
ATOM   4630 C  CB  . LYS A 1 614 ? -8.009  73.546  1.815   1.00 54.57  ? 625  LYS A CB  1 
ATOM   4631 C  CG  . LYS A 1 614 ? -9.526  73.542  1.729   1.00 62.43  ? 625  LYS A CG  1 
ATOM   4632 C  CD  . LYS A 1 614 ? -10.057 72.354  0.948   1.00 65.95  ? 625  LYS A CD  1 
ATOM   4633 C  CE  . LYS A 1 614 ? -11.558 72.483  0.735   1.00 72.16  ? 625  LYS A CE  1 
ATOM   4634 N  NZ  . LYS A 1 614 ? -12.086 71.461  -0.208  1.00 79.44  ? 625  LYS A NZ  1 
ATOM   4635 N  N   . CYS A 1 615 ? -8.814  76.828  2.613   1.00 77.69  ? 626  CYS A N   1 
ATOM   4636 C  CA  . CYS A 1 615 ? -9.680  77.590  3.502   1.00 85.71  ? 626  CYS A CA  1 
ATOM   4637 C  C   . CYS A 1 615 ? -11.019 76.874  3.624   1.00 95.49  ? 626  CYS A C   1 
ATOM   4638 O  O   . CYS A 1 615 ? -11.734 76.707  2.630   1.00 101.80 ? 626  CYS A O   1 
ATOM   4639 C  CB  . CYS A 1 615 ? -9.873  79.010  2.976   1.00 95.24  ? 626  CYS A CB  1 
ATOM   4640 S  SG  . CYS A 1 615 ? -10.948 80.041  4.000   1.00 102.29 ? 626  CYS A SG  1 
ATOM   4641 N  N   . THR A 1 616 ? -11.356 76.449  4.839   1.00 91.66  ? 627  THR A N   1 
ATOM   4642 C  CA  . THR A 1 616 ? -12.571 75.689  5.092   1.00 93.44  ? 627  THR A CA  1 
ATOM   4643 C  C   . THR A 1 616 ? -13.717 76.555  5.597   1.00 92.25  ? 627  THR A C   1 
ATOM   4644 O  O   . THR A 1 616 ? -14.771 76.020  5.954   1.00 87.74  ? 627  THR A O   1 
ATOM   4645 C  CB  . THR A 1 616 ? -12.289 74.568  6.094   1.00 84.66  ? 627  THR A CB  1 
ATOM   4646 O  OG1 . THR A 1 616 ? -11.806 75.132  7.319   1.00 79.15  ? 627  THR A OG1 1 
ATOM   4647 C  CG2 . THR A 1 616 ? -11.246 73.613  5.540   1.00 84.91  ? 627  THR A CG2 1 
ATOM   4648 N  N   . LEU A 1 617 ? -13.540 77.874  5.626   1.00 92.89  ? 628  LEU A N   1 
ATOM   4649 C  CA  . LEU A 1 617 ? -14.558 78.762  6.174   1.00 89.12  ? 628  LEU A CA  1 
ATOM   4650 C  C   . LEU A 1 617 ? -15.851 78.667  5.376   1.00 97.76  ? 628  LEU A C   1 
ATOM   4651 O  O   . LEU A 1 617 ? -15.867 78.912  4.165   1.00 101.20 ? 628  LEU A O   1 
ATOM   4652 C  CB  . LEU A 1 617 ? -14.046 80.201  6.189   1.00 72.00  ? 628  LEU A CB  1 
ATOM   4653 C  CG  . LEU A 1 617 ? -13.005 80.528  7.261   1.00 74.72  ? 628  LEU A CG  1 
ATOM   4654 C  CD1 . LEU A 1 617 ? -12.555 81.976  7.152   1.00 63.17  ? 628  LEU A CD1 1 
ATOM   4655 C  CD2 . LEU A 1 617 ? -13.561 80.238  8.648   1.00 68.82  ? 628  LEU A CD2 1 
ATOM   4656 N  N   . HIS A 1 618 ? -16.932 78.301  6.062   1.00 112.68 ? 629  HIS A N   1 
ATOM   4657 C  CA  . HIS A 1 618 ? -18.249 78.283  5.450   1.00 124.64 ? 629  HIS A CA  1 
ATOM   4658 C  C   . HIS A 1 618 ? -18.619 79.694  4.992   1.00 130.34 ? 629  HIS A C   1 
ATOM   4659 O  O   . HIS A 1 618 ? -18.177 80.681  5.589   1.00 133.36 ? 629  HIS A O   1 
ATOM   4660 C  CB  . HIS A 1 618 ? -19.281 77.757  6.449   1.00 136.93 ? 629  HIS A CB  1 
ATOM   4661 C  CG  . HIS A 1 618 ? -20.523 77.210  5.816   1.00 140.37 ? 629  HIS A CG  1 
ATOM   4662 N  ND1 . HIS A 1 618 ? -20.513 76.105  4.991   1.00 140.62 ? 629  HIS A ND1 1 
ATOM   4663 C  CD2 . HIS A 1 618 ? -21.813 77.613  5.889   1.00 142.04 ? 629  HIS A CD2 1 
ATOM   4664 C  CE1 . HIS A 1 618 ? -21.744 75.853  4.582   1.00 139.17 ? 629  HIS A CE1 1 
ATOM   4665 N  NE2 . HIS A 1 618 ? -22.552 76.753  5.113   1.00 141.84 ? 629  HIS A NE2 1 
ATOM   4666 N  N   . PRO A 1 619 ? -19.412 79.822  3.922   1.00 125.02 ? 630  PRO A N   1 
ATOM   4667 C  CA  . PRO A 1 619 ? -19.816 81.167  3.474   1.00 126.06 ? 630  PRO A CA  1 
ATOM   4668 C  C   . PRO A 1 619 ? -20.501 81.990  4.552   1.00 128.31 ? 630  PRO A C   1 
ATOM   4669 O  O   . PRO A 1 619 ? -20.399 83.223  4.534   1.00 125.64 ? 630  PRO A O   1 
ATOM   4670 C  CB  . PRO A 1 619 ? -20.758 80.877  2.294   1.00 117.68 ? 630  PRO A CB  1 
ATOM   4671 C  CG  . PRO A 1 619 ? -21.105 79.416  2.405   1.00 114.51 ? 630  PRO A CG  1 
ATOM   4672 C  CD  . PRO A 1 619 ? -19.900 78.776  3.010   1.00 118.61 ? 630  PRO A CD  1 
ATOM   4673 N  N   . SER A 1 620 ? -21.190 81.348  5.496   1.00 129.96 ? 631  SER A N   1 
ATOM   4674 C  CA  . SER A 1 620 ? -21.831 82.028  6.623   1.00 122.79 ? 631  SER A CA  1 
ATOM   4675 C  C   . SER A 1 620 ? -21.427 81.286  7.894   1.00 124.68 ? 631  SER A C   1 
ATOM   4676 O  O   . SER A 1 620 ? -22.088 80.328  8.302   1.00 118.76 ? 631  SER A O   1 
ATOM   4677 C  CB  . SER A 1 620 ? -23.347 82.076  6.449   1.00 117.57 ? 631  SER A CB  1 
ATOM   4678 N  N   . ASP A 1 621 ? -20.339 81.732  8.516   1.00 130.02 ? 632  ASP A N   1 
ATOM   4679 C  CA  . ASP A 1 621 ? -19.815 81.114  9.722   1.00 133.20 ? 632  ASP A CA  1 
ATOM   4680 C  C   . ASP A 1 621 ? -20.229 81.928  10.948  1.00 142.61 ? 632  ASP A C   1 
ATOM   4681 O  O   . ASP A 1 621 ? -21.017 82.874  10.859  1.00 148.39 ? 632  ASP A O   1 
ATOM   4682 C  CB  . ASP A 1 621 ? -18.295 80.972  9.617   1.00 124.42 ? 632  ASP A CB  1 
ATOM   4683 N  N   . GLN A 1 622 ? -19.690 81.560  12.108  1.00 143.81 ? 633  GLN A N   1 
ATOM   4684 C  CA  . GLN A 1 622 ? -20.045 82.208  13.361  1.00 140.95 ? 633  GLN A CA  1 
ATOM   4685 C  C   . GLN A 1 622 ? -19.348 83.563  13.480  1.00 139.64 ? 633  GLN A C   1 
ATOM   4686 O  O   . GLN A 1 622 ? -18.548 83.963  12.630  1.00 148.91 ? 633  GLN A O   1 
ATOM   4687 C  CB  . GLN A 1 622 ? -19.693 81.304  14.540  1.00 136.54 ? 633  GLN A CB  1 
ATOM   4688 N  N   . LEU A 1 623 ? -19.659 84.279  14.557  1.00 132.10 ? 634  LEU A N   1 
ATOM   4689 C  CA  . LEU A 1 623 ? -19.072 85.591  14.809  1.00 125.51 ? 634  LEU A CA  1 
ATOM   4690 C  C   . LEU A 1 623 ? -17.588 85.474  15.141  1.00 121.84 ? 634  LEU A C   1 
ATOM   4691 O  O   . LEU A 1 623 ? -16.917 86.476  15.390  1.00 122.69 ? 634  LEU A O   1 
ATOM   4692 C  CB  . LEU A 1 623 ? -19.808 86.306  15.948  1.00 117.12 ? 634  LEU A CB  1 
ATOM   4693 C  CG  . LEU A 1 623 ? -21.112 87.045  15.628  1.00 113.83 ? 634  LEU A CG  1 
ATOM   4694 C  CD1 . LEU A 1 623 ? -22.237 86.084  15.263  1.00 109.12 ? 634  LEU A CD1 1 
ATOM   4695 C  CD2 . LEU A 1 623 ? -21.521 87.932  16.795  1.00 110.00 ? 634  LEU A CD2 1 
ATOM   4696 N  N   . SER A 1 697 ? -16.231 79.070  17.490  1.00 120.24 ? 708  SER A N   1 
ATOM   4697 C  CA  . SER A 1 697 ? -16.159 77.838  16.713  1.00 118.75 ? 708  SER A CA  1 
ATOM   4698 C  C   . SER A 1 697 ? -17.067 77.905  15.490  1.00 119.38 ? 708  SER A C   1 
ATOM   4699 O  O   . SER A 1 697 ? -18.227 78.308  15.588  1.00 113.23 ? 708  SER A O   1 
ATOM   4700 C  CB  . SER A 1 697 ? -16.532 76.634  17.581  1.00 114.84 ? 708  SER A CB  1 
ATOM   4701 O  OG  . SER A 1 697 ? -15.634 76.489  18.668  1.00 107.31 ? 708  SER A OG  1 
ATOM   4702 N  N   . PHE A 1 698 ? -16.532 77.509  14.339  1.00 116.55 ? 709  PHE A N   1 
ATOM   4703 C  CA  . PHE A 1 698 ? -17.260 77.497  13.082  1.00 107.44 ? 709  PHE A CA  1 
ATOM   4704 C  C   . PHE A 1 698 ? -17.493 76.054  12.640  1.00 98.91  ? 709  PHE A C   1 
ATOM   4705 O  O   . PHE A 1 698 ? -17.185 75.100  13.364  1.00 96.36  ? 709  PHE A O   1 
ATOM   4706 C  CB  . PHE A 1 698 ? -16.497 78.294  12.021  1.00 107.93 ? 709  PHE A CB  1 
ATOM   4707 C  CG  . PHE A 1 698 ? -15.772 79.491  12.566  1.00 115.63 ? 709  PHE A CG  1 
ATOM   4708 C  CD1 . PHE A 1 698 ? -16.453 80.664  12.845  1.00 123.96 ? 709  PHE A CD1 1 
ATOM   4709 C  CD2 . PHE A 1 698 ? -14.407 79.444  12.794  1.00 114.40 ? 709  PHE A CD2 1 
ATOM   4710 C  CE1 . PHE A 1 698 ? -15.785 81.767  13.345  1.00 123.87 ? 709  PHE A CE1 1 
ATOM   4711 C  CE2 . PHE A 1 698 ? -13.734 80.542  13.293  1.00 111.21 ? 709  PHE A CE2 1 
ATOM   4712 C  CZ  . PHE A 1 698 ? -14.424 81.705  13.570  1.00 116.64 ? 709  PHE A CZ  1 
ATOM   4713 N  N   . THR A 1 699 ? -18.043 75.893  11.437  1.00 97.16  ? 710  THR A N   1 
ATOM   4714 C  CA  . THR A 1 699 ? -18.246 74.566  10.868  1.00 88.27  ? 710  THR A CA  1 
ATOM   4715 C  C   . THR A 1 699 ? -17.010 74.066  10.131  1.00 87.17  ? 710  THR A C   1 
ATOM   4716 O  O   . THR A 1 699 ? -16.655 72.888  10.248  1.00 89.01  ? 710  THR A O   1 
ATOM   4717 C  CB  . THR A 1 699 ? -19.449 74.571  9.921   1.00 69.21  ? 710  THR A CB  1 
ATOM   4718 O  OG1 . THR A 1 699 ? -19.233 75.523  8.873   1.00 63.35  ? 710  THR A OG1 1 
ATOM   4719 C  CG2 . THR A 1 699 ? -20.719 74.933  10.677  1.00 63.98  ? 710  THR A CG2 1 
ATOM   4720 N  N   . GLY A 1 700 ? -16.345 74.940  9.379   1.00 81.94  ? 711  GLY A N   1 
ATOM   4721 C  CA  . GLY A 1 700 ? -15.113 74.579  8.705   1.00 79.46  ? 711  GLY A CA  1 
ATOM   4722 C  C   . GLY A 1 700 ? -13.913 74.676  9.623   1.00 74.75  ? 711  GLY A C   1 
ATOM   4723 O  O   . GLY A 1 700 ? -12.873 75.233  9.258   1.00 84.58  ? 711  GLY A O   1 
ATOM   4724 N  N   . PHE A 1 701 ? -14.058 74.132  10.825  1.00 77.12  ? 712  PHE A N   1 
ATOM   4725 C  CA  . PHE A 1 701 ? -13.029 74.167  11.860  1.00 84.02  ? 712  PHE A CA  1 
ATOM   4726 C  C   . PHE A 1 701 ? -12.376 72.791  11.894  1.00 93.42  ? 712  PHE A C   1 
ATOM   4727 O  O   . PHE A 1 701 ? -12.938 71.842  12.445  1.00 110.78 ? 712  PHE A O   1 
ATOM   4728 C  CB  . PHE A 1 701 ? -13.658 74.547  13.199  1.00 82.51  ? 712  PHE A CB  1 
ATOM   4729 C  CG  . PHE A 1 701 ? -12.762 74.341  14.388  1.00 71.07  ? 712  PHE A CG  1 
ATOM   4730 C  CD1 . PHE A 1 701 ? -11.911 75.343  14.810  1.00 69.79  ? 712  PHE A CD1 1 
ATOM   4731 C  CD2 . PHE A 1 701 ? -12.803 73.158  15.109  1.00 75.42  ? 712  PHE A CD2 1 
ATOM   4732 C  CE1 . PHE A 1 701 ? -11.101 75.161  15.910  1.00 72.28  ? 712  PHE A CE1 1 
ATOM   4733 C  CE2 . PHE A 1 701 ? -11.993 72.968  16.207  1.00 74.49  ? 712  PHE A CE2 1 
ATOM   4734 C  CZ  . PHE A 1 701 ? -11.141 73.971  16.610  1.00 70.53  ? 712  PHE A CZ  1 
ATOM   4735 N  N   . VAL A 1 702 ? -11.190 72.677  11.288  1.00 74.79  ? 713  VAL A N   1 
ATOM   4736 C  CA  . VAL A 1 702 ? -10.519 71.384  11.224  1.00 69.51  ? 713  VAL A CA  1 
ATOM   4737 C  C   . VAL A 1 702 ? -10.156 70.931  12.630  1.00 56.91  ? 713  VAL A C   1 
ATOM   4738 O  O   . VAL A 1 702 ? -9.559  71.680  13.413  1.00 63.45  ? 713  VAL A O   1 
ATOM   4739 C  CB  . VAL A 1 702 ? -9.288  71.458  10.308  1.00 65.24  ? 713  VAL A CB  1 
ATOM   4740 C  CG1 . VAL A 1 702 ? -8.417  72.645  10.669  1.00 82.88  ? 713  VAL A CG1 1 
ATOM   4741 C  CG2 . VAL A 1 702 ? -8.491  70.163  10.384  1.00 52.48  ? 713  VAL A CG2 1 
ATOM   4742 N  N   . ARG A 1 703 ? -10.534 69.700  12.961  1.00 56.79  ? 714  ARG A N   1 
ATOM   4743 C  CA  . ARG A 1 703 ? -10.358 69.165  14.302  1.00 61.04  ? 714  ARG A CA  1 
ATOM   4744 C  C   . ARG A 1 703 ? -9.424  67.967  14.366  1.00 63.94  ? 714  ARG A C   1 
ATOM   4745 O  O   . ARG A 1 703 ? -8.741  67.794  15.377  1.00 70.65  ? 714  ARG A O   1 
ATOM   4746 C  CB  . ARG A 1 703 ? -11.724 68.775  14.893  1.00 61.31  ? 714  ARG A CB  1 
ATOM   4747 C  CG  . ARG A 1 703 ? -11.724 68.515  16.390  1.00 67.04  ? 714  ARG A CG  1 
ATOM   4748 C  CD  . ARG A 1 703 ? -13.134 68.622  16.953  1.00 77.90  ? 714  ARG A CD  1 
ATOM   4749 N  NE  . ARG A 1 703 ? -13.198 68.253  18.364  1.00 87.80  ? 714  ARG A NE  1 
ATOM   4750 C  CZ  . ARG A 1 703 ? -14.273 68.416  19.129  1.00 100.04 ? 714  ARG A CZ  1 
ATOM   4751 N  NH1 . ARG A 1 703 ? -15.375 68.949  18.621  1.00 103.11 ? 714  ARG A NH1 1 
ATOM   4752 N  NH2 . ARG A 1 703 ? -14.245 68.050  20.403  1.00 108.40 ? 714  ARG A NH2 1 
ATOM   4753 N  N   . THR A 1 704 ? -9.368  67.144  13.322  1.00 59.76  ? 715  THR A N   1 
ATOM   4754 C  CA  . THR A 1 704 ? -8.499  65.976  13.293  1.00 57.03  ? 715  THR A CA  1 
ATOM   4755 C  C   . THR A 1 704 ? -7.768  65.905  11.961  1.00 49.78  ? 715  THR A C   1 
ATOM   4756 O  O   . THR A 1 704 ? -8.349  66.171  10.905  1.00 45.64  ? 715  THR A O   1 
ATOM   4757 C  CB  . THR A 1 704 ? -9.285  64.676  13.514  1.00 57.22  ? 715  THR A CB  1 
ATOM   4758 O  OG1 . THR A 1 704 ? -10.365 64.598  12.576  1.00 70.90  ? 715  THR A OG1 1 
ATOM   4759 C  CG2 . THR A 1 704 ? -9.834  64.617  14.929  1.00 56.89  ? 715  THR A CG2 1 
ATOM   4760 N  N   . LEU A 1 705 ? -6.488  65.547  12.025  1.00 53.53  ? 716  LEU A N   1 
ATOM   4761 C  CA  . LEU A 1 705 ? -5.662  65.318  10.850  1.00 45.19  ? 716  LEU A CA  1 
ATOM   4762 C  C   . LEU A 1 705 ? -5.053  63.929  10.955  1.00 43.19  ? 716  LEU A C   1 
ATOM   4763 O  O   . LEU A 1 705 ? -4.642  63.506  12.039  1.00 42.64  ? 716  LEU A O   1 
ATOM   4764 C  CB  . LEU A 1 705 ? -4.565  66.382  10.723  1.00 51.53  ? 716  LEU A CB  1 
ATOM   4765 C  CG  . LEU A 1 705 ? -5.073  67.807  10.498  1.00 44.85  ? 716  LEU A CG  1 
ATOM   4766 C  CD1 . LEU A 1 705 ? -3.933  68.809  10.559  1.00 44.84  ? 716  LEU A CD1 1 
ATOM   4767 C  CD2 . LEU A 1 705 ? -5.804  67.906  9.169   1.00 45.69  ? 716  LEU A CD2 1 
ATOM   4768 N  N   . TYR A 1 706 ? -4.998  63.222  9.829   1.00 43.31  ? 717  TYR A N   1 
ATOM   4769 C  CA  . TYR A 1 706 ? -4.664  61.802  9.848   1.00 42.82  ? 717  TYR A CA  1 
ATOM   4770 C  C   . TYR A 1 706 ? -4.047  61.408  8.516   1.00 43.03  ? 717  TYR A C   1 
ATOM   4771 O  O   . TYR A 1 706 ? -4.693  61.535  7.472   1.00 43.71  ? 717  TYR A O   1 
ATOM   4772 C  CB  . TYR A 1 706 ? -5.919  60.972  10.132  1.00 42.99  ? 717  TYR A CB  1 
ATOM   4773 C  CG  . TYR A 1 706 ? -5.693  59.483  10.222  1.00 42.60  ? 717  TYR A CG  1 
ATOM   4774 C  CD1 . TYR A 1 706 ? -5.293  58.893  11.412  1.00 42.04  ? 717  TYR A CD1 1 
ATOM   4775 C  CD2 . TYR A 1 706 ? -5.901  58.665  9.122   1.00 42.95  ? 717  TYR A CD2 1 
ATOM   4776 C  CE1 . TYR A 1 706 ? -5.093  57.529  11.500  1.00 65.42  ? 717  TYR A CE1 1 
ATOM   4777 C  CE2 . TYR A 1 706 ? -5.704  57.303  9.200   1.00 50.40  ? 717  TYR A CE2 1 
ATOM   4778 C  CZ  . TYR A 1 706 ? -5.301  56.739  10.390  1.00 55.47  ? 717  TYR A CZ  1 
ATOM   4779 O  OH  . TYR A 1 706 ? -5.104  55.379  10.469  1.00 53.89  ? 717  TYR A OH  1 
ATOM   4780 N  N   . PHE A 1 707 ? -2.804  60.934  8.553   1.00 56.07  ? 718  PHE A N   1 
ATOM   4781 C  CA  . PHE A 1 707 ? -2.152  60.387  7.373   1.00 42.88  ? 718  PHE A CA  1 
ATOM   4782 C  C   . PHE A 1 707 ? -2.482  58.907  7.233   1.00 51.20  ? 718  PHE A C   1 
ATOM   4783 O  O   . PHE A 1 707 ? -2.668  58.196  8.225   1.00 42.41  ? 718  PHE A O   1 
ATOM   4784 C  CB  . PHE A 1 707 ? -0.635  60.577  7.442   1.00 42.65  ? 718  PHE A CB  1 
ATOM   4785 C  CG  . PHE A 1 707 ? -0.188  61.994  7.224   1.00 42.89  ? 718  PHE A CG  1 
ATOM   4786 C  CD1 . PHE A 1 707 ? -0.312  62.590  5.980   1.00 44.09  ? 718  PHE A CD1 1 
ATOM   4787 C  CD2 . PHE A 1 707 ? 0.371   62.725  8.258   1.00 54.70  ? 718  PHE A CD2 1 
ATOM   4788 C  CE1 . PHE A 1 707 ? 0.102   63.892  5.774   1.00 43.93  ? 718  PHE A CE1 1 
ATOM   4789 C  CE2 . PHE A 1 707 ? 0.789   64.028  8.058   1.00 42.85  ? 718  PHE A CE2 1 
ATOM   4790 C  CZ  . PHE A 1 707 ? 0.654   64.611  6.815   1.00 43.54  ? 718  PHE A CZ  1 
ATOM   4791 N  N   . ALA A 1 708 ? -2.549  58.445  5.987   1.00 48.46  ? 719  ALA A N   1 
ATOM   4792 C  CA  . ALA A 1 708 ? -2.940  57.069  5.717   1.00 48.45  ? 719  ALA A CA  1 
ATOM   4793 C  C   . ALA A 1 708 ? -2.443  56.658  4.339   1.00 51.52  ? 719  ALA A C   1 
ATOM   4794 O  O   . ALA A 1 708 ? -2.255  57.497  3.455   1.00 61.77  ? 719  ALA A O   1 
ATOM   4795 C  CB  . ALA A 1 708 ? -4.459  56.893  5.805   1.00 44.26  ? 719  ALA A CB  1 
ATOM   4796 N  N   . ASP A 1 709 ? -2.242  55.356  4.171   1.00 44.37  ? 720  ASP A N   1 
ATOM   4797 C  CA  . ASP A 1 709 ? -1.816  54.761  2.907   1.00 49.10  ? 720  ASP A CA  1 
ATOM   4798 C  C   . ASP A 1 709 ? -2.828  53.686  2.519   1.00 52.56  ? 720  ASP A C   1 
ATOM   4799 O  O   . ASP A 1 709 ? -2.558  52.487  2.639   1.00 51.13  ? 720  ASP A O   1 
ATOM   4800 C  CB  . ASP A 1 709 ? -0.396  54.187  3.027   1.00 57.96  ? 720  ASP A CB  1 
ATOM   4801 C  CG  . ASP A 1 709 ? 0.130   53.645  1.712   1.00 67.20  ? 720  ASP A CG  1 
ATOM   4802 O  OD1 . ASP A 1 709 ? -0.441  53.986  0.654   1.00 67.27  ? 720  ASP A OD1 1 
ATOM   4803 O  OD2 . ASP A 1 709 ? 1.111   52.871  1.738   1.00 64.69  ? 720  ASP A OD2 1 
ATOM   4804 N  N   . THR A 1 710 ? -3.996  54.117  2.055   1.00 62.27  ? 721  THR A N   1 
ATOM   4805 C  CA  . THR A 1 710 ? -5.098  53.220  1.738   1.00 62.13  ? 721  THR A CA  1 
ATOM   4806 C  C   . THR A 1 710 ? -5.520  53.398  0.281   1.00 54.76  ? 721  THR A C   1 
ATOM   4807 O  O   . THR A 1 710 ? -4.898  54.135  -0.488  1.00 48.31  ? 721  THR A O   1 
ATOM   4808 C  CB  . THR A 1 710 ? -6.281  53.463  2.679   1.00 60.91  ? 721  THR A CB  1 
ATOM   4809 O  OG1 . THR A 1 710 ? -6.767  54.799  2.499   1.00 46.59  ? 721  THR A OG1 1 
ATOM   4810 C  CG2 . THR A 1 710 ? -5.859  53.274  4.122   1.00 76.39  ? 721  THR A CG2 1 
ATOM   4811 N  N   . TYR A 1 711 ? -6.596  52.709  -0.089  1.00 49.79  ? 722  TYR A N   1 
ATOM   4812 C  CA  . TYR A 1 711 ? -7.176  52.813  -1.420  1.00 59.85  ? 722  TYR A CA  1 
ATOM   4813 C  C   . TYR A 1 711 ? -8.267  53.877  -1.395  1.00 62.20  ? 722  TYR A C   1 
ATOM   4814 O  O   . TYR A 1 711 ? -9.233  53.762  -0.633  1.00 62.41  ? 722  TYR A O   1 
ATOM   4815 C  CB  . TYR A 1 711 ? -7.747  51.468  -1.870  1.00 50.71  ? 722  TYR A CB  1 
ATOM   4816 C  CG  . TYR A 1 711 ? -6.781  50.305  -1.763  1.00 63.32  ? 722  TYR A CG  1 
ATOM   4817 C  CD1 . TYR A 1 711 ? -6.048  49.882  -2.864  1.00 64.40  ? 722  TYR A CD1 1 
ATOM   4818 C  CD2 . TYR A 1 711 ? -6.613  49.624  -0.564  1.00 62.96  ? 722  TYR A CD2 1 
ATOM   4819 C  CE1 . TYR A 1 711 ? -5.169  48.817  -2.772  1.00 66.15  ? 722  TYR A CE1 1 
ATOM   4820 C  CE2 . TYR A 1 711 ? -5.736  48.560  -0.462  1.00 58.86  ? 722  TYR A CE2 1 
ATOM   4821 C  CZ  . TYR A 1 711 ? -5.017  48.161  -1.568  1.00 60.90  ? 722  TYR A CZ  1 
ATOM   4822 O  OH  . TYR A 1 711 ? -4.144  47.101  -1.469  1.00 50.46  ? 722  TYR A OH  1 
ATOM   4823 N  N   . LEU A 1 712 ? -8.109  54.911  -2.217  1.00 73.54  ? 723  LEU A N   1 
ATOM   4824 C  CA  . LEU A 1 712 ? -9.070  56.005  -2.294  1.00 68.54  ? 723  LEU A CA  1 
ATOM   4825 C  C   . LEU A 1 712 ? -9.842  56.017  -3.604  1.00 71.00  ? 723  LEU A C   1 
ATOM   4826 O  O   . LEU A 1 712 ? -11.076 56.006  -3.596  1.00 76.75  ? 723  LEU A O   1 
ATOM   4827 C  CB  . LEU A 1 712 ? -8.360  57.354  -2.098  1.00 51.16  ? 723  LEU A CB  1 
ATOM   4828 C  CG  . LEU A 1 712 ? -8.036  57.801  -0.669  1.00 70.69  ? 723  LEU A CG  1 
ATOM   4829 C  CD1 . LEU A 1 712 ? -6.939  56.950  -0.044  1.00 78.13  ? 723  LEU A CD1 1 
ATOM   4830 C  CD2 . LEU A 1 712 ? -7.649  59.271  -0.652  1.00 70.76  ? 723  LEU A CD2 1 
ATOM   4831 N  N   . LYS A 1 713 ? -9.142  56.041  -4.736  1.00 71.97  ? 724  LYS A N   1 
ATOM   4832 C  CA  . LYS A 1 713 ? -9.798  56.028  -6.036  1.00 68.35  ? 724  LYS A CA  1 
ATOM   4833 C  C   . LYS A 1 713 ? -9.811  54.618  -6.611  1.00 72.98  ? 724  LYS A C   1 
ATOM   4834 O  O   . LYS A 1 713 ? -10.866 53.982  -6.691  1.00 72.87  ? 724  LYS A O   1 
ATOM   4835 C  CB  . LYS A 1 713 ? -9.103  56.993  -7.000  1.00 69.74  ? 724  LYS A CB  1 
ATOM   4836 N  N   . ASP A 1 714 ? -8.642  54.122  -7.007  1.00 84.20  ? 725  ASP A N   1 
ATOM   4837 C  CA  . ASP A 1 714 ? -8.552  52.785  -7.573  1.00 88.42  ? 725  ASP A CA  1 
ATOM   4838 C  C   . ASP A 1 714 ? -8.765  51.734  -6.492  1.00 81.02  ? 725  ASP A C   1 
ATOM   4839 O  O   . ASP A 1 714 ? -8.318  51.890  -5.352  1.00 54.38  ? 725  ASP A O   1 
ATOM   4840 C  CB  . ASP A 1 714 ? -7.194  52.583  -8.245  1.00 90.04  ? 725  ASP A CB  1 
ATOM   4841 C  CG  . ASP A 1 714 ? -7.131  51.306  -9.058  1.00 94.51  ? 725  ASP A CG  1 
ATOM   4842 O  OD1 . ASP A 1 714 ? -7.741  51.264  -10.147 1.00 98.93  ? 725  ASP A OD1 1 
ATOM   4843 O  OD2 . ASP A 1 714 ? -6.473  50.344  -8.610  1.00 95.55  ? 725  ASP A OD2 1 
ATOM   4844 N  N   . SER A 1 715 ? -9.459  50.656  -6.856  1.00 79.99  ? 726  SER A N   1 
ATOM   4845 C  CA  . SER A 1 715 ? -9.728  49.574  -5.919  1.00 83.88  ? 726  SER A CA  1 
ATOM   4846 C  C   . SER A 1 715 ? -8.524  48.670  -5.695  1.00 78.99  ? 726  SER A C   1 
ATOM   4847 O  O   . SER A 1 715 ? -8.529  47.885  -4.741  1.00 70.53  ? 726  SER A O   1 
ATOM   4848 C  CB  . SER A 1 715 ? -10.910 48.733  -6.410  1.00 86.03  ? 726  SER A CB  1 
ATOM   4849 O  OG  . SER A 1 715 ? -12.059 49.536  -6.621  1.00 78.05  ? 726  SER A OG  1 
ATOM   4850 N  N   . SER A 1 716 ? -7.496  48.763  -6.542  1.00 79.25  ? 727  SER A N   1 
ATOM   4851 C  CA  . SER A 1 716 ? -6.345  47.873  -6.460  1.00 76.97  ? 727  SER A CA  1 
ATOM   4852 C  C   . SER A 1 716 ? -5.019  48.619  -6.370  1.00 75.47  ? 727  SER A C   1 
ATOM   4853 O  O   . SER A 1 716 ? -3.962  47.981  -6.432  1.00 78.73  ? 727  SER A O   1 
ATOM   4854 C  CB  . SER A 1 716 ? -6.321  46.921  -7.663  1.00 69.26  ? 727  SER A CB  1 
ATOM   4855 O  OG  . SER A 1 716 ? -6.207  47.639  -8.879  1.00 58.55  ? 727  SER A OG  1 
ATOM   4856 N  N   . ARG A 1 717 ? -5.039  49.943  -6.228  1.00 69.52  ? 728  ARG A N   1 
ATOM   4857 C  CA  . ARG A 1 717 ? -3.819  50.737  -6.112  1.00 73.99  ? 728  ARG A CA  1 
ATOM   4858 C  C   . ARG A 1 717 ? -3.943  51.642  -4.894  1.00 75.24  ? 728  ARG A C   1 
ATOM   4859 O  O   . ARG A 1 717 ? -4.751  52.577  -4.890  1.00 65.74  ? 728  ARG A O   1 
ATOM   4860 C  CB  . ARG A 1 717 ? -3.567  51.556  -7.379  1.00 83.23  ? 728  ARG A CB  1 
ATOM   4861 C  CG  . ARG A 1 717 ? -2.210  52.245  -7.408  1.00 92.37  ? 728  ARG A CG  1 
ATOM   4862 C  CD  . ARG A 1 717 ? -2.071  53.164  -8.613  1.00 100.92 ? 728  ARG A CD  1 
ATOM   4863 N  NE  . ARG A 1 717 ? -2.200  52.445  -9.878  1.00 111.22 ? 728  ARG A NE  1 
ATOM   4864 C  CZ  . ARG A 1 717 ? -2.112  53.018  -11.074 1.00 112.70 ? 728  ARG A CZ  1 
ATOM   4865 N  NH1 . ARG A 1 717 ? -1.895  54.323  -11.171 1.00 113.95 ? 728  ARG A NH1 1 
ATOM   4866 N  NH2 . ARG A 1 717 ? -2.242  52.289  -12.174 1.00 106.39 ? 728  ARG A NH2 1 
ATOM   4867 N  N   . HIS A 1 718 ? -3.149  51.363  -3.864  1.00 66.18  ? 729  HIS A N   1 
ATOM   4868 C  CA  . HIS A 1 718 ? -3.134  52.178  -2.659  1.00 60.43  ? 729  HIS A CA  1 
ATOM   4869 C  C   . HIS A 1 718 ? -2.034  53.227  -2.755  1.00 71.77  ? 729  HIS A C   1 
ATOM   4870 O  O   . HIS A 1 718 ? -0.926  52.944  -3.219  1.00 78.94  ? 729  HIS A O   1 
ATOM   4871 C  CB  . HIS A 1 718 ? -2.932  51.308  -1.416  1.00 65.42  ? 729  HIS A CB  1 
ATOM   4872 C  CG  . HIS A 1 718 ? -1.620  50.589  -1.385  1.00 66.69  ? 729  HIS A CG  1 
ATOM   4873 N  ND1 . HIS A 1 718 ? -0.472  51.158  -0.876  1.00 69.36  ? 729  HIS A ND1 1 
ATOM   4874 C  CD2 . HIS A 1 718 ? -1.273  49.348  -1.798  1.00 64.04  ? 729  HIS A CD2 1 
ATOM   4875 C  CE1 . HIS A 1 718 ? 0.526   50.297  -0.977  1.00 66.91  ? 729  HIS A CE1 1 
ATOM   4876 N  NE2 . HIS A 1 718 ? 0.066   49.191  -1.534  1.00 68.93  ? 729  HIS A NE2 1 
ATOM   4877 N  N   . CYS A 1 719 ? -2.350  54.438  -2.318  1.00 73.58  ? 730  CYS A N   1 
ATOM   4878 C  CA  . CYS A 1 719 ? -1.447  55.573  -2.402  1.00 75.57  ? 730  CYS A CA  1 
ATOM   4879 C  C   . CYS A 1 719 ? -1.538  56.374  -1.114  1.00 60.43  ? 730  CYS A C   1 
ATOM   4880 O  O   . CYS A 1 719 ? -2.534  56.281  -0.388  1.00 60.69  ? 730  CYS A O   1 
ATOM   4881 C  CB  . CYS A 1 719 ? -1.783  56.462  -3.608  1.00 92.99  ? 730  CYS A CB  1 
ATOM   4882 S  SG  . CYS A 1 719 ? -3.522  56.942  -3.721  1.00 124.92 ? 730  CYS A SG  1 
ATOM   4883 N  N   . PRO A 1 720 ? -0.504  57.153  -0.791  1.00 52.58  ? 731  PRO A N   1 
ATOM   4884 C  CA  . PRO A 1 720 ? -0.566  58.003  0.404   1.00 49.00  ? 731  PRO A CA  1 
ATOM   4885 C  C   . PRO A 1 720 ? -1.730  58.980  0.338   1.00 59.58  ? 731  PRO A C   1 
ATOM   4886 O  O   . PRO A 1 720 ? -2.183  59.370  -0.740  1.00 76.08  ? 731  PRO A O   1 
ATOM   4887 C  CB  . PRO A 1 720 ? 0.779   58.737  0.385   1.00 54.67  ? 731  PRO A CB  1 
ATOM   4888 C  CG  . PRO A 1 720 ? 1.686   57.825  -0.362  1.00 63.97  ? 731  PRO A CG  1 
ATOM   4889 C  CD  . PRO A 1 720 ? 0.831   57.177  -1.413  1.00 65.78  ? 731  PRO A CD  1 
ATOM   4890 N  N   . SER A 1 721 ? -2.212  59.378  1.513   1.00 50.07  ? 732  SER A N   1 
ATOM   4891 C  CA  . SER A 1 721 ? -3.363  60.266  1.584   1.00 55.13  ? 732  SER A CA  1 
ATOM   4892 C  C   . SER A 1 721 ? -3.352  61.014  2.908   1.00 64.31  ? 732  SER A C   1 
ATOM   4893 O  O   . SER A 1 721 ? -2.660  60.633  3.856   1.00 55.54  ? 732  SER A O   1 
ATOM   4894 C  CB  . SER A 1 721 ? -4.675  59.494  1.419   1.00 60.25  ? 732  SER A CB  1 
ATOM   4895 O  OG  . SER A 1 721 ? -4.837  58.544  2.457   1.00 74.00  ? 732  SER A OG  1 
ATOM   4896 N  N   . LEU A 1 722 ? -4.139  62.088  2.955   1.00 76.27  ? 733  LEU A N   1 
ATOM   4897 C  CA  . LEU A 1 722 ? -4.316  62.903  4.149   1.00 45.66  ? 733  LEU A CA  1 
ATOM   4898 C  C   . LEU A 1 722 ? -5.804  63.101  4.389   1.00 55.49  ? 733  LEU A C   1 
ATOM   4899 O  O   . LEU A 1 722 ? -6.547  63.426  3.457   1.00 63.32  ? 733  LEU A O   1 
ATOM   4900 C  CB  . LEU A 1 722 ? -3.615  64.259  4.007   1.00 45.90  ? 733  LEU A CB  1 
ATOM   4901 C  CG  . LEU A 1 722 ? -3.870  65.280  5.118   1.00 45.67  ? 733  LEU A CG  1 
ATOM   4902 C  CD1 . LEU A 1 722 ? -3.361  64.766  6.456   1.00 44.62  ? 733  LEU A CD1 1 
ATOM   4903 C  CD2 . LEU A 1 722 ? -3.234  66.617  4.775   1.00 46.14  ? 733  LEU A CD2 1 
ATOM   4904 N  N   . TRP A 1 723 ? -6.236  62.905  5.632   1.00 53.96  ? 734  TRP A N   1 
ATOM   4905 C  CA  . TRP A 1 723 ? -7.639  63.005  6.006   1.00 48.15  ? 734  TRP A CA  1 
ATOM   4906 C  C   . TRP A 1 723 ? -7.828  64.130  7.013   1.00 53.90  ? 734  TRP A C   1 
ATOM   4907 O  O   . TRP A 1 723 ? -7.037  64.278  7.950   1.00 56.35  ? 734  TRP A O   1 
ATOM   4908 C  CB  . TRP A 1 723 ? -8.146  61.682  6.591   1.00 46.27  ? 734  TRP A CB  1 
ATOM   4909 C  CG  . TRP A 1 723 ? -8.102  60.546  5.612   1.00 49.58  ? 734  TRP A CG  1 
ATOM   4910 C  CD1 . TRP A 1 723 ? -6.990  59.903  5.151   1.00 45.45  ? 734  TRP A CD1 1 
ATOM   4911 C  CD2 . TRP A 1 723 ? -9.221  59.915  4.978   1.00 46.67  ? 734  TRP A CD2 1 
ATOM   4912 N  NE1 . TRP A 1 723 ? -7.347  58.915  4.267   1.00 58.89  ? 734  TRP A NE1 1 
ATOM   4913 C  CE2 . TRP A 1 723 ? -8.711  58.901  4.144   1.00 57.92  ? 734  TRP A CE2 1 
ATOM   4914 C  CE3 . TRP A 1 723 ? -10.604 60.110  5.034   1.00 47.51  ? 734  TRP A CE3 1 
ATOM   4915 C  CZ2 . TRP A 1 723 ? -9.535  58.085  3.372   1.00 47.51  ? 734  TRP A CZ2 1 
ATOM   4916 C  CZ3 . TRP A 1 723 ? -11.419 59.300  4.267   1.00 48.32  ? 734  TRP A CZ3 1 
ATOM   4917 C  CH2 . TRP A 1 723 ? -10.883 58.299  3.447   1.00 48.29  ? 734  TRP A CH2 1 
ATOM   4918 N  N   . ALA A 1 724 ? -8.881  64.921  6.816   1.00 54.40  ? 735  ALA A N   1 
ATOM   4919 C  CA  . ALA A 1 724 ? -9.160  66.070  7.668   1.00 58.47  ? 735  ALA A CA  1 
ATOM   4920 C  C   . ALA A 1 724 ? -10.638 66.097  8.019   1.00 58.78  ? 735  ALA A C   1 
ATOM   4921 O  O   . ALA A 1 724 ? -11.490 66.025  7.129   1.00 49.19  ? 735  ALA A O   1 
ATOM   4922 C  CB  . ALA A 1 724 ? -8.757  67.380  6.979   1.00 63.71  ? 735  ALA A CB  1 
ATOM   4923 N  N   . GLY A 1 725 ? -10.934 66.204  9.306   1.00 55.96  ? 736  GLY A N   1 
ATOM   4924 C  CA  . GLY A 1 725 ? -12.306 66.291  9.786   1.00 52.48  ? 736  GLY A CA  1 
ATOM   4925 C  C   . GLY A 1 725 ? -12.544 67.615  10.485  1.00 54.39  ? 736  GLY A C   1 
ATOM   4926 O  O   . GLY A 1 725 ? -11.667 68.116  11.191  1.00 48.81  ? 736  GLY A O   1 
ATOM   4927 N  N   . THR A 1 726 ? -13.733 68.174  10.285  1.00 59.90  ? 737  THR A N   1 
ATOM   4928 C  CA  . THR A 1 726 ? -14.089 69.486  10.810  1.00 60.39  ? 737  THR A CA  1 
ATOM   4929 C  C   . THR A 1 726 ? -15.282 69.371  11.756  1.00 68.71  ? 737  THR A C   1 
ATOM   4930 O  O   . THR A 1 726 ? -15.809 68.283  12.003  1.00 68.41  ? 737  THR A O   1 
ATOM   4931 C  CB  . THR A 1 726 ? -14.395 70.467  9.674   1.00 70.54  ? 737  THR A CB  1 
ATOM   4932 O  OG1 . THR A 1 726 ? -15.539 70.010  8.941   1.00 78.25  ? 737  THR A OG1 1 
ATOM   4933 C  CG2 . THR A 1 726 ? -13.205 70.581  8.732   1.00 69.02  ? 737  THR A CG2 1 
ATOM   4934 N  N   . ASN A 1 727 ? -15.705 70.522  12.288  1.00 72.60  ? 738  ASN A N   1 
ATOM   4935 C  CA  . ASN A 1 727 ? -16.847 70.545  13.197  1.00 88.59  ? 738  ASN A CA  1 
ATOM   4936 C  C   . ASN A 1 727 ? -18.161 70.303  12.466  1.00 87.79  ? 738  ASN A C   1 
ATOM   4937 O  O   . ASN A 1 727 ? -19.108 69.773  13.057  1.00 90.30  ? 738  ASN A O   1 
ATOM   4938 C  CB  . ASN A 1 727 ? -16.907 71.876  13.947  1.00 95.97  ? 738  ASN A CB  1 
ATOM   4939 C  CG  . ASN A 1 727 ? -16.004 71.903  15.163  1.00 106.87 ? 738  ASN A CG  1 
ATOM   4940 O  OD1 . ASN A 1 727 ? -15.439 70.882  15.555  1.00 111.10 ? 738  ASN A OD1 1 
ATOM   4941 N  ND2 . ASN A 1 727 ? -15.877 73.073  15.778  1.00 109.31 ? 738  ASN A ND2 1 
ATOM   4942 N  N   . GLY A 1 728 ? -18.244 70.685  11.194  1.00 84.16  ? 739  GLY A N   1 
ATOM   4943 C  CA  . GLY A 1 728 ? -19.455 70.504  10.425  1.00 88.28  ? 739  GLY A CA  1 
ATOM   4944 C  C   . GLY A 1 728 ? -19.704 69.101  9.924   1.00 80.68  ? 739  GLY A C   1 
ATOM   4945 O  O   . GLY A 1 728 ? -20.568 68.907  9.064   1.00 84.12  ? 739  GLY A O   1 
ATOM   4946 N  N   . GLY A 1 729 ? -18.978 68.111  10.440  1.00 68.97  ? 740  GLY A N   1 
ATOM   4947 C  CA  . GLY A 1 729 ? -19.091 66.753  9.953   1.00 63.52  ? 740  GLY A CA  1 
ATOM   4948 C  C   . GLY A 1 729 ? -18.452 66.505  8.607   1.00 65.03  ? 740  GLY A C   1 
ATOM   4949 O  O   . GLY A 1 729 ? -18.673 65.439  8.021   1.00 70.75  ? 740  GLY A O   1 
ATOM   4950 N  N   . THR A 1 730 ? -17.671 67.452  8.096   1.00 59.37  ? 741  THR A N   1 
ATOM   4951 C  CA  . THR A 1 730 ? -17.035 67.320  6.793   1.00 64.50  ? 741  THR A CA  1 
ATOM   4952 C  C   . THR A 1 730 ? -15.710 66.583  6.943   1.00 71.24  ? 741  THR A C   1 
ATOM   4953 O  O   . THR A 1 730 ? -14.912 66.899  7.832   1.00 65.72  ? 741  THR A O   1 
ATOM   4954 C  CB  . THR A 1 730 ? -16.810 68.693  6.159   1.00 73.89  ? 741  THR A CB  1 
ATOM   4955 O  OG1 . THR A 1 730 ? -18.025 69.450  6.210   1.00 70.01  ? 741  THR A OG1 1 
ATOM   4956 C  CG2 . THR A 1 730 ? -16.381 68.544  4.709   1.00 88.43  ? 741  THR A CG2 1 
ATOM   4957 N  N   . ILE A 1 731 ? -15.480 65.605  6.072   1.00 70.94  ? 742  ILE A N   1 
ATOM   4958 C  CA  . ILE A 1 731 ? -14.285 64.769  6.109   1.00 59.95  ? 742  ILE A CA  1 
ATOM   4959 C  C   . ILE A 1 731 ? -13.628 64.866  4.739   1.00 55.43  ? 742  ILE A C   1 
ATOM   4960 O  O   . ILE A 1 731 ? -14.104 64.268  3.767   1.00 54.80  ? 742  ILE A O   1 
ATOM   4961 C  CB  . ILE A 1 731 ? -14.606 63.316  6.471   1.00 50.83  ? 742  ILE A CB  1 
ATOM   4962 C  CG1 . ILE A 1 731 ? -15.292 63.256  7.835   1.00 61.41  ? 742  ILE A CG1 1 
ATOM   4963 C  CG2 . ILE A 1 731 ? -13.340 62.474  6.466   1.00 49.42  ? 742  ILE A CG2 1 
ATOM   4964 C  CD1 . ILE A 1 731 ? -16.180 62.054  8.010   1.00 76.04  ? 742  ILE A CD1 1 
ATOM   4965 N  N   . TYR A 1 732 ? -12.534 65.614  4.655   1.00 72.87  ? 743  TYR A N   1 
ATOM   4966 C  CA  . TYR A 1 732 ? -11.789 65.758  3.416   1.00 67.07  ? 743  TYR A CA  1 
ATOM   4967 C  C   . TYR A 1 732 ? -10.733 64.667  3.300   1.00 63.34  ? 743  TYR A C   1 
ATOM   4968 O  O   . TYR A 1 732 ? -10.176 64.202  4.299   1.00 62.05  ? 743  TYR A O   1 
ATOM   4969 C  CB  . TYR A 1 732 ? -11.123 67.133  3.342   1.00 58.93  ? 743  TYR A CB  1 
ATOM   4970 C  CG  . TYR A 1 732 ? -12.097 68.283  3.237   1.00 58.08  ? 743  TYR A CG  1 
ATOM   4971 C  CD1 . TYR A 1 732 ? -13.126 68.264  2.305   1.00 68.56  ? 743  TYR A CD1 1 
ATOM   4972 C  CD2 . TYR A 1 732 ? -11.990 69.385  4.074   1.00 59.77  ? 743  TYR A CD2 1 
ATOM   4973 C  CE1 . TYR A 1 732 ? -14.017 69.315  2.205   1.00 83.30  ? 743  TYR A CE1 1 
ATOM   4974 C  CE2 . TYR A 1 732 ? -12.878 70.440  3.983   1.00 68.85  ? 743  TYR A CE2 1 
ATOM   4975 C  CZ  . TYR A 1 732 ? -13.889 70.400  3.047   1.00 82.57  ? 743  TYR A CZ  1 
ATOM   4976 O  OH  . TYR A 1 732 ? -14.775 71.448  2.954   1.00 93.00  ? 743  TYR A OH  1 
ATOM   4977 N  N   . ALA A 1 733 ? -10.463 64.260  2.062   1.00 57.31  ? 744  ALA A N   1 
ATOM   4978 C  CA  . ALA A 1 733 ? -9.443  63.258  1.775   1.00 56.91  ? 744  ALA A CA  1 
ATOM   4979 C  C   . ALA A 1 733 ? -8.668  63.700  0.545   1.00 50.56  ? 744  ALA A C   1 
ATOM   4980 O  O   . ALA A 1 733 ? -9.259  63.915  -0.517  1.00 56.51  ? 744  ALA A O   1 
ATOM   4981 C  CB  . ALA A 1 733 ? -10.063 61.875  1.558   1.00 50.03  ? 744  ALA A CB  1 
ATOM   4982 N  N   . PHE A 1 734 ? -7.353  63.838  0.690   1.00 49.74  ? 745  PHE A N   1 
ATOM   4983 C  CA  . PHE A 1 734 ? -6.480  64.289  -0.385  1.00 50.31  ? 745  PHE A CA  1 
ATOM   4984 C  C   . PHE A 1 734 ? -5.497  63.182  -0.732  1.00 63.75  ? 745  PHE A C   1 
ATOM   4985 O  O   . PHE A 1 734 ? -4.801  62.668  0.148   1.00 48.61  ? 745  PHE A O   1 
ATOM   4986 C  CB  . PHE A 1 734 ? -5.724  65.560  0.014   1.00 55.52  ? 745  PHE A CB  1 
ATOM   4987 C  CG  . PHE A 1 734 ? -6.610  66.755  0.215   1.00 50.88  ? 745  PHE A CG  1 
ATOM   4988 C  CD1 . PHE A 1 734 ? -6.775  67.687  -0.794  1.00 65.85  ? 745  PHE A CD1 1 
ATOM   4989 C  CD2 . PHE A 1 734 ? -7.276  66.948  1.413   1.00 50.41  ? 745  PHE A CD2 1 
ATOM   4990 C  CE1 . PHE A 1 734 ? -7.590  68.788  -0.615  1.00 75.76  ? 745  PHE A CE1 1 
ATOM   4991 C  CE2 . PHE A 1 734 ? -8.092  68.047  1.600   1.00 75.06  ? 745  PHE A CE2 1 
ATOM   4992 C  CZ  . PHE A 1 734 ? -8.248  68.969  0.584   1.00 80.25  ? 745  PHE A CZ  1 
ATOM   4993 N  N   . SER A 1 735 ? -5.441  62.822  -2.012  1.00 58.00  ? 746  SER A N   1 
ATOM   4994 C  CA  . SER A 1 735 ? -4.515  61.798  -2.477  1.00 54.26  ? 746  SER A CA  1 
ATOM   4995 C  C   . SER A 1 735 ? -3.125  62.407  -2.626  1.00 52.10  ? 746  SER A C   1 
ATOM   4996 O  O   . SER A 1 735 ? -2.933  63.347  -3.405  1.00 57.97  ? 746  SER A O   1 
ATOM   4997 C  CB  . SER A 1 735 ? -4.994  61.207  -3.801  1.00 56.90  ? 746  SER A CB  1 
ATOM   4998 O  OG  . SER A 1 735 ? -4.154  60.146  -4.219  1.00 68.40  ? 746  SER A OG  1 
ATOM   4999 N  N   . LEU A 1 736 ? -2.162  61.875  -1.881  1.00 51.53  ? 747  LEU A N   1 
ATOM   5000 C  CA  . LEU A 1 736 ? -0.798  62.378  -1.893  1.00 53.81  ? 747  LEU A CA  1 
ATOM   5001 C  C   . LEU A 1 736 ? 0.080   61.507  -2.783  1.00 59.06  ? 747  LEU A C   1 
ATOM   5002 O  O   . LEU A 1 736 ? -0.105  60.290  -2.870  1.00 68.47  ? 747  LEU A O   1 
ATOM   5003 C  CB  . LEU A 1 736 ? -0.218  62.420  -0.477  1.00 51.52  ? 747  LEU A CB  1 
ATOM   5004 C  CG  . LEU A 1 736 ? -1.082  63.062  0.611   1.00 54.75  ? 747  LEU A CG  1 
ATOM   5005 C  CD1 . LEU A 1 736 ? -0.309  63.175  1.916   1.00 52.32  ? 747  LEU A CD1 1 
ATOM   5006 C  CD2 . LEU A 1 736 ? -1.595  64.421  0.170   1.00 67.26  ? 747  LEU A CD2 1 
ATOM   5007 N  N   . ARG A 1 737 ? 1.043   62.146  -3.446  1.00 58.01  ? 748  ARG A N   1 
ATOM   5008 C  CA  . ARG A 1 737 ? 2.002   61.466  -4.317  1.00 63.65  ? 748  ARG A CA  1 
ATOM   5009 C  C   . ARG A 1 737 ? 3.399   61.844  -3.834  1.00 68.94  ? 748  ARG A C   1 
ATOM   5010 O  O   . ARG A 1 737 ? 3.955   62.863  -4.253  1.00 70.43  ? 748  ARG A O   1 
ATOM   5011 C  CB  . ARG A 1 737 ? 1.790   61.842  -5.780  1.00 67.69  ? 748  ARG A CB  1 
ATOM   5012 C  CG  . ARG A 1 737 ? 2.497   60.924  -6.765  1.00 71.87  ? 748  ARG A CG  1 
ATOM   5013 C  CD  . ARG A 1 737 ? 2.927   61.681  -8.010  1.00 86.79  ? 748  ARG A CD  1 
ATOM   5014 N  NE  . ARG A 1 737 ? 4.089   62.526  -7.751  1.00 101.83 ? 748  ARG A NE  1 
ATOM   5015 C  CZ  . ARG A 1 737 ? 4.559   63.435  -8.599  1.00 109.82 ? 748  ARG A CZ  1 
ATOM   5016 N  NH1 . ARG A 1 737 ? 3.960   63.629  -9.766  1.00 106.68 ? 748  ARG A NH1 1 
ATOM   5017 N  NH2 . ARG A 1 737 ? 5.625   64.155  -8.278  1.00 112.68 ? 748  ARG A NH2 1 
ATOM   5018 N  N   . VAL A 1 738 ? 3.962   61.024  -2.953  1.00 69.52  ? 749  VAL A N   1 
ATOM   5019 C  CA  . VAL A 1 738 ? 5.294   61.280  -2.410  1.00 65.30  ? 749  VAL A CA  1 
ATOM   5020 C  C   . VAL A 1 738 ? 6.321   60.505  -3.228  1.00 69.60  ? 749  VAL A C   1 
ATOM   5021 O  O   . VAL A 1 738 ? 6.070   59.353  -3.612  1.00 77.96  ? 749  VAL A O   1 
ATOM   5022 C  CB  . VAL A 1 738 ? 5.369   60.919  -0.917  1.00 62.59  ? 749  VAL A CB  1 
ATOM   5023 C  CG1 . VAL A 1 738 ? 4.467   61.836  -0.107  1.00 59.23  ? 749  VAL A CG1 1 
ATOM   5024 C  CG2 . VAL A 1 738 ? 4.987   59.463  -0.691  1.00 65.66  ? 749  VAL A CG2 1 
ATOM   5025 N  N   . PRO A 1 739 ? 7.470   61.097  -3.537  1.00 62.69  ? 750  PRO A N   1 
ATOM   5026 C  CA  . PRO A 1 739 ? 8.501   60.377  -4.289  1.00 65.87  ? 750  PRO A CA  1 
ATOM   5027 C  C   . PRO A 1 739 ? 9.204   59.364  -3.405  1.00 74.04  ? 750  PRO A C   1 
ATOM   5028 O  O   . PRO A 1 739 ? 9.080   59.414  -2.172  1.00 80.99  ? 750  PRO A O   1 
ATOM   5029 C  CB  . PRO A 1 739 ? 9.465   61.493  -4.730  1.00 52.32  ? 750  PRO A CB  1 
ATOM   5030 C  CG  . PRO A 1 739 ? 8.723   62.780  -4.496  1.00 63.60  ? 750  PRO A CG  1 
ATOM   5031 C  CD  . PRO A 1 739 ? 7.817   62.512  -3.343  1.00 61.81  ? 750  PRO A CD  1 
ATOM   5032 N  N   . PRO A 1 740 ? 9.939   58.422  -3.992  1.00 82.73  ? 751  PRO A N   1 
ATOM   5033 C  CA  . PRO A 1 740 ? 10.752  57.508  -3.181  1.00 75.18  ? 751  PRO A CA  1 
ATOM   5034 C  C   . PRO A 1 740 ? 11.857  58.260  -2.453  1.00 79.79  ? 751  PRO A C   1 
ATOM   5035 O  O   . PRO A 1 740 ? 12.141  59.430  -2.717  1.00 80.16  ? 751  PRO A O   1 
ATOM   5036 C  CB  . PRO A 1 740 ? 11.324  56.526  -4.208  1.00 65.49  ? 751  PRO A CB  1 
ATOM   5037 C  CG  . PRO A 1 740 ? 10.402  56.618  -5.380  1.00 70.34  ? 751  PRO A CG  1 
ATOM   5038 C  CD  . PRO A 1 740 ? 9.942   58.045  -5.415  1.00 76.23  ? 751  PRO A CD  1 
ATOM   5039 N  N   . ALA A 1 741 ? 12.490  57.554  -1.513  1.00 83.13  ? 752  ALA A N   1 
ATOM   5040 C  CA  . ALA A 1 741 ? 13.554  58.166  -0.725  1.00 87.14  ? 752  ALA A CA  1 
ATOM   5041 C  C   . ALA A 1 741 ? 14.733  58.581  -1.595  1.00 93.24  ? 752  ALA A C   1 
ATOM   5042 O  O   . ALA A 1 741 ? 15.415  59.565  -1.286  1.00 101.45 ? 752  ALA A O   1 
ATOM   5043 C  CB  . ALA A 1 741 ? 14.014  57.207  0.373   1.00 82.20  ? 752  ALA A CB  1 
ATOM   5044 N  N   . GLU A 1 742 ? 14.986  57.854  -2.684  1.00 92.38  ? 753  GLU A N   1 
ATOM   5045 C  CA  . GLU A 1 742 ? 16.097  58.177  -3.569  1.00 93.87  ? 753  GLU A CA  1 
ATOM   5046 C  C   . GLU A 1 742 ? 15.820  59.390  -4.449  1.00 100.32 ? 753  GLU A C   1 
ATOM   5047 O  O   . GLU A 1 742 ? 16.734  59.856  -5.138  1.00 108.25 ? 753  GLU A O   1 
ATOM   5048 C  CB  . GLU A 1 742 ? 16.440  56.969  -4.444  1.00 89.67  ? 753  GLU A CB  1 
ATOM   5049 C  CG  . GLU A 1 742 ? 17.923  56.832  -4.752  1.00 94.74  ? 753  GLU A CG  1 
ATOM   5050 C  CD  . GLU A 1 742 ? 18.229  55.634  -5.628  1.00 99.73  ? 753  GLU A CD  1 
ATOM   5051 O  OE1 . GLU A 1 742 ? 17.318  55.176  -6.349  1.00 99.96  ? 753  GLU A OE1 1 
ATOM   5052 O  OE2 . GLU A 1 742 ? 19.380  55.149  -5.592  1.00 100.90 ? 753  GLU A OE2 1 
ATOM   5053 N  N   . ARG A 1 743 ? 14.586  59.907  -4.447  1.00 93.00  ? 754  ARG A N   1 
ATOM   5054 C  CA  . ARG A 1 743 ? 14.264  61.126  -5.179  1.00 85.00  ? 754  ARG A CA  1 
ATOM   5055 C  C   . ARG A 1 743 ? 13.387  62.066  -4.358  1.00 86.20  ? 754  ARG A C   1 
ATOM   5056 O  O   . ARG A 1 743 ? 12.664  62.887  -4.937  1.00 84.05  ? 754  ARG A O   1 
ATOM   5057 C  CB  . ARG A 1 743 ? 13.567  60.810  -6.507  1.00 76.03  ? 754  ARG A CB  1 
ATOM   5058 C  CG  . ARG A 1 743 ? 14.498  60.321  -7.604  1.00 81.91  ? 754  ARG A CG  1 
ATOM   5059 C  CD  . ARG A 1 743 ? 13.758  60.127  -8.921  1.00 91.91  ? 754  ARG A CD  1 
ATOM   5060 N  NE  . ARG A 1 743 ? 12.878  58.961  -8.900  1.00 108.51 ? 754  ARG A NE  1 
ATOM   5061 C  CZ  . ARG A 1 743 ? 11.571  59.008  -8.661  1.00 113.55 ? 754  ARG A CZ  1 
ATOM   5062 N  NH1 . ARG A 1 743 ? 10.978  60.170  -8.421  1.00 121.57 ? 754  ARG A NH1 1 
ATOM   5063 N  NH2 . ARG A 1 743 ? 10.854  57.892  -8.664  1.00 98.92  ? 754  ARG A NH2 1 
ATOM   5064 N  N   . ARG A 1 744 ? 13.432  61.966  -3.027  1.00 88.78  ? 755  ARG A N   1 
ATOM   5065 C  CA  . ARG A 1 744 ? 12.593  62.810  -2.183  1.00 84.92  ? 755  ARG A CA  1 
ATOM   5066 C  C   . ARG A 1 744 ? 12.964  64.283  -2.308  1.00 91.60  ? 755  ARG A C   1 
ATOM   5067 O  O   . ARG A 1 744 ? 12.106  65.155  -2.128  1.00 92.41  ? 755  ARG A O   1 
ATOM   5068 C  CB  . ARG A 1 744 ? 12.698  62.351  -0.727  1.00 74.32  ? 755  ARG A CB  1 
ATOM   5069 C  CG  . ARG A 1 744 ? 11.765  63.068  0.234   1.00 72.72  ? 755  ARG A CG  1 
ATOM   5070 C  CD  . ARG A 1 744 ? 10.311  62.871  -0.157  1.00 66.36  ? 755  ARG A CD  1 
ATOM   5071 N  NE  . ARG A 1 744 ? 9.404   63.526  0.780   1.00 49.03  ? 755  ARG A NE  1 
ATOM   5072 C  CZ  . ARG A 1 744 ? 9.051   64.805  0.705   1.00 49.64  ? 755  ARG A CZ  1 
ATOM   5073 N  NH1 . ARG A 1 744 ? 9.530   65.572  -0.265  1.00 48.83  ? 755  ARG A NH1 1 
ATOM   5074 N  NH2 . ARG A 1 744 ? 8.219   65.318  1.601   1.00 58.10  ? 755  ARG A NH2 1 
ATOM   5075 N  N   . MET A 1 745 ? 14.223  64.581  -2.623  1.00 97.96  ? 756  MET A N   1 
ATOM   5076 C  CA  . MET A 1 745 ? 14.702  65.949  -2.761  1.00 94.66  ? 756  MET A CA  1 
ATOM   5077 C  C   . MET A 1 745 ? 14.688  66.431  -4.209  1.00 96.42  ? 756  MET A C   1 
ATOM   5078 O  O   . MET A 1 745 ? 15.178  67.527  -4.495  1.00 94.51  ? 756  MET A O   1 
ATOM   5079 C  CB  . MET A 1 745 ? 16.114  66.067  -2.174  1.00 92.70  ? 756  MET A CB  1 
ATOM   5080 C  CG  . MET A 1 745 ? 16.542  67.484  -1.803  1.00 101.78 ? 756  MET A CG  1 
ATOM   5081 S  SD  . MET A 1 745 ? 15.538  68.209  -0.494  1.00 109.20 ? 756  MET A SD  1 
ATOM   5082 C  CE  . MET A 1 745 ? 16.147  67.311  0.930   1.00 110.03 ? 756  MET A CE  1 
ATOM   5083 N  N   . ASP A 1 746 ? 14.126  65.644  -5.129  1.00 103.24 ? 757  ASP A N   1 
ATOM   5084 C  CA  . ASP A 1 746 ? 14.137  65.989  -6.542  1.00 101.91 ? 757  ASP A CA  1 
ATOM   5085 C  C   . ASP A 1 746 ? 12.757  66.193  -7.151  1.00 94.11  ? 757  ASP A C   1 
ATOM   5086 O  O   . ASP A 1 746 ? 12.659  66.858  -8.188  1.00 86.75  ? 757  ASP A O   1 
ATOM   5087 C  CB  . ASP A 1 746 ? 14.880  64.911  -7.348  1.00 109.12 ? 757  ASP A CB  1 
ATOM   5088 C  CG  . ASP A 1 746 ? 16.345  64.809  -6.966  1.00 103.79 ? 757  ASP A CG  1 
ATOM   5089 O  OD1 . ASP A 1 746 ? 16.955  65.857  -6.663  1.00 97.03  ? 757  ASP A OD1 1 
ATOM   5090 O  OD2 . ASP A 1 746 ? 16.885  63.683  -6.964  1.00 98.49  ? 757  ASP A OD2 1 
ATOM   5091 N  N   . GLU A 1 747 ? 11.698  65.650  -6.552  1.00 93.11  ? 758  GLU A N   1 
ATOM   5092 C  CA  . GLU A 1 747 ? 10.355  65.891  -7.046  1.00 108.72 ? 758  GLU A CA  1 
ATOM   5093 C  C   . GLU A 1 747 ? 9.490   66.509  -5.956  1.00 107.49 ? 758  GLU A C   1 
ATOM   5094 O  O   . GLU A 1 747 ? 9.556   66.084  -4.797  1.00 112.57 ? 758  GLU A O   1 
ATOM   5095 C  CB  . GLU A 1 747 ? 9.691   64.596  -7.538  1.00 119.43 ? 758  GLU A CB  1 
ATOM   5096 C  CG  . GLU A 1 747 ? 10.371  63.945  -8.727  1.00 133.73 ? 758  GLU A CG  1 
ATOM   5097 C  CD  . GLU A 1 747 ? 9.443   63.009  -9.477  1.00 146.99 ? 758  GLU A CD  1 
ATOM   5098 O  OE1 . GLU A 1 747 ? 8.383   63.474  -9.948  1.00 151.84 ? 758  GLU A OE1 1 
ATOM   5099 O  OE2 . GLU A 1 747 ? 9.766   61.808  -9.586  1.00 151.85 ? 758  GLU A OE2 1 
ATOM   5100 N  N   . PRO A 1 748 ? 8.678   67.510  -6.288  1.00 107.36 ? 759  PRO A N   1 
ATOM   5101 C  CA  . PRO A 1 748 ? 7.774   68.082  -5.286  1.00 98.66  ? 759  PRO A CA  1 
ATOM   5102 C  C   . PRO A 1 748 ? 6.649   67.119  -4.944  1.00 96.95  ? 759  PRO A C   1 
ATOM   5103 O  O   . PRO A 1 748 ? 6.239   66.288  -5.759  1.00 92.28  ? 759  PRO A O   1 
ATOM   5104 C  CB  . PRO A 1 748 ? 7.233   69.346  -5.970  1.00 94.33  ? 759  PRO A CB  1 
ATOM   5105 C  CG  . PRO A 1 748 ? 8.150   69.596  -7.134  1.00 99.16  ? 759  PRO A CG  1 
ATOM   5106 C  CD  . PRO A 1 748 ? 8.629   68.247  -7.560  1.00 108.93 ? 759  PRO A CD  1 
ATOM   5107 N  N   . VAL A 1 749 ? 6.155   67.236  -3.716  1.00 89.92  ? 760  VAL A N   1 
ATOM   5108 C  CA  . VAL A 1 749 ? 5.006   66.451  -3.277  1.00 82.24  ? 760  VAL A CA  1 
ATOM   5109 C  C   . VAL A 1 749 ? 3.740   67.152  -3.750  1.00 77.74  ? 760  VAL A C   1 
ATOM   5110 O  O   . VAL A 1 749 ? 3.468   68.293  -3.363  1.00 78.97  ? 760  VAL A O   1 
ATOM   5111 C  CB  . VAL A 1 749 ? 5.004   66.270  -1.754  1.00 87.40  ? 760  VAL A CB  1 
ATOM   5112 C  CG1 . VAL A 1 749 ? 3.694   65.646  -1.299  1.00 95.01  ? 760  VAL A CG1 1 
ATOM   5113 C  CG2 . VAL A 1 749 ? 6.182   65.411  -1.323  1.00 88.28  ? 760  VAL A CG2 1 
ATOM   5114 N  N   . ARG A 1 750 ? 2.967   66.473  -4.593  1.00 76.62  ? 761  ARG A N   1 
ATOM   5115 C  CA  . ARG A 1 750 ? 1.760   67.034  -5.182  1.00 77.55  ? 761  ARG A CA  1 
ATOM   5116 C  C   . ARG A 1 750 ? 0.542   66.293  -4.651  1.00 64.02  ? 761  ARG A C   1 
ATOM   5117 O  O   . ARG A 1 750 ? 0.503   65.058  -4.667  1.00 55.25  ? 761  ARG A O   1 
ATOM   5118 C  CB  . ARG A 1 750 ? 1.814   66.957  -6.709  1.00 83.34  ? 761  ARG A CB  1 
ATOM   5119 C  CG  . ARG A 1 750 ? 3.006   67.687  -7.302  1.00 87.75  ? 761  ARG A CG  1 
ATOM   5120 C  CD  . ARG A 1 750 ? 3.216   67.337  -8.764  1.00 101.64 ? 761  ARG A CD  1 
ATOM   5121 N  NE  . ARG A 1 750 ? 4.597   67.581  -9.171  1.00 113.02 ? 761  ARG A NE  1 
ATOM   5122 C  CZ  . ARG A 1 750 ? 5.081   67.315  -10.379 1.00 106.54 ? 761  ARG A CZ  1 
ATOM   5123 N  NH1 . ARG A 1 750 ? 4.295   66.797  -11.313 1.00 100.88 ? 761  ARG A NH1 1 
ATOM   5124 N  NH2 . ARG A 1 750 ? 6.354   67.568  -10.654 1.00 99.04  ? 761  ARG A NH2 1 
ATOM   5125 N  N   . ALA A 1 751 ? -0.443  67.050  -4.180  1.00 61.27  ? 762  ALA A N   1 
ATOM   5126 C  CA  . ALA A 1 751 ? -1.668  66.503  -3.621  1.00 56.65  ? 762  ALA A CA  1 
ATOM   5127 C  C   . ALA A 1 751 ? -2.841  66.787  -4.548  1.00 62.13  ? 762  ALA A C   1 
ATOM   5128 O  O   . ALA A 1 751 ? -2.767  67.629  -5.447  1.00 63.06  ? 762  ALA A O   1 
ATOM   5129 C  CB  . ALA A 1 751 ? -1.946  67.087  -2.232  1.00 57.49  ? 762  ALA A CB  1 
ATOM   5130 N  N   . GLU A 1 752 ? -3.936  66.067  -4.312  1.00 57.19  ? 763  GLU A N   1 
ATOM   5131 C  CA  . GLU A 1 752 ? -5.151  66.240  -5.097  1.00 67.71  ? 763  GLU A CA  1 
ATOM   5132 C  C   . GLU A 1 752 ? -6.319  65.704  -4.286  1.00 70.91  ? 763  GLU A C   1 
ATOM   5133 O  O   . GLU A 1 752 ? -6.248  64.589  -3.761  1.00 68.18  ? 763  GLU A O   1 
ATOM   5134 C  CB  . GLU A 1 752 ? -5.045  65.518  -6.445  1.00 72.00  ? 763  GLU A CB  1 
ATOM   5135 C  CG  . GLU A 1 752 ? -6.181  65.820  -7.407  1.00 86.90  ? 763  GLU A CG  1 
ATOM   5136 C  CD  . GLU A 1 752 ? -5.918  65.284  -8.801  1.00 110.75 ? 763  GLU A CD  1 
ATOM   5137 O  OE1 . GLU A 1 752 ? -4.824  64.724  -9.026  1.00 119.39 ? 763  GLU A OE1 1 
ATOM   5138 O  OE2 . GLU A 1 752 ? -6.802  65.425  -9.671  1.00 117.95 ? 763  GLU A OE2 1 
ATOM   5139 N  N   . GLN A 1 753 ? -7.381  66.499  -4.180  1.00 69.91  ? 764  GLN A N   1 
ATOM   5140 C  CA  . GLN A 1 753 ? -8.531  66.105  -3.378  1.00 61.66  ? 764  GLN A CA  1 
ATOM   5141 C  C   . GLN A 1 753 ? -9.218  64.895  -3.997  1.00 64.17  ? 764  GLN A C   1 
ATOM   5142 O  O   . GLN A 1 753 ? -9.485  64.866  -5.202  1.00 64.22  ? 764  GLN A O   1 
ATOM   5143 C  CB  . GLN A 1 753 ? -9.513  67.269  -3.247  1.00 63.89  ? 764  GLN A CB  1 
ATOM   5144 C  CG  . GLN A 1 753 ? -10.719 66.960  -2.375  1.00 70.81  ? 764  GLN A CG  1 
ATOM   5145 C  CD  . GLN A 1 753 ? -11.468 68.208  -1.952  1.00 80.59  ? 764  GLN A CD  1 
ATOM   5146 O  OE1 . GLN A 1 753 ? -10.961 69.323  -2.077  1.00 88.31  ? 764  GLN A OE1 1 
ATOM   5147 N  NE2 . GLN A 1 753 ? -12.682 68.026  -1.445  1.00 85.20  ? 764  GLN A NE2 1 
ATOM   5148 N  N   . ALA A 1 754 ? -9.500  63.895  -3.167  1.00 63.63  ? 765  ALA A N   1 
ATOM   5149 C  CA  . ALA A 1 754 ? -10.102 62.645  -3.614  1.00 54.90  ? 765  ALA A CA  1 
ATOM   5150 C  C   . ALA A 1 754 ? -11.544 62.471  -3.171  1.00 55.43  ? 765  ALA A C   1 
ATOM   5151 O  O   . ALA A 1 754 ? -12.362 61.971  -3.945  1.00 56.68  ? 765  ALA A O   1 
ATOM   5152 C  CB  . ALA A 1 754 ? -9.277  61.455  -3.114  1.00 53.48  ? 765  ALA A CB  1 
ATOM   5153 N  N   . LYS A 1 755 ? -11.882 62.866  -1.944  1.00 54.65  ? 766  LYS A N   1 
ATOM   5154 C  CA  . LYS A 1 755 ? -13.226 62.675  -1.419  1.00 55.18  ? 766  LYS A CA  1 
ATOM   5155 C  C   . LYS A 1 755 ? -13.633 63.868  -0.567  1.00 73.16  ? 766  LYS A C   1 
ATOM   5156 O  O   . LYS A 1 755 ? -12.798 64.508  0.078   1.00 54.28  ? 766  LYS A O   1 
ATOM   5157 C  CB  . LYS A 1 755 ? -13.333 61.396  -0.576  1.00 57.46  ? 766  LYS A CB  1 
ATOM   5158 C  CG  . LYS A 1 755 ? -13.099 60.107  -1.340  1.00 61.56  ? 766  LYS A CG  1 
ATOM   5159 C  CD  . LYS A 1 755 ? -13.226 58.904  -0.424  1.00 72.37  ? 766  LYS A CD  1 
ATOM   5160 C  CE  . LYS A 1 755 ? -12.869 57.623  -1.152  1.00 67.00  ? 766  LYS A CE  1 
ATOM   5161 N  NZ  . LYS A 1 755 ? -13.754 57.390  -2.326  1.00 62.49  ? 766  LYS A NZ  1 
ATOM   5162 N  N   . GLU A 1 756 ? -14.934 64.155  -0.576  1.00 77.66  ? 767  GLU A N   1 
ATOM   5163 C  CA  . GLU A 1 756 ? -15.555 65.089  0.359   1.00 72.70  ? 767  GLU A CA  1 
ATOM   5164 C  C   . GLU A 1 756 ? -16.765 64.388  0.959   1.00 64.86  ? 767  GLU A C   1 
ATOM   5165 O  O   . GLU A 1 756 ? -17.785 64.216  0.283   1.00 82.38  ? 767  GLU A O   1 
ATOM   5166 C  CB  . GLU A 1 756 ? -15.962 66.395  -0.324  1.00 76.67  ? 767  GLU A CB  1 
ATOM   5167 C  CG  . GLU A 1 756 ? -16.602 67.399  0.626   1.00 77.77  ? 767  GLU A CG  1 
ATOM   5168 C  CD  . GLU A 1 756 ? -17.053 68.669  -0.069  1.00 86.66  ? 767  GLU A CD  1 
ATOM   5169 O  OE1 . GLU A 1 756 ? -17.006 68.716  -1.316  1.00 86.54  ? 767  GLU A OE1 1 
ATOM   5170 O  OE2 . GLU A 1 756 ? -17.455 69.621  0.634   1.00 82.92  ? 767  GLU A OE2 1 
ATOM   5171 N  N   . ILE A 1 757 ? -16.650 63.979  2.218   1.00 55.87  ? 768  ILE A N   1 
ATOM   5172 C  CA  . ILE A 1 757 ? -17.678 63.206  2.903   1.00 66.76  ? 768  ILE A CA  1 
ATOM   5173 C  C   . ILE A 1 757 ? -18.330 64.087  3.958   1.00 85.88  ? 768  ILE A C   1 
ATOM   5174 O  O   . ILE A 1 757 ? -17.642 64.795  4.703   1.00 97.64  ? 768  ILE A O   1 
ATOM   5175 C  CB  . ILE A 1 757 ? -17.085 61.934  3.538   1.00 62.47  ? 768  ILE A CB  1 
ATOM   5176 C  CG1 . ILE A 1 757 ? -16.319 61.130  2.486   1.00 58.23  ? 768  ILE A CG1 1 
ATOM   5177 C  CG2 . ILE A 1 757 ? -18.180 61.088  4.170   1.00 54.73  ? 768  ILE A CG2 1 
ATOM   5178 C  CD1 . ILE A 1 757 ? -15.365 60.118  3.071   1.00 59.76  ? 768  ILE A CD1 1 
ATOM   5179 N  N   . GLN A 1 758 ? -19.659 64.043  4.020   1.00 76.38  ? 769  GLN A N   1 
ATOM   5180 C  CA  . GLN A 1 758 ? -20.433 64.836  4.969   1.00 69.12  ? 769  GLN A CA  1 
ATOM   5181 C  C   . GLN A 1 758 ? -21.320 63.901  5.781   1.00 72.85  ? 769  GLN A C   1 
ATOM   5182 O  O   . GLN A 1 758 ? -22.231 63.271  5.234   1.00 80.79  ? 769  GLN A O   1 
ATOM   5183 C  CB  . GLN A 1 758 ? -21.269 65.892  4.250   1.00 60.79  ? 769  GLN A CB  1 
ATOM   5184 C  CG  . GLN A 1 758 ? -22.208 66.660  5.166   1.00 72.45  ? 769  GLN A CG  1 
ATOM   5185 C  CD  . GLN A 1 758 ? -21.472 67.428  6.247   1.00 60.80  ? 769  GLN A CD  1 
ATOM   5186 O  OE1 . GLN A 1 758 ? -20.376 67.940  6.024   1.00 59.90  ? 769  GLN A OE1 1 
ATOM   5187 N  NE2 . GLN A 1 758 ? -22.073 67.507  7.429   1.00 60.97  ? 769  GLN A NE2 1 
ATOM   5188 N  N   . LEU A 1 759 ? -21.050 63.811  7.081   1.00 77.39  ? 770  LEU A N   1 
ATOM   5189 C  CA  . LEU A 1 759 ? -21.922 63.064  7.976   1.00 80.49  ? 770  LEU A CA  1 
ATOM   5190 C  C   . LEU A 1 759 ? -23.244 63.805  8.135   1.00 86.54  ? 770  LEU A C   1 
ATOM   5191 O  O   . LEU A 1 759 ? -23.264 65.010  8.403   1.00 80.00  ? 770  LEU A O   1 
ATOM   5192 C  CB  . LEU A 1 759 ? -21.245 62.868  9.331   1.00 71.84  ? 770  LEU A CB  1 
ATOM   5193 C  CG  . LEU A 1 759 ? -19.867 62.202  9.293   1.00 62.58  ? 770  LEU A CG  1 
ATOM   5194 C  CD1 . LEU A 1 759 ? -19.186 62.298  10.648  1.00 66.19  ? 770  LEU A CD1 1 
ATOM   5195 C  CD2 . LEU A 1 759 ? -19.980 60.752  8.850   1.00 53.87  ? 770  LEU A CD2 1 
ATOM   5196 N  N   . MET A 1 760 ? -24.353 63.081  7.968   1.00 89.54  ? 771  MET A N   1 
ATOM   5197 C  CA  . MET A 1 760 ? -25.655 63.731  7.866   1.00 88.73  ? 771  MET A CA  1 
ATOM   5198 C  C   . MET A 1 760 ? -26.168 64.259  9.201   1.00 84.82  ? 771  MET A C   1 
ATOM   5199 O  O   . MET A 1 760 ? -27.078 65.094  9.208   1.00 85.21  ? 771  MET A O   1 
ATOM   5200 C  CB  . MET A 1 760 ? -26.669 62.767  7.249   1.00 99.86  ? 771  MET A CB  1 
ATOM   5201 C  CG  . MET A 1 760 ? -26.321 62.375  5.823   1.00 98.50  ? 771  MET A CG  1 
ATOM   5202 S  SD  . MET A 1 760 ? -25.976 63.822  4.802   1.00 93.13  ? 771  MET A SD  1 
ATOM   5203 C  CE  . MET A 1 760 ? -25.271 63.057  3.345   1.00 87.25  ? 771  MET A CE  1 
ATOM   5204 N  N   . HIS A 1 761 ? -25.615 63.799  10.324  1.00 75.06  ? 772  HIS A N   1 
ATOM   5205 C  CA  . HIS A 1 761 ? -25.966 64.375  11.616  1.00 69.47  ? 772  HIS A CA  1 
ATOM   5206 C  C   . HIS A 1 761 ? -25.162 65.629  11.935  1.00 69.61  ? 772  HIS A C   1 
ATOM   5207 O  O   . HIS A 1 761 ? -25.486 66.322  12.906  1.00 62.58  ? 772  HIS A O   1 
ATOM   5208 C  CB  . HIS A 1 761 ? -25.785 63.338  12.729  1.00 61.07  ? 772  HIS A CB  1 
ATOM   5209 C  CG  . HIS A 1 761 ? -24.457 62.648  12.703  1.00 75.07  ? 772  HIS A CG  1 
ATOM   5210 N  ND1 . HIS A 1 761 ? -24.141 61.679  11.775  1.00 91.28  ? 772  HIS A ND1 1 
ATOM   5211 C  CD2 . HIS A 1 761 ? -23.367 62.782  13.493  1.00 76.83  ? 772  HIS A CD2 1 
ATOM   5212 C  CE1 . HIS A 1 761 ? -22.911 61.250  11.991  1.00 86.99  ? 772  HIS A CE1 1 
ATOM   5213 N  NE2 . HIS A 1 761 ? -22.419 61.903  13.029  1.00 77.61  ? 772  HIS A NE2 1 
ATOM   5214 N  N   . ARG A 1 762 ? -24.126 65.925  11.145  1.00 74.18  ? 773  ARG A N   1 
ATOM   5215 C  CA  . ARG A 1 762 ? -23.380 67.183  11.226  1.00 78.96  ? 773  ARG A CA  1 
ATOM   5216 C  C   . ARG A 1 762 ? -22.792 67.411  12.618  1.00 77.29  ? 773  ARG A C   1 
ATOM   5217 O  O   . ARG A 1 762 ? -22.872 68.507  13.176  1.00 78.29  ? 773  ARG A O   1 
ATOM   5218 C  CB  . ARG A 1 762 ? -24.252 68.366  10.797  1.00 75.35  ? 773  ARG A CB  1 
ATOM   5219 C  CG  . ARG A 1 762 ? -24.771 68.247  9.370   1.00 67.12  ? 773  ARG A CG  1 
ATOM   5220 C  CD  . ARG A 1 762 ? -25.470 69.515  8.911   1.00 73.11  ? 773  ARG A CD  1 
ATOM   5221 N  NE  . ARG A 1 762 ? -25.901 69.421  7.518   1.00 83.59  ? 773  ARG A NE  1 
ATOM   5222 C  CZ  . ARG A 1 762 ? -25.133 69.722  6.476   1.00 90.62  ? 773  ARG A CZ  1 
ATOM   5223 N  NH1 . ARG A 1 762 ? -23.889 70.140  6.665   1.00 92.75  ? 773  ARG A NH1 1 
ATOM   5224 N  NH2 . ARG A 1 762 ? -25.608 69.606  5.243   1.00 91.62  ? 773  ARG A NH2 1 
ATOM   5225 N  N   . ALA A 1 763 ? -22.184 66.359  13.184  1.00 73.98  ? 774  ALA A N   1 
ATOM   5226 C  CA  . ALA A 1 763 ? -21.477 66.441  14.451  1.00 78.79  ? 774  ALA A CA  1 
ATOM   5227 C  C   . ALA A 1 763 ? -19.974 66.545  14.214  1.00 73.23  ? 774  ALA A C   1 
ATOM   5228 O  O   . ALA A 1 763 ? -19.461 66.020  13.221  1.00 81.18  ? 774  ALA A O   1 
ATOM   5229 C  CB  . ALA A 1 763 ? -21.773 65.215  15.320  1.00 85.06  ? 774  ALA A CB  1 
ATOM   5230 N  N   . PRO A 1 764 ? -19.247 67.227  15.101  1.00 68.12  ? 775  PRO A N   1 
ATOM   5231 C  CA  . PRO A 1 764 ? -17.804 67.399  14.893  1.00 77.52  ? 775  PRO A CA  1 
ATOM   5232 C  C   . PRO A 1 764 ? -17.073 66.066  14.847  1.00 51.60  ? 775  PRO A C   1 
ATOM   5233 O  O   . PRO A 1 764 ? -17.460 65.095  15.499  1.00 51.34  ? 775  PRO A O   1 
ATOM   5234 C  CB  . PRO A 1 764 ? -17.368 68.232  16.104  1.00 53.09  ? 775  PRO A CB  1 
ATOM   5235 C  CG  . PRO A 1 764 ? -18.605 68.943  16.532  1.00 54.89  ? 775  PRO A CG  1 
ATOM   5236 C  CD  . PRO A 1 764 ? -19.729 67.986  16.267  1.00 55.53  ? 775  PRO A CD  1 
ATOM   5237 N  N   . VAL A 1 765 ? -16.000 66.032  14.063  1.00 50.66  ? 776  VAL A N   1 
ATOM   5238 C  CA  . VAL A 1 765 ? -15.220 64.818  13.847  1.00 49.33  ? 776  VAL A CA  1 
ATOM   5239 C  C   . VAL A 1 765 ? -14.062 64.815  14.840  1.00 58.92  ? 776  VAL A C   1 
ATOM   5240 O  O   . VAL A 1 765 ? -13.144 65.634  14.742  1.00 47.83  ? 776  VAL A O   1 
ATOM   5241 C  CB  . VAL A 1 765 ? -14.713 64.726  12.403  1.00 49.17  ? 776  VAL A CB  1 
ATOM   5242 C  CG1 . VAL A 1 765 ? -13.982 63.412  12.185  1.00 55.94  ? 776  VAL A CG1 1 
ATOM   5243 C  CG2 . VAL A 1 765 ? -15.871 64.873  11.427  1.00 50.58  ? 776  VAL A CG2 1 
ATOM   5244 N  N   . VAL A 1 766 ? -14.102 63.884  15.797  1.00 48.60  ? 777  VAL A N   1 
ATOM   5245 C  CA  . VAL A 1 766 ? -13.058 63.773  16.808  1.00 52.05  ? 777  VAL A CA  1 
ATOM   5246 C  C   . VAL A 1 766 ? -12.082 62.643  16.520  1.00 55.46  ? 777  VAL A C   1 
ATOM   5247 O  O   . VAL A 1 766 ? -11.169 62.407  17.324  1.00 51.89  ? 777  VAL A O   1 
ATOM   5248 C  CB  . VAL A 1 766 ? -13.664 63.599  18.216  1.00 50.42  ? 777  VAL A CB  1 
ATOM   5249 C  CG1 . VAL A 1 766 ? -14.507 64.809  18.584  1.00 52.14  ? 777  VAL A CG1 1 
ATOM   5250 C  CG2 . VAL A 1 766 ? -14.489 62.326  18.283  1.00 49.99  ? 777  VAL A CG2 1 
ATOM   5251 N  N   . GLY A 1 767 ? -12.236 61.942  15.400  1.00 57.77  ? 778  GLY A N   1 
ATOM   5252 C  CA  . GLY A 1 767 ? -11.323 60.864  15.077  1.00 44.58  ? 778  GLY A CA  1 
ATOM   5253 C  C   . GLY A 1 767 ? -11.543 60.225  13.722  1.00 62.89  ? 778  GLY A C   1 
ATOM   5254 O  O   . GLY A 1 767 ? -12.657 59.804  13.393  1.00 59.87  ? 778  GLY A O   1 
ATOM   5255 N  N   . ILE A 1 768 ? -10.481 60.153  12.924  1.00 61.03  ? 779  ILE A N   1 
ATOM   5256 C  CA  . ILE A 1 768 ? -10.474 59.419  11.666  1.00 54.81  ? 779  ILE A CA  1 
ATOM   5257 C  C   . ILE A 1 768 ? -9.457  58.295  11.791  1.00 55.52  ? 779  ILE A C   1 
ATOM   5258 O  O   . ILE A 1 768 ? -8.384  58.481  12.375  1.00 61.36  ? 779  ILE A O   1 
ATOM   5259 C  CB  . ILE A 1 768 ? -10.141 60.332  10.467  1.00 44.76  ? 779  ILE A CB  1 
ATOM   5260 C  CG1 . ILE A 1 768 ? -11.086 61.533  10.430  1.00 54.77  ? 779  ILE A CG1 1 
ATOM   5261 C  CG2 . ILE A 1 768 ? -10.228 59.558  9.160   1.00 45.10  ? 779  ILE A CG2 1 
ATOM   5262 C  CD1 . ILE A 1 768 ? -10.832 62.471  9.270   1.00 60.51  ? 779  ILE A CD1 1 
ATOM   5263 N  N   . LEU A 1 769 ? -9.798  57.127  11.255  1.00 43.72  ? 780  LEU A N   1 
ATOM   5264 C  CA  . LEU A 1 769 ? -8.930  55.965  11.375  1.00 43.16  ? 780  LEU A CA  1 
ATOM   5265 C  C   . LEU A 1 769 ? -9.253  54.994  10.250  1.00 60.36  ? 780  LEU A C   1 
ATOM   5266 O  O   . LEU A 1 769 ? -10.425 54.750  9.956   1.00 65.13  ? 780  LEU A O   1 
ATOM   5267 C  CB  . LEU A 1 769 ? -9.106  55.290  12.741  1.00 42.86  ? 780  LEU A CB  1 
ATOM   5268 C  CG  . LEU A 1 769 ? -8.142  54.167  13.127  1.00 54.45  ? 780  LEU A CG  1 
ATOM   5269 C  CD1 . LEU A 1 769 ? -6.714  54.680  13.192  1.00 57.24  ? 780  LEU A CD1 1 
ATOM   5270 C  CD2 . LEU A 1 769 ? -8.550  53.555  14.457  1.00 42.33  ? 780  LEU A CD2 1 
ATOM   5271 N  N   . VAL A 1 770 ? -8.214  54.452  9.623   1.00 55.97  ? 781  VAL A N   1 
ATOM   5272 C  CA  . VAL A 1 770 ? -8.362  53.476  8.550   1.00 56.88  ? 781  VAL A CA  1 
ATOM   5273 C  C   . VAL A 1 770 ? -7.801  52.143  9.019   1.00 60.08  ? 781  VAL A C   1 
ATOM   5274 O  O   . VAL A 1 770 ? -6.767  52.092  9.695   1.00 50.50  ? 781  VAL A O   1 
ATOM   5275 C  CB  . VAL A 1 770 ? -7.671  53.937  7.254   1.00 54.93  ? 781  VAL A CB  1 
ATOM   5276 C  CG1 . VAL A 1 770 ? -8.420  55.107  6.642   1.00 44.76  ? 781  VAL A CG1 1 
ATOM   5277 C  CG2 . VAL A 1 770 ? -6.231  54.311  7.532   1.00 68.58  ? 781  VAL A CG2 1 
ATOM   5278 N  N   . LEU A 1 771 ? -8.488  51.065  8.660   1.00 57.55  ? 782  LEU A N   1 
ATOM   5279 C  CA  . LEU A 1 771 ? -8.091  49.716  9.024   1.00 44.02  ? 782  LEU A CA  1 
ATOM   5280 C  C   . LEU A 1 771 ? -7.634  48.962  7.783   1.00 56.71  ? 782  LEU A C   1 
ATOM   5281 O  O   . LEU A 1 771 ? -8.020  49.287  6.657   1.00 66.76  ? 782  LEU A O   1 
ATOM   5282 C  CB  . LEU A 1 771 ? -9.248  48.973  9.699   1.00 57.65  ? 782  LEU A CB  1 
ATOM   5283 C  CG  . LEU A 1 771 ? -10.022 49.750  10.767  1.00 67.47  ? 782  LEU A CG  1 
ATOM   5284 C  CD1 . LEU A 1 771 ? -11.203 48.936  11.278  1.00 68.23  ? 782  LEU A CD1 1 
ATOM   5285 C  CD2 . LEU A 1 771 ? -9.111  50.162  11.916  1.00 43.36  ? 782  LEU A CD2 1 
ATOM   5286 N  N   . ASP A 1 772 ? -6.803  47.948  7.996   1.00 64.21  ? 783  ASP A N   1 
ATOM   5287 C  CA  . ASP A 1 772 ? -6.304  47.138  6.894   1.00 57.85  ? 783  ASP A CA  1 
ATOM   5288 C  C   . ASP A 1 772 ? -7.259  45.968  6.650   1.00 59.72  ? 783  ASP A C   1 
ATOM   5289 O  O   . ASP A 1 772 ? -8.407  45.975  7.104   1.00 54.20  ? 783  ASP A O   1 
ATOM   5290 C  CB  . ASP A 1 772 ? -4.869  46.677  7.176   1.00 51.75  ? 783  ASP A CB  1 
ATOM   5291 C  CG  . ASP A 1 772 ? -4.780  45.685  8.325   1.00 55.42  ? 783  ASP A CG  1 
ATOM   5292 O  OD1 . ASP A 1 772 ? -5.694  45.661  9.174   1.00 65.90  ? 783  ASP A OD1 1 
ATOM   5293 O  OD2 . ASP A 1 772 ? -3.783  44.934  8.384   1.00 51.93  ? 783  ASP A OD2 1 
ATOM   5294 N  N   . GLY A 1 773 ? -6.788  44.951  5.925   1.00 65.00  ? 784  GLY A N   1 
ATOM   5295 C  CA  . GLY A 1 773 ? -7.633  43.811  5.618   1.00 61.61  ? 784  GLY A CA  1 
ATOM   5296 C  C   . GLY A 1 773 ? -8.082  43.055  6.851   1.00 56.48  ? 784  GLY A C   1 
ATOM   5297 O  O   . GLY A 1 773 ? -9.198  42.532  6.889   1.00 55.80  ? 784  GLY A O   1 
ATOM   5298 N  N   . HIS A 1 774 ? -7.229  42.989  7.870   1.00 46.49  ? 785  HIS A N   1 
ATOM   5299 C  CA  . HIS A 1 774 ? -7.556  42.339  9.130   1.00 46.35  ? 785  HIS A CA  1 
ATOM   5300 C  C   . HIS A 1 774 ? -8.216  43.282  10.127  1.00 58.22  ? 785  HIS A C   1 
ATOM   5301 O  O   . HIS A 1 774 ? -8.282  42.956  11.317  1.00 61.15  ? 785  HIS A O   1 
ATOM   5302 C  CB  . HIS A 1 774 ? -6.296  41.733  9.751   1.00 46.25  ? 785  HIS A CB  1 
ATOM   5303 C  CG  . HIS A 1 774 ? -5.920  40.403  9.178   1.00 47.17  ? 785  HIS A CG  1 
ATOM   5304 N  ND1 . HIS A 1 774 ? -5.561  40.234  7.858   1.00 47.77  ? 785  HIS A ND1 1 
ATOM   5305 C  CD2 . HIS A 1 774 ? -5.853  39.176  9.747   1.00 47.71  ? 785  HIS A CD2 1 
ATOM   5306 C  CE1 . HIS A 1 774 ? -5.285  38.960  7.639   1.00 49.52  ? 785  HIS A CE1 1 
ATOM   5307 N  NE2 . HIS A 1 774 ? -5.455  38.297  8.769   1.00 51.03  ? 785  HIS A NE2 1 
ATOM   5308 N  N   . SER A 1 775 ? -8.696  44.440  9.669   1.00 53.06  ? 786  SER A N   1 
ATOM   5309 C  CA  . SER A 1 775 ? -9.330  45.451  10.514  1.00 47.97  ? 786  SER A CA  1 
ATOM   5310 C  C   . SER A 1 775 ? -8.395  45.964  11.606  1.00 52.84  ? 786  SER A C   1 
ATOM   5311 O  O   . SER A 1 775 ? -8.853  46.511  12.615  1.00 44.24  ? 786  SER A O   1 
ATOM   5312 C  CB  . SER A 1 775 ? -10.632 44.926  11.130  1.00 51.74  ? 786  SER A CB  1 
ATOM   5313 O  OG  . SER A 1 775 ? -11.535 44.508  10.121  1.00 52.74  ? 786  SER A OG  1 
ATOM   5314 N  N   . VAL A 1 776 ? -7.090  45.796  11.421  1.00 61.64  ? 787  VAL A N   1 
ATOM   5315 C  CA  . VAL A 1 776 ? -6.090  46.326  12.343  1.00 43.46  ? 787  VAL A CA  1 
ATOM   5316 C  C   . VAL A 1 776 ? -5.790  47.760  11.922  1.00 43.04  ? 787  VAL A C   1 
ATOM   5317 O  O   . VAL A 1 776 ? -5.638  48.028  10.721  1.00 63.19  ? 787  VAL A O   1 
ATOM   5318 C  CB  . VAL A 1 776 ? -4.822  45.457  12.347  1.00 43.65  ? 787  VAL A CB  1 
ATOM   5319 C  CG1 . VAL A 1 776 ? -3.776  46.030  13.290  1.00 43.20  ? 787  VAL A CG1 1 
ATOM   5320 C  CG2 . VAL A 1 776 ? -5.163  44.025  12.729  1.00 44.22  ? 787  VAL A CG2 1 
ATOM   5321 N  N   . PRO A 1 777 ? -5.720  48.710  12.855  1.00 42.56  ? 788  PRO A N   1 
ATOM   5322 C  CA  . PRO A 1 777 ? -5.417  50.094  12.471  1.00 44.78  ? 788  PRO A CA  1 
ATOM   5323 C  C   . PRO A 1 777 ? -4.069  50.199  11.774  1.00 57.36  ? 788  PRO A C   1 
ATOM   5324 O  O   . PRO A 1 777 ? -3.123  49.476  12.096  1.00 46.68  ? 788  PRO A O   1 
ATOM   5325 C  CB  . PRO A 1 777 ? -5.419  50.840  13.810  1.00 41.86  ? 788  PRO A CB  1 
ATOM   5326 C  CG  . PRO A 1 777 ? -6.280  50.013  14.699  1.00 42.07  ? 788  PRO A CG  1 
ATOM   5327 C  CD  . PRO A 1 777 ? -6.044  48.590  14.286  1.00 46.22  ? 788  PRO A CD  1 
ATOM   5328 N  N   . LEU A 1 778 ? -3.996  51.104  10.804  1.00 67.11  ? 789  LEU A N   1 
ATOM   5329 C  CA  . LEU A 1 778 ? -2.757  51.306  10.069  1.00 47.40  ? 789  LEU A CA  1 
ATOM   5330 C  C   . LEU A 1 778 ? -1.659  51.761  11.023  1.00 48.22  ? 789  LEU A C   1 
ATOM   5331 O  O   . LEU A 1 778 ? -1.900  52.638  11.865  1.00 50.05  ? 789  LEU A O   1 
ATOM   5332 C  CB  . LEU A 1 778 ? -2.946  52.333  8.954   1.00 42.49  ? 789  LEU A CB  1 
ATOM   5333 C  CG  . LEU A 1 778 ? -3.150  51.759  7.550   1.00 43.18  ? 789  LEU A CG  1 
ATOM   5334 C  CD1 . LEU A 1 778 ? -4.475  51.021  7.449   1.00 43.55  ? 789  LEU A CD1 1 
ATOM   5335 C  CD2 . LEU A 1 778 ? -3.050  52.854  6.497   1.00 70.24  ? 789  LEU A CD2 1 
ATOM   5336 N  N   . PRO A 1 779 ? -0.460  51.193  10.937  1.00 47.90  ? 790  PRO A N   1 
ATOM   5337 C  CA  . PRO A 1 779 ? 0.597   51.547  11.887  1.00 41.85  ? 790  PRO A CA  1 
ATOM   5338 C  C   . PRO A 1 779 ? 1.076   52.977  11.697  1.00 41.61  ? 790  PRO A C   1 
ATOM   5339 O  O   . PRO A 1 779 ? 0.913   53.590  10.639  1.00 41.73  ? 790  PRO A O   1 
ATOM   5340 C  CB  . PRO A 1 779 ? 1.712   50.543  11.570  1.00 60.44  ? 790  PRO A CB  1 
ATOM   5341 C  CG  . PRO A 1 779 ? 1.026   49.427  10.830  1.00 42.78  ? 790  PRO A CG  1 
ATOM   5342 C  CD  . PRO A 1 779 ? -0.059  50.092  10.049  1.00 42.65  ? 790  PRO A CD  1 
ATOM   5343 N  N   . GLU A 1 780 ? 1.676   53.507  12.760  1.00 41.38  ? 791  GLU A N   1 
ATOM   5344 C  CA  . GLU A 1 780 ? 2.230   54.846  12.727  1.00 51.83  ? 791  GLU A CA  1 
ATOM   5345 C  C   . GLU A 1 780 ? 3.429   54.898  11.782  1.00 47.14  ? 791  GLU A C   1 
ATOM   5346 O  O   . GLU A 1 780 ? 3.998   53.862  11.429  1.00 42.02  ? 791  GLU A O   1 
ATOM   5347 C  CB  . GLU A 1 780 ? 2.637   55.279  14.133  1.00 56.01  ? 791  GLU A CB  1 
ATOM   5348 C  CG  . GLU A 1 780 ? 1.467   55.453  15.084  1.00 66.01  ? 791  GLU A CG  1 
ATOM   5349 C  CD  . GLU A 1 780 ? 1.901   55.875  16.473  1.00 92.24  ? 791  GLU A CD  1 
ATOM   5350 O  OE1 . GLU A 1 780 ? 3.102   55.740  16.789  1.00 101.68 ? 791  GLU A OE1 1 
ATOM   5351 O  OE2 . GLU A 1 780 ? 1.042   56.343  17.248  1.00 98.32  ? 791  GLU A OE2 1 
ATOM   5352 N  N   . PRO A 1 781 ? 3.813   56.094  11.335  1.00 41.61  ? 792  PRO A N   1 
ATOM   5353 C  CA  . PRO A 1 781 ? 4.999   56.216  10.479  1.00 42.08  ? 792  PRO A CA  1 
ATOM   5354 C  C   . PRO A 1 781 ? 6.223   55.569  11.110  1.00 43.77  ? 792  PRO A C   1 
ATOM   5355 O  O   . PRO A 1 781 ? 6.502   55.748  12.299  1.00 46.48  ? 792  PRO A O   1 
ATOM   5356 C  CB  . PRO A 1 781 ? 5.169   57.731  10.334  1.00 57.60  ? 792  PRO A CB  1 
ATOM   5357 C  CG  . PRO A 1 781 ? 3.787   58.261  10.452  1.00 41.64  ? 792  PRO A CG  1 
ATOM   5358 C  CD  . PRO A 1 781 ? 3.086   57.372  11.446  1.00 41.34  ? 792  PRO A CD  1 
ATOM   5359 N  N   . LEU A 1 782 ? 6.941   54.790  10.301  1.00 47.97  ? 793  LEU A N   1 
ATOM   5360 C  CA  . LEU A 1 782 ? 8.160   54.066  10.652  1.00 54.87  ? 793  LEU A CA  1 
ATOM   5361 C  C   . LEU A 1 782 ? 7.928   52.947  11.661  1.00 53.86  ? 793  LEU A C   1 
ATOM   5362 O  O   . LEU A 1 782 ? 8.893   52.274  12.041  1.00 54.50  ? 793  LEU A O   1 
ATOM   5363 C  CB  . LEU A 1 782 ? 9.259   54.996  11.187  1.00 46.55  ? 793  LEU A CB  1 
ATOM   5364 C  CG  . LEU A 1 782 ? 9.727   56.084  10.218  1.00 43.98  ? 793  LEU A CG  1 
ATOM   5365 C  CD1 . LEU A 1 782 ? 10.779  56.966  10.866  1.00 64.26  ? 793  LEU A CD1 1 
ATOM   5366 C  CD2 . LEU A 1 782 ? 10.257  55.467  8.933   1.00 44.75  ? 793  LEU A CD2 1 
ATOM   5367 N  N   . GLU A 1 783 ? 6.691   52.718  12.108  1.00 61.24  ? 794  GLU A N   1 
ATOM   5368 C  CA  . GLU A 1 783 ? 6.432   51.574  12.977  1.00 62.93  ? 794  GLU A CA  1 
ATOM   5369 C  C   . GLU A 1 783 ? 6.666   50.265  12.235  1.00 62.10  ? 794  GLU A C   1 
ATOM   5370 O  O   . GLU A 1 783 ? 7.246   49.323  12.788  1.00 57.35  ? 794  GLU A O   1 
ATOM   5371 C  CB  . GLU A 1 783 ? 5.006   51.637  13.527  1.00 67.77  ? 794  GLU A CB  1 
ATOM   5372 C  CG  . GLU A 1 783 ? 4.612   50.428  14.364  1.00 67.49  ? 794  GLU A CG  1 
ATOM   5373 C  CD  . GLU A 1 783 ? 3.322   50.640  15.133  1.00 67.52  ? 794  GLU A CD  1 
ATOM   5374 O  OE1 . GLU A 1 783 ? 2.983   51.808  15.418  1.00 75.33  ? 794  GLU A OE1 1 
ATOM   5375 O  OE2 . GLU A 1 783 ? 2.647   49.640  15.454  1.00 65.57  ? 794  GLU A OE2 1 
ATOM   5376 N  N   . VAL A 1 784 ? 6.229   50.192  10.976  1.00 59.70  ? 795  VAL A N   1 
ATOM   5377 C  CA  . VAL A 1 784 ? 6.517   49.020  10.158  1.00 55.35  ? 795  VAL A CA  1 
ATOM   5378 C  C   . VAL A 1 784 ? 7.999   48.958  9.814   1.00 53.90  ? 795  VAL A C   1 
ATOM   5379 O  O   . VAL A 1 784 ? 8.573   47.867  9.706   1.00 58.12  ? 795  VAL A O   1 
ATOM   5380 C  CB  . VAL A 1 784 ? 5.646   49.029  8.888   1.00 60.90  ? 795  VAL A CB  1 
ATOM   5381 C  CG1 . VAL A 1 784 ? 5.896   47.781  8.055   1.00 72.20  ? 795  VAL A CG1 1 
ATOM   5382 C  CG2 . VAL A 1 784 ? 4.182   49.142  9.255   1.00 52.03  ? 795  VAL A CG2 1 
ATOM   5383 N  N   . ALA A 1 785 ? 8.643   50.117  9.647   1.00 45.50  ? 796  ALA A N   1 
ATOM   5384 C  CA  . ALA A 1 785 ? 10.053  50.142  9.273   1.00 46.41  ? 796  ALA A CA  1 
ATOM   5385 C  C   . ALA A 1 785 ? 10.930  49.462  10.315  1.00 47.02  ? 796  ALA A C   1 
ATOM   5386 O  O   . ALA A 1 785 ? 12.002  48.945  9.981   1.00 53.75  ? 796  ALA A O   1 
ATOM   5387 C  CB  . ALA A 1 785 ? 10.513  51.583  9.057   1.00 46.13  ? 796  ALA A CB  1 
ATOM   5388 N  N   . HIS A 1 786 ? 10.496  49.447  11.573  1.00 56.70  ? 797  HIS A N   1 
ATOM   5389 C  CA  . HIS A 1 786 ? 11.248  48.825  12.654  1.00 47.16  ? 797  HIS A CA  1 
ATOM   5390 C  C   . HIS A 1 786 ? 10.707  47.455  13.042  1.00 72.68  ? 797  HIS A C   1 
ATOM   5391 O  O   . HIS A 1 786 ? 11.282  46.802  13.917  1.00 61.32  ? 797  HIS A O   1 
ATOM   5392 C  CB  . HIS A 1 786 ? 11.268  49.749  13.875  1.00 46.61  ? 797  HIS A CB  1 
ATOM   5393 C  CG  . HIS A 1 786 ? 12.020  51.024  13.651  1.00 54.81  ? 797  HIS A CG  1 
ATOM   5394 N  ND1 . HIS A 1 786 ? 13.192  51.323  14.311  1.00 70.63  ? 797  HIS A ND1 1 
ATOM   5395 C  CD2 . HIS A 1 786 ? 11.773  52.073  12.831  1.00 57.00  ? 797  HIS A CD2 1 
ATOM   5396 C  CE1 . HIS A 1 786 ? 13.631  52.504  13.913  1.00 67.79  ? 797  HIS A CE1 1 
ATOM   5397 N  NE2 . HIS A 1 786 ? 12.788  52.980  13.015  1.00 61.25  ? 797  HIS A NE2 1 
ATOM   5398 N  N   . ASP A 1 787 ? 9.618   47.008  12.415  1.00 47.08  ? 798  ASP A N   1 
ATOM   5399 C  CA  . ASP A 1 787 ? 9.105   45.653  12.636  1.00 47.52  ? 798  ASP A CA  1 
ATOM   5400 C  C   . ASP A 1 787 ? 8.268   45.302  11.400  1.00 47.41  ? 798  ASP A C   1 
ATOM   5401 O  O   . ASP A 1 787 ? 7.067   45.567  11.360  1.00 49.31  ? 798  ASP A O   1 
ATOM   5402 C  CB  . ASP A 1 787 ? 8.293   45.548  13.912  1.00 46.95  ? 798  ASP A CB  1 
ATOM   5403 C  CG  . ASP A 1 787 ? 8.081   44.109  14.354  1.00 47.70  ? 798  ASP A CG  1 
ATOM   5404 O  OD1 . ASP A 1 787 ? 7.959   43.222  13.483  1.00 48.28  ? 798  ASP A OD1 1 
ATOM   5405 O  OD2 . ASP A 1 787 ? 8.040   43.864  15.579  1.00 53.03  ? 798  ASP A OD2 1 
ATOM   5406 N  N   . LEU A 1 788 ? 8.925   44.705  10.404  1.00 48.41  ? 799  LEU A N   1 
