data_6N8Q
# 
_entry.id   6N8Q 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6N8Q         
WWPDB D_1000238331 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6N8Q 
_pdbx_database_status.recvd_initial_deposition_date   2018-11-30 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Almagor, L.' 1 0000-0002-5175-7420 
'Weis, W.I.'  2 0000-0002-5583-6150 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Proc.Natl.Acad.Sci.USA 
_citation.journal_id_ASTM           PNASA6 
_citation.journal_id_CSD            0040 
_citation.journal_id_ISSN           1091-6490 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            116 
_citation.language                  ? 
_citation.page_first                10804 
_citation.page_last                 10812 
_citation.title                     
'Structural insights into the aPKC regulatory switch mechanism of the human cell polarity protein lethal giant larvae 2.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1073/pnas.1821514116 
_citation.pdbx_database_id_PubMed   31088962 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Almagor, L.'    1 ? 
primary 'Ufimtsev, I.S.' 2 ? 
primary 'Ayer, A.'       3 ? 
primary 'Li, J.'         4 ? 
primary 'Weis, W.I.'     5 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   116.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6N8Q 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     174.528 
_cell.length_a_esd                 ? 
_cell.length_b                     46.759 
_cell.length_b_esd                 ? 
_cell.length_c                     137.689 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        4 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6N8Q 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Lethal(2) giant larvae protein homolog 2' 109275.109 1   ? ? ? ? 
2 non-polymer syn 'CHLORIDE ION'                             35.453     1   ? ? ? ? 
3 non-polymer syn GLYCEROL                                   92.094     1   ? ? ? ? 
4 water       nat water                                      18.015     223 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        HGL 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MRERLKRDLFQFNKTVEHGFPHQPSALGYSPSLRILAIGTRSGAIKLYGAPGVEFMGLHQENNAVTQIHLLPGQCQLVTL
LDDNSLHLWSLKVKGGASELQEDESFTLRGPPGAAPSATQITVVLPHSSCELLYLGTESGNVFVVQLPAFRALEDRTISS
DAVLQRLPEEARHRRVFEMVEALQEHPRDPNQILIGYSRGLVVIWDLQGSRVLYHFLSSQQLENIWWQRDGRLLVSCHSD
GSYCQWPVSSEAQQPEPLRSLVPYGPFPCKAITRILWLTTRQGLPFTIFQGGMPRASYGDRHCISVIHDGQQTAFDFTSR
VIGFTVLTEADPAATFDDPYALVVLAEEELVVIDLQTAGWPPVQLPYLASLHCSAITCSHHVSNIPLKLWERIIAAGSRQ
NAHFSTMEWPIDGGTSLTPAPPQRDLLLTGHEDGTVRFWDASGVCLRLLYKLSTVRVFLTDTDPNENFSAQGEDEWPPLR
KVGSFDPYSDDPRLGIQKIFLCKYSGYLAVAGTAGQVLVLELNDEAAEQAVEQVEADLLQDQEGYRWKGHERLAARSGPV
RFEPGFQPFVLVQCQPPAVVTSLALHSEWRLVAFGTSHGFGLFDHQQRRQVFVKCTLHPSDQLALEGPLSRVKSLKKSLR
QSFRRMRRSRVSSRKRHPAGPPGEAQEGSAKAERPGLQNMELAPVQRKIEARSAEDSFTGFVRTLYFADTYLKDSSRHCP
SLWAGTNGGTIYAFSLRVPPAERRMDEPVRAEQAKEIQLMHRAPVVGILVLDGHSVPLPEPLEVAHDLSKSPDMQGSHQL
LVVSEEQFKVFTLPKVSAKLKLKLTALEGSRVRRVSVAHFGSRRAEDYGEHHLAVLTNLGDIQVVSLPLLKPQVRYSCIR
REDVSGIASCVFTKYGQGFYLISPSEFERFSLSTKWLVEPRCLVDSAETKNHRPGNGAGPKKAPSRARNSGTQSDGEEKQ
PGLVMEREFTTASENLYFQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MRERLKRDLFQFNKTVEHGFPHQPSALGYSPSLRILAIGTRSGAIKLYGAPGVEFMGLHQENNAVTQIHLLPGQCQLVTL
LDDNSLHLWSLKVKGGASELQEDESFTLRGPPGAAPSATQITVVLPHSSCELLYLGTESGNVFVVQLPAFRALEDRTISS
DAVLQRLPEEARHRRVFEMVEALQEHPRDPNQILIGYSRGLVVIWDLQGSRVLYHFLSSQQLENIWWQRDGRLLVSCHSD
GSYCQWPVSSEAQQPEPLRSLVPYGPFPCKAITRILWLTTRQGLPFTIFQGGMPRASYGDRHCISVIHDGQQTAFDFTSR
VIGFTVLTEADPAATFDDPYALVVLAEEELVVIDLQTAGWPPVQLPYLASLHCSAITCSHHVSNIPLKLWERIIAAGSRQ
NAHFSTMEWPIDGGTSLTPAPPQRDLLLTGHEDGTVRFWDASGVCLRLLYKLSTVRVFLTDTDPNENFSAQGEDEWPPLR
KVGSFDPYSDDPRLGIQKIFLCKYSGYLAVAGTAGQVLVLELNDEAAEQAVEQVEADLLQDQEGYRWKGHERLAARSGPV
RFEPGFQPFVLVQCQPPAVVTSLALHSEWRLVAFGTSHGFGLFDHQQRRQVFVKCTLHPSDQLALEGPLSRVKSLKKSLR
QSFRRMRRSRVSSRKRHPAGPPGEAQEGSAKAERPGLQNMELAPVQRKIEARSAEDSFTGFVRTLYFADTYLKDSSRHCP
SLWAGTNGGTIYAFSLRVPPAERRMDEPVRAEQAKEIQLMHRAPVVGILVLDGHSVPLPEPLEVAHDLSKSPDMQGSHQL
LVVSEEQFKVFTLPKVSAKLKLKLTALEGSRVRRVSVAHFGSRRAEDYGEHHLAVLTNLGDIQVVSLPLLKPQVRYSCIR
REDVSGIASCVFTKYGQGFYLISPSEFERFSLSTKWLVEPRCLVDSAETKNHRPGNGAGPKKAPSRARNSGTQSDGEEKQ
PGLVMEREFTTASENLYFQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ARG n 
1 3   GLU n 
1 4   ARG n 
1 5   LEU n 
1 6   LYS n 
1 7   ARG n 
1 8   ASP n 
1 9   LEU n 
1 10  PHE n 
1 11  GLN n 
1 12  PHE n 
1 13  ASN n 
1 14  LYS n 
1 15  THR n 
1 16  VAL n 
1 17  GLU n 
1 18  HIS n 
1 19  GLY n 
1 20  PHE n 
1 21  PRO n 
1 22  HIS n 
1 23  GLN n 
1 24  PRO n 
1 25  SER n 
1 26  ALA n 
1 27  LEU n 
1 28  GLY n 
1 29  TYR n 
1 30  SER n 
1 31  PRO n 
1 32  SER n 
1 33  LEU n 
1 34  ARG n 
1 35  ILE n 
1 36  LEU n 
1 37  ALA n 
1 38  ILE n 
1 39  GLY n 
1 40  THR n 
1 41  ARG n 
1 42  SER n 
1 43  GLY n 
1 44  ALA n 
1 45  ILE n 
1 46  LYS n 
1 47  LEU n 
1 48  TYR n 
1 49  GLY n 
1 50  ALA n 
1 51  PRO n 
1 52  GLY n 
1 53  VAL n 
1 54  GLU n 
1 55  PHE n 
1 56  MET n 
1 57  GLY n 
1 58  LEU n 
1 59  HIS n 
1 60  GLN n 
1 61  GLU n 
1 62  ASN n 
1 63  ASN n 
1 64  ALA n 
1 65  VAL n 
1 66  THR n 
1 67  GLN n 
1 68  ILE n 
1 69  HIS n 
1 70  LEU n 
1 71  LEU n 
1 72  PRO n 
1 73  GLY n 
1 74  GLN n 
1 75  CYS n 
1 76  GLN n 
1 77  LEU n 
1 78  VAL n 
1 79  THR n 
1 80  LEU n 
1 81  LEU n 
1 82  ASP n 
1 83  ASP n 
1 84  ASN n 
1 85  SER n 
1 86  LEU n 
1 87  HIS n 
1 88  LEU n 
1 89  TRP n 
1 90  SER n 
1 91  LEU n 
1 92  LYS n 
1 93  VAL n 
1 94  LYS n 
1 95  GLY n 
1 96  GLY n 
1 97  ALA n 
1 98  SER n 
1 99  GLU n 
1 100 LEU n 
1 101 GLN n 
1 102 GLU n 
1 103 ASP n 
1 104 GLU n 
1 105 SER n 
1 106 PHE n 
1 107 THR n 
1 108 LEU n 
1 109 ARG n 
1 110 GLY n 
1 111 PRO n 
1 112 PRO n 
1 113 GLY n 
1 114 ALA n 
1 115 ALA n 
1 116 PRO n 
1 117 SER n 
1 118 ALA n 
1 119 THR n 
1 120 GLN n 
1 121 ILE n 
1 122 THR n 
1 123 VAL n 
1 124 VAL n 
1 125 LEU n 
1 126 PRO n 
1 127 HIS n 
1 128 SER n 
1 129 SER n 
1 130 CYS n 
1 131 GLU n 
1 132 LEU n 
1 133 LEU n 
1 134 TYR n 
1 135 LEU n 
1 136 GLY n 
1 137 THR n 
1 138 GLU n 
1 139 SER n 
1 140 GLY n 
1 141 ASN n 
1 142 VAL n 
1 143 PHE n 
1 144 VAL n 
1 145 VAL n 
1 146 GLN n 
1 147 LEU n 
1 148 PRO n 
1 149 ALA n 
1 150 PHE n 
1 151 ARG n 
1 152 ALA n 
1 153 LEU n 
1 154 GLU n 
1 155 ASP n 
1 156 ARG n 
1 157 THR n 
1 158 ILE n 
1 159 SER n 
1 160 SER n 
1 161 ASP n 
1 162 ALA n 
1 163 VAL n 
1 164 LEU n 
1 165 GLN n 
1 166 ARG n 
1 167 LEU n 
1 168 PRO n 
1 169 GLU n 
1 170 GLU n 
1 171 ALA n 
1 172 ARG n 
1 173 HIS n 
1 174 ARG n 
1 175 ARG n 
1 176 VAL n 
1 177 PHE n 
1 178 GLU n 
1 179 MET n 
1 180 VAL n 
1 181 GLU n 
1 182 ALA n 
1 183 LEU n 
1 184 GLN n 
1 185 GLU n 
1 186 HIS n 
1 187 PRO n 
1 188 ARG n 
1 189 ASP n 
1 190 PRO n 
1 191 ASN n 
1 192 GLN n 
1 193 ILE n 
1 194 LEU n 
1 195 ILE n 
1 196 GLY n 
1 197 TYR n 
1 198 SER n 
1 199 ARG n 
1 200 GLY n 
1 201 LEU n 
1 202 VAL n 
1 203 VAL n 
1 204 ILE n 
1 205 TRP n 
1 206 ASP n 
1 207 LEU n 
1 208 GLN n 
1 209 GLY n 
1 210 SER n 
1 211 ARG n 
1 212 VAL n 
1 213 LEU n 
1 214 TYR n 
1 215 HIS n 
1 216 PHE n 
1 217 LEU n 
1 218 SER n 
1 219 SER n 
1 220 GLN n 
1 221 GLN n 
1 222 LEU n 
1 223 GLU n 
1 224 ASN n 
1 225 ILE n 
1 226 TRP n 
1 227 TRP n 
1 228 GLN n 
1 229 ARG n 
1 230 ASP n 
1 231 GLY n 
1 232 ARG n 
1 233 LEU n 
1 234 LEU n 
1 235 VAL n 
1 236 SER n 
1 237 CYS n 
1 238 HIS n 
1 239 SER n 
1 240 ASP n 
1 241 GLY n 
1 242 SER n 
1 243 TYR n 
1 244 CYS n 
1 245 GLN n 
1 246 TRP n 
1 247 PRO n 
1 248 VAL n 
1 249 SER n 
1 250 SER n 
1 251 GLU n 
1 252 ALA n 
1 253 GLN n 
1 254 GLN n 
1 255 PRO n 
1 256 GLU n 
1 257 PRO n 
1 258 LEU n 
1 259 ARG n 
1 260 SER n 
1 261 LEU n 
1 262 VAL n 
1 263 PRO n 
1 264 TYR n 
1 265 GLY n 
1 266 PRO n 
1 267 PHE n 
1 268 PRO n 
1 269 CYS n 
1 270 LYS n 
1 271 ALA n 
1 272 ILE n 
1 273 THR n 
1 274 ARG n 
1 275 ILE n 
1 276 LEU n 
1 277 TRP n 
1 278 LEU n 
1 279 THR n 
1 280 THR n 
1 281 ARG n 
1 282 GLN n 
1 283 GLY n 
1 284 LEU n 
1 285 PRO n 
1 286 PHE n 
1 287 THR n 
1 288 ILE n 
1 289 PHE n 
1 290 GLN n 
1 291 GLY n 
1 292 GLY n 
1 293 MET n 
1 294 PRO n 
1 295 ARG n 
1 296 ALA n 
1 297 SER n 
1 298 TYR n 
1 299 GLY n 
1 300 ASP n 
1 301 ARG n 
1 302 HIS n 
1 303 CYS n 
1 304 ILE n 
1 305 SER n 
1 306 VAL n 
1 307 ILE n 
1 308 HIS n 
1 309 ASP n 
1 310 GLY n 
1 311 GLN n 
1 312 GLN n 
1 313 THR n 
1 314 ALA n 
1 315 PHE n 
1 316 ASP n 
1 317 PHE n 
1 318 THR n 
1 319 SER n 
1 320 ARG n 
1 321 VAL n 
1 322 ILE n 
1 323 GLY n 
1 324 PHE n 
1 325 THR n 
1 326 VAL n 
1 327 LEU n 
1 328 THR n 
1 329 GLU n 
1 330 ALA n 
1 331 ASP n 
1 332 PRO n 
1 333 ALA n 
1 334 ALA n 
1 335 THR n 
1 336 PHE n 
1 337 ASP n 
1 338 ASP n 
1 339 PRO n 
1 340 TYR n 
1 341 ALA n 
1 342 LEU n 
1 343 VAL n 
1 344 VAL n 
1 345 LEU n 
1 346 ALA n 
1 347 GLU n 
1 348 GLU n 
1 349 GLU n 
1 350 LEU n 
1 351 VAL n 
1 352 VAL n 
1 353 ILE n 
1 354 ASP n 
1 355 LEU n 
1 356 GLN n 
1 357 THR n 
1 358 ALA n 
1 359 GLY n 
1 360 TRP n 
1 361 PRO n 
1 362 PRO n 
1 363 VAL n 
1 364 GLN n 
1 365 LEU n 
1 366 PRO n 
1 367 TYR n 
1 368 LEU n 
1 369 ALA n 
1 370 SER n 
1 371 LEU n 
1 372 HIS n 
1 373 CYS n 
1 374 SER n 
1 375 ALA n 
1 376 ILE n 
1 377 THR n 
1 378 CYS n 
1 379 SER n 
1 380 HIS n 
1 381 HIS n 
1 382 VAL n 
1 383 SER n 
1 384 ASN n 
1 385 ILE n 
1 386 PRO n 
1 387 LEU n 
1 388 LYS n 
1 389 LEU n 
1 390 TRP n 
1 391 GLU n 
1 392 ARG n 
1 393 ILE n 
1 394 ILE n 
1 395 ALA n 
1 396 ALA n 
1 397 GLY n 
1 398 SER n 
1 399 ARG n 
1 400 GLN n 
1 401 ASN n 
1 402 ALA n 
1 403 HIS n 
1 404 PHE n 
1 405 SER n 
1 406 THR n 
1 407 MET n 
1 408 GLU n 
1 409 TRP n 
1 410 PRO n 
1 411 ILE n 
1 412 ASP n 
1 413 GLY n 
1 414 GLY n 
1 415 THR n 
1 416 SER n 
1 417 LEU n 
1 418 THR n 
1 419 PRO n 
1 420 ALA n 
1 421 PRO n 
1 422 PRO n 
1 423 GLN n 
1 424 ARG n 
1 425 ASP n 
1 426 LEU n 
1 427 LEU n 
1 428 LEU n 
1 429 THR n 
1 430 GLY n 
1 431 HIS n 
1 432 GLU n 
1 433 ASP n 
1 434 GLY n 
1 435 THR n 
1 436 VAL n 
1 437 ARG n 
1 438 PHE n 
1 439 TRP n 
1 440 ASP n 
1 441 ALA n 
1 442 SER n 
1 443 GLY n 
1 444 VAL n 
1 445 CYS n 
1 446 LEU n 
1 447 ARG n 
1 448 LEU n 
1 449 LEU n 
1 450 TYR n 
1 451 LYS n 
1 452 LEU n 
1 453 SER n 
1 454 THR n 
1 455 VAL n 
1 456 ARG n 
1 457 VAL n 
1 458 PHE n 
1 459 LEU n 
1 460 THR n 
1 461 ASP n 
1 462 THR n 
1 463 ASP n 
1 464 PRO n 
1 465 ASN n 
1 466 GLU n 
1 467 ASN n 
1 468 PHE n 
1 469 SER n 
1 470 ALA n 
1 471 GLN n 
1 472 GLY n 
1 473 GLU n 
1 474 ASP n 
1 475 GLU n 
1 476 TRP n 
1 477 PRO n 
1 478 PRO n 
1 479 LEU n 
1 480 ARG n 
1 481 LYS n 
1 482 VAL n 
1 483 GLY n 
1 484 SER n 
1 485 PHE n 
1 486 ASP n 
1 487 PRO n 
1 488 TYR n 
1 489 SER n 
1 490 ASP n 
1 491 ASP n 
1 492 PRO n 
1 493 ARG n 
1 494 LEU n 
1 495 GLY n 
1 496 ILE n 
1 497 GLN n 
1 498 LYS n 
1 499 ILE n 
1 500 PHE n 
1 501 LEU n 
1 502 CYS n 
1 503 LYS n 
1 504 TYR n 
1 505 SER n 
1 506 GLY n 
1 507 TYR n 
1 508 LEU n 
1 509 ALA n 
1 510 VAL n 
1 511 ALA n 
1 512 GLY n 
1 513 THR n 
1 514 ALA n 
1 515 GLY n 
1 516 GLN n 
1 517 VAL n 
1 518 LEU n 
1 519 VAL n 
1 520 LEU n 
1 521 GLU n 
1 522 LEU n 
1 523 ASN n 
1 524 ASP n 
1 525 GLU n 
1 526 ALA n 
1 527 ALA n 
1 528 GLU n 
1 529 GLN n 
1 530 ALA n 
1 531 VAL n 
1 532 GLU n 
1 533 GLN n 
1 534 VAL n 
1 535 GLU n 
1 536 ALA n 
1 537 ASP n 
1 538 LEU n 
1 539 LEU n 
1 540 GLN n 
1 541 ASP n 
1 542 GLN n 
1 543 GLU n 
1 544 GLY n 
1 545 TYR n 
1 546 ARG n 
1 547 TRP n 
1 548 LYS n 
1 549 GLY n 
1 550 HIS n 
1 551 GLU n 
1 552 ARG n 
1 553 LEU n 
1 554 ALA n 
1 555 ALA n 
1 556 ARG n 
1 557 SER n 
1 558 GLY n 
1 559 PRO n 
1 560 VAL n 
1 561 ARG n 
1 562 PHE n 
1 563 GLU n 
1 564 PRO n 
1 565 GLY n 
1 566 PHE n 
1 567 GLN n 
1 568 PRO n 
1 569 PHE n 
1 570 VAL n 
1 571 LEU n 
1 572 VAL n 
1 573 GLN n 
1 574 CYS n 
1 575 GLN n 
1 576 PRO n 
1 577 PRO n 
1 578 ALA n 
1 579 VAL n 
1 580 VAL n 
1 581 THR n 
1 582 SER n 
1 583 LEU n 
1 584 ALA n 
1 585 LEU n 
1 586 HIS n 
1 587 SER n 
1 588 GLU n 
1 589 TRP n 
1 590 ARG n 
1 591 LEU n 
1 592 VAL n 
1 593 ALA n 
1 594 PHE n 
1 595 GLY n 
1 596 THR n 
1 597 SER n 
1 598 HIS n 
1 599 GLY n 
1 600 PHE n 
1 601 GLY n 
1 602 LEU n 
1 603 PHE n 
1 604 ASP n 
1 605 HIS n 
1 606 GLN n 
1 607 GLN n 
1 608 ARG n 
1 609 ARG n 
1 610 GLN n 
1 611 VAL n 
1 612 PHE n 
1 613 VAL n 
1 614 LYS n 
1 615 CYS n 
1 616 THR n 
1 617 LEU n 
1 618 HIS n 
1 619 PRO n 
1 620 SER n 
1 621 ASP n 
1 622 GLN n 
1 623 LEU n 
1 624 ALA n 
1 625 LEU n 
1 626 GLU n 
1 627 GLY n 
1 628 PRO n 
1 629 LEU n 
1 630 SER n 
1 631 ARG n 
1 632 VAL n 
1 633 LYS n 
1 634 SER n 
1 635 LEU n 
1 636 LYS n 
1 637 LYS n 
1 638 SER n 
1 639 LEU n 
1 640 ARG n 
1 641 GLN n 
1 642 SER n 
1 643 PHE n 
1 644 ARG n 
1 645 ARG n 
1 646 MET n 
1 647 ARG n 
1 648 ARG n 
1 649 SER n 
1 650 ARG n 
1 651 VAL n 
1 652 SER n 
1 653 SER n 
1 654 ARG n 
1 655 LYS n 
1 656 ARG n 
1 657 HIS n 
1 658 PRO n 
1 659 ALA n 
1 660 GLY n 
1 661 PRO n 
1 662 PRO n 
1 663 GLY n 
1 664 GLU n 
1 665 ALA n 
1 666 GLN n 
1 667 GLU n 
1 668 GLY n 
1 669 SER n 
1 670 ALA n 
1 671 LYS n 
1 672 ALA n 
1 673 GLU n 
1 674 ARG n 
1 675 PRO n 
1 676 GLY n 
1 677 LEU n 
1 678 GLN n 
1 679 ASN n 
1 680 MET n 
1 681 GLU n 
1 682 LEU n 
1 683 ALA n 
1 684 PRO n 
1 685 VAL n 
1 686 GLN n 
1 687 ARG n 
1 688 LYS n 
1 689 ILE n 
1 690 GLU n 
1 691 ALA n 
1 692 ARG n 
1 693 SER n 
1 694 ALA n 
1 695 GLU n 
1 696 ASP n 
1 697 SER n 
1 698 PHE n 
1 699 THR n 
1 700 GLY n 
1 701 PHE n 
1 702 VAL n 
1 703 ARG n 
1 704 THR n 
1 705 LEU n 
1 706 TYR n 
1 707 PHE n 
1 708 ALA n 
1 709 ASP n 
1 710 THR n 
1 711 TYR n 
1 712 LEU n 
1 713 LYS n 
1 714 ASP n 
1 715 SER n 
1 716 SER n 
1 717 ARG n 
1 718 HIS n 
1 719 CYS n 
1 720 PRO n 
1 721 SER n 
1 722 LEU n 
1 723 TRP n 
1 724 ALA n 
1 725 GLY n 
1 726 THR n 
1 727 ASN n 
1 728 GLY n 
1 729 GLY n 
1 730 THR n 
1 731 ILE n 
1 732 TYR n 
1 733 ALA n 
1 734 PHE n 
1 735 SER n 
1 736 LEU n 
1 737 ARG n 
1 738 VAL n 
1 739 PRO n 
1 740 PRO n 
1 741 ALA n 
1 742 GLU n 
1 743 ARG n 
1 744 ARG n 
1 745 MET n 
1 746 ASP n 
1 747 GLU n 
1 748 PRO n 
1 749 VAL n 
1 750 ARG n 
1 751 ALA n 
1 752 GLU n 
1 753 GLN n 
1 754 ALA n 
1 755 LYS n 
1 756 GLU n 
1 757 ILE n 
1 758 GLN n 
1 759 LEU n 
1 760 MET n 
1 761 HIS n 
1 762 ARG n 
1 763 ALA n 
1 764 PRO n 
1 765 VAL n 
1 766 VAL n 
1 767 GLY n 
1 768 ILE n 
1 769 LEU n 
1 770 VAL n 
1 771 LEU n 
1 772 ASP n 
1 773 GLY n 
1 774 HIS n 
1 775 SER n 
1 776 VAL n 
1 777 PRO n 
1 778 LEU n 
1 779 PRO n 
1 780 GLU n 
1 781 PRO n 
1 782 LEU n 
1 783 GLU n 
1 784 VAL n 
1 785 ALA n 
1 786 HIS n 
1 787 ASP n 
1 788 LEU n 
1 789 SER n 
1 790 LYS n 
1 791 SER n 
1 792 PRO n 
1 793 ASP n 
1 794 MET n 
1 795 GLN n 
1 796 GLY n 
1 797 SER n 
1 798 HIS n 
1 799 GLN n 
1 800 LEU n 
1 801 LEU n 
1 802 VAL n 
1 803 VAL n 
1 804 SER n 
1 805 GLU n 
1 806 GLU n 
1 807 GLN n 
1 808 PHE n 
1 809 LYS n 
1 810 VAL n 
1 811 PHE n 
1 812 THR n 
1 813 LEU n 
1 814 PRO n 
1 815 LYS n 
1 816 VAL n 
1 817 SER n 
1 818 ALA n 
1 819 LYS n 
1 820 LEU n 
1 821 LYS n 
1 822 LEU n 
1 823 LYS n 
1 824 LEU n 
1 825 THR n 
1 826 ALA n 
1 827 LEU n 
1 828 GLU n 
1 829 GLY n 
1 830 SER n 
1 831 ARG n 
1 832 VAL n 
1 833 ARG n 
1 834 ARG n 
1 835 VAL n 
1 836 SER n 
1 837 VAL n 
1 838 ALA n 
1 839 HIS n 
1 840 PHE n 
1 841 GLY n 
1 842 SER n 
1 843 ARG n 
1 844 ARG n 
1 845 ALA n 
1 846 GLU n 
1 847 ASP n 
1 848 TYR n 
1 849 GLY n 
1 850 GLU n 
1 851 HIS n 
1 852 HIS n 
1 853 LEU n 
1 854 ALA n 
1 855 VAL n 
1 856 LEU n 
1 857 THR n 
1 858 ASN n 
1 859 LEU n 
1 860 GLY n 
1 861 ASP n 
1 862 ILE n 
1 863 GLN n 
1 864 VAL n 
1 865 VAL n 
1 866 SER n 
1 867 LEU n 
1 868 PRO n 
1 869 LEU n 
1 870 LEU n 
1 871 LYS n 
1 872 PRO n 
1 873 GLN n 
1 874 VAL n 
1 875 ARG n 
1 876 TYR n 
1 877 SER n 
1 878 CYS n 
1 879 ILE n 
1 880 ARG n 
1 881 ARG n 
1 882 GLU n 
1 883 ASP n 
1 884 VAL n 
1 885 SER n 
1 886 GLY n 
1 887 ILE n 
1 888 ALA n 
1 889 SER n 
1 890 CYS n 
1 891 VAL n 
1 892 PHE n 
1 893 THR n 
1 894 LYS n 
1 895 TYR n 
1 896 GLY n 
1 897 GLN n 
1 898 GLY n 
1 899 PHE n 
1 900 TYR n 
1 901 LEU n 
1 902 ILE n 
1 903 SER n 
1 904 PRO n 
1 905 SER n 
1 906 GLU n 
1 907 PHE n 
1 908 GLU n 
1 909 ARG n 
1 910 PHE n 
1 911 SER n 
1 912 LEU n 
1 913 SER n 
1 914 THR n 
1 915 LYS n 
1 916 TRP n 
1 917 LEU n 
1 918 VAL n 
1 919 GLU n 
1 920 PRO n 
1 921 ARG n 
1 922 CYS n 
1 923 LEU n 
1 924 VAL n 
1 925 ASP n 
1 926 SER n 
1 927 ALA n 
1 928 GLU n 
1 929 THR n 
1 930 LYS n 
1 931 ASN n 
1 932 HIS n 
1 933 ARG n 
1 934 PRO n 
1 935 GLY n 
1 936 ASN n 
1 937 GLY n 
1 938 ALA n 
1 939 GLY n 
1 940 PRO n 
1 941 LYS n 
1 942 LYS n 
1 943 ALA n 
1 944 PRO n 
1 945 SER n 
1 946 ARG n 
1 947 ALA n 
1 948 ARG n 
1 949 ASN n 
1 950 SER n 
1 951 GLY n 
1 952 THR n 
1 953 GLN n 
1 954 SER n 
1 955 ASP n 
1 956 GLY n 
1 957 GLU n 
1 958 GLU n 
1 959 LYS n 
1 960 GLN n 
1 961 PRO n 
1 962 GLY n 
1 963 LEU n 
1 964 VAL n 
1 965 MET n 
1 966 GLU n 
1 967 ARG n 
1 968 GLU n 
1 969 PHE n 
1 970 THR n 
1 971 THR n 
1 972 ALA n 
1 973 SER n 
1 974 GLU n 
1 975 ASN n 
1 976 LEU n 
1 977 TYR n 
1 978 PHE n 
1 979 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   979 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 LLGL2 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 SF9 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    L2GL2_HUMAN 
_struct_ref.pdbx_db_accession          Q6P1M3 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;RERLKRDLFQFNKTVEHGFPHQPSALGYSPSLRILAIGTRSGAIKLYGAPGVEFMGLHQENNAVTQIHLLPGQCQLVTLL
DDNSLHLWSLKVKGGASELQEDESFTLRGPPGAAPSATQITVVLPHSSCELLYLGTESGNVFVVQLPAFRALEDRTISSD
AVLQRLPEEARHRRVFEMVEALQEHPRDPNQILIGYSRGLVVIWDLQGSRVLYHFLSSQQLENIWWQRDGRLLVSCHSDG
SYCQWPVSSEAQQPEPLRSLVPYGPFPCKAITRILWLTTRQGLPFTIFQGGMPRASYGDRHCISVIHDGQQTAFDFTSRV
IGFTVLTEADPAATFDDPYALVVLAEEELVVIDLQTAGWPPVQLPYLASLHCSAITCSHHVSNIPLKLWERIIAAGSRQN
AHFSTMEWPIDGGTSLTPAPPQRDLLLTGHEDGTVRFWDASGVCLRLLYKLSTVRVFLTDTDPNENFSAQGEDEWPPLRK
VGSFDPYSDDPRLGIQKIFLCKYSGYLAVAGTAGQVLVLELNDEAAEQAVEQVEADLLQDQEGYRWKGHERLAARSGPVR
FEPGFQPFVLVQCQPPAVVTSLALHSEWRLVAFGTSHGFGLFDHQQRRQVFVKCTLHPSDQLALEGPLSRVKSLKKSLRQ
SFRRMRRSRVSSRKRHPAGPPGEAQEGSAKAERPGLQNMELAPVQRKIEARSAEDSFTGFVRTLYFADTYLKDSSRHCPS
LWAGTNGGTIYAFSLRVPPAERRMDEPVRAEQAKEIQLMHRAPVVGILVLDGHSVPLPEPLEVAHDLSKSPDMQGSHQLL
VVSEEQFKVFTLPKVSAKLKLKLTALEGSRVRRVSVAHFGSRRAEDYGEHHLAVLTNLGDIQVVSLPLLKPQVRYSCIRR
EDVSGIASCVFTKYGQGFYLISPSEFERFSLSTKWLVEPRCLVDSAETKNHRPGNGAGPKKAPSRARNSGTQSDGEEKQP
GLVMER
;
_struct_ref.pdbx_align_begin           13 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              6N8Q 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 2 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 967 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q6P1M3 
_struct_ref_seq.db_align_beg                  13 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  978 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       13 
_struct_ref_seq.pdbx_auth_seq_align_end       978 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6N8Q MET A 1   ? UNP Q6P1M3 ? ? 'initiating methionine' 12  1  
1 6N8Q GLU A 968 ? UNP Q6P1M3 ? ? 'expression tag'        979 2  
1 6N8Q PHE A 969 ? UNP Q6P1M3 ? ? 'expression tag'        980 3  
1 6N8Q THR A 970 ? UNP Q6P1M3 ? ? 'expression tag'        981 4  
1 6N8Q THR A 971 ? UNP Q6P1M3 ? ? 'expression tag'        982 5  
1 6N8Q ALA A 972 ? UNP Q6P1M3 ? ? 'expression tag'        983 6  
1 6N8Q SER A 973 ? UNP Q6P1M3 ? ? 'expression tag'        984 7  
1 6N8Q GLU A 974 ? UNP Q6P1M3 ? ? 'expression tag'        985 8  
1 6N8Q ASN A 975 ? UNP Q6P1M3 ? ? 'expression tag'        986 9  
1 6N8Q LEU A 976 ? UNP Q6P1M3 ? ? 'expression tag'        987 10 
1 6N8Q TYR A 977 ? UNP Q6P1M3 ? ? 'expression tag'        988 11 
1 6N8Q PHE A 978 ? UNP Q6P1M3 ? ? 'expression tag'        989 12 
1 6N8Q GLN A 979 ? UNP Q6P1M3 ? ? 'expression tag'        990 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ?                               'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6N8Q 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.31 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         46.77 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              6.0 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295.15 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '18-21 % PEG 2000 MME, 80-100 mM SPG pH 6.0' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS PILATUS3 S 6M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-07-25 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.0055 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'SSRL BEAMLINE BL12-2' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.0055 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL12-2 
_diffrn_source.pdbx_synchrotron_site       SSRL 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6N8Q 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.2 
_reflns.d_resolution_low                 39.220 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       48731 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             95.300 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.400 
_reflns.pdbx_Rmerge_I_obs                0.112 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            7.800 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.125 
_reflns.pdbx_Rpim_I_all                  0.054 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     0.998 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.200 
_reflns_shell.d_res_low                   2.260 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         ? 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           3566 
_reflns_shell.percent_possible_all        81.000 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                3.398 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             5.200 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             3.776 
_reflns_shell.pdbx_Rpim_I_all             1.610 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.352 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                142.040 
_refine.B_iso_mean                               46.8813 
_refine.B_iso_min                                12.120 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6N8Q 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.2 
_refine.ls_d_res_low                             39.2160 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     34245 
_refine.ls_number_reflns_R_free                  1706 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    66.5200 
_refine.ls_percent_reflns_R_free                 4.9800 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2074 
_refine.ls_R_factor_R_free                       0.2262 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2064 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 28.4600 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.2700 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       2.2 
_refine_hist.d_res_low                        39.2160 
_refine_hist.pdbx_number_atoms_ligand         7 
_refine_hist.number_atoms_solvent             223 
_refine_hist.number_atoms_total               6671 
_refine_hist.pdbx_number_residues_total       829 
_refine_hist.pdbx_B_iso_mean_ligand           29.29 
_refine_hist.pdbx_B_iso_mean_solvent          38.42 
_refine_hist.pdbx_number_atoms_protein        6441 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.1988 2.2635  946  . 59  887  22.0000 . . . 0.3427 0.0000 0.3084 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 2.2635 2.3366  1258 . 55  1203 30.0000 . . . 0.3660 0.0000 0.2967 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 2.3366 2.4201  1543 . 69  1474 37.0000 . . . 0.3238 0.0000 0.2931 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 2.4201 2.5169  1847 . 90  1757 44.0000 . . . 0.3037 0.0000 0.2969 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 2.5169 2.6315  2210 . 108 2102 52.0000 . . . 0.3054 0.0000 0.2911 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 2.6315 2.7702  2761 . 138 2623 65.0000 . . . 0.2984 0.0000 0.2916 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 2.7702 2.9437  3339 . 156 3183 78.0000 . . . 0.2896 0.0000 0.2776 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 2.9437 3.1709  3850 . 177 3673 90.0000 . . . 0.3249 0.0000 0.2570 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 3.1709 3.4898  4089 . 194 3895 95.0000 . . . 0.2383 0.0000 0.2179 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 3.4898 3.9943  4179 . 210 3969 97.0000 . . . 0.2101 0.0000 0.1892 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 3.9943 5.0308  4095 . 240 3855 94.0000 . . . 0.1737 0.0000 0.1503 . . . . . . 12 . . . 
'X-RAY DIFFRACTION' 5.0308 39.2217 4128 . 210 3918 92.0000 . . . 0.1867 0.0000 0.1685 . . . . . . 12 . . . 
# 
_struct.entry_id                     6N8Q 
_struct.title                        
'Crystal structure of the human cell polarity protein Lethal Giant Larvae 2 (Lgl2). Unphosphorylated, crystal form 2.' 
_struct.pdbx_descriptor              'Lethal(2) giant larvae protein homolog 2' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6N8Q 
_struct_keywords.text            'Lgl, Polarity, beta propeller, LIPID BINDING PROTEIN' 
_struct_keywords.pdbx_keywords   'LIPID BINDING PROTEIN' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ARG A 2   ? LEU A 9   ? ARG A 13  LEU A 20  1 ? 8  
HELX_P HELX_P2  AA2 ALA A 115 ? GLN A 120 ? ALA A 126 GLN A 131 1 ? 6  
HELX_P HELX_P3  AA3 LEU A 153 ? THR A 157 ? LEU A 164 THR A 168 5 ? 5  
HELX_P HELX_P4  AA4 SER A 159 ? ARG A 166 ? SER A 170 ARG A 177 1 ? 8  
HELX_P HELX_P5  AA5 PRO A 168 ? ARG A 172 ? PRO A 179 ARG A 183 5 ? 5  
HELX_P HELX_P6  AA6 PRO A 294 ? GLY A 299 ? PRO A 305 GLY A 310 1 ? 6  
HELX_P HELX_P7  AA7 PRO A 386 ? GLN A 400 ? PRO A 397 GLN A 411 1 ? 15 
HELX_P HELX_P8  AA8 VAL A 455 ? PHE A 458 ? VAL A 466 PHE A 469 5 ? 4  
HELX_P HELX_P9  AA9 ASP A 491 ? LEU A 494 ? ASP A 502 LEU A 505 5 ? 4  
HELX_P HELX_P10 AB1 ALA A 741 ? MET A 745 ? ALA A 752 MET A 756 5 ? 5  
HELX_P HELX_P11 AB2 ASP A 787 ? SER A 791 ? ASP A 798 SER A 802 5 ? 5  
HELX_P HELX_P12 AB3 LEU A 824 ? GLY A 829 ? LEU A 835 GLY A 840 1 ? 6  
HELX_P HELX_P13 AB4 ASP A 883 ? CYS A 890 ? ASP A 894 CYS A 901 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 147 A . ? LEU 158 A PRO 148 A ? PRO 159 A 1 1.61  
2 TRP 476 A . ? TRP 487 A PRO 477 A ? PRO 488 A 1 -3.24 
3 GLN 575 A . ? GLN 586 A PRO 576 A ? PRO 587 A 1 0.86  
4 LEU 813 A . ? LEU 824 A PRO 814 A ? PRO 825 A 1 5.08  
5 LEU 867 A . ? LEU 878 A PRO 868 A ? PRO 879 A 1 0.55  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 4 ? 
AA2 ? 4 ? 
AA3 ? 4 ? 
AA4 ? 3 ? 
AA5 ? 4 ? 
AA6 ? 4 ? 
AA7 ? 5 ? 
AA8 ? 3 ? 
AA9 ? 4 ? 
AB1 ? 2 ? 
AB2 ? 5 ? 
AB3 ? 4 ? 
AB4 ? 4 ? 
AB5 ? 4 ? 