ATOM   5407 C  CA  . LEU A 1 788 ? 8.277   44.422  9.130   1.00 48.52  ? 799  LEU A CA  1 
ATOM   5408 C  C   . LEU A 1 788 ? 7.154   43.399  9.241   1.00 59.96  ? 799  LEU A C   1 
ATOM   5409 O  O   . LEU A 1 788 ? 6.374   43.263  8.293   1.00 55.85  ? 799  LEU A O   1 
ATOM   5410 C  CB  . LEU A 1 788 ? 9.317   43.953  8.111   1.00 49.82  ? 799  LEU A CB  1 
ATOM   5411 C  CG  . LEU A 1 788 ? 10.302  45.040  7.673   1.00 49.92  ? 799  LEU A CG  1 
ATOM   5412 C  CD1 . LEU A 1 788 ? 11.325  44.493  6.695   1.00 51.39  ? 799  LEU A CD1 1 
ATOM   5413 C  CD2 . LEU A 1 788 ? 9.555   46.215  7.064   1.00 54.45  ? 799  LEU A CD2 1 
ATOM   5414 N  N   . SER A 1 789 ? 7.047   42.682  10.362  1.00 54.45  ? 800  SER A N   1 
ATOM   5415 C  CA  . SER A 1 789 ? 5.897   41.813  10.571  1.00 56.65  ? 800  SER A CA  1 
ATOM   5416 C  C   . SER A 1 789 ? 4.624   42.596  10.861  1.00 60.76  ? 800  SER A C   1 
ATOM   5417 O  O   . SER A 1 789 ? 3.534   42.015  10.813  1.00 58.46  ? 800  SER A O   1 
ATOM   5418 C  CB  . SER A 1 789 ? 6.171   40.831  11.712  1.00 49.19  ? 800  SER A CB  1 
ATOM   5419 O  OG  . SER A 1 789 ? 6.268   41.504  12.954  1.00 50.63  ? 800  SER A OG  1 
ATOM   5420 N  N   . LYS A 1 790 ? 4.736   43.890  11.162  1.00 46.48  ? 801  LYS A N   1 
ATOM   5421 C  CA  . LYS A 1 790 ? 3.584   44.758  11.362  1.00 58.83  ? 801  LYS A CA  1 
ATOM   5422 C  C   . LYS A 1 790 ? 3.032   45.320  10.059  1.00 65.43  ? 801  LYS A C   1 
ATOM   5423 O  O   . LYS A 1 790 ? 2.168   46.203  10.106  1.00 75.68  ? 801  LYS A O   1 
ATOM   5424 C  CB  . LYS A 1 790 ? 3.945   45.920  12.292  1.00 44.78  ? 801  LYS A CB  1 
ATOM   5425 C  CG  . LYS A 1 790 ? 4.260   45.533  13.724  1.00 44.92  ? 801  LYS A CG  1 
ATOM   5426 C  CD  . LYS A 1 790 ? 4.475   46.783  14.563  1.00 44.29  ? 801  LYS A CD  1 
ATOM   5427 C  CE  . LYS A 1 790 ? 4.839   46.452  15.998  1.00 52.40  ? 801  LYS A CE  1 
ATOM   5428 N  NZ  . LYS A 1 790 ? 5.052   47.689  16.801  1.00 56.75  ? 801  LYS A NZ  1 
ATOM   5429 N  N   . SER A 1 791 ? 3.516   44.850  8.915   1.00 46.05  ? 802  SER A N   1 
ATOM   5430 C  CA  . SER A 1 791 ? 3.061   45.356  7.627   1.00 46.10  ? 802  SER A CA  1 
ATOM   5431 C  C   . SER A 1 791 ? 1.555   45.164  7.493   1.00 56.04  ? 802  SER A C   1 
ATOM   5432 O  O   . SER A 1 791 ? 1.070   44.028  7.613   1.00 46.28  ? 802  SER A O   1 
ATOM   5433 C  CB  . SER A 1 791 ? 3.788   44.648  6.488   1.00 62.00  ? 802  SER A CB  1 
ATOM   5434 O  OG  . SER A 1 791 ? 5.184   44.871  6.563   1.00 76.52  ? 802  SER A OG  1 
ATOM   5435 N  N   . PRO A 1 792 ? 0.787   46.225  7.256   1.00 45.26  ? 803  PRO A N   1 
ATOM   5436 C  CA  . PRO A 1 792 ? -0.672  46.086  7.227   1.00 49.58  ? 803  PRO A CA  1 
ATOM   5437 C  C   . PRO A 1 792 ? -1.133  45.239  6.053   1.00 46.01  ? 803  PRO A C   1 
ATOM   5438 O  O   . PRO A 1 792 ? -0.494  45.189  4.999   1.00 47.48  ? 803  PRO A O   1 
ATOM   5439 C  CB  . PRO A 1 792 ? -1.164  47.532  7.098   1.00 44.54  ? 803  PRO A CB  1 
ATOM   5440 C  CG  . PRO A 1 792 ? -0.028  48.257  6.459   1.00 47.24  ? 803  PRO A CG  1 
ATOM   5441 C  CD  . PRO A 1 792 ? 1.220   47.606  6.984   1.00 44.85  ? 803  PRO A CD  1 
ATOM   5442 N  N   . ASP A 1 793 ? -2.261  44.563  6.255   1.00 49.38  ? 804  ASP A N   1 
ATOM   5443 C  CA  . ASP A 1 793 ? -2.828  43.692  5.232   1.00 56.73  ? 804  ASP A CA  1 
ATOM   5444 C  C   . ASP A 1 793 ? -3.383  44.541  4.096   1.00 58.25  ? 804  ASP A C   1 
ATOM   5445 O  O   . ASP A 1 793 ? -4.415  45.202  4.250   1.00 65.50  ? 804  ASP A O   1 
ATOM   5446 C  CB  . ASP A 1 793 ? -3.916  42.810  5.835   1.00 64.46  ? 804  ASP A CB  1 
ATOM   5447 C  CG  . ASP A 1 793 ? -4.460  41.797  4.846   1.00 68.46  ? 804  ASP A CG  1 
ATOM   5448 O  OD1 . ASP A 1 793 ? -3.816  41.582  3.797   1.00 69.67  ? 804  ASP A OD1 1 
ATOM   5449 O  OD2 . ASP A 1 793 ? -5.533  41.218  5.116   1.00 60.70  ? 804  ASP A OD2 1 
ATOM   5450 N  N   . MET A 1 794 ? -2.698  44.528  2.954   1.00 60.05  ? 805  MET A N   1 
ATOM   5451 C  CA  . MET A 1 794 ? -3.182  45.228  1.773   1.00 61.45  ? 805  MET A CA  1 
ATOM   5452 C  C   . MET A 1 794 ? -4.061  44.354  0.890   1.00 57.67  ? 805  MET A C   1 
ATOM   5453 O  O   . MET A 1 794 ? -4.786  44.886  0.042   1.00 57.56  ? 805  MET A O   1 
ATOM   5454 C  CB  . MET A 1 794 ? -2.004  45.766  0.955   1.00 48.89  ? 805  MET A CB  1 
ATOM   5455 C  CG  . MET A 1 794 ? -1.159  46.789  1.696   1.00 47.95  ? 805  MET A CG  1 
ATOM   5456 S  SD  . MET A 1 794 ? -2.146  48.145  2.358   1.00 50.90  ? 805  MET A SD  1 
ATOM   5457 C  CE  . MET A 1 794 ? -0.868  49.218  3.010   1.00 65.59  ? 805  MET A CE  1 
ATOM   5458 N  N   . GLN A 1 795 ? -4.012  43.035  1.067   1.00 55.05  ? 806  GLN A N   1 
ATOM   5459 C  CA  . GLN A 1 795 ? -4.910  42.118  0.373   1.00 64.34  ? 806  GLN A CA  1 
ATOM   5460 C  C   . GLN A 1 795 ? -6.175  41.974  1.210   1.00 76.81  ? 806  GLN A C   1 
ATOM   5461 O  O   . GLN A 1 795 ? -6.157  41.349  2.275   1.00 103.86 ? 806  GLN A O   1 
ATOM   5462 C  CB  . GLN A 1 795 ? -4.245  40.764  0.147   1.00 68.50  ? 806  GLN A CB  1 
ATOM   5463 C  CG  . GLN A 1 795 ? -5.143  39.755  -0.550  1.00 82.08  ? 806  GLN A CG  1 
ATOM   5464 C  CD  . GLN A 1 795 ? -4.573  38.351  -0.530  1.00 95.58  ? 806  GLN A CD  1 
ATOM   5465 O  OE1 . GLN A 1 795 ? -3.649  38.055  0.227   1.00 98.47  ? 806  GLN A OE1 1 
ATOM   5466 N  NE2 . GLN A 1 795 ? -5.123  37.478  -1.366  1.00 100.09 ? 806  GLN A NE2 1 
ATOM   5467 N  N   . GLY A 1 796 ? -7.271  42.548  0.730   1.00 71.94  ? 807  GLY A N   1 
ATOM   5468 C  CA  . GLY A 1 796 ? -8.489  42.573  1.535   1.00 74.32  ? 807  GLY A CA  1 
ATOM   5469 C  C   . GLY A 1 796 ? -8.889  44.024  1.711   1.00 64.17  ? 807  GLY A C   1 
ATOM   5470 O  O   . GLY A 1 796 ? -8.073  44.889  2.026   1.00 49.29  ? 807  GLY A O   1 
ATOM   5471 N  N   . SER A 1 797 ? -10.177 44.288  1.501   1.00 70.26  ? 808  SER A N   1 
ATOM   5472 C  CA  . SER A 1 797 ? -10.672 45.658  1.467   1.00 60.92  ? 808  SER A CA  1 
ATOM   5473 C  C   . SER A 1 797 ? -10.417 46.368  2.790   1.00 54.35  ? 808  SER A C   1 
ATOM   5474 O  O   . SER A 1 797 ? -10.688 45.827  3.866   1.00 54.92  ? 808  SER A O   1 
ATOM   5475 C  CB  . SER A 1 797 ? -12.166 45.665  1.143   1.00 67.61  ? 808  SER A CB  1 
ATOM   5476 O  OG  . SER A 1 797 ? -12.423 45.018  -0.092  1.00 73.50  ? 808  SER A OG  1 
ATOM   5477 N  N   . HIS A 1 798 ? -9.881  47.582  2.702   1.00 48.60  ? 809  HIS A N   1 
ATOM   5478 C  CA  . HIS A 1 798 ? -9.687  48.409  3.880   1.00 47.53  ? 809  HIS A CA  1 
ATOM   5479 C  C   . HIS A 1 798 ? -11.023 48.977  4.355   1.00 66.54  ? 809  HIS A C   1 
ATOM   5480 O  O   . HIS A 1 798 ? -12.044 48.910  3.664   1.00 76.69  ? 809  HIS A O   1 
ATOM   5481 C  CB  . HIS A 1 798 ? -8.705  49.543  3.585   1.00 63.51  ? 809  HIS A CB  1 
ATOM   5482 C  CG  . HIS A 1 798 ? -7.269  49.120  3.604   1.00 72.30  ? 809  HIS A CG  1 
ATOM   5483 N  ND1 . HIS A 1 798 ? -6.231  50.020  3.705   1.00 46.15  ? 809  HIS A ND1 1 
ATOM   5484 C  CD2 . HIS A 1 798 ? -6.698  47.894  3.536   1.00 75.06  ? 809  HIS A CD2 1 
ATOM   5485 C  CE1 . HIS A 1 798 ? -5.082  49.367  3.700   1.00 46.04  ? 809  HIS A CE1 1 
ATOM   5486 N  NE2 . HIS A 1 798 ? -5.338  48.076  3.598   1.00 46.51  ? 809  HIS A NE2 1 
ATOM   5487 N  N   . GLN A 1 799 ? -11.007 49.542  5.558   1.00 55.59  ? 810  GLN A N   1 
ATOM   5488 C  CA  . GLN A 1 799 ? -12.188 50.153  6.147   1.00 55.21  ? 810  GLN A CA  1 
ATOM   5489 C  C   . GLN A 1 799 ? -11.835 51.527  6.695   1.00 54.56  ? 810  GLN A C   1 
ATOM   5490 O  O   . GLN A 1 799 ? -10.721 51.755  7.173   1.00 63.82  ? 810  GLN A O   1 
ATOM   5491 C  CB  . GLN A 1 799 ? -12.780 49.284  7.265   1.00 46.96  ? 810  GLN A CB  1 
ATOM   5492 C  CG  . GLN A 1 799 ? -13.204 47.898  6.814   1.00 60.57  ? 810  GLN A CG  1 
ATOM   5493 C  CD  . GLN A 1 799 ? -12.387 46.802  7.465   1.00 70.91  ? 810  GLN A CD  1 
ATOM   5494 O  OE1 . GLN A 1 799 ? -12.163 46.815  8.675   1.00 73.29  ? 810  GLN A OE1 1 
ATOM   5495 N  NE2 . GLN A 1 799 ? -11.930 45.848  6.661   1.00 73.67  ? 810  GLN A NE2 1 
ATOM   5496 N  N   . LEU A 1 800 ? -12.796 52.441  6.616   1.00 54.42  ? 811  LEU A N   1 
ATOM   5497 C  CA  . LEU A 1 800 ? -12.656 53.787  7.152   1.00 46.72  ? 811  LEU A CA  1 
ATOM   5498 C  C   . LEU A 1 800 ? -13.505 53.917  8.408   1.00 59.04  ? 811  LEU A C   1 
ATOM   5499 O  O   . LEU A 1 800 ? -14.709 53.642  8.378   1.00 78.42  ? 811  LEU A O   1 
ATOM   5500 C  CB  . LEU A 1 800 ? -13.075 54.839  6.124   1.00 47.60  ? 811  LEU A CB  1 
ATOM   5501 C  CG  . LEU A 1 800 ? -13.125 56.273  6.654   1.00 47.51  ? 811  LEU A CG  1 
ATOM   5502 C  CD1 . LEU A 1 800 ? -11.723 56.799  6.919   1.00 46.52  ? 811  LEU A CD1 1 
ATOM   5503 C  CD2 . LEU A 1 800 ? -13.880 57.183  5.698   1.00 48.74  ? 811  LEU A CD2 1 
ATOM   5504 N  N   . LEU A 1 801 ? -12.879 54.332  9.503   1.00 49.77  ? 812  LEU A N   1 
ATOM   5505 C  CA  . LEU A 1 801 ? -13.554 54.520  10.781  1.00 45.82  ? 812  LEU A CA  1 
ATOM   5506 C  C   . LEU A 1 801 ? -13.623 56.009  11.087  1.00 45.93  ? 812  LEU A C   1 
ATOM   5507 O  O   . LEU A 1 801 ? -12.587 56.663  11.245  1.00 45.28  ? 812  LEU A O   1 
ATOM   5508 C  CB  . LEU A 1 801 ? -12.827 53.778  11.902  1.00 57.02  ? 812  LEU A CB  1 
ATOM   5509 C  CG  . LEU A 1 801 ? -13.247 54.145  13.327  1.00 60.92  ? 812  LEU A CG  1 
ATOM   5510 C  CD1 . LEU A 1 801 ? -14.691 53.744  13.592  1.00 66.23  ? 812  LEU A CD1 1 
ATOM   5511 C  CD2 . LEU A 1 801 ? -12.310 53.509  14.339  1.00 44.13  ? 812  LEU A CD2 1 
ATOM   5512 N  N   . VAL A 1 802 ? -14.839 56.538  11.167  1.00 58.91  ? 813  VAL A N   1 
ATOM   5513 C  CA  . VAL A 1 802 ? -15.074 57.932  11.523  1.00 62.07  ? 813  VAL A CA  1 
ATOM   5514 C  C   . VAL A 1 802 ? -15.717 57.959  12.900  1.00 47.39  ? 813  VAL A C   1 
ATOM   5515 O  O   . VAL A 1 802 ? -16.754 57.322  13.124  1.00 51.13  ? 813  VAL A O   1 
ATOM   5516 C  CB  . VAL A 1 802 ? -15.957 58.645  10.489  1.00 62.56  ? 813  VAL A CB  1 
ATOM   5517 C  CG1 . VAL A 1 802 ? -16.281 60.053  10.962  1.00 49.05  ? 813  VAL A CG1 1 
ATOM   5518 C  CG2 . VAL A 1 802 ? -15.266 58.674  9.134   1.00 51.48  ? 813  VAL A CG2 1 
ATOM   5519 N  N   . VAL A 1 803 ? -15.099 58.688  13.823  1.00 46.87  ? 814  VAL A N   1 
ATOM   5520 C  CA  . VAL A 1 803 ? -15.615 58.865  15.174  1.00 51.99  ? 814  VAL A CA  1 
ATOM   5521 C  C   . VAL A 1 803 ? -16.002 60.328  15.321  1.00 52.04  ? 814  VAL A C   1 
ATOM   5522 O  O   . VAL A 1 803 ? -15.138 61.214  15.302  1.00 47.46  ? 814  VAL A O   1 
ATOM   5523 C  CB  . VAL A 1 803 ? -14.589 58.452  16.238  1.00 51.47  ? 814  VAL A CB  1 
ATOM   5524 C  CG1 . VAL A 1 803 ? -15.140 58.715  17.631  1.00 50.44  ? 814  VAL A CG1 1 
ATOM   5525 C  CG2 . VAL A 1 803 ? -14.210 56.988  16.071  1.00 45.50  ? 814  VAL A CG2 1 
ATOM   5526 N  N   . SER A 1 804 ? -17.298 60.588  15.458  1.00 70.43  ? 815  SER A N   1 
ATOM   5527 C  CA  . SER A 1 804 ? -17.800 61.934  15.664  1.00 73.82  ? 815  SER A CA  1 
ATOM   5528 C  C   . SER A 1 804 ? -18.114 62.144  17.142  1.00 73.41  ? 815  SER A C   1 
ATOM   5529 O  O   . SER A 1 804 ? -17.943 61.252  17.976  1.00 86.07  ? 815  SER A O   1 
ATOM   5530 C  CB  . SER A 1 804 ? -19.035 62.189  14.797  1.00 71.47  ? 815  SER A CB  1 
ATOM   5531 O  OG  . SER A 1 804 ? -20.145 61.435  15.253  1.00 74.98  ? 815  SER A OG  1 
ATOM   5532 N  N   . GLU A 1 805 ? -18.582 63.349  17.469  1.00 73.93  ? 816  GLU A N   1 
ATOM   5533 C  CA  . GLU A 1 805 ? -18.990 63.632  18.838  1.00 76.24  ? 816  GLU A CA  1 
ATOM   5534 C  C   . GLU A 1 805 ? -20.256 62.884  19.231  1.00 52.95  ? 816  GLU A C   1 
ATOM   5535 O  O   . GLU A 1 805 ? -20.546 62.772  20.426  1.00 53.29  ? 816  GLU A O   1 
ATOM   5536 C  CB  . GLU A 1 805 ? -19.203 65.135  19.032  1.00 68.54  ? 816  GLU A CB  1 
ATOM   5537 C  CG  . GLU A 1 805 ? -18.073 65.843  19.761  1.00 72.91  ? 816  GLU A CG  1 
ATOM   5538 C  CD  . GLU A 1 805 ? -18.421 67.276  20.118  1.00 78.48  ? 816  GLU A CD  1 
ATOM   5539 O  OE1 . GLU A 1 805 ? -19.426 67.794  19.587  1.00 71.23  ? 816  GLU A OE1 1 
ATOM   5540 O  OE2 . GLU A 1 805 ? -17.694 67.882  20.933  1.00 83.02  ? 816  GLU A OE2 1 
ATOM   5541 N  N   . GLU A 1 806 ? -21.008 62.365  18.264  1.00 59.64  ? 817  GLU A N   1 
ATOM   5542 C  CA  . GLU A 1 806 ? -22.295 61.740  18.545  1.00 62.89  ? 817  GLU A CA  1 
ATOM   5543 C  C   . GLU A 1 806 ? -22.339 60.252  18.245  1.00 54.08  ? 817  GLU A C   1 
ATOM   5544 O  O   . GLU A 1 806 ? -22.989 59.505  18.980  1.00 54.52  ? 817  GLU A O   1 
ATOM   5545 C  CB  . GLU A 1 806 ? -23.410 62.444  17.758  1.00 74.27  ? 817  GLU A CB  1 
ATOM   5546 C  CG  . GLU A 1 806 ? -23.760 63.829  18.276  1.00 72.87  ? 817  GLU A CG  1 
ATOM   5547 C  CD  . GLU A 1 806 ? -24.981 64.412  17.593  1.00 75.23  ? 817  GLU A CD  1 
ATOM   5548 O  OE1 . GLU A 1 806 ? -25.618 63.689  16.798  1.00 77.27  ? 817  GLU A OE1 1 
ATOM   5549 O  OE2 . GLU A 1 806 ? -25.304 65.590  17.852  1.00 75.09  ? 817  GLU A OE2 1 
ATOM   5550 N  N   . GLN A 1 807 ? -21.675 59.790  17.188  1.00 53.16  ? 818  GLN A N   1 
ATOM   5551 C  CA  . GLN A 1 807 ? -21.822 58.400  16.783  1.00 67.73  ? 818  GLN A CA  1 
ATOM   5552 C  C   . GLN A 1 807 ? -20.564 57.918  16.074  1.00 65.40  ? 818  GLN A C   1 
ATOM   5553 O  O   . GLN A 1 807 ? -19.706 58.705  15.666  1.00 69.46  ? 818  GLN A O   1 
ATOM   5554 C  CB  . GLN A 1 807 ? -23.053 58.220  15.890  1.00 71.23  ? 818  GLN A CB  1 
ATOM   5555 C  CG  . GLN A 1 807 ? -23.126 59.198  14.736  1.00 91.77  ? 818  GLN A CG  1 
ATOM   5556 C  CD  . GLN A 1 807 ? -24.463 59.161  14.026  1.00 95.10  ? 818  GLN A CD  1 
ATOM   5557 O  OE1 . GLN A 1 807 ? -24.565 58.689  12.894  1.00 96.65  ? 818  GLN A OE1 1 
ATOM   5558 N  NE2 . GLN A 1 807 ? -25.499 59.667  14.686  1.00 86.26  ? 818  GLN A NE2 1 
ATOM   5559 N  N   . PHE A 1 808 ? -20.472 56.598  15.937  1.00 64.49  ? 819  PHE A N   1 
ATOM   5560 C  CA  . PHE A 1 808 ? -19.372 55.926  15.261  1.00 65.68  ? 819  PHE A CA  1 
ATOM   5561 C  C   . PHE A 1 808 ? -19.883 55.360  13.944  1.00 64.12  ? 819  PHE A C   1 
ATOM   5562 O  O   . PHE A 1 808 ? -20.938 54.719  13.912  1.00 75.44  ? 819  PHE A O   1 
ATOM   5563 C  CB  . PHE A 1 808 ? -18.800 54.795  16.123  1.00 70.39  ? 819  PHE A CB  1 
ATOM   5564 C  CG  . PHE A 1 808 ? -18.211 55.253  17.430  1.00 79.67  ? 819  PHE A CG  1 
ATOM   5565 C  CD1 . PHE A 1 808 ? -16.843 55.226  17.632  1.00 82.24  ? 819  PHE A CD1 1 
ATOM   5566 C  CD2 . PHE A 1 808 ? -19.025 55.694  18.462  1.00 83.59  ? 819  PHE A CD2 1 
ATOM   5567 C  CE1 . PHE A 1 808 ? -16.296 55.638  18.833  1.00 84.69  ? 819  PHE A CE1 1 
ATOM   5568 C  CE2 . PHE A 1 808 ? -18.483 56.110  19.663  1.00 85.87  ? 819  PHE A CE2 1 
ATOM   5569 C  CZ  . PHE A 1 808 ? -17.118 56.082  19.848  1.00 80.48  ? 819  PHE A CZ  1 
ATOM   5570 N  N   . LYS A 1 809 ? -19.140 55.590  12.865  1.00 49.92  ? 820  LYS A N   1 
ATOM   5571 C  CA  . LYS A 1 809 ? -19.511 55.077  11.554  1.00 50.57  ? 820  LYS A CA  1 
ATOM   5572 C  C   . LYS A 1 809 ? -18.295 54.440  10.896  1.00 49.53  ? 820  LYS A C   1 
ATOM   5573 O  O   . LYS A 1 809 ? -17.183 54.970  10.980  1.00 48.59  ? 820  LYS A O   1 
ATOM   5574 C  CB  . LYS A 1 809 ? -20.090 56.188  10.662  1.00 85.55  ? 820  LYS A CB  1 
ATOM   5575 C  CG  . LYS A 1 809 ? -21.154 55.703  9.683   1.00 76.02  ? 820  LYS A CG  1 
ATOM   5576 C  CD  . LYS A 1 809 ? -21.879 56.858  8.999   1.00 89.60  ? 820  LYS A CD  1 
ATOM   5577 C  CE  . LYS A 1 809 ? -22.648 57.719  9.992   1.00 92.38  ? 820  LYS A CE  1 
ATOM   5578 N  NZ  . LYS A 1 809 ? -23.549 58.695  9.307   1.00 77.83  ? 820  LYS A NZ  1 
ATOM   5579 N  N   . VAL A 1 810 ? -18.514 53.295  10.253  1.00 60.10  ? 821  VAL A N   1 
ATOM   5580 C  CA  . VAL A 1 810 ? -17.460 52.529  9.597   1.00 59.30  ? 821  VAL A CA  1 
ATOM   5581 C  C   . VAL A 1 810 ? -17.802 52.408  8.119   1.00 55.85  ? 821  VAL A C   1 
ATOM   5582 O  O   . VAL A 1 810 ? -18.938 52.068  7.766   1.00 61.32  ? 821  VAL A O   1 
ATOM   5583 C  CB  . VAL A 1 810 ? -17.287 51.138  10.236  1.00 54.36  ? 821  VAL A CB  1 
ATOM   5584 C  CG1 . VAL A 1 810 ? -16.351 50.275  9.402   1.00 48.26  ? 821  VAL A CG1 1 
ATOM   5585 C  CG2 . VAL A 1 810 ? -16.762 51.271  11.655  1.00 47.74  ? 821  VAL A CG2 1 
ATOM   5586 N  N   . PHE A 1 811 ? -16.824 52.683  7.262   1.00 53.25  ? 822  PHE A N   1 
ATOM   5587 C  CA  . PHE A 1 811 ? -16.995 52.663  5.815   1.00 57.39  ? 822  PHE A CA  1 
ATOM   5588 C  C   . PHE A 1 811 ? -16.079 51.609  5.200   1.00 61.13  ? 822  PHE A C   1 
ATOM   5589 O  O   . PHE A 1 811 ? -15.286 50.961  5.887   1.00 49.56  ? 822  PHE A O   1 
ATOM   5590 C  CB  . PHE A 1 811 ? -16.720 54.045  5.218   1.00 54.86  ? 822  PHE A CB  1 
ATOM   5591 C  CG  . PHE A 1 811 ? -17.613 55.124  5.756   1.00 51.45  ? 822  PHE A CG  1 
ATOM   5592 C  CD1 . PHE A 1 811 ? -17.266 55.821  6.902   1.00 53.29  ? 822  PHE A CD1 1 
ATOM   5593 C  CD2 . PHE A 1 811 ? -18.799 55.442  5.117   1.00 56.20  ? 822  PHE A CD2 1 
ATOM   5594 C  CE1 . PHE A 1 811 ? -18.087 56.813  7.401   1.00 54.78  ? 822  PHE A CE1 1 
ATOM   5595 C  CE2 . PHE A 1 811 ? -19.623 56.433  5.610   1.00 70.89  ? 822  PHE A CE2 1 
ATOM   5596 C  CZ  . PHE A 1 811 ? -19.265 57.121  6.753   1.00 67.78  ? 822  PHE A CZ  1 
ATOM   5597 N  N   . THR A 1 812 ? -16.195 51.444  3.883   1.00 60.56  ? 823  THR A N   1 
ATOM   5598 C  CA  . THR A 1 812 ? -15.428 50.454  3.132   1.00 65.85  ? 823  THR A CA  1 
ATOM   5599 C  C   . THR A 1 812 ? -14.677 51.166  2.016   1.00 64.06  ? 823  THR A C   1 
ATOM   5600 O  O   . THR A 1 812 ? -15.286 51.615  1.040   1.00 79.22  ? 823  THR A O   1 
ATOM   5601 C  CB  . THR A 1 812 ? -16.339 49.367  2.561   1.00 72.06  ? 823  THR A CB  1 
ATOM   5602 O  OG1 . THR A 1 812 ? -17.152 48.822  3.606   1.00 93.29  ? 823  THR A OG1 1 
ATOM   5603 C  CG2 . THR A 1 812 ? -15.510 48.251  1.940   1.00 66.75  ? 823  THR A CG2 1 
ATOM   5604 N  N   . LEU A 1 813 ? -13.360 51.262  2.157   1.00 58.97  ? 824  LEU A N   1 
ATOM   5605 C  CA  . LEU A 1 813 ? -12.538 51.871  1.126   1.00 53.81  ? 824  LEU A CA  1 
ATOM   5606 C  C   . LEU A 1 813 ? -12.333 50.898  -0.035  1.00 53.60  ? 824  LEU A C   1 
ATOM   5607 O  O   . LEU A 1 813 ? -12.281 49.682  0.168   1.00 55.72  ? 824  LEU A O   1 
ATOM   5608 C  CB  . LEU A 1 813 ? -11.190 52.287  1.705   1.00 49.29  ? 824  LEU A CB  1 
ATOM   5609 C  CG  . LEU A 1 813 ? -11.268 53.392  2.759   1.00 48.54  ? 824  LEU A CG  1 
ATOM   5610 C  CD1 . LEU A 1 813 ? -9.933  53.574  3.460   1.00 61.16  ? 824  LEU A CD1 1 
ATOM   5611 C  CD2 . LEU A 1 813 ? -11.723 54.696  2.121   1.00 49.31  ? 824  LEU A CD2 1 
ATOM   5612 N  N   . PRO A 1 814 ? -12.206 51.409  -1.272  1.00 58.89  ? 825  PRO A N   1 
ATOM   5613 C  CA  . PRO A 1 814 ? -12.185 52.829  -1.638  1.00 68.26  ? 825  PRO A CA  1 
ATOM   5614 C  C   . PRO A 1 814 ? -13.564 53.449  -1.859  1.00 60.63  ? 825  PRO A C   1 
ATOM   5615 O  O   . PRO A 1 814 ? -13.676 54.673  -1.897  1.00 54.03  ? 825  PRO A O   1 
ATOM   5616 C  CB  . PRO A 1 814 ? -11.394 52.826  -2.944  1.00 70.83  ? 825  PRO A CB  1 
ATOM   5617 C  CG  . PRO A 1 814 ? -11.772 51.531  -3.574  1.00 62.51  ? 825  PRO A CG  1 
ATOM   5618 C  CD  . PRO A 1 814 ? -11.952 50.546  -2.440  1.00 56.64  ? 825  PRO A CD  1 
ATOM   5619 N  N   . LYS A 1 815 ? -14.597 52.617  -2.000  1.00 60.45  ? 826  LYS A N   1 
ATOM   5620 C  CA  . LYS A 1 815 ? -15.926 53.113  -2.339  1.00 61.70  ? 826  LYS A CA  1 
ATOM   5621 C  C   . LYS A 1 815 ? -16.600 53.859  -1.193  1.00 69.43  ? 826  LYS A C   1 
ATOM   5622 O  O   . LYS A 1 815 ? -17.685 54.412  -1.403  1.00 76.50  ? 826  LYS A O   1 
ATOM   5623 C  CB  . LYS A 1 815 ? -16.807 51.950  -2.797  1.00 76.50  ? 826  LYS A CB  1 
ATOM   5624 C  CG  . LYS A 1 815 ? -16.229 51.177  -3.974  1.00 86.46  ? 826  LYS A CG  1 
ATOM   5625 C  CD  . LYS A 1 815 ? -17.005 49.899  -4.243  1.00 95.85  ? 826  LYS A CD  1 
ATOM   5626 C  CE  . LYS A 1 815 ? -16.344 49.076  -5.338  1.00 87.23  ? 826  LYS A CE  1 
ATOM   5627 N  NZ  . LYS A 1 815 ? -17.045 47.782  -5.561  1.00 77.62  ? 826  LYS A NZ  1 
ATOM   5628 N  N   . VAL A 1 816 ? -15.978 53.891  -0.009  1.00 83.08  ? 827  VAL A N   1 
ATOM   5629 C  CA  . VAL A 1 816 ? -16.449 54.581  1.195   1.00 78.51  ? 827  VAL A CA  1 
ATOM   5630 C  C   . VAL A 1 816 ? -17.961 54.425  1.374   1.00 78.35  ? 827  VAL A C   1 
ATOM   5631 O  O   . VAL A 1 816 ? -18.691 55.397  1.602   1.00 71.38  ? 827  VAL A O   1 
ATOM   5632 C  CB  . VAL A 1 816 ? -15.991 56.061  1.195   1.00 83.81  ? 827  VAL A CB  1 
ATOM   5633 C  CG1 . VAL A 1 816 ? -16.659 56.910  0.097   1.00 82.64  ? 827  VAL A CG1 1 
ATOM   5634 C  CG2 . VAL A 1 816 ? -16.149 56.686  2.584   1.00 83.20  ? 827  VAL A CG2 1 
ATOM   5635 N  N   . SER A 1 817 ? -18.437 53.186  1.295   1.00 92.46  ? 828  SER A N   1 
ATOM   5636 C  CA  . SER A 1 817 ? -19.838 52.880  1.546   1.00 87.69  ? 828  SER A CA  1 
ATOM   5637 C  C   . SER A 1 817 ? -20.028 52.451  2.996   1.00 86.94  ? 828  SER A C   1 
ATOM   5638 O  O   . SER A 1 817 ? -19.225 51.688  3.541   1.00 88.23  ? 828  SER A O   1 
ATOM   5639 C  CB  . SER A 1 817 ? -20.329 51.784  0.599   1.00 85.77  ? 828  SER A CB  1 
ATOM   5640 O  OG  . SER A 1 817 ? -19.416 50.702  0.554   1.00 86.57  ? 828  SER A OG  1 
ATOM   5641 N  N   . ALA A 1 818 ? -21.095 52.951  3.617   1.00 81.83  ? 829  ALA A N   1 
ATOM   5642 C  CA  . ALA A 1 818 ? -21.343 52.682  5.027   1.00 73.20  ? 829  ALA A CA  1 
ATOM   5643 C  C   . ALA A 1 818 ? -21.673 51.211  5.254   1.00 67.40  ? 829  ALA A C   1 
ATOM   5644 O  O   . ALA A 1 818 ? -22.181 50.519  4.368   1.00 65.45  ? 829  ALA A O   1 
ATOM   5645 C  CB  . ALA A 1 818 ? -22.482 53.559  5.545   1.00 72.43  ? 829  ALA A CB  1 
ATOM   5646 N  N   . LYS A 1 819 ? -21.382 50.734  6.466   1.00 72.87  ? 830  LYS A N   1 
ATOM   5647 C  CA  . LYS A 1 819 ? -21.582 49.326  6.783   1.00 75.66  ? 830  LYS A CA  1 
ATOM   5648 C  C   . LYS A 1 819 ? -21.831 49.107  8.272   1.00 73.70  ? 830  LYS A C   1 
ATOM   5649 O  O   . LYS A 1 819 ? -22.301 48.037  8.674   1.00 73.26  ? 830  LYS A O   1 
ATOM   5650 C  CB  . LYS A 1 819 ? -20.375 48.507  6.313   1.00 77.97  ? 830  LYS A CB  1 
ATOM   5651 C  CG  . LYS A 1 819 ? -20.633 47.011  6.208   1.00 87.49  ? 830  LYS A CG  1 
ATOM   5652 C  CD  . LYS A 1 819 ? -19.775 46.369  5.127   1.00 96.00  ? 830  LYS A CD  1 
ATOM   5653 C  CE  . LYS A 1 819 ? -18.294 46.453  5.455   1.00 94.20  ? 830  LYS A CE  1 
ATOM   5654 N  NZ  . LYS A 1 819 ? -17.458 45.854  4.376   1.00 89.41  ? 830  LYS A NZ  1 
ATOM   5655 N  N   . LEU A 1 820 ? -21.533 50.107  9.101   1.00 79.51  ? 831  LEU A N   1 
ATOM   5656 C  CA  . LEU A 1 820 ? -21.716 49.965  10.539  1.00 76.09  ? 831  LEU A CA  1 
ATOM   5657 C  C   . LEU A 1 820 ? -21.993 51.322  11.168  1.00 73.10  ? 831  LEU A C   1 
ATOM   5658 O  O   . LEU A 1 820 ? -21.596 52.364  10.638  1.00 76.46  ? 831  LEU A O   1 
ATOM   5659 C  CB  . LEU A 1 820 ? -20.495 49.313  11.198  1.00 65.89  ? 831  LEU A CB  1 
ATOM   5660 C  CG  . LEU A 1 820 ? -20.715 47.874  11.665  1.00 61.54  ? 831  LEU A CG  1 
ATOM   5661 C  CD1 . LEU A 1 820 ? -19.395 47.200  11.979  1.00 61.06  ? 831  LEU A CD1 1 
ATOM   5662 C  CD2 . LEU A 1 820 ? -21.633 47.846  12.877  1.00 68.06  ? 831  LEU A CD2 1 
ATOM   5663 N  N   . LYS A 1 821 ? -22.674 51.293  12.312  1.00 71.50  ? 832  LYS A N   1 
ATOM   5664 C  CA  . LYS A 1 821 ? -23.059 52.505  13.019  1.00 68.86  ? 832  LYS A CA  1 
ATOM   5665 C  C   . LYS A 1 821 ? -23.129 52.210  14.511  1.00 78.26  ? 832  LYS A C   1 
ATOM   5666 O  O   . LYS A 1 821 ? -23.290 51.061  14.931  1.00 91.01  ? 832  LYS A O   1 
ATOM   5667 C  CB  . LYS A 1 821 ? -24.407 53.041  12.520  1.00 59.06  ? 832  LYS A CB  1 
ATOM   5668 C  CG  . LYS A 1 821 ? -24.386 54.490  12.061  1.00 60.63  ? 832  LYS A CG  1 
ATOM   5669 C  CD  . LYS A 1 821 ? -25.784 54.949  11.674  1.00 78.47  ? 832  LYS A CD  1 
ATOM   5670 C  CE  . LYS A 1 821 ? -25.774 56.350  11.090  1.00 82.87  ? 832  LYS A CE  1 
ATOM   5671 N  NZ  . LYS A 1 821 ? -27.146 56.830  10.771  1.00 96.14  ? 832  LYS A NZ  1 
ATOM   5672 N  N   . LEU A 1 822 ? -23.003 53.270  15.312  1.00 69.20  ? 833  LEU A N   1 
ATOM   5673 C  CA  . LEU A 1 822 ? -23.149 53.154  16.766  1.00 68.54  ? 833  LEU A CA  1 
ATOM   5674 C  C   . LEU A 1 822 ? -23.455 54.559  17.300  1.00 76.50  ? 833  LEU A C   1 
ATOM   5675 O  O   . LEU A 1 822 ? -22.542 55.334  17.583  1.00 82.53  ? 833  LEU A O   1 
ATOM   5676 C  CB  . LEU A 1 822 ? -21.915 52.567  17.422  1.00 67.81  ? 833  LEU A CB  1 
ATOM   5677 C  CG  . LEU A 1 822 ? -21.960 52.456  18.950  1.00 62.97  ? 833  LEU A CG  1 
ATOM   5678 C  CD1 . LEU A 1 822 ? -23.171 51.652  19.397  1.00 70.98  ? 833  LEU A CD1 1 
ATOM   5679 C  CD2 . LEU A 1 822 ? -20.678 51.844  19.491  1.00 55.84  ? 833  LEU A CD2 1 
ATOM   5680 N  N   . LYS A 1 823 ? -24.744 54.863  17.429  1.00 81.38  ? 834  LYS A N   1 
ATOM   5681 C  CA  . LYS A 1 823 ? -25.191 56.181  17.879  1.00 81.52  ? 834  LYS A CA  1 
ATOM   5682 C  C   . LYS A 1 823 ? -25.124 56.221  19.401  1.00 94.44  ? 834  LYS A C   1 
ATOM   5683 O  O   . LYS A 1 823 ? -26.090 55.917  20.102  1.00 105.87 ? 834  LYS A O   1 
ATOM   5684 C  CB  . LYS A 1 823 ? -26.591 56.479  17.357  1.00 80.74  ? 834  LYS A CB  1 
ATOM   5685 C  CG  . LYS A 1 823 ? -26.654 56.576  15.836  1.00 79.50  ? 834  LYS A CG  1 
ATOM   5686 C  CD  . LYS A 1 823 ? -27.954 57.193  15.342  1.00 80.33  ? 834  LYS A CD  1 
ATOM   5687 C  CE  . LYS A 1 823 ? -28.998 56.135  15.025  1.00 84.75  ? 834  LYS A CE  1 
ATOM   5688 N  NZ  . LYS A 1 823 ? -30.152 56.714  14.280  1.00 87.33  ? 834  LYS A NZ  1 
ATOM   5689 N  N   . LEU A 1 824 ? -23.954 56.610  19.916  1.00 91.91  ? 835  LEU A N   1 
ATOM   5690 C  CA  . LEU A 1 824 ? -23.738 56.625  21.360  1.00 77.12  ? 835  LEU A CA  1 
ATOM   5691 C  C   . LEU A 1 824 ? -24.539 57.732  22.034  1.00 72.91  ? 835  LEU A C   1 
ATOM   5692 O  O   . LEU A 1 824 ? -25.156 57.507  23.082  1.00 74.20  ? 835  LEU A O   1 
ATOM   5693 C  CB  . LEU A 1 824 ? -22.248 56.784  21.663  1.00 62.15  ? 835  LEU A CB  1 
ATOM   5694 C  CG  . LEU A 1 824 ? -21.868 56.950  23.135  1.00 63.51  ? 835  LEU A CG  1 
ATOM   5695 C  CD1 . LEU A 1 824 ? -22.240 55.707  23.925  1.00 83.71  ? 835  LEU A CD1 1 
ATOM   5696 C  CD2 . LEU A 1 824 ? -20.387 57.260  23.279  1.00 59.16  ? 835  LEU A CD2 1 
ATOM   5697 N  N   . THR A 1 825 ? -24.536 58.935  21.455  1.00 67.25  ? 836  THR A N   1 
ATOM   5698 C  CA  . THR A 1 825 ? -25.273 60.044  22.053  1.00 65.95  ? 836  THR A CA  1 
ATOM   5699 C  C   . THR A 1 825 ? -26.776 59.796  22.007  1.00 69.47  ? 836  THR A C   1 
ATOM   5700 O  O   . THR A 1 825 ? -27.500 60.158  22.942  1.00 84.19  ? 836  THR A O   1 
ATOM   5701 C  CB  . THR A 1 825 ? -24.915 61.353  21.347  1.00 69.03  ? 836  THR A CB  1 
ATOM   5702 O  OG1 . THR A 1 825 ? -23.519 61.624  21.525  1.00 63.88  ? 836  THR A OG1 1 
ATOM   5703 C  CG2 . THR A 1 825 ? -25.720 62.514  21.915  1.00 70.38  ? 836  THR A CG2 1 
ATOM   5704 N  N   . ALA A 1 826 ? -27.262 59.165  20.936  1.00 67.36  ? 837  ALA A N   1 
ATOM   5705 C  CA  . ALA A 1 826 ? -28.680 58.841  20.847  1.00 76.04  ? 837  ALA A CA  1 
ATOM   5706 C  C   . ALA A 1 826 ? -29.107 57.811  21.885  1.00 95.27  ? 837  ALA A C   1 
ATOM   5707 O  O   . ALA A 1 826 ? -30.308 57.668  22.139  1.00 102.43 ? 837  ALA A O   1 
ATOM   5708 C  CB  . ALA A 1 826 ? -29.018 58.337  19.443  1.00 68.08  ? 837  ALA A CB  1 
ATOM   5709 N  N   . LEU A 1 827 ? -28.157 57.099  22.491  1.00 69.67  ? 838  LEU A N   1 
ATOM   5710 C  CA  . LEU A 1 827 ? -28.476 56.096  23.500  1.00 91.99  ? 838  LEU A CA  1 
ATOM   5711 C  C   . LEU A 1 827 ? -28.149 56.599  24.901  1.00 88.09  ? 838  LEU A C   1 
ATOM   5712 O  O   . LEU A 1 827 ? -29.042 57.030  25.637  1.00 105.61 ? 838  LEU A O   1 
ATOM   5713 C  CB  . LEU A 1 827 ? -27.720 54.795  23.215  1.00 69.23  ? 838  LEU A CB  1 
ATOM   5714 C  CG  . LEU A 1 827 ? -28.072 54.074  21.913  1.00 68.08  ? 838  LEU A CG  1 
ATOM   5715 C  CD1 . LEU A 1 827 ? -27.159 52.877  21.698  1.00 66.28  ? 838  LEU A CD1 1 
ATOM   5716 C  CD2 . LEU A 1 827 ? -29.531 53.645  21.916  1.00 86.09  ? 838  LEU A CD2 1 
ATOM   5717 N  N   . GLU A 1 828 ? -26.869 56.550  25.275  1.00 81.14  ? 839  GLU A N   1 
ATOM   5718 C  CA  . GLU A 1 828 ? -26.449 56.924  26.620  1.00 71.85  ? 839  GLU A CA  1 
ATOM   5719 C  C   . GLU A 1 828 ? -26.518 58.423  26.878  1.00 87.05  ? 839  GLU A C   1 
ATOM   5720 O  O   . GLU A 1 828 ? -26.403 58.836  28.037  1.00 83.33  ? 839  GLU A O   1 
ATOM   5721 C  CB  . GLU A 1 828 ? -25.027 56.424  26.880  1.00 91.82  ? 839  GLU A CB  1 
ATOM   5722 C  CG  . GLU A 1 828 ? -24.917 54.916  27.036  1.00 105.94 ? 839  GLU A CG  1 
ATOM   5723 C  CD  . GLU A 1 828 ? -23.482 54.447  27.175  1.00 114.86 ? 839  GLU A CD  1 
ATOM   5724 O  OE1 . GLU A 1 828 ? -23.020 53.677  26.307  1.00 109.62 ? 839  GLU A OE1 1 
ATOM   5725 O  OE2 . GLU A 1 828 ? -22.813 54.853  28.149  1.00 117.27 ? 839  GLU A OE2 1 
ATOM   5726 N  N   . GLY A 1 829 ? -26.701 59.242  25.846  1.00 91.59  ? 840  GLY A N   1 
ATOM   5727 C  CA  . GLY A 1 829 ? -26.734 60.678  26.043  1.00 86.26  ? 840  GLY A CA  1 
ATOM   5728 C  C   . GLY A 1 829 ? -25.388 61.293  26.352  1.00 81.61  ? 840  GLY A C   1 
ATOM   5729 O  O   . GLY A 1 829 ? -25.324 62.312  27.046  1.00 73.02  ? 840  GLY A O   1 
ATOM   5730 N  N   . SER A 1 830 ? -24.307 60.698  25.855  1.00 85.13  ? 841  SER A N   1 
ATOM   5731 C  CA  . SER A 1 830 ? -22.958 61.185  26.087  1.00 79.80  ? 841  SER A CA  1 
ATOM   5732 C  C   . SER A 1 830 ? -22.279 61.486  24.758  1.00 74.76  ? 841  SER A C   1 
ATOM   5733 O  O   . SER A 1 830 ? -22.567 60.854  23.738  1.00 68.01  ? 841  SER A O   1 
ATOM   5734 C  CB  . SER A 1 830 ? -22.128 60.166  26.877  1.00 87.05  ? 841  SER A CB  1 
ATOM   5735 O  OG  . SER A 1 830 ? -22.117 58.906  26.228  1.00 82.70  ? 841  SER A OG  1 
ATOM   5736 N  N   . ARG A 1 831 ? -21.371 62.456  24.781  1.00 75.27  ? 842  ARG A N   1 
ATOM   5737 C  CA  . ARG A 1 831 ? -20.632 62.867  23.598  1.00 73.76  ? 842  ARG A CA  1 
ATOM   5738 C  C   . ARG A 1 831 ? -19.156 62.526  23.750  1.00 69.10  ? 842  ARG A C   1 
ATOM   5739 O  O   . ARG A 1 831 ? -18.599 62.576  24.850  1.00 77.32  ? 842  ARG A O   1 
ATOM   5740 C  CB  . ARG A 1 831 ? -20.798 64.367  23.337  1.00 72.35  ? 842  ARG A CB  1 
ATOM   5741 C  CG  . ARG A 1 831 ? -22.146 64.737  22.743  1.00 65.61  ? 842  ARG A CG  1 
ATOM   5742 C  CD  . ARG A 1 831 ? -22.261 66.231  22.502  1.00 67.08  ? 842  ARG A CD  1 
ATOM   5743 N  NE  . ARG A 1 831 ? -23.378 66.547  21.616  1.00 68.31  ? 842  ARG A NE  1 
ATOM   5744 C  CZ  . ARG A 1 831 ? -23.257 66.751  20.308  1.00 67.30  ? 842  ARG A CZ  1 
ATOM   5745 N  NH1 . ARG A 1 831 ? -22.065 66.680  19.733  1.00 88.13  ? 842  ARG A NH1 1 
ATOM   5746 N  NH2 . ARG A 1 831 ? -24.325 67.031  19.575  1.00 68.57  ? 842  ARG A NH2 1 
ATOM   5747 N  N   . VAL A 1 832 ? -18.528 62.181  22.630  1.00 66.19  ? 843  VAL A N   1 
ATOM   5748 C  CA  . VAL A 1 832 ? -17.129 61.765  22.626  1.00 68.96  ? 843  VAL A CA  1 
ATOM   5749 C  C   . VAL A 1 832 ? -16.241 63.001  22.701  1.00 62.55  ? 843  VAL A C   1 
ATOM   5750 O  O   . VAL A 1 832 ? -16.279 63.862  21.816  1.00 62.74  ? 843  VAL A O   1 
ATOM   5751 C  CB  . VAL A 1 832 ? -16.804 60.931  21.379  1.00 67.55  ? 843  VAL A CB  1 
ATOM   5752 C  CG1 . VAL A 1 832 ? -15.333 60.546  21.370  1.00 71.21  ? 843  VAL A CG1 1 
ATOM   5753 C  CG2 . VAL A 1 832 ? -17.687 59.693  21.322  1.00 62.39  ? 843  VAL A CG2 1 
ATOM   5754 N  N   . ARG A 1 833 ? -15.437 63.089  23.760  1.00 67.44  ? 844  ARG A N   1 
ATOM   5755 C  CA  . ARG A 1 833 ? -14.462 64.164  23.899  1.00 73.55  ? 844  ARG A CA  1 
ATOM   5756 C  C   . ARG A 1 833 ? -13.156 63.827  23.187  1.00 67.04  ? 844  ARG A C   1 
ATOM   5757 O  O   . ARG A 1 833 ? -12.652 64.629  22.395  1.00 71.15  ? 844  ARG A O   1 
ATOM   5758 C  CB  . ARG A 1 833 ? -14.202 64.451  25.382  1.00 80.15  ? 844  ARG A CB  1 
ATOM   5759 C  CG  . ARG A 1 833 ? -13.136 65.507  25.635  1.00 97.96  ? 844  ARG A CG  1 
ATOM   5760 C  CD  . ARG A 1 833 ? -13.553 66.862  25.087  1.00 115.87 ? 844  ARG A CD  1 
ATOM   5761 N  NE  . ARG A 1 833 ? -12.533 67.882  25.317  1.00 124.27 ? 844  ARG A NE  1 
ATOM   5762 C  CZ  . ARG A 1 833 ? -11.585 68.201  24.441  1.00 136.30 ? 844  ARG A CZ  1 
ATOM   5763 N  NH1 . ARG A 1 833 ? -11.525 67.582  23.270  1.00 141.88 ? 844  ARG A NH1 1 
ATOM   5764 N  NH2 . ARG A 1 833 ? -10.697 69.141  24.735  1.00 135.50 ? 844  ARG A NH2 1 
ATOM   5765 N  N   . ARG A 1 834 ? -12.603 62.647  23.459  1.00 63.39  ? 845  ARG A N   1 
ATOM   5766 C  CA  . ARG A 1 834 ? -11.401 62.171  22.793  1.00 65.94  ? 845  ARG A CA  1 
ATOM   5767 C  C   . ARG A 1 834 ? -11.521 60.675  22.548  1.00 59.00  ? 845  ARG A C   1 
ATOM   5768 O  O   . ARG A 1 834 ? -12.142 59.949  23.328  1.00 51.82  ? 845  ARG A O   1 
ATOM   5769 C  CB  . ARG A 1 834 ? -10.133 62.458  23.612  1.00 70.93  ? 845  ARG A CB  1 
ATOM   5770 C  CG  . ARG A 1 834 ? -9.652  63.899  23.555  1.00 80.03  ? 845  ARG A CG  1 
ATOM   5771 C  CD  . ARG A 1 834 ? -8.238  64.036  24.111  1.00 86.31  ? 845  ARG A CD  1 
ATOM   5772 N  NE  . ARG A 1 834 ? -7.253  63.313  23.308  1.00 108.48 ? 845  ARG A NE  1 
ATOM   5773 C  CZ  . ARG A 1 834 ? -6.752  62.122  23.626  1.00 109.72 ? 845  ARG A CZ  1 
ATOM   5774 N  NH1 . ARG A 1 834 ? -7.139  61.513  24.737  1.00 112.24 ? 845  ARG A NH1 1 
ATOM   5775 N  NH2 . ARG A 1 834 ? -5.862  61.540  22.833  1.00 100.05 ? 845  ARG A NH2 1 
ATOM   5776 N  N   . VAL A 1 835 ? -10.917 60.223  21.453  1.00 58.37  ? 846  VAL A N   1 
ATOM   5777 C  CA  . VAL A 1 835 ? -10.873 58.809  21.107  1.00 59.38  ? 846  VAL A CA  1 
ATOM   5778 C  C   . VAL A 1 835 ? -9.433  58.445  20.771  1.00 59.97  ? 846  VAL A C   1 
ATOM   5779 O  O   . VAL A 1 835 ? -8.657  59.276  20.290  1.00 73.92  ? 846  VAL A O   1 
ATOM   5780 C  CB  . VAL A 1 835 ? -11.826 58.470  19.935  1.00 53.04  ? 846  VAL A CB  1 
ATOM   5781 C  CG1 . VAL A 1 835 ? -11.284 59.009  18.616  1.00 59.12  ? 846  VAL A CG1 1 
ATOM   5782 C  CG2 . VAL A 1 835 ? -12.077 56.970  19.857  1.00 57.29  ? 846  VAL A CG2 1 
ATOM   5783 N  N   . SER A 1 836 ? -9.071  57.195  21.053  1.00 62.19  ? 847  SER A N   1 
ATOM   5784 C  CA  . SER A 1 836 ? -7.721  56.717  20.791  1.00 77.56  ? 847  SER A CA  1 
ATOM   5785 C  C   . SER A 1 836 ? -7.753  55.203  20.649  1.00 76.32  ? 847  SER A C   1 
ATOM   5786 O  O   . SER A 1 836 ? -8.501  54.524  21.357  1.00 79.24  ? 847  SER A O   1 
ATOM   5787 C  CB  . SER A 1 836 ? -6.752  57.124  21.909  1.00 92.24  ? 847  SER A CB  1 
ATOM   5788 O  OG  . SER A 1 836 ? -6.584  58.530  21.958  1.00 104.76 ? 847  SER A OG  1 
ATOM   5789 N  N   . VAL A 1 837 ? -6.940  54.686  19.734  1.00 70.65  ? 848  VAL A N   1 
ATOM   5790 C  CA  . VAL A 1 837 ? -6.824  53.246  19.544  1.00 66.74  ? 848  VAL A CA  1 
ATOM   5791 C  C   . VAL A 1 837 ? -5.989  52.667  20.678  1.00 67.37  ? 848  VAL A C   1 
ATOM   5792 O  O   . VAL A 1 837 ? -4.912  53.182  21.000  1.00 74.84  ? 848  VAL A O   1 
ATOM   5793 C  CB  . VAL A 1 837 ? -6.212  52.924  18.170  1.00 54.83  ? 848  VAL A CB  1 
ATOM   5794 C  CG1 . VAL A 1 837 ? -4.980  53.783  17.914  1.00 70.70  ? 848  VAL A CG1 1 
ATOM   5795 C  CG2 . VAL A 1 837 ? -5.867  51.445  18.073  1.00 46.43  ? 848  VAL A CG2 1 
ATOM   5796 N  N   . ALA A 1 838 ? -6.492  51.603  21.298  1.00 74.21  ? 849  ALA A N   1 
ATOM   5797 C  CA  . ALA A 1 838 ? -5.830  50.984  22.436  1.00 88.06  ? 849  ALA A CA  1 
ATOM   5798 C  C   . ALA A 1 838 ? -5.636  49.498  22.175  1.00 87.93  ? 849  ALA A C   1 
ATOM   5799 O  O   . ALA A 1 838 ? -6.550  48.816  21.702  1.00 76.60  ? 849  ALA A O   1 
ATOM   5800 C  CB  . ALA A 1 838 ? -6.630  51.194  23.725  1.00 104.62 ? 849  ALA A CB  1 
ATOM   5801 N  N   . HIS A 1 839 ? -4.441  49.004  22.491  1.00 91.20  ? 850  HIS A N   1 
ATOM   5802 C  CA  . HIS A 1 839 ? -4.071  47.608  22.283  1.00 73.31  ? 850  HIS A CA  1 
ATOM   5803 C  C   . HIS A 1 839 ? -3.902  46.951  23.648  1.00 73.83  ? 850  HIS A C   1 
ATOM   5804 O  O   . HIS A 1 839 ? -2.951  47.256  24.376  1.00 75.46  ? 850  HIS A O   1 
ATOM   5805 C  CB  . HIS A 1 839 ? -2.792  47.504  21.455  1.00 72.40  ? 850  HIS A CB  1 
ATOM   5806 C  CG  . HIS A 1 839 ? -2.409  46.099  21.107  1.00 80.07  ? 850  HIS A CG  1 
ATOM   5807 N  ND1 . HIS A 1 839 ? -1.336  45.456  21.685  1.00 96.58  ? 850  HIS A ND1 1 
ATOM   5808 C  CD2 . HIS A 1 839 ? -2.956  45.215  20.240  1.00 88.36  ? 850  HIS A CD2 1 
ATOM   5809 C  CE1 . HIS A 1 839 ? -1.237  44.236  21.189  1.00 97.89  ? 850  HIS A CE1 1 
ATOM   5810 N  NE2 . HIS A 1 839 ? -2.208  44.064  20.310  1.00 92.32  ? 850  HIS A NE2 1 
ATOM   5811 N  N   . PHE A 1 840 ? -4.820  46.054  23.990  1.00 83.27  ? 851  PHE A N   1 
ATOM   5812 C  CA  . PHE A 1 840 ? -4.806  45.365  25.271  1.00 86.83  ? 851  PHE A CA  1 
ATOM   5813 C  C   . PHE A 1 840 ? -4.293  43.938  25.109  1.00 75.32  ? 851  PHE A C   1 
ATOM   5814 O  O   . PHE A 1 840 ? -4.300  43.367  24.016  1.00 73.08  ? 851  PHE A O   1 
ATOM   5815 C  CB  . PHE A 1 840 ? -6.205  45.349  25.893  1.00 98.10  ? 851  PHE A CB  1 
ATOM   5816 C  CG  . PHE A 1 840 ? -6.822  46.711  26.040  1.00 85.29  ? 851  PHE A CG  1 
ATOM   5817 C  CD1 . PHE A 1 840 ? -6.563  47.487  27.159  1.00 86.62  ? 851  PHE A CD1 1 
ATOM   5818 C  CD2 . PHE A 1 840 ? -7.664  47.213  25.063  1.00 80.84  ? 851  PHE A CD2 1 
ATOM   5819 C  CE1 . PHE A 1 840 ? -7.131  48.741  27.298  1.00 72.26  ? 851  PHE A CE1 1 
ATOM   5820 C  CE2 . PHE A 1 840 ? -8.235  48.464  25.197  1.00 82.87  ? 851  PHE A CE2 1 
ATOM   5821 C  CZ  . PHE A 1 840 ? -7.968  49.229  26.317  1.00 71.22  ? 851  PHE A CZ  1 
ATOM   5822 N  N   . GLY A 1 841 ? -3.848  43.366  26.223  1.00 65.13  ? 852  GLY A N   1 
ATOM   5823 C  CA  . GLY A 1 841 ? -3.337  42.008  26.229  1.00 58.28  ? 852  GLY A CA  1 
ATOM   5824 C  C   . GLY A 1 841 ? -3.785  41.206  27.435  1.00 58.84  ? 852  GLY A C   1 
ATOM   5825 O  O   . GLY A 1 841 ? -4.283  41.764  28.413  1.00 74.51  ? 852  GLY A O   1 
ATOM   5826 N  N   . TYR A 1 848 ? -1.759  36.821  23.466  1.00 71.29  ? 859  TYR A N   1 
ATOM   5827 C  CA  . TYR A 1 848 ? -2.284  37.469  22.271  1.00 88.10  ? 859  TYR A CA  1 
ATOM   5828 C  C   . TYR A 1 848 ? -2.653  38.920  22.569  1.00 92.01  ? 859  TYR A C   1 
ATOM   5829 O  O   . TYR A 1 848 ? -2.594  39.361  23.717  1.00 89.87  ? 859  TYR A O   1 
ATOM   5830 C  CB  . TYR A 1 848 ? -3.502  36.709  21.738  1.00 105.28 ? 859  TYR A CB  1 
ATOM   5831 C  CG  . TYR A 1 848 ? -4.829  37.253  22.222  1.00 122.99 ? 859  TYR A CG  1 
ATOM   5832 C  CD1 . TYR A 1 848 ? -5.675  37.940  21.359  1.00 130.03 ? 859  TYR A CD1 1 
ATOM   5833 C  CD2 . TYR A 1 848 ? -5.233  37.088  23.541  1.00 130.63 ? 859  TYR A CD2 1 
ATOM   5834 C  CE1 . TYR A 1 848 ? -6.886  38.444  21.794  1.00 129.56 ? 859  TYR A CE1 1 
ATOM   5835 C  CE2 . TYR A 1 848 ? -6.443  37.590  23.985  1.00 132.17 ? 859  TYR A CE2 1 
ATOM   5836 C  CZ  . TYR A 1 848 ? -7.265  38.266  23.107  1.00 127.85 ? 859  TYR A CZ  1 
ATOM   5837 O  OH  . TYR A 1 848 ? -8.470  38.766  23.543  1.00 118.64 ? 859  TYR A OH  1 
ATOM   5838 N  N   . GLY A 1 849 ? -3.036  39.658  21.530  1.00 98.70  ? 860  GLY A N   1 
ATOM   5839 C  CA  . GLY A 1 849 ? -3.478  41.027  21.704  1.00 105.91 ? 860  GLY A CA  1 
ATOM   5840 C  C   . GLY A 1 849 ? -4.181  41.589  20.486  1.00 105.97 ? 860  GLY A C   1 
ATOM   5841 O  O   . GLY A 1 849 ? -3.608  41.620  19.393  1.00 110.98 ? 860  GLY A O   1 
ATOM   5842 N  N   . GLU A 1 850 ? -5.422  42.032  20.657  1.00 91.19  ? 861  GLU A N   1 
ATOM   5843 C  CA  . GLU A 1 850 ? -6.183  42.664  19.591  1.00 90.62  ? 861  GLU A CA  1 
ATOM   5844 C  C   . GLU A 1 850 ? -6.480  44.111  19.967  1.00 78.43  ? 861  GLU A C   1 
ATOM   5845 O  O   . GLU A 1 850 ? -6.329  44.525  21.119  1.00 61.48  ? 861  GLU A O   1 
ATOM   5846 C  CB  . GLU A 1 850 ? -7.482  41.899  19.300  1.00 102.41 ? 861  GLU A CB  1 
ATOM   5847 C  CG  . GLU A 1 850 ? -8.551  42.027  20.371  1.00 115.85 ? 861  GLU A CG  1 
ATOM   5848 C  CD  . GLU A 1 850 ? -9.823  41.280  20.010  1.00 127.68 ? 861  GLU A CD  1 
ATOM   5849 O  OE1 . GLU A 1 850 ? -9.723  40.186  19.416  1.00 129.90 ? 861  GLU A OE1 1 
ATOM   5850 O  OE2 . GLU A 1 850 ? -10.922 41.791  20.311  1.00 131.37 ? 861  GLU A OE2 1 
ATOM   5851 N  N   . HIS A 1 851 ? -6.910  44.882  18.973  1.00 80.49  ? 862  HIS A N   1 
ATOM   5852 C  CA  . HIS A 1 851 ? -7.093  46.318  19.116  1.00 70.44  ? 862  HIS A CA  1 
ATOM   5853 C  C   . HIS A 1 851 ? -8.550  46.657  19.407  1.00 61.97  ? 862  HIS A C   1 
ATOM   5854 O  O   . HIS A 1 851 ? -9.469  45.934  19.013  1.00 75.52  ? 862  HIS A O   1 
ATOM   5855 C  CB  . HIS A 1 851 ? -6.633  47.050  17.854  1.00 67.45  ? 862  HIS A CB  1 
ATOM   5856 C  CG  . HIS A 1 851 ? -5.224  46.739  17.455  1.00 64.24  ? 862  HIS A CG  1 
ATOM   5857 N  ND1 . HIS A 1 851 ? -4.843  45.507  16.967  1.00 56.43  ? 862  HIS A ND1 1 
ATOM   5858 C  CD2 . HIS A 1 851 ? -4.104  47.499  17.474  1.00 60.91  ? 862  HIS A CD2 1 
ATOM   5859 C  CE1 . HIS A 1 851 ? -3.549  45.522  16.703  1.00 60.24  ? 862  HIS A CE1 1 
ATOM   5860 N  NE2 . HIS A 1 851 ? -3.077  46.719  17.000  1.00 65.92  ? 862  HIS A NE2 1 
ATOM   5861 N  N   . HIS A 1 852 ? -8.749  47.774  20.103  1.00 56.91  ? 863  HIS A N   1 
ATOM   5862 C  CA  . HIS A 1 852 ? -10.076 48.262  20.454  1.00 62.56  ? 863  HIS A CA  1 
ATOM   5863 C  C   . HIS A 1 852 ? -10.066 49.785  20.344  1.00 66.44  ? 863  HIS A C   1 
ATOM   5864 O  O   . HIS A 1 852 ? -9.096  50.387  19.872  1.00 73.24  ? 863  HIS A O   1 
ATOM   5865 C  CB  . HIS A 1 852 ? -10.482 47.784  21.855  1.00 64.44  ? 863  HIS A CB  1 
ATOM   5866 C  CG  . HIS A 1 852 ? -10.627 46.298  21.971  1.00 63.12  ? 863  HIS A CG  1 
ATOM   5867 N  ND1 . HIS A 1 852 ? -11.839 45.656  21.837  1.00 69.02  ? 863  HIS A ND1 1 
ATOM   5868 C  CD2 . HIS A 1 852 ? -9.713  45.328  22.213  1.00 64.42  ? 863  HIS A CD2 1 
ATOM   5869 C  CE1 . HIS A 1 852 ? -11.666 44.356  21.989  1.00 70.39  ? 863  HIS A CE1 1 
ATOM   5870 N  NE2 . HIS A 1 852 ? -10.385 44.130  22.218  1.00 70.98  ? 863  HIS A NE2 1 
ATOM   5871 N  N   . LEU A 1 853 ? -11.153 50.414  20.786  1.00 59.67  ? 864  LEU A N   1 
ATOM   5872 C  CA  . LEU A 1 853 ? -11.297 51.865  20.756  1.00 56.50  ? 864  LEU A CA  1 
ATOM   5873 C  C   . LEU A 1 853 ? -11.557 52.375  22.166  1.00 64.85  ? 864  LEU A C   1 
ATOM   5874 O  O   . LEU A 1 853 ? -12.581 52.040  22.771  1.00 62.08  ? 864  LEU A O   1 
ATOM   5875 C  CB  . LEU A 1 853 ? -12.432 52.293  19.824  1.00 54.55  ? 864  LEU A CB  1 
ATOM   5876 C  CG  . LEU A 1 853 ? -12.049 52.820  18.441  1.00 48.06  ? 864  LEU A CG  1 
ATOM   5877 C  CD1 . LEU A 1 853 ? -13.230 53.542  17.812  1.00 48.29  ? 864  LEU A CD1 1 
ATOM   5878 C  CD2 . LEU A 1 853 ? -10.834 53.730  18.520  1.00 47.46  ? 864  LEU A CD2 1 
ATOM   5879 N  N   . ALA A 1 854 ? -10.637 53.187  22.680  1.00 70.88  ? 865  ALA A N   1 
ATOM   5880 C  CA  . ALA A 1 854 ? -10.806 53.837  23.973  1.00 74.92  ? 865  ALA A CA  1 
ATOM   5881 C  C   . ALA A 1 854 ? -11.463 55.195  23.759  1.00 80.74  ? 865  ALA A C   1 
ATOM   5882 O  O   . ALA A 1 854 ? -10.944 56.029  23.008  1.00 97.55  ? 865  ALA A O   1 
ATOM   5883 C  CB  . ALA A 1 854 ? -9.464  53.989  24.686  1.00 77.49  ? 865  ALA A CB  1 
ATOM   5884 N  N   . VAL A 1 855 ? -12.598 55.416  24.416  1.00 74.57  ? 866  VAL A N   1 
ATOM   5885 C  CA  . VAL A 1 855 ? -13.403 56.616  24.226  1.00 67.74  ? 866  VAL A CA  1 
ATOM   5886 C  C   . VAL A 1 855 ? -13.559 57.319  25.566  1.00 68.53  ? 866  VAL A C   1 
ATOM   5887 O  O   . VAL A 1 855 ? -13.926 56.689  26.564  1.00 67.06  ? 866  VAL A O   1 
ATOM   5888 C  CB  . VAL A 1 855 ? -14.781 56.282  23.624  1.00 75.23  ? 866  VAL A CB  1 
ATOM   5889 C  CG1 . VAL A 1 855 ? -15.604 57.546  23.444  1.00 67.59  ? 866  VAL A CG1 1 
ATOM   5890 C  CG2 . VAL A 1 855 ? -14.618 55.549  22.303  1.00 86.61  ? 866  VAL A CG2 1 
ATOM   5891 N  N   . LEU A 1 856 ? -13.281 58.621  25.585  1.00 53.74  ? 867  LEU A N   1 
ATOM   5892 C  CA  . LEU A 1 856 ? -13.498 59.468  26.753  1.00 70.48  ? 867  LEU A CA  1 
ATOM   5893 C  C   . LEU A 1 856 ? -14.716 60.341  26.476  1.00 66.92  ? 867  LEU A C   1 
ATOM   5894 O  O   . LEU A 1 856 ? -14.663 61.238  25.629  1.00 74.23  ? 867  LEU A O   1 
ATOM   5895 C  CB  . LEU A 1 856 ? -12.265 60.319  27.053  1.00 73.92  ? 867  LEU A CB  1 
ATOM   5896 C  CG  . LEU A 1 856 ? -12.422 61.427  28.099  1.00 72.57  ? 867  LEU A CG  1 
ATOM   5897 C  CD1 . LEU A 1 856 ? -12.798 60.853  29.456  1.00 68.95  ? 867  LEU A CD1 1 
ATOM   5898 C  CD2 . LEU A 1 856 ? -11.151 62.258  28.200  1.00 67.33  ? 867  LEU A CD2 1 
ATOM   5899 N  N   . THR A 1 857 ? -15.809 60.075  27.182  1.00 58.07  ? 868  THR A N   1 
ATOM   5900 C  CA  . THR A 1 857 ? -17.029 60.845  27.008  1.00 63.15  ? 868  THR A CA  1 
ATOM   5901 C  C   . THR A 1 857 ? -16.993 62.103  27.874  1.00 67.35  ? 868  THR A C   1 
ATOM   5902 O  O   . THR A 1 857 ? -16.168 62.243  28.778  1.00 75.40  ? 868  THR A O   1 
ATOM   5903 C  CB  . THR A 1 857 ? -18.255 59.997  27.351  1.00 69.24  ? 868  THR A CB  1 
ATOM   5904 O  OG1 . THR A 1 857 ? -18.340 59.827  28.771  1.00 80.90  ? 868  THR A OG1 1 
ATOM   5905 C  CG2 . THR A 1 857 ? -18.157 58.631  26.690  1.00 68.54  ? 868  THR A CG2 1 
ATOM   5906 N  N   . ASN A 1 858 ? -17.909 63.030  27.583  1.00 64.57  ? 869  ASN A N   1 
ATOM   5907 C  CA  . ASN A 1 858 ? -18.000 64.265  28.355  1.00 64.31  ? 869  ASN A CA  1 
ATOM   5908 C  C   . ASN A 1 858 ? -18.519 64.041  29.771  1.00 86.09  ? 869  ASN A C   1 
ATOM   5909 O  O   . ASN A 1 858 ? -18.379 64.938  30.610  1.00 83.89  ? 869  ASN A O   1 
ATOM   5910 C  CB  . ASN A 1 858 ? -18.891 65.278  27.630  1.00 65.75  ? 869  ASN A CB  1 
ATOM   5911 C  CG  . ASN A 1 858 ? -20.245 64.706  27.250  1.00 66.88  ? 869  ASN A CG  1 
ATOM   5912 O  OD1 . ASN A 1 858 ? -20.605 63.602  27.656  1.00 66.92  ? 869  ASN A OD1 1 
ATOM   5913 N  ND2 . ASN A 1 858 ? -21.005 65.462  26.467  1.00 77.97  ? 869  ASN A ND2 1 
ATOM   5914 N  N   . LEU A 1 859 ? -19.112 62.879  30.056  1.00 81.39  ? 870  LEU A N   1 
ATOM   5915 C  CA  . LEU A 1 859 ? -19.580 62.572  31.403  1.00 84.17  ? 870  LEU A CA  1 
ATOM   5916 C  C   . LEU A 1 859 ? -18.444 62.264  32.366  1.00 95.32  ? 870  LEU A C   1 
ATOM   5917 O  O   . LEU A 1 859 ? -18.673 62.245  33.580  1.00 97.85  ? 870  LEU A O   1 
ATOM   5918 C  CB  . LEU A 1 859 ? -20.540 61.380  31.371  1.00 82.92  ? 870  LEU A CB  1 
ATOM   5919 C  CG  . LEU A 1 859 ? -21.746 61.449  30.433  1.00 79.81  ? 870  LEU A CG  1 
ATOM   5920 C  CD1 . LEU A 1 859 ? -22.537 60.152  30.495  1.00 85.51  ? 870  LEU A CD1 1 
ATOM   5921 C  CD2 . LEU A 1 859 ? -22.629 62.635  30.778  1.00 72.89  ? 870  LEU A CD2 1 
ATOM   5922 N  N   . GLY A 1 860 ? -17.236 62.025  31.863  1.00 107.39 ? 871  GLY A N   1 
ATOM   5923 C  CA  . GLY A 1 860 ? -16.141 61.541  32.672  1.00 112.18 ? 871  GLY A CA  1 
ATOM   5924 C  C   . GLY A 1 860 ? -15.933 60.045  32.598  1.00 105.12 ? 871  GLY A C   1 
ATOM   5925 O  O   . GLY A 1 860 ? -14.913 59.551  33.094  1.00 101.42 ? 871  GLY A O   1 
ATOM   5926 N  N   . ASP A 1 861 ? -16.868 59.316  31.998  1.00 107.06 ? 872  ASP A N   1 
ATOM   5927 C  CA  . ASP A 1 861 ? -16.731 57.882  31.819  1.00 101.60 ? 872  ASP A CA  1 
ATOM   5928 C  C   . ASP A 1 861 ? -15.780 57.580  30.664  1.00 82.94  ? 872  ASP A C   1 
ATOM   5929 O  O   . ASP A 1 861 ? -15.544 58.410  29.782  1.00 66.24  ? 872  ASP A O   1 
ATOM   5930 C  CB  . ASP A 1 861 ? -18.096 57.242  31.559  1.00 104.06 ? 872  ASP A CB  1 
ATOM   5931 C  CG  . ASP A 1 861 ? -19.102 57.548  32.653  1.00 110.34 ? 872  ASP A CG  1 
ATOM   5932 O  OD1 . ASP A 1 861 ? -18.770 58.330  33.568  1.00 109.47 ? 872  ASP A OD1 1 
ATOM   5933 O  OD2 . ASP A 1 861 ? -20.225 57.004  32.598  1.00 113.15 ? 872  ASP A OD2 1 
ATOM   5934 N  N   . ILE A 1 862 ? -15.228 56.370  30.681  1.00 78.36  ? 873  ILE A N   1 
ATOM   5935 C  CA  . ILE A 1 862 ? -14.322 55.900  29.640  1.00 69.50  ? 873  ILE A CA  1 
ATOM   5936 C  C   . ILE A 1 862 ? -14.769 54.508  29.220  1.00 73.39  ? 873  ILE A C   1 
ATOM   5937 O  O   . ILE A 1 862 ? -14.729 53.570  30.025  1.00 90.47  ? 873  ILE A O   1 
ATOM   5938 C  CB  . ILE A 1 862 ? -12.858 55.884  30.106  1.00 83.54  ? 873  ILE A CB  1 
ATOM   5939 C  CG1 . ILE A 1 862 ? -12.358 57.314  30.321  1.00 107.82 ? 873  ILE A CG1 1 
ATOM   5940 C  CG2 . ILE A 1 862 ? -11.985 55.154  29.097  1.00 80.13  ? 873  ILE A CG2 1 
ATOM   5941 C  CD1 . ILE A 1 862 ? -10.882 57.412  30.627  1.00 110.55 ? 873  ILE A CD1 1 
ATOM   5942 N  N   . GLN A 1 863 ? -15.191 54.375  27.966  1.00 62.68  ? 874  GLN A N   1 
ATOM   5943 C  CA  . GLN A 1 863 ? -15.693 53.122  27.428  1.00 71.48  ? 874  GLN A CA  1 
ATOM   5944 C  C   . GLN A 1 863 ? -14.712 52.557  26.410  1.00 66.55  ? 874  GLN A C   1 
ATOM   5945 O  O   . GLN A 1 863 ? -13.937 53.292  25.791  1.00 59.61  ? 874  GLN A O   1 
ATOM   5946 C  CB  . GLN A 1 863 ? -17.066 53.315  26.775  1.00 80.66  ? 874  GLN A CB  1 
ATOM   5947 C  CG  . GLN A 1 863 ? -18.108 53.937  27.694  1.00 89.88  ? 874  GLN A CG  1 
ATOM   5948 C  CD  . GLN A 1 863 ? -19.382 54.312  26.962  1.00 95.28  ? 874  GLN A CD  1 
ATOM   5949 O  OE1 . GLN A 1 863 ? -19.555 53.989  25.787  1.00 89.61  ? 874  GLN A OE1 1 
ATOM   5950 N  NE2 . GLN A 1 863 ? -20.280 55.003  27.654  1.00 97.22  ? 874  GLN A NE2 1 
ATOM   5951 N  N   . VAL A 1 864 ? -14.752 51.237  26.245  1.00 70.10  ? 875  VAL A N   1 
ATOM   5952 C  CA  . VAL A 1 864 ? -13.910 50.530  25.290  1.00 68.73  ? 875  VAL A CA  1 
ATOM   5953 C  C   . VAL A 1 864 ? -14.810 49.881  24.248  1.00 67.36  ? 875  VAL A C   1 
ATOM   5954 O  O   . VAL A 1 864 ? -15.867 49.333  24.579  1.00 69.64  ? 875  VAL A O   1 
ATOM   5955 C  CB  . VAL A 1 864 ? -13.014 49.483  25.981  1.00 54.84  ? 875  VAL A CB  1 
ATOM   5956 C  CG1 . VAL A 1 864 ? -12.111 48.807  24.965  1.00 53.68  ? 875  VAL A CG1 1 
ATOM   5957 C  CG2 . VAL A 1 864 ? -12.183 50.141  27.068  1.00 54.76  ? 875  VAL A CG2 1 
ATOM   5958 N  N   . VAL A 1 865 ? -14.384 49.945  22.989  1.00 60.88  ? 876  VAL A N   1 
ATOM   5959 C  CA  . VAL A 1 865 ? -15.204 49.555  21.850  1.00 60.70  ? 876  VAL A CA  1 
ATOM   5960 C  C   . VAL A 1 865 ? -14.369 48.680  20.925  1.00 68.55  ? 876  VAL A C   1 
ATOM   5961 O  O   . VAL A 1 865 ? -13.243 49.044  20.571  1.00 77.04  ? 876  VAL A O   1 
ATOM   5962 C  CB  . VAL A 1 865 ? -15.738 50.792  21.102  1.00 61.11  ? 876  VAL A CB  1 
ATOM   5963 C  CG1 . VAL A 1 865 ? -16.396 50.391  19.814  1.00 65.83  ? 876  VAL A CG1 1 
ATOM   5964 C  CG2 . VAL A 1 865 ? -16.717 51.561  21.977  1.00 62.10  ? 876  VAL A CG2 1 
ATOM   5965 N  N   . SER A 1 866 ? -14.921 47.535  20.529  1.00 64.30  ? 877  SER A N   1 
ATOM   5966 C  CA  . SER A 1 866 ? -14.196 46.570  19.717  1.00 68.90  ? 877  SER A CA  1 
ATOM   5967 C  C   . SER A 1 866 ? -14.101 47.038  18.264  1.00 82.06  ? 877  SER A C   1 
ATOM   5968 O  O   . SER A 1 866 ? -14.804 47.951  17.824  1.00 92.31  ? 877  SER A O   1 
ATOM   5969 C  CB  . SER A 1 866 ? -14.867 45.198  19.787  1.00 64.41  ? 877  SER A CB  1 
ATOM   5970 O  OG  . SER A 1 866 ? -16.166 45.235  19.224  1.00 60.00  ? 877  SER A OG  1 
ATOM   5971 N  N   . LEU A 1 867 ? -13.210 46.390  17.513  1.00 67.89  ? 878  LEU A N   1 
ATOM   5972 C  CA  . LEU A 1 867 ? -12.979 46.694  16.110  1.00 60.94  ? 878  LEU A CA  1 
ATOM   5973 C  C   . LEU A 1 867 ? -13.094 45.427  15.273  1.00 64.85  ? 878  LEU A C   1 
ATOM   5974 O  O   . LEU A 1 867 ? -12.567 44.377  15.658  1.00 76.69  ? 878  LEU A O   1 
ATOM   5975 C  CB  . LEU A 1 867 ? -11.593 47.322  15.900  1.00 63.24  ? 878  LEU A CB  1 
ATOM   5976 C  CG  . LEU A 1 867 ? -11.513 48.841  15.740  1.00 62.17  ? 878  LEU A CG  1 
ATOM   5977 C  CD1 . LEU A 1 867 ? -12.118 49.543  16.940  1.00 69.03  ? 878  LEU A CD1 1 
ATOM   5978 C  CD2 . LEU A 1 867 ? -10.072 49.283  15.533  1.00 46.92  ? 878  LEU A CD2 1 
ATOM   5979 N  N   . PRO A 1 868 ? -13.771 45.493  14.116  1.00 67.58  ? 879  PRO A N   1 
ATOM   5980 C  CA  . PRO A 1 868 ? -14.463 46.691  13.635  1.00 67.12  ? 879  PRO A CA  1 
ATOM   5981 C  C   . PRO A 1 868 ? -15.956 46.692  13.955  1.00 64.33  ? 879  PRO A C   1 
ATOM   5982 O  O   . PRO A 1 868 ? -16.661 47.607  13.533  1.00 63.18  ? 879  PRO A O   1 
ATOM   5983 C  CB  . PRO A 1 868 ? -14.240 46.622  12.128  1.00 68.54  ? 879  PRO A CB  1 
ATOM   5984 C  CG  . PRO A 1 868 ? -14.273 45.152  11.844  1.00 66.26  ? 879  PRO A CG  1 
ATOM   5985 C  CD  . PRO A 1 868 ? -13.697 44.458  13.069  1.00 68.06  ? 879  PRO A CD  1 
ATOM   5986 N  N   . LEU A 1 869 ? -16.426 45.680  14.691  1.00 69.51  ? 880  LEU A N   1 
ATOM   5987 C  CA  . LEU A 1 869 ? -17.857 45.539  14.945  1.00 61.45  ? 880  LEU A CA  1 
ATOM   5988 C  C   . LEU A 1 869 ? -18.415 46.643  15.831  1.00 72.08  ? 880  LEU A C   1 
ATOM   5989 O  O   . LEU A 1 869 ? -19.632 46.859  15.830  1.00 83.49  ? 880  LEU A O   1 
ATOM   5990 C  CB  . LEU A 1 869 ? -18.155 44.182  15.584  1.00 70.26  ? 880  LEU A CB  1 
ATOM   5991 C  CG  . LEU A 1 869 ? -17.960 42.940  14.714  1.00 73.19  ? 880  LEU A CG  1 
ATOM   5992 C  CD1 . LEU A 1 869 ? -18.725 41.757  15.295  1.00 78.93  ? 880  LEU A CD1 1 
ATOM   5993 C  CD2 . LEU A 1 869 ? -18.384 43.212  13.279  1.00 52.37  ? 880  LEU A CD2 1 
ATOM   5994 N  N   . LEU A 1 870 ? -17.561 47.332  16.590  1.00 64.15  ? 881  LEU A N   1 
ATOM   5995 C  CA  . LEU A 1 870 ? -17.979 48.417  17.478  1.00 64.86  ? 881  LEU A CA  1 
ATOM   5996 C  C   . LEU A 1 870 ? -18.929 47.914  18.566  1.00 81.83  ? 881  LEU A C   1 
ATOM   5997 O  O   . LEU A 1 870 ? -20.035 48.429  18.746  1.00 89.41  ? 881  LEU A O   1 
ATOM   5998 C  CB  . LEU A 1 870 ? -18.610 49.569  16.690  1.00 51.76  ? 881  LEU A CB  1 
ATOM   5999 C  CG  . LEU A 1 870 ? -17.758 50.245  15.616  1.00 50.18  ? 881  LEU A CG  1 
ATOM   6000 C  CD1 . LEU A 1 870 ? -18.603 51.233  14.832  1.00 50.25  ? 881  LEU A CD1 1 
ATOM   6001 C  CD2 . LEU A 1 870 ? -16.554 50.940  16.231  1.00 49.63  ? 881  LEU A CD2 1 
ATOM   6002 N  N   . LYS A 1 871 ? -18.482 46.897  19.305  1.00 84.76  ? 882  LYS A N   1 
ATOM   6003 C  CA  . LYS A 1 871 ? -19.261 46.360  20.412  1.00 86.92  ? 882  LYS A CA  1 
ATOM   6004 C  C   . LYS A 1 871 ? -18.745 46.932  21.721  1.00 92.59  ? 882  LYS A C   1 
ATOM   6005 O  O   . LYS A 1 871 ? -17.548 46.788  22.016  1.00 97.12  ? 882  LYS A O   1 
ATOM   6006 C  CB  . LYS A 1 871 ? -19.187 44.837  20.439  1.00 57.97  ? 882  LYS A CB  1 
ATOM   6007 C  CG  . LYS A 1 871 ? -19.918 44.210  21.618  1.00 81.39  ? 882  LYS A CG  1 
ATOM   6008 C  CD  . LYS A 1 871 ? -19.892 42.690  21.560  1.00 84.34  ? 882  LYS A CD  1 
ATOM   6009 C  CE  . LYS A 1 871 ? -20.674 42.084  22.719  1.00 77.87  ? 882  LYS A CE  1 
ATOM   6010 N  NZ  . LYS A 1 871 ? -20.725 40.597  22.653  1.00 65.84  ? 882  LYS A NZ  1 
ATOM   6011 N  N   . PRO A 1 872 ? -19.589 47.590  22.525  1.00 91.29  ? 883  PRO A N   1 
ATOM   6012 C  CA  . PRO A 1 872 ? -19.131 48.094  23.828  1.00 95.10  ? 883  PRO A CA  1 
ATOM   6013 C  C   . PRO A 1 872 ? -18.646 46.977  24.738  1.00 96.05  ? 883  PRO A C   1 
ATOM   6014 O  O   . PRO A 1 872 ? -19.436 46.137  25.181  1.00 99.70  ? 883  PRO A O   1 
ATOM   6015 C  CB  . PRO A 1 872 ? -20.379 48.782  24.397  1.00 96.55  ? 883  PRO A CB  1 
ATOM   6016 C  CG  . PRO A 1 872 ? -21.206 49.120  23.198  1.00 94.85  ? 883  PRO A CG  1 
ATOM   6017 C  CD  . PRO A 1 872 ? -20.970 48.004  22.224  1.00 95.44  ? 883  PRO A CD  1 
ATOM   6018 N  N   . GLN A 1 873 ? -17.344 46.960  25.021  1.00 94.96  ? 884  GLN A N   1 
ATOM   6019 C  CA  . GLN A 1 873 ? -16.743 45.887  25.802  1.00 87.84  ? 884  GLN A CA  1 
ATOM   6020 C  C   . GLN A 1 873 ? -16.780 46.160  27.301  1.00 89.23  ? 884  GLN A C   1 
ATOM   6021 O  O   . GLN A 1 873 ? -16.967 45.229  28.092  1.00 97.76  ? 884  GLN A O   1 
ATOM   6022 C  CB  . GLN A 1 873 ? -15.298 45.657  25.350  1.00 80.54  ? 884  GLN A CB  1 
ATOM   6023 C  CG  . GLN A 1 873 ? -15.146 45.294  23.878  1.00 83.66  ? 884  GLN A CG  1 
ATOM   6024 C  CD  . GLN A 1 873 ? -15.662 43.903  23.555  1.00 82.14  ? 884  GLN A CD  1 
ATOM   6025 O  OE1 . GLN A 1 873 ? -16.866 43.693  23.404  1.00 95.75  ? 884  GLN A OE1 1 
ATOM   6026 N  NE2 . GLN A 1 873 ? -14.749 42.944  23.445  1.00 64.83  ? 884  GLN A NE2 1 
ATOM   6027 N  N   . VAL A 1 874 ? -16.607 47.416  27.712  1.00 88.54  ? 885  VAL A N   1 
ATOM   6028 C  CA  . VAL A 1 874 ? -16.601 47.768  29.128  1.00 89.87  ? 885  VAL A CA  1 
ATOM   6029 C  C   . VAL A 1 874 ? -16.866 49.262  29.251  1.00 85.51  ? 885  VAL A C   1 
ATOM   6030 O  O   . VAL A 1 874 ? -16.772 50.009  28.275  1.00 90.14  ? 885  VAL A O   1 
ATOM   6031 C  CB  . VAL A 1 874 ? -15.262 47.369  29.800  1.00 93.41  ? 885  VAL A CB  1 
ATOM   6032 C  CG1 . VAL A 1 874 ? -14.206 48.437  29.567  1.00 93.45  ? 885  VAL A CG1 1 
ATOM   6033 C  CG2 . VAL A 1 874 ? -15.462 47.100  31.284  1.00 102.66 ? 885  VAL A CG2 1 
ATOM   6034 N  N   . ARG A 1 875 ? -17.203 49.700  30.463  1.00 81.56  ? 886  ARG A N   1 
ATOM   6035 C  CA  . ARG A 1 875 ? -17.490 51.102  30.742  1.00 95.07  ? 886  ARG A CA  1 
ATOM   6036 C  C   . ARG A 1 875 ? -17.039 51.411  32.162  1.00 111.15 ? 886  ARG A C   1 
ATOM   6037 O  O   . ARG A 1 875 ? -17.324 50.642  33.085  1.00 121.54 ? 886  ARG A O   1 
ATOM   6038 C  CB  . ARG A 1 875 ? -18.982 51.403  30.571  1.00 94.87  ? 886  ARG A CB  1 
ATOM   6039 C  CG  . ARG A 1 875 ? -19.414 52.775  31.060  1.00 95.26  ? 886  ARG A CG  1 
ATOM   6040 C  CD  . ARG A 1 875 ? -20.593 52.658  32.013  1.00 107.88 ? 886  ARG A CD  1 
ATOM   6041 N  NE  . ARG A 1 875 ? -21.128 53.960  32.400  1.00 116.88 ? 886  ARG A NE  1 
ATOM   6042 C  CZ  . ARG A 1 875 ? -22.151 54.555  31.794  1.00 126.28 ? 886  ARG A CZ  1 
ATOM   6043 N  NH1 . ARG A 1 875 ? -22.753 53.965  30.771  1.00 123.32 ? 886  ARG A NH1 1 
ATOM   6044 N  NH2 . ARG A 1 875 ? -22.573 55.740  32.213  1.00 130.21 ? 886  ARG A NH2 1 
ATOM   6045 N  N   . TYR A 1 876 ? -16.344 52.530  32.334  1.00 115.37 ? 887  TYR A N   1 
ATOM   6046 C  CA  . TYR A 1 876 ? -15.744 52.897  33.610  1.00 98.02  ? 887  TYR A CA  1 
ATOM   6047 C  C   . TYR A 1 876 ? -16.234 54.278  34.047  1.00 90.54  ? 887  TYR A C   1 
ATOM   6048 O  O   . TYR A 1 876 ? -17.156 54.850  33.461  1.00 103.29 ? 887  TYR A O   1 
ATOM   6049 C  CB  . TYR A 1 876 ? -14.219 52.839  33.505  1.00 91.39  ? 887  TYR A CB  1 
ATOM   6050 C  CG  . TYR A 1 876 ? -13.691 51.441  33.290  1.00 95.52  ? 887  TYR A CG  1 
ATOM   6051 C  CD1 . TYR A 1 876 ? -14.230 50.364  33.979  1.00 97.23  ? 887  TYR A CD1 1 
ATOM   6052 C  CD2 . TYR A 1 876 ? -12.663 51.196  32.389  1.00 97.57  ? 887  TYR A CD2 1 
ATOM   6053 C  CE1 . TYR A 1 876 ? -13.755 49.083  33.787  1.00 104.71 ? 887  TYR A CE1 1 
ATOM   6054 C  CE2 . TYR A 1 876 ? -12.179 49.917  32.190  1.00 101.48 ? 887  TYR A CE2 1 
ATOM   6055 C  CZ  . TYR A 1 876 ? -12.730 48.865  32.892  1.00 112.81 ? 887  TYR A CZ  1 
ATOM   6056 O  OH  . TYR A 1 876 ? -12.257 47.589  32.698  1.00 126.73 ? 887  TYR A OH  1 
ATOM   6057 N  N   . SER A 1 877 ? -15.603 54.812  35.102  1.00 79.56  ? 888  SER A N   1 
ATOM   6058 C  CA  . SER A 1 877 ? -15.970 56.114  35.662  1.00 87.06  ? 888  SER A CA  1 
ATOM   6059 C  C   . SER A 1 877 ? -14.706 56.731  36.271  1.00 102.31 ? 888  SER A C   1 
ATOM   6060 O  O   . SER A 1 877 ? -14.453 56.657  37.476  1.00 112.32 ? 888  SER A O   1 
ATOM   6061 C  CB  . SER A 1 877 ? -17.088 55.997  36.697  1.00 87.72  ? 888  SER A CB  1 
ATOM   6062 O  OG  . SER A 1 877 ? -17.374 57.255  37.283  1.00 91.79  ? 888  SER A OG  1 
ATOM   6063 N  N   . CYS A 1 878 ? -13.901 57.358  35.412  1.00 117.30 ? 889  CYS A N   1 
ATOM   6064 C  CA  . CYS A 1 878 ? -12.648 57.957  35.861  1.00 126.41 ? 889  CYS A CA  1 
ATOM   6065 C  C   . CYS A 1 878 ? -12.881 59.324  36.496  1.00 126.65 ? 889  CYS A C   1 
ATOM   6066 O  O   . CYS A 1 878 ? -12.623 59.520  37.689  1.00 143.74 ? 889  CYS A O   1 
ATOM   6067 C  CB  . CYS A 1 878 ? -11.670 58.069  34.689  1.00 125.69 ? 889  CYS A CB  1 
ATOM   6068 S  SG  . CYS A 1 878 ? -11.169 56.484  33.986  1.00 128.25 ? 889  CYS A SG  1 
ATOM   6069 N  N   . ILE A 1 879 ? -13.367 60.279  35.712  1.00 106.20 ? 890  ILE A N   1 
ATOM   6070 C  CA  . ILE A 1 879 ? -13.539 61.649  36.168  1.00 94.03  ? 890  ILE A CA  1 
ATOM   6071 C  C   . ILE A 1 879 ? -15.021 61.916  36.396  1.00 92.76  ? 890  ILE A C   1 
ATOM   6072 O  O   . ILE A 1 879 ? -15.897 61.248  35.837  1.00 100.66 ? 890  ILE A O   1 
ATOM   6073 C  CB  . ILE A 1 879 ? -12.944 62.659  35.164  1.00 79.39  ? 890  ILE A CB  1 
ATOM   6074 C  CG1 . ILE A 1 879 ? -11.694 62.075  34.505  1.00 69.58  ? 890  ILE A CG1 1 
ATOM   6075 C  CG2 . ILE A 1 879 ? -12.590 63.962  35.857  1.00 98.32  ? 890  ILE A CG2 1 
ATOM   6076 C  CD1 . ILE A 1 879 ? -11.069 62.983  33.471  1.00 59.05  ? 890  ILE A CD1 1 
ATOM   6077 N  N   . ARG A 1 880 ? -15.300 62.903  37.242  1.00 88.99  ? 891  ARG A N   1 
ATOM   6078 C  CA  . ARG A 1 880 ? -16.667 63.343  37.463  1.00 96.54  ? 891  ARG A CA  1 
ATOM   6079 C  C   . ARG A 1 880 ? -17.132 64.220  36.302  1.00 103.39 ? 891  ARG A C   1 
ATOM   6080 O  O   . ARG A 1 880 ? -16.345 64.650  35.454  1.00 111.74 ? 891  ARG A O   1 
ATOM   6081 C  CB  . ARG A 1 880 ? -16.780 64.100  38.785  1.00 112.43 ? 891  ARG A CB  1 
ATOM   6082 C  CG  . ARG A 1 880 ? -16.278 63.332  40.000  1.00 122.56 ? 891  ARG A CG  1 
ATOM   6083 C  CD  . ARG A 1 880 ? -17.077 62.058  40.231  1.00 127.16 ? 891  ARG A CD  1 
ATOM   6084 N  NE  . ARG A 1 880 ? -16.761 61.445  41.520  1.00 126.07 ? 891  ARG A NE  1 
ATOM   6085 C  CZ  . ARG A 1 880 ? -15.784 60.565  41.711  1.00 121.58 ? 891  ARG A CZ  1 
ATOM   6086 N  NH1 . ARG A 1 880 ? -15.020 60.187  40.696  1.00 116.71 ? 891  ARG A NH1 1 
ATOM   6087 N  NH2 . ARG A 1 880 ? -15.571 60.061  42.920  1.00 121.15 ? 891  ARG A NH2 1 
ATOM   6088 N  N   . ARG A 1 881 ? -18.439 64.489  36.272  1.00 97.47  ? 892  ARG A N   1 
ATOM   6089 C  CA  . ARG A 1 881 ? -19.012 65.284  35.190  1.00 91.32  ? 892  ARG A CA  1 
ATOM   6090 C  C   . ARG A 1 881 ? -18.686 66.765  35.346  1.00 90.83  ? 892  ARG A C   1 
ATOM   6091 O  O   . ARG A 1 881 ? -18.454 67.460  34.350  1.00 89.17  ? 892  ARG A O   1 
ATOM   6092 C  CB  . ARG A 1 881 ? -20.524 65.073  35.136  1.00 81.52  ? 892  ARG A CB  1 
ATOM   6093 C  CG  . ARG A 1 881 ? -20.934 63.624  35.330  1.00 75.99  ? 892  ARG A CG  1 
ATOM   6094 C  CD  . ARG A 1 881 ? -22.413 63.410  35.085  1.00 92.53  ? 892  ARG A CD  1 
ATOM   6095 N  NE  . ARG A 1 881 ? -22.779 62.008  35.267  1.00 97.58  ? 892  ARG A NE  1 
ATOM   6096 C  CZ  . ARG A 1 881 ? -23.992 61.517  35.039  1.00 112.24 ? 892  ARG A CZ  1 
ATOM   6097 N  NH1 . ARG A 1 881 ? -24.964 62.313  34.617  1.00 119.81 ? 892  ARG A NH1 1 
ATOM   6098 N  NH2 . ARG A 1 881 ? -24.233 60.227  35.232  1.00 118.77 ? 892  ARG A NH2 1 
ATOM   6099 N  N   . GLU A 1 882 ? -18.659 67.262  36.583  1.00 97.81  ? 893  GLU A N   1 
ATOM   6100 C  CA  . GLU A 1 882 ? -18.379 68.670  36.837  1.00 98.37  ? 893  GLU A CA  1 
ATOM   6101 C  C   . GLU A 1 882 ? -16.908 69.025  36.670  1.00 98.71  ? 893  GLU A C   1 
ATOM   6102 O  O   . GLU A 1 882 ? -16.578 70.216  36.639  1.00 103.09 ? 893  GLU A O   1 
ATOM   6103 C  CB  . GLU A 1 882 ? -18.846 69.053  38.245  1.00 103.80 ? 893  GLU A CB  1 
ATOM   6104 C  CG  . GLU A 1 882 ? -18.323 68.152  39.361  1.00 112.37 ? 893  GLU A CG  1 
ATOM   6105 C  CD  . GLU A 1 882 ? -19.147 66.885  39.537  1.00 124.83 ? 893  GLU A CD  1 
ATOM   6106 O  OE1 . GLU A 1 882 ? -20.099 66.676  38.755  1.00 128.41 ? 893  GLU A OE1 1 
ATOM   6107 O  OE2 . GLU A 1 882 ? -18.842 66.099  40.459  1.00 127.76 ? 893  GLU A OE2 1 
ATOM   6108 N  N   . ASP A 1 883 ? -16.022 68.035  36.560  1.00 93.43  ? 894  ASP A N   1 
ATOM   6109 C  CA  . ASP A 1 883 ? -14.590 68.289  36.396  1.00 95.04  ? 894  ASP A CA  1 
ATOM   6110 C  C   . ASP A 1 883 ? -14.279 68.489  34.911  1.00 97.04  ? 894  ASP A C   1 
ATOM   6111 O  O   . ASP A 1 883 ? -13.650 67.662  34.247  1.00 66.25  ? 894  ASP A O   1 
ATOM   6112 C  CB  . ASP A 1 883 ? -13.777 67.150  37.000  1.00 92.50  ? 894  ASP A CB  1 
ATOM   6113 C  CG  . ASP A 1 883 ? -12.317 67.517  37.217  1.00 96.78  ? 894  ASP A CG  1 
ATOM   6114 O  OD1 . ASP A 1 883 ? -11.802 68.406  36.507  1.00 99.32  ? 894  ASP A OD1 1 
ATOM   6115 O  OD2 . ASP A 1 883 ? -11.680 66.910  38.104  1.00 94.97  ? 894  ASP A OD2 1 
ATOM   6116 N  N   . VAL A 1 884 ? -14.741 69.630  34.395  1.00 100.25 ? 895  VAL A N   1 
ATOM   6117 C  CA  . VAL A 1 884 ? -14.515 69.955  32.991  1.00 80.77  ? 895  VAL A CA  1 
ATOM   6118 C  C   . VAL A 1 884 ? -13.060 70.338  32.751  1.00 89.43  ? 895  VAL A C   1 
ATOM   6119 O  O   . VAL A 1 884 ? -12.504 70.056  31.682  1.00 104.64 ? 895  VAL A O   1 
ATOM   6120 C  CB  . VAL A 1 884 ? -15.480 71.069  32.545  1.00 71.14  ? 895  VAL A CB  1 
ATOM   6121 C  CG1 . VAL A 1 884 ? -15.213 71.471  31.102  1.00 70.14  ? 895  VAL A CG1 1 
ATOM   6122 C  CG2 . VAL A 1 884 ? -16.922 70.616  32.714  1.00 72.91  ? 895  VAL A CG2 1 
ATOM   6123 N  N   . SER A 1 885 ? -12.417 70.973  33.734  1.00 94.44  ? 896  SER A N   1 
ATOM   6124 C  CA  . SER A 1 885 ? -11.024 71.379  33.574  1.00 90.18  ? 896  SER A CA  1 
ATOM   6125 C  C   . SER A 1 885 ? -10.117 70.170  33.384  1.00 92.12  ? 896  SER A C   1 
ATOM   6126 O  O   . SER A 1 885 ? -9.255  70.157  32.498  1.00 90.11  ? 896  SER A O   1 
ATOM   6127 C  CB  . SER A 1 885 ? -10.576 72.203  34.783  1.00 86.33  ? 896  SER A CB  1 
ATOM   6128 O  OG  . SER A 1 885 ? -11.406 73.335  34.970  1.00 91.70  ? 896  SER A OG  1 
ATOM   6129 N  N   . GLY A 1 886 ? -10.300 69.137  34.211  1.00 97.61  ? 897  GLY A N   1 
ATOM   6130 C  CA  . GLY A 1 886 ? -9.464  67.955  34.105  1.00 98.40  ? 897  GLY A CA  1 
ATOM   6131 C  C   . GLY A 1 886 ? -9.825  67.046  32.951  1.00 93.84  ? 897  GLY A C   1 
ATOM   6132 O  O   . GLY A 1 886 ? -8.942  66.421  32.357  1.00 98.62  ? 897  GLY A O   1 
ATOM   6133 N  N   . ILE A 1 887 ? -11.114 66.959  32.613  1.00 89.68  ? 898  ILE A N   1 
ATOM   6134 C  CA  . ILE A 1 887 ? -11.538 66.084  31.527  1.00 95.69  ? 898  ILE A CA  1 
ATOM   6135 C  C   . ILE A 1 887 ? -11.113 66.629  30.170  1.00 90.82  ? 898  ILE A C   1 
ATOM   6136 O  O   . ILE A 1 887 ? -11.000 65.861  29.207  1.00 93.94  ? 898  ILE A O   1 
ATOM   6137 C  CB  . ILE A 1 887 ? -13.062 65.864  31.580  1.00 85.60  ? 898  ILE A CB  1 
ATOM   6138 C  CG1 . ILE A 1 887 ? -13.449 64.588  30.835  1.00 78.18  ? 898  ILE A CG1 1 
ATOM   6139 C  CG2 . ILE A 1 887 ? -13.803 67.050  30.986  1.00 85.50  ? 898  ILE A CG2 1 
ATOM   6140 C  CD1 . ILE A 1 887 ? -14.935 64.346  30.803  1.00 62.39  ? 898  ILE A CD1 1 
ATOM   6141 N  N   . ALA A 1 888 ? -10.866 67.937  30.066  1.00 92.40  ? 899  ALA A N   1 
ATOM   6142 C  CA  . ALA A 1 888 ? -10.386 68.503  28.811  1.00 96.79  ? 899  ALA A CA  1 
ATOM   6143 C  C   . ALA A 1 888 ? -8.909  68.201  28.598  1.00 80.69  ? 899  ALA A C   1 
ATOM   6144 O  O   . ALA A 1 888 ? -8.474  67.983  27.461  1.00 78.10  ? 899  ALA A O   1 
ATOM   6145 C  CB  . ALA A 1 888 ? -10.635 70.011  28.783  1.00 105.66 ? 899  ALA A CB  1 
ATOM   6146 N  N   . SER A 1 889 ? -8.126  68.184  29.675  1.00 70.07  ? 900  SER A N   1 
ATOM   6147 C  CA  . SER A 1 889 ? -6.714  67.820  29.602  1.00 77.05  ? 900  SER A CA  1 
ATOM   6148 C  C   . SER A 1 889 ? -6.522  66.412  30.165  1.00 65.06  ? 900  SER A C   1 
ATOM   6149 O  O   . SER A 1 889 ? -5.956  66.197  31.237  1.00 69.68  ? 900  SER A O   1 
ATOM   6150 C  CB  . SER A 1 889 ? -5.859  68.849  30.338  1.00 86.13  ? 900  SER A CB  1 
ATOM   6151 O  OG  . SER A 1 889 ? -5.758  70.052  29.595  1.00 83.23  ? 900  SER A OG  1 
ATOM   6152 N  N   . CYS A 1 890 ? -7.029  65.444  29.406  1.00 66.94  ? 901  CYS A N   1 
ATOM   6153 C  CA  . CYS A 1 890 ? -6.858  64.029  29.698  1.00 61.03  ? 901  CYS A CA  1 
ATOM   6154 C  C   . CYS A 1 890 ? -6.292  63.340  28.467  1.00 66.92  ? 901  CYS A C   1 
ATOM   6155 O  O   . CYS A 1 890 ? -6.749  63.582  27.346  1.00 85.60  ? 901  CYS A O   1 
ATOM   6156 C  CB  . CYS A 1 890 ? -8.180  63.372  30.106  1.00 55.57  ? 901  CYS A CB  1 
ATOM   6157 S  SG  . CYS A 1 890 ? -8.079  61.580  30.297  1.00 53.53  ? 901  CYS A SG  1 
ATOM   6158 N  N   . VAL A 1 891 ? -5.298  62.481  28.678  1.00 60.02  ? 902  VAL A N   1 
ATOM   6159 C  CA  . VAL A 1 891 ? -4.562  61.851  27.590  1.00 49.78  ? 902  VAL A CA  1 
ATOM   6160 C  C   . VAL A 1 891 ? -4.561  60.341  27.797  1.00 88.04  ? 902  VAL A C   1 
ATOM   6161 O  O   . VAL A 1 891 ? -4.516  59.860  28.935  1.00 49.64  ? 902  VAL A O   1 
ATOM   6162 C  CB  . VAL A 1 891 ? -3.122  62.406  27.496  1.00 49.34  ? 902  VAL A CB  1 
ATOM   6163 C  CG1 . VAL A 1 891 ? -2.343  62.116  28.774  1.00 49.28  ? 902  VAL A CG1 1 
ATOM   6164 C  CG2 . VAL A 1 891 ? -2.401  61.856  26.271  1.00 56.75  ? 902  VAL A CG2 1 
ATOM   6165 N  N   . PHE A 1 892 ? -4.633  59.598  26.696  1.00 60.61  ? 903  PHE A N   1 
ATOM   6166 C  CA  . PHE A 1 892 ? -4.566  58.145  26.709  1.00 53.96  ? 903  PHE A CA  1 
ATOM   6167 C  C   . PHE A 1 892 ? -3.192  57.668  26.253  1.00 63.76  ? 903  PHE A C   1 
ATOM   6168 O  O   . PHE A 1 892 ? -2.345  58.447  25.809  1.00 81.68  ? 903  PHE A O   1 
ATOM   6169 C  CB  . PHE A 1 892 ? -5.649  57.542  25.809  1.00 69.42  ? 903  PHE A CB  1 
ATOM   6170 C  CG  . PHE A 1 892 ? -7.035  57.640  26.370  1.00 76.85  ? 903  PHE A CG  1 
ATOM   6171 C  CD1 . PHE A 1 892 ? -7.902  58.629  25.939  1.00 91.97  ? 903  PHE A CD1 1 
ATOM   6172 C  CD2 . PHE A 1 892 ? -7.475  56.738  27.323  1.00 75.40  ? 903  PHE A CD2 1 
ATOM   6173 C  CE1 . PHE A 1 892 ? -9.180  58.720  26.450  1.00 96.12  ? 903  PHE A CE1 1 
ATOM   6174 C  CE2 . PHE A 1 892 ? -8.753  56.824  27.839  1.00 83.16  ? 903  PHE A CE2 1 
ATOM   6175 C  CZ  . PHE A 1 892 ? -9.606  57.816  27.401  1.00 89.59  ? 903  PHE A CZ  1 
ATOM   6176 N  N   . THR A 1 893 ? -2.980  56.358  26.366  1.00 59.99  ? 904  THR A N   1 
ATOM   6177 C  CA  . THR A 1 893 ? -1.778  55.702  25.873  1.00 64.97  ? 904  THR A CA  1 
ATOM   6178 C  C   . THR A 1 893 ? -2.179  54.552  24.959  1.00 70.42  ? 904  THR A C   1 
ATOM   6179 O  O   . THR A 1 893 ? -3.354  54.187  24.861  1.00 65.02  ? 904  THR A O   1 
ATOM   6180 C  CB  . THR A 1 893 ? -0.899  55.178  27.017  1.00 60.66  ? 904  THR A CB  1 
ATOM   6181 O  OG1 . THR A 1 893 ? -1.500  54.006  27.581  1.00 80.78  ? 904  THR A OG1 1 
ATOM   6182 C  CG2 . THR A 1 893 ? -0.739  56.232  28.103  1.00 55.80  ? 904  THR A CG2 1 
ATOM   6183 N  N   . LYS A 1 894 ? -1.179  53.974  24.288  1.00 81.89  ? 905  LYS A N   1 