AB6 ? 4 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
AA2 3 4 ? anti-parallel 
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA3 3 4 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? anti-parallel 
AA5 1 2 ? anti-parallel 
AA5 2 3 ? anti-parallel 
AA5 3 4 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? anti-parallel 
AA6 3 4 ? anti-parallel 
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA7 4 5 ? parallel      
AA8 1 2 ? anti-parallel 
AA8 2 3 ? anti-parallel 
AA9 1 2 ? anti-parallel 
AA9 2 3 ? anti-parallel 
AA9 3 4 ? anti-parallel 
AB1 1 2 ? anti-parallel 
AB2 1 2 ? anti-parallel 
AB2 2 3 ? anti-parallel 
AB2 3 4 ? anti-parallel 
AB2 4 5 ? parallel      
AB3 1 2 ? anti-parallel 
AB3 2 3 ? anti-parallel 
AB3 3 4 ? anti-parallel 
AB4 1 2 ? anti-parallel 
AB4 2 3 ? anti-parallel 
AB4 3 4 ? anti-parallel 
AB5 1 2 ? anti-parallel 
AB5 2 3 ? anti-parallel 
AB5 3 4 ? anti-parallel 
AB6 1 2 ? anti-parallel 
AB6 2 3 ? anti-parallel 
AB6 3 4 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 PHE A 10  ? GLY A 19  ? PHE A 21  GLY A 30  
AA1 2 GLU A 906 ? SER A 913 ? GLU A 917 SER A 924 
AA1 3 GLN A 897 ? SER A 903 ? GLN A 908 SER A 914 
AA1 4 VAL A 891 ? PHE A 892 ? VAL A 902 PHE A 903 
AA2 1 PRO A 24  ? SER A 30  ? PRO A 35  SER A 41  
AA2 2 ILE A 35  ? THR A 40  ? ILE A 46  THR A 51  
AA2 3 ALA A 44  ? TYR A 48  ? ALA A 55  TYR A 59  
AA2 4 GLU A 54  ? LEU A 58  ? GLU A 65  LEU A 69  
AA3 1 VAL A 65  ? LEU A 70  ? VAL A 76  LEU A 81  
AA3 2 GLN A 76  ? LEU A 81  ? GLN A 87  LEU A 92  
AA3 3 SER A 85  ? LYS A 94  ? SER A 96  LYS A 105 
AA3 4 ALA A 97  ? THR A 107 ? ALA A 108 THR A 118 
AA4 1 ILE A 121 ? PRO A 126 ? ILE A 132 PRO A 137 
AA4 2 LEU A 132 ? THR A 137 ? LEU A 143 THR A 148 
AA4 3 VAL A 142 ? GLN A 146 ? VAL A 153 GLN A 157 
AA5 1 VAL A 180 ? HIS A 186 ? VAL A 191 HIS A 197 
AA5 2 ASP A 189 ? TYR A 197 ? ASP A 200 TYR A 208 
AA5 3 LEU A 201 ? ASP A 206 ? LEU A 212 ASP A 217 
AA5 4 ARG A 211 ? LEU A 217 ? ARG A 222 LEU A 228 
AA6 1 LEU A 222 ? TRP A 227 ? LEU A 233 TRP A 238 
AA6 2 LEU A 233 ? HIS A 238 ? LEU A 244 HIS A 249 
AA6 3 TYR A 243 ? PRO A 247 ? TYR A 254 PRO A 258 
AA6 4 ARG A 259 ? LEU A 261 ? ARG A 270 LEU A 272 
AA7 1 ILE A 272 ? LEU A 278 ? ILE A 283 LEU A 289 
AA7 2 PHE A 286 ? GLY A 291 ? PHE A 297 GLY A 302 
AA7 3 HIS A 302 ? HIS A 308 ? HIS A 313 HIS A 319 
AA7 4 GLN A 311 ? PHE A 317 ? GLN A 322 PHE A 328 
AA7 5 LEU A 479 ? LYS A 481 ? LEU A 490 LYS A 492 
AA8 1 VAL A 321 ? THR A 328 ? VAL A 332 THR A 339 
AA8 2 PRO A 339 ? ALA A 346 ? PRO A 350 ALA A 357 
AA8 3 LEU A 350 ? ASP A 354 ? LEU A 361 ASP A 365 
AA9 1 ILE A 376 ? VAL A 382 ? ILE A 387 VAL A 393 
AA9 2 LEU A 426 ? HIS A 431 ? LEU A 437 HIS A 442 
AA9 3 THR A 435 ? ASP A 440 ? THR A 446 ASP A 451 
AA9 4 ARG A 447 ? SER A 453 ? ARG A 458 SER A 464 
AB1 1 THR A 415 ? SER A 416 ? THR A 426 SER A 427 
AB1 2 CYS A 922 ? LEU A 923 ? CYS A 933 LEU A 934 
AB2 1 ILE A 496 ? LEU A 501 ? ILE A 507 LEU A 512 
AB2 2 TYR A 507 ? GLY A 512 ? TYR A 518 GLY A 523 
AB2 3 GLN A 516 ? ASN A 523 ? GLN A 527 ASN A 534 
AB2 4 GLY A 565 ? GLN A 575 ? GLY A 576 GLN A 586 
AB2 5 GLU A 532 ? ASP A 537 ? GLU A 543 ASP A 548 
AB3 1 SER A 582 ? HIS A 586 ? SER A 593 HIS A 597 
AB3 2 LEU A 591 ? GLY A 595 ? LEU A 602 GLY A 606 
AB3 3 GLY A 599 ? ASP A 604 ? GLY A 610 ASP A 615 
AB3 4 ARG A 609 ? CYS A 615 ? ARG A 620 CYS A 626 
AB4 1 VAL A 702 ? THR A 710 ? VAL A 713 THR A 721 
AB4 2 CYS A 719 ? THR A 726 ? CYS A 730 THR A 737 
AB4 3 THR A 730 ? ARG A 737 ? THR A 741 ARG A 748 
AB4 4 ARG A 750 ? GLN A 758 ? ARG A 761 GLN A 769 
AB5 1 VAL A 765 ? LEU A 771 ? VAL A 776 LEU A 782 
AB5 2 GLN A 799 ? SER A 804 ? GLN A 810 SER A 815 
AB5 3 GLN A 807 ? THR A 812 ? GLN A 818 THR A 823 
AB5 4 SER A 817 ? LYS A 823 ? SER A 828 LYS A 834 
AB6 1 VAL A 832 ? PHE A 840 ? VAL A 843 PHE A 851 
AB6 2 GLU A 850 ? THR A 857 ? GLU A 861 THR A 868 
AB6 3 ASP A 861 ? SER A 866 ? ASP A 872 SER A 877 
AB6 4 PRO A 872 ? SER A 877 ? PRO A 883 SER A 888 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N HIS A 18  ? N HIS A 29  O PHE A 907 ? O PHE A 918 
AA1 2 3 O GLU A 908 ? O GLU A 919 N TYR A 900 ? N TYR A 911 
AA1 3 4 O PHE A 899 ? O PHE A 910 N VAL A 891 ? N VAL A 902 
AA2 1 2 N SER A 25  ? N SER A 36  O GLY A 39  ? O GLY A 50  
AA2 2 3 N LEU A 36  ? N LEU A 47  O TYR A 48  ? O TYR A 59  
AA2 3 4 N LEU A 47  ? N LEU A 58  O PHE A 55  ? O PHE A 66  
AA3 1 2 N HIS A 69  ? N HIS A 80  O VAL A 78  ? O VAL A 89  
AA3 2 3 N LEU A 77  ? N LEU A 88  O TRP A 89  ? O TRP A 100 
AA3 3 4 N SER A 90  ? N SER A 101 O GLN A 101 ? O GLN A 112 
AA4 1 2 N THR A 122 ? N THR A 133 O GLY A 136 ? O GLY A 147 
AA4 2 3 N LEU A 135 ? N LEU A 146 O PHE A 143 ? O PHE A 154 
AA5 1 2 N GLN A 184 ? N GLN A 195 O LEU A 194 ? O LEU A 205 
AA5 2 3 N ILE A 193 ? N ILE A 204 O TRP A 205 ? O TRP A 216 
AA5 3 4 N ASP A 206 ? N ASP A 217 O ARG A 211 ? O ARG A 222 
AA6 1 2 N GLU A 223 ? N GLU A 234 O CYS A 237 ? O CYS A 248 
AA6 2 3 N LEU A 234 ? N LEU A 245 O TRP A 246 ? O TRP A 257 
AA6 3 4 N TYR A 243 ? N TYR A 254 O LEU A 261 ? O LEU A 272 
AA7 1 2 N LEU A 278 ? N LEU A 289 O PHE A 286 ? O PHE A 297 
AA7 2 3 N PHE A 289 ? N PHE A 300 O SER A 305 ? O SER A 316 
AA7 3 4 N HIS A 308 ? N HIS A 319 O GLN A 311 ? O GLN A 322 
AA7 4 5 N ASP A 316 ? N ASP A 327 O ARG A 480 ? O ARG A 491 
AA8 1 2 N GLY A 323 ? N GLY A 334 O LEU A 345 ? O LEU A 356 
AA8 2 3 N VAL A 344 ? N VAL A 355 O VAL A 351 ? O VAL A 362 
AA9 1 2 N THR A 377 ? N THR A 388 O GLY A 430 ? O GLY A 441 
AA9 2 3 N LEU A 427 ? N LEU A 438 O TRP A 439 ? O TRP A 450 
AA9 3 4 N PHE A 438 ? N PHE A 449 O TYR A 450 ? O TYR A 461 
AB1 1 2 N THR A 415 ? N THR A 426 O LEU A 923 ? O LEU A 934 
AB2 1 2 N GLN A 497 ? N GLN A 508 O ALA A 511 ? O ALA A 522 
AB2 2 3 N LEU A 508 ? N LEU A 519 O LEU A 520 ? O LEU A 531 
AB2 3 4 N VAL A 517 ? N VAL A 528 O VAL A 572 ? O VAL A 583 
AB2 4 5 O LEU A 571 ? O LEU A 582 N GLU A 532 ? N GLU A 543 
AB3 1 2 N ALA A 584 ? N ALA A 595 O ALA A 593 ? O ALA A 604 
AB3 2 3 N VAL A 592 ? N VAL A 603 O PHE A 603 ? O PHE A 614 
AB3 3 4 N PHE A 600 ? N PHE A 611 O LYS A 614 ? O LYS A 625 
AB4 1 2 N ALA A 708 ? N ALA A 719 O SER A 721 ? O SER A 732 
AB4 2 3 N ALA A 724 ? N ALA A 735 O TYR A 732 ? O TYR A 743 
AB4 3 4 N ILE A 731 ? N ILE A 742 O ILE A 757 ? O ILE A 768 
AB5 1 2 N LEU A 769 ? N LEU A 780 O LEU A 801 ? O LEU A 812 
AB5 2 3 N SER A 804 ? N SER A 815 O GLN A 807 ? O GLN A 818 
AB5 3 4 N VAL A 810 ? N VAL A 821 O LYS A 819 ? O LYS A 830 
AB6 1 2 N SER A 836 ? N SER A 847 O ALA A 854 ? O ALA A 865 
AB6 2 3 N VAL A 855 ? N VAL A 866 O GLN A 863 ? O GLN A 874 
AB6 3 4 N VAL A 864 ? N VAL A 875 O GLN A 873 ? O GLN A 884 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A CL  1001 ? 6 'binding site for residue CL A 1001'  
AC2 Software A GOL 1002 ? 9 'binding site for residue GOL A 1002' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 6 GLN A 11  ? GLN A 22   . ? 2_757 ? 
2  AC1 6 GLN A 11  ? GLN A 22   . ? 1_555 ? 
3  AC1 6 PHE A 12  ? PHE A 23   . ? 2_757 ? 
4  AC1 6 PHE A 12  ? PHE A 23   . ? 1_555 ? 
5  AC1 6 HOH D .   ? HOH A 1116 . ? 2_757 ? 
6  AC1 6 HOH D .   ? HOH A 1116 . ? 1_555 ? 
7  AC2 9 GLU A 17  ? GLU A 28   . ? 1_555 ? 
8  AC2 9 HIS A 18  ? HIS A 29   . ? 1_555 ? 
9  AC2 9 GLY A 19  ? GLY A 30   . ? 1_555 ? 
10 AC2 9 GLU A 54  ? GLU A 65   . ? 1_555 ? 
11 AC2 9 TYR A 367 ? TYR A 378  . ? 1_555 ? 
12 AC2 9 LEU A 368 ? LEU A 379  . ? 1_555 ? 
13 AC2 9 VAL A 444 ? VAL A 455  . ? 1_555 ? 
14 AC2 9 CYS A 445 ? CYS A 456  . ? 1_555 ? 
15 AC2 9 LEU A 446 ? LEU A 457  . ? 1_555 ? 
# 
_atom_sites.entry_id                    6N8Q 
_atom_sites.fract_transf_matrix[1][1]   0.005730 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.002795 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.021386 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.008081 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 1   ? 102.946 -44.642 113.326 1.00 38.53  ?  12   MET A N   1 
ATOM   2    C  CA  . MET A 1 1   ? 103.376 -43.251 113.248 1.00 38.53  ?  12   MET A CA  1 
ATOM   3    C  C   . MET A 1 1   ? 104.841 -43.165 112.834 1.00 41.33  ?  12   MET A C   1 
ATOM   4    O  O   . MET A 1 1   ? 105.573 -44.151 112.915 1.00 39.64  ?  12   MET A O   1 
ATOM   5    C  CB  . MET A 1 1   ? 103.165 -42.550 114.590 1.00 40.77  ?  12   MET A CB  1 
ATOM   6    C  CG  . MET A 1 1   ? 104.161 -42.951 115.662 1.00 44.13  ?  12   MET A CG  1 
ATOM   7    S  SD  . MET A 1 1   ? 103.685 -42.344 117.288 1.00 48.23  ?  12   MET A SD  1 
ATOM   8    C  CE  . MET A 1 1   ? 102.271 -43.388 117.621 1.00 44.74  ?  12   MET A CE  1 
ATOM   9    N  N   . ARG A 1 2   ? 105.264 -41.983 112.388 1.00 42.22  ?  13   ARG A N   1 
ATOM   10   C  CA  . ARG A 1 2   ? 106.662 -41.781 112.033 1.00 42.34  ?  13   ARG A CA  1 
ATOM   11   C  C   . ARG A 1 2   ? 107.565 -42.019 113.239 1.00 44.46  ?  13   ARG A C   1 
ATOM   12   O  O   . ARG A 1 2   ? 107.153 -41.873 114.393 1.00 45.09  ?  13   ARG A O   1 
ATOM   13   C  CB  . ARG A 1 2   ? 106.879 -40.369 111.489 1.00 45.85  ?  13   ARG A CB  1 
ATOM   14   C  CG  . ARG A 1 2   ? 106.772 -40.264 109.978 1.00 61.98  ?  13   ARG A CG  1 
ATOM   15   C  CD  . ARG A 1 2   ? 107.228 -38.898 109.482 1.00 78.30  ?  13   ARG A CD  1 
ATOM   16   N  NE  . ARG A 1 2   ? 106.120 -37.954 109.369 1.00 95.22  ?  13   ARG A NE  1 
ATOM   17   C  CZ  . ARG A 1 2   ? 105.398 -37.784 108.266 1.00 113.20 ?  13   ARG A CZ  1 
ATOM   18   N  NH1 . ARG A 1 2   ? 105.668 -38.496 107.181 1.00 97.02  ?  13   ARG A NH1 1 
ATOM   19   N  NH2 . ARG A 1 2   ? 104.406 -36.904 108.247 1.00 104.50 ?  13   ARG A NH2 1 
ATOM   20   N  N   . GLU A 1 3   ? 108.817 -42.394 112.955 1.00 32.07  ?  14   GLU A N   1 
ATOM   21   C  CA  . GLU A 1 3   ? 109.774 -42.650 114.025 1.00 31.54  ?  14   GLU A CA  1 
ATOM   22   C  C   . GLU A 1 3   ? 110.059 -41.398 114.843 1.00 36.74  ?  14   GLU A C   1 
ATOM   23   O  O   . GLU A 1 3   ? 110.380 -41.496 116.032 1.00 36.21  ?  14   GLU A O   1 
ATOM   24   C  CB  . GLU A 1 3   ? 111.078 -43.204 113.440 1.00 32.40  ?  14   GLU A CB  1 
ATOM   25   C  CG  . GLU A 1 3   ? 110.942 -44.552 112.745 1.00 33.07  ?  14   GLU A CG  1 
ATOM   26   C  CD  . GLU A 1 3   ? 110.436 -45.640 113.670 1.00 43.63  ?  14   GLU A CD  1 
ATOM   27   O  OE1 . GLU A 1 3   ? 109.556 -46.419 113.249 1.00 33.35  ?  14   GLU A OE1 1 
ATOM   28   O  OE2 . GLU A 1 3   ? 110.912 -45.712 114.822 1.00 30.34  ?  14   GLU A OE2 1 
ATOM   29   N  N   . ARG A 1 4   ? 109.959 -40.218 114.226 1.00 36.98  ?  15   ARG A N   1 
ATOM   30   C  CA  . ARG A 1 4   ? 110.136 -38.975 114.970 1.00 38.24  ?  15   ARG A CA  1 
ATOM   31   C  C   . ARG A 1 4   ? 109.058 -38.819 116.033 1.00 41.61  ?  15   ARG A C   1 
ATOM   32   O  O   . ARG A 1 4   ? 109.332 -38.354 117.146 1.00 40.78  ?  15   ARG A O   1 
ATOM   33   C  CB  . ARG A 1 4   ? 110.120 -37.785 114.010 1.00 41.18  ?  15   ARG A CB  1 
ATOM   34   C  CG  . ARG A 1 4   ? 110.649 -36.484 114.594 1.00 55.21  ?  15   ARG A CG  1 
ATOM   35   C  CD  . ARG A 1 4   ? 112.166 -36.503 114.706 1.00 69.95  ?  15   ARG A CD  1 
ATOM   36   N  NE  . ARG A 1 4   ? 112.627 -36.934 116.022 1.00 81.06  ?  15   ARG A NE  1 
ATOM   37   C  CZ  . ARG A 1 4   ? 113.908 -37.079 116.349 1.00 95.02  ?  15   ARG A CZ  1 
ATOM   38   N  NH1 . ARG A 1 4   ? 114.853 -36.835 115.451 1.00 79.02  ?  15   ARG A NH1 1 
ATOM   39   N  NH2 . ARG A 1 4   ? 114.245 -37.472 117.570 1.00 80.95  ?  15   ARG A NH2 1 
ATOM   40   N  N   . LEU A 1 5   ? 107.822 -39.205 115.707 1.00 42.25  ?  16   LEU A N   1 
ATOM   41   C  CA  . LEU A 1 5   ? 106.740 -39.135 116.683 1.00 42.15  ?  16   LEU A CA  1 
ATOM   42   C  C   . LEU A 1 5   ? 106.931 -40.168 117.785 1.00 40.17  ?  16   LEU A C   1 
ATOM   43   O  O   . LEU A 1 5   ? 106.618 -39.904 118.952 1.00 37.67  ?  16   LEU A O   1 
ATOM   44   C  CB  . LEU A 1 5   ? 105.390 -39.334 115.993 1.00 43.12  ?  16   LEU A CB  1 
ATOM   45   C  CG  . LEU A 1 5   ? 104.759 -38.159 115.238 1.00 51.32  ?  16   LEU A CG  1 
ATOM   46   C  CD1 . LEU A 1 5   ? 105.558 -37.765 113.999 1.00 52.29  ?  16   LEU A CD1 1 
ATOM   47   C  CD2 . LEU A 1 5   ? 103.316 -38.480 114.864 1.00 56.85  ?  16   LEU A CD2 1 
ATOM   48   N  N   . LYS A 1 6   ? 107.438 -41.352 117.428 1.00 35.62  ?  17   LYS A N   1 
ATOM   49   C  CA  . LYS A 1 6   ? 107.711 -42.380 118.428 1.00 33.59  ?  17   LYS A CA  1 
ATOM   50   C  C   . LYS A 1 6   ? 108.705 -41.886 119.471 1.00 36.89  ?  17   LYS A C   1 
ATOM   51   O  O   . LYS A 1 6   ? 108.562 -42.180 120.663 1.00 36.92  ?  17   LYS A O   1 
ATOM   52   C  CB  . LYS A 1 6   ? 108.240 -43.646 117.754 1.00 32.78  ?  17   LYS A CB  1 
ATOM   53   C  CG  . LYS A 1 6   ? 107.251 -44.336 116.838 1.00 23.47  ?  17   LYS A CG  1 
ATOM   54   C  CD  . LYS A 1 6   ? 107.823 -45.643 116.312 1.00 23.23  ?  17   LYS A CD  1 
ATOM   55   C  CE  . LYS A 1 6   ? 106.954 -46.240 115.214 1.00 21.58  ?  17   LYS A CE  1 
ATOM   56   N  NZ  . LYS A 1 6   ? 107.563 -47.478 114.648 1.00 22.20  ?  17   LYS A NZ  1 
ATOM   57   N  N   . ARG A 1 7   ? 109.720 -41.130 119.043 1.00 32.29  ?  18   ARG A N   1 
ATOM   58   C  CA  . ARG A 1 7   ? 110.727 -40.647 119.980 1.00 32.40  ?  18   ARG A CA  1 
ATOM   59   C  C   . ARG A 1 7   ? 110.187 -39.564 120.901 1.00 38.49  ?  18   ARG A C   1 
ATOM   60   O  O   . ARG A 1 7   ? 110.764 -39.332 121.969 1.00 39.75  ?  18   ARG A O   1 
ATOM   61   C  CB  . ARG A 1 7   ? 111.953 -40.139 119.219 1.00 28.96  ?  18   ARG A CB  1 
ATOM   62   C  CG  . ARG A 1 7   ? 112.735 -41.252 118.547 1.00 20.58  ?  18   ARG A CG  1 
ATOM   63   C  CD  . ARG A 1 7   ? 114.129 -40.812 118.144 1.00 31.95  ?  18   ARG A CD  1 
ATOM   64   N  NE  . ARG A 1 7   ? 115.043 -41.950 118.096 1.00 30.08  ?  18   ARG A NE  1 
ATOM   65   C  CZ  . ARG A 1 7   ? 116.281 -41.903 117.618 1.00 42.03  ?  18   ARG A CZ  1 
ATOM   66   N  NH1 . ARG A 1 7   ? 117.032 -42.995 117.621 1.00 24.67  ?  18   ARG A NH1 1 
ATOM   67   N  NH2 . ARG A 1 7   ? 116.766 -40.771 117.130 1.00 38.90  ?  18   ARG A NH2 1 
ATOM   68   N  N   . ASP A 1 8   ? 109.094 -38.903 120.521 1.00 36.57  ?  19   ASP A N   1 
ATOM   69   C  CA  . ASP A 1 8   ? 108.454 -37.941 121.410 1.00 36.92  ?  19   ASP A CA  1 
ATOM   70   C  C   . ASP A 1 8   ? 107.609 -38.625 122.479 1.00 37.19  ?  19   ASP A C   1 
ATOM   71   O  O   . ASP A 1 8   ? 107.439 -38.072 123.572 1.00 36.87  ?  19   ASP A O   1 
ATOM   72   C  CB  . ASP A 1 8   ? 107.578 -36.973 120.608 1.00 40.15  ?  19   ASP A CB  1 
ATOM   73   C  CG  . ASP A 1 8   ? 108.351 -36.234 119.531 1.00 55.52  ?  19   ASP A CG  1 
ATOM   74   O  OD1 . ASP A 1 8   ? 109.592 -36.143 119.635 1.00 53.29  ?  19   ASP A OD1 1 
ATOM   75   O  OD2 . ASP A 1 8   ? 107.707 -35.734 118.583 1.00 68.56  ?  19   ASP A OD2 1 
ATOM   76   N  N   . LEU A 1 9   ? 107.083 -39.815 122.189 1.00 29.70  ?  20   LEU A N   1 
ATOM   77   C  CA  . LEU A 1 9   ? 106.166 -40.522 123.077 1.00 28.69  ?  20   LEU A CA  1 
ATOM   78   C  C   . LEU A 1 9   ? 106.801 -41.677 123.835 1.00 29.85  ?  20   LEU A C   1 
ATOM   79   O  O   . LEU A 1 9   ? 106.499 -41.868 125.015 1.00 27.42  ?  20   LEU A O   1 
ATOM   80   C  CB  . LEU A 1 9   ? 104.974 -41.062 122.278 1.00 29.11  ?  20   LEU A CB  1 
ATOM   81   C  CG  . LEU A 1 9   ? 104.097 -40.035 121.566 1.00 35.67  ?  20   LEU A CG  1 
ATOM   82   C  CD1 . LEU A 1 9   ? 103.147 -40.712 120.589 1.00 34.62  ?  20   LEU A CD1 1 
ATOM   83   C  CD2 . LEU A 1 9   ? 103.325 -39.212 122.584 1.00 40.25  ?  20   LEU A CD2 1 
ATOM   84   N  N   . PHE A 1 10  ? 107.665 -42.463 123.196 1.00 28.01  ?  21   PHE A N   1 
ATOM   85   C  CA  . PHE A 1 10  ? 108.123 -43.730 123.750 1.00 25.84  ?  21   PHE A CA  1 
ATOM   86   C  C   . PHE A 1 10  ? 109.626 -43.715 123.984 1.00 29.41  ?  21   PHE A C   1 
ATOM   87   O  O   . PHE A 1 10  ? 110.394 -43.212 123.156 1.00 29.50  ?  21   PHE A O   1 
ATOM   88   C  CB  . PHE A 1 10  ? 107.762 -44.897 122.825 1.00 26.23  ?  21   PHE A CB  1 
ATOM   89   C  CG  . PHE A 1 10  ? 106.360 -44.837 122.298 1.00 27.49  ?  21   PHE A CG  1 
ATOM   90   C  CD1 . PHE A 1 10  ? 105.281 -45.025 123.142 1.00 29.35  ?  21   PHE A CD1 1 
ATOM   91   C  CD2 . PHE A 1 10  ? 106.122 -44.597 120.954 1.00 28.76  ?  21   PHE A CD2 1 
ATOM   92   C  CE1 . PHE A 1 10  ? 103.990 -44.969 122.659 1.00 29.77  ?  21   PHE A CE1 1 
ATOM   93   C  CE2 . PHE A 1 10  ? 104.832 -44.542 120.462 1.00 31.28  ?  21   PHE A CE2 1 
ATOM   94   C  CZ  . PHE A 1 10  ? 103.764 -44.729 121.315 1.00 29.16  ?  21   PHE A CZ  1 
ATOM   95   N  N   . GLN A 1 11  ? 110.030 -44.279 125.124 1.00 31.16  ?  22   GLN A N   1 
ATOM   96   C  CA  . GLN A 1 11  ? 111.429 -44.503 125.469 1.00 29.64  ?  22   GLN A CA  1 
ATOM   97   C  C   . GLN A 1 11  ? 111.487 -45.391 126.705 1.00 31.74  ?  22   GLN A C   1 
ATOM   98   O  O   . GLN A 1 11  ? 110.890 -45.062 127.736 1.00 32.86  ?  22   GLN A O   1 
ATOM   99   C  CB  . GLN A 1 11  ? 112.157 -43.179 125.706 1.00 31.25  ?  22   GLN A CB  1 
ATOM   100  C  CG  . GLN A 1 11  ? 113.672 -43.290 125.679 1.00 26.11  ?  22   GLN A CG  1 
ATOM   101  C  CD  . GLN A 1 11  ? 114.354 -41.939 125.632 1.00 33.03  ?  22   GLN A CD  1 
ATOM   102  O  OE1 . GLN A 1 11  ? 113.814 -40.939 126.106 1.00 32.40  ?  22   GLN A OE1 1 
ATOM   103  N  NE2 . GLN A 1 11  ? 115.547 -41.900 125.052 1.00 22.45  ?  22   GLN A NE2 1 
ATOM   104  N  N   . PHE A 1 12  ? 112.191 -46.518 126.613 1.00 20.67  ?  23   PHE A N   1 
ATOM   105  C  CA  . PHE A 1 12  ? 112.179 -47.532 127.659 1.00 18.47  ?  23   PHE A CA  1 
ATOM   106  C  C   . PHE A 1 12  ? 113.347 -47.339 128.618 1.00 24.17  ?  23   PHE A C   1 
ATOM   107  O  O   . PHE A 1 12  ? 114.498 -47.214 128.186 1.00 24.65  ?  23   PHE A O   1 
ATOM   108  C  CB  . PHE A 1 12  ? 112.229 -48.938 127.066 1.00 17.97  ?  23   PHE A CB  1 
ATOM   109  C  CG  . PHE A 1 12  ? 112.107 -50.018 128.096 1.00 17.61  ?  23   PHE A CG  1 
ATOM   110  C  CD1 . PHE A 1 12  ? 110.866 -50.373 128.594 1.00 19.07  ?  23   PHE A CD1 1 
ATOM   111  C  CD2 . PHE A 1 12  ? 113.232 -50.659 128.589 1.00 19.11  ?  23   PHE A CD2 1 
ATOM   112  C  CE1 . PHE A 1 12  ? 110.746 -51.355 129.554 1.00 20.58  ?  23   PHE A CE1 1 
ATOM   113  C  CE2 . PHE A 1 12  ? 113.120 -51.643 129.550 1.00 21.22  ?  23   PHE A CE2 1 
ATOM   114  C  CZ  . PHE A 1 12  ? 111.874 -51.992 130.033 1.00 19.29  ?  23   PHE A CZ  1 
ATOM   115  N  N   . ASN A 1 13  ? 113.045 -47.343 129.916 1.00 19.28  ?  24   ASN A N   1 
ATOM   116  C  CA  . ASN A 1 13  ? 114.048 -47.218 130.965 1.00 19.14  ?  24   ASN A CA  1 
ATOM   117  C  C   . ASN A 1 13  ? 113.550 -47.930 132.212 1.00 21.48  ?  24   ASN A C   1 
ATOM   118  O  O   . ASN A 1 13  ? 112.378 -47.806 132.574 1.00 20.51  ?  24   ASN A O   1 
ATOM   119  C  CB  . ASN A 1 13  ? 114.342 -45.751 131.301 1.00 20.67  ?  24   ASN A CB  1 
ATOM   120  C  CG  . ASN A 1 13  ? 114.946 -44.993 130.140 1.00 34.54  ?  24   ASN A CG  1 
ATOM   121  O  OD1 . ASN A 1 13  ? 114.229 -44.432 129.313 1.00 26.05  ?  24   ASN A OD1 1 
ATOM   122  N  ND2 . ASN A 1 13  ? 116.271 -44.968 130.073 1.00 28.16  ?  24   ASN A ND2 1 
ATOM   123  N  N   . LYS A 1 14  ? 114.442 -48.680 132.855 1.00 23.15  ?  25   LYS A N   1 
ATOM   124  C  CA  . LYS A 1 14  ? 114.222 -49.187 134.204 1.00 22.08  ?  25   LYS A CA  1 
ATOM   125  C  C   . LYS A 1 14  ? 114.828 -48.187 135.178 1.00 25.61  ?  25   LYS A C   1 
ATOM   126  O  O   . LYS A 1 14  ? 116.008 -47.843 135.059 1.00 23.69  ?  25   LYS A O   1 
ATOM   127  C  CB  . LYS A 1 14  ? 114.842 -50.573 134.384 1.00 23.57  ?  25   LYS A CB  1 
ATOM   128  C  CG  . LYS A 1 14  ? 114.156 -51.653 133.563 1.00 31.61  ?  25   LYS A CG  1 
ATOM   129  C  CD  . LYS A 1 14  ? 114.871 -52.985 133.681 1.00 38.03  ?  25   LYS A CD  1 
ATOM   130  C  CE  . LYS A 1 14  ? 114.130 -54.072 132.922 1.00 44.72  ?  25   LYS A CE  1 
ATOM   131  N  NZ  . LYS A 1 14  ? 114.839 -55.376 133.012 1.00 52.00  ?  25   LYS A NZ  1 
ATOM   132  N  N   . THR A 1 15  ? 114.026 -47.720 136.134 1.00 24.67  ?  26   THR A N   1 
ATOM   133  C  CA  . THR A 1 15  ? 114.314 -46.464 136.812 1.00 25.99  ?  26   THR A CA  1 
ATOM   134  C  C   . THR A 1 15  ? 114.598 -46.572 138.306 1.00 27.77  ?  26   THR A C   1 
ATOM   135  O  O   . THR A 1 15  ? 115.427 -45.815 138.810 1.00 27.74  ?  26   THR A O   1 
ATOM   136  C  CB  . THR A 1 15  ? 113.159 -45.475 136.579 1.00 40.67  ?  26   THR A CB  1 
ATOM   137  O  OG1 . THR A 1 15  ? 113.486 -44.210 137.156 1.00 54.91  ?  26   THR A OG1 1 
ATOM   138  C  CG2 . THR A 1 15  ? 111.863 -45.991 137.181 1.00 33.95  ?  26   THR A CG2 1 
ATOM   139  N  N   . VAL A 1 16  ? 113.944 -47.483 139.038 1.00 22.38  ?  27   VAL A N   1 
ATOM   140  C  CA  . VAL A 1 16  ? 114.149 -47.597 140.479 1.00 21.75  ?  27   VAL A CA  1 
ATOM   141  C  C   . VAL A 1 16  ? 113.530 -48.905 140.948 1.00 27.45  ?  27   VAL A C   1 
ATOM   142  O  O   . VAL A 1 16  ? 112.638 -49.456 140.289 1.00 26.76  ?  27   VAL A O   1 
ATOM   143  C  CB  . VAL A 1 16  ? 113.533 -46.375 141.219 1.00 24.86  ?  27   VAL A CB  1 
ATOM   144  C  CG1 . VAL A 1 16  ? 112.014 -46.410 141.148 1.00 23.17  ?  27   VAL A CG1 1 
ATOM   145  C  CG2 . VAL A 1 16  ? 114.018 -46.306 142.660 1.00 24.36  ?  27   VAL A CG2 1 
ATOM   146  N  N   . GLU A 1 17  ? 114.003 -49.411 142.083 1.00 27.06  ?  28   GLU A N   1 
ATOM   147  C  CA  . GLU A 1 17  ? 113.468 -50.618 142.699 1.00 25.91  ?  28   GLU A CA  1 
ATOM   148  C  C   . GLU A 1 17  ? 112.752 -50.257 143.995 1.00 28.52  ?  28   GLU A C   1 
ATOM   149  O  O   . GLU A 1 17  ? 113.175 -49.348 144.715 1.00 29.82  ?  28   GLU A O   1 
ATOM   150  C  CB  . GLU A 1 17  ? 114.583 -51.633 142.970 1.00 26.65  ?  28   GLU A CB  1 
ATOM   151  C  CG  . GLU A 1 17  ? 115.331 -52.070 141.714 1.00 31.16  ?  28   GLU A CG  1 
ATOM   152  C  CD  . GLU A 1 17  ? 116.726 -52.606 142.002 1.00 67.01  ?  28   GLU A CD  1 
ATOM   153  O  OE1 . GLU A 1 17  ? 117.306 -52.245 143.048 1.00 69.29  ?  28   GLU A OE1 1 
ATOM   154  O  OE2 . GLU A 1 17  ? 117.247 -53.387 141.177 1.00 75.03  ?  28   GLU A OE2 1 
ATOM   155  N  N   . HIS A 1 18  ? 111.661 -50.965 144.279 1.00 21.90  ?  29   HIS A N   1 
ATOM   156  C  CA  . HIS A 1 18  ? 110.865 -50.752 145.479 1.00 20.72  ?  29   HIS A CA  1 
ATOM   157  C  C   . HIS A 1 18  ? 110.759 -52.050 146.264 1.00 25.73  ?  29   HIS A C   1 
ATOM   158  O  O   . HIS A 1 18  ? 110.506 -53.115 145.693 1.00 25.85  ?  29   HIS A O   1 
ATOM   159  C  CB  . HIS A 1 18  ? 109.448 -50.263 145.147 1.00 21.43  ?  29   HIS A CB  1 
ATOM   160  C  CG  . HIS A 1 18  ? 109.409 -49.050 144.272 1.00 24.88  ?  29   HIS A CG  1 
ATOM   161  N  ND1 . HIS A 1 18  ? 109.680 -47.782 144.741 1.00 26.33  ?  29   HIS A ND1 1 
ATOM   162  C  CD2 . HIS A 1 18  ? 109.109 -48.909 142.959 1.00 25.80  ?  29   HIS A CD2 1 
ATOM   163  C  CE1 . HIS A 1 18  ? 109.560 -46.914 143.752 1.00 26.08  ?  29   HIS A CE1 1 
ATOM   164  N  NE2 . HIS A 1 18  ? 109.215 -47.572 142.660 1.00 26.31  ?  29   HIS A NE2 1 
ATOM   165  N  N   . GLY A 1 19  ? 110.938 -51.954 147.575 1.00 22.68  ?  30   GLY A N   1 
ATOM   166  C  CA  . GLY A 1 19  ? 110.765 -53.089 148.460 1.00 22.02  ?  30   GLY A CA  1 
ATOM   167  C  C   . GLY A 1 19  ? 112.025 -53.478 149.198 1.00 23.90  ?  30   GLY A C   1 
ATOM   168  O  O   . GLY A 1 19  ? 112.964 -52.688 149.315 1.00 23.23  ?  30   GLY A O   1 
ATOM   169  N  N   . PHE A 1 20  ? 112.049 -54.712 149.701 1.00 22.91  ?  31   PHE A N   1 
ATOM   170  C  CA  . PHE A 1 20  ? 113.155 -55.276 150.459 1.00 21.46  ?  31   PHE A CA  1 
ATOM   171  C  C   . PHE A 1 20  ? 114.022 -56.126 149.549 1.00 27.92  ?  31   PHE A C   1 
ATOM   172  O  O   . PHE A 1 20  ? 113.520 -57.085 148.940 1.00 28.15  ?  31   PHE A O   1 
ATOM   173  C  CB  . PHE A 1 20  ? 112.638 -56.116 151.617 1.00 21.05  ?  31   PHE A CB  1 
ATOM   174  C  CG  . PHE A 1 20  ? 113.706 -56.531 152.584 1.00 20.77  ?  31   PHE A CG  1 
ATOM   175  C  CD1 . PHE A 1 20  ? 114.201 -55.630 153.512 1.00 22.59  ?  31   PHE A CD1 1 
ATOM   176  C  CD2 . PHE A 1 20  ? 114.204 -57.821 152.574 1.00 21.51  ?  31   PHE A CD2 1 
ATOM   177  C  CE1 . PHE A 1 20  ? 115.181 -56.005 154.411 1.00 22.28  ?  31   PHE A CE1 1 
ATOM   178  C  CE2 . PHE A 1 20  ? 115.184 -58.204 153.469 1.00 24.01  ?  31   PHE A CE2 1 
ATOM   179  C  CZ  . PHE A 1 20  ? 115.673 -57.293 154.391 1.00 22.44  ?  31   PHE A CZ  1 
ATOM   180  N  N   . PRO A 1 21  ? 115.312 -55.810 149.444 1.00 25.67  ?  32   PRO A N   1 
ATOM   181  C  CA  . PRO A 1 21  ? 116.186 -56.546 148.525 1.00 24.87  ?  32   PRO A CA  1 
ATOM   182  C  C   . PRO A 1 21  ? 116.327 -58.010 148.916 1.00 28.58  ?  32   PRO A C   1 
ATOM   183  O  O   . PRO A 1 21  ? 116.438 -58.354 150.096 1.00 27.70  ?  32   PRO A O   1 
ATOM   184  C  CB  . PRO A 1 21  ? 117.523 -55.806 148.639 1.00 26.41  ?  32   PRO A CB  1 
ATOM   185  C  CG  . PRO A 1 21  ? 117.167 -54.455 149.188 1.00 31.32  ?  32   PRO A CG  1 
ATOM   186  C  CD  . PRO A 1 21  ? 116.015 -54.702 150.104 1.00 27.24  ?  32   PRO A CD  1 
ATOM   187  N  N   . HIS A 1 22  ? 116.341 -58.867 147.900 1.00 25.25  ?  33   HIS A N   1 
ATOM   188  C  CA  . HIS A 1 22  ? 116.351 -60.306 148.116 1.00 23.62  ?  33   HIS A CA  1 
ATOM   189  C  C   . HIS A 1 22  ? 117.679 -60.765 148.705 1.00 26.83  ?  33   HIS A C   1 
ATOM   190  O  O   . HIS A 1 22  ? 118.753 -60.398 148.213 1.00 25.35  ?  33   HIS A O   1 
ATOM   191  C  CB  . HIS A 1 22  ? 116.082 -61.027 146.796 1.00 23.62  ?  33   HIS A CB  1 
ATOM   192  C  CG  . HIS A 1 22  ? 115.921 -62.507 146.937 1.00 26.48  ?  33   HIS A CG  1 
ATOM   193  N  ND1 . HIS A 1 22  ? 115.037 -63.078 147.827 1.00 27.97  ?  33   HIS A ND1 1 
ATOM   194  C  CD2 . HIS A 1 22  ? 116.522 -63.534 146.291 1.00 28.51  ?  33   HIS A CD2 1 
ATOM   195  C  CE1 . HIS A 1 22  ? 115.104 -64.394 147.727 1.00 27.50  ?  33   HIS A CE1 1 
ATOM   196  N  NE2 . HIS A 1 22  ? 115.998 -64.696 146.802 1.00 27.96  ?  33   HIS A NE2 1 
ATOM   197  N  N   . GLN A 1 23  ? 117.594 -61.575 149.763 1.00 21.09  ?  34   GLN A N   1 