ATOM   6184 C  CA  . LYS A 1 894 ? -1.446  52.863  23.379  1.00 95.34  ? 905  LYS A CA  1 
ATOM   6185 C  C   . LYS A 1 894 ? -1.959  51.641  24.130  1.00 93.05  ? 905  LYS A C   1 
ATOM   6186 O  O   . LYS A 1 894 ? -2.855  50.937  23.649  1.00 75.73  ? 905  LYS A O   1 
ATOM   6187 C  CB  . LYS A 1 894 ? -0.182  52.497  22.600  1.00 104.14 ? 905  LYS A CB  1 
ATOM   6188 C  CG  . LYS A 1 894 ? 0.482   53.638  21.856  1.00 122.70 ? 905  LYS A CG  1 
ATOM   6189 C  CD  . LYS A 1 894 ? 1.780   53.160  21.218  1.00 137.47 ? 905  LYS A CD  1 
ATOM   6190 C  CE  . LYS A 1 894 ? 2.534   54.297  20.552  1.00 147.97 ? 905  LYS A CE  1 
ATOM   6191 N  NZ  . LYS A 1 894 ? 1.769   54.876  19.416  1.00 155.92 ? 905  LYS A NZ  1 
ATOM   6192 N  N   . TYR A 1 895 ? -1.405  51.372  25.310  1.00 88.03  ? 906  TYR A N   1 
ATOM   6193 C  CA  . TYR A 1 895 ? -1.606  50.109  26.010  1.00 73.16  ? 906  TYR A CA  1 
ATOM   6194 C  C   . TYR A 1 895 ? -2.514  50.257  27.229  1.00 63.09  ? 906  TYR A C   1 
ATOM   6195 O  O   . TYR A 1 895 ? -2.312  49.608  28.256  1.00 60.66  ? 906  TYR A O   1 
ATOM   6196 C  CB  . TYR A 1 895 ? -0.260  49.508  26.408  1.00 65.43  ? 906  TYR A CB  1 
ATOM   6197 C  CG  . TYR A 1 895 ? 0.658   49.266  25.227  1.00 61.36  ? 906  TYR A CG  1 
ATOM   6198 C  CD1 . TYR A 1 895 ? 1.529   50.254  24.783  1.00 62.88  ? 906  TYR A CD1 1 
ATOM   6199 C  CD2 . TYR A 1 895 ? 0.647   48.052  24.552  1.00 50.09  ? 906  TYR A CD2 1 
ATOM   6200 C  CE1 . TYR A 1 895 ? 2.364   50.038  23.701  1.00 67.66  ? 906  TYR A CE1 1 
ATOM   6201 C  CE2 . TYR A 1 895 ? 1.479   47.827  23.470  1.00 50.11  ? 906  TYR A CE2 1 
ATOM   6202 C  CZ  . TYR A 1 895 ? 2.335   48.822  23.049  1.00 57.95  ? 906  TYR A CZ  1 
ATOM   6203 O  OH  . TYR A 1 895 ? 3.164   48.600  21.972  1.00 54.66  ? 906  TYR A OH  1 
ATOM   6204 N  N   . GLY A 1 896 ? -3.528  51.109  27.124  1.00 64.53  ? 907  GLY A N   1 
ATOM   6205 C  CA  . GLY A 1 896 ? -4.555  51.181  28.148  1.00 71.85  ? 907  GLY A CA  1 
ATOM   6206 C  C   . GLY A 1 896 ? -4.173  51.909  29.417  1.00 69.66  ? 907  GLY A C   1 
ATOM   6207 O  O   . GLY A 1 896 ? -4.537  51.467  30.515  1.00 70.02  ? 907  GLY A O   1 
ATOM   6208 N  N   . GLN A 1 897 ? -3.454  53.022  29.303  1.00 69.99  ? 908  GLN A N   1 
ATOM   6209 C  CA  . GLN A 1 897 ? -3.101  53.845  30.449  1.00 66.40  ? 908  GLN A CA  1 
ATOM   6210 C  C   . GLN A 1 897 ? -3.515  55.282  30.162  1.00 75.02  ? 908  GLN A C   1 
ATOM   6211 O  O   . GLN A 1 897 ? -3.771  55.655  29.014  1.00 75.62  ? 908  GLN A O   1 
ATOM   6212 C  CB  . GLN A 1 897 ? -1.599  53.755  30.761  1.00 66.15  ? 908  GLN A CB  1 
ATOM   6213 C  CG  . GLN A 1 897 ? -1.247  53.944  32.227  1.00 76.30  ? 908  GLN A CG  1 
ATOM   6214 C  CD  . GLN A 1 897 ? 0.117   53.379  32.572  1.00 83.12  ? 908  GLN A CD  1 
ATOM   6215 O  OE1 . GLN A 1 897 ? 0.615   53.562  33.682  1.00 84.58  ? 908  GLN A OE1 1 
ATOM   6216 N  NE2 . GLN A 1 897 ? 0.726   52.682  31.620  1.00 86.35  ? 908  GLN A NE2 1 
ATOM   6217 N  N   . GLY A 1 898 ? -3.593  56.090  31.215  1.00 82.63  ? 909  GLY A N   1 
ATOM   6218 C  CA  . GLY A 1 898 ? -4.075  57.448  31.048  1.00 83.33  ? 909  GLY A CA  1 
ATOM   6219 C  C   . GLY A 1 898 ? -3.582  58.381  32.128  1.00 69.67  ? 909  GLY A C   1 
ATOM   6220 O  O   . GLY A 1 898 ? -3.146  57.956  33.202  1.00 54.83  ? 909  GLY A O   1 
ATOM   6221 N  N   . PHE A 1 899 ? -3.662  59.676  31.821  1.00 69.88  ? 910  PHE A N   1 
ATOM   6222 C  CA  . PHE A 1 899 ? -3.296  60.744  32.739  1.00 58.80  ? 910  PHE A CA  1 
ATOM   6223 C  C   . PHE A 1 899 ? -4.321  61.861  32.629  1.00 56.43  ? 910  PHE A C   1 
ATOM   6224 O  O   . PHE A 1 899 ? -4.770  62.192  31.528  1.00 60.06  ? 910  PHE A O   1 
ATOM   6225 C  CB  . PHE A 1 899 ? -1.900  61.307  32.434  1.00 55.17  ? 910  PHE A CB  1 
ATOM   6226 C  CG  . PHE A 1 899 ? -0.790  60.309  32.584  1.00 60.17  ? 910  PHE A CG  1 
ATOM   6227 C  CD1 . PHE A 1 899 ? -0.055  60.243  33.756  1.00 61.93  ? 910  PHE A CD1 1 
ATOM   6228 C  CD2 . PHE A 1 899 ? -0.471  59.446  31.549  1.00 67.94  ? 910  PHE A CD2 1 
ATOM   6229 C  CE1 . PHE A 1 899 ? 0.971   59.331  33.895  1.00 67.56  ? 910  PHE A CE1 1 
ATOM   6230 C  CE2 . PHE A 1 899 ? 0.552   58.531  31.684  1.00 81.88  ? 910  PHE A CE2 1 
ATOM   6231 C  CZ  . PHE A 1 899 ? 1.275   58.474  32.857  1.00 82.58  ? 910  PHE A CZ  1 
ATOM   6232 N  N   . TYR A 1 900 ? -4.688  62.441  33.770  1.00 52.94  ? 911  TYR A N   1 
ATOM   6233 C  CA  . TYR A 1 900 ? -5.556  63.609  33.773  1.00 59.55  ? 911  TYR A CA  1 
ATOM   6234 C  C   . TYR A 1 900 ? -5.250  64.447  35.005  1.00 61.10  ? 911  TYR A C   1 
ATOM   6235 O  O   . TYR A 1 900 ? -4.716  63.953  36.002  1.00 54.91  ? 911  TYR A O   1 
ATOM   6236 C  CB  . TYR A 1 900 ? -7.041  63.221  33.720  1.00 59.34  ? 911  TYR A CB  1 
ATOM   6237 C  CG  . TYR A 1 900 ? -7.647  62.811  35.044  1.00 62.65  ? 911  TYR A CG  1 
ATOM   6238 C  CD1 . TYR A 1 900 ? -8.414  63.704  35.783  1.00 61.39  ? 911  TYR A CD1 1 
ATOM   6239 C  CD2 . TYR A 1 900 ? -7.466  61.530  35.548  1.00 56.22  ? 911  TYR A CD2 1 
ATOM   6240 C  CE1 . TYR A 1 900 ? -8.976  63.335  36.991  1.00 62.74  ? 911  TYR A CE1 1 
ATOM   6241 C  CE2 . TYR A 1 900 ? -8.025  61.151  36.755  1.00 58.44  ? 911  TYR A CE2 1 
ATOM   6242 C  CZ  . TYR A 1 900 ? -8.779  62.058  37.472  1.00 66.97  ? 911  TYR A CZ  1 
ATOM   6243 O  OH  . TYR A 1 900 ? -9.337  61.686  38.674  1.00 83.46  ? 911  TYR A OH  1 
ATOM   6244 N  N   . LEU A 1 901 ? -5.593  65.730  34.920  1.00 56.03  ? 912  LEU A N   1 
ATOM   6245 C  CA  . LEU A 1 901 ? -5.240  66.701  35.948  1.00 56.96  ? 912  LEU A CA  1 
ATOM   6246 C  C   . LEU A 1 901 ? -6.306  66.729  37.036  1.00 68.65  ? 912  LEU A C   1 
ATOM   6247 O  O   . LEU A 1 901 ? -7.478  67.008  36.758  1.00 101.73 ? 912  LEU A O   1 
ATOM   6248 C  CB  . LEU A 1 901 ? -5.070  68.091  35.336  1.00 57.53  ? 912  LEU A CB  1 
ATOM   6249 C  CG  . LEU A 1 901 ? -3.868  68.311  34.415  1.00 56.24  ? 912  LEU A CG  1 
ATOM   6250 C  CD1 . LEU A 1 901 ? -3.941  69.678  33.759  1.00 57.27  ? 912  LEU A CD1 1 
ATOM   6251 C  CD2 . LEU A 1 901 ? -2.572  68.163  35.192  1.00 70.98  ? 912  LEU A CD2 1 
ATOM   6252 N  N   . ILE A 1 902 ? -5.897  66.437  38.274  1.00 58.91  ? 913  ILE A N   1 
ATOM   6253 C  CA  . ILE A 1 902 ? -6.748  66.683  39.435  1.00 81.17  ? 913  ILE A CA  1 
ATOM   6254 C  C   . ILE A 1 902 ? -6.558  68.086  39.987  1.00 79.37  ? 913  ILE A C   1 
ATOM   6255 O  O   . ILE A 1 902 ? -7.382  68.547  40.792  1.00 64.05  ? 913  ILE A O   1 
ATOM   6256 C  CB  . ILE A 1 902 ? -6.480  65.648  40.545  1.00 60.77  ? 913  ILE A CB  1 
ATOM   6257 C  CG1 . ILE A 1 902 ? -4.985  65.585  40.859  1.00 59.28  ? 913  ILE A CG1 1 
ATOM   6258 C  CG2 . ILE A 1 902 ? -6.999  64.283  40.135  1.00 60.35  ? 913  ILE A CG2 1 
ATOM   6259 C  CD1 . ILE A 1 902 ? -4.620  64.536  41.883  1.00 59.17  ? 913  ILE A CD1 1 
ATOM   6260 N  N   . SER A 1 903 ? -5.500  68.776  39.581  1.00 75.53  ? 914  SER A N   1 
ATOM   6261 C  CA  . SER A 1 903 ? -5.245  70.154  39.973  1.00 73.36  ? 914  SER A CA  1 
ATOM   6262 C  C   . SER A 1 903 ? -4.286  70.745  38.953  1.00 61.20  ? 914  SER A C   1 
ATOM   6263 O  O   . SER A 1 903 ? -3.696  70.007  38.151  1.00 73.63  ? 914  SER A O   1 
ATOM   6264 C  CB  . SER A 1 903 ? -4.662  70.233  41.397  1.00 62.66  ? 914  SER A CB  1 
ATOM   6265 O  OG  . SER A 1 903 ? -3.362  69.673  41.456  1.00 60.77  ? 914  SER A OG  1 
ATOM   6266 N  N   . PRO A 1 904 ? -4.103  72.070  38.947  1.00 62.40  ? 915  PRO A N   1 
ATOM   6267 C  CA  . PRO A 1 904 ? -3.101  72.651  38.036  1.00 61.59  ? 915  PRO A CA  1 
ATOM   6268 C  C   . PRO A 1 904 ? -1.701  72.052  38.189  1.00 59.73  ? 915  PRO A C   1 
ATOM   6269 O  O   . PRO A 1 904 ? -0.884  72.183  37.270  1.00 58.84  ? 915  PRO A O   1 
ATOM   6270 C  CB  . PRO A 1 904 ? -3.114  74.141  38.407  1.00 63.59  ? 915  PRO A CB  1 
ATOM   6271 C  CG  . PRO A 1 904 ? -4.471  74.386  38.933  1.00 81.07  ? 915  PRO A CG  1 
ATOM   6272 C  CD  . PRO A 1 904 ? -4.876  73.117  39.644  1.00 87.53  ? 915  PRO A CD  1 
ATOM   6273 N  N   . SER A 1 905 ? -1.409  71.373  39.305  1.00 59.26  ? 916  SER A N   1 
ATOM   6274 C  CA  . SER A 1 905 ? -0.061  70.903  39.602  1.00 57.80  ? 916  SER A CA  1 
ATOM   6275 C  C   . SER A 1 905 ? 0.101   69.389  39.612  1.00 56.34  ? 916  SER A C   1 
ATOM   6276 O  O   . SER A 1 905 ? 1.242   68.916  39.597  1.00 55.12  ? 916  SER A O   1 
ATOM   6277 C  CB  . SER A 1 905 ? 0.403   71.448  40.964  1.00 58.54  ? 916  SER A CB  1 
ATOM   6278 O  OG  . SER A 1 905 ? 1.575   70.799  41.427  1.00 90.44  ? 916  SER A OG  1 
ATOM   6279 N  N   . GLU A 1 906 ? -0.989  68.621  39.625  1.00 56.62  ? 917  GLU A N   1 
ATOM   6280 C  CA  . GLU A 1 906 ? -0.927  67.181  39.836  1.00 55.67  ? 917  GLU A CA  1 
ATOM   6281 C  C   . GLU A 1 906 ? -1.605  66.434  38.697  1.00 55.16  ? 917  GLU A C   1 
ATOM   6282 O  O   . GLU A 1 906 ? -2.703  66.801  38.267  1.00 71.66  ? 917  GLU A O   1 
ATOM   6283 C  CB  . GLU A 1 906 ? -1.588  66.787  41.160  1.00 64.09  ? 917  GLU A CB  1 
ATOM   6284 C  CG  . GLU A 1 906 ? -1.120  67.593  42.357  1.00 78.47  ? 917  GLU A CG  1 
ATOM   6285 C  CD  . GLU A 1 906 ? -1.777  67.154  43.652  1.00 85.96  ? 917  GLU A CD  1 
ATOM   6286 O  OE1 . GLU A 1 906 ? -1.734  65.946  43.964  1.00 88.96  ? 917  GLU A OE1 1 
ATOM   6287 O  OE2 . GLU A 1 906 ? -2.344  68.017  44.354  1.00 83.15  ? 917  GLU A OE2 1 
ATOM   6288 N  N   . PHE A 1 907 ? -0.939  65.385  38.222  1.00 65.56  ? 918  PHE A N   1 
ATOM   6289 C  CA  . PHE A 1 907 ? -1.515  64.396  37.324  1.00 55.59  ? 918  PHE A CA  1 
ATOM   6290 C  C   . PHE A 1 907 ? -1.906  63.160  38.123  1.00 55.91  ? 918  PHE A C   1 
ATOM   6291 O  O   . PHE A 1 907 ? -1.146  62.702  38.983  1.00 57.77  ? 918  PHE A O   1 
ATOM   6292 C  CB  . PHE A 1 907 ? -0.516  63.991  36.236  1.00 51.93  ? 918  PHE A CB  1 
ATOM   6293 C  CG  . PHE A 1 907 ? -0.557  64.848  35.003  1.00 55.86  ? 918  PHE A CG  1 
ATOM   6294 C  CD1 . PHE A 1 907 ? -1.630  64.781  34.132  1.00 68.86  ? 918  PHE A CD1 1 
ATOM   6295 C  CD2 . PHE A 1 907 ? 0.499   65.689  34.693  1.00 55.75  ? 918  PHE A CD2 1 
ATOM   6296 C  CE1 . PHE A 1 907 ? -1.662  65.556  32.986  1.00 67.85  ? 918  PHE A CE1 1 
ATOM   6297 C  CE2 . PHE A 1 907 ? 0.474   66.466  33.551  1.00 61.74  ? 918  PHE A CE2 1 
ATOM   6298 C  CZ  . PHE A 1 907 ? -0.608  66.399  32.696  1.00 66.71  ? 918  PHE A CZ  1 
ATOM   6299 N  N   . GLU A 1 908 ? -3.088  62.620  37.841  1.00 54.15  ? 919  GLU A N   1 
ATOM   6300 C  CA  . GLU A 1 908 ? -3.488  61.323  38.367  1.00 63.73  ? 919  GLU A CA  1 
ATOM   6301 C  C   . GLU A 1 908 ? -3.416  60.290  37.253  1.00 68.09  ? 919  GLU A C   1 
ATOM   6302 O  O   . GLU A 1 908 ? -3.948  60.508  36.160  1.00 70.31  ? 919  GLU A O   1 
ATOM   6303 C  CB  . GLU A 1 908 ? -4.896  61.349  38.965  1.00 63.22  ? 919  GLU A CB  1 
ATOM   6304 C  CG  . GLU A 1 908 ? -5.321  59.978  39.485  1.00 65.52  ? 919  GLU A CG  1 
ATOM   6305 C  CD  . GLU A 1 908 ? -6.577  60.010  40.331  1.00 87.51  ? 919  GLU A CD  1 
ATOM   6306 O  OE1 . GLU A 1 908 ? -7.367  60.968  40.202  1.00 99.82  ? 919  GLU A OE1 1 
ATOM   6307 O  OE2 . GLU A 1 908 ? -6.771  59.071  41.132  1.00 95.84  ? 919  GLU A OE2 1 
ATOM   6308 N  N   . ARG A 1 909 ? -2.758  59.173  37.537  1.00 64.13  ? 920  ARG A N   1 
ATOM   6309 C  CA  . ARG A 1 909 ? -2.578  58.092  36.583  1.00 65.00  ? 920  ARG A CA  1 
ATOM   6310 C  C   . ARG A 1 909 ? -3.621  57.006  36.820  1.00 68.50  ? 920  ARG A C   1 
ATOM   6311 O  O   . ARG A 1 909 ? -4.037  56.756  37.954  1.00 88.46  ? 920  ARG A O   1 
ATOM   6312 C  CB  . ARG A 1 909 ? -1.168  57.507  36.704  1.00 64.29  ? 920  ARG A CB  1 
ATOM   6313 C  CG  . ARG A 1 909 ? -0.830  56.423  35.695  1.00 68.40  ? 920  ARG A CG  1 
ATOM   6314 C  CD  . ARG A 1 909 ? 0.444   55.698  36.096  1.00 69.84  ? 920  ARG A CD  1 
ATOM   6315 N  NE  . ARG A 1 909 ? 1.608   56.578  36.081  1.00 68.66  ? 920  ARG A NE  1 
ATOM   6316 C  CZ  . ARG A 1 909 ? 2.566   56.535  35.160  1.00 64.51  ? 920  ARG A CZ  1 
ATOM   6317 N  NH1 . ARG A 1 909 ? 2.503   55.648  34.177  1.00 53.56  ? 920  ARG A NH1 1 
ATOM   6318 N  NH2 . ARG A 1 909 ? 3.589   57.377  35.224  1.00 66.95  ? 920  ARG A NH2 1 
ATOM   6319 N  N   . PHE A 1 910 ? -4.047  56.366  35.733  1.00 53.10  ? 921  PHE A N   1 
ATOM   6320 C  CA  . PHE A 1 910 ? -4.963  55.239  35.821  1.00 65.32  ? 921  PHE A CA  1 
ATOM   6321 C  C   . PHE A 1 910 ? -4.636  54.261  34.703  1.00 76.17  ? 921  PHE A C   1 
ATOM   6322 O  O   . PHE A 1 910 ? -4.070  54.633  33.672  1.00 90.13  ? 921  PHE A O   1 
ATOM   6323 C  CB  . PHE A 1 910 ? -6.429  55.687  35.746  1.00 71.13  ? 921  PHE A CB  1 
ATOM   6324 C  CG  . PHE A 1 910 ? -6.779  56.420  34.482  1.00 54.34  ? 921  PHE A CG  1 
ATOM   6325 C  CD1 . PHE A 1 910 ? -7.325  55.745  33.403  1.00 54.07  ? 921  PHE A CD1 1 
ATOM   6326 C  CD2 . PHE A 1 910 ? -6.568  57.785  34.375  1.00 61.63  ? 921  PHE A CD2 1 
ATOM   6327 C  CE1 . PHE A 1 910 ? -7.649  56.416  32.240  1.00 62.94  ? 921  PHE A CE1 1 
ATOM   6328 C  CE2 . PHE A 1 910 ? -6.891  58.461  33.214  1.00 63.19  ? 921  PHE A CE2 1 
ATOM   6329 C  CZ  . PHE A 1 910 ? -7.433  57.775  32.145  1.00 64.76  ? 921  PHE A CZ  1 
ATOM   6330 N  N   . SER A 1 911 ? -4.999  52.999  34.919  1.00 72.55  ? 922  SER A N   1 
ATOM   6331 C  CA  . SER A 1 911 ? -4.692  51.928  33.981  1.00 76.09  ? 922  SER A CA  1 
ATOM   6332 C  C   . SER A 1 911 ? -5.936  51.087  33.741  1.00 70.55  ? 922  SER A C   1 
ATOM   6333 O  O   . SER A 1 911 ? -6.550  50.596  34.694  1.00 73.36  ? 922  SER A O   1 
ATOM   6334 C  CB  . SER A 1 911 ? -3.549  51.050  34.504  1.00 81.90  ? 922  SER A CB  1 
ATOM   6335 O  OG  . SER A 1 911 ? -3.192  50.057  33.559  1.00 84.63  ? 922  SER A OG  1 
ATOM   6336 N  N   . LEU A 1 912 ? -6.302  50.924  32.470  1.00 64.76  ? 923  LEU A N   1 
ATOM   6337 C  CA  . LEU A 1 912 ? -7.426  50.079  32.088  1.00 65.20  ? 923  LEU A CA  1 
ATOM   6338 C  C   . LEU A 1 912 ? -7.010  48.654  31.750  1.00 78.36  ? 923  LEU A C   1 
ATOM   6339 O  O   . LEU A 1 912 ? -7.884  47.805  31.542  1.00 84.04  ? 923  LEU A O   1 
ATOM   6340 C  CB  . LEU A 1 912 ? -8.167  50.675  30.885  1.00 60.30  ? 923  LEU A CB  1 
ATOM   6341 C  CG  . LEU A 1 912 ? -8.934  51.987  31.056  1.00 61.32  ? 923  LEU A CG  1 
ATOM   6342 C  CD1 . LEU A 1 912 ? -8.012  53.185  30.908  1.00 59.33  ? 923  LEU A CD1 1 
ATOM   6343 C  CD2 . LEU A 1 912 ? -10.077 52.063  30.056  1.00 66.69  ? 923  LEU A CD2 1 
ATOM   6344 N  N   . SER A 1 913 ? -5.713  48.373  31.687  1.00 84.75  ? 924  SER A N   1 
ATOM   6345 C  CA  . SER A 1 913 ? -5.211  47.062  31.302  1.00 91.89  ? 924  SER A CA  1 
ATOM   6346 C  C   . SER A 1 913 ? -4.825  46.258  32.535  1.00 89.89  ? 924  SER A C   1 
ATOM   6347 O  O   . SER A 1 913 ? -4.286  46.802  33.503  1.00 90.44  ? 924  SER A O   1 
ATOM   6348 C  CB  . SER A 1 913 ? -4.005  47.194  30.370  1.00 100.92 ? 924  SER A CB  1 
ATOM   6349 O  OG  . SER A 1 913 ? -3.482  45.922  30.030  1.00 112.30 ? 924  SER A OG  1 
ATOM   6350 N  N   . THR A 1 914 ? -5.108  44.955  32.492  1.00 93.61  ? 925  THR A N   1 
ATOM   6351 C  CA  . THR A 1 914 ? -4.725  44.063  33.579  1.00 98.24  ? 925  THR A CA  1 
ATOM   6352 C  C   . THR A 1 914 ? -3.247  43.700  33.543  1.00 97.79  ? 925  THR A C   1 
ATOM   6353 O  O   . THR A 1 914 ? -2.703  43.275  34.568  1.00 92.64  ? 925  THR A O   1 
ATOM   6354 C  CB  . THR A 1 914 ? -5.562  42.783  33.535  1.00 102.52 ? 925  THR A CB  1 
ATOM   6355 O  OG1 . THR A 1 914 ? -5.354  42.116  32.284  1.00 113.09 ? 925  THR A OG1 1 
ATOM   6356 C  CG2 . THR A 1 914 ? -7.039  43.106  33.688  1.00 99.70  ? 925  THR A CG2 1 
ATOM   6357 N  N   . LYS A 1 915 ? -2.591  43.856  32.394  1.00 102.70 ? 926  LYS A N   1 
ATOM   6358 C  CA  . LYS A 1 915 ? -1.181  43.515  32.262  1.00 109.89 ? 926  LYS A CA  1 
ATOM   6359 C  C   . LYS A 1 915 ? -0.251  44.649  32.665  1.00 122.40 ? 926  LYS A C   1 
ATOM   6360 O  O   . LYS A 1 915 ? 0.921   44.392  32.967  1.00 121.64 ? 926  LYS A O   1 
ATOM   6361 C  CB  . LYS A 1 915 ? -0.872  43.096  30.821  1.00 105.52 ? 926  LYS A CB  1 
ATOM   6362 N  N   . TRP A 1 916 ? -0.736  45.888  32.678  1.00 123.91 ? 927  TRP A N   1 
ATOM   6363 C  CA  . TRP A 1 916 ? 0.063   47.049  33.054  1.00 119.16 ? 927  TRP A CA  1 
ATOM   6364 C  C   . TRP A 1 916 ? -0.431  47.674  34.356  1.00 110.51 ? 927  TRP A C   1 
ATOM   6365 O  O   . TRP A 1 916 ? -0.540  48.896  34.477  1.00 105.43 ? 927  TRP A O   1 
ATOM   6366 C  CB  . TRP A 1 916 ? 0.078   48.083  31.932  1.00 127.04 ? 927  TRP A CB  1 
ATOM   6367 C  CG  . TRP A 1 916 ? 1.244   47.928  31.003  1.00 137.46 ? 927  TRP A CG  1 
ATOM   6368 C  CD1 . TRP A 1 916 ? 2.440   48.581  31.076  1.00 141.56 ? 927  TRP A CD1 1 
ATOM   6369 C  CD2 . TRP A 1 916 ? 1.331   47.058  29.868  1.00 142.18 ? 927  TRP A CD2 1 
ATOM   6370 N  NE1 . TRP A 1 916 ? 3.264   48.175  30.055  1.00 143.88 ? 927  TRP A NE1 1 
ATOM   6371 C  CE2 . TRP A 1 916 ? 2.607   47.240  29.299  1.00 141.91 ? 927  TRP A CE2 1 
ATOM   6372 C  CE3 . TRP A 1 916 ? 0.453   46.144  29.276  1.00 144.07 ? 927  TRP A CE3 1 
ATOM   6373 C  CZ2 . TRP A 1 916 ? 3.027   46.543  28.168  1.00 136.46 ? 927  TRP A CZ2 1 
ATOM   6374 C  CZ3 . TRP A 1 916 ? 0.873   45.453  28.153  1.00 142.03 ? 927  TRP A CZ3 1 
ATOM   6375 C  CH2 . TRP A 1 916 ? 2.148   45.657  27.611  1.00 136.22 ? 927  TRP A CH2 1 
ATOM   6376 N  N   . LEU A 1 917 ? -0.737  46.837  35.342  1.00 114.73 ? 928  LEU A N   1 
ATOM   6377 C  CA  . LEU A 1 917 ? -1.075  47.305  36.677  1.00 116.26 ? 928  LEU A CA  1 
ATOM   6378 C  C   . LEU A 1 917 ? 0.192   47.461  37.508  1.00 130.83 ? 928  LEU A C   1 
ATOM   6379 O  O   . LEU A 1 917 ? 1.149   46.695  37.367  1.00 130.95 ? 928  LEU A O   1 
ATOM   6380 C  CB  . LEU A 1 917 ? -2.035  46.338  37.371  1.00 101.31 ? 928  LEU A CB  1 
ATOM   6381 C  CG  . LEU A 1 917 ? -3.445  46.216  36.792  1.00 96.03  ? 928  LEU A CG  1 
ATOM   6382 C  CD1 . LEU A 1 917 ? -4.209  45.115  37.505  1.00 95.65  ? 928  LEU A CD1 1 
ATOM   6383 C  CD2 . LEU A 1 917 ? -4.187  47.540  36.895  1.00 93.05  ? 928  LEU A CD2 1 
ATOM   6384 N  N   . VAL A 1 918 ? 0.189   48.465  38.382  1.00 141.22 ? 929  VAL A N   1 
ATOM   6385 C  CA  . VAL A 1 918 ? 1.342   48.772  39.221  1.00 143.11 ? 929  VAL A CA  1 
ATOM   6386 C  C   . VAL A 1 918 ? 0.831   49.193  40.594  1.00 137.35 ? 929  VAL A C   1 
ATOM   6387 O  O   . VAL A 1 918 ? 0.184   50.238  40.726  1.00 137.47 ? 929  VAL A O   1 
ATOM   6388 C  CB  . VAL A 1 918 ? 2.232   49.867  38.612  1.00 137.30 ? 929  VAL A CB  1 
ATOM   6389 C  CG1 . VAL A 1 918 ? 3.201   49.261  37.609  1.00 134.00 ? 929  VAL A CG1 1 
ATOM   6390 C  CG2 . VAL A 1 918 ? 1.382   50.934  37.932  1.00 130.16 ? 929  VAL A CG2 1 
ATOM   6391 N  N   . GLU A 1 919 ? 1.112   48.379  41.617  1.00 128.33 ? 930  GLU A N   1 
ATOM   6392 C  CA  . GLU A 1 919 ? 0.796   48.750  42.988  1.00 118.04 ? 930  GLU A CA  1 
ATOM   6393 C  C   . GLU A 1 919 ? 2.083   49.154  43.699  1.00 102.71 ? 930  GLU A C   1 
ATOM   6394 O  O   . GLU A 1 919 ? 2.876   48.281  44.084  1.00 96.71  ? 930  GLU A O   1 
ATOM   6395 C  CB  . GLU A 1 919 ? 0.100   47.602  43.729  1.00 116.61 ? 930  GLU A CB  1 
ATOM   6396 C  CG  . GLU A 1 919 ? 0.737   46.230  43.559  1.00 119.95 ? 930  GLU A CG  1 
ATOM   6397 C  CD  . GLU A 1 919 ? 0.211   45.220  44.561  1.00 130.13 ? 930  GLU A CD  1 
ATOM   6398 O  OE1 . GLU A 1 919 ? -1.003  45.249  44.857  1.00 135.80 ? 930  GLU A OE1 1 
ATOM   6399 O  OE2 . GLU A 1 919 ? 1.014   44.405  45.062  1.00 130.18 ? 930  GLU A OE2 1 
ATOM   6400 N  N   . PRO A 1 920 ? 2.352   50.449  43.877  1.00 92.36  ? 931  PRO A N   1 
ATOM   6401 C  CA  . PRO A 1 920 ? 3.608   50.862  44.519  1.00 77.45  ? 931  PRO A CA  1 
ATOM   6402 C  C   . PRO A 1 920 ? 3.731   50.377  45.954  1.00 84.58  ? 931  PRO A C   1 
ATOM   6403 O  O   . PRO A 1 920 ? 3.003   50.830  46.843  1.00 101.03 ? 931  PRO A O   1 
ATOM   6404 C  CB  . PRO A 1 920 ? 3.550   52.393  44.449  1.00 70.99  ? 931  PRO A CB  1 
ATOM   6405 C  CG  . PRO A 1 920 ? 2.632   52.681  43.309  1.00 76.52  ? 931  PRO A CG  1 
ATOM   6406 C  CD  . PRO A 1 920 ? 1.596   51.599  43.355  1.00 85.40  ? 931  PRO A CD  1 
ATOM   6407 N  N   . ARG A 1 921 ? 4.651   49.446  46.182  1.00 76.86  ? 932  ARG A N   1 
ATOM   6408 C  CA  . ARG A 1 921 ? 4.970   48.950  47.510  1.00 72.61  ? 932  ARG A CA  1 
ATOM   6409 C  C   . ARG A 1 921 ? 6.313   49.510  47.958  1.00 71.41  ? 932  ARG A C   1 
ATOM   6410 O  O   . ARG A 1 921 ? 7.214   49.735  47.144  1.00 71.54  ? 932  ARG A O   1 
ATOM   6411 C  CB  . ARG A 1 921 ? 5.008   47.418  47.532  1.00 76.00  ? 932  ARG A CB  1 
ATOM   6412 C  CG  . ARG A 1 921 ? 3.640   46.756  47.471  1.00 85.63  ? 932  ARG A CG  1 
ATOM   6413 C  CD  . ARG A 1 921 ? 3.745   45.320  46.980  1.00 95.57  ? 932  ARG A CD  1 
ATOM   6414 N  NE  . ARG A 1 921 ? 4.806   44.579  47.656  1.00 101.65 ? 932  ARG A NE  1 
ATOM   6415 C  CZ  . ARG A 1 921 ? 4.623   43.819  48.731  1.00 104.05 ? 932  ARG A CZ  1 
ATOM   6416 N  NH1 . ARG A 1 921 ? 3.413   43.696  49.260  1.00 103.81 ? 932  ARG A NH1 1 
ATOM   6417 N  NH2 . ARG A 1 921 ? 5.649   43.181  49.277  1.00 102.03 ? 932  ARG A NH2 1 
ATOM   6418 N  N   . CYS A 1 922 ? 6.438   49.740  49.261  1.00 74.28  ? 933  CYS A N   1 
ATOM   6419 C  CA  . CYS A 1 922 ? 7.672   50.260  49.831  1.00 75.64  ? 933  CYS A CA  1 
ATOM   6420 C  C   . CYS A 1 922 ? 7.743   49.839  51.291  1.00 79.03  ? 933  CYS A C   1 
ATOM   6421 O  O   . CYS A 1 922 ? 6.754   49.396  51.880  1.00 80.33  ? 933  CYS A O   1 
ATOM   6422 C  CB  . CYS A 1 922 ? 7.758   51.782  49.686  1.00 85.59  ? 933  CYS A CB  1 
ATOM   6423 S  SG  . CYS A 1 922 ? 6.316   52.671  50.302  1.00 109.02 ? 933  CYS A SG  1 
ATOM   6424 N  N   . LEU A 1 923 ? 8.933   49.984  51.870  1.00 80.25  ? 934  LEU A N   1 
ATOM   6425 C  CA  . LEU A 1 923 ? 9.183   49.543  53.235  1.00 74.75  ? 934  LEU A CA  1 
ATOM   6426 C  C   . LEU A 1 923 ? 9.968   50.605  53.987  1.00 79.93  ? 934  LEU A C   1 
ATOM   6427 O  O   . LEU A 1 923 ? 10.945  51.149  53.464  1.00 88.34  ? 934  LEU A O   1 
ATOM   6428 C  CB  . LEU A 1 923 ? 9.947   48.214  53.254  1.00 64.18  ? 934  LEU A CB  1 
ATOM   6429 C  CG  . LEU A 1 923 ? 9.216   47.019  53.869  1.00 66.71  ? 934  LEU A CG  1 
ATOM   6430 C  CD1 . LEU A 1 923 ? 10.079  45.770  53.801  1.00 68.06  ? 934  LEU A CD1 1 
ATOM   6431 C  CD2 . LEU A 1 923 ? 8.812   47.320  55.304  1.00 67.85  ? 934  LEU A CD2 1 
ATOM   6432 N  N   . VAL A 1 924 ? 9.534   50.895  55.211  1.00 82.53  ? 935  VAL A N   1 
ATOM   6433 C  CA  . VAL A 1 924 ? 10.247  51.774  56.130  1.00 68.51  ? 935  VAL A CA  1 
ATOM   6434 C  C   . VAL A 1 924 ? 10.572  50.967  57.378  1.00 78.85  ? 935  VAL A C   1 
ATOM   6435 O  O   . VAL A 1 924 ? 9.676   50.371  57.987  1.00 94.88  ? 935  VAL A O   1 
ATOM   6436 C  CB  . VAL A 1 924 ? 9.422   53.026  56.480  1.00 61.81  ? 935  VAL A CB  1 
ATOM   6437 C  CG1 . VAL A 1 924 ? 10.122  53.838  57.558  1.00 61.52  ? 935  VAL A CG1 1 
ATOM   6438 C  CG2 . VAL A 1 924 ? 9.190   53.870  55.237  1.00 60.13  ? 935  VAL A CG2 1 
ATOM   6439 N  N   . ASP A 1 925 ? 11.848  50.943  57.754  1.00 76.01  ? 936  ASP A N   1 
ATOM   6440 C  CA  . ASP A 1 925 ? 12.319  50.084  58.829  1.00 81.01  ? 936  ASP A CA  1 
ATOM   6441 C  C   . ASP A 1 925 ? 13.078  50.905  59.863  1.00 88.35  ? 936  ASP A C   1 
ATOM   6442 O  O   . ASP A 1 925 ? 13.515  52.029  59.599  1.00 87.22  ? 936  ASP A O   1 
ATOM   6443 C  CB  . ASP A 1 925 ? 13.211  48.958  58.285  1.00 72.07  ? 936  ASP A CB  1 
ATOM   6444 C  CG  . ASP A 1 925 ? 13.213  47.733  59.177  1.00 95.54  ? 936  ASP A CG  1 
ATOM   6445 O  OD1 . ASP A 1 925 ? 13.336  47.890  60.410  1.00 106.93 ? 936  ASP A OD1 1 
ATOM   6446 O  OD2 . ASP A 1 925 ? 13.083  46.611  58.643  1.00 102.20 ? 936  ASP A OD2 1 
ATOM   6447 N  N   . SER A 1 926 ? 13.225  50.318  61.050  1.00 95.12  ? 937  SER A N   1 
ATOM   6448 C  CA  . SER A 1 926 ? 13.925  50.937  62.175  1.00 98.20  ? 937  SER A CA  1 
ATOM   6449 C  C   . SER A 1 926 ? 13.353  52.312  62.515  1.00 103.65 ? 937  SER A C   1 
ATOM   6450 O  O   . SER A 1 926 ? 12.584  52.457  63.466  1.00 102.31 ? 937  SER A O   1 
ATOM   6451 C  CB  . SER A 1 926 ? 15.424  51.050  61.883  1.00 91.80  ? 937  SER A CB  1 
ATOM   6452 O  OG  . SER A 1 926 ? 16.122  51.579  62.997  1.00 84.19  ? 937  SER A OG  1 
HETATM 6453 CL CL  . CL  B 2 .   ? 4.938   49.901  19.591  1.00 56.50  ? 1001 CL  A CL  1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
6    N N   . ASP A 8   ? 1.9133 1.6363 2.1865 -0.0642 -0.4069 -0.2415 19  ASP A N   
7    C CA  . ASP A 8   ? 1.6729 1.3746 1.9126 -0.0615 -0.3829 -0.2279 19  ASP A CA  
8    C C   . ASP A 8   ? 1.5422 1.2251 1.7233 -0.0407 -0.3785 -0.2257 19  ASP A C   
9    O O   . ASP A 8   ? 1.2875 0.9463 1.4336 -0.0354 -0.3654 -0.2217 19  ASP A O   
10   C CB  . ASP A 8   ? 1.5047 1.1749 1.7386 -0.0695 -0.3867 -0.2334 19  ASP A CB  
11   N N   . LEU A 9   ? 1.6903 1.3827 1.8594 -0.0290 -0.3892 -0.2291 20  LEU A N   
12   C CA  . LEU A 9   ? 1.7154 1.3883 1.8266 -0.0118 -0.3828 -0.2257 20  LEU A CA  
13   C C   . LEU A 9   ? 1.7745 1.4673 1.8851 -0.0036 -0.3829 -0.2203 20  LEU A C   
14   O O   . LEU A 9   ? 1.7209 1.3955 1.7816 0.0094  -0.3779 -0.2170 20  LEU A O   
15   C CB  . LEU A 9   ? 1.5648 1.1999 1.6286 -0.0002 -0.4038 -0.2414 20  LEU A CB  
16   C CG  . LEU A 9   ? 1.2453 0.8789 1.3193 0.0034  -0.4382 -0.2585 20  LEU A CG  
17   C CD1 . LEU A 9   ? 1.1955 0.8180 1.2267 0.0209  -0.4500 -0.2608 20  LEU A CD1 
18   C CD2 . LEU A 9   ? 1.0987 0.7017 1.1572 0.0028  -0.4559 -0.2741 20  LEU A CD2 
19   N N   . PHE A 10  ? 1.8040 1.5327 1.9672 -0.0109 -0.3878 -0.2199 21  PHE A N   
20   C CA  . PHE A 10  ? 1.7913 1.5412 1.9592 -0.0026 -0.3877 -0.2152 21  PHE A CA  
21   C C   . PHE A 10  ? 1.7280 1.5158 1.9443 -0.0155 -0.3651 -0.2022 21  PHE A C   
22   O O   . PHE A 10  ? 1.7039 1.5134 1.9707 -0.0314 -0.3646 -0.2045 21  PHE A O   
23   C CB  . PHE A 10  ? 1.8012 1.5608 1.9871 0.0047  -0.4202 -0.2315 21  PHE A CB  
24   C CG  . PHE A 10  ? 1.7981 1.5182 1.9281 0.0207  -0.4442 -0.2435 21  PHE A CG  
25   C CD1 . PHE A 10  ? 1.7739 1.4605 1.8365 0.0334  -0.4350 -0.2363 21  PHE A CD1 
26   C CD2 . PHE A 10  ? 1.7508 1.4664 1.8943 0.0221  -0.4756 -0.2624 21  PHE A CD2 
27   C CE1 . PHE A 10  ? 1.7382 1.3853 1.7442 0.0473  -0.4557 -0.2469 21  PHE A CE1 
28   C CE2 . PHE A 10  ? 1.7430 1.4194 1.8308 0.0375  -0.4985 -0.2735 21  PHE A CE2 
29   C CZ  . PHE A 10  ? 1.7493 1.3903 1.7664 0.0501  -0.4880 -0.2653 21  PHE A CZ  
30   N N   . GLN A 11  ? 1.7148 1.5087 1.9137 -0.0095 -0.3461 -0.1889 22  GLN A N   
31   C CA  . GLN A 11  ? 1.6040 1.4324 1.8431 -0.0197 -0.3246 -0.1766 22  GLN A CA  
32   C C   . GLN A 11  ? 1.6198 1.4518 1.8341 -0.0086 -0.3120 -0.1663 22  GLN A C   
33   O O   . GLN A 11  ? 1.7390 1.5456 1.9047 -0.0016 -0.3004 -0.1595 22  GLN A O   
34   C CB  . GLN A 11  ? 1.6447 1.4695 1.8918 -0.0337 -0.3024 -0.1663 22  GLN A CB  
35   C CG  . GLN A 11  ? 1.5847 1.4436 1.8791 -0.0480 -0.2839 -0.1559 22  GLN A CG  
36   C CD  . GLN A 11  ? 1.5421 1.3906 1.8354 -0.0594 -0.2635 -0.1447 22  GLN A CD  
37   O OE1 . GLN A 11  ? 1.5504 1.3759 1.8046 -0.0522 -0.2532 -0.1390 22  GLN A OE1 
38   N NE2 . GLN A 11  ? 1.4466 1.3113 1.7824 -0.0773 -0.2577 -0.1423 22  GLN A NE2 
39   N N   . PHE A 12  ? 1.5163 1.3800 1.7643 -0.0075 -0.3136 -0.1660 23  PHE A N   
40   C CA  . PHE A 12  ? 1.5189 1.3864 1.7467 0.0031  -0.3037 -0.1573 23  PHE A CA  
41   C C   . PHE A 12  ? 1.5753 1.4743 1.8383 -0.0079 -0.2780 -0.1447 23  PHE A C   
42   O O   . PHE A 12  ? 1.5961 1.5287 1.9126 -0.0183 -0.2778 -0.1478 23  PHE A O   
43   C CB  . PHE A 12  ? 1.4333 1.3084 1.6659 0.0174  -0.3283 -0.1683 23  PHE A CB  
44   C CG  . PHE A 12  ? 1.3970 1.2852 1.6264 0.0257  -0.3183 -0.1603 23  PHE A CG  
45   C CD1 . PHE A 12  ? 1.4607 1.3195 1.6341 0.0342  -0.3070 -0.1501 23  PHE A CD1 
46   C CD2 . PHE A 12  ? 1.4008 1.3307 1.6836 0.0244  -0.3197 -0.1640 23  PHE A CD2 
47   C CE1 . PHE A 12  ? 1.4608 1.3286 1.6299 0.0414  -0.2985 -0.1431 23  PHE A CE1 
48   C CE2 . PHE A 12  ? 1.4539 1.3943 1.7327 0.0332  -0.3112 -0.1577 23  PHE A CE2 
49   C CZ  . PHE A 12  ? 1.4455 1.3533 1.6666 0.0418  -0.3013 -0.1468 23  PHE A CZ  
50   N N   . ASN A 13  ? 1.6233 1.5118 1.8558 -0.0063 -0.2562 -0.1312 24  ASN A N   
51   C CA  . ASN A 13  ? 1.6536 1.5677 1.9105 -0.0145 -0.2321 -0.1187 24  ASN A CA  
52   C C   . ASN A 13  ? 1.5744 1.4783 1.7937 -0.0044 -0.2197 -0.1096 24  ASN A C   
53   O O   . ASN A 13  ? 1.3332 1.2058 1.5034 0.0043  -0.2227 -0.1101 24  ASN A O   
54   C CB  . ASN A 13  ? 1.6483 1.5601 1.9144 -0.0288 -0.2147 -0.1107 24  ASN A CB  
55   C CG  . ASN A 13  ? 1.6863 1.6008 1.9839 -0.0405 -0.2264 -0.1192 24  ASN A CG  
56   O OD1 . ASN A 13  ? 1.6967 1.5851 1.9736 -0.0390 -0.2380 -0.1262 24  ASN A OD1 
57   N ND2 . ASN A 13  ? 1.6410 1.5868 1.9885 -0.0531 -0.2226 -0.1195 24  ASN A ND2 
58   N N   . LYS A 14  ? 1.7811 1.7109 2.0227 -0.0067 -0.2050 -0.1018 25  LYS A N   
59   C CA  . LYS A 14  ? 1.7627 1.6844 1.9723 0.0010  -0.1921 -0.0931 25  LYS A CA  
60   C C   . LYS A 14  ? 1.6266 1.5320 1.8086 -0.0043 -0.1720 -0.0834 25  LYS A C   
61   O O   . LYS A 14  ? 1.6068 1.5180 1.8066 -0.0147 -0.1625 -0.0798 25  LYS A O   
62   C CB  . LYS A 14  ? 1.7492 1.7038 1.9921 0.0000  -0.1821 -0.0886 25  LYS A CB  
63   C CG  . LYS A 14  ? 1.5565 1.5301 1.8260 0.0086  -0.2015 -0.0998 25  LYS A CG  
64   C CD  . LYS A 14  ? 1.3425 1.2886 1.5683 0.0261  -0.2172 -0.1038 25  LYS A CD  
65   C CE  . LYS A 14  ? 1.1480 1.1133 1.4010 0.0378  -0.2385 -0.1160 25  LYS A CE  
66   N NZ  . LYS A 14  ? 1.0930 1.0266 1.2983 0.0561  -0.2537 -0.1183 25  LYS A NZ  
67   N N   . THR A 15  ? 1.4496 1.3336 1.5874 0.0031  -0.1659 -0.0800 26  THR A N   
68   C CA  . THR A 15  ? 1.4186 1.2918 1.5326 -0.0009 -0.1463 -0.0729 26  THR A CA  
69   C C   . THR A 15  ? 1.2903 1.1719 1.3962 0.0002  -0.1294 -0.0639 26  THR A C   
70   O O   . THR A 15  ? 1.2793 1.1862 1.4161 -0.0018 -0.1245 -0.0595 26  THR A O   
71   C CB  . THR A 15  ? 1.4825 1.3218 1.5491 0.0037  -0.1507 -0.0785 26  THR A CB  
72   O OG1 . THR A 15  ? 1.6074 1.4276 1.6360 0.0121  -0.1545 -0.0789 26  THR A OG1 
73   C CG2 . THR A 15  ? 1.5534 1.3816 1.6244 0.0045  -0.1708 -0.0890 26  THR A CG2 
74   N N   . VAL A 16  ? 1.2049 1.0658 1.2695 0.0027  -0.1199 -0.0620 27  VAL A N   
75   C CA  . VAL A 16  ? 1.2465 1.1128 1.3010 0.0022  -0.1032 -0.0543 27  VAL A CA  
76   C C   . VAL A 16  ? 1.0381 0.8805 1.0531 0.0099  -0.1093 -0.0558 27  VAL A C   
77   O O   . VAL A 16  ? 0.9771 0.7968 0.9689 0.0161  -0.1260 -0.0623 27  VAL A O   
78   C CB  . VAL A 16  ? 1.3626 1.2278 1.4057 -0.0035 -0.0841 -0.0512 27  VAL A CB  
79   C CG1 . VAL A 16  ? 1.4587 1.3432 1.5375 -0.0096 -0.0796 -0.0487 27  VAL A CG1 
80   C CG2 . VAL A 16  ? 1.2444 1.0818 1.2477 -0.0023 -0.0850 -0.0579 27  VAL A CG2 
81   N N   . GLU A 17  ? 0.8855 0.7301 0.8901 0.0095  -0.0961 -0.0496 28  GLU A N   
82   C CA  . GLU A 17  ? 0.8354 0.6544 0.8006 0.0157  -0.0999 -0.0492 28  GLU A CA  
83   C C   . GLU A 17  ? 0.9186 0.7193 0.8455 0.0092  -0.0812 -0.0465 28  GLU A C   
84   O O   . GLU A 17  ? 0.8630 0.6811 0.8041 0.0016  -0.0640 -0.0439 28  GLU A O   
85   C CB  . GLU A 17  ? 0.8900 0.7256 0.8756 0.0208  -0.1016 -0.0457 28  GLU A CB  
86   C CG  . GLU A 17  ? 0.9992 0.8615 1.0311 0.0254  -0.1164 -0.0499 28  GLU A CG  
87   C CD  . GLU A 17  ? 1.2103 1.0981 1.2706 0.0285  -0.1121 -0.0468 28  GLU A CD  
88   O OE1 . GLU A 17  ? 1.2866 1.1719 1.3325 0.0265  -0.0972 -0.0406 28  GLU A OE1 
89   O OE2 . GLU A 17  ? 1.2263 1.1377 1.3244 0.0325  -0.1232 -0.0518 28  GLU A OE2 
90   N N   . HIS A 18  ? 0.9063 0.6710 0.7836 0.0120  -0.0850 -0.0477 29  HIS A N   
91   C CA  . HIS A 18  ? 0.7963 0.5400 0.6328 0.0038  -0.0668 -0.0467 29  HIS A CA  
92   C C   . HIS A 18  ? 0.8329 0.5545 0.6375 0.0049  -0.0641 -0.0420 29  HIS A C   
93   O O   . HIS A 18  ? 0.9733 0.6777 0.7659 0.0152  -0.0820 -0.0419 29  HIS A O   
94   C CB  . HIS A 18  ? 0.9329 0.6456 0.7284 0.0028  -0.0705 -0.0530 29  HIS A CB  
95   C CG  . HIS A 18  ? 1.0727 0.8015 0.8946 0.0027  -0.0749 -0.0589 29  HIS A CG  
96   N ND1 . HIS A 18  ? 1.0941 0.8588 0.9630 -0.0012 -0.0664 -0.0577 29  HIS A ND1 
97   C CD2 . HIS A 18  ? 1.0959 0.8065 0.9012 0.0063  -0.0880 -0.0660 29  HIS A CD2 
98   C CE1 . HIS A 18  ? 1.0889 0.8557 0.9692 -0.0003 -0.0739 -0.0637 29  HIS A CE1 
99   N NE2 . HIS A 18  ? 1.0737 0.8095 0.9173 0.0041  -0.0869 -0.0693 29  HIS A NE2 
100  N N   . GLY A 19  ? 0.8399 0.5614 0.6314 -0.0053 -0.0428 -0.0392 30  GLY A N   
101  C CA  . GLY A 19  ? 0.8517 0.5473 0.6077 -0.0072 -0.0377 -0.0351 30  GLY A CA  
102  C C   . GLY A 19  ? 0.8975 0.6201 0.6852 -0.0079 -0.0295 -0.0302 30  GLY A C   
103  O O   . GLY A 19  ? 0.8642 0.6257 0.6973 -0.0099 -0.0225 -0.0296 30  GLY A O   
104  N N   . PHE A 20  ? 0.9495 0.6472 0.7089 -0.0059 -0.0311 -0.0268 31  PHE A N   
105  C CA  . PHE A 20  ? 1.0369 0.7523 0.8166 -0.0062 -0.0238 -0.0229 31  PHE A CA  
106  C C   . PHE A 20  ? 0.9627 0.6950 0.7746 0.0088  -0.0419 -0.0225 31  PHE A C   
107  O O   . PHE A 20  ? 0.9317 0.6404 0.7256 0.0203  -0.0616 -0.0245 31  PHE A O   
108  C CB  . PHE A 20  ? 0.9469 0.6237 0.6775 -0.0122 -0.0162 -0.0203 31  PHE A CB  
109  C CG  . PHE A 20  ? 0.7734 0.4660 0.5211 -0.0144 -0.0068 -0.0174 31  PHE A CG  
110  C CD1 . PHE A 20  ? 0.7404 0.4636 0.5128 -0.0260 0.0129  -0.0179 31  PHE A CD1 
111  C CD2 . PHE A 20  ? 0.7893 0.4654 0.5274 -0.0036 -0.0187 -0.0152 31  PHE A CD2 
112  C CE1 . PHE A 20  ? 0.8464 0.5830 0.6326 -0.0277 0.0204  -0.0159 31  PHE A CE1 
113  C CE2 . PHE A 20  ? 0.7723 0.4617 0.5244 -0.0052 -0.0103 -0.0134 31  PHE A CE2 
114  C CZ  . PHE A 20  ? 0.9534 0.6727 0.7289 -0.0177 0.0094  -0.0135 31  PHE A CZ  
115  N N   . PRO A 21  ? 0.9108 0.6833 0.7694 0.0093  -0.0359 -0.0209 32  PRO A N   
116  C CA  . PRO A 21  ? 0.8071 0.6011 0.7009 0.0221  -0.0504 -0.0221 32  PRO A CA  
117  C C   . PRO A 21  ? 0.8103 0.5783 0.6795 0.0333  -0.0621 -0.0226 32  PRO A C   
118  O O   . PRO A 21  ? 0.7700 0.5132 0.6061 0.0292  -0.0538 -0.0198 32  PRO A O   
119  C CB  . PRO A 21  ? 0.7144 0.5502 0.6515 0.0171  -0.0360 -0.0192 32  PRO A CB  
120  C CG  . PRO A 21  ? 0.7613 0.6023 0.6949 0.0040  -0.0196 -0.0180 32  PRO A CG  
121  C CD  . PRO A 21  ? 0.8888 0.6902 0.7709 -0.0016 -0.0159 -0.0189 32  PRO A CD  
122  N N   . HIS A 22  ? 0.8260 0.6001 0.7130 0.0478  -0.0824 -0.0274 33  HIS A N   
123  C CA  . HIS A 22  ? 0.8093 0.5583 0.6748 0.0624  -0.0982 -0.0299 33  HIS A CA  
124  C C   . HIS A 22  ? 0.7740 0.5497 0.6691 0.0667  -0.0914 -0.0297 33  HIS A C   
125  O O   . HIS A 22  ? 0.7169 0.5380 0.6633 0.0666  -0.0868 -0.0312 33  HIS A O   
126  C CB  . HIS A 22  ? 0.9164 0.6641 0.7922 0.0779  -0.1245 -0.0377 33  HIS A CB  
127  C CG  . HIS A 22  ? 0.8735 0.5954 0.7287 0.0963  -0.1445 -0.0422 33  HIS A CG  
128  N ND1 . HIS A 22  ? 0.9135 0.5769 0.7038 0.1001  -0.1521 -0.0397 33  HIS A ND1 
129  C CD2 . HIS A 22  ? 0.7961 0.5417 0.6862 0.1126  -0.1587 -0.0498 33  HIS A CD2 
130  C CE1 . HIS A 22  ? 0.8805 0.5299 0.6650 0.1193  -0.1720 -0.0452 33  HIS A CE1 
131  N NE2 . HIS A 22  ? 0.8616 0.5627 0.7083 0.1278  -0.1764 -0.0523 33  HIS A NE2 
132  N N   . GLN A 23  ? 0.7492 0.4940 0.6091 0.0700  -0.0905 -0.0279 34  GLN A N   
133  C CA  . GLN A 23  ? 0.7347 0.4964 0.6132 0.0756  -0.0854 -0.0286 34  GLN A CA  
134  C C   . GLN A 23  ? 0.8077 0.6119 0.7235 0.0628  -0.0631 -0.0248 34  GLN A C   
135  O O   . GLN A 23  ? 0.7404 0.5865 0.7034 0.0672  -0.0621 -0.0275 34  GLN A O   
136  C CB  . GLN A 23  ? 0.7999 0.5818 0.7108 0.0954  -0.1046 -0.0372 34  GLN A CB  
137  C CG  . GLN A 23  ? 0.7859 0.5235 0.6584 0.1130  -0.1294 -0.0422 34  GLN A CG  
138  C CD  . GLN A 23  ? 0.9652 0.7299 0.8772 0.1339  -0.1486 -0.0534 34  GLN A CD  
139  O OE1 . GLN A 23  ? 0.8683 0.6855 0.8375 0.1329  -0.1443 -0.0578 34  GLN A OE1 
140  N NE2 . GLN A 23  ? 1.1506 0.8791 1.0321 0.1527  -0.1698 -0.0589 34  GLN A NE2 
141  N N   . PRO A 24  ? 0.8478 0.6428 0.7437 0.0471  -0.0452 -0.0194 35  PRO A N   
142  C CA  . PRO A 24  ? 0.6739 0.5059 0.6016 0.0373  -0.0266 -0.0166 35  PRO A CA  
143  C C   . PRO A 24  ? 0.6381 0.4768 0.5711 0.0427  -0.0222 -0.0172 35  PRO A C   
144  O O   . PRO A 24  ? 0.7601 0.5692 0.6659 0.0515  -0.0310 -0.0194 35  PRO A O   
145  C CB  . PRO A 24  ? 0.7193 0.5360 0.6209 0.0207  -0.0118 -0.0132 35  PRO A CB  
146  C CG  . PRO A 24  ? 0.6895 0.4634 0.5475 0.0205  -0.0213 -0.0140 35  PRO A CG  
147  C CD  . PRO A 24  ? 0.7778 0.5288 0.6215 0.0371  -0.0409 -0.0166 35  PRO A CD  
148  N N   . SER A 25  ? 0.6572 0.5327 0.6232 0.0379  -0.0090 -0.0156 36  SER A N   
149  C CA  . SER A 25  ? 0.8372 0.7229 0.8109 0.0434  -0.0043 -0.0170 36  SER A CA  
150  C C   . SER A 25  ? 0.5678 0.4790 0.5575 0.0328  0.0134  -0.0135 36  SER A C   
151  O O   . SER A 25  ? 0.5647 0.4827 0.5567 0.0355  0.0191  -0.0146 36  SER A O   
152  C CB  . SER A 25  ? 0.8344 0.7448 0.8410 0.0584  -0.0142 -0.0222 36  SER A CB  
153  O OG  . SER A 25  ? 0.7564 0.7046 0.8032 0.0545  -0.0099 -0.0212 36  SER A OG  
154  N N   . ALA A 26  ? 0.5491 0.4732 0.5487 0.0219  0.0209  -0.0102 37  ALA A N   
155  C CA  . ALA A 26  ? 0.5243 0.4718 0.5389 0.0138  0.0349  -0.0075 37  ALA A CA  
156  C C   . ALA A 26  ? 0.8219 0.7660 0.8290 0.0019  0.0410  -0.0062 37  ALA A C   
157  O O   . ALA A 26  ? 0.8609 0.7971 0.8652 0.0004  0.0354  -0.0063 37  ALA A O   
158  C CB  . ALA A 26  ? 0.4982 0.4811 0.5505 0.0174  0.0372  -0.0057 37  ALA A CB  
159  N N   . LEU A 27  ? 0.6553 0.6064 0.6601 -0.0059 0.0520  -0.0063 38  LEU A N   
160  C CA  . LEU A 27  ? 0.5708 0.5249 0.5739 -0.0161 0.0588  -0.0073 38  LEU A CA  
161  C C   . LEU A 27  ? 0.5482 0.5309 0.5753 -0.0171 0.0653  -0.0058 38  LEU A C   
162  O O   . LEU A 27  ? 0.5756 0.5679 0.6068 -0.0148 0.0690  -0.0054 38  LEU A O   
163  C CB  . LEU A 27  ? 0.6265 0.5587 0.6003 -0.0257 0.0654  -0.0116 38  LEU A CB  
164  C CG  . LEU A 27  ? 0.5701 0.5099 0.5452 -0.0365 0.0740  -0.0156 38  LEU A CG  
165  C CD1 . LEU A 27  ? 0.5203 0.4587 0.4989 -0.0360 0.0695  -0.0151 38  LEU A CD1 
166  C CD2 . LEU A 27  ? 0.5451 0.4641 0.4922 -0.0483 0.0824  -0.0208 38  LEU A CD2 
167  N N   . GLY A 28  ? 0.4684 0.4621 0.5087 -0.0198 0.0656  -0.0052 39  GLY A N   
168  C CA  . GLY A 28  ? 0.4507 0.4659 0.5089 -0.0201 0.0697  -0.0038 39  GLY A CA  
169  C C   . GLY A 28  ? 0.5683 0.5861 0.6278 -0.0253 0.0717  -0.0080 39  GLY A C   
170  O O   . GLY A 28  ? 0.6807 0.6868 0.7322 -0.0281 0.0697  -0.0106 39  GLY A O   
171  N N   . TYR A 29  ? 0.5292 0.5623 0.5981 -0.0254 0.0750  -0.0097 40  TYR A N   
172  C CA  . TYR A 29  ? 0.5918 0.6312 0.6651 -0.0284 0.0765  -0.0162 40  TYR A CA  
173  C C   . TYR A 29  ? 0.6204 0.6765 0.7076 -0.0237 0.0752  -0.0157 40  TYR A C   
174  O O   . TYR A 29  ? 0.7606 0.8231 0.8467 -0.0221 0.0770  -0.0151 40  TYR A O   
175  C CB  . TYR A 29  ? 0.4469 0.4814 0.5065 -0.0369 0.0836  -0.0257 40  TYR A CB  
176  C CG  . TYR A 29  ? 0.5353 0.5835 0.6042 -0.0398 0.0868  -0.0356 40  TYR A CG  
177  C CD1 . TYR A 29  ? 0.4466 0.4925 0.5178 -0.0400 0.0855  -0.0389 40  TYR A CD1 
178  C CD2 . TYR A 29  ? 0.6928 0.7572 0.7691 -0.0415 0.0903  -0.0434 40  TYR A CD2 
179  C CE1 . TYR A 29  ? 0.6773 0.7379 0.7590 -0.0411 0.0884  -0.0500 40  TYR A CE1 
180  C CE2 . TYR A 29  ? 0.8051 0.8858 0.8938 -0.0427 0.0924  -0.0549 40  TYR A CE2 
181  C CZ  . TYR A 29  ? 0.7681 0.8474 0.8600 -0.0422 0.0918  -0.0583 40  TYR A CZ  
182  O OH  . TYR A 29  ? 0.8377 0.9355 0.9441 -0.0420 0.0939  -0.0717 40  TYR A OH  
183  N N   . SER A 30  ? 0.4807 0.5408 0.5781 -0.0207 0.0710  -0.0162 41  SER A N   
184  C CA  . SER A 30  ? 0.5528 0.6236 0.6594 -0.0147 0.0675  -0.0162 41  SER A CA  
185  C C   . SER A 30  ? 0.4878 0.5699 0.5990 -0.0153 0.0686  -0.0295 41  SER A C   
186  O O   . SER A 30  ? 0.4229 0.5047 0.5382 -0.0160 0.0678  -0.0357 41  SER A O   
187  C CB  . SER A 30  ? 0.5766 0.6418 0.6903 -0.0103 0.0610  -0.0091 41  SER A CB  
188  O OG  . SER A 30  ? 0.5993 0.6686 0.7161 -0.0037 0.0563  -0.0079 41  SER A OG  
189  N N   . PRO A 31  ? 0.4200 0.5138 0.5321 -0.0152 0.0703  -0.0356 42  PRO A N   
190  C CA  . PRO A 31  ? 0.4503 0.5600 0.5722 -0.0160 0.0713  -0.0509 42  PRO A CA  
191  C C   . PRO A 31  ? 0.6053 0.7214 0.7395 -0.0062 0.0626  -0.0547 42  PRO A C   
192  O O   . PRO A 31  ? 0.6312 0.7594 0.7760 -0.0065 0.0637  -0.0683 42  PRO A O   
193  C CB  . PRO A 31  ? 0.4761 0.5966 0.5978 -0.0162 0.0720  -0.0553 42  PRO A CB  
194  C CG  . PRO A 31  ? 0.4213 0.5281 0.5285 -0.0191 0.0754  -0.0441 42  PRO A CG  
195  C CD  . PRO A 31  ? 0.4202 0.5143 0.5252 -0.0147 0.0719  -0.0309 42  PRO A CD  
196  N N   . SER A 32  ? 0.5833 0.6904 0.7154 0.0023  0.0543  -0.0437 43  SER A N   
197  C CA  . SER A 32  ? 0.5766 0.6828 0.7159 0.0125  0.0443  -0.0461 43  SER A CA  
198  C C   . SER A 32  ? 0.6030 0.6983 0.7439 0.0110  0.0440  -0.0448 43  SER A C   
199  O O   . SER A 32  ? 0.7215 0.8233 0.8716 0.0148  0.0414  -0.0564 43  SER A O   
200  C CB  . SER A 32  ? 0.6387 0.7332 0.7692 0.0206  0.0363  -0.0338 43  SER A CB  
201  O OG  . SER A 32  ? 0.8197 0.9000 0.9409 0.0149  0.0410  -0.0188 43  SER A OG  
202  N N   . LEU A 33  ? 0.7016 0.7817 0.8349 0.0058  0.0462  -0.0322 44  LEU A N   
203  C CA  . LEU A 33  ? 0.6666 0.7349 0.8007 0.0043  0.0443  -0.0309 44  LEU A CA  
204  C C   . LEU A 33  ? 0.6713 0.7429 0.8036 -0.0029 0.0516  -0.0408 44  LEU A C   
205  O O   . LEU A 33  ? 0.4979 0.5620 0.6305 -0.0026 0.0495  -0.0442 44  LEU A O   
206  C CB  . LEU A 33  ? 0.5851 0.6389 0.7145 0.0006  0.0437  -0.0161 44  LEU A CB  
207  C CG  . LEU A 33  ? 0.5127 0.5547 0.6420 0.0051  0.0367  -0.0056 44  LEU A CG  
208  C CD1 . LEU A 33  ? 0.5377 0.5833 0.6616 0.0104  0.0355  -0.0021 44  LEU A CD1 
209  C CD2 . LEU A 33  ? 0.6412 0.6736 0.7707 -0.0015 0.0385  0.0058  44  LEU A CD2 
210  N N   . ARG A 34  ? 0.7012 0.7809 0.8287 -0.0097 0.0602  -0.0454 45  ARG A N   
211  C CA  . ARG A 34  ? 0.5553 0.6328 0.6744 -0.0188 0.0690  -0.0533 45  ARG A CA  
212  C C   . ARG A 34  ? 0.5770 0.6344 0.6846 -0.0218 0.0673  -0.0454 45  ARG A C   
213  O O   . ARG A 34  ? 0.7119 0.7624 0.8153 -0.0231 0.0674  -0.0507 45  ARG A O   
214  C CB  . ARG A 34  ? 0.6580 0.7488 0.7862 -0.0179 0.0717  -0.0696 45  ARG A CB  
215  C CG  . ARG A 34  ? 0.7793 0.8859 0.9085 -0.0266 0.0830  -0.0824 45  ARG A CG  
216  C CD  . ARG A 34  ? 0.8561 0.9845 1.0024 -0.0236 0.0850  -0.1008 45  ARG A CD  
217  N NE  . ARG A 34  ? 0.9194 1.0629 1.0843 -0.0102 0.0737  -0.1041 45  ARG A NE  
218  C CZ  . ARG A 34  ? 0.8693 1.0102 1.0423 0.0024  0.0626  -0.1047 45  ARG A CZ  
219  N NH1 . ARG A 34  ? 0.7540 0.8802 0.9206 0.0028  0.0619  -0.1030 45  ARG A NH1 
220  N NH2 . ARG A 34  ? 0.8140 0.9641 0.9990 0.0152  0.0511  -0.1073 45  ARG A NH2 
221  N N   . ILE A 35  ? 0.5477 0.5969 0.6509 -0.0221 0.0652  -0.0336 46  ILE A N   
222  C CA  . ILE A 35  ? 0.5384 0.5716 0.6348 -0.0234 0.0611  -0.0264 46  ILE A CA  
223  C C   . ILE A 35  ? 0.6078 0.6341 0.6919 -0.0271 0.0645  -0.0221 46  ILE A C   
224  O O   . ILE A 35  ? 0.4951 0.5286 0.5826 -0.0258 0.0662  -0.0178 46  ILE A O   
225  C CB  . ILE A 35  ? 0.5216 0.5531 0.6305 -0.0183 0.0528  -0.0171 46  ILE A CB  
226  C CG1 . ILE A 35  ? 0.4427 0.4719 0.5585 -0.0146 0.0472  -0.0215 46  ILE A CG1 
227  C CG2 . ILE A 35  ? 0.4405 0.4619 0.5475 -0.0200 0.0490  -0.0102 46  ILE A CG2 
228  C CD1 . ILE A 35  ? 0.4444 0.4671 0.5698 -0.0119 0.0395  -0.0124 46  ILE A CD1 
229  N N   . LEU A 36  ? 0.6623 0.6723 0.7296 -0.0309 0.0646  -0.0237 47  LEU A N   
230  C CA  . LEU A 36  ? 0.4663 0.4640 0.5180 -0.0329 0.0656  -0.0204 47  LEU A CA  
231  C C   . LEU A 36  ? 0.5623 0.5553 0.6206 -0.0274 0.0563  -0.0127 47  LEU A C   
232  O O   . LEU A 36  ? 0.7300 0.7187 0.7939 -0.0254 0.0491  -0.0120 47  LEU A O   
233  C CB  . LEU A 36  ? 0.4888 0.4664 0.5135 -0.0397 0.0699  -0.0262 47  LEU A CB  
234  C CG  . LEU A 36  ? 0.6721 0.6313 0.6738 -0.0425 0.0716  -0.0241 47  LEU A CG  
235  C CD1 . LEU A 36  ? 0.6794 0.6471 0.6796 -0.0486 0.0817  -0.0279 47  LEU A CD1 
236  C CD2 . LEU A 36  ? 0.6631 0.5931 0.6329 -0.0471 0.0713  -0.0267 47  LEU A CD2 
237  N N   . ALA A 37  ? 0.5591 0.5540 0.6181 -0.0249 0.0564  -0.0083 48  ALA A N   
238  C CA  . ALA A 37  ? 0.6174 0.6134 0.6871 -0.0194 0.0489  -0.0032 48  ALA A CA  
239  C C   . ALA A 37  ? 0.4858 0.4658 0.5373 -0.0168 0.0459  -0.0041 48  ALA A C   
240  O O   . ALA A 37  ? 0.4816 0.4564 0.5191 -0.0186 0.0518  -0.0054 48  ALA A O   
241  C CB  . ALA A 37  ? 0.4441 0.4601 0.5350 -0.0169 0.0517  0.0022  48  ALA A CB  
242  N N   . ILE A 38  ? 0.6158 0.5866 0.6671 -0.0121 0.0354  -0.0041 49  ILE A N   
243  C CA  . ILE A 38  ? 0.6255 0.5776 0.6584 -0.0067 0.0287  -0.0055 49  ILE A CA  
244  C C   . ILE A 38  ? 0.7172 0.6829 0.7741 0.0019  0.0195  -0.0049 49  ILE A C   
245  O O   . ILE A 38  ? 0.8689 0.8462 0.9470 0.0022  0.0140  -0.0047 49  ILE A O   
246  C CB  . ILE A 38  ? 0.5338 0.4555 0.5356 -0.0082 0.0225  -0.0088 49  ILE A CB  
247  C CG1 . ILE A 38  ? 0.5433 0.4550 0.5237 -0.0187 0.0345  -0.0112 49  ILE A CG1 
248  C CG2 . ILE A 38  ? 0.5608 0.4576 0.5390 -0.0009 0.0132  -0.0099 49  ILE A CG2 
249  C CD1 . ILE A 38  ? 0.5737 0.4536 0.5187 -0.0222 0.0317  -0.0143 49  ILE A CD1 
250  N N   . GLY A 39  ? 0.6368 0.6022 0.6918 0.0086  0.0182  -0.0056 50  GLY A N   
251  C CA  . GLY A 39  ? 0.6565 0.6369 0.7353 0.0179  0.0099  -0.0077 50  GLY A CA  
252  C C   . GLY A 39  ? 0.6987 0.6544 0.7565 0.0281  -0.0042 -0.0125 50  GLY A C   
253  O O   . GLY A 39  ? 0.6986 0.6264 0.7222 0.0283  -0.0038 -0.0127 50  GLY A O   
254  N N   . THR A 40  ? 0.6469 0.6118 0.7248 0.0364  -0.0174 -0.0170 51  THR A N   
255  C CA  . THR A 40  ? 0.7308 0.6722 0.7906 0.0489  -0.0350 -0.0228 51  THR A CA  
256  C C   . THR A 40  ? 0.7077 0.6701 0.7934 0.0617  -0.0406 -0.0289 51  THR A C   
257  O O   . THR A 40  ? 0.7748 0.7724 0.8952 0.0594  -0.0302 -0.0287 51  THR A O   
258  C CB  . THR A 40  ? 0.7715 0.7043 0.8316 0.0505  -0.0499 -0.0262 51  THR A CB  
259  O OG1 . THR A 40  ? 0.7134 0.6831 0.8205 0.0502  -0.0518 -0.0291 51  THR A OG1 
260  C CG2 . THR A 40  ? 0.9169 0.8306 0.9519 0.0385  -0.0432 -0.0216 51  THR A CG2 
261  N N   . ARG A 41  ? 0.6342 0.5731 0.7009 0.0759  -0.0574 -0.0349 52  ARG A N   
262  C CA  . ARG A 41  ? 0.6812 0.6393 0.7727 0.0912  -0.0657 -0.0436 52  ARG A CA  
263  C C   . ARG A 41  ? 0.7501 0.7436 0.8885 0.0959  -0.0754 -0.0516 52  ARG A C   
264  O O   . ARG A 41  ? 0.8234 0.8428 0.9922 0.1075  -0.0801 -0.0608 52  ARG A O   
265  C CB  . ARG A 41  ? 0.7971 0.7142 0.8501 0.1068  -0.0829 -0.0482 52  ARG A CB  
266  C CG  . ARG A 41  ? 0.9571 0.8430 0.9695 0.1028  -0.0726 -0.0425 52  ARG A CG  
267  C CD  . ARG A 41  ? 1.1458 0.9887 1.1198 0.1191  -0.0904 -0.0472 52  ARG A CD  
268  N NE  . ARG A 41  ? 1.3834 1.1997 1.3239 0.1148  -0.0799 -0.0430 52  ARG A NE  
269  C CZ  . ARG A 41  ? 1.6044 1.3796 1.4976 0.1021  -0.0734 -0.0357 52  ARG A CZ  
270  N NH1 . ARG A 41  ? 1.7454 1.5011 1.6177 0.0933  -0.0758 -0.0317 52  ARG A NH1 
271  N NH2 . ARG A 41  ? 1.5309 1.2850 1.3982 0.0975  -0.0639 -0.0333 52  ARG A NH2 
272  N N   . SER A 42  ? 0.7473 0.7435 0.8934 0.0869  -0.0781 -0.0496 53  SER A N   
273  C CA  . SER A 42  ? 0.6626 0.6927 0.8547 0.0878  -0.0861 -0.0573 53  SER A CA  
274  C C   . SER A 42  ? 0.7302 0.7988 0.9605 0.0724  -0.0662 -0.0527 53  SER A C   
275  O O   . SER A 42  ? 0.7843 0.8819 1.0542 0.0691  -0.0695 -0.0583 53  SER A O   
276  C CB  . SER A 42  ? 0.7321 0.7402 0.9093 0.0874  -0.1028 -0.0590 53  SER A CB  
277  O OG  . SER A 42  ? 0.8427 0.8356 0.9989 0.0720  -0.0907 -0.0490 53  SER A OG  
278  N N   . GLY A 43  ? 0.7354 0.8032 0.9534 0.0627  -0.0464 -0.0430 54  GLY A N   
279  C CA  . GLY A 43  ? 0.7522 0.8494 0.9982 0.0489  -0.0281 -0.0374 54  GLY A CA  
280  C C   . GLY A 43  ? 0.6665 0.7530 0.9028 0.0349  -0.0224 -0.0289 54  GLY A C   
281  O O   . GLY A 43  ? 0.4570 0.5627 0.7128 0.0235  -0.0089 -0.0235 54  GLY A O   
282  N N   . ALA A 44  ? 0.6472 0.7021 0.8521 0.0355  -0.0321 -0.0278 55  ALA A N   
283  C CA  . ALA A 44  ? 0.8015 0.8463 0.9976 0.0241  -0.0280 -0.0220 55  ALA A CA  
284  C C   . ALA A 44  ? 0.7655 0.7972 0.9348 0.0180  -0.0134 -0.0142 55  ALA A C   
285  O O   . ALA A 44  ? 0.5981 0.6117 0.7395 0.0225  -0.0123 -0.0140 55  ALA A O   
286  C CB  . ALA A 44  ? 0.8093 0.8281 0.9849 0.0277  -0.0448 -0.0263 55  ALA A CB  
287  N N   . ILE A 45  ? 0.8564 0.8966 1.0345 0.0077  -0.0031 -0.0084 56  ILE A N   
288  C CA  . ILE A 45  ? 0.8223 0.8523 0.9788 0.0021  0.0083  -0.0030 56  ILE A CA  
289  C C   . ILE A 45  ? 0.7709 0.7871 0.9177 -0.0033 0.0051  -0.0029 56  ILE A C   
290  O O   . ILE A 45  ? 0.6475 0.6712 0.8139 -0.0071 0.0012  -0.0029 56  ILE A O   
291  C CB  . ILE A 45  ? 0.8135 0.8636 0.9853 -0.0028 0.0224  0.0029  56  ILE A CB  
292  C CG1 . ILE A 45  ? 0.7314 0.7990 0.9330 -0.0090 0.0234  0.0052  56  ILE A CG1 
293  C CG2 . ILE A 45  ? 0.9529 1.0130 1.1264 0.0031  0.0273  0.0020  56  ILE A CG2 
294  C CD1 . ILE A 45  ? 0.7897 0.8698 0.9984 -0.0149 0.0371  0.0124  56  ILE A CD1 
295  N N   . LYS A 46  ? 0.7669 0.7625 0.8835 -0.0042 0.0072  -0.0038 57  LYS A N   
296  C CA  . LYS A 46  ? 0.6048 0.5869 0.7091 -0.0083 0.0052  -0.0058 57  LYS A CA  
297  C C   . LYS A 46  ? 0.6601 0.6438 0.7555 -0.0134 0.0177  -0.0041 57  LYS A C   
298  O O   . LYS A 46  ? 0.7092 0.6877 0.7873 -0.0140 0.0248  -0.0046 57  LYS A O   
299  C CB  . LYS A 46  ? 0.6312 0.5864 0.7056 -0.0050 -0.0039 -0.0108 57  LYS A CB  
300  C CG  . LYS A 46  ? 0.7045 0.6568 0.7875 0.0018  -0.0203 -0.0144 57  LYS A CG  
301  C CD  . LYS A 46  ? 0.6866 0.6068 0.7337 0.0053  -0.0306 -0.0189 57  LYS A CD  
302  C CE  . LYS A 46  ? 0.7198 0.6374 0.7768 0.0132  -0.0500 -0.0241 57  LYS A CE  
303  N NZ  . LYS A 46  ? 0.7288 0.6111 0.7460 0.0169  -0.0614 -0.0283 57  LYS A NZ  
304  N N   . LEU A 47  ? 0.6387 0.6293 0.7467 -0.0167 0.0194  -0.0032 58  LEU A N   
305  C CA  . LEU A 47  ? 0.4795 0.4736 0.5828 -0.0194 0.0285  -0.0036 58  LEU A CA  
306  C C   . LEU A 47  ? 0.5479 0.5279 0.6341 -0.0210 0.0276  -0.0106 58  LEU A C   
307  O O   . LEU A 47  ? 0.5804 0.5518 0.6676 -0.0204 0.0193  -0.0129 58  LEU A O   
308  C CB  . LEU A 47  ? 0.4530 0.4598 0.5773 -0.0203 0.0299  0.0013  58  LEU A CB  
309  C CG  . LEU A 47  ? 0.5450 0.5664 0.6808 -0.0201 0.0361  0.0079  58  LEU A CG  
310  C CD1 . LEU A 47  ? 0.7790 0.8071 0.9266 -0.0192 0.0335  0.0102  58  LEU A CD1 
311  C CD2 . LEU A 47  ? 0.5609 0.5866 0.7080 -0.0216 0.0373  0.0129  58  LEU A CD2 
312  N N   . TYR A 48  ? 0.4801 0.4586 0.5510 -0.0237 0.0366  -0.0149 59  TYR A N   
313  C CA  . TYR A 48  ? 0.5520 0.5196 0.6056 -0.0265 0.0393  -0.0231 59  TYR A CA  
314  C C   . TYR A 48  ? 0.6830 0.6654 0.7447 -0.0277 0.0477  -0.0282 59  TYR A C   
315  O O   . TYR A 48  ? 0.6818 0.6746 0.7448 -0.0295 0.0553  -0.0284 59  TYR A O   
316  C CB  . TYR A 48  ? 0.5790 0.5277 0.6023 -0.0303 0.0431  -0.0259 59  TYR A CB  
317  C CG  . TYR A 48  ? 0.6066 0.5367 0.6178 -0.0267 0.0316  -0.0230 59  TYR A CG  
318  C CD1 . TYR A 48  ? 0.6693 0.5838 0.6696 -0.0253 0.0229  -0.0265 59  TYR A CD1 
319  C CD2 . TYR A 48  ? 0.6090 0.5372 0.6197 -0.0234 0.0281  -0.0181 59  TYR A CD2 
320  C CE1 . TYR A 48  ? 0.8032 0.7009 0.7928 -0.0205 0.0099  -0.0253 59  TYR A CE1 
321  C CE2 . TYR A 48  ? 0.8018 0.7146 0.8036 -0.0179 0.0154  -0.0173 59  TYR A CE2 
322  C CZ  . TYR A 48  ? 0.9457 0.8434 0.9372 -0.0163 0.0057  -0.0210 59  TYR A CZ  
323  O OH  . TYR A 48  ? 1.2200 1.1023 1.2027 -0.0095 -0.0094 -0.0215 59  TYR A OH  
324  N N   . GLY A 49  ? 0.6344 0.6176 0.7021 -0.0257 0.0452  -0.0336 60  GLY A N   
325  C CA  . GLY A 49  ? 0.5615 0.5590 0.6376 -0.0246 0.0511  -0.0414 60  GLY A CA  
326  C C   . GLY A 49  ? 0.6267 0.6189 0.6896 -0.0272 0.0563  -0.0535 60  GLY A C   
327  O O   . GLY A 49  ? 0.8217 0.8023 0.8621 -0.0339 0.0629  -0.0565 60  GLY A O   
328  N N   . ALA A 50  ? 0.6980 0.6968 0.7724 -0.0220 0.0537  -0.0608 61  ALA A N   
329  C CA  . ALA A 50  ? 0.6871 0.6823 0.7503 -0.0235 0.0589  -0.0738 61  ALA A CA  
330  C C   . ALA A 50  ? 0.8571 0.8276 0.8998 -0.0252 0.0529  -0.0715 61  ALA A C   
331  O O   . ALA A 50  ? 0.9943 0.9547 1.0405 -0.0228 0.0416  -0.0617 61  ALA A O   
332  C CB  . ALA A 50  ? 0.5077 0.5143 0.5893 -0.0148 0.0548  -0.0827 61  ALA A CB  
333  N N   . PRO A 51  ? 0.7959 0.7565 0.8162 -0.0298 0.0606  -0.0813 62  PRO A N   
334  C CA  . PRO A 51  ? 0.7729 0.7076 0.7702 -0.0299 0.0530  -0.0806 62  PRO A CA  
335  C C   . PRO A 51  ? 0.5704 0.5009 0.5832 -0.0216 0.0379  -0.0793 62  PRO A C   
336  O O   . PRO A 51  ? 0.5694 0.5084 0.5950 -0.0164 0.0374  -0.0877 62  PRO A O   
337  C CB  . PRO A 51  ? 0.6977 0.6268 0.6709 -0.0356 0.0663  -0.0940 62  PRO A CB  
338  C CG  . PRO A 51  ? 0.5901 0.5372 0.5668 -0.0432 0.0825  -0.0977 62  PRO A CG  
339  C CD  . PRO A 51  ? 0.7533 0.7252 0.7657 -0.0368 0.0775  -0.0935 62  PRO A CD  
340  N N   . GLY A 52  ? 0.6546 0.5723 0.6675 -0.0204 0.0251  -0.0698 63  GLY A N   
341  C CA  . GLY A 52  ? 0.6247 0.5387 0.6550 -0.0153 0.0108  -0.0672 63  GLY A CA  
342  C C   . GLY A 52  ? 0.7828 0.7093 0.8404 -0.0143 0.0059  -0.0560 63  GLY A C   
343  O O   . GLY A 52  ? 0.8141 0.7352 0.8851 -0.0131 -0.0056 -0.0519 63  GLY A O   
344  N N   . VAL A 53  ? 0.9062 0.8483 0.9711 -0.0158 0.0150  -0.0516 64  VAL A N   
345  C CA  . VAL A 53  ? 0.7391 0.6925 0.8253 -0.0154 0.0127  -0.0409 64  VAL A CA  
346  C C   . VAL A 53  ? 0.6937 0.6472 0.7755 -0.0187 0.0134  -0.0336 64  VAL A C   
347  O O   . VAL A 53  ? 0.6048 0.5619 0.6749 -0.0209 0.0223  -0.0342 64  VAL A O   
348  C CB  . VAL A 53  ? 0.6887 0.6586 0.7851 -0.0130 0.0204  -0.0419 64  VAL A CB  
349  C CG1 . VAL A 53  ? 0.5844 0.5623 0.6966 -0.0130 0.0189  -0.0302 64  VAL A CG1 
350  C CG2 . VAL A 53  ? 0.7691 0.7384 0.8707 -0.0071 0.0176  -0.0508 64  VAL A CG2 
351  N N   . GLU A 54  ? 0.7271 0.6771 0.8194 -0.0190 0.0037  -0.0279 65  GLU A N   
352  C CA  . GLU A 54  ? 0.6638 0.6151 0.7549 -0.0198 0.0021  -0.0229 65  GLU A CA  
353  C C   . GLU A 54  ? 0.6011 0.5623 0.7186 -0.0207 -0.0040 -0.0161 65  GLU A C   
354  O O   . GLU A 54  ? 0.5578 0.5155 0.6877 -0.0220 -0.0115 -0.0166 65  GLU A O   
355  C CB  . GLU A 54  ? 0.7494 0.6818 0.8174 -0.0187 -0.0051 -0.0279 65  GLU A CB  
356  C CG  . GLU A 54  ? 0.8554 0.7857 0.9182 -0.0169 -0.0085 -0.0244 65  GLU A CG  
357  C CD  . GLU A 54  ? 1.0603 0.9658 1.0920 -0.0146 -0.0163 -0.0294 65  GLU A CD  
358  O OE1 . GLU A 54  ? 1.0388 0.9292 1.0496 -0.0159 -0.0154 -0.0354 65  GLU A OE1 
359  O OE2 . GLU A 54  ? 1.0974 0.9970 1.1236 -0.0107 -0.0236 -0.0278 65  GLU A OE2 
360  N N   . PHE A 55  ? 0.6284 0.6017 0.7542 -0.0209 0.0002  -0.0104 66  PHE A N   
361  C CA  . PHE A 55  ? 0.5669 0.5530 0.7181 -0.0231 -0.0025 -0.0050 66  PHE A CA  
362  C C   . PHE A 55  ? 0.7689 0.7599 0.9213 -0.0200 -0.0057 -0.0055 66  PHE A C   
363  O O   . PHE A 55  ? 0.9110 0.8969 1.0444 -0.0168 -0.0020 -0.0066 66  PHE A O   
364  C CB  . PHE A 55  ? 0.5377 0.5366 0.7004 -0.0255 0.0075  0.0024  66  PHE A CB  
365  C CG  . PHE A 55  ? 0.4652 0.4575 0.6263 -0.0263 0.0085  0.0029  66  PHE A CG  
366  C CD1 . PHE A 55  ? 0.4711 0.4598 0.6465 -0.0305 0.0045  0.0065  66  PHE A CD1 
367  C CD2 . PHE A 55  ? 0.5189 0.5082 0.6647 -0.0227 0.0132  -0.0012 66  PHE A CD2 
368  C CE1 . PHE A 55  ? 0.4919 0.4703 0.6630 -0.0293 0.0035  0.0067  66  PHE A CE1 
369  C CE2 . PHE A 55  ? 0.4743 0.4584 0.6201 -0.0208 0.0123  -0.0025 66  PHE A CE2 
370  C CZ  . PHE A 55  ? 0.4777 0.4544 0.6346 -0.0232 0.0066  0.0018  66  PHE A CZ  
371  N N   . MET A 56  ? 0.8106 0.8114 0.9864 -0.0211 -0.0129 -0.0058 67  MET A N   
372  C CA  . MET A 56  ? 0.6850 0.6939 0.8675 -0.0162 -0.0178 -0.0082 67  MET A CA  
373  C C   . MET A 56  ? 0.6245 0.6580 0.8416 -0.0204 -0.0144 -0.0056 67  MET A C   
374  O O   . MET A 56  ? 0.6497 0.6882 0.8860 -0.0278 -0.0154 -0.0045 67  MET A O   
375  C CB  . MET A 56  ? 0.7039 0.6986 0.8775 -0.0109 -0.0343 -0.0161 67  MET A CB  
376  C CG  . MET A 56  ? 0.8928 0.8920 1.0689 -0.0026 -0.0422 -0.0200 67  MET A CG  
377  S SD  . MET A 56  ? 0.9898 0.9654 1.1462 0.0063  -0.0643 -0.0293 67  MET A SD  
378  C CE  . MET A 56  ? 0.7118 0.6961 0.8753 0.0181  -0.0723 -0.0334 67  MET A CE  
379  N N   . GLY A 57  ? 0.5773 0.6249 0.8010 -0.0164 -0.0097 -0.0052 68  GLY A N   
380  C CA  . GLY A 57  ? 0.4487 0.5223 0.7048 -0.0205 -0.0043 -0.0043 68  GLY A CA  
381  C C   . GLY A 57  ? 0.7005 0.7869 0.9673 -0.0113 -0.0104 -0.0114 68  GLY A C   
382  O O   . GLY A 57  ? 0.6558 0.7277 0.8991 -0.0017 -0.0164 -0.0142 68  GLY A O   
383  N N   . LEU A 58  ? 0.6822 0.7956 0.9848 -0.0147 -0.0086 -0.0148 69  LEU A N   
384  C CA  . LEU A 58  ? 0.5617 0.6934 0.8825 -0.0050 -0.0150 -0.0240 69  LEU A CA  
385  C C   . LEU A 58  ? 0.5294 0.6918 0.8777 -0.0102 0.0011  -0.0228 69  LEU A C   
386  O O   . LEU A 58  ? 0.5860 0.7640 0.9587 -0.0233 0.0096  -0.0206 69  LEU A O   
387  C CB  . LEU A 58  ? 0.5449 0.6829 0.8881 -0.0020 -0.0336 -0.0351 69  LEU A CB  
388  C CG  . LEU A 58  ? 0.5031 0.6125 0.8175 0.0097  -0.0535 -0.0404 69  LEU A CG  
389  C CD1 . LEU A 58  ? 0.4841 0.6026 0.8242 0.0124  -0.0728 -0.0522 69  LEU A CD1 
390  C CD2 . LEU A 58  ? 0.6694 0.7687 0.9612 0.0242  -0.0569 -0.0425 69  LEU A CD2 
391  N N   . HIS A 59  ? 0.4347 0.6037 0.7768 -0.0008 0.0059  -0.0245 70  HIS A N   
392  C CA  . HIS A 59  ? 0.6145 0.8154 0.9843 -0.0033 0.0199  -0.0268 70  HIS A CA  
393  C C   . HIS A 59  ? 0.7192 0.9495 1.1311 -0.0001 0.0105  -0.0408 70  HIS A C   
394  O O   . HIS A 59  ? 0.7466 0.9706 1.1587 0.0125  -0.0092 -0.0503 70  HIS A O   
395  C CB  . HIS A 59  ? 0.6199 0.8181 0.9702 0.0075  0.0260  -0.0264 70  HIS A CB  
396  C CG  . HIS A 59  ? 0.5814 0.7533 0.8927 0.0051  0.0336  -0.0152 70  HIS A CG  
397  N ND1 . HIS A 59  ? 0.4340 0.5754 0.7118 0.0114  0.0235  -0.0140 70  HIS A ND1 
398  C CD2 . HIS A 59  ? 0.6107 0.7828 0.9116 -0.0030 0.0500  -0.0058 70  HIS A CD2 
399  C CE1 . HIS A 59  ? 0.6590 0.7869 0.9120 0.0069  0.0337  -0.0055 70  HIS A CE1 
400  N NE2 . HIS A 59  ? 0.5076 0.6530 0.7735 -0.0007 0.0484  -0.0004 70  HIS A NE2 
401  N N   . GLN A 60  ? 0.6941 0.9564 1.1417 -0.0118 0.0246  -0.0427 71  GLN A N   
402  C CA  . GLN A 60  ? 0.5728 0.8692 1.0674 -0.0110 0.0172  -0.0580 71  GLN A CA  
403  C C   . GLN A 60  ? 0.4428 0.7546 0.9477 0.0093  0.0072  -0.0716 71  GLN A C   
404  O O   . GLN A 60  ? 0.6349 0.9667 1.1717 0.0170  -0.0086 -0.0869 71  GLN A O   
405  C CB  . GLN A 60  ? 0.6161 0.9446 1.1456 -0.0299 0.0384  -0.0575 71  GLN A CB  
406  C CG  . GLN A 60  ? 0.7625 1.1115 1.2949 -0.0292 0.0594  -0.0568 71  GLN A CG  
407  C CD  . GLN A 60  ? 1.0004 1.3888 1.5757 -0.0462 0.0785  -0.0622 71  GLN A CD  
408  O OE1 . GLN A 60  ? 1.1166 1.5157 1.7197 -0.0604 0.0766  -0.0655 71  GLN A OE1 
409  N NE2 . GLN A 60  ? 0.9571 1.3668 1.5374 -0.0456 0.0977  -0.0638 71  GLN A NE2 
410  N N   . GLU A 61  ? 0.5255 0.8272 1.0039 0.0189  0.0145  -0.0676 72  GLU A N   
411  C CA  . GLU A 61  ? 0.7723 1.0810 1.2532 0.0399  0.0039  -0.0798 72  GLU A CA  
412  C C   . GLU A 61  ? 0.8504 1.1151 1.2863 0.0541  -0.0156 -0.0770 72  GLU A C   
413  O O   . GLU A 61  ? 0.8413 1.0732 1.2377 0.0481  -0.0111 -0.0635 72  GLU A O   
414  C CB  . GLU A 61  ? 0.9465 1.2699 1.4252 0.0420  0.0237  -0.0786 72  GLU A CB  
415  C CG  . GLU A 61  ? 0.9670 1.2598 1.4001 0.0361  0.0368  -0.0618 72  GLU A CG  
416  C CD  . GLU A 61  ? 0.8868 1.1940 1.3265 0.0172  0.0617  -0.0520 72  GLU A CD  
417  O OE1 . GLU A 61  ? 0.8849 1.1974 1.3402 0.0015  0.0653  -0.0477 72  GLU A OE1 
418  O OE2 . GLU A 61  ? 0.8100 1.1204 1.2367 0.0182  0.0770  -0.0485 72  GLU A OE2 
419  N N   . ASN A 62  ? 0.9813 1.2449 1.4229 0.0727  -0.0372 -0.0904 73  ASN A N   
420  C CA  . ASN A 62  ? 0.9979 1.2162 1.3936 0.0865  -0.0566 -0.0887 73  ASN A CA  
421  C C   . ASN A 62  ? 0.9477 1.1494 1.3134 0.0968  -0.0503 -0.0860 73  ASN A C   
422  O O   . ASN A 62  ? 1.0752 1.2837 1.4483 0.1147  -0.0598 -0.0977 73  ASN A O   
423  C CB  . ASN A 62  ? 1.1646 1.3837 1.5746 0.1032  -0.0846 -0.1041 73  ASN A CB  
424  C CG  . ASN A 62  ? 1.2519 1.4195 1.6088 0.1182  -0.1046 -0.1023 73  ASN A CG  
425  O OD1 . ASN A 62  ? 1.3051 1.4353 1.6167 0.1107  -0.0987 -0.0888 73  ASN A OD1 
426  N ND2 . ASN A 62  ? 1.2740 1.4389 1.6357 0.1396  -0.1284 -0.1167 73  ASN A ND2 
427  N N   . ASN A 63  ? 0.7352 0.9146 1.0671 0.0860  -0.0351 -0.0714 74  ASN A N   
428  C CA  . ASN A 63  ? 0.7109 0.8736 1.0134 0.0928  -0.0277 -0.0683 74  ASN A CA  
429  C C   . ASN A 63  ? 0.6658 0.7886 0.9210 0.0839  -0.0234 -0.0548 74  ASN A C   
430  O O   . ASN A 63  ? 0.8489 0.9697 1.1021 0.0691  -0.0160 -0.0459 74  ASN A O   
431  C CB  . ASN A 63  ? 0.6558 0.8531 0.9825 0.0875  -0.0057 -0.0683 74  ASN A CB  
432  C CG  . ASN A 63  ? 0.8561 1.0897 1.2226 0.1009  -0.0090 -0.0846 74  ASN A CG  
433  O OD1 . ASN A 63  ? 0.8920 1.1153 1.2537 0.1201  -0.0274 -0.0955 74  ASN A OD1 
434  N ND2 . ASN A 63  ? 0.9615 1.2370 1.3668 0.0908  0.0088  -0.0871 74  ASN A ND2 
435  N N   . ALA A 64  ? 0.7198 0.8110 0.9376 0.0930  -0.0280 -0.0543 75  ALA A N   
436  C CA  . ALA A 64  ? 0.6627 0.7159 0.8359 0.0847  -0.0246 -0.0440 75  ALA A CA  
437  C C   . ALA A 64  ? 0.6756 0.7405 0.8491 0.0697  -0.0031 -0.0344 75  ALA A C   
438  O O   . ALA A 64  ? 0.4911 0.5791 0.6803 0.0700  0.0093  -0.0351 75  ALA A O   
439  C CB  . ALA A 64  ? 0.5540 0.5706 0.6880 0.0962  -0.0329 -0.0464 75  ALA A CB  
440  N N   . VAL A 65  ? 0.6657 0.7142 0.8206 0.0575  0.0008  -0.0262 76  VAL A N   
441  C CA  . VAL A 65  ? 0.5327 0.5872 0.6831 0.0451  0.0179  -0.0179 76  VAL A CA  
442  C C   . VAL A 65  ? 0.6168 0.6469 0.7329 0.0462  0.0218  -0.0167 76  VAL A C   
443  O O   . VAL A 65  ? 0.5132 0.5113 0.5980 0.0458  0.0152  -0.0165 76  VAL A O   
444  C CB  . VAL A 65  ? 0.4732 0.5222 0.6210 0.0333  0.0192  -0.0120 76  VAL A CB  
445  C CG1 . VAL A 65  ? 0.4567 0.5166 0.6064 0.0230  0.0347  -0.0048 76  VAL A CG1 
446  C CG2 . VAL A 65  ? 0.6663 0.7311 0.8431 0.0328  0.0112  -0.0148 76  VAL A CG2 
447  N N   . THR A 66  ? 0.4867 0.5307 0.6070 0.0465  0.0332  -0.0161 77  THR A N   
448  C CA  . THR A 66  ? 0.5000 0.5231 0.5909 0.0478  0.0365  -0.0166 77  THR A CA  
449  C C   . THR A 66  ? 0.6194 0.6396 0.6974 0.0353  0.0478  -0.0106 77  THR A C   
450  O O   . THR A 66  ? 0.6920 0.6877 0.7419 0.0316  0.0480  -0.0110 77  THR A O   
451  C CB  . THR A 66  ? 0.5023 0.5402 0.6029 0.0579  0.0403  -0.0219 77  THR A CB  
452  O OG1 . THR A 66  ? 0.5199 0.5864 0.6397 0.0519  0.0546  -0.0182 77  THR A OG1 
453  C CG2 . THR A 66  ? 0.5094 0.5585 0.6312 0.0715  0.0292  -0.0301 77  THR A CG2 
454  N N   . GLN A 67  ? 0.4702 0.5139 0.5677 0.0287  0.0567  -0.0058 78  GLN A N   
455  C CA  . GLN A 67  ? 0.4623 0.5054 0.5500 0.0193  0.0651  -0.0016 78  GLN A CA  
456  C C   . GLN A 67  ? 0.4821 0.5373 0.5859 0.0122  0.0669  0.0037  78  GLN A C   
457  O O   . GLN A 67  ? 0.4926 0.5648 0.6192 0.0130  0.0673  0.0055  78  GLN A O   
458  C CB  . GLN A 67  ? 0.4599 0.5148 0.5469 0.0210  0.0744  -0.0015 78  GLN A CB  
459  C CG  . GLN A 67  ? 0.5867 0.6271 0.6551 0.0276  0.0728  -0.0073 78  GLN A CG  
460  C CD  . GLN A 67  ? 0.7858 0.8358 0.8502 0.0286  0.0816  -0.0078 78  GLN A CD  
461  O OE1 . GLN A 67  ? 0.8910 0.9529 0.9593 0.0230  0.0880  -0.0035 78  GLN A OE1 
462  N NE2 . GLN A 67  ? 0.8755 0.9180 0.9296 0.0367  0.0807  -0.0136 78  GLN A NE2 
463  N N   . ILE A 68  ? 0.5204 0.5668 0.6129 0.0051  0.0682  0.0051  79  ILE A N   
464  C CA  . ILE A 68  ? 0.4864 0.5403 0.5903 -0.0006 0.0689  0.0092  79  ILE A CA  
465  C C   . ILE A 68  ? 0.5513 0.6084 0.6480 -0.0042 0.0750  0.0104  79  ILE A C   
466  O O   . ILE A 68  ? 0.9018 0.9494 0.9831 -0.0068 0.0758  0.0060  79  ILE A O   
467  C CB  . ILE A 68  ? 0.4930 0.5330 0.5919 -0.0036 0.0618  0.0074  79  ILE A CB  
468  C CG1 . ILE A 68  ? 0.4464 0.4825 0.5520 0.0016  0.0529  0.0054  79  ILE A CG1 
469  C CG2 . ILE A 68  ? 0.5740 0.6201 0.6835 -0.0084 0.0622  0.0105  79  ILE A CG2 
470  C CD1 . ILE A 68  ? 0.4557 0.4745 0.5513 -0.0004 0.0447  0.0031  79  ILE A CD1 
471  N N   . HIS A 69  ? 0.5033 0.5728 0.6103 -0.0048 0.0789  0.0156  80  HIS A N   
472  C CA  . HIS A 69  ? 0.5212 0.5934 0.6210 -0.0058 0.0821  0.0165  80  HIS A CA  
473  C C   . HIS A 69  ? 0.4456 0.5191 0.5535 -0.0082 0.0801  0.0213  80  HIS A C   
474  O O   . HIS A 69  ? 0.5383 0.6166 0.6539 -0.0088 0.0827  0.0279  80  HIS A O   
475  C CB  . HIS A 69  ? 0.4912 0.5710 0.5867 -0.0023 0.0882  0.0185  80  HIS A CB  
476  C CG  . HIS A 69  ? 0.5966 0.6730 0.6827 0.0011  0.0895  0.0130  80  HIS A CG  
477  N ND1 . HIS A 69  ? 0.5880 0.6579 0.6592 0.0004  0.0894  0.0073  80  HIS A ND1 
478  C CD2 . HIS A 69  ? 0.4861 0.5640 0.5758 0.0056  0.0902  0.0113  80  HIS A CD2 
479  C CE1 . HIS A 69  ? 0.6872 0.7511 0.7505 0.0037  0.0900  0.0034  80  HIS A CE1 
480  N NE2 . HIS A 69  ? 0.5522 0.6207 0.6262 0.0081  0.0899  0.0055  80  HIS A NE2 
481  N N   . LEU A 70  ? 0.4605 0.5288 0.5657 -0.0099 0.0760  0.0173  81  LEU A N   
482  C CA  . LEU A 70  ? 0.5492 0.6162 0.6597 -0.0102 0.0725  0.0204  81  LEU A CA  
483  C C   . LEU A 70  ? 0.4573 0.5269 0.5603 -0.0067 0.0730  0.0218  81  LEU A C   
484  O O   . LEU A 70  ? 0.5129 0.5861 0.6092 -0.0049 0.0728  0.0149  81  LEU A O   
485  C CB  . LEU A 70  ? 0.5397 0.6015 0.6510 -0.0117 0.0678  0.0137  81  LEU A CB  
486  C CG  . LEU A 70  ? 0.6045 0.6594 0.7200 -0.0145 0.0648  0.0130  81  LEU A CG  
487  C CD1 . LEU A 70  ? 0.7703 0.8197 0.8751 -0.0159 0.0664  0.0076  81  LEU A CD1 
488  C CD2 . LEU A 70  ? 0.4223 0.4715 0.5412 -0.0152 0.0597  0.0099  81  LEU A CD2 
489  N N   . LEU A 71  ? 0.5101 0.5766 0.6127 -0.0061 0.0735  0.0303  82  LEU A N   
490  C CA  . LEU A 71  ? 0.6337 0.6982 0.7236 -0.0018 0.0731  0.0330  82  LEU A CA  
491  C C   . LEU A 71  ? 0.7372 0.8001 0.8249 0.0032  0.0645  0.0260  82  LEU A C   
492  O O   . LEU A 71  ? 0.8684 0.9285 0.9645 0.0027  0.0597  0.0225  82  LEU A O   
493  C CB  . LEU A 71  ? 0.7443 0.8001 0.8300 -0.0039 0.0758  0.0445  82  LEU A CB  
494  C CG  . LEU A 71  ? 0.4635 0.5256 0.5578 -0.0098 0.0852  0.0497  82  LEU A CG  
495  C CD1 . LEU A 71  ? 0.6698 0.7231 0.7573 -0.0144 0.0908  0.0605  82  LEU A CD1 
496  C CD2 . LEU A 71  ? 0.4576 0.5309 0.5489 -0.0074 0.0913  0.0455  82  LEU A CD2 
497  N N   . PRO A 72  ? 0.7040 0.7699 0.7816 0.0087  0.0620  0.0221  83  PRO A N   
498  C CA  . PRO A 72  ? 0.5199 0.5901 0.6003 0.0143  0.0533  0.0117  83  PRO A CA  
499  C C   . PRO A 72  ? 0.5592 0.6178 0.6392 0.0194  0.0445  0.0147  83  PRO A C   
500  O O   . PRO A 72  ? 0.6084 0.6527 0.6744 0.0228  0.0418  0.0243  83  PRO A O   
501  C CB  . PRO A 72  ? 0.5446 0.6195 0.6132 0.0196  0.0513  0.0082  83  PRO A CB  
502  C CG  . PRO A 72  ? 0.7776 0.8532 0.8393 0.0152  0.0610  0.0136  83  PRO A CG  
503  C CD  . PRO A 72  ? 0.8622 0.9300 0.9268 0.0103  0.0667  0.0249  83  PRO A CD  
504  N N   . GLY A 73  ? 0.6413 0.7038 0.7341 0.0199  0.0404  0.0062  84  GLY A N   
505  C CA  . GLY A 73  ? 0.7357 0.7872 0.8289 0.0269  0.0303  0.0059  84  GLY A CA  
506  C C   . GLY A 73  ? 0.8120 0.8429 0.8989 0.0235  0.0304  0.0196  84  GLY A C   
507  O O   . GLY A 73  ? 0.8084 0.8222 0.8862 0.0300  0.0215  0.0234  84  GLY A O   
508  N N   . GLN A 74  ? 0.8519 0.8832 0.9435 0.0137  0.0395  0.0265  85  GLN A N   
509  C CA  . GLN A 74  ? 0.8206 0.8359 0.9104 0.0080  0.0410  0.0381  85  GLN A CA  
510  C C   . GLN A 74  ? 0.7385 0.7595 0.8440 0.0000  0.0450  0.0365  85  GLN A C   
511  O O   . GLN A 74  ? 0.7559 0.7906 0.8680 -0.0020 0.0493  0.0301  85  GLN A O   
512  C CB  . GLN A 74  ? 0.9962 1.0062 1.0733 0.0039  0.0487  0.0499  85  GLN A CB  
513  C CG  . GLN A 74  ? 1.1778 1.1740 1.2324 0.0118  0.0433  0.0540  85  GLN A CG  
514  C CD  . GLN A 74  ? 1.4816 1.4700 1.5195 0.0064  0.0531  0.0660  85  GLN A CD  
515  O OE1 . GLN A 74  ? 1.6248 1.6253 1.6718 -0.0018 0.0647  0.0686  85  GLN A OE1 
516  N NE2 . GLN A 74  ? 1.5302 1.4975 1.5422 0.0117  0.0482  0.0727  85  GLN A NE2 
517  N N   . CYS A 75  ? 0.6577 0.6653 0.7671 -0.0045 0.0427  0.0423  86  CYS A N   
518  C CA  . CYS A 75  ? 0.7134 0.7243 0.8372 -0.0115 0.0441  0.0408  86  CYS A CA  
519  C C   . CYS A 75  ? 0.6966 0.7150 0.8270 -0.0196 0.0530  0.0478  86  CYS A C   
520  O O   . CYS A 75  ? 0.4768 0.4912 0.6172 -0.0270 0.0537  0.0521  86  CYS A O   
521  C CB  . CYS A 75  ? 0.8591 0.8527 0.9857 -0.0127 0.0362  0.0417  86  CYS A CB  
522  S SG  . CYS A 75  ? 0.7829 0.7691 0.9043 -0.0010 0.0251  0.0312  86  CYS A SG  
523  N N   . GLN A 76  ? 0.4638 0.4947 0.5903 -0.0180 0.0598  0.0475  87  GLN A N   
524  C CA  . GLN A 76  ? 0.6073 0.6489 0.7409 -0.0234 0.0687  0.0516  87  GLN A CA  
525  C C   . GLN A 76  ? 0.5864 0.6413 0.7206 -0.0197 0.0713  0.0445  87  GLN A C   
526  O O   . GLN A 76  ? 0.5783 0.6337 0.7037 -0.0147 0.0687  0.0385  87  GLN A O   
527  C CB  . GLN A 76  ? 0.7035 0.7411 0.8254 -0.0256 0.0764  0.0609  87  GLN A CB  
528  C CG  . GLN A 76  ? 0.7339 0.7531 0.8511 -0.0316 0.0755  0.0697  87  GLN A CG  
529  C CD  . GLN A 76  ? 0.7703 0.7800 0.8676 -0.0337 0.0834  0.0794  87  GLN A CD  
530  O OE1 . GLN A 76  ? 0.8512 0.8560 0.9292 -0.0256 0.0812  0.0793  87  GLN A OE1 
531  N NE2 . GLN A 76  ? 0.6722 0.6792 0.7734 -0.0453 0.0930  0.0871  87  GLN A NE2 
532  N N   . LEU A 77  ? 0.6418 0.7074 0.7871 -0.0224 0.0761  0.0445  88  LEU A N   
533  C CA  . LEU A 77  ? 0.6101 0.6839 0.7534 -0.0183 0.0776  0.0383  88  LEU A CA  
534  C C   . LEU A 77  ? 0.6231 0.7099 0.7769 -0.0194 0.0848  0.0397  88  LEU A C   
535  O O   . LEU A 77  ? 0.5586 0.6510 0.7277 -0.0249 0.0875  0.0432  88  LEU A O   
536  C CB  . LEU A 77  ? 0.5249 0.5941 0.6703 -0.0173 0.0702  0.0310  88  LEU A CB  
537  C CG  . LEU A 77  ? 0.5474 0.6154 0.7080 -0.0204 0.0645  0.0304  88  LEU A CG  
538  C CD1 . LEU A 77  ? 0.5802 0.6569 0.7502 -0.0181 0.0639  0.0268  88  LEU A CD1 
539  C CD2 . LEU A 77  ? 0.5288 0.5846 0.6835 -0.0202 0.0566  0.0254  88  LEU A CD2 
540  N N   . VAL A 78  ? 0.5487 0.6411 0.6954 -0.0144 0.0882  0.0360  89  VAL A N   
541  C CA  . VAL A 78  ? 0.4289 0.5353 0.5850 -0.0128 0.0950  0.0348  89  VAL A CA  
542  C C   . VAL A 78  ? 0.4794 0.5858 0.6378 -0.0068 0.0889  0.0266  89  VAL A C   
543  O O   . VAL A 78  ? 0.5202 0.6155 0.6621 -0.0035 0.0851  0.0229  89  VAL A O   
544  C CB  . VAL A 78  ? 0.4366 0.5463 0.5784 -0.0105 0.1041  0.0372  89  VAL A CB  
545  C CG1 . VAL A 78  ? 0.6006 0.7262 0.7526 -0.0076 0.1117  0.0338  89  VAL A CG1 
546  C CG2 . VAL A 78  ? 0.4486 0.5527 0.5824 -0.0158 0.1089  0.0461  89  VAL A CG2 
547  N N   . THR A 79  ? 0.5540 0.6718 0.7322 -0.0056 0.0874  0.0232  90  THR A N   