ATOM   198  C  CA  . GLN A 1 23  ? 118.721 -62.233 150.417 1.00 20.07  ?  34   GLN A CA  1 
ATOM   199  C  C   . GLN A 1 23  ? 119.815 -61.245 150.811 1.00 22.77  ?  34   GLN A C   1 
ATOM   200  O  O   . GLN A 1 23  ? 120.897 -61.248 150.212 1.00 22.23  ?  34   GLN A O   1 
ATOM   201  C  CB  . GLN A 1 23  ? 119.295 -63.326 149.512 1.00 20.34  ?  34   GLN A CB  1 
ATOM   202  C  CG  . GLN A 1 23  ? 118.332 -64.484 149.278 1.00 26.95  ?  34   GLN A CG  1 
ATOM   203  C  CD  . GLN A 1 23  ? 118.969 -65.640 148.533 1.00 42.92  ?  34   GLN A CD  1 
ATOM   204  O  OE1 . GLN A 1 23  ? 119.670 -65.447 147.540 1.00 34.67  ?  34   GLN A OE1 1 
ATOM   205  N  NE2 . GLN A 1 23  ? 118.727 -66.854 149.013 1.00 40.18  ?  34   GLN A NE2 1 
ATOM   206  N  N   . PRO A 1 24  ? 119.578 -60.392 151.805 1.00 19.30  ?  35   PRO A N   1 
ATOM   207  C  CA  . PRO A 1 24  ? 120.655 -59.527 152.293 1.00 19.50  ?  35   PRO A CA  1 
ATOM   208  C  C   . PRO A 1 24  ? 121.709 -60.343 153.017 1.00 21.38  ?  35   PRO A C   1 
ATOM   209  O  O   . PRO A 1 24  ? 121.438 -61.420 153.553 1.00 19.37  ?  35   PRO A O   1 
ATOM   210  C  CB  . PRO A 1 24  ? 119.937 -58.565 153.245 1.00 21.54  ?  35   PRO A CB  1 
ATOM   211  C  CG  . PRO A 1 24  ? 118.739 -59.323 153.699 1.00 24.48  ?  35   PRO A CG  1 
ATOM   212  C  CD  . PRO A 1 24  ? 118.315 -60.163 152.531 1.00 20.47  ?  35   PRO A CD  1 
ATOM   213  N  N   . SER A 1 25  ? 122.933 -59.819 153.015 1.00 16.84  ?  36   SER A N   1 
ATOM   214  C  CA  . SER A 1 25  ? 124.073 -60.544 153.559 1.00 16.12  ?  36   SER A CA  1 
ATOM   215  C  C   . SER A 1 25  ? 124.976 -59.708 154.452 1.00 20.10  ?  36   SER A C   1 
ATOM   216  O  O   . SER A 1 25  ? 125.855 -60.281 155.102 1.00 19.18  ?  36   SER A O   1 
ATOM   217  C  CB  . SER A 1 25  ? 124.916 -61.139 152.422 1.00 18.85  ?  36   SER A CB  1 
ATOM   218  O  OG  . SER A 1 25  ? 125.492 -60.118 151.629 1.00 27.97  ?  36   SER A OG  1 
ATOM   219  N  N   . ALA A 1 26  ? 124.787 -58.391 154.521 1.00 18.31  ?  37   ALA A N   1 
ATOM   220  C  CA  . ALA A 1 26  ? 125.625 -57.551 155.367 1.00 17.27  ?  37   ALA A CA  1 
ATOM   221  C  C   . ALA A 1 26  ? 124.893 -56.253 155.671 1.00 22.24  ?  37   ALA A C   1 
ATOM   222  O  O   . ALA A 1 26  ? 124.038 -55.809 154.902 1.00 22.77  ?  37   ALA A O   1 
ATOM   223  C  CB  . ALA A 1 26  ? 126.974 -57.251 154.706 1.00 17.17  ?  37   ALA A CB  1 
ATOM   224  N  N   . LEU A 1 27  ? 125.251 -55.647 156.798 1.00 18.71  ?  38   LEU A N   1 
ATOM   225  C  CA  . LEU A 1 27  ? 124.684 -54.379 157.232 1.00 19.68  ?  38   LEU A CA  1 
ATOM   226  C  C   . LEU A 1 27  ? 125.799 -53.429 157.642 1.00 21.47  ?  38   LEU A C   1 
ATOM   227  O  O   . LEU A 1 27  ? 126.737 -53.821 158.343 1.00 18.17  ?  38   LEU A O   1 
ATOM   228  C  CB  . LEU A 1 27  ? 123.714 -54.567 158.406 1.00 20.37  ?  38   LEU A CB  1 
ATOM   229  C  CG  . LEU A 1 27  ? 123.232 -53.279 159.082 1.00 27.70  ?  38   LEU A CG  1 
ATOM   230  C  CD1 . LEU A 1 27  ? 122.369 -52.450 158.140 1.00 29.51  ?  38   LEU A CD1 1 
ATOM   231  C  CD2 . LEU A 1 27  ? 122.486 -53.586 160.364 1.00 32.50  ?  38   LEU A CD2 1 
ATOM   232  N  N   . GLY A 1 28  ? 125.694 -52.180 157.189 1.00 22.01  ?  39   GLY A N   1 
ATOM   233  C  CA  . GLY A 1 28  ? 126.600 -51.140 157.611 1.00 21.97  ?  39   GLY A CA  1 
ATOM   234  C  C   . GLY A 1 28  ? 125.822 -49.893 157.982 1.00 27.22  ?  39   GLY A C   1 
ATOM   235  O  O   . GLY A 1 28  ? 124.654 -49.732 157.624 1.00 24.29  ?  39   GLY A O   1 
ATOM   236  N  N   . TYR A 1 29  ? 126.487 -49.012 158.722 1.00 28.21  ?  40   TYR A N   1 
ATOM   237  C  CA  . TYR A 1 29  ? 125.860 -47.760 159.121 1.00 29.62  ?  40   TYR A CA  1 
ATOM   238  C  C   . TYR A 1 29  ? 126.925 -46.708 159.368 1.00 36.33  ?  40   TYR A C   1 
ATOM   239  O  O   . TYR A 1 29  ? 127.922 -46.973 160.046 1.00 36.30  ?  40   TYR A O   1 
ATOM   240  C  CB  . TYR A 1 29  ? 125.000 -47.938 160.377 1.00 31.07  ?  40   TYR A CB  1 
ATOM   241  C  CG  . TYR A 1 29  ? 124.314 -46.660 160.801 1.00 33.19  ?  40   TYR A CG  1 
ATOM   242  C  CD1 . TYR A 1 29  ? 123.218 -46.173 160.100 1.00 34.93  ?  40   TYR A CD1 1 
ATOM   243  C  CD2 . TYR A 1 29  ? 124.769 -45.933 161.893 1.00 34.01  ?  40   TYR A CD2 1 
ATOM   244  C  CE1 . TYR A 1 29  ? 122.589 -45.000 160.480 1.00 37.09  ?  40   TYR A CE1 1 
ATOM   245  C  CE2 . TYR A 1 29  ? 124.148 -44.759 162.280 1.00 35.74  ?  40   TYR A CE2 1 
ATOM   246  C  CZ  . TYR A 1 29  ? 123.059 -44.297 161.571 1.00 47.71  ?  40   TYR A CZ  1 
ATOM   247  O  OH  . TYR A 1 29  ? 122.441 -43.129 161.960 1.00 52.60  ?  40   TYR A OH  1 
ATOM   248  N  N   . SER A 1 30  ? 126.707 -45.518 158.815 1.00 30.37  ?  41   SER A N   1 
ATOM   249  C  CA  . SER A 1 30  ? 127.556 -44.373 159.093 1.00 31.89  ?  41   SER A CA  1 
ATOM   250  C  C   . SER A 1 30  ? 126.878 -43.494 160.127 1.00 37.68  ?  41   SER A C   1 
ATOM   251  O  O   . SER A 1 30  ? 125.832 -42.904 159.821 1.00 36.23  ?  41   SER A O   1 
ATOM   252  C  CB  . SER A 1 30  ? 127.815 -43.577 157.822 1.00 35.34  ?  41   SER A CB  1 
ATOM   253  O  OG  . SER A 1 30  ? 128.450 -42.350 158.132 1.00 40.64  ?  41   SER A OG  1 
ATOM   254  N  N   . PRO A 1 31  ? 127.411 -43.371 161.347 1.00 39.77  ?  42   PRO A N   1 
ATOM   255  C  CA  . PRO A 1 31  ? 126.782 -42.459 162.316 1.00 40.22  ?  42   PRO A CA  1 
ATOM   256  C  C   . PRO A 1 31  ? 126.999 -40.996 161.972 1.00 44.06  ?  42   PRO A C   1 
ATOM   257  O  O   . PRO A 1 31  ? 126.167 -40.153 162.330 1.00 42.52  ?  42   PRO A O   1 
ATOM   258  C  CB  . PRO A 1 31  ? 127.449 -42.836 163.649 1.00 41.52  ?  42   PRO A CB  1 
ATOM   259  C  CG  . PRO A 1 31  ? 128.192 -44.128 163.384 1.00 44.87  ?  42   PRO A CG  1 
ATOM   260  C  CD  . PRO A 1 31  ? 128.543 -44.103 161.934 1.00 41.17  ?  42   PRO A CD  1 
ATOM   261  N  N   . SER A 1 32  ? 128.087 -40.671 161.270 1.00 36.74  ?  43   SER A N   1 
ATOM   262  C  CA  . SER A 1 32  ? 128.323 -39.288 160.868 1.00 38.78  ?  43   SER A CA  1 
ATOM   263  C  C   . SER A 1 32  ? 127.373 -38.860 159.758 1.00 45.91  ?  43   SER A C   1 
ATOM   264  O  O   . SER A 1 32  ? 126.928 -37.707 159.724 1.00 48.13  ?  43   SER A O   1 
ATOM   265  C  CB  . SER A 1 32  ? 129.772 -39.112 160.419 1.00 42.07  ?  43   SER A CB  1 
ATOM   266  O  OG  . SER A 1 32  ? 130.216 -40.245 159.693 1.00 50.14  ?  43   SER A OG  1 
ATOM   267  N  N   . LEU A 1 33  ? 127.056 -39.771 158.839 1.00 44.38  ?  44   LEU A N   1 
ATOM   268  C  CA  . LEU A 1 33  ? 126.206 -39.467 157.696 1.00 44.10  ?  44   LEU A CA  1 
ATOM   269  C  C   . LEU A 1 33  ? 124.770 -39.947 157.865 1.00 46.59  ?  44   LEU A C   1 
ATOM   270  O  O   . LEU A 1 33  ? 123.912 -39.563 157.061 1.00 46.68  ?  44   LEU A O   1 
ATOM   271  C  CB  . LEU A 1 33  ? 126.800 -40.083 156.422 1.00 43.71  ?  44   LEU A CB  1 
ATOM   272  C  CG  . LEU A 1 33  ? 128.176 -39.563 156.003 1.00 49.65  ?  44   LEU A CG  1 
ATOM   273  C  CD1 . LEU A 1 33  ? 128.811 -40.492 154.985 1.00 49.66  ?  44   LEU A CD1 1 
ATOM   274  C  CD2 . LEU A 1 33  ? 128.060 -38.156 155.440 1.00 54.24  ?  44   LEU A CD2 1 
ATOM   275  N  N   . ARG A 1 34  ? 124.488 -40.759 158.884 1.00 41.59  ?  45   ARG A N   1 
ATOM   276  C  CA  . ARG A 1 34  ? 123.171 -41.362 159.095 1.00 40.36  ?  45   ARG A CA  1 
ATOM   277  C  C   . ARG A 1 34  ? 122.672 -42.036 157.815 1.00 42.92  ?  45   ARG A C   1 
ATOM   278  O  O   . ARG A 1 34  ? 121.593 -41.744 157.297 1.00 44.32  ?  45   ARG A O   1 
ATOM   279  C  CB  . ARG A 1 34  ? 122.163 -40.332 159.610 1.00 41.34  ?  45   ARG A CB  1 
ATOM   280  C  CG  . ARG A 1 34  ? 122.486 -39.779 160.994 1.00 52.07  ?  45   ARG A CG  1 
ATOM   281  C  CD  . ARG A 1 34  ? 121.305 -39.012 161.576 1.00 69.32  ?  45   ARG A CD  1 
ATOM   282  N  NE  . ARG A 1 34  ? 121.680 -38.204 162.734 1.00 89.07  ?  45   ARG A NE  1 
ATOM   283  C  CZ  . ARG A 1 34  ? 120.829 -37.458 163.432 1.00 106.55 ?  45   ARG A CZ  1 
ATOM   284  N  NH1 . ARG A 1 34  ? 119.548 -37.420 163.093 1.00 94.26  ?  45   ARG A NH1 1 
ATOM   285  N  NH2 . ARG A 1 34  ? 121.258 -36.751 164.470 1.00 93.55  ?  45   ARG A NH2 1 
ATOM   286  N  N   . ILE A 1 35  ? 123.496 -42.951 157.307 1.00 34.76  ?  46   ILE A N   1 
ATOM   287  C  CA  . ILE A 1 35  ? 123.222 -43.670 156.070 1.00 33.12  ?  46   ILE A CA  1 
ATOM   288  C  C   . ILE A 1 35  ? 123.280 -45.162 156.362 1.00 34.37  ?  46   ILE A C   1 
ATOM   289  O  O   . ILE A 1 35  ? 124.216 -45.636 157.016 1.00 33.02  ?  46   ILE A O   1 
ATOM   290  C  CB  . ILE A 1 35  ? 124.219 -43.293 154.957 1.00 36.18  ?  46   ILE A CB  1 
ATOM   291  C  CG1 . ILE A 1 35  ? 124.113 -41.802 154.619 1.00 37.51  ?  46   ILE A CG1 1 
ATOM   292  C  CG2 . ILE A 1 35  ? 123.992 -44.143 153.717 1.00 34.99  ?  46   ILE A CG2 1 
ATOM   293  C  CD1 . ILE A 1 35  ? 122.804 -41.405 153.979 1.00 41.24  ?  46   ILE A CD1 1 
ATOM   294  N  N   . LEU A 1 36  ? 122.276 -45.895 155.890 1.00 37.77  ?  47   LEU A N   1 
ATOM   295  C  CA  . LEU A 1 36  ? 122.211 -47.339 156.057 1.00 35.93  ?  47   LEU A CA  1 
ATOM   296  C  C   . LEU A 1 36  ? 122.743 -48.022 154.804 1.00 38.71  ?  47   LEU A C   1 
ATOM   297  O  O   . LEU A 1 36  ? 122.464 -47.588 153.683 1.00 39.90  ?  47   LEU A O   1 
ATOM   298  C  CB  . LEU A 1 36  ? 120.774 -47.786 156.328 1.00 35.65  ?  47   LEU A CB  1 
ATOM   299  C  CG  . LEU A 1 36  ? 120.601 -49.163 156.964 1.00 40.18  ?  47   LEU A CG  1 
ATOM   300  C  CD1 . LEU A 1 36  ? 120.982 -49.115 158.436 1.00 41.34  ?  47   LEU A CD1 1 
ATOM   301  C  CD2 . LEU A 1 36  ? 119.176 -49.658 156.785 1.00 40.34  ?  47   LEU A CD2 1 
ATOM   302  N  N   . ALA A 1 37  ? 123.513 -49.091 154.997 1.00 24.84  ?  48   ALA A N   1 
ATOM   303  C  CA  . ALA A 1 37  ? 124.108 -49.831 153.893 1.00 23.70  ?  48   ALA A CA  1 
ATOM   304  C  C   . ALA A 1 37  ? 123.720 -51.297 153.995 1.00 28.92  ?  48   ALA A C   1 
ATOM   305  O  O   . ALA A 1 37  ? 123.850 -51.903 155.064 1.00 29.60  ?  48   ALA A O   1 
ATOM   306  C  CB  . ALA A 1 37  ? 125.632 -49.685 153.887 1.00 24.37  ?  48   ALA A CB  1 
ATOM   307  N  N   . ILE A 1 38  ? 123.251 -51.865 152.886 1.00 26.56  ?  49   ILE A N   1 
ATOM   308  C  CA  . ILE A 1 38  ? 122.846 -53.264 152.823 1.00 24.07  ?  49   ILE A CA  1 
ATOM   309  C  C   . ILE A 1 38  ? 123.628 -53.944 151.707 1.00 26.97  ?  49   ILE A C   1 
ATOM   310  O  O   . ILE A 1 38  ? 123.692 -53.430 150.584 1.00 29.01  ?  49   ILE A O   1 
ATOM   311  C  CB  . ILE A 1 38  ? 121.330 -53.414 152.595 1.00 25.91  ?  49   ILE A CB  1 
ATOM   312  C  CG1 . ILE A 1 38  ? 120.549 -52.872 153.795 1.00 25.14  ?  49   ILE A CG1 1 
ATOM   313  C  CG2 . ILE A 1 38  ? 120.968 -54.868 152.334 1.00 24.75  ?  49   ILE A CG2 1 
ATOM   314  C  CD1 . ILE A 1 38  ? 119.050 -53.052 153.682 1.00 31.28  ?  49   ILE A CD1 1 
ATOM   315  N  N   . GLY A 1 39  ? 124.229 -55.087 152.021 1.00 25.50  ?  50   GLY A N   1 
ATOM   316  C  CA  . GLY A 1 39  ? 124.843 -55.933 151.018 1.00 23.56  ?  50   GLY A CA  1 
ATOM   317  C  C   . GLY A 1 39  ? 124.019 -57.184 150.794 1.00 24.97  ?  50   GLY A C   1 
ATOM   318  O  O   . GLY A 1 39  ? 123.266 -57.595 151.683 1.00 23.16  ?  50   GLY A O   1 
ATOM   319  N  N   . THR A 1 40  ? 124.139 -57.797 149.616 1.00 20.71  ?  51   THR A N   1 
ATOM   320  C  CA  . THR A 1 40  ? 123.345 -58.966 149.262 1.00 20.47  ?  51   THR A CA  1 
ATOM   321  C  C   . THR A 1 40  ? 124.265 -60.096 148.815 1.00 26.22  ?  51   THR A C   1 
ATOM   322  O  O   . THR A 1 40  ? 125.462 -59.901 148.592 1.00 26.73  ?  51   THR A O   1 
ATOM   323  C  CB  . THR A 1 40  ? 122.328 -58.645 148.156 1.00 24.52  ?  51   THR A CB  1 
ATOM   324  O  OG1 . THR A 1 40  ? 123.020 -58.334 146.941 1.00 27.81  ?  51   THR A OG1 1 
ATOM   325  C  CG2 . THR A 1 40  ? 121.453 -57.464 148.552 1.00 16.90  ?  51   THR A CG2 1 
ATOM   326  N  N   . ARG A 1 41  ? 123.686 -61.294 148.683 1.00 23.57  ?  52   ARG A N   1 
ATOM   327  C  CA  . ARG A 1 41  ? 124.461 -62.439 148.212 1.00 22.88  ?  52   ARG A CA  1 
ATOM   328  C  C   . ARG A 1 41  ? 124.923 -62.250 146.774 1.00 25.58  ?  52   ARG A C   1 
ATOM   329  O  O   . ARG A 1 41  ? 125.938 -62.828 146.367 1.00 24.57  ?  52   ARG A O   1 
ATOM   330  C  CB  . ARG A 1 41  ? 123.646 -63.728 148.328 1.00 22.21  ?  52   ARG A CB  1 
ATOM   331  C  CG  . ARG A 1 41  ? 123.278 -64.132 149.745 1.00 28.51  ?  52   ARG A CG  1 
ATOM   332  C  CD  . ARG A 1 41  ? 122.638 -65.512 149.757 1.00 34.99  ?  52   ARG A CD  1 
ATOM   333  N  NE  . ARG A 1 41  ? 121.948 -65.793 151.012 1.00 33.32  ?  52   ARG A NE  1 
ATOM   334  C  CZ  . ARG A 1 41  ? 121.287 -66.918 151.264 1.00 55.64  ?  52   ARG A CZ  1 
ATOM   335  N  NH1 . ARG A 1 41  ? 121.229 -67.875 150.348 1.00 46.26  ?  52   ARG A NH1 1 
ATOM   336  N  NH2 . ARG A 1 41  ? 120.685 -67.087 152.433 1.00 49.42  ?  52   ARG A NH2 1 
ATOM   337  N  N   . SER A 1 42  ? 124.199 -61.449 145.993 1.00 24.63  ?  53   SER A N   1 
ATOM   338  C  CA  . SER A 1 42  ? 124.526 -61.232 144.589 1.00 24.73  ?  53   SER A CA  1 
ATOM   339  C  C   . SER A 1 42  ? 125.604 -60.173 144.376 1.00 27.89  ?  53   SER A C   1 
ATOM   340  O  O   . SER A 1 42  ? 125.975 -59.917 143.226 1.00 28.23  ?  53   SER A O   1 
ATOM   341  C  CB  . SER A 1 42  ? 123.263 -60.844 143.811 1.00 27.87  ?  53   SER A CB  1 
ATOM   342  O  OG  . SER A 1 42  ? 122.666 -59.674 144.342 1.00 40.89  ?  53   SER A OG  1 
ATOM   343  N  N   . GLY A 1 43  ? 126.117 -59.557 145.437 1.00 17.91  ?  54   GLY A N   1 
ATOM   344  C  CA  . GLY A 1 43  ? 127.162 -58.564 145.313 1.00 18.08  ?  54   GLY A CA  1 
ATOM   345  C  C   . GLY A 1 43  ? 126.691 -57.127 145.315 1.00 21.70  ?  54   GLY A C   1 
ATOM   346  O  O   . GLY A 1 43  ? 127.519 -56.222 145.156 1.00 22.96  ?  54   GLY A O   1 
ATOM   347  N  N   . ALA A 1 44  ? 125.398 -56.887 145.493 1.00 18.46  ?  55   ALA A N   1 
ATOM   348  C  CA  . ALA A 1 44  ? 124.874 -55.533 145.490 1.00 20.28  ?  55   ALA A CA  1 
ATOM   349  C  C   . ALA A 1 44  ? 125.198 -54.822 146.797 1.00 28.34  ?  55   ALA A C   1 
ATOM   350  O  O   . ALA A 1 44  ? 125.244 -55.432 147.869 1.00 27.86  ?  55   ALA A O   1 
ATOM   351  C  CB  . ALA A 1 44  ? 123.360 -55.543 145.268 1.00 20.71  ?  55   ALA A CB  1 
ATOM   352  N  N   . ILE A 1 45  ? 125.436 -53.518 146.694 1.00 27.26  ?  56   ILE A N   1 
ATOM   353  C  CA  . ILE A 1 45  ? 125.587 -52.641 147.848 1.00 28.26  ?  56   ILE A CA  1 
ATOM   354  C  C   . ILE A 1 45  ? 124.550 -51.537 147.700 1.00 33.57  ?  56   ILE A C   1 
ATOM   355  O  O   . ILE A 1 45  ? 124.550 -50.805 146.702 1.00 34.23  ?  56   ILE A O   1 
ATOM   356  C  CB  . ILE A 1 45  ? 127.014 -52.074 147.967 1.00 33.28  ?  56   ILE A CB  1 
ATOM   357  C  CG1 . ILE A 1 45  ? 127.114 -51.069 149.119 1.00 34.00  ?  56   ILE A CG1 1 
ATOM   358  C  CG2 . ILE A 1 45  ? 127.501 -51.469 146.649 1.00 35.86  ?  56   ILE A CG2 1 
ATOM   359  C  CD1 . ILE A 1 45  ? 127.214 -51.716 150.476 1.00 31.49  ?  56   ILE A CD1 1 
ATOM   360  N  N   . LYS A 1 46  ? 123.642 -51.441 148.667 1.00 29.24  ?  57   LYS A N   1 
ATOM   361  C  CA  . LYS A 1 46  ? 122.535 -50.497 148.607 1.00 29.08  ?  57   LYS A CA  1 
ATOM   362  C  C   . LYS A 1 46  ? 122.622 -49.547 149.792 1.00 35.63  ?  57   LYS A C   1 
ATOM   363  O  O   . LYS A 1 46  ? 122.583 -49.983 150.948 1.00 35.65  ?  57   LYS A O   1 
ATOM   364  C  CB  . LYS A 1 46  ? 121.193 -51.231 148.582 1.00 29.54  ?  57   LYS A CB  1 
ATOM   365  C  CG  . LYS A 1 46  ? 121.001 -52.107 147.347 1.00 31.03  ?  57   LYS A CG  1 
ATOM   366  C  CD  . LYS A 1 46  ? 119.541 -52.478 147.140 1.00 33.33  ?  57   LYS A CD  1 
ATOM   367  C  CE  . LYS A 1 46  ? 119.298 -53.035 145.745 1.00 34.08  ?  57   LYS A CE  1 
ATOM   368  N  NZ  . LYS A 1 46  ? 117.855 -52.950 145.374 1.00 26.87  ?  57   LYS A NZ  1 
ATOM   369  N  N   . LEU A 1 47  ? 122.742 -48.255 149.500 1.00 33.37  ?  58   LEU A N   1 
ATOM   370  C  CA  . LEU A 1 47  ? 122.831 -47.212 150.514 1.00 33.63  ?  58   LEU A CA  1 
ATOM   371  C  C   . LEU A 1 47  ? 121.494 -46.490 150.635 1.00 37.46  ?  58   LEU A C   1 
ATOM   372  O  O   . LEU A 1 47  ? 120.818 -46.240 149.633 1.00 36.39  ?  58   LEU A O   1 
ATOM   373  C  CB  . LEU A 1 47  ? 123.937 -46.211 150.167 1.00 34.25  ?  58   LEU A CB  1 
ATOM   374  C  CG  . LEU A 1 47  ? 125.367 -46.464 150.656 1.00 38.92  ?  58   LEU A CG  1 
ATOM   375  C  CD1 . LEU A 1 47  ? 125.782 -47.915 150.479 1.00 38.27  ?  58   LEU A CD1 1 
ATOM   376  C  CD2 . LEU A 1 47  ? 126.332 -45.546 149.920 1.00 41.91  ?  58   LEU A CD2 1 
ATOM   377  N  N   . TYR A 1 48  ? 121.115 -46.155 151.868 1.00 33.15  ?  59   TYR A N   1 
ATOM   378  C  CA  . TYR A 1 48  ? 119.844 -45.494 152.129 1.00 32.45  ?  59   TYR A CA  1 
ATOM   379  C  C   . TYR A 1 48  ? 120.024 -44.405 153.173 1.00 36.27  ?  59   TYR A C   1 
ATOM   380  O  O   . TYR A 1 48  ? 120.725 -44.598 154.171 1.00 37.54  ?  59   TYR A O   1 
ATOM   381  C  CB  . TYR A 1 48  ? 118.777 -46.486 152.612 1.00 32.47  ?  59   TYR A CB  1 
ATOM   382  C  CG  . TYR A 1 48  ? 118.486 -47.593 151.632 1.00 33.19  ?  59   TYR A CG  1 
ATOM   383  C  CD1 . TYR A 1 48  ? 117.513 -47.443 150.655 1.00 34.41  ?  59   TYR A CD1 1 
ATOM   384  C  CD2 . TYR A 1 48  ? 119.189 -48.790 151.682 1.00 33.29  ?  59   TYR A CD2 1 
ATOM   385  C  CE1 . TYR A 1 48  ? 117.248 -48.453 149.755 1.00 34.07  ?  59   TYR A CE1 1 
ATOM   386  C  CE2 . TYR A 1 48  ? 118.930 -49.805 150.788 1.00 33.60  ?  59   TYR A CE2 1 
ATOM   387  C  CZ  . TYR A 1 48  ? 117.961 -49.631 149.825 1.00 40.56  ?  59   TYR A CZ  1 
ATOM   388  O  OH  . TYR A 1 48  ? 117.701 -50.643 148.935 1.00 40.51  ?  59   TYR A OH  1 
ATOM   389  N  N   . GLY A 1 49  ? 119.383 -43.268 152.936 1.00 26.88  ?  60   GLY A N   1 
ATOM   390  C  CA  . GLY A 1 49  ? 119.305 -42.178 153.889 1.00 26.81  ?  60   GLY A CA  1 
ATOM   391  C  C   . GLY A 1 49  ? 117.863 -41.741 154.043 1.00 31.74  ?  60   GLY A C   1 
ATOM   392  O  O   . GLY A 1 49  ? 116.940 -42.556 154.058 1.00 30.86  ?  60   GLY A O   1 
ATOM   393  N  N   . ALA A 1 50  ? 117.675 -40.429 154.157 1.00 42.04  ?  61   ALA A N   1 
ATOM   394  C  CA  . ALA A 1 50  ? 116.331 -39.873 154.165 1.00 43.11  ?  61   ALA A CA  1 
ATOM   395  C  C   . ALA A 1 50  ? 115.616 -40.240 152.867 1.00 46.11  ?  61   ALA A C   1 
ATOM   396  O  O   . ALA A 1 50  ? 116.254 -40.356 151.816 1.00 47.29  ?  61   ALA A O   1 
ATOM   397  C  CB  . ALA A 1 50  ? 116.378 -38.355 154.324 1.00 45.45  ?  61   ALA A CB  1 
ATOM   398  N  N   . PRO A 1 51  ? 114.289 -40.449 152.917 1.00 31.57  ?  62   PRO A N   1 
ATOM   399  C  CA  . PRO A 1 51  ? 113.536 -40.799 151.702 1.00 31.50  ?  62   PRO A CA  1 
ATOM   400  C  C   . PRO A 1 51  ? 113.888 -39.927 150.508 1.00 37.69  ?  62   PRO A C   1 
ATOM   401  O  O   . PRO A 1 51  ? 113.773 -38.698 150.559 1.00 39.51  ?  62   PRO A O   1 
ATOM   402  C  CB  . PRO A 1 51  ? 112.078 -40.604 152.136 1.00 32.70  ?  62   PRO A CB  1 
ATOM   403  C  CG  . PRO A 1 51  ? 112.100 -40.918 153.598 1.00 36.08  ?  62   PRO A CG  1 
ATOM   404  C  CD  . PRO A 1 51  ? 113.428 -40.426 154.113 1.00 32.10  ?  62   PRO A CD  1 
ATOM   405  N  N   . GLY A 1 52  ? 114.334 -40.567 149.432 1.00 36.56  ?  63   GLY A N   1 
ATOM   406  C  CA  . GLY A 1 52  ? 114.868 -39.886 148.278 1.00 36.65  ?  63   GLY A CA  1 
ATOM   407  C  C   . GLY A 1 52  ? 116.374 -39.964 148.157 1.00 40.11  ?  63   GLY A C   1 
ATOM   408  O  O   . GLY A 1 52  ? 116.911 -39.677 147.081 1.00 39.00  ?  63   GLY A O   1 
ATOM   409  N  N   . VAL A 1 53  ? 117.064 -40.338 149.232 1.00 33.36  ?  64   VAL A N   1 
ATOM   410  C  CA  . VAL A 1 53  ? 118.507 -40.549 149.221 1.00 32.53  ?  64   VAL A CA  1 
ATOM   411  C  C   . VAL A 1 53  ? 118.744 -42.049 149.077 1.00 35.56  ?  64   VAL A C   1 
ATOM   412  O  O   . VAL A 1 53  ? 118.467 -42.823 150.002 1.00 35.45  ?  64   VAL A O   1 
ATOM   413  C  CB  . VAL A 1 53  ? 119.170 -39.992 150.488 1.00 36.34  ?  64   VAL A CB  1 
ATOM   414  C  CG1 . VAL A 1 53  ? 120.687 -40.082 150.379 1.00 35.48  ?  64   VAL A CG1 1 
ATOM   415  C  CG2 . VAL A 1 53  ? 118.730 -38.554 150.732 1.00 36.97  ?  64   VAL A CG2 1 
ATOM   416  N  N   . GLU A 1 54  ? 119.254 -42.459 147.916 1.00 33.63  ?  65   GLU A N   1 
ATOM   417  C  CA  . GLU A 1 54  ? 119.404 -43.866 147.576 1.00 33.36  ?  65   GLU A CA  1 
ATOM   418  C  C   . GLU A 1 54  ? 120.599 -44.049 146.656 1.00 38.24  ?  65   GLU A C   1 
ATOM   419  O  O   . GLU A 1 54  ? 120.851 -43.216 145.784 1.00 39.15  ?  65   GLU A O   1 
ATOM   420  C  CB  . GLU A 1 54  ? 118.153 -44.418 146.883 1.00 34.70  ?  65   GLU A CB  1 
ATOM   421  C  CG  . GLU A 1 54  ? 117.053 -44.855 147.822 1.00 45.91  ?  65   GLU A CG  1 
ATOM   422  C  CD  . GLU A 1 54  ? 115.833 -45.360 147.083 1.00 65.76  ?  65   GLU A CD  1 
ATOM   423  O  OE1 . GLU A 1 54  ? 115.998 -45.956 145.997 1.00 55.29  ?  65   GLU A OE1 1 
ATOM   424  O  OE2 . GLU A 1 54  ? 114.709 -45.153 147.586 1.00 63.65  ?  65   GLU A OE2 1 
ATOM   425  N  N   . PHE A 1 55  ? 121.313 -45.158 146.839 1.00 32.39  ?  66   PHE A N   1 
ATOM   426  C  CA  . PHE A 1 55  ? 122.461 -45.493 146.008 1.00 32.74  ?  66   PHE A CA  1 
ATOM   427  C  C   . PHE A 1 55  ? 122.533 -47.001 145.843 1.00 36.93  ?  66   PHE A C   1 
ATOM   428  O  O   . PHE A 1 55  ? 122.546 -47.739 146.832 1.00 35.84  ?  66   PHE A O   1 
ATOM   429  C  CB  . PHE A 1 55  ? 123.764 -44.963 146.616 1.00 35.14  ?  66   PHE A CB  1 
ATOM   430  C  CG  . PHE A 1 55  ? 123.798 -43.471 146.758 1.00 38.11  ?  66   PHE A CG  1 
ATOM   431  C  CD1 . PHE A 1 55  ? 124.045 -42.664 145.661 1.00 42.47  ?  66   PHE A CD1 1 
ATOM   432  C  CD2 . PHE A 1 55  ? 123.575 -42.873 147.987 1.00 40.21  ?  66   PHE A CD2 1 
ATOM   433  C  CE1 . PHE A 1 55  ? 124.072 -41.290 145.787 1.00 44.35  ?  66   PHE A CE1 1 
ATOM   434  C  CE2 . PHE A 1 55  ? 123.602 -41.499 148.120 1.00 44.26  ?  66   PHE A CE2 1 
ATOM   435  C  CZ  . PHE A 1 55  ? 123.851 -40.707 147.019 1.00 43.23  ?  66   PHE A CZ  1 
ATOM   436  N  N   . MET A 1 56  ? 122.574 -47.450 144.593 1.00 42.06  ?  67   MET A N   1 
ATOM   437  C  CA  . MET A 1 56  ? 122.663 -48.863 144.255 1.00 41.91  ?  67   MET A CA  1 
ATOM   438  C  C   . MET A 1 56  ? 123.989 -49.119 143.557 1.00 40.77  ?  67   MET A C   1 
ATOM   439  O  O   . MET A 1 56  ? 124.320 -48.443 142.578 1.00 41.44  ?  67   MET A O   1 
ATOM   440  C  CB  . MET A 1 56  ? 121.497 -49.291 143.356 1.00 45.51  ?  67   MET A CB  1 
ATOM   441  C  CG  . MET A 1 56  ? 120.397 -50.067 144.067 1.00 50.31  ?  67   MET A CG  1 
ATOM   442  S  SD  . MET A 1 56  ? 119.638 -49.175 145.437 1.00 56.82  ?  67   MET A SD  1 
ATOM   443  C  CE  . MET A 1 56  ? 119.077 -47.693 144.605 1.00 55.09  ?  67   MET A CE  1 
ATOM   444  N  N   . GLY A 1 57  ? 124.750 -50.090 144.070 1.00 29.50  ?  68   GLY A N   1 
ATOM   445  C  CA  . GLY A 1 57  ? 126.008 -50.470 143.471 1.00 28.04  ?  68   GLY A CA  1 
ATOM   446  C  C   . GLY A 1 57  ? 126.079 -51.975 143.276 1.00 29.63  ?  68   GLY A C   1 
ATOM   447  O  O   . GLY A 1 57  ? 125.265 -52.731 143.809 1.00 28.46  ?  68   GLY A O   1 
ATOM   448  N  N   . LEU A 1 58  ? 127.077 -52.397 142.502 1.00 31.74  ?  69   LEU A N   1 
ATOM   449  C  CA  . LEU A 1 58  ? 127.223 -53.807 142.165 1.00 30.78  ?  69   LEU A CA  1 
ATOM   450  C  C   . LEU A 1 58  ? 128.698 -54.135 142.004 1.00 34.43  ?  69   LEU A C   1 
ATOM   451  O  O   . LEU A 1 58  ? 129.407 -53.455 141.257 1.00 35.45  ?  69   LEU A O   1 
ATOM   452  C  CB  . LEU A 1 58  ? 126.461 -54.143 140.877 1.00 30.53  ?  69   LEU A CB  1 
ATOM   453  C  CG  . LEU A 1 58  ? 125.790 -55.514 140.779 1.00 34.55  ?  69   LEU A CG  1 
ATOM   454  C  CD1 . LEU A 1 58  ? 124.696 -55.647 141.824 1.00 34.10  ?  69   LEU A CD1 1 
ATOM   455  C  CD2 . LEU A 1 58  ? 125.222 -55.729 139.384 1.00 34.36  ?  69   LEU A CD2 1 
ATOM   456  N  N   . HIS A 1 59  ? 129.154 -55.171 142.703 1.00 26.07  ?  70   HIS A N   1 
ATOM   457  C  CA  . HIS A 1 59  ? 130.530 -55.624 142.568 1.00 24.70  ?  70   HIS A CA  1 
ATOM   458  C  C   . HIS A 1 59  ? 130.694 -56.423 141.281 1.00 30.26  ?  70   HIS A C   1 
ATOM   459  O  O   . HIS A 1 59  ? 129.786 -57.153 140.870 1.00 29.16  ?  70   HIS A O   1 
ATOM   460  C  CB  . HIS A 1 59  ? 130.934 -56.473 143.777 1.00 23.02  ?  70   HIS A CB  1 
ATOM   461  C  CG  . HIS A 1 59  ? 131.009 -55.703 145.059 1.00 25.44  ?  70   HIS A CG  1 
ATOM   462  N  ND1 . HIS A 1 59  ? 129.892 -55.350 145.784 1.00 26.73  ?  70   HIS A ND1 1 
ATOM   463  C  CD2 . HIS A 1 59  ? 132.070 -55.215 145.744 1.00 26.96  ?  70   HIS A CD2 1 
ATOM   464  C  CE1 . HIS A 1 59  ? 130.260 -54.680 146.860 1.00 25.81  ?  70   HIS A CE1 1 
ATOM   465  N  NE2 . HIS A 1 59  ? 131.577 -54.583 146.860 1.00 26.49  ?  70   HIS A NE2 1 
ATOM   466  N  N   . GLN A 1 60  ? 131.861 -56.275 140.643 1.00 33.48  ?  71   GLN A N   1 
ATOM   467  C  CA  . GLN A 1 60  ? 132.127 -56.965 139.381 1.00 33.81  ?  71   GLN A CA  1 
ATOM   468  C  C   . GLN A 1 60  ? 132.057 -58.477 139.535 1.00 35.63  ?  71   GLN A C   1 
ATOM   469  O  O   . GLN A 1 60  ? 131.711 -59.182 138.582 1.00 33.86  ?  71   GLN A O   1 
ATOM   470  C  CB  . GLN A 1 60  ? 133.496 -56.550 138.839 1.00 36.44  ?  71   GLN A CB  1 
ATOM   471  C  CG  . GLN A 1 60  ? 133.594 -55.072 138.520 1.00 53.33  ?  71   GLN A CG  1 
ATOM   472  C  CD  . GLN A 1 60  ? 134.918 -54.478 138.941 1.00 74.11  ?  71   GLN A CD  1 
ATOM   473  O  OE1 . GLN A 1 60  ? 135.939 -55.165 138.963 1.00 67.61  ?  71   GLN A OE1 1 
ATOM   474  N  NE2 . GLN A 1 60  ? 134.906 -53.198 139.293 1.00 67.62  ?  71   GLN A NE2 1 
ATOM   475  N  N   A GLU A 1 61  ? 132.390 -58.993 140.712 0.45 41.22  ?  72   GLU A N   1 
ATOM   476  N  N   B GLU A 1 61  ? 132.381 -58.988 140.715 0.55 41.78  ?  72   GLU A N   1 
ATOM   477  C  CA  A GLU A 1 61  ? 132.212 -60.402 141.028 0.45 40.72  ?  72   GLU A CA  1 
ATOM   478  C  CA  B GLU A 1 61  ? 132.208 -60.394 141.036 0.55 41.55  ?  72   GLU A CA  1 
ATOM   479  C  C   A GLU A 1 61  ? 130.887 -60.594 141.750 0.45 45.99  ?  72   GLU A C   1 
ATOM   480  C  C   B GLU A 1 61  ? 130.873 -60.583 141.743 0.55 46.61  ?  72   GLU A C   1 
ATOM   481  O  O   A GLU A 1 61  ? 130.527 -59.806 142.630 0.45 47.20  ?  72   GLU A O   1 
ATOM   482  O  O   B GLU A 1 61  ? 130.491 -59.779 142.599 0.55 48.12  ?  72   GLU A O   1 
ATOM   483  C  CB  A GLU A 1 61  ? 133.362 -60.926 141.891 0.45 41.86  ?  72   GLU A CB  1 
ATOM   484  C  CB  B GLU A 1 61  ? 133.352 -60.907 141.916 0.55 42.92  ?  72   GLU A CB  1 
ATOM   485  C  CG  A GLU A 1 61  ? 134.643 -61.221 141.125 0.45 46.87  ?  72   GLU A CG  1 
ATOM   486  C  CG  B GLU A 1 61  ? 133.719 -59.994 143.077 0.55 50.63  ?  72   GLU A CG  1 
ATOM   487  C  CD  A GLU A 1 61  ? 134.543 -62.476 140.278 0.45 55.66  ?  72   GLU A CD  1 
ATOM   488  C  CD  B GLU A 1 61  ? 134.620 -58.844 142.666 0.55 68.31  ?  72   GLU A CD  1 
ATOM   489  O  OE1 A GLU A 1 61  ? 133.679 -63.328 140.575 0.45 42.75  ?  72   GLU A OE1 1 
ATOM   490  O  OE1 B GLU A 1 61  ? 135.688 -59.106 142.073 0.55 70.87  ?  72   GLU A OE1 1 
ATOM   491  O  OE2 A GLU A 1 61  ? 135.326 -62.609 139.313 0.45 47.26  ?  72   GLU A OE2 1 
ATOM   492  O  OE2 B GLU A 1 61  ? 134.253 -57.679 142.922 0.55 57.44  ?  72   GLU A OE2 1 
ATOM   493  N  N   . ASN A 1 62  ? 130.159 -61.642 141.371 1.00 45.10  ?  73   ASN A N   1 
ATOM   494  C  CA  . ASN A 1 62  ? 128.855 -61.926 141.966 1.00 44.07  ?  73   ASN A CA  1 
ATOM   495  C  C   . ASN A 1 62  ? 129.043 -62.805 143.203 1.00 48.18  ?  73   ASN A C   1 
ATOM   496  O  O   . ASN A 1 62  ? 128.639 -63.968 143.268 1.00 49.01  ?  73   ASN A O   1 
ATOM   497  C  CB  . ASN A 1 62  ? 127.928 -62.549 140.934 1.00 45.08  ?  73   ASN A CB  1 
ATOM   498  C  CG  . ASN A 1 62  ? 127.571 -61.576 139.828 1.00 66.82  ?  73   ASN A CG  1 
ATOM   499  O  OD1 . ASN A 1 62  ? 128.320 -61.411 138.864 1.00 49.01  ?  73   ASN A OD1 1 
ATOM   500  N  ND2 . ASN A 1 62  ? 126.434 -60.905 139.975 1.00 58.62  ?  73   ASN A ND2 1 
ATOM   501  N  N   . ASN A 1 63  ? 129.686 -62.203 144.200 1.00 36.49  ?  74   ASN A N   1 
ATOM   502  C  CA  . ASN A 1 63  ? 129.962 -62.825 145.484 1.00 34.35  ?  74   ASN A CA  1 
ATOM   503  C  C   . ASN A 1 63  ? 129.273 -62.032 146.586 1.00 32.36  ?  74   ASN A C   1 
ATOM   504  O  O   . ASN A 1 63  ? 129.062 -60.823 146.461 1.00 30.62  ?  74   ASN A O   1 
ATOM   505  C  CB  . ASN A 1 63  ? 131.471 -62.896 145.748 1.00 35.21  ?  74   ASN A CB  1 
ATOM   506  C  CG  . ASN A 1 63  ? 132.139 -64.039 145.013 1.00 61.12  ?  74   ASN A CG  1 
ATOM   507  O  OD1 . ASN A 1 63  ? 132.257 -64.021 143.788 1.00 52.42  ?  74   ASN A OD1 1 
ATOM   508  N  ND2 . ASN A 1 63  ? 132.588 -65.039 145.761 1.00 61.07  ?  74   ASN A ND2 1 
ATOM   509  N  N   . ALA A 1 64  ? 128.925 -62.723 147.667 1.00 30.19  ?  75   ALA A N   1 
ATOM   510  C  CA  . ALA A 1 64  ? 128.167 -62.102 148.744 1.00 29.03  ?  75   ALA A CA  1 
ATOM   511  C  C   . ALA A 1 64  ? 128.982 -61.020 149.442 1.00 31.79  ?  75   ALA A C   1 
ATOM   512  O  O   . ALA A 1 64  ? 130.191 -61.159 149.638 1.00 31.17  ?  75   ALA A O   1 
ATOM   513  C  CB  . ALA A 1 64  ? 127.733 -63.157 149.760 1.00 28.66  ?  75   ALA A CB  1 
ATOM   514  N  N   . VAL A 1 65  ? 128.310 -59.935 149.816 1.00 20.11  ?  76   VAL A N   1 
ATOM   515  C  CA  . VAL A 1 65  ? 128.909 -58.920 150.677 1.00 20.42  ?  76   VAL A CA  1 
ATOM   516  C  C   . VAL A 1 65  ? 128.779 -59.391 152.120 1.00 24.57  ?  76   VAL A C   1 
ATOM   517  O  O   . VAL A 1 65  ? 127.666 -59.591 152.618 1.00 24.18  ?  76   VAL A O   1 
ATOM   518  C  CB  . VAL A 1 65  ? 128.238 -57.554 150.480 1.00 23.30  ?  76   VAL A CB  1 
ATOM   519  C  CG1 . VAL A 1 65  ? 128.978 -56.481 151.268 1.00 22.71  ?  76   VAL A CG1 1 
ATOM   520  C  CG2 . VAL A 1 65  ? 128.176 -57.200 149.003 1.00 23.19  ?  76   VAL A CG2 1 
ATOM   521  N  N   . THR A 1 66  ? 129.914 -59.580 152.794 1.00 24.06  ?  77   THR A N   1 
ATOM   522  C  CA  . THR A 1 66  ? 129.901 -60.083 154.161 1.00 23.54  ?  77   THR A CA  1 
ATOM   523  C  C   . THR A 1 66  ? 130.111 -58.999 155.209 1.00 28.05  ?  77   THR A C   1 
ATOM   524  O  O   . THR A 1 66  ? 129.653 -59.169 156.345 1.00 27.83  ?  77   THR A O   1 
ATOM   525  C  CB  . THR A 1 66  ? 130.967 -61.169 154.343 1.00 23.55  ?  77   THR A CB  1 
ATOM   526  O  OG1 . THR A 1 66  ? 132.270 -60.596 154.178 1.00 19.55  ?  77   THR A OG1 1 
ATOM   527  C  CG2 . THR A 1 66  ? 130.770 -62.285 153.323 1.00 17.46  ?  77   THR A CG2 1 
ATOM   528  N  N   . GLN A 1 67  ? 130.785 -57.901 154.865 1.00 22.31  ?  78   GLN A N   1 
ATOM   529  C  CA  . GLN A 1 67  ? 130.982 -56.798 155.795 1.00 22.50  ?  78   GLN A CA  1 
ATOM   530  C  C   . GLN A 1 67  ? 130.938 -55.479 155.039 1.00 25.77  ?  78   GLN A C   1 
ATOM   531  O  O   . GLN A 1 67  ? 131.379 -55.391 153.891 1.00 24.60  ?  78   GLN A O   1 
ATOM   532  C  CB  . GLN A 1 67  ? 132.311 -56.920 156.549 1.00 24.39  ?  78   GLN A CB  1 
ATOM   533  C  CG  . GLN A 1 67  ? 132.360 -58.070 157.533 1.00 34.29  ?  78   GLN A CG  1 
ATOM   534  C  CD  . GLN A 1 67  ? 133.684 -58.164 158.249 1.00 38.11  ?  78   GLN A CD  1 
ATOM   535  O  OE1 . GLN A 1 67  ? 134.386 -57.167 158.412 1.00 30.08  ?  78   GLN A OE1 1 
ATOM   536  N  NE2 . GLN A 1 67  ? 134.039 -59.370 158.679 1.00 28.21  ?  78   GLN A NE2 1 
ATOM   537  N  N   . ILE A 1 68  ? 130.404 -54.453 155.698 1.00 25.11  ?  79   ILE A N   1 
ATOM   538  C  CA  . ILE A 1 68  ? 130.337 -53.100 155.153 1.00 26.26  ?  79   ILE A CA  1 
ATOM   539  C  C   . ILE A 1 68  ? 130.805 -52.146 156.239 1.00 33.12  ?  79   ILE A C   1 
ATOM   540  O  O   . ILE A 1 68  ? 130.224 -52.118 157.330 1.00 34.79  ?  79   ILE A O   1 
ATOM   541  C  CB  . ILE A 1 68  ? 128.918 -52.727 154.691 1.00 28.96  ?  79   ILE A CB  1 
ATOM   542  C  CG1 . ILE A 1 68  ? 128.414 -53.716 153.639 1.00 27.80  ?  79   ILE A CG1 1 
ATOM   543  C  CG2 . ILE A 1 68  ? 128.899 -51.305 154.151 1.00 32.18  ?  79   ILE A CG2 1 
ATOM   544  C  CD1 . ILE A 1 68  ? 126.913 -53.689 153.433 1.00 29.33  ?  79   ILE A CD1 1 
ATOM   545  N  N   . HIS A 1 69  ? 131.840 -51.363 155.946 1.00 29.12  ?  80   HIS A N   1 
ATOM   546  C  CA  . HIS A 1 69  ? 132.403 -50.422 156.913 1.00 28.73  ?  80   HIS A CA  1 
ATOM   547  C  C   . HIS A 1 69  ? 132.466 -49.038 156.277 1.00 34.72  ?  80   HIS A C   1 
ATOM   548  O  O   . HIS A 1 69  ? 133.340 -48.767 155.447 1.00 32.53  ?  80   HIS A O   1 
ATOM   549  C  CB  . HIS A 1 69  ? 133.784 -50.873 157.381 1.00 28.43  ?  80   HIS A CB  1 
ATOM   550  C  CG  . HIS A 1 69  ? 133.782 -52.209 158.052 1.00 30.23  ?  80   HIS A CG  1 
ATOM   551  N  ND1 . HIS A 1 69  ? 133.544 -52.365 159.401 1.00 30.90  ?  80   HIS A ND1 1 
ATOM   552  C  CD2 . HIS A 1 69  ? 133.980 -53.454 157.558 1.00 30.62  ?  80   HIS A CD2 1 
ATOM   553  C  CE1 . HIS A 1 69  ? 133.598 -53.648 159.710 1.00 29.41  ?  80   HIS A CE1 1 
ATOM   554  N  NE2 . HIS A 1 69  ? 133.862 -54.331 158.610 1.00 29.64  ?  80   HIS A NE2 1 
ATOM   555  N  N   . LEU A 1 70  ? 131.541 -48.165 156.663 1.00 30.73  ?  81   LEU A N   1 
ATOM   556  C  CA  . LEU A 1 70  ? 131.624 -46.774 156.245 1.00 32.48  ?  81   LEU A CA  1 
ATOM   557  C  C   . LEU A 1 70  ? 132.699 -46.066 157.058 1.00 40.67  ?  81   LEU A C   1 
ATOM   558  O  O   . LEU A 1 70  ? 132.747 -46.191 158.285 1.00 41.23  ?  81   LEU A O   1 
ATOM   559  C  CB  . LEU A 1 70  ? 130.276 -46.080 156.412 1.00 32.84  ?  81   LEU A CB  1 
ATOM   560  C  CG  . LEU A 1 70  ? 129.194 -46.514 155.426 1.00 36.34  ?  81   LEU A CG  1 
ATOM   561  C  CD1 . LEU A 1 70  ? 128.085 -47.261 156.144 1.00 35.49  ?  81   LEU A CD1 1 
ATOM   562  C  CD2 . LEU A 1 70  ? 128.645 -45.310 154.675 1.00 38.44  ?  81   LEU A CD2 1 
ATOM   563  N  N   . LEU A 1 71  ? 133.571 -45.339 156.369 1.00 33.24  ?  82   LEU A N   1 
ATOM   564  C  CA  . LEU A 1 71  ? 134.686 -44.692 157.038 1.00 32.28  ?  82   LEU A CA  1 
ATOM   565  C  C   . LEU A 1 71  ? 134.176 -43.551 157.918 1.00 37.93  ?  82   LEU A C   1 
ATOM   566  O  O   . LEU A 1 71  ? 133.222 -42.859 157.546 1.00 37.50  ?  82   LEU A O   1 
ATOM   567  C  CB  . LEU A 1 71  ? 135.693 -44.171 156.014 1.00 32.24  ?  82   LEU A CB  1 
ATOM   568  C  CG  . LEU A 1 71  ? 136.312 -45.233 155.099 1.00 35.62  ?  82   LEU A CG  1 
ATOM   569  C  CD1 . LEU A 1 71  ? 137.469 -44.653 154.301 1.00 36.01  ?  82   LEU A CD1 1 
ATOM   570  C  CD2 . LEU A 1 71  ? 136.763 -46.447 155.900 1.00 37.04  ?  82   LEU A CD2 1 
ATOM   571  N  N   . PRO A 1 72  ? 134.778 -43.337 159.088 1.00 35.85  ?  83   PRO A N   1 
ATOM   572  C  CA  . PRO A 1 72  ? 134.261 -42.317 160.011 1.00 36.67  ?  83   PRO A CA  1 
ATOM   573  C  C   . PRO A 1 72  ? 134.326 -40.926 159.398 1.00 42.51  ?  83   PRO A C   1 
ATOM   574  O  O   . PRO A 1 72  ? 135.382 -40.471 158.952 1.00 43.52  ?  83   PRO A O   1 
ATOM   575  C  CB  . PRO A 1 72  ? 135.180 -42.446 161.232 1.00 38.63  ?  83   PRO A CB  1 
ATOM   576  C  CG  . PRO A 1 72  ? 136.436 -43.063 160.696 1.00 42.54  ?  83   PRO A CG  1 
ATOM   577  C  CD  . PRO A 1 72  ? 135.982 -44.002 159.618 1.00 37.26  ?  83   PRO A CD  1 
ATOM   578  N  N   . GLY A 1 73  ? 133.176 -40.260 159.360 1.00 40.78  ?  84   GLY A N   1 
ATOM   579  C  CA  . GLY A 1 73  ? 133.090 -38.911 158.835 1.00 42.62  ?  84   GLY A CA  1 
ATOM   580  C  C   . GLY A 1 73  ? 133.170 -38.828 157.325 1.00 49.21  ?  84   GLY A C   1 
ATOM   581  O  O   . GLY A 1 73  ? 132.536 -37.965 156.711 1.00 49.63  ?  84   GLY A O   1 
ATOM   582  N  N   . GLN A 1 74  ? 133.944 -39.723 156.716 1.00 50.87  ?  85   GLN A N   1 
ATOM   583  C  CA  . GLN A 1 74  ? 134.169 -39.672 155.281 1.00 50.59  ?  85   GLN A CA  1 
ATOM   584  C  C   . GLN A 1 74  ? 132.940 -40.150 154.513 1.00 54.18  ?  85   GLN A C   1 
ATOM   585  O  O   . GLN A 1 74  ? 132.100 -40.896 155.024 1.00 54.28  ?  85   GLN A O   1 
ATOM   586  C  CB  . GLN A 1 74  ? 135.375 -40.527 154.894 1.00 51.54  ?  85   GLN A CB  1 
ATOM   587  C  CG  . GLN A 1 74  ? 136.699 -40.001 155.407 1.00 68.85  ?  85   GLN A CG  1 
ATOM   588  C  CD  . GLN A 1 74  ? 137.870 -40.458 154.561 1.00 90.64  ?  85   GLN A CD  1 
ATOM   589  O  OE1 . GLN A 1 74  ? 137.748 -41.379 153.753 1.00 85.98  ?  85   GLN A OE1 1 
ATOM   590  N  NE2 . GLN A 1 74  ? 139.014 -39.806 154.735 1.00 83.48  ?  85   GLN A NE2 1 
ATOM   591  N  N   . CYS A 1 75  ? 132.848 -39.701 153.262 1.00 52.12  ?  86   CYS A N   1 
ATOM   592  C  CA  . CYS A 1 75  ? 131.861 -40.202 152.306 1.00 50.45  ?  86   CYS A CA  1 
ATOM   593  C  C   . CYS A 1 75  ? 132.377 -41.416 151.544 1.00 50.72  ?  86   CYS A C   1 
ATOM   594  O  O   . CYS A 1 75  ? 132.089 -41.580 150.354 1.00 49.50  ?  86   CYS A O   1 
ATOM   595  C  CB  . CYS A 1 75  ? 131.456 -39.087 151.344 1.00 51.34  ?  86   CYS A CB  1 
ATOM   596  S  SG  . CYS A 1 75  ? 130.148 -37.992 151.957 1.00 55.82  ?  86   CYS A SG  1 
ATOM   597  N  N   . GLN A 1 76  ? 133.154 -42.273 152.204 1.00 42.13  ?  87   GLN A N   1 
ATOM   598  C  CA  . GLN A 1 76  ? 133.685 -43.491 151.612 1.00 40.41  ?  87   GLN A CA  1 
ATOM   599  C  C   . GLN A 1 76  ? 133.291 -44.686 152.470 1.00 42.02  ?  87   GLN A C   1 
ATOM   600  O  O   . GLN A 1 76  ? 132.863 -44.542 153.619 1.00 42.46  ?  87   GLN A O   1 
ATOM   601  C  CB  . GLN A 1 76  ? 135.215 -43.425 151.462 1.00 41.97  ?  87   GLN A CB  1 
ATOM   602  C  CG  . GLN A 1 76  ? 135.698 -42.389 150.464 1.00 57.64  ?  87   GLN A CG  1 
ATOM   603  C  CD  . GLN A 1 76  ? 137.146 -42.597 150.067 1.00 76.59  ?  87   GLN A CD  1 
ATOM   604  O  OE1 . GLN A 1 76  ? 137.462 -42.745 148.886 1.00 71.89  ?  87   GLN A OE1 1 
ATOM   605  N  NE2 . GLN A 1 76  ? 138.036 -42.608 151.052 1.00 65.47  ?  87   GLN A NE2 1 
ATOM   606  N  N   . LEU A 1 77  ? 133.435 -45.880 151.897 1.00 34.52  ?  88   LEU A N   1 
ATOM   607  C  CA  . LEU A 1 77  ? 133.136 -47.105 152.624 1.00 32.01  ?  88   LEU A CA  1 
ATOM   608  C  C   . LEU A 1 77  ? 133.964 -48.242 152.046 1.00 33.72  ?  88   LEU A C   1 
ATOM   609  O  O   . LEU A 1 77  ? 134.355 -48.213 150.877 1.00 31.97  ?  88   LEU A O   1 
ATOM   610  C  CB  . LEU A 1 77  ? 131.638 -47.446 152.574 1.00 30.98  ?  88   LEU A CB  1 
ATOM   611  C  CG  . LEU A 1 77  ? 130.974 -47.697 151.214 1.00 34.31  ?  88   LEU A CG  1 
ATOM   612  C  CD1 . LEU A 1 77  ? 131.003 -49.169 150.860 1.00 33.46  ?  88   LEU A CD1 1 
ATOM   613  C  CD2 . LEU A 1 77  ? 129.547 -47.179 151.205 1.00 32.93  ?  88   LEU A CD2 1 
ATOM   614  N  N   . VAL A 1 78  ? 134.222 -49.245 152.879 1.00 34.67  ?  89   VAL A N   1 
ATOM   615  C  CA  . VAL A 1 78  ? 134.990 -50.422 152.497 1.00 34.10  ?  89   VAL A CA  1 
ATOM   616  C  C   . VAL A 1 78  ? 134.111 -51.646 152.696 1.00 36.39  ?  89   VAL A C   1 
ATOM   617  O  O   . VAL A 1 78  ? 133.519 -51.822 153.768 1.00 35.30  ?  89   VAL A O   1 
ATOM   618  C  CB  . VAL A 1 78  ? 136.290 -50.542 153.311 1.00 38.90  ?  89   VAL A CB  1 
ATOM   619  C  CG1 . VAL A 1 78  ? 137.048 -51.804 152.923 1.00 38.45  ?  89   VAL A CG1 1 
ATOM   620  C  CG2 . VAL A 1 78  ? 137.157 -49.308 153.112 1.00 40.27  ?  89   VAL A CG2 1 
ATOM   621  N  N   . THR A 1 79  ? 134.017 -52.480 151.665 1.00 28.32  ?  90   THR A N   1 
ATOM   622  C  CA  . THR A 1 79  ? 133.254 -53.717 151.727 1.00 26.89  ?  90   THR A CA  1 
ATOM   623  C  C   . THR A 1 79  ? 134.194 -54.911 151.678 1.00 28.46  ?  90   THR A C   1 
ATOM   624  O  O   . THR A 1 79  ? 135.350 -54.808 151.260 1.00 27.74  ?  90   THR A O   1 
ATOM   625  C  CB  . THR A 1 79  ? 132.242 -53.821 150.578 1.00 33.59  ?  90   THR A CB  1 
ATOM   626  O  OG1 . THR A 1 79  ? 132.931 -53.784 149.322 1.00 34.41  ?  90   THR A OG1 1 
ATOM   627  C  CG2 . THR A 1 79  ? 131.237 -52.689 150.642 1.00 30.71  ?  90   THR A CG2 1 
ATOM   628  N  N   . LEU A 1 80  ? 133.670 -56.055 152.112 1.00 26.01  ?  91   LEU A N   1 
ATOM   629  C  CA  . LEU A 1 80  ? 134.392 -57.317 152.103 1.00 25.23  ?  91   LEU A CA  1 
ATOM   630  C  C   . LEU A 1 80  ? 133.461 -58.390 151.567 1.00 26.43  ?  91   LEU A C   1 
ATOM   631  O  O   . LEU A 1 80  ? 132.304 -58.479 151.992 1.00 24.35  ?  91   LEU A O   1 
ATOM   632  C  CB  . LEU A 1 80  ? 134.886 -57.683 153.505 1.00 25.16  ?  91   LEU A CB  1 
ATOM   633  C  CG  . LEU A 1 80  ? 135.552 -59.046 153.693 1.00 29.76  ?  91   LEU A CG  1 
ATOM   634  C  CD1 . LEU A 1 80  ? 136.863 -59.130 152.924 1.00 29.44  ?  91   LEU A CD1 1 
ATOM   635  C  CD2 . LEU A 1 80  ? 135.772 -59.314 155.173 1.00 33.05  ?  91   LEU A CD2 1 
ATOM   636  N  N   . LEU A 1 81  ? 133.957 -59.191 150.631 1.00 23.76  ?  92   LEU A N   1 
ATOM   637  C  CA  . LEU A 1 81  ? 133.170 -60.238 150.001 1.00 23.68  ?  92   LEU A CA  1 
ATOM   638  C  C   . LEU A 1 81  ? 133.625 -61.604 150.500 1.00 25.77  ?  92   LEU A C   1 
ATOM   639  O  O   . LEU A 1 81  ? 134.710 -61.751 151.068 1.00 25.85  ?  92   LEU A O   1 
ATOM   640  C  CB  . LEU A 1 81  ? 133.278 -60.160 148.474 1.00 24.30  ?  92   LEU A CB  1 
ATOM   641  C  CG  . LEU A 1 81  ? 133.015 -58.784 147.852 1.00 29.09  ?  92   LEU A CG  1 
ATOM   642  C  CD1 . LEU A 1 81  ? 132.959 -58.879 146.340 1.00 29.60  ?  92   LEU A CD1 1 
ATOM   643  C  CD2 . LEU A 1 81  ? 131.738 -58.160 148.392 1.00 29.51  ?  92   LEU A CD2 1 
ATOM   644  N  N   . ASP A 1 82  ? 132.773 -62.613 150.287 1.00 21.70  ?  93   ASP A N   1 
ATOM   645  C  CA  . ASP A 1 82  ? 133.083 -63.948 150.787 1.00 21.93  ?  93   ASP A CA  1 
ATOM   646  C  C   . ASP A 1 82  ? 134.209 -64.621 150.014 1.00 29.20  ?  93   ASP A C   1 
ATOM   647  O  O   . ASP A 1 82  ? 134.642 -65.706 150.413 1.00 31.73  ?  93   ASP A O   1 
ATOM   648  C  CB  . ASP A 1 82  ? 131.831 -64.833 150.784 1.00 22.92  ?  93   ASP A CB  1 
ATOM   649  C  CG  . ASP A 1 82  ? 131.318 -65.126 149.393 1.00 39.00  ?  93   ASP A CG  1 
ATOM   650  O  OD1 . ASP A 1 82  ? 131.642 -64.362 148.465 1.00 43.77  ?  93   ASP A OD1 1 
ATOM   651  O  OD2 . ASP A 1 82  ? 130.578 -66.121 149.233 1.00 42.68  ?  93   ASP A OD2 1 
ATOM   652  N  N   . ASP A 1 83  ? 134.693 -64.015 148.933 1.00 27.49  ?  94   ASP A N   1 
ATOM   653  C  CA  . ASP A 1 83  ? 135.947 -64.428 148.317 1.00 28.38  ?  94   ASP A CA  1 
ATOM   654  C  C   . ASP A 1 83  ? 137.144 -63.705 148.924 1.00 33.36  ?  94   ASP A C   1 
ATOM   655  O  O   . ASP A 1 83  ? 138.242 -63.766 148.362 1.00 35.74  ?  94   ASP A O   1 
ATOM   656  C  CB  . ASP A 1 83  ? 135.903 -64.221 146.794 1.00 29.65  ?  94   ASP A CB  1 
ATOM   657  C  CG  . ASP A 1 83  ? 135.740 -62.758 146.383 1.00 36.22  ?  94   ASP A CG  1 
ATOM   658  O  OD1 . ASP A 1 83  ? 135.833 -61.850 147.237 1.00 36.59  ?  94   ASP A OD1 1 
ATOM   659  O  OD2 . ASP A 1 83  ? 135.514 -62.517 145.179 1.00 41.18  ?  94   ASP A OD2 1 
ATOM   660  N  N   . ASN A 1 84  ? 136.936 -63.004 150.042 1.00 26.44  ?  95   ASN A N   1 
ATOM   661  C  CA  . ASN A 1 84  ? 137.974 -62.370 150.850 1.00 26.26  ?  95   ASN A CA  1 
ATOM   662  C  C   . ASN A 1 84  ? 138.559 -61.119 150.199 1.00 31.40  ?  95   ASN A C   1 
ATOM   663  O  O   . ASN A 1 84  ? 139.664 -60.697 150.555 1.00 32.17  ?  95   ASN A O   1 
ATOM   664  C  CB  . ASN A 1 84  ? 139.084 -63.373 151.195 1.00 28.28  ?  95   ASN A CB  1 
ATOM   665  C  CG  . ASN A 1 84  ? 139.956 -62.914 152.343 1.00 45.91  ?  95   ASN A CG  1 
ATOM   666  O  OD1 . ASN A 1 84  ? 139.525 -62.887 153.495 1.00 37.60  ?  95   ASN A OD1 1 
ATOM   667  N  ND2 . ASN A 1 84  ? 141.198 -62.561 152.034 1.00 43.04  ?  95   ASN A ND2 1 
ATOM   668  N  N   . SER A 1 85  ? 137.839 -60.493 149.269 1.00 27.95  ?  96   SER A N   1 
ATOM   669  C  CA  . SER A 1 85  ? 138.324 -59.292 148.600 1.00 27.89  ?  96   SER A CA  1 
ATOM   670  C  C   . SER A 1 85  ? 137.759 -58.033 149.251 1.00 32.75  ?  96   SER A C   1 
ATOM   671  O  O   . SER A 1 85  ? 136.615 -58.007 149.714 1.00 32.56  ?  96   SER A O   1 
ATOM   672  C  CB  . SER A 1 85  ? 137.963 -59.313 147.110 1.00 29.35  ?  96   SER A CB  1 
ATOM   673  O  OG  . SER A 1 85  ? 136.560 -59.349 146.907 1.00 32.65  ?  96   SER A OG  1 
ATOM   674  N  N   . LEU A 1 86  ? 138.580 -56.986 149.281 1.00 29.52  ?  97   LEU A N   1 
ATOM   675  C  CA  . LEU A 1 86  ? 138.210 -55.689 149.832 1.00 30.31  ?  97   LEU A CA  1 
ATOM   676  C  C   . LEU A 1 86  ? 137.965 -54.694 148.705 1.00 36.65  ?  97   LEU A C   1 
ATOM   677  O  O   . LEU A 1 86  ? 138.577 -54.779 147.638 1.00 38.35  ?  97   LEU A O   1 
ATOM   678  C  CB  . LEU A 1 86  ? 139.300 -55.147 150.760 1.00 30.68  ?  97   LEU A CB  1 
ATOM   679  C  CG  . LEU A 1 86  ? 139.465 -55.825 152.118 1.00 34.72  ?  97   LEU A CG  1 
ATOM   680  C  CD1 . LEU A 1 86  ? 140.816 -55.481 152.713 1.00 35.43  ?  97   LEU A CD1 1 
ATOM   681  C  CD2 . LEU A 1 86  ? 138.346 -55.406 153.059 1.00 35.10  ?  97   LEU A CD2 1 
ATOM   682  N  N   . HIS A 1 87  ? 137.067 -53.744 148.951 1.00 29.45  ?  98   HIS A N   1 
ATOM   683  C  CA  . HIS A 1 87  ? 136.668 -52.794 147.922 1.00 28.66  ?  98   HIS A CA  1 
ATOM   684  C  C   . HIS A 1 87  ? 136.416 -51.432 148.550 1.00 34.80  ?  98   HIS A C   1 
ATOM   685  O  O   . HIS A 1 87  ? 135.676 -51.327 149.532 1.00 33.93  ?  98   HIS A O   1 
ATOM   686  C  CB  . HIS A 1 87  ? 135.413 -53.282 147.190 1.00 28.38  ?  98   HIS A CB  1 
ATOM   687  C  CG  . HIS A 1 87  ? 135.577 -54.619 146.538 1.00 30.85  ?  98   HIS A CG  1 
ATOM   688  N  ND1 . HIS A 1 87  ? 135.854 -54.765 145.196 1.00 32.12  ?  98   HIS A ND1 1 
ATOM   689  C  CD2 . HIS A 1 87  ? 135.517 -55.872 147.048 1.00 31.33  ?  98   HIS A CD2 1 
ATOM   690  C  CE1 . HIS A 1 87  ? 135.951 -56.050 144.906 1.00 30.79  ?  98   HIS A CE1 1 
ATOM   691  N  NE2 . HIS A 1 87  ? 135.753 -56.743 146.012 1.00 30.59  ?  98   HIS A NE2 1 
ATOM   692  N  N   . LEU A 1 88  ? 137.026 -50.395 147.975 1.00 34.86  ?  99   LEU A N   1 
ATOM   693  C  CA  . LEU A 1 88  ? 136.858 -49.018 148.434 1.00 35.05  ?  99   LEU A CA  1 
ATOM   694  C  C   . LEU A 1 88  ? 135.846 -48.319 147.530 1.00 37.04  ?  99   LEU A C   1 
ATOM   695  O  O   . LEU A 1 88  ? 136.125 -48.070 146.352 1.00 38.07  ?  99   LEU A O   1 
ATOM   696  C  CB  . LEU A 1 88  ? 138.198 -48.282 148.431 1.00 35.90  ?  99   LEU A CB  1 
ATOM   697  C  CG  . LEU A 1 88  ? 138.197 -46.787 148.761 1.00 40.50  ?  99   LEU A CG  1 
ATOM   698  C  CD1 . LEU A 1 88  ? 137.741 -46.534 150.191 1.00 39.64  ?  99   LEU A CD1 1 
ATOM   699  C  CD2 . LEU A 1 88  ? 139.574 -46.182 148.518 1.00 41.41  ?  99   LEU A CD2 1 
ATOM   700  N  N   . TRP A 1 89  ? 134.676 -48.004 148.080 1.00 30.91  ?  100  TRP A N   1 
ATOM   701  C  CA  . TRP A 1 89  ? 133.625 -47.286 147.372 1.00 30.92  ?  100  TRP A CA  1 
ATOM   702  C  C   . TRP A 1 89  ? 133.600 -45.824 147.804 1.00 38.87  ?  100  TRP A C   1 
ATOM   703  O  O   . TRP A 1 89  ? 134.052 -45.468 148.895 1.00 38.26  ?  100  TRP A O   1 
ATOM   704  C  CB  . TRP A 1 89  ? 132.254 -47.927 147.626 1.00 28.56  ?  100  TRP A CB  1 
ATOM   705  C  CG  . TRP A 1 89  ? 132.089 -49.285 147.008 1.00 28.54  ?  100  TRP A CG  1 
ATOM   706  C  CD1 . TRP A 1 89  ? 132.650 -50.453 147.434 1.00 30.85  ?  100  TRP A CD1 1 
ATOM   707  C  CD2 . TRP A 1 89  ? 131.299 -49.615 145.858 1.00 28.31  ?  100  TRP A CD2 1 
ATOM   708  N  NE1 . TRP A 1 89  ? 132.265 -51.488 146.617 1.00 29.81  ?  100  TRP A NE1 1 
ATOM   709  C  CE2 . TRP A 1 89  ? 131.435 -51.001 145.642 1.00 31.11  ?  100  TRP A CE2 1 
ATOM   710  C  CE3 . TRP A 1 89  ? 130.493 -48.873 144.989 1.00 30.19  ?  100  TRP A CE3 1 
ATOM   711  C  CZ2 . TRP A 1 89  ? 130.797 -51.659 144.593 1.00 29.55  ?  100  TRP A CZ2 1 
ATOM   712  C  CZ3 . TRP A 1 89  ? 129.860 -49.528 143.949 1.00 31.18  ?  100  TRP A CZ3 1 
ATOM   713  C  CH2 . TRP A 1 89  ? 130.016 -50.908 143.760 1.00 31.11  ?  100  TRP A CH2 1 
ATOM   714  N  N   . SER A 1 90  ? 133.049 -44.975 146.936 1.00 41.57  ?  101  SER A N   1 
ATOM   715  C  CA  . SER A 1 90  ? 133.032 -43.540 147.182 1.00 43.66  ?  101  SER A CA  1 
ATOM   716  C  C   . SER A 1 90  ? 131.714 -42.936 146.718 1.00 47.69  ?  101  SER A C   1 
ATOM   717  O  O   . SER A 1 90  ? 131.010 -43.488 145.869 1.00 44.72  ?  101  SER A O   1 
ATOM   718  C  CB  . SER A 1 90  ? 134.195 -42.831 146.477 1.00 49.97  ?  101  SER A CB  1 
ATOM   719  O  OG  . SER A 1 90  ? 134.422 -41.547 147.028 1.00 64.90  ?  101  SER A OG  1 
ATOM   720  N  N   . LEU A 1 91  ? 131.396 -41.782 147.298 1.00 44.11  ?  102  LEU A N   1 
ATOM   721  C  CA  . LEU A 1 91  ? 130.277 -40.946 146.882 1.00 46.63  ?  102  LEU A CA  1 
ATOM   722  C  C   . LEU A 1 91  ? 130.857 -39.631 146.375 1.00 55.99  ?  102  LEU A C   1 
ATOM   723  O  O   . LEU A 1 91  ? 131.347 -38.815 147.164 1.00 56.02  ?  102  LEU A O   1 
ATOM   724  C  CB  . LEU A 1 91  ? 129.300 -40.719 148.034 1.00 46.92  ?  102  LEU A CB  1 
ATOM   725  C  CG  . LEU A 1 91  ? 128.374 -41.887 148.371 1.00 51.73  ?  102  LEU A CG  1 
ATOM   726  C  CD1 . LEU A 1 91  ? 127.835 -41.765 149.788 1.00 52.56  ?  102  LEU A CD1 1 
ATOM   727  C  CD2 . LEU A 1 91  ? 127.232 -41.955 147.370 1.00 54.52  ?  102  LEU A CD2 1 
ATOM   728  N  N   . LYS A 1 92  ? 130.816 -39.433 145.061 1.00 59.99  ?  103  LYS A N   1 
ATOM   729  C  CA  . LYS A 1 92  ? 131.393 -38.258 144.426 1.00 62.36  ?  103  LYS A CA  1 
ATOM   730  C  C   . LYS A 1 92  ? 130.292 -37.419 143.795 1.00 68.04  ?  103  LYS A C   1 
ATOM   731  O  O   . LYS A 1 92  ? 129.369 -37.954 143.171 1.00 66.67  ?  103  LYS A O   1 
ATOM   732  C  CB  . LYS A 1 92  ? 132.426 -38.656 143.368 1.00 38.74  ?  103  LYS A CB  1 
ATOM   733  N  N   . VAL A 1 93  ? 130.397 -36.104 143.959 1.00 61.56  ?  104  VAL A N   1 
ATOM   734  C  CA  . VAL A 1 93  ? 129.407 -35.178 143.421 1.00 62.83  ?  104  VAL A CA  1 
ATOM   735  C  C   . VAL A 1 93  ? 129.751 -34.874 141.967 1.00 68.82  ?  104  VAL A C   1 
ATOM   736  O  O   . VAL A 1 93  ? 130.844 -34.386 141.664 1.00 69.41  ?  104  VAL A O   1 
ATOM   737  C  CB  . VAL A 1 93  ? 129.341 -33.891 144.255 1.00 67.43  ?  104  VAL A CB  1 
ATOM   738  C  CG1 . VAL A 1 93  ? 128.508 -32.838 143.541 1.00 68.03  ?  104  VAL A CG1 1 
ATOM   739  C  CG2 . VAL A 1 93  ? 128.768 -34.182 145.635 1.00 66.44  ?  104  VAL A CG2 1 
ATOM   740  N  N   . LYS A 1 94  ? 128.816 -35.169 141.066 1.00 70.49  ?  105  LYS A N   1 
ATOM   741  C  CA  . LYS A 1 94  ? 128.946 -34.842 139.653 1.00 71.47  ?  105  LYS A CA  1 
ATOM   742  C  C   . LYS A 1 94  ? 127.574 -34.452 139.129 1.00 77.05  ?  105  LYS A C   1 
ATOM   743  O  O   . LYS A 1 94  ? 126.615 -35.215 139.272 1.00 75.93  ?  105  LYS A O   1 
ATOM   744  C  CB  . LYS A 1 94  ? 129.511 -36.020 138.851 1.00 39.00  ?  105  LYS A CB  1 
ATOM   745  N  N   . GLY A 1 95  ? 127.482 -33.268 138.530 1.00 90.18  ?  106  GLY A N   1 
ATOM   746  C  CA  . GLY A 1 95  ? 126.191 -32.757 138.112 1.00 90.02  ?  106  GLY A CA  1 
ATOM   747  C  C   . GLY A 1 95  ? 125.336 -32.261 139.255 1.00 93.32  ?  106  GLY A C   1 
ATOM   748  O  O   . GLY A 1 95  ? 124.105 -32.338 139.180 1.00 93.47  ?  106  GLY A O   1 
ATOM   749  N  N   . GLY A 1 96  ? 125.961 -31.760 140.320 1.00 71.64  ?  107  GLY A N   1 
ATOM   750  C  CA  . GLY A 1 96  ? 125.250 -31.262 141.480 1.00 71.13  ?  107  GLY A CA  1 
ATOM   751  C  C   . GLY A 1 96  ? 124.602 -32.313 142.351 1.00 72.56  ?  107  GLY A C   1 
ATOM   752  O  O   . GLY A 1 96  ? 123.917 -31.952 143.316 1.00 72.10  ?  107  GLY A O   1 
ATOM   753  N  N   . ALA A 1 97  ? 124.790 -33.598 142.049 1.00 65.44  ?  108  ALA A N   1 
ATOM   754  C  CA  . ALA A 1 97  ? 124.182 -34.677 142.815 1.00 62.98  ?  108  ALA A CA  1 
ATOM   755  C  C   . ALA A 1 97  ? 125.204 -35.785 143.020 1.00 64.12  ?  108  ALA A C   1 
ATOM   756  O  O   . ALA A 1 97  ? 126.170 -35.917 142.262 1.00 63.22  ?  108  ALA A O   1 
ATOM   757  C  CB  . ALA A 1 97  ? 122.929 -35.227 142.121 1.00 62.85  ?  108  ALA A CB  1 
ATOM   758  N  N   . SER A 1 98  ? 124.971 -36.593 144.052 1.00 52.26  ?  109  SER A N   1 
ATOM   759  C  CA  . SER A 1 98  ? 125.923 -37.618 144.451 1.00 50.00  ?  109  SER A CA  1 
ATOM   760  C  C   . SER A 1 98  ? 125.743 -38.899 143.642 1.00 49.09  ?  109  SER A C   1 
ATOM   761  O  O   . SER A 1 98  ? 124.637 -39.246 143.216 1.00 47.70  ?  109  SER A O   1 
ATOM   762  C  CB  . SER A 1 98  ? 125.782 -37.925 145.943 1.00 52.92  ?  109  SER A CB  1 
ATOM   763  O  OG  . SER A 1 98  ? 126.195 -36.827 146.736 1.00 61.30  ?  109  SER A OG  1 