548  C CA  . THR A 79  ? 0.5793 0.6943 0.7583 0.0021  0.0793  0.0153  90  THR A CA  
549  C C   . THR A 79  ? 0.5376 0.6679 0.7249 0.0089  0.0847  0.0106  90  THR A C   
550  O O   . THR A 79  ? 0.6328 0.7816 0.8346 0.0057  0.0951  0.0125  90  THR A O   
551  C CB  . THR A 79  ? 0.7773 0.8925 0.9731 0.0013  0.0690  0.0122  90  THR A CB  
552  O OG1 . THR A 79  ? 0.8669 1.0034 1.0908 -0.0033 0.0739  0.0128  90  THR A OG1 
553  C CG2 . THR A 79  ? 0.8327 0.9316 1.0184 -0.0043 0.0635  0.0154  90  THR A CG2 
554  N N   . LEU A 80  ? 0.4337 0.5545 0.6100 0.0180  0.0781  0.0040  91  LEU A N   
555  C CA  . LEU A 80  ? 0.5175 0.6504 0.7009 0.0275  0.0805  -0.0029 91  LEU A CA  
556  C C   . LEU A 80  ? 0.6233 0.7506 0.8129 0.0372  0.0663  -0.0113 91  LEU A C   
557  O O   . LEU A 80  ? 0.5534 0.6545 0.7204 0.0399  0.0562  -0.0122 91  LEU A O   
558  C CB  . LEU A 80  ? 0.4467 0.5685 0.6049 0.0314  0.0853  -0.0035 91  LEU A CB  
559  C CG  . LEU A 80  ? 0.6161 0.7465 0.7773 0.0429  0.0870  -0.0118 91  LEU A CG  
560  C CD1 . LEU A 80  ? 0.7120 0.8741 0.9007 0.0422  0.0985  -0.0134 91  LEU A CD1 
561  C CD2 . LEU A 80  ? 0.4649 0.5808 0.5986 0.0452  0.0909  -0.0123 91  LEU A CD2 
562  N N   . LEU A 81  ? 0.4463 0.5976 0.6657 0.0422  0.0655  -0.0180 92  LEU A N   
563  C CA  . LEU A 81  ? 0.4561 0.6049 0.6844 0.0543  0.0497  -0.0279 92  LEU A CA  
564  C C   . LEU A 81  ? 0.4680 0.6200 0.6938 0.0688  0.0490  -0.0370 92  LEU A C   
565  O O   . LEU A 81  ? 0.4659 0.6303 0.6914 0.0683  0.0626  -0.0366 92  LEU A O   
566  C CB  . LEU A 81  ? 0.4488 0.6250 0.7165 0.0519  0.0467  -0.0326 92  LEU A CB  
567  C CG  . LEU A 81  ? 0.5432 0.7199 0.8182 0.0368  0.0492  -0.0243 92  LEU A CG  
568  C CD1 . LEU A 81  ? 0.4337 0.6397 0.7505 0.0334  0.0472  -0.0308 92  LEU A CD1 
569  C CD2 . LEU A 81  ? 0.4440 0.5875 0.6914 0.0360  0.0365  -0.0206 92  LEU A CD2 
570  N N   . ASP A 82  ? 0.5686 0.7070 0.7903 0.0827  0.0317  -0.0456 93  ASP A N   
571  C CA  . ASP A 82  ? 0.5007 0.6354 0.7158 0.0989  0.0275  -0.0552 93  ASP A CA  
572  C C   . ASP A 82  ? 0.5393 0.7165 0.7928 0.1049  0.0370  -0.0649 93  ASP A C   
573  O O   . ASP A 82  ? 0.5063 0.6847 0.7560 0.1182  0.0370  -0.0734 93  ASP A O   
574  C CB  . ASP A 82  ? 0.5250 0.6320 0.7253 0.1137  0.0045  -0.0624 93  ASP A CB  
575  C CG  . ASP A 82  ? 0.6279 0.7517 0.8585 0.1167  -0.0084 -0.0684 93  ASP A CG  
576  O OD1 . ASP A 82  ? 0.7931 0.9563 1.0636 0.1094  0.0011  -0.0702 93  ASP A OD1 
577  O OD2 . ASP A 82  ? 0.7937 0.8892 1.0061 0.1256  -0.0282 -0.0714 93  ASP A OD2 
578  N N   . ASP A 83  ? 0.6572 0.8685 0.9469 0.0949  0.0458  -0.0646 94  ASP A N   
579  C CA  . ASP A 83  ? 0.6778 0.9320 1.0040 0.0957  0.0600  -0.0731 94  ASP A CA  
580  C C   . ASP A 83  ? 0.4636 0.7260 0.7802 0.0826  0.0835  -0.0635 94  ASP A C   
581  O O   . ASP A 83  ? 0.6178 0.9148 0.9624 0.0763  0.0998  -0.0667 94  ASP A O   
582  C CB  . ASP A 83  ? 0.6854 0.9725 1.0566 0.0900  0.0580  -0.0790 94  ASP A CB  
583  C CG  . ASP A 83  ? 0.6879 0.9668 1.0560 0.0705  0.0618  -0.0655 94  ASP A CG  
584  O OD1 . ASP A 83  ? 0.6463 0.8970 0.9794 0.0625  0.0662  -0.0523 94  ASP A OD1 
585  O OD2 . ASP A 83  ? 0.7251 1.0262 1.1270 0.0636  0.0596  -0.0694 94  ASP A OD2 
586  N N   . ASN A 84  ? 0.4655 0.6964 0.7425 0.0778  0.0855  -0.0525 95  ASN A N   
587  C CA  . ASN A 84  ? 0.4745 0.7070 0.7358 0.0677  0.1042  -0.0437 95  ASN A CA  
588  C C   . ASN A 84  ? 0.5197 0.7682 0.7964 0.0500  0.1169  -0.0344 95  ASN A C   
589  O O   . ASN A 84  ? 0.6204 0.8825 0.8967 0.0426  0.1347  -0.0306 95  ASN A O   
590  C CB  . ASN A 84  ? 0.4730 0.7238 0.7382 0.0771  0.1155  -0.0528 95  ASN A CB  
591  C CG  . ASN A 84  ? 0.7817 1.0110 1.0094 0.0769  0.1220  -0.0472 95  ASN A CG  
592  O OD1 . ASN A 84  ? 0.8821 1.0795 1.0807 0.0765  0.1123  -0.0418 95  ASN A OD1 
593  N ND2 . ASN A 84  ? 0.7571 1.0041 0.9851 0.0766  0.1389  -0.0493 95  ASN A ND2 
594  N N   . SER A 85  ? 0.4826 0.7260 0.7694 0.0430  0.1076  -0.0305 96  SER A N   
595  C CA  . SER A 85  ? 0.4815 0.7350 0.7817 0.0262  0.1172  -0.0219 96  SER A CA  
596  C C   . SER A 85  ? 0.7219 0.9458 0.9914 0.0176  0.1153  -0.0087 96  SER A C   
597  O O   . SER A 85  ? 0.8130 1.0126 1.0631 0.0224  0.1020  -0.0079 96  SER A O   
598  C CB  . SER A 85  ? 0.4555 0.7249 0.7905 0.0237  0.1079  -0.0281 96  SER A CB  
599  O OG  . SER A 85  ? 0.8878 1.1886 1.2560 0.0327  0.1083  -0.0428 96  SER A OG  
600  N N   . LEU A 86  ? 0.7126 0.9381 0.9771 0.0050  0.1288  0.0011  97  LEU A N   
601  C CA  . LEU A 86  ? 0.6537 0.8546 0.8938 -0.0025 0.1265  0.0124  97  LEU A CA  
602  C C   . LEU A 86  ? 0.6103 0.8130 0.8671 -0.0150 0.1263  0.0178  97  LEU A C   
603  O O   . LEU A 86  ? 0.7197 0.9433 1.0012 -0.0230 0.1358  0.0164  97  LEU A O   
604  C CB  . LEU A 86  ? 0.7099 0.9036 0.9240 -0.0052 0.1388  0.0198  97  LEU A CB  
605  C CG  . LEU A 86  ? 0.5481 0.7350 0.7406 0.0060  0.1381  0.0152  97  LEU A CG  
606  C CD1 . LEU A 86  ? 0.6815 0.8601 0.8474 0.0029  0.1483  0.0224  97  LEU A CD1 
607  C CD2 . LEU A 86  ? 0.4441 0.6104 0.6229 0.0121  0.1227  0.0126  97  LEU A CD2 
608  N N   . HIS A 87  ? 0.4783 0.6593 0.7219 -0.0174 0.1159  0.0229  98  HIS A N   
609  C CA  . HIS A 87  ? 0.4989 0.6767 0.7555 -0.0280 0.1129  0.0271  98  HIS A CA  
610  C C   . HIS A 87  ? 0.5830 0.7353 0.8137 -0.0314 0.1097  0.0362  98  HIS A C   
611  O O   . HIS A 87  ? 0.6236 0.7614 0.8356 -0.0244 0.1016  0.0349  98  HIS A O   
612  C CB  . HIS A 87  ? 0.4385 0.6192 0.7145 -0.0242 0.0979  0.0189  98  HIS A CB  
613  C CG  . HIS A 87  ? 0.5917 0.7970 0.8939 -0.0172 0.0968  0.0075  98  HIS A CG  
614  N ND1 . HIS A 87  ? 0.5323 0.7636 0.8699 -0.0243 0.1015  0.0024  98  HIS A ND1 
615  C CD2 . HIS A 87  ? 0.5817 0.7897 0.8805 -0.0034 0.0910  -0.0009 98  HIS A CD2 
616  C CE1 . HIS A 87  ? 0.5627 0.8146 0.9201 -0.0137 0.0980  -0.0097 98  HIS A CE1 
617  N NE2 . HIS A 87  ? 0.5232 0.7594 0.8559 -0.0002 0.0910  -0.0114 98  HIS A NE2 
618  N N   . LEU A 88  ? 0.5530 0.6996 0.7829 -0.0424 0.1162  0.0445  99  LEU A N   
619  C CA  . LEU A 88  ? 0.5740 0.6963 0.7811 -0.0443 0.1119  0.0523  99  LEU A CA  
620  C C   . LEU A 88  ? 0.6970 0.8099 0.9154 -0.0488 0.1011  0.0517  99  LEU A C   
621  O O   . LEU A 88  ? 0.8934 1.0113 1.1302 -0.0590 0.1040  0.0532  99  LEU A O   
622  C CB  . LEU A 88  ? 0.4757 0.5899 0.6674 -0.0521 0.1240  0.0625  99  LEU A CB  
623  C CG  . LEU A 88  ? 0.6358 0.7230 0.8014 -0.0514 0.1180  0.0701  99  LEU A CG  
624  C CD1 . LEU A 88  ? 0.9131 0.9950 1.0605 -0.0392 0.1106  0.0661  99  LEU A CD1 
625  C CD2 . LEU A 88  ? 0.6530 0.7278 0.7997 -0.0592 0.1293  0.0808  99  LEU A CD2 
626  N N   . TRP A 89  ? 0.7671 0.8668 0.9744 -0.0421 0.0894  0.0486  100 TRP A N   
627  C CA  . TRP A 89  ? 0.7773 0.8658 0.9908 -0.0447 0.0785  0.0469  100 TRP A CA  
628  C C   . TRP A 89  ? 0.8250 0.8922 1.0188 -0.0447 0.0753  0.0524  100 TRP A C   
629  O O   . TRP A 89  ? 0.7634 0.8253 0.9381 -0.0392 0.0774  0.0543  100 TRP A O   
630  C CB  . TRP A 89  ? 0.6855 0.7738 0.8998 -0.0369 0.0678  0.0379  100 TRP A CB  
631  C CG  . TRP A 89  ? 0.6383 0.7439 0.8714 -0.0344 0.0667  0.0313  100 TRP A CG  
632  C CD1 . TRP A 89  ? 0.6124 0.7310 0.8459 -0.0287 0.0723  0.0285  100 TRP A CD1 
633  C CD2 . TRP A 89  ? 0.6593 0.7711 0.9138 -0.0359 0.0576  0.0251  100 TRP A CD2 
634  N NE1 . TRP A 89  ? 0.6382 0.7709 0.8927 -0.0255 0.0670  0.0206  100 TRP A NE1 
635  C CE2 . TRP A 89  ? 0.5989 0.7284 0.8671 -0.0298 0.0575  0.0183  100 TRP A CE2 
636  C CE3 . TRP A 89  ? 0.4884 0.5920 0.7518 -0.0408 0.0483  0.0236  100 TRP A CE3 
637  C CZ2 . TRP A 89  ? 0.4996 0.6401 0.7911 -0.0278 0.0474  0.0097  100 TRP A CZ2 
638  C CZ3 . TRP A 89  ? 0.4320 0.5460 0.7176 -0.0402 0.0389  0.0155  100 TRP A CZ3 
639  C CH2 . TRP A 89  ? 0.5183 0.6512 0.8183 -0.0334 0.0380  0.0084  100 TRP A CH2 
640  N N   . SER A 90  ? 0.7191 0.7742 0.9185 -0.0501 0.0690  0.0536  101 SER A N   
641  C CA  . SER A 90  ? 0.7059 0.7392 0.8883 -0.0488 0.0641  0.0576  101 SER A CA  
642  C C   . SER A 90  ? 0.6619 0.6853 0.8493 -0.0474 0.0521  0.0514  101 SER A C   
643  O O   . SER A 90  ? 0.4913 0.5223 0.6946 -0.0496 0.0477  0.0458  101 SER A O   
644  C CB  . SER A 90  ? 0.7843 0.8046 0.9614 -0.0581 0.0703  0.0680  101 SER A CB  
645  O OG  . SER A 90  ? 0.9923 1.0197 1.1602 -0.0593 0.0823  0.0737  101 SER A OG  
646  N N   . LEU A 91  ? 0.6191 0.6252 0.7919 -0.0426 0.0459  0.0514  102 LEU A N   
647  C CA  . LEU A 91  ? 0.5925 0.5866 0.7668 -0.0404 0.0351  0.0450  102 LEU A CA  
648  C C   . LEU A 91  ? 0.7553 0.7270 0.9249 -0.0449 0.0312  0.0512  102 LEU A C   
649  O O   . LEU A 91  ? 0.9482 0.9045 1.1025 -0.0379 0.0264  0.0515  102 LEU A O   
650  C CB  . LEU A 91  ? 0.6574 0.6517 0.8198 -0.0299 0.0311  0.0367  102 LEU A CB  
651  C CG  . LEU A 91  ? 0.6471 0.6505 0.8125 -0.0279 0.0292  0.0276  102 LEU A CG  
652  C CD1 . LEU A 91  ? 0.7355 0.7543 0.9072 -0.0301 0.0354  0.0291  102 LEU A CD1 
653  C CD2 . LEU A 91  ? 0.5513 0.5555 0.7046 -0.0204 0.0287  0.0194  102 LEU A CD2 
654  N N   . LYS A 92  ? 0.9966 0.9658 1.1796 -0.0566 0.0329  0.0552  103 LYS A N   
655  C CA  . LYS A 92  ? 1.1324 1.0764 1.3097 -0.0637 0.0299  0.0617  103 LYS A CA  
656  C C   . LYS A 92  ? 1.1344 1.0624 1.3123 -0.0599 0.0165  0.0541  103 LYS A C   
657  O O   . LYS A 92  ? 1.1337 1.0714 1.3261 -0.0609 0.0115  0.0460  103 LYS A O   
658  C CB  . LYS A 92  ? 1.1549 1.1040 1.3488 -0.0802 0.0382  0.0675  103 LYS A CB  
659  C CG  . LYS A 92  ? 1.1086 1.0644 1.2957 -0.0859 0.0530  0.0769  103 LYS A CG  
660  C CD  . LYS A 92  ? 1.2696 1.1936 1.4342 -0.0931 0.0558  0.0886  103 LYS A CD  
661  C CE  . LYS A 92  ? 1.3242 1.2537 1.4812 -0.1021 0.0727  0.0981  103 LYS A CE  
662  N NZ  . LYS A 92  ? 1.2792 1.1723 1.4103 -0.1119 0.0764  0.1106  103 LYS A NZ  
663  N N   . VAL A 93  ? 1.1143 1.0164 1.2746 -0.0545 0.0098  0.0561  104 VAL A N   
664  C CA  . VAL A 93  ? 1.0709 0.9552 1.2295 -0.0497 -0.0029 0.0483  104 VAL A CA  
665  C C   . VAL A 93  ? 1.0556 0.9193 1.2201 -0.0637 -0.0056 0.0534  104 VAL A C   
666  O O   . VAL A 93  ? 1.0586 0.8960 1.2085 -0.0683 -0.0053 0.0626  104 VAL A O   
667  C CB  . VAL A 93  ? 0.9772 0.8446 1.1161 -0.0352 -0.0103 0.0457  104 VAL A CB  
668  C CG1 . VAL A 93  ? 0.8513 0.7018 0.9896 -0.0291 -0.0229 0.0357  104 VAL A CG1 
669  C CG2 . VAL A 93  ? 1.0659 0.9569 1.2023 -0.0240 -0.0062 0.0399  104 VAL A CG2 
670  N N   . LYS A 94  ? 1.1070 0.9807 1.2915 -0.0709 -0.0087 0.0470  105 LYS A N   
671  C CA  . LYS A 94  ? 1.1047 0.9635 1.3004 -0.0862 -0.0114 0.0494  105 LYS A CA  
672  C C   . LYS A 94  ? 1.1450 0.9873 1.3402 -0.0811 -0.0264 0.0388  105 LYS A C   
673  O O   . LYS A 94  ? 1.1230 0.9809 1.3311 -0.0789 -0.0317 0.0287  105 LYS A O   
674  C CB  . LYS A 94  ? 1.0061 0.8930 1.2291 -0.0992 -0.0038 0.0489  105 LYS A CB  
675  N N   . GLY A 95  ? 1.1789 0.9871 1.3566 -0.0783 -0.0340 0.0407  106 GLY A N   
676  C CA  . GLY A 95  ? 1.1755 0.9643 1.3509 -0.0734 -0.0483 0.0304  106 GLY A CA  
677  C C   . GLY A 95  ? 1.1894 0.9827 1.3537 -0.0536 -0.0544 0.0192  106 GLY A C   
678  O O   . GLY A 95  ? 1.2074 1.0076 1.3770 -0.0494 -0.0607 0.0075  106 GLY A O   
679  N N   . GLY A 96  ? 1.2176 1.0072 1.3659 -0.0417 -0.0523 0.0218  107 GLY A N   
680  C CA  . GLY A 96  ? 1.1952 0.9921 1.3358 -0.0239 -0.0565 0.0098  107 GLY A CA  
681  C C   . GLY A 96  ? 1.1629 0.9939 1.3113 -0.0205 -0.0489 0.0030  107 GLY A C   
682  O O   . GLY A 96  ? 1.1780 1.0176 1.3206 -0.0080 -0.0496 -0.0076 107 GLY A O   
683  N N   . ALA A 97  ? 1.1612 1.0113 1.3223 -0.0314 -0.0416 0.0080  108 ALA A N   
684  C CA  . ALA A 97  ? 1.1730 1.0502 1.3378 -0.0286 -0.0352 0.0029  108 ALA A CA  
685  C C   . ALA A 97  ? 1.0061 0.9018 1.1798 -0.0366 -0.0246 0.0131  108 ALA A C   
686  O O   . ALA A 97  ? 1.0062 0.9000 1.1915 -0.0484 -0.0232 0.0202  108 ALA A O   
687  C CB  . ALA A 97  ? 1.2679 1.1466 1.4376 -0.0306 -0.0416 -0.0066 108 ALA A CB  
688  N N   . SER A 98  ? 0.8836 0.7976 1.0526 -0.0308 -0.0168 0.0126  109 SER A N   
689  C CA  . SER A 98  ? 0.8239 0.7551 0.9990 -0.0362 -0.0066 0.0212  109 SER A CA  
690  C C   . SER A 98  ? 0.7352 0.6822 0.9237 -0.0418 -0.0058 0.0186  109 SER A C   
691  O O   . SER A 98  ? 0.5127 0.4596 0.6998 -0.0387 -0.0119 0.0097  109 SER A O   
692  C CB  . SER A 98  ? 0.6693 0.6126 0.8339 -0.0277 0.0001  0.0206  109 SER A CB  
693  O OG  . SER A 98  ? 0.6484 0.5986 0.8075 -0.0207 -0.0011 0.0094  109 SER A OG  
694  N N   . GLU A 99  ? 0.8063 0.7664 1.0068 -0.0493 0.0016  0.0259  110 GLU A N   
695  C CA  . GLU A 99  ? 0.9223 0.9003 1.1380 -0.0525 0.0019  0.0227  110 GLU A CA  
696  C C   . GLU A 99  ? 0.9180 0.9146 1.1368 -0.0531 0.0135  0.0284  110 GLU A C   
697  O O   . GLU A 99  ? 0.9562 0.9506 1.1674 -0.0540 0.0214  0.0361  110 GLU A O   
698  C CB  . GLU A 99  ? 1.1480 1.1252 1.3849 -0.0632 -0.0036 0.0219  110 GLU A CB  
699  C CG  . GLU A 99  ? 1.3854 1.3631 1.6330 -0.0753 0.0052  0.0316  110 GLU A CG  
700  C CD  . GLU A 99  ? 1.5381 1.5165 1.8093 -0.0882 0.0005  0.0291  110 GLU A CD  
701  O OE1 . GLU A 99  ? 1.5811 1.5493 1.8546 -0.0868 -0.0124 0.0211  110 GLU A OE1 
702  O OE2 . GLU A 99  ? 1.5618 1.5513 1.8494 -0.1004 0.0101  0.0342  110 GLU A OE2 
703  N N   . LEU A 100 ? 0.7878 0.8009 1.0161 -0.0514 0.0133  0.0240  111 LEU A N   
704  C CA  . LEU A 100 ? 0.6035 0.6344 0.8342 -0.0498 0.0231  0.0270  111 LEU A CA  
705  C C   . LEU A 100 ? 0.5602 0.6080 0.8166 -0.0588 0.0279  0.0289  111 LEU A C   
706  O O   . LEU A 100 ? 0.7447 0.7983 1.0204 -0.0624 0.0202  0.0230  111 LEU A O   
707  C CB  . LEU A 100 ? 0.5691 0.6048 0.7911 -0.0410 0.0196  0.0201  111 LEU A CB  
708  C CG  . LEU A 100 ? 0.5276 0.5789 0.7499 -0.0373 0.0275  0.0211  111 LEU A CG  
709  C CD1 . LEU A 100 ? 0.4398 0.4913 0.6495 -0.0369 0.0384  0.0279  111 LEU A CD1 
710  C CD2 . LEU A 100 ? 0.5996 0.6466 0.8079 -0.0291 0.0218  0.0143  111 LEU A CD2 
711  N N   . GLN A 101 ? 0.5336 0.5903 0.7904 -0.0626 0.0408  0.0361  112 GLN A N   
712  C CA  . GLN A 101 ? 0.6050 0.6808 0.8864 -0.0725 0.0491  0.0373  112 GLN A CA  
713  C C   . GLN A 101 ? 0.5823 0.6732 0.8594 -0.0697 0.0623  0.0406  112 GLN A C   
714  O O   . GLN A 101 ? 0.6704 0.7514 0.9234 -0.0640 0.0664  0.0456  112 GLN A O   
715  C CB  . GLN A 101 ? 0.7171 0.7807 1.0029 -0.0868 0.0535  0.0443  112 GLN A CB  
716  C CG  . GLN A 101 ? 0.9414 0.9854 1.2003 -0.0879 0.0617  0.0556  112 GLN A CG  
717  C CD  . GLN A 101 ? 1.0532 1.0782 1.3112 -0.1024 0.0651  0.0632  112 GLN A CD  
718  O OE1 . GLN A 101 ? 1.0641 1.0804 1.3081 -0.1090 0.0768  0.0730  112 GLN A OE1 
719  N NE2 . GLN A 101 ? 1.1561 1.1715 1.4260 -0.1076 0.0546  0.0589  112 GLN A NE2 
720  N N   . GLU A 102 ? 0.6294 0.7455 0.9313 -0.0731 0.0683  0.0363  113 GLU A N   
721  C CA  . GLU A 102 ? 0.5467 0.6797 0.8477 -0.0705 0.0814  0.0376  113 GLU A CA  
722  C C   . GLU A 102 ? 0.5905 0.7274 0.8961 -0.0850 0.0977  0.0455  113 GLU A C   
723  O O   . GLU A 102 ? 0.6687 0.8192 1.0015 -0.0970 0.1016  0.0427  113 GLU A O   
724  C CB  . GLU A 102 ? 0.5149 0.6739 0.8398 -0.0633 0.0779  0.0262  113 GLU A CB  
725  C CG  . GLU A 102 ? 0.6084 0.7869 0.9353 -0.0598 0.0914  0.0253  113 GLU A CG  
726  C CD  . GLU A 102 ? 0.7352 0.9376 1.0857 -0.0499 0.0853  0.0124  113 GLU A CD  
727  O OE1 . GLU A 102 ? 0.7142 0.9309 1.0645 -0.0434 0.0936  0.0095  113 GLU A OE1 
728  O OE2 . GLU A 102 ? 0.7268 0.9322 1.0947 -0.0476 0.0709  0.0044  113 GLU A OE2 
729  N N   . ASP A 103 ? 0.7002 0.8242 0.9783 -0.0844 0.1073  0.0548  114 ASP A N   
730  C CA  . ASP A 103 ? 0.8444 0.9623 1.1159 -0.0985 0.1225  0.0644  114 ASP A CA  
731  C C   . ASP A 103 ? 0.8738 1.0205 1.1619 -0.1034 0.1396  0.0614  114 ASP A C   
732  O O   . ASP A 103 ? 0.9993 1.1609 1.3117 -0.1181 0.1496  0.0600  114 ASP A O   
733  C CB  . ASP A 103 ? 0.8336 0.9227 1.0652 -0.0943 0.1235  0.0751  114 ASP A CB  
734  C CG  . ASP A 103 ? 0.9393 1.0018 1.1570 -0.0896 0.1077  0.0767  114 ASP A CG  
735  O OD1 . ASP A 103 ? 0.9617 1.0204 1.1960 -0.0957 0.1000  0.0737  114 ASP A OD1 
736  O OD2 . ASP A 103 ? 1.0947 1.1414 1.2861 -0.0794 0.1028  0.0795  114 ASP A OD2 
737  N N   . GLU A 104 ? 0.6963 0.8521 0.9725 -0.0918 0.1437  0.0594  115 GLU A N   
738  C CA  . GLU A 104 ? 0.8253 1.0070 1.1127 -0.0944 0.1608  0.0560  115 GLU A CA  
739  C C   . GLU A 104 ? 0.6930 0.8947 0.9902 -0.0777 0.1546  0.0445  115 GLU A C   
740  O O   . GLU A 104 ? 0.6634 0.8551 0.9535 -0.0657 0.1385  0.0410  115 GLU A O   
741  C CB  . GLU A 104 ? 0.8937 1.0591 1.1463 -0.0985 0.1756  0.0674  115 GLU A CB  
742  C CG  . GLU A 104 ? 1.0846 1.2265 1.3232 -0.1160 0.1835  0.0795  115 GLU A CG  
743  C CD  . GLU A 104 ? 1.1855 1.2902 1.3774 -0.1116 0.1805  0.0918  115 GLU A CD  
744  O OE1 . GLU A 104 ? 1.1674 1.2674 1.3425 -0.0956 0.1709  0.0898  115 GLU A OE1 
745  O OE2 . GLU A 104 ? 1.2761 1.3553 1.4478 -0.1242 0.1871  0.1029  115 GLU A OE2 
746  N N   . SER A 105 ? 0.8139 1.0425 1.1258 -0.0774 0.1682  0.0383  116 SER A N   
747  C CA  . SER A 105 ? 0.8383 1.0848 1.1592 -0.0611 0.1630  0.0267  116 SER A CA  
748  C C   . SER A 105 ? 0.6997 0.9617 1.0144 -0.0600 0.1816  0.0253  116 SER A C   
749  O O   . SER A 105 ? 0.7948 1.0611 1.1072 -0.0739 0.2000  0.0311  116 SER A O   
750  C CB  . SER A 105 ? 0.9448 1.2170 1.3074 -0.0578 0.1532  0.0127  116 SER A CB  
751  O OG  . SER A 105 ? 1.0238 1.3243 1.4198 -0.0717 0.1675  0.0083  116 SER A OG  
752  N N   . PHE A 106 ? 0.4659 0.7340 0.7754 -0.0437 0.1769  0.0173  117 PHE A N   
753  C CA  . PHE A 106 ? 0.4767 0.7565 0.7758 -0.0396 0.1925  0.0147  117 PHE A CA  
754  C C   . PHE A 106 ? 0.5432 0.8328 0.8482 -0.0205 0.1826  0.0018  117 PHE A C   
755  O O   . PHE A 106 ? 0.7312 1.0020 1.0244 -0.0104 0.1648  0.0010  117 PHE A O   
756  C CB  . PHE A 106 ? 0.7027 0.9539 0.9568 -0.0416 0.1983  0.0277  117 PHE A CB  
757  C CG  . PHE A 106 ? 0.7280 0.9845 0.9636 -0.0329 0.2087  0.0241  117 PHE A CG  
758  C CD1 . PHE A 106 ? 0.6595 0.9339 0.8979 -0.0405 0.2308  0.0232  117 PHE A CD1 
759  C CD2 . PHE A 106 ? 0.7048 0.9471 0.9188 -0.0181 0.1973  0.0212  117 PHE A CD2 
760  C CE1 . PHE A 106 ? 0.6654 0.9436 0.8847 -0.0319 0.2403  0.0191  117 PHE A CE1 
761  C CE2 . PHE A 106 ? 0.7610 1.0064 0.9571 -0.0100 0.2058  0.0171  117 PHE A CE2 
762  C CZ  . PHE A 106 ? 0.6871 0.9504 0.8853 -0.0160 0.2270  0.0159  117 PHE A CZ  
763  N N   . THR A 107 ? 0.5088 0.8260 0.8301 -0.0158 0.1949  -0.0086 118 THR A N   
764  C CA  . THR A 107 ? 0.6326 0.9580 0.9581 0.0035  0.1864  -0.0218 118 THR A CA  
765  C C   . THR A 107 ? 0.6564 0.9857 0.9614 0.0079  0.2023  -0.0233 118 THR A C   
766  O O   . THR A 107 ? 0.6429 0.9947 0.9588 -0.0009 0.2230  -0.0249 118 THR A O   
767  C CB  . THR A 107 ? 0.5807 0.9405 0.9534 0.0094  0.1818  -0.0382 118 THR A CB  
768  O OG1 . THR A 107 ? 0.6204 0.9733 1.0083 0.0070  0.1643  -0.0376 118 THR A OG1 
769  C CG2 . THR A 107 ? 0.4786 0.8435 0.8523 0.0313  0.1724  -0.0523 118 THR A CG2 
770  N N   . LEU A 108 ? 0.5977 0.9043 0.8720 0.0205  0.1933  -0.0232 119 LEU A N   
771  C CA  . LEU A 108 ? 0.6401 0.9473 0.8921 0.0264  0.2059  -0.0257 119 LEU A CA  
772  C C   . LEU A 108 ? 0.7252 1.0651 1.0058 0.0380  0.2120  -0.0433 119 LEU A C   
773  O O   . LEU A 108 ? 0.7703 1.1150 1.0693 0.0518  0.1963  -0.0548 119 LEU A O   
774  C CB  . LEU A 108 ? 0.5621 0.8369 0.7770 0.0362  0.1928  -0.0228 119 LEU A CB  
775  C CG  . LEU A 108 ? 0.6475 0.9132 0.8290 0.0387  0.2040  -0.0210 119 LEU A CG  
776  C CD1 . LEU A 108 ? 0.5297 0.7880 0.6920 0.0234  0.2174  -0.0070 119 LEU A CD1 
777  C CD2 . LEU A 108 ? 0.6560 0.8926 0.8077 0.0483  0.1890  -0.0213 119 LEU A CD2 
778  N N   . ARG A 109 ? 0.6577 1.0189 0.9406 0.0329  0.2347  -0.0462 120 ARG A N   
779  C CA  . ARG A 109 ? 0.7181 1.1173 1.0347 0.0426  0.2432  -0.0649 120 ARG A CA  
780  C C   . ARG A 109 ? 0.6167 1.0120 0.9097 0.0578  0.2478  -0.0732 120 ARG A C   
781  O O   . ARG A 109 ? 0.6461 1.0391 0.9434 0.0770  0.2328  -0.0855 120 ARG A O   
782  C CB  . ARG A 109 ? 0.9203 1.3536 1.2639 0.0252  0.2683  -0.0662 120 ARG A CB  
783  C CG  . ARG A 109 ? 0.9226 1.3640 1.2952 0.0092  0.2651  -0.0607 120 ARG A CG  
784  C CD  . ARG A 109 ? 0.7929 1.2527 1.2071 0.0219  0.2444  -0.0753 120 ARG A CD  
785  N NE  . ARG A 109 ? 0.8080 1.2769 1.2516 0.0068  0.2406  -0.0718 120 ARG A NE  
786  C CZ  . ARG A 109 ? 0.8008 1.2826 1.2790 0.0147  0.2211  -0.0824 120 ARG A CZ  
787  N NH1 . ARG A 109 ? 0.8006 1.2853 1.2864 0.0381  0.2032  -0.0965 120 ARG A NH1 
788  N NH2 . ARG A 109 ? 0.7373 1.2260 1.2400 -0.0003 0.2183  -0.0792 120 ARG A NH2 
789  N N   . GLY A 110 ? 0.5580 0.9495 0.8231 0.0495  0.2679  -0.0666 121 GLY A N   
790  C CA  . GLY A 110 ? 0.5770 0.9683 0.8202 0.0621  0.2759  -0.0755 121 GLY A CA  
791  C C   . GLY A 110 ? 0.6556 1.0894 0.9257 0.0605  0.3007  -0.0890 121 GLY A C   
792  O O   . GLY A 110 ? 0.7357 1.2013 1.0460 0.0499  0.3103  -0.0930 121 GLY A O   
793  N N   . PRO A 111 ? 0.7053 1.1417 0.9546 0.0704  0.3123  -0.0976 122 PRO A N   
794  C CA  . PRO A 111 ? 0.6301 1.1089 0.9042 0.0691  0.3384  -0.1122 122 PRO A CA  
795  C C   . PRO A 111 ? 0.8459 1.3654 1.1789 0.0810  0.3315  -0.1330 122 PRO A C   
796  O O   . PRO A 111 ? 1.1690 1.6775 1.5126 0.0979  0.3046  -0.1391 122 PRO A O   
797  C CB  . PRO A 111 ? 0.6547 1.1213 0.8914 0.0832  0.3444  -0.1192 122 PRO A CB  
798  C CG  . PRO A 111 ? 0.9222 1.3384 1.1075 0.0817  0.3293  -0.1015 122 PRO A CG  
799  C CD  . PRO A 111 ? 0.6260 1.0268 0.8271 0.0815  0.3036  -0.0944 122 PRO A CD  
800  N N   . PRO A 112 ? 0.7874 1.3541 1.1597 0.0727  0.3549  -0.1452 123 PRO A N   
801  C CA  . PRO A 112 ? 0.8385 1.4495 1.2730 0.0842  0.3476  -0.1672 123 PRO A CA  
802  C C   . PRO A 112 ? 0.8561 1.4689 1.2961 0.1157  0.3296  -0.1872 123 PRO A C   
803  O O   . PRO A 112 ? 0.8891 1.4992 1.3515 0.1312  0.3025  -0.1947 123 PRO A O   
804  C CB  . PRO A 112 ? 0.9490 1.6104 1.4164 0.0681  0.3824  -0.1776 123 PRO A CB  
805  C CG  . PRO A 112 ? 0.9056 1.5409 1.3304 0.0410  0.4031  -0.1538 123 PRO A CG  
806  C CD  . PRO A 112 ? 0.8847 1.4661 1.2462 0.0508  0.3895  -0.1394 123 PRO A CD  
807  N N   . GLY A 113 ? 0.8803 1.4937 1.2962 0.1259  0.3434  -0.1956 124 GLY A N   
808  C CA  . GLY A 113 ? 0.6388 1.2555 1.0609 0.1561  0.3285  -0.2167 124 GLY A CA  
809  C C   . GLY A 113 ? 0.8051 1.3646 1.1804 0.1697  0.3007  -0.2069 124 GLY A C   
810  O O   . GLY A 113 ? 0.6521 1.2016 1.0174 0.1935  0.2891  -0.2212 124 GLY A O   
811  N N   . ALA A 114 ? 0.7912 1.3128 1.1380 0.1547  0.2903  -0.1834 125 ALA A N   
812  C CA  . ALA A 114 ? 0.6255 1.0938 0.9283 0.1634  0.2664  -0.1734 125 ALA A CA  
813  C C   . ALA A 114 ? 0.7258 1.1819 1.0477 0.1773  0.2360  -0.1784 125 ALA A C   
814  O O   . ALA A 114 ? 0.9147 1.4002 1.2816 0.1776  0.2314  -0.1859 125 ALA A O   
815  C CB  . ALA A 114 ? 0.6201 1.0549 0.8839 0.1417  0.2692  -0.1478 125 ALA A CB  
816  N N   . ALA A 115 ? 0.7479 1.1582 1.0329 0.1885  0.2150  -0.1747 126 ALA A N   
817  C CA  . ALA A 115 ? 0.6119 0.9998 0.9028 0.2010  0.1859  -0.1773 126 ALA A CA  
818  C C   . ALA A 115 ? 0.7849 1.1618 1.0796 0.1825  0.1784  -0.1594 126 ALA A C   
819  O O   . ALA A 115 ? 0.7939 1.1582 1.0666 0.1627  0.1887  -0.1414 126 ALA A O   
820  C CB  . ALA A 115 ? 0.6304 0.9682 0.8757 0.2140  0.1684  -0.1767 126 ALA A CB  
821  N N   . PRO A 116 ? 0.8097 1.1899 1.1310 0.1899  0.1592  -0.1646 127 PRO A N   
822  C CA  . PRO A 116 ? 0.7242 1.0954 1.0502 0.1727  0.1524  -0.1490 127 PRO A CA  
823  C C   . PRO A 116 ? 0.6981 1.0171 0.9772 0.1656  0.1400  -0.1317 127 PRO A C   
824  O O   . PRO A 116 ? 0.6333 0.9445 0.9041 0.1463  0.1450  -0.1153 127 PRO A O   
825  C CB  . PRO A 116 ? 0.5567 0.9431 0.9202 0.1867  0.1327  -0.1627 127 PRO A CB  
826  C CG  . PRO A 116 ? 0.6428 1.0189 0.9993 0.2139  0.1191  -0.1801 127 PRO A CG  
827  C CD  . PRO A 116 ? 0.7419 1.1326 1.0886 0.2152  0.1414  -0.1857 127 PRO A CD  
828  N N   . SER A 117 ? 0.6577 0.9405 0.9061 0.1805  0.1243  -0.1359 128 SER A N   
829  C CA  . SER A 117 ? 0.6012 0.8360 0.8067 0.1726  0.1137  -0.1216 128 SER A CA  
830  C C   . SER A 117 ? 0.6332 0.8576 0.8081 0.1604  0.1291  -0.1115 128 SER A C   
831  O O   . SER A 117 ? 0.7244 0.9152 0.8681 0.1512  0.1229  -0.1001 128 SER A O   
832  C CB  . SER A 117 ? 0.6447 0.8409 0.8260 0.1909  0.0920  -0.1296 128 SER A CB  
833  O OG  . SER A 117 ? 0.8271 1.0249 1.0003 0.2066  0.0958  -0.1431 128 SER A OG  
834  N N   . ALA A 118 ? 0.6432 0.8957 0.8257 0.1601  0.1489  -0.1165 129 ALA A N   
835  C CA  . ALA A 118 ? 0.6627 0.9038 0.8131 0.1499  0.1620  -0.1076 129 ALA A CA  
836  C C   . ALA A 118 ? 0.5724 0.8101 0.7172 0.1286  0.1677  -0.0893 129 ALA A C   
837  O O   . ALA A 118 ? 0.8510 1.0677 0.9642 0.1205  0.1700  -0.0800 129 ALA A O   
838  C CB  . ALA A 118 ? 0.8212 1.0923 0.9785 0.1544  0.1829  -0.1172 129 ALA A CB  
839  N N   . THR A 119 ? 0.6545 0.9122 0.8299 0.1202  0.1688  -0.0851 130 THR A N   
840  C CA  . THR A 119 ? 0.5708 0.8242 0.7426 0.1012  0.1729  -0.0686 130 THR A CA  
841  C C   . THR A 119 ? 0.5512 0.7885 0.7301 0.0982  0.1548  -0.0634 130 THR A C   
842  O O   . THR A 119 ? 0.6435 0.8861 0.8338 0.0849  0.1567  -0.0536 130 THR A O   
843  C CB  . THR A 119 ? 0.6291 0.9170 0.8263 0.0898  0.1929  -0.0664 130 THR A CB  
844  O OG1 . THR A 119 ? 0.7564 1.0752 0.9962 0.0965  0.1916  -0.0790 130 THR A OG1 
845  C CG2 . THR A 119 ? 0.8140 1.1114 0.9939 0.0895  0.2129  -0.0685 130 THR A CG2 
846  N N   . GLN A 120 ? 0.5317 0.7467 0.7013 0.1106  0.1371  -0.0701 131 GLN A N   
847  C CA  . GLN A 120 ? 0.6657 0.8585 0.8325 0.1077  0.1201  -0.0648 131 GLN A CA  
848  C C   . GLN A 120 ? 0.5200 0.6848 0.6554 0.0952  0.1189  -0.0522 131 GLN A C   
849  O O   . GLN A 120 ? 0.6497 0.7925 0.7564 0.0980  0.1170  -0.0533 131 GLN A O   
850  C CB  . GLN A 120 ? 0.8185 0.9915 0.9795 0.1248  0.1020  -0.0757 131 GLN A CB  
851  C CG  . GLN A 120 ? 0.9544 1.1517 1.1520 0.1364  0.0946  -0.0871 131 GLN A CG  
852  C CD  . GLN A 120 ? 0.9290 1.1245 1.1407 0.1288  0.0842  -0.0811 131 GLN A CD  
853  O OE1 . GLN A 120 ? 0.9003 1.0671 1.0882 0.1191  0.0780  -0.0702 131 GLN A OE1 
854  N NE2 . GLN A 120 ? 0.8641 1.0918 1.1158 0.1330  0.0825  -0.0895 131 GLN A NE2 
855  N N   . ILE A 121 ? 0.5042 0.6708 0.6465 0.0818  0.1195  -0.0416 132 ILE A N   
856  C CA  . ILE A 121 ? 0.5781 0.7249 0.6962 0.0703  0.1196  -0.0311 132 ILE A CA  
857  C C   . ILE A 121 ? 0.5635 0.6778 0.6593 0.0721  0.1054  -0.0323 132 ILE A C   
858  O O   . ILE A 121 ? 0.6855 0.7900 0.7869 0.0755  0.0939  -0.0345 132 ILE A O   
859  C CB  . ILE A 121 ? 0.5520 0.7085 0.6845 0.0572  0.1230  -0.0209 132 ILE A CB  
860  C CG1 . ILE A 121 ? 0.5387 0.7234 0.6892 0.0526  0.1390  -0.0189 132 ILE A CG1 
861  C CG2 . ILE A 121 ? 0.4802 0.6176 0.5900 0.0477  0.1213  -0.0121 132 ILE A CG2 
862  C CD1 . ILE A 121 ? 0.4725 0.6653 0.6391 0.0399  0.1418  -0.0099 132 ILE A CD1 
863  N N   . THR A 122 ? 0.5139 0.6102 0.5830 0.0692  0.1062  -0.0312 133 THR A N   
864  C CA  . THR A 122 ? 0.5229 0.5878 0.5688 0.0667  0.0959  -0.0321 133 THR A CA  
865  C C   . THR A 122 ? 0.5112 0.5700 0.5501 0.0528  0.0964  -0.0243 133 THR A C   
866  O O   . THR A 122 ? 0.5783 0.6215 0.6128 0.0476  0.0892  -0.0225 133 THR A O   
867  C CB  . THR A 122 ? 0.7097 0.7581 0.7320 0.0727  0.0955  -0.0394 133 THR A CB  
868  O OG1 . THR A 122 ? 0.6884 0.7461 0.7029 0.0678  0.1046  -0.0371 133 THR A OG1 
869  C CG2 . THR A 122 ? 0.6991 0.7537 0.7287 0.0887  0.0944  -0.0489 133 THR A CG2 
870  N N   . VAL A 123 ? 0.5054 0.5754 0.5417 0.0476  0.1043  -0.0203 134 VAL A N   
871  C CA  . VAL A 123 ? 0.4960 0.5627 0.5274 0.0369  0.1038  -0.0149 134 VAL A CA  
872  C C   . VAL A 123 ? 0.6745 0.7607 0.7201 0.0333  0.1103  -0.0069 134 VAL A C   
873  O O   . VAL A 123 ? 0.8313 0.9311 0.8796 0.0370  0.1186  -0.0059 134 VAL A O   
874  C CB  . VAL A 123 ? 0.5057 0.5624 0.5164 0.0344  0.1037  -0.0189 134 VAL A CB  
875  C CG1 . VAL A 123 ? 0.4966 0.5512 0.5060 0.0243  0.1011  -0.0164 134 VAL A CG1 
876  C CG2 . VAL A 123 ? 1.0481 1.0832 1.0423 0.0377  0.0988  -0.0271 134 VAL A CG2 
877  N N   . VAL A 124 ? 0.5773 0.6627 0.6297 0.0259  0.1072  -0.0015 135 VAL A N   
878  C CA  . VAL A 124 ? 0.5178 0.6149 0.5795 0.0215  0.1117  0.0066  135 VAL A CA  
879  C C   . VAL A 124 ? 0.5645 0.6552 0.6147 0.0170  0.1083  0.0082  135 VAL A C   
880  O O   . VAL A 124 ? 0.6580 0.7405 0.7078 0.0129  0.1021  0.0056  135 VAL A O   
881  C CB  . VAL A 124 ? 0.4562 0.5582 0.5382 0.0181  0.1093  0.0104  135 VAL A CB  
882  C CG1 . VAL A 124 ? 0.4548 0.5658 0.5446 0.0129  0.1148  0.0189  135 VAL A CG1 
883  C CG2 . VAL A 124 ? 0.4576 0.5668 0.5536 0.0242  0.1092  0.0056  135 VAL A CG2 
884  N N   . LEU A 125 ? 0.6405 0.7347 0.6805 0.0181  0.1123  0.0114  136 LEU A N   
885  C CA  . LEU A 125 ? 0.4770 0.5664 0.5064 0.0164  0.1070  0.0112  136 LEU A CA  
886  C C   . LEU A 125 ? 0.4794 0.5697 0.5109 0.0144  0.1074  0.0204  136 LEU A C   
887  O O   . LEU A 125 ? 0.5356 0.6262 0.5564 0.0160  0.1133  0.0261  136 LEU A O   
888  C CB  . LEU A 125 ? 0.4916 0.5789 0.5017 0.0210  0.1075  0.0064  136 LEU A CB  
889  C CG  . LEU A 125 ? 0.5825 0.6672 0.5825 0.0214  0.1001  0.0043  136 LEU A CG  
890  C CD1 . LEU A 125 ? 0.5191 0.6034 0.5296 0.0164  0.0928  -0.0023 136 LEU A CD1 
891  C CD2 . LEU A 125 ? 0.5137 0.5961 0.4944 0.0263  0.0994  -0.0017 136 LEU A CD2 
892  N N   . PRO A 126 ? 0.4694 0.5576 0.5115 0.0106  0.1018  0.0220  137 PRO A N   
893  C CA  . PRO A 126 ? 0.4765 0.5605 0.5167 0.0095  0.0999  0.0300  137 PRO A CA  
894  C C   . PRO A 126 ? 0.7132 0.7919 0.7362 0.0143  0.0935  0.0281  137 PRO A C   
895  O O   . PRO A 126 ? 0.8187 0.8990 0.8441 0.0155  0.0857  0.0197  137 PRO A O   
896  C CB  . PRO A 126 ? 0.4624 0.5451 0.5187 0.0056  0.0942  0.0292  137 PRO A CB  
897  C CG  . PRO A 126 ? 0.5471 0.6332 0.6133 0.0039  0.0954  0.0236  137 PRO A CG  
898  C CD  . PRO A 126 ? 0.4551 0.5419 0.5095 0.0072  0.0974  0.0172  137 PRO A CD  
899  N N   . HIS A 127 ? 0.6922 0.7645 0.6972 0.0169  0.0968  0.0351  138 HIS A N   
900  C CA  . HIS A 127 ? 0.6288 0.6934 0.6141 0.0234  0.0882  0.0333  138 HIS A CA  
901  C C   . HIS A 127 ? 0.7663 0.8252 0.7570 0.0251  0.0769  0.0333  138 HIS A C   
902  O O   . HIS A 127 ? 0.6829 0.7378 0.6844 0.0209  0.0779  0.0393  138 HIS A O   
903  C CB  . HIS A 127 ? 0.6357 0.6895 0.5948 0.0256  0.0945  0.0421  138 HIS A CB  
904  C CG  . HIS A 127 ? 0.6800 0.7244 0.6141 0.0342  0.0846  0.0390  138 HIS A CG  
905  N ND1 . HIS A 127 ? 0.6986 0.7250 0.6126 0.0387  0.0766  0.0458  138 HIS A ND1 
906  C CD2 . HIS A 127 ? 0.7038 0.7527 0.6287 0.0397  0.0798  0.0290  138 HIS A CD2 
907  C CE1 . HIS A 127 ? 0.7368 0.7580 0.6305 0.0477  0.0664  0.0399  138 HIS A CE1 
908  N NE2 . HIS A 127 ? 0.6731 0.7091 0.5743 0.0479  0.0684  0.0293  138 HIS A NE2 
909  N N   . SER A 128 ? 0.8900 0.9491 0.8742 0.0321  0.0653  0.0250  139 SER A N   
910  C CA  . SER A 128 ? 0.7511 0.8083 0.7435 0.0359  0.0533  0.0213  139 SER A CA  
911  C C   . SER A 128 ? 0.8399 0.8767 0.8173 0.0386  0.0501  0.0336  139 SER A C   
912  O O   . SER A 128 ? 0.8423 0.8746 0.8293 0.0401  0.0427  0.0332  139 SER A O   
913  C CB  . SER A 128 ? 0.6004 0.6648 0.5904 0.0440  0.0408  0.0082  139 SER A CB  
914  O OG  . SER A 128 ? 0.5668 0.6196 0.5289 0.0515  0.0366  0.0115  139 SER A OG  
915  N N   . SER A 129 ? 0.8382 0.8605 0.7901 0.0386  0.0562  0.0444  140 SER A N   
916  C CA  . SER A 129 ? 0.8347 0.8321 0.7666 0.0389  0.0547  0.0573  140 SER A CA  
917  C C   . SER A 129 ? 0.8231 0.8184 0.7707 0.0279  0.0644  0.0659  140 SER A C   
918  O O   . SER A 129 ? 0.8291 0.8021 0.7626 0.0260  0.0632  0.0763  140 SER A O   
919  C CB  . SER A 129 ? 0.8549 0.8359 0.7511 0.0402  0.0608  0.0662  140 SER A CB  
920  O OG  . SER A 129 ? 0.7965 0.7898 0.6977 0.0317  0.0785  0.0687  140 SER A OG  
921  N N   . CYS A 130 ? 0.9064 0.9220 0.8810 0.0208  0.0729  0.0614  141 CYS A N   
922  C CA  . CYS A 130 ? 0.8900 0.9071 0.8815 0.0104  0.0820  0.0680  141 CYS A CA  
923  C C   . CYS A 130 ? 0.9814 0.9872 0.9565 0.0030  0.0949  0.0804  141 CYS A C   
924  O O   . CYS A 130 ? 1.1392 1.1372 1.1206 -0.0057 0.0997  0.0881  141 CYS A O   
925  C CB  . CYS A 130 ? 0.9501 0.9582 0.9528 0.0101  0.0724  0.0682  141 CYS A CB  
926  S SG  . CYS A 130 ? 1.0751 1.1011 1.1034 0.0140  0.0633  0.0529  141 CYS A SG  
927  N N   . GLU A 131 ? 0.8752 0.8801 0.8288 0.0057  0.1012  0.0818  142 GLU A N   
928  C CA  . GLU A 131 ? 0.7886 0.7844 0.7238 -0.0019 0.1164  0.0923  142 GLU A CA  
929  C C   . GLU A 131 ? 0.7740 0.7921 0.7189 -0.0049 0.1313  0.0880  142 GLU A C   
930  O O   . GLU A 131 ? 0.6367 0.6559 0.5785 -0.0139 0.1472  0.0945  142 GLU A O   
931  C CB  . GLU A 131 ? 0.7991 0.7680 0.6909 0.0043  0.1120  0.0989  142 GLU A CB  
932  C CG  . GLU A 131 ? 1.0052 0.9441 0.8796 0.0065  0.0993  0.1064  142 GLU A CG  
933  C CD  . GLU A 131 ? 1.2523 1.1624 1.0810 0.0161  0.0907  0.1112  142 GLU A CD  
934  O OE1 . GLU A 131 ? 1.3026 1.2135 1.1275 0.0300  0.0732  0.1020  142 GLU A OE1 
935  O OE2 . GLU A 131 ? 1.3655 1.2519 1.1614 0.0095  0.1014  0.1235  142 GLU A OE2 
936  N N   . LEU A 132 ? 0.5963 0.6315 0.5530 0.0021  0.1270  0.0766  143 LEU A N   
937  C CA  . LEU A 132 ? 0.5939 0.6471 0.5567 0.0022  0.1386  0.0710  143 LEU A CA  
938  C C   . LEU A 132 ? 0.7069 0.7785 0.6997 0.0039  0.1343  0.0606  143 LEU A C   
939  O O   . LEU A 132 ? 0.6328 0.7029 0.6338 0.0068  0.1219  0.0556  143 LEU A O   
940  C CB  . LEU A 132 ? 0.6081 0.6556 0.5416 0.0106  0.1377  0.0676  143 LEU A CB  
941  C CG  . LEU A 132 ? 0.6510 0.6761 0.5458 0.0106  0.1416  0.0775  143 LEU A CG  
942  C CD1 . LEU A 132 ? 0.8182 0.8387 0.6853 0.0205  0.1377  0.0717  143 LEU A CD1 
943  C CD2 . LEU A 132 ? 0.6689 0.6958 0.5616 -0.0004 0.1621  0.0859  143 LEU A CD2 
944  N N   . LEU A 133 ? 0.5451 0.6332 0.5531 0.0022  0.1450  0.0569  144 LEU A N   
945  C CA  . LEU A 133 ? 0.5678 0.6688 0.5964 0.0058  0.1410  0.0467  144 LEU A CA  
946  C C   . LEU A 133 ? 0.6164 0.7238 0.6345 0.0123  0.1469  0.0397  144 LEU A C   
947  O O   . LEU A 133 ? 0.6313 0.7469 0.6469 0.0114  0.1601  0.0410  144 LEU A O   
948  C CB  . LEU A 133 ? 0.6383 0.7524 0.6967 0.0004  0.1449  0.0464  144 LEU A CB  
949  C CG  . LEU A 133 ? 0.6153 0.7244 0.6893 -0.0042 0.1354  0.0487  144 LEU A CG  
950  C CD1 . LEU A 133 ? 0.7125 0.8361 0.8156 -0.0077 0.1379  0.0459  144 LEU A CD1 
951  C CD2 . LEU A 133 ? 0.6592 0.7607 0.7293 0.0006  0.1225  0.0427  144 LEU A CD2 
952  N N   . TYR A 134 ? 0.5676 0.6712 0.5795 0.0183  0.1379  0.0315  145 TYR A N   
953  C CA  . TYR A 134 ? 0.5468 0.6532 0.5481 0.0250  0.1412  0.0234  145 TYR A CA  
954  C C   . TYR A 134 ? 0.5271 0.6407 0.5480 0.0276  0.1396  0.0155  145 TYR A C   
955  O O   . TYR A 134 ? 0.5261 0.6336 0.5541 0.0265  0.1298  0.0122  145 TYR A O   
956  C CB  . TYR A 134 ? 0.5823 0.6777 0.5627 0.0291  0.1318  0.0185  145 TYR A CB  
957  C CG  . TYR A 134 ? 0.5595 0.6459 0.5147 0.0302  0.1323  0.0246  145 TYR A CG  
958  C CD1 . TYR A 134 ? 0.6018 0.6855 0.5332 0.0353  0.1384  0.0228  145 TYR A CD1 
959  C CD2 . TYR A 134 ? 0.6326 0.7107 0.5852 0.0273  0.1258  0.0319  145 TYR A CD2 
960  C CE1 . TYR A 134 ? 0.6095 0.6807 0.5124 0.0371  0.1377  0.0288  145 TYR A CE1 
961  C CE2 . TYR A 134 ? 0.6488 0.7138 0.5742 0.0299  0.1242  0.0378  145 TYR A CE2 
962  C CZ  . TYR A 134 ? 0.6133 0.6741 0.5125 0.0346  0.1300  0.0366  145 TYR A CZ  
963  O OH  . TYR A 134 ? 0.6459 0.6895 0.5126 0.0378  0.1272  0.0428  145 TYR A OH  
964  N N   . LEU A 135 ? 0.5752 0.7008 0.6033 0.0314  0.1491  0.0119  146 LEU A N   
965  C CA  . LEU A 135 ? 0.5081 0.6411 0.5565 0.0357  0.1468  0.0046  146 LEU A CA  
966  C C   . LEU A 135 ? 0.5196 0.6492 0.5557 0.0455  0.1467  -0.0057 146 LEU A C   
967  O O   . LEU A 135 ? 0.5386 0.6772 0.5682 0.0498  0.1572  -0.0084 146 LEU A O   
968  C CB  . LEU A 135 ? 0.6550 0.8081 0.7281 0.0333  0.1566  0.0062  146 LEU A CB  
969  C CG  . LEU A 135 ? 0.6911 0.8484 0.7858 0.0249  0.1536  0.0124  146 LEU A CG  
970  C CD1 . LEU A 135 ? 0.6571 0.7997 0.7383 0.0173  0.1494  0.0221  146 LEU A CD1 
971  C CD2 . LEU A 135 ? 0.7159 0.8953 0.8323 0.0203  0.1669  0.0134  146 LEU A CD2 
972  N N   . GLY A 136 ? 0.5164 0.6312 0.5474 0.0483  0.1356  -0.0116 147 GLY A N   
973  C CA  . GLY A 136 ? 0.5470 0.6540 0.5666 0.0576  0.1336  -0.0219 147 GLY A CA  
974  C C   . GLY A 136 ? 0.5410 0.6556 0.5793 0.0660  0.1326  -0.0284 147 GLY A C   
975  O O   . GLY A 136 ? 0.5813 0.6972 0.6368 0.0640  0.1269  -0.0265 147 GLY A O   
976  N N   . THR A 137 ? 0.5446 0.6642 0.5791 0.0765  0.1372  -0.0372 148 THR A N   
977  C CA  . THR A 137 ? 0.6464 0.7764 0.7002 0.0877  0.1358  -0.0461 148 THR A CA  
978  C C   . THR A 137 ? 0.6958 0.8042 0.7317 0.0994  0.1269  -0.0570 148 THR A C   
979  O O   . THR A 137 ? 0.9494 1.0369 0.9591 0.0973  0.1238  -0.0576 148 THR A O   
980  C CB  . THR A 137 ? 0.6907 0.8521 0.7624 0.0906  0.1516  -0.0489 148 THR A CB  
981  O OG1 . THR A 137 ? 0.8847 1.0450 0.9336 0.0925  0.1613  -0.0507 148 THR A OG1 
982  C CG2 . THR A 137 ? 0.6565 0.8355 0.7468 0.0778  0.1596  -0.0383 148 THR A CG2 
983  N N   . GLU A 138 ? 0.5737 0.6866 0.6245 0.1123  0.1217  -0.0664 149 GLU A N   
984  C CA  . GLU A 138 ? 0.7142 0.8025 0.7468 0.1253  0.1116  -0.0771 149 GLU A CA  
985  C C   . GLU A 138 ? 0.8280 0.9218 0.8484 0.1340  0.1204  -0.0859 149 GLU A C   
986  O O   . GLU A 138 ? 0.9465 1.0138 0.9433 0.1416  0.1127  -0.0933 149 GLU A O   
987  C CB  . GLU A 138 ? 0.7689 0.8588 0.8203 0.1391  0.1007  -0.0855 149 GLU A CB  
988  C CG  . GLU A 138 ? 0.7985 0.8809 0.8596 0.1322  0.0905  -0.0782 149 GLU A CG  
989  C CD  . GLU A 138 ? 0.8230 0.9015 0.8972 0.1481  0.0761  -0.0877 149 GLU A CD  
990  O OE1 . GLU A 138 ? 0.8761 0.9486 0.9457 0.1650  0.0711  -0.1000 149 GLU A OE1 
991  O OE2 . GLU A 138 ? 0.7644 0.8450 0.8529 0.1447  0.0686  -0.0836 149 GLU A OE2 
992  N N   . SER A 139 ? 0.7425 0.8678 0.7760 0.1325  0.1368  -0.0853 150 SER A N   
993  C CA  . SER A 139 ? 0.7453 0.8763 0.7644 0.1404  0.1469  -0.0936 150 SER A CA  
994  C C   . SER A 139 ? 0.6786 0.7885 0.6639 0.1322  0.1471  -0.0885 150 SER A C   
995  O O   . SER A 139 ? 0.6594 0.7608 0.6241 0.1402  0.1491  -0.0972 150 SER A O   
996  C CB  . SER A 139 ? 0.7370 0.9070 0.7776 0.1392  0.1664  -0.0942 150 SER A CB  
997  O OG  . SER A 139 ? 0.6833 0.8606 0.7240 0.1222  0.1747  -0.0794 150 SER A OG  
998  N N   . GLY A 140 ? 0.6445 0.7465 0.6244 0.1173  0.1443  -0.0761 151 GLY A N   
999  C CA  . GLY A 140 ? 0.6286 0.7163 0.5816 0.1095  0.1439  -0.0721 151 GLY A CA  
1000 C C   . GLY A 140 ? 0.6222 0.7265 0.5743 0.1004  0.1553  -0.0618 151 GLY A C   
1001 O O   . GLY A 140 ? 0.7106 0.8037 0.6421 0.0940  0.1525  -0.0576 151 GLY A O   
1002 N N   . ASN A 141 ? 0.6151 0.7446 0.5881 0.0994  0.1674  -0.0581 152 ASN A N   
1003 C CA  . ASN A 141 ? 0.7492 0.8898 0.7176 0.0898  0.1792  -0.0474 152 ASN A CA  
1004 C C   . ASN A 141 ? 0.6989 0.8362 0.6783 0.0778  0.1727  -0.0352 152 ASN A C   
1005 O O   . ASN A 141 ? 0.5760 0.7152 0.5778 0.0766  0.1656  -0.0350 152 ASN A O   
1006 C CB  . ASN A 141 ? 0.7341 0.9027 0.7199 0.0915  0.1973  -0.0494 152 ASN A CB  
1007 C CG  . ASN A 141 ? 0.9479 1.1232 0.9268 0.1051  0.2044  -0.0638 152 ASN A CG  
1008 O OD1 . ASN A 141 ? 0.9507 1.1092 0.8999 0.1104  0.2015  -0.0684 152 ASN A OD1 
1009 N ND2 . ASN A 141 ? 1.0562 1.2574 1.0639 0.1114  0.2132  -0.0723 152 ASN A ND2 
1010 N N   . VAL A 142 ? 0.6872 0.8178 0.6488 0.0701  0.1742  -0.0258 153 VAL A N   
1011 C CA  . VAL A 142 ? 0.7158 0.8425 0.6851 0.0598  0.1683  -0.0149 153 VAL A CA  
1012 C C   . VAL A 142 ? 0.7527 0.8904 0.7236 0.0526  0.1820  -0.0049 153 VAL A C   
1013 O O   . VAL A 142 ? 0.7792 0.9110 0.7238 0.0519  0.1890  -0.0009 153 VAL A O   
1014 C CB  . VAL A 142 ? 0.5844 0.6924 0.5327 0.0574  0.1561  -0.0134 153 VAL A CB  
1015 C CG1 . VAL A 142 ? 0.5686 0.6742 0.5266 0.0485  0.1501  -0.0037 153 VAL A CG1 
1016 C CG2 . VAL A 142 ? 0.5816 0.6775 0.5271 0.0616  0.1448  -0.0239 153 VAL A CG2 
1017 N N   . PHE A 143 ? 0.6867 0.8378 0.6858 0.0469  0.1856  -0.0009 154 PHE A N   
1018 C CA  . PHE A 143 ? 0.6243 0.7846 0.6273 0.0374  0.1994  0.0085  154 PHE A CA  
1019 C C   . PHE A 143 ? 0.7372 0.8829 0.7350 0.0284  0.1915  0.0205  154 PHE A C   
1020 O O   . PHE A 143 ? 0.7302 0.8680 0.7363 0.0286  0.1770  0.0202  154 PHE A O   
1021 C CB  . PHE A 143 ? 0.5718 0.7575 0.6115 0.0354  0.2081  0.0042  154 PHE A CB  
1022 C CG  . PHE A 143 ? 0.6730 0.8764 0.7209 0.0456  0.2167  -0.0091 154 PHE A CG  
1023 C CD1 . PHE A 143 ? 0.7236 0.9404 0.7635 0.0439  0.2366  -0.0106 154 PHE A CD1 
1024 C CD2 . PHE A 143 ? 0.5680 0.7726 0.6293 0.0573  0.2049  -0.0206 154 PHE A CD2 
1025 C CE1 . PHE A 143 ? 0.6358 0.8710 0.6847 0.0546  0.2448  -0.0247 154 PHE A CE1 
1026 C CE2 . PHE A 143 ? 0.5779 0.7974 0.6466 0.0688  0.2111  -0.0341 154 PHE A CE2 
1027 C CZ  . PHE A 143 ? 0.6318 0.8686 0.6962 0.0680  0.2312  -0.0368 154 PHE A CZ  
1028 N N   . VAL A 144 ? 0.7900 0.9304 0.7718 0.0207  0.2017  0.0307  155 VAL A N   
1029 C CA  . VAL A 144 ? 0.8067 0.9291 0.7778 0.0138  0.1942  0.0421  155 VAL A CA  
1030 C C   . VAL A 144 ? 0.7461 0.8765 0.7376 0.0017  0.2039  0.0497  155 VAL A C   
1031 O O   . VAL A 144 ? 0.6204 0.7596 0.6099 -0.0048 0.2220  0.0522  155 VAL A O   
1032 C CB  . VAL A 144 ? 0.9888 1.0898 0.9173 0.0154  0.1945  0.0485  155 VAL A CB  
1033 C CG1 . VAL A 144 ? 1.1229 1.2038 1.0405 0.0101  0.1852  0.0597  155 VAL A CG1 
1034 C CG2 . VAL A 144 ? 1.1269 1.2216 1.0382 0.0266  0.1833  0.0392  155 VAL A CG2 
1035 N N   . VAL A 145 ? 0.6732 0.8008 0.6841 -0.0021 0.1928  0.0525  156 VAL A N   
1036 C CA  . VAL A 145 ? 0.6028 0.7358 0.6346 -0.0140 0.1989  0.0590  156 VAL A CA  
1037 C C   . VAL A 145 ? 0.6712 0.7787 0.6855 -0.0188 0.1898  0.0700  156 VAL A C   
1038 O O   . VAL A 145 ? 0.6608 0.7579 0.6725 -0.0127 0.1733  0.0684  156 VAL A O   
1039 C CB  . VAL A 145 ? 0.5471 0.6990 0.6190 -0.0133 0.1926  0.0510  156 VAL A CB  
1040 C CG1 . VAL A 145 ? 0.5716 0.7273 0.6650 -0.0260 0.1962  0.0570  156 VAL A CG1 
1041 C CG2 . VAL A 145 ? 0.6172 0.7935 0.7068 -0.0068 0.2005  0.0392  156 VAL A CG2 
1042 N N   . GLN A 146 ? 0.7170 0.8138 0.7188 -0.0300 0.2008  0.0806  157 GLN A N   
1043 C CA  . GLN A 146 ? 0.7780 0.8465 0.7602 -0.0341 0.1921  0.0916  157 GLN A CA  
1044 C C   . GLN A 146 ? 0.6900 0.7625 0.7030 -0.0428 0.1881  0.0932  157 GLN A C   
1045 O O   . GLN A 146 ? 0.8089 0.8991 0.8469 -0.0532 0.2005  0.0922  157 GLN A O   
1046 C CB  . GLN A 146 ? 0.8788 0.9256 0.8239 -0.0420 0.2055  0.1032  157 GLN A CB  
1047 C CG  . GLN A 146 ? 1.0821 1.0933 1.0006 -0.0447 0.1953  0.1150  157 GLN A CG  
1048 C CD  . GLN A 146 ? 1.1905 1.1737 1.0641 -0.0521 0.2080  0.1273  157 GLN A CD  
1049 O OE1 . GLN A 146 ? 1.1854 1.1791 1.0519 -0.0586 0.2282  0.1273  157 GLN A OE1 
1050 N NE2 . GLN A 146 ? 1.2074 1.1531 1.0483 -0.0507 0.1963  0.1374  157 GLN A NE2 
1051 N N   . LEU A 147 ? 0.8007 0.8583 0.8131 -0.0384 0.1706  0.0942  158 LEU A N   
1052 C CA  . LEU A 147 ? 0.9057 0.9638 0.9436 -0.0455 0.1648  0.0952  158 LEU A CA  
1053 C C   . LEU A 147 ? 0.9639 0.9900 0.9793 -0.0500 0.1587  0.1062  158 LEU A C   
1054 O O   . LEU A 147 ? 1.0086 1.0135 0.9942 -0.0413 0.1492  0.1091  158 LEU A O   
1055 C CB  . LEU A 147 ? 0.9086 0.9776 0.9686 -0.0366 0.1496  0.0850  158 LEU A CB  
1056 C CG  . LEU A 147 ? 0.9665 1.0227 1.0102 -0.0253 0.1340  0.0820  158 LEU A CG  
1057 C CD1 . LEU A 147 ? 1.2319 1.2701 1.2753 -0.0263 0.1219  0.0855  158 LEU A CD1 
1058 C CD2 . LEU A 147 ? 0.7938 0.8668 0.8530 -0.0178 0.1282  0.0703  158 LEU A CD2 
1059 N N   . PRO A 148 ? 0.8854 0.9059 0.9140 -0.0630 0.1628  0.1115  159 PRO A N   
1060 C CA  . PRO A 148 ? 1.0153 1.0619 1.0813 -0.0740 0.1731  0.1069  159 PRO A CA  
1061 C C   . PRO A 148 ? 1.2372 1.2975 1.3024 -0.0845 0.1957  0.1089  159 PRO A C   
1062 O O   . PRO A 148 ? 1.5738 1.6293 1.6113 -0.0798 0.2031  0.1111  159 PRO A O   
1063 C CB  . PRO A 148 ? 0.8986 0.9275 0.9722 -0.0847 0.1678  0.1127  159 PRO A CB  
1064 C CG  . PRO A 148 ? 0.7851 0.7824 0.8304 -0.0750 0.1511  0.1174  159 PRO A CG  
1065 C CD  . PRO A 148 ? 0.7513 0.7386 0.7617 -0.0662 0.1535  0.1205  159 PRO A CD  
1066 N N   . ALA A 149 ? 1.1208 1.1995 1.2173 -0.0985 0.2064  0.1068  160 ALA A N   
1067 C CA  . ALA A 149 ? 1.2755 1.3747 1.3813 -0.1108 0.2299  0.1057  160 ALA A CA  
1068 C C   . ALA A 149 ? 1.2342 1.3688 1.3600 -0.0997 0.2346  0.0926  160 ALA A C   
1069 O O   . ALA A 149 ? 1.4963 1.6605 1.6480 -0.1074 0.2509  0.0857  160 ALA A O   
1070 C CB  . ALA A 149 ? 1.4245 1.4948 1.4842 -0.1193 0.2444  0.1189  160 ALA A CB  
1071 N N   . PHE A 150 ? 0.9147 1.0464 1.0294 -0.0817 0.2203  0.0880  161 PHE A N   
1072 C CA  . PHE A 150 ? 0.7874 0.9465 0.9182 -0.0693 0.2209  0.0751  161 PHE A CA  
1073 C C   . PHE A 150 ? 0.9270 1.1008 1.0493 -0.0725 0.2427  0.0732  161 PHE A C   
1074 O O   . PHE A 150 ? 1.0890 1.2955 1.2419 -0.0718 0.2521  0.0620  161 PHE A O   
1075 C CB  . PHE A 150 ? 0.8555 1.0417 1.0322 -0.0675 0.2136  0.0635  161 PHE A CB  
1076 C CG  . PHE A 150 ? 1.0976 1.2712 1.2784 -0.0596 0.1915  0.0621  161 PHE A CG  
1077 C CD1 . PHE A 150 ? 1.1117 1.2844 1.2863 -0.0443 0.1793  0.0553  161 PHE A CD1 
1078 C CD2 . PHE A 150 ? 1.2247 1.3859 1.4139 -0.0683 0.1838  0.0671  161 PHE A CD2 
1079 C CE1 . PHE A 150 ? 1.0098 1.1708 1.1863 -0.0388 0.1615  0.0536  161 PHE A CE1 
1080 C CE2 . PHE A 150 ? 1.2353 1.3854 1.4268 -0.0610 0.1649  0.0649  161 PHE A CE2 
1081 C CZ  . PHE A 150 ? 1.0632 1.2138 1.2481 -0.0467 0.1546  0.0582  161 PHE A CZ  
1082 N N   . ARG A 151 ? 0.9186 1.0674 0.9979 -0.0750 0.2504  0.0835  162 ARG A N   
1083 C CA  . ARG A 151 ? 0.9970 1.1542 1.0590 -0.0779 0.2718  0.0827  162 ARG A CA  
1084 C C   . ARG A 151 ? 1.0872 1.2474 1.1338 -0.0593 0.2650  0.0746  162 ARG A C   
1085 O O   . ARG A 151 ? 1.2157 1.3492 1.2267 -0.0511 0.2536  0.0801  162 ARG A O   
1086 C CB  . ARG A 151 ? 1.0061 1.1297 1.0233 -0.0902 0.2831  0.0983  162 ARG A CB  
1087 N N   . ALA A 152 ? 1.0178 1.2105 1.0922 -0.0524 0.2709  0.0606  163 ALA A N   
1088 C CA  . ALA A 152 ? 0.8929 1.0883 0.9541 -0.0353 0.2653  0.0516  163 ALA A CA  
1089 C C   . ALA A 152 ? 0.8810 1.0615 0.8980 -0.0360 0.2794  0.0568  163 ALA A C   
1090 O O   . ALA A 152 ? 0.8636 1.0615 0.8818 -0.0414 0.3012  0.0529  163 ALA A O   
1091 C CB  . ALA A 152 ? 0.8269 1.0582 0.9271 -0.0274 0.2686  0.0351  163 ALA A CB  
1092 N N   . LEU A 153 ? 0.9074 1.0562 0.8849 -0.0302 0.2670  0.0644  164 LEU A N   
1093 C CA  . LEU A 153 ? 0.8614 0.9895 0.7902 -0.0294 0.2764  0.0702  164 LEU A CA  
1094 C C   . LEU A 153 ? 0.9597 1.1029 0.8841 -0.0163 0.2802  0.0569  164 LEU A C   
1095 O O   . LEU A 153 ? 0.9320 1.0683 0.8491 -0.0028 0.2631  0.0509  164 LEU A O   
1096 C CB  . LEU A 153 ? 0.7328 0.8242 0.6248 -0.0249 0.2578  0.0800  164 LEU A CB  
1097 C CG  . LEU A 153 ? 0.8204 0.8944 0.7179 -0.0344 0.2491  0.0913  164 LEU A CG  
1098 C CD1 . LEU A 153 ? 0.7441 0.7848 0.6072 -0.0262 0.2288  0.0979  164 LEU A CD1 
1099 C CD2 . LEU A 153 ? 0.7638 0.8318 0.6540 -0.0528 0.2700  0.1017  164 LEU A CD2 
1100 N N   . GLU A 154 ? 0.9814 1.1456 0.9108 -0.0207 0.3035  0.0514  165 GLU A N   
1101 C CA  . GLU A 154 ? 1.0379 1.2161 0.9619 -0.0076 0.3088  0.0378  165 GLU A CA  
1102 C C   . GLU A 154 ? 1.0980 1.2468 0.9665 -0.0005 0.3057  0.0416  165 GLU A C   
1103 O O   . GLU A 154 ? 1.0106 1.1645 0.8702 0.0126  0.3040  0.0302  165 GLU A O   
1104 C CB  . GLU A 154 ? 1.0832 1.2938 1.0276 -0.0144 0.3361  0.0296  165 GLU A CB  
1105 C CG  . GLU A 154 ? 1.1211 1.3610 1.1184 -0.0254 0.3421  0.0268  165 GLU A CG  
1106 C CD  . GLU A 154 ? 1.0952 1.3591 1.1381 -0.0120 0.3257  0.0124  165 GLU A CD  
1107 O OE1 . GLU A 154 ? 1.0892 1.3458 1.1220 0.0046  0.3111  0.0050  165 GLU A OE1 
1108 O OE2 . GLU A 154 ? 1.0417 1.3298 1.1289 -0.0184 0.3269  0.0084  165 GLU A OE2 
1109 N N   . ASP A 155 ? 1.2293 1.3458 1.0594 -0.0078 0.3036  0.0568  166 ASP A N   
1110 C CA  . ASP A 155 ? 1.3906 1.4770 1.1659 0.0001  0.2978  0.0602  166 ASP A CA  
1111 C C   . ASP A 155 ? 1.3563 1.4324 1.1301 0.0148  0.2697  0.0546  166 ASP A C   
1112 O O   . ASP A 155 ? 1.4288 1.4948 1.1735 0.0259  0.2640  0.0483  166 ASP A O   
1113 C CB  . ASP A 155 ? 1.5958 1.6474 1.3287 -0.0111 0.3021  0.0781  166 ASP A CB  
1114 C CG  . ASP A 155 ? 1.7255 1.7420 1.3988 -0.0014 0.2920  0.0820  166 ASP A CG  
1115 O OD1 . ASP A 155 ? 1.7421 1.7447 1.4099 0.0098  0.2660  0.0806  166 ASP A OD1 
1116 O OD2 . ASP A 155 ? 1.7330 1.7363 1.3647 -0.0051 0.3100  0.0856  166 ASP A OD2 
1117 N N   . ARG A 156 ? 1.1745 1.2534 0.9793 0.0143  0.2528  0.0558  167 ARG A N   
1118 C CA  . ARG A 156 ? 1.0746 1.1444 0.8800 0.0251  0.2279  0.0506  167 ARG A CA  
1119 C C   . ARG A 156 ? 0.9737 1.0653 0.8114 0.0333  0.2220  0.0357  167 ARG A C   
1120 O O   . ARG A 156 ? 0.9475 1.0338 0.7909 0.0395  0.2031  0.0306  167 ARG A O   
1121 C CB  . ARG A 156 ? 1.0754 1.1341 0.8932 0.0201  0.2130  0.0593  167 ARG A CB  
1122 C CG  . ARG A 156 ? 1.1416 1.1710 0.9232 0.0143  0.2132  0.0741  167 ARG A CG  
1123 C CD  . ARG A 156 ? 1.1379 1.1599 0.9385 0.0094  0.2003  0.0811  167 ARG A CD  
1124 N NE  . ARG A 156 ? 1.2281 1.2176 0.9927 0.0049  0.1985  0.0952  167 ARG A NE  
1125 C CZ  . ARG A 156 ? 1.2751 1.2403 1.0160 0.0134  0.1781  0.0978  167 ARG A CZ  
1126 N NH1 . ARG A 156 ? 1.3550 1.3285 1.1078 0.0250  0.1594  0.0865  167 ARG A NH1 
1127 N NH2 . ARG A 156 ? 1.1701 1.1021 0.8755 0.0101  0.1761  0.1109  167 ARG A NH2 
1128 N N   . THR A 157 ? 0.9860 1.1011 0.8443 0.0336  0.2377  0.0279  168 THR A N   
1129 C CA  . THR A 157 ? 0.9641 1.0957 0.8510 0.0425  0.2309  0.0140  168 THR A CA  
1130 C C   . THR A 157 ? 0.7863 0.9055 0.6476 0.0543  0.2208  0.0046  168 THR A C   
1131 O O   . THR A 157 ? 0.7339 0.8451 0.5618 0.0579  0.2287  0.0034  168 THR A O   
1132 C CB  . THR A 157 ? 0.9880 1.1479 0.9013 0.0424  0.2492  0.0062  168 THR A CB  
1133 O OG1 . THR A 157 ? 1.0593 1.2329 1.0024 0.0306  0.2563  0.0130  168 THR A OG1 
1134 C CG2 . THR A 157 ? 0.7660 0.9376 0.7025 0.0545  0.2403  -0.0089 168 THR A CG2 
1135 N N   . ILE A 158 ? 0.6768 0.7926 0.5519 0.0594  0.2034  -0.0023 169 ILE A N   
1136 C CA  . ILE A 158 ? 0.6852 0.7892 0.5409 0.0687  0.1924  -0.0126 169 ILE A CA  
1137 C C   . ILE A 158 ? 0.7528 0.8688 0.6263 0.0769  0.1957  -0.0258 169 ILE A C   
1138 O O   . ILE A 158 ? 0.8216 0.9397 0.7197 0.0778  0.1863  -0.0300 169 ILE A O   
1139 C CB  . ILE A 158 ? 0.6683 0.7588 0.5256 0.0671  0.1721  -0.0124 169 ILE A CB  
1140 C CG1 . ILE A 158 ? 0.8337 0.9141 0.6783 0.0609  0.1676  -0.0001 169 ILE A CG1 
1141 C CG2 . ILE A 158 ? 0.6812 0.7594 0.5177 0.0746  0.1615  -0.0237 169 ILE A CG2 
1142 C CD1 . ILE A 158 ? 0.9183 0.9904 0.7690 0.0595  0.1486  -0.0015 169 ILE A CD1 
1143 N N   . SER A 159 ? 0.7030 0.8249 0.5617 0.0837  0.2086  -0.0328 170 SER A N   
1144 C CA  . SER A 159 ? 0.8265 0.9597 0.7008 0.0940  0.2118  -0.0469 170 SER A CA  
1145 C C   . SER A 159 ? 0.8440 0.9583 0.7082 0.1016  0.1943  -0.0570 170 SER A C   
1146 O O   . SER A 159 ? 0.7056 0.8016 0.5491 0.0989  0.1823  -0.0549 170 SER A O   
1147 C CB  . SER A 159 ? 0.8373 0.9825 0.6970 0.0995  0.2313  -0.0531 170 SER A CB  
1148 O OG  . SER A 159 ? 1.0237 1.1800 0.8989 0.1119  0.2329  -0.0687 170 SER A OG  
1149 N N   . SER A 160 ? 0.9649 1.0094 0.9841 0.1714  0.2366  0.0269  171 SER A N   
1150 C CA  . SER A 160 ? 1.0822 1.1002 1.0741 0.1691  0.2247  0.0028  171 SER A CA  
1151 C C   . SER A 160 ? 1.1325 1.1292 1.0613 0.1769  0.2382  -0.0151 171 SER A C   
1152 O O   . SER A 160 ? 1.1598 1.1426 1.0453 0.1670  0.2216  -0.0312 171 SER A O   
1153 C CB  . SER A 160 ? 1.1152 1.1293 1.1482 0.1751  0.2285  0.0024  171 SER A CB  
1154 O OG  . SER A 160 ? 1.1144 1.0995 1.1227 0.1728  0.2185  -0.0195 171 SER A OG  
1155 N N   . ASP A 161 ? 1.0972 1.0920 1.0190 0.1938  0.2686  -0.0128 172 ASP A N   
1156 C CA  . ASP A 161 ? 1.1259 1.0984 0.9815 0.2005  0.2839  -0.0315 172 ASP A CA  
1157 C C   . ASP A 161 ? 1.0268 1.0125 0.8391 0.1937  0.2778  -0.0262 172 ASP A C   
1158 O O   . ASP A 161 ? 1.0994 1.0684 0.8484 0.1921  0.2796  -0.0442 172 ASP A O   
1159 C CB  . ASP A 161 ? 1.2074 1.1755 1.0664 0.2223  0.3217  -0.0289 172 ASP A CB  
1160 C CG  . ASP A 161 ? 1.2475 1.2515 1.1457 0.2303  0.3394  0.0013  172 ASP A CG  
1161 O OD1 . ASP A 161 ? 1.3041 1.3332 1.2505 0.2199  0.3227  0.0206  172 ASP A OD1 
1162 O OD2 . ASP A 161 ? 1.0852 1.0910 0.9651 0.2462  0.3711  0.0052  172 ASP A OD2 
1163 N N   . ALA A 162 ? 0.8363 0.8509 0.6806 0.1890  0.2706  -0.0016 173 ALA A N   
1164 C CA  . ALA A 162 ? 0.8632 0.8912 0.6719 0.1829  0.2620  0.0070  173 ALA A CA  
1165 C C   . ALA A 162 ? 0.9571 0.9769 0.7375 0.1673  0.2308  -0.0081 173 ALA A C   
1166 O O   . ALA A 162 ? 1.0107 1.0360 0.7430 0.1630  0.2235  -0.0095 173 ALA A O   
1167 C CB  . ALA A 162 ? 0.7493 0.8043 0.6039 0.1816  0.2626  0.0373  173 ALA A CB  
1168 N N   . VAL A 163 ? 0.9534 0.9637 0.7640 0.1584  0.2119  -0.0173 174 VAL A N   
1169 C CA  . VAL A 163 ? 0.9403 0.9436 0.7276 0.1435  0.1839  -0.0318 174 VAL A CA  
1170 C C   . VAL A 163 ? 1.0555 1.0307 0.7912 0.1410  0.1852  -0.0603 174 VAL A C   
1171 O O   . VAL A 163 ? 1.2751 1.2489 0.9674 0.1292  0.1683  -0.0715 174 VAL A O   
1172 C CB  . VAL A 163 ? 0.7564 0.7603 0.5937 0.1347  0.1650  -0.0299 174 VAL A CB  
1173 C CG1 . VAL A 163 ? 0.6799 0.6759 0.4956 0.1199  0.1388  -0.0456 174 VAL A CG1 
1174 C CG2 . VAL A 163 ? 0.7612 0.7882 0.6399 0.1337  0.1619  -0.0053 174 VAL A CG2 
1175 N N   . LEU A 164 ? 0.9462 0.8984 0.6865 0.1515  0.2057  -0.0717 175 LEU A N   
1176 C CA  . LEU A 164 ? 1.0914 1.0079 0.7842 0.1491  0.2097  -0.1011 175 LEU A CA  
1177 C C   . LEU A 164 ? 1.0742 0.9851 0.6976 0.1506  0.2220  -0.1117 175 LEU A C   
1178 O O   . LEU A 164 ? 1.1662 1.0492 0.7376 0.1411  0.2174  -0.1383 175 LEU A O   
1179 C CB  . LEU A 164 ? 1.1544 1.0465 0.8747 0.1636  0.2320  -0.1077 175 LEU A CB  
1180 C CG  . LEU A 164 ? 1.2813 1.1603 1.0428 0.1575  0.2164  -0.1121 175 LEU A CG  
1181 C CD1 . LEU A 164 ? 1.2173 1.1292 1.0384 0.1525  0.1991  -0.0881 175 LEU A CD1 
1182 C CD2 . LEU A 164 ? 1.3169 1.1696 1.0959 0.1746  0.2419  -0.1184 175 LEU A CD2 
1183 N N   . GLN A 165 ? 1.1426 1.0784 0.7618 0.1608  0.2377  -0.0917 176 GLN A N   
1184 C CA  . GLN A 165 ? 1.2482 1.1822 0.7975 0.1619  0.2491  -0.0995 176 GLN A CA  
1185 C C   . GLN A 165 ? 1.2952 1.2441 0.8028 0.1426  0.2186  -0.1024 176 GLN A C   
1186 O O   . GLN A 165 ? 1.3443 1.2853 0.7834 0.1368  0.2200  -0.1179 176 GLN A O   
1187 C CB  . GLN A 165 ? 1.4153 1.3747 0.9747 0.1783  0.2748  -0.0732 176 GLN A CB  
1188 C CG  . GLN A 165 ? 1.5429 1.4903 1.1319 0.1986  0.3099  -0.0714 176 GLN A CG  
1189 C CD  . GLN A 165 ? 1.5682 1.5456 1.1769 0.2127  0.3341  -0.0417 176 GLN A CD  
1190 O OE1 . GLN A 165 ? 1.5690 1.5698 1.1539 0.2089  0.3290  -0.0255 176 GLN A OE1 
1191 N NE2 . GLN A 165 ? 1.5482 1.5270 1.2034 0.2290  0.3608  -0.0318 176 GLN A NE2 
1192 N N   . ARG A 166 ? 1.2143 1.1858 0.7612 0.1326  0.1916  -0.0876 177 ARG A N   
1193 C CA  . ARG A 166 ? 1.1522 1.1429 0.6699 0.1154  0.1618  -0.0869 177 ARG A CA  
1194 C C   . ARG A 166 ? 1.2192 1.1876 0.7202 0.0967  0.1396  -0.1142 177 ARG A C   
1195 O O   . ARG A 166 ? 1.2870 1.2723 0.7618 0.0801  0.1139  -0.1159 177 ARG A O   
1196 C CB  . ARG A 166 ? 1.0244 1.0498 0.5932 0.1154  0.1463  -0.0564 177 ARG A CB  
1197 C CG  . ARG A 166 ? 0.8932 0.9465 0.4645 0.1278  0.1602  -0.0263 177 ARG A CG  
1198 C CD  . ARG A 166 ? 0.8803 0.9270 0.4886 0.1445  0.1901  -0.0155 177 ARG A CD  
1199 N NE  . ARG A 166 ? 1.0154 1.0883 0.6344 0.1542  0.2026  0.0161  177 ARG A NE  
1200 C CZ  . ARG A 166 ? 1.0909 1.1658 0.7381 0.1676  0.2296  0.0310  177 ARG A CZ  
1201 N NH1 . ARG A 166 ? 1.1956 1.2513 0.8646 0.1742  0.2468  0.0181  177 ARG A NH1 
1202 N NH2 . ARG A 166 ? 0.8746 0.9722 0.5308 0.1744  0.2399  0.0609  177 ARG A NH2 
1203 N N   . LEU A 167 ? 1.1278 1.0607 0.6457 0.0988  0.1488  -0.1332 178 LEU A N   
1204 C CA  . LEU A 167 ? 1.2210 1.1277 0.7289 0.0814  0.1307  -0.1579 178 LEU A CA  
1205 C C   . LEU A 167 ? 1.3614 1.2287 0.8016 0.0755  0.1421  -0.1903 178 LEU A C   
1206 O O   . LEU A 167 ? 1.4375 1.2904 0.8493 0.0902  0.1707  -0.1954 178 LEU A O   
1207 C CB  . LEU A 167 ? 1.2209 1.1101 0.7890 0.0875  0.1342  -0.1573 178 LEU A CB  
1208 C CG  . LEU A 167 ? 1.0602 0.9810 0.6940 0.0913  0.1237  -0.1298 178 LEU A CG  
1209 C CD1 . LEU A 167 ? 1.0471 0.9499 0.7320 0.0980  0.1304  -0.1302 178 LEU A CD1 
1210 C CD2 . LEU A 167 ? 0.8581 0.8032 0.4947 0.0736  0.0922  -0.1240 178 LEU A CD2 
1211 N N   . PRO A 168 ? 1.3486 1.1964 0.7604 0.0531  0.1213  -0.2135 179 PRO A N   
1212 C CA  . PRO A 168 ? 1.6182 1.4181 0.9662 0.0452  0.1332  -0.2489 179 PRO A CA  
1213 C C   . PRO A 168 ? 1.7717 1.5252 1.1400 0.0643  0.1648  -0.2608 179 PRO A C   
1214 O O   . PRO A 168 ? 1.7300 1.4901 1.1644 0.0793  0.1716  -0.2429 179 PRO A O   
1215 C CB  . PRO A 168 ? 1.5294 1.3212 0.8621 0.0151  0.1009  -0.2662 179 PRO A CB  
1216 C CG  . PRO A 168 ? 1.3971 1.2464 0.7646 0.0074  0.0717  -0.2375 179 PRO A CG  
1217 C CD  . PRO A 168 ? 1.2833 1.1548 0.7148 0.0323  0.0859  -0.2078 179 PRO A CD  
1218 N N   . GLU A 169 ? 1.9784 1.6842 1.2875 0.0635  0.1848  -0.2917 180 GLU A N   
1219 C CA  . GLU A 169 ? 2.0273 1.6878 1.3514 0.0857  0.2203  -0.3023 180 GLU A CA  
1220 C C   . GLU A 169 ? 1.9752 1.6085 1.3483 0.0820  0.2121  -0.3065 180 GLU A C   
1221 O O   . GLU A 169 ? 1.9667 1.5910 1.3926 0.1041  0.2323  -0.2947 180 GLU A O   
1222 C CB  . GLU A 169 ? 2.2112 1.8213 1.4545 0.0851  0.2451  -0.3371 180 GLU A CB  
1223 C CG  . GLU A 169 ? 2.2815 1.9179 1.4748 0.0914  0.2578  -0.3319 180 GLU A CG  
1224 C CD  . GLU A 169 ? 2.2849 1.9523 1.4257 0.0634  0.2239  -0.3342 180 GLU A CD  
1225 O OE1 . GLU A 169 ? 2.2592 1.9257 1.4012 0.0374  0.1910  -0.3432 180 GLU A OE1 
1226 O OE2 . GLU A 169 ? 2.3026 2.0020 1.4089 0.0672  0.2286  -0.3233 180 GLU A OE2 
1227 N N   . GLU A 170 ? 1.9401 1.5633 1.2983 0.0540  0.1823  -0.3211 181 GLU A N   
1228 C CA  . GLU A 170 ? 1.9100 1.5048 1.3085 0.0481  0.1742  -0.3256 181 GLU A CA  
1229 C C   . GLU A 170 ? 1.8015 1.4401 1.2787 0.0537  0.1575  -0.2926 181 GLU A C   
1230 O O   . GLU A 170 ? 1.7856 1.4061 1.3016 0.0515  0.1519  -0.2913 181 GLU A O   
1231 C CB  . GLU A 170 ? 1.8707 1.4415 1.2263 0.0137  0.1482  -0.3516 181 GLU A CB  
1232 C CG  . GLU A 170 ? 2.0285 1.5436 1.3047 0.0044  0.1647  -0.3899 181 GLU A CG  
1233 C CD  . GLU A 170 ? 2.0380 1.5466 1.2874 -0.0322 0.1317  -0.4087 181 GLU A CD  
1234 O OE1 . GLU A 170 ? 1.9915 1.5305 1.2560 -0.0532 0.1010  -0.3986 181 GLU A OE1 
1235 O OE2 . GLU A 170 ? 2.0380 1.5126 1.2533 -0.0398 0.1368  -0.4326 181 GLU A OE2 
1236 N N   . ALA A 171 ? 1.8225 1.5157 1.3219 0.0604  0.1503  -0.2662 182 ALA A N   
1237 C CA  . ALA A 171 ? 1.7734 1.5056 1.3427 0.0660  0.1372  -0.2366 182 ALA A CA  
1238 C C   . ALA A 171 ? 1.7606 1.5133 1.3679 0.0927  0.1611  -0.2140 182 ALA A C   
1239 O O   . ALA A 171 ? 1.6459 1.4405 1.2939 0.0959  0.1514  -0.1885 182 ALA A O   
1240 C CB  . ALA A 171 ? 1.7061 1.4841 1.2762 0.0482  0.1058  -0.2233 182 ALA A CB  
1241 N N   . ARG A 172 ? 1.8344 1.5570 1.4299 0.1116  0.1935  -0.2231 183 ARG A N   
1242 C CA  . ARG A 172 ? 1.7354 1.4785 1.3663 0.1367  0.2189  -0.2016 183 ARG A CA  
1243 C C   . ARG A 172 ? 1.8074 1.5318 1.4895 0.1549  0.2374  -0.1954 183 ARG A C   
1244 O O   . ARG A 172 ? 1.9262 1.6670 1.6413 0.1762  0.2606  -0.1778 183 ARG A O   
1245 C CB  . ARG A 172 ? 1.6371 1.3718 1.2140 0.1476  0.2457  -0.2111 183 ARG A CB  
1246 C CG  . ARG A 172 ? 1.5984 1.3706 1.1428 0.1381  0.2328  -0.2017 183 ARG A CG  
1247 C CD  . ARG A 172 ? 1.7415 1.4980 1.2190 0.1456  0.2583  -0.2164 183 ARG A CD  
1248 N NE  . ARG A 172 ? 1.8457 1.6444 1.3260 0.1557  0.2673  -0.1911 183 ARG A NE  
1249 C CZ  . ARG A 172 ? 2.0048 1.8003 1.4338 0.1653  0.2920  -0.1958 183 ARG A CZ  
1250 N NH1 . ARG A 172 ? 2.0743 1.8242 1.4422 0.1659  0.3104  -0.2275 183 ARG A NH1 
1251 N NH2 . ARG A 172 ? 2.0114 1.8468 1.4484 0.1740  0.2995  -0.1691 183 ARG A NH2 
1252 N N   . HIS A 173 ? 1.7809 1.4737 1.4727 0.1472  0.2280  -0.2071 184 HIS A N   
1253 C CA  . HIS A 173 ? 1.7164 1.3919 1.4576 0.1651  0.2445  -0.1987 184 HIS A CA  
1254 C C   . HIS A 173 ? 1.7295 1.4542 1.5413 0.1701  0.2329  -0.1657 184 HIS A C   
1255 O O   . HIS A 173 ? 1.6929 1.4324 1.5304 0.1551  0.2055  -0.1580 184 HIS A O   
1256 C CB  . HIS A 173 ? 1.5937 1.2240 1.3268 0.1532  0.2347  -0.2169 184 HIS A CB  
1257 C CG  . HIS A 173 ? 1.5786 1.1504 1.2467 0.1505  0.2523  -0.2509 184 HIS A CG  
1258 N ND1 . HIS A 173 ? 1.6255 1.1450 1.2807 0.1410  0.2506  -0.2706 184 HIS A ND1 
1259 C CD2 . HIS A 173 ? 1.5425 1.0973 1.1519 0.1548  0.2728  -0.2696 184 HIS A CD2 
1260 C CE1 . HIS A 173 ? 1.6198 1.0898 1.2104 0.1386  0.2690  -0.3020 184 HIS A CE1 
1261 N NE2 . HIS A 173 ? 1.6248 1.1160 1.1847 0.1470  0.2826  -0.3023 184 HIS A NE2 
1262 N N   . ARG A 174 ? 1.7313 1.4812 1.5739 0.1902  0.2545  -0.1465 185 ARG A N   
1263 C CA  . ARG A 174 ? 1.6705 1.4699 1.5740 0.1921  0.2443  -0.1162 185 ARG A CA  
1264 C C   . ARG A 174 ? 1.6342 1.4367 1.5976 0.2092  0.2566  -0.0990 185 ARG A C   
1265 O O   . ARG A 174 ? 1.5911 1.3729 1.5565 0.2307  0.2873  -0.1013 185 ARG A O   
1266 C CB  . ARG A 174 ? 1.5251 1.3570 1.4251 0.1993  0.2577  -0.1030 185 ARG A CB  
1267 C CG  . ARG A 174 ? 1.3835 1.2631 1.3459 0.2008  0.2515  -0.0725 185 ARG A CG  
1268 C CD  . ARG A 174 ? 1.3482 1.2533 1.3052 0.2090  0.2700  -0.0599 185 ARG A CD  
1269 N NE  . ARG A 174 ? 1.3809 1.3277 1.4007 0.2114  0.2696  -0.0309 185 ARG A NE  
1270 C CZ  . ARG A 174 ? 1.4988 1.4719 1.5302 0.2191  0.2874  -0.0139 185 ARG A CZ  
1271 N NH1 . ARG A 174 ? 1.5500 1.5131 1.5324 0.2269  0.3076  -0.0222 185 ARG A NH1 
1272 N NH2 . ARG A 174 ? 1.5127 1.5225 1.6033 0.2174  0.2847  0.0115  185 ARG A NH2 
1273 N N   . ARG A 175 ? 1.6853 1.5148 1.6966 0.2003  0.2334  -0.0811 186 ARG A N   
1274 C CA  . ARG A 175 ? 1.7190 1.5657 1.7932 0.2145  0.2404  -0.0582 186 ARG A CA  
1275 C C   . ARG A 175 ? 1.7525 1.6440 1.8651 0.2247  0.2532  -0.0343 186 ARG A C   
1276 O O   . ARG A 175 ? 1.8178 1.7318 1.9174 0.2151  0.2472  -0.0316 186 ARG A O   
1277 C CB  . ARG A 175 ? 1.6935 1.5545 1.7993 0.1985  0.2092  -0.0481 186 ARG A CB  
1278 C CG  . ARG A 175 ? 1.6721 1.5449 1.8363 0.2116  0.2129  -0.0262 186 ARG A CG  
1279 C CD  . ARG A 175 ? 1.5925 1.4874 1.7833 0.1931  0.1804  -0.0145 186 ARG A CD  
1280 N NE  . ARG A 175 ? 1.5649 1.4296 1.7154 0.1753  0.1618  -0.0348 186 ARG A NE  
1281 C CZ  . ARG A 175 ? 1.4999 1.3802 1.6561 0.1557  0.1335  -0.0310 186 ARG A CZ  
1282 N NH1 . ARG A 175 ? 1.4692 1.3913 1.6648 0.1500  0.1198  -0.0102 186 ARG A NH1 
1283 N NH2 . ARG A 175 ? 1.3884 1.2428 1.5100 0.1406  0.1193  -0.0484 186 ARG A NH2 
1284 N N   . VAL A 176 ? 1.6924 1.5976 1.8553 0.2445  0.2717  -0.0150 187 VAL A N   
1285 C CA  . VAL A 176 ? 1.5386 1.4892 1.7446 0.2539  0.2854  0.0100  187 VAL A CA  
1286 C C   . VAL A 176 ? 1.6272 1.6193 1.8584 0.2315  0.2564  0.0248  187 VAL A C   
1287 O O   . VAL A 176 ? 1.6338 1.6512 1.8674 0.2279  0.2612  0.0336  187 VAL A O   
1288 C CB  . VAL A 176 ? 1.1467 1.1119 1.4121 0.2772  0.3050  0.0323  187 VAL A CB  
1289 C CG1 . VAL A 176 ? 0.9416 0.9629 1.2615 0.2816  0.3130  0.0619  187 VAL A CG1 
1290 C CG2 . VAL A 176 ? 1.1222 1.0429 1.3602 0.3028  0.3415  0.0171  187 VAL A CG2 
1291 N N   . PHE A 177 ? 1.7489 1.7460 1.9971 0.2159  0.2272  0.0276  188 PHE A N   
1292 C CA  . PHE A 177 ? 1.7321 1.7594 1.9952 0.1928  0.1991  0.0363  188 PHE A CA  
1293 C C   . PHE A 177 ? 1.7375 1.7383 1.9547 0.1748  0.1761  0.0149  188 PHE A C   
1294 O O   . PHE A 177 ? 1.8070 1.8038 2.0326 0.1649  0.1556  0.0143  188 PHE A O   
1295 C CB  . PHE A 177 ? 1.6136 1.6766 1.9378 0.1884  0.1846  0.0604  188 PHE A CB  
1296 C CG  . PHE A 177 ? 1.5381 1.6452 1.9116 0.1928  0.1957  0.0852  188 PHE A CG  
1297 C CD1 . PHE A 177 ? 1.5930 1.7036 1.9556 0.2024  0.2202  0.0859  188 PHE A CD1 
1298 C CD2 . PHE A 177 ? 1.4653 1.6125 1.8954 0.1856  0.1810  0.1090  188 PHE A CD2 
1299 C CE1 . PHE A 177 ? 1.5111 1.6638 1.9219 0.2051  0.2311  0.1104  188 PHE A CE1 
1300 C CE2 . PHE A 177 ? 1.4317 1.6226 1.9100 0.1866  0.1897  0.1327  188 PHE A CE2 
1301 C CZ  . PHE A 177 ? 1.4486 1.6419 1.9189 0.1964  0.2155  0.1336  188 PHE A CZ  
1302 N N   . GLU A 178 ? 1.6080 1.5939 1.7773 0.1710  0.1799  -0.0007 189 GLU A N   
1303 C CA  . GLU A 178 ? 1.3886 1.3561 1.5158 0.1542  0.1592  -0.0187 189 GLU A CA  
1304 C C   . GLU A 178 ? 1.2973 1.2920 1.4430 0.1364  0.1367  -0.0083 189 GLU A C   
1305 O O   . GLU A 178 ? 1.4621 1.4661 1.5920 0.1303  0.1353  -0.0076 189 GLU A O   
1306 C CB  . GLU A 178 ? 1.3343 1.2827 1.4067 0.1569  0.1710  -0.0353 189 GLU A CB  
1307 C CG  . GLU A 178 ? 1.2752 1.1922 1.2998 0.1465  0.1584  -0.0586 189 GLU A CG  
1308 C CD  . GLU A 178 ? 1.3104 1.2157 1.2800 0.1468  0.1676  -0.0729 189 GLU A CD  
1309 O OE1 . GLU A 178 ? 1.3211 1.2449 1.2900 0.1543  0.1816  -0.0626 189 GLU A OE1 
1310 O OE2 . GLU A 178 ? 1.3492 1.2280 1.2759 0.1383  0.1603  -0.0934 189 GLU A OE2 
1311 N N   . MET A 179 ? 1.1013 1.1074 1.2798 0.1282  0.1198  0.0003  190 MET A N   
1312 C CA  . MET A 179 ? 0.8820 0.9129 1.0816 0.1117  0.1013  0.0104  190 MET A CA  
1313 C C   . MET A 179 ? 0.6877 0.7097 0.8514 0.0987  0.0884  -0.0017 190 MET A C   
1314 O O   . MET A 179 ? 0.8178 0.8195 0.9515 0.0948  0.0798  -0.0161 190 MET A O   
1315 C CB  . MET A 179 ? 0.8696 0.9106 1.0994 0.1040  0.0839  0.0185  190 MET A CB  
1316 C CG  . MET A 179 ? 1.0301 1.0938 1.3080 0.1140  0.0920  0.0381  190 MET A CG  
1317 S SD  . MET A 179 ? 1.0906 1.1781 1.4030 0.0986  0.0656  0.0520  190 MET A SD  
1318 C CE  . MET A 179 ? 0.9224 0.9754 1.1975 0.0941  0.0528  0.0346  190 MET A CE  
1319 N N   . VAL A 180 ? 0.4336 0.4714 0.6035 0.0920  0.0875  0.0059  191 VAL A N   
1320 C CA  . VAL A 180 ? 0.5493 0.5824 0.6937 0.0813  0.0762  -0.0008 191 VAL A CA  
1321 C C   . VAL A 180 ? 0.5786 0.6149 0.7352 0.0665  0.0555  -0.0017 191 VAL A C   
1322 O O   . VAL A 180 ? 0.5492 0.6005 0.7337 0.0577  0.0502  0.0079  191 VAL A O   
1323 C CB  . VAL A 180 ? 0.4912 0.5356 0.6393 0.0810  0.0853  0.0092  191 VAL A CB  
1324 C CG1 . VAL A 180 ? 0.5667 0.6072 0.6973 0.0710  0.0737  0.0058  191 VAL A CG1 
1325 C CG2 . VAL A 180 ? 0.6606 0.7018 0.7879 0.0954  0.1057  0.0096  191 VAL A CG2 
1326 N N   . GLU A 181 ? 0.4733 0.4957 0.6077 0.0623  0.0441  -0.0133 192 GLU A N   
1327 C CA  . GLU A 181 ? 0.5200 0.5448 0.6604 0.0490  0.0262  -0.0146 192 GLU A CA  
1328 C C   . GLU A 181 ? 0.5750 0.5975 0.6949 0.0413  0.0189  -0.0200 192 GLU A C   
1329 O O   . GLU A 181 ? 0.6880 0.7126 0.8109 0.0306  0.0068  -0.0212 192 GLU A O   
1330 C CB  . GLU A 181 ? 0.4345 0.4474 0.5702 0.0491  0.0189  -0.0204 192 GLU A CB  
1331 C CG  . GLU A 181 ? 0.5889 0.6059 0.7527 0.0570  0.0244  -0.0112 192 GLU A CG  
1332 C CD  . GLU A 181 ? 0.8027 0.8224 0.9805 0.0495  0.0097  -0.0066 192 GLU A CD  
1333 O OE1 . GLU A 181 ? 0.8492 0.8510 1.0173 0.0528  0.0088  -0.0117 192 GLU A OE1 
1334 O OE2 . GLU A 181 ? 0.8747 0.9136 1.0715 0.0392  -0.0010 0.0023  192 GLU A OE2 
1335 N N   . ALA A 182 ? 0.6455 0.6653 0.7448 0.0472  0.0269  -0.0218 193 ALA A N   
1336 C CA  . ALA A 182 ? 0.6029 0.6241 0.6877 0.0431  0.0222  -0.0228 193 ALA A CA  
1337 C C   . ALA A 182 ? 0.6211 0.6466 0.7025 0.0503  0.0350  -0.0145 193 ALA A C   
1338 O O   . ALA A 182 ? 0.7473 0.7729 0.8202 0.0595  0.0462  -0.0130 193 ALA A O   
1339 C CB  . ALA A 182 ? 0.4232 0.4395 0.4816 0.0417  0.0139  -0.0322 193 ALA A CB  
1340 N N   . LEU A 183 ? 0.6298 0.6571 0.7168 0.0466  0.0348  -0.0088 194 LEU A N   
1341 C CA  . LEU A 183 ? 0.5754 0.6051 0.6615 0.0532  0.0473  0.0021  194 LEU A CA  
1342 C C   . LEU A 183 ? 0.5608 0.5871 0.6467 0.0506  0.0456  0.0060  194 LEU A C   
1343 O O   . LEU A 183 ? 0.5003 0.5195 0.6036 0.0431  0.0468  0.0076  194 LEU A O   
1344 C CB  . LEU A 183 ? 0.3973 0.4297 0.5087 0.0525  0.0581  0.0109  194 LEU A CB  
1345 C CG  . LEU A 183 ? 0.6755 0.7103 0.7886 0.0594  0.0737  0.0246  194 LEU A CG  
1346 C CD1 . LEU A 183 ? 0.8110 0.8503 0.8954 0.0720  0.0807  0.0259  194 LEU A CD1 
1347 C CD2 . LEU A 183 ? 0.7480 0.7889 0.8913 0.0561  0.0831  0.0334  194 LEU A CD2 
1348 N N   . GLN A 184 ? 0.6028 0.6340 0.6691 0.0566  0.0432  0.0076  195 GLN A N   
1349 C CA  . GLN A 184 ? 0.5759 0.6054 0.6437 0.0570  0.0421  0.0119  195 GLN A CA  
1350 C C   . GLN A 184 ? 0.4494 0.4872 0.5073 0.0688  0.0500  0.0265  195 GLN A C   
1351 O O   . GLN A 184 ? 0.4458 0.4942 0.4869 0.0747  0.0513  0.0300  195 GLN A O   
1352 C CB  . GLN A 184 ? 0.4234 0.4575 0.4833 0.0520  0.0286  0.0025  195 GLN A CB  
1353 C CG  . GLN A 184 ? 0.4689 0.4961 0.5371 0.0407  0.0202  -0.0092 195 GLN A CG  
1354 C CD  . GLN A 184 ? 0.5541 0.5876 0.6116 0.0361  0.0075  -0.0174 195 GLN A CD  
1355 O OE1 . GLN A 184 ? 0.6622 0.7065 0.7074 0.0396  0.0037  -0.0153 195 GLN A OE1 
1356 N NE2 . GLN A 184 ? 0.7357 0.7642 0.7992 0.0274  0.0001  -0.0251 195 GLN A NE2 
1357 N N   . GLU A 185 ? 0.4969 0.5292 0.5641 0.0726  0.0560  0.0356  196 GLU A N   
1358 C CA  . GLU A 185 ? 0.4330 0.4741 0.4952 0.0854  0.0638  0.0538  196 GLU A CA  
1359 C C   . GLU A 185 ? 0.5131 0.5730 0.5658 0.0899  0.0537  0.0567  196 GLU A C   
1360 O O   . GLU A 185 ? 0.5752 0.6336 0.6329 0.0844  0.0466  0.0474  196 GLU A O   
1361 C CB  . GLU A 185 ? 0.4444 0.4657 0.5253 0.0887  0.0790  0.0647  196 GLU A CB  
1362 C CG  . GLU A 185 ? 0.5487 0.5774 0.6290 0.1041  0.0887  0.0874  196 GLU A CG  
1363 C CD  . GLU A 185 ? 0.6387 0.6402 0.7383 0.1072  0.1056  0.0970  196 GLU A CD  
1364 O OE1 . GLU A 185 ? 0.6816 0.6591 0.7927 0.0947  0.1093  0.0849  196 GLU A OE1 
1365 O OE2 . GLU A 185 ? 0.7553 0.7591 0.8586 0.1215  0.1150  0.1172  196 GLU A OE2 
1366 N N   . HIS A 186 ? 0.5192 0.6000 0.5581 0.0990  0.0527  0.0708  197 HIS A N   
1367 C CA  . HIS A 186 ? 0.4456 0.5514 0.4794 0.1029  0.0422  0.0779  197 HIS A CA  
1368 C C   . HIS A 186 ? 0.5070 0.6072 0.5632 0.1114  0.0509  0.0889  197 HIS A C   
1369 O O   . HIS A 186 ? 0.5804 0.6659 0.6485 0.1209  0.0667  0.1027  197 HIS A O   
1370 C CB  . HIS A 186 ? 0.5329 0.6646 0.5473 0.1106  0.0394  0.0942  197 HIS A CB  
1371 C CG  . HIS A 186 ? 0.6580 0.8230 0.6655 0.1105  0.0239  0.1009  197 HIS A CG  
1372 N ND1 . HIS A 186 ? 0.5815 0.7631 0.6085 0.1214  0.0259  0.1202  197 HIS A ND1 
1373 C CD2 . HIS A 186 ? 0.6689 0.8543 0.6537 0.1000  0.0063  0.0915  197 HIS A CD2 
1374 C CE1 . HIS A 186 ? 0.5742 0.7905 0.5938 0.1174  0.0090  0.1243  197 HIS A CE1 
1375 N NE2 . HIS A 186 ? 0.5973 0.8153 0.5899 0.1028  -0.0039 0.1060  197 HIS A NE2 
1376 N N   . PRO A 187 ? 0.4341 0.5432 0.4970 0.1086  0.0433  0.0835  198 PRO A N   
1377 C CA  . PRO A 187 ? 0.4378 0.5369 0.5212 0.1178  0.0553  0.0913  198 PRO A CA  
1378 C C   . PRO A 187 ? 0.5787 0.6950 0.6725 0.1367  0.0641  0.1193  198 PRO A C   