ATOM   764  N  N   . GLU A 1 99  ? 126.855 -39.604 143.439 1.00 49.42  ?  110  GLU A N   1 
ATOM   765  C  CA  . GLU A 1 99  ? 126.879 -40.857 142.699 1.00 47.42  ?  110  GLU A CA  1 
ATOM   766  C  C   . GLU A 1 99  ? 127.750 -41.858 143.439 1.00 47.31  ?  110  GLU A C   1 
ATOM   767  O  O   . GLU A 1 99  ? 128.840 -41.514 143.905 1.00 46.72  ?  110  GLU A O   1 
ATOM   768  C  CB  . GLU A 1 99  ? 127.417 -40.659 141.276 1.00 49.42  ?  110  GLU A CB  1 
ATOM   769  C  CG  . GLU A 1 99  ? 126.575 -39.743 140.404 1.00 66.37  ?  110  GLU A CG  1 
ATOM   770  C  CD  . GLU A 1 99  ? 127.317 -39.279 139.165 1.00 94.30  ?  110  GLU A CD  1 
ATOM   771  O  OE1 . GLU A 1 99  ? 128.556 -39.427 139.123 1.00 92.35  ?  110  GLU A OE1 1 
ATOM   772  O  OE2 . GLU A 1 99  ? 126.662 -38.765 138.233 1.00 91.73  ?  110  GLU A OE2 1 
ATOM   773  N  N   . LEU A 1 100 ? 127.267 -43.093 143.541 1.00 40.24  ?  111  LEU A N   1 
ATOM   774  C  CA  . LEU A 1 100 ? 128.025 -44.173 144.159 1.00 37.68  ?  111  LEU A CA  1 
ATOM   775  C  C   . LEU A 1 100 ? 128.929 -44.827 143.122 1.00 39.14  ?  111  LEU A C   1 
ATOM   776  O  O   . LEU A 1 100 ? 128.517 -45.066 141.983 1.00 38.68  ?  111  LEU A O   1 
ATOM   777  C  CB  . LEU A 1 100 ? 127.083 -45.211 144.773 1.00 36.33  ?  111  LEU A CB  1 
ATOM   778  C  CG  . LEU A 1 100 ? 127.711 -46.441 145.430 1.00 38.80  ?  111  LEU A CG  1 
ATOM   779  C  CD1 . LEU A 1 100 ? 128.530 -46.051 146.651 1.00 38.44  ?  111  LEU A CD1 1 
ATOM   780  C  CD2 . LEU A 1 100 ? 126.629 -47.444 145.799 1.00 38.10  ?  111  LEU A CD2 1 
ATOM   781  N  N   . GLN A 1 101 ? 130.164 -45.113 143.526 1.00 43.31  ?  112  GLN A N   1 
ATOM   782  C  CA  . GLN A 1 101 ? 131.187 -45.571 142.599 1.00 43.15  ?  112  GLN A CA  1 
ATOM   783  C  C   . GLN A 1 101 ? 132.252 -46.338 143.368 1.00 45.77  ?  112  GLN A C   1 
ATOM   784  O  O   . GLN A 1 101 ? 132.580 -45.984 144.504 1.00 47.20  ?  112  GLN A O   1 
ATOM   785  C  CB  . GLN A 1 101 ? 131.812 -44.384 141.857 1.00 46.35  ?  112  GLN A CB  1 
ATOM   786  C  CG  . GLN A 1 101 ? 132.190 -43.235 142.788 1.00 71.26  ?  112  GLN A CG  1 
ATOM   787  C  CD  . GLN A 1 101 ? 132.816 -42.054 142.069 1.00 94.79  ?  112  GLN A CD  1 
ATOM   788  O  OE1 . GLN A 1 101 ? 132.179 -41.407 141.238 1.00 93.98  ?  112  GLN A OE1 1 
ATOM   789  N  NE2 . GLN A 1 101 ? 134.071 -41.765 142.393 1.00 81.86  ?  112  GLN A NE2 1 
ATOM   790  N  N   . GLU A 1 102 ? 132.786 -47.384 142.744 1.00 33.58  ?  113  GLU A N   1 
ATOM   791  C  CA  . GLU A 1 102 ? 133.865 -48.174 143.322 1.00 31.67  ?  113  GLU A CA  1 
ATOM   792  C  C   . GLU A 1 102 ? 135.206 -47.649 142.823 1.00 38.99  ?  113  GLU A C   1 
ATOM   793  O  O   . GLU A 1 102 ? 135.419 -47.526 141.612 1.00 40.01  ?  113  GLU A O   1 
ATOM   794  C  CB  . GLU A 1 102 ? 133.717 -49.656 142.971 1.00 31.17  ?  113  GLU A CB  1 
ATOM   795  C  CG  . GLU A 1 102 ? 134.829 -50.518 143.550 1.00 34.72  ?  113  GLU A CG  1 
ATOM   796  C  CD  . GLU A 1 102 ? 134.649 -51.996 143.265 1.00 38.77  ?  113  GLU A CD  1 
ATOM   797  O  OE1 . GLU A 1 102 ? 133.535 -52.398 142.871 1.00 32.55  ?  113  GLU A OE1 1 
ATOM   798  O  OE2 . GLU A 1 102 ? 135.625 -52.757 143.435 1.00 31.45  ?  113  GLU A OE2 1 
ATOM   799  N  N   . ASP A 1 103 ? 136.110 -47.353 143.757 1.00 34.50  ?  114  ASP A N   1 
ATOM   800  C  CA  . ASP A 1 103 ? 137.400 -46.764 143.420 1.00 34.83  ?  114  ASP A CA  1 
ATOM   801  C  C   . ASP A 1 103 ? 138.459 -47.818 143.116 1.00 39.81  ?  114  ASP A C   1 
ATOM   802  O  O   . ASP A 1 103 ? 139.119 -47.755 142.074 1.00 40.18  ?  114  ASP A O   1 
ATOM   803  C  CB  . ASP A 1 103 ? 137.878 -45.860 144.556 1.00 36.93  ?  114  ASP A CB  1 
ATOM   804  C  CG  . ASP A 1 103 ? 136.861 -44.803 144.926 1.00 46.76  ?  114  ASP A CG  1 
ATOM   805  O  OD1 . ASP A 1 103 ? 136.282 -44.178 144.011 1.00 46.97  ?  114  ASP A OD1 1 
ATOM   806  O  OD2 . ASP A 1 103 ? 136.638 -44.605 146.136 1.00 54.37  ?  114  ASP A OD2 1 
ATOM   807  N  N   . GLU A 1 104 ? 138.641 -48.785 144.009 1.00 39.28  ?  115  GLU A N   1 
ATOM   808  C  CA  . GLU A 1 104 ? 139.698 -49.772 143.834 1.00 39.43  ?  115  GLU A CA  1 
ATOM   809  C  C   . GLU A 1 104 ? 139.374 -51.004 144.666 1.00 42.36  ?  115  GLU A C   1 
ATOM   810  O  O   . GLU A 1 104 ? 138.430 -51.016 145.460 1.00 40.65  ?  115  GLU A O   1 
ATOM   811  C  CB  . GLU A 1 104 ? 141.062 -49.187 144.214 1.00 42.15  ?  115  GLU A CB  1 
ATOM   812  C  CG  . GLU A 1 104 ? 141.151 -48.710 145.649 1.00 58.93  ?  115  GLU A CG  1 
ATOM   813  C  CD  . GLU A 1 104 ? 142.163 -47.597 145.823 1.00 92.26  ?  115  GLU A CD  1 
ATOM   814  O  OE1 . GLU A 1 104 ? 141.756 -46.416 145.791 1.00 98.35  ?  115  GLU A OE1 1 
ATOM   815  O  OE2 . GLU A 1 104 ? 143.364 -47.903 145.976 1.00 87.98  ?  115  GLU A OE2 1 
ATOM   816  N  N   . SER A 1 105 ? 140.179 -52.047 144.470 1.00 40.71  ?  116  SER A N   1 
ATOM   817  C  CA  . SER A 1 105 ? 140.006 -53.312 145.166 1.00 39.97  ?  116  SER A CA  1 
ATOM   818  C  C   . SER A 1 105 ? 141.367 -53.841 145.598 1.00 47.57  ?  116  SER A C   1 
ATOM   819  O  O   . SER A 1 105 ? 142.412 -53.386 145.126 1.00 49.06  ?  116  SER A O   1 
ATOM   820  C  CB  . SER A 1 105 ? 139.290 -54.343 144.286 1.00 42.56  ?  116  SER A CB  1 
ATOM   821  O  OG  . SER A 1 105 ? 139.985 -54.530 143.067 1.00 54.16  ?  116  SER A OG  1 
ATOM   822  N  N   . PHE A 1 106 ? 141.342 -54.817 146.505 1.00 44.20  ?  117  PHE A N   1 
ATOM   823  C  CA  . PHE A 1 106 ? 142.570 -55.382 147.049 1.00 43.49  ?  117  PHE A CA  1 
ATOM   824  C  C   . PHE A 1 106 ? 142.261 -56.740 147.660 1.00 44.27  ?  117  PHE A C   1 
ATOM   825  O  O   . PHE A 1 106 ? 141.317 -56.865 148.446 1.00 43.13  ?  117  PHE A O   1 
ATOM   826  C  CB  . PHE A 1 106 ? 143.183 -54.445 148.099 1.00 46.26  ?  117  PHE A CB  1 
ATOM   827  C  CG  . PHE A 1 106 ? 144.407 -55.000 148.772 1.00 48.59  ?  117  PHE A CG  1 
ATOM   828  C  CD1 . PHE A 1 106 ? 145.658 -54.847 148.200 1.00 52.21  ?  117  PHE A CD1 1 
ATOM   829  C  CD2 . PHE A 1 106 ? 144.306 -55.664 149.985 1.00 51.08  ?  117  PHE A CD2 1 
ATOM   830  C  CE1 . PHE A 1 106 ? 146.787 -55.354 148.820 1.00 54.42  ?  117  PHE A CE1 1 
ATOM   831  C  CE2 . PHE A 1 106 ? 145.430 -56.174 150.609 1.00 54.98  ?  117  PHE A CE2 1 
ATOM   832  C  CZ  . PHE A 1 106 ? 146.672 -56.018 150.026 1.00 54.03  ?  117  PHE A CZ  1 
ATOM   833  N  N   . THR A 1 107 ? 143.051 -57.747 147.301 1.00 34.65  ?  118  THR A N   1 
ATOM   834  C  CA  . THR A 1 107 ? 142.939 -59.081 147.879 1.00 33.89  ?  118  THR A CA  1 
ATOM   835  C  C   . THR A 1 107 ? 144.184 -59.358 148.708 1.00 39.08  ?  118  THR A C   1 
ATOM   836  O  O   . THR A 1 107 ? 145.294 -59.418 148.169 1.00 38.59  ?  118  THR A O   1 
ATOM   837  C  CB  . THR A 1 107 ? 142.766 -60.150 146.799 1.00 41.42  ?  118  THR A CB  1 
ATOM   838  O  OG1 . THR A 1 107 ? 141.561 -59.902 146.064 1.00 43.92  ?  118  THR A OG1 1 
ATOM   839  C  CG2 . THR A 1 107 ? 142.689 -61.533 147.430 1.00 37.46  ?  118  THR A CG2 1 
ATOM   840  N  N   . LEU A 1 108 ? 143.997 -59.514 150.015 1.00 40.41  ?  119  LEU A N   1 
ATOM   841  C  CA  . LEU A 1 108 ? 145.100 -59.869 150.897 1.00 41.69  ?  119  LEU A CA  1 
ATOM   842  C  C   . LEU A 1 108 ? 145.515 -61.313 150.646 1.00 49.96  ?  119  LEU A C   1 
ATOM   843  O  O   . LEU A 1 108 ? 144.675 -62.219 150.638 1.00 49.40  ?  119  LEU A O   1 
ATOM   844  C  CB  . LEU A 1 108 ? 144.688 -59.674 152.355 1.00 40.98  ?  119  LEU A CB  1 
ATOM   845  C  CG  . LEU A 1 108 ? 145.729 -59.919 153.446 1.00 45.27  ?  119  LEU A CG  1 
ATOM   846  C  CD1 . LEU A 1 108 ? 146.809 -58.852 153.400 1.00 45.64  ?  119  LEU A CD1 1 
ATOM   847  C  CD2 . LEU A 1 108 ? 145.057 -59.952 154.810 1.00 46.11  ?  119  LEU A CD2 1 
ATOM   848  N  N   . ARG A 1 109 ? 146.809 -61.527 150.429 1.00 55.76  ?  120  ARG A N   1 
ATOM   849  C  CA  . ARG A 1 109 ? 147.324 -62.859 150.153 1.00 57.74  ?  120  ARG A CA  1 
ATOM   850  C  C   . ARG A 1 109 ? 148.727 -62.976 150.731 1.00 65.60  ?  120  ARG A C   1 
ATOM   851  O  O   . ARG A 1 109 ? 149.525 -62.041 150.639 1.00 65.60  ?  120  ARG A O   1 
ATOM   852  C  CB  . ARG A 1 109 ? 147.314 -63.148 148.641 1.00 59.62  ?  120  ARG A CB  1 
ATOM   853  C  CG  . ARG A 1 109 ? 148.166 -64.331 148.179 1.00 74.89  ?  120  ARG A CG  1 
ATOM   854  C  CD  . ARG A 1 109 ? 147.825 -65.645 148.883 1.00 87.04  ?  120  ARG A CD  1 
ATOM   855  N  NE  . ARG A 1 109 ? 146.446 -66.076 148.679 1.00 96.48  ?  120  ARG A NE  1 
ATOM   856  C  CZ  . ARG A 1 109 ? 145.961 -67.233 149.117 1.00 112.99 ?  120  ARG A CZ  1 
ATOM   857  N  NH1 . ARG A 1 109 ? 146.746 -68.072 149.780 1.00 99.21  ?  120  ARG A NH1 1 
ATOM   858  N  NH2 . ARG A 1 109 ? 144.694 -67.555 148.892 1.00 102.76 ?  120  ARG A NH2 1 
ATOM   859  N  N   . GLY A 1 110 ? 149.008 -64.121 151.350 1.00 67.59  ?  121  GLY A N   1 
ATOM   860  C  CA  . GLY A 1 110 ? 150.321 -64.400 151.883 1.00 71.27  ?  121  GLY A CA  1 
ATOM   861  C  C   . GLY A 1 110 ? 151.234 -65.039 150.855 1.00 82.76  ?  121  GLY A C   1 
ATOM   862  O  O   . GLY A 1 110 ? 150.977 -64.995 149.647 1.00 82.82  ?  121  GLY A O   1 
ATOM   863  N  N   . PRO A 1 111 ? 152.325 -65.651 151.316 1.00 94.27  ?  122  PRO A N   1 
ATOM   864  C  CA  . PRO A 1 111 ? 153.263 -66.269 150.385 1.00 96.27  ?  122  PRO A CA  1 
ATOM   865  C  C   . PRO A 1 111 ? 152.680 -67.546 149.800 1.00 102.86 ?  122  PRO A C   1 
ATOM   866  O  O   . PRO A 1 111 ? 151.860 -68.219 150.448 1.00 101.84 ?  122  PRO A O   1 
ATOM   867  C  CB  . PRO A 1 111 ? 154.493 -66.563 151.258 1.00 98.87  ?  122  PRO A CB  1 
ATOM   868  C  CG  . PRO A 1 111 ? 153.925 -66.751 152.625 1.00 102.34 ?  122  PRO A CG  1 
ATOM   869  C  CD  . PRO A 1 111 ? 152.757 -65.801 152.720 1.00 96.53  ?  122  PRO A CD  1 
ATOM   870  N  N   . PRO A 1 112 ? 153.068 -67.914 148.580 1.00 106.45 ?  123  PRO A N   1 
ATOM   871  C  CA  . PRO A 1 112 ? 152.570 -69.168 147.999 1.00 106.44 ?  123  PRO A CA  1 
ATOM   872  C  C   . PRO A 1 112 ? 152.972 -70.360 148.854 1.00 111.95 ?  123  PRO A C   1 
ATOM   873  O  O   . PRO A 1 112 ? 154.117 -70.472 149.298 1.00 113.05 ?  123  PRO A O   1 
ATOM   874  C  CB  . PRO A 1 112 ? 153.229 -69.208 146.614 1.00 108.69 ?  123  PRO A CB  1 
ATOM   875  C  CG  . PRO A 1 112 ? 154.401 -68.284 146.713 1.00 113.88 ?  123  PRO A CG  1 
ATOM   876  C  CD  . PRO A 1 112 ? 153.978 -67.205 147.664 1.00 109.09 ?  123  PRO A CD  1 
ATOM   877  N  N   . GLY A 1 113 ? 152.012 -71.249 149.090 1.00 121.35 ?  124  GLY A N   1 
ATOM   878  C  CA  . GLY A 1 113 ? 152.214 -72.360 149.996 1.00 121.18 ?  124  GLY A CA  1 
ATOM   879  C  C   . GLY A 1 113 ? 151.413 -72.187 151.268 1.00 124.33 ?  124  GLY A C   1 
ATOM   880  O  O   . GLY A 1 113 ? 150.881 -73.157 151.816 1.00 123.75 ?  124  GLY A O   1 
ATOM   881  N  N   . ALA A 1 114 ? 151.324 -70.948 151.747 1.00 79.96  ?  125  ALA A N   1 
ATOM   882  C  CA  . ALA A 1 114 ? 150.483 -70.648 152.896 1.00 78.50  ?  125  ALA A CA  1 
ATOM   883  C  C   . ALA A 1 114 ? 149.018 -70.862 152.535 1.00 79.47  ?  125  ALA A C   1 
ATOM   884  O  O   . ALA A 1 114 ? 148.546 -70.379 151.500 1.00 78.48  ?  125  ALA A O   1 
ATOM   885  C  CB  . ALA A 1 114 ? 150.715 -69.213 153.365 1.00 79.48  ?  125  ALA A CB  1 
ATOM   886  N  N   . ALA A 1 115 ? 148.305 -71.593 153.389 1.00 79.42  ?  126  ALA A N   1 
ATOM   887  C  CA  . ALA A 1 115 ? 146.923 -71.946 153.109 1.00 77.32  ?  126  ALA A CA  1 
ATOM   888  C  C   . ALA A 1 115 ? 146.036 -70.700 153.111 1.00 77.79  ?  126  ALA A C   1 
ATOM   889  O  O   . ALA A 1 115 ? 146.297 -69.742 153.844 1.00 77.15  ?  126  ALA A O   1 
ATOM   890  C  CB  . ALA A 1 115 ? 146.412 -72.951 154.139 1.00 77.56  ?  126  ALA A CB  1 
ATOM   891  N  N   . PRO A 1 116 ? 144.984 -70.685 152.284 1.00 85.84  ?  127  PRO A N   1 
ATOM   892  C  CA  . PRO A 1 116 ? 144.060 -69.540 152.313 1.00 84.47  ?  127  PRO A CA  1 
ATOM   893  C  C   . PRO A 1 116 ? 143.303 -69.436 153.616 1.00 84.60  ?  127  PRO A C   1 
ATOM   894  O  O   . PRO A 1 116 ? 142.865 -68.340 153.983 1.00 83.37  ?  127  PRO A O   1 
ATOM   895  C  CB  . PRO A 1 116 ? 143.114 -69.818 151.138 1.00 85.92  ?  127  PRO A CB  1 
ATOM   896  C  CG  . PRO A 1 116 ? 143.162 -71.299 150.962 1.00 90.46  ?  127  PRO A CG  1 
ATOM   897  C  CD  . PRO A 1 116 ? 144.563 -71.715 151.320 1.00 86.95  ?  127  PRO A CD  1 
ATOM   898  N  N   . SER A 1 117 ? 143.148 -70.544 154.335 1.00 95.03  ?  128  SER A N   1 
ATOM   899  C  CA  . SER A 1 117 ? 142.411 -70.553 155.590 1.00 92.87  ?  128  SER A CA  1 
ATOM   900  C  C   . SER A 1 117 ? 143.225 -69.870 156.681 1.00 93.05  ?  128  SER A C   1 
ATOM   901  O  O   . SER A 1 117 ? 142.898 -69.975 157.867 1.00 93.14  ?  128  SER A O   1 
ATOM   902  C  CB  . SER A 1 117 ? 142.049 -71.984 155.981 1.00 95.69  ?  128  SER A CB  1 
ATOM   903  O  OG  . SER A 1 117 ? 143.183 -72.826 155.871 1.00 102.73 ?  128  SER A OG  1 
ATOM   904  N  N   . ALA A 1 118 ? 144.292 -69.180 156.290 1.00 63.88  ?  129  ALA A N   1 
ATOM   905  C  CA  . ALA A 1 118 ? 145.085 -68.389 157.208 1.00 61.97  ?  129  ALA A CA  1 
ATOM   906  C  C   . ALA A 1 118 ? 145.066 -66.906 156.888 1.00 61.43  ?  129  ALA A C   1 
ATOM   907  O  O   . ALA A 1 118 ? 145.219 -66.092 157.804 1.00 60.72  ?  129  ALA A O   1 
ATOM   908  C  CB  . ALA A 1 118 ? 146.540 -68.884 157.226 1.00 63.41  ?  129  ALA A CB  1 
ATOM   909  N  N   . THR A 1 119 ? 144.873 -66.533 155.625 1.00 60.35  ?  130  THR A N   1 
ATOM   910  C  CA  . THR A 1 119 ? 144.748 -65.140 155.221 1.00 58.71  ?  130  THR A CA  1 
ATOM   911  C  C   . THR A 1 119 ? 143.292 -64.703 155.089 1.00 56.91  ?  130  THR A C   1 
ATOM   912  O  O   . THR A 1 119 ? 143.029 -63.587 154.630 1.00 56.34  ?  130  THR A O   1 
ATOM   913  C  CB  . THR A 1 119 ? 145.492 -64.906 153.900 1.00 72.02  ?  130  THR A CB  1 
ATOM   914  O  OG1 . THR A 1 119 ? 145.454 -63.514 153.560 1.00 74.32  ?  130  THR A OG1 1 
ATOM   915  C  CG2 . THR A 1 119 ? 144.860 -65.721 152.779 1.00 68.28  ?  130  THR A CG2 1 
ATOM   916  N  N   . GLN A 1 120 ? 142.347 -65.559 155.476 1.00 38.02  ?  131  GLN A N   1 
ATOM   917  C  CA  . GLN A 1 120 ? 140.937 -65.196 155.457 1.00 35.48  ?  131  GLN A CA  1 
ATOM   918  C  C   . GLN A 1 120 ? 140.674 -64.071 156.447 1.00 36.91  ?  131  GLN A C   1 
ATOM   919  O  O   . GLN A 1 120 ? 140.935 -64.212 157.645 1.00 37.79  ?  131  GLN A O   1 
ATOM   920  C  CB  . GLN A 1 120 ? 140.072 -66.412 155.782 1.00 35.84  ?  131  GLN A CB  1 
ATOM   921  C  CG  . GLN A 1 120 ? 139.874 -67.356 154.610 1.00 50.42  ?  131  GLN A CG  1 
ATOM   922  C  CD  . GLN A 1 120 ? 139.181 -66.684 153.441 1.00 68.27  ?  131  GLN A CD  1 
ATOM   923  O  OE1 . GLN A 1 120 ? 139.776 -66.482 152.382 1.00 70.40  ?  131  GLN A OE1 1 
ATOM   924  N  NE2 . GLN A 1 120 ? 137.914 -66.333 153.627 1.00 48.96  ?  131  GLN A NE2 1 
ATOM   925  N  N   . ILE A 1 121 ? 140.160 -62.954 155.942 1.00 28.66  ?  132  ILE A N   1 
ATOM   926  C  CA  . ILE A 1 121 ? 139.900 -61.780 156.769 1.00 27.12  ?  132  ILE A CA  1 
ATOM   927  C  C   . ILE A 1 121 ? 138.668 -62.029 157.630 1.00 28.75  ?  132  ILE A C   1 
ATOM   928  O  O   . ILE A 1 121 ? 137.591 -62.358 157.119 1.00 29.36  ?  132  ILE A O   1 
ATOM   929  C  CB  . ILE A 1 121 ? 139.722 -60.531 155.891 1.00 29.89  ?  132  ILE A CB  1 
ATOM   930  C  CG1 . ILE A 1 121 ? 141.039 -60.170 155.201 1.00 30.34  ?  132  ILE A CG1 1 
ATOM   931  C  CG2 . ILE A 1 121 ? 139.210 -59.366 156.715 1.00 29.24  ?  132  ILE A CG2 1 
ATOM   932  C  CD1 . ILE A 1 121 ? 140.893 -59.118 154.121 1.00 30.92  ?  132  ILE A CD1 1 
ATOM   933  N  N   . THR A 1 122 ? 138.824 -61.869 158.946 1.00 27.41  ?  133  THR A N   1 
ATOM   934  C  CA  . THR A 1 122 ? 137.717 -61.988 159.891 1.00 25.64  ?  133  THR A CA  1 
ATOM   935  C  C   . THR A 1 122 ? 137.167 -60.621 160.287 1.00 29.08  ?  133  THR A C   1 
ATOM   936  O  O   . THR A 1 122 ? 136.014 -60.299 159.988 1.00 30.25  ?  133  THR A O   1 
ATOM   937  C  CB  . THR A 1 122 ? 138.157 -62.764 161.140 1.00 26.72  ?  133  THR A CB  1 
ATOM   938  O  OG1 . THR A 1 122 ? 139.298 -62.123 161.725 1.00 27.46  ?  133  THR A OG1 1 
ATOM   939  C  CG2 . THR A 1 122 ? 138.509 -64.203 160.788 1.00 23.11  ?  133  THR A CG2 1 
ATOM   940  N  N   . VAL A 1 123 ? 137.979 -59.803 160.951 1.00 28.73  ?  134  VAL A N   1 
ATOM   941  C  CA  . VAL A 1 123 ? 137.567 -58.487 161.427 1.00 28.61  ?  134  VAL A CA  1 
ATOM   942  C  C   . VAL A 1 123 ? 138.282 -57.425 160.603 1.00 34.86  ?  134  VAL A C   1 
ATOM   943  O  O   . VAL A 1 123 ? 139.509 -57.468 160.451 1.00 34.65  ?  134  VAL A O   1 
ATOM   944  C  CB  . VAL A 1 123 ? 137.869 -58.314 162.927 1.00 32.48  ?  134  VAL A CB  1 
ATOM   945  C  CG1 . VAL A 1 123 ? 137.404 -56.949 163.414 1.00 32.52  ?  134  VAL A CG1 1 
ATOM   946  C  CG2 . VAL A 1 123 ? 137.216 -59.426 163.736 1.00 31.30  ?  134  VAL A CG2 1 
ATOM   947  N  N   . VAL A 1 124 ? 137.517 -56.477 160.071 1.00 28.00  ?  135  VAL A N   1 
ATOM   948  C  CA  . VAL A 1 124 ? 138.064 -55.293 159.418 1.00 27.39  ?  135  VAL A CA  1 
ATOM   949  C  C   . VAL A 1 124 ? 137.906 -54.119 160.373 1.00 32.55  ?  135  VAL A C   1 
ATOM   950  O  O   . VAL A 1 124 ? 136.800 -53.845 160.854 1.00 30.41  ?  135  VAL A O   1 
ATOM   951  C  CB  . VAL A 1 124 ? 137.364 -55.014 158.077 1.00 29.09  ?  135  VAL A CB  1 
ATOM   952  C  CG1 . VAL A 1 124 ? 137.909 -53.741 157.449 1.00 29.43  ?  135  VAL A CG1 1 
ATOM   953  C  CG2 . VAL A 1 124 ? 137.533 -56.190 157.131 1.00 27.87  ?  135  VAL A CG2 1 
ATOM   954  N  N   . LEU A 1 125 ? 139.009 -53.434 160.659 1.00 30.24  ?  136  LEU A N   1 
ATOM   955  C  CA  . LEU A 1 125 ? 139.001 -52.282 161.562 1.00 31.06  ?  136  LEU A CA  1 
ATOM   956  C  C   . LEU A 1 125 ? 139.548 -51.057 160.845 1.00 38.20  ?  136  LEU A C   1 
ATOM   957  O  O   . LEU A 1 125 ? 140.774 -50.929 160.675 1.00 38.96  ?  136  LEU A O   1 
ATOM   958  C  CB  . LEU A 1 125 ? 139.816 -52.567 162.821 1.00 31.27  ?  136  LEU A CB  1 
ATOM   959  C  CG  . LEU A 1 125 ? 140.034 -51.366 163.748 1.00 35.51  ?  136  LEU A CG  1 
ATOM   960  C  CD1 . LEU A 1 125 ? 138.716 -50.880 164.333 1.00 33.90  ?  136  LEU A CD1 1 
ATOM   961  C  CD2 . LEU A 1 125 ? 141.025 -51.704 164.849 1.00 37.49  ?  136  LEU A CD2 1 
ATOM   962  N  N   . PRO A 1 126 ? 138.693 -50.139 160.399 1.00 29.13  ?  137  PRO A N   1 
ATOM   963  C  CA  . PRO A 1 126 ? 139.196 -48.863 159.877 1.00 30.47  ?  137  PRO A CA  1 
ATOM   964  C  C   . PRO A 1 126 ? 139.684 -47.984 161.018 1.00 39.40  ?  137  PRO A C   1 
ATOM   965  O  O   . PRO A 1 126 ? 138.942 -47.697 161.960 1.00 38.14  ?  137  PRO A O   1 
ATOM   966  C  CB  . PRO A 1 126 ? 137.975 -48.254 159.176 1.00 31.54  ?  137  PRO A CB  1 
ATOM   967  C  CG  . PRO A 1 126 ? 136.977 -49.375 159.062 1.00 34.09  ?  137  PRO A CG  1 
ATOM   968  C  CD  . PRO A 1 126 ? 137.238 -50.263 160.233 1.00 28.72  ?  137  PRO A CD  1 
ATOM   969  N  N   . HIS A 1 127 ? 140.943 -47.566 160.936 1.00 47.31  ?  138  HIS A N   1 
ATOM   970  C  CA  . HIS A 1 127 ? 141.491 -46.678 161.948 1.00 49.20  ?  138  HIS A CA  1 
ATOM   971  C  C   . HIS A 1 127 ? 140.787 -45.327 161.901 1.00 54.64  ?  138  HIS A C   1 
ATOM   972  O  O   . HIS A 1 127 ? 140.297 -44.894 160.855 1.00 54.75  ?  138  HIS A O   1 
ATOM   973  C  CB  . HIS A 1 127 ? 142.993 -46.495 161.744 1.00 51.45  ?  138  HIS A CB  1 
ATOM   974  C  CG  . HIS A 1 127 ? 143.705 -45.976 162.952 1.00 56.05  ?  138  HIS A CG  1 
ATOM   975  N  ND1 . HIS A 1 127 ? 143.900 -44.631 163.182 1.00 58.74  ?  138  HIS A ND1 1 
ATOM   976  C  CD2 . HIS A 1 127 ? 144.265 -46.622 164.001 1.00 58.66  ?  138  HIS A CD2 1 
ATOM   977  C  CE1 . HIS A 1 127 ? 144.551 -44.472 164.320 1.00 58.85  ?  138  HIS A CE1 1 
ATOM   978  N  NE2 . HIS A 1 127 ? 144.785 -45.665 164.837 1.00 59.10  ?  138  HIS A NE2 1 
ATOM   979  N  N   . SER A 1 128 ? 140.740 -44.656 163.056 1.00 48.66  ?  139  SER A N   1 
ATOM   980  C  CA  . SER A 1 128 ? 140.086 -43.353 163.144 1.00 49.04  ?  139  SER A CA  1 
ATOM   981  C  C   . SER A 1 128 ? 140.763 -42.295 162.282 1.00 56.53  ?  139  SER A C   1 
ATOM   982  O  O   . SER A 1 128 ? 140.165 -41.238 162.046 1.00 56.11  ?  139  SER A O   1 
ATOM   983  C  CB  . SER A 1 128 ? 140.040 -42.887 164.601 1.00 51.44  ?  139  SER A CB  1 
ATOM   984  O  OG  . SER A 1 128 ? 141.344 -42.653 165.106 1.00 61.66  ?  139  SER A OG  1 
ATOM   985  N  N   . SER A 1 129 ? 141.981 -42.556 161.805 1.00 53.79  ?  140  SER A N   1 
ATOM   986  C  CA  . SER A 1 129 ? 142.710 -41.642 160.933 1.00 54.74  ?  140  SER A CA  1 
ATOM   987  C  C   . SER A 1 129 ? 142.306 -41.758 159.472 1.00 58.52  ?  140  SER A C   1 
ATOM   988  O  O   . SER A 1 129 ? 142.773 -40.956 158.657 1.00 59.02  ?  140  SER A O   1 
ATOM   989  C  CB  . SER A 1 129 ? 144.217 -41.891 161.054 1.00 59.30  ?  140  SER A CB  1 
ATOM   990  O  OG  . SER A 1 129 ? 144.570 -43.166 160.540 1.00 65.45  ?  140  SER A OG  1 
ATOM   991  N  N   . CYS A 1 130 ? 141.478 -42.739 159.117 1.00 74.41  ?  141  CYS A N   1 
ATOM   992  C  CA  . CYS A 1 130 ? 141.019 -42.978 157.751 1.00 74.11  ?  141  CYS A CA  1 
ATOM   993  C  C   . CYS A 1 130 ? 142.162 -43.256 156.782 1.00 76.68  ?  141  CYS A C   1 
ATOM   994  O  O   . CYS A 1 130 ? 141.947 -43.272 155.565 1.00 76.53  ?  141  CYS A O   1 
ATOM   995  C  CB  . CYS A 1 130 ? 140.173 -41.807 157.232 1.00 74.85  ?  141  CYS A CB  1 
ATOM   996  S  SG  . CYS A 1 130 ? 138.659 -41.495 158.171 1.00 78.24  ?  141  CYS A SG  1 
ATOM   997  N  N   . GLU A 1 131 ? 143.375 -43.474 157.290 1.00 59.20  ?  142  GLU A N   1 
ATOM   998  C  CA  . GLU A 1 131 ? 144.535 -43.746 156.455 1.00 58.44  ?  142  GLU A CA  1 
ATOM   999  C  C   . GLU A 1 131 ? 144.924 -45.216 156.430 1.00 57.39  ?  142  GLU A C   1 
ATOM   1000 O  O   . GLU A 1 131 ? 145.739 -45.606 155.588 1.00 56.97  ?  142  GLU A O   1 
ATOM   1001 C  CB  . GLU A 1 131 ? 145.743 -42.927 156.929 1.00 61.04  ?  142  GLU A CB  1 
ATOM   1002 C  CG  . GLU A 1 131 ? 145.558 -41.423 156.882 1.00 74.16  ?  142  GLU A CG  1 
ATOM   1003 C  CD  . GLU A 1 131 ? 146.836 -40.680 157.217 1.00 92.86  ?  142  GLU A CD  1 
ATOM   1004 O  OE1 . GLU A 1 131 ? 147.839 -40.881 156.502 1.00 78.67  ?  142  GLU A OE1 1 
ATOM   1005 O  OE2 . GLU A 1 131 ? 146.841 -39.910 158.201 1.00 85.76  ?  142  GLU A OE2 1 
ATOM   1006 N  N   . LEU A 1 132 ? 144.371 -46.036 157.323 1.00 49.76  ?  143  LEU A N   1 
ATOM   1007 C  CA  . LEU A 1 132 ? 144.801 -47.419 157.454 1.00 47.74  ?  143  LEU A CA  1 
ATOM   1008 C  C   . LEU A 1 132 ? 143.616 -48.331 157.729 1.00 46.40  ?  143  LEU A C   1 
ATOM   1009 O  O   . LEU A 1 132 ? 142.639 -47.938 158.372 1.00 44.83  ?  143  LEU A O   1 
ATOM   1010 C  CB  . LEU A 1 132 ? 145.828 -47.585 158.583 1.00 47.92  ?  143  LEU A CB  1 
ATOM   1011 C  CG  . LEU A 1 132 ? 147.217 -46.979 158.387 1.00 53.16  ?  143  LEU A CG  1 
ATOM   1012 C  CD1 . LEU A 1 132 ? 148.085 -47.229 159.612 1.00 53.43  ?  143  LEU A CD1 1 
ATOM   1013 C  CD2 . LEU A 1 132 ? 147.874 -47.543 157.140 1.00 54.80  ?  143  LEU A CD2 1 
ATOM   1014 N  N   . LEU A 1 133 ? 143.724 -49.561 157.234 1.00 38.74  ?  144  LEU A N   1 
ATOM   1015 C  CA  . LEU A 1 133 ? 142.840 -50.659 157.601 1.00 35.67  ?  144  LEU A CA  1 
ATOM   1016 C  C   . LEU A 1 133 ? 143.667 -51.717 158.315 1.00 38.88  ?  144  LEU A C   1 
ATOM   1017 O  O   . LEU A 1 133 ? 144.683 -52.174 157.781 1.00 39.02  ?  144  LEU A O   1 
ATOM   1018 C  CB  . LEU A 1 133 ? 142.161 -51.278 156.374 1.00 34.07  ?  144  LEU A CB  1 
ATOM   1019 C  CG  . LEU A 1 133 ? 141.046 -50.546 155.627 1.00 34.99  ?  144  LEU A CG  1 
ATOM   1020 C  CD1 . LEU A 1 133 ? 140.496 -51.442 154.528 1.00 33.06  ?  144  LEU A CD1 1 
ATOM   1021 C  CD2 . LEU A 1 133 ? 139.934 -50.118 156.568 1.00 33.69  ?  144  LEU A CD2 1 
ATOM   1022 N  N   . TYR A 1 134 ? 143.249 -52.084 159.523 1.00 36.15  ?  145  TYR A N   1 
ATOM   1023 C  CA  . TYR A 1 134 ? 143.824 -53.218 160.237 1.00 35.27  ?  145  TYR A CA  1 
ATOM   1024 C  C   . TYR A 1 134 ? 142.946 -54.438 159.990 1.00 36.46  ?  145  TYR A C   1 
ATOM   1025 O  O   . TYR A 1 134 ? 141.721 -54.369 160.145 1.00 35.04  ?  145  TYR A O   1 
ATOM   1026 C  CB  . TYR A 1 134 ? 143.945 -52.927 161.738 1.00 35.93  ?  145  TYR A CB  1 
ATOM   1027 C  CG  . TYR A 1 134 ? 144.990 -51.878 162.064 1.00 39.77  ?  145  TYR A CG  1 
ATOM   1028 C  CD1 . TYR A 1 134 ? 146.315 -52.232 162.292 1.00 41.24  ?  145  TYR A CD1 1 
ATOM   1029 C  CD2 . TYR A 1 134 ? 144.653 -50.533 162.132 1.00 42.50  ?  145  TYR A CD2 1 
ATOM   1030 C  CE1 . TYR A 1 134 ? 147.272 -51.274 162.582 1.00 43.33  ?  145  TYR A CE1 1 
ATOM   1031 C  CE2 . TYR A 1 134 ? 145.602 -49.569 162.421 1.00 44.42  ?  145  TYR A CE2 1 
ATOM   1032 C  CZ  . TYR A 1 134 ? 146.908 -49.944 162.644 1.00 54.23  ?  145  TYR A CZ  1 
ATOM   1033 O  OH  . TYR A 1 134 ? 147.850 -48.981 162.931 1.00 59.54  ?  145  TYR A OH  1 
ATOM   1034 N  N   . LEU A 1 135 ? 143.567 -55.546 159.594 1.00 27.61  ?  146  LEU A N   1 
ATOM   1035 C  CA  . LEU A 1 135 ? 142.842 -56.724 159.128 1.00 26.17  ?  146  LEU A CA  1 
ATOM   1036 C  C   . LEU A 1 135 ? 143.210 -57.930 159.980 1.00 29.95  ?  146  LEU A C   1 
ATOM   1037 O  O   . LEU A 1 135 ? 144.330 -58.444 159.889 1.00 30.57  ?  146  LEU A O   1 
ATOM   1038 C  CB  . LEU A 1 135 ? 143.142 -56.992 157.653 1.00 25.89  ?  146  LEU A CB  1 
ATOM   1039 C  CG  . LEU A 1 135 ? 142.832 -55.837 156.704 1.00 30.08  ?  146  LEU A CG  1 
ATOM   1040 C  CD1 . LEU A 1 135 ? 143.226 -56.197 155.283 1.00 30.11  ?  146  LEU A CD1 1 
ATOM   1041 C  CD2 . LEU A 1 135 ? 141.361 -55.459 156.781 1.00 29.13  ?  146  LEU A CD2 1 
ATOM   1042 N  N   . GLY A 1 136 ? 142.263 -58.384 160.798 1.00 28.15  ?  147  GLY A N   1 
ATOM   1043 C  CA  . GLY A 1 136 ? 142.443 -59.634 161.511 1.00 27.85  ?  147  GLY A CA  1 
ATOM   1044 C  C   . GLY A 1 136 ? 142.076 -60.824 160.643 1.00 31.59  ?  147  GLY A C   1 
ATOM   1045 O  O   . GLY A 1 136 ? 141.150 -60.773 159.832 1.00 30.45  ?  147  GLY A O   1 
ATOM   1046 N  N   . THR A 1 137 ? 142.827 -61.911 160.815 1.00 26.73  ?  148  THR A N   1 
ATOM   1047 C  CA  . THR A 1 137 ? 142.692 -63.094 159.977 1.00 26.17  ?  148  THR A CA  1 
ATOM   1048 C  C   . THR A 1 137 ? 142.481 -64.337 160.834 1.00 29.41  ?  148  THR A C   1 
ATOM   1049 O  O   . THR A 1 137 ? 142.575 -64.302 162.064 1.00 28.62  ?  148  THR A O   1 
ATOM   1050 C  CB  . THR A 1 137 ? 143.919 -63.279 159.073 1.00 36.36  ?  148  THR A CB  1 
ATOM   1051 O  OG1 . THR A 1 137 ? 145.107 -63.291 159.874 1.00 37.73  ?  148  THR A OG1 1 
ATOM   1052 C  CG2 . THR A 1 137 ? 144.008 -62.149 158.057 1.00 32.52  ?  148  THR A CG2 1 
ATOM   1053 N  N   . GLU A 1 138 ? 142.188 -65.451 160.156 1.00 29.39  ?  149  GLU A N   1 
ATOM   1054 C  CA  . GLU A 1 138 ? 141.975 -66.720 160.843 1.00 29.63  ?  149  GLU A CA  1 
ATOM   1055 C  C   . GLU A 1 138 ? 143.261 -67.288 161.425 1.00 38.68  ?  149  GLU A C   1 
ATOM   1056 O  O   . GLU A 1 138 ? 143.200 -68.070 162.379 1.00 38.88  ?  149  GLU A O   1 
ATOM   1057 C  CB  . GLU A 1 138 ? 141.346 -67.737 159.889 1.00 30.46  ?  149  GLU A CB  1 
ATOM   1058 C  CG  . GLU A 1 138 ? 139.946 -67.366 159.424 1.00 39.48  ?  149  GLU A CG  1 
ATOM   1059 C  CD  . GLU A 1 138 ? 139.297 -68.450 158.584 1.00 61.02  ?  149  GLU A CD  1 
ATOM   1060 O  OE1 . GLU A 1 138 ? 140.030 -69.277 158.002 1.00 56.68  ?  149  GLU A OE1 1 
ATOM   1061 O  OE2 . GLU A 1 138 ? 138.050 -68.477 158.508 1.00 52.97  ?  149  GLU A OE2 1 
ATOM   1062 N  N   . SER A 1 139 ? 144.419 -66.918 160.873 1.00 39.36  ?  150  SER A N   1 
ATOM   1063 C  CA  . SER A 1 139 ? 145.685 -67.399 161.416 1.00 40.24  ?  150  SER A CA  1 
ATOM   1064 C  C   . SER A 1 139 ? 145.960 -66.821 162.796 1.00 45.93  ?  150  SER A C   1 
ATOM   1065 O  O   . SER A 1 139 ? 146.625 -67.464 163.615 1.00 46.74  ?  150  SER A O   1 
ATOM   1066 C  CB  . SER A 1 139 ? 146.832 -67.044 160.472 1.00 43.29  ?  150  SER A CB  1 
ATOM   1067 O  OG  . SER A 1 139 ? 147.158 -65.669 160.573 1.00 47.91  ?  150  SER A OG  1 
ATOM   1068 N  N   . GLY A 1 140 ? 145.458 -65.620 163.074 1.00 54.67  ?  151  GLY A N   1 
ATOM   1069 C  CA  . GLY A 1 140 ? 145.797 -64.895 164.280 1.00 54.11  ?  151  GLY A CA  1 
ATOM   1070 C  C   . GLY A 1 140 ? 146.680 -63.691 164.046 1.00 56.36  ?  151  GLY A C   1 
ATOM   1071 O  O   . GLY A 1 140 ? 147.058 -63.021 165.015 1.00 56.65  ?  151  GLY A O   1 
ATOM   1072 N  N   . ASN A 1 141 ? 147.019 -63.395 162.796 1.00 36.80  ?  152  ASN A N   1 
ATOM   1073 C  CA  . ASN A 1 141 ? 147.868 -62.268 162.448 1.00 36.56  ?  152  ASN A CA  1 
ATOM   1074 C  C   . ASN A 1 141 ? 147.016 -61.094 161.982 1.00 38.55  ?  152  ASN A C   1 
ATOM   1075 O  O   . ASN A 1 141 ? 145.973 -61.274 161.349 1.00 38.16  ?  152  ASN A O   1 
ATOM   1076 C  CB  . ASN A 1 141 ? 148.866 -62.660 161.356 1.00 39.28  ?  152  ASN A CB  1 
ATOM   1077 C  CG  . ASN A 1 141 ? 149.728 -63.846 161.752 1.00 63.31  ?  152  ASN A CG  1 
ATOM   1078 O  OD1 . ASN A 1 141 ? 150.156 -63.960 162.901 1.00 57.06  ?  152  ASN A OD1 1 
ATOM   1079 N  ND2 . ASN A 1 141 ? 149.983 -64.739 160.802 1.00 54.74  ?  152  ASN A ND2 1 
ATOM   1080 N  N   . VAL A 1 142 ? 147.473 -59.888 162.306 1.00 34.04  ?  153  VAL A N   1 
ATOM   1081 C  CA  . VAL A 1 142 ? 146.797 -58.649 161.937 1.00 33.68  ?  153  VAL A CA  1 
ATOM   1082 C  C   . VAL A 1 142 ? 147.647 -57.950 160.884 1.00 39.77  ?  153  VAL A C   1 
ATOM   1083 O  O   . VAL A 1 142 ? 148.818 -57.634 161.130 1.00 40.72  ?  153  VAL A O   1 
ATOM   1084 C  CB  . VAL A 1 142 ? 146.570 -57.743 163.156 1.00 36.90  ?  153  VAL A CB  1 
ATOM   1085 C  CG1 . VAL A 1 142 ? 145.918 -56.432 162.735 1.00 36.01  ?  153  VAL A CG1 1 
ATOM   1086 C  CG2 . VAL A 1 142 ? 145.723 -58.456 164.198 1.00 35.80  ?  153  VAL A CG2 1 
ATOM   1087 N  N   . PHE A 1 143 ? 147.060 -57.711 159.715 1.00 34.00  ?  154  PHE A N   1 
ATOM   1088 C  CA  . PHE A 1 143 ? 147.729 -57.038 158.613 1.00 33.33  ?  154  PHE A CA  1 
ATOM   1089 C  C   . PHE A 1 143 ? 147.213 -55.611 158.477 1.00 39.84  ?  154  PHE A C   1 
ATOM   1090 O  O   . PHE A 1 143 ? 146.099 -55.286 158.898 1.00 37.70  ?  154  PHE A O   1 
ATOM   1091 C  CB  . PHE A 1 143 ? 147.525 -57.803 157.302 1.00 33.25  ?  154  PHE A CB  1 
ATOM   1092 C  CG  . PHE A 1 143 ? 148.079 -59.199 157.325 1.00 34.08  ?  154  PHE A CG  1 
ATOM   1093 C  CD1 . PHE A 1 143 ? 147.315 -60.254 157.795 1.00 34.75  ?  154  PHE A CD1 1 
ATOM   1094 C  CD2 . PHE A 1 143 ? 149.368 -59.457 156.885 1.00 37.95  ?  154  PHE A CD2 1 
ATOM   1095 C  CE1 . PHE A 1 143 ? 147.820 -61.541 157.822 1.00 35.46  ?  154  PHE A CE1 1 
ATOM   1096 C  CE2 . PHE A 1 143 ? 149.880 -60.743 156.909 1.00 40.79  ?  154  PHE A CE2 1 
ATOM   1097 C  CZ  . PHE A 1 143 ? 149.103 -61.787 157.379 1.00 37.27  ?  154  PHE A CZ  1 
ATOM   1098 N  N   . VAL A 1 144 ? 148.043 -54.755 157.888 1.00 42.83  ?  155  VAL A N   1 
ATOM   1099 C  CA  . VAL A 1 144 ? 147.724 -53.345 157.707 1.00 43.26  ?  155  VAL A CA  1 
ATOM   1100 C  C   . VAL A 1 144 ? 147.732 -53.031 156.219 1.00 47.75  ?  155  VAL A C   1 
ATOM   1101 O  O   . VAL A 1 144 ? 148.604 -53.502 155.481 1.00 48.66  ?  155  VAL A O   1 
ATOM   1102 C  CB  . VAL A 1 144 ? 148.713 -52.434 158.466 1.00 47.42  ?  155  VAL A CB  1 
ATOM   1103 C  CG1 . VAL A 1 144 ? 148.220 -50.995 158.474 1.00 46.46  ?  155  VAL A CG1 1 
ATOM   1104 C  CG2 . VAL A 1 144 ? 148.911 -52.936 159.881 1.00 47.56  ?  155  VAL A CG2 1 
ATOM   1105 N  N   . VAL A 1 145 ? 146.753 -52.243 155.779 1.00 40.28  ?  156  VAL A N   1 
ATOM   1106 C  CA  . VAL A 1 145 ? 146.633 -51.821 154.389 1.00 40.43  ?  156  VAL A CA  1 
ATOM   1107 C  C   . VAL A 1 145 ? 146.442 -50.311 154.361 1.00 47.44  ?  156  VAL A C   1 
ATOM   1108 O  O   . VAL A 1 145 ? 145.728 -49.749 155.199 1.00 45.02  ?  156  VAL A O   1 
ATOM   1109 C  CB  . VAL A 1 145 ? 145.471 -52.545 153.675 1.00 43.69  ?  156  VAL A CB  1 
ATOM   1110 C  CG1 . VAL A 1 145 ? 145.230 -51.957 152.290 1.00 44.05  ?  156  VAL A CG1 1 
ATOM   1111 C  CG2 . VAL A 1 145 ? 145.763 -54.035 153.570 1.00 43.12  ?  156  VAL A CG2 1 
ATOM   1112 N  N   . GLN A 1 146 ? 147.096 -49.655 153.404 1.00 56.21  ?  157  GLN A N   1 
ATOM   1113 C  CA  . GLN A 1 146 ? 147.025 -48.208 153.274 1.00 58.44  ?  157  GLN A CA  1 
ATOM   1114 C  C   . GLN A 1 146 ? 145.758 -47.794 152.536 1.00 63.92  ?  157  GLN A C   1 
ATOM   1115 O  O   . GLN A 1 146 ? 145.206 -48.547 151.729 1.00 61.92  ?  157  GLN A O   1 
ATOM   1116 C  CB  . GLN A 1 146 ? 148.258 -47.679 152.540 1.00 61.48  ?  157  GLN A CB  1 
ATOM   1117 C  CG  . GLN A 1 146 ? 148.582 -46.223 152.831 1.00 85.34  ?  157  GLN A CG  1 
ATOM   1118 C  CD  . GLN A 1 146 ? 150.038 -45.889 152.569 1.00 110.56 ?  157  GLN A CD  1 
ATOM   1119 O  OE1 . GLN A 1 146 ? 150.534 -46.050 151.453 1.00 107.80 ?  157  GLN A OE1 1 
ATOM   1120 N  NE2 . GLN A 1 146 ? 150.734 -45.431 153.602 1.00 103.70 ?  157  GLN A NE2 1 
ATOM   1121 N  N   . LEU A 1 147 ? 145.296 -46.575 152.823 1.00 56.92  ?  158  LEU A N   1 
ATOM   1122 C  CA  . LEU A 1 147 ? 144.084 -46.028 152.232 1.00 57.20  ?  158  LEU A CA  1 
ATOM   1123 C  C   . LEU A 1 147 ? 144.368 -44.567 151.896 1.00 64.87  ?  158  LEU A C   1 
ATOM   1124 O  O   . LEU A 1 147 ? 144.947 -43.845 152.729 1.00 65.77  ?  158  LEU A O   1 
ATOM   1125 C  CB  . LEU A 1 147 ? 142.893 -46.155 153.192 1.00 56.41  ?  158  LEU A CB  1 
ATOM   1126 C  CG  . LEU A 1 147 ? 141.466 -46.001 152.658 1.00 60.09  ?  158  LEU A CG  1 
ATOM   1127 C  CD1 . LEU A 1 147 ? 140.490 -46.785 153.523 1.00 59.17  ?  158  LEU A CD1 1 
ATOM   1128 C  CD2 . LEU A 1 147 ? 141.052 -44.537 152.594 1.00 63.78  ?  158  LEU A CD2 1 
ATOM   1129 N  N   . PRO A 1 148 ? 143.980 -44.091 150.702 1.00 66.54  ?  159  PRO A N   1 
ATOM   1130 C  CA  . PRO A 1 148 ? 143.262 -44.842 149.669 1.00 66.34  ?  159  PRO A CA  1 
ATOM   1131 C  C   . PRO A 1 148 ? 144.164 -45.451 148.599 1.00 71.40  ?  159  PRO A C   1 
ATOM   1132 O  O   . PRO A 1 148 ? 143.804 -45.425 147.425 1.00 71.46  ?  159  PRO A O   1 
ATOM   1133 C  CB  . PRO A 1 148 ? 142.361 -43.776 149.055 1.00 67.96  ?  159  PRO A CB  1 
ATOM   1134 C  CG  . PRO A 1 148 ? 143.209 -42.541 149.110 1.00 73.15  ?  159  PRO A CG  1 
ATOM   1135 C  CD  . PRO A 1 148 ? 144.072 -42.661 150.355 1.00 69.02  ?  159  PRO A CD  1 
ATOM   1136 N  N   . ALA A 1 149 ? 145.316 -45.988 148.994 1.00 60.86  ?  160  ALA A N   1 
ATOM   1137 C  CA  . ALA A 1 149 ? 146.192 -46.658 148.042 1.00 61.62  ?  160  ALA A CA  1 
ATOM   1138 C  C   . ALA A 1 149 ? 145.866 -48.136 147.889 1.00 65.63  ?  160  ALA A C   1 
ATOM   1139 O  O   . ALA A 1 149 ? 146.121 -48.712 146.824 1.00 65.48  ?  160  ALA A O   1 
ATOM   1140 C  CB  . ALA A 1 149 ? 147.655 -46.501 148.466 1.00 63.59  ?  160  ALA A CB  1 
ATOM   1141 N  N   . PHE A 1 150 ? 145.299 -48.751 148.926 1.00 72.21  ?  161  PHE A N   1 
ATOM   1142 C  CA  . PHE A 1 150 ? 145.022 -50.186 148.972 1.00 71.11  ?  161  PHE A CA  1 
ATOM   1143 C  C   . PHE A 1 150 ? 146.277 -50.993 148.629 1.00 74.03  ?  161  PHE A C   1 
ATOM   1144 O  O   . PHE A 1 150 ? 146.363 -51.692 147.620 1.00 73.45  ?  161  PHE A O   1 
ATOM   1145 C  CB  . PHE A 1 150 ? 143.847 -50.552 148.059 1.00 72.21  ?  161  PHE A CB  1 
ATOM   1146 C  CG  . PHE A 1 150 ? 142.532 -50.650 148.783 1.00 72.75  ?  161  PHE A CG  1 
ATOM   1147 C  CD1 . PHE A 1 150 ? 142.371 -50.074 150.032 1.00 75.67  ?  161  PHE A CD1 1 
ATOM   1148 C  CD2 . PHE A 1 150 ? 141.466 -51.338 148.227 1.00 73.76  ?  161  PHE A CD2 1 
ATOM   1149 C  CE1 . PHE A 1 150 ? 141.168 -50.167 150.707 1.00 75.43  ?  161  PHE A CE1 1 
ATOM   1150 C  CE2 . PHE A 1 150 ? 140.261 -51.436 148.899 1.00 75.71  ?  161  PHE A CE2 1 
ATOM   1151 C  CZ  . PHE A 1 150 ? 140.113 -50.849 150.141 1.00 73.73  ?  161  PHE A CZ  1 
ATOM   1152 N  N   . ARG A 1 151 ? 147.260 -50.859 149.516 1.00 63.02  ?  162  ARG A N   1 
ATOM   1153 C  CA  . ARG A 1 151 ? 148.510 -51.597 149.431 1.00 62.86  ?  162  ARG A CA  1 
ATOM   1154 C  C   . ARG A 1 151 ? 148.861 -52.130 150.810 1.00 63.09  ?  162  ARG A C   1 
ATOM   1155 O  O   . ARG A 1 151 ? 148.674 -51.441 151.816 1.00 61.87  ?  162  ARG A O   1 
ATOM   1156 C  CB  . ARG A 1 151 ? 149.652 -50.720 148.901 1.00 65.81  ?  162  ARG A CB  1 
ATOM   1157 C  CG  . ARG A 1 151 ? 149.773 -49.374 149.599 1.00 78.64  ?  162  ARG A CG  1 
ATOM   1158 C  CD  . ARG A 1 151 ? 151.143 -48.744 149.382 1.00 85.30  ?  162  ARG A CD  1 
ATOM   1159 N  NE  . ARG A 1 151 ? 152.182 -49.400 150.173 1.00 90.59  ?  162  ARG A NE  1 
ATOM   1160 C  CZ  . ARG A 1 151 ? 153.051 -50.281 149.688 1.00 100.58 ?  162  ARG A CZ  1 
ATOM   1161 N  NH1 . ARG A 1 151 ? 153.017 -50.614 148.405 1.00 86.46  ?  162  ARG A NH1 1 
ATOM   1162 N  NH2 . ARG A 1 151 ? 153.960 -50.826 150.486 1.00 82.52  ?  162  ARG A NH2 1 
ATOM   1163 N  N   . ALA A 1 152 ? 149.362 -53.360 150.854 1.00 50.24  ?  163  ALA A N   1 
ATOM   1164 C  CA  . ALA A 1 152 ? 149.743 -53.959 152.123 1.00 49.54  ?  163  ALA A CA  1 
ATOM   1165 C  C   . ALA A 1 152 ? 151.053 -53.361 152.627 1.00 53.16  ?  163  ALA A C   1 
ATOM   1166 O  O   . ALA A 1 152 ? 151.930 -52.975 151.848 1.00 52.65  ?  163  ALA A O   1 
ATOM   1167 C  CB  . ALA A 1 152 ? 149.867 -55.475 151.984 1.00 50.03  ?  163  ALA A CB  1 
ATOM   1168 N  N   . LEU A 1 153 ? 151.175 -53.283 153.950 1.00 46.01  ?  164  LEU A N   1 
ATOM   1169 C  CA  . LEU A 1 153 ? 152.334 -52.700 154.623 1.00 45.88  ?  164  LEU A CA  1 
ATOM   1170 C  C   . LEU A 1 153 ? 152.907 -53.759 155.561 1.00 52.53  ?  164  LEU A C   1 
ATOM   1171 O  O   . LEU A 1 153 ? 152.539 -53.831 156.736 1.00 52.82  ?  164  LEU A O   1 
ATOM   1172 C  CB  . LEU A 1 153 ? 151.937 -51.433 155.371 1.00 45.03  ?  164  LEU A CB  1 
ATOM   1173 C  CG  . LEU A 1 153 ? 151.272 -50.358 154.508 1.00 48.15  ?  164  LEU A CG  1 
ATOM   1174 C  CD1 . LEU A 1 153 ? 150.559 -49.331 155.372 1.00 47.93  ?  164  LEU A CD1 1 
ATOM   1175 C  CD2 . LEU A 1 153 ? 152.298 -49.682 153.612 1.00 49.40  ?  164  LEU A CD2 1 
ATOM   1176 N  N   . GLU A 1 154 ? 153.822 -54.576 155.033 1.00 69.29  ?  165  GLU A N   1 
ATOM   1177 C  CA  . GLU A 1 154 ? 154.338 -55.719 155.777 1.00 69.99  ?  165  GLU A CA  1 
ATOM   1178 C  C   . GLU A 1 154 ? 155.220 -55.317 156.954 1.00 76.49  ?  165  GLU A C   1 
ATOM   1179 O  O   . GLU A 1 154 ? 155.482 -56.154 157.826 1.00 77.01  ?  165  GLU A O   1 
ATOM   1180 C  CB  . GLU A 1 154 ? 155.104 -56.642 154.829 1.00 71.83  ?  165  GLU A CB  1 
ATOM   1181 C  CG  . GLU A 1 154 ? 154.210 -57.289 153.782 1.00 84.20  ?  165  GLU A CG  1 
ATOM   1182 C  CD  . GLU A 1 154 ? 154.949 -57.648 152.511 1.00 106.66 ?  165  GLU A CD  1 
ATOM   1183 O  OE1 . GLU A 1 154 ? 155.908 -58.445 152.576 1.00 103.06 ?  165  GLU A OE1 1 
ATOM   1184 O  OE2 . GLU A 1 154 ? 154.569 -57.124 151.442 1.00 97.59  ?  165  GLU A OE2 1 
ATOM   1185 N  N   . ASP A 1 155 ? 155.682 -54.067 157.004 1.00 73.30  ?  166  ASP A N   1 
ATOM   1186 C  CA  . ASP A 1 155 ? 156.458 -53.596 158.143 1.00 73.63  ?  166  ASP A CA  1 
ATOM   1187 C  C   . ASP A 1 155 ? 155.593 -53.277 159.355 1.00 75.21  ?  166  ASP A C   1 
ATOM   1188 O  O   . ASP A 1 155 ? 156.135 -53.050 160.443 1.00 75.46  ?  166  ASP A O   1 
ATOM   1189 C  CB  . ASP A 1 155 ? 157.271 -52.356 157.757 1.00 76.67  ?  166  ASP A CB  1 
ATOM   1190 C  CG  . ASP A 1 155 ? 158.350 -52.660 156.734 1.00 91.38  ?  166  ASP A CG  1 
ATOM   1191 O  OD1 . ASP A 1 155 ? 158.883 -53.790 156.743 1.00 92.70  ?  166  ASP A OD1 1 
ATOM   1192 O  OD2 . ASP A 1 155 ? 158.668 -51.765 155.922 1.00 98.91  ?  166  ASP A OD2 1 
ATOM   1193 N  N   . ARG A 1 156 ? 154.271 -53.257 159.196 1.00 57.24  ?  167  ARG A N   1 
ATOM   1194 C  CA  . ARG A 1 156 ? 153.353 -52.945 160.283 1.00 54.77  ?  167  ARG A CA  1 
ATOM   1195 C  C   . ARG A 1 156 ? 152.519 -54.146 160.708 1.00 54.52  ?  167  ARG A C   1 
ATOM   1196 O  O   . ARG A 1 156 ? 151.538 -53.979 161.439 1.00 54.03  ?  167  ARG A O   1 
ATOM   1197 C  CB  . ARG A 1 156 ? 152.444 -51.783 159.876 1.00 52.75  ?  167  ARG A CB  1 
ATOM   1198 C  CG  . ARG A 1 156 ? 153.173 -50.456 159.743 1.00 58.34  ?  167  ARG A CG  1 
ATOM   1199 C  CD  . ARG A 1 156 ? 152.316 -49.419 159.044 1.00 67.57  ?  167  ARG A CD  1 
ATOM   1200 N  NE  . ARG A 1 156 ? 152.845 -48.071 159.217 1.00 81.76  ?  167  ARG A NE  1 
ATOM   1201 C  CZ  . ARG A 1 156 ? 152.416 -47.217 160.139 1.00 98.22  ?  167  ARG A CZ  1 
ATOM   1202 N  NH1 . ARG A 1 156 ? 151.445 -47.571 160.971 1.00 84.27  ?  167  ARG A NH1 1 
ATOM   1203 N  NH2 . ARG A 1 156 ? 152.953 -46.008 160.227 1.00 87.00  ?  167  ARG A NH2 1 
ATOM   1204 N  N   . THR A 1 157 ? 152.892 -55.351 160.279 1.00 41.67  ?  168  THR A N   1 
ATOM   1205 C  CA  . THR A 1 157 ? 152.137 -56.547 160.629 1.00 39.49  ?  168  THR A CA  1 
ATOM   1206 C  C   . THR A 1 157 ? 152.277 -56.855 162.116 1.00 42.07  ?  168  THR A C   1 
ATOM   1207 O  O   . THR A 1 157 ? 153.384 -56.857 162.663 1.00 44.73  ?  168  THR A O   1 
ATOM   1208 C  CB  . THR A 1 157 ? 152.615 -57.739 159.799 1.00 41.57  ?  168  THR A CB  1 
ATOM   1209 O  OG1 . THR A 1 157 ? 152.380 -57.484 158.408 1.00 44.42  ?  168  THR A OG1 1 
ATOM   1210 C  CG2 . THR A 1 157 ? 151.880 -59.009 160.207 1.00 34.53  ?  168  THR A CG2 1 
ATOM   1211 N  N   . ILE A 1 158 ? 151.146 -57.107 162.772 1.00 33.00  ?  169  ILE A N   1 
ATOM   1212 C  CA  . ILE A 1 158 ? 151.123 -57.532 164.167 1.00 31.39  ?  169  ILE A CA  1 
ATOM   1213 C  C   . ILE A 1 158 ? 150.783 -59.017 164.198 1.00 35.65  ?  169  ILE A C   1 
ATOM   1214 O  O   . ILE A 1 158 ? 149.609 -59.401 164.189 1.00 33.62  ?  169  ILE A O   1 
ATOM   1215 C  CB  . ILE A 1 158 ? 150.125 -56.704 164.992 1.00 32.56  ?  169  ILE A CB  1 
ATOM   1216 C  CG1 . ILE A 1 158 ? 150.405 -55.211 164.819 1.00 32.79  ?  169  ILE A CG1 1 
ATOM   1217 C  CG2 . ILE A 1 158 ? 150.191 -57.092 166.465 1.00 31.21  ?  169  ILE A CG2 1 
ATOM   1218 C  CD1 . ILE A 1 158 ? 149.174 -54.342 164.924 1.00 33.67  ?  169  ILE A CD1 1 
ATOM   1219 N  N   . SER A 1 159 ? 151.810 -59.863 164.220 1.00 48.18  ?  170  SER A N   1 
ATOM   1220 C  CA  . SER A 1 159 ? 151.614 -61.301 164.146 1.00 48.61  ?  170  SER A CA  1 
ATOM   1221 C  C   . SER A 1 159 ? 151.247 -61.870 165.515 1.00 51.84  ?  170  SER A C   1 
ATOM   1222 O  O   . SER A 1 159 ? 151.319 -61.194 166.545 1.00 51.66  ?  170  SER A O   1 
ATOM   1223 C  CB  . SER A 1 159 ? 152.871 -61.983 163.604 1.00 54.56  ?  170  SER A CB  1 
ATOM   1224 O  OG  . SER A 1 159 ? 153.997 -61.711 164.421 1.00 66.07  ?  170  SER A OG  1 
ATOM   1225 N  N   . SER A 1 160 ? 150.844 -63.141 165.514 1.00 49.43  ?  171  SER A N   1 
ATOM   1226 C  CA  . SER A 1 160 ? 150.510 -63.809 166.768 1.00 49.21  ?  171  SER A CA  1 
ATOM   1227 C  C   . SER A 1 160 ? 151.765 -64.140 167.566 1.00 55.37  ?  171  SER A C   1 
ATOM   1228 O  O   . SER A 1 160 ? 151.782 -63.995 168.795 1.00 55.92  ?  171  SER A O   1 
ATOM   1229 C  CB  . SER A 1 160 ? 149.701 -65.074 166.490 1.00 52.42  ?  171  SER A CB  1 
ATOM   1230 O  OG  . SER A 1 160 ? 149.405 -65.767 167.690 1.00 63.70  ?  171  SER A OG  1 
ATOM   1231 N  N   . ASP A 1 161 ? 152.824 -64.589 166.882 1.00 48.89  ?  172  ASP A N   1 
ATOM   1232 C  CA  . ASP A 1 161 ? 154.081 -64.896 167.559 1.00 48.19  ?  172  ASP A CA  1 
ATOM   1233 C  C   . ASP A 1 161 ? 154.685 -63.655 168.205 1.00 52.59  ?  172  ASP A C   1 
ATOM   1234 O  O   . ASP A 1 161 ? 155.329 -63.755 169.255 1.00 53.27  ?  172  ASP A O   1 
ATOM   1235 C  CB  . ASP A 1 161 ? 155.077 -65.519 166.576 1.00 49.60  ?  172  ASP A CB  1 
ATOM   1236 C  CG  . ASP A 1 161 ? 154.677 -66.920 166.139 1.00 55.62  ?  172  ASP A CG  1 
ATOM   1237 O  OD1 . ASP A 1 161 ? 153.966 -67.607 166.903 1.00 56.99  ?  172  ASP A OD1 1 
ATOM   1238 O  OD2 . ASP A 1 161 ? 155.083 -67.338 165.032 1.00 56.12  ?  172  ASP A OD2 1 
ATOM   1239 N  N   . ALA A 1 162 ? 154.482 -62.482 167.599 1.00 42.39  ?  173  ALA A N   1 
ATOM   1240 C  CA  . ALA A 1 162 ? 154.993 -61.244 168.177 1.00 41.66  ?  173  ALA A CA  1 
ATOM   1241 C  C   . ALA A 1 162 ? 154.217 -60.835 169.425 1.00 45.07  ?  173  ALA A C   1 
ATOM   1242 O  O   . ALA A 1 162 ? 154.800 -60.259 170.351 1.00 42.79  ?  173  ALA A O   1 
ATOM   1243 C  CB  . ALA A 1 162 ? 154.953 -60.126 167.135 1.00 42.08  ?  173  ALA A CB  1 
ATOM   1244 N  N   . VAL A 1 163 ? 152.914 -61.122 169.471 1.00 44.58  ?  174  VAL A N   1 
ATOM   1245 C  CA  . VAL A 1 163 ? 152.111 -60.773 170.641 1.00 44.17  ?  174  VAL A CA  1 
ATOM   1246 C  C   . VAL A 1 163 ? 152.371 -61.749 171.784 1.00 50.28  ?  174  VAL A C   1 
ATOM   1247 O  O   . VAL A 1 163 ? 152.602 -61.338 172.927 1.00 50.62  ?  174  VAL A O   1 
ATOM   1248 C  CB  . VAL A 1 163 ? 150.615 -60.716 170.271 1.00 46.33  ?  174  VAL A CB  1 
ATOM   1249 C  CG1 . VAL A 1 163 ? 149.760 -60.630 171.525 1.00 44.99  ?  174  VAL A CG1 1 
ATOM   1250 C  CG2 . VAL A 1 163 ? 150.339 -59.529 169.361 1.00 45.86  ?  174  VAL A CG2 1 
ATOM   1251 N  N   . LEU A 1 164 ? 152.347 -63.054 171.490 1.00 47.22  ?  175  LEU A N   1 
ATOM   1252 C  CA  . LEU A 1 164 ? 152.617 -64.083 172.489 1.00 47.74  ?  175  LEU A CA  1 
ATOM   1253 C  C   . LEU A 1 164 ? 154.041 -64.028 173.026 1.00 55.95  ?  175  LEU A C   1 
ATOM   1254 O  O   . LEU A 1 164 ? 154.322 -64.644 174.060 1.00 55.47  ?  175  LEU A O   1 
ATOM   1255 C  CB  . LEU A 1 164 ? 152.343 -65.467 171.897 1.00 47.29  ?  175  LEU A CB  1 
ATOM   1256 C  CG  . LEU A 1 164 ? 150.911 -65.701 171.413 1.00 50.85  ?  175  LEU A CG  1 
ATOM   1257 C  CD1 . LEU A 1 164 ? 150.801 -67.005 170.639 1.00 50.25  ?  175  LEU A CD1 1 
ATOM   1258 C  CD2 . LEU A 1 164 ? 149.949 -65.692 172.586 1.00 52.69  ?  175  LEU A CD2 1 
ATOM   1259 N  N   . GLN A 1 165 ? 154.939 -63.307 172.352 1.00 57.43  ?  176  GLN A N   1 
ATOM   1260 C  CA  . GLN A 1 165 ? 156.315 -63.183 172.818 1.00 60.04  ?  176  GLN A CA  1 
ATOM   1261 C  C   . GLN A 1 165 ? 156.422 -62.243 174.012 1.00 68.38  ?  176  GLN A C   1 
ATOM   1262 O  O   . GLN A 1 165 ? 157.270 -62.450 174.889 1.00 68.70  ?  176  GLN A O   1 
ATOM   1263 C  CB  . GLN A 1 165 ? 157.197 -62.692 171.670 1.00 62.02  ?  176  GLN A CB  1 
ATOM   1264 C  CG  . GLN A 1 165 ? 158.686 -62.860 171.880 1.00 81.95  ?  176  GLN A CG  1 
ATOM   1265 C  CD  . GLN A 1 165 ? 159.477 -62.480 170.644 1.00 102.71 ?  176  GLN A CD  1 
ATOM   1266 O  OE1 . GLN A 1 165 ? 159.540 -63.237 169.675 1.00 97.92  ?  176  GLN A OE1 1 
ATOM   1267 N  NE2 . GLN A 1 165 ? 160.075 -61.295 170.667 1.00 92.97  ?  176  GLN A NE2 1 
ATOM   1268 N  N   . ARG A 1 166 ? 155.576 -61.212 174.062 1.00 77.12  ?  177  ARG A N   1 
ATOM   1269 C  CA  . ARG A 1 166 ? 155.584 -60.239 175.150 1.00 78.22  ?  177  ARG A CA  1 
ATOM   1270 C  C   . ARG A 1 166 ? 154.898 -60.746 176.413 1.00 83.47  ?  177  ARG A C   1 
ATOM   1271 O  O   . ARG A 1 166 ? 154.967 -60.068 177.444 1.00 84.68  ?  177  ARG A O   1 
ATOM   1272 C  CB  . ARG A 1 166 ? 154.903 -58.937 174.706 1.00 77.46  ?  177  ARG A CB  1 
ATOM   1273 C  CG  . ARG A 1 166 ? 155.781 -57.949 173.939 1.00 86.57  ?  177  ARG A CG  1 
ATOM   1274 C  CD  . ARG A 1 166 ? 156.193 -58.475 172.572 1.00 97.02  ?  177  ARG A CD  1 
ATOM   1275 N  NE  . ARG A 1 166 ? 156.467 -57.395 171.627 1.00 97.87  ?  177  ARG A NE  1 
ATOM   1276 C  CZ  . ARG A 1 166 ? 156.995 -57.573 170.420 1.00 101.46 ?  177  ARG A CZ  1 
ATOM   1277 N  NH1 . ARG A 1 166 ? 157.207 -56.531 169.627 1.00 82.37  ?  177  ARG A NH1 1 
ATOM   1278 N  NH2 . ARG A 1 166 ? 157.318 -58.790 170.007 1.00 83.36  ?  177  ARG A NH2 1 
ATOM   1279 N  N   . LEU A 1 167 ? 154.249 -61.905 176.361 1.00 58.37  ?  178  LEU A N   1 
ATOM   1280 C  CA  . LEU A 1 167 ? 153.391 -62.402 177.426 1.00 57.16  ?  178  LEU A CA  1 
ATOM   1281 C  C   . LEU A 1 167 ? 154.056 -63.535 178.200 1.00 61.61  ?  178  LEU A C   1 
ATOM   1282 O  O   . LEU A 1 167 ? 154.994 -64.172 177.709 1.00 61.92  ?  178  LEU A O   1 
ATOM   1283 C  CB  . LEU A 1 167 ? 152.062 -62.903 176.842 1.00 55.92  ?  178  LEU A CB  1 
ATOM   1284 C  CG  . LEU A 1 167 ? 151.304 -61.951 175.916 1.00 59.45  ?  178  LEU A CG  1 
ATOM   1285 C  CD1 . LEU A 1 167 ? 150.301 -62.723 175.077 1.00 58.44  ?  178  LEU A CD1 1 
ATOM   1286 C  CD2 . LEU A 1 167 ? 150.608 -60.861 176.714 1.00 60.93  ?  178  LEU A CD2 1 
ATOM   1287 N  N   . PRO A 1 168 ? 153.597 -63.812 179.420 1.00 57.39  ?  179  PRO A N   1 
ATOM   1288 C  CA  . PRO A 1 168 ? 154.111 -64.971 180.162 1.00 57.55  ?  179  PRO A CA  1 
ATOM   1289 C  C   . PRO A 1 168 ? 153.751 -66.286 179.481 1.00 61.66  ?  179  PRO A C   1 
ATOM   1290 O  O   . PRO A 1 168 ? 152.895 -66.358 178.597 1.00 60.25  ?  179  PRO A O   1 
ATOM   1291 C  CB  . PRO A 1 168 ? 153.429 -64.847 181.528 1.00 58.93  ?  179  PRO A CB  1 
ATOM   1292 C  CG  . PRO A 1 168 ? 153.091 -63.396 181.650 1.00 63.19  ?  179  PRO A CG  1 
ATOM   1293 C  CD  . PRO A 1 168 ? 152.742 -62.956 180.262 1.00 58.56  ?  179  PRO A CD  1 
ATOM   1294 N  N   . GLU A 1 169 ? 154.430 -67.350 179.927 1.00 75.69  ?  180  GLU A N   1 
ATOM   1295 C  CA  . GLU A 1 169 ? 154.227 -68.687 179.373 1.00 75.49  ?  180  GLU A CA  1 
ATOM   1296 C  C   . GLU A 1 169 ? 152.821 -69.219 179.623 1.00 77.52  ?  180  GLU A C   1 
ATOM   1297 O  O   . GLU A 1 169 ? 152.350 -70.069 178.859 1.00 75.96  ?  180  GLU A O   1 
ATOM   1298 C  CB  . GLU A 1 169 ? 155.263 -69.655 179.959 1.00 77.59  ?  180  GLU A CB  1 
ATOM   1299 C  CG  . GLU A 1 169 ? 155.249 -71.070 179.375 1.00 89.52  ?  180  GLU A CG  1 
ATOM   1300 C  CD  . GLU A 1 169 ? 155.658 -71.114 177.913 1.00 119.25 ?  180  GLU A CD  1 
ATOM   1301 O  OE1 . GLU A 1 169 ? 154.929 -71.730 177.107 1.00 115.68 ?  180  GLU A OE1 1 
ATOM   1302 O  OE2 . GLU A 1 169 ? 156.706 -70.530 177.568 1.00 116.18 ?  180  GLU A OE2 1 
ATOM   1303 N  N   . GLU A 1 170 ? 152.139 -68.739 180.668 1.00 69.50  ?  181  GLU A N   1 
ATOM   1304 C  CA  . GLU A 1 170 ? 150.788 -69.214 180.954 1.00 68.07  ?  181  GLU A CA  1 
ATOM   1305 C  C   . GLU A 1 170 ? 149.812 -68.838 179.849 1.00 70.64  ?  181  GLU A C   1 
ATOM   1306 O  O   . GLU A 1 170 ? 148.797 -69.518 179.661 1.00 69.41  ?  181  GLU A O   1 
ATOM   1307 C  CB  . GLU A 1 170 ? 150.299 -68.660 182.295 1.00 69.21  ?  181  GLU A CB  1 
ATOM   1308 C  CG  . GLU A 1 170 ? 150.695 -69.484 183.514 1.00 81.63  ?  181  GLU A CG  1 
ATOM   1309 C  CD  . GLU A 1 170 ? 152.186 -69.450 183.798 1.00 104.70 ?  181  GLU A CD  1 
ATOM   1310 O  OE1 . GLU A 1 170 ? 152.851 -68.470 183.400 1.00 97.06  ?  181  GLU A OE1 1 
ATOM   1311 O  OE2 . GLU A 1 170 ? 152.693 -70.408 184.418 1.00 96.17  ?  181  GLU A OE2 1 
ATOM   1312 N  N   . ALA A 1 171 ? 150.096 -67.767 179.111 1.00 67.48  ?  182  ALA A N   1 
ATOM   1313 C  CA  . ALA A 1 171 ? 149.223 -67.276 178.052 1.00 66.31  ?  182  ALA A CA  1 
ATOM   1314 C  C   . ALA A 1 171 ? 149.863 -67.431 176.675 1.00 70.71  ?  182  ALA A C   1 
ATOM   1315 O  O   . ALA A 1 171 ? 149.759 -66.548 175.823 1.00 71.30  ?  182  ALA A O   1 
ATOM   1316 C  CB  . ALA A 1 171 ? 148.841 -65.820 178.304 1.00 66.83  ?  182  ALA A CB  1 
ATOM   1317 N  N   . ARG A 1 172 ? 150.533 -68.561 176.440 1.00 49.80  ?  183  ARG A N   1 
ATOM   1318 C  CA  . ARG A 1 172 ? 151.162 -68.841 175.155 1.00 49.32  ?  183  ARG A CA  1 
ATOM   1319 C  C   . ARG A 1 172 ? 150.673 -70.130 174.511 1.00 52.10  ?  183  ARG A C   1 
ATOM   1320 O  O   . ARG A 1 172 ? 151.149 -70.479 173.424 1.00 51.14  ?  183  ARG A O   1 
ATOM   1321 C  CB  . ARG A 1 172 ? 152.689 -68.904 175.306 1.00 50.03  ?  183  ARG A CB  1 
ATOM   1322 C  CG  . ARG A 1 172 ? 153.352 -67.565 175.577 1.00 61.37  ?  183  ARG A CG  1 
ATOM   1323 C  CD  . ARG A 1 172 ? 154.839 -67.743 175.837 1.00 70.00  ?  183  ARG A CD  1 
ATOM   1324 N  NE  . ARG A 1 172 ? 155.524 -66.467 176.016 1.00 78.20  ?  183  ARG A NE  1 
ATOM   1325 C  CZ  . ARG A 1 172 ? 156.790 -66.350 176.404 1.00 92.74  ?  183  ARG A CZ  1 
ATOM   1326 N  NH1 . ARG A 1 172 ? 157.509 -67.434 176.661 1.00 82.58  ?  183  ARG A NH1 1 
ATOM   1327 N  NH2 . ARG A 1 172 ? 157.336 -65.149 176.539 1.00 75.05  ?  183  ARG A NH2 1 
ATOM   1328 N  N   . HIS A 1 173 ? 149.741 -70.848 175.143 1.00 73.20  ?  184  HIS A N   1 
ATOM   1329 C  CA  . HIS A 1 173 ? 149.224 -72.112 174.617 1.00 73.09  ?  184  HIS A CA  1 