1379 O O   . PRO A 187 ? 0.7149 0.8157 0.8267 0.1478  0.0796  0.1278  198 PRO A O   
1380 C CB  . PRO A 187 ? 0.4227 0.5346 0.5080 0.1101  0.0441  0.0801  198 PRO A CB  
1381 C CG  . PRO A 187 ? 0.4100 0.5248 0.4781 0.0938  0.0281  0.0618  198 PRO A CG  
1382 C CD  . PRO A 187 ? 0.4206 0.5448 0.4731 0.0960  0.0255  0.0686  198 PRO A CD  
1383 N N   . ARG A 188 ? 0.6131 0.7603 0.6951 0.1410  0.0552  0.1344  199 ARG A N   
1384 C CA  . ARG A 188 ? 0.5779 0.7475 0.6701 0.1595  0.0616  0.1654  199 ARG A CA  
1385 C C   . ARG A 188 ? 0.5284 0.7037 0.6052 0.1643  0.0642  0.1801  199 ARG A C   
1386 O O   . ARG A 188 ? 0.5568 0.7578 0.6375 0.1787  0.0659  0.2085  199 ARG A O   
1387 C CB  . ARG A 188 ? 0.7110 0.9281 0.8063 0.1612  0.0451  0.1767  199 ARG A CB  
1388 C CG  . ARG A 188 ? 0.6256 0.8439 0.7358 0.1561  0.0421  0.1642  199 ARG A CG  
1389 C CD  . ARG A 188 ? 0.5149 0.7094 0.6514 0.1720  0.0650  0.1725  199 ARG A CD  
1390 N NE  . ARG A 188 ? 0.5575 0.7503 0.7037 0.1665  0.0645  0.1583  199 ARG A NE  
1391 C CZ  . ARG A 188 ? 0.5850 0.7552 0.7490 0.1778  0.0844  0.1592  199 ARG A CZ  
1392 N NH1 . ARG A 188 ? 0.4885 0.6323 0.6641 0.1949  0.1064  0.1731  199 ARG A NH1 
1393 N NH2 . ARG A 188 ? 0.5269 0.6987 0.6957 0.1719  0.0838  0.1462  199 ARG A NH2 
1394 N N   . ASP A 189 ? 0.5421 0.6967 0.6024 0.1534  0.0653  0.1637  200 ASP A N   
1395 C CA  . ASP A 189 ? 0.6053 0.7662 0.6478 0.1572  0.0692  0.1763  200 ASP A CA  
1396 C C   . ASP A 189 ? 0.7340 0.8585 0.7787 0.1505  0.0825  0.1633  200 ASP A C   
1397 O O   . ASP A 189 ? 0.8298 0.9476 0.8613 0.1374  0.0757  0.1410  200 ASP A O   
1398 C CB  . ASP A 189 ? 0.7099 0.9021 0.7195 0.1485  0.0502  0.1701  200 ASP A CB  
1399 C CG  . ASP A 189 ? 0.7995 1.0091 0.7874 0.1563  0.0538  0.1906  200 ASP A CG  
1400 O OD1 . ASP A 189 ? 0.9112 1.1579 0.8780 0.1560  0.0388  0.2006  200 ASP A OD1 
1401 O OD2 . ASP A 189 ? 0.8465 1.0345 0.8381 0.1617  0.0714  0.1978  200 ASP A OD2 
1402 N N   . PRO A 190 ? 0.6801 0.7809 0.7436 0.1589  0.1019  0.1780  201 PRO A N   
1403 C CA  . PRO A 190 ? 0.5582 0.6288 0.6275 0.1503  0.1137  0.1682  201 PRO A CA  
1404 C C   . PRO A 190 ? 0.6123 0.6955 0.6602 0.1481  0.1140  0.1698  201 PRO A C   
1405 O O   . PRO A 190 ? 0.7656 0.8309 0.8194 0.1397  0.1215  0.1600  201 PRO A O   
1406 C CB  . PRO A 190 ? 0.5858 0.6308 0.6787 0.1602  0.1345  0.1881  201 PRO A CB  
1407 C CG  . PRO A 190 ? 0.6880 0.7399 0.7920 0.1726  0.1340  0.1990  201 PRO A CG  
1408 C CD  . PRO A 190 ? 0.7475 0.8448 0.8320 0.1756  0.1147  0.2034  201 PRO A CD  
1409 N N   . ASN A 191 ? 0.5507 0.6654 0.5735 0.1549  0.1063  0.1822  202 ASN A N   
1410 C CA  . ASN A 191 ? 0.5658 0.6910 0.5617 0.1534  0.1085  0.1820  202 ASN A CA  
1411 C C   . ASN A 191 ? 0.5535 0.6807 0.5286 0.1406  0.0955  0.1526  202 ASN A C   
1412 O O   . ASN A 191 ? 0.7083 0.8324 0.6678 0.1383  0.1023  0.1459  202 ASN A O   
1413 C CB  . ASN A 191 ? 0.6803 0.8379 0.6518 0.1646  0.1055  0.2071  202 ASN A CB  
1414 C CG  . ASN A 191 ? 0.7556 0.9225 0.6939 0.1641  0.1109  0.2077  202 ASN A CG  
1415 O OD1 . ASN A 191 ? 0.7642 0.9126 0.7102 0.1631  0.1273  0.2063  202 ASN A OD1 
1416 N ND2 . ASN A 191 ? 0.8533 1.0501 0.7538 0.1638  0.0974  0.2095  202 ASN A ND2 
1417 N N   . GLN A 192 ? 0.5349 0.6662 0.5107 0.1332  0.0790  0.1363  203 GLN A N   
1418 C CA  . GLN A 192 ? 0.5264 0.6560 0.4842 0.1210  0.0670  0.1095  203 GLN A CA  
1419 C C   . GLN A 192 ? 0.5727 0.6767 0.5554 0.1123  0.0687  0.0912  203 GLN A C   
1420 O O   . GLN A 192 ? 0.7377 0.8314 0.7454 0.1117  0.0696  0.0930  203 GLN A O   
1421 C CB  . GLN A 192 ? 0.5260 0.6783 0.4680 0.1157  0.0464  0.1040  203 GLN A CB  
1422 C CG  . GLN A 192 ? 0.6224 0.8070 0.5395 0.1219  0.0400  0.1232  203 GLN A CG  
1423 C CD  . GLN A 192 ? 0.6507 0.8617 0.5568 0.1134  0.0176  0.1184  203 GLN A CD  
1424 O OE1 . GLN A 192 ? 0.7116 0.9153 0.6078 0.0996  0.0063  0.0943  203 GLN A OE1 
1425 N NE2 . GLN A 192 ? 0.5626 0.8057 0.4734 0.1214  0.0113  0.1434  203 GLN A NE2 
1426 N N   . ILE A 193 ? 0.4989 0.5928 0.4737 0.1059  0.0701  0.0744  204 ILE A N   
1427 C CA  . ILE A 193 ? 0.4761 0.5518 0.4719 0.0967  0.0682  0.0578  204 ILE A CA  
1428 C C   . ILE A 193 ? 0.5599 0.6349 0.5363 0.0896  0.0576  0.0374  204 ILE A C   
1429 O O   . ILE A 193 ? 0.5215 0.6027 0.4683 0.0918  0.0580  0.0338  204 ILE A O   
1430 C CB  . ILE A 193 ? 0.6746 0.7369 0.6926 0.0968  0.0839  0.0621  204 ILE A CB  
1431 C CG1 . ILE A 193 ? 0.8271 0.8939 0.8278 0.1019  0.0943  0.0624  204 ILE A CG1 
1432 C CG2 . ILE A 193 ? 0.6655 0.7224 0.7028 0.1017  0.0954  0.0816  204 ILE A CG2 
1433 C CD1 . ILE A 193 ? 0.9126 0.9714 0.9397 0.1003  0.1078  0.0647  204 ILE A CD1 
1434 N N   . LEU A 194 ? 0.5630 0.6281 0.5542 0.0808  0.0489  0.0239  205 LEU A N   
1435 C CA  . LEU A 194 ? 0.5657 0.6248 0.5441 0.0738  0.0401  0.0056  205 LEU A CA  
1436 C C   . LEU A 194 ? 0.6723 0.7179 0.6676 0.0734  0.0488  -0.0002 205 LEU A C   
1437 O O   . LEU A 194 ? 0.8298 0.8713 0.8533 0.0714  0.0530  0.0052  205 LEU A O   
1438 C CB  . LEU A 194 ? 0.6182 0.6784 0.6025 0.0646  0.0244  -0.0025 205 LEU A CB  
1439 C CG  . LEU A 194 ? 0.6352 0.6852 0.6122 0.0558  0.0152  -0.0199 205 LEU A CG  
1440 C CD1 . LEU A 194 ? 0.6734 0.7338 0.6393 0.0475  -0.0005 -0.0243 205 LEU A CD1 
1441 C CD2 . LEU A 194 ? 0.6098 0.6477 0.6134 0.0515  0.0157  -0.0239 205 LEU A CD2 
1442 N N   . ILE A 195 ? 0.6065 0.6451 0.5845 0.0750  0.0520  -0.0110 206 ILE A N   
1443 C CA  . ILE A 195 ? 0.5427 0.5713 0.5386 0.0770  0.0608  -0.0150 206 ILE A CA  
1444 C C   . ILE A 195 ? 0.5944 0.6099 0.5816 0.0716  0.0517  -0.0314 206 ILE A C   
1445 O O   . ILE A 195 ? 0.7461 0.7560 0.7013 0.0697  0.0472  -0.0422 206 ILE A O   
1446 C CB  . ILE A 195 ? 0.4934 0.5227 0.4801 0.0881  0.0802  -0.0098 206 ILE A CB  
1447 C CG1 . ILE A 195 ? 0.4916 0.5333 0.4833 0.0928  0.0892  0.0085  206 ILE A CG1 
1448 C CG2 . ILE A 195 ? 0.4853 0.5102 0.5003 0.0917  0.0906  -0.0093 206 ILE A CG2 
1449 C CD1 . ILE A 195 ? 0.5466 0.5921 0.5286 0.1037  0.1098  0.0165  206 ILE A CD1 
1450 N N   . GLY A 196 ? 0.5000 0.5107 0.5150 0.0680  0.0484  -0.0324 207 GLY A N   
1451 C CA  . GLY A 196 ? 0.4562 0.4529 0.4677 0.0636  0.0408  -0.0445 207 GLY A CA  
1452 C C   . GLY A 196 ? 0.5597 0.5490 0.5927 0.0706  0.0511  -0.0431 207 GLY A C   
1453 O O   . GLY A 196 ? 0.5973 0.5979 0.6632 0.0709  0.0531  -0.0319 207 GLY A O   
1454 N N   . TYR A 197 ? 0.5610 0.5314 0.5765 0.0759  0.0580  -0.0542 208 TYR A N   
1455 C CA  . TYR A 197 ? 0.5418 0.5040 0.5779 0.0866  0.0715  -0.0516 208 TYR A CA  
1456 C C   . TYR A 197 ? 0.6716 0.6181 0.7166 0.0821  0.0621  -0.0570 208 TYR A C   
1457 O O   . TYR A 197 ? 0.7982 0.7335 0.8230 0.0713  0.0489  -0.0675 208 TYR A O   
1458 C CB  . TYR A 197 ? 0.5768 0.5242 0.5864 0.0995  0.0923  -0.0594 208 TYR A CB  
1459 C CG  . TYR A 197 ? 0.5507 0.5144 0.5491 0.1044  0.1027  -0.0518 208 TYR A CG  
1460 C CD1 . TYR A 197 ? 0.5700 0.5511 0.5993 0.1136  0.1174  -0.0355 208 TYR A CD1 
1461 C CD2 . TYR A 197 ? 0.6742 0.6384 0.6331 0.0991  0.0974  -0.0585 208 TYR A CD2 
1462 C CE1 . TYR A 197 ? 0.6001 0.5950 0.6202 0.1177  0.1280  -0.0264 208 TYR A CE1 
1463 C CE2 . TYR A 197 ? 0.7027 0.6824 0.6515 0.1044  0.1071  -0.0483 208 TYR A CE2 
1464 C CZ  . TYR A 197 ? 0.6694 0.6626 0.6484 0.1138  0.1232  -0.0324 208 TYR A CZ  
1465 O OH  . TYR A 197 ? 0.7063 0.7137 0.6763 0.1188  0.1341  -0.0203 208 TYR A OH  
1466 N N   . SER A 198 ? 0.5660 0.5143 0.6443 0.0906  0.0694  -0.0473 209 SER A N   
1467 C CA  . SER A 198 ? 0.5868 0.5246 0.6808 0.0874  0.0603  -0.0463 209 SER A CA  
1468 C C   . SER A 198 ? 0.6956 0.5972 0.7588 0.0879  0.0640  -0.0637 209 SER A C   
1469 O O   . SER A 198 ? 0.7018 0.5925 0.7578 0.0761  0.0495  -0.0691 209 SER A O   
1470 C CB  . SER A 198 ? 0.6527 0.6031 0.7901 0.0990  0.0689  -0.0291 209 SER A CB  
1471 O OG  . SER A 198 ? 0.8320 0.8156 0.9986 0.0926  0.0605  -0.0139 209 SER A OG  
1472 N N   . ARG A 199 ? 0.6825 0.5636 0.7256 0.1004  0.0843  -0.0732 210 ARG A N   
1473 C CA  . ARG A 199 ? 0.6525 0.4925 0.6657 0.1006  0.0906  -0.0917 210 ARG A CA  
1474 C C   . ARG A 199 ? 0.7782 0.6084 0.7527 0.0810  0.0734  -0.1080 210 ARG A C   
1475 O O   . ARG A 199 ? 0.9726 0.7700 0.9274 0.0742  0.0717  -0.1223 210 ARG A O   
1476 C CB  . ARG A 199 ? 0.7228 0.5419 0.7149 0.1173  0.1178  -0.1011 210 ARG A CB  
1477 C CG  . ARG A 199 ? 0.9618 0.7942 0.9210 0.1158  0.1219  -0.1071 210 ARG A CG  
1478 C CD  . ARG A 199 ? 1.0226 0.8302 0.9535 0.1316  0.1501  -0.1188 210 ARG A CD  
1479 N NE  . ARG A 199 ? 1.0234 0.8428 0.9159 0.1291  0.1534  -0.1244 210 ARG A NE  
1480 C CZ  . ARG A 199 ? 1.1127 0.9179 0.9532 0.1152  0.1443  -0.1435 210 ARG A CZ  
1481 N NH1 . ARG A 199 ? 1.1561 0.9329 0.9777 0.1011  0.1315  -0.1603 210 ARG A NH1 
1482 N NH2 . ARG A 199 ? 1.1874 1.0084 0.9956 0.1145  0.1472  -0.1442 210 ARG A NH2 
1483 N N   . GLY A 200 ? 0.7745 0.6327 0.7402 0.0718  0.0610  -0.1050 211 GLY A N   
1484 C CA  . GLY A 200 ? 0.7556 0.6137 0.6932 0.0535  0.0430  -0.1156 211 GLY A CA  
1485 C C   . GLY A 200 ? 0.7633 0.6376 0.6699 0.0506  0.0416  -0.1194 211 GLY A C   
1486 O O   . GLY A 200 ? 0.8232 0.7058 0.7100 0.0359  0.0256  -0.1247 211 GLY A O   
1487 N N   . LEU A 201 ? 0.8497 0.7316 0.7538 0.0646  0.0583  -0.1144 212 LEU A N   
1488 C CA  . LEU A 201 ? 0.8401 0.7381 0.7141 0.0636  0.0587  -0.1148 212 LEU A CA  
1489 C C   . LEU A 201 ? 0.7404 0.6733 0.6372 0.0605  0.0471  -0.0971 212 LEU A C   
1490 O O   . LEU A 201 ? 0.6844 0.6302 0.6178 0.0670  0.0513  -0.0826 212 LEU A O   
1491 C CB  . LEU A 201 ? 0.7742 0.6667 0.6362 0.0803  0.0835  -0.1145 212 LEU A CB  
1492 C CG  . LEU A 201 ? 0.7711 0.6822 0.6018 0.0814  0.0863  -0.1111 212 LEU A CG  
1493 C CD1 . LEU A 201 ? 0.7079 0.6086 0.4864 0.0675  0.0751  -0.1292 212 LEU A CD1 
1494 C CD2 . LEU A 201 ? 0.8094 0.7186 0.6364 0.0993  0.1133  -0.1064 212 LEU A CD2 
1495 N N   . VAL A 202 ? 0.6955 0.6432 0.5709 0.0501  0.0328  -0.0979 213 VAL A N   
1496 C CA  . VAL A 202 ? 0.5758 0.5533 0.4684 0.0492  0.0245  -0.0814 213 VAL A CA  
1497 C C   . VAL A 202 ? 0.6299 0.6227 0.4910 0.0513  0.0261  -0.0777 213 VAL A C   
1498 O O   . VAL A 202 ? 0.6019 0.5908 0.4260 0.0430  0.0191  -0.0896 213 VAL A O   
1499 C CB  . VAL A 202 ? 0.5405 0.5272 0.4457 0.0361  0.0050  -0.0805 213 VAL A CB  
1500 C CG1 . VAL A 202 ? 0.6301 0.6440 0.5511 0.0377  0.0003  -0.0640 213 VAL A CG1 
1501 C CG2 . VAL A 202 ? 0.5432 0.5163 0.4766 0.0337  0.0032  -0.0822 213 VAL A CG2 
1502 N N   . VAL A 203 ? 0.6367 0.6469 0.5116 0.0610  0.0347  -0.0605 214 VAL A N   
1503 C CA  . VAL A 203 ? 0.5778 0.6028 0.4247 0.0664  0.0401  -0.0526 214 VAL A CA  
1504 C C   . VAL A 203 ? 0.6801 0.7288 0.5498 0.0704  0.0378  -0.0308 214 VAL A C   
1505 O O   . VAL A 203 ? 0.8740 0.9215 0.7796 0.0744  0.0437  -0.0215 214 VAL A O   
1506 C CB  . VAL A 203 ? 0.6221 0.6358 0.4566 0.0787  0.0629  -0.0537 214 VAL A CB  
1507 C CG1 . VAL A 203 ? 0.7968 0.8305 0.6162 0.0869  0.0716  -0.0368 214 VAL A CG1 
1508 C CG2 . VAL A 203 ? 0.6493 0.6382 0.4453 0.0756  0.0669  -0.0766 214 VAL A CG2 
1509 N N   . ILE A 204 ? 0.6773 0.7470 0.5259 0.0690  0.0292  -0.0222 215 ILE A N   
1510 C CA  . ILE A 204 ? 0.7389 0.8294 0.6046 0.0765  0.0311  0.0013  215 ILE A CA  
1511 C C   . ILE A 204 ? 0.6967 0.7936 0.5423 0.0873  0.0466  0.0133  215 ILE A C   
1512 O O   . ILE A 204 ? 0.7641 0.8656 0.5682 0.0856  0.0453  0.0073  215 ILE A O   
1513 C CB  . ILE A 204 ? 0.6841 0.7992 0.5453 0.0706  0.0126  0.0087  215 ILE A CB  
1514 C CG1 . ILE A 204 ? 0.5556 0.6655 0.4369 0.0598  -0.0006 -0.0024 215 ILE A CG1 
1515 C CG2 . ILE A 204 ? 0.5375 0.6713 0.4183 0.0817  0.0178  0.0350  215 ILE A CG2 
1516 C CD1 . ILE A 204 ? 0.5175 0.6551 0.4011 0.0542  -0.0175 0.0065  215 ILE A CD1 
1517 N N   . TRP A 205 ? 0.6295 0.7257 0.5024 0.0968  0.0613  0.0302  216 TRP A N   
1518 C CA  . TRP A 205 ? 0.6490 0.7484 0.5098 0.1072  0.0799  0.0430  216 TRP A CA  
1519 C C   . TRP A 205 ? 0.6285 0.7473 0.4942 0.1150  0.0820  0.0703  216 TRP A C   
1520 O O   . TRP A 205 ? 0.6333 0.7528 0.5312 0.1158  0.0791  0.0812  216 TRP A O   
1521 C CB  . TRP A 205 ? 0.6595 0.7431 0.5513 0.1113  0.0975  0.0433  216 TRP A CB  
1522 C CG  . TRP A 205 ? 0.6533 0.7410 0.5368 0.1216  0.1191  0.0570  216 TRP A CG  
1523 C CD1 . TRP A 205 ? 0.6946 0.7891 0.5991 0.1280  0.1318  0.0810  216 TRP A CD1 
1524 C CD2 . TRP A 205 ? 0.7851 0.8684 0.6369 0.1269  0.1329  0.0479  216 TRP A CD2 
1525 N NE1 . TRP A 205 ? 0.7738 0.8722 0.6633 0.1365  0.1518  0.0892  216 TRP A NE1 
1526 C CE2 . TRP A 205 ? 0.8320 0.9240 0.6880 0.1368  0.1536  0.0687  216 TRP A CE2 
1527 C CE3 . TRP A 205 ? 0.9099 0.9800 0.7293 0.1243  0.1315  0.0239  216 TRP A CE3 
1528 C CZ2 . TRP A 205 ? 0.8505 0.9416 0.6789 0.1451  0.1735  0.0666  216 TRP A CZ2 
1529 C CZ3 . TRP A 205 ? 0.9377 1.0027 0.7281 0.1329  0.1518  0.0199  216 TRP A CZ3 
1530 C CH2 . TRP A 205 ? 0.8869 0.9640 0.6816 0.1437  0.1729  0.0413  216 TRP A CH2 
1531 N N   . ASP A 206 ? 0.6272 0.7604 0.4595 0.1213  0.0884  0.0815  217 ASP A N   
1532 C CA  . ASP A 206 ? 0.6604 0.8124 0.4961 0.1310  0.0935  0.1117  217 ASP A CA  
1533 C C   . ASP A 206 ? 0.7223 0.8634 0.5797 0.1396  0.1179  0.1265  217 ASP A C   
1534 O O   . ASP A 206 ? 1.0977 1.2378 0.9328 0.1436  0.1324  0.1254  217 ASP A O   
1535 C CB  . ASP A 206 ? 0.7914 0.9686 0.5777 0.1321  0.0862  0.1188  217 ASP A CB  
1536 C CG  . ASP A 206 ? 0.8721 1.0729 0.6629 0.1433  0.0893  0.1540  217 ASP A CG  
1537 O OD1 . ASP A 206 ? 1.0420 1.2620 0.8434 0.1435  0.0738  0.1660  217 ASP A OD1 
1538 O OD2 . ASP A 206 ? 0.9167 1.1178 0.7026 0.1528  0.1084  0.1718  217 ASP A OD2 
1539 N N   . LEU A 207 ? 0.6145 0.7464 0.5150 0.1417  0.1233  0.1398  218 LEU A N   
1540 C CA  . LEU A 207 ? 0.7541 0.8736 0.6817 0.1453  0.1448  0.1520  218 LEU A CA  
1541 C C   . LEU A 207 ? 0.8156 0.9491 0.7251 0.1563  0.1605  0.1786  218 LEU A C   
1542 O O   . LEU A 207 ? 0.8873 1.0201 0.7901 0.1592  0.1778  0.1809  218 LEU A O   
1543 C CB  . LEU A 207 ? 0.8600 0.9630 0.8328 0.1420  0.1457  0.1583  218 LEU A CB  
1544 C CG  . LEU A 207 ? 0.8024 0.8900 0.7957 0.1303  0.1339  0.1336  218 LEU A CG  
1545 C CD1 . LEU A 207 ? 0.7047 0.7756 0.7331 0.1270  0.1348  0.1396  218 LEU A CD1 
1546 C CD2 . LEU A 207 ? 0.5490 0.6290 0.5515 0.1248  0.1412  0.1198  218 LEU A CD2 
1547 N N   . GLN A 208 ? 0.8491 0.9976 0.7518 0.1635  0.1558  0.2013  219 GLN A N   
1548 C CA  . GLN A 208 ? 0.8976 1.0621 0.7818 0.1746  0.1695  0.2308  219 GLN A CA  
1549 C C   . GLN A 208 ? 1.0205 1.2098 0.8475 0.1753  0.1594  0.2254  219 GLN A C   
1550 O O   . GLN A 208 ? 1.3150 1.5281 1.1216 0.1782  0.1449  0.2384  219 GLN A O   
1551 C CB  . GLN A 208 ? 0.8804 1.0482 0.7886 0.1836  0.1710  0.2615  219 GLN A CB  
1552 C CG  . GLN A 208 ? 0.9190 1.1007 0.8153 0.1958  0.1875  0.2971  219 GLN A CG  
1553 C CD  . GLN A 208 ? 1.0131 1.2074 0.9205 0.2075  0.1836  0.3288  219 GLN A CD  
1554 O OE1 . GLN A 208 ? 1.0631 1.2647 0.9772 0.2072  0.1660  0.3236  219 GLN A OE1 
1555 N NE2 . GLN A 208 ? 1.1607 1.3587 1.0723 0.2189  0.2014  0.3642  219 GLN A NE2 
1556 N N   . GLY A 209 ? 0.7917 0.9753 0.5922 0.1721  0.1676  0.2058  220 GLY A N   
1557 C CA  . GLY A 209 ? 0.7843 0.9836 0.5247 0.1700  0.1601  0.1941  220 GLY A CA  
1558 C C   . GLY A 209 ? 1.0230 1.2032 0.7450 0.1641  0.1659  0.1607  220 GLY A C   
1559 O O   . GLY A 209 ? 1.2023 1.3864 0.8738 0.1650  0.1726  0.1516  220 GLY A O   
1560 N N   . SER A 210 ? 0.8537 1.0123 0.6153 0.1585  0.1641  0.1428  221 SER A N   
1561 C CA  . SER A 210 ? 0.8396 0.9782 0.5961 0.1553  0.1717  0.1148  221 SER A CA  
1562 C C   . SER A 210 ? 1.0370 1.1730 0.7392 0.1479  0.1583  0.0882  221 SER A C   
1563 O O   . SER A 210 ? 1.1953 1.3252 0.8558 0.1509  0.1717  0.0762  221 SER A O   
1564 C CB  . SER A 210 ? 0.8725 1.0085 0.6318 0.1654  0.2017  0.1242  221 SER A CB  
1565 O OG  . SER A 210 ? 0.7804 0.9175 0.5918 0.1685  0.2130  0.1480  221 SER A OG  
1566 N N   . ARG A 211 ? 0.9181 1.0574 0.6213 0.1373  0.1325  0.0785  222 ARG A N   
1567 C CA  . ARG A 211 ? 0.9070 1.0425 0.5645 0.1257  0.1161  0.0525  222 ARG A CA  
1568 C C   . ARG A 211 ? 0.8130 0.9382 0.4994 0.1143  0.0960  0.0364  222 ARG A C   
1569 O O   . ARG A 211 ? 0.8088 0.9408 0.5393 0.1149  0.0887  0.0500  222 ARG A O   
1570 C CB  . ARG A 211 ? 0.9082 1.0730 0.5196 0.1219  0.1014  0.0641  222 ARG A CB  
1571 C CG  . ARG A 211 ? 0.8010 0.9940 0.4434 0.1248  0.0879  0.0940  222 ARG A CG  
1572 C CD  . ARG A 211 ? 1.0212 1.2483 0.6212 0.1185  0.0675  0.1038  222 ARG A CD  
1573 N NE  . ARG A 211 ? 1.0605 1.3156 0.6956 0.1235  0.0551  0.1337  222 ARG A NE  
1574 C CZ  . ARG A 211 ? 1.1263 1.4180 0.7424 0.1181  0.0329  0.1471  222 ARG A CZ  
1575 N NH1 . ARG A 211 ? 1.2100 1.5143 0.7687 0.1042  0.0183  0.1313  222 ARG A NH1 
1576 N NH2 . ARG A 211 ? 1.1593 1.4749 0.8140 0.1263  0.0256  0.1765  222 ARG A NH2 
1577 N N   . VAL A 212 ? 0.7705 0.8769 0.4302 0.1040  0.0888  0.0071  223 VAL A N   
1578 C CA  . VAL A 212 ? 0.7397 0.8351 0.4224 0.0921  0.0708  -0.0090 223 VAL A CA  
1579 C C   . VAL A 212 ? 0.7769 0.8956 0.4379 0.0787  0.0441  -0.0083 223 VAL A C   
1580 O O   . VAL A 212 ? 0.9216 1.0440 0.5309 0.0694  0.0364  -0.0204 223 VAL A O   
1581 C CB  . VAL A 212 ? 0.8334 0.8938 0.5029 0.0879  0.0779  -0.0387 223 VAL A CB  
1582 C CG1 . VAL A 212 ? 0.9575 1.0082 0.6425 0.0735  0.0572  -0.0541 223 VAL A CG1 
1583 C CG2 . VAL A 212 ? 0.7398 0.7840 0.4437 0.1017  0.1023  -0.0351 223 VAL A CG2 
1584 N N   . LEU A 213 ? 0.7075 0.8430 0.4079 0.0770  0.0303  0.0058  224 LEU A N   
1585 C CA  . LEU A 213 ? 0.8498 1.0149 0.5411 0.0662  0.0056  0.0121  224 LEU A CA  
1586 C C   . LEU A 213 ? 0.8775 1.0320 0.5704 0.0484  -0.0124 -0.0108 224 LEU A C   
1587 O O   . LEU A 213 ? 0.9255 1.1051 0.6056 0.0355  -0.0341 -0.0093 224 LEU A O   
1588 C CB  . LEU A 213 ? 0.8468 1.0369 0.5811 0.0762  0.0032  0.0420  224 LEU A CB  
1589 C CG  . LEU A 213 ? 0.6768 0.8741 0.4212 0.0940  0.0221  0.0688  224 LEU A CG  
1590 C CD1 . LEU A 213 ? 0.6437 0.8558 0.4335 0.1030  0.0210  0.0943  224 LEU A CD1 
1591 C CD2 . LEU A 213 ? 0.7257 0.9459 0.4220 0.0958  0.0214  0.0798  224 LEU A CD2 
1592 N N   . TYR A 214 ? 0.8887 1.0092 0.5987 0.0471  -0.0043 -0.0296 225 TYR A N   
1593 C CA  . TYR A 214 ? 0.8247 0.9337 0.5454 0.0319  -0.0193 -0.0468 225 TYR A CA  
1594 C C   . TYR A 214 ? 0.7982 0.8670 0.5295 0.0345  -0.0050 -0.0655 225 TYR A C   
1595 O O   . TYR A 214 ? 0.7742 0.8339 0.5308 0.0487  0.0127  -0.0574 225 TYR A O   
1596 C CB  . TYR A 214 ? 0.6273 0.7586 0.3932 0.0322  -0.0304 -0.0297 225 TYR A CB  
1597 C CG  . TYR A 214 ? 0.7068 0.8293 0.4892 0.0177  -0.0441 -0.0435 225 TYR A CG  
1598 C CD1 . TYR A 214 ? 0.8423 0.9842 0.6102 0.0001  -0.0655 -0.0477 225 TYR A CD1 
1599 C CD2 . TYR A 214 ? 0.7795 0.8773 0.5932 0.0206  -0.0362 -0.0499 225 TYR A CD2 
1600 C CE1 . TYR A 214 ? 0.9256 1.0602 0.7104 -0.0139 -0.0769 -0.0581 225 TYR A CE1 
1601 C CE2 . TYR A 214 ? 0.8460 0.9366 0.6740 0.0078  -0.0478 -0.0599 225 TYR A CE2 
1602 C CZ  . TYR A 214 ? 0.8799 0.9877 0.6939 -0.0092 -0.0671 -0.0639 225 TYR A CZ  
1603 O OH  . TYR A 214 ? 0.7177 0.8187 0.5476 -0.0227 -0.0775 -0.0720 225 TYR A OH  
1604 N N   . HIS A 215 ? 0.7783 0.8241 0.4922 0.0203  -0.0126 -0.0888 226 HIS A N   
1605 C CA  . HIS A 215 ? 0.6977 0.7055 0.4234 0.0240  0.0009  -0.1043 226 HIS A CA  
1606 C C   . HIS A 215 ? 0.7033 0.6906 0.4208 0.0057  -0.0129 -0.1243 226 HIS A C   
1607 O O   . HIS A 215 ? 0.8238 0.8191 0.5106 -0.0115 -0.0294 -0.1330 226 HIS A O   
1608 C CB  . HIS A 215 ? 0.7701 0.7550 0.4658 0.0352  0.0237  -0.1142 226 HIS A CB  
1609 C CG  . HIS A 215 ? 0.9585 0.9161 0.6017 0.0231  0.0228  -0.1408 226 HIS A CG  
1610 N ND1 . HIS A 215 ? 1.0114 0.9276 0.6525 0.0200  0.0301  -0.1620 226 HIS A ND1 
1611 C CD2 . HIS A 215 ? 1.0732 1.0373 0.6624 0.0125  0.0158  -0.1501 226 HIS A CD2 
1612 C CE1 . HIS A 215 ? 1.1228 1.0163 0.7098 0.0076  0.0289  -0.1853 226 HIS A CE1 
1613 N NE2 . HIS A 215 ? 1.1617 1.0848 0.7148 0.0017  0.0192  -0.1794 226 HIS A NE2 
1614 N N   . PHE A 216 ? 0.6841 0.6464 0.4305 0.0084  -0.0067 -0.1298 227 PHE A N   
1615 C CA  . PHE A 216 ? 0.7889 0.7231 0.5285 -0.0068 -0.0147 -0.1485 227 PHE A CA  
1616 C C   . PHE A 216 ? 0.8440 0.7454 0.6078 0.0048  0.0021  -0.1527 227 PHE A C   
1617 O O   . PHE A 216 ? 0.8373 0.7490 0.6372 0.0193  0.0112  -0.1373 227 PHE A O   
1618 C CB  . PHE A 216 ? 0.6739 0.6300 0.4360 -0.0225 -0.0372 -0.1414 227 PHE A CB  
1619 C CG  . PHE A 216 ? 0.7972 0.7694 0.6088 -0.0134 -0.0369 -0.1229 227 PHE A CG  
1620 C CD1 . PHE A 216 ? 0.8019 0.7519 0.6402 -0.0118 -0.0325 -0.1252 227 PHE A CD1 
1621 C CD2 . PHE A 216 ? 0.8163 0.8245 0.6457 -0.0071 -0.0408 -0.1031 227 PHE A CD2 
1622 C CE1 . PHE A 216 ? 0.5535 0.5185 0.4312 -0.0058 -0.0333 -0.1098 227 PHE A CE1 
1623 C CE2 . PHE A 216 ? 0.7145 0.7325 0.5838 -0.0004 -0.0395 -0.0895 227 PHE A CE2 
1624 C CZ  . PHE A 216 ? 0.5247 0.5219 0.4160 -0.0009 -0.0365 -0.0937 227 PHE A CZ  
1625 N N   . LEU A 217 ? 0.8547 0.7167 0.5987 -0.0024 0.0061  -0.1731 228 LEU A N   
1626 C CA  . LEU A 217 ? 0.8773 0.7074 0.6459 0.0082  0.0208  -0.1758 228 LEU A CA  
1627 C C   . LEU A 217 ? 0.8327 0.6586 0.6289 -0.0046 0.0055  -0.1731 228 LEU A C   
1628 O O   . LEU A 217 ? 1.0351 0.8594 0.8145 -0.0252 -0.0113 -0.1822 228 LEU A O   
1629 C CB  . LEU A 217 ? 1.0674 0.8504 0.7988 0.0113  0.0391  -0.1987 228 LEU A CB  
1630 C CG  . LEU A 217 ? 1.2208 1.0021 0.9233 0.0269  0.0602  -0.2022 228 LEU A CG  
1631 C CD1 . LEU A 217 ? 1.2680 0.9968 0.9297 0.0288  0.0795  -0.2283 228 LEU A CD1 
1632 C CD2 . LEU A 217 ? 1.1616 0.9630 0.9073 0.0499  0.0759  -0.1803 228 LEU A CD2 
1633 N N   . SER A 218 ? 0.6797 0.5066 0.5182 0.0065  0.0109  -0.1594 229 SER A N   
1634 C CA  . SER A 218 ? 0.6576 0.4824 0.5234 -0.0034 -0.0016 -0.1537 229 SER A CA  
1635 C C   . SER A 218 ? 0.6951 0.4738 0.5605 -0.0019 0.0089  -0.1643 229 SER A C   
1636 O O   . SER A 218 ? 0.7636 0.5220 0.6340 0.0160  0.0290  -0.1649 229 SER A O   
1637 C CB  . SER A 218 ? 0.6453 0.4993 0.5545 0.0057  -0.0038 -0.1318 229 SER A CB  
1638 O OG  . SER A 218 ? 0.7960 0.6863 0.7064 0.0061  -0.0101 -0.1222 229 SER A OG  
1639 N N   . SER A 219 ? 0.7955 0.5577 0.6571 -0.0203 -0.0035 -0.1709 230 SER A N   
1640 C CA  . SER A 219 ? 0.8437 0.5586 0.7079 -0.0198 0.0063  -0.1788 230 SER A CA  
1641 C C   . SER A 219 ? 0.8234 0.5415 0.7330 -0.0031 0.0135  -0.1584 230 SER A C   
1642 O O   . SER A 219 ? 0.7484 0.4291 0.6655 0.0069  0.0284  -0.1603 230 SER A O   
1643 C CB  . SER A 219 ? 0.8519 0.5517 0.7053 -0.0459 -0.0100 -0.1877 230 SER A CB  
1644 O OG  . SER A 219 ? 0.9761 0.7161 0.8562 -0.0555 -0.0285 -0.1703 230 SER A OG  
1645 N N   . GLN A 220 ? 0.7681 0.5295 0.7072 -0.0001 0.0037  -0.1387 231 GLN A N   
1646 C CA  . GLN A 220 ? 0.6304 0.4026 0.6104 0.0129  0.0071  -0.1182 231 GLN A CA  
1647 C C   . GLN A 220 ? 0.5946 0.4016 0.5909 0.0267  0.0117  -0.1063 231 GLN A C   
1648 O O   . GLN A 220 ? 0.5835 0.4108 0.5632 0.0243  0.0091  -0.1105 231 GLN A O   
1649 C CB  . GLN A 220 ? 0.7437 0.5323 0.7435 -0.0007 -0.0106 -0.1056 231 GLN A CB  
1650 C CG  . GLN A 220 ? 0.9173 0.6694 0.9169 -0.0099 -0.0113 -0.1087 231 GLN A CG  
1651 C CD  . GLN A 220 ? 1.0742 0.8020 1.0980 0.0079  0.0035  -0.0981 231 GLN A CD  
1652 O OE1 . GLN A 220 ? 1.1156 0.8644 1.1638 0.0248  0.0099  -0.0837 231 GLN A OE1 
1653 N NE2 . GLN A 220 ? 1.0837 0.7677 1.1032 0.0038  0.0091  -0.1036 231 GLN A NE2 
1654 N N   . GLN A 221 ? 0.6010 0.4156 0.6317 0.0405  0.0184  -0.0898 232 GLN A N   
1655 C CA  . GLN A 221 ? 0.5834 0.4296 0.6342 0.0519  0.0234  -0.0774 232 GLN A CA  
1656 C C   . GLN A 221 ? 0.5083 0.3894 0.5615 0.0402  0.0072  -0.0715 232 GLN A C   
1657 O O   . GLN A 221 ? 0.5630 0.4519 0.6209 0.0277  -0.0076 -0.0675 232 GLN A O   
1658 C CB  . GLN A 221 ? 0.7347 0.5875 0.8258 0.0651  0.0294  -0.0583 232 GLN A CB  
1659 C CG  . GLN A 221 ? 0.8057 0.6905 0.9216 0.0756  0.0355  -0.0449 232 GLN A CG  
1660 C CD  . GLN A 221 ? 0.8195 0.7134 0.9769 0.0891  0.0420  -0.0250 232 GLN A CD  
1661 O OE1 . GLN A 221 ? 0.8230 0.6978 0.9908 0.0928  0.0428  -0.0199 232 GLN A OE1 
1662 N NE2 . GLN A 221 ? 0.9110 0.8358 1.0947 0.0963  0.0465  -0.0115 232 GLN A NE2 
1663 N N   . LEU A 222 ? 0.4952 0.3956 0.5452 0.0450  0.0120  -0.0704 233 LEU A N   
1664 C CA  . LEU A 222 ? 0.5488 0.4765 0.5984 0.0361  0.0006  -0.0661 233 LEU A CA  
1665 C C   . LEU A 222 ? 0.5002 0.4505 0.5822 0.0362  -0.0041 -0.0504 233 LEU A C   
1666 O O   . LEU A 222 ? 0.6044 0.5618 0.7085 0.0461  0.0049  -0.0412 233 LEU A O   
1667 C CB  . LEU A 222 ? 0.4688 0.4045 0.4999 0.0411  0.0087  -0.0703 233 LEU A CB  
1668 C CG  . LEU A 222 ? 0.5799 0.5393 0.6091 0.0344  0.0000  -0.0655 233 LEU A CG  
1669 C CD1 . LEU A 222 ? 0.4451 0.4052 0.4561 0.0216  -0.0136 -0.0722 233 LEU A CD1 
1670 C CD2 . LEU A 222 ? 0.5529 0.5206 0.5708 0.0427  0.0110  -0.0639 233 LEU A CD2 
1671 N N   . GLU A 223 ? 0.4983 0.4613 0.5825 0.0243  -0.0180 -0.0473 234 GLU A N   
1672 C CA  . GLU A 223 ? 0.6332 0.6163 0.7400 0.0202  -0.0245 -0.0355 234 GLU A CA  
1673 C C   . GLU A 223 ? 0.5652 0.5635 0.6677 0.0161  -0.0255 -0.0357 234 GLU A C   
1674 O O   . GLU A 223 ? 0.7509 0.7614 0.8701 0.0168  -0.0228 -0.0286 234 GLU A O   
1675 C CB  . GLU A 223 ? 0.6812 0.6650 0.7916 0.0100  -0.0373 -0.0315 234 GLU A CB  
1676 C CG  . GLU A 223 ? 0.8469 0.8189 0.9718 0.0149  -0.0365 -0.0244 234 GLU A CG  
1677 C CD  . GLU A 223 ? 0.8226 0.8103 0.9773 0.0218  -0.0344 -0.0096 234 GLU A CD  
1678 O OE1 . GLU A 223 ? 0.7643 0.7738 0.9278 0.0166  -0.0388 -0.0048 234 GLU A OE1 
1679 O OE2 . GLU A 223 ? 0.7731 0.7516 0.9440 0.0322  -0.0279 -0.0022 234 GLU A OE2 
1680 N N   . ASN A 224 ? 0.3731 0.3708 0.4554 0.0114  -0.0288 -0.0426 235 ASN A N   
1681 C CA  . ASN A 224 ? 0.3626 0.3711 0.4411 0.0101  -0.0273 -0.0416 235 ASN A CA  
1682 C C   . ASN A 224 ? 0.5930 0.6020 0.6504 0.0093  -0.0291 -0.0473 235 ASN A C   
1683 O O   . ASN A 224 ? 0.5848 0.5860 0.6302 0.0066  -0.0331 -0.0534 235 ASN A O   
1684 C CB  . ASN A 224 ? 0.5658 0.5826 0.6535 0.0010  -0.0341 -0.0378 235 ASN A CB  
1685 C CG  . ASN A 224 ? 0.7830 0.8044 0.8723 0.0012  -0.0284 -0.0362 235 ASN A CG  
1686 O OD1 . ASN A 224 ? 1.1327 1.1556 1.2129 -0.0011 -0.0286 -0.0380 235 ASN A OD1 
1687 N ND2 . ASN A 224 ? 0.5230 0.5462 0.6259 0.0043  -0.0217 -0.0315 235 ASN A ND2 
1688 N N   . ILE A 225 ? 0.6772 0.6957 0.7314 0.0111  -0.0262 -0.0444 236 ILE A N   
1689 C CA  . ILE A 225 ? 0.7582 0.7846 0.7967 0.0115  -0.0284 -0.0454 236 ILE A CA  
1690 C C   . ILE A 225 ? 0.7156 0.7520 0.7597 0.0131  -0.0256 -0.0390 236 ILE A C   
1691 O O   . ILE A 225 ? 0.7070 0.7394 0.7622 0.0143  -0.0196 -0.0359 236 ILE A O   
1692 C CB  . ILE A 225 ? 0.7042 0.7292 0.7271 0.0189  -0.0224 -0.0471 236 ILE A CB  
1693 C CG1 . ILE A 225 ? 0.7764 0.8105 0.7800 0.0145  -0.0304 -0.0502 236 ILE A CG1 
1694 C CG2 . ILE A 225 ? 0.6221 0.6526 0.6500 0.0279  -0.0116 -0.0385 236 ILE A CG2 
1695 C CD1 . ILE A 225 ? 0.8768 0.9086 0.8574 0.0189  -0.0264 -0.0541 236 ILE A CD1 
1696 N N   . TRP A 226 ? 0.4837 0.5331 0.5212 0.0127  -0.0295 -0.0365 237 TRP A N   
1697 C CA  . TRP A 226 ? 0.4275 0.4856 0.4713 0.0174  -0.0240 -0.0291 237 TRP A CA  
1698 C C   . TRP A 226 ? 0.5067 0.5833 0.5435 0.0234  -0.0249 -0.0214 237 TRP A C   
1699 O O   . TRP A 226 ? 0.6007 0.6874 0.6273 0.0179  -0.0347 -0.0239 237 TRP A O   
1700 C CB  . TRP A 226 ? 0.5930 0.6537 0.6425 0.0106  -0.0274 -0.0304 237 TRP A CB  
1701 C CG  . TRP A 226 ? 0.6161 0.6780 0.6719 0.0169  -0.0173 -0.0250 237 TRP A CG  
1702 C CD1 . TRP A 226 ? 0.4652 0.5435 0.5245 0.0234  -0.0140 -0.0167 237 TRP A CD1 
1703 C CD2 . TRP A 226 ? 0.5250 0.5696 0.5848 0.0173  -0.0079 -0.0273 237 TRP A CD2 
1704 N NE1 . TRP A 226 ? 0.4211 0.4894 0.4859 0.0301  -0.0007 -0.0142 237 TRP A NE1 
1705 C CE2 . TRP A 226 ? 0.6423 0.6878 0.7052 0.0250  0.0028  -0.0222 237 TRP A CE2 
1706 C CE3 . TRP A 226 ? 0.4823 0.5117 0.5444 0.0110  -0.0077 -0.0329 237 TRP A CE3 
1707 C CZ2 . TRP A 226 ? 0.6839 0.7089 0.7478 0.0256  0.0147  -0.0254 237 TRP A CZ2 
1708 C CZ3 . TRP A 226 ? 0.3642 0.3783 0.4283 0.0091  0.0012  -0.0353 237 TRP A CZ3 
1709 C CH2 . TRP A 226 ? 0.3758 0.3845 0.4386 0.0159  0.0128  -0.0330 237 TRP A CH2 
1710 N N   . TRP A 227 ? 0.4894 0.5702 0.5320 0.0339  -0.0151 -0.0111 238 TRP A N   
1711 C CA  . TRP A 227 ? 0.4077 0.5095 0.4462 0.0420  -0.0153 0.0011  238 TRP A CA  
1712 C C   . TRP A 227 ? 0.5471 0.6648 0.5991 0.0468  -0.0129 0.0110  238 TRP A C   
1713 O O   . TRP A 227 ? 0.6555 0.7595 0.7182 0.0509  -0.0020 0.0113  238 TRP A O   
1714 C CB  . TRP A 227 ? 0.4010 0.4967 0.4383 0.0531  -0.0037 0.0099  238 TRP A CB  
1715 C CG  . TRP A 227 ? 0.5422 0.6559 0.5633 0.0572  -0.0078 0.0174  238 TRP A CG  
1716 C CD1 . TRP A 227 ? 0.6556 0.7954 0.6673 0.0537  -0.0203 0.0214  238 TRP A CD1 
1717 C CD2 . TRP A 227 ? 0.6587 0.7677 0.6691 0.0639  0.0001  0.0222  238 TRP A CD2 
1718 N NE1 . TRP A 227 ? 0.6499 0.8009 0.6421 0.0571  -0.0218 0.0272  238 TRP A NE1 
1719 C CE2 . TRP A 227 ? 0.5478 0.6796 0.5381 0.0645  -0.0083 0.0281  238 TRP A CE2 
1720 C CE3 . TRP A 227 ? 0.6724 0.7622 0.6885 0.0683  0.0133  0.0230  238 TRP A CE3 
1721 C CZ2 . TRP A 227 ? 0.5506 0.6849 0.5225 0.0706  -0.0026 0.0341  238 TRP A CZ2 
1722 C CZ3 . TRP A 227 ? 0.5486 0.6417 0.5509 0.0749  0.0200  0.0303  238 TRP A CZ3 
1723 C CH2 . TRP A 227 ? 0.6280 0.7423 0.6065 0.0767  0.0127  0.0356  238 TRP A CH2 
1724 N N   . GLN A 228 ? 0.3736 0.5202 0.4248 0.0459  -0.0224 0.0189  239 GLN A N   
1725 C CA  . GLN A 228 ? 0.4729 0.6406 0.5413 0.0523  -0.0191 0.0314  239 GLN A CA  
1726 C C   . GLN A 228 ? 0.4907 0.6610 0.5698 0.0709  -0.0044 0.0486  239 GLN A C   
1727 O O   . GLN A 228 ? 0.5476 0.7104 0.6192 0.0771  -0.0001 0.0532  239 GLN A O   
1728 C CB  . GLN A 228 ? 0.4151 0.6189 0.4841 0.0443  -0.0351 0.0375  239 GLN A CB  
1729 C CG  . GLN A 228 ? 0.6383 0.8654 0.7288 0.0467  -0.0328 0.0476  239 GLN A CG  
1730 C CD  . GLN A 228 ? 0.5740 0.8407 0.6688 0.0354  -0.0503 0.0549  239 GLN A CD  
1731 O OE1 . GLN A 228 ? 0.5617 0.8342 0.6390 0.0234  -0.0653 0.0491  239 GLN A OE1 
1732 N NE2 . GLN A 228 ? 0.5608 0.8547 0.6787 0.0383  -0.0477 0.0672  239 GLN A NE2 
1733 N N   . ARG A 229 ? 0.3812 0.5611 0.4787 0.0807  0.0054  0.0591  240 ARG A N   
1734 C CA  . ARG A 229 ? 0.4828 0.6592 0.5938 0.1003  0.0230  0.0762  240 ARG A CA  
1735 C C   . ARG A 229 ? 0.5288 0.7300 0.6381 0.1092  0.0182  0.0954  240 ARG A C   
1736 O O   . ARG A 229 ? 0.4160 0.6009 0.5246 0.1199  0.0299  0.1036  240 ARG A O   
1737 C CB  . ARG A 229 ? 0.7076 0.8984 0.8397 0.1109  0.0335  0.0868  240 ARG A CB  
1738 C CG  . ARG A 229 ? 0.5661 0.7289 0.6961 0.1049  0.0430  0.0693  240 ARG A CG  
1739 C CD  . ARG A 229 ? 0.4357 0.5529 0.5602 0.1098  0.0610  0.0607  240 ARG A CD  
1740 N NE  . ARG A 229 ? 0.4322 0.5442 0.5724 0.1314  0.0811  0.0786  240 ARG A NE  
1741 C CZ  . ARG A 229 ? 0.4543 0.5244 0.5932 0.1376  0.1012  0.0733  240 ARG A CZ  
1742 N NH1 . ARG A 229 ? 0.4568 0.4914 0.5792 0.1220  0.1015  0.0506  240 ARG A NH1 
1743 N NH2 . ARG A 229 ? 0.5621 0.6256 0.7170 0.1587  0.1209  0.0914  240 ARG A NH2 
1744 N N   . ASP A 230 ? 0.5830 0.8248 0.6908 0.1035  0.0007  0.1036  241 ASP A N   
1745 C CA  . ASP A 230 ? 0.6027 0.8738 0.7046 0.1097  -0.0068 0.1224  241 ASP A CA  
1746 C C   . ASP A 230 ? 0.6155 0.8738 0.6868 0.0985  -0.0160 0.1093  241 ASP A C   
1747 O O   . ASP A 230 ? 0.5126 0.7904 0.5721 0.1033  -0.0205 0.1233  241 ASP A O   
1748 C CB  . ASP A 230 ? 0.6545 0.9782 0.7666 0.1055  -0.0237 0.1372  241 ASP A CB  
1749 C CG  . ASP A 230 ? 0.7013 1.0302 0.8043 0.0823  -0.0410 0.1173  241 ASP A CG  
1750 O OD1 . ASP A 230 ? 0.7042 0.9956 0.7954 0.0724  -0.0383 0.0939  241 ASP A OD1 
1751 O OD2 . ASP A 230 ? 0.7581 1.1294 0.8671 0.0733  -0.0578 0.1266  241 ASP A OD2 
1752 N N   . GLY A 231 ? 0.6751 0.9025 0.7332 0.0851  -0.0177 0.0843  242 GLY A N   
1753 C CA  . GLY A 231 ? 0.6022 0.8160 0.6332 0.0763  -0.0233 0.0713  242 GLY A CA  
1754 C C   . GLY A 231 ? 0.4326 0.6694 0.4417 0.0615  -0.0434 0.0649  242 GLY A C   
1755 O O   . GLY A 231 ? 0.4479 0.6742 0.4302 0.0561  -0.0463 0.0549  242 GLY A O   
1756 N N   . ARG A 232 ? 0.4292 0.6961 0.4484 0.0540  -0.0565 0.0698  243 ARG A N   
1757 C CA  . ARG A 232 ? 0.4453 0.7358 0.4443 0.0364  -0.0775 0.0642  243 ARG A CA  
1758 C C   . ARG A 232 ? 0.4403 0.7108 0.4328 0.0169  -0.0860 0.0405  243 ARG A C   
1759 O O   . ARG A 232 ? 0.4550 0.7425 0.4349 -0.0009 -0.1036 0.0346  243 ARG A O   
1760 C CB  . ARG A 232 ? 0.4486 0.7914 0.4655 0.0377  -0.0888 0.0876  243 ARG A CB  
1761 C CG  . ARG A 232 ? 0.4588 0.8253 0.4825 0.0578  -0.0817 0.1152  243 ARG A CG  
1762 C CD  . ARG A 232 ? 0.4644 0.8894 0.5079 0.0589  -0.0952 0.1413  243 ARG A CD  
1763 N NE  . ARG A 232 ? 0.4765 0.9252 0.5287 0.0802  -0.0878 0.1715  243 ARG A NE  
1764 C CZ  . ARG A 232 ? 0.5026 0.9726 0.5284 0.0788  -0.0981 0.1817  243 ARG A CZ  
1765 N NH1 . ARG A 232 ? 0.5219 0.9896 0.5080 0.0565  -0.1153 0.1611  243 ARG A NH1 
1766 N NH2 . ARG A 232 ? 0.5140 1.0056 0.5511 0.1000  -0.0900 0.2128  243 ARG A NH2 
1767 N N   . LEU A 233 ? 0.5238 0.7589 0.5243 0.0188  -0.0746 0.0278  244 LEU A N   
1768 C CA  . LEU A 233 ? 0.4209 0.6347 0.4160 0.0024  -0.0811 0.0081  244 LEU A CA  
1769 C C   . LEU A 233 ? 0.7181 0.8921 0.7140 0.0078  -0.0676 -0.0037 244 LEU A C   
1770 O O   . LEU A 233 ? 0.8154 0.9820 0.8276 0.0201  -0.0546 0.0032  244 LEU A O   
1771 C CB  . LEU A 233 ? 0.4070 0.6399 0.4253 -0.0054 -0.0872 0.0131  244 LEU A CB  
1772 C CG  . LEU A 233 ? 0.4056 0.6174 0.4214 -0.0223 -0.0934 -0.0035 244 LEU A CG  
1773 C CD1 . LEU A 233 ? 0.4293 0.6513 0.4281 -0.0431 -0.1115 -0.0113 244 LEU A CD1 
1774 C CD2 . LEU A 233 ? 0.3858 0.6055 0.4276 -0.0219 -0.0889 0.0030  244 LEU A CD2 
1775 N N   . LEU A 234 ? 0.5599 0.7084 0.5387 -0.0019 -0.0706 -0.0211 245 LEU A N   
1776 C CA  . LEU A 234 ? 0.4781 0.5940 0.4606 0.0016  -0.0603 -0.0308 245 LEU A CA  
1777 C C   . LEU A 234 ? 0.4158 0.5182 0.4045 -0.0109 -0.0666 -0.0406 245 LEU A C   
1778 O O   . LEU A 234 ? 0.4222 0.5265 0.4006 -0.0247 -0.0779 -0.0475 245 LEU A O   
1779 C CB  . LEU A 234 ? 0.4320 0.5284 0.3928 0.0051  -0.0545 -0.0397 245 LEU A CB  
1780 C CG  . LEU A 234 ? 0.4378 0.5426 0.3929 0.0189  -0.0446 -0.0287 245 LEU A CG  
1781 C CD1 . LEU A 234 ? 0.4767 0.5651 0.4058 0.0206  -0.0388 -0.0385 245 LEU A CD1 
1782 C CD2 . LEU A 234 ? 0.4163 0.5141 0.3955 0.0298  -0.0317 -0.0199 245 LEU A CD2 
1783 N N   . VAL A 235 ? 0.3896 0.4782 0.3941 -0.0076 -0.0597 -0.0407 246 VAL A N   
1784 C CA  . VAL A 235 ? 0.3853 0.4613 0.3965 -0.0177 -0.0644 -0.0467 246 VAL A CA  
1785 C C   . VAL A 235 ? 0.4817 0.5319 0.4944 -0.0134 -0.0574 -0.0526 246 VAL A C   
1786 O O   . VAL A 235 ? 0.6904 0.7382 0.7145 -0.0063 -0.0498 -0.0483 246 VAL A O   
1787 C CB  . VAL A 235 ? 0.3681 0.4576 0.3964 -0.0190 -0.0639 -0.0388 246 VAL A CB  
1788 C CG1 . VAL A 235 ? 0.3827 0.4608 0.4154 -0.0300 -0.0691 -0.0428 246 VAL A CG1 
1789 C CG2 . VAL A 235 ? 0.6163 0.7366 0.6491 -0.0200 -0.0686 -0.0293 246 VAL A CG2 
1790 N N   . SER A 236 ? 0.5303 0.5613 0.5327 -0.0180 -0.0593 -0.0620 247 SER A N   
1791 C CA  . SER A 236 ? 0.6490 0.6584 0.6564 -0.0121 -0.0519 -0.0652 247 SER A CA  
1792 C C   . SER A 236 ? 0.5804 0.5776 0.5982 -0.0196 -0.0567 -0.0656 247 SER A C   
1793 O O   . SER A 236 ? 0.6633 0.6565 0.6753 -0.0307 -0.0645 -0.0693 247 SER A O   
1794 C CB  . SER A 236 ? 0.6968 0.6898 0.6852 -0.0078 -0.0460 -0.0745 247 SER A CB  
1795 O OG  . SER A 236 ? 0.4578 0.4385 0.4291 -0.0192 -0.0532 -0.0849 247 SER A OG  
1796 N N   . CYS A 237 ? 0.5646 0.5576 0.5985 -0.0148 -0.0529 -0.0602 248 CYS A N   
1797 C CA  . CYS A 237 ? 0.4509 0.4336 0.4958 -0.0195 -0.0568 -0.0569 248 CYS A CA  
1798 C C   . CYS A 237 ? 0.4602 0.4237 0.5111 -0.0107 -0.0492 -0.0578 248 CYS A C   
1799 O O   . CYS A 237 ? 0.5462 0.5111 0.5998 -0.0005 -0.0403 -0.0576 248 CYS A O   
1800 C CB  . CYS A 237 ? 0.3752 0.3722 0.4336 -0.0220 -0.0599 -0.0478 248 CYS A CB  
1801 S SG  . CYS A 237 ? 0.4054 0.4118 0.4738 -0.0137 -0.0529 -0.0440 248 CYS A SG  
1802 N N   . HIS A 238 ? 0.6438 0.5894 0.6988 -0.0138 -0.0510 -0.0572 249 HIS A N   
1803 C CA  . HIS A 238 ? 0.6712 0.5935 0.7303 -0.0038 -0.0411 -0.0590 249 HIS A CA  
1804 C C   . HIS A 238 ? 0.5164 0.4358 0.5992 -0.0013 -0.0427 -0.0454 249 HIS A C   
1805 O O   . HIS A 238 ? 0.4478 0.3802 0.5382 -0.0099 -0.0528 -0.0363 249 HIS A O   
1806 C CB  . HIS A 238 ? 0.6822 0.5764 0.7186 -0.0084 -0.0385 -0.0737 249 HIS A CB  
1807 C CG  . HIS A 238 ? 0.7358 0.6373 0.7470 -0.0123 -0.0394 -0.0851 249 HIS A CG  
1808 N ND1 . HIS A 238 ? 0.7667 0.6660 0.7659 -0.0014 -0.0284 -0.0909 249 HIS A ND1 
1809 C CD2 . HIS A 238 ? 0.6782 0.5935 0.6759 -0.0253 -0.0501 -0.0890 249 HIS A CD2 
1810 C CE1 . HIS A 238 ? 0.7380 0.6486 0.7148 -0.0078 -0.0332 -0.0978 249 HIS A CE1 
1811 N NE2 . HIS A 238 ? 0.6720 0.5937 0.6492 -0.0222 -0.0469 -0.0964 249 HIS A NE2 
1812 N N   . SER A 239 ? 0.4643 0.3676 0.5587 0.0118  -0.0316 -0.0425 250 SER A N   
1813 C CA  . SER A 239 ? 0.5096 0.4160 0.6319 0.0178  -0.0323 -0.0250 250 SER A CA  
1814 C C   . SER A 239 ? 0.5416 0.4288 0.6649 0.0106  -0.0376 -0.0204 250 SER A C   
1815 O O   . SER A 239 ? 0.5509 0.4467 0.6959 0.0126  -0.0421 -0.0023 250 SER A O   
1816 C CB  . SER A 239 ? 0.4800 0.3764 0.6186 0.0365  -0.0164 -0.0210 250 SER A CB  
1817 O OG  . SER A 239 ? 0.4615 0.3809 0.6064 0.0425  -0.0117 -0.0199 250 SER A OG  
1818 N N   . ASP A 240 ? 0.5712 0.4341 0.6719 0.0011  -0.0378 -0.0347 251 ASP A N   
1819 C CA  . ASP A 240 ? 0.5235 0.3653 0.6251 -0.0082 -0.0421 -0.0306 251 ASP A CA  
1820 C C   . ASP A 240 ? 0.5010 0.3672 0.6012 -0.0243 -0.0569 -0.0234 251 ASP A C   
1821 O O   . ASP A 240 ? 0.5172 0.3694 0.6170 -0.0349 -0.0610 -0.0194 251 ASP A O   
1822 C CB  . ASP A 240 ? 0.6842 0.4870 0.7621 -0.0144 -0.0358 -0.0502 251 ASP A CB  
1823 C CG  . ASP A 240 ? 0.9990 0.8146 1.0512 -0.0283 -0.0434 -0.0662 251 ASP A CG  
1824 O OD1 . ASP A 240 ? 1.0831 0.9313 1.1349 -0.0258 -0.0471 -0.0647 251 ASP A OD1 
1825 O OD2 . ASP A 240 ? 1.2579 1.0511 1.2913 -0.0422 -0.0459 -0.0792 251 ASP A OD2 
1826 N N   . GLY A 241 ? 0.4680 0.3681 0.5674 -0.0263 -0.0631 -0.0215 252 GLY A N   
1827 C CA  . GLY A 241 ? 0.5027 0.4250 0.5985 -0.0396 -0.0736 -0.0160 252 GLY A CA  
1828 C C   . GLY A 241 ? 0.6750 0.6003 0.7530 -0.0513 -0.0769 -0.0284 252 GLY A C   
1829 O O   . GLY A 241 ? 0.6935 0.6338 0.7702 -0.0626 -0.0835 -0.0231 252 GLY A O   
1830 N N   . SER A 242 ? 0.5841 0.4985 0.6485 -0.0491 -0.0724 -0.0435 253 SER A N   
1831 C CA  . SER A 242 ? 0.5734 0.4949 0.6219 -0.0607 -0.0773 -0.0537 253 SER A CA  
1832 C C   . SER A 242 ? 0.5347 0.4794 0.5762 -0.0541 -0.0758 -0.0582 253 SER A C   
1833 O O   . SER A 242 ? 0.5027 0.4488 0.5476 -0.0412 -0.0690 -0.0578 253 SER A O   
1834 C CB  . SER A 242 ? 0.6423 0.5318 0.6756 -0.0671 -0.0753 -0.0677 253 SER A CB  
1835 O OG  . SER A 242 ? 0.5706 0.4441 0.5939 -0.0541 -0.0652 -0.0778 253 SER A OG  
1836 N N   . TYR A 243 ? 0.5006 0.4651 0.5349 -0.0629 -0.0817 -0.0602 254 TYR A N   
1837 C CA  . TYR A 243 ? 0.5607 0.5449 0.5873 -0.0568 -0.0800 -0.0634 254 TYR A CA  
1838 C C   . TYR A 243 ? 0.6278 0.6199 0.6409 -0.0683 -0.0872 -0.0699 254 TYR A C   
1839 O O   . TYR A 243 ? 0.7058 0.7015 0.7218 -0.0829 -0.0949 -0.0681 254 TYR A O   
1840 C CB  . TYR A 243 ? 0.5739 0.5843 0.6111 -0.0524 -0.0789 -0.0537 254 TYR A CB  
1841 C CG  . TYR A 243 ? 0.7091 0.7408 0.7515 -0.0624 -0.0845 -0.0470 254 TYR A CG  
1842 C CD1 . TYR A 243 ? 0.7370 0.7920 0.7772 -0.0643 -0.0869 -0.0459 254 TYR A CD1 
1843 C CD2 . TYR A 243 ? 0.7766 0.8082 0.8274 -0.0690 -0.0865 -0.0395 254 TYR A CD2 
1844 C CE1 . TYR A 243 ? 0.7513 0.8297 0.8007 -0.0720 -0.0901 -0.0377 254 TYR A CE1 
1845 C CE2 . TYR A 243 ? 0.8785 0.9313 0.9348 -0.0774 -0.0890 -0.0323 254 TYR A CE2 
1846 C CZ  . TYR A 243 ? 0.7620 0.8385 0.8191 -0.0785 -0.0902 -0.0315 254 TYR A CZ  
1847 O OH  . TYR A 243 ? 0.5693 0.6706 0.6362 -0.0854 -0.0910 -0.0222 254 TYR A OH  
1848 N N   . CYS A 244 ? 0.6118 0.6088 0.6104 -0.0627 -0.0852 -0.0760 255 CYS A N   
1849 C CA  . CYS A 244 ? 0.6853 0.6949 0.6688 -0.0741 -0.0941 -0.0813 255 CYS A CA  
1850 C C   . CYS A 244 ? 0.6384 0.6777 0.6197 -0.0645 -0.0929 -0.0747 255 CYS A C   
1851 O O   . CYS A 244 ? 0.4331 0.4735 0.4196 -0.0490 -0.0832 -0.0703 255 CYS A O   
1852 C CB  . CYS A 244 ? 0.7584 0.7365 0.7166 -0.0805 -0.0938 -0.0980 255 CYS A CB  
1853 S SG  . CYS A 244 ? 1.0060 0.9625 0.9498 -0.0608 -0.0781 -0.1055 255 CYS A SG  
1854 N N   . GLN A 245 ? 0.5823 0.6471 0.5577 -0.0745 -0.1033 -0.0725 256 GLN A N   
1855 C CA  . GLN A 245 ? 0.4480 0.5454 0.4240 -0.0656 -0.1035 -0.0622 256 GLN A CA  
1856 C C   . GLN A 245 ? 0.4920 0.5891 0.4389 -0.0691 -0.1082 -0.0705 256 GLN A C   
1857 O O   . GLN A 245 ? 0.5096 0.5956 0.4379 -0.0864 -0.1178 -0.0828 256 GLN A O   
1858 C CB  . GLN A 245 ? 0.4346 0.5704 0.4302 -0.0723 -0.1117 -0.0483 256 GLN A CB  
1859 C CG  . GLN A 245 ? 0.6350 0.7714 0.6542 -0.0702 -0.1061 -0.0409 256 GLN A CG  
1860 C CD  . GLN A 245 ? 0.6654 0.8380 0.7038 -0.0791 -0.1130 -0.0282 256 GLN A CD  
1861 O OE1 . GLN A 245 ? 0.7958 0.9923 0.8321 -0.0914 -0.1254 -0.0257 256 GLN A OE1 
1862 N NE2 . GLN A 245 ? 0.6744 0.8534 0.7313 -0.0735 -0.1049 -0.0197 256 GLN A NE2 
1863 N N   . TRP A 246 ? 0.4869 0.5947 0.4280 -0.0538 -0.1010 -0.0640 257 TRP A N   
1864 C CA  . TRP A 246 ? 0.5165 0.6258 0.4264 -0.0548 -0.1035 -0.0700 257 TRP A CA  
1865 C C   . TRP A 246 ? 0.6444 0.7964 0.5591 -0.0478 -0.1078 -0.0513 257 TRP A C   
1866 O O   . TRP A 246 ? 0.7110 0.8738 0.6473 -0.0311 -0.0977 -0.0366 257 TRP A O   
1867 C CB  . TRP A 246 ? 0.5895 0.6677 0.4852 -0.0408 -0.0874 -0.0783 257 TRP A CB  
1868 C CG  . TRP A 246 ? 0.6084 0.6470 0.5053 -0.0430 -0.0806 -0.0924 257 TRP A CG  
1869 C CD1 . TRP A 246 ? 0.5803 0.6078 0.5043 -0.0376 -0.0746 -0.0882 257 TRP A CD1 
1870 C CD2 . TRP A 246 ? 0.6985 0.7028 0.5677 -0.0503 -0.0781 -0.1117 257 TRP A CD2 
1871 N NE1 . TRP A 246 ? 0.6361 0.6282 0.5550 -0.0399 -0.0694 -0.1006 257 TRP A NE1 
1872 C CE2 . TRP A 246 ? 0.8199 0.7946 0.7060 -0.0468 -0.0700 -0.1157 257 TRP A CE2 
1873 C CE3 . TRP A 246 ? 0.7220 0.7167 0.5518 -0.0596 -0.0815 -0.1262 257 TRP A CE3 
1874 C CZ2 . TRP A 246 ? 0.8328 0.7670 0.7017 -0.0497 -0.0631 -0.1324 257 TRP A CZ2 
1875 C CZ3 . TRP A 246 ? 0.7212 0.6722 0.5293 -0.0642 -0.0741 -0.1463 257 TRP A CZ3 
1876 C CH2 . TRP A 246 ? 0.7358 0.6560 0.5654 -0.0581 -0.0640 -0.1486 257 TRP A CH2 
1877 N N   . PRO A 247 ? 0.7889 0.9654 0.6840 -0.0604 -0.1227 -0.0506 258 PRO A N   
1878 C CA  . PRO A 247 ? 0.6569 0.8770 0.5568 -0.0516 -0.1268 -0.0292 258 PRO A CA  
1879 C C   . PRO A 247 ? 0.7101 0.9224 0.5871 -0.0364 -0.1157 -0.0271 258 PRO A C   
1880 O O   . PRO A 247 ? 0.8340 1.0178 0.6781 -0.0403 -0.1119 -0.0448 258 PRO A O   
1881 C CB  . PRO A 247 ? 0.5497 0.8003 0.4351 -0.0746 -0.1496 -0.0300 258 PRO A CB  
1882 C CG  . PRO A 247 ? 0.6300 0.8394 0.4829 -0.0931 -0.1531 -0.0582 258 PRO A CG  
1883 C CD  . PRO A 247 ? 0.9515 1.1188 0.8214 -0.0852 -0.1376 -0.0679 258 PRO A CD  
1884 N N   . VAL A 248 ? 0.5840 0.8205 0.4793 -0.0182 -0.1083 -0.0044 259 VAL A N   
1885 C CA  . VAL A 248 ? 0.5302 0.7642 0.4089 -0.0027 -0.0967 0.0033  259 VAL A CA  
1886 C C   . VAL A 248 ? 0.7065 0.9880 0.5798 -0.0008 -0.1082 0.0257  259 VAL A C   
1887 O O   . VAL A 248 ? 0.7060 1.0181 0.6116 0.0087  -0.1087 0.0484  259 VAL A O   
1888 C CB  . VAL A 248 ? 0.5839 0.7999 0.4894 0.0176  -0.0760 0.0124  259 VAL A CB  
1889 C CG1 . VAL A 248 ? 0.5718 0.7898 0.4636 0.0326  -0.0642 0.0248  259 VAL A CG1 
1890 C CG2 . VAL A 248 ? 0.7662 0.9408 0.6759 0.0148  -0.0670 -0.0075 259 VAL A CG2 
1891 N N   . SER A 249 ? 0.6858 0.9743 0.5177 -0.0093 -0.1165 0.0201  260 SER A N   
1892 C CA  . SER A 249 ? 0.7966 1.1341 0.6183 -0.0097 -0.1303 0.0422  260 SER A CA  
1893 C C   . SER A 249 ? 0.8096 1.1403 0.5833 -0.0081 -0.1266 0.0378  260 SER A C   
1894 O O   . SER A 249 ? 0.8636 1.1591 0.6012 -0.0188 -0.1237 0.0105  260 SER A O   
1895 C CB  . SER A 249 ? 0.8278 1.1990 0.6466 -0.0342 -0.1568 0.0398  260 SER A CB  
1896 O OG  . SER A 249 ? 0.9304 1.3534 0.7363 -0.0366 -0.1728 0.0617  260 SER A OG  
1897 N N   . SER A 250 ? 0.8367 1.2005 0.6101 0.0065  -0.1249 0.0660  261 SER A N   
1898 C CA  . SER A 250 ? 0.7601 1.1249 0.4857 0.0082  -0.1219 0.0665  261 SER A CA  
1899 C C   . SER A 250 ? 0.8507 1.2347 0.5271 -0.0177 -0.1459 0.0523  261 SER A C   
1900 O O   . SER A 250 ? 0.9665 1.3423 0.5920 -0.0207 -0.1429 0.0435  261 SER A O   
1901 C CB  . SER A 250 ? 0.9020 1.3004 0.6423 0.0302  -0.1150 0.1046  261 SER A CB  
1902 O OG  . SER A 250 ? 1.1346 1.5845 0.9050 0.0304  -0.1320 0.1311  261 SER A OG  
1903 N N   . GLU A 251 ? 0.9755 1.3846 0.6645 -0.0378 -0.1689 0.0495  262 GLU A N   
1904 C CA  . GLU A 251 ? 1.1935 1.6184 0.8358 -0.0675 -0.1938 0.0332  262 GLU A CA  
1905 C C   . GLU A 251 ? 1.3113 1.6781 0.9199 -0.0860 -0.1896 -0.0098 262 GLU A C   
1906 O O   . GLU A 251 ? 1.4222 1.7801 0.9738 -0.1062 -0.1996 -0.0309 262 GLU A O   
1907 C CB  . GLU A 251 ? 1.2464 1.7255 0.9197 -0.0835 -0.2207 0.0498  262 GLU A CB  
1908 C CG  . GLU A 251 ? 1.2531 1.7912 0.9680 -0.0627 -0.2234 0.0951  262 GLU A CG  
1909 C CD  . GLU A 251 ? 1.3644 1.9433 1.0440 -0.0620 -0.2345 0.1157  262 GLU A CD  
1910 O OE1 . GLU A 251 ? 1.4495 2.0084 1.0736 -0.0812 -0.2414 0.0918  262 GLU A OE1 
1911 O OE2 . GLU A 251 ? 1.3359 1.9528 1.0491 -0.0403 -0.2306 0.1539  262 GLU A OE2 
1912 N N   . ALA A 252 ? 1.3408 1.6669 0.9824 -0.0795 -0.1746 -0.0228 263 ALA A N   
1913 C CA  . ALA A 252 ? 1.4500 1.7184 1.0685 -0.0929 -0.1676 -0.0597 263 ALA A CA  
1914 C C   . ALA A 252 ? 1.2807 1.5056 0.9164 -0.0680 -0.1376 -0.0639 263 ALA A C   
1915 O O   . ALA A 252 ? 1.1591 1.3687 0.8384 -0.0606 -0.1299 -0.0624 263 ALA A O   
1916 C CB  . ALA A 252 ? 1.5232 1.7903 1.1679 -0.1141 -0.1832 -0.0694 263 ALA A CB  
1917 N N   . GLN A 253 ? 1.2416 1.4491 0.8423 -0.0560 -0.1210 -0.0681 264 GLN A N   
1918 C CA  . GLN A 253 ? 1.1351 1.3083 0.7532 -0.0330 -0.0929 -0.0689 264 GLN A CA  
1919 C C   . GLN A 253 ? 1.1926 1.3114 0.8059 -0.0378 -0.0812 -0.0987 264 GLN A C   
1920 O O   . GLN A 253 ? 1.2086 1.3018 0.8438 -0.0201 -0.0596 -0.0984 264 GLN A O   
1921 C CB  . GLN A 253 ? 1.1864 1.3627 0.7707 -0.0184 -0.0775 -0.0608 264 GLN A CB  
1922 C CG  . GLN A 253 ? 1.1398 1.3678 0.7314 -0.0092 -0.0852 -0.0265 264 GLN A CG  
1923 C CD  . GLN A 253 ? 1.3569 1.6176 0.8980 -0.0268 -0.1067 -0.0262 264 GLN A CD  
1924 O OE1 . GLN A 253 ? 1.3791 1.6236 0.8805 -0.0497 -0.1185 -0.0539 264 GLN A OE1 
1925 N NE2 . GLN A 253 ? 1.5099 1.8164 1.0517 -0.0171 -0.1120 0.0057  264 GLN A NE2 
1926 N N   . GLN A 254 ? 1.1472 1.2480 0.7342 -0.0614 -0.0946 -0.1228 265 GLN A N   
1927 C CA  . GLN A 254 ? 1.2224 1.2685 0.8044 -0.0656 -0.0829 -0.1501 265 GLN A CA  
1928 C C   . GLN A 254 ? 1.0929 1.1359 0.6894 -0.0893 -0.1028 -0.1597 265 GLN A C   
1929 O O   . GLN A 254 ? 1.1099 1.1418 0.6680 -0.1138 -0.1165 -0.1799 265 GLN A O   
1930 C CB  . GLN A 254 ? 1.3279 1.3377 0.8481 -0.0695 -0.0706 -0.1760 265 GLN A CB  
1931 C CG  . GLN A 254 ? 1.4540 1.4634 0.9609 -0.0451 -0.0466 -0.1668 265 GLN A CG  
1932 C CD  . GLN A 254 ? 1.5751 1.5590 1.0121 -0.0505 -0.0366 -0.1901 265 GLN A CD  
1933 O OE1 . GLN A 254 ? 1.6705 1.6836 1.0685 -0.0546 -0.0441 -0.1831 265 GLN A OE1 
1934 N NE2 . GLN A 254 ? 1.5425 1.4713 0.9622 -0.0496 -0.0184 -0.2173 265 GLN A NE2 
1935 N N   . PRO A 255 ? 1.0906 1.1429 0.7410 -0.0840 -0.1048 -0.1457 266 PRO A N   
1936 C CA  . PRO A 255 ? 1.1856 1.2408 0.8536 -0.1061 -0.1231 -0.1505 266 PRO A CA  
1937 C C   . PRO A 255 ? 1.3068 1.3113 0.9867 -0.1085 -0.1127 -0.1681 266 PRO A C   
1938 O O   . PRO A 255 ? 1.3567 1.3260 1.0362 -0.0911 -0.0911 -0.1750 266 PRO A O   
1939 C CB  . PRO A 255 ? 1.1082 1.2098 0.8265 -0.0968 -0.1300 -0.1211 266 PRO A CB  
1940 C CG  . PRO A 255 ? 0.9363 1.0287 0.6751 -0.0683 -0.1076 -0.1098 266 PRO A CG  
1941 C CD  . PRO A 255 ? 0.9436 1.0142 0.6395 -0.0601 -0.0934 -0.1213 266 PRO A CD  
1942 N N   . GLU A 256 ? 1.3904 1.3936 1.0836 -0.1298 -0.1279 -0.1727 267 GLU A N   
1943 C CA  . GLU A 256 ? 1.3893 1.3524 1.1032 -0.1329 -0.1210 -0.1821 267 GLU A CA  
1944 C C   . GLU A 256 ? 1.3564 1.3501 1.1227 -0.1302 -0.1278 -0.1600 267 GLU A C   
1945 O O   . GLU A 256 ? 1.3967 1.4400 1.1793 -0.1314 -0.1400 -0.1413 267 GLU A O   
1946 C CB  . GLU A 256 ? 1.3678 1.2979 1.0511 -0.1623 -0.1314 -0.2067 267 GLU A CB  
1947 C CG  . GLU A 256 ? 1.4089 1.3741 1.1066 -0.1897 -0.1571 -0.1995 267 GLU A CG  
1948 C CD  . GLU A 256 ? 1.5719 1.5841 1.2440 -0.2038 -0.1768 -0.1950 267 GLU A CD  
1949 O OE1 . GLU A 256 ? 1.6449 1.6648 1.2890 -0.1900 -0.1700 -0.1948 267 GLU A OE1 
1950 O OE2 . GLU A 256 ? 1.6390 1.6832 1.3202 -0.2291 -0.1993 -0.1898 267 GLU A OE2 
1951 N N   . PRO A 257 ? 1.1377 1.1040 0.9309 -0.1253 -0.1188 -0.1601 268 PRO A N   
1952 C CA  . PRO A 257 ? 1.0157 1.0101 0.8541 -0.1200 -0.1219 -0.1393 268 PRO A CA  
1953 C C   . PRO A 257 ? 1.0357 1.0664 0.8866 -0.1417 -0.1422 -0.1309 268 PRO A C   
1954 O O   . PRO A 257 ? 1.0577 1.0805 0.8887 -0.1663 -0.1550 -0.1437 268 PRO A O   
1955 C CB  . PRO A 257 ? 0.9426 0.8963 0.7978 -0.1159 -0.1108 -0.1440 268 PRO A CB  
1956 C CG  . PRO A 257 ? 1.0442 0.9500 0.8660 -0.1270 -0.1071 -0.1678 268 PRO A CG  
1957 C CD  . PRO A 257 ? 1.1297 1.0389 0.9134 -0.1229 -0.1043 -0.1776 268 PRO A CD  
1958 N N   . LEU A 258 ? 0.9699 1.0409 0.8548 -0.1326 -0.1440 -0.1090 269 LEU A N   
1959 C CA  . LEU A 258 ? 0.9191 1.0332 0.8239 -0.1484 -0.1602 -0.0957 269 LEU A CA  
1960 C C   . LEU A 258 ? 0.9968 1.1015 0.9277 -0.1595 -0.1615 -0.0929 269 LEU A C   
1961 O O   . LEU A 258 ? 1.0216 1.1452 0.9597 -0.1825 -0.1761 -0.0906 269 LEU A O   
1962 C CB  . LEU A 258 ? 0.7502 0.9120 0.6784 -0.1303 -0.1582 -0.0723 269 LEU A CB  
1963 C CG  . LEU A 258 ? 0.8558 1.0738 0.8079 -0.1397 -0.1724 -0.0529 269 LEU A CG  
1964 C CD1 . LEU A 258 ? 0.7833 1.0396 0.7404 -0.1208 -0.1702 -0.0346 269 LEU A CD1 
1965 C CD2 . LEU A 258 ? 0.9526 1.1809 0.9419 -0.1390 -0.1681 -0.0409 269 LEU A CD2 
1966 N N   . ARG A 259 ? 1.0605 1.1390 1.0058 -0.1449 -0.1471 -0.0915 270 ARG A N   
1967 C CA  . ARG A 259 ? 1.0933 1.1650 1.0627 -0.1529 -0.1468 -0.0855 270 ARG A CA  
1968 C C   . ARG A 259 ? 1.1071 1.1433 1.0821 -0.1365 -0.1316 -0.0873 270 ARG A C   
1969 O O   . ARG A 259 ? 1.2560 1.3009 1.2397 -0.1163 -0.1219 -0.0796 270 ARG A O   
1970 C CB  . ARG A 259 ? 1.2338 1.3547 1.2339 -0.1510 -0.1499 -0.0643 270 ARG A CB  
1971 C CG  . ARG A 259 ? 1.3258 1.4462 1.3490 -0.1612 -0.1498 -0.0560 270 ARG A CG  
1972 C CD  . ARG A 259 ? 1.3075 1.4754 1.3590 -0.1541 -0.1478 -0.0354 270 ARG A CD  
1973 N NE  . ARG A 259 ? 1.3307 1.5425 1.3855 -0.1548 -0.1564 -0.0272 270 ARG A NE  
1974 C CZ  . ARG A 259 ? 1.3749 1.6189 1.4385 -0.1760 -0.1716 -0.0214 270 ARG A CZ  
1975 N NH1 . ARG A 259 ? 1.4160 1.6495 1.4854 -0.1995 -0.1789 -0.0244 270 ARG A NH1 
1976 N NH2 . ARG A 259 ? 1.3264 1.6148 1.3947 -0.1743 -0.1799 -0.0108 270 ARG A NH2 
1977 N N   . SER A 260 ? 0.9946 0.9913 0.9661 -0.1457 -0.1297 -0.0961 271 SER A N   
1978 C CA  . SER A 260 ? 0.8344 0.7992 0.8126 -0.1307 -0.1168 -0.0957 271 SER A CA  
1979 C C   . SER A 260 ? 0.8095 0.7672 0.8082 -0.1397 -0.1180 -0.0857 271 SER A C   
1980 O O   . SER A 260 ? 1.0192 0.9740 1.0191 -0.1610 -0.1266 -0.0869 271 SER A O   
1981 C CB  . SER A 260 ? 0.8715 0.7898 0.8260 -0.1275 -0.1089 -0.1136 271 SER A CB  
1982 O OG  . SER A 260 ? 0.9951 0.8888 0.9616 -0.1112 -0.0963 -0.1094 271 SER A OG  
1983 N N   . LEU A 261 ? 0.6906 0.6466 0.7048 -0.1251 -0.1098 -0.0749 272 LEU A N   
1984 C CA  . LEU A 261 ? 0.7058 0.6566 0.7374 -0.1315 -0.1100 -0.0628 272 LEU A CA  
1985 C C   . LEU A 261 ? 0.7124 0.6538 0.7532 -0.1137 -0.1012 -0.0546 272 LEU A C   
1986 O O   . LEU A 261 ? 0.6165 0.5678 0.6558 -0.0981 -0.0961 -0.0554 272 LEU A O   
1987 C CB  . LEU A 261 ? 0.6197 0.6113 0.6660 -0.1406 -0.1160 -0.0493 272 LEU A CB  
1988 C CG  . LEU A 261 ? 0.5677 0.5898 0.6225 -0.1247 -0.1104 -0.0390 272 LEU A CG  
1989 C CD1 . LEU A 261 ? 0.4377 0.4858 0.5079 -0.1318 -0.1108 -0.0238 272 LEU A CD1 
1990 C CD2 . LEU A 261 ? 0.5710 0.6171 0.6195 -0.1167 -0.1107 -0.0434 272 LEU A CD2 
1991 N N   . VAL A 262 ? 0.6699 0.5936 0.7215 -0.1175 -0.1002 -0.0452 273 VAL A N   
1992 C CA  . VAL A 262 ? 0.6084 0.5332 0.6719 -0.1047 -0.0955 -0.0320 273 VAL A CA  
1993 C C   . VAL A 262 ? 0.7133 0.6675 0.7860 -0.1118 -0.0993 -0.0169 273 VAL A C   
1994 O O   . VAL A 262 ? 0.8986 0.8488 0.9770 -0.1260 -0.1025 -0.0095 273 VAL A O   
1995 C CB  . VAL A 262 ? 0.5156 0.4021 0.5853 -0.1013 -0.0907 -0.0282 273 VAL A CB  
1996 C CG1 . VAL A 262 ? 0.5500 0.4451 0.6333 -0.0875 -0.0881 -0.0124 273 VAL A CG1 
1997 C CG2 . VAL A 262 ? 0.5422 0.3956 0.5996 -0.0952 -0.0839 -0.0455 273 VAL A CG2 
1998 N N   . PRO A 263 ? 0.6416 0.6233 0.7148 -0.1032 -0.0978 -0.0122 274 PRO A N   
1999 C CA  . PRO A 263 ? 0.6536 0.6641 0.7301 -0.1098 -0.0987 -0.0015 274 PRO A CA  
2000 C C   . PRO A 263 ? 0.7055 0.7128 0.7882 -0.1157 -0.0995 0.0147  274 PRO A C   
2001 O O   . PRO A 263 ? 0.7135 0.7427 0.7976 -0.1231 -0.0988 0.0241  274 PRO A O   
2002 C CB  . PRO A 263 ? 0.6032 0.6329 0.6745 -0.0974 -0.0943 -0.0037 274 PRO A CB  
2003 C CG  . PRO A 263 ? 0.5414 0.5584 0.6086 -0.0872 -0.0926 -0.0158 274 PRO A CG  
2004 C CD  . PRO A 263 ? 0.6021 0.5883 0.6715 -0.0880 -0.0936 -0.0179 274 PRO A CD  
2005 N N   . TYR A 264 ? 0.7023 0.6848 0.7896 -0.1118 -0.0997 0.0204  275 TYR A N   
2006 C CA  . TYR A 264 ? 0.8163 0.7989 0.9092 -0.1152 -0.1008 0.0396  275 TYR A CA  
2007 C C   . TYR A 264 ? 0.8085 0.7563 0.9113 -0.1193 -0.1006 0.0457  275 TYR A C   
2008 O O   . TYR A 264 ? 0.5270 0.4526 0.6353 -0.1081 -0.0984 0.0467  275 TYR A O   
2009 C CB  . TYR A 264 ? 0.7190 0.7132 0.8098 -0.1039 -0.1015 0.0467  275 TYR A CB  
2010 C CG  . TYR A 264 ? 0.6361 0.6596 0.7145 -0.1031 -0.1002 0.0423  275 TYR A CG  
2011 C CD1 . TYR A 264 ? 0.5804 0.6241 0.6521 -0.1118 -0.0983 0.0499  275 TYR A CD1 
2012 C CD2 . TYR A 264 ? 0.6288 0.6576 0.7022 -0.0935 -0.0987 0.0307  275 TYR A CD2 
2013 C CE1 . TYR A 264 ? 0.5250 0.5903 0.5837 -0.1096 -0.0939 0.0445  275 TYR A CE1 
2014 C CE2 . TYR A 264 ? 0.5627 0.6117 0.6240 -0.0929 -0.0954 0.0256  275 TYR A CE2 
2015 C CZ  . TYR A 264 ? 0.5552 0.6208 0.6083 -0.1003 -0.0924 0.0317  275 TYR A CZ  
2016 O OH  . TYR A 264 ? 0.6786 0.7593 0.7178 -0.0982 -0.0860 0.0254  275 TYR A OH  
2017 N N   . GLY A 265 ? 0.9437 0.8863 1.0504 -0.1352 -0.1016 0.0508  276 GLY A N   
2018 C CA  . GLY A 265 ? 0.9099 0.8175 1.0264 -0.1415 -0.1002 0.0599  276 GLY A CA  
2019 C C   . GLY A 265 ? 0.8561 0.7221 0.9709 -0.1390 -0.0969 0.0428  276 GLY A C   
2020 O O   . GLY A 265 ? 0.8315 0.6967 0.9374 -0.1291 -0.0955 0.0256  276 GLY A O   
2021 N N   . PRO A 266 ? 0.6112 0.4392 0.7326 -0.1484 -0.0941 0.0469  277 PRO A N   
2022 C CA  . PRO A 266 ? 0.6455 0.4251 0.7619 -0.1454 -0.0878 0.0297  277 PRO A CA  
2023 C C   . PRO A 266 ? 0.8269 0.5811 0.9529 -0.1231 -0.0788 0.0383  277 PRO A C   
2024 O O   . PRO A 266 ? 1.1072 0.8206 1.2282 -0.1164 -0.0701 0.0234  277 PRO A O   
2025 C CB  . PRO A 266 ? 0.8517 0.5993 0.9715 -0.1681 -0.0880 0.0310  277 PRO A CB  
2026 C CG  . PRO A 266 ? 1.0055 0.7935 1.1337 -0.1830 -0.0951 0.0488  277 PRO A CG  
2027 C CD  . PRO A 266 ? 0.6302 0.4567 0.7615 -0.1656 -0.0956 0.0647  277 PRO A CD  
2028 N N   . PHE A 267 ? 0.7556 0.5339 0.8950 -0.1117 -0.0804 0.0622  278 PHE A N   
2029 C CA  . PHE A 267 ? 0.7484 0.5122 0.9026 -0.0900 -0.0735 0.0753  278 PHE A CA  
2030 C C   . PHE A 267 ? 0.9388 0.7207 1.0890 -0.0735 -0.0720 0.0625  278 PHE A C   
2031 O O   . PHE A 267 ? 0.8247 0.6351 0.9608 -0.0784 -0.0776 0.0482  278 PHE A O   
2032 C CB  . PHE A 267 ? 0.6786 0.4677 0.8475 -0.0868 -0.0786 0.1077  278 PHE A CB  
2033 C CG  . PHE A 267 ? 0.7786 0.5456 0.9556 -0.0997 -0.0773 0.1255  278 PHE A CG  
2034 C CD1 . PHE A 267 ? 0.9226 0.6415 1.1149 -0.0924 -0.0670 0.1359  278 PHE A CD1 
2035 C CD2 . PHE A 267 ? 0.9641 0.7571 1.1346 -0.1185 -0.0843 0.1331  278 PHE A CD2 
2036 C CE1 . PHE A 267 ? 0.9582 0.6536 1.1592 -0.1050 -0.0648 0.1538  278 PHE A CE1 
2037 C CE2 . PHE A 267 ? 0.6985 0.4722 0.8780 -0.1315 -0.0822 0.1515  278 PHE A CE2 
2038 C CZ  . PHE A 267 ? 0.8150 0.5390 1.0098 -0.1254 -0.0730 0.1620  278 PHE A CZ  
2039 N N   . PRO A 268 ? 0.6342 0.3996 0.7989 -0.0532 -0.0631 0.0689  279 PRO A N   
2040 C CA  . PRO A 268 ? 0.6094 0.3938 0.7737 -0.0380 -0.0607 0.0593  279 PRO A CA  
2041 C C   . PRO A 268 ? 0.5652 0.4029 0.7288 -0.0400 -0.0728 0.0674  279 PRO A C   
2042 O O   . PRO A 268 ? 0.5579 0.4186 0.7270 -0.0455 -0.0813 0.0876  279 PRO A O   
2043 C CB  . PRO A 268 ? 1.0471 0.8114 1.2359 -0.0159 -0.0493 0.0748  279 PRO A CB  
2044 C CG  . PRO A 268 ? 0.6815 0.3951 0.8734 -0.0195 -0.0404 0.0779  279 PRO A CG  
2045 C CD  . PRO A 268 ? 0.6771 0.4015 0.8604 -0.0425 -0.0523 0.0841  279 PRO A CD  
2046 N N   . CYS A 269 ? 0.5403 0.3953 0.6946 -0.0359 -0.0725 0.0510  280 CYS A N   
2047 C CA  . CYS A 269 ? 0.5039 0.4022 0.6534 -0.0393 -0.0820 0.0531  280 CYS A CA  
2048 C C   . CYS A 269 ? 0.6837 0.5964 0.8429 -0.0248 -0.0787 0.0514  280 CYS A C   
2049 O O   . CYS A 269 ? 0.9022 0.7938 1.0653 -0.0131 -0.0677 0.0420  280 CYS A O   
2050 C CB  . CYS A 269 ? 0.4876 0.3968 0.6150 -0.0528 -0.0855 0.0350  280 CYS A CB  
2051 S SG  . CYS A 269 ? 0.6707 0.5788 0.7907 -0.0724 -0.0909 0.0406  280 CYS A SG  
2052 N N   . LYS A 270 ? 0.5957 0.5443 0.7574 -0.0271 -0.0876 0.0602  281 LYS A N   
2053 C CA  . LYS A 270 ? 0.6476 0.6148 0.8178 -0.0183 -0.0863 0.0577  281 LYS A CA  
2054 C C   . LYS A 270 ? 0.5924 0.5567 0.7444 -0.0201 -0.0811 0.0342  281 LYS A C   
2055 O O   . LYS A 270 ? 0.4335 0.3904 0.5665 -0.0295 -0.0817 0.0218  281 LYS A O   
2056 C CB  . LYS A 270 ? 0.4327 0.4368 0.6063 -0.0250 -0.0988 0.0713  281 LYS A CB  
2057 C CG  . LYS A 270 ? 0.4473 0.4608 0.6326 -0.0268 -0.1072 0.0968  281 LYS A CG  
2058 C CD  . LYS A 270 ? 0.4565 0.4770 0.6744 -0.0118 -0.1059 0.1171  281 LYS A CD  
2059 C CE  . LYS A 270 ? 0.6683 0.7252 0.8960 -0.0131 -0.1139 0.1212  281 LYS A CE  
2060 N NZ  . LYS A 270 ? 0.7489 0.8225 1.0137 0.0007  -0.1147 0.1462  281 LYS A NZ  
2061 N N   . ALA A 271 ? 0.4884 0.4618 0.6488 -0.0109 -0.0761 0.0306  282 ALA A N   
2062 C CA  . ALA A 271 ? 0.4661 0.4370 0.6109 -0.0104 -0.0701 0.0117  282 ALA A CA  
2063 C C   . ALA A 271 ? 0.5779 0.5687 0.7070 -0.0223 -0.0773 0.0058  282 ALA A C   
2064 O O   . ALA A 271 ? 0.7225 0.7323 0.8531 -0.0299 -0.0860 0.0149  282 ALA A O   
2065 C CB  . ALA A 271 ? 0.4100 0.3870 0.5698 0.0024  -0.0615 0.0124  282 ALA A CB  
2066 N N   . ILE A 272 ? 0.4998 0.4858 0.6124 -0.0236 -0.0729 -0.0092 283 ILE A N   
2067 C CA  . ILE A 272 ? 0.3741 0.3761 0.4743 -0.0303 -0.0753 -0.0150 283 ILE A CA  
2068 C C   . ILE A 272 ? 0.7246 0.7334 0.8297 -0.0233 -0.0693 -0.0185 283 ILE A C   
2069 O O   . ILE A 272 ? 0.7872 0.7879 0.8876 -0.0161 -0.0614 -0.0263 283 ILE A O   
2070 C CB  . ILE A 272 ? 0.5497 0.5473 0.6335 -0.0352 -0.0745 -0.0248 283 ILE A CB  
2071 C CG1 . ILE A 272 ? 0.6198 0.6101 0.7021 -0.0440 -0.0798 -0.0202 283 ILE A CG1 
2072 C CG2 . ILE A 272 ? 0.6368 0.6510 0.7119 -0.0386 -0.0741 -0.0281 283 ILE A CG2 
2073 C CD1 . ILE A 272 ? 0.3896 0.3826 0.4601 -0.0519 -0.0811 -0.0271 283 ILE A CD1 
2074 N N   . THR A 273 ? 0.6814 0.7056 0.7944 -0.0271 -0.0733 -0.0124 284 THR A N   
2075 C CA  . THR A 273 ? 0.5541 0.5849 0.6771 -0.0224 -0.0681 -0.0129 284 THR A CA  
2076 C C   . THR A 273 ? 0.5882 0.6173 0.6973 -0.0223 -0.0615 -0.0233 284 THR A C   
2077 O O   . THR A 273 ? 0.6528 0.6802 0.7663 -0.0150 -0.0531 -0.0253 284 THR A O   
2078 C CB  . THR A 273 ? 0.5497 0.5981 0.6852 -0.0304 -0.0764 -0.0034 284 THR A CB  
2079 O OG1 . THR A 273 ? 0.5446 0.5976 0.6624 -0.0429 -0.0828 -0.0072 284 THR A OG1 
2080 C CG2 . THR A 273 ? 0.6621 0.7166 0.8165 -0.0276 -0.0826 0.0116  284 THR A CG2 
2081 N N   . ARG A 274 ? 0.4960 0.5263 0.5896 -0.0291 -0.0638 -0.0280 285 ARG A N   
2082 C CA  . ARG A 274 ? 0.4347 0.4639 0.5181 -0.0271 -0.0565 -0.0348 285 ARG A CA  
2083 C C   . ARG A 274 ? 0.5285 0.5590 0.5986 -0.0293 -0.0573 -0.0377 285 ARG A C   
2084 O O   . ARG A 274 ? 0.5913 0.6243 0.6587 -0.0358 -0.0637 -0.0349 285 ARG A O   
2085 C CB  . ARG A 274 ? 0.3438 0.3755 0.4273 -0.0334 -0.0551 -0.0360 285 ARG A CB  
2086 C CG  . ARG A 274 ? 0.3776 0.4036 0.4563 -0.0283 -0.0443 -0.0406 285 ARG A CG  
2087 C CD  . ARG A 274 ? 0.3553 0.3766 0.4305 -0.0372 -0.0422 -0.0444 285 ARG A CD  
2088 N NE  . ARG A 274 ? 0.3666 0.3778 0.4380 -0.0312 -0.0296 -0.0475 285 ARG A NE  
2089 C CZ  . ARG A 274 ? 0.3862 0.3852 0.4502 -0.0374 -0.0235 -0.0533 285 ARG A CZ  
2090 N NH1 . ARG A 274 ? 0.4443 0.4415 0.5003 -0.0519 -0.0303 -0.0584 285 ARG A NH1 
2091 N NH2 . ARG A 274 ? 0.3850 0.3723 0.4481 -0.0294 -0.0102 -0.0538 285 ARG A NH2 
2092 N N   . ILE A 275 ? 0.5795 0.6112 0.6436 -0.0235 -0.0506 -0.0409 286 ILE A N   
2093 C CA  . ILE A 275 ? 0.4567 0.4960 0.5134 -0.0247 -0.0509 -0.0411 286 ILE A CA  
2094 C C   . ILE A 275 ? 0.6125 0.6558 0.6669 -0.0172 -0.0414 -0.0410 286 ILE A C   
2095 O O   . ILE A 275 ? 0.5444 0.5833 0.6013 -0.0102 -0.0355 -0.0409 286 ILE A O   
2096 C CB  . ILE A 275 ? 0.3441 0.3835 0.3988 -0.0255 -0.0563 -0.0416 286 ILE A CB  
2097 C CG1 . ILE A 275 ? 0.3445 0.3969 0.3964 -0.0309 -0.0594 -0.0393 286 ILE A CG1 
2098 C CG2 . ILE A 275 ? 0.3475 0.3848 0.3986 -0.0173 -0.0521 -0.0442 286 ILE A CG2 
2099 C CD1 . ILE A 275 ? 0.4349 0.4859 0.4841 -0.0370 -0.0667 -0.0409 286 ILE A CD1 
2100 N N   . LEU A 276 ? 0.5595 0.6116 0.6111 -0.0177 -0.0385 -0.0393 287 LEU A N   
2101 C CA  . LEU A 276 ? 0.4780 0.5354 0.5306 -0.0082 -0.0281 -0.0363 287 LEU A CA  
2102 C C   . LEU A 276 ? 0.4872 0.5654 0.5429 -0.0069 -0.0305 -0.0301 287 LEU A C   
2103 O O   . LEU A 276 ? 0.7299 0.8159 0.7856 -0.0155 -0.0372 -0.0294 287 LEU A O   
2104 C CB  . LEU A 276 ? 0.4201 0.4672 0.4686 -0.0079 -0.0175 -0.0394 287 LEU A CB  
2105 C CG  . LEU A 276 ? 0.5748 0.6026 0.6220 -0.0091 -0.0124 -0.0447 287 LEU A CG  
2106 C CD1 . LEU A 276 ? 0.5983 0.6217 0.6441 -0.0212 -0.0231 -0.0486 287 LEU A CD1 
2107 C CD2 . LEU A 276 ? 0.4561 0.4702 0.4964 -0.0070 0.0016  -0.0489 287 LEU A CD2 
2108 N N   . TRP A 277 ? 0.4472 0.5369 0.5074 0.0033  -0.0253 -0.0234 288 TRP A N   
2109 C CA  . TRP A 277 ? 0.3433 0.4599 0.4107 0.0049  -0.0281 -0.0143 288 TRP A CA  
2110 C C   . TRP A 277 ? 0.6603 0.7846 0.7364 0.0195  -0.0135 -0.0051 288 TRP A C   
2111 O O   . TRP A 277 ? 0.7626 0.8906 0.8417 0.0300  -0.0095 0.0019  288 TRP A O   
2112 C CB  . TRP A 277 ? 0.3440 0.4721 0.4080 0.0021  -0.0395 -0.0127 288 TRP A CB  
2113 C CG  . TRP A 277 ? 0.5054 0.6663 0.5780 0.0012  -0.0453 -0.0019 288 TRP A CG  
2114 C CD1 . TRP A 277 ? 0.5234 0.7069 0.6033 0.0121  -0.0424 0.0108  288 TRP A CD1 
2115 C CD2 . TRP A 277 ? 0.5212 0.6993 0.5990 -0.0121 -0.0555 -0.0004 288 TRP A CD2 
2116 N NE1 . TRP A 277 ? 0.4815 0.6990 0.5719 0.0060  -0.0516 0.0204  288 TRP A NE1 
2117 C CE2 . TRP A 277 ? 0.4496 0.6636 0.5391 -0.0098 -0.0595 0.0130  288 TRP A CE2 
2118 C CE3 . TRP A 277 ? 0.6218 0.7897 0.6973 -0.0262 -0.0618 -0.0071 288 TRP A CE3 
2119 C CZ2 . TRP A 277 ? 0.4174 0.6584 0.5173 -0.0230 -0.0700 0.0188  288 TRP A CZ2 
2120 C CZ3 . TRP A 277 ? 0.6923 0.8827 0.7766 -0.0385 -0.0708 -0.0014 288 TRP A CZ3 
2121 C CH2 . TRP A 277 ? 0.4894 0.7165 0.5863 -0.0379 -0.0750 0.0108  288 TRP A CH2 
2122 N N   . LEU A 278 ? 0.3537 0.4791 0.4333 0.0212  -0.0038 -0.0042 289 LEU A N   
2123 C CA  . LEU A 278 ? 0.6255 0.7515 0.7132 0.0367  0.0143  0.0033  289 LEU A CA  
2124 C C   . LEU A 278 ? 0.6249 0.7873 0.7301 0.0426  0.0158  0.0183  289 LEU A C   
2125 O O   . LEU A 278 ? 0.5448 0.7244 0.6527 0.0320  0.0080  0.0190  289 LEU A O   
2126 C CB  . LEU A 278 ? 0.3801 0.4786 0.4565 0.0355  0.0279  -0.0078 289 LEU A CB  
2127 C CG  . LEU A 278 ? 0.3819 0.4507 0.4431 0.0249  0.0228  -0.0219 289 LEU A CG  
2128 C CD1 . LEU A 278 ? 0.6230 0.6691 0.6691 0.0196  0.0330  -0.0333 289 LEU A CD1 
2129 C CD2 . LEU A 278 ? 0.3842 0.4392 0.4486 0.0324  0.0267  -0.0203 289 LEU A CD2 
2130 N N   . THR A 279 ? 0.3703 0.5464 0.4900 0.0597  0.0262  0.0327  290 THR A N   
2131 C CA  . THR A 279 ? 0.3694 0.5871 0.5119 0.0675  0.0276  0.0515  290 THR A CA  
2132 C C   . THR A 279 ? 0.5642 0.7775 0.7170 0.0839  0.0527  0.0571  290 THR A C   
2133 O O   . THR A 279 ? 0.7524 0.9307 0.8968 0.0943  0.0704  0.0504  290 THR A O   
2134 C CB  . THR A 279 ? 0.3684 0.6120 0.5227 0.0769  0.0210  0.0685  290 THR A CB  
2135 O OG1 . THR A 279 ? 0.3825 0.6057 0.5398 0.0962  0.0394  0.0745  290 THR A OG1 
2136 C CG2 . THR A 279 ? 0.5271 0.7673 0.6644 0.0620  0.0000  0.0598  290 THR A CG2 
2137 N N   . THR A 280 ? 0.6461 0.8943 0.8173 0.0855  0.0553  0.0692  291 THR A N   
2138 C CA  . THR A 280 ? 0.6145 0.8639 0.7980 0.1032  0.0816  0.0766  291 THR A CA  
2139 C C   . THR A 280 ? 0.5767 0.8757 0.7964 0.1199  0.0854  0.1052  291 THR A C   
2140 O O   . THR A 280 ? 0.4550 0.7948 0.6888 0.1111  0.0637  0.1178  291 THR A O   
2141 C CB  . THR A 280 ? 0.7037 0.9530 0.8787 0.0923  0.0862  0.0679  291 THR A CB  
2142 O OG1 . THR A 280 ? 0.4654 0.7585 0.6564 0.0781  0.0672  0.0786  291 THR A OG1 
2143 C CG2 . THR A 280 ? 0.7875 0.9924 0.9277 0.0761  0.0811  0.0428  291 THR A CG2 
2144 N N   . ARG A 281 ? 0.5875 0.8826 0.8221 0.1440  0.1136  0.1156  292 ARG A N   
2145 C CA  . ARG A 281 ? 0.4262 0.7708 0.7006 0.1640  0.1202  0.1467  292 ARG A CA  
2146 C C   . ARG A 281 ? 0.5509 0.9520 0.8501 0.1549  0.1107  0.1612  292 ARG A C   
2147 O O   . ARG A 281 ? 0.6598 1.1157 0.9944 0.1634  0.1049  0.1890  292 ARG A O   
2148 C CB  . ARG A 281 ? 0.4583 0.7803 0.7438 0.1941  0.1570  0.1542  292 ARG A CB  
2149 C CG  . ARG A 281 ? 0.6689 0.9783 0.9494 0.1983  0.1815  0.1450  292 ARG A CG  
2150 C CD  . ARG A 281 ? 0.8779 1.1648 1.1711 0.2306  0.2206  0.1535  292 ARG A CD  
2151 N NE  . ARG A 281 ? 1.0633 1.2826 1.3275 0.2346  0.2334  0.1336  292 ARG A NE  
2152 C CZ  . ARG A 281 ? 1.1487 1.3111 1.3751 0.2267  0.2483  0.1039  292 ARG A CZ  
2153 N NH1 . ARG A 281 ? 1.1140 1.2791 1.3248 0.2161  0.2529  0.0914  292 ARG A NH1 
2154 N NH2 . ARG A 281 ? 1.1318 1.2358 1.3352 0.2279  0.2579  0.0875  292 ARG A NH2 
2155 N N   . GLN A 282 ? 0.6009 0.9925 0.8839 0.1370  0.1084  0.1451  293 GLN A N   
2156 C CA  . GLN A 282 ? 0.3973 0.8401 0.7035 0.1250  0.0991  0.1586  293 GLN A CA  
2157 C C   . GLN A 282 ? 0.6123 1.0805 0.9175 0.0975  0.0628  0.1582  293 GLN A C   
2158 O O   . GLN A 282 ? 0.8790 1.3888 1.2036 0.0828  0.0516  0.1688  293 GLN A O   
2159 C CB  . GLN A 282 ? 0.4074 0.8290 0.6956 0.1174  0.1134  0.1436  293 GLN A CB  
2160 C CG  . GLN A 282 ? 0.4387 0.8239 0.7159 0.1408  0.1502  0.1366  293 GLN A CG  
2161 C CD  . GLN A 282 ? 0.9265 1.2439 1.1582 0.1349  0.1531  0.1065  293 GLN A CD  
2162 O OE1 . GLN A 282 ? 1.0599 1.3597 1.2670 0.1116  0.1307  0.0900  293 GLN A OE1 
2163 N NE2 . GLN A 282 ? 0.8750 1.1542 1.0971 0.1557  0.1811  0.1001  293 GLN A NE2 
2164 N N   . GLY A 283 ? 0.3682 0.8111 0.6509 0.0899  0.0458  0.1460  294 GLY A N   
2165 C CA  . GLY A 283 ? 0.3545 0.8127 0.6299 0.0644  0.0142  0.1418  294 GLY A CA  
2166 C C   . GLY A 283 ? 0.4456 0.8729 0.6946 0.0402  0.0032  0.1191  294 GLY A C   
2167 O O   . GLY A 283 ? 0.3431 0.7809 0.5873 0.0179  -0.0208 0.1152  294 GLY A O   
2168 N N   . LEU A 284 ? 0.3999 0.7885 0.6304 0.0437  0.0202  0.1044  295 LEU A N   
2169 C CA  . LEU A 284 ? 0.5631 0.9243 0.7701 0.0229  0.0110  0.0864  295 LEU A CA  
2170 C C   . LEU A 284 ? 0.6311 0.9403 0.8064 0.0230  0.0104  0.0653  295 LEU A C   
2171 O O   . LEU A 284 ? 0.6886 0.9677 0.8502 0.0341  0.0289  0.0566  295 LEU A O   
2172 C CB  . LEU A 284 ? 0.7519 1.1152 0.9608 0.0240  0.0288  0.0881  295 LEU A CB  
2173 C CG  . LEU A 284 ? 0.3629 0.7808 0.6088 0.0290  0.0361  0.1122  295 LEU A CG  
2174 C CD1 . LEU A 284 ? 0.3774 0.7931 0.6210 0.0342  0.0594  0.1131  295 LEU A CD1 
2175 C CD2 . LEU A 284 ? 0.3514 0.8056 0.6144 0.0053  0.0100  0.1213  295 LEU A CD2 
2176 N N   . PRO A 285 ? 0.4376 0.7347 0.6003 0.0102  -0.0094 0.0563  296 PRO A N   
2177 C CA  . PRO A 285 ? 0.5248 0.7786 0.6632 0.0120  -0.0091 0.0396  296 PRO A CA  
2178 C C   . PRO A 285 ? 0.4794 0.7021 0.5981 0.0014  -0.0082 0.0250  296 PRO A C   
2179 O O   . PRO A 285 ? 0.5285 0.7585 0.6475 -0.0129 -0.0157 0.0254  296 PRO A O   
2180 C CB  . PRO A 285 ? 0.3418 0.5987 0.4751 0.0020  -0.0293 0.0370  296 PRO A CB  
2181 C CG  . PRO A 285 ? 0.3403 0.6274 0.4854 -0.0148 -0.0439 0.0438  296 PRO A CG  
2182 C CD  . PRO A 285 ? 0.3411 0.6640 0.5114 -0.0063 -0.0320 0.0612  296 PRO A CD  
2183 N N   . PHE A 286 ? 0.4591 0.6480 0.5613 0.0078  0.0007  0.0135  297 PHE A N   
2184 C CA  . PHE A 286 ? 0.3603 0.5210 0.4426 -0.0027 -0.0014 0.0003  297 PHE A CA  
2185 C C   . PHE A 286 ? 0.3599 0.5057 0.4350 -0.0123 -0.0181 -0.0072 297 PHE A C   
2186 O O   . PHE A 286 ? 0.4911 0.6289 0.5659 -0.0058 -0.0193 -0.0092 297 PHE A O   
2187 C CB  . PHE A 286 ? 0.4567 0.5897 0.5247 0.0058  0.0152  -0.0090 297 PHE A CB  
2188 C CG  . PHE A 286 ? 0.3943 0.5300 0.4581 0.0108  0.0331  -0.0078 297 PHE A CG  
2189 C CD1 . PHE A 286 ? 0.7214 0.8721 0.8006 0.0277  0.0506  0.0023  297 PHE A CD1 
2190 C CD2 . PHE A 286 ? 0.4065 0.5303 0.4502 -0.0003 0.0338  -0.0158 297 PHE A CD2 
2191 C CE1 . PHE A 286 ? 0.5619 0.7131 0.6362 0.0343  0.0708  0.0028  297 PHE A CE1 
2192 C CE2 . PHE A 286 ? 0.7017 0.8265 0.7365 0.0044  0.0524  -0.0160 297 PHE A CE2 
2193 C CZ  . PHE A 286 ? 0.7314 0.8686 0.7814 0.0222  0.0721  -0.0076 297 PHE A CZ  
2194 N N   . THR A 287 ? 0.4313 0.5729 0.5013 -0.0263 -0.0290 -0.0098 298 THR A N   
2195 C CA  . THR A 287 ? 0.4048 0.5284 0.4685 -0.0337 -0.0416 -0.0167 298 THR A CA  
2196 C C   . THR A 287 ? 0.3511 0.4549 0.4026 -0.0387 -0.0410 -0.0225 298 THR A C   
2197 O O   . THR A 287 ? 0.3980 0.5052 0.4460 -0.0471 -0.0428 -0.0193 298 THR A O   
2198 C CB  . THR A 287 ? 0.5879 0.7202 0.6572 -0.0458 -0.0548 -0.0135 298 THR A CB  
2199 O OG1 . THR A 287 ? 0.6997 0.8557 0.7792 -0.0441 -0.0575 -0.0075 298 THR A OG1 
2200 C CG2 . THR A 287 ? 0.4382 0.5476 0.5008 -0.0501 -0.0638 -0.0211 298 THR A CG2 
2201 N N   . ILE A 288 ? 0.6113 0.6974 0.6572 -0.0344 -0.0390 -0.0294 299 ILE A N   
2202 C CA  . ILE A 288 ? 0.5245 0.5960 0.5599 -0.0402 -0.0401 -0.0342 299 ILE A CA  
2203 C C   . ILE A 288 ? 0.5657 0.6263 0.6056 -0.0420 -0.0494 -0.0359 299 ILE A C   
2204 O O   . ILE A 288 ? 0.7087 0.7633 0.7528 -0.0350 -0.0467 -0.0388 299 ILE A O   
2205 C CB  . ILE A 288 ? 0.3706 0.4313 0.3965 -0.0353 -0.0275 -0.0407 299 ILE A CB  
2206 C CG1 . ILE A 288 ? 0.4376 0.5078 0.4612 -0.0292 -0.0139 -0.0384 299 ILE A CG1 
2207 C CG2 . ILE A 288 ? 0.4244 0.4736 0.4365 -0.0457 -0.0314 -0.0462 299 ILE A CG2 
2208 C CD1 . ILE A 288 ? 0.5521 0.6056 0.5666 -0.0219 0.0024  -0.0457 299 ILE A CD1 
2209 N N   . PHE A 289 ? 0.4988 0.5576 0.5391 -0.0501 -0.0588 -0.0323 300 PHE A N   
2210 C CA  . PHE A 289 ? 0.5741 0.6237 0.6221 -0.0497 -0.0657 -0.0317 300 PHE A CA  