ATOM   1330 C  C   . HIS A 1 173 ? 148.309 -71.814 173.434 1.00 74.99  ?  184  HIS A C   1 
ATOM   1331 O  O   . HIS A 1 173 ? 147.078 -71.839 173.527 1.00 72.96  ?  184  HIS A O   1 
ATOM   1332 C  CB  . HIS A 1 173 ? 148.504 -72.891 175.709 1.00 74.23  ?  184  HIS A CB  1 
ATOM   1333 C  CG  . HIS A 1 173 ? 149.341 -73.128 176.927 1.00 78.99  ?  184  HIS A CG  1 
ATOM   1334 N  ND1 . HIS A 1 173 ? 149.256 -72.341 178.056 1.00 81.22  ?  184  HIS A ND1 1 
ATOM   1335 C  CD2 . HIS A 1 173 ? 150.293 -74.056 177.188 1.00 81.59  ?  184  HIS A CD2 1 
ATOM   1336 C  CE1 . HIS A 1 173 ? 150.112 -72.778 178.962 1.00 81.34  ?  184  HIS A CE1 1 
ATOM   1337 N  NE2 . HIS A 1 173 ? 150.755 -73.817 178.460 1.00 81.95  ?  184  HIS A NE2 1 
ATOM   1338 N  N   . ARG A 1 174 ? 148.938 -71.544 172.294 1.00 63.38  ?  185  ARG A N   1 
ATOM   1339 C  CA  . ARG A 1 174 ? 148.246 -71.072 171.106 1.00 61.81  ?  185  ARG A CA  1 
ATOM   1340 C  C   . ARG A 1 174 ? 147.681 -72.225 170.287 1.00 64.38  ?  185  ARG A C   1 
ATOM   1341 O  O   . ARG A 1 174 ? 148.186 -73.351 170.322 1.00 64.08  ?  185  ARG A O   1 
ATOM   1342 C  CB  . ARG A 1 174 ? 149.195 -70.249 170.232 1.00 60.76  ?  185  ARG A CB  1 
ATOM   1343 C  CG  . ARG A 1 174 ? 150.375 -71.035 169.672 1.00 68.91  ?  185  ARG A CG  1 
ATOM   1344 C  CD  . ARG A 1 174 ? 151.058 -70.255 168.563 1.00 72.29  ?  185  ARG A CD  1 
ATOM   1345 N  NE  . ARG A 1 174 ? 150.207 -70.137 167.382 1.00 73.73  ?  185  ARG A NE  1 
ATOM   1346 C  CZ  . ARG A 1 174 ? 150.298 -69.154 166.492 1.00 84.19  ?  185  ARG A CZ  1 
ATOM   1347 N  NH1 . ARG A 1 174 ? 151.198 -68.193 166.655 1.00 71.92  ?  185  ARG A NH1 1 
ATOM   1348 N  NH2 . ARG A 1 174 ? 149.484 -69.124 165.445 1.00 64.45  ?  185  ARG A NH2 1 
ATOM   1349 N  N   . ARG A 1 175 ? 146.621 -71.925 169.544 1.00 53.78  ?  186  ARG A N   1 
ATOM   1350 C  CA  . ARG A 1 175 ? 146.101 -72.836 168.540 1.00 52.14  ?  186  ARG A CA  1 
ATOM   1351 C  C   . ARG A 1 175 ? 146.867 -72.656 167.233 1.00 55.62  ?  186  ARG A C   1 
ATOM   1352 O  O   . ARG A 1 175 ? 147.591 -71.674 167.038 1.00 55.34  ?  186  ARG A O   1 
ATOM   1353 C  CB  . ARG A 1 175 ? 144.610 -72.589 168.311 1.00 49.56  ?  186  ARG A CB  1 
ATOM   1354 C  CG  . ARG A 1 175 ? 143.793 -72.521 169.586 1.00 50.01  ?  186  ARG A CG  1 
ATOM   1355 C  CD  . ARG A 1 175 ? 142.343 -72.187 169.292 1.00 52.12  ?  186  ARG A CD  1 
ATOM   1356 N  NE  . ARG A 1 175 ? 141.506 -72.314 170.480 1.00 55.36  ?  186  ARG A NE  1 
ATOM   1357 C  CZ  . ARG A 1 175 ? 140.192 -72.120 170.489 1.00 59.45  ?  186  ARG A CZ  1 
ATOM   1358 N  NH1 . ARG A 1 175 ? 139.563 -71.787 169.371 1.00 39.39  ?  186  ARG A NH1 1 
ATOM   1359 N  NH2 . ARG A 1 175 ? 139.508 -72.259 171.616 1.00 42.83  ?  186  ARG A NH2 1 
ATOM   1360 N  N   . VAL A 1 176 ? 146.707 -73.627 166.331 1.00 67.34  ?  187  VAL A N   1 
ATOM   1361 C  CA  . VAL A 1 176 ? 147.306 -73.498 165.006 1.00 67.68  ?  187  VAL A CA  1 
ATOM   1362 C  C   . VAL A 1 176 ? 146.756 -72.263 164.306 1.00 69.55  ?  187  VAL A C   1 
ATOM   1363 O  O   . VAL A 1 176 ? 147.502 -71.489 163.692 1.00 69.02  ?  187  VAL A O   1 
ATOM   1364 C  CB  . VAL A 1 176 ? 147.068 -74.777 164.182 1.00 71.60  ?  187  VAL A CB  1 
ATOM   1365 C  CG1 . VAL A 1 176 ? 147.770 -74.680 162.834 1.00 71.76  ?  187  VAL A CG1 1 
ATOM   1366 C  CG2 . VAL A 1 176 ? 147.544 -75.996 164.953 1.00 71.61  ?  187  VAL A CG2 1 
ATOM   1367 N  N   . PHE A 1 177 ? 145.445 -72.054 164.400 1.00 59.12  ?  188  PHE A N   1 
ATOM   1368 C  CA  . PHE A 1 177 ? 144.787 -70.844 163.922 1.00 57.60  ?  188  PHE A CA  1 
ATOM   1369 C  C   . PHE A 1 177 ? 144.270 -70.093 165.142 1.00 57.47  ?  188  PHE A C   1 
ATOM   1370 O  O   . PHE A 1 177 ? 143.275 -70.501 165.750 1.00 55.36  ?  188  PHE A O   1 
ATOM   1371 C  CB  . PHE A 1 177 ? 143.653 -71.179 162.956 1.00 58.54  ?  188  PHE A CB  1 
ATOM   1372 C  CG  . PHE A 1 177 ? 144.065 -72.077 161.826 1.00 60.19  ?  188  PHE A CG  1 
ATOM   1373 C  CD1 . PHE A 1 177 ? 144.755 -71.571 160.737 1.00 63.92  ?  188  PHE A CD1 1 
ATOM   1374 C  CD2 . PHE A 1 177 ? 143.758 -73.429 161.850 1.00 61.97  ?  188  PHE A CD2 1 
ATOM   1375 C  CE1 . PHE A 1 177 ? 145.136 -72.397 159.694 1.00 64.91  ?  188  PHE A CE1 1 
ATOM   1376 C  CE2 . PHE A 1 177 ? 144.134 -74.260 160.811 1.00 64.66  ?  188  PHE A CE2 1 
ATOM   1377 C  CZ  . PHE A 1 177 ? 144.824 -73.744 159.731 1.00 63.32  ?  188  PHE A CZ  1 
ATOM   1378 N  N   . GLU A 1 178 ? 144.952 -69.004 165.506 1.00 54.53  ?  189  GLU A N   1 
ATOM   1379 C  CA  . GLU A 1 178 ? 144.536 -68.227 166.669 1.00 52.96  ?  189  GLU A CA  1 
ATOM   1380 C  C   . GLU A 1 178 ? 143.188 -67.550 166.463 1.00 51.52  ?  189  GLU A C   1 
ATOM   1381 O  O   . GLU A 1 178 ? 142.523 -67.223 167.452 1.00 51.82  ?  189  GLU A O   1 
ATOM   1382 C  CB  . GLU A 1 178 ? 145.605 -67.191 167.020 1.00 55.20  ?  189  GLU A CB  1 
ATOM   1383 C  CG  . GLU A 1 178 ? 146.776 -67.770 167.795 1.00 61.76  ?  189  GLU A CG  1 
ATOM   1384 C  CD  . GLU A 1 178 ? 146.393 -68.168 169.209 1.00 60.26  ?  189  GLU A CD  1 
ATOM   1385 O  OE1 . GLU A 1 178 ? 146.636 -67.368 170.137 1.00 43.89  ?  189  GLU A OE1 1 
ATOM   1386 O  OE2 . GLU A 1 178 ? 145.837 -69.272 169.392 1.00 41.25  ?  189  GLU A OE2 1 
ATOM   1387 N  N   . MET A 1 179 ? 142.777 -67.337 165.210 1.00 42.94  ?  190  MET A N   1 
ATOM   1388 C  CA  . MET A 1 179 ? 141.441 -66.854 164.873 1.00 39.60  ?  190  MET A CA  1 
ATOM   1389 C  C   . MET A 1 179 ? 141.129 -65.518 165.537 1.00 37.30  ?  190  MET A C   1 
ATOM   1390 O  O   . MET A 1 179 ? 140.535 -65.480 166.620 1.00 35.13  ?  190  MET A O   1 
ATOM   1391 C  CB  . MET A 1 179 ? 140.388 -67.895 165.267 1.00 41.43  ?  190  MET A CB  1 
ATOM   1392 C  CG  . MET A 1 179 ? 139.008 -67.634 164.692 1.00 45.31  ?  190  MET A CG  1 
ATOM   1393 S  SD  . MET A 1 179 ? 138.966 -67.814 162.901 1.00 50.37  ?  190  MET A SD  1 
ATOM   1394 C  CE  . MET A 1 179 ? 137.240 -67.463 162.567 1.00 46.64  ?  190  MET A CE  1 
ATOM   1395 N  N   . VAL A 1 180 ? 141.518 -64.416 164.898 1.00 23.02  ?  191  VAL A N   1 
ATOM   1396 C  CA  . VAL A 1 180 ? 141.221 -63.093 165.434 1.00 21.77  ?  191  VAL A CA  1 
ATOM   1397 C  C   . VAL A 1 180 ? 139.710 -62.907 165.461 1.00 26.54  ?  191  VAL A C   1 
ATOM   1398 O  O   . VAL A 1 180 ? 139.063 -62.827 164.411 1.00 24.62  ?  191  VAL A O   1 
ATOM   1399 C  CB  . VAL A 1 180 ? 141.908 -61.984 164.616 1.00 23.84  ?  191  VAL A CB  1 
ATOM   1400 C  CG1 . VAL A 1 180 ? 141.468 -60.612 165.103 1.00 23.13  ?  191  VAL A CG1 1 
ATOM   1401 C  CG2 . VAL A 1 180 ? 143.421 -62.122 164.706 1.00 23.70  ?  191  VAL A CG2 1 
ATOM   1402 N  N   . GLU A 1 181 ? 139.134 -62.860 166.660 1.00 33.39  ?  192  GLU A N   1 
ATOM   1403 C  CA  . GLU A 1 181 ? 137.699 -62.665 166.801 1.00 32.60  ?  192  GLU A CA  1 
ATOM   1404 C  C   . GLU A 1 181 ? 137.318 -61.221 167.080 1.00 36.49  ?  192  GLU A C   1 
ATOM   1405 O  O   . GLU A 1 181 ? 136.182 -60.829 166.790 1.00 36.25  ?  192  GLU A O   1 
ATOM   1406 C  CB  . GLU A 1 181 ? 137.145 -63.560 167.918 1.00 33.12  ?  192  GLU A CB  1 
ATOM   1407 C  CG  . GLU A 1 181 ? 137.251 -65.055 167.640 1.00 39.54  ?  192  GLU A CG  1 
ATOM   1408 C  CD  . GLU A 1 181 ? 136.243 -65.547 166.614 1.00 45.55  ?  192  GLU A CD  1 
ATOM   1409 O  OE1 . GLU A 1 181 ? 135.449 -64.729 166.103 1.00 49.90  ?  192  GLU A OE1 1 
ATOM   1410 O  OE2 . GLU A 1 181 ? 136.241 -66.761 166.321 1.00 33.03  ?  192  GLU A OE2 1 
ATOM   1411 N  N   . ALA A 1 182 ? 138.234 -60.424 167.623 1.00 24.60  ?  193  ALA A N   1 
ATOM   1412 C  CA  . ALA A 1 182 ? 137.965 -59.027 167.919 1.00 23.91  ?  193  ALA A CA  1 
ATOM   1413 C  C   . ALA A 1 182 ? 139.193 -58.200 167.578 1.00 27.97  ?  193  ALA A C   1 
ATOM   1414 O  O   . ALA A 1 182 ? 140.325 -58.632 167.809 1.00 26.52  ?  193  ALA A O   1 
ATOM   1415 C  CB  . ALA A 1 182 ? 137.583 -58.827 169.390 1.00 23.92  ?  193  ALA A CB  1 
ATOM   1416 N  N   . LEU A 1 183 ? 138.958 -57.011 167.023 1.00 25.28  ?  194  LEU A N   1 
ATOM   1417 C  CA  . LEU A 1 183 ? 140.048 -56.118 166.637 1.00 26.24  ?  194  LEU A CA  1 
ATOM   1418 C  C   . LEU A 1 183 ? 139.478 -54.701 166.644 1.00 29.20  ?  194  LEU A C   1 
ATOM   1419 O  O   . LEU A 1 183 ? 138.786 -54.310 165.701 1.00 26.66  ?  194  LEU A O   1 
ATOM   1420 C  CB  . LEU A 1 183 ? 140.610 -56.491 165.276 1.00 26.77  ?  194  LEU A CB  1 
ATOM   1421 C  CG  . LEU A 1 183 ? 141.850 -55.725 164.813 1.00 31.88  ?  194  LEU A CG  1 
ATOM   1422 C  CD1 . LEU A 1 183 ? 143.060 -56.112 165.649 1.00 32.39  ?  194  LEU A CD1 1 
ATOM   1423 C  CD2 . LEU A 1 183 ? 142.105 -55.977 163.338 1.00 32.75  ?  194  LEU A CD2 1 
ATOM   1424 N  N   . GLN A 1 184 ? 139.769 -53.952 167.706 1.00 29.20  ?  195  GLN A N   1 
ATOM   1425 C  CA  . GLN A 1 184 ? 139.138 -52.660 167.930 1.00 29.57  ?  195  GLN A CA  1 
ATOM   1426 C  C   . GLN A 1 184 ? 140.185 -51.628 168.327 1.00 38.52  ?  195  GLN A C   1 
ATOM   1427 O  O   . GLN A 1 184 ? 141.308 -51.963 168.711 1.00 38.38  ?  195  GLN A O   1 
ATOM   1428 C  CB  . GLN A 1 184 ? 138.050 -52.755 169.007 1.00 29.54  ?  195  GLN A CB  1 
ATOM   1429 C  CG  . GLN A 1 184 ? 136.982 -53.788 168.697 1.00 33.06  ?  195  GLN A CG  1 
ATOM   1430 C  CD  . GLN A 1 184 ? 136.005 -53.988 169.833 1.00 36.31  ?  195  GLN A CD  1 
ATOM   1431 O  OE1 . GLN A 1 184 ? 135.833 -53.118 170.687 1.00 22.93  ?  195  GLN A OE1 1 
ATOM   1432 N  NE2 . GLN A 1 184 ? 135.355 -55.145 169.849 1.00 32.92  ?  195  GLN A NE2 1 
ATOM   1433 N  N   . GLU A 1 185 ? 139.793 -50.362 168.228 1.00 38.18  ?  196  GLU A N   1 
ATOM   1434 C  CA  . GLU A 1 185 ? 140.636 -49.229 168.577 1.00 39.87  ?  196  GLU A CA  1 
ATOM   1435 C  C   . GLU A 1 185 ? 140.260 -48.711 169.960 1.00 44.42  ?  196  GLU A C   1 
ATOM   1436 O  O   . GLU A 1 185 ? 139.105 -48.806 170.383 1.00 44.07  ?  196  GLU A O   1 
ATOM   1437 C  CB  . GLU A 1 185 ? 140.487 -48.113 167.540 1.00 41.81  ?  196  GLU A CB  1 
ATOM   1438 C  CG  . GLU A 1 185 ? 141.601 -47.081 167.544 1.00 53.17  ?  196  GLU A CG  1 
ATOM   1439 C  CD  . GLU A 1 185 ? 141.233 -45.824 166.777 1.00 63.85  ?  196  GLU A CD  1 
ATOM   1440 O  OE1 . GLU A 1 185 ? 141.286 -44.727 167.372 1.00 45.14  ?  196  GLU A OE1 1 
ATOM   1441 O  OE2 . GLU A 1 185 ? 140.882 -45.933 165.583 1.00 55.78  ?  196  GLU A OE2 1 
ATOM   1442 N  N   . HIS A 1 186 ? 141.245 -48.169 170.669 1.00 38.52  ?  197  HIS A N   1 
ATOM   1443 C  CA  . HIS A 1 186 ? 140.961 -47.568 171.964 1.00 37.85  ?  197  HIS A CA  1 
ATOM   1444 C  C   . HIS A 1 186 ? 140.065 -46.351 171.759 1.00 40.98  ?  197  HIS A C   1 
ATOM   1445 O  O   . HIS A 1 186 ? 140.403 -45.464 170.963 1.00 39.23  ?  197  HIS A O   1 
ATOM   1446 C  CB  . HIS A 1 186 ? 142.248 -47.169 172.684 1.00 39.35  ?  197  HIS A CB  1 
ATOM   1447 C  CG  . HIS A 1 186 ? 142.051 -46.813 174.127 1.00 42.58  ?  197  HIS A CG  1 
ATOM   1448 N  ND1 . HIS A 1 186 ? 141.266 -45.755 174.534 1.00 44.06  ?  197  HIS A ND1 1 
ATOM   1449 C  CD2 . HIS A 1 186 ? 142.546 -47.369 175.259 1.00 44.32  ?  197  HIS A CD2 1 
ATOM   1450 C  CE1 . HIS A 1 186 ? 141.279 -45.679 175.853 1.00 43.38  ?  197  HIS A CE1 1 
ATOM   1451 N  NE2 . HIS A 1 186 ? 142.049 -46.646 176.317 1.00 43.76  ?  197  HIS A NE2 1 
ATOM   1452 N  N   . PRO A 1 187 ? 138.920 -46.273 172.440 1.00 40.22  ?  198  PRO A N   1 
ATOM   1453 C  CA  . PRO A 1 187 ? 137.989 -45.161 172.186 1.00 41.19  ?  198  PRO A CA  1 
ATOM   1454 C  C   . PRO A 1 187 ? 138.554 -43.792 172.524 1.00 49.78  ?  198  PRO A C   1 
ATOM   1455 O  O   . PRO A 1 187 ? 137.988 -42.783 172.085 1.00 49.45  ?  198  PRO A O   1 
ATOM   1456 C  CB  . PRO A 1 187 ? 136.784 -45.504 173.074 1.00 41.65  ?  198  PRO A CB  1 
ATOM   1457 C  CG  . PRO A 1 187 ? 136.910 -46.966 173.355 1.00 45.00  ?  198  PRO A CG  1 
ATOM   1458 C  CD  . PRO A 1 187 ? 138.375 -47.248 173.397 1.00 41.17  ?  198  PRO A CD  1 
ATOM   1459 N  N   . ARG A 1 188 ? 139.652 -43.720 173.282 1.00 62.52  ?  199  ARG A N   1 
ATOM   1460 C  CA  . ARG A 1 188 ? 140.244 -42.448 173.680 1.00 63.17  ?  199  ARG A CA  1 
ATOM   1461 C  C   . ARG A 1 188 ? 141.754 -42.439 173.461 1.00 67.46  ?  199  ARG A C   1 
ATOM   1462 O  O   . ARG A 1 188 ? 142.476 -41.698 174.134 1.00 69.62  ?  199  ARG A O   1 
ATOM   1463 C  CB  . ARG A 1 188 ? 139.915 -42.128 175.140 1.00 62.93  ?  199  ARG A CB  1 
ATOM   1464 C  CG  . ARG A 1 188 ? 138.436 -41.897 175.409 1.00 69.86  ?  199  ARG A CG  1 
ATOM   1465 C  CD  . ARG A 1 188 ? 137.946 -40.635 174.719 1.00 84.48  ?  199  ARG A CD  1 
ATOM   1466 N  NE  . ARG A 1 188 ? 136.494 -40.622 174.568 1.00 96.54  ?  199  ARG A NE  1 
ATOM   1467 C  CZ  . ARG A 1 188 ? 135.652 -40.129 175.469 1.00 111.34 ?  199  ARG A CZ  1 
ATOM   1468 N  NH1 . ARG A 1 188 ? 136.114 -39.603 176.595 1.00 102.69 ?  199  ARG A NH1 1 
ATOM   1469 N  NH2 . ARG A 1 188 ? 134.346 -40.163 175.243 1.00 93.56  ?  199  ARG A NH2 1 
ATOM   1470 N  N   . ASP A 1 189 ? 142.250 -43.253 172.523 1.00 48.69  ?  200  ASP A N   1 
ATOM   1471 C  CA  . ASP A 1 189 ? 143.676 -43.294 172.209 1.00 48.36  ?  200  ASP A CA  1 
ATOM   1472 C  C   . ASP A 1 189 ? 143.908 -43.994 170.873 1.00 51.52  ?  200  ASP A C   1 
ATOM   1473 O  O   . ASP A 1 189 ? 143.857 -45.228 170.800 1.00 49.85  ?  200  ASP A O   1 
ATOM   1474 C  CB  . ASP A 1 189 ? 144.456 -44.000 173.322 1.00 49.92  ?  200  ASP A CB  1 
ATOM   1475 C  CG  . ASP A 1 189 ? 145.962 -43.800 173.206 1.00 54.00  ?  200  ASP A CG  1 
ATOM   1476 O  OD1 . ASP A 1 189 ? 146.418 -43.195 172.213 1.00 53.15  ?  200  ASP A OD1 1 
ATOM   1477 O  OD2 . ASP A 1 189 ? 146.692 -44.247 174.117 1.00 57.24  ?  200  ASP A OD2 1 
ATOM   1478 N  N   . PRO A 1 190 ? 144.177 -43.245 169.799 1.00 49.05  ?  201  PRO A N   1 
ATOM   1479 C  CA  . PRO A 1 190 ? 144.424 -43.874 168.491 1.00 48.32  ?  201  PRO A CA  1 
ATOM   1480 C  C   . PRO A 1 190 ? 145.707 -44.690 168.419 1.00 51.74  ?  201  PRO A C   1 
ATOM   1481 O  O   . PRO A 1 190 ? 145.969 -45.301 167.376 1.00 51.99  ?  201  PRO A O   1 
ATOM   1482 C  CB  . PRO A 1 190 ? 144.488 -42.673 167.533 1.00 50.50  ?  201  PRO A CB  1 
ATOM   1483 C  CG  . PRO A 1 190 ? 143.807 -41.553 168.263 1.00 54.94  ?  201  PRO A CG  1 
ATOM   1484 C  CD  . PRO A 1 190 ? 144.120 -41.777 169.705 1.00 50.98  ?  201  PRO A CD  1 
ATOM   1485 N  N   . ASN A 1 191 ? 146.518 -44.722 169.478 1.00 44.01  ?  202  ASN A N   1 
ATOM   1486 C  CA  . ASN A 1 191 ? 147.738 -45.520 169.489 1.00 43.82  ?  202  ASN A CA  1 
ATOM   1487 C  C   . ASN A 1 191 ? 147.522 -46.929 170.024 1.00 46.02  ?  202  ASN A C   1 
ATOM   1488 O  O   . ASN A 1 191 ? 148.354 -47.809 169.772 1.00 46.30  ?  202  ASN A O   1 
ATOM   1489 C  CB  . ASN A 1 191 ? 148.819 -44.824 170.325 1.00 44.58  ?  202  ASN A CB  1 
ATOM   1490 C  CG  . ASN A 1 191 ? 150.155 -45.547 170.279 1.00 53.75  ?  202  ASN A CG  1 
ATOM   1491 O  OD1 . ASN A 1 191 ? 150.633 -45.928 169.210 1.00 48.36  ?  202  ASN A OD1 1 
ATOM   1492 N  ND2 . ASN A 1 191 ? 150.756 -45.752 171.445 1.00 37.29  ?  202  ASN A ND2 1 
ATOM   1493 N  N   . GLN A 1 192 ? 146.432 -47.166 170.748 1.00 44.92  ?  203  GLN A N   1 
ATOM   1494 C  CA  . GLN A 1 192 ? 146.142 -48.468 171.330 1.00 43.47  ?  203  GLN A CA  1 
ATOM   1495 C  C   . GLN A 1 192 ? 145.058 -49.172 170.527 1.00 44.28  ?  203  GLN A C   1 
ATOM   1496 O  O   . GLN A 1 192 ? 144.055 -48.558 170.146 1.00 42.96  ?  203  GLN A O   1 
ATOM   1497 C  CB  . GLN A 1 192 ? 145.695 -48.333 172.787 1.00 44.26  ?  203  GLN A CB  1 
ATOM   1498 C  CG  . GLN A 1 192 ? 146.700 -47.653 173.696 1.00 45.00  ?  203  GLN A CG  1 
ATOM   1499 C  CD  . GLN A 1 192 ? 146.206 -47.564 175.123 1.00 57.22  ?  203  GLN A CD  1 
ATOM   1500 O  OE1 . GLN A 1 192 ? 145.779 -48.559 175.705 1.00 47.42  ?  203  GLN A OE1 1 
ATOM   1501 N  NE2 . GLN A 1 192 ? 146.247 -46.364 175.690 1.00 44.11  ?  203  GLN A NE2 1 
ATOM   1502 N  N   . ILE A 1 193 ? 145.266 -50.461 170.269 1.00 38.47  ?  204  ILE A N   1 
ATOM   1503 C  CA  . ILE A 1 193 ? 144.263 -51.305 169.637 1.00 36.47  ?  204  ILE A CA  1 
ATOM   1504 C  C   . ILE A 1 193 ? 144.113 -52.576 170.458 1.00 35.36  ?  204  ILE A C   1 
ATOM   1505 O  O   . ILE A 1 193 ? 145.057 -53.035 171.110 1.00 34.58  ?  204  ILE A O   1 
ATOM   1506 C  CB  . ILE A 1 193 ? 144.605 -51.650 168.167 1.00 39.83  ?  204  ILE A CB  1 
ATOM   1507 C  CG1 . ILE A 1 193 ? 145.894 -52.471 168.083 1.00 41.22  ?  204  ILE A CG1 1 
ATOM   1508 C  CG2 . ILE A 1 193 ? 144.702 -50.386 167.326 1.00 41.42  ?  204  ILE A CG2 1 
ATOM   1509 C  CD1 . ILE A 1 193 ? 146.096 -53.153 166.744 1.00 49.39  ?  204  ILE A CD1 1 
ATOM   1510 N  N   . LEU A 1 194 ? 142.912 -53.143 170.426 1.00 29.66  ?  205  LEU A N   1 
ATOM   1511 C  CA  . LEU A 1 194 ? 142.622 -54.398 171.102 1.00 28.04  ?  205  LEU A CA  1 
ATOM   1512 C  C   . LEU A 1 194 ? 142.619 -55.533 170.089 1.00 30.75  ?  205  LEU A C   1 
ATOM   1513 O  O   . LEU A 1 194 ? 142.132 -55.377 168.965 1.00 29.73  ?  205  LEU A O   1 
ATOM   1514 C  CB  . LEU A 1 194 ? 141.274 -54.328 171.825 1.00 26.54  ?  205  LEU A CB  1 
ATOM   1515 C  CG  . LEU A 1 194 ? 140.834 -55.530 172.663 1.00 29.78  ?  205  LEU A CG  1 
ATOM   1516 C  CD1 . LEU A 1 194 ? 140.045 -55.051 173.859 1.00 29.25  ?  205  LEU A CD1 1 
ATOM   1517 C  CD2 . LEU A 1 194 ? 139.998 -56.509 171.849 1.00 30.28  ?  205  LEU A CD2 1 
ATOM   1518 N  N   . ILE A 1 195 ? 143.172 -56.674 170.490 1.00 24.42  ?  206  ILE A N   1 
ATOM   1519 C  CA  . ILE A 1 195 ? 143.168 -57.883 169.676 1.00 24.39  ?  206  ILE A CA  1 
ATOM   1520 C  C   . ILE A 1 195 ? 142.641 -59.026 170.532 1.00 29.17  ?  206  ILE A C   1 
ATOM   1521 O  O   . ILE A 1 195 ? 143.157 -59.273 171.629 1.00 30.90  ?  206  ILE A O   1 
ATOM   1522 C  CB  . ILE A 1 195 ? 144.568 -58.219 169.127 1.00 28.39  ?  206  ILE A CB  1 
ATOM   1523 C  CG1 . ILE A 1 195 ? 145.243 -56.965 168.565 1.00 29.86  ?  206  ILE A CG1 1 
ATOM   1524 C  CG2 . ILE A 1 195 ? 144.470 -59.287 168.050 1.00 27.59  ?  206  ILE A CG2 1 
ATOM   1525 C  CD1 . ILE A 1 195 ? 146.663 -57.193 168.085 1.00 36.15  ?  206  ILE A CD1 1 
ATOM   1526 N  N   . GLY A 1 196 ? 141.614 -59.708 170.040 1.00 27.59  ?  207  GLY A N   1 
ATOM   1527 C  CA  . GLY A 1 196 ? 141.028 -60.841 170.740 1.00 26.17  ?  207  GLY A CA  1 
ATOM   1528 C  C   . GLY A 1 196 ? 141.103 -62.096 169.892 1.00 30.88  ?  207  GLY A C   1 
ATOM   1529 O  O   . GLY A 1 196 ? 140.842 -62.056 168.690 1.00 30.11  ?  207  GLY A O   1 
ATOM   1530 N  N   . TYR A 1 197 ? 141.460 -63.208 170.526 1.00 29.07  ?  208  TYR A N   1 
ATOM   1531 C  CA  . TYR A 1 197 ? 141.638 -64.478 169.838 1.00 29.18  ?  208  TYR A CA  1 
ATOM   1532 C  C   . TYR A 1 197 ? 140.605 -65.483 170.327 1.00 32.38  ?  208  TYR A C   1 
ATOM   1533 O  O   . TYR A 1 197 ? 140.054 -65.357 171.425 1.00 30.15  ?  208  TYR A O   1 
ATOM   1534 C  CB  . TYR A 1 197 ? 143.053 -65.029 170.049 1.00 31.17  ?  208  TYR A CB  1 
ATOM   1535 C  CG  . TYR A 1 197 ? 144.141 -64.042 169.691 1.00 34.96  ?  208  TYR A CG  1 
ATOM   1536 C  CD1 . TYR A 1 197 ? 144.529 -63.856 168.371 1.00 36.92  ?  208  TYR A CD1 1 
ATOM   1537 C  CD2 . TYR A 1 197 ? 144.772 -63.289 170.673 1.00 37.17  ?  208  TYR A CD2 1 
ATOM   1538 C  CE1 . TYR A 1 197 ? 145.518 -62.952 168.037 1.00 36.84  ?  208  TYR A CE1 1 
ATOM   1539 C  CE2 . TYR A 1 197 ? 145.764 -62.382 170.349 1.00 39.69  ?  208  TYR A CE2 1 
ATOM   1540 C  CZ  . TYR A 1 197 ? 146.133 -62.218 169.030 1.00 46.31  ?  208  TYR A CZ  1 
ATOM   1541 O  OH  . TYR A 1 197 ? 147.119 -61.315 168.704 1.00 45.70  ?  208  TYR A OH  1 
ATOM   1542 N  N   . SER A 1 198 ? 140.365 -66.499 169.493 1.00 35.67  ?  209  SER A N   1 
ATOM   1543 C  CA  . SER A 1 198 ? 139.293 -67.454 169.760 1.00 34.84  ?  209  SER A CA  1 
ATOM   1544 C  C   . SER A 1 198 ? 139.491 -68.170 171.093 1.00 40.75  ?  209  SER A C   1 
ATOM   1545 O  O   . SER A 1 198 ? 138.538 -68.334 171.863 1.00 40.38  ?  209  SER A O   1 
ATOM   1546 C  CB  . SER A 1 198 ? 139.196 -68.464 168.615 1.00 35.58  ?  209  SER A CB  1 
ATOM   1547 O  OG  . SER A 1 198 ? 138.132 -69.376 168.824 1.00 38.50  ?  209  SER A OG  1 
ATOM   1548 N  N   . ARG A 1 199 ? 140.726 -68.583 171.396 1.00 34.32  ?  210  ARG A N   1 
ATOM   1549 C  CA  . ARG A 1 199 ? 140.968 -69.357 172.612 1.00 34.24  ?  210  ARG A CA  1 
ATOM   1550 C  C   . ARG A 1 199 ? 140.618 -68.573 173.872 1.00 40.05  ?  210  ARG A C   1 
ATOM   1551 O  O   . ARG A 1 199 ? 140.302 -69.173 174.907 1.00 40.84  ?  210  ARG A O   1 
ATOM   1552 C  CB  . ARG A 1 199 ? 142.424 -69.825 172.665 1.00 33.35  ?  210  ARG A CB  1 
ATOM   1553 C  CG  . ARG A 1 199 ? 143.453 -68.709 172.649 1.00 39.05  ?  210  ARG A CG  1 
ATOM   1554 C  CD  . ARG A 1 199 ? 144.859 -69.284 172.687 1.00 41.80  ?  210  ARG A CD  1 
ATOM   1555 N  NE  . ARG A 1 199 ? 145.509 -69.041 173.970 1.00 61.36  ?  210  ARG A NE  1 
ATOM   1556 C  CZ  . ARG A 1 199 ? 146.548 -68.229 174.137 1.00 70.77  ?  210  ARG A CZ  1 
ATOM   1557 N  NH1 . ARG A 1 199 ? 147.067 -67.591 173.096 1.00 49.41  ?  210  ARG A NH1 1 
ATOM   1558 N  NH2 . ARG A 1 199 ? 147.075 -68.065 175.342 1.00 56.66  ?  210  ARG A NH2 1 
ATOM   1559 N  N   . GLY A 1 200 ? 140.665 -67.245 173.813 1.00 35.75  ?  211  GLY A N   1 
ATOM   1560 C  CA  . GLY A 1 200 ? 140.253 -66.442 174.946 1.00 33.79  ?  211  GLY A CA  1 
ATOM   1561 C  C   . GLY A 1 200 ? 141.226 -65.345 175.322 1.00 35.85  ?  211  GLY A C   1 
ATOM   1562 O  O   . GLY A 1 200 ? 140.939 -64.531 176.204 1.00 35.78  ?  211  GLY A O   1 
ATOM   1563 N  N   . LEU A 1 201 ? 142.382 -65.310 174.665 1.00 26.07  ?  212  LEU A N   1 
ATOM   1564 C  CA  . LEU A 1 201 ? 143.370 -64.279 174.951 1.00 26.49  ?  212  LEU A CA  1 
ATOM   1565 C  C   . LEU A 1 201 ? 142.936 -62.948 174.351 1.00 31.50  ?  212  LEU A C   1 
ATOM   1566 O  O   . LEU A 1 201 ? 142.603 -62.865 173.165 1.00 31.54  ?  212  LEU A O   1 
ATOM   1567 C  CB  . LEU A 1 201 ? 144.739 -64.680 174.402 1.00 26.73  ?  212  LEU A CB  1 
ATOM   1568 C  CG  . LEU A 1 201 ? 145.846 -63.636 174.584 1.00 30.40  ?  212  LEU A CG  1 
ATOM   1569 C  CD1 . LEU A 1 201 ? 146.302 -63.561 176.034 1.00 29.79  ?  212  LEU A CD1 1 
ATOM   1570 C  CD2 . LEU A 1 201 ? 147.022 -63.910 173.662 1.00 32.38  ?  212  LEU A CD2 1 
ATOM   1571 N  N   . VAL A 1 202 ? 142.937 -61.906 175.176 1.00 28.57  ?  213  VAL A N   1 
ATOM   1572 C  CA  . VAL A 1 202 ? 142.693 -60.539 174.736 1.00 28.55  ?  213  VAL A CA  1 
ATOM   1573 C  C   . VAL A 1 202 ? 143.889 -59.699 175.157 1.00 35.19  ?  213  VAL A C   1 
ATOM   1574 O  O   . VAL A 1 202 ? 144.414 -59.874 176.260 1.00 35.37  ?  213  VAL A O   1 
ATOM   1575 C  CB  . VAL A 1 202 ? 141.382 -59.974 175.324 1.00 30.89  ?  213  VAL A CB  1 
ATOM   1576 C  CG1 . VAL A 1 202 ? 141.128 -58.563 174.817 1.00 30.61  ?  213  VAL A CG1 1 
ATOM   1577 C  CG2 . VAL A 1 202 ? 140.213 -60.885 174.985 1.00 29.60  ?  213  VAL A CG2 1 
ATOM   1578 N  N   . VAL A 1 203 ? 144.342 -58.810 174.267 1.00 30.06  ?  214  VAL A N   1 
ATOM   1579 C  CA  . VAL A 1 203 ? 145.472 -57.932 174.545 1.00 30.59  ?  214  VAL A CA  1 
ATOM   1580 C  C   . VAL A 1 203 ? 145.141 -56.517 174.086 1.00 35.51  ?  214  VAL A C   1 
ATOM   1581 O  O   . VAL A 1 203 ? 144.306 -56.301 173.204 1.00 35.26  ?  214  VAL A O   1 
ATOM   1582 C  CB  . VAL A 1 203 ? 146.781 -58.409 173.867 1.00 34.43  ?  214  VAL A CB  1 
ATOM   1583 C  CG1 . VAL A 1 203 ? 147.099 -59.851 174.243 1.00 33.66  ?  214  VAL A CG1 1 
ATOM   1584 C  CG2 . VAL A 1 203 ? 146.701 -58.245 172.355 1.00 34.21  ?  214  VAL A CG2 1 
ATOM   1585 N  N   . ILE A 1 204 ? 145.808 -55.547 174.707 1.00 32.60  ?  215  ILE A N   1 
ATOM   1586 C  CA  . ILE A 1 204 ? 145.776 -54.152 174.280 1.00 32.21  ?  215  ILE A CA  1 
ATOM   1587 C  C   . ILE A 1 204 ? 147.190 -53.785 173.845 1.00 38.66  ?  215  ILE A C   1 
ATOM   1588 O  O   . ILE A 1 204 ? 148.127 -53.830 174.653 1.00 38.25  ?  215  ILE A O   1 
ATOM   1589 C  CB  . ILE A 1 204 ? 145.265 -53.219 175.389 1.00 34.91  ?  215  ILE A CB  1 
ATOM   1590 C  CG1 . ILE A 1 204 ? 143.820 -53.574 175.754 1.00 33.58  ?  215  ILE A CG1 1 
ATOM   1591 C  CG2 . ILE A 1 204 ? 145.354 -51.767 174.946 1.00 36.39  ?  215  ILE A CG2 1 
ATOM   1592 C  CD1 . ILE A 1 204 ? 143.158 -52.595 176.712 1.00 26.62  ?  215  ILE A CD1 1 
ATOM   1593 N  N   . TRP A 1 205 ? 147.339 -53.426 172.575 1.00 38.75  ?  216  TRP A N   1 
ATOM   1594 C  CA  . TRP A 1 205 ? 148.630 -53.381 171.901 1.00 40.62  ?  216  TRP A CA  1 
ATOM   1595 C  C   . TRP A 1 205 ? 149.037 -51.939 171.625 1.00 48.03  ?  216  TRP A C   1 
ATOM   1596 O  O   . TRP A 1 205 ? 148.279 -51.183 171.007 1.00 46.64  ?  216  TRP A O   1 
ATOM   1597 C  CB  . TRP A 1 205 ? 148.558 -54.185 170.601 1.00 39.46  ?  216  TRP A CB  1 
ATOM   1598 C  CG  . TRP A 1 205 ? 149.766 -54.114 169.728 1.00 41.30  ?  216  TRP A CG  1 
ATOM   1599 C  CD1 . TRP A 1 205 ? 150.006 -53.210 168.735 1.00 44.38  ?  216  TRP A CD1 1 
ATOM   1600 C  CD2 . TRP A 1 205 ? 150.890 -55.001 169.744 1.00 41.95  ?  216  TRP A CD2 1 
ATOM   1601 N  NE1 . TRP A 1 205 ? 151.215 -53.470 168.140 1.00 44.71  ?  216  TRP A NE1 1 
ATOM   1602 C  CE2 . TRP A 1 205 ? 151.779 -54.565 168.741 1.00 46.39  ?  216  TRP A CE2 1 
ATOM   1603 C  CE3 . TRP A 1 205 ? 151.235 -56.117 170.513 1.00 43.23  ?  216  TRP A CE3 1 
ATOM   1604 C  CZ2 . TRP A 1 205 ? 152.989 -55.205 168.487 1.00 45.98  ?  216  TRP A CZ2 1 
ATOM   1605 C  CZ3 . TRP A 1 205 ? 152.439 -56.750 170.260 1.00 45.25  ?  216  TRP A CZ3 1 
ATOM   1606 C  CH2 . TRP A 1 205 ? 153.301 -56.293 169.255 1.00 46.39  ?  216  TRP A CH2 1 
ATOM   1607 N  N   . ASP A 1 206 ? 150.230 -51.563 172.088 1.00 57.72  ?  217  ASP A N   1 
ATOM   1608 C  CA  . ASP A 1 206 ? 150.812 -50.255 171.794 1.00 58.89  ?  217  ASP A CA  1 
ATOM   1609 C  C   . ASP A 1 206 ? 151.355 -50.291 170.371 1.00 63.73  ?  217  ASP A C   1 
ATOM   1610 O  O   . ASP A 1 206 ? 152.357 -50.961 170.100 1.00 64.58  ?  217  ASP A O   1 
ATOM   1611 C  CB  . ASP A 1 206 ? 151.907 -49.922 172.806 1.00 62.01  ?  217  ASP A CB  1 
ATOM   1612 C  CG  . ASP A 1 206 ? 152.359 -48.467 172.740 1.00 75.51  ?  217  ASP A CG  1 