2211 C C   . PHE A 289 ? 0.5195 0.5687 0.5658 -0.0572 -0.0724 -0.0269 300 PHE A C   
2212 O O   . PHE A 289 ? 0.5770 0.6325 0.6150 -0.0645 -0.0748 -0.0224 300 PHE A O   
2213 C CB  . PHE A 289 ? 0.5083 0.5544 0.5628 -0.0498 -0.0707 -0.0295 300 PHE A CB  
2214 C CG  . PHE A 289 ? 0.4444 0.4940 0.4988 -0.0589 -0.0760 -0.0228 300 PHE A CG  
2215 C CD1 . PHE A 289 ? 0.3850 0.4275 0.4436 -0.0632 -0.0822 -0.0155 300 PHE A CD1 
2216 C CD2 . PHE A 289 ? 0.3586 0.4206 0.4116 -0.0627 -0.0743 -0.0211 300 PHE A CD2 
2217 C CE1 . PHE A 289 ? 0.4228 0.4669 0.4820 -0.0717 -0.0861 -0.0071 300 PHE A CE1 
2218 C CE2 . PHE A 289 ? 0.4184 0.4844 0.4734 -0.0724 -0.0783 -0.0133 300 PHE A CE2 
2219 C CZ  . PHE A 289 ? 0.4232 0.4784 0.4802 -0.0771 -0.0840 -0.0066 300 PHE A CZ  
2220 N N   . GLN A 290 ? 0.5265 0.5716 0.5816 -0.0552 -0.0755 -0.0261 301 GLN A N   
2221 C CA  . GLN A 290 ? 0.5295 0.5799 0.5874 -0.0621 -0.0841 -0.0187 301 GLN A CA  
2222 C C   . GLN A 290 ? 0.3640 0.4118 0.4377 -0.0587 -0.0899 -0.0084 301 GLN A C   
2223 O O   . GLN A 290 ? 0.3598 0.3986 0.4445 -0.0498 -0.0859 -0.0104 301 GLN A O   
2224 C CB  . GLN A 290 ? 0.5178 0.5697 0.5798 -0.0635 -0.0840 -0.0220 301 GLN A CB  
2225 C CG  . GLN A 290 ? 0.5742 0.6378 0.6444 -0.0711 -0.0956 -0.0117 301 GLN A CG  
2226 C CD  . GLN A 290 ? 0.7396 0.8075 0.8199 -0.0741 -0.0964 -0.0137 301 GLN A CD  
2227 O OE1 . GLN A 290 ? 0.8824 0.9410 0.9614 -0.0707 -0.0870 -0.0232 301 GLN A OE1 
2228 N NE2 . GLN A 290 ? 0.7326 0.8167 0.8252 -0.0810 -0.1080 -0.0024 301 GLN A NE2 
2229 N N   . GLY A 291 ? 0.4593 0.5132 0.5328 -0.0650 -0.0978 0.0029  302 GLY A N   
2230 C CA  . GLY A 291 ? 0.5645 0.6128 0.6545 -0.0605 -0.1016 0.0150  302 GLY A CA  
2231 C C   . GLY A 291 ? 0.4940 0.5295 0.5816 -0.0612 -0.0993 0.0157  302 GLY A C   
2232 O O   . GLY A 291 ? 0.5108 0.5517 0.5856 -0.0690 -0.0996 0.0156  302 GLY A O   
2233 N N   . GLY A 292 ? 0.5469 0.6699 0.5784 0.0327  -0.0939 -0.0644 303 GLY A N   
2234 C CA  . GLY A 292 ? 0.6450 0.7457 0.6614 0.0280  -0.1012 -0.0594 303 GLY A CA  
2235 C C   . GLY A 292 ? 0.6131 0.6723 0.6021 0.0264  -0.1140 -0.0555 303 GLY A C   
2236 O O   . GLY A 292 ? 0.6083 0.6458 0.5809 0.0191  -0.1197 -0.0495 303 GLY A O   
2237 N N   . MET A 293 ? 0.5542 0.6002 0.5355 0.0318  -0.1192 -0.0587 304 MET A N   
2238 C CA  . MET A 293 ? 0.7982 0.8018 0.7499 0.0288  -0.1324 -0.0544 304 MET A CA  
2239 C C   . MET A 293 ? 0.7917 0.7675 0.7258 0.0391  -0.1544 -0.0649 304 MET A C   
2240 O O   . MET A 293 ? 0.8888 0.8810 0.8361 0.0539  -0.1613 -0.0801 304 MET A O   
2241 C CB  . MET A 293 ? 0.8524 0.8491 0.8003 0.0333  -0.1335 -0.0562 304 MET A CB  
2242 C CG  . MET A 293 ? 0.8892 0.9102 0.8529 0.0249  -0.1137 -0.0473 304 MET A CG  
2243 S SD  . MET A 293 ? 0.9921 1.0069 0.9460 0.0042  -0.1015 -0.0288 304 MET A SD  
2244 C CE  . MET A 293 ? 0.9397 0.9048 0.8550 -0.0021 -0.1178 -0.0245 304 MET A CE  
2245 N N   . PRO A 294 ? 0.7610 0.6946 0.6639 0.0310  -0.1666 -0.0577 305 PRO A N   
2246 C CA  . PRO A 294 ? 0.8584 0.7588 0.7402 0.0411  -0.1903 -0.0675 305 PRO A CA  
2247 C C   . PRO A 294 ? 0.9407 0.8291 0.8180 0.0610  -0.2073 -0.0832 305 PRO A C   
2248 O O   . PRO A 294 ? 1.0029 0.8839 0.8748 0.0612  -0.2065 -0.0811 305 PRO A O   
2249 C CB  . PRO A 294 ? 0.7332 0.5886 0.5787 0.0234  -0.1978 -0.0533 305 PRO A CB  
2250 C CG  . PRO A 294 ? 0.7052 0.5833 0.5607 0.0035  -0.1746 -0.0374 305 PRO A CG  
2251 C CD  . PRO A 294 ? 0.6676 0.5834 0.5523 0.0107  -0.1591 -0.0405 305 PRO A CD  
2252 N N   . ARG A 295 ? 0.9350 0.8234 0.8149 0.0788  -0.2233 -0.1004 306 ARG A N   
2253 C CA  . ARG A 295 ? 0.8995 0.7755 0.7734 0.1001  -0.2430 -0.1181 306 ARG A CA  
2254 C C   . ARG A 295 ? 1.1480 0.9620 0.9797 0.0995  -0.2655 -0.1140 306 ARG A C   
2255 O O   . ARG A 295 ? 1.1759 0.9740 0.9986 0.1155  -0.2819 -0.1259 306 ARG A O   
2256 C CB  . ARG A 295 ? 0.8255 0.7193 0.7127 0.1202  -0.2556 -0.1396 306 ARG A CB  
2257 C CG  . ARG A 295 ? 0.7795 0.7262 0.7005 0.1169  -0.2363 -0.1419 306 ARG A CG  
2258 C CD  . ARG A 295 ? 0.6995 0.6698 0.6352 0.1385  -0.2491 -0.1668 306 ARG A CD  
2259 N NE  . ARG A 295 ? 0.7449 0.7562 0.7051 0.1336  -0.2346 -0.1683 306 ARG A NE  
2260 C CZ  . ARG A 295 ? 0.8498 0.8999 0.8317 0.1480  -0.2371 -0.1891 306 ARG A CZ  
2261 N NH1 . ARG A 295 ? 0.7899 0.8458 0.7740 0.1693  -0.2535 -0.2114 306 ARG A NH1 
2262 N NH2 . ARG A 295 ? 0.9521 1.0371 0.9535 0.1409  -0.2234 -0.1883 306 ARG A NH2 
2263 N N   . ALA A 296 ? 1.3449 1.1236 1.1491 0.0805  -0.2672 -0.0976 307 ALA A N   
2264 C CA  . ALA A 296 ? 1.4021 1.1166 1.1605 0.0776  -0.2913 -0.0937 307 ALA A CA  
2265 C C   . ALA A 296 ? 1.4617 1.1589 1.2063 0.0748  -0.2923 -0.0884 307 ALA A C   
2266 O O   . ALA A 296 ? 1.8237 1.4780 1.5399 0.0859  -0.3166 -0.0954 307 ALA A O   
2267 C CB  . ALA A 296 ? 1.6097 1.2960 1.3424 0.0530  -0.2894 -0.0760 307 ALA A CB  
2268 N N   . SER A 297 ? 0.8526 0.5814 0.6159 0.0609  -0.2671 -0.0767 308 SER A N   
2269 C CA  . SER A 297 ? 1.2905 1.0044 1.0409 0.0567  -0.2666 -0.0711 308 SER A CA  
2270 C C   . SER A 297 ? 1.2952 1.0610 1.0821 0.0547  -0.2404 -0.0688 308 SER A C   
2271 O O   . SER A 297 ? 1.2092 0.9819 1.0029 0.0652  -0.2416 -0.0756 308 SER A O   
2272 C CB  . SER A 297 ? 1.1923 0.8629 0.9033 0.0316  -0.2691 -0.0523 308 SER A CB  
2273 O OG  . SER A 297 ? 1.2194 0.8708 0.9135 0.0281  -0.2717 -0.0479 308 SER A OG  
2274 N N   . TYR A 298 ? 1.2678 1.0690 1.0772 0.0415  -0.2176 -0.0595 309 TYR A N   
2275 C CA  . TYR A 298 ? 1.3085 1.1547 1.1492 0.0378  -0.1934 -0.0558 309 TYR A CA  
2276 C C   . TYR A 298 ? 1.4435 1.3345 1.3204 0.0541  -0.1868 -0.0701 309 TYR A C   
2277 O O   . TYR A 298 ? 1.4977 1.4278 1.4014 0.0487  -0.1660 -0.0661 309 TYR A O   
2278 C CB  . TYR A 298 ? 1.2210 1.0819 1.0660 0.0162  -0.1737 -0.0395 309 TYR A CB  
2279 C CG  . TYR A 298 ? 1.3674 1.1885 1.1758 -0.0032 -0.1798 -0.0262 309 TYR A CG  
2280 C CD1 . TYR A 298 ? 1.5590 1.3557 1.3473 -0.0109 -0.1902 -0.0231 309 TYR A CD1 
2281 C CD2 . TYR A 298 ? 1.4296 1.2383 1.2225 -0.0152 -0.1753 -0.0170 309 TYR A CD2 
2282 C CE1 . TYR A 298 ? 1.7078 1.4684 1.4601 -0.0317 -0.1958 -0.0109 309 TYR A CE1 
2283 C CE2 . TYR A 298 ? 1.5455 1.3202 1.3032 -0.0358 -0.1804 -0.0052 309 TYR A CE2 
2284 C CZ  . TYR A 298 ? 1.6917 1.4422 1.4286 -0.0447 -0.1907 -0.0020 309 TYR A CZ  
2285 O OH  . TYR A 298 ? 1.7714 1.4883 1.4708 -0.0680 -0.1958 0.0099  309 TYR A OH  
2286 N N   . GLY A 299 ? 1.4621 1.3487 1.3394 0.0735  -0.2047 -0.0876 310 GLY A N   
2287 C CA  . GLY A 299 ? 1.4207 1.3528 1.3309 0.0866  -0.1987 -0.1024 310 GLY A CA  
2288 C C   . GLY A 299 ? 1.3162 1.2770 1.2460 0.0952  -0.1921 -0.1112 310 GLY A C   
2289 O O   . GLY A 299 ? 1.2330 1.2383 1.1918 0.0959  -0.1773 -0.1160 310 GLY A O   
2290 N N   . ASP A 300 ? 1.4133 1.3487 1.3263 0.1009  -0.2032 -0.1134 311 ASP A N   
2291 C CA  . ASP A 300 ? 1.2920 1.2527 1.2217 0.1085  -0.1978 -0.1218 311 ASP A CA  
2292 C C   . ASP A 300 ? 1.1889 1.1631 1.1269 0.0923  -0.1758 -0.1061 311 ASP A C   
2293 O O   . ASP A 300 ? 1.0823 1.0631 1.0243 0.0956  -0.1733 -0.1090 311 ASP A O   
2294 C CB  . ASP A 300 ? 1.2249 1.1528 1.1330 0.1230  -0.2204 -0.1321 311 ASP A CB  
2295 C CG  . ASP A 300 ? 1.2494 1.1284 1.1237 0.1108  -0.2260 -0.1157 311 ASP A CG  
2296 O OD1 . ASP A 300 ? 1.2696 1.1324 1.1313 0.0935  -0.2192 -0.0995 311 ASP A OD1 
2297 O OD2 . ASP A 300 ? 1.2533 1.1114 1.1131 0.1178  -0.2373 -0.1196 311 ASP A OD2 
2298 N N   . ARG A 301 ? 1.1663 1.1453 1.1069 0.0759  -0.1606 -0.0906 312 ARG A N   
2299 C CA  . ARG A 301 ? 1.0338 1.0234 0.9804 0.0614  -0.1413 -0.0761 312 ARG A CA  
2300 C C   . ARG A 301 ? 0.8181 0.8500 0.7934 0.0567  -0.1225 -0.0747 312 ARG A C   
2301 O O   . ARG A 301 ? 0.7797 0.8238 0.7632 0.0564  -0.1214 -0.0764 312 ARG A O   
2302 C CB  . ARG A 301 ? 1.0910 1.0508 1.0143 0.0452  -0.1399 -0.0595 312 ARG A CB  
2303 C CG  . ARG A 301 ? 1.1865 1.0984 1.0752 0.0466  -0.1604 -0.0594 312 ARG A CG  
2304 C CD  . ARG A 301 ? 1.2828 1.1691 1.1475 0.0267  -0.1574 -0.0428 312 ARG A CD  
2305 N NE  . ARG A 301 ? 1.3747 1.2721 1.2427 0.0147  -0.1411 -0.0324 312 ARG A NE  
2306 C CZ  . ARG A 301 ? 1.4804 1.3561 1.3298 0.0117  -0.1456 -0.0294 312 ARG A CZ  
2307 N NH1 . ARG A 301 ? 1.5418 1.3812 1.3666 0.0199  -0.1667 -0.0355 312 ARG A NH1 
2308 N NH2 . ARG A 301 ? 1.5094 1.3991 1.3641 0.0012  -0.1299 -0.0210 312 ARG A NH2 
2309 N N   . HIS A 302 ? 0.7053 0.7571 0.6938 0.0529  -0.1087 -0.0714 313 HIS A N   
2310 C CA  . HIS A 302 ? 0.8114 0.8985 0.8232 0.0474  -0.0920 -0.0690 313 HIS A CA  
2311 C C   . HIS A 302 ? 0.8205 0.9039 0.8297 0.0333  -0.0793 -0.0525 313 HIS A C   
2312 O O   . HIS A 302 ? 0.8536 0.9277 0.8560 0.0273  -0.0736 -0.0443 313 HIS A O   
2313 C CB  . HIS A 302 ? 0.7122 0.8201 0.7372 0.0503  -0.0854 -0.0748 313 HIS A CB  
2314 C CG  . HIS A 302 ? 0.7172 0.8227 0.7396 0.0637  -0.0991 -0.0903 313 HIS A CG  
2315 N ND1 . HIS A 302 ? 0.7251 0.8564 0.7613 0.0734  -0.1043 -0.1070 313 HIS A ND1 
2316 C CD2 . HIS A 302 ? 0.7360 0.8177 0.7432 0.0695  -0.1094 -0.0927 313 HIS A CD2 
2317 C CE1 . HIS A 302 ? 0.7626 0.8874 0.7935 0.0858  -0.1176 -0.1199 313 HIS A CE1 
2318 N NE2 . HIS A 302 ? 0.6279 0.7210 0.6407 0.0838  -0.1212 -0.1110 313 HIS A NE2 
2319 N N   . CYS A 303 ? 0.6365 0.7290 0.6514 0.0285  -0.0753 -0.0486 314 CYS A N   
2320 C CA  . CYS A 303 ? 0.6775 0.7672 0.6890 0.0163  -0.0656 -0.0348 314 CYS A CA  
2321 C C   . CYS A 303 ? 0.5805 0.6986 0.6114 0.0126  -0.0532 -0.0320 314 CYS A C   
2322 O O   . CYS A 303 ? 0.5250 0.6609 0.5678 0.0174  -0.0542 -0.0398 314 CYS A O   
2323 C CB  . CYS A 303 ? 0.7074 0.7732 0.7006 0.0116  -0.0747 -0.0309 314 CYS A CB  
2324 S SG  . CYS A 303 ? 0.9071 0.9310 0.8697 0.0120  -0.0907 -0.0310 314 CYS A SG  
2325 N N   . ILE A 304 ? 0.6564 0.7791 0.6893 0.0042  -0.0421 -0.0215 315 ILE A N   
2326 C CA  . ILE A 304 ? 0.5896 0.7336 0.6366 0.0000  -0.0319 -0.0169 315 ILE A CA  
2327 C C   . ILE A 304 ? 0.5604 0.6993 0.6007 -0.0087 -0.0277 -0.0073 315 ILE A C   
2328 O O   . ILE A 304 ? 0.5081 0.6414 0.5423 -0.0131 -0.0235 -0.0020 315 ILE A O   
2329 C CB  . ILE A 304 ? 0.5465 0.7053 0.6047 0.0004  -0.0226 -0.0160 315 ILE A CB  
2330 C CG1 . ILE A 304 ? 0.4200 0.5892 0.4854 0.0065  -0.0258 -0.0263 315 ILE A CG1 
2331 C CG2 . ILE A 304 ? 0.4115 0.5859 0.4795 -0.0041 -0.0139 -0.0098 315 ILE A CG2 
2332 C CD1 . ILE A 304 ? 0.4095 0.5905 0.4826 0.0047  -0.0177 -0.0253 315 ILE A CD1 
2333 N N   . SER A 305 ? 0.6439 0.7872 0.6858 -0.0116 -0.0288 -0.0059 316 SER A N   
2334 C CA  . SER A 305 ? 0.4971 0.6380 0.5324 -0.0209 -0.0258 0.0018  316 SER A CA  
2335 C C   . SER A 305 ? 0.4626 0.6260 0.5125 -0.0231 -0.0150 0.0064  316 SER A C   
2336 O O   . SER A 305 ? 0.4170 0.5945 0.4794 -0.0191 -0.0128 0.0042  316 SER A O   
2337 C CB  . SER A 305 ? 0.4612 0.5910 0.4872 -0.0234 -0.0346 0.0006  316 SER A CB  
2338 O OG  . SER A 305 ? 0.7153 0.8208 0.7259 -0.0194 -0.0473 -0.0047 316 SER A OG  
2339 N N   . VAL A 306 ? 0.4319 0.5991 0.4789 -0.0297 -0.0091 0.0121  317 VAL A N   
2340 C CA  . VAL A 306 ? 0.4185 0.6063 0.4778 -0.0305 -0.0007 0.0154  317 VAL A CA  
2341 C C   . VAL A 306 ? 0.4996 0.6921 0.5538 -0.0397 0.0005  0.0191  317 VAL A C   
2342 O O   . VAL A 306 ? 0.4391 0.6227 0.4798 -0.0478 -0.0005 0.0209  317 VAL A O   
2343 C CB  . VAL A 306 ? 0.4138 0.6076 0.4773 -0.0277 0.0057  0.0162  317 VAL A CB  
2344 C CG1 . VAL A 306 ? 0.4032 0.6161 0.4784 -0.0259 0.0118  0.0182  317 VAL A CG1 
2345 C CG2 . VAL A 306 ? 0.4103 0.5977 0.4764 -0.0205 0.0042  0.0127  317 VAL A CG2 
2346 N N   . ILE A 307 ? 0.4440 0.6508 0.5077 -0.0398 0.0025  0.0201  318 ILE A N   
2347 C CA  . ILE A 307 ? 0.4200 0.6353 0.4808 -0.0487 0.0040  0.0228  318 ILE A CA  
2348 C C   . ILE A 307 ? 0.4070 0.6466 0.4820 -0.0459 0.0113  0.0237  318 ILE A C   
2349 O O   . ILE A 307 ? 0.6122 0.8592 0.6984 -0.0386 0.0119  0.0232  318 ILE A O   
2350 C CB  . ILE A 307 ? 0.4234 0.6330 0.4816 -0.0508 -0.0021 0.0223  318 ILE A CB  
2351 C CG1 . ILE A 307 ? 0.4365 0.6217 0.4825 -0.0487 -0.0117 0.0190  318 ILE A CG1 
2352 C CG2 . ILE A 307 ? 0.4322 0.6471 0.4835 -0.0626 -0.0014 0.0253  318 ILE A CG2 
2353 C CD1 . ILE A 307 ? 0.4420 0.6205 0.4849 -0.0490 -0.0193 0.0167  318 ILE A CD1 
2354 N N   . HIS A 308 ? 0.4109 0.6630 0.4841 -0.0519 0.0160  0.0241  319 HIS A N   
2355 C CA  . HIS A 308 ? 0.4733 0.7500 0.5598 -0.0476 0.0213  0.0228  319 HIS A CA  
2356 C C   . HIS A 308 ? 0.4079 0.7024 0.4908 -0.0582 0.0254  0.0218  319 HIS A C   
2357 O O   . HIS A 308 ? 0.5831 0.8751 0.6563 -0.0648 0.0273  0.0212  319 HIS A O   
2358 C CB  . HIS A 308 ? 0.4459 0.7243 0.5394 -0.0368 0.0235  0.0208  319 HIS A CB  
2359 C CG  . HIS A 308 ? 0.4102 0.7108 0.5153 -0.0301 0.0266  0.0181  319 HIS A CG  
2360 N ND1 . HIS A 308 ? 0.5676 0.8831 0.6746 -0.0286 0.0305  0.0139  319 HIS A ND1 
2361 C CD2 . HIS A 308 ? 0.4559 0.7664 0.5705 -0.0237 0.0254  0.0180  319 HIS A CD2 
2362 C CE1 . HIS A 308 ? 0.5400 0.8738 0.6580 -0.0200 0.0307  0.0104  319 HIS A CE1 
2363 N NE2 . HIS A 308 ? 0.4511 0.7806 0.5731 -0.0171 0.0273  0.0134  319 HIS A NE2 
2364 N N   . ASP A 309 ? 0.4037 0.7176 0.4937 -0.0605 0.0269  0.0212  320 ASP A N   
2365 C CA  . ASP A 309 ? 0.5603 0.8992 0.6499 -0.0705 0.0316  0.0185  320 ASP A CA  
2366 C C   . ASP A 309 ? 0.5540 0.8812 0.6238 -0.0884 0.0310  0.0209  320 ASP A C   
2367 O O   . ASP A 309 ? 0.4866 0.8247 0.5500 -0.0966 0.0352  0.0186  320 ASP A O   
2368 C CB  . ASP A 309 ? 0.6199 0.9814 0.7199 -0.0623 0.0364  0.0125  320 ASP A CB  
2369 C CG  . ASP A 309 ? 0.8024 1.1997 0.9082 -0.0688 0.0412  0.0068  320 ASP A CG  
2370 O OD1 . ASP A 309 ? 0.8724 1.2781 0.9774 -0.0777 0.0408  0.0082  320 ASP A OD1 
2371 O OD2 . ASP A 309 ? 0.8691 1.2878 0.9805 -0.0652 0.0451  0.0000  320 ASP A OD2 
2372 N N   . GLY A 310 ? 0.5356 0.8392 0.5936 -0.0946 0.0248  0.0252  321 GLY A N   
2373 C CA  . GLY A 310 ? 0.6542 0.9391 0.6888 -0.1118 0.0213  0.0283  321 GLY A CA  
2374 C C   . GLY A 310 ? 0.5614 0.8247 0.5821 -0.1130 0.0193  0.0292  321 GLY A C   
2375 O O   . GLY A 310 ? 0.6296 0.8786 0.6282 -0.1290 0.0166  0.0317  321 GLY A O   
2376 N N   . GLN A 311 ? 0.5429 0.8021 0.5741 -0.0977 0.0199  0.0274  322 GLN A N   
2377 C CA  . GLN A 311 ? 0.5508 0.7905 0.5707 -0.0971 0.0179  0.0277  322 GLN A CA  
2378 C C   . GLN A 311 ? 0.7115 0.9242 0.7304 -0.0860 0.0100  0.0281  322 GLN A C   
2379 O O   . GLN A 311 ? 0.7082 0.9273 0.7437 -0.0729 0.0106  0.0264  322 GLN A O   
2380 C CB  . GLN A 311 ? 0.5492 0.8090 0.5816 -0.0891 0.0253  0.0238  322 GLN A CB  
2381 C CG  . GLN A 311 ? 0.7372 1.0312 0.7749 -0.0969 0.0333  0.0202  322 GLN A CG  
2382 C CD  . GLN A 311 ? 1.0306 1.3228 1.0464 -0.1181 0.0342  0.0217  322 GLN A CD  
2383 O OE1 . GLN A 311 ? 1.1868 1.4568 1.1858 -0.1236 0.0313  0.0239  322 GLN A OE1 
2384 N NE2 . GLN A 311 ? 1.0381 1.3536 1.0528 -0.1314 0.0378  0.0205  322 GLN A NE2 
2385 N N   . GLN A 312 ? 0.6690 0.8522 0.6673 -0.0916 0.0019  0.0298  323 GLN A N   
2386 C CA  . GLN A 312 ? 0.4876 0.6469 0.4838 -0.0807 -0.0067 0.0280  323 GLN A CA  
2387 C C   . GLN A 312 ? 0.4986 0.6406 0.4833 -0.0795 -0.0092 0.0274  323 GLN A C   
2388 O O   . GLN A 312 ? 0.5937 0.7266 0.5598 -0.0922 -0.0097 0.0300  323 GLN A O   
2389 C CB  . GLN A 312 ? 0.5053 0.6413 0.4865 -0.0850 -0.0178 0.0285  323 GLN A CB  
2390 C CG  . GLN A 312 ? 0.6583 0.8070 0.6540 -0.0798 -0.0178 0.0272  323 GLN A CG  
2391 C CD  . GLN A 312 ? 0.7406 0.8674 0.7307 -0.0722 -0.0298 0.0233  323 GLN A CD  
2392 O OE1 . GLN A 312 ? 0.6386 0.7537 0.6288 -0.0620 -0.0348 0.0190  323 GLN A OE1 
2393 N NE2 . GLN A 312 ? 0.7996 0.9222 0.7849 -0.0766 -0.0348 0.0236  323 GLN A NE2 
2394 N N   . THR A 313 ? 0.4872 0.6255 0.4820 -0.0656 -0.0107 0.0238  324 THR A N   
2395 C CA  . THR A 313 ? 0.4967 0.6181 0.4818 -0.0627 -0.0140 0.0224  324 THR A CA  
2396 C C   . THR A 313 ? 0.5624 0.6728 0.5530 -0.0492 -0.0214 0.0171  324 THR A C   
2397 O O   . THR A 313 ? 0.5553 0.6823 0.5651 -0.0399 -0.0170 0.0143  324 THR A O   
2398 C CB  . THR A 313 ? 0.4843 0.6240 0.4797 -0.0605 -0.0039 0.0221  324 THR A CB  
2399 O OG1 . THR A 313 ? 0.6947 0.8467 0.6832 -0.0735 0.0022  0.0249  324 THR A OG1 
2400 C CG2 . THR A 313 ? 0.4915 0.6146 0.4793 -0.0556 -0.0074 0.0201  324 THR A CG2 
2401 N N   . ALA A 314 ? 0.6651 0.7478 0.6376 -0.0488 -0.0334 0.0150  325 ALA A N   
2402 C CA  . ALA A 314 ? 0.5116 0.5858 0.4885 -0.0354 -0.0417 0.0075  325 ALA A CA  
2403 C C   . ALA A 314 ? 0.5725 0.6435 0.5493 -0.0303 -0.0402 0.0055  325 ALA A C   
2404 O O   . ALA A 314 ? 0.6360 0.6836 0.5936 -0.0327 -0.0479 0.0056  325 ALA A O   
2405 C CB  . ALA A 314 ? 0.5376 0.5833 0.4950 -0.0348 -0.0575 0.0045  325 ALA A CB  
2406 N N   . PHE A 315 ? 0.5322 0.6251 0.5289 -0.0241 -0.0309 0.0038  326 PHE A N   
2407 C CA  . PHE A 315 ? 0.5256 0.6171 0.5237 -0.0192 -0.0290 0.0015  326 PHE A CA  
2408 C C   . PHE A 315 ? 0.6376 0.7157 0.6316 -0.0097 -0.0403 -0.0067 326 PHE A C   
2409 O O   . PHE A 315 ? 0.6497 0.7392 0.6563 -0.0020 -0.0423 -0.0133 326 PHE A O   
2410 C CB  . PHE A 315 ? 0.4615 0.5767 0.4795 -0.0154 -0.0180 0.0016  326 PHE A CB  
2411 C CG  . PHE A 315 ? 0.4554 0.5840 0.4773 -0.0218 -0.0082 0.0076  326 PHE A CG  
2412 C CD1 . PHE A 315 ? 0.4612 0.5884 0.4766 -0.0256 -0.0040 0.0097  326 PHE A CD1 
2413 C CD2 . PHE A 315 ? 0.4804 0.6251 0.5128 -0.0234 -0.0037 0.0099  326 PHE A CD2 
2414 C CE1 . PHE A 315 ? 0.5742 0.7178 0.5944 -0.0301 0.0045  0.0127  326 PHE A CE1 
2415 C CE2 . PHE A 315 ? 0.4989 0.6584 0.5358 -0.0275 0.0042  0.0134  326 PHE A CE2 
2416 C CZ  . PHE A 315 ? 0.5645 0.7246 0.5958 -0.0305 0.0082  0.0142  326 PHE A CZ  
2417 N N   . ASP A 316 ? 0.7157 0.7710 0.6917 -0.0102 -0.0481 -0.0073 327 ASP A N   
2418 C CA  . ASP A 316 ? 0.6254 0.6655 0.5949 0.0000  -0.0612 -0.0163 327 ASP A CA  
2419 C C   . ASP A 316 ? 0.5923 0.6375 0.5674 0.0055  -0.0579 -0.0198 327 ASP A C   
2420 O O   . ASP A 316 ? 0.6051 0.6468 0.5742 -0.0006 -0.0518 -0.0140 327 ASP A O   
2421 C CB  . ASP A 316 ? 0.5604 0.5656 0.5015 -0.0037 -0.0755 -0.0148 327 ASP A CB  
2422 C CG  . ASP A 316 ? 1.0110 0.9989 0.9444 0.0094  -0.0919 -0.0257 327 ASP A CG  
2423 O OD1 . ASP A 316 ? 1.0045 0.9768 0.9262 0.0119  -0.0973 -0.0272 327 ASP A OD1 
2424 O OD2 . ASP A 316 ? 1.1513 1.1427 1.0908 0.0181  -0.0997 -0.0338 327 ASP A OD2 
2425 N N   . PHE A 317 ? 0.5573 0.6128 0.5440 0.0164  -0.0620 -0.0301 328 PHE A N   
2426 C CA  . PHE A 317 ? 0.5855 0.6488 0.5791 0.0214  -0.0591 -0.0348 328 PHE A CA  
2427 C C   . PHE A 317 ? 0.6118 0.6581 0.5942 0.0311  -0.0742 -0.0446 328 PHE A C   
2428 O O   . PHE A 317 ? 0.6665 0.7011 0.6414 0.0373  -0.0873 -0.0509 328 PHE A O   
2429 C CB  . PHE A 317 ? 0.6293 0.7226 0.6454 0.0241  -0.0507 -0.0396 328 PHE A CB  
2430 C CG  . PHE A 317 ? 0.7250 0.8332 0.7513 0.0166  -0.0390 -0.0313 328 PHE A CG  
2431 C CD1 . PHE A 317 ? 0.7361 0.8507 0.7667 0.0117  -0.0280 -0.0244 328 PHE A CD1 
2432 C CD2 . PHE A 317 ? 0.8072 0.9221 0.8379 0.0156  -0.0401 -0.0312 328 PHE A CD2 
2433 C CE1 . PHE A 317 ? 0.6298 0.7567 0.6688 0.0067  -0.0192 -0.0180 328 PHE A CE1 
2434 C CE2 . PHE A 317 ? 0.7657 0.8938 0.8051 0.0095  -0.0303 -0.0240 328 PHE A CE2 
2435 C CZ  . PHE A 317 ? 0.6741 0.8079 0.7174 0.0054  -0.0203 -0.0175 328 PHE A CZ  
2436 N N   . THR A 318 ? 0.6753 0.7195 0.6561 0.0334  -0.0733 -0.0465 329 THR A N   
2437 C CA  . THR A 318 ? 0.7275 0.7562 0.6977 0.0435  -0.0878 -0.0563 329 THR A CA  
2438 C C   . THR A 318 ? 0.6028 0.6557 0.5907 0.0549  -0.0911 -0.0714 329 THR A C   
2439 O O   . THR A 318 ? 0.5758 0.6212 0.5580 0.0654  -0.1035 -0.0822 329 THR A O   
2440 C CB  . THR A 318 ? 0.6686 0.6848 0.6285 0.0404  -0.0855 -0.0520 329 THR A CB  
2441 O OG1 . THR A 318 ? 0.7560 0.7973 0.7343 0.0408  -0.0739 -0.0543 329 THR A OG1 
2442 C CG2 . THR A 318 ? 0.6542 0.6558 0.5999 0.0269  -0.0788 -0.0380 329 THR A CG2 
2443 N N   . SER A 319 ? 0.5686 0.6511 0.5765 0.0525  -0.0808 -0.0730 330 SER A N   
2444 C CA  . SER A 319 ? 0.5625 0.6732 0.5871 0.0601  -0.0825 -0.0876 330 SER A CA  
2445 C C   . SER A 319 ? 0.6395 0.7722 0.6776 0.0568  -0.0768 -0.0883 330 SER A C   
2446 O O   . SER A 319 ? 0.6634 0.7895 0.6991 0.0490  -0.0708 -0.0768 330 SER A O   
2447 C CB  . SER A 319 ? 0.5331 0.6612 0.5675 0.0571  -0.0730 -0.0892 330 SER A CB  
2448 O OG  . SER A 319 ? 0.4719 0.5984 0.5071 0.0458  -0.0591 -0.0749 330 SER A OG  
2449 N N   . ARG A 320 ? 0.6452 0.8062 0.6976 0.0623  -0.0788 -0.1027 331 ARG A N   
2450 C CA  . ARG A 320 ? 0.7102 0.8942 0.7748 0.0591  -0.0742 -0.1051 331 ARG A CA  
2451 C C   . ARG A 320 ? 0.6786 0.8716 0.7496 0.0452  -0.0578 -0.0913 331 ARG A C   
2452 O O   . ARG A 320 ? 0.6447 0.8373 0.7159 0.0393  -0.0496 -0.0851 331 ARG A O   
2453 C CB  . ARG A 320 ? 0.8471 1.0656 0.9262 0.0651  -0.0775 -0.1241 331 ARG A CB  
2454 C CG  . ARG A 320 ? 1.0347 1.2495 1.1099 0.0818  -0.0954 -0.1417 331 ARG A CG  
2455 C CD  . ARG A 320 ? 1.1660 1.4236 1.2584 0.0864  -0.0964 -0.1620 331 ARG A CD  
2456 N NE  . ARG A 320 ? 1.3904 1.6484 1.4807 0.1043  -0.1139 -0.1814 331 ARG A NE  
2457 C CZ  . ARG A 320 ? 1.5340 1.8305 1.6387 0.1109  -0.1172 -0.2025 331 ARG A CZ  
2458 N NH1 . ARG A 320 ? 1.5756 1.9124 1.6960 0.0985  -0.1034 -0.2058 331 ARG A NH1 
2459 N NH2 . ARG A 320 ? 1.5824 1.8776 1.6846 0.1294  -0.1349 -0.2210 331 ARG A NH2 
2460 N N   . VAL A 321 ? 0.6416 0.8417 0.7170 0.0408  -0.0543 -0.0871 332 VAL A N   
2461 C CA  . VAL A 321 ? 0.5215 0.7315 0.6030 0.0292  -0.0410 -0.0760 332 VAL A CA  
2462 C C   . VAL A 321 ? 0.4842 0.7269 0.5785 0.0254  -0.0371 -0.0854 332 VAL A C   
2463 O O   . VAL A 321 ? 0.6007 0.8584 0.7007 0.0278  -0.0408 -0.0933 332 VAL A O   
2464 C CB  . VAL A 321 ? 0.4212 0.6196 0.4988 0.0257  -0.0394 -0.0653 332 VAL A CB  
2465 C CG1 . VAL A 321 ? 0.4090 0.6161 0.4920 0.0155  -0.0272 -0.0545 332 VAL A CG1 
2466 C CG2 . VAL A 321 ? 0.4353 0.6038 0.4982 0.0273  -0.0440 -0.0576 332 VAL A CG2 
2467 N N   . ILE A 322 ? 0.4306 0.6846 0.5280 0.0184  -0.0298 -0.0850 333 ILE A N   
2468 C CA  . ILE A 322 ? 0.6158 0.9014 0.7223 0.0113  -0.0256 -0.0939 333 ILE A CA  
2469 C C   . ILE A 322 ? 0.7009 0.9877 0.8064 -0.0022 -0.0153 -0.0813 333 ILE A C   
2470 O O   . ILE A 322 ? 0.8446 1.1473 0.9512 -0.0128 -0.0098 -0.0829 333 ILE A O   
2471 C CB  . ILE A 322 ? 0.6119 0.9109 0.7205 0.0113  -0.0263 -0.1044 333 ILE A CB  
2472 C CG1 . ILE A 322 ? 0.6233 0.9004 0.7238 0.0074  -0.0212 -0.0928 333 ILE A CG1 
2473 C CG2 . ILE A 322 ? 0.7716 1.0736 0.8821 0.0262  -0.0386 -0.1201 333 ILE A CG2 
2474 C CD1 . ILE A 322 ? 0.5629 0.8466 0.6637 0.0099  -0.0237 -0.1025 333 ILE A CD1 
2475 N N   . GLY A 323 ? 0.6280 0.8973 0.7299 -0.0023 -0.0136 -0.0690 334 GLY A N   
2476 C CA  . GLY A 323 ? 0.4832 0.7509 0.5832 -0.0125 -0.0060 -0.0573 334 GLY A CA  
2477 C C   . GLY A 323 ? 0.3904 0.6327 0.4841 -0.0106 -0.0037 -0.0436 334 GLY A C   
2478 O O   . GLY A 323 ? 0.4996 0.7264 0.5888 -0.0057 -0.0049 -0.0416 334 GLY A O   
2479 N N   . PHE A 324 ? 0.4936 0.7338 0.5871 -0.0146 -0.0004 -0.0349 335 PHE A N   
2480 C CA  . PHE A 324 ? 0.4137 0.6358 0.5027 -0.0132 0.0022  -0.0235 335 PHE A CA  
2481 C C   . PHE A 324 ? 0.4417 0.6664 0.5305 -0.0194 0.0058  -0.0160 335 PHE A C   
2482 O O   . PHE A 324 ? 0.4746 0.7134 0.5664 -0.0244 0.0058  -0.0187 335 PHE A O   
2483 C CB  . PHE A 324 ? 0.4956 0.7081 0.5837 -0.0067 -0.0014 -0.0222 335 PHE A CB  
2484 C CG  . PHE A 324 ? 0.3872 0.6071 0.4789 -0.0073 -0.0030 -0.0221 335 PHE A CG  
2485 C CD1 . PHE A 324 ? 0.3856 0.6019 0.4771 -0.0092 -0.0001 -0.0133 335 PHE A CD1 
2486 C CD2 . PHE A 324 ? 0.3860 0.6181 0.4817 -0.0052 -0.0081 -0.0319 335 PHE A CD2 
2487 C CE1 . PHE A 324 ? 0.4221 0.6452 0.5167 -0.0102 -0.0016 -0.0131 335 PHE A CE1 
2488 C CE2 . PHE A 324 ? 0.4402 0.6786 0.5389 -0.0055 -0.0099 -0.0322 335 PHE A CE2 
2489 C CZ  . PHE A 324 ? 0.5020 0.7352 0.5998 -0.0085 -0.0065 -0.0222 335 PHE A CZ  
2490 N N   . THR A 325 ? 0.4632 0.6746 0.5479 -0.0186 0.0082  -0.0074 336 THR A N   
2491 C CA  . THR A 325 ? 0.3955 0.6054 0.4782 -0.0224 0.0097  -0.0003 336 THR A CA  
2492 C C   . THR A 325 ? 0.3964 0.5964 0.4788 -0.0162 0.0106  0.0059  336 THR A C   
2493 O O   . THR A 325 ? 0.8027 0.9966 0.8848 -0.0113 0.0109  0.0053  336 THR A O   
2494 C CB  . THR A 325 ? 0.4054 0.6104 0.4801 -0.0297 0.0103  0.0017  336 THR A CB  
2495 O OG1 . THR A 325 ? 0.4144 0.6170 0.4849 -0.0340 0.0098  0.0079  336 THR A OG1 
2496 C CG2 . THR A 325 ? 0.4130 0.6015 0.4820 -0.0256 0.0105  0.0043  336 THR A CG2 
2497 N N   . VAL A 326 ? 0.5003 0.7004 0.5824 -0.0169 0.0106  0.0112  337 VAL A N   
2498 C CA  . VAL A 326 ? 0.7165 0.9127 0.7998 -0.0109 0.0112  0.0154  337 VAL A CA  
2499 C C   . VAL A 326 ? 0.4106 0.5972 0.4876 -0.0101 0.0092  0.0197  337 VAL A C   
2500 O O   . VAL A 326 ? 0.4913 0.6780 0.5649 -0.0149 0.0073  0.0223  337 VAL A O   
2501 C CB  . VAL A 326 ? 0.3922 0.5986 0.4815 -0.0106 0.0114  0.0166  337 VAL A CB  
2502 C CG1 . VAL A 326 ? 0.3935 0.6006 0.4846 -0.0052 0.0124  0.0191  337 VAL A CG1 
2503 C CG2 . VAL A 326 ? 0.3863 0.5971 0.4781 -0.0116 0.0109  0.0122  337 VAL A CG2 
2504 N N   . LEU A 327 ? 0.4480 0.6251 0.5220 -0.0040 0.0088  0.0199  338 LEU A N   
2505 C CA  . LEU A 327 ? 0.5312 0.6953 0.5973 -0.0007 0.0047  0.0229  338 LEU A CA  
2506 C C   . LEU A 327 ? 0.6140 0.7843 0.6846 0.0056  0.0029  0.0245  338 LEU A C   
2507 O O   . LEU A 327 ? 0.6463 0.8284 0.7251 0.0108  0.0057  0.0223  338 LEU A O   
2508 C CB  . LEU A 327 ? 0.4484 0.6011 0.5103 0.0052  0.0040  0.0208  338 LEU A CB  
2509 C CG  . LEU A 327 ? 0.5912 0.7305 0.6434 -0.0007 0.0030  0.0204  338 LEU A CG  
2510 C CD1 . LEU A 327 ? 0.6038 0.7537 0.6598 -0.0090 0.0066  0.0176  338 LEU A CD1 
2511 C CD2 . LEU A 327 ? 0.4793 0.6090 0.5288 0.0065  0.0026  0.0178  338 LEU A CD2 
2512 N N   . THR A 328 ? 0.6139 0.7768 0.6777 0.0041  -0.0020 0.0281  339 THR A N   
2513 C CA  . THR A 328 ? 0.5799 0.7486 0.6473 0.0104  -0.0050 0.0292  339 THR A CA  
2514 C C   . THR A 328 ? 0.6324 0.7824 0.6887 0.0182  -0.0136 0.0302  339 THR A C   
2515 O O   . THR A 328 ? 0.7385 0.8675 0.7803 0.0136  -0.0182 0.0329  339 THR A O   
2516 C CB  . THR A 328 ? 0.6444 0.8209 0.7129 0.0026  -0.0050 0.0324  339 THR A CB  
2517 O OG1 . THR A 328 ? 0.8527 1.0146 0.9076 -0.0064 -0.0087 0.0360  339 THR A OG1 
2518 C CG2 . THR A 328 ? 0.4960 0.6892 0.5744 -0.0032 0.0015  0.0302  339 THR A CG2 
2519 N N   . GLU A 329 ? 0.4688 0.6263 0.5310 0.0299  -0.0165 0.0273  340 GLU A N   
2520 C CA  . GLU A 329 ? 0.4922 0.6321 0.5441 0.0406  -0.0270 0.0265  340 GLU A CA  
2521 C C   . GLU A 329 ? 0.5095 0.6324 0.5476 0.0357  -0.0351 0.0326  340 GLU A C   
2522 O O   . GLU A 329 ? 0.6403 0.7412 0.6647 0.0435  -0.0464 0.0329  340 GLU A O   
2523 C CB  . GLU A 329 ? 0.7395 0.8981 0.8034 0.0550  -0.0282 0.0195  340 GLU A CB  
2524 C CG  . GLU A 329 ? 0.9121 1.0881 0.9872 0.0596  -0.0211 0.0127  340 GLU A CG  
2525 C CD  . GLU A 329 ? 0.9136 1.1125 0.9999 0.0726  -0.0225 0.0043  340 GLU A CD  
2526 O OE1 . GLU A 329 ? 0.8957 1.0952 0.9814 0.0802  -0.0300 0.0032  340 GLU A OE1 
2527 O OE2 . GLU A 329 ? 0.8992 1.1168 0.9945 0.0747  -0.0162 -0.0019 340 GLU A OE2 
2528 N N   . ALA A 330 ? 0.5427 0.6740 0.5825 0.0231  -0.0306 0.0370  341 ALA A N   
2529 C CA  . ALA A 330 ? 0.6607 0.7818 0.6892 0.0177  -0.0372 0.0425  341 ALA A CA  
2530 C C   . ALA A 330 ? 0.7917 0.8898 0.7999 0.0031  -0.0404 0.0481  341 ALA A C   
2531 O O   . ALA A 330 ? 0.8713 0.9712 0.8795 -0.0060 -0.0343 0.0475  341 ALA A O   
2532 C CB  . ALA A 330 ? 0.4913 0.6371 0.5330 0.0118  -0.0306 0.0432  341 ALA A CB  
2533 N N   . ASP A 331 ? 0.7480 0.8250 0.7378 0.0004  -0.0506 0.0532  342 ASP A N   
2534 C CA  . ASP A 331 ? 0.6584 0.7177 0.6270 -0.0179 -0.0536 0.0597  342 ASP A CA  
2535 C C   . ASP A 331 ? 0.8280 0.9045 0.8005 -0.0282 -0.0500 0.0625  342 ASP A C   
2536 O O   . ASP A 331 ? 0.8563 0.9523 0.8450 -0.0194 -0.0477 0.0603  342 ASP A O   
2537 C CB  . ASP A 331 ? 0.6477 0.6668 0.5880 -0.0159 -0.0691 0.0642  342 ASP A CB  
2538 C CG  . ASP A 331 ? 0.9102 0.9208 0.8442 -0.0076 -0.0796 0.0665  342 ASP A CG  
2539 O OD1 . ASP A 331 ? 1.1049 1.1390 1.0600 0.0065  -0.0768 0.0616  342 ASP A OD1 
2540 O OD2 . ASP A 331 ? 1.0751 1.0553 0.9816 -0.0159 -0.0911 0.0731  342 ASP A OD2 
2541 N N   . PRO A 332 ? 0.7552 0.8274 0.7130 -0.0479 -0.0491 0.0666  343 PRO A N   
2542 C CA  . PRO A 332 ? 0.7251 0.8166 0.6872 -0.0580 -0.0453 0.0682  343 PRO A CA  
2543 C C   . PRO A 332 ? 0.6458 0.7308 0.6040 -0.0503 -0.0535 0.0717  343 PRO A C   
2544 O O   . PRO A 332 ? 0.6088 0.7139 0.5761 -0.0544 -0.0495 0.0717  343 PRO A O   
2545 C CB  . PRO A 332 ? 0.5854 0.6673 0.5255 -0.0810 -0.0458 0.0720  343 PRO A CB  
2546 C CG  . PRO A 332 ? 0.5872 0.6622 0.5248 -0.0832 -0.0431 0.0692  343 PRO A CG  
2547 C CD  . PRO A 332 ? 0.7950 0.8518 0.7350 -0.0630 -0.0492 0.0684  343 PRO A CD  
2548 N N   . ALA A 333 ? 0.6017 0.6593 0.5468 -0.0381 -0.0657 0.0736  344 ALA A N   
2549 C CA  . ALA A 333 ? 0.6961 0.7455 0.6360 -0.0289 -0.0757 0.0760  344 ALA A CA  
2550 C C   . ALA A 333 ? 0.7448 0.8119 0.7077 -0.0065 -0.0753 0.0691  344 ALA A C   
2551 O O   . ALA A 333 ? 0.8174 0.8841 0.7802 0.0030  -0.0830 0.0691  344 ALA A O   
2552 C CB  . ALA A 333 ? 0.7507 0.7551 0.6568 -0.0298 -0.0928 0.0819  344 ALA A CB  
2553 N N   . ALA A 334 ? 0.7525 0.8365 0.7343 0.0013  -0.0668 0.0628  345 ALA A N   
2554 C CA  . ALA A 334 ? 0.6444 0.7479 0.6465 0.0199  -0.0657 0.0555  345 ALA A CA  
2555 C C   . ALA A 334 ? 0.5443 0.6806 0.5665 0.0182  -0.0573 0.0539  345 ALA A C   
2556 O O   . ALA A 334 ? 0.5962 0.7431 0.6205 0.0039  -0.0501 0.0570  345 ALA A O   
2557 C CB  . ALA A 334 ? 0.5454 0.6567 0.5591 0.0261  -0.0589 0.0497  345 ALA A CB  
2558 N N   . THR A 335 ? 0.5232 0.6771 0.5601 0.0330  -0.0584 0.0480  346 THR A N   
2559 C CA  . THR A 335 ? 0.5002 0.6839 0.5545 0.0315  -0.0516 0.0464  346 THR A CA  
2560 C C   . THR A 335 ? 0.4713 0.6784 0.5428 0.0255  -0.0379 0.0434  346 THR A C   
2561 O O   . THR A 335 ? 0.7019 0.9225 0.7796 0.0151  -0.0313 0.0452  346 THR A O   
2562 C CB  . THR A 335 ? 0.5035 0.7001 0.5667 0.0481  -0.0579 0.0402  346 THR A CB  
2563 O OG1 . THR A 335 ? 0.5336 0.7054 0.5787 0.0544  -0.0728 0.0429  346 THR A OG1 
2564 C CG2 . THR A 335 ? 0.6111 0.8389 0.6915 0.0448  -0.0506 0.0385  346 THR A CG2 
2565 N N   . PHE A 336 ? 0.4783 0.6888 0.5560 0.0321  -0.0347 0.0384  347 PHE A N   
2566 C CA  . PHE A 336 ? 0.6577 0.8870 0.7488 0.0271  -0.0235 0.0355  347 PHE A CA  
2567 C C   . PHE A 336 ? 0.6142 0.8291 0.6990 0.0228  -0.0206 0.0361  347 PHE A C   
2568 O O   . PHE A 336 ? 0.7166 0.9108 0.7899 0.0274  -0.0268 0.0366  347 PHE A O   
2569 C CB  . PHE A 336 ? 0.4347 0.6866 0.5397 0.0368  -0.0208 0.0283  347 PHE A CB  
2570 C CG  . PHE A 336 ? 0.6931 0.9614 0.8048 0.0430  -0.0247 0.0259  347 PHE A CG  
2571 C CD1 . PHE A 336 ? 0.7044 0.9871 0.8222 0.0345  -0.0207 0.0283  347 PHE A CD1 
2572 C CD2 . PHE A 336 ? 0.5264 0.7962 0.6382 0.0582  -0.0331 0.0201  347 PHE A CD2 
2573 C CE1 . PHE A 336 ? 0.6304 0.9292 0.7544 0.0399  -0.0243 0.0258  347 PHE A CE1 
2574 C CE2 . PHE A 336 ? 0.4500 0.7372 0.5687 0.0648  -0.0373 0.0166  347 PHE A CE2 
2575 C CZ  . PHE A 336 ? 0.4365 0.7385 0.5614 0.0550  -0.0324 0.0198  347 PHE A CZ  
2576 N N   . ASP A 337 ? 0.5878 0.8125 0.6792 0.0143  -0.0122 0.0356  348 ASP A N   
2577 C CA  . ASP A 337 ? 0.4280 0.6422 0.5150 0.0103  -0.0091 0.0352  348 ASP A CA  
2578 C C   . ASP A 337 ? 0.5808 0.7942 0.6703 0.0199  -0.0088 0.0308  348 ASP A C   
2579 O O   . ASP A 337 ? 0.5859 0.7815 0.6661 0.0230  -0.0126 0.0308  348 ASP A O   
2580 C CB  . ASP A 337 ? 0.4111 0.6366 0.5047 0.0013  -0.0021 0.0343  348 ASP A CB  
2581 C CG  . ASP A 337 ? 0.6503 0.8750 0.7396 -0.0088 -0.0024 0.0368  348 ASP A CG  
2582 O OD1 . ASP A 337 ? 0.6376 0.8490 0.7159 -0.0140 -0.0049 0.0388  348 ASP A OD1 
2583 O OD2 . ASP A 337 ? 0.6192 0.8574 0.7151 -0.0123 -0.0004 0.0364  348 ASP A OD2 
2584 N N   . ASP A 338 ? 0.6475 0.8806 0.7485 0.0236  -0.0043 0.0265  349 ASP A N   
2585 C CA  . ASP A 338 ? 0.6099 0.8486 0.7146 0.0310  -0.0025 0.0211  349 ASP A CA  
2586 C C   . ASP A 338 ? 0.5212 0.7470 0.6207 0.0272  0.0004  0.0213  349 ASP A C   
2587 O O   . ASP A 338 ? 0.4707 0.6806 0.5627 0.0325  -0.0037 0.0206  349 ASP A O   
2588 C CB  . ASP A 338 ? 0.6375 0.8717 0.7397 0.0447  -0.0104 0.0173  349 ASP A CB  
2589 C CG  . ASP A 338 ? 0.6196 0.8744 0.7305 0.0510  -0.0125 0.0137  349 ASP A CG  
2590 O OD1 . ASP A 338 ? 0.6117 0.8901 0.7329 0.0461  -0.0058 0.0116  349 ASP A OD1 
2591 O OD2 . ASP A 338 ? 0.6061 0.8526 0.7123 0.0606  -0.0218 0.0128  349 ASP A OD2 
2592 N N   . PRO A 339 ? 0.5148 0.7454 0.6168 0.0187  0.0062  0.0219  350 PRO A N   
2593 C CA  . PRO A 339 ? 0.5774 0.7972 0.6749 0.0160  0.0084  0.0212  350 PRO A CA  
2594 C C   . PRO A 339 ? 0.5739 0.7985 0.6732 0.0220  0.0106  0.0166  350 PRO A C   
2595 O O   . PRO A 339 ? 0.6937 0.9341 0.7989 0.0267  0.0115  0.0131  350 PRO A O   
2596 C CB  . PRO A 339 ? 0.5764 0.8009 0.6759 0.0070  0.0120  0.0219  350 PRO A CB  
2597 C CG  . PRO A 339 ? 0.4178 0.6584 0.5237 0.0056  0.0135  0.0219  350 PRO A CG  
2598 C CD  . PRO A 339 ? 0.5752 0.8196 0.6830 0.0115  0.0097  0.0228  350 PRO A CD  
2599 N N   . TYR A 340 ? 0.5140 0.7268 0.6082 0.0212  0.0116  0.0158  351 TYR A N   
2600 C CA  . TYR A 340 ? 0.4870 0.7037 0.5819 0.0262  0.0137  0.0112  351 TYR A CA  
2601 C C   . TYR A 340 ? 0.4620 0.6683 0.5518 0.0217  0.0161  0.0111  351 TYR A C   
2602 O O   . TYR A 340 ? 0.6312 0.8405 0.7204 0.0237  0.0186  0.0077  351 TYR A O   
2603 C CB  . TYR A 340 ? 0.4857 0.6965 0.5784 0.0376  0.0085  0.0080  351 TYR A CB  
2604 C CG  . TYR A 340 ? 0.4876 0.6735 0.5698 0.0382  0.0031  0.0110  351 TYR A CG  
2605 C CD1 . TYR A 340 ? 0.4878 0.6612 0.5641 0.0394  0.0032  0.0092  351 TYR A CD1 
2606 C CD2 . TYR A 340 ? 0.4898 0.6645 0.5661 0.0362  -0.0022 0.0155  351 TYR A CD2 
2607 C CE1 . TYR A 340 ? 0.4847 0.6353 0.5497 0.0379  -0.0018 0.0119  351 TYR A CE1 
2608 C CE2 . TYR A 340 ? 0.5385 0.6898 0.6020 0.0336  -0.0073 0.0185  351 TYR A CE2 
2609 C CZ  . TYR A 340 ? 0.5374 0.6768 0.5952 0.0342  -0.0070 0.0167  351 TYR A CZ  
2610 O OH  . TYR A 340 ? 0.4859 0.6019 0.5293 0.0297  -0.0122 0.0197  351 TYR A OH  
2611 N N   . ALA A 341 ? 0.4725 0.6684 0.5587 0.0156  0.0152  0.0140  352 ALA A N   
2612 C CA  . ALA A 341 ? 0.5240 0.7109 0.6058 0.0124  0.0164  0.0128  352 ALA A CA  
2613 C C   . ALA A 341 ? 0.6298 0.8163 0.7116 0.0054  0.0160  0.0136  352 ALA A C   
2614 O O   . ALA A 341 ? 0.7198 0.9081 0.8028 0.0026  0.0143  0.0155  352 ALA A O   
2615 C CB  . ALA A 341 ? 0.4943 0.6665 0.5698 0.0155  0.0139  0.0122  352 ALA A CB  
2616 N N   . LEU A 342 ? 0.6266 0.8109 0.7064 0.0029  0.0167  0.0114  353 LEU A N   
2617 C CA  . LEU A 342 ? 0.4382 0.6219 0.5177 -0.0012 0.0146  0.0095  353 LEU A CA  
2618 C C   . LEU A 342 ? 0.4039 0.5795 0.4793 -0.0009 0.0136  0.0060  353 LEU A C   
2619 O O   . LEU A 342 ? 0.6035 0.7736 0.6751 0.0005  0.0138  0.0045  353 LEU A O   
2620 C CB  . LEU A 342 ? 0.3994 0.5856 0.4780 -0.0036 0.0137  0.0092  353 LEU A CB  
2621 C CG  . LEU A 342 ? 0.4490 0.6319 0.5257 -0.0050 0.0093  0.0051  353 LEU A CG  
2622 C CD1 . LEU A 342 ? 0.3936 0.5851 0.4759 -0.0064 0.0081  0.0035  353 LEU A CD1 
2623 C CD2 . LEU A 342 ? 0.4813 0.6600 0.5525 -0.0073 0.0064  0.0053  353 LEU A CD2 
2624 N N   . VAL A 343 ? 0.4734 0.6491 0.5488 -0.0033 0.0126  0.0046  354 VAL A N   
2625 C CA  . VAL A 343 ? 0.4388 0.6099 0.5110 -0.0042 0.0118  0.0003  354 VAL A CA  
2626 C C   . VAL A 343 ? 0.4395 0.6182 0.5143 -0.0056 0.0089  -0.0059 354 VAL A C   
2627 O O   . VAL A 343 ? 0.5018 0.6908 0.5803 -0.0090 0.0080  -0.0075 354 VAL A O   
2628 C CB  . VAL A 343 ? 0.4135 0.5809 0.4819 -0.0080 0.0120  0.0015  354 VAL A CB  
2629 C CG1 . VAL A 343 ? 0.4168 0.5820 0.4819 -0.0103 0.0115  -0.0035 354 VAL A CG1 
2630 C CG2 . VAL A 343 ? 0.4386 0.5960 0.5032 -0.0040 0.0124  0.0064  354 VAL A CG2 
2631 N N   . VAL A 344 ? 0.4052 0.5790 0.4775 -0.0024 0.0064  -0.0101 355 VAL A N   
2632 C CA  . VAL A 344 ? 0.4448 0.6237 0.5185 -0.0008 0.0013  -0.0179 355 VAL A CA  
2633 C C   . VAL A 344 ? 0.4075 0.5863 0.4797 0.0003  -0.0003 -0.0246 355 VAL A C   
2634 O O   . VAL A 344 ? 0.5106 0.6781 0.5775 0.0030  -0.0005 -0.0237 355 VAL A O   
2635 C CB  . VAL A 344 ? 0.5927 0.7625 0.6617 0.0026  -0.0032 -0.0177 355 VAL A CB  
2636 C CG1 . VAL A 344 ? 0.6027 0.7747 0.6716 0.0067  -0.0111 -0.0272 355 VAL A CG1 
2637 C CG2 . VAL A 344 ? 0.6261 0.7982 0.6967 0.0002  -0.0013 -0.0116 355 VAL A CG2 
2638 N N   . LEU A 345 ? 0.4046 0.5983 0.4814 -0.0024 -0.0013 -0.0318 356 LEU A N   
2639 C CA  . LEU A 345 ? 0.5554 0.7544 0.6322 -0.0021 -0.0030 -0.0402 356 LEU A CA  
2640 C C   . LEU A 345 ? 0.5422 0.7447 0.6204 0.0057  -0.0111 -0.0505 356 LEU A C   
2641 O O   . LEU A 345 ? 0.4416 0.6614 0.5260 0.0065  -0.0143 -0.0593 356 LEU A O   
2642 C CB  . LEU A 345 ? 0.4051 0.6211 0.4848 -0.0112 0.0002  -0.0437 356 LEU A CB  
2643 C CG  . LEU A 345 ? 0.4073 0.6352 0.4880 -0.0129 -0.0012 -0.0542 356 LEU A CG  
2644 C CD1 . LEU A 345 ? 0.4134 0.6247 0.4874 -0.0122 0.0003  -0.0502 356 LEU A CD1 
2645 C CD2 . LEU A 345 ? 0.4141 0.6630 0.4966 -0.0250 0.0020  -0.0584 356 LEU A CD2 
2646 N N   . ALA A 346 ? 0.6122 0.7979 0.6836 0.0119  -0.0152 -0.0501 357 ALA A N   
2647 C CA  . ALA A 346 ? 0.5538 0.7372 0.6230 0.0204  -0.0254 -0.0601 357 ALA A CA  
2648 C C   . ALA A 346 ? 0.7182 0.9164 0.7918 0.0228  -0.0280 -0.0725 357 ALA A C   
2649 O O   . ALA A 346 ? 0.7791 0.9853 0.8550 0.0164  -0.0216 -0.0716 357 ALA A O   
2650 C CB  . ALA A 346 ? 0.6550 0.8125 0.7116 0.0244  -0.0299 -0.0548 357 ALA A CB  
2651 N N   . GLU A 347 ? 0.7640 0.9659 0.8380 0.0323  -0.0386 -0.0850 358 GLU A N   
2652 C CA  . GLU A 347 ? 0.6311 0.8514 0.7107 0.0360  -0.0424 -0.0994 358 GLU A CA  
2653 C C   . GLU A 347 ? 0.5325 0.7393 0.6053 0.0364  -0.0416 -0.0970 358 GLU A C   
2654 O O   . GLU A 347 ? 0.5696 0.7933 0.6474 0.0354  -0.0410 -0.1062 358 GLU A O   
2655 C CB  . GLU A 347 ? 0.6604 0.8857 0.7410 0.0491  -0.0563 -0.1146 358 GLU A CB  
2656 C CG  . GLU A 347 ? 0.8110 1.0630 0.9002 0.0545  -0.0612 -0.1333 358 GLU A CG  
2657 C CD  . GLU A 347 ? 1.0292 1.2935 1.1227 0.0681  -0.0749 -0.1508 358 GLU A CD  
2658 O OE1 . GLU A 347 ? 1.0561 1.3514 1.1616 0.0657  -0.0726 -0.1601 358 GLU A OE1 
2659 O OE2 . GLU A 347 ? 1.0292 1.2712 1.1127 0.0813  -0.0887 -0.1556 358 GLU A OE2 
2660 N N   . GLU A 348 ? 0.6159 0.7947 0.6774 0.0367  -0.0412 -0.0853 359 GLU A N   
2661 C CA  . GLU A 348 ? 0.6325 0.7974 0.6865 0.0373  -0.0407 -0.0828 359 GLU A CA  
2662 C C   . GLU A 348 ? 0.6426 0.7953 0.6924 0.0292  -0.0303 -0.0685 359 GLU A C   
2663 O O   . GLU A 348 ? 0.8022 0.9471 0.8473 0.0286  -0.0283 -0.0670 359 GLU A O   
2664 C CB  . GLU A 348 ? 0.6087 0.7502 0.6496 0.0467  -0.0528 -0.0852 359 GLU A CB  
2665 C CG  . GLU A 348 ? 0.5952 0.7450 0.6382 0.0583  -0.0664 -0.1015 359 GLU A CG  
2666 C CD  . GLU A 348 ? 0.6867 0.8583 0.7383 0.0614  -0.0675 -0.1149 359 GLU A CD  
2667 O OE1 . GLU A 348 ? 0.6105 0.7792 0.6603 0.0564  -0.0611 -0.1106 359 GLU A OE1 
2668 O OE2 . GLU A 348 ? 0.6888 0.8821 0.7492 0.0689  -0.0749 -0.1308 359 GLU A OE2 
2669 N N   . GLU A 349 ? 0.6939 0.8458 0.7453 0.0239  -0.0243 -0.0592 360 GLU A N   
2670 C CA  . GLU A 349 ? 0.5685 0.7099 0.6161 0.0187  -0.0161 -0.0476 360 GLU A CA  
2671 C C   . GLU A 349 ? 0.5214 0.6711 0.5751 0.0132  -0.0099 -0.0412 360 GLU A C   
2672 O O   . GLU A 349 ? 0.5966 0.7585 0.6564 0.0126  -0.0116 -0.0446 360 GLU A O   
2673 C CB  . GLU A 349 ? 0.6268 0.7477 0.6628 0.0207  -0.0186 -0.0416 360 GLU A CB  
2674 C CG  . GLU A 349 ? 0.7260 0.8403 0.7574 0.0222  -0.0246 -0.0405 360 GLU A CG  
2675 C CD  . GLU A 349 ? 0.9046 0.9975 0.9205 0.0211  -0.0280 -0.0350 360 GLU A CD  
2676 O OE1 . GLU A 349 ? 0.9305 1.0170 0.9411 0.0189  -0.0238 -0.0313 360 GLU A OE1 
2677 O OE2 . GLU A 349 ? 0.9841 1.0661 0.9916 0.0216  -0.0353 -0.0346 360 GLU A OE2 
2678 N N   . LEU A 350 ? 0.4854 0.6287 0.5372 0.0098  -0.0034 -0.0327 361 LEU A N   
2679 C CA  . LEU A 350 ? 0.4503 0.5979 0.5058 0.0059  0.0015  -0.0261 361 LEU A CA  
2680 C C   . LEU A 350 ? 0.5185 0.6571 0.5702 0.0072  0.0037  -0.0188 361 LEU A C   
2681 O O   . LEU A 350 ? 0.6225 0.7523 0.6687 0.0085  0.0053  -0.0170 361 LEU A O   
2682 C CB  . LEU A 350 ? 0.4259 0.5750 0.4817 0.0012  0.0058  -0.0241 361 LEU A CB  
2683 C CG  . LEU A 350 ? 0.4694 0.6197 0.5267 -0.0022 0.0089  -0.0175 361 LEU A CG  
2684 C CD1 . LEU A 350 ? 0.4237 0.5879 0.4866 -0.0059 0.0077  -0.0197 361 LEU A CD1 
2685 C CD2 . LEU A 350 ? 0.5538 0.6970 0.6061 -0.0060 0.0108  -0.0148 361 LEU A CD2 
2686 N N   . VAL A 351 ? 0.4239 0.5667 0.4782 0.0060  0.0039  -0.0155 362 VAL A N   
2687 C CA  . VAL A 351 ? 0.5978 0.7366 0.6488 0.0056  0.0060  -0.0098 362 VAL A CA  
2688 C C   . VAL A 351 ? 0.6246 0.7714 0.6817 0.0042  0.0102  -0.0052 362 VAL A C   
2689 O O   . VAL A 351 ? 0.4939 0.6481 0.5563 0.0026  0.0096  -0.0055 362 VAL A O   
2690 C CB  . VAL A 351 ? 0.4971 0.6312 0.5429 0.0049  0.0007  -0.0104 362 VAL A CB  
2691 C CG1 . VAL A 351 ? 0.4354 0.5673 0.4760 0.0013  0.0035  -0.0047 362 VAL A CG1 
2692 C CG2 . VAL A 351 ? 0.4402 0.5634 0.4781 0.0077  -0.0060 -0.0158 362 VAL A CG2 
2693 N N   . VAL A 352 ? 0.4228 0.5693 0.4789 0.0053  0.0139  -0.0018 363 VAL A N   
2694 C CA  . VAL A 352 ? 0.4199 0.5737 0.4811 0.0061  0.0165  0.0016  363 VAL A CA  
2695 C C   . VAL A 352 ? 0.6191 0.7790 0.6796 0.0052  0.0189  0.0033  363 VAL A C   
2696 O O   . VAL A 352 ? 0.5655 0.7238 0.6212 0.0054  0.0206  0.0023  363 VAL A O   
2697 C CB  . VAL A 352 ? 0.4244 0.5739 0.4852 0.0097  0.0176  0.0017  363 VAL A CB  
2698 C CG1 . VAL A 352 ? 0.4911 0.6460 0.5557 0.0123  0.0180  0.0043  363 VAL A CG1 
2699 C CG2 . VAL A 352 ? 0.4260 0.5697 0.4850 0.0072  0.0155  0.0001  363 VAL A CG2 
2700 N N   . ILE A 353 ? 0.4901 0.6583 0.5546 0.0032  0.0190  0.0056  364 ILE A N   
2701 C CA  . ILE A 353 ? 0.4183 0.5955 0.4819 -0.0001 0.0213  0.0069  364 ILE A CA  
2702 C C   . ILE A 353 ? 0.6032 0.7934 0.6746 0.0037  0.0237  0.0074  364 ILE A C   
2703 O O   . ILE A 353 ? 0.6199 0.8112 0.6963 0.0057  0.0220  0.0089  364 ILE A O   
2704 C CB  . ILE A 353 ? 0.4188 0.5942 0.4789 -0.0061 0.0184  0.0084  364 ILE A CB  
2705 C CG1 . ILE A 353 ? 0.6662 0.8264 0.7171 -0.0076 0.0136  0.0066  364 ILE A CG1 
2706 C CG2 . ILE A 353 ? 0.4226 0.6075 0.4798 -0.0122 0.0209  0.0101  364 ILE A CG2 
2707 C CD1 . ILE A 353 ? 0.6051 0.7585 0.6457 -0.0103 0.0144  0.0063  364 ILE A CD1 
2708 N N   . ASP A 354 ? 0.5067 0.7077 0.5785 0.0049  0.0270  0.0053  365 ASP A N   
2709 C CA  . ASP A 354 ? 0.4169 0.6329 0.4965 0.0105  0.0281  0.0035  365 ASP A CA  
2710 C C   . ASP A 354 ? 0.5271 0.7561 0.6100 0.0049  0.0289  0.0053  365 ASP A C   
2711 O O   . ASP A 354 ? 0.5285 0.7670 0.6079 -0.0028 0.0317  0.0049  365 ASP A O   
2712 C CB  . ASP A 354 ? 0.5830 0.8104 0.6629 0.0143  0.0311  -0.0020 365 ASP A CB  
2713 C CG  . ASP A 354 ? 0.7771 1.0212 0.8657 0.0234  0.0305  -0.0065 365 ASP A CG  
2714 O OD1 . ASP A 354 ? 0.9153 1.1609 1.0086 0.0257  0.0278  -0.0043 365 ASP A OD1 
2715 O OD2 . ASP A 354 ? 0.8132 1.0693 0.9035 0.0289  0.0320  -0.0131 365 ASP A OD2 
2716 N N   . LEU A 355 ? 0.5285 0.7577 0.6168 0.0075  0.0264  0.0076  366 LEU A N   
2717 C CA  . LEU A 355 ? 0.4038 0.6446 0.4955 0.0025  0.0268  0.0094  366 LEU A CA  
2718 C C   . LEU A 355 ? 0.4038 0.6667 0.5028 0.0063  0.0287  0.0057  366 LEU A C   
2719 O O   . LEU A 355 ? 0.5352 0.8114 0.6370 0.0009  0.0299  0.0064  366 LEU A O   
2720 C CB  . LEU A 355 ? 0.3992 0.6323 0.4932 0.0030  0.0233  0.0129  366 LEU A CB  
2721 C CG  . LEU A 355 ? 0.5392 0.7573 0.6280 -0.0013 0.0212  0.0144  366 LEU A CG  
2722 C CD1 . LEU A 355 ? 0.7396 0.9559 0.8316 -0.0015 0.0185  0.0164  366 LEU A CD1 
2723 C CD2 . LEU A 355 ? 0.4006 0.6170 0.4834 -0.0091 0.0211  0.0147  366 LEU A CD2 
2724 N N   . GLN A 356 ? 0.5232 0.7912 0.6254 0.0160  0.0283  0.0008  367 GLN A N   
2725 C CA  . GLN A 356 ? 0.6105 0.9026 0.7208 0.0222  0.0288  -0.0054 367 GLN A CA  
2726 C C   . GLN A 356 ? 0.6734 0.9873 0.7836 0.0166  0.0346  -0.0111 367 GLN A C   
2727 O O   . GLN A 356 ? 0.7096 1.0483 0.8247 0.0123  0.0373  -0.0146 367 GLN A O   
2728 C CB  . GLN A 356 ? 0.5933 0.8793 0.7060 0.0374  0.0233  -0.0094 367 GLN A CB  
2729 C CG  . GLN A 356 ? 0.7304 1.0054 0.8438 0.0425  0.0170  -0.0055 367 GLN A CG  
2730 C CD  . GLN A 356 ? 0.8657 1.1295 0.9770 0.0569  0.0093  -0.0092 367 GLN A CD  
2731 O OE1 . GLN A 356 ? 0.9498 1.2127 1.0597 0.0640  0.0086  -0.0150 367 GLN A OE1 
2732 N NE2 . GLN A 356 ? 0.7345 0.9877 0.8437 0.0612  0.0025  -0.0060 367 GLN A NE2 
2733 N N   . THR A 357 ? 0.6928 0.9991 0.7967 0.0154  0.0365  -0.0126 368 THR A N   
2734 C CA  . THR A 357 ? 0.6791 1.0060 0.7806 0.0082  0.0422  -0.0181 368 THR A CA  
2735 C C   . THR A 357 ? 0.7027 1.0313 0.7957 -0.0097 0.0454  -0.0130 368 THR A C   
2736 O O   . THR A 357 ? 0.6927 0.9968 0.7770 -0.0160 0.0430  -0.0055 368 THR A O   
2737 C CB  . THR A 357 ? 0.7075 1.0225 0.8027 0.0105  0.0429  -0.0201 368 THR A CB  
2738 O OG1 . THR A 357 ? 0.7137 1.0248 0.8148 0.0270  0.0388  -0.0251 368 THR A OG1 
2739 C CG2 . THR A 357 ? 0.7002 1.0378 0.7913 0.0013  0.0490  -0.0259 368 THR A CG2 
2740 N N   . ALA A 358 ? 0.7344 1.0920 0.8288 -0.0181 0.0499  -0.0178 369 ALA A N   
2741 C CA  . ALA A 358 ? 0.5875 0.9456 0.6705 -0.0373 0.0522  -0.0130 369 ALA A CA  
2742 C C   . ALA A 358 ? 0.5946 0.9304 0.6600 -0.0479 0.0522  -0.0086 369 ALA A C   
2743 O O   . ALA A 358 ? 0.7809 1.1222 0.8434 -0.0473 0.0550  -0.0131 369 ALA A O   
2744 C CB  . ALA A 358 ? 0.6537 1.0508 0.7403 -0.0461 0.0578  -0.0203 369 ALA A CB  
2745 N N   . GLY A 359 ? 0.4457 0.7558 0.4989 -0.0570 0.0481  -0.0004 370 GLY A N   
2746 C CA  . GLY A 359 ? 0.6581 0.9412 0.6933 -0.0649 0.0453  0.0040  370 GLY A CA  
2747 C C   . GLY A 359 ? 0.7703 1.0242 0.8062 -0.0538 0.0394  0.0073  370 GLY A C   
2748 O O   . GLY A 359 ? 0.8527 1.0817 0.8736 -0.0592 0.0348  0.0109  370 GLY A O   
2749 N N   . TRP A 360 ? 0.7466 1.0032 0.7982 -0.0391 0.0387  0.0058  371 TRP A N   
2750 C CA  . TRP A 360 ? 0.5202 0.7546 0.5740 -0.0298 0.0339  0.0080  371 TRP A CA  
2751 C C   . TRP A 360 ? 0.4504 0.6692 0.4954 -0.0288 0.0329  0.0072  371 TRP A C   
2752 O O   . TRP A 360 ? 0.5873 0.7849 0.6213 -0.0326 0.0281  0.0098  371 TRP A O   
2753 C CB  . TRP A 360 ? 0.5413 0.7603 0.5903 -0.0340 0.0285  0.0124  371 TRP A CB  
2754 C CG  . TRP A 360 ? 0.5206 0.7534 0.5797 -0.0332 0.0290  0.0133  371 TRP A CG  
2755 C CD1 . TRP A 360 ? 0.4175 0.6703 0.4898 -0.0262 0.0322  0.0107  371 TRP A CD1 
2756 C CD2 . TRP A 360 ? 0.4274 0.6539 0.4832 -0.0388 0.0251  0.0164  371 TRP A CD2 
2757 N NE1 . TRP A 360 ? 0.4152 0.6753 0.4929 -0.0277 0.0311  0.0125  371 TRP A NE1 
2758 C CE2 . TRP A 360 ? 0.4177 0.6625 0.4858 -0.0357 0.0272  0.0160  371 TRP A CE2 
2759 C CE3 . TRP A 360 ? 0.5725 0.7786 0.6153 -0.0451 0.0190  0.0188  371 TRP A CE3 
2760 C CZ2 . TRP A 360 ? 0.4162 0.6609 0.4848 -0.0398 0.0246  0.0184  371 TRP A CZ2 
2761 C CZ3 . TRP A 360 ? 0.6342 0.8394 0.6772 -0.0484 0.0156  0.0205  371 TRP A CZ3 
2762 C CH2 . TRP A 360 ? 0.5218 0.7468 0.5780 -0.0462 0.0190  0.0206  371 TRP A CH2 
2763 N N   . PRO A 361 ? 0.4401 0.6685 0.4894 -0.0228 0.0365  0.0027  372 PRO A N   
2764 C CA  . PRO A 361 ? 0.4473 0.6625 0.4878 -0.0226 0.0361  0.0017  372 PRO A CA  
2765 C C   . PRO A 361 ? 0.5897 0.7876 0.6343 -0.0126 0.0323  0.0020  372 PRO A C   
2766 O O   . PRO A 361 ? 0.6092 0.8091 0.6641 -0.0049 0.0313  0.0020  372 PRO A O   
2767 C CB  . PRO A 361 ? 0.4487 0.6855 0.4936 -0.0200 0.0417  -0.0046 372 PRO A CB  
2768 C CG  . PRO A 361 ? 0.4390 0.6927 0.4993 -0.0101 0.0423  -0.0076 372 PRO A CG  
2769 C CD  . PRO A 361 ? 0.5708 0.8232 0.6327 -0.0151 0.0403  -0.0027 372 PRO A CD  
2770 N N   . PRO A 362 ? 0.5346 0.7157 0.5700 -0.0135 0.0299  0.0021  373 PRO A N   
2771 C CA  . PRO A 362 ? 0.4437 0.6116 0.4827 -0.0054 0.0268  0.0014  373 PRO A CA  
2772 C C   . PRO A 362 ? 0.4411 0.6149 0.4874 0.0034  0.0294  -0.0021 373 PRO A C   
2773 O O   . PRO A 362 ? 0.6482 0.8331 0.6943 0.0044  0.0330  -0.0054 373 PRO A O   
2774 C CB  . PRO A 362 ? 0.4535 0.6044 0.4798 -0.0090 0.0233  0.0013  373 PRO A CB  
2775 C CG  . PRO A 362 ? 0.4876 0.6367 0.5012 -0.0199 0.0224  0.0038  373 PRO A CG  
2776 C CD  . PRO A 362 ? 0.4621 0.6339 0.4814 -0.0232 0.0288  0.0032  373 PRO A CD  
2777 N N   . VAL A 363 ? 0.4365 0.6029 0.4880 0.0093  0.0269  -0.0018 374 VAL A N   
2778 C CA  . VAL A 363 ? 0.4763 0.6412 0.5312 0.0174  0.0269  -0.0045 374 VAL A CA  
2779 C C   . VAL A 363 ? 0.6049 0.7555 0.6538 0.0182  0.0255  -0.0060 374 VAL A C   
2780 O O   . VAL A 363 ? 0.7570 0.8985 0.8035 0.0151  0.0229  -0.0049 374 VAL A O   
2781 C CB  . VAL A 363 ? 0.4669 0.6298 0.5273 0.0211  0.0242  -0.0025 374 VAL A CB  
2782 C CG1 . VAL A 363 ? 0.5271 0.6812 0.5862 0.0286  0.0218  -0.0047 374 VAL A CG1 
2783 C CG2 . VAL A 363 ? 0.6008 0.7788 0.6675 0.0214  0.0253  -0.0017 374 VAL A CG2 
2784 N N   . GLN A 364 ? 0.6109 0.7617 0.6580 0.0229  0.0269  -0.0097 375 GLN A N   
2785 C CA  . GLN A 364 ? 0.4600 0.5979 0.5011 0.0237  0.0257  -0.0115 375 GLN A CA  
2786 C C   . GLN A 364 ? 0.5972 0.7230 0.6387 0.0257  0.0222  -0.0107 375 GLN A C   
2787 O O   . GLN A 364 ? 0.5500 0.6743 0.5938 0.0297  0.0204  -0.0101 375 GLN A O   
2788 C CB  . GLN A 364 ? 0.5742 0.7165 0.6133 0.0284  0.0280  -0.0163 375 GLN A CB  
2789 C CG  . GLN A 364 ? 0.7015 0.8321 0.7334 0.0280  0.0274  -0.0183 375 GLN A CG  
2790 C CD  . GLN A 364 ? 0.8175 0.9543 0.8477 0.0328  0.0298  -0.0239 375 GLN A CD  
2791 O OE1 . GLN A 364 ? 0.9107 1.0612 0.9458 0.0381  0.0312  -0.0275 375 GLN A OE1 
2792 N NE2 . GLN A 364 ? 0.9065 1.0348 0.9297 0.0316  0.0298  -0.0256 375 GLN A NE2 
2793 N N   . LEU A 365 ? 0.4554 0.5722 0.4931 0.0222  0.0206  -0.0111 376 LEU A N   
2794 C CA  . LEU A 365 ? 0.4756 0.5839 0.5123 0.0206  0.0178  -0.0109 376 LEU A CA  
2795 C C   . LEU A 365 ? 0.5573 0.6544 0.5884 0.0240  0.0167  -0.0133 376 LEU A C   
2796 O O   . LEU A 365 ? 0.6232 0.7179 0.6509 0.0255  0.0178  -0.0161 376 LEU A O   
2797 C CB  . LEU A 365 ? 0.4617 0.5700 0.4980 0.0156  0.0162  -0.0124 376 LEU A CB  
2798 C CG  . LEU A 365 ? 0.5884 0.7046 0.6283 0.0130  0.0154  -0.0114 376 LEU A CG  
2799 C CD1 . LEU A 365 ? 0.4434 0.5597 0.4827 0.0109  0.0119  -0.0156 376 LEU A CD1 
2800 C CD2 . LEU A 365 ? 0.7172 0.8399 0.7625 0.0117  0.0157  -0.0082 376 LEU A CD2 
2801 N N   . PRO A 366 ? 0.4985 0.5863 0.5264 0.0250  0.0138  -0.0121 377 PRO A N   
2802 C CA  . PRO A 366 ? 0.5637 0.6366 0.5835 0.0271  0.0112  -0.0143 377 PRO A CA  
2803 C C   . PRO A 366 ? 0.6750 0.7417 0.6900 0.0190  0.0103  -0.0151 377 PRO A C   
2804 O O   . PRO A 366 ? 0.6979 0.7543 0.7064 0.0195  0.0090  -0.0176 377 PRO A O   
2805 C CB  . PRO A 366 ? 0.6730 0.7349 0.6880 0.0305  0.0063  -0.0122 377 PRO A CB  
2806 C CG  . PRO A 366 ? 0.4953 0.5648 0.5146 0.0247  0.0066  -0.0080 377 PRO A CG  
2807 C CD  . PRO A 366 ? 0.4775 0.5655 0.5068 0.0238  0.0116  -0.0084 377 PRO A CD  
2808 N N   . TYR A 367 ? 0.7260 0.8010 0.7445 0.0116  0.0107  -0.0140 378 TYR A N   
2809 C CA  . TYR A 367 ? 0.4841 0.5606 0.5004 0.0036  0.0101  -0.0170 378 TYR A CA  
2810 C C   . TYR A 367 ? 0.5697 0.6627 0.5945 0.0015  0.0112  -0.0190 378 TYR A C   
2811 O O   . TYR A 367 ? 0.5996 0.6987 0.6298 0.0057  0.0122  -0.0173 378 TYR A O   
2812 C CB  . TYR A 367 ? 0.4970 0.5643 0.5045 -0.0053 0.0074  -0.0150 378 TYR A CB  
2813 C CG  . TYR A 367 ? 0.4989 0.5656 0.5060 -0.0071 0.0060  -0.0100 378 TYR A CG  
2814 C CD1 . TYR A 367 ? 0.4871 0.5698 0.5014 -0.0121 0.0075  -0.0098 378 TYR A CD1 
2815 C CD2 . TYR A 367 ? 0.7672 0.8169 0.7662 -0.0028 0.0021  -0.0063 378 TYR A CD2 
2816 C CE1 . TYR A 367 ? 0.4891 0.5714 0.5027 -0.0140 0.0062  -0.0051 378 TYR A CE1 
2817 C CE2 . TYR A 367 ? 0.6817 0.7297 0.6793 -0.0038 -0.0002 -0.0018 378 TYR A CE2 
2818 C CZ  . TYR A 367 ? 0.5426 0.6071 0.5476 -0.0101 0.0023  -0.0008 378 TYR A CZ  
2819 O OH  . TYR A 367 ? 0.5944 0.6573 0.5976 -0.0115 0.0000  0.0037  378 TYR A OH  
2820 N N   . LEU A 368 ? 0.5694 0.6702 0.5948 -0.0050 0.0103  -0.0235 379 LEU A N   
2821 C CA  . LEU A 368 ? 0.5631 0.6801 0.5963 -0.0057 0.0094  -0.0279 379 LEU A CA  
2822 C C   . LEU A 368 ? 0.5794 0.6963 0.6150 0.0022  0.0082  -0.0295 379 LEU A C   
2823 O O   . LEU A 368 ? 0.5464 0.6714 0.5865 0.0038  0.0062  -0.0315 379 LEU A O   
2824 C CB  . LEU A 368 ? 0.4518 0.5769 0.4892 -0.0090 0.0099  -0.0247 379 LEU A CB  
2825 C CG  . LEU A 368 ? 0.6113 0.7404 0.6450 -0.0200 0.0099  -0.0246 379 LEU A CG  
2826 C CD1 . LEU A 368 ? 0.4529 0.5901 0.4903 -0.0230 0.0103  -0.0213 379 LEU A CD1 
2827 C CD2 . LEU A 368 ? 0.6053 0.7492 0.6407 -0.0261 0.0092  -0.0336 379 LEU A CD2 
2828 N N   . ALA A 369 ? 0.7101 0.8163 0.7406 0.0064  0.0089  -0.0288 380 ALA A N   
2829 C CA  . ALA A 369 ? 0.6811 0.7845 0.7098 0.0114  0.0072  -0.0298 380 ALA A CA  
2830 C C   . ALA A 369 ? 0.6408 0.7485 0.6696 0.0123  0.0022  -0.0374 380 ALA A C   
2831 O O   . ALA A 369 ? 0.5703 0.6795 0.5983 0.0107  0.0016  -0.0422 380 ALA A O   
2832 C CB  . ALA A 369 ? 0.8062 0.8994 0.8287 0.0144  0.0094  -0.0279 380 ALA A CB  
2833 N N   . SER A 370 ? 0.7663 0.8754 0.7953 0.0153  -0.0022 -0.0391 381 SER A N   
2834 C CA  . SER A 370 ? 0.8196 0.9322 0.8484 0.0189  -0.0094 -0.0480 381 SER A CA  
2835 C C   . SER A 370 ? 0.7708 0.8714 0.7909 0.0220  -0.0118 -0.0497 381 SER A C   
2836 O O   . SER A 370 ? 0.5944 0.6818 0.6053 0.0241  -0.0146 -0.0465 381 SER A O   
2837 C CB  . SER A 370 ? 0.8630 0.9748 0.8911 0.0224  -0.0155 -0.0491 381 SER A CB  
2838 O OG  . SER A 370 ? 0.9521 1.0769 0.9889 0.0195  -0.0133 -0.0485 381 SER A OG  
2839 N N   . LEU A 371 ? 0.8448 0.9500 0.8664 0.0208  -0.0110 -0.0548 382 LEU A N   
2840 C CA  . LEU A 371 ? 0.6513 0.7465 0.6652 0.0238  -0.0135 -0.0573 382 LEU A CA  
2841 C C   . LEU A 371 ? 0.6052 0.6950 0.6135 0.0305  -0.0236 -0.0634 382 LEU A C   
2842 O O   . LEU A 371 ? 0.5951 0.6723 0.5937 0.0331  -0.0269 -0.0641 382 LEU A O   
2843 C CB  . LEU A 371 ? 0.7095 0.8129 0.7267 0.0205  -0.0115 -0.0628 382 LEU A CB  
2844 C CG  . LEU A 371 ? 0.8734 0.9783 0.8926 0.0132  -0.0042 -0.0578 382 LEU A CG  
2845 C CD1 . LEU A 371 ? 0.9564 1.0711 0.9772 0.0073  -0.0039 -0.0644 382 LEU A CD1 
2846 C CD2 . LEU A 371 ? 0.9128 1.0022 0.9253 0.0143  0.0000  -0.0504 382 LEU A CD2 
2847 N N   . HIS A 372 ? 0.6594 0.7566 0.6720 0.0338  -0.0295 -0.0683 383 HIS A N   
2848 C CA  . HIS A 372 ? 0.6774 0.7674 0.6835 0.0420  -0.0419 -0.0758 383 HIS A CA  
2849 C C   . HIS A 372 ? 0.7655 0.8396 0.7622 0.0432  -0.0468 -0.0698 383 HIS A C   
2850 O O   . HIS A 372 ? 0.7978 0.8672 0.7905 0.0502  -0.0583 -0.0765 383 HIS A O   
2851 C CB  . HIS A 372 ? 0.7189 0.8311 0.7364 0.0468  -0.0475 -0.0896 383 HIS A CB  
2852 C CG  . HIS A 372 ? 0.5221 0.6489 0.5492 0.0451  -0.0460 -0.0903 383 HIS A CG  
2853 N ND1 . HIS A 372 ? 0.5070 0.6362 0.5381 0.0368  -0.0358 -0.0801 383 HIS A ND1 
2854 C CD2 . HIS A 372 ? 0.5500 0.6901 0.5832 0.0514  -0.0540 -0.1009 383 HIS A CD2 
2855 C CE1 . HIS A 372 ? 0.5204 0.6633 0.5594 0.0370  -0.0371 -0.0833 383 HIS A CE1 
2856 N NE2 . HIS A 372 ? 0.5162 0.6667 0.5570 0.0457  -0.0477 -0.0962 383 HIS A NE2 
2857 N N   . CYS A 373 ? 0.7478 0.8139 0.7403 0.0364  -0.0391 -0.0583 384 CYS A N   
2858 C CA  . CYS A 373 ? 0.7423 0.7924 0.7230 0.0349  -0.0435 -0.0521 384 CYS A CA  
2859 C C   . CYS A 373 ? 0.6440 0.6706 0.6055 0.0386  -0.0556 -0.0542 384 CYS A C   
2860 O O   . CYS A 373 ? 0.5514 0.5623 0.5009 0.0399  -0.0653 -0.0536 384 CYS A O   
2861 C CB  . CYS A 373 ? 0.9753 1.0239 0.9540 0.0266  -0.0328 -0.0411 384 CYS A CB  
2862 S SG  . CYS A 373 ? 1.1900 1.2326 1.1616 0.0233  -0.0263 -0.0376 384 CYS A SG  
2863 N N   . SER A 374 ? 0.6729 0.6946 0.6294 0.0401  -0.0562 -0.0566 385 SER A N   
2864 C CA  . SER A 374 ? 0.7113 0.7137 0.6520 0.0462  -0.0699 -0.0620 385 SER A CA  
2865 C C   . SER A 374 ? 0.8028 0.8196 0.7541 0.0530  -0.0710 -0.0727 385 SER A C   
2866 O O   . SER A 374 ? 0.9867 1.0200 0.9503 0.0491  -0.0597 -0.0720 385 SER A O   
2867 C CB  . SER A 374 ? 0.7771 0.7563 0.6962 0.0391  -0.0700 -0.0533 385 SER A CB  
2868 O OG  . SER A 374 ? 0.9404 0.8960 0.8402 0.0447  -0.0855 -0.0578 385 SER A OG  
2869 N N   . ALA A 375 ? 0.7658 0.7759 0.7113 0.0632  -0.0857 -0.0833 386 ALA A N   
2870 C CA  . ALA A 375 ? 0.7430 0.7717 0.7002 0.0702  -0.0880 -0.0961 386 ALA A CA  
2871 C C   . ALA A 375 ? 0.7462 0.7732 0.7008 0.0654  -0.0804 -0.0926 386 ALA A C   
2872 O O   . ALA A 375 ? 0.8200 0.8234 0.7564 0.0642  -0.0844 -0.0874 386 ALA A O   
2873 C CB  . ALA A 375 ? 0.7468 0.7655 0.6953 0.0838  -0.1074 -0.1088 386 ALA A CB  
2874 N N   . ILE A 376 ? 0.7044 0.7554 0.6756 0.0617  -0.0699 -0.0956 387 ILE A N   
2875 C CA  . ILE A 376 ? 0.6689 0.7189 0.6384 0.0573  -0.0628 -0.0931 387 ILE A CA  
2876 C C   . ILE A 376 ? 0.5559 0.6013 0.5188 0.0654  -0.0739 -0.1034 387 ILE A C   
2877 O O   . ILE A 376 ? 0.5543 0.6166 0.5262 0.0728  -0.0814 -0.1168 387 ILE A O   
2878 C CB  . ILE A 376 ? 0.5237 0.5971 0.5097 0.0505  -0.0508 -0.0939 387 ILE A CB  
2879 C CG1 . ILE A 376 ? 0.6408 0.7178 0.6326 0.0439  -0.0418 -0.0847 387 ILE A CG1 
2880 C CG2 . ILE A 376 ? 0.5250 0.5937 0.5073 0.0460  -0.0441 -0.0909 387 ILE A CG2 
2881 C CD1 . ILE A 376 ? 0.7597 0.8543 0.7634 0.0363  -0.0319 -0.0844 387 ILE A CD1 
2882 N N   . THR A 377 ? 0.6644 0.6887 0.6115 0.0641  -0.0752 -0.0980 388 THR A N   
2883 C CA  . THR A 377 ? 0.7743 0.7911 0.7127 0.0716  -0.0860 -0.1065 388 THR A CA  
2884 C C   . THR A 377 ? 0.7435 0.7673 0.6852 0.0673  -0.0779 -0.1070 388 THR A C   
2885 O O   . THR A 377 ? 0.7152 0.7445 0.6575 0.0734  -0.0849 -0.1174 388 THR A O   
2886 C CB  . THR A 377 ? 0.7644 0.7472 0.6772 0.0735  -0.0973 -0.1008 388 THR A CB  
2887 O OG1 . THR A 377 ? 0.7680 0.7384 0.6706 0.0624  -0.0868 -0.0873 388 THR A OG1 
2888 C CG2 . THR A 377 ? 0.6221 0.5937 0.5284 0.0780  -0.1079 -0.1010 388 THR A CG2 
2889 N N   . CYS A 378 ? 0.6615 0.6855 0.6052 0.0578  -0.0641 -0.0970 389 CYS A N   
2890 C CA  . CYS A 378 ? 0.7665 0.7959 0.7129 0.0537  -0.0566 -0.0975 389 CYS A CA  
2891 C C   . CYS A 378 ? 0.7087 0.7440 0.6626 0.0452  -0.0426 -0.0890 389 CYS A C   
2892 O O   . CYS A 378 ? 0.6144 0.6463 0.5682 0.0424  -0.0387 -0.0813 389 CYS A O   
2893 C CB  . CYS A 378 ? 0.7495 0.7581 0.6780 0.0545  -0.0604 -0.0949 389 CYS A CB  
2894 S SG  . CYS A 378 ? 0.8358 0.8240 0.7481 0.0471  -0.0549 -0.0805 389 CYS A SG  
2895 N N   . SER A 379 ? 0.7653 0.8084 0.7245 0.0413  -0.0362 -0.0910 390 SER A N   
2896 C CA  . SER A 379 ? 0.6379 0.6830 0.6018 0.0346  -0.0253 -0.0842 390 SER A CA  
2897 C C   . SER A 379 ? 0.5672 0.6067 0.5263 0.0324  -0.0215 -0.0847 390 SER A C   
2898 O O   . SER A 379 ? 0.6858 0.7302 0.6453 0.0331  -0.0250 -0.0924 390 SER A O   
2899 C CB  . SER A 379 ? 0.5279 0.5903 0.5048 0.0302  -0.0221 -0.0867 390 SER A CB  
2900 O OG  . SER A 379 ? 0.6452 0.7228 0.6278 0.0298  -0.0260 -0.0974 390 SER A OG  
2901 N N   . HIS A 380 ? 0.5468 0.5776 0.5018 0.0304  -0.0147 -0.0777 391 HIS A N   
2902 C CA  . HIS A 380 ? 0.5932 0.6169 0.5425 0.0295  -0.0114 -0.0782 391 HIS A CA  
2903 C C   . HIS A 380 ? 0.7169 0.7395 0.6696 0.0267  -0.0045 -0.0740 391 HIS A C   
2904 O O   . HIS A 380 ? 0.9474 0.9697 0.9017 0.0272  -0.0011 -0.0685 391 HIS A O   
2905 C CB  . HIS A 380 ? 0.8032 0.8159 0.7402 0.0318  -0.0125 -0.0758 391 HIS A CB  
2906 C CG  . HIS A 380 ? 1.0123 1.0192 0.9435 0.0315  -0.0088 -0.0769 391 HIS A CG  
2907 N ND1 . HIS A 380 ? 1.1125 1.1188 1.0428 0.0314  -0.0110 -0.0829 391 HIS A ND1 
2908 C CD2 . HIS A 380 ? 1.0294 1.0325 0.9556 0.0315  -0.0034 -0.0738 391 HIS A CD2 
2909 C CE1 . HIS A 380 ? 1.1220 1.1220 1.0463 0.0316  -0.0073 -0.0829 391 HIS A CE1 
2910 N NE2 . HIS A 380 ? 1.0005 0.9993 0.9226 0.0321  -0.0027 -0.0780 391 HIS A NE2 
2911 N N   . HIS A 381 ? 0.6780 0.6986 0.6303 0.0237  -0.0033 -0.0770 392 HIS A N   
2912 C CA  . HIS A 381 ? 0.7533 0.7679 0.7057 0.0215  0.0005  -0.0739 392 HIS A CA  
2913 C C   . HIS A 381 ? 0.7004 0.7038 0.6448 0.0246  0.0021  -0.0750 392 HIS A C   
2914 O O   . HIS A 381 ? 0.8332 0.8338 0.7728 0.0241  0.0002  -0.0795 392 HIS A O   
2915 C CB  . HIS A 381 ? 0.7255 0.7432 0.6800 0.0136  -0.0005 -0.0762 392 HIS A CB  
2916 C CG  . HIS A 381 ? 0.7079 0.7161 0.6600 0.0105  0.0012  -0.0718 392 HIS A CG  
2917 N ND1 . HIS A 381 ? 0.6308 0.6228 0.5743 0.0117  0.0010  -0.0716 392 HIS A ND1 
2918 C CD2 . HIS A 381 ? 0.7222 0.7329 0.6779 0.0069  0.0018  -0.0677 392 HIS A CD2 
2919 C CE1 . HIS A 381 ? 0.7254 0.7084 0.6663 0.0095  0.0004  -0.0676 392 HIS A CE1 
2920 N NE2 . HIS A 381 ? 0.6697 0.6641 0.6178 0.0060  0.0012  -0.0648 392 HIS A NE2 
2921 N N   . VAL A 382 ? 0.5727 0.5714 0.5162 0.0285  0.0050  -0.0719 393 VAL A N   
2922 C CA  . VAL A 382 ? 0.5838 0.5742 0.5208 0.0332  0.0062  -0.0745 393 VAL A CA  
2923 C C   . VAL A 382 ? 0.7535 0.7333 0.6890 0.0344  0.0051  -0.0739 393 VAL A C   
2924 O O   . VAL A 382 ? 0.7195 0.7013 0.6591 0.0367  0.0060  -0.0706 393 VAL A O   
2925 C CB  . VAL A 382 ? 0.5822 0.5794 0.5183 0.0380  0.0095  -0.0738 393 VAL A CB  
2926 C CG1 . VAL A 382 ? 0.7815 0.7743 0.7110 0.0425  0.0106  -0.0788 393 VAL A CG1 
2927 C CG2 . VAL A 382 ? 0.5766 0.5799 0.5112 0.0353  0.0086  -0.0723 393 VAL A CG2 
2928 N N   . SER A 383 ? 0.7970 0.7636 0.7248 0.0329  0.0023  -0.0773 394 SER A N   
2929 C CA  . SER A 383 ? 0.8415 0.7914 0.7631 0.0328  -0.0013 -0.0767 394 SER A CA  
2930 C C   . SER A 383 ? 0.9984 0.9405 0.9159 0.0440  -0.0024 -0.0804 394 SER A C   
2931 O O   . SER A 383 ? 1.2767 1.2225 1.1927 0.0488  -0.0006 -0.0851 394 SER A O   
2932 C CB  . SER A 383 ? 0.8167 0.7541 0.7292 0.0234  -0.0051 -0.0784 394 SER A CB  
2933 O OG  . SER A 383 ? 1.0719 1.0216 0.9893 0.0132  -0.0042 -0.0773 394 SER A OG  
2934 N N   . ASN A 384 ? 0.7788 0.7108 0.6942 0.0486  -0.0059 -0.0792 395 ASN A N   
2935 C CA  . ASN A 384 ? 0.7706 0.6942 0.6817 0.0611  -0.0092 -0.0848 395 ASN A CA  
2936 C C   . ASN A 384 ? 0.9264 0.8724 0.8461 0.0696  -0.0033 -0.0892 395 ASN A C   
2937 O O   . ASN A 384 ? 1.0976 1.0473 1.0147 0.0720  -0.0015 -0.0946 395 ASN A O   
2938 C CB  . ASN A 384 ? 0.6804 0.5822 0.5782 0.0615  -0.0149 -0.0896 395 ASN A CB  
2939 C CG  . ASN A 384 ? 0.7034 0.5879 0.5933 0.0745  -0.0226 -0.0954 395 ASN A CG  
2940 O OD1 . ASN A 384 ? 0.7240 0.6193 0.6209 0.0855  -0.0223 -0.0983 395 ASN A OD1 
2941 N ND2 . ASN A 384 ? 0.7285 0.5860 0.6030 0.0735  -0.0304 -0.0981 395 ASN A ND2 
2942 N N   . ILE A 385 ? 0.9506 0.9123 0.8794 0.0729  -0.0003 -0.0873 396 ILE A N   
2943 C CA  . ILE A 385 ? 0.6259 0.6115 0.5615 0.0778  0.0058  -0.0912 396 ILE A CA  
2944 C C   . ILE A 385 ? 0.7810 0.7692 0.7166 0.0918  0.0029  -0.1007 396 ILE A C   
2945 O O   . ILE A 385 ? 0.7323 0.7092 0.6671 0.0987  -0.0034 -0.1014 396 ILE A O   
2946 C CB  . ILE A 385 ? 0.6080 0.6108 0.5528 0.0731  0.0106  -0.0851 396 ILE A CB  
2947 C CG1 . ILE A 385 ? 0.5976 0.5957 0.5426 0.0617  0.0110  -0.0773 396 ILE A CG1 
2948 C CG2 . ILE A 385 ? 0.6716 0.6982 0.6197 0.0733  0.0172  -0.0881 396 ILE A CG2 
2949 C CD1 . ILE A 385 ? 0.5963 0.5942 0.5365 0.0561  0.0124  -0.0780 396 ILE A CD1 
2950 N N   . PRO A 386 ? 0.8135 0.8163 0.7491 0.0967  0.0063  -0.1089 397 PRO A N   
2951 C CA  . PRO A 386 ? 0.8327 0.8452 0.7707 0.1114  0.0037  -0.1204 397 PRO A CA  
2952 C C   . PRO A 386 ? 0.8099 0.8422 0.7582 0.1154  0.0056  -0.1206 397 PRO A C   
2953 O O   . PRO A 386 ? 0.7792 0.8252 0.7331 0.1056  0.0119  -0.1130 397 PRO A O   
2954 C CB  . PRO A 386 ? 0.7710 0.8032 0.7082 0.1113  0.0097  -0.1280 397 PRO A CB  
2955 C CG  . PRO A 386 ? 0.8399 0.8581 0.7697 0.0998  0.0112  -0.1213 397 PRO A CG  
2956 C CD  . PRO A 386 ? 0.6373 0.6469 0.5692 0.0896  0.0114  -0.1092 397 PRO A CD  
2957 N N   . LEU A 387 ? 0.9108 0.9439 0.8610 0.1306  -0.0008 -0.1302 398 LEU A N   
2958 C CA  . LEU A 387 ? 0.9209 0.9711 0.8809 0.1359  -0.0007 -0.1312 398 LEU A CA  
2959 C C   . LEU A 387 ? 0.6362 0.7275 0.6061 0.1326  0.0097  -0.1360 398 LEU A C   
2960 O O   . LEU A 387 ? 0.6236 0.7312 0.6013 0.1286  0.0135  -0.1318 398 LEU A O   
2961 C CB  . LEU A 387 ? 0.6727 0.7121 0.6309 0.1550  -0.0123 -0.1418 398 LEU A CB  
2962 C CG  . LEU A 387 ? 0.6700 0.7182 0.6361 0.1615  -0.0154 -0.1418 398 LEU A CG  
2963 C CD1 . LEU A 387 ? 0.6590 0.6906 0.6235 0.1477  -0.0143 -0.1254 398 LEU A CD1 
2964 C CD2 . LEU A 387 ? 0.6969 0.7270 0.6576 0.1817  -0.0301 -0.1524 398 LEU A CD2 
2965 N N   . LYS A 388 ? 0.6389 0.7473 0.6072 0.1328  0.0144  -0.1446 399 LYS A N   
2966 C CA  . LYS A 388 ? 0.6670 0.8149 0.6415 0.1264  0.0244  -0.1492 399 LYS A CA  
2967 C C   . LYS A 388 ? 0.6973 0.8465 0.6695 0.1071  0.0318  -0.1349 399 LYS A C   
2968 O O   . LYS A 388 ? 0.6945 0.8690 0.6718 0.1001  0.0379  -0.1339 399 LYS A O   
2969 C CB  . LYS A 388 ? 0.7014 0.8659 0.6722 0.1287  0.0277  -0.1612 399 LYS A CB  
2970 C CG  . LYS A 388 ? 0.9041 1.0449 0.8633 0.1205  0.0279  -0.1550 399 LYS A CG  
2971 C CD  . LYS A 388 ? 1.0100 1.1706 0.9655 0.1220  0.0318  -0.1672 399 LYS A CD  
2972 C CE  . LYS A 388 ? 1.1217 1.2587 1.0655 0.1142  0.0315  -0.1612 399 LYS A CE  
2973 N NZ  . LYS A 388 ? 1.0713 1.2265 1.0106 0.1158  0.0350  -0.1733 399 LYS A NZ  
2974 N N   . LEU A 389 ? 0.6632 0.7855 0.6273 0.0985  0.0305  -0.1244 400 LEU A N   
2975 C CA  . LEU A 389 ? 0.5986 0.7183 0.5598 0.0829  0.0347  -0.1118 400 LEU A CA  
2976 C C   . LEU A 389 ? 0.7170 0.8268 0.6842 0.0822  0.0318  -0.1031 400 LEU A C   
2977 O O   . LEU A 389 ? 0.6554 0.7734 0.6239 0.0722  0.0356  -0.0958 400 LEU A O   
2978 C CB  . LEU A 389 ? 0.7792 0.8773 0.7304 0.0755  0.0335  -0.1061 400 LEU A CB  
2979 C CG  . LEU A 389 ? 0.5929 0.6890 0.5382 0.0608  0.0364  -0.0958 400 LEU A CG  
2980 C CD1 . LEU A 389 ? 0.7899 0.9048 0.7271 0.0522  0.0423  -0.0988 400 LEU A CD1 
2981 C CD2 . LEU A 389 ? 0.5932 0.6639 0.5328 0.0573  0.0319  -0.0899 400 LEU A CD2 
2982 N N   . TRP A 390 ? 0.6873 0.7779 0.6561 0.0919  0.0246  -0.1038 401 TRP A N   
2983 C CA  . TRP A 390 ? 0.7091 0.7894 0.6821 0.0904  0.0215  -0.0956 401 TRP A CA  
2984 C C   . TRP A 390 ? 0.7877 0.8924 0.7703 0.0930  0.0244  -0.0977 401 TRP A C   
2985 O O   . TRP A 390 ? 0.7049 0.8155 0.6907 0.0841  0.0276  -0.0897 401 TRP A O   
2986 C CB  . TRP A 390 ? 0.8281 0.8811 0.7970 0.0989  0.0122  -0.0964 401 TRP A CB  
2987 C CG  . TRP A 390 ? 0.8659 0.9069 0.8367 0.0959  0.0087  -0.0879 401 TRP A CG  
2988 C CD1 . TRP A 390 ? 0.8691 0.9113 0.8441 0.1041  0.0043  -0.0894 401 TRP A CD1 
2989 C CD2 . TRP A 390 ? 0.7817 0.8095 0.7501 0.0839  0.0090  -0.0776 401 TRP A CD2 
2990 N NE1 . TRP A 390 ? 0.8007 0.8299 0.7751 0.0968  0.0023  -0.0796 401 TRP A NE1 
2991 C CE2 . TRP A 390 ? 0.8069 0.8287 0.7778 0.0843  0.0054  -0.0728 401 TRP A CE2 
2992 C CE3 . TRP A 390 ? 0.8263 0.8484 0.7908 0.0735  0.0114  -0.0731 401 TRP A CE3 
2993 C CZ2 . TRP A 390 ? 0.8395 0.8518 0.8094 0.0738  0.0050  -0.0639 401 TRP A CZ2 
2994 C CZ3 . TRP A 390 ? 0.7107 0.7245 0.6753 0.0644  0.0104  -0.0654 401 TRP A CZ3 
2995 C CH2 . TRP A 390 ? 0.7259 0.7358 0.6933 0.0641  0.0076  -0.0610 401 TRP A CH2 
2996 N N   . GLU A 391 ? 0.7693 0.8896 0.7565 0.1059  0.0226  -0.1096 402 GLU A N   
2997 C CA  . GLU A 391 ? 0.6870 0.8353 0.6843 0.1090  0.0254  -0.1138 402 GLU A CA  
2998 C C   . GLU A 391 ? 0.6972 0.8741 0.6954 0.0953  0.0355  -0.1126 402 GLU A C   
2999 O O   . GLU A 391 ? 0.7939 0.9920 0.7990 0.0921  0.0390  -0.1122 402 GLU A O   
3000 C CB  . GLU A 391 ? 0.6521 0.8140 0.6544 0.1273  0.0203  -0.1297 402 GLU A CB  
3001 C CG  . GLU A 391 ? 0.7244 0.8578 0.7245 0.1413  0.0080  -0.1305 402 GLU A CG  
3002 C CD  . GLU A 391 ? 0.8817 1.0289 0.8865 0.1619  0.0009  -0.1476 402 GLU A CD  
3003 O OE1 . GLU A 391 ? 0.9064 1.0822 0.9153 0.1661  0.0053  -0.1605 402 GLU A OE1 
3004 O OE2 . GLU A 391 ? 0.9359 1.0655 0.9396 0.1740  -0.0099 -0.1490 402 GLU A OE2 
3005 N N   . ARG A 392 ? 0.6556 0.8320 0.6453 0.0863  0.0398  -0.1118 403 ARG A N   
3006 C CA  . ARG A 392 ? 0.6876 0.8852 0.6729 0.0708  0.0480  -0.1093 403 ARG A CA  
3007 C C   . ARG A 392 ? 0.8304 1.0128 0.8113 0.0575  0.0484  -0.0947 403 ARG A C   
3008 O O   . ARG A 392 ? 0.8183 1.0170 0.7982 0.0466  0.0530  -0.0914 403 ARG A O   
3009 C CB  . ARG A 392 ? 0.6502 0.8496 0.6252 0.0656  0.0510  -0.1133 403 ARG A CB  
3010 C CG  . ARG A 392 ? 0.5850 0.8225 0.5604 0.0629  0.0578  -0.1253 403 ARG A CG  
3011 C CD  . ARG A 392 ? 0.7420 0.9783 0.7062 0.0584  0.0600  -0.1292 403 ARG A CD  
3012 N NE  . ARG A 392 ? 0.9210 1.1792 0.8744 0.0399  0.0676  -0.1283 403 ARG A NE  
3013 C CZ  . ARG A 392 ? 1.1027 1.3581 1.0421 0.0305  0.0700  -0.1284 403 ARG A CZ  
3014 N NH1 . ARG A 392 ? 1.0478 1.2814 0.9843 0.0388  0.0657  -0.1298 403 ARG A NH1 
3015 N NH2 . ARG A 392 ? 1.3058 1.5792 1.2323 0.0115  0.0762  -0.1269 403 ARG A NH2 
3016 N N   . ILE A 393 ? 0.8071 0.9592 0.7849 0.0580  0.0433  -0.0868 404 ILE A N   
3017 C CA  . ILE A 393 ? 0.6472 0.7860 0.6217 0.0475  0.0425  -0.0751 404 ILE A CA  
3018 C C   . ILE A 393 ? 0.7311 0.8752 0.7153 0.0495  0.0417  -0.0717 404 ILE A C   
3019 O O   . ILE A 393 ? 0.7111 0.8598 0.6940 0.0399  0.0436  -0.0653 404 ILE A O   
3020 C CB  . ILE A 393 ? 0.5534 0.6640 0.5231 0.0477  0.0374  -0.0702 404 ILE A CB  
3021 C CG1 . ILE A 393 ? 0.5623 0.6683 0.5217 0.0448  0.0382  -0.0732 404 ILE A CG1 
3022 C CG2 . ILE A 393 ? 0.5457 0.6452 0.5139 0.0396  0.0354  -0.0605 404 ILE A CG2 
3023 C CD1 . ILE A 393 ? 0.5636 0.6455 0.5187 0.0449  0.0332  -0.0700 404 ILE A CD1 
3024 N N   . ILE A 394 ? 0.7330 0.8745 0.7254 0.0620  0.0379  -0.0758 405 ILE A N   
3025 C CA  . ILE A 394 ? 0.6529 0.7996 0.6539 0.0646  0.0365  -0.0731 405 ILE A CA  
3026 C C   . ILE A 394 ? 0.7107 0.8895 0.7174 0.0629  0.0418  -0.0784 405 ILE A C   
3027 O O   . ILE A 394 ? 0.8876 1.0740 0.8998 0.0601  0.0425  -0.0744 405 ILE A O   
3028 C CB  . ILE A 394 ? 0.5445 0.6768 0.5493 0.0781  0.0293  -0.0763 405 ILE A CB  
3029 C CG1 . ILE A 394 ? 0.7547 0.9026 0.7631 0.0916  0.0279  -0.0895 405 ILE A CG1 
3030 C CG2 . ILE A 394 ? 0.5505 0.6534 0.5475 0.0775  0.0245  -0.0724 405 ILE A CG2 
3031 C CD1 . ILE A 394 ? 0.8214 0.9510 0.8301 0.1061  0.0182  -0.0932 405 ILE A CD1 
3032 N N   . ALA A 395 ? 0.6141 0.8139 0.6193 0.0636  0.0459  -0.0879 406 ALA A N   
3033 C CA  . ALA A 395 ? 0.5400 0.7755 0.5498 0.0593  0.0519  -0.0943 406 ALA A CA  
3034 C C   . ALA A 395 ? 0.7081 0.9481 0.7082 0.0394  0.0574  -0.0858 406 ALA A C   
3035 O O   . ALA A 395 ? 0.7992 1.0548 0.8021 0.0321  0.0602  -0.0834 406 ALA A O   
3036 C CB  . ALA A 395 ? 0.6492 0.9094 0.6608 0.0666  0.0543  -0.1093 406 ALA A CB  
3037 N N   . ALA A 396 ? 0.6976 0.9222 0.6843 0.0303  0.0579  -0.0813 407 ALA A N   
3038 C CA  . ALA A 396 ? 0.7917 1.0124 0.7646 0.0118  0.0603  -0.0725 407 ALA A CA  
3039 C C   . ALA A 396 ? 0.8449 1.0449 0.8185 0.0088  0.0560  -0.0613 407 ALA A C   
3040 O O   . ALA A 396 ? 0.8021 1.0032 0.7673 -0.0046 0.0570  -0.0551 407 ALA A O   
3041 C CB  . ALA A 396 ? 0.8931 1.0976 0.8505 0.0049  0.0595  -0.0705 407 ALA A CB  
3042 N N   . GLY A 397 ? 0.8412 1.0223 0.8231 0.0203  0.0508  -0.0591 408 GLY A N   
3043 C CA  . GLY A 397 ? 0.8530 1.0181 0.8373 0.0187  0.0469  -0.0503 408 GLY A CA  
3044 C C   . GLY A 397 ? 0.8650 1.0451 0.8607 0.0214  0.0479  -0.0503 408 GLY A C   
3045 O O   . GLY A 397 ? 1.1001 1.2701 1.0973 0.0184  0.0453  -0.0431 408 GLY A O   
3046 N N   . SER A 398 ? 0.7526 0.9578 0.7567 0.0278  0.0511  -0.0591 409 SER A N   
3047 C CA  . SER A 398 ? 0.6730 0.8957 0.6878 0.0306  0.0519  -0.0603 409 SER A CA  
3048 C C   . SER A 398 ? 0.7450 0.9891 0.7553 0.0157  0.0573  -0.0589 409 SER A C   
3049 O O   . SER A 398 ? 0.7682 1.0174 0.7834 0.0127  0.0571  -0.0550 409 SER A O   
3050 C CB  . SER A 398 ? 0.6724 0.9131 0.6985 0.0462  0.0510  -0.0722 409 SER A CB  
3051 O OG  . SER A 398 ? 0.7475 1.0157 0.7723 0.0443  0.0563  -0.0826 409 SER A OG  
3052 N N   . ARG A 399 ? 0.7184 0.9748 0.7180 0.0048  0.0619  -0.0620 410 ARG A N   
3053 C CA  . ARG A 399 ? 0.6469 0.9218 0.6378 -0.0129 0.0668  -0.0602 410 ARG A CA  
3054 C C   . ARG A 399 ? 0.8016 1.0503 0.7804 -0.0251 0.0630  -0.0473 410 ARG A C   
3055 O O   . ARG A 399 ? 0.8980 1.1566 0.8733 -0.0365 0.0647  -0.0440 410 ARG A O   
3056 C CB  . ARG A 399 ? 0.6530 0.9440 0.6314 -0.0241 0.0721  -0.0659 410 ARG A CB  
3057 C CG  . ARG A 399 ? 0.7904 1.1129 0.7807 -0.0124 0.0759  -0.0812 410 ARG A CG  
3058 C CD  . ARG A 399 ? 1.0358 1.3762 1.0125 -0.0257 0.0817  -0.0868 410 ARG A CD  
3059 N NE  . ARG A 399 ? 1.2043 1.5616 1.1673 -0.0492 0.0868  -0.0835 410 ARG A NE  
3060 C CZ  . ARG A 399 ? 1.1556 1.5569 1.1247 -0.0557 0.0936  -0.0935 410 ARG A CZ  
3061 N NH1 . ARG A 399 ? 1.1603 1.5935 1.1501 -0.0380 0.0953  -0.1087 410 ARG A NH1 
3062 N NH2 . ARG A 399 ? 1.0644 1.4775 1.0176 -0.0802 0.0978  -0.0892 410 ARG A NH2 
3063 N N   . GLN A 400 ? 0.7608 0.9768 0.7326 -0.0224 0.0573  -0.0409 411 GLN A N   
3064 C CA  . GLN A 400 ? 0.7696 0.9604 0.7298 -0.0313 0.0518  -0.0307 411 GLN A CA  
3065 C C   . GLN A 400 ? 0.8179 1.0047 0.7907 -0.0248 0.0489  -0.0270 411 GLN A C   
3066 O O   . GLN A 400 ? 0.8728 1.0453 0.8377 -0.0325 0.0449  -0.0200 411 GLN A O   
3067 C CB  . GLN A 400 ? 0.7201 0.8812 0.6703 -0.0290 0.0459  -0.0275 411 GLN A CB  
3068 C CG  . GLN A 400 ? 0.8520 1.0046 0.8162 -0.0126 0.0436  -0.0303 411 GLN A CG  
3069 C CD  . GLN A 400 ? 0.8412 0.9678 0.7962 -0.0112 0.0378  -0.0280 411 GLN A CD  
3070 O OE1 . GLN A 400 ? 0.9854 1.0998 0.9484 -0.0023 0.0339  -0.0275 411 GLN A OE1 
3071 N NE2 . GLN A 400 ? 0.5873 0.7065 0.5245 -0.0208 0.0369  -0.0270 411 GLN A NE2 
3072 N N   . ASN A 401 ? 0.9326 1.1304 0.9234 -0.0109 0.0500  -0.0316 412 ASN A N   
3073 C CA  . ASN A 401 ? 1.0411 1.2365 1.0434 -0.0050 0.0474  -0.0284 412 ASN A CA  
3074 C C   . ASN A 401 ? 0.9690 1.1928 0.9809 -0.0054 0.0517  -0.0323 412 ASN A C   
3075 O O   . ASN A 401 ? 1.1744 1.4041 1.1999 0.0057  0.0504  -0.0345 412 ASN A O   
3076 C CB  . ASN A 401 ? 1.1892 1.3719 1.2014 0.0094  0.0438  -0.0298 412 ASN A CB  
3077 C CG  . ASN A 401 ? 1.2351 1.3925 1.2394 0.0093  0.0395  -0.0265 412 ASN A CG  
3078 O OD1 . ASN A 401 ? 1.2402 1.3851 1.2343 0.0009  0.0368  -0.0217 412 ASN A OD1 
3079 N ND2 . ASN A 401 ? 1.1200 1.2693 1.1283 0.0188  0.0378  -0.0297 412 ASN A ND2 
3080 N N   . ALA A 402 ? 0.8326 1.0748 0.8365 -0.0189 0.0562  -0.0335 413 ALA A N   
3081 C CA  . ALA A 402 ? 0.8311 1.1055 0.8445 -0.0202 0.0607  -0.0389 413 ALA A CA  
3082 C C   . ALA A 402 ? 0.6893 0.9596 0.7050 -0.0248 0.0586  -0.0320 413 ALA A C   
3083 O O   . ALA A 402 ? 0.7635 1.0520 0.7931 -0.0178 0.0595  -0.0355 413 ALA A O   
3084 C CB  . ALA A 402 ? 0.8596 1.1591 0.8626 -0.0355 0.0672  -0.0437 413 ALA A CB  
3085 N N   . HIS A 403 ? 0.7131 0.9588 0.7149 -0.0356 0.0548  -0.0228 414 HIS A N   
3086 C CA  . HIS A 403 ? 0.6965 0.9368 0.6985 -0.0408 0.0522  -0.0166 414 HIS A CA  
3087 C C   . HIS A 403 ? 0.5258 0.7578 0.5432 -0.0262 0.0485  -0.0152 414 HIS A C   
3088 O O   . HIS A 403 ? 0.5123 0.7452 0.5334 -0.0285 0.0470  -0.0116 414 HIS A O   
3089 C CB  . HIS A 403 ? 0.8247 1.0368 0.8061 -0.0536 0.0468  -0.0085 414 HIS A CB  
3090 C CG  . HIS A 403 ? 0.8566 1.0393 0.8351 -0.0453 0.0403  -0.0058 414 HIS A CG  
3091 N ND1 . HIS A 403 ? 0.8937 1.0712 0.8709 -0.0394 0.0409  -0.0092 414 HIS A ND1 
3092 C CD2 . HIS A 403 ? 0.8563 1.0157 0.8332 -0.0418 0.0331  -0.0013 414 HIS A CD2 
3093 C CE1 . HIS A 403 ? 0.9299 1.0828 0.9050 -0.0332 0.0345  -0.0067 414 HIS A CE1 
3094 N NE2 . HIS A 403 ? 0.9286 1.0714 0.9039 -0.0342 0.0296  -0.0024 414 HIS A NE2 
3095 N N   . PHE A 404 ? 0.4724 0.6958 0.4972 -0.0128 0.0467  -0.0178 415 PHE A N   
3096 C CA  . PHE A 404 ? 0.4787 0.6929 0.5147 -0.0016 0.0429  -0.0161 415 PHE A CA  
3097 C C   . PHE A 404 ? 0.5240 0.7603 0.5735 0.0059  0.0445  -0.0206 415 PHE A C   
3098 O O   . PHE A 404 ? 0.4583 0.7195 0.5112 0.0059  0.0486  -0.0273 415 PHE A O   
3099 C CB  . PHE A 404 ? 0.5342 0.7316 0.5709 0.0080  0.0401  -0.0175 415 PHE A CB  
3100 C CG  . PHE A 404 ? 0.7376 0.9118 0.7644 0.0035  0.0365  -0.0132 415 PHE A CG  
3101 C CD1 . PHE A 404 ? 0.8055 0.9704 0.8258 -0.0046 0.0335  -0.0081 415 PHE A CD1 
3102 C CD2 . PHE A 404 ? 0.7641 0.9257 0.7877 0.0083  0.0350  -0.0153 415 PHE A CD2 
3103 C CE1 . PHE A 404 ? 0.7870 0.9316 0.7984 -0.0064 0.0285  -0.0061 415 PHE A CE1 
3104 C CE2 . PHE A 404 ? 0.8424 0.9852 0.8578 0.0052  0.0310  -0.0128 415 PHE A CE2 
3105 C CZ  . PHE A 404 ? 0.8137 0.9484 0.8232 -0.0014 0.0273  -0.0087 415 PHE A CZ  
3106 N N   . SER A 405 ? 0.5291 0.7571 0.5858 0.0124  0.0407  -0.0175 416 SER A N   
3107 C CA  . SER A 405 ? 0.4448 0.6891 0.5128 0.0206  0.0402  -0.0210 416 SER A CA  
3108 C C   . SER A 405 ? 0.6786 0.9263 0.7515 0.0347  0.0383  -0.0288 416 SER A C   
3109 O O   . SER A 405 ? 0.8747 1.1060 0.9429 0.0388  0.0364  -0.0293 416 SER A O   
3110 C CB  . SER A 405 ? 0.4385 0.6700 0.5102 0.0224  0.0360  -0.0150 416 SER A CB  
3111 O OG  . SER A 405 ? 0.5450 0.7871 0.6257 0.0321  0.0336  -0.0182 416 SER A OG  
3112 N N   . THR A 406 ? 0.5598 0.8292 0.6418 0.0427  0.0378  -0.0355 417 THR A N   
3113 C CA  . THR A 406 ? 0.6325 0.9037 0.7188 0.0590  0.0332  -0.0441 417 THR A CA  
3114 C C   . THR A 406 ? 0.7256 0.9742 0.8121 0.0685  0.0250  -0.0403 417 THR A C   
3115 O O   . THR A 406 ? 0.7088 0.9523 0.7958 0.0827  0.0185  -0.0467 417 THR A O   
3116 C CB  . THR A 406 ? 0.4785 0.7862 0.5744 0.0648  0.0353  -0.0557 417 THR A CB  
3117 O OG1 . THR A 406 ? 0.4525 0.7739 0.5548 0.0613  0.0357  -0.0533 417 THR A OG1 
3118 C CG2 . THR A 406 ? 0.4949 0.8259 0.5882 0.0543  0.0434  -0.0609 417 THR A CG2 
3119 N N   . MET A 407 ? 0.6708 0.9051 0.7551 0.0606  0.0243  -0.0306 418 MET A N   
3120 C CA  . MET A 407 ? 0.5495 0.7635 0.6317 0.0662  0.0169  -0.0263 418 MET A CA  
3121 C C   . MET A 407 ? 0.5723 0.7581 0.6449 0.0689  0.0124  -0.0245 418 MET A C   
3122 O O   . MET A 407 ? 0.7649 0.9417 0.8327 0.0611  0.0158  -0.0214 418 MET A O   
3123 C CB  . MET A 407 ? 0.4501 0.6605 0.5328 0.0555  0.0184  -0.0174 418 MET A CB  
3124 C CG  . MET A 407 ? 0.5380 0.7251 0.6153 0.0562  0.0120  -0.0115 418 MET A CG  
3125 S SD  . MET A 407 ? 0.5192 0.7056 0.5977 0.0435  0.0144  -0.0031 418 MET A SD  
3126 C CE  . MET A 407 ? 0.7976 1.0075 0.8856 0.0463  0.0148  -0.0048 418 MET A CE  
3127 N N   . GLU A 408 ? 0.4857 0.6565 0.5540 0.0799  0.0038  -0.0268 419 GLU A N   
3128 C CA  . GLU A 408 ? 0.7016 0.8427 0.7580 0.0805  -0.0016 -0.0242 419 GLU A CA  
3129 C C   . GLU A 408 ? 0.7522 0.8782 0.8032 0.0674  -0.0008 -0.0144 419 GLU A C   
3130 O O   . GLU A 408 ? 0.8463 0.9791 0.9013 0.0619  0.0005  -0.0099 419 GLU A O   
3131 C CB  . GLU A 408 ? 0.8627 0.9868 0.9119 0.0942  -0.0132 -0.0282 419 GLU A CB  
3132 C CG  . GLU A 408 ? 1.0569 1.1964 1.1115 0.1099  -0.0158 -0.0407 419 GLU A CG  
3133 C CD  . GLU A 408 ? 1.3023 1.4398 1.3541 0.1108  -0.0127 -0.0455 419 GLU A CD  
3134 O OE1 . GLU A 408 ? 1.3607 1.4744 1.4024 0.1031  -0.0130 -0.0395 419 GLU A OE1 
3135 O OE2 . GLU A 408 ? 1.2671 1.4286 1.3267 0.1186  -0.0098 -0.0559 419 GLU A OE2 
3136 N N   . TRP A 409 ? 0.6874 0.7949 0.7296 0.0623  -0.0014 -0.0123 420 TRP A N   
3137 C CA  . TRP A 409 ? 0.4944 0.5929 0.5325 0.0495  0.0001  -0.0056 420 TRP A CA  
3138 C C   . TRP A 409 ? 0.5024 0.5905 0.5352 0.0467  -0.0055 -0.0005 420 TRP A C   
3139 O O   . TRP A 409 ? 0.5234 0.5904 0.5445 0.0507  -0.0138 0.0000  420 TRP A O   
3140 C CB  . TRP A 409 ? 0.5030 0.5840 0.5316 0.0454  -0.0009 -0.0057 420 TRP A CB  
3141 C CG  . TRP A 409 ? 0.6604 0.7376 0.6859 0.0323  0.0008  -0.0012 420 TRP A CG  
3142 C CD1 . TRP A 409 ? 0.7086 0.7682 0.7224 0.0247  -0.0037 0.0019  420 TRP A CD1 
3143 C CD2 . TRP A 409 ? 0.7205 0.8132 0.7541 0.0251  0.0066  -0.0005 420 TRP A CD2 
3144 N NE1 . TRP A 409 ? 0.6747 0.7427 0.6910 0.0133  0.0001  0.0033  420 TRP A NE1 
3145 C CE2 . TRP A 409 ? 0.7282 0.8155 0.7568 0.0148  0.0057  0.0015  420 TRP A CE2 
3146 C CE3 . TRP A 409 ? 0.6837 0.7934 0.7263 0.0259  0.0116  -0.0019 420 TRP A CE3 
3147 C CZ2 . TRP A 409 ? 0.6623 0.7625 0.6969 0.0080  0.0091  0.0007  420 TRP A CZ2 
3148 C CZ3 . TRP A 409 ? 0.6624 0.7793 0.7083 0.0188  0.0139  -0.0012 420 TRP A CZ3 
3149 C CH2 . TRP A 409 ? 0.6840 0.7970 0.7269 0.0113  0.0124  -0.0007 420 TRP A CH2 
3150 N N   . PRO A 410 ? 0.5941 0.6945 0.6332 0.0396  -0.0022 0.0034  421 PRO A N   
3151 C CA  . PRO A 410 ? 0.5689 0.6621 0.6033 0.0373  -0.0074 0.0079  421 PRO A CA  
3152 C C   . PRO A 410 ? 0.5514 0.6249 0.5720 0.0263  -0.0111 0.0125  421 PRO A C   
3153 O O   . PRO A 410 ? 0.9010 0.9605 0.9114 0.0246  -0.0179 0.0162  421 PRO A O   
3154 C CB  . PRO A 410 ? 0.5805 0.6955 0.6268 0.0326  -0.0017 0.0096  421 PRO A CB  
3155 C CG  . PRO A 410 ? 0.5945 0.7191 0.6461 0.0273  0.0050  0.0079  421 PRO A CG  
3156 C CD  . PRO A 410 ? 0.5997 0.7195 0.6490 0.0339  0.0054  0.0034  421 PRO A CD  
3157 N N   . ILE A 411 ? 0.5148 0.5876 0.5336 0.0179  -0.0072 0.0119  422 ILE A N   
3158 C CA  . ILE A 411 ? 0.5802 0.6385 0.5857 0.0053  -0.0100 0.0150  422 ILE A CA  
3159 C C   . ILE A 411 ? 0.6094 0.6413 0.5991 0.0080  -0.0169 0.0146  422 ILE A C   
3160 O O   . ILE A 411 ? 0.7330 0.7598 0.7187 0.0041  -0.0153 0.0124  422 ILE A O   
3161 C CB  . ILE A 411 ? 0.5059 0.5788 0.5175 -0.0046 -0.0034 0.0127  422 ILE A CB  
3162 C CG1 . ILE A 411 ? 0.5213 0.6179 0.5482 -0.0038 0.0019  0.0117  422 ILE A CG1 
3163 C CG2 . ILE A 411 ? 0.5865 0.6529 0.5861 -0.0200 -0.0053 0.0148  422 ILE A CG2 
3164 C CD1 . ILE A 411 ? 0.5839 0.6944 0.6164 -0.0111 0.0060  0.0079  422 ILE A CD1 
3165 N N   . ASP A 412 ? 0.5637 0.5772 0.5432 0.0154  -0.0258 0.0163  423 ASP A N   
3166 C CA  . ASP A 412 ? 0.5924 0.5766 0.5547 0.0207  -0.0351 0.0153  423 ASP A CA  
3167 C C   . ASP A 412 ? 0.8518 0.8068 0.7896 0.0076  -0.0438 0.0216  423 ASP A C   
3168 O O   . ASP A 412 ? 1.0219 0.9458 0.9408 0.0126  -0.0552 0.0220  423 ASP A O   
3169 C CB  . ASP A 412 ? 0.8839 0.8652 0.8495 0.0403  -0.0415 0.0108  423 ASP A CB  
3170 C CG  . ASP A 412 ? 0.9154 0.8981 0.8811 0.0436  -0.0465 0.0136  423 ASP A CG  
3171 O OD1 . ASP A 412 ? 1.0010 1.0102 0.9828 0.0415  -0.0387 0.0144  423 ASP A OD1 
3172 O OD2 . ASP A 412 ? 0.9319 0.8869 0.8799 0.0483  -0.0593 0.0152  423 ASP A OD2 
3173 N N   . GLY A 413 ? 0.7175 0.6813 0.6535 -0.0096 -0.0395 0.0260  424 GLY A N   
3174 C CA  . GLY A 413 ? 0.7811 0.7194 0.6918 -0.0255 -0.0473 0.0323  424 GLY A CA  
3175 C C   . GLY A 413 ? 0.7439 0.6601 0.6362 -0.0353 -0.0505 0.0322  424 GLY A C   
3176 O O   . GLY A 413 ? 0.8283 0.7608 0.7306 -0.0393 -0.0423 0.0280  424 GLY A O   
3177 N N   . GLY A 414 ? 0.7229 0.6001 0.5867 -0.0394 -0.0636 0.0367  425 GLY A N   
3178 C CA  . GLY A 414 ? 0.7581 0.6091 0.5995 -0.0510 -0.0685 0.0376  425 GLY A CA  
3179 C C   . GLY A 414 ? 0.8357 0.6606 0.6701 -0.0328 -0.0776 0.0336  425 GLY A C   
3180 O O   . GLY A 414 ? 0.7711 0.6057 0.6223 -0.0106 -0.0778 0.0283  425 GLY A O   
3181 N N   . THR A 415 ? 0.9699 0.7624 0.7783 -0.0434 -0.0854 0.0354  426 THR A N   
3182 C CA  . THR A 415 ? 0.8118 0.5754 0.6093 -0.0281 -0.0955 0.0311  426 THR A CA  
3183 C C   . THR A 415 ? 0.9418 0.7036 0.7337 -0.0408 -0.0907 0.0293  426 THR A C   
3184 O O   . THR A 415 ? 0.8393 0.5820 0.6068 -0.0639 -0.0940 0.0346  426 THR A O   
3185 C CB  . THR A 415 ? 0.8643 0.5765 0.6272 -0.0261 -0.1157 0.0357  426 THR A CB  
3186 O OG1 . THR A 415 ? 0.9106 0.6264 0.6773 -0.0184 -0.1198 0.0383  426 THR A OG1 
3187 C CG2 . THR A 415 ? 0.9062 0.5927 0.6625 -0.0038 -0.1273 0.0285  426 THR A CG2 
3188 N N   . SER A 416 ? 0.9734 0.7557 0.7868 -0.0270 -0.0830 0.0216  427 SER A N   
3189 C CA  . SER A 416 ? 0.9024 0.6867 0.7136 -0.0370 -0.0779 0.0188  427 SER A CA  
3190 C C   . SER A 416 ? 0.9211 0.6587 0.7027 -0.0356 -0.0925 0.0189  427 SER A C   
3191 O O   . SER A 416 ? 1.0892 0.8100 0.8696 -0.0138 -0.1014 0.0142  427 SER A O   
3192 C CB  . SER A 416 ? 0.7468 0.5668 0.5890 -0.0228 -0.0657 0.0110  427 SER A CB  
3193 O OG  . SER A 416 ? 0.8156 0.6365 0.6555 -0.0309 -0.0616 0.0079  427 SER A OG  
3194 N N   . LEU A 417 ? 0.8924 0.6100 0.6494 -0.0592 -0.0953 0.0232  428 LEU A N   
3195 C CA  . LEU A 417 ? 1.0363 0.7063 0.7613 -0.0616 -0.1098 0.0239  428 LEU A CA  
3196 C C   . LEU A 417 ? 1.2115 0.8886 0.9444 -0.0579 -0.1045 0.0170  428 LEU A C   
3197 O O   . LEU A 417 ? 1.3329 0.9713 1.0415 -0.0567 -0.1164 0.0161  428 LEU A O   
3198 C CB  . LEU A 417 ? 1.0599 0.7005 0.7488 -0.0923 -0.1170 0.0328  428 LEU A CB  
3199 C CG  . LEU A 417 ? 1.0047 0.6048 0.6636 -0.0956 -0.1333 0.0408  428 LEU A CG  
3200 C CD1 . LEU A 417 ? 1.0455 0.6748 0.7265 -0.0873 -0.1272 0.0422  428 LEU A CD1 
3201 C CD2 . LEU A 417 ? 1.0615 0.6330 0.6816 -0.1304 -0.1393 0.0495  428 LEU A CD2 
3202 N N   . THR A 418 ? 1.1686 0.8915 0.9330 -0.0559 -0.0882 0.0120  429 THR A N   
3203 C CA  . THR A 418 ? 1.1614 0.8924 0.9335 -0.0527 -0.0830 0.0055  429 THR A CA  
3204 C C   . THR A 418 ? 1.2693 0.9864 1.0455 -0.0257 -0.0898 -0.0011 429 THR A C   
3205 O O   . THR A 418 ? 1.2951 1.0301 1.0911 -0.0063 -0.0875 -0.0043 429 THR A O   
3206 C CB  . THR A 418 ? 1.2714 1.0529 1.0753 -0.0546 -0.0657 0.0015  429 THR A CB  
3207 O OG1 . THR A 418 ? 1.4475 1.2483 1.2529 -0.0741 -0.0599 0.0058  429 THR A OG1 
3208 C CG2 . THR A 418 ? 1.2540 1.0413 1.0591 -0.0602 -0.0611 -0.0037 429 THR A CG2 
3209 N N   . PRO A 419 ? 1.1970 0.8843 0.9548 -0.0240 -0.0982 -0.0041 430 PRO A N   
3210 C CA  . PRO A 419 ? 1.1206 0.7964 0.8820 0.0025  -0.1054 -0.0123 430 PRO A CA  
3211 C C   . PRO A 419 ? 1.1481 0.8667 0.9428 0.0168  -0.0913 -0.0202 430 PRO A C   
3212 O O   . PRO A 419 ? 1.1122 0.8653 0.9256 0.0066  -0.0772 -0.0191 430 PRO A O   
3213 C CB  . PRO A 419 ? 0.9367 0.5692 0.6675 -0.0039 -0.1175 -0.0129 430 PRO A CB  
3214 C CG  . PRO A 419 ? 1.0220 0.6626 0.7461 -0.0327 -0.1092 -0.0078 430 PRO A CG  
3215 C CD  . PRO A 419 ? 1.2214 0.8842 0.9529 -0.0471 -0.1021 -0.0009 430 PRO A CD  
3216 N N   . ALA A 420 ? 1.3258 1.0420 1.1266 0.0403  -0.0961 -0.0289 431 ALA A N   
3217 C CA  . ALA A 420 ? 1.3916 1.1465 1.2207 0.0531  -0.0838 -0.0365 431 ALA A CA  
3218 C C   . ALA A 420 ? 1.3404 1.1029 1.1710 0.0422  -0.0759 -0.0380 431 ALA A C   
3219 O O   . ALA A 420 ? 1.3619 1.0953 1.1704 0.0305  -0.0826 -0.0360 431 ALA A O   
3220 C CB  . ALA A 420 ? 1.5406 1.2909 1.3726 0.0792  -0.0917 -0.0471 431 ALA A CB  
3221 N N   . PRO A 421 ? 1.2851 1.0858 1.1403 0.0450  -0.0622 -0.0413 432 PRO A N   
3222 C CA  . PRO A 421 ? 1.2837 1.0925 1.1408 0.0359  -0.0555 -0.0432 432 PRO A CA  
3223 C C   . PRO A 421 ? 1.2453 1.0342 1.0920 0.0469  -0.0623 -0.0507 432 PRO A C   
3224 O O   . PRO A 421 ? 1.1268 0.9117 0.9753 0.0662  -0.0680 -0.0574 432 PRO A O   
3225 C CB  . PRO A 421 ? 1.2311 1.0818 1.1149 0.0395  -0.0418 -0.0451 432 PRO A CB  
3226 C CG  . PRO A 421 ? 1.1445 1.0066 1.0393 0.0558  -0.0424 -0.0476 432 PRO A CG  
3227 C CD  . PRO A 421 ? 1.2232 1.0596 1.1031 0.0548  -0.0531 -0.0429 432 PRO A CD  
3228 N N   . PRO A 422 ? 1.2208 0.9984 1.0568 0.0355  -0.0623 -0.0510 433 PRO A N   
3229 C CA  . PRO A 422 ? 1.1761 0.9348 1.0020 0.0457  -0.0687 -0.0586 433 PRO A CA  
3230 C C   . PRO A 422 ? 1.2048 0.9940 1.0518 0.0607  -0.0600 -0.0668 433 PRO A C   
3231 O O   . PRO A 422 ? 1.2503 1.0355 1.0977 0.0791  -0.0652 -0.0750 433 PRO A O   
3232 C CB  . PRO A 422 ? 1.1187 0.8628 0.9293 0.0258  -0.0690 -0.0558 433 PRO A CB  
3233 C CG  . PRO A 422 ? 1.0373 0.8107 0.8612 0.0092  -0.0577 -0.0503 433 PRO A CG  
3234 C CD  . PRO A 422 ? 1.0789 0.8610 0.9105 0.0124  -0.0573 -0.0455 433 PRO A CD  
3235 N N   . GLN A 423 ? 1.0901 0.9098 0.9533 0.0528  -0.0475 -0.0655 434 GLN A N   
3236 C CA  . GLN A 423 ? 0.9950 0.8425 0.8749 0.0628  -0.0389 -0.0719 434 GLN A CA  
3237 C C   . GLN A 423 ? 0.8979 0.7782 0.7973 0.0616  -0.0289 -0.0685 434 GLN A C   
3238 O O   . GLN A 423 ? 0.6820 0.5651 0.5836 0.0528  -0.0279 -0.0616 434 GLN A O   
3239 C CB  . GLN A 423 ? 1.0380 0.8870 0.9154 0.0551  -0.0351 -0.0742 434 GLN A CB  
3240 C CG  . GLN A 423 ? 1.0962 0.9536 0.9751 0.0365  -0.0301 -0.0682 434 GLN A CG  
3241 C CD  . GLN A 423 ? 1.1756 1.0361 1.0526 0.0303  -0.0272 -0.0718 434 GLN A CD  
3242 O OE1 . GLN A 423 ? 1.2023 1.0544 1.0744 0.0385  -0.0294 -0.0778 434 GLN A OE1 
3243 N NE2 . GLN A 423 ? 1.1959 1.0701 1.0771 0.0164  -0.0226 -0.0692 434 GLN A NE2 
3244 N N   . ARG A 424 ? 0.9000 0.8047 0.8123 0.0697  -0.0218 -0.0734 435 ARG A N   
3245 C CA  . ARG A 424 ? 0.8042 0.7379 0.7324 0.0679  -0.0130 -0.0705 435 ARG A CA  
3246 C C   . ARG A 424 ? 0.7269 0.6721 0.6586 0.0576  -0.0066 -0.0687 435 ARG A C   
3247 O O   . ARG A 424 ? 0.7733 0.7268 0.7063 0.0606  -0.0033 -0.0733 435 ARG A O   
3248 C CB  . ARG A 424 ? 0.7785 0.7320 0.7158 0.0811  -0.0098 -0.0771 435 ARG A CB  
3249 C CG  . ARG A 424 ? 0.9848 0.9371 0.9240 0.0918  -0.0150 -0.0791 435 ARG A CG  
3250 C CD  . ARG A 424 ? 1.1879 1.1230 1.1179 0.1059  -0.0243 -0.0882 435 ARG A CD  
3251 N NE  . ARG A 424 ? 1.2552 1.2038 1.1877 0.1123  -0.0205 -0.0973 435 ARG A NE  
3252 C CZ  . ARG A 424 ? 1.3595 1.3027 1.2877 0.1271  -0.0269 -0.1084 435 ARG A CZ  
3253 N NH1 . ARG A 424 ? 1.3745 1.2963 1.2947 0.1382  -0.0389 -0.1118 435 ARG A NH1 
3254 N NH2 . ARG A 424 ? 1.3882 1.3469 1.3191 0.1311  -0.0224 -0.1167 435 ARG A NH2 
3255 N N   . ASP A 425 ? 0.6679 0.6143 0.6009 0.0458  -0.0056 -0.0629 436 ASP A N   
3256 C CA  . ASP A 425 ? 0.6980 0.6580 0.6360 0.0381  -0.0010 -0.0624 436 ASP A CA  
3257 C C   . ASP A 425 ? 0.6010 0.5821 0.5505 0.0392  0.0043  -0.0600 436 ASP A C   
3258 O O   . ASP A 425 ? 0.5805 0.5671 0.5352 0.0428  0.0049  -0.0574 436 ASP A O   
3259 C CB  . ASP A 425 ? 0.7069 0.6614 0.6406 0.0250  -0.0030 -0.0600 436 ASP A CB  
3260 C CG  . ASP A 425 ? 0.8629 0.7954 0.7822 0.0205  -0.0083 -0.0621 436 ASP A CG  
3261 O OD1 . ASP A 425 ? 0.9555 0.8794 0.8697 0.0278  -0.0097 -0.0666 436 ASP A OD1 
3262 O OD2 . ASP A 425 ? 0.8842 0.8080 0.7960 0.0086  -0.0113 -0.0595 436 ASP A OD2 
3263 N N   . LEU A 426 ? 0.5749 0.5664 0.5272 0.0361  0.0070  -0.0609 437 LEU A N   
3264 C CA  . LEU A 426 ? 0.6349 0.6419 0.5940 0.0366  0.0104  -0.0588 437 LEU A CA  
3265 C C   . LEU A 426 ? 0.5531 0.5652 0.5135 0.0305  0.0094  -0.0589 437 LEU A C   
3266 O O   . LEU A 426 ? 0.5576 0.5665 0.5134 0.0294  0.0081  -0.0626 437 LEU A O   
3267 C CB  . LEU A 426 ? 0.7043 0.7173 0.6614 0.0422  0.0135  -0.0616 437 LEU A CB  
3268 C CG  . LEU A 426 ? 0.5540 0.5810 0.5144 0.0416  0.0170  -0.0590 437 LEU A CG  
3269 C CD1 . LEU A 426 ? 0.5496 0.5834 0.5168 0.0445  0.0182  -0.0567 437 LEU A CD1 
3270 C CD2 . LEU A 426 ? 0.7291 0.7622 0.6840 0.0434  0.0199  -0.0627 437 LEU A CD2 
3271 N N   . LEU A 427 ? 0.5426 0.5631 0.5091 0.0277  0.0093  -0.0558 438 LEU A N   
3272 C CA  . LEU A 427 ? 0.5362 0.5634 0.5048 0.0243  0.0068  -0.0576 438 LEU A CA  
3273 C C   . LEU A 427 ? 0.7588 0.7907 0.7271 0.0266  0.0067  -0.0555 438 LEU A C   
3274 O O   . LEU A 427 ? 0.7462 0.7822 0.7177 0.0272  0.0088  -0.0514 438 LEU A O   
3275 C CB  . LEU A 427 ? 0.5687 0.6025 0.5434 0.0189  0.0054  -0.0574 438 LEU A CB  
3276 C CG  . LEU A 427 ? 0.5238 0.5684 0.5024 0.0172  0.0017  -0.0619 438 LEU A CG  
3277 C CD1 . LEU A 427 ? 0.5300 0.5737 0.5046 0.0163  -0.0008 -0.0684 438 LEU A CD1 
3278 C CD2 . LEU A 427 ? 0.5171 0.5728 0.5027 0.0117  0.0013  -0.0625 438 LEU A CD2 
3279 N N   . LEU A 428 ? 0.7202 0.7498 0.6827 0.0273  0.0036  -0.0583 439 LEU A N   
3280 C CA  . LEU A 428 ? 0.7363 0.7649 0.6933 0.0277  0.0013  -0.0562 439 LEU A CA  
3281 C C   . LEU A 428 ? 0.8175 0.8478 0.7759 0.0282  -0.0058 -0.0593 439 LEU A C   
3282 O O   . LEU A 428 ? 0.8499 0.8827 0.8105 0.0289  -0.0091 -0.0653 439 LEU A O   
3283 C CB  . LEU A 428 ? 0.6440 0.6654 0.5892 0.0280  0.0013  -0.0570 439 LEU A CB  
3284 C CG  . LEU A 428 ? 0.6783 0.7019 0.6206 0.0279  0.0078  -0.0551 439 LEU A CG  
3285 C CD1 . LEU A 428 ? 0.7771 0.8014 0.7251 0.0311  0.0112  -0.0578 439 LEU A CD1 
3286 C CD2 . LEU A 428 ? 0.6370 0.6555 0.5658 0.0260  0.0072  -0.0560 439 LEU A CD2 
3287 N N   . THR A 429 ? 0.8203 0.8501 0.7771 0.0282  -0.0086 -0.0563 440 THR A N   
3288 C CA  . THR A 429 ? 0.7638 0.7947 0.7216 0.0308  -0.0170 -0.0605 440 THR A CA  
3289 C C   . THR A 429 ? 0.6988 0.7160 0.6421 0.0313  -0.0236 -0.0579 440 THR A C   
3290 O O   . THR A 429 ? 0.6646 0.6783 0.6030 0.0275  -0.0208 -0.0513 440 THR A O   
3291 C CB  . THR A 429 ? 0.7219 0.7646 0.6917 0.0300  -0.0158 -0.0601 440 THR A CB  
3292 O OG1 . THR A 429 ? 0.7745 0.8155 0.7435 0.0276  -0.0116 -0.0525 440 THR A OG1 
3293 C CG2 . THR A 429 ? 0.7554 0.8087 0.7354 0.0271  -0.0107 -0.0622 440 THR A CG2 
3294 N N   . GLY A 430 ? 0.7577 0.7663 0.6926 0.0354  -0.0332 -0.0634 441 GLY A N   
3295 C CA  . GLY A 430 ? 0.8692 0.8599 0.7869 0.0360  -0.0429 -0.0615 441 GLY A CA  
3296 C C   . GLY A 430 ? 0.7887 0.7803 0.7100 0.0413  -0.0523 -0.0657 441 GLY A C   
3297 O O   . GLY A 430 ? 0.7544 0.7613 0.6898 0.0465  -0.0543 -0.0739 441 GLY A O   
3298 N N   . HIS A 431 ? 0.7156 0.6915 0.6231 0.0392  -0.0583 -0.0606 442 HIS A N   
3299 C CA  . HIS A 431 ? 0.6749 0.6502 0.5849 0.0442  -0.0671 -0.0639 442 HIS A CA  
3300 C C   . HIS A 431 ? 0.8654 0.8128 0.7519 0.0478  -0.0837 -0.0650 442 HIS A C   
3301 O O   . HIS A 431 ? 1.0164 0.9442 0.8830 0.0439  -0.0874 -0.0613 442 HIS A O   
3302 C CB  . HIS A 431 ? 0.5818 0.5641 0.4983 0.0379  -0.0589 -0.0562 442 HIS A CB  
3303 C CG  . HIS A 431 ? 0.5577 0.5632 0.4944 0.0351  -0.0449 -0.0550 442 HIS A CG  
3304 N ND1 . HIS A 431 ? 0.7040 0.7282 0.6585 0.0382  -0.0431 -0.0602 442 HIS A ND1 
3305 C CD2 . HIS A 431 ? 0.5689 0.5802 0.5088 0.0296  -0.0334 -0.0498 442 HIS A CD2 
3306 C CE1 . HIS A 431 ? 0.5809 0.6180 0.5466 0.0339  -0.0316 -0.0570 442 HIS A CE1 
3307 N NE2 . HIS A 431 ? 0.5614 0.5906 0.5191 0.0299  -0.0260 -0.0512 442 HIS A NE2 
3308 N N   . GLU A 432 ? 0.7522 0.6970 0.6398 0.0552  -0.0948 -0.0707 443 GLU A N   
3309 C CA  . GLU A 432 ? 0.7390 0.6547 0.6036 0.0615  -0.1143 -0.0740 443 GLU A CA  
3310 C C   . GLU A 432 ? 0.8371 0.7238 0.6752 0.0502  -0.1172 -0.0617 443 GLU A C   
3311 O O   . GLU A 432 ? 0.9523 0.8077 0.7629 0.0499  -0.1311 -0.0603 443 GLU A O   
3312 C CB  . GLU A 432 ? 0.7484 0.6715 0.6228 0.0741  -0.1260 -0.0855 443 GLU A CB  
3313 C CG  . GLU A 432 ? 1.0878 0.9807 0.9394 0.0849  -0.1494 -0.0925 443 GLU A CG  
3314 C CD  . GLU A 432 ? 1.2473 1.1477 1.1080 0.0976  -0.1612 -0.1040 443 GLU A CD  
3315 O OE1 . GLU A 432 ? 1.3565 1.2750 1.2327 0.0936  -0.1517 -0.1015 443 GLU A OE1 
3316 O OE2 . GLU A 432 ? 1.3490 1.2376 1.2011 0.1123  -0.1806 -0.1166 443 GLU A OE2 
3317 N N   . ASP A 433 ? 0.8012 0.6975 0.6455 0.0400  -0.1050 -0.0528 444 ASP A N   
3318 C CA  . ASP A 433 ? 0.8213 0.6950 0.6414 0.0269  -0.1066 -0.0417 444 ASP A CA  
3319 C C   . ASP A 433 ? 0.7666 0.6374 0.5743 0.0136  -0.0966 -0.0334 444 ASP A C   
3320 O O   . ASP A 433 ? 0.7123 0.5713 0.5015 -0.0004 -0.0946 -0.0243 444 ASP A O   
3321 C CB  . ASP A 433 ? 0.8945 0.7827 0.7273 0.0221  -0.0983 -0.0372 444 ASP A CB  
3322 C CG  . ASP A 433 ? 1.0113 0.9294 0.8654 0.0156  -0.0779 -0.0329 444 ASP A CG  
3323 O OD1 . ASP A 433 ? 1.1668 1.0892 1.0189 0.0049  -0.0699 -0.0251 444 ASP A OD1 
3324 O OD2 . ASP A 433 ? 1.0383 0.9747 0.9098 0.0211  -0.0707 -0.0378 444 ASP A OD2 
3325 N N   . GLY A 434 ? 0.7965 0.6793 0.6134 0.0169  -0.0903 -0.0371 445 GLY A N   
3326 C CA  . GLY A 434 ? 0.8190 0.7004 0.6243 0.0058  -0.0817 -0.0313 445 GLY A CA  
3327 C C   . GLY A 434 ? 0.7870 0.6978 0.6123 0.0000  -0.0623 -0.0282 445 GLY A C   
3328 O O   . GLY A 434 ? 0.7905 0.7035 0.6063 -0.0098 -0.0546 -0.0241 445 GLY A O   
3329 N N   . THR A 435 ? 0.7406 0.6738 0.5918 0.0060  -0.0550 -0.0308 446 THR A N   
3330 C CA  . THR A 435 ? 0.7844 0.7427 0.6534 0.0023  -0.0390 -0.0284 446 THR A CA  
3331 C C   . THR A 435 ? 0.7565 0.7296 0.6431 0.0099  -0.0328 -0.0344 446 THR A C   
3332 O O   . THR A 435 ? 0.8123 0.7856 0.7066 0.0187  -0.0389 -0.0409 446 THR A O   
3333 C CB  . THR A 435 ? 0.7893 0.7606 0.6731 0.0026  -0.0350 -0.0265 446 THR A CB  
3334 O OG1 . THR A 435 ? 0.8960 0.8692 0.7920 0.0130  -0.0419 -0.0327 446 THR A OG1 
3335 C CG2 . THR A 435 ? 1.0071 0.9654 0.8729 -0.0075 -0.0390 -0.0199 446 THR A CG2 
3336 N N   . VAL A 436 ? 0.6627 0.6491 0.5550 0.0062  -0.0213 -0.0328 447 VAL A N   
3337 C CA  . VAL A 436 ? 0.6669 0.6658 0.5744 0.0121  -0.0150 -0.0375 447 VAL A CA  
3338 C C   . VAL A 436 ? 0.7428 0.7599 0.6664 0.0119  -0.0048 -0.0358 447 VAL A C   
3339 O O   . VAL A 436 ? 0.5616 0.5852 0.4818 0.0061  0.0009  -0.0322 447 VAL A O   
3340 C CB  . VAL A 436 ? 0.5872 0.5816 0.4841 0.0101  -0.0131 -0.0390 447 VAL A CB  
3341 C CG1 . VAL A 436 ? 0.5744 0.5794 0.4857 0.0160  -0.0074 -0.0439 447 VAL A CG1 
3342 C CG2 . VAL A 436 ? 0.6067 0.5808 0.4856 0.0106  -0.0248 -0.0405 447 VAL A CG2 
3343 N N   . ARG A 437 ? 0.7494 0.7749 0.6890 0.0176  -0.0030 -0.0389 448 ARG A N   
3344 C CA  . ARG A 437 ? 0.7306 0.7692 0.6837 0.0185  0.0042  -0.0374 448 ARG A CA  
3345 C C   . ARG A 437 ? 0.6809 0.7228 0.6405 0.0222  0.0084  -0.0409 448 ARG A C   
3346 O O   . ARG A 437 ? 0.6742 0.7115 0.6340 0.0243  0.0053  -0.0449 448 ARG A O   
3347 C CB  . ARG A 437 ? 0.6728 0.7158 0.6362 0.0199  0.0017  -0.0369 448 ARG A CB  
3348 C CG  . ARG A 437 ? 0.6577 0.6982 0.6157 0.0163  -0.0014 -0.0329 448 ARG A CG  
3349 C CD  . ARG A 437 ? 0.5157 0.5603 0.4829 0.0186  -0.0053 -0.0340 448 ARG A CD  
3350 N NE  . ARG A 437 ? 0.5622 0.6036 0.5240 0.0151  -0.0080 -0.0298 448 ARG A NE  
3351 C CZ  . ARG A 437 ? 0.6822 0.7089 0.6300 0.0141  -0.0170 -0.0298 448 ARG A CZ  
3352 N NH1 . ARG A 437 ? 0.5455 0.5606 0.4843 0.0173  -0.0242 -0.0341 448 ARG A NH1 
3353 N NH2 . ARG A 437 ? 0.9326 0.9546 0.8740 0.0098  -0.0197 -0.0257 448 ARG A NH2 
3354 N N   . PHE A 438 ? 0.5926 0.6423 0.5566 0.0232  0.0145  -0.0402 449 PHE A N   
3355 C CA  . PHE A 438 ? 0.6827 0.7323 0.6501 0.0276  0.0171  -0.0437 449 PHE A CA  
3356 C C   . PHE A 438 ? 0.7345 0.7864 0.7118 0.0299  0.0175  -0.0426 449 PHE A C   
3357 O O   . PHE A 438 ? 0.7766 0.8361 0.7589 0.0309  0.0199  -0.0404 449 PHE A O   
3358 C CB  . PHE A 438 ? 0.5952 0.6517 0.5588 0.0288  0.0218  -0.0457 449 PHE A CB  
3359 C CG  . PHE A 438 ? 0.6610 0.7141 0.6123 0.0250  0.0215  -0.0470 449 PHE A CG  
3360 C CD1 . PHE A 438 ? 0.6943 0.7447 0.6416 0.0279  0.0225  -0.0518 449 PHE A CD1 
3361 C CD2 . PHE A 438 ? 0.5488 0.5990 0.4904 0.0181  0.0193  -0.0433 449 PHE A CD2 
3362 C CE1 . PHE A 438 ? 0.5614 0.6085 0.4962 0.0237  0.0221  -0.0528 449 PHE A CE1 
3363 C CE2 . PHE A 438 ? 0.5621 0.6059 0.4888 0.0134  0.0179  -0.0438 449 PHE A CE2 
3364 C CZ  . PHE A 438 ? 0.5676 0.6109 0.4914 0.0161  0.0197  -0.0486 449 PHE A CZ  
3365 N N   . TRP A 439 ? 0.6123 0.6577 0.5912 0.0297  0.0148  -0.0444 450 TRP A N   
3366 C CA  . TRP A 439 ? 0.5469 0.5915 0.5314 0.0291  0.0142  -0.0428 450 TRP A CA  
3367 C C   . TRP A 439 ? 0.6960 0.7310 0.6771 0.0321  0.0137  -0.0448 450 TRP A C   
3368 O O   . TRP A 439 ? 0.8260 0.8545 0.8015 0.0334  0.0132  -0.0485 450 TRP A O   
3369 C CB  . TRP A 439 ? 0.5858 0.6317 0.5727 0.0240  0.0110  -0.0437 450 TRP A CB  
3370 C CG  . TRP A 439 ? 0.6428 0.6958 0.6321 0.0230  0.0092  -0.0432 450 TRP A CG  
3371 C CD1 . TRP A 439 ? 0.6435 0.6948 0.6281 0.0236  0.0057  -0.0461 450 TRP A CD1 
3372 C CD2 . TRP A 439 ? 0.6143 0.6744 0.6094 0.0218  0.0091  -0.0400 450 TRP A CD2 
3373 N NE1 . TRP A 439 ? 0.5612 0.6162 0.5473 0.0234  0.0026  -0.0451 450 TRP A NE1 
3374 C CE2 . TRP A 439 ? 0.6776 0.7389 0.6707 0.0220  0.0052  -0.0414 450 TRP A CE2 
3375 C CE3 . TRP A 439 ? 0.6552 0.7192 0.6558 0.0209  0.0111  -0.0363 450 TRP A CE3 
3376 C CZ2 . TRP A 439 ? 0.7699 0.8365 0.7667 0.0213  0.0034  -0.0394 450 TRP A CZ2 
3377 C CZ3 . TRP A 439 ? 0.7219 0.7932 0.7272 0.0197  0.0104  -0.0341 450 TRP A CZ3 
3378 C CH2 . TRP A 439 ? 0.7354 0.8080 0.7389 0.0199  0.0066  -0.0357 450 TRP A CH2 
3379 N N   . ASP A 440 ? 0.6769 0.7090 0.6600 0.0334  0.0128  -0.0426 451 ASP A N   
3380 C CA  . ASP A 440 ? 0.7026 0.7207 0.6796 0.0372  0.0099  -0.0444 451 ASP A CA  
3381 C C   . ASP A 440 ? 0.8716 0.8780 0.8430 0.0290  0.0063  -0.0432 451 ASP A C   
3382 O O   . ASP A 440 ? 1.0306 1.0311 1.0001 0.0254  0.0037  -0.0399 451 ASP A O   
3383 C CB  . ASP A 440 ? 0.7293 0.7486 0.7091 0.0439  0.0090  -0.0432 451 ASP A CB  
3384 C CG  . ASP A 440 ? 0.7282 0.7295 0.6997 0.0502  0.0033  -0.0460 451 ASP A CG  
3385 O OD1 . ASP A 440 ? 0.7854 0.7727 0.7483 0.0485  0.0007  -0.0484 451 ASP A OD1 
3386 O OD2 . ASP A 440 ? 0.7359 0.7360 0.7085 0.0573  0.0005  -0.0463 451 ASP A OD2 
3387 N N   . ALA A 441 ? 0.8961 0.8997 0.8635 0.0249  0.0059  -0.0464 452 ALA A N   
3388 C CA  . ALA A 441 ? 0.7433 0.7391 0.7043 0.0149  0.0031  -0.0467 452 ALA A CA  
3389 C C   . ALA A 441 ? 0.7577 0.7311 0.7057 0.0151  -0.0014 -0.0476 452 ALA A C   
3390 O O   . ALA A 441 ? 0.8851 0.8513 0.8256 0.0080  -0.0031 -0.0500 452 ALA A O   
3391 C CB  . ALA A 441 ? 0.5558 0.5620 0.5194 0.0103  0.0042  -0.0509 452 ALA A CB  
3392 N N   . SER A 442 ? 0.7340 0.6959 0.6784 0.0233  -0.0043 -0.0464 453 SER A N   
3393 C CA  . SER A 442 ? 0.9156 0.8532 0.8462 0.0268  -0.0106 -0.0485 453 SER A CA  
3394 C C   . SER A 442 ? 1.1855 1.1040 1.1015 0.0131  -0.0159 -0.0455 453 SER A C   
3395 O O   . SER A 442 ? 1.5360 1.4428 1.4417 0.0069  -0.0181 -0.0478 453 SER A O   
3396 C CB  . SER A 442 ? 0.8119 0.7429 0.7422 0.0401  -0.0143 -0.0493 453 SER A CB  
3397 O OG  . SER A 442 ? 0.9530 0.9043 0.8953 0.0504  -0.0088 -0.0532 453 SER A OG  
3398 N N   . GLY A 443 ? 1.0181 0.9334 0.9314 0.0069  -0.0180 -0.0402 454 GLY A N   
3399 C CA  . GLY A 443 ? 1.0930 0.9907 0.9899 -0.0090 -0.0230 -0.0367 454 GLY A CA  
3400 C C   . GLY A 443 ? 1.2607 1.1796 1.1646 -0.0233 -0.0181 -0.0344 454 GLY A C   
3401 O O   . GLY A 443 ? 1.3767 1.3053 1.2795 -0.0356 -0.0157 -0.0371 454 GLY A O   
3402 N N   . VAL A 444 ? 1.2484 1.1768 1.1600 -0.0212 -0.0168 -0.0306 455 VAL A N   
3403 C CA  . VAL A 444 ? 1.2203 1.1707 1.1395 -0.0332 -0.0125 -0.0293 455 VAL A CA  
3404 C C   . VAL A 444 ? 1.2744 1.2480 1.2133 -0.0225 -0.0072 -0.0294 455 VAL A C   
3405 O O   . VAL A 444 ? 1.3513 1.3476 1.3030 -0.0223 -0.0024 -0.0333 455 VAL A O   
3406 C CB  . VAL A 444 ? 1.0894 1.0247 0.9930 -0.0468 -0.0175 -0.0235 455 VAL A CB  
3407 C CG1 . VAL A 444 ? 0.9579 0.9199 0.8724 -0.0559 -0.0125 -0.0229 455 VAL A CG1 
3408 C CG2 . VAL A 444 ? 1.0798 0.9951 0.9617 -0.0631 -0.0222 -0.0235 455 VAL A CG2 
3409 N N   . CYS A 445 ? 1.4549 1.4219 1.3950 -0.0134 -0.0092 -0.0256 456 CYS A N   
3410 C CA  . CYS A 445 ? 1.5894 1.5770 1.5459 -0.0057 -0.0046 -0.0249 456 CYS A CA  
3411 C C   . CYS A 445 ? 1.6001 1.6016 1.5676 0.0033  0.0000  -0.0294 456 CYS A C   
3412 O O   . CYS A 445 ? 1.7582 1.7507 1.7223 0.0110  -0.0009 -0.0321 456 CYS A O   
3413 C CB  . CYS A 445 ? 1.6198 1.5977 1.5750 0.0038  -0.0080 -0.0215 456 CYS A CB  
3414 S SG  . CYS A 445 ? 1.5819 1.5842 1.5548 0.0100  -0.0028 -0.0198 456 CYS A SG  
3415 N N   . LEU A 446 ? 1.3771 1.3992 1.3562 0.0020  0.0040  -0.0305 457 LEU A N   
3416 C CA  . LEU A 446 ? 1.1022 1.1351 1.0884 0.0080  0.0069  -0.0341 457 LEU A CA  
3417 C C   . LEU A 446 ? 1.0025 1.0463 0.9974 0.0141  0.0094  -0.0316 457 LEU A C   
3418 O O   . LEU A 446 ? 1.0874 1.1434 1.0889 0.0111  0.0101  -0.0311 457 LEU A O   
3419 C CB  . LEU A 446 ? 0.8231 0.8678 0.8123 0.0014  0.0072  -0.0386 457 LEU A CB  
3420 C CG  . LEU A 446 ? 0.6387 0.6902 0.6316 0.0071  0.0078  -0.0426 457 LEU A CG  
3421 C CD1 . LEU A 446 ? 0.6079 0.6494 0.5936 0.0083  0.0072  -0.0459 457 LEU A CD1 
3422 C CD2 . LEU A 446 ? 0.5011 0.5683 0.5004 0.0040  0.0063  -0.0472 457 LEU A CD2 
3423 N N   . ARG A 447 ? 0.9313 0.9722 0.9261 0.0224  0.0103  -0.0312 458 ARG A N   
3424 C CA  . ARG A 447 ? 0.8758 0.9283 0.8775 0.0266  0.0130  -0.0293 458 ARG A CA  
3425 C C   . ARG A 447 ? 0.6596 0.7175 0.6609 0.0300  0.0156  -0.0318 458 ARG A C   
3426 O O   . ARG A 447 ? 0.5844 0.6362 0.5806 0.0324  0.0155  -0.0352 458 ARG A O   
3427 C CB  . ARG A 447 ? 0.9866 1.0366 0.9889 0.0326  0.0119  -0.0277 458 ARG A CB  
3428 C CG  . ARG A 447 ? 1.0801 1.1235 1.0781 0.0412  0.0108  -0.0319 458 ARG A CG  
3429 C CD  . ARG A 447 ? 1.1974 1.2417 1.1974 0.0491  0.0085  -0.0321 458 ARG A CD  
3430 N NE  . ARG A 447 ? 1.3262 1.3578 1.3219 0.0457  0.0036  -0.0279 458 ARG A NE  
3431 C CZ  . ARG A 447 ? 1.3139 1.3462 1.3115 0.0502  0.0007  -0.0263 458 ARG A CZ  
3432 N NH1 . ARG A 447 ? 1.2853 1.3336 1.2910 0.0587  0.0029  -0.0295 458 ARG A NH1 
3433 N NH2 . ARG A 447 ? 1.3031 1.3212 1.2937 0.0453  -0.0043 -0.0218 458 ARG A NH2 
3434 N N   . LEU A 448 ? 0.5827 0.6513 0.5879 0.0291  0.0176  -0.0300 459 LEU A N   
3435 C CA  . LEU A 448 ? 0.5467 0.6192 0.5480 0.0291  0.0195  -0.0313 459 LEU A CA  
3436 C C   . LEU A 448 ? 0.7843 0.8630 0.7852 0.0339  0.0227  -0.0336 459 LEU A C   
3437 O O   . LEU A 448 ? 1.0395 1.1253 1.0456 0.0374  0.0237  -0.0332 459 LEU A O   
3438 C CB  . LEU A 448 ? 0.4898 0.5683 0.4919 0.0248  0.0192  -0.0282 459 LEU A CB  
3439 C CG  . LEU A 448 ? 0.4954 0.5737 0.4889 0.0217  0.0195  -0.0283 459 LEU A CG  
3440 C CD1 . LEU A 448 ? 0.6131 0.6809 0.5994 0.0216  0.0161  -0.0313 459 LEU A CD1 
3441 C CD2 . LEU A 448 ? 0.5137 0.5940 0.5056 0.0170  0.0176  -0.0247 459 LEU A CD2 
3442 N N   . LEU A 449 ? 0.7007 0.7784 0.6953 0.0344  0.0240  -0.0369 460 LEU A N   
3443 C CA  . LEU A 449 ? 0.6183 0.7061 0.6124 0.0386  0.0274  -0.0413 460 LEU A CA  
3444 C C   . LEU A 449 ? 0.5480 0.6472 0.5369 0.0321  0.0310  -0.0409 460 LEU A C   
3445 O O   . LEU A 449 ? 0.7023 0.8184 0.6942 0.0322  0.0347  -0.0428 460 LEU A O   
3446 C CB  . LEU A 449 ? 0.6023 0.6813 0.5918 0.0436  0.0263  -0.0465 460 LEU A CB  
3447 C CG  . LEU A 449 ? 0.6224 0.6955 0.6144 0.0527  0.0234  -0.0503 460 LEU A CG  
3448 C CD1 . LEU A 449 ? 0.6907 0.7545 0.6857 0.0518  0.0197  -0.0455 460 LEU A CD1 
3449 C CD2 . LEU A 449 ? 0.6565 0.7164 0.6417 0.0558  0.0211  -0.0546 460 LEU A CD2 
3450 N N   . TYR A 450 ? 0.5334 0.6237 0.5132 0.0259  0.0293  -0.0388 461 TYR A N   
3451 C CA  . TYR A 450 ? 0.6445 0.7400 0.6139 0.0176  0.0313  -0.0376 461 TYR A CA  
3452 C C   . TYR A 450 ? 0.6172 0.6965 0.5769 0.0120  0.0256  -0.0335 461 TYR A C   
3453 O O   . TYR A 450 ? 0.7068 0.7741 0.6668 0.0155  0.0213  -0.0345 461 TYR A O   
3454 C CB  . TYR A 450 ? 0.6897 0.7912 0.6528 0.0179  0.0346  -0.0431 461 TYR A CB  
3455 C CG  . TYR A 450 ? 0.7097 0.8117 0.6571 0.0065  0.0355  -0.0414 461 TYR A CG  
3456 C CD1 . TYR A 450 ? 0.7974 0.9158 0.7408 -0.0022 0.0398  -0.0406 461 TYR A CD1 
3457 C CD2 . TYR A 450 ? 0.6981 0.7836 0.6327 0.0036  0.0315  -0.0406 461 TYR A CD2 
3458 C CE1 . TYR A 450 ? 0.9429 1.0595 0.8679 -0.0155 0.0400  -0.0383 461 TYR A CE1 
3459 C CE2 . TYR A 450 ? 0.7635 0.8456 0.6800 -0.0079 0.0310  -0.0383 461 TYR A CE2 
3460 C CZ  . TYR A 450 ? 0.9339 1.0304 0.8444 -0.0182 0.0352  -0.0368 461 TYR A CZ  
3461 O OH  . TYR A 450 ? 0.9570 1.0477 0.8456 -0.0324 0.0341  -0.0338 461 TYR A OH  
3462 N N   . LYS A 451 ? 0.6130 0.6921 0.5633 0.0033  0.0247  -0.0295 462 LYS A N   
3463 C CA  . LYS A 451 ? 0.5962 0.6571 0.5337 -0.0013 0.0171  -0.0262 462 LYS A CA  
3464 C C   . LYS A 451 ? 0.5938 0.6490 0.5112 -0.0112 0.0165  -0.0249 462 LYS A C   
3465 O O   . LYS A 451 ? 0.6323 0.7009 0.5451 -0.0192 0.0221  -0.0242 462 LYS A O   
3466 C CB  . LYS A 451 ? 0.5406 0.5993 0.4799 -0.0038 0.0135  -0.0220 462 LYS A CB  
3467 C CG  . LYS A 451 ? 0.6395 0.6775 0.5664 -0.0052 0.0031  -0.0205 462 LYS A CG  
3468 C CD  . LYS A 451 ? 0.8817 0.9164 0.8057 -0.0095 -0.0007 -0.0164 462 LYS A CD  
3469 C CE  . LYS A 451 ? 1.1013 1.1500 1.0454 -0.0038 0.0028  -0.0169 462 LYS A CE  
3470 N NZ  . LYS A 451 ? 1.1504 1.1963 1.0919 -0.0079 -0.0010 -0.0133 462 LYS A NZ  
3471 N N   . LEU A 452 ? 0.7183 0.7547 0.6229 -0.0113 0.0095  -0.0252 463 LEU A N   
3472 C CA  . LEU A 452 ? 0.8350 0.8607 0.7166 -0.0215 0.0069  -0.0233 463 LEU A CA  
3473 C C   . LEU A 452 ? 0.8360 0.8363 0.7000 -0.0253 -0.0052 -0.0192 463 LEU A C   
3474 O O   . LEU A 452 ? 0.8424 0.8313 0.7113 -0.0160 -0.0130 -0.0215 463 LEU A O   
3475 C CB  . LEU A 452 ? 0.7802 0.8029 0.6586 -0.0178 0.0076  -0.0277 463 LEU A CB  
3476 C CG  . LEU A 452 ? 0.7479 0.7549 0.6000 -0.0279 0.0029  -0.0257 463 LEU A CG  
3477 C CD1 . LEU A 452 ? 0.8155 0.8349 0.6551 -0.0429 0.0094  -0.0231 463 LEU A CD1 
3478 C CD2 . LEU A 452 ? 0.8110 0.8159 0.6627 -0.0225 0.0033  -0.0307 463 LEU A CD2 
3479 N N   . SER A 453 ? 0.8177 0.8095 0.6603 -0.0391 -0.0074 -0.0140 464 SER A N   
3480 C CA  . SER A 453 ? 0.9193 0.8819 0.7399 -0.0436 -0.0209 -0.0098 464 SER A CA  
3481 C C   . SER A 453 ? 0.9645 0.9067 0.7556 -0.0538 -0.0268 -0.0076 464 SER A C   
3482 O O   . SER A 453 ? 1.0774 1.0255 0.8532 -0.0693 -0.0211 -0.0043 464 SER A O   
3483 C CB  . SER A 453 ? 1.0155 0.9792 0.8310 -0.0533 -0.0208 -0.0045 464 SER A CB  
3484 O OG  . SER A 453 ? 1.1762 1.1084 0.9702 -0.0557 -0.0359 -0.0011 464 SER A OG  
3485 N N   . THR A 454 ? 0.9177 0.8374 0.7002 -0.0455 -0.0384 -0.0101 465 THR A N   
3486 C CA  . THR A 454 ? 0.7920 0.6888 0.5452 -0.0537 -0.0459 -0.0082 465 THR A CA  
3487 C C   . THR A 454 ? 0.8944 0.7567 0.6134 -0.0650 -0.0604 -0.0016 465 THR A C   
3488 O O   . THR A 454 ? 0.9029 0.7434 0.5915 -0.0761 -0.0670 0.0018  465 THR A O   
3489 C CB  . THR A 454 ? 0.8074 0.6951 0.5656 -0.0393 -0.0530 -0.0146 465 THR A CB  
3490 O OG1 . THR A 454 ? 0.7805 0.6536 0.5431 -0.0267 -0.0659 -0.0179 465 THR A OG1 
3491 C CG2 . THR A 454 ? 0.6953 0.6128 0.4832 -0.0301 -0.0397 -0.0206 465 THR A CG2 
3492 N N   . VAL A 455 ? 0.9749 0.8300 0.6961 -0.0630 -0.0664 0.0003  466 VAL A N   
3493 C CA  . VAL A 455 ? 1.0644 0.8823 0.7512 -0.0728 -0.0824 0.0062  466 VAL A CA  
3494 C C   . VAL A 455 ? 1.0284 0.8431 0.6875 -0.0983 -0.0773 0.0146  466 VAL A C   
3495 O O   . VAL A 455 ? 1.0547 0.8327 0.6755 -0.1112 -0.0912 0.0206  466 VAL A O   
3496 C CB  . VAL A 455 ? 0.9342 0.7486 0.6322 -0.0644 -0.0888 0.0054  466 VAL A CB  
3497 C CG1 . VAL A 455 ? 0.8583 0.7050 0.5765 -0.0716 -0.0726 0.0080  466 VAL A CG1 
3498 C CG2 . VAL A 455 ? 0.8399 0.6096 0.5006 -0.0711 -0.1091 0.0101  466 VAL A CG2 
3499 N N   . ARG A 456 ? 1.1656 1.0182 0.8419 -0.1064 -0.0584 0.0143  467 ARG A N   
3500 C CA  . ARG A 456 ? 1.2342 1.0923 0.8869 -0.1319 -0.0519 0.0203  467 ARG A CA  
3501 C C   . ARG A 456 ? 1.3880 1.2216 1.0040 -0.1462 -0.0587 0.0237  467 ARG A C   
3502 O O   . ARG A 456 ? 1.5264 1.3525 1.1116 -0.1709 -0.0586 0.0301  467 ARG A O   
3503 C CB  . ARG A 456 ? 1.1487 1.0568 0.8300 -0.1338 -0.0308 0.0159  467 ARG A CB  
3504 C CG  . ARG A 456 ? 1.1776 1.1056 0.8670 -0.1429 -0.0237 0.0182  467 ARG A CG  
3505 C CD  . ARG A 456 ? 1.2827 1.2604 0.9991 -0.1431 -0.0047 0.0121  467 ARG A CD  
3506 N NE  . ARG A 456 ? 1.4943 1.4923 1.2124 -0.1561 0.0020  0.0141  467 ARG A NE  
3507 C CZ  . ARG A 456 ? 1.6620 1.6678 1.3557 -0.1815 0.0058  0.0172  467 ARG A CZ  
3508 N NH1 . ARG A 456 ? 1.8282 1.8215 1.4924 -0.1971 0.0035  0.0192  467 ARG A NH1 
3509 N NH2 . ARG A 456 ? 1.6624 1.6893 1.3601 -0.1926 0.0119  0.0181  467 ARG A NH2 
3510 N N   . VAL A 457 ? 1.3484 1.1699 0.9659 -0.1326 -0.0648 0.0195  468 VAL A N   
3511 C CA  . VAL A 457 ? 1.3144 1.1088 0.8954 -0.1451 -0.0732 0.0229  468 VAL A CA  
3512 C C   . VAL A 457 ? 1.3301 1.0702 0.8705 -0.1510 -0.0964 0.0295  468 VAL A C   
3513 O O   . VAL A 457 ? 1.3749 1.0863 0.8744 -0.1690 -0.1051 0.0354  468 VAL A O   
3514 C CB  . VAL A 457 ? 1.1031 0.9036 0.7001 -0.1278 -0.0722 0.0156  468 VAL A CB  
3515 C CG1 . VAL A 457 ? 1.0540 0.8355 0.6162 -0.1426 -0.0767 0.0186  468 VAL A CG1 
3516 C CG2 . VAL A 457 ? 0.9788 0.8280 0.6181 -0.1176 -0.0522 0.0082  468 VAL A CG2 
3517 N N   . PHE A 458 ? 1.2595 0.9837 0.8081 -0.1368 -0.1076 0.0284  469 PHE A N   
3518 C CA  . PHE A 458 ? 1.2938 0.9645 0.8064 -0.1369 -0.1324 0.0324  469 PHE A CA  
3519 C C   . PHE A 458 ? 1.2557 0.9171 0.7586 -0.1475 -0.1357 0.0381  469 PHE A C   
3520 O O   . PHE A 458 ? 1.3448 1.0354 0.8822 -0.1374 -0.1260 0.0345  469 PHE A O   
3521 C CB  . PHE A 458 ? 1.3525 1.0107 0.8823 -0.1075 -0.1461 0.0232  469 PHE A CB  
3522 C CG  . PHE A 458 ? 1.3020 0.9843 0.8565 -0.0937 -0.1375 0.0155  469 PHE A CG  
3523 C CD1 . PHE A 458 ? 1.3002 0.9619 0.8289 -0.0989 -0.1443 0.0165  469 PHE A CD1 
3524 C CD2 . PHE A 458 ? 1.1119 0.8356 0.7133 -0.0768 -0.1230 0.0076  469 PHE A CD2 
3525 C CE1 . PHE A 458 ? 1.1247 0.8083 0.6756 -0.0866 -0.1365 0.0093  469 PHE A CE1 
3526 C CE2 . PHE A 458 ? 0.9840 0.7274 0.6057 -0.0656 -0.1158 0.0008  469 PHE A CE2 
3527 C CZ  . PHE A 458 ? 0.9059 0.6300 0.5032 -0.0701 -0.1223 0.0014  469 PHE A CZ  
3528 N N   . LEU A 459 ? 1.4241 1.0432 0.8783 -0.1687 -0.1500 0.0471  470 LEU A N   
3529 C CA  . LEU A 459 ? 1.5365 1.1424 0.9753 -0.1823 -0.1544 0.0534  470 LEU A CA  
3530 C C   . LEU A 459 ? 1.4941 1.0740 0.9393 -0.1596 -0.1727 0.0489  470 LEU A C   
3531 O O   . LEU A 459 ? 1.2564 0.8467 0.7152 -0.1590 -0.1697 0.0494  470 LEU A O   
3532 C CB  . LEU A 459 ? 1.6568 1.2217 1.0367 -0.2145 -0.1654 0.0649  470 LEU A CB  
3533 C CG  . LEU A 459 ? 1.5582 1.0634 0.8915 -0.2152 -0.1907 0.0680  470 LEU A CG  
3534 C CD1 . LEU A 459 ? 1.6030 1.0524 0.9096 -0.2056 -0.2188 0.0691  470 LEU A CD1 
3535 C CD2 . LEU A 459 ? 1.4895 0.9787 0.7756 -0.2507 -0.1895 0.0780  470 LEU A CD2 
3536 N N   . ASP A 474 ? 1.7209 1.4386 1.3369 -0.1778 -0.1521 0.0577  485 ASP A N   
3537 C CA  . ASP A 474 ? 1.7362 1.4737 1.3716 -0.1753 -0.1477 0.0561  485 ASP A CA  
3538 C C   . ASP A 474 ? 1.4947 1.2939 1.1698 -0.1779 -0.1217 0.0561  485 ASP A C   
3539 O O   . ASP A 474 ? 1.4486 1.2759 1.1389 -0.1784 -0.1076 0.0561  485 ASP A O   
3540 C CB  . ASP A 474 ? 1.9375 1.6670 1.5912 -0.1460 -0.1598 0.0457  485 ASP A CB  
3541 C CG  . ASP A 474 ? 2.1921 1.8601 1.8062 -0.1419 -0.1884 0.0437  485 ASP A CG  
3542 O OD1 . ASP A 474 ? 2.2964 1.9234 1.8667 -0.1615 -0.1996 0.0515  485 ASP A OD1 
3543 O OD2 . ASP A 474 ? 2.2418 1.9022 1.8675 -0.1191 -0.2004 0.0338  485 ASP A OD2 
3544 N N   . GLU A 475 ? 1.4300 1.2489 1.1209 -0.1787 -0.1167 0.0557  486 GLU A N   
3545 C CA  . GLU A 475 ? 1.2751 1.1501 1.0039 -0.1779 -0.0949 0.0545  486 GLU A CA  
3546 C C   . GLU A 475 ? 1.1239 1.0197 0.8872 -0.1558 -0.0929 0.0478  486 GLU A C   
3547 O O   . GLU A 475 ? 0.8712 0.8103 0.6693 -0.1475 -0.0767 0.0451  486 GLU A O   
3548 C CB  . GLU A 475 ? 1.4347 1.3234 1.1500 -0.2055 -0.0871 0.0611  486 GLU A CB  
3549 C CG  . GLU A 475 ? 1.4313 1.3789 1.1811 -0.2073 -0.0647 0.0594  486 GLU A CG  
3550 C CD  . GLU A 475 ? 1.5376 1.5025 1.2766 -0.2329 -0.0581 0.0636  486 GLU A CD  
3551 O OE1 . GLU A 475 ? 1.5905 1.5297 1.3092 -0.2422 -0.0691 0.0667  486 GLU A OE1 
3552 O OE2 . GLU A 475 ? 1.5222 1.5276 1.2729 -0.2436 -0.0423 0.0629  486 GLU A OE2 
3553 N N   . TRP A 476 ? 1.1454 1.0109 0.8984 -0.1460 -0.1095 0.0444  487 TRP A N   
3554 C CA  . TRP A 476 ? 0.9252 0.8095 0.7077 -0.1269 -0.1088 0.0373  487 TRP A CA  
3555 C C   . TRP A 476 ? 0.9069 0.7624 0.6849 -0.1058 -0.1265 0.0286  487 TRP A C   
3556 O O   . TRP A 476 ? 1.1255 0.9345 0.8688 -0.1091 -0.1460 0.0290  487 TRP A O   
3557 C CB  . TRP A 476 ? 0.7459 0.6298 0.5224 -0.1382 -0.1106 0.0402  487 TRP A CB  
3558 C CG  . TRP A 476 ? 0.8492 0.7568 0.6563 -0.1212 -0.1077 0.0336  487 TRP A CG  
3559 C CD1 . TRP A 476 ? 0.9048 0.7919 0.7084 -0.1082 -0.1228 0.0270  487 TRP A CD1 
3560 C CD2 . TRP A 476 ? 0.8247 0.7809 0.6690 -0.1155 -0.0895 0.0325  487 TRP A CD2 
3561 N NE1 . TRP A 476 ? 0.8232 0.7452 0.6600 -0.0964 -0.1138 0.0221  487 TRP A NE1 
3562 C CE2 . TRP A 476 ? 0.7808 0.7434 0.6418 -0.1009 -0.0939 0.0260  487 TRP A CE2 
3563 C CE3 . TRP A 476 ? 0.6422 0.6361 0.5062 -0.1208 -0.0711 0.0356  487 TRP A CE3 
3564 C CZ2 . TRP A 476 ? 0.6995 0.7025 0.5939 -0.0932 -0.0804 0.0239  487 TRP A CZ2 
3565 C CZ3 . TRP A 476 ? 0.6045 0.6365 0.5016 -0.1113 -0.0590 0.0330  487 TRP A CZ3 
3566 C CH2 . TRP A 476 ? 0.5924 0.6276 0.5034 -0.0985 -0.0637 0.0279  487 TRP A CH2 
3567 N N   . PRO A 477 ? 0.9425 0.8237 0.7531 -0.0843 -0.1217 0.0200  488 PRO A N   
3568 C CA  . PRO A 477 ? 0.8413 0.7713 0.6901 -0.0784 -0.1017 0.0190  488 PRO A CA  
3569 C C   . PRO A 477 ? 0.8357 0.7836 0.6905 -0.0850 -0.0878 0.0236  488 PRO A C   
3570 O O   . PRO A 477 ? 0.8154 0.7403 0.6505 -0.0878 -0.0939 0.0248  488 PRO A O   
3571 C CB  . PRO A 477 ? 0.6480 0.5868 0.5182 -0.0551 -0.1064 0.0077  488 PRO A CB  
3572 C CG  . PRO A 477 ? 0.6817 0.5831 0.5295 -0.0482 -0.1282 0.0015  488 PRO A CG  
3573 C CD  . PRO A 477 ? 0.8371 0.6977 0.6462 -0.0635 -0.1386 0.0091  488 PRO A CD  
3574 N N   . PRO A 478 ? 0.7288 0.7164 0.6096 -0.0866 -0.0702 0.0255  489 PRO A N   
3575 C CA  . PRO A 478 ? 0.6094 0.6156 0.4962 -0.0920 -0.0574 0.0286  489 PRO A CA  
3576 C C   . PRO A 478 ? 0.7353 0.7434 0.6340 -0.0766 -0.0569 0.0234  489 PRO A C   
3577 O O   . PRO A 478 ? 0.7022 0.7393 0.6258 -0.0691 -0.0450 0.0216  489 PRO A O   
3578 C CB  . PRO A 478 ? 0.5794 0.6258 0.4915 -0.0940 -0.0420 0.0299  489 PRO A CB  
3579 C CG  . PRO A 478 ? 0.5642 0.6166 0.4926 -0.0820 -0.0453 0.0257  489 PRO A CG  
3580 C CD  . PRO A 478 ? 0.5942 0.6104 0.4992 -0.0826 -0.0624 0.0242  489 PRO A CD  
3581 N N   . LEU A 479 ? 0.6689 0.6447 0.5482 -0.0720 -0.0708 0.0206  490 LEU A N   
3582 C CA  . LEU A 479 ? 0.6832 0.6603 0.5722 -0.0580 -0.0713 0.0150  490 LEU A CA  
3583 C C   . LEU A 479 ? 0.6263 0.6173 0.5177 -0.0647 -0.0592 0.0189  490 LEU A C   
3584 O O   . LEU A 479 ? 0.6181 0.6052 0.4926 -0.0813 -0.0558 0.0253  490 LEU A O   
3585 C CB  . LEU A 479 ? 0.6415 0.5800 0.5068 -0.0517 -0.0904 0.0106  490 LEU A CB  
3586 C CG  . LEU A 479 ? 0.7373 0.6644 0.6041 -0.0383 -0.1044 0.0021  490 LEU A CG  
3587 C CD1 . LEU A 479 ? 0.7755 0.6670 0.6208 -0.0286 -0.1238 -0.0043 490 LEU A CD1 
3588 C CD2 . LEU A 479 ? 0.6093 0.5725 0.5111 -0.0243 -0.0954 -0.0051 490 LEU A CD2 
3589 N N   . ARG A 480 ? 0.5789 0.5871 0.4908 -0.0525 -0.0528 0.0144  491 ARG A N   
3590 C CA  . ARG A 480 ? 0.6497 0.6717 0.5659 -0.0561 -0.0419 0.0166  491 ARG A CA  
3591 C C   . ARG A 480 ? 0.6713 0.6959 0.6000 -0.0414 -0.0425 0.0104  491 ARG A C   
3592 O O   . ARG A 480 ? 0.7540 0.7982 0.7055 -0.0312 -0.0378 0.0063  491 ARG A O   
3593 C CB  . ARG A 480 ? 0.6383 0.6939 0.5737 -0.0603 -0.0269 0.0192  491 ARG A CB  
3594 C CG  . ARG A 480 ? 0.5353 0.6087 0.4797 -0.0598 -0.0161 0.0190  491 ARG A CG  
3595 C CD  . ARG A 480 ? 0.6829 0.7879 0.6437 -0.0631 -0.0039 0.0202  491 ARG A CD  
3596 N NE  . ARG A 480 ? 0.8126 0.9361 0.7897 -0.0548 0.0046  0.0173  491 ARG A NE  
3597 C CZ  . ARG A 480 ? 0.9048 1.0550 0.8972 -0.0535 0.0139  0.0163  491 ARG A CZ  
3598 N NH1 . ARG A 480 ? 0.8685 1.0333 0.8634 -0.0604 0.0167  0.0179  491 ARG A NH1 
3599 N NH2 . ARG A 480 ? 0.8619 1.0237 0.8662 -0.0448 0.0193  0.0132  491 ARG A NH2 
3600 N N   . LYS A 481 ? 0.6730 0.6777 0.5854 -0.0417 -0.0485 0.0098  492 LYS A N   
3601 C CA  . LYS A 481 ? 0.7201 0.7274 0.6427 -0.0290 -0.0492 0.0035  492 LYS A CA  
3602 C C   . LYS A 481 ? 0.6556 0.6907 0.5985 -0.0277 -0.0341 0.0043  492 LYS A C   
3603 O O   . LYS A 481 ? 0.6658 0.7087 0.6049 -0.0371 -0.0259 0.0089  492 LYS A O   
3604 C CB  . LYS A 481 ? 0.9365 0.9151 0.8351 -0.0305 -0.0594 0.0032  492 LYS A CB  
3605 C CG  . LYS A 481 ? 1.0148 0.9596 0.8896 -0.0296 -0.0778 0.0015  492 LYS A CG  
3606 C CD  . LYS A 481 ? 1.0462 0.9936 0.9348 -0.0124 -0.0867 -0.0089 492 LYS A CD  
3607 C CE  . LYS A 481 ? 1.0570 1.0134 0.9580 -0.0001 -0.0864 -0.0167 492 LYS A CE  
3608 N NZ  . LYS A 481 ? 1.1892 1.1512 1.1022 0.0156  -0.0959 -0.0289 492 LYS A NZ  
3609 N N   . VAL A 482 ? 0.5189 0.5693 0.4822 -0.0166 -0.0312 -0.0010 493 VAL A N   
3610 C CA  . VAL A 482 ? 0.5649 0.6357 0.5446 -0.0140 -0.0198 -0.0010 493 VAL A CA  
3611 C C   . VAL A 482 ? 0.6009 0.6704 0.5865 -0.0044 -0.0227 -0.0076 493 VAL A C   
3612 O O   . VAL A 482 ? 0.7968 0.8571 0.7796 0.0018  -0.0325 -0.0135 493 VAL A O   
3613 C CB  . VAL A 482 ? 0.5671 0.6603 0.5653 -0.0130 -0.0118 0.0003  493 VAL A CB  
3614 C CG1 . VAL A 482 ? 0.4827 0.5818 0.4766 -0.0227 -0.0075 0.0060  493 VAL A CG1 
3615 C CG2 . VAL A 482 ? 0.6609 0.7566 0.6675 -0.0070 -0.0173 -0.0041 493 VAL A CG2 
3616 N N   . GLY A 483 ? 0.5319 0.6115 0.5254 -0.0029 -0.0148 -0.0075 494 GLY A N   
3617 C CA  . GLY A 483 ? 0.6544 0.7328 0.6516 0.0038  -0.0167 -0.0133 494 GLY A CA  
3618 C C   . GLY A 483 ? 0.7102 0.7712 0.6912 0.0028  -0.0213 -0.0137 494 GLY A C   
3619 O O   . GLY A 483 ? 0.8229 0.8688 0.7868 -0.0036 -0.0254 -0.0099 494 GLY A O   
3620 N N   . SER A 484 ? 0.6995 0.7620 0.6845 0.0079  -0.0208 -0.0181 495 SER A N   
3621 C CA  . SER A 484 ? 0.7722 0.8199 0.7432 0.0074  -0.0243 -0.0188 495 SER A CA  
3622 C C   . SER A 484 ? 0.9119 0.9491 0.8784 0.0152  -0.0355 -0.0267 495 SER A C   
3623 O O   . SER A 484 ? 1.0945 1.1183 1.0490 0.0159  -0.0397 -0.0280 495 SER A O   
3624 C CB  . SER A 484 ? 0.8498 0.9071 0.8272 0.0071  -0.0147 -0.0180 495 SER A CB  
3625 O OG  . SER A 484 ? 0.8734 0.9436 0.8664 0.0124  -0.0116 -0.0222 495 SER A OG  
3626 N N   . PHE A 485 ? 0.8270 0.8713 0.8027 0.0215  -0.0409 -0.0332 496 PHE A N   
3627 C CA  . PHE A 485 ? 0.8483 0.8881 0.8223 0.0307  -0.0521 -0.0435 496 PHE A CA  
3628 C C   . PHE A 485 ? 0.8722 0.8861 0.8261 0.0331  -0.0670 -0.0446 496 PHE A C   
3629 O O   . PHE A 485 ? 0.8466 0.8549 0.7964 0.0311  -0.0707 -0.0421 496 PHE A O   
3630 C CB  . PHE A 485 ? 0.6454 0.7083 0.6382 0.0360  -0.0516 -0.0520 496 PHE A CB  
3631 C CG  . PHE A 485 ? 0.5937 0.6580 0.5870 0.0465  -0.0639 -0.0654 496 PHE A CG  
3632 C CD1 . PHE A 485 ? 0.6584 0.7298 0.6553 0.0501  -0.0641 -0.0723 496 PHE A CD1 
3633 C CD2 . PHE A 485 ? 0.6230 0.6828 0.6132 0.0534  -0.0759 -0.0722 496 PHE A CD2 
3634 C CE1 . PHE A 485 ? 0.6898 0.7662 0.6884 0.0607  -0.0758 -0.0865 496 PHE A CE1 
3635 C CE2 . PHE A 485 ? 0.5962 0.6598 0.5877 0.0652  -0.0884 -0.0869 496 PHE A CE2 
3636 C CZ  . PHE A 485 ? 0.5264 0.5997 0.5227 0.0690  -0.0883 -0.0944 496 PHE A CZ  
3637 N N   . ASP A 486 ? 0.9577 0.9537 0.8973 0.0373  -0.0764 -0.0483 497 ASP A N   
3638 C CA  . ASP A 486 ? 0.7826 0.7483 0.6990 0.0405  -0.0936 -0.0501 497 ASP A CA  
3639 C C   . ASP A 486 ? 0.7448 0.7121 0.6653 0.0559  -0.1075 -0.0650 497 ASP A C   
3640 O O   . ASP A 486 ? 0.7307 0.7013 0.6531 0.0611  -0.1089 -0.0710 497 ASP A O   
3641 C CB  . ASP A 486 ? 0.6180 0.5576 0.5097 0.0326  -0.0961 -0.0425 497 ASP A CB  
3642 C CG  . ASP A 486 ? 0.9035 0.8056 0.7652 0.0320  -0.1143 -0.0413 497 ASP A CG  
3643 O OD1 . ASP A 486 ? 1.0486 0.9407 0.9006 0.0241  -0.1156 -0.0348 497 ASP A OD1 
3644 O OD2 . ASP A 486 ? 1.0299 0.9110 0.8762 0.0393  -0.1282 -0.0469 497 ASP A OD2 
3645 N N   . PRO A 487 ? 0.7839 0.7510 0.7064 0.0640  -0.1181 -0.0728 498 PRO A N   
3646 C CA  . PRO A 487 ? 0.8211 0.7954 0.7496 0.0802  -0.1319 -0.0899 498 PRO A CA  
3647 C C   . PRO A 487 ? 0.9859 0.9243 0.8883 0.0893  -0.1531 -0.0950 498 PRO A C   
3648 O O   . PRO A 487 ? 0.9587 0.9004 0.8640 0.1051  -0.1680 -0.1109 498 PRO A O   
3649 C CB  . PRO A 487 ? 0.8585 0.8476 0.7990 0.0848  -0.1344 -0.0961 498 PRO A CB  
3650 C CG  . PRO A 487 ? 0.9146 0.8817 0.8399 0.0735  -0.1326 -0.0819 498 PRO A CG  
3651 C CD  . PRO A 487 ? 0.8564 0.8217 0.7783 0.0589  -0.1171 -0.0674 498 PRO A CD  
3652 N N   . TYR A 488 ? 1.0501 0.9551 0.9263 0.0797  -0.1557 -0.0829 499 TYR A N   
3653 C CA  . TYR A 488 ? 1.1895 1.0545 1.0356 0.0861  -0.1771 -0.0859 499 TYR A CA  
3654 C C   . TYR A 488 ? 1.2665 1.1235 1.1033 0.0818  -0.1737 -0.0818 499 TYR A C   
3655 O O   . TYR A 488 ? 1.2570 1.1323 1.1050 0.0705  -0.1546 -0.0733 499 TYR A O   
3656 C CB  . TYR A 488 ? 1.3813 1.2068 1.1966 0.0762  -0.1868 -0.0749 499 TYR A CB  
3657 C CG  . TYR A 488 ? 1.5172 1.3481 1.3397 0.0793  -0.1901 -0.0778 499 TYR A CG  
3658 C CD1 . TYR A 488 ? 1.6251 1.4701 1.4565 0.0649  -0.1739 -0.0664 499 TYR A CD1 
3659 C CD2 . TYR A 488 ? 1.5878 1.4107 1.4084 0.0975  -0.2102 -0.0930 499 TYR A CD2 
3660 C CE1 . TYR A 488 ? 1.7064 1.5563 1.5440 0.0674  -0.1769 -0.0689 499 TYR A CE1 
3661 C CE2 . TYR A 488 ? 1.6642 1.4925 1.4913 0.1006  -0.2135 -0.0963 499 TYR A CE2 
3662 C CZ  . TYR A 488 ? 1.7647 1.6060 1.6001 0.0849  -0.1964 -0.0837 499 TYR A CZ  
3663 O OH  . TYR A 488 ? 1.7922 1.6390 1.6338 0.0876  -0.1995 -0.0869 499 TYR A OH  
3664 N N   . SER A 489 ? 1.3314 1.1597 1.1467 0.0918  -0.1935 -0.0887 500 SER A N   
3665 C CA  . SER A 489 ? 1.3812 1.1969 1.1836 0.0890  -0.1939 -0.0859 500 SER A CA  
3666 C C   . SER A 489 ? 1.4879 1.2511 1.2471 0.0812  -0.2100 -0.0765 500 SER A C   
3667 O O   . SER A 489 ? 1.5412 1.2729 1.2786 0.0935  -0.2339 -0.0846 500 SER A O   
3668 C CB  . SER A 489 ? 1.3627 1.1930 1.1776 0.1076  -0.2035 -0.1035 500 SER A CB  
3669 O OG  . SER A 489 ? 1.3749 1.1938 1.1779 0.1046  -0.2033 -0.1006 500 SER A OG  
3670 N N   . ASP A 490 ? 1.5460 1.3001 1.2917 0.0602  -0.1976 -0.0600 501 ASP A N   
3671 C CA  . ASP A 490 ? 1.6773 1.3829 1.3795 0.0476  -0.2110 -0.0494 501 ASP A CA  
3672 C C   . ASP A 490 ? 1.4406 1.1182 1.1183 0.0508  -0.2244 -0.0512 501 ASP A C   
3673 O O   . ASP A 490 ? 1.3613 0.9929 1.0034 0.0539  -0.2482 -0.0520 501 ASP A O   
3674 C CB  . ASP A 490 ? 1.8973 1.6089 1.5941 0.0231  -0.1922 -0.0332 501 ASP A CB  
3675 C CG  . ASP A 490 ? 2.0985 1.7655 1.7531 0.0071  -0.2051 -0.0225 501 ASP A CG  
3676 O OD1 . ASP A 490 ? 2.1589 1.7820 1.7814 0.0131  -0.2295 -0.0254 501 ASP A OD1 
3677 O OD2 . ASP A 490 ? 2.1292 1.8046 1.7814 -0.0118 -0.1916 -0.0115 501 ASP A OD2 
3678 N N   . ASP A 491 ? 1.3679 1.0704 1.0622 0.0501  -0.2103 -0.0520 502 ASP A N   
3679 C CA  . ASP A 491 ? 1.2704 0.9501 0.9436 0.0525  -0.2210 -0.0536 502 ASP A CA  
3680 C C   . ASP A 491 ? 1.3026 1.0216 1.0083 0.0614  -0.2074 -0.0619 502 ASP A C   
3681 O O   . ASP A 491 ? 1.2780 1.0250 1.0013 0.0502  -0.1851 -0.0553 502 ASP A O   
3682 C CB  . ASP A 491 ? 1.1004 0.7529 0.7394 0.0288  -0.2174 -0.0376 502 ASP A CB  
3683 C CG  . ASP A 491 ? 1.1596 0.7744 0.7650 0.0303  -0.2351 -0.0382 502 ASP A CG  
3684 O OD1 . ASP A 491 ? 1.1267 0.7457 0.7425 0.0498  -0.2450 -0.0510 502 ASP A OD1 
3685 O OD2 . ASP A 491 ? 1.1916 0.7735 0.7595 0.0109  -0.2391 -0.0259 502 ASP A OD2 
3686 N N   . PRO A 492 ? 1.2865 1.0088 1.0003 0.0815  -0.2210 -0.0772 503 PRO A N   
3687 C CA  . PRO A 492 ? 1.1630 0.9224 0.9060 0.0883  -0.2086 -0.0854 503 PRO A CA  
3688 C C   . PRO A 492 ? 1.2404 0.9889 0.9682 0.0792  -0.2040 -0.0788 503 PRO A C   
3689 O O   . PRO A 492 ? 1.3223 1.1013 1.0732 0.0805  -0.1901 -0.0825 503 PRO A O   
3690 C CB  . PRO A 492 ? 1.2293 0.9934 0.9809 0.1120  -0.2275 -0.1050 503 PRO A CB  
3691 C CG  . PRO A 492 ? 1.2889 1.0024 1.0028 0.1175  -0.2544 -0.1052 503 PRO A CG  
3692 C CD  . PRO A 492 ? 1.3568 1.0504 1.0536 0.0995  -0.2490 -0.0891 503 PRO A CD  
3693 N N   . ARG A 493 ? 1.1662 0.8716 0.8545 0.0691  -0.2156 -0.0692 504 ARG A N   
3694 C CA  . ARG A 493 ? 1.1608 0.8560 0.8327 0.0588  -0.2110 -0.0626 504 ARG A CA  
3695 C C   . ARG A 493 ? 1.0608 0.7872 0.7507 0.0425  -0.1835 -0.0531 504 ARG A C   
3696 O O   . ARG A 493 ? 1.0883 0.8223 0.7787 0.0381  -0.1752 -0.0519 504 ARG A O   
3697 C CB  . ARG A 493 ? 1.3136 0.9554 0.9360 0.0475  -0.2287 -0.0530 504 ARG A CB  
3698 C CG  . ARG A 493 ? 1.3381 0.9408 0.9362 0.0644  -0.2596 -0.0623 504 ARG A CG  
3699 C CD  . ARG A 493 ? 1.4181 0.9633 0.9625 0.0495  -0.2770 -0.0504 504 ARG A CD  
3700 N NE  . ARG A 493 ? 1.5128 1.0520 1.0459 0.0285  -0.2675 -0.0367 504 ARG A NE  
3701 C CZ  . ARG A 493 ? 1.6748 1.1709 1.1624 0.0078  -0.2765 -0.0235 504 ARG A CZ  
3702 N NH1 . ARG A 493 ? 1.6957 1.1930 1.1769 -0.0115 -0.2662 -0.0124 504 ARG A NH1 
3703 N NH2 . ARG A 493 ? 1.8191 1.2709 1.2662 0.0055  -0.2959 -0.0214 504 ARG A NH2 
3704 N N   . LEU A 494 ? 0.8889 0.6330 0.5930 0.0344  -0.1703 -0.0473 505 LEU A N   
3705 C CA  . LEU A 494 ? 0.9243 0.6988 0.6464 0.0214  -0.1459 -0.0400 505 LEU A CA  
3706 C C   . LEU A 494 ? 0.9794 0.7931 0.7387 0.0312  -0.1321 -0.0482 505 LEU A C   
3707 O O   . LEU A 494 ? 1.0833 0.9189 0.8554 0.0229  -0.1141 -0.0438 505 LEU A O   
3708 C CB  . LEU A 494 ? 1.0114 0.7931 0.7377 0.0113  -0.1377 -0.0325 505 LEU A CB  
3709 C CG  . LEU A 494 ? 1.1495 0.9067 0.8432 -0.0092 -0.1388 -0.0199 505 LEU A CG  
3710 C CD1 . LEU A 494 ? 1.3014 1.0094 0.9531 -0.0109 -0.1624 -0.0182 505 LEU A CD1 
3711 C CD2 . LEU A 494 ? 1.0642 0.8317 0.7670 -0.0148 -0.1329 -0.0156 505 LEU A CD2 
3712 N N   . GLY A 495 ? 1.0066 0.8299 0.7822 0.0482  -0.1407 -0.0607 506 GLY A N   
3713 C CA  . GLY A 495 ? 0.9771 0.8374 0.7861 0.0554  -0.1286 -0.0687 506 GLY A CA  
3714 C C   . GLY A 495 ? 0.9176 0.7879 0.7303 0.0509  -0.1176 -0.0675 506 GLY A C   
3715 O O   . GLY A 495 ? 1.0692 0.9211 0.8638 0.0523  -0.1265 -0.0690 506 GLY A O   
3716 N N   . ILE A 496 ? 0.6774 0.5752 0.5123 0.0458  -0.0992 -0.0649 507 ILE A N   
3717 C CA  . ILE A 496 ? 0.8592 0.7673 0.6988 0.0419  -0.0882 -0.0643 507 ILE A CA  
3718 C C   . ILE A 496 ? 0.8556 0.7781 0.7103 0.0528  -0.0916 -0.0763 507 ILE A C   
3719 O O   . ILE A 496 ? 0.8857 0.8286 0.7610 0.0590  -0.0906 -0.0835 507 ILE A O   
3720 C CB  . ILE A 496 ? 0.7933 0.7226 0.6490 0.0338  -0.0696 -0.0581 507 ILE A CB  
3721 C CG1 . ILE A 496 ? 0.7363 0.6557 0.5774 0.0223  -0.0661 -0.0477 507 ILE A CG1 
3722 C CG2 . ILE A 496 ? 0.8678 0.8068 0.7286 0.0318  -0.0598 -0.0590 507 ILE A CG2 
3723 C CD1 . ILE A 496 ? 0.6823 0.5810 0.4958 0.0132  -0.0693 -0.0425 507 ILE A CD1 
3724 N N   . GLN A 497 ? 0.8661 0.7797 0.7102 0.0539  -0.0952 -0.0788 508 GLN A N   
3725 C CA  . GLN A 497 ? 0.9784 0.9053 0.8343 0.0633  -0.0991 -0.0907 508 GLN A CA  
3726 C C   . GLN A 497 ? 0.7949 0.7386 0.6629 0.0585  -0.0850 -0.0905 508 GLN A C   
3727 O O   . GLN A 497 ? 0.7171 0.6831 0.6046 0.0618  -0.0811 -0.0984 508 GLN A O   
3728 C CB  . GLN A 497 ? 1.2282 1.1313 1.0625 0.0705  -0.1169 -0.0959 508 GLN A CB  
3729 C CG  . GLN A 497 ? 1.2581 1.1411 1.0786 0.0784  -0.1352 -0.0989 508 GLN A CG  
3730 C CD  . GLN A 497 ? 1.1352 1.0407 0.9771 0.0917  -0.1419 -0.1132 508 GLN A CD  
3731 O OE1 . GLN A 497 ? 1.1948 1.1309 1.0600 0.0937  -0.1334 -0.1212 508 GLN A OE1 
3732 N NE2 . GLN A 497 ? 1.0829 0.9736 0.9155 0.1001  -0.1577 -0.1172 508 GLN A NE2 
3733 N N   . LYS A 498 ? 0.8125 0.7465 0.6685 0.0501  -0.0777 -0.0824 509 LYS A N   
3734 C CA  . LYS A 498 ? 0.7822 0.7289 0.6472 0.0465  -0.0656 -0.0827 509 LYS A CA  
3735 C C   . LYS A 498 ? 0.7964 0.7457 0.6610 0.0373  -0.0525 -0.0733 509 LYS A C   
3736 O O   . LYS A 498 ? 0.8208 0.7575 0.6698 0.0312  -0.0535 -0.0662 509 LYS A O   
3737 C CB  . LYS A 498 ? 0.6715 0.6064 0.5222 0.0479  -0.0713 -0.0860 509 LYS A CB  
3738 C CG  . LYS A 498 ? 0.7538 0.6894 0.6063 0.0584  -0.0847 -0.0975 509 LYS A CG  
3739 C CD  . LYS A 498 ? 0.7839 0.7471 0.6615 0.0615  -0.0792 -0.1062 509 LYS A CD  
3740 C CE  . LYS A 498 ? 0.8033 0.7736 0.6847 0.0720  -0.0925 -0.1198 509 LYS A CE  
3741 N NZ  . LYS A 498 ? 0.8272 0.8275 0.7315 0.0720  -0.0864 -0.1289 509 LYS A NZ  
3742 N N   . ILE A 499 ? 0.6607 0.6263 0.5413 0.0360  -0.0411 -0.0741 510 ILE A N   
3743 C CA  . ILE A 499 ? 0.6123 0.5840 0.4956 0.0301  -0.0293 -0.0678 510 ILE A CA  
3744 C C   . ILE A 499 ? 0.6747 0.6522 0.5622 0.0301  -0.0221 -0.0707 510 ILE A C   
3745 O O   . ILE A 499 ? 0.8424 0.8265 0.7407 0.0333  -0.0219 -0.0762 510 ILE A O   
3746 C CB  . ILE A 499 ? 0.5954 0.5793 0.4945 0.0300  -0.0241 -0.0654 510 ILE A CB  
3747 C CG1 . ILE A 499 ? 0.6949 0.6722 0.5881 0.0292  -0.0305 -0.0617 510 ILE A CG1 
3748 C CG2 . ILE A 499 ? 0.5885 0.5809 0.4927 0.0265  -0.0128 -0.0615 510 ILE A CG2 
3749 C CD1 . ILE A 499 ? 0.7359 0.7252 0.6440 0.0289  -0.0257 -0.0593 510 ILE A CD1 
3750 N N   . PHE A 500 ? 0.6806 0.6565 0.5589 0.0258  -0.0164 -0.0678 511 PHE A N   
3751 C CA  . PHE A 500 ? 0.7005 0.6818 0.5824 0.0267  -0.0096 -0.0712 511 PHE A CA  
3752 C C   . PHE A 500 ? 0.7053 0.6955 0.5879 0.0236  -0.0007 -0.0683 511 PHE A C   
3753 O O   . PHE A 500 ? 0.6848 0.6742 0.5553 0.0177  0.0002  -0.0647 511 PHE A O   
3754 C CB  . PHE A 500 ? 0.6294 0.6015 0.4976 0.0264  -0.0136 -0.0745 511 PHE A CB  
3755 C CG  . PHE A 500 ? 0.6784 0.6548 0.5510 0.0285  -0.0082 -0.0793 511 PHE A CG  
3756 C CD1 . PHE A 500 ? 0.9480 0.9242 0.8278 0.0320  -0.0110 -0.0847 511 PHE A CD1 
3757 C CD2 . PHE A 500 ? 0.6321 0.6139 0.5011 0.0267  -0.0009 -0.0793 511 PHE A CD2 
3758 C CE1 . PHE A 500 ? 1.0120 0.9890 0.8936 0.0333  -0.0071 -0.0889 511 PHE A CE1 
3759 C CE2 . PHE A 500 ? 0.8565 0.8404 0.7286 0.0299  0.0026  -0.0847 511 PHE A CE2 
3760 C CZ  . PHE A 500 ? 0.9672 0.9465 0.8447 0.0330  -0.0008 -0.0888 511 PHE A CZ  
3761 N N   . LEU A 501 ? 0.6037 0.6024 0.4991 0.0274  0.0051  -0.0705 512 LEU A N   
3762 C CA  . LEU A 501 ? 0.6022 0.6121 0.5008 0.0274  0.0126  -0.0705 512 LEU A CA  
3763 C C   . LEU A 501 ? 0.6062 0.6176 0.5063 0.0322  0.0156  -0.0767 512 LEU A C   
3764 O O   . LEU A 501 ? 0.8035 0.8088 0.7096 0.0361  0.0136  -0.0794 512 LEU A O   
3765 C CB  . LEU A 501 ? 0.8090 0.8257 0.7207 0.0295  0.0147  -0.0678 512 LEU A CB  
3766 C CG  . LEU A 501 ? 0.5879 0.6174 0.5056 0.0325  0.0210  -0.0698 512 LEU A CG  
3767 C CD1 . LEU A 501 ? 0.5943 0.6353 0.5036 0.0265  0.0251  -0.0691 512 LEU A CD1 
3768 C CD2 . LEU A 501 ? 0.5770 0.6099 0.5070 0.0353  0.0214  -0.0672 512 LEU A CD2 
3769 N N   . CYS A 502 ? 0.6810 0.7008 0.5746 0.0310  0.0200  -0.0796 513 CYS A N   
3770 C CA  . CYS A 502 ? 0.6195 0.6425 0.5145 0.0369  0.0226  -0.0870 513 CYS A CA  
3771 C C   . CYS A 502 ? 0.7625 0.7968 0.6685 0.0433  0.0262  -0.0899 513 CYS A C   
3772 O O   . CYS A 502 ? 0.8389 0.8899 0.7454 0.0416  0.0308  -0.0909 513 CYS A O   
3773 C CB  . CYS A 502 ? 0.6317 0.6608 0.5140 0.0328  0.0253  -0.0905 513 CYS A CB  
3774 S SG  . CYS A 502 ? 0.7918 0.8248 0.6752 0.0412  0.0275  -0.1013 513 CYS A SG  
3775 N N   . LYS A 503 ? 0.7612 0.7860 0.6744 0.0501  0.0233  -0.0917 514 LYS A N   
3776 C CA  . LYS A 503 ? 0.7361 0.7668 0.6580 0.0576  0.0241  -0.0944 514 LYS A CA  
3777 C C   . LYS A 503 ? 0.7033 0.7464 0.6247 0.0652  0.0265  -0.1042 514 LYS A C   
3778 O O   . LYS A 503 ? 0.8292 0.8800 0.7577 0.0733  0.0264  -0.1085 514 LYS A O   
3779 C CB  . LYS A 503 ? 0.7072 0.7198 0.6323 0.0611  0.0187  -0.0933 514 LYS A CB  
3780 C CG  . LYS A 503 ? 0.6245 0.6214 0.5425 0.0622  0.0150  -0.0973 514 LYS A CG  
3781 C CD  . LYS A 503 ? 0.7400 0.7185 0.6581 0.0627  0.0095  -0.0957 514 LYS A CD  
3782 C CE  . LYS A 503 ? 0.8914 0.8538 0.8010 0.0620  0.0056  -0.0997 514 LYS A CE  
3783 N NZ  . LYS A 503 ? 0.7669 0.7093 0.6725 0.0605  -0.0003 -0.0984 514 LYS A NZ  
3784 N N   . TYR A 504 ? 0.6291 0.6754 0.5424 0.0635  0.0283  -0.1089 515 TYR A N   
3785 C CA  . TYR A 504 ? 0.6388 0.6992 0.5518 0.0713  0.0304  -0.1203 515 TYR A CA  
3786 C C   . TYR A 504 ? 0.8689 0.9571 0.7796 0.0651  0.0375  -0.1233 515 TYR A C   
3787 O O   . TYR A 504 ? 0.9499 1.0593 0.8656 0.0723  0.0401  -0.1335 515 TYR A O   
3788 C CB  . TYR A 504 ? 0.6501 0.6975 0.5551 0.0735  0.0277  -0.1253 515 TYR A CB  
3789 C CG  . TYR A 504 ? 0.8162 0.8371 0.7211 0.0779  0.0207  -0.1237 515 TYR A CG  
3790 C CD1 . TYR A 504 ? 0.7557 0.7677 0.6630 0.0893  0.0157  -0.1300 515 TYR A CD1 
3791 C CD2 . TYR A 504 ? 0.6513 0.6561 0.5520 0.0699  0.0181  -0.1167 515 TYR A CD2 
3792 C CE1 . TYR A 504 ? 0.7833 0.7686 0.6866 0.0904  0.0087  -0.1279 515 TYR A CE1 
3793 C CE2 . TYR A 504 ? 0.6568 0.6404 0.5562 0.0710  0.0123  -0.1157 515 TYR A CE2 
3794 C CZ  . TYR A 504 ? 0.6686 0.6412 0.5680 0.0800  0.0078  -0.1206 515 TYR A CZ  
3795 O OH  . TYR A 504 ? 0.6783 0.6272 0.5726 0.0782  0.0014  -0.1189 515 TYR A OH  
3796 N N   . SER A 505 ? 0.6366 0.7252 0.5383 0.0518  0.0399  -0.1156 516 SER A N   
3797 C CA  . SER A 505 ? 0.6409 0.7531 0.5356 0.0419  0.0463  -0.1174 516 SER A CA  
3798 C C   . SER A 505 ? 0.6339 0.7535 0.5289 0.0324  0.0484  -0.1092 516 SER A C   
3799 O O   . SER A 505 ? 0.8421 0.9863 0.7341 0.0248  0.0543  -0.1122 516 SER A O   
3800 C CB  . SER A 505 ? 0.8785 0.9834 0.7562 0.0318  0.0463  -0.1155 516 SER A CB  
3801 O OG  . SER A 505 ? 0.9152 0.9964 0.7857 0.0252  0.0411  -0.1045 516 SER A OG  
3802 N N   . GLY A 506 ? 0.6253 0.7259 0.5235 0.0317  0.0439  -0.0997 517 GLY A N   
3803 C CA  . GLY A 506 ? 0.6198 0.7245 0.5175 0.0231  0.0449  -0.0919 517 GLY A CA  
3804 C C   . GLY A 506 ? 0.7702 0.8620 0.6504 0.0092  0.0425  -0.0833 517 GLY A C   
3805 O O   . GLY A 506 ? 0.6285 0.7241 0.5042 0.0000  0.0432  -0.0774 517 GLY A O   
3806 N N   . TYR A 507 ? 0.7038 0.7793 0.5727 0.0075  0.0386  -0.0828 518 TYR A N   
3807 C CA  . TYR A 507 ? 0.7038 0.7618 0.5539 -0.0037 0.0334  -0.0751 518 TYR A CA  
3808 C C   . TYR A 507 ? 0.7604 0.7976 0.6154 0.0008  0.0255  -0.0691 518 TYR A C   
3809 O O   . TYR A 507 ? 0.8313 0.8612 0.6973 0.0106  0.0230  -0.0718 518 TYR A O   
3810 C CB  . TYR A 507 ? 0.7258 0.7758 0.5609 -0.0067 0.0316  -0.0780 518 TYR A CB  
3811 C CG  . TYR A 507 ? 0.8469 0.9175 0.6710 -0.0159 0.0387  -0.0830 518 TYR A CG  
3812 C CD1 . TYR A 507 ? 0.9072 0.9834 0.7142 -0.0323 0.0404  -0.0781 518 TYR A CD1 
3813 C CD2 . TYR A 507 ? 0.8519 0.9366 0.6814 -0.0092 0.0432  -0.0931 518 TYR A CD2 
3814 C CE1 . TYR A 507 ? 0.9151 1.0139 0.7112 -0.0432 0.0476  -0.0834 518 TYR A CE1 
3815 C CE2 . TYR A 507 ? 0.9078 1.0156 0.7279 -0.0177 0.0500  -0.0994 518 TYR A CE2 
3816 C CZ  . TYR A 507 ? 0.9441 1.0606 0.7478 -0.0355 0.0526  -0.0946 518 TYR A CZ  
3817 O OH  . TYR A 507 ? 1.0505 1.1937 0.8441 -0.0464 0.0601  -0.1016 518 TYR A OH  
3818 N N   . LEU A 508 ? 0.7413 0.7695 0.5871 -0.0070 0.0214  -0.0618 519 LEU A N   
3819 C CA  . LEU A 508 ? 0.6923 0.7039 0.5422 -0.0028 0.0134  -0.0575 519 LEU A CA  
3820 C C   . LEU A 508 ? 0.7600 0.7492 0.5883 -0.0088 0.0036  -0.0536 519 LEU A C   
3821 O O   . LEU A 508 ? 0.8270 0.8116 0.6350 -0.0208 0.0027  -0.0496 519 LEU A O   
3822 C CB  . LEU A 508 ? 0.6296 0.6482 0.4885 -0.0041 0.0149  -0.0533 519 LEU A CB  
3823 C CG  . LEU A 508 ? 0.6965 0.7024 0.5621 0.0009  0.0074  -0.0503 519 LEU A CG  
3824 C CD1 . LEU A 508 ? 0.6066 0.6147 0.4900 0.0117  0.0077  -0.0549 519 LEU A CD1 
3825 C CD2 . LEU A 508 ? 0.7878 0.7999 0.6582 -0.0025 0.0088  -0.0456 519 LEU A CD2 
3826 N N   . ALA A 509 ? 0.7042 0.6795 0.5353 -0.0011 -0.0045 -0.0553 520 ALA A N   
3827 C CA  . ALA A 509 ? 0.7171 0.6696 0.5288 -0.0032 -0.0165 -0.0534 520 ALA A CA  
3828 C C   . ALA A 509 ? 0.7466 0.6910 0.5664 0.0038  -0.0252 -0.0531 520 ALA A C   
3829 O O   . ALA A 509 ? 0.7431 0.6942 0.5809 0.0129  -0.0253 -0.0581 520 ALA A O   
3830 C CB  . ALA A 509 ? 0.6831 0.6293 0.4898 0.0007  -0.0194 -0.0586 520 ALA A CB  
3831 N N   . VAL A 510 ? 0.6829 0.6132 0.4881 -0.0014 -0.0327 -0.0479 521 VAL A N   
3832 C CA  . VAL A 510 ? 0.6794 0.6018 0.4902 0.0057  -0.0423 -0.0487 521 VAL A CA  
3833 C C   . VAL A 510 ? 0.7073 0.6018 0.4936 0.0060  -0.0586 -0.0485 521 VAL A C   
3834 O O   . VAL A 510 ? 0.7326 0.6106 0.4930 -0.0038 -0.0621 -0.0438 521 VAL A O   
3835 C CB  . VAL A 510 ? 0.7202 0.6491 0.5369 0.0015  -0.0388 -0.0435 521 VAL A CB  
3836 C CG1 . VAL A 510 ? 0.7093 0.6639 0.5494 0.0029  -0.0245 -0.0444 521 VAL A CG1 
3837 C CG2 . VAL A 510 ? 0.8315 0.7474 0.6226 -0.0124 -0.0405 -0.0360 521 VAL A CG2 
3838 N N   . ALA A 511 ? 0.7047 0.5943 0.4982 0.0175  -0.0694 -0.0544 522 ALA A N   
3839 C CA  . ALA A 511 ? 1.0664 0.9294 0.8387 0.0221  -0.0877 -0.0569 522 ALA A CA  
3840 C C   . ALA A 511 ? 0.7331 0.5897 0.5086 0.0296  -0.0987 -0.0592 522 ALA A C   
3841 O O   . ALA A 511 ? 0.7076 0.5858 0.5088 0.0364  -0.0938 -0.0639 522 ALA A O   
3842 C CB  . ALA A 511 ? 1.0547 0.9205 0.8325 0.0319  -0.0925 -0.0661 522 ALA A CB  
3843 N N   . GLY A 512 ? 0.7654 0.5909 0.5130 0.0278  -0.1145 -0.0560 523 GLY A N   
3844 C CA  . GLY A 512 ? 0.7724 0.5872 0.5182 0.0340  -0.1265 -0.0577 523 GLY A CA  
3845 C C   . GLY A 512 ? 0.7899 0.5890 0.5293 0.0500  -0.1473 -0.0685 523 GLY A C   
3846 O O   . GLY A 512 ? 0.8916 0.6874 0.6272 0.0563  -0.1532 -0.0748 523 GLY A O   
3847 N N   . THR A 513 ? 0.7971 0.5874 0.5354 0.0574  -0.1591 -0.0717 524 THR A N   
3848 C CA  . THR A 513 ? 0.8832 0.6615 0.6175 0.0753  -0.1805 -0.0845 524 THR A CA  
3849 C C   . THR A 513 ? 0.9375 0.6689 0.6304 0.0748  -0.2018 -0.0816 524 THR A C   
3850 O O   . THR A 513 ? 0.9864 0.7076 0.6727 0.0884  -0.2177 -0.0920 524 THR A O   
3851 C CB  . THR A 513 ? 0.8059 0.5918 0.5533 0.0841  -0.1863 -0.0901 524 THR A CB  
3852 O OG1 . THR A 513 ? 0.8388 0.6666 0.6221 0.0828  -0.1668 -0.0919 524 THR A OG1 
3853 C CG2 . THR A 513 ? 0.8214 0.6014 0.5684 0.1050  -0.2086 -0.1066 524 THR A CG2 
3854 N N   . ALA A 514 ? 0.9343 0.6368 0.5977 0.0585  -0.2029 -0.0678 525 ALA A N   
3855 C CA  . ALA A 514 ? 1.0689 0.7218 0.6872 0.0543  -0.2238 -0.0629 525 ALA A CA  
3856 C C   . ALA A 514 ? 1.0601 0.7050 0.6615 0.0442  -0.2195 -0.0579 525 ALA A C   
3857 O O   . ALA A 514 ? 1.0629 0.6667 0.6230 0.0340  -0.2329 -0.0503 525 ALA A O   
3858 C CB  . ALA A 514 ? 1.1999 0.8243 0.7903 0.0378  -0.2272 -0.0499 525 ALA A CB  
3859 N N   . GLY A 515 ? 0.9576 0.6391 0.5878 0.0458  -0.2017 -0.0620 526 GLY A N   
3860 C CA  . GLY A 515 ? 1.0400 0.7162 0.6562 0.0379  -0.1977 -0.0588 526 GLY A CA  
3861 C C   . GLY A 515 ? 1.1059 0.7864 0.7113 0.0147  -0.1800 -0.0455 526 GLY A C   
3862 O O   . GLY A 515 ? 1.0772 0.7409 0.6571 0.0039  -0.1815 -0.0406 526 GLY A O   
3863 N N   . GLN A 516 ? 1.0596 0.7637 0.6835 0.0066  -0.1634 -0.0405 527 GLN A N   
3864 C CA  . GLN A 516 ? 1.0942 0.8106 0.7129 -0.0139 -0.1454 -0.0306 527 GLN A CA  
3865 C C   . GLN A 516 ? 1.0964 0.8552 0.7507 -0.0106 -0.1242 -0.0351 527 GLN A C   
3866 O O   . GLN A 516 ? 0.8233 0.6059 0.5101 0.0033  -0.1194 -0.0428 527 GLN A O   
3867 C CB  . GLN A 516 ? 0.9623 0.6784 0.5772 -0.0255 -0.1410 -0.0227 527 GLN A CB  
3868 C CG  . GLN A 516 ? 0.8583 0.6052 0.5114 -0.0148 -0.1313 -0.0272 527 GLN A CG  
3869 C CD  . GLN A 516 ? 1.0494 0.7817 0.7059 0.0019  -0.1489 -0.0341 527 GLN A CD  
3870 O OE1 . GLN A 516 ? 1.2238 0.9292 0.8623 0.0115  -0.1681 -0.0392 527 GLN A OE1 
3871 N NE2 . GLN A 516 ? 0.9640 0.7150 0.6435 0.0061  -0.1430 -0.0353 527 GLN A NE2 
3872 N N   . VAL A 517 ? 1.0746 0.8416 0.7206 -0.0239 -0.1124 -0.0309 528 VAL A N   
3873 C CA  . VAL A 517 ? 0.8792 0.6822 0.5541 -0.0217 -0.0935 -0.0351 528 VAL A CA  
3874 C C   . VAL A 517 ? 0.8349 0.6546 0.5064 -0.0390 -0.0779 -0.0285 528 VAL A C   
3875 O O   . VAL A 517 ? 0.9414 0.7491 0.5843 -0.0548 -0.0784 -0.0232 528 VAL A O   
3876 C CB  . VAL A 517 ? 0.8298 0.6305 0.5005 -0.0172 -0.0955 -0.0403 528 VAL A CB  
3877 C CG1 . VAL A 517 ? 0.8162 0.6513 0.5155 -0.0144 -0.0772 -0.0450 528 VAL A CG1 
3878 C CG2 . VAL A 517 ? 0.8357 0.6212 0.5080 -0.0003 -0.1124 -0.0482 528 VAL A CG2 
3879 N N   . LEU A 518 ? 0.7899 0.6384 0.4897 -0.0365 -0.0644 -0.0295 529 LEU A N   
3880 C CA  . LEU A 518 ? 0.8522 0.7224 0.5537 -0.0502 -0.0496 -0.0256 529 LEU A CA  
3881 C C   . LEU A 518 ? 0.7568 0.6588 0.4837 -0.0446 -0.0343 -0.0320 529 LEU A C   
3882 O O   . LEU A 518 ? 0.8728 0.7877 0.6270 -0.0304 -0.0311 -0.0374 529 LEU A O   
3883 C CB  . LEU A 518 ? 0.7915 0.6691 0.5038 -0.0515 -0.0472 -0.0222 529 LEU A CB  
3884 C CG  . LEU A 518 ? 0.8070 0.6562 0.4900 -0.0631 -0.0592 -0.0144 529 LEU A CG  
3885 C CD1 . LEU A 518 ? 0.7857 0.6436 0.4853 -0.0598 -0.0574 -0.0128 529 LEU A CD1 
3886 C CD2 . LEU A 518 ? 0.9707 0.8179 0.6248 -0.0861 -0.0547 -0.0082 529 LEU A CD2 
3887 N N   . VAL A 519 ? 0.7659 0.6799 0.4822 -0.0564 -0.0255 -0.0319 530 VAL A N   
3888 C CA  . VAL A 519 ? 0.7444 0.6888 0.4822 -0.0517 -0.0115 -0.0388 530 VAL A CA  
3889 C C   . VAL A 519 ? 0.7373 0.7080 0.4811 -0.0612 0.0003  -0.0380 530 VAL A C   
3890 O O   . VAL A 519 ? 0.7581 0.7316 0.4801 -0.0786 0.0028  -0.0348 530 VAL A O   
3891 C CB  . VAL A 519 ? 0.9335 0.8762 0.6571 -0.0556 -0.0106 -0.0422 530 VAL A CB  
3892 C CG1 . VAL A 519 ? 0.9852 0.9567 0.7326 -0.0471 0.0018  -0.0507 530 VAL A CG1 
3893 C CG2 . VAL A 519 ? 0.8461 0.7605 0.5592 -0.0479 -0.0243 -0.0424 530 VAL A CG2 
3894 N N   . LEU A 520 ? 0.7250 0.7155 0.4972 -0.0506 0.0072  -0.0413 531 LEU A N   
3895 C CA  . LEU A 520 ? 0.7007 0.7175 0.4823 -0.0565 0.0172  -0.0418 531 LEU A CA  
3896 C C   . LEU A 520 ? 0.7747 0.8215 0.5760 -0.0487 0.0283  -0.0513 531 LEU A C   
3897 O O   . LEU A 520 ? 0.8555 0.9001 0.6664 -0.0371 0.0279  -0.0566 531 LEU A O   
3898 C CB  . LEU A 520 ? 0.7985 0.8140 0.5957 -0.0501 0.0151  -0.0384 531 LEU A CB  
3899 C CG  . LEU A 520 ? 0.7970 0.7827 0.5790 -0.0533 0.0025  -0.0309 531 LEU A CG  
3900 C CD1 . LEU A 520 ? 0.8005 0.7680 0.5906 -0.0385 -0.0068 -0.0330 531 LEU A CD1 
3901 C CD2 . LEU A 520 ? 0.8419 0.8346 0.6318 -0.0559 0.0040  -0.0270 531 LEU A CD2 
3902 N N   . GLU A 521 ? 0.8003 0.8754 0.6070 -0.0549 0.0375  -0.0543 532 GLU A N   
3903 C CA  . GLU A 521 ? 0.7532 0.8590 0.5782 -0.0464 0.0468  -0.0651 532 GLU A CA  
3904 C C   . GLU A 521 ? 0.6521 0.7800 0.4965 -0.0418 0.0519  -0.0671 532 GLU A C   
3905 O O   . GLU A 521 ? 0.6560 0.7866 0.4937 -0.0531 0.0522  -0.0614 532 GLU A O   
3906 C CB  . GLU A 521 ? 0.9159 1.0424 0.7259 -0.0592 0.0534  -0.0708 532 GLU A CB  
3907 C CG  . GLU A 521 ? 0.9083 1.0663 0.7364 -0.0480 0.0614  -0.0844 532 GLU A CG  
3908 C CD  . GLU A 521 ? 1.0237 1.2051 0.8370 -0.0611 0.0680  -0.0915 532 GLU A CD  
3909 O OE1 . GLU A 521 ? 1.0666 1.2394 0.8538 -0.0812 0.0667  -0.0845 532 GLU A OE1 
3910 O OE2 . GLU A 521 ? 1.0311 1.2389 0.8573 -0.0514 0.0736  -0.1044 532 GLU A OE2 
3911 N N   . LEU A 522 ? 0.6360 0.7774 0.5027 -0.0253 0.0548  -0.0752 533 LEU A N   
3912 C CA  . LEU A 522 ? 0.7560 0.9164 0.6417 -0.0181 0.0581  -0.0781 533 LEU A CA  
3913 C C   . LEU A 522 ? 0.8998 1.0993 0.7898 -0.0206 0.0667  -0.0892 533 LEU A C   
3914 O O   . LEU A 522 ? 1.0137 1.2267 0.9091 -0.0118 0.0691  -0.1000 533 LEU A O   
3915 C CB  . LEU A 522 ? 0.6639 0.8139 0.5684 0.0009  0.0545  -0.0807 533 LEU A CB  
3916 C CG  . LEU A 522 ? 0.5944 0.7632 0.5180 0.0112  0.0568  -0.0856 533 LEU A CG  
3917 C CD1 . LEU A 522 ? 0.7064 0.8786 0.6306 0.0026  0.0573  -0.0780 533 LEU A CD1 
3918 C CD2 . LEU A 522 ? 0.5862 0.7382 0.5225 0.0275  0.0516  -0.0869 533 LEU A CD2 
3919 N N   . ASN A 523 ? 0.8538 1.0728 0.7413 -0.0326 0.0709  -0.0877 534 ASN A N   
3920 C CA  . ASN A 523 ? 0.9902 1.2526 0.8855 -0.0344 0.0791  -0.0997 534 ASN A CA  
3921 C C   . ASN A 523 ? 0.9040 1.1803 0.8157 -0.0290 0.0799  -0.0998 534 ASN A C   
3922 O O   . ASN A 523 ? 0.7608 1.0141 0.6724 -0.0303 0.0753  -0.0887 534 ASN A O   
3923 C CB  . ASN A 523 ? 0.9515 1.2320 0.8248 -0.0586 0.0849  -0.0997 534 ASN A CB  
3924 C CG  . ASN A 523 ? 0.8814 1.1512 0.7397 -0.0776 0.0835  -0.0874 534 ASN A CG  
3925 O OD1 . ASN A 523 ? 1.0580 1.2955 0.9158 -0.0742 0.0763  -0.0764 534 ASN A OD1 
3926 N ND2 . ASN A 523 ? 0.6882 0.9860 0.5334 -0.0983 0.0902  -0.0899 534 ASN A ND2 
3927 N N   . ASP A 524 ? 0.7382 0.9346 0.9785 -0.0896 -0.1155 0.0362  535 ASP A N   
3928 C CA  . ASP A 524 ? 0.7446 0.9561 1.0006 -0.0958 -0.1332 0.0455  535 ASP A CA  
3929 C C   . ASP A 524 ? 0.8217 1.0385 1.0751 -0.1114 -0.1385 0.0460  535 ASP A C   
3930 O O   . ASP A 524 ? 0.8086 1.0301 1.0588 -0.1201 -0.1547 0.0526  535 ASP A O   
3931 C CB  . ASP A 524 ? 0.7774 1.0135 1.0812 -0.0880 -0.1358 0.0518  535 ASP A CB  
3932 C CG  . ASP A 524 ? 1.0031 1.2329 1.3095 -0.0736 -0.1318 0.0520  535 ASP A CG  
3933 O OD1 . ASP A 524 ? 1.0864 1.2950 1.3577 -0.0707 -0.1290 0.0480  535 ASP A OD1 
3934 O OD2 . ASP A 524 ? 1.0786 1.3247 1.4233 -0.0653 -0.1310 0.0560  535 ASP A OD2 
3935 N N   . GLU A 525 ? 0.8869 1.1019 1.1395 -0.1165 -0.1256 0.0392  536 GLU A N   
3936 C CA  . GLU A 525 ? 0.9923 1.2125 1.2441 -0.1323 -0.1290 0.0390  536 GLU A CA  
3937 C C   . GLU A 525 ? 0.8474 1.0391 1.0549 -0.1392 -0.1216 0.0318  536 GLU A C   
3938 O O   . GLU A 525 ? 0.7641 0.9353 0.9468 -0.1309 -0.1124 0.0268  536 GLU A O   
3939 C CB  . GLU A 525 ? 1.1202 1.3643 1.4130 -0.1345 -0.1200 0.0378  536 GLU A CB  
3940 C CG  . GLU A 525 ? 1.2589 1.4980 1.5568 -0.1250 -0.0999 0.0304  536 GLU A CG  
3941 C CD  . GLU A 525 ? 1.3995 1.6616 1.7372 -0.1287 -0.0890 0.0280  536 GLU A CD  
3942 O OE1 . GLU A 525 ? 1.4358 1.6889 1.7657 -0.1294 -0.0711 0.0200  536 GLU A OE1 
3943 O OE2 . GLU A 525 ? 1.4707 1.7601 1.8476 -0.1316 -0.0983 0.0342  536 GLU A OE2 
3944 N N   . ALA A 526 ? 0.7478 0.9387 0.9464 -0.1548 -0.1261 0.0316  537 ALA A N   
3945 C CA  . ALA A 526 ? 0.7323 0.8955 0.8911 -0.1625 -0.1192 0.0252  537 ALA A CA  
3946 C C   . ALA A 526 ? 0.7599 0.9183 0.9205 -0.1616 -0.1014 0.0191  537 ALA A C   
3947 O O   . ALA A 526 ? 0.8003 0.9789 0.9943 -0.1580 -0.0941 0.0190  537 ALA A O   
3948 C CB  . ALA A 526 ? 0.6217 0.7844 0.7701 -0.1809 -0.1291 0.0266  537 ALA A CB  
3949 N N   . ALA A 527 ? 0.6927 0.8227 0.8163 -0.1652 -0.0941 0.0141  538 ALA A N   
3950 C CA  . ALA A 527 ? 0.7803 0.9008 0.8980 -0.1658 -0.0781 0.0090  538 ALA A CA  
3951 C C   . ALA A 527 ? 0.9795 1.0690 1.0569 -0.1745 -0.0748 0.0056  538 ALA A C   
3952 O O   . ALA A 527 ? 1.0938 1.1637 1.1438 -0.1725 -0.0810 0.0056  538 ALA A O   
3953 C CB  . ALA A 527 ? 0.7767 0.8925 0.8938 -0.1501 -0.0691 0.0070  538 ALA A CB  
3954 N N   . GLU A 528 ? 1.0877 1.1723 1.1621 -0.1842 -0.0643 0.0027  539 GLU A N   
3955 C CA  . GLU A 528 ? 1.1685 1.2213 1.2053 -0.1921 -0.0591 -0.0002 539 GLU A CA  
3956 C C   . GLU A 528 ? 1.1733 1.2108 1.1967 -0.1851 -0.0457 -0.0025 539 GLU A C   
3957 O O   . GLU A 528 ? 1.2292 1.2746 1.2645 -0.1912 -0.0351 -0.0044 539 GLU A O   
3958 C CB  . GLU A 528 ? 1.2434 1.3001 1.2836 -0.2116 -0.0587 -0.0011 539 GLU A CB  
3959 C CG  . GLU A 528 ? 1.3761 1.3975 1.3771 -0.2209 -0.0528 -0.0039 539 GLU A CG  
3960 C CD  . GLU A 528 ? 1.5035 1.5278 1.5057 -0.2418 -0.0543 -0.0050 539 GLU A CD  
3961 O OE1 . GLU A 528 ? 1.4995 1.5491 1.5255 -0.2487 -0.0649 -0.0029 539 GLU A OE1 
3962 O OE2 . GLU A 528 ? 1.5863 1.5875 1.5655 -0.2518 -0.0455 -0.0074 539 GLU A OE2 
3963 N N   . GLN A 529 ? 1.1244 1.1404 1.1229 -0.1729 -0.0462 -0.0025 540 GLN A N   
3964 C CA  . GLN A 529 ? 1.0877 1.0901 1.0725 -0.1653 -0.0363 -0.0035 540 GLN A CA  
3965 C C   . GLN A 529 ? 1.1484 1.1166 1.0953 -0.1608 -0.0375 -0.0031 540 GLN A C   
3966 O O   . GLN A 529 ? 1.2745 1.2328 1.2100 -0.1585 -0.0456 -0.0027 540 GLN A O   
3967 C CB  . GLN A 529 ? 0.9053 0.9249 0.9093 -0.1510 -0.0360 -0.0033 540 GLN A CB  
3968 C CG  . GLN A 529 ? 0.8008 0.8170 0.7985 -0.1387 -0.0461 -0.0017 540 GLN A CG  
3969 C CD  . GLN A 529 ? 0.8678 0.9037 0.8885 -0.1267 -0.0466 -0.0013 540 GLN A CD  
3970 O OE1 . GLN A 529 ? 1.0065 1.0639 1.0554 -0.1281 -0.0418 -0.0019 540 GLN A OE1 
3971 N NE2 . GLN A 529 ? 0.8267 0.8549 0.8361 -0.1151 -0.0515 -0.0008 540 GLN A NE2 
3972 N N   . ALA A 530 ? 1.0161 0.9661 0.9439 -0.1598 -0.0292 -0.0030 541 ALA A N   
3973 C CA  . ALA A 530 ? 0.9295 0.8478 0.8245 -0.1534 -0.0305 -0.0013 541 ALA A CA  
3974 C C   . ALA A 530 ? 0.9675 0.8884 0.8631 -0.1364 -0.0339 -0.0003 541 ALA A C   
3975 O O   . ALA A 530 ? 1.1360 1.0754 1.0483 -0.1315 -0.0308 -0.0009 541 ALA A O   
3976 C CB  . ALA A 530 ? 0.9622 0.8579 0.8342 -0.1611 -0.0216 -0.0001 541 ALA A CB  
3977 N N   . VAL A 531 ? 0.8605 0.7627 0.7384 -0.1279 -0.0395 0.0008  542 VAL A N   
3978 C CA  . VAL A 531 ? 0.7730 0.6767 0.6507 -0.1123 -0.0433 0.0016  542 VAL A CA  
3979 C C   . VAL A 531 ? 0.7950 0.6757 0.6493 -0.1077 -0.0406 0.0048  542 VAL A C   
3980 O O   . VAL A 531 ? 0.7551 0.6094 0.5879 -0.1082 -0.0414 0.0067  542 VAL A O   
3981 C CB  . VAL A 531 ? 0.7253 0.6254 0.6013 -0.1055 -0.0506 0.0005  542 VAL A CB  
3982 C CG1 . VAL A 531 ? 0.6939 0.5987 0.5728 -0.0902 -0.0538 0.0009  542 VAL A CG1 
3983 C CG2 . VAL A 531 ? 0.6960 0.6165 0.5911 -0.1126 -0.0547 -0.0014 542 VAL A CG2 
3984 N N   . GLU A 532 ? 0.8348 0.7243 0.6925 -0.1035 -0.0377 0.0056  543 GLU A N   
3985 C CA  . GLU A 532 ? 0.9114 0.7805 0.7460 -0.1006 -0.0365 0.0096  543 GLU A CA  
3986 C C   . GLU A 532 ? 0.9487 0.8056 0.7741 -0.0865 -0.0443 0.0122  543 GLU A C   
3987 O O   . GLU A 532 ? 1.1360 1.0075 0.9760 -0.0771 -0.0488 0.0100  543 GLU A O   
3988 C CB  . GLU A 532 ? 1.0061 0.8887 0.8459 -0.1013 -0.0313 0.0089  543 GLU A CB  
3989 C CG  . GLU A 532 ? 1.2896 1.1510 1.1026 -0.1058 -0.0281 0.0132  543 GLU A CG  
3990 C CD  . GLU A 532 ? 1.3930 1.2657 1.2095 -0.1152 -0.0179 0.0104  543 GLU A CD  
3991 O OE1 . GLU A 532 ? 1.2934 1.1910 1.1363 -0.1165 -0.0133 0.0051  543 GLU A OE1 
3992 O OE2 . GLU A 532 ? 1.4053 1.2608 1.1978 -0.1216 -0.0142 0.0135  543 GLU A OE2 
3993 N N   . GLN A 533 ? 0.8370 0.6668 0.6391 -0.0850 -0.0457 0.0171  544 GLN A N   
3994 C CA  . GLN A 533 ? 0.9037 0.7198 0.6987 -0.0715 -0.0526 0.0200  544 GLN A CA  
3995 C C   . GLN A 533 ? 0.8859 0.6937 0.6676 -0.0657 -0.0560 0.0262  544 GLN A C   
3996 O O   . GLN A 533 ? 0.9618 0.7558 0.7256 -0.0742 -0.0531 0.0303  544 GLN A O   
3997 C CB  . GLN A 533 ? 0.9871 0.7760 0.7678 -0.0733 -0.0526 0.0211  544 GLN A CB  
3998 C CG  . GLN A 533 ? 1.0203 0.8158 0.8109 -0.0805 -0.0504 0.0150  544 GLN A CG  
3999 C CD  . GLN A 533 ? 1.2262 0.9940 0.9989 -0.0898 -0.0472 0.0153  544 GLN A CD  
4000 O OE1 . GLN A 533 ? 1.3735 1.1135 1.1271 -0.0867 -0.0474 0.0202  544 GLN A OE1 
4001 N NE2 . GLN A 533 ? 1.2841 1.0589 1.0628 -0.1018 -0.0446 0.0105  544 GLN A NE2 
4002 N N   . VAL A 534 ? 0.9143 0.7309 0.7040 -0.0524 -0.0623 0.0270  545 VAL A N   
4003 C CA  . VAL A 534 ? 1.0230 0.8350 0.8022 -0.0464 -0.0679 0.0332  545 VAL A CA  
4004 C C   . VAL A 534 ? 1.0820 0.8866 0.8646 -0.0311 -0.0758 0.0362  545 VAL A C   
4005 O O   . VAL A 534 ? 1.0653 0.8855 0.8664 -0.0230 -0.0770 0.0313  545 VAL A O   
4006 C CB  . VAL A 534 ? 0.9406 0.7775 0.7301 -0.0471 -0.0670 0.0304  545 VAL A CB  
4007 C CG1 . VAL A 534 ? 1.1341 0.9674 0.9129 -0.0406 -0.0748 0.0367  545 VAL A CG1 
4008 C CG2 . VAL A 534 ? 0.9318 0.7743 0.7184 -0.0618 -0.0577 0.0274  545 VAL A CG2 
4009 N N   . GLU A 535 ? 1.0148 0.7955 0.7804 -0.0272 -0.0810 0.0445  546 GLU A N   
4010 C CA  . GLU A 535 ? 1.0774 0.8507 0.8490 -0.0116 -0.0883 0.0480  546 GLU A CA  
4011 C C   . GLU A 535 ? 1.0916 0.8826 0.8708 -0.0033 -0.0965 0.0512  546 GLU A C   
4012 O O   . GLU A 535 ? 1.1682 0.9586 0.9335 -0.0089 -0.0999 0.0567  546 GLU A O   
4013 C CB  . GLU A 535 ? 1.0690 0.8084 0.8214 -0.0098 -0.0912 0.0566  546 GLU A CB  
4014 C CG  . GLU A 535 ? 1.1167 0.8466 0.8791 0.0072  -0.0973 0.0598  546 GLU A CG  
4015 C CD  . GLU A 535 ? 1.3341 1.0342 1.0788 0.0116  -0.1042 0.0719  546 GLU A CD  
4016 O OE1 . GLU A 535 ? 1.3566 1.0525 1.0838 0.0051  -0.1093 0.0798  546 GLU A OE1 
4017 O OE2 . GLU A 535 ? 1.4000 1.0795 1.1474 0.0212  -0.1043 0.0737  546 GLU A OE2 
4018 N N   . ALA A 536 ? 1.1347 0.9412 0.9348 0.0086  -0.0992 0.0475  547 ALA A N   
4019 C CA  . ALA A 536 ? 1.0278 0.8533 0.8384 0.0166  -0.1070 0.0496  547 ALA A CA  
4020 C C   . ALA A 536 ? 1.0830 0.8978 0.8998 0.0316  -0.1153 0.0560  547 ALA A C   
4021 O O   . ALA A 536 ? 1.0434 0.8663 0.8799 0.0420  -0.1142 0.0513  547 ALA A O   
4022 C CB  . ALA A 536 ? 0.8861 0.7397 0.7178 0.0179  -0.1032 0.0402  547 ALA A CB  
4023 N N   . ASP A 537 ? 1.1663 0.9627 0.9665 0.0324  -0.1232 0.0671  548 ASP A N   
4024 C CA  . ASP A 537 ? 1.2101 0.9956 1.0175 0.0473  -0.1326 0.0753  548 ASP A CA  
4025 C C   . ASP A 537 ? 1.1807 0.9930 1.0069 0.0561  -0.1416 0.0762  548 ASP A C   
4026 O O   . ASP A 537 ? 1.2451 1.0634 1.0613 0.0524  -0.1508 0.0833  548 ASP A O   
4027 C CB  . ASP A 537 ? 1.3315 1.0885 1.1137 0.0444  -0.1398 0.0883  548 ASP A CB  
4028 C CG  . ASP A 537 ? 1.3364 1.0755 1.1269 0.0605  -0.1479 0.0971  548 ASP A CG  
4029 O OD1 . ASP A 537 ? 1.2974 1.0528 1.1146 0.0747  -0.1515 0.0952  548 ASP A OD1 
4030 O OD2 . ASP A 537 ? 1.3937 1.1018 1.1646 0.0590  -0.1501 0.1061  548 ASP A OD2 
4031 N N   . LEU A 538 ? 1.0815 0.9097 0.9340 0.0665  -0.1385 0.0688  549 LEU A N   
4032 C CA  . LEU A 538 ? 1.0722 0.9269 0.9453 0.0747  -0.1462 0.0689  549 LEU A CA  
4033 C C   . LEU A 538 ? 1.2356 1.0844 1.1136 0.0864  -0.1604 0.0815  549 LEU A C   
4034 O O   . LEU A 538 ? 1.2954 1.1656 1.1849 0.0900  -0.1702 0.0846  549 LEU A O   
4035 C CB  . LEU A 538 ? 0.9985 0.8697 0.8977 0.0822  -0.1381 0.0577  549 LEU A CB  
4036 C CG  . LEU A 538 ? 0.9407 0.8240 0.8390 0.0714  -0.1268 0.0462  549 LEU A CG  
4037 C CD1 . LEU A 538 ? 0.9693 0.8634 0.8895 0.0784  -0.1192 0.0363  549 LEU A CD1 
4038 C CD2 . LEU A 538 ? 0.8678 0.7726 0.7629 0.0627  -0.1299 0.0453  549 LEU A CD2 
4039 N N   . LEU A 539 ? 1.3456 1.1656 1.2157 0.0921  -0.1624 0.0892  550 LEU A N   
4040 C CA  . LEU A 539 ? 1.3565 1.1685 1.2327 0.1044  -0.1769 0.1027  550 LEU A CA  
4041 C C   . LEU A 539 ? 1.6711 1.4596 1.5145 0.0953  -0.1859 0.1160  550 LEU A C   
4042 O O   . LEU A 539 ? 1.8959 1.6568 1.7322 0.1020  -0.1909 0.1262  550 LEU A O   
4043 C CB  . LEU A 539 ? 1.1268 0.9221 1.0221 0.1203  -0.1727 0.1024  550 LEU A CB  
4044 C CG  . LEU A 539 ? 0.9750 0.7929 0.9084 0.1350  -0.1697 0.0948  550 LEU A CG  
4045 C CD1 . LEU A 539 ? 0.9119 0.7550 0.8533 0.1273  -0.1582 0.0795  550 LEU A CD1 
4046 C CD2 . LEU A 539 ? 0.8863 0.6807 0.8327 0.1481  -0.1620 0.0932  550 LEU A CD2 
4047 N N   . GLN A 540 ? 1.7001 1.4976 1.5224 0.0797  -0.1872 0.1157  551 GLN A N   
4048 C CA  . GLN A 540 ? 1.7181 1.4929 1.5055 0.0682  -0.1938 0.1271  551 GLN A CA  
4049 C C   . GLN A 540 ? 1.6794 1.4563 1.4639 0.0733  -0.2140 0.1424  551 GLN A C   
4050 O O   . GLN A 540 ? 1.6730 1.4233 1.4350 0.0716  -0.2232 0.1561  551 GLN A O   
4051 C CB  . GLN A 540 ? 1.6882 1.4700 1.4536 0.0484  -0.1849 0.1196  551 GLN A CB  
4052 C CG  . GLN A 540 ? 1.7076 1.5223 1.4825 0.0444  -0.1877 0.1140  551 GLN A CG  
4053 C CD  . GLN A 540 ? 1.7571 1.5737 1.5066 0.0249  -0.1804 0.1093  551 GLN A CD  
4054 O OE1 . GLN A 540 ? 1.8225 1.6217 1.5542 0.0145  -0.1698 0.1067  551 GLN A OE1 
4055 N NE2 . GLN A 540 ? 1.7303 1.5680 1.4788 0.0192  -0.1855 0.1079  551 GLN A NE2 
4056 N N   . ASP A 541 ? 1.6565 1.4646 1.4630 0.0788  -0.2219 0.1408  552 ASP A N   
4057 C CA  . ASP A 541 ? 1.6739 1.4891 1.4801 0.0826  -0.2426 0.1550  552 ASP A CA  
4058 C C   . ASP A 541 ? 1.5417 1.3637 1.3842 0.1047  -0.2526 0.1614  552 ASP A C   
4059 O O   . ASP A 541 ? 1.5486 1.3860 1.4018 0.1101  -0.2703 0.1714  552 ASP A O   
4060 C CB  . ASP A 541 ? 1.7797 1.6253 1.5845 0.0720  -0.2461 0.1497  552 ASP A CB  
4061 C CG  . ASP A 541 ? 1.8490 1.6840 1.6131 0.0501  -0.2426 0.1495  552 ASP A CG  
4062 O OD1 . ASP A 541 ? 1.8985 1.7055 1.6324 0.0435  -0.2486 0.1612  552 ASP A OD1 
4063 O OD2 . ASP A 541 ? 1.8141 1.6676 1.5765 0.0393  -0.2329 0.1374  552 ASP A OD2 
4064 N N   . GLN A 542 ? 1.4703 1.2813 1.3326 0.1171  -0.2414 0.1554  553 GLN A N   
4065 C CA  . GLN A 542 ? 1.4869 1.2991 1.3837 0.1387  -0.2481 0.1611  553 GLN A CA  
4066 C C   . GLN A 542 ? 1.5248 1.3005 1.4169 0.1458  -0.2390 0.1625  553 GLN A C   
4067 O O   . GLN A 542 ? 1.4953 1.2594 1.3767 0.1383  -0.2214 0.1504  553 GLN A O   
4068 C CB  . GLN A 542 ? 1.4026 1.2483 1.3394 0.1483  -0.2405 0.1475  553 GLN A CB  
4069 C CG  . GLN A 542 ? 1.4262 1.3084 1.3766 0.1462  -0.2529 0.1489  553 GLN A CG  
4070 C CD  . GLN A 542 ? 1.4383 1.3488 1.4356 0.1624  -0.2519 0.1428  553 GLN A CD  
4071 O OE1 . GLN A 542 ? 1.6389 1.5415 1.6585 0.1753  -0.2408 0.1367  553 GLN A OE1 
4072 N NE2 . GLN A 542 ? 1.2098 1.1533 1.2220 0.1609  -0.2629 0.1438  553 GLN A NE2 
4073 N N   . GLU A 543 ? 1.6170 1.3743 1.5173 0.1599  -0.2516 0.1774  554 GLU A N   
4074 C CA  . GLU A 543 ? 1.6821 1.4008 1.5769 0.1673  -0.2443 0.1805  554 GLU A CA  
4075 C C   . GLU A 543 ? 1.7672 1.4867 1.7035 0.1918  -0.2484 0.1848  554 GLU A C   
4076 O O   . GLU A 543 ? 1.7119 1.4564 1.6752 0.2027  -0.2636 0.1925  554 GLU A O   
4077 C CB  . GLU A 543 ? 1.7207 1.4042 1.5751 0.1579  -0.2546 0.1970  554 GLU A CB  
4078 N N   . GLY A 544 ? 1.8346 1.5268 1.7769 0.2001  -0.2342 0.1793  555 GLY A N   
4079 C CA  . GLY A 544 ? 1.8538 1.5424 1.8359 0.2236  -0.2343 0.1815  555 GLY A CA  
4080 C C   . GLY A 544 ? 1.8869 1.5806 1.8920 0.2290  -0.2113 0.1610  555 GLY A C   
4081 O O   . GLY A 544 ? 1.9269 1.6225 1.9692 0.2481  -0.2074 0.1589  555 GLY A O   
4082 N N   . TYR A 545 ? 1.8867 1.5826 1.8701 0.2118  -0.1958 0.1460  556 TYR A N   
4083 C CA  . TYR A 545 ? 1.7988 1.4991 1.7972 0.2128  -0.1744 0.1264  556 TYR A CA  
4084 C C   . TYR A 545 ? 1.6420 1.3079 1.6072 0.1995  -0.1595 0.1193  556 TYR A C   
4085 O O   . TYR A 545 ? 1.6993 1.3483 1.6292 0.1851  -0.1640 0.1263  556 TYR A O   
4086 C CB  . TYR A 545 ? 1.8627 1.6046 1.8712 0.2043  -0.1702 0.1136  556 TYR A CB  
4087 C CG  . TYR A 545 ? 1.9865 1.7630 2.0126 0.2085  -0.1881 0.1224  556 TYR A CG  
4088 C CD1 . TYR A 545 ? 2.0208 1.8089 2.0212 0.1932  -0.1995 0.1286  556 TYR A CD1 
4089 C CD2 . TYR A 545 ? 2.0402 1.8380 2.1091 0.2268  -0.1932 0.1239  556 TYR A CD2 
4090 C CE1 . TYR A 545 ? 2.0509 1.8695 2.0648 0.1952  -0.2159 0.1361  556 TYR A CE1 
4091 C CE2 . TYR A 545 ? 2.0484 1.8792 2.1337 0.2293  -0.2104 0.1320  556 TYR A CE2 
4092 C CZ  . TYR A 545 ? 2.0920 1.9323 2.1483 0.2130  -0.2221 0.1381  556 TYR A CZ  
4093 O OH  . TYR A 545 ? 2.1372 2.0092 2.2073 0.2137  -0.2392 0.1455  556 TYR A OH  
4094 N N   . ARG A 546 ? 1.5251 1.1809 1.5018 0.2034  -0.1411 0.1049  557 ARG A N   
4095 C CA  . ARG A 546 ? 1.5397 1.1646 1.4877 0.1903  -0.1260 0.0964  557 ARG A CA  
4096 C C   . ARG A 546 ? 1.6322 1.2697 1.5913 0.1866  -0.1074 0.0763  557 ARG A C   
4097 O O   . ARG A 546 ? 1.6140 1.2608 1.6047 0.2009  -0.1007 0.0694  557 ARG A O   
4098 C CB  . ARG A 546 ? 1.3733 0.9531 1.3157 0.1997  -0.1237 0.1039  557 ARG A CB  
4099 N N   . TRP A 547 ? 1.6412 1.2792 1.5747 0.1671  -0.0993 0.0673  558 TRP A N   
4100 C CA  . TRP A 547 ? 1.5639 1.2130 1.5026 0.1606  -0.0832 0.0493  558 TRP A CA  
4101 C C   . TRP A 547 ? 1.6250 1.2421 1.5669 0.1669  -0.0677 0.0408  558 TRP A C   
4102 O O   . TRP A 547 ? 1.7673 1.3480 1.6961 0.1694  -0.0671 0.0473  558 TRP A O   
4103 C CB  . TRP A 547 ? 1.5638 1.2177 1.4739 0.1383  -0.0800 0.0438  558 TRP A CB  
4104 C CG  . TRP A 547 ? 1.5218 1.1927 1.4358 0.1299  -0.0675 0.0276  558 TRP A CG  
4105 C CD1 . TRP A 547 ? 1.5535 1.2092 1.4478 0.1154  -0.0557 0.0175  558 TRP A CD1 
4106 C CD2 . TRP A 547 ? 1.4493 1.1550 1.3868 0.1341  -0.0663 0.0203  558 TRP A CD2 
4107 N NE1 . TRP A 547 ? 1.4831 1.1613 1.3862 0.1106  -0.0480 0.0051  558 TRP A NE1 
4108 C CE2 . TRP A 547 ? 1.3559 1.0642 1.2851 0.1219  -0.0537 0.0064  558 TRP A CE2 
4109 C CE3 . TRP A 547 ? 1.4952 1.2300 1.4594 0.1462  -0.0750 0.0245  558 TRP A CE3 
4110 C CZ2 . TRP A 547 ? 1.2442 0.9812 1.1894 0.1215  -0.0492 -0.0031 558 TRP A CZ2 
4111 C CZ3 . TRP A 547 ? 1.4040 1.1681 1.3852 0.1456  -0.0697 0.0142  558 TRP A CZ3 
4112 C CH2 . TRP A 547 ? 1.2756 1.0397 1.2466 0.1334  -0.0567 0.0007  558 TRP A CH2 
4113 N N   . LYS A 548 ? 1.5124 1.1419 1.4708 0.1686  -0.0543 0.0257  559 LYS A N   
4114 C CA  . LYS A 548 ? 1.5027 1.1040 1.4662 0.1744  -0.0372 0.0152  559 LYS A CA  
4115 C C   . LYS A 548 ? 1.4073 1.0152 1.3597 0.1590  -0.0221 -0.0025 559 LYS A C   
4116 O O   . LYS A 548 ? 1.3771 1.0131 1.3485 0.1613  -0.0175 -0.0112 559 LYS A O   
4117 C CB  . LYS A 548 ? 1.3711 0.9789 1.3743 0.1976  -0.0357 0.0158  559 LYS A CB  
4118 N N   . GLY A 549 ? 1.4638 1.0456 1.3848 0.1427  -0.0149 -0.0071 560 GLY A N   
4119 C CA  . GLY A 549 ? 1.4900 1.0741 1.3967 0.1265  -0.0020 -0.0226 560 GLY A CA  
4120 C C   . GLY A 549 ? 1.4763 1.0921 1.3725 0.1110  -0.0100 -0.0224 560 GLY A C   
4121 O O   . GLY A 549 ? 1.4647 1.1078 1.3714 0.1149  -0.0232 -0.0134 560 GLY A O   
4122 N N   . HIS A 550 ? 1.5448 1.1558 1.4199 0.0927  -0.0018 -0.0327 561 HIS A N   
4123 C CA  . HIS A 550 ? 1.5407 1.1794 1.4064 0.0772  -0.0076 -0.0338 561 HIS A CA  
4124 C C   . HIS A 550 ? 1.5423 1.1866 1.3973 0.0718  -0.0213 -0.0209 561 HIS A C   
4125 O O   . HIS A 550 ? 1.6849 1.3588 1.5491 0.0727  -0.0313 -0.0153 561 HIS A O   
4126 C CB  . HIS A 550 ? 1.5570 1.2318 1.4455 0.0833  -0.0088 -0.0377 561 HIS A CB  
4127 C CG  . HIS A 550 ? 1.6085 1.3022 1.4866 0.0667  -0.0072 -0.0451 561 HIS A CG  
4128 N ND1 . HIS A 550 ? 1.6972 1.3843 1.5681 0.0586  0.0054  -0.0582 561 HIS A ND1 
4129 C CD2 . HIS A 550 ? 1.6164 1.3343 1.4899 0.0568  -0.0165 -0.0409 561 HIS A CD2 
4130 C CE1 . HIS A 550 ? 1.6893 1.3960 1.5513 0.0444  0.0021  -0.0606 561 HIS A CE1 
4131 N NE2 . HIS A 550 ? 1.6688 1.3947 1.5339 0.0438  -0.0109 -0.0503 561 HIS A NE2 
4132 N N   . GLU A 551 ? 1.4660 1.0798 1.3004 0.0652  -0.0205 -0.0169 562 GLU A N   
4133 C CA  . GLU A 551 ? 1.4540 1.0687 1.2748 0.0577  -0.0310 -0.0058 562 GLU A CA  
4134 C C   . GLU A 551 ? 1.5054 1.1445 1.3179 0.0403  -0.0334 -0.0089 562 GLU A C   
4135 O O   . GLU A 551 ? 1.5040 1.1510 1.3145 0.0311  -0.0270 -0.0191 562 GLU A O   
4136 C CB  . GLU A 551 ? 1.3289 0.9033 1.1277 0.0525  -0.0276 -0.0021 562 GLU A CB  
4137 N N   . ARG A 552 ? 1.5299 1.1806 1.3375 0.0356  -0.0428 0.0003  563 ARG A N   
4138 C CA  . ARG A 552 ? 1.4872 1.1642 1.2924 0.0218  -0.0458 -0.0015 563 ARG A CA  
4139 C C   . ARG A 552 ? 1.4344 1.0987 1.2215 0.0033  -0.0396 -0.0077 563 ARG A C   
4140 O O   . ARG A 552 ? 1.4242 1.0576 1.1972 -0.0002 -0.0330 -0.0104 563 ARG A O   
4141 C CB  . ARG A 552 ? 1.5198 1.2080 1.3226 0.0203  -0.0551 0.0090  563 ARG A CB  
4142 C CG  . ARG A 552 ? 1.5300 1.1890 1.3123 0.0147  -0.0558 0.0166  563 ARG A CG  
4143 C CD  . ARG A 552 ? 1.6565 1.3275 1.4287 -0.0003 -0.0585 0.0199  563 ARG A CD  
4144 N NE  . ARG A 552 ? 1.7515 1.3962 1.5037 -0.0055 -0.0597 0.0283  563 ARG A NE  
4145 C CZ  . ARG A 552 ? 1.6468 1.2649 1.3811 -0.0168 -0.0536 0.0267  563 ARG A CZ  
4146 N NH1 . ARG A 552 ? 1.6616 1.2762 1.3951 -0.0245 -0.0465 0.0169  563 ARG A NH1 
4147 N NH2 . ARG A 552 ? 1.5067 1.1007 1.2219 -0.0217 -0.0547 0.0351  563 ARG A NH2 
4148 N N   . LEU A 553 ? 1.3081 0.9972 1.0967 -0.0087 -0.0421 -0.0098 564 LEU A N   
4149 C CA  . LEU A 553 ? 1.2291 0.9131 1.0041 -0.0272 -0.0385 -0.0150 564 LEU A CA  
4150 C C   . LEU A 553 ? 1.2712 0.9398 1.0309 -0.0376 -0.0394 -0.0089 564 LEU A C   
4151 O O   . LEU A 553 ? 1.3578 1.0113 1.1128 -0.0302 -0.0415 -0.0013 564 LEU A O   
4152 C CB  . LEU A 553 ? 1.0637 0.7810 0.8492 -0.0351 -0.0421 -0.0180 564 LEU A CB  
4153 C CG  . LEU A 553 ? 1.0974 0.8272 0.8927 -0.0302 -0.0398 -0.0254 564 LEU A CG  
4154 C CD1 . LEU A 553 ? 1.1956 0.9596 1.0041 -0.0341 -0.0455 -0.0250 564 LEU A CD1 
4155 C CD2 . LEU A 553 ? 1.0060 0.7155 0.7863 -0.0405 -0.0324 -0.0342 564 LEU A CD2 
4156 N N   . ALA A 554 ? 1.2494 0.9218 1.0012 -0.0555 -0.0383 -0.0120 565 ALA A N   
4157 C CA  . ALA A 554 ? 1.1603 0.8199 0.8981 -0.0681 -0.0378 -0.0076 565 ALA A CA  
4158 C C   . ALA A 554 ? 1.2186 0.9073 0.9644 -0.0823 -0.0407 -0.0085 565 ALA A C   
4159 O O   . ALA A 554 ? 1.3189 1.0132 1.0637 -0.0944 -0.0398 -0.0144 565 ALA A O   
4160 C CB  . ALA A 554 ? 1.1686 0.7921 0.8858 -0.0770 -0.0308 -0.0115 565 ALA A CB  
4161 N N   . ALA A 555 ? 1.1343 0.8411 0.8883 -0.0811 -0.0443 -0.0025 566 ALA A N   
4162 C CA  . ALA A 555 ? 1.0969 0.8330 0.8633 -0.0922 -0.0464 -0.0031 566 ALA A CA  
4163 C C   . ALA A 555 ? 1.1357 0.8620 0.8911 -0.1103 -0.0429 -0.0029 566 ALA A C   
4164 O O   . ALA A 555 ? 1.2240 0.9235 0.9618 -0.1132 -0.0394 0.0004  566 ALA A O   
4165 C CB  . ALA A 555 ? 0.9715 0.7294 0.7507 -0.0845 -0.0495 0.0019  566 ALA A CB  
4166 N N   . ARG A 556 ? 1.1753 0.9239 0.9420 -0.1229 -0.0444 -0.0061 567 ARG A N   
4167 C CA  . ARG A 556 ? 1.3110 1.0569 1.0723 -0.1412 -0.0415 -0.0062 567 ARG A CA  
4168 C C   . ARG A 556 ? 1.4069 1.1590 1.1709 -0.1427 -0.0388 -0.0010 567 ARG A C   
4169 O O   . ARG A 556 ? 1.4290 1.2060 1.2102 -0.1359 -0.0406 0.0008  567 ARG A O   
4170 C CB  . ARG A 556 ? 1.2699 1.0429 1.0474 -0.1533 -0.0454 -0.0098 567 ARG A CB  
4171 C CG  . ARG A 556 ? 1.3042 1.0682 1.0732 -0.1578 -0.0475 -0.0154 567 ARG A CG  
4172 C CD  . ARG A 556 ? 1.3485 1.1388 1.1317 -0.1724 -0.0532 -0.0171 567 ARG A CD  
4173 N NE  . ARG A 556 ? 1.5258 1.3075 1.2978 -0.1790 -0.0560 -0.0223 567 ARG A NE  
4174 C CZ  . ARG A 556 ? 1.7387 1.5396 1.5186 -0.1926 -0.0628 -0.0235 567 ARG A CZ  
4175 N NH1 . ARG A 556 ? 1.8002 1.6313 1.6033 -0.1994 -0.0674 -0.0197 567 ARG A NH1 
4176 N NH2 . ARG A 556 ? 1.7932 1.5831 1.5582 -0.1997 -0.0649 -0.0285 567 ARG A NH2 
4177 N N   . SER A 557 ? 1.5603 1.2878 1.3055 -0.1525 -0.0336 0.0010  568 SER A N   
4178 C CA  . SER A 557 ? 1.5295 1.2588 1.2724 -0.1560 -0.0297 0.0057  568 SER A CA  
4179 C C   . SER A 557 ? 1.4441 1.2021 1.2056 -0.1706 -0.0270 0.0034  568 SER A C   
4180 O O   . SER A 557 ? 1.3269 1.1032 1.0998 -0.1695 -0.0246 0.0052  568 SER A O   
4181 C CB  . SER A 557 ? 1.4756 1.1657 1.1896 -0.1616 -0.0250 0.0095  568 SER A CB  
4182 O OG  . SER A 557 ? 1.3540 1.0183 1.0545 -0.1462 -0.0277 0.0126  568 SER A OG  
4183 N N   . GLY A 558 ? 1.4277 1.1906 1.1935 -0.1847 -0.0272 -0.0007 569 GLY A N   
4184 C CA  . GLY A 558 ? 1.4709 1.2625 1.2579 -0.1987 -0.0254 -0.0026 569 GLY A CA  
4185 C C   . GLY A 558 ? 1.3885 1.2185 1.2072 -0.1911 -0.0308 -0.0035 569 GLY A C   
4186 O O   . GLY A 558 ? 1.3262 1.1603 1.1486 -0.1775 -0.0368 -0.0036 569 GLY A O   
4187 N N   . PRO A 559 ? 1.4777 1.3362 1.3208 -0.1998 -0.0282 -0.0042 570 PRO A N   
4188 C CA  . PRO A 559 ? 1.4016 1.2965 1.2774 -0.1929 -0.0332 -0.0045 570 PRO A CA  
4189 C C   . PRO A 559 ? 1.3530 1.2581 1.2370 -0.1957 -0.0433 -0.0058 570 PRO A C   
4190 O O   . PRO A 559 ? 1.3977 1.3050 1.2828 -0.2112 -0.0453 -0.0072 570 PRO A O   
4191 C CB  . PRO A 559 ? 1.4274 1.3462 1.3267 -0.2040 -0.0263 -0.0053 570 PRO A CB  
4192 C CG  . PRO A 559 ? 1.5367 1.4297 1.4115 -0.2130 -0.0161 -0.0050 570 PRO A CG  
4193 C CD  . PRO A 559 ? 1.5883 1.4464 1.4310 -0.2155 -0.0192 -0.0045 570 PRO A CD  
4194 N N   . VAL A 560 ? 1.3007 1.2121 1.1894 -0.1818 -0.0499 -0.0053 571 VAL A N   
4195 C CA  . VAL A 560 ? 1.2057 1.1243 1.0979 -0.1838 -0.0596 -0.0062 571 VAL A CA  
4196 C C   . VAL A 560 ? 1.1272 1.0838 1.0546 -0.1844 -0.0659 -0.0042 571 VAL A C   
4197 O O   . VAL A 560 ? 1.0374 1.0116 0.9845 -0.1742 -0.0635 -0.0027 571 VAL A O   
4198 C CB  . VAL A 560 ? 0.9716 0.8739 0.8477 -0.1693 -0.0624 -0.0070 571 VAL A CB  
4199 C CG1 . VAL A 560 ? 0.7575 0.6620 0.6306 -0.1743 -0.0708 -0.0088 571 VAL A CG1 
4200 C CG2 . VAL A 560 ? 0.9432 0.8094 0.7897 -0.1657 -0.0558 -0.0079 571 VAL A CG2 
4201 N N   . ARG A 561 ? 1.1634 1.1317 1.0985 -0.1966 -0.0742 -0.0040 572 ARG A N   
4202 C CA  . ARG A 561 ? 1.1515 1.1549 1.1202 -0.1969 -0.0828 -0.0006 572 ARG A CA  
4203 C C   . ARG A 561 ? 1.0724 1.0778 1.0390 -0.1858 -0.0913 0.0008  572 ARG A C   
4204 O O   . ARG A 561 ? 1.0640 1.0464 1.0031 -0.1854 -0.0930 -0.0016 572 ARG A O   
4205 C CB  . ARG A 561 ? 1.2672 1.2840 1.2458 -0.2161 -0.0899 0.0002  572 ARG A CB  
4206 C CG  . ARG A 561 ? 1.3803 1.3782 1.3314 -0.2267 -0.0976 -0.0017 572 ARG A CG  
4207 C CD  . ARG A 561 ? 1.5247 1.4863 1.4408 -0.2342 -0.0886 -0.0066 572 ARG A CD  
4208 N NE  . ARG A 561 ? 1.6140 1.5519 1.5003 -0.2401 -0.0929 -0.0099 572 ARG A NE  
4209 C CZ  . ARG A 561 ? 1.6123 1.5136 1.4656 -0.2426 -0.0852 -0.0146 572 ARG A CZ  
4210 N NH1 . ARG A 561 ? 1.5993 1.4833 1.4442 -0.2396 -0.0744 -0.0153 572 ARG A NH1 
4211 N NH2 . ARG A 561 ? 1.5976 1.4781 1.4256 -0.2483 -0.0880 -0.0186 572 ARG A NH2 
4212 N N   . PHE A 562 ? 1.0245 1.0565 1.0202 -0.1771 -0.0956 0.0045  573 PHE A N   
4213 C CA  . PHE A 562 ? 0.9725 1.0076 0.9678 -0.1665 -0.1030 0.0063  573 PHE A CA  
4214 C C   . PHE A 562 ? 1.0222 1.0873 1.0474 -0.1699 -0.1149 0.0121  573 PHE A C   
4215 O O   . PHE A 562 ? 1.2025 1.2914 1.2588 -0.1728 -0.1147 0.0147  573 PHE A O   
4216 C CB  . PHE A 562 ? 1.0270 1.0598 1.0247 -0.1488 -0.0957 0.0056  573 PHE A CB  
4217 C CG  . PHE A 562 ? 1.0499 1.0541 1.0192 -0.1437 -0.0864 0.0016  573 PHE A CG  
4218 C CD1 . PHE A 562 ? 1.1119 1.0937 1.0550 -0.1397 -0.0877 -0.0009 573 PHE A CD1 
4219 C CD2 . PHE A 562 ? 1.0406 1.0399 1.0098 -0.1431 -0.0764 0.0005  573 PHE A CD2 
4220 C CE1 . PHE A 562 ? 1.1511 1.1073 1.0716 -0.1339 -0.0800 -0.0036 573 PHE A CE1 
4221 C CE2 . PHE A 562 ? 1.1004 1.0729 1.0434 -0.1384 -0.0696 -0.0016 573 PHE A CE2 
4222 C CZ  . PHE A 562 ? 1.1366 1.0881 1.0569 -0.1330 -0.0720 -0.0032 573 PHE A CZ  
4223 N N   . GLU A 563 ? 0.9095 0.9728 0.9252 -0.1697 -0.1251 0.0142  574 GLU A N   
4224 C CA  . GLU A 563 ? 0.7773 0.8660 0.8177 -0.1720 -0.1387 0.0212  574 GLU A CA  
4225 C C   . GLU A 563 ? 0.7416 0.8457 0.8069 -0.1554 -0.1371 0.0244  574 GLU A C   
4226 O O   . GLU A 563 ? 0.8559 0.9489 0.9137 -0.1431 -0.1266 0.0205  574 GLU A O   
4227 C CB  . GLU A 563 ? 0.9565 1.0338 0.9718 -0.1798 -0.1496 0.0221  574 GLU A CB  
4228 C CG  . GLU A 563 ? 1.1165 1.1747 1.1088 -0.1681 -0.1457 0.0190  574 GLU A CG  
4229 C CD  . GLU A 563 ? 1.1963 1.2440 1.1641 -0.1772 -0.1554 0.0195  574 GLU A CD  
4230 O OE1 . GLU A 563 ? 1.1858 1.2315 1.1431 -0.1943 -0.1626 0.0199  574 GLU A OE1 
4231 O OE2 . GLU A 563 ? 1.1984 1.2394 1.1564 -0.1685 -0.1554 0.0191  574 GLU A OE2 
4232 N N   . PRO A 564 ? 0.7785 0.9081 0.8745 -0.1548 -0.1477 0.0317  575 PRO A N   
4233 C CA  . PRO A 564 ? 0.7757 0.9172 0.8939 -0.1392 -0.1462 0.0347  575 PRO A CA  
4234 C C   . PRO A 564 ? 0.6539 0.7767 0.7458 -0.1303 -0.1458 0.0329  575 PRO A C   
4235 O O   . PRO A 564 ? 0.7319 0.8422 0.7987 -0.1370 -0.1535 0.0333  575 PRO A O   
4236 C CB  . PRO A 564 ? 0.7399 0.9082 0.8908 -0.1427 -0.1611 0.0443  575 PRO A CB  
4237 C CG  . PRO A 564 ? 0.6011 0.7796 0.7602 -0.1584 -0.1653 0.0451  575 PRO A CG  
4238 C CD  . PRO A 564 ? 0.7799 0.9306 0.8962 -0.1684 -0.1607 0.0379  575 PRO A CD  
4239 N N   . GLY A 565 ? 0.5769 0.6980 0.6747 -0.1162 -0.1360 0.0303  576 GLY A N   
4240 C CA  . GLY A 565 ? 0.8488 0.9543 0.9250 -0.1072 -0.1340 0.0279  576 GLY A CA  
4241 C C   . GLY A 565 ? 0.9641 1.0581 1.0320 -0.0971 -0.1199 0.0214  576 GLY A C   
4242 O O   . GLY A 565 ? 1.0924 1.1964 1.1805 -0.0921 -0.1122 0.0206  576 GLY A O   
4243 N N   . PHE A 566 ? 0.8462 0.9193 0.8847 -0.0943 -0.1163 0.0167  577 PHE A N   
4244 C CA  . PHE A 566 ? 0.7481 0.8098 0.7767 -0.0850 -0.1051 0.0116  577 PHE A CA  
4245 C C   . PHE A 566 ? 0.7173 0.7647 0.7303 -0.0913 -0.0991 0.0081  577 PHE A C   
4246 O O   . PHE A 566 ? 0.6079 0.6378 0.5974 -0.0965 -0.1002 0.0057  577 PHE A O   
4247 C CB  . PHE A 566 ? 0.6620 0.7108 0.6714 -0.0776 -0.1048 0.0090  577 PHE A CB  
4248 C CG  . PHE A 566 ? 0.5792 0.6396 0.6027 -0.0699 -0.1076 0.0116  577 PHE A CG  
4249 C CD1 . PHE A 566 ? 0.5544 0.6192 0.5879 -0.0599 -0.1006 0.0100  577 PHE A CD1 
4250 C CD2 . PHE A 566 ? 0.6610 0.7264 0.6858 -0.0737 -0.1173 0.0159  577 PHE A CD2 
4251 C CE1 . PHE A 566 ? 0.5583 0.6318 0.6039 -0.0534 -0.1024 0.0120  577 PHE A CE1 
4252 C CE2 . PHE A 566 ? 0.5479 0.6218 0.5845 -0.0670 -0.1198 0.0189  577 PHE A CE2 
4253 C CZ  . PHE A 566 ? 0.5344 0.6122 0.5820 -0.0566 -0.1119 0.0167  577 PHE A CZ  
4254 N N   . GLN A 567 ? 0.5803 0.6337 0.6058 -0.0914 -0.0918 0.0075  578 GLN A N   
4255 C CA  . GLN A 567 ? 0.5951 0.6348 0.6064 -0.0981 -0.0854 0.0049  578 GLN A CA  
4256 C C   . GLN A 567 ? 0.9123 0.9368 0.9079 -0.0896 -0.0770 0.0020  578 GLN A C   
4257 O O   . GLN A 567 ? 0.9003 0.9335 0.9075 -0.0820 -0.0724 0.0016  578 GLN A O   
4258 C CB  . GLN A 567 ? 0.7372 0.7931 0.7712 -0.1061 -0.0823 0.0061  578 GLN A CB  
4259 C CG  . GLN A 567 ? 0.5929 0.6670 0.6464 -0.1151 -0.0921 0.0101  578 GLN A CG  
4260 C CD  . GLN A 567 ? 0.9738 1.0682 1.0567 -0.1212 -0.0882 0.0111  578 GLN A CD  
4261 O OE1 . GLN A 567 ? 1.3103 1.4076 1.4021 -0.1171 -0.0772 0.0086  578 GLN A OE1 
4262 N NE2 . GLN A 567 ? 1.0083 1.1176 1.1068 -0.1317 -0.0969 0.0147  578 GLN A NE2 
4263 N N   . PRO A 568 ? 0.8780 0.8794 0.8476 -0.0907 -0.0750 0.0000  579 PRO A N   
4264 C CA  . PRO A 568 ? 0.9402 0.9273 0.8954 -0.0828 -0.0688 -0.0012 579 PRO A CA  
4265 C C   . PRO A 568 ? 0.7986 0.7837 0.7538 -0.0882 -0.0612 -0.0011 579 PRO A C   
4266 O O   . PRO A 568 ? 0.8295 0.8152 0.7871 -0.0995 -0.0596 -0.0009 579 PRO A O   
4267 C CB  . PRO A 568 ? 0.8775 0.8402 0.8076 -0.0823 -0.0702 -0.0026 579 PRO A CB  
4268 C CG  . PRO A 568 ? 0.6478 0.6079 0.5751 -0.0953 -0.0732 -0.0029 579 PRO A CG  
4269 C CD  . PRO A 568 ? 0.6315 0.6176 0.5833 -0.0991 -0.0787 -0.0009 579 PRO A CD  
4270 N N   . PHE A 569 ? 0.7705 0.7530 0.7218 -0.0813 -0.0563 -0.0013 580 PHE A N   
4271 C CA  . PHE A 569 ? 0.6336 0.6113 0.5799 -0.0869 -0.0481 -0.0014 580 PHE A CA  
4272 C C   . PHE A 569 ? 0.6494 0.6051 0.5702 -0.0825 -0.0462 -0.0001 580 PHE A C   
4273 O O   . PHE A 569 ? 0.7059 0.6511 0.6150 -0.0895 -0.0402 0.0007  580 PHE A O   
4274 C CB  . PHE A 569 ? 0.7501 0.7486 0.7189 -0.0862 -0.0422 -0.0029 580 PHE A CB  
4275 C CG  . PHE A 569 ? 0.6033 0.6093 0.5778 -0.0748 -0.0439 -0.0036 580 PHE A CG  
4276 C CD1 . PHE A 569 ? 0.6087 0.6054 0.5682 -0.0701 -0.0406 -0.0041 580 PHE A CD1 
4277 C CD2 . PHE A 569 ? 0.6304 0.6525 0.6244 -0.0698 -0.0493 -0.0034 580 PHE A CD2 
4278 C CE1 . PHE A 569 ? 0.5955 0.5997 0.5602 -0.0610 -0.0421 -0.0051 580 PHE A CE1 
4279 C CE2 . PHE A 569 ? 0.5727 0.6007 0.5713 -0.0604 -0.0502 -0.0043 580 PHE A CE2 
4280 C CZ  . PHE A 569 ? 0.5773 0.5968 0.5617 -0.0561 -0.0463 -0.0056 580 PHE A CZ  
4281 N N   . VAL A 570 ? 0.6492 0.5979 0.5614 -0.0718 -0.0513 0.0006  581 VAL A N   
4282 C CA  . VAL A 570 ? 0.7132 0.6421 0.6037 -0.0666 -0.0517 0.0031  581 VAL A CA  
4283 C C   . VAL A 570 ? 0.8385 0.7557 0.7211 -0.0581 -0.0577 0.0034  581 VAL A C   
4284 O O   . VAL A 570 ? 0.8532 0.7815 0.7473 -0.0533 -0.0612 0.0012  581 VAL A O   
4285 C CB  . VAL A 570 ? 0.6554 0.5923 0.5473 -0.0612 -0.0500 0.0033  581 VAL A CB  
4286 C CG1 . VAL A 570 ? 0.6359 0.5885 0.5424 -0.0513 -0.0542 0.0013  581 VAL A CG1 
4287 C CG2 . VAL A 570 ? 0.6765 0.5931 0.5448 -0.0585 -0.0514 0.0074  581 VAL A CG2 
4288 N N   . LEU A 571 ? 0.8494 0.7428 0.7122 -0.0565 -0.0583 0.0063  582 LEU A N   
4289 C CA  . LEU A 571 ? 0.8268 0.7062 0.6825 -0.0477 -0.0623 0.0063  582 LEU A CA  
4290 C C   . LEU A 571 ? 0.9701 0.8370 0.8144 -0.0386 -0.0649 0.0110  582 LEU A C   
4291 O O   . LEU A 571 ? 1.1045 0.9570 0.9338 -0.0430 -0.0637 0.0153  582 LEU A O   
4292 C CB  . LEU A 571 ? 0.7933 0.6526 0.6372 -0.0547 -0.0606 0.0054  582 LEU A CB  
4293 C CG  . LEU A 571 ? 0.7969 0.6362 0.6314 -0.0459 -0.0622 0.0049  582 LEU A CG  
4294 C CD1 . LEU A 571 ? 0.7135 0.5664 0.5607 -0.0393 -0.0641 0.0003  582 LEU A CD1 
4295 C CD2 . LEU A 571 ? 0.8848 0.6997 0.7039 -0.0547 -0.0590 0.0041  582 LEU A CD2 
4296 N N   . VAL A 572 ? 0.9639 0.8366 0.8152 -0.0266 -0.0690 0.0104  583 VAL A N   
4297 C CA  . VAL A 572 ? 0.9758 0.8410 0.8207 -0.0170 -0.0736 0.0153  583 VAL A CA  
4298 C C   . VAL A 572 ? 0.9992 0.8500 0.8435 -0.0070 -0.0756 0.0152  583 VAL A C   
4299 O O   . VAL A 572 ? 0.9144 0.7763 0.7717 -0.0007 -0.0758 0.0106  583 VAL A O   
4300 C CB  . VAL A 572 ? 0.8455 0.7329 0.7021 -0.0118 -0.0764 0.0147  583 VAL A CB  
4301 C CG1 . VAL A 572 ? 0.9429 0.8233 0.7915 -0.0040 -0.0826 0.0208  583 VAL A CG1 
4302 C CG2 . VAL A 572 ? 0.6835 0.5851 0.5435 -0.0217 -0.0720 0.0130  583 VAL A CG2 
4303 N N   . GLN A 573 ? 0.9415 0.7668 0.7709 -0.0058 -0.0763 0.0200  584 GLN A N   
4304 C CA  . GLN A 573 ? 0.8253 0.6332 0.6546 0.0041  -0.0767 0.0198  584 GLN A CA  
4305 C C   . GLN A 573 ? 0.9457 0.7532 0.7790 0.0175  -0.0838 0.0261  584 GLN A C   
4306 O O   . GLN A 573 ? 1.1477 0.9449 0.9688 0.0170  -0.0885 0.0342  584 GLN A O   
4307 C CB  . GLN A 573 ? 0.7922 0.5699 0.6037 -0.0021 -0.0730 0.0216  584 GLN A CB  
4308 C CG  . GLN A 573 ? 0.8865 0.6427 0.6977 0.0080  -0.0716 0.0208  584 GLN A CG  
4309 C CD  . GLN A 573 ? 1.1061 0.8720 0.9299 0.0103  -0.0670 0.0112  584 GLN A CD  
4310 O OE1 . GLN A 573 ? 1.2861 1.0499 1.1050 -0.0006 -0.0619 0.0053  584 GLN A OE1 
4311 N NE2 . GLN A 573 ? 1.0521 0.8291 0.8917 0.0236  -0.0689 0.0099  584 GLN A NE2 
4312 N N   . CYS A 574 ? 0.9065 0.7256 0.7568 0.0287  -0.0849 0.0225  585 CYS A N   
4313 C CA  . CYS A 574 ? 0.9923 0.8146 0.8512 0.0420  -0.0923 0.0282  585 CYS A CA  
4314 C C   . CYS A 574 ? 0.9582 0.7527 0.8123 0.0509  -0.0934 0.0332  585 CYS A C   
4315 O O   . CYS A 574 ? 1.0072 0.7854 0.8601 0.0512  -0.0862 0.0280  585 CYS A O   
4316 C CB  . CYS A 574 ? 0.9867 0.8327 0.8678 0.0502  -0.0920 0.0219  585 CYS A CB  
4317 S SG  . CYS A 574 ? 1.0990 0.9760 0.9875 0.0414  -0.0909 0.0165  585 CYS A SG  
4318 N N   . GLN A 575 ? 0.8809 0.6689 0.7316 0.0576  -0.1026 0.0434  586 GLN A N   
4319 C CA  . GLN A 575 ? 1.0280 0.7901 0.8771 0.0684  -0.1055 0.0502  586 GLN A CA  
4320 C C   . GLN A 575 ? 1.0939 0.8698 0.9634 0.0840  -0.1150 0.0556  586 GLN A C   
4321 O O   . GLN A 575 ? 1.2547 1.0437 1.1218 0.0832  -0.1251 0.0629  586 GLN A O   
4322 C CB  . GLN A 575 ? 1.1175 0.8533 0.9406 0.0610  -0.1091 0.0602  586 GLN A CB  
4323 C CG  . GLN A 575 ? 1.3030 1.0185 1.1081 0.0477  -0.0991 0.0554  586 GLN A CG  
4324 C CD  . GLN A 575 ? 1.4247 1.1200 1.2347 0.0536  -0.0910 0.0495  586 GLN A CD  
4325 O OE1 . GLN A 575 ? 1.4481 1.1327 1.2694 0.0685  -0.0934 0.0526  586 GLN A OE1 
4326 N NE2 . GLN A 575 ? 1.4673 1.1572 1.2692 0.0414  -0.0813 0.0408  586 GLN A NE2 
4327 N N   . PRO A 576 ? 1.0614 0.8357 0.9516 0.0977  -0.1119 0.0519  587 PRO A N   
4328 C CA  . PRO A 576 ? 0.9804 0.7374 0.8730 0.0992  -0.0993 0.0427  587 PRO A CA  
4329 C C   . PRO A 576 ? 1.1012 0.8733 0.9942 0.0884  -0.0891 0.0296  587 PRO A C   
4330 O O   . PRO A 576 ? 1.1723 0.9730 1.0740 0.0854  -0.0914 0.0267  587 PRO A O   
4331 C CB  . PRO A 576 ? 0.9992 0.7591 0.9191 0.1179  -0.0999 0.0426  587 PRO A CB  
4332 C CG  . PRO A 576 ? 0.9511 0.7434 0.8879 0.1229  -0.1105 0.0465  587 PRO A CG  
4333 C CD  . PRO A 576 ? 0.9905 0.7830 0.9055 0.1126  -0.1207 0.0562  587 PRO A CD  
4334 N N   . PRO A 577 ? 1.0188 0.7707 0.9010 0.0818  -0.0785 0.0224  588 PRO A N   
4335 C CA  . PRO A 577 ? 0.9807 0.7440 0.8600 0.0698  -0.0702 0.0113  588 PRO A CA  
4336 C C   . PRO A 577 ? 0.9447 0.7253 0.8443 0.0767  -0.0646 0.0020  588 PRO A C   
4337 O O   . PRO A 577 ? 0.8043 0.5753 0.7016 0.0732  -0.0544 -0.0075 588 PRO A O   
4338 C CB  . PRO A 577 ? 1.0081 0.7400 0.8681 0.0611  -0.0620 0.0079  588 PRO A CB  
4339 C CG  . PRO A 577 ? 1.0775 0.7826 0.9265 0.0660  -0.0670 0.0189  588 PRO A CG  
4340 C CD  . PRO A 577 ? 1.0405 0.7558 0.9097 0.0835  -0.0747 0.0252  588 PRO A CD  
4341 N N   . ALA A 578 ? 1.1270 0.9328 1.0455 0.0855  -0.0709 0.0044  589 ALA A N   
4342 C CA  . ALA A 578 ? 0.9638 0.7878 0.9028 0.0918  -0.0655 -0.0040 589 ALA A CA  
4343 C C   . ALA A 578 ? 0.7817 0.6245 0.7166 0.0792  -0.0620 -0.0114 589 ALA A C   
4344 O O   . ALA A 578 ? 0.7834 0.6297 0.7045 0.0675  -0.0652 -0.0091 589 ALA A O   
4345 C CB  . ALA A 578 ? 0.9849 0.8295 0.9464 0.1050  -0.0742 0.0016  589 ALA A CB  
4346 N N   . VAL A 579 ? 0.7620 0.6165 0.7098 0.0817  -0.0550 -0.0203 590 VAL A N   
4347 C CA  . VAL A 579 ? 0.7101 0.5813 0.6546 0.0705  -0.0520 -0.0267 590 VAL A CA  
4348 C C   . VAL A 579 ? 0.8053 0.7024 0.7565 0.0692  -0.0611 -0.0216 590 VAL A C   
4349 O O   . VAL A 579 ? 0.9809 0.8920 0.9478 0.0790  -0.0666 -0.0179 590 VAL A O   
4350 C CB  . VAL A 579 ? 0.7097 0.5860 0.6653 0.0733  -0.0419 -0.0372 590 VAL A CB  
4351 C CG1 . VAL A 579 ? 0.6911 0.5827 0.6409 0.0611  -0.0400 -0.0424 590 VAL A CG1 
4352 C CG2 . VAL A 579 ? 0.7380 0.5861 0.6856 0.0740  -0.0311 -0.0434 590 VAL A CG2 
4353 N N   . VAL A 580 ? 0.7449 0.6486 0.6850 0.0569  -0.0627 -0.0214 591 VAL A N   
4354 C CA  . VAL A 580 ? 0.7613 0.6882 0.7074 0.0546  -0.0691 -0.0183 591 VAL A CA  
4355 C C   . VAL A 580 ? 0.9157 0.8622 0.8760 0.0565  -0.0660 -0.0245 591 VAL A C   
4356 O O   . VAL A 580 ? 0.6338 0.5781 0.5912 0.0514  -0.0590 -0.0314 591 VAL A O   
4357 C CB  . VAL A 580 ? 0.6419 0.5695 0.5752 0.0417  -0.0705 -0.0166 591 VAL A CB  
4358 C CG1 . VAL A 580 ? 0.6219 0.5707 0.5616 0.0400  -0.0756 -0.0138 591 VAL A CG1 
4359 C CG2 . VAL A 580 ? 0.6602 0.5672 0.5787 0.0383  -0.0719 -0.0115 591 VAL A CG2 
4360 N N   . THR A 581 ? 0.9640 0.9291 0.9380 0.0627  -0.0711 -0.0220 592 THR A N   
4361 C CA  . THR A 581 ? 0.7554 0.7391 0.7446 0.0653  -0.0681 -0.0276 592 THR A CA  
4362 C C   . THR A 581 ? 0.5884 0.5922 0.5801 0.0594  -0.0718 -0.0270 592 THR A C   
4363 O O   . THR A 581 ? 0.7951 0.8136 0.7970 0.0593  -0.0687 -0.0319 592 THR A O   
4364 C CB  . THR A 581 ? 0.7119 0.7018 0.7201 0.0785  -0.0698 -0.0267 592 THR A CB  
4365 O OG1 . THR A 581 ? 0.7588 0.7586 0.7704 0.0817  -0.0805 -0.0186 592 THR A OG1 
4366 C CG2 . THR A 581 ? 0.6386 0.6061 0.6456 0.0858  -0.0660 -0.0265 592 THR A CG2 
4367 N N   . SER A 582 ? 0.5840 0.5880 0.5667 0.0542  -0.0773 -0.0215 593 SER A N   
4368 C CA  . SER A 582 ? 0.6599 0.6805 0.6446 0.0485  -0.0796 -0.0214 593 SER A CA  
4369 C C   . SER A 582 ? 0.6547 0.6685 0.6266 0.0406  -0.0814 -0.0174 593 SER A C   
4370 O O   . SER A 582 ? 0.5795 0.5797 0.5422 0.0410  -0.0836 -0.0130 593 SER A O   
4371 C CB  . SER A 582 ? 0.7465 0.7826 0.7421 0.0539  -0.0853 -0.0192 593 SER A CB  
4372 O OG  . SER A 582 ? 0.9282 0.9566 0.9198 0.0587  -0.0919 -0.0124 593 SER A OG  
4373 N N   . LEU A 583 ? 0.7658 0.7890 0.7383 0.0336  -0.0800 -0.0190 594 LEU A N   
4374 C CA  . LEU A 583 ? 0.5520 0.5710 0.5166 0.0260  -0.0801 -0.0163 594 LEU A CA  
4375 C C   . LEU A 583 ? 0.6044 0.6376 0.5749 0.0218  -0.0796 -0.0173 594 LEU A C   
4376 O O   . LEU A 583 ? 0.7653 0.8080 0.7432 0.0217  -0.0779 -0.0207 594 LEU A O   
4377 C CB  . LEU A 583 ? 0.5562 0.5648 0.5149 0.0205  -0.0771 -0.0174 594 LEU A CB  
4378 C CG  . LEU A 583 ? 0.5571 0.5616 0.5104 0.0127  -0.0770 -0.0145 594 LEU A CG  
4379 C CD1 . LEU A 583 ? 0.7326 0.7266 0.6769 0.0135  -0.0786 -0.0104 594 LEU A CD1 
4380 C CD2 . LEU A 583 ? 0.5620 0.5586 0.5108 0.0065  -0.0755 -0.0156 594 LEU A CD2 
4381 N N   . ALA A 584 ? 0.5992 0.6321 0.5653 0.0178  -0.0800 -0.0147 595 ALA A N   
4382 C CA  . ALA A 584 ? 0.6889 0.7322 0.6602 0.0134  -0.0779 -0.0161 595 ALA A CA  
4383 C C   . ALA A 584 ? 0.6603 0.6985 0.6272 0.0072  -0.0753 -0.0142 595 ALA A C   
4384 O O   . ALA A 584 ? 0.6403 0.6689 0.5970 0.0062  -0.0762 -0.0113 595 ALA A O   
4385 C CB  . ALA A 584 ? 0.5271 0.5793 0.4994 0.0153  -0.0800 -0.0168 595 ALA A CB  
4386 N N   . LEU A 585 ? 0.6870 0.7312 0.6625 0.0030  -0.0718 -0.0155 596 LEU A N   
4387 C CA  . LEU A 585 ? 0.6014 0.6434 0.5779 -0.0029 -0.0680 -0.0144 596 LEU A CA  
4388 C C   . LEU A 585 ? 0.6172 0.6681 0.6031 -0.0053 -0.0632 -0.0168 596 LEU A C   
4389 O O   . LEU A 585 ? 0.6708 0.7288 0.6683 -0.0046 -0.0627 -0.0178 596 LEU A O   
4390 C CB  . LEU A 585 ? 0.5294 0.5692 0.5107 -0.0056 -0.0687 -0.0129 596 LEU A CB  
4391 C CG  . LEU A 585 ? 0.5477 0.5898 0.5366 -0.0117 -0.0648 -0.0119 596 LEU A CG  
4392 C CD1 . LEU A 585 ? 0.7618 0.7945 0.7392 -0.0153 -0.0622 -0.0108 596 LEU A CD1 
4393 C CD2 . LEU A 585 ? 0.5544 0.5981 0.5508 -0.0148 -0.0677 -0.0100 596 LEU A CD2 
4394 N N   . HIS A 586 ? 0.5575 0.6065 0.5371 -0.0086 -0.0594 -0.0177 597 HIS A N   
4395 C CA  . HIS A 586 ? 0.6478 0.7025 0.6350 -0.0119 -0.0524 -0.0211 597 HIS A CA  
4396 C C   . HIS A 586 ? 0.7131 0.7672 0.7084 -0.0167 -0.0462 -0.0209 597 HIS A C   
4397 O O   . HIS A 586 ? 0.7609 0.8079 0.7461 -0.0210 -0.0439 -0.0200 597 HIS A O   
4398 C CB  . HIS A 586 ? 0.6120 0.6645 0.5858 -0.0145 -0.0509 -0.0233 597 HIS A CB  
4399 C CG  . HIS A 586 ? 0.5287 0.5867 0.5090 -0.0170 -0.0444 -0.0282 597 HIS A CG  
4400 N ND1 . HIS A 586 ? 0.5302 0.5884 0.5192 -0.0213 -0.0346 -0.0313 597 HIS A ND1 
4401 C CD2 . HIS A 586 ? 0.5821 0.6450 0.5621 -0.0161 -0.0455 -0.0311 597 HIS A CD2 
4402 C CE1 . HIS A 586 ? 0.5896 0.6507 0.5824 -0.0225 -0.0296 -0.0360 597 HIS A CE1 
4403 N NE2 . HIS A 586 ? 0.6085 0.6724 0.5950 -0.0200 -0.0364 -0.0359 597 HIS A NE2 
4404 N N   . SER A 587 ? 0.7197 0.7813 0.7341 -0.0161 -0.0436 -0.0214 598 SER A N   
4405 C CA  . SER A 587 ? 0.5809 0.6452 0.6088 -0.0197 -0.0389 -0.0205 598 SER A CA  
4406 C C   . SER A 587 ? 0.6385 0.7027 0.6690 -0.0243 -0.0275 -0.0250 598 SER A C   
4407 O O   . SER A 587 ? 0.8992 0.9623 0.9323 -0.0293 -0.0222 -0.0251 598 SER A O   
4408 C CB  . SER A 587 ? 0.7165 0.7895 0.7657 -0.0169 -0.0417 -0.0182 598 SER A CB  
4409 O OG  . SER A 587 ? 1.0408 1.1129 1.0842 -0.0134 -0.0506 -0.0157 598 SER A OG  
4410 N N   . GLU A 588 ? 0.5220 0.5867 0.5515 -0.0238 -0.0228 -0.0292 599 GLU A N   
4411 C CA  . GLU A 588 ? 0.5315 0.5947 0.5628 -0.0291 -0.0101 -0.0348 599 GLU A CA  
4412 C C   . GLU A 588 ? 0.5485 0.6018 0.5543 -0.0360 -0.0076 -0.0362 599 GLU A C   
4413 O O   . GLU A 588 ? 0.7957 0.8460 0.8005 -0.0424 0.0015  -0.0384 599 GLU A O   
4414 C CB  . GLU A 588 ? 0.5296 0.5943 0.5662 -0.0275 -0.0054 -0.0395 599 GLU A CB  
4415 C CG  . GLU A 588 ? 0.5391 0.6024 0.5837 -0.0323 0.0099  -0.0463 599 GLU A CG  
4416 C CD  . GLU A 588 ? 0.8915 0.9551 0.9449 -0.0301 0.0151  -0.0508 599 GLU A CD  
4417 O OE1 . GLU A 588 ? 0.8044 0.8657 0.8668 -0.0332 0.0289  -0.0571 599 GLU A OE1 
4418 O OE2 . GLU A 588 ? 0.8920 0.9573 0.9433 -0.0257 0.0063  -0.0484 599 GLU A OE2 
4419 N N   . TRP A 589 ? 0.6577 0.7061 0.6430 -0.0350 -0.0156 -0.0346 600 TRP A N   
4420 C CA  . TRP A 589 ? 0.7108 0.7488 0.6703 -0.0411 -0.0163 -0.0337 600 TRP A CA  
4421 C C   . TRP A 589 ? 0.6465 0.6784 0.6002 -0.0421 -0.0201 -0.0285 600 TRP A C   
4422 O O   . TRP A 589 ? 0.7808 0.8021 0.7138 -0.0484 -0.0189 -0.0272 600 TRP A O   
4423 C CB  . TRP A 589 ? 0.6988 0.7351 0.6419 -0.0388 -0.0260 -0.0320 600 TRP A CB  
4424 C CG  . TRP A 589 ? 0.5708 0.6128 0.5179 -0.0387 -0.0234 -0.0371 600 TRP A CG  
4425 C CD1 . TRP A 589 ? 0.5707 0.6147 0.5283 -0.0421 -0.0117 -0.0435 600 TRP A CD1 
4426 C CD2 . TRP A 589 ? 0.5677 0.6139 0.5093 -0.0354 -0.0322 -0.0364 600 TRP A CD2 
4427 N NE1 . TRP A 589 ? 0.5688 0.6161 0.5253 -0.0417 -0.0127 -0.0470 600 TRP A NE1 
4428 C CE2 . TRP A 589 ? 0.5663 0.6162 0.5134 -0.0380 -0.0254 -0.0427 600 TRP A CE2 
4429 C CE3 . TRP A 589 ? 0.5669 0.6143 0.5013 -0.0304 -0.0446 -0.0314 600 TRP A CE3 
4430 C CZ2 . TRP A 589 ? 0.5639 0.6191 0.5082 -0.0370 -0.0310 -0.0441 600 TRP A CZ2 
4431 C CZ3 . TRP A 589 ? 0.5635 0.6181 0.4978 -0.0285 -0.0500 -0.0327 600 TRP A CZ3 
4432 C CH2 . TRP A 589 ? 0.5619 0.6206 0.5004 -0.0324 -0.0434 -0.0390 600 TRP A CH2 
4433 N N   . ARG A 590 ? 0.6693 0.7064 0.6388 -0.0370 -0.0246 -0.0254 601 ARG A N   
4434 C CA  . ARG A 590 ? 0.6866 0.7173 0.6510 -0.0384 -0.0284 -0.0209 601 ARG A CA  
4435 C C   . ARG A 590 ? 0.6901 0.7089 0.6310 -0.0369 -0.0370 -0.0166 601 ARG A C   
4436 O O   . ARG A 590 ? 0.5990 0.6060 0.5229 -0.0422 -0.0362 -0.0142 601 ARG A O   
4437 C CB  . ARG A 590 ? 0.7667 0.7953 0.7333 -0.0471 -0.0181 -0.0227 601 ARG A CB  
4438 C CG  . ARG A 590 ? 0.9250 0.9666 0.9210 -0.0468 -0.0129 -0.0244 601 ARG A CG  
4439 C CD  . ARG A 590 ? 1.1531 1.1987 1.1593 -0.0524 0.0016  -0.0305 601 ARG A CD  
4440 N NE  . ARG A 590 ? 1.3101 1.3697 1.3488 -0.0510 0.0059  -0.0311 601 ARG A NE  
4441 C CZ  . ARG A 590 ? 1.3314 1.3972 1.3880 -0.0542 0.0194  -0.0365 601 ARG A CZ  
4442 N NH1 . ARG A 590 ? 1.1644 1.2224 1.2064 -0.0603 0.0310  -0.0425 601 ARG A NH1 
4443 N NH2 . ARG A 590 ? 1.3813 1.4612 1.4708 -0.0516 0.0212  -0.0357 601 ARG A NH2 
4444 N N   . LEU A 591 ? 0.6311 0.6532 0.5722 -0.0294 -0.0451 -0.0156 602 LEU A N   
4445 C CA  . LEU A 591 ? 0.5820 0.5955 0.5072 -0.0253 -0.0542 -0.0112 602 LEU A CA  
4446 C C   . LEU A 591 ? 0.6433 0.6598 0.5782 -0.0172 -0.0608 -0.0098 602 LEU A C   
4447 O O   . LEU A 591 ? 0.8947 0.9217 0.8451 -0.0144 -0.0602 -0.0124 602 LEU A O   
4448 C CB  . LEU A 591 ? 0.5898 0.6054 0.5051 -0.0249 -0.0572 -0.0119 602 LEU A CB  
4449 C CG  . LEU A 591 ? 0.6377 0.6497 0.5398 -0.0344 -0.0502 -0.0145 602 LEU A CG  
4450 C CD1 . LEU A 591 ? 0.6060 0.6224 0.5002 -0.0345 -0.0545 -0.0157 602 LEU A CD1 
4451 C CD2 . LEU A 591 ? 0.6305 0.6270 0.5119 -0.0408 -0.0499 -0.0102 602 LEU A CD2 
4452 N N   . VAL A 592 ? 0.5805 0.5860 0.5052 -0.0140 -0.0665 -0.0057 603 VAL A N   
4453 C CA  . VAL A 592 ? 0.5740 0.5797 0.5050 -0.0067 -0.0716 -0.0052 603 VAL A CA  
4454 C C   . VAL A 592 ? 0.7703 0.7697 0.6922 -0.0002 -0.0785 -0.0018 603 VAL A C   
4455 O O   . VAL A 592 ? 0.9252 0.9119 0.8324 -0.0016 -0.0808 0.0026  603 VAL A O   
4456 C CB  . VAL A 592 ? 0.5772 0.5746 0.5084 -0.0093 -0.0703 -0.0042 603 VAL A CB  
4457 C CG1 . VAL A 592 ? 0.5968 0.5787 0.5124 -0.0146 -0.0691 -0.0007 603 VAL A CG1 
4458 C CG2 . VAL A 592 ? 0.5760 0.5698 0.5092 -0.0028 -0.0744 -0.0045 603 VAL A CG2 
4459 N N   . ALA A 593 ? 0.6505 0.6590 0.5819 0.0068  -0.0819 -0.0036 604 ALA A N   
4460 C CA  . ALA A 593 ? 0.7187 0.7253 0.6478 0.0144  -0.0888 -0.0006 604 ALA A CA  
4461 C C   . ALA A 593 ? 0.7204 0.7222 0.6561 0.0213  -0.0893 -0.0015 604 ALA A C   
4462 O O   . ALA A 593 ? 0.7943 0.8039 0.7403 0.0219  -0.0862 -0.0060 604 ALA A O   
4463 C CB  . ALA A 593 ? 0.6725 0.6949 0.6089 0.0163  -0.0914 -0.0027 604 ALA A CB  
4464 N N   . PHE A 594 ? 0.7237 0.7111 0.6521 0.0259  -0.0927 0.0028  605 PHE A N   
4465 C CA  . PHE A 594 ? 0.8080 0.7873 0.7411 0.0324  -0.0918 0.0014  605 PHE A CA  
4466 C C   . PHE A 594 ? 0.8633 0.8418 0.8016 0.0429  -0.0979 0.0049  605 PHE A C   
4467 O O   . PHE A 594 ? 0.7696 0.7468 0.7017 0.0440  -0.1044 0.0109  605 PHE A O   
4468 C CB  . PHE A 594 ? 0.6191 0.5783 0.5402 0.0282  -0.0888 0.0030  605 PHE A CB  
4469 C CG  . PHE A 594 ? 0.7251 0.6708 0.6308 0.0248  -0.0916 0.0095  605 PHE A CG  
4470 C CD1 . PHE A 594 ? 0.6971 0.6291 0.5968 0.0318  -0.0970 0.0155  605 PHE A CD1 
4471 C CD2 . PHE A 594 ? 0.8281 0.7743 0.7257 0.0144  -0.0886 0.0099  605 PHE A CD2 
4472 C CE1 . PHE A 594 ? 0.8018 0.7192 0.6843 0.0275  -0.1000 0.0224  605 PHE A CE1 
4473 C CE2 . PHE A 594 ? 0.8526 0.7852 0.7336 0.0097  -0.0900 0.0155  605 PHE A CE2 
4474 C CZ  . PHE A 594 ? 0.9033 0.8208 0.7750 0.0158  -0.0961 0.0221  605 PHE A CZ  
4475 N N   . GLY A 595 ? 0.9508 0.9301 0.9006 0.0503  -0.0956 0.0012  606 GLY A N   
4476 C CA  . GLY A 595 ? 0.9495 0.9300 0.9100 0.0617  -0.1005 0.0039  606 GLY A CA  
4477 C C   . GLY A 595 ? 0.9173 0.8859 0.8842 0.0688  -0.0950 0.0004  606 GLY A C   
4478 O O   . GLY A 595 ? 0.8399 0.8093 0.8088 0.0654  -0.0873 -0.0069 606 GLY A O   
4479 N N   . THR A 596 ? 0.9345 0.8909 0.9040 0.0782  -0.0989 0.0056  607 THR A N   
4480 C CA  . THR A 596 ? 0.9133 0.8553 0.8891 0.0856  -0.0923 0.0018  607 THR A CA  
4481 C C   . THR A 596 ? 0.8699 0.8234 0.8698 0.0992  -0.0945 0.0017  607 THR A C   
4482 O O   . THR A 596 ? 0.6530 0.6295 0.6656 0.1010  -0.1001 0.0026  607 THR A O   
4483 C CB  . THR A 596 ? 1.0034 0.9166 0.9635 0.0859  -0.0928 0.0073  607 THR A CB  
4484 O OG1 . THR A 596 ? 0.9588 0.8679 0.9221 0.0949  -0.1028 0.0173  607 THR A OG1 
4485 C CG2 . THR A 596 ? 1.1455 1.0507 1.0838 0.0721  -0.0921 0.0087  607 THR A CG2 
4486 N N   . SER A 597 ? 1.0663 1.0040 1.0737 0.1085  -0.0897 0.0003  608 SER A N   
4487 C CA  . SER A 597 ? 1.0879 1.0368 1.1226 0.1225  -0.0904 -0.0003 608 SER A CA  
4488 C C   . SER A 597 ? 1.0269 0.9816 1.0701 0.1312  -0.1051 0.0118  608 SER A C   
4489 O O   . SER A 597 ? 1.0797 1.0527 1.1488 0.1415  -0.1090 0.0127  608 SER A O   
4490 C CB  . SER A 597 ? 1.1783 1.1062 1.2191 0.1303  -0.0795 -0.0057 608 SER A CB  
4491 O OG  . SER A 597 ? 1.1520 1.0731 1.1815 0.1205  -0.0666 -0.0167 608 SER A OG  
4492 N N   . HIS A 598 ? 0.9970 0.9371 1.0189 0.1264  -0.1135 0.0214  609 HIS A N   
4493 C CA  . HIS A 598 ? 1.0388 0.9796 1.0636 0.1333  -0.1284 0.0343  609 HIS A CA  
4494 C C   . HIS A 598 ? 1.0809 1.0360 1.0918 0.1229  -0.1385 0.0397  609 HIS A C   
4495 O O   . HIS A 598 ? 1.1379 1.1062 1.1577 0.1275  -0.1513 0.0477  609 HIS A O   
4496 C CB  . HIS A 598 ? 1.0268 0.9343 1.0360 0.1366  -0.1305 0.0426  609 HIS A CB  
4497 C CG  . HIS A 598 ? 1.1091 0.9960 1.1243 0.1432  -0.1179 0.0358  609 HIS A CG  
4498 N ND1 . HIS A 598 ? 1.1552 1.0211 1.1492 0.1332  -0.1068 0.0295  609 HIS A ND1 
4499 C CD2 . HIS A 598 ? 1.1365 1.0205 1.1769 0.1582  -0.1137 0.0337  609 HIS A CD2 
4500 C CE1 . HIS A 598 ? 1.1590 1.0083 1.1619 0.1408  -0.0965 0.0235  609 HIS A CE1 
4501 N NE2 . HIS A 598 ? 1.0919 0.9513 1.1234 0.1564  -0.0996 0.0256  609 HIS A NE2 
4502 N N   . GLY A 599 ? 1.1466 1.0995 1.1366 0.1087  -0.1331 0.0353  610 GLY A N   
4503 C CA  . GLY A 599 ? 1.2074 1.1719 1.1839 0.0983  -0.1401 0.0389  610 GLY A CA  
4504 C C   . GLY A 599 ? 1.1638 1.1315 1.1278 0.0850  -0.1305 0.0306  610 GLY A C   
4505 O O   . GLY A 599 ? 1.1271 1.0926 1.0952 0.0839  -0.1199 0.0222  610 GLY A O   
4506 N N   . PHE A 600 ? 1.0733 1.0458 1.0218 0.0746  -0.1343 0.0332  611 PHE A N   
4507 C CA  . PHE A 600 ? 0.9408 0.9171 0.8797 0.0625  -0.1259 0.0265  611 PHE A CA  
4508 C C   . PHE A 600 ? 0.9023 0.8688 0.8176 0.0519  -0.1286 0.0319  611 PHE A C   
4509 O O   . PHE A 600 ? 0.6896 0.6493 0.5949 0.0528  -0.1382 0.0408  611 PHE A O   
4510 C CB  . PHE A 600 ? 0.9639 0.9655 0.9171 0.0606  -0.1238 0.0194  611 PHE A CB  
4511 C CG  . PHE A 600 ? 0.9209 0.9376 0.8750 0.0594  -0.1332 0.0233  611 PHE A CG  
4512 C CD1 . PHE A 600 ? 0.8748 0.8947 0.8138 0.0478  -0.1332 0.0230  611 PHE A CD1 
4513 C CD2 . PHE A 600 ? 0.8075 0.8354 0.7783 0.0692  -0.1419 0.0269  611 PHE A CD2 
4514 C CE1 . PHE A 600 ? 0.9093 0.9418 0.8463 0.0448  -0.1417 0.0260  611 PHE A CE1 
4515 C CE2 . PHE A 600 ? 0.8728 0.9155 0.8438 0.0666  -0.1519 0.0308  611 PHE A CE2 
4516 C CZ  . PHE A 600 ? 0.9327 0.9769 0.8850 0.0537  -0.1519 0.0302  611 PHE A CZ  
4517 N N   . GLY A 601 ? 0.9905 0.9565 0.8974 0.0414  -0.1202 0.0267  612 GLY A N   
4518 C CA  . GLY A 601 ? 1.0513 1.0082 0.9370 0.0302  -0.1196 0.0299  612 GLY A CA  
4519 C C   . GLY A 601 ? 0.9767 0.9434 0.8631 0.0204  -0.1102 0.0224  612 GLY A C   
4520 O O   . GLY A 601 ? 1.0140 0.9875 0.9133 0.0214  -0.1039 0.0160  612 GLY A O   
4521 N N   . LEU A 602 ? 0.8747 0.8414 0.7469 0.0106  -0.1093 0.0233  613 LEU A N   
4522 C CA  . LEU A 602 ? 0.8290 0.8036 0.7025 0.0013  -0.0997 0.0165  613 LEU A CA  
4523 C C   . LEU A 602 ? 0.7771 0.7363 0.6363 -0.0077 -0.0931 0.0177  613 LEU A C   
4524 O O   . LEU A 602 ? 0.7363 0.6807 0.5757 -0.0121 -0.0963 0.0237  613 LEU A O   
4525 C CB  . LEU A 602 ? 0.6465 0.6322 0.5152 -0.0045 -0.1006 0.0147  613 LEU A CB  
4526 C CG  . LEU A 602 ? 0.8872 0.8792 0.7574 -0.0139 -0.0895 0.0075  613 LEU A CG  
4527 C CD1 . LEU A 602 ? 0.8748 0.8791 0.7673 -0.0097 -0.0841 0.0013  613 LEU A CD1 
4528 C CD2 . LEU A 602 ? 0.6429 0.6416 0.5039 -0.0207 -0.0901 0.0056  613 LEU A CD2 
4529 N N   . PHE A 603 ? 0.7954 0.7584 0.6648 -0.0110 -0.0846 0.0123  614 PHE A N   
4530 C CA  . PHE A 603 ? 0.7752 0.7264 0.6358 -0.0196 -0.0778 0.0126  614 PHE A CA  
4531 C C   . PHE A 603 ? 0.7188 0.6808 0.5862 -0.0282 -0.0679 0.0066  614 PHE A C   
4532 O O   . PHE A 603 ? 0.6246 0.6025 0.5094 -0.0256 -0.0656 0.0016  614 PHE A O   
4533 C CB  . PHE A 603 ? 0.8335 0.7783 0.7014 -0.0163 -0.0771 0.0124  614 PHE A CB  
4534 C CG  . PHE A 603 ? 0.9468 0.8795 0.8060 -0.0257 -0.0711 0.0130  614 PHE A CG  
4535 C CD1 . PHE A 603 ? 1.1149 1.0274 0.9527 -0.0299 -0.0724 0.0188  614 PHE A CD1 
4536 C CD2 . PHE A 603 ? 0.8391 0.7806 0.7118 -0.0309 -0.0645 0.0083  614 PHE A CD2 
4537 C CE1 . PHE A 603 ? 1.1751 1.0763 1.0046 -0.0398 -0.0661 0.0190  614 PHE A CE1 
4538 C CE2 . PHE A 603 ? 0.9018 0.8344 0.7687 -0.0403 -0.0590 0.0086  614 PHE A CE2 
4539 C CZ  . PHE A 603 ? 1.0585 0.9709 0.9035 -0.0451 -0.0591 0.0135  614 PHE A CZ  
4540 N N   . ASP A 604 ? 0.6668 0.6195 0.5211 -0.0385 -0.0615 0.0071  615 ASP A N   
4541 C CA  . ASP A 604 ? 0.7215 0.6831 0.5834 -0.0471 -0.0501 0.0011  615 ASP A CA  
4542 C C   . ASP A 604 ? 0.6957 0.6573 0.5691 -0.0505 -0.0447 -0.0001 615 ASP A C   
4543 O O   . ASP A 604 ? 0.7135 0.6637 0.5753 -0.0589 -0.0399 0.0014  615 ASP A O   
4544 C CB  . ASP A 604 ? 0.8328 0.7848 0.6724 -0.0576 -0.0452 0.0016  615 ASP A CB  
4545 C CG  . ASP A 604 ? 0.7649 0.7255 0.6134 -0.0665 -0.0311 -0.0059 615 ASP A CG  
4546 O OD1 . ASP A 604 ? 0.6528 0.6275 0.5269 -0.0635 -0.0263 -0.0104 615 ASP A OD1 
4547 O OD2 . ASP A 604 ? 0.7694 0.7219 0.5991 -0.0767 -0.0246 -0.0071 615 ASP A OD2 
4548 N N   . HIS A 605 ? 0.6555 0.6302 0.5511 -0.0450 -0.0456 -0.0028 616 HIS A N   
4549 C CA  . HIS A 605 ? 0.7694 0.7458 0.6767 -0.0488 -0.0427 -0.0034 616 HIS A CA  
4550 C C   . HIS A 605 ? 0.8552 0.8411 0.7752 -0.0574 -0.0317 -0.0074 616 HIS A C   
4551 O O   . HIS A 605 ? 1.0684 1.0598 1.0023 -0.0610 -0.0296 -0.0079 616 HIS A O   
4552 C CB  . HIS A 605 ? 0.7424 0.7289 0.6670 -0.0414 -0.0483 -0.0041 616 HIS A CB  
4553 C CG  . HIS A 605 ? 0.8131 0.8176 0.7580 -0.0384 -0.0462 -0.0078 616 HIS A CG  
4554 N ND1 . HIS A 605 ? 0.8126 0.8293 0.7771 -0.0428 -0.0400 -0.0102 616 HIS A ND1 
4555 C CD2 . HIS A 605 ? 0.7186 0.7308 0.6686 -0.0315 -0.0494 -0.0092 616 HIS A CD2 
4556 C CE1 . HIS A 605 ? 0.7646 0.7937 0.7443 -0.0381 -0.0396 -0.0125 616 HIS A CE1 
4557 N NE2 . HIS A 605 ? 0.7243 0.7506 0.6944 -0.0319 -0.0450 -0.0122 616 HIS A NE2 
4558 N N   . GLN A 606 ? 0.7765 0.7647 0.6927 -0.0612 -0.0245 -0.0106 617 GLN A N   
4559 C CA  . GLN A 606 ? 0.8636 0.8580 0.7900 -0.0701 -0.0117 -0.0151 617 GLN A CA  
4560 C C   . GLN A 606 ? 0.9270 0.9056 0.8310 -0.0812 -0.0058 -0.0137 617 GLN A C   
4561 O O   . GLN A 606 ? 0.8532 0.8346 0.7665 -0.0890 0.0022  -0.0155 617 GLN A O   
4562 C CB  . GLN A 606 ? 1.0494 1.0525 0.9824 -0.0698 -0.0044 -0.0206 617 GLN A CB  
4563 C CG  . GLN A 606 ? 1.1288 1.1371 1.0725 -0.0789 0.0114  -0.0267 617 GLN A CG  
4564 C CD  . GLN A 606 ? 1.0306 1.0570 1.0107 -0.0762 0.0152  -0.0288 617 GLN A CD  
4565 O OE1 . GLN A 606 ? 1.1137 1.1464 1.1066 -0.0705 0.0055  -0.0248 617 GLN A OE1 
4566 N NE2 . GLN A 606 ? 0.9191 0.9538 0.9162 -0.0808 0.0294  -0.0350 617 GLN A NE2 
4567 N N   . GLN A 607 ? 0.9057 0.8680 0.7806 -0.0824 -0.0102 -0.0101 618 GLN A N   
4568 C CA  . GLN A 607 ? 0.8234 0.7667 0.6720 -0.0929 -0.0067 -0.0071 618 GLN A CA  
4569 C C   . GLN A 607 ? 0.8841 0.8115 0.7193 -0.0900 -0.0167 0.0002  618 GLN A C   
4570 O O   . GLN A 607 ? 0.8729 0.7819 0.6856 -0.0986 -0.0146 0.0038  618 GLN A O   
4571 C CB  . GLN A 607 ? 0.7232 0.6559 0.5449 -0.0976 -0.0060 -0.0064 618 GLN A CB  
4572 C CG  . GLN A 607 ? 0.7269 0.6712 0.5570 -0.1022 0.0057  -0.0146 618 GLN A CG  
4573 C CD  . GLN A 607 ? 0.9417 0.8736 0.7407 -0.1094 0.0060  -0.0140 618 GLN A CD  
4574 O OE1 . GLN A 607 ? 1.0110 0.9252 0.7816 -0.1123 -0.0022 -0.0065 618 GLN A OE1 
4575 N NE2 . GLN A 607 ? 1.0015 0.9418 0.8051 -0.1128 0.0151  -0.0215 618 GLN A NE2 
4576 N N   . ARG A 608 ? 0.9027 0.8350 0.7502 -0.0788 -0.0265 0.0021  619 ARG A N   
4577 C CA  . ARG A 608 ? 0.8340 0.7500 0.6699 -0.0747 -0.0351 0.0079  619 ARG A CA  
4578 C C   . ARG A 608 ? 0.7835 0.6786 0.5901 -0.0745 -0.0411 0.0147  619 ARG A C   
4579 O O   . ARG A 608 ? 0.7552 0.6298 0.5439 -0.0782 -0.0428 0.0199  619 ARG A O   
4580 C CB  . ARG A 608 ? 0.8403 0.7506 0.6786 -0.0833 -0.0301 0.0075  619 ARG A CB  
4581 C CG  . ARG A 608 ? 0.8450 0.7753 0.7126 -0.0818 -0.0288 0.0030  619 ARG A CG  
4582 C CD  . ARG A 608 ? 0.9630 0.9006 0.8416 -0.0941 -0.0185 -0.0003 619 ARG A CD  
4583 N NE  . ARG A 608 ? 1.1678 1.1287 1.0780 -0.0921 -0.0181 -0.0039 619 ARG A NE  
4584 C CZ  . ARG A 608 ? 1.3466 1.3266 1.2776 -0.0892 -0.0137 -0.0078 619 ARG A CZ  
4585 N NH1 . ARG A 608 ? 1.3809 1.3593 1.3032 -0.0889 -0.0083 -0.0097 619 ARG A NH1 
4586 N NH2 . ARG A 608 ? 1.3402 1.3398 1.3000 -0.0871 -0.0149 -0.0094 619 ARG A NH2 
4587 N N   . ARG A 609 ? 0.9555 0.8557 0.7573 -0.0706 -0.0449 0.0152  620 ARG A N   
4588 C CA  . ARG A 609 ? 1.0281 0.9119 0.8041 -0.0700 -0.0531 0.0226  620 ARG A CA  
4589 C C   . ARG A 609 ? 1.0291 0.9206 0.8136 -0.0561 -0.0648 0.0249  620 ARG A C   
4590 O O   . ARG A 609 ? 1.0729 0.9841 0.8780 -0.0506 -0.0642 0.0194  620 ARG A O   
4591 C CB  . ARG A 609 ? 0.9648 0.8465 0.7226 -0.0816 -0.0468 0.0212  620 ARG A CB  
4592 N N   . GLN A 610 ? 0.9636 0.8394 0.7332 -0.0506 -0.0755 0.0335  621 GLN A N   
4593 C CA  . GLN A 610 ? 1.0162 0.8996 0.7952 -0.0374 -0.0868 0.0363  621 GLN A CA  
4594 C C   . GLN A 610 ? 1.0389 0.9299 0.8082 -0.0404 -0.0912 0.0375  621 GLN A C   
4595 O O   . GLN A 610 ? 1.1883 1.0648 0.9322 -0.0477 -0.0950 0.0439  621 GLN A O   
4596 C CB  . GLN A 610 ? 1.0325 0.8963 0.8031 -0.0291 -0.0963 0.0452  621 GLN A CB  
4597 C CG  . GLN A 610 ? 1.1131 0.9863 0.8997 -0.0141 -0.1066 0.0473  621 GLN A CG  
4598 C CD  . GLN A 610 ? 1.3443 1.2338 1.1573 -0.0069 -0.1021 0.0390  621 GLN A CD  
4599 O OE1 . GLN A 610 ? 1.3870 1.2729 1.2047 -0.0099 -0.0946 0.0347  621 GLN A OE1 
4600 N NE2 . GLN A 610 ? 1.4078 1.3155 1.2370 0.0015  -0.1069 0.0368  621 GLN A NE2 
4601 N N   . VAL A 611 ? 0.9746 0.8871 0.7621 -0.0361 -0.0909 0.0314  622 VAL A N   
4602 C CA  . VAL A 611 ? 0.9364 0.8571 0.7153 -0.0398 -0.0951 0.0315  622 VAL A CA  
4603 C C   . VAL A 611 ? 0.9350 0.8503 0.7058 -0.0324 -0.1110 0.0413  622 VAL A C   
4604 O O   . VAL A 611 ? 1.0920 0.9967 0.8384 -0.0395 -0.1172 0.0479  622 VAL A O   
4605 C CB  . VAL A 611 ? 0.9093 0.8530 0.7106 -0.0369 -0.0906 0.0224  622 VAL A CB  
4606 C CG1 . VAL A 611 ? 0.7534 0.7042 0.5438 -0.0428 -0.0940 0.0216  622 VAL A CG1 
4607 C CG2 . VAL A 611 ? 0.9065 0.8555 0.7192 -0.0428 -0.0760 0.0141  622 VAL A CG2 
4608 N N   . PHE A 612 ? 0.7917 0.7143 0.5831 -0.0183 -0.1178 0.0426  623 PHE A N   
4609 C CA  . PHE A 612 ? 0.7588 0.6777 0.5489 -0.0090 -0.1328 0.0523  623 PHE A CA  
4610 C C   . PHE A 612 ? 0.8488 0.7711 0.6633 0.0061  -0.1346 0.0516  623 PHE A C   
4611 O O   . PHE A 612 ? 0.8674 0.7987 0.6990 0.0083  -0.1256 0.0431  623 PHE A O   
4612 C CB  . PHE A 612 ? 0.7747 0.7101 0.5650 -0.0101 -0.1415 0.0530  623 PHE A CB  
4613 C CG  . PHE A 612 ? 0.8090 0.7688 0.6269 -0.0032 -0.1394 0.0447  623 PHE A CG  
4614 C CD1 . PHE A 612 ? 0.7646 0.7346 0.6039 0.0106  -0.1479 0.0472  623 PHE A CD1 
4615 C CD2 . PHE A 612 ? 0.8889 0.8608 0.7115 -0.0106 -0.1283 0.0345  623 PHE A CD2 
4616 C CE1 . PHE A 612 ? 0.7891 0.7807 0.6520 0.0156  -0.1451 0.0394  623 PHE A CE1 
4617 C CE2 . PHE A 612 ? 0.8999 0.8920 0.7457 -0.0050 -0.1265 0.0275  623 PHE A CE2 
4618 C CZ  . PHE A 612 ? 0.8815 0.8834 0.7463 0.0074  -0.1348 0.0299  623 PHE A CZ  
4619 N N   . VAL A 613 ? 0.8770 0.7913 0.6927 0.0160  -0.1463 0.0608  624 VAL A N   
4620 C CA  . VAL A 613 ? 0.7693 0.6884 0.6097 0.0313  -0.1487 0.0602  624 VAL A CA  
4621 C C   . VAL A 613 ? 0.8145 0.7436 0.6640 0.0402  -0.1635 0.0678  624 VAL A C   
4622 O O   . VAL A 613 ? 0.9777 0.9014 0.8093 0.0353  -0.1740 0.0768  624 VAL A O   
4623 C CB  . VAL A 613 ? 0.7671 0.6616 0.6036 0.0363  -0.1459 0.0636  624 VAL A CB  
4624 C CG1 . VAL A 613 ? 0.7572 0.6440 0.5862 0.0264  -0.1322 0.0562  624 VAL A CG1 
4625 C CG2 . VAL A 613 ? 0.8027 0.6746 0.6181 0.0360  -0.1561 0.0768  624 VAL A CG2 
4626 N N   . LYS A 614 ? 0.7417 0.6863 0.6193 0.0526  -0.1645 0.0642  625 LYS A N   
4627 C CA  . LYS A 614 ? 0.7478 0.7057 0.6408 0.0624  -0.1783 0.0708  625 LYS A CA  
4628 C C   . LYS A 614 ? 0.9692 0.9268 0.8888 0.0788  -0.1773 0.0701  625 LYS A C   
4629 O O   . LYS A 614 ? 1.0565 1.0241 0.9935 0.0820  -0.1666 0.0595  625 LYS A O   
4630 C CB  . LYS A 614 ? 0.7280 0.7142 0.6313 0.0579  -0.1801 0.0650  625 LYS A CB  
4631 C CG  . LYS A 614 ? 0.8134 0.8183 0.7402 0.0689  -0.1930 0.0699  625 LYS A CG  
4632 C CD  . LYS A 614 ? 0.8516 0.8782 0.7759 0.0600  -0.2003 0.0691  625 LYS A CD  
4633 C CE  . LYS A 614 ? 0.9162 0.9617 0.8640 0.0702  -0.2155 0.0760  625 LYS A CE  
4634 N NZ  . LYS A 614 ? 1.0045 1.0686 0.9452 0.0595  -0.2254 0.0772  625 LYS A NZ  
4635 N N   . CYS A 615 ? 1.0283 0.9732 0.9505 0.0888  -0.1880 0.0813  626 CYS A N   
4636 C CA  . CYS A 615 ? 1.1206 1.0653 1.0707 0.1057  -0.1873 0.0811  626 CYS A CA  
4637 C C   . CYS A 615 ? 1.2240 1.2000 1.2041 0.1136  -0.1942 0.0796  626 CYS A C   
4638 O O   . CYS A 615 ? 1.3001 1.2868 1.2811 0.1140  -0.2097 0.0890  626 CYS A O   
4639 C CB  . CYS A 615 ? 1.2520 1.1708 1.1959 0.1144  -0.1964 0.0944  626 CYS A CB  
4640 S SG  . CYS A 615 ? 1.3303 1.2457 1.3104 0.1365  -0.1942 0.0941  626 CYS A SG  
4641 N N   . THR A 616 ? 1.1627 1.1535 1.1664 0.1186  -0.1830 0.0678  627 THR A N   
4642 C CA  . THR A 616 ? 1.1652 1.1870 1.1983 0.1245  -0.1866 0.0641  627 THR A CA  
4643 C C   . THR A 616 ? 1.1380 1.1631 1.2039 0.1427  -0.1889 0.0667  627 THR A C   
4644 O O   . THR A 616 ? 1.0624 1.1140 1.1574 0.1487  -0.1899 0.0626  627 THR A O   
4645 C CB  . THR A 616 ? 1.0470 1.0842 1.0856 0.1174  -0.1723 0.0494  627 THR A CB  
4646 O OG1 . THR A 616 ? 0.9813 1.0034 1.0225 0.1210  -0.1578 0.0415  627 THR A OG1 
4647 C CG2 . THR A 616 ? 1.0594 1.0961 1.0707 0.1006  -0.1703 0.0470  627 THR A CG2 
4648 N N   . LEU A 617 ? 1.1560 1.1545 1.2188 0.1516  -0.1891 0.0732  628 LEU A N   
4649 C CA  . LEU A 617 ? 1.0974 1.0958 1.1928 0.1700  -0.1887 0.0746  628 LEU A CA  
4650 C C   . LEU A 617 ? 1.1907 1.2124 1.3115 0.1792  -0.2068 0.0851  628 LEU A C   
4651 O O   . LEU A 617 ? 1.2409 1.2570 1.3472 0.1772  -0.2239 0.0993  628 LEU A O   
4652 C CB  . LEU A 617 ? 0.8970 0.8585 0.9801 0.1765  -0.1865 0.0809  628 LEU A CB  
4653 C CG  . LEU A 617 ? 0.9441 0.8834 1.0115 0.1708  -0.1673 0.0693  628 LEU A CG  
4654 C CD1 . LEU A 617 ? 0.8148 0.7165 0.8690 0.1764  -0.1664 0.0764  628 LEU A CD1 
4655 C CD2 . LEU A 617 ? 0.8557 0.8092 0.9498 0.1766  -0.1521 0.0546  628 LEU A CD2 
4656 N N   . HIS A 618 ? 1.3583 1.4065 1.5166 0.1884  -0.2031 0.0781  629 HIS A N   
4657 C CA  . HIS A 618 ? 1.4908 1.5642 1.6807 0.1988  -0.2196 0.0874  629 HIS A CA  
4658 C C   . HIS A 618 ? 1.5663 1.6194 1.7665 0.2148  -0.2303 0.1019  629 HIS A C   
4659 O O   . HIS A 618 ? 1.6155 1.6398 1.8119 0.2218  -0.2190 0.0997  629 HIS A O   
4660 C CB  . HIS A 618 ? 1.6229 1.7263 1.8537 0.2062  -0.2097 0.0754  629 HIS A CB  
4661 C CG  . HIS A 618 ? 1.6444 1.7838 1.9051 0.2101  -0.2260 0.0817  629 HIS A CG  
4662 N ND1 . HIS A 618 ? 1.6462 1.8051 1.8916 0.1954  -0.2375 0.0841  629 HIS A ND1 
4663 C CD2 . HIS A 618 ? 1.6436 1.8037 1.9497 0.2264  -0.2326 0.0858  629 HIS A CD2 
4664 C CE1 . HIS A 618 ? 1.6064 1.7966 1.8848 0.2016  -0.2514 0.0897  629 HIS A CE1 
4665 N NE2 . HIS A 618 ? 1.6264 1.8192 1.9436 0.2208  -0.2491 0.0911  629 HIS A NE2 
4666 N N   . PRO A 619 ? 1.4907 1.5567 1.7026 0.2201  -0.2527 0.1173  630 PRO A N   
4667 C CA  . PRO A 619 ? 1.5065 1.5527 1.7304 0.2366  -0.2644 0.1328  630 PRO A CA  
4668 C C   . PRO A 619 ? 1.5221 1.5657 1.7872 0.2568  -0.2513 0.1265  630 PRO A C   
4669 O O   . PRO A 619 ? 1.4979 1.5117 1.7640 0.2687  -0.2515 0.1343  630 PRO A O   
4670 C CB  . PRO A 619 ? 1.3875 1.4590 1.6248 0.2382  -0.2911 0.1486  630 PRO A CB  
4671 C CG  . PRO A 619 ? 1.3324 1.4417 1.5769 0.2260  -0.2896 0.1379  630 PRO A CG  
4672 C CD  . PRO A 619 ? 1.3999 1.4960 1.6107 0.2101  -0.2694 0.1225  630 PRO A CD  
4673 N N   . SER A 620 ? 1.5225 1.5947 1.8208 0.2602  -0.2386 0.1120  631 SER A N   
4674 C CA  . SER A 620 ? 1.4192 1.4900 1.7563 0.2775  -0.2222 0.1028  631 SER A CA  
4675 C C   . SER A 620 ? 1.4432 1.5195 1.7747 0.2673  -0.1974 0.0811  631 SER A C   
4676 O O   . SER A 620 ? 1.3495 1.4595 1.7035 0.2644  -0.1932 0.0718  631 SER A O   
4677 C CB  . SER A 620 ? 1.3235 1.4279 1.7156 0.2943  -0.2335 0.1087  631 SER A CB  
4678 N N   . ASP A 621 ? 1.5322 1.5750 1.8329 0.2611  -0.1816 0.0736  632 ASP A N   
4679 C CA  . ASP A 621 ? 1.5761 1.6192 1.8658 0.2502  -0.1594 0.0546  632 ASP A CA  
4680 C C   . ASP A 621 ? 1.6910 1.7218 2.0056 0.2628  -0.1390 0.0431  632 ASP A C   
4681 O O   . ASP A 621 ? 1.7555 1.7815 2.1013 0.2812  -0.1415 0.0491  632 ASP A O   
4682 C CB  . ASP A 621 ? 1.4905 1.5075 1.7294 0.2327  -0.1559 0.0534  632 ASP A CB  
4683 N N   . GLN A 622 ? 1.7130 1.7376 2.0135 0.2526  -0.1184 0.0265  633 GLN A N   
4684 C CA  . GLN A 622 ? 1.6744 1.6872 1.9938 0.2610  -0.0966 0.0130  633 GLN A CA  
4685 C C   . GLN A 622 ? 1.6789 1.6474 1.9793 0.2659  -0.0906 0.0158  633 GLN A C   
4686 O O   . GLN A 622 ? 1.8130 1.7603 2.0846 0.2617  -0.1030 0.0279  633 GLN A O   
4687 C CB  . GLN A 622 ? 1.6202 1.6408 1.9267 0.2461  -0.0780 -0.0048 633 GLN A CB  
4688 N N   . LEU A 623 ? 1.5835 1.5365 1.8992 0.2737  -0.0703 0.0037  634 LEU A N   
4689 C CA  . LEU A 623 ? 1.5202 1.4294 1.8194 0.2781  -0.0617 0.0040  634 LEU A CA  
4690 C C   . LEU A 623 ? 1.4990 1.3834 1.7472 0.2577  -0.0556 -0.0010 634 LEU A C   
4691 O O   . LEU A 623 ? 1.5290 1.3761 1.7566 0.2569  -0.0479 -0.0019 634 LEU A O   
4692 C CB  . LEU A 623 ? 1.4074 1.3068 1.7357 0.2901  -0.0390 -0.0100 634 LEU A CB  
4693 C CG  . LEU A 623 ? 1.3459 1.2533 1.7258 0.3151  -0.0424 -0.0035 634 LEU A CG  
4694 C CD1 . LEU A 623 ? 1.2567 1.2133 1.6762 0.3210  -0.0530 -0.0008 634 LEU A CD1 
4695 C CD2 . LEU A 623 ? 1.2984 1.1841 1.6971 0.3247  -0.0160 -0.0189 634 LEU A CD2 
4696 N N   . SER A 697 ? 1.4614 1.4536 1.6536 0.1825  -0.0384 -0.0416 708 SER A N   
4697 C CA  . SER A 697 ? 1.4349 1.4533 1.6238 0.1750  -0.0522 -0.0355 708 SER A CA  
4698 C C   . SER A 697 ? 1.4278 1.4653 1.6429 0.1875  -0.0690 -0.0235 708 SER A C   
4699 O O   . SER A 697 ? 1.3343 1.3835 1.5846 0.2015  -0.0669 -0.0245 708 SER A O   
4700 C CB  . SER A 697 ? 1.3758 1.4172 1.5706 0.1659  -0.0427 -0.0469 708 SER A CB  
4701 O OG  . SER A 697 ? 1.2952 1.3194 1.4628 0.1526  -0.0298 -0.0563 708 SER A OG  
4702 N N   . PHE A 698 ? 1.3966 1.4373 1.5946 0.1819  -0.0855 -0.0122 709 PHE A N   
4703 C CA  . PHE A 698 ? 1.2697 1.3274 1.4852 0.1904  -0.1041 0.0007  709 PHE A CA  
4704 C C   . PHE A 698 ? 1.1511 1.2397 1.3675 0.1803  -0.1119 0.0004  709 PHE A C   
4705 O O   . PHE A 698 ? 1.1191 1.2159 1.3264 0.1689  -0.1021 -0.00