ATOM   1613 O  OD1 . ASP A 1 206 ? 152.476 -47.913 171.628 1.00 77.70  ?  217  ASP A OD1 1 
ATOM   1614 O  OD2 . ASP A 1 206 ? 152.606 -47.877 173.815 1.00 82.83  ?  217  ASP A OD2 1 
ATOM   1615 N  N   . LEU A 1 207 ? 150.691 -49.573 169.461 1.00 49.02  ?  218  LEU A N   1 
ATOM   1616 C  CA  . LEU A 1 207 ? 151.053 -49.640 168.047 1.00 48.99  ?  218  LEU A CA  1 
ATOM   1617 C  C   . LEU A 1 207 ? 152.459 -49.101 167.802 1.00 56.22  ?  218  LEU A C   1 
ATOM   1618 O  O   . LEU A 1 207 ? 153.267 -49.737 167.115 1.00 56.14  ?  218  LEU A O   1 
ATOM   1619 C  CB  . LEU A 1 207 ? 150.029 -48.873 167.207 1.00 47.66  ?  218  LEU A CB  1 
ATOM   1620 C  CG  . LEU A 1 207 ? 148.697 -49.575 166.941 1.00 50.05  ?  218  LEU A CG  1 
ATOM   1621 C  CD1 . LEU A 1 207 ? 147.727 -48.639 166.236 1.00 50.09  ?  218  LEU A CD1 1 
ATOM   1622 C  CD2 . LEU A 1 207 ? 148.924 -50.831 166.117 1.00 49.52  ?  218  LEU A CD2 1 
ATOM   1623 N  N   . GLN A 1 208 ? 152.770 -47.927 168.358 1.00 63.97  ?  219  GLN A N   1 
ATOM   1624 C  CA  . GLN A 1 208 ? 154.074 -47.319 168.106 1.00 65.84  ?  219  GLN A CA  1 
ATOM   1625 C  C   . GLN A 1 208 ? 155.184 -48.049 168.853 1.00 70.64  ?  219  GLN A C   1 
ATOM   1626 O  O   . GLN A 1 208 ? 156.265 -48.277 168.298 1.00 71.99  ?  219  GLN A O   1 
ATOM   1627 C  CB  . GLN A 1 208 ? 154.051 -45.840 168.490 1.00 67.89  ?  219  GLN A CB  1 
ATOM   1628 C  CG  . GLN A 1 208 ? 155.290 -45.076 168.050 1.00 91.03  ?  219  GLN A CG  1 
ATOM   1629 C  CD  . GLN A 1 208 ? 155.167 -43.582 168.272 1.00 117.26 ?  219  GLN A CD  1 
ATOM   1630 O  OE1 . GLN A 1 208 ? 154.704 -43.134 169.320 1.00 112.33 ?  219  GLN A OE1 1 
ATOM   1631 N  NE2 . GLN A 1 208 ? 155.577 -42.802 167.279 1.00 112.78 ?  219  GLN A NE2 1 
ATOM   1632 N  N   . GLY A 1 209 ? 154.937 -48.423 170.108 1.00 48.94  ?  220  GLY A N   1 
ATOM   1633 C  CA  . GLY A 1 209 ? 155.940 -49.111 170.900 1.00 48.55  ?  220  GLY A CA  1 
ATOM   1634 C  C   . GLY A 1 209 ? 156.083 -50.592 170.625 1.00 51.25  ?  220  GLY A C   1 
ATOM   1635 O  O   . GLY A 1 209 ? 157.057 -51.196 171.083 1.00 50.38  ?  220  GLY A O   1 
ATOM   1636 N  N   . SER A 1 210 ? 155.136 -51.185 169.894 1.00 55.74  ?  221  SER A N   1 
ATOM   1637 C  CA  . SER A 1 210 ? 155.162 -52.606 169.543 1.00 55.36  ?  221  SER A CA  1 
ATOM   1638 C  C   . SER A 1 210 ? 155.289 -53.482 170.788 1.00 59.97  ?  221  SER A C   1 
ATOM   1639 O  O   . SER A 1 210 ? 156.191 -54.315 170.908 1.00 60.69  ?  221  SER A O   1 
ATOM   1640 C  CB  . SER A 1 210 ? 156.287 -52.903 168.547 1.00 59.22  ?  221  SER A CB  1 
ATOM   1641 O  OG  . SER A 1 210 ? 156.129 -52.151 167.358 1.00 70.92  ?  221  SER A OG  1 
ATOM   1642 N  N   . ARG A 1 211 ? 154.364 -53.290 171.726 1.00 55.18  ?  222  ARG A N   1 
ATOM   1643 C  CA  . ARG A 1 211 ? 154.401 -54.025 172.981 1.00 53.96  ?  222  ARG A CA  1 
ATOM   1644 C  C   . ARG A 1 211 ? 152.996 -54.138 173.553 1.00 53.33  ?  222  ARG A C   1 
ATOM   1645 O  O   . ARG A 1 211 ? 152.126 -53.309 173.275 1.00 52.05  ?  222  ARG A O   1 
ATOM   1646 C  CB  . ARG A 1 211 ? 155.340 -53.356 173.994 1.00 56.28  ?  222  ARG A CB  1 
ATOM   1647 C  CG  . ARG A 1 211 ? 155.056 -51.882 174.238 1.00 64.45  ?  222  ARG A CG  1 
ATOM   1648 C  CD  . ARG A 1 211 ? 156.149 -51.252 175.086 1.00 74.77  ?  222  ARG A CD  1 
ATOM   1649 N  NE  . ARG A 1 211 ? 155.938 -49.820 175.274 1.00 89.03  ?  222  ARG A NE  1 
ATOM   1650 C  CZ  . ARG A 1 211 ? 155.305 -49.288 176.314 1.00 104.20 ?  222  ARG A CZ  1 
ATOM   1651 N  NH1 . ARG A 1 211 ? 154.821 -50.070 177.269 1.00 88.81  ?  222  ARG A NH1 1 
ATOM   1652 N  NH2 . ARG A 1 211 ? 155.160 -47.973 176.402 1.00 90.47  ?  222  ARG A NH2 1 
ATOM   1653 N  N   . VAL A 1 212 ? 152.789 -55.178 174.355 1.00 46.80  ?  223  VAL A N   1 
ATOM   1654 C  CA  . VAL A 1 212 ? 151.505 -55.412 175.005 1.00 44.61  ?  223  VAL A CA  1 
ATOM   1655 C  C   . VAL A 1 212 ? 151.445 -54.595 176.288 1.00 47.78  ?  223  VAL A C   1 
ATOM   1656 O  O   . VAL A 1 212 ? 152.371 -54.631 177.107 1.00 48.66  ?  223  VAL A O   1 
ATOM   1657 C  CB  . VAL A 1 212 ? 151.305 -56.910 175.285 1.00 47.08  ?  223  VAL A CB  1 
ATOM   1658 C  CG1 . VAL A 1 212 ? 150.003 -57.144 176.037 1.00 45.86  ?  223  VAL A CG1 1 
ATOM   1659 C  CG2 . VAL A 1 212 ? 151.326 -57.696 173.983 1.00 46.43  ?  223  VAL A CG2 1 
ATOM   1660 N  N   . LEU A 1 213 ? 150.355 -53.846 176.460 1.00 47.42  ?  224  LEU A N   1 
ATOM   1661 C  CA  . LEU A 1 213 ? 150.153 -53.016 177.641 1.00 46.15  ?  224  LEU A CA  1 
ATOM   1662 C  C   . LEU A 1 213 ? 149.221 -53.646 178.665 1.00 48.32  ?  224  LEU A C   1 
ATOM   1663 O  O   . LEU A 1 213 ? 149.211 -53.213 179.822 1.00 47.96  ?  224  LEU A O   1 
ATOM   1664 C  CB  . LEU A 1 213 ? 149.578 -51.653 177.236 1.00 45.20  ?  224  LEU A CB  1 
ATOM   1665 C  CG  . LEU A 1 213 ? 150.244 -50.915 176.076 1.00 49.09  ?  224  LEU A CG  1 
ATOM   1666 C  CD1 . LEU A 1 213 ? 149.333 -49.810 175.566 1.00 49.22  ?  224  LEU A CD1 1 
ATOM   1667 C  CD2 . LEU A 1 213 ? 151.580 -50.347 176.509 1.00 49.87  ?  224  LEU A CD2 1 
ATOM   1668 N  N   . TYR A 1 214 ? 148.457 -54.660 178.269 1.00 41.87  ?  225  TYR A N   1 
ATOM   1669 C  CA  . TYR A 1 214 ? 147.331 -55.172 179.036 1.00 39.36  ?  225  TYR A CA  1 
ATOM   1670 C  C   . TYR A 1 214 ? 146.882 -56.468 178.380 1.00 40.45  ?  225  TYR A C   1 
ATOM   1671 O  O   . TYR A 1 214 ? 146.981 -56.616 177.158 1.00 38.48  ?  225  TYR A O   1 
ATOM   1672 C  CB  . TYR A 1 214 ? 146.195 -54.138 179.068 1.00 40.34  ?  225  TYR A CB  1 
ATOM   1673 C  CG  . TYR A 1 214 ? 144.857 -54.600 179.611 1.00 41.10  ?  225  TYR A CG  1 
ATOM   1674 C  CD1 . TYR A 1 214 ? 143.962 -55.301 178.811 1.00 42.61  ?  225  TYR A CD1 1 
ATOM   1675 C  CD2 . TYR A 1 214 ? 144.468 -54.286 180.904 1.00 41.93  ?  225  TYR A CD2 1 
ATOM   1676 C  CE1 . TYR A 1 214 ? 142.736 -55.707 179.294 1.00 42.91  ?  225  TYR A CE1 1 
ATOM   1677 C  CE2 . TYR A 1 214 ? 143.242 -54.684 181.395 1.00 42.30  ?  225  TYR A CE2 1 
ATOM   1678 C  CZ  . TYR A 1 214 ? 142.380 -55.396 180.586 1.00 47.86  ?  225  TYR A CZ  1 
ATOM   1679 O  OH  . TYR A 1 214 ? 141.156 -55.798 181.065 1.00 47.58  ?  225  TYR A OH  1 
ATOM   1680 N  N   . HIS A 1 215 ? 146.395 -57.403 179.194 1.00 40.83  ?  226  HIS A N   1 
ATOM   1681 C  CA  . HIS A 1 215 ? 145.939 -58.672 178.644 1.00 40.69  ?  226  HIS A CA  1 
ATOM   1682 C  C   . HIS A 1 215 ? 145.172 -59.450 179.701 1.00 43.94  ?  226  HIS A C   1 
ATOM   1683 O  O   . HIS A 1 215 ? 145.276 -59.176 180.899 1.00 43.92  ?  226  HIS A O   1 
ATOM   1684 C  CB  . HIS A 1 215 ? 147.108 -59.516 178.126 1.00 42.35  ?  226  HIS A CB  1 
ATOM   1685 C  CG  . HIS A 1 215 ? 147.790 -60.315 179.190 1.00 46.32  ?  226  HIS A CG  1 
ATOM   1686 N  ND1 . HIS A 1 215 ? 147.496 -61.640 179.427 1.00 47.82  ?  226  HIS A ND1 1 
ATOM   1687 C  CD2 . HIS A 1 215 ? 148.748 -59.976 180.085 1.00 48.63  ?  226  HIS A CD2 1 
ATOM   1688 C  CE1 . HIS A 1 215 ? 148.247 -62.086 180.418 1.00 47.37  ?  226  HIS A CE1 1 
ATOM   1689 N  NE2 . HIS A 1 215 ? 149.015 -61.095 180.835 1.00 48.40  ?  226  HIS A NE2 1 
ATOM   1690 N  N   . PHE A 1 216 ? 144.397 -60.426 179.231 1.00 38.35  ?  227  PHE A N   1 
ATOM   1691 C  CA  . PHE A 1 216 ? 143.787 -61.433 180.089 1.00 37.48  ?  227  PHE A CA  1 
ATOM   1692 C  C   . PHE A 1 216 ? 143.459 -62.655 179.243 1.00 40.14  ?  227  PHE A C   1 
ATOM   1693 O  O   . PHE A 1 216 ? 143.416 -62.590 178.012 1.00 38.44  ?  227  PHE A O   1 
ATOM   1694 C  CB  . PHE A 1 216 ? 142.533 -60.908 180.809 1.00 38.58  ?  227  PHE A CB  1 
ATOM   1695 C  CG  . PHE A 1 216 ? 141.427 -60.458 179.887 1.00 39.70  ?  227  PHE A CG  1 
ATOM   1696 C  CD1 . PHE A 1 216 ? 140.549 -61.375 179.325 1.00 40.88  ?  227  PHE A CD1 1 
ATOM   1697 C  CD2 . PHE A 1 216 ? 141.243 -59.112 179.615 1.00 41.65  ?  227  PHE A CD2 1 
ATOM   1698 C  CE1 . PHE A 1 216 ? 139.529 -60.958 178.491 1.00 41.72  ?  227  PHE A CE1 1 
ATOM   1699 C  CE2 . PHE A 1 216 ? 140.223 -58.689 178.784 1.00 43.64  ?  227  PHE A CE2 1 
ATOM   1700 C  CZ  . PHE A 1 216 ? 139.365 -59.613 178.222 1.00 41.37  ?  227  PHE A CZ  1 
ATOM   1701 N  N   . LEU A 1 217 ? 143.226 -63.771 179.926 1.00 45.47  ?  228  LEU A N   1 
ATOM   1702 C  CA  . LEU A 1 217 ? 142.897 -65.044 179.291 1.00 45.40  ?  228  LEU A CA  1 
ATOM   1703 C  C   . LEU A 1 217 ? 141.554 -65.497 179.855 1.00 48.98  ?  228  LEU A C   1 
ATOM   1704 O  O   . LEU A 1 217 ? 141.489 -66.016 180.973 1.00 49.79  ?  228  LEU A O   1 
ATOM   1705 C  CB  . LEU A 1 217 ? 144.001 -66.074 179.541 1.00 46.28  ?  228  LEU A CB  1 
ATOM   1706 C  CG  . LEU A 1 217 ? 144.024 -67.405 178.776 1.00 52.00  ?  228  LEU A CG  1 
ATOM   1707 C  CD1 . LEU A 1 217 ? 143.046 -68.425 179.353 1.00 50.87  ?  228  LEU A CD1 1 
ATOM   1708 C  CD2 . LEU A 1 217 ? 143.760 -67.183 177.294 1.00 57.62  ?  228  LEU A CD2 1 
ATOM   1709 N  N   . SER A 1 218 ? 140.482 -65.295 179.090 1.00 28.63  ?  229  SER A N   1 
ATOM   1710 C  CA  . SER A 1 218 ? 139.165 -65.717 179.540 1.00 28.15  ?  229  SER A CA  1 
ATOM   1711 C  C   . SER A 1 218 ? 139.073 -67.242 179.564 1.00 33.34  ?  229  SER A C   1 
ATOM   1712 O  O   . SER A 1 218 ? 139.784 -67.949 178.845 1.00 32.43  ?  229  SER A O   1 
ATOM   1713 C  CB  . SER A 1 218 ? 138.075 -65.133 178.644 1.00 30.65  ?  229  SER A CB  1 
ATOM   1714 O  OG  . SER A 1 218 ? 138.221 -65.559 177.303 1.00 36.83  ?  229  SER A OG  1 
ATOM   1715 N  N   . SER A 1 219 ? 138.175 -67.746 180.414 1.00 35.25  ?  230  SER A N   1 
ATOM   1716 C  CA  . SER A 1 219 ? 138.036 -69.189 180.591 1.00 35.43  ?  230  SER A CA  1 
ATOM   1717 C  C   . SER A 1 219 ? 137.260 -69.838 179.453 1.00 37.60  ?  230  SER A C   1 
ATOM   1718 O  O   . SER A 1 219 ? 137.556 -70.979 179.081 1.00 37.67  ?  230  SER A O   1 
ATOM   1719 C  CB  . SER A 1 219 ? 137.361 -69.494 181.927 1.00 40.95  ?  230  SER A CB  1 
ATOM   1720 O  OG  . SER A 1 219 ? 136.116 -68.827 182.039 1.00 54.38  ?  230  SER A OG  1 
ATOM   1721 N  N   . GLN A 1 220 ? 136.277 -69.145 178.892 1.00 40.58  ?  231  GLN A N   1 
ATOM   1722 C  CA  . GLN A 1 220 ? 135.485 -69.667 177.789 1.00 38.40  ?  231  GLN A CA  1 
ATOM   1723 C  C   . GLN A 1 220 ? 135.993 -69.116 176.460 1.00 39.19  ?  231  GLN A C   1 
ATOM   1724 O  O   . GLN A 1 220 ? 136.659 -68.079 176.401 1.00 36.96  ?  231  GLN A O   1 
ATOM   1725 C  CB  . GLN A 1 220 ? 134.004 -69.319 177.969 1.00 39.12  ?  231  GLN A CB  1 
ATOM   1726 C  CG  . GLN A 1 220 ? 133.453 -69.611 179.360 1.00 36.27  ?  231  GLN A CG  1 
ATOM   1727 C  CD  . GLN A 1 220 ? 133.348 -71.095 179.654 1.00 40.11  ?  231  GLN A CD  1 
ATOM   1728 O  OE1 . GLN A 1 220 ? 133.097 -71.900 178.758 1.00 32.20  ?  231  GLN A OE1 1 
ATOM   1729 N  NE2 . GLN A 1 220 ? 133.543 -71.464 180.916 1.00 50.29  ?  231  GLN A NE2 1 
ATOM   1730 N  N   . GLN A 1 221 ? 135.669 -69.836 175.387 1.00 30.65  ?  232  GLN A N   1 
ATOM   1731 C  CA  . GLN A 1 221 ? 136.044 -69.408 174.046 1.00 30.07  ?  232  GLN A CA  1 
ATOM   1732 C  C   . GLN A 1 221 ? 135.435 -68.044 173.740 1.00 30.93  ?  232  GLN A C   1 
ATOM   1733 O  O   . GLN A 1 221 ? 134.298 -67.760 174.119 1.00 28.53  ?  232  GLN A O   1 
ATOM   1734 C  CB  . GLN A 1 221 ? 135.579 -70.447 173.023 1.00 31.26  ?  232  GLN A CB  1 
ATOM   1735 C  CG  . GLN A 1 221 ? 136.118 -70.251 171.620 1.00 44.12  ?  232  GLN A CG  1 
ATOM   1736 C  CD  . GLN A 1 221 ? 135.860 -71.451 170.731 1.00 62.22  ?  232  GLN A CD  1 
ATOM   1737 O  OE1 . GLN A 1 221 ? 136.782 -72.003 170.132 1.00 58.92  ?  232  GLN A OE1 1 
ATOM   1738 N  NE2 . GLN A 1 221 ? 134.601 -71.861 170.642 1.00 52.98  ?  232  GLN A NE2 1 
ATOM   1739 N  N   . LEU A 1 222 ? 136.196 -67.194 173.054 1.00 32.62  ?  233  LEU A N   1 
ATOM   1740 C  CA  . LEU A 1 222 ? 135.798 -65.809 172.832 1.00 32.24  ?  233  LEU A CA  1 
ATOM   1741 C  C   . LEU A 1 222 ? 135.026 -65.666 171.525 1.00 33.45  ?  233  LEU A C   1 
ATOM   1742 O  O   . LEU A 1 222 ? 135.439 -66.198 170.488 1.00 31.51  ?  233  LEU A O   1 
ATOM   1743 C  CB  . LEU A 1 222 ? 137.020 -64.891 172.819 1.00 32.55  ?  233  LEU A CB  1 
ATOM   1744 C  CG  . LEU A 1 222 ? 136.729 -63.401 172.611 1.00 36.06  ?  233  LEU A CG  1 
ATOM   1745 C  CD1 . LEU A 1 222 ? 135.993 -62.822 173.809 1.00 35.30  ?  233  LEU A CD1 1 
ATOM   1746 C  CD2 . LEU A 1 222 ? 138.009 -62.629 172.337 1.00 35.81  ?  233  LEU A CD2 1 
ATOM   1747 N  N   . GLU A 1 223 ? 133.910 -64.940 171.580 1.00 29.43  ?  234  GLU A N   1 
ATOM   1748 C  CA  . GLU A 1 223 ? 133.097 -64.626 170.409 1.00 28.79  ?  234  GLU A CA  1 
ATOM   1749 C  C   . GLU A 1 223 ? 133.218 -63.178 169.965 1.00 33.27  ?  234  GLU A C   1 
ATOM   1750 O  O   . GLU A 1 223 ? 133.349 -62.919 168.765 1.00 32.82  ?  234  GLU A O   1 
ATOM   1751 C  CB  . GLU A 1 223 ? 131.621 -64.943 170.680 1.00 29.57  ?  234  GLU A CB  1 
ATOM   1752 C  CG  . GLU A 1 223 ? 131.290 -66.428 170.760 1.00 36.51  ?  234  GLU A CG  1 
ATOM   1753 C  CD  . GLU A 1 223 ? 131.127 -67.075 169.396 1.00 44.03  ?  234  GLU A CD  1 
ATOM   1754 O  OE1 . GLU A 1 223 ? 130.980 -66.342 168.394 1.00 42.19  ?  234  GLU A OE1 1 
ATOM   1755 O  OE2 . GLU A 1 223 ? 131.142 -68.322 169.329 1.00 27.16  ?  234  GLU A OE2 1 
ATOM   1756 N  N   . ASN A 1 224 ? 133.185 -62.225 170.896 1.00 23.14  ?  235  ASN A N   1 
ATOM   1757 C  CA  . ASN A 1 224 ? 133.227 -60.813 170.535 1.00 22.56  ?  235  ASN A CA  1 
ATOM   1758 C  C   . ASN A 1 224 ? 133.589 -59.989 171.764 1.00 26.77  ?  235  ASN A C   1 
ATOM   1759 O  O   . ASN A 1 224 ? 133.683 -60.503 172.881 1.00 26.32  ?  235  ASN A O   1 
ATOM   1760 C  CB  . ASN A 1 224 ? 131.894 -60.350 169.943 1.00 21.01  ?  235  ASN A CB  1 
ATOM   1761 C  CG  . ASN A 1 224 ? 132.069 -59.564 168.668 1.00 28.77  ?  235  ASN A CG  1 
ATOM   1762 O  OD1 . ASN A 1 224 ? 132.958 -58.721 168.566 1.00 18.92  ?  235  ASN A OD1 1 
ATOM   1763 N  ND2 . ASN A 1 224 ? 131.229 -59.845 167.678 1.00 22.25  ?  235  ASN A ND2 1 
ATOM   1764 N  N   . ILE A 1 225 ? 133.777 -58.688 171.535 1.00 27.39  ?  236  ILE A N   1 
ATOM   1765 C  CA  . ILE A 1 225 ? 134.249 -57.753 172.549 1.00 28.11  ?  236  ILE A CA  1 
ATOM   1766 C  C   . ILE A 1 225 ? 133.548 -56.421 172.322 1.00 30.09  ?  236  ILE A C   1 
ATOM   1767 O  O   . ILE A 1 225 ? 133.236 -56.054 171.187 1.00 29.39  ?  236  ILE A O   1 
ATOM   1768 C  CB  . ILE A 1 225 ? 135.791 -57.597 172.485 1.00 31.46  ?  236  ILE A CB  1 
ATOM   1769 C  CG1 . ILE A 1 225 ? 136.494 -58.860 172.995 1.00 32.17  ?  236  ILE A CG1 1 
ATOM   1770 C  CG2 . ILE A 1 225 ? 136.272 -56.364 173.250 1.00 32.49  ?  236  ILE A CG2 1 
ATOM   1771 C  CD1 . ILE A 1 225 ? 136.686 -58.896 174.489 1.00 36.41  ?  236  ILE A CD1 1 
ATOM   1772 N  N   . TRP A 1 226 ? 133.281 -55.697 173.410 1.00 25.20  ?  237  TRP A N   1 
ATOM   1773 C  CA  . TRP A 1 226 ? 132.834 -54.312 173.311 1.00 25.49  ?  237  TRP A CA  1 
ATOM   1774 C  C   . TRP A 1 226 ? 133.636 -53.442 174.268 1.00 30.96  ?  237  TRP A C   1 
ATOM   1775 O  O   . TRP A 1 226 ? 133.854 -53.819 175.424 1.00 29.40  ?  237  TRP A O   1 
ATOM   1776 C  CB  . TRP A 1 226 ? 131.341 -54.166 173.600 1.00 24.27  ?  237  TRP A CB  1 
ATOM   1777 C  CG  . TRP A 1 226 ? 130.831 -52.846 173.119 1.00 25.34  ?  237  TRP A CG  1 
ATOM   1778 C  CD1 . TRP A 1 226 ? 130.634 -51.717 173.861 1.00 28.74  ?  237  TRP A CD1 1 
ATOM   1779 C  CD2 . TRP A 1 226 ? 130.493 -52.505 171.771 1.00 24.75  ?  237  TRP A CD2 1 
ATOM   1780 N  NE1 . TRP A 1 226 ? 130.177 -50.701 173.061 1.00 28.61  ?  237  TRP A NE1 1 
ATOM   1781 C  CE2 . TRP A 1 226 ? 130.081 -51.159 171.773 1.00 29.49  ?  237  TRP A CE2 1 
ATOM   1782 C  CE3 . TRP A 1 226 ? 130.487 -53.211 170.565 1.00 25.12  ?  237  TRP A CE3 1 
ATOM   1783 C  CZ2 . TRP A 1 226 ? 129.669 -50.504 170.615 1.00 28.37  ?  237  TRP A CZ2 1 
ATOM   1784 C  CZ3 . TRP A 1 226 ? 130.079 -52.562 169.419 1.00 26.12  ?  237  TRP A CZ3 1 
ATOM   1785 C  CH2 . TRP A 1 226 ? 129.675 -51.221 169.451 1.00 27.02  ?  237  TRP A CH2 1 
ATOM   1786 N  N   . TRP A 1 227 ? 134.058 -52.276 173.786 1.00 27.93  ?  238  TRP A N   1 
ATOM   1787 C  CA  . TRP A 1 227 ? 134.940 -51.378 174.524 1.00 29.14  ?  238  TRP A CA  1 
ATOM   1788 C  C   . TRP A 1 227 ? 134.141 -50.147 174.932 1.00 35.70  ?  238  TRP A C   1 
ATOM   1789 O  O   . TRP A 1 227 ? 133.689 -49.382 174.075 1.00 35.98  ?  238  TRP A O   1 
ATOM   1790 C  CB  . TRP A 1 227 ? 136.151 -50.990 173.677 1.00 27.89  ?  238  TRP A CB  1 
ATOM   1791 C  CG  . TRP A 1 227 ? 137.380 -50.658 174.481 1.00 29.91  ?  238  TRP A CG  1 
ATOM   1792 C  CD1 . TRP A 1 227 ? 137.427 -50.256 175.786 1.00 33.35  ?  238  TRP A CD1 1 
ATOM   1793 C  CD2 . TRP A 1 227 ? 138.740 -50.723 174.033 1.00 29.91  ?  238  TRP A CD2 1 
ATOM   1794 N  NE1 . TRP A 1 227 ? 138.731 -50.060 176.174 1.00 33.37  ?  238  TRP A NE1 1 
ATOM   1795 C  CE2 . TRP A 1 227 ? 139.556 -50.339 175.116 1.00 34.40  ?  238  TRP A CE2 1 
ATOM   1796 C  CE3 . TRP A 1 227 ? 139.345 -51.064 172.820 1.00 30.85  ?  238  TRP A CE3 1 
ATOM   1797 C  CZ2 . TRP A 1 227 ? 140.946 -50.288 175.021 1.00 33.73  ?  238  TRP A CZ2 1 
ATOM   1798 C  CZ3 . TRP A 1 227 ? 140.725 -51.013 172.728 1.00 32.50  ?  238  TRP A CZ3 1 
ATOM   1799 C  CH2 . TRP A 1 227 ? 141.510 -50.628 173.822 1.00 33.52  ?  238  TRP A CH2 1 
ATOM   1800 N  N   . GLN A 1 228 ? 133.976 -49.960 176.240 1.00 38.41  ?  239  GLN A N   1 
ATOM   1801 C  CA  . GLN A 1 228 ? 133.209 -48.836 176.764 1.00 38.90  ?  239  GLN A CA  1 
ATOM   1802 C  C   . GLN A 1 228 ? 133.787 -47.517 176.260 1.00 44.08  ?  239  GLN A C   1 
ATOM   1803 O  O   . GLN A 1 228 ? 134.956 -47.435 175.871 1.00 42.39  ?  239  GLN A O   1 
ATOM   1804 C  CB  . GLN A 1 228 ? 133.198 -48.880 178.294 1.00 40.69  ?  239  GLN A CB  1 
ATOM   1805 C  CG  . GLN A 1 228 ? 132.170 -47.991 178.985 1.00 39.91  ?  239  GLN A CG  1 
ATOM   1806 C  CD  . GLN A 1 228 ? 132.187 -48.177 180.491 1.00 49.60  ?  239  GLN A CD  1 
ATOM   1807 O  OE1 . GLN A 1 228 ? 131.193 -48.588 181.091 1.00 43.55  ?  239  GLN A OE1 1 
ATOM   1808 N  NE2 . GLN A 1 228 ? 133.327 -47.888 181.108 1.00 44.75  ?  239  GLN A NE2 1 
ATOM   1809 N  N   . ARG A 1 229 ? 132.942 -46.480 176.264 1.00 44.20  ?  240  ARG A N   1 
ATOM   1810 C  CA  . ARG A 1 229 ? 133.306 -45.178 175.708 1.00 45.44  ?  240  ARG A CA  1 
ATOM   1811 C  C   . ARG A 1 229 ? 134.608 -44.648 176.295 1.00 51.18  ?  240  ARG A C   1 
ATOM   1812 O  O   . ARG A 1 229 ? 135.508 -44.230 175.560 1.00 52.32  ?  240  ARG A O   1 
ATOM   1813 C  CB  . ARG A 1 229 ? 132.176 -44.181 175.957 1.00 49.17  ?  240  ARG A CB  1 
ATOM   1814 C  CG  . ARG A 1 229 ? 130.942 -44.386 175.110 1.00 60.20  ?  240  ARG A CG  1 
ATOM   1815 C  CD  . ARG A 1 229 ? 130.138 -43.099 175.046 1.00 66.09  ?  240  ARG A CD  1 
ATOM   1816 N  NE  . ARG A 1 229 ? 130.917 -42.012 174.459 1.00 67.72  ?  240  ARG A NE  1 
ATOM   1817 C  CZ  . ARG A 1 229 ? 130.985 -41.763 173.156 1.00 74.74  ?  240  ARG A CZ  1 
ATOM   1818 N  NH1 . ARG A 1 229 ? 130.319 -42.525 172.299 1.00 51.80  ?  240  ARG A NH1 1 
ATOM   1819 N  NH2 . ARG A 1 229 ? 131.720 -40.754 172.708 1.00 70.42  ?  240  ARG A NH2 1 
ATOM   1820 N  N   . ASP A 1 230 ? 134.715 -44.631 177.621 1.00 45.46  ?  241  ASP A N   1 
ATOM   1821 C  CA  . ASP A 1 230 ? 135.900 -44.093 178.274 1.00 44.81  ?  241  ASP A CA  1 
ATOM   1822 C  C   . ASP A 1 230 ? 137.093 -45.036 178.209 1.00 46.49  ?  241  ASP A C   1 
ATOM   1823 O  O   . ASP A 1 230 ? 138.166 -44.684 178.709 1.00 47.07  ?  241  ASP A O   1 
ATOM   1824 C  CB  . ASP A 1 230 ? 135.584 -43.741 179.734 1.00 47.46  ?  241  ASP A CB  1 
ATOM   1825 C  CG  . ASP A 1 230 ? 134.950 -44.892 180.499 1.00 59.43  ?  241  ASP A CG  1 
ATOM   1826 O  OD1 . ASP A 1 230 ? 135.011 -46.047 180.025 1.00 61.61  ?  241  ASP A OD1 1 
ATOM   1827 O  OD2 . ASP A 1 230 ? 134.381 -44.634 181.582 1.00 61.14  ?  241  ASP A OD2 1 
ATOM   1828 N  N   . GLY A 1 231 ? 136.934 -46.212 177.604 1.00 38.40  ?  242  GLY A N   1 
ATOM   1829 C  CA  . GLY A 1 231 ? 138.006 -47.175 177.490 1.00 36.86  ?  242  GLY A CA  1 
ATOM   1830 C  C   . GLY A 1 231 ? 138.374 -47.883 178.772 1.00 37.67  ?  242  GLY A C   1 
ATOM   1831 O  O   . GLY A 1 231 ? 139.339 -48.657 178.774 1.00 36.07  ?  242  GLY A O   1 
ATOM   1832 N  N   . ARG A 1 232 ? 137.637 -47.657 179.857 1.00 36.55  ?  243  ARG A N   1 
ATOM   1833 C  CA  . ARG A 1 232 ? 137.984 -48.203 181.160 1.00 36.32  ?  243  ARG A CA  1 
ATOM   1834 C  C   . ARG A 1 232 ? 137.198 -49.460 181.511 1.00 40.38  ?  243  ARG A C   1 
ATOM   1835 O  O   . ARG A 1 232 ? 137.306 -49.947 182.641 1.00 41.13  ?  243  ARG A O   1 
ATOM   1836 C  CB  . ARG A 1 232 ? 137.781 -47.138 182.243 1.00 33.68  ?  243  ARG A CB  1 
ATOM   1837 C  CG  . ARG A 1 232 ? 138.816 -46.027 182.201 1.00 43.71  ?  243  ARG A CG  1 
ATOM   1838 C  CD  . ARG A 1 232 ? 138.603 -45.015 183.312 1.00 60.85  ?  243  ARG A CD  1 
ATOM   1839 N  NE  . ARG A 1 232 ? 138.572 -45.638 184.633 1.00 72.03  ?  243  ARG A NE  1 
ATOM   1840 C  CZ  . ARG A 1 232 ? 139.654 -45.953 185.338 1.00 81.64  ?  243  ARG A CZ  1 
ATOM   1841 N  NH1 . ARG A 1 232 ? 140.863 -45.713 184.847 1.00 67.78  ?  243  ARG A NH1 1 
ATOM   1842 N  NH2 . ARG A 1 232 ? 139.528 -46.513 186.533 1.00 63.13  ?  243  ARG A NH2 1 
ATOM   1843 N  N   . LEU A 1 233 ? 136.421 -50.002 180.576 1.00 29.21  ?  244  LEU A N   1 
ATOM   1844 C  CA  . LEU A 1 233 ? 135.709 -51.249 180.815 1.00 27.88  ?  244  LEU A CA  1 
ATOM   1845 C  C   . LEU A 1 233 ? 135.597 -52.022 179.510 1.00 28.32  ?  244  LEU A C   1 
ATOM   1846 O  O   . LEU A 1 233 ? 135.369 -51.435 178.449 1.00 25.11  ?  244  LEU A O   1 
ATOM   1847 C  CB  . LEU A 1 233 ? 134.312 -51.009 181.402 1.00 28.03  ?  244  LEU A CB  1 
ATOM   1848 C  CG  . LEU A 1 233 ? 133.556 -52.273 181.828 1.00 32.05  ?  244  LEU A CG  1 
ATOM   1849 C  CD1 . LEU A 1 233 ? 134.112 -52.826 183.131 1.00 32.70  ?  244  LEU A CD1 1 
ATOM   1850 C  CD2 . LEU A 1 233 ? 132.056 -52.029 181.936 1.00 33.39  ?  244  LEU A CD2 1 
ATOM   1851 N  N   . LEU A 1 234 ? 135.760 -53.338 179.600 1.00 34.68  ?  245  LEU A N   1 
ATOM   1852 C  CA  . LEU A 1 234 ? 135.606 -54.235 178.466 1.00 34.33  ?  245  LEU A CA  1 
ATOM   1853 C  C   . LEU A 1 234 ? 134.524 -55.259 178.771 1.00 36.73  ?  245  LEU A C   1 
ATOM   1854 O  O   . LEU A 1 234 ? 134.395 -55.719 179.910 1.00 34.74  ?  245  LEU A O   1 
ATOM   1855 C  CB  . LEU A 1 234 ? 136.921 -54.949 178.142 1.00 34.34  ?  245  LEU A CB  1 
ATOM   1856 C  CG  . LEU A 1 234 ? 137.983 -54.103 177.442 1.00 37.99  ?  245  LEU A CG  1 
ATOM   1857 C  CD1 . LEU A 1 234 ? 139.304 -54.849 177.391 1.00 37.91  ?  245  LEU A CD1 1 
ATOM   1858 C  CD2 . LEU A 1 234 ? 137.521 -53.727 176.045 1.00 38.20  ?  245  LEU A CD2 1 
ATOM   1859 N  N   . VAL A 1 235 ? 133.743 -55.607 177.754 1.00 27.02  ?  246  VAL A N   1 
ATOM   1860 C  CA  . VAL A 1 235 ? 132.725 -56.646 177.863 1.00 25.95  ?  246  VAL A CA  1 
ATOM   1861 C  C   . VAL A 1 235 ? 133.004 -57.685 176.787 1.00 28.23  ?  246  VAL A C   1 
ATOM   1862 O  O   . VAL A 1 235 ? 133.065 -57.352 175.597 1.00 29.06  ?  246  VAL A O   1 
ATOM   1863 C  CB  . VAL A 1 235 ? 131.302 -56.081 177.727 1.00 29.15  ?  246  VAL A CB  1 
ATOM   1864 C  CG1 . VAL A 1 235 ? 130.281 -57.203 177.828 1.00 28.88  ?  246  VAL A CG1 1 
ATOM   1865 C  CG2 . VAL A 1 235 ? 131.042 -55.031 178.796 1.00 29.10  ?  246  VAL A CG2 1 
ATOM   1866 N  N   . SER A 1 236 ? 133.179 -58.934 177.205 1.00 30.16  ?  247  SER A N   1 
ATOM   1867 C  CA  . SER A 1 236 ? 133.409 -60.050 176.300 1.00 28.51  ?  247  SER A CA  1 
ATOM   1868 C  C   . SER A 1 236 ? 132.217 -60.994 176.338 1.00 31.19  ?  247  SER A C   1 
ATOM   1869 O  O   . SER A 1 236 ? 131.627 -61.213 177.399 1.00 29.93  ?  247  SER A O   1 
ATOM   1870 C  CB  . SER A 1 236 ? 134.681 -60.813 176.684 1.00 28.94  ?  247  SER A CB  1 
ATOM   1871 O  OG  . SER A 1 236 ? 134.544 -61.412 177.961 1.00 31.35  ?  247  SER A OG  1 
ATOM   1872 N  N   . CYS A 1 237 ? 131.858 -61.542 175.178 1.00 27.27  ?  248  CYS A N   1 
ATOM   1873 C  CA  . CYS A 1 237 ? 130.844 -62.582 175.089 1.00 26.50  ?  248  CYS A CA  1 
ATOM   1874 C  C   . CYS A 1 237 ? 131.479 -63.847 174.525 1.00 29.96  ?  248  CYS A C   1 
ATOM   1875 O  O   . CYS A 1 237 ? 132.486 -63.792 173.812 1.00 26.61  ?  248  CYS A O   1 
ATOM   1876 C  CB  . CYS A 1 237 ? 129.650 -62.143 174.234 1.00 25.82  ?  248  CYS A CB  1 
ATOM   1877 S  SG  . CYS A 1 237 ? 130.043 -61.634 172.558 1.00 28.81  ?  248  CYS A SG  1 
ATOM   1878 N  N   . HIS A 1 238 ? 130.885 -64.994 174.855 1.00 21.22  ?  249  HIS A N   1 
ATOM   1879 C  CA  . HIS A 1 238 ? 131.589 -66.260 174.727 1.00 20.83  ?  249  HIS A CA  1 
ATOM   1880 C  C   . HIS A 1 238 ? 130.693 -67.336 174.127 1.00 28.35  ?  249  HIS A C   1 
ATOM   1881 O  O   . HIS A 1 238 ? 129.481 -67.163 173.972 1.00 28.67  ?  249  HIS A O   1 
ATOM   1882 C  CB  . HIS A 1 238 ? 132.143 -66.697 176.088 1.00 21.77  ?  249  HIS A CB  1 
ATOM   1883 C  CG  . HIS A 1 238 ? 133.053 -65.684 176.707 1.00 24.71  ?  249  HIS A CG  1 
ATOM   1884 N  ND1 . HIS A 1 238 ? 134.426 -65.764 176.620 1.00 26.09  ?  249  HIS A ND1 1 
ATOM   1885 C  CD2 . HIS A 1 238 ? 132.785 -64.548 177.394 1.00 26.30  ?  249  HIS A CD2 1 
ATOM   1886 C  CE1 . HIS A 1 238 ? 134.965 -64.730 177.240 1.00 25.59  ?  249  HIS A CE1 1 
ATOM   1887 N  NE2 . HIS A 1 238 ? 133.991 -63.976 177.718 1.00 26.23  ?  249  HIS A NE2 1 
ATOM   1888 N  N   . SER A 1 239 ? 131.321 -68.472 173.801 1.00 30.99  ?  250  SER A N   1 
ATOM   1889 C  CA  . SER A 1 239 ? 130.670 -69.536 173.045 1.00 30.80  ?  250  SER A CA  1 
ATOM   1890 C  C   . SER A 1 239 ? 129.702 -70.366 173.877 1.00 35.63  ?  250  SER A C   1 
ATOM   1891 O  O   . SER A 1 239 ? 128.844 -71.045 173.302 1.00 33.65  ?  250  SER A O   1 
ATOM   1892 C  CB  . SER A 1 239 ? 131.724 -70.456 172.422 1.00 33.31  ?  250  SER A CB  1 
ATOM   1893 O  OG  . SER A 1 239 ? 132.582 -69.736 171.556 1.00 38.73  ?  250  SER A OG  1 
ATOM   1894 N  N   . ASP A 1 240 ? 129.820 -70.343 175.203 1.00 35.43  ?  251  ASP A N   1 
ATOM   1895 C  CA  . ASP A 1 240 ? 128.897 -71.071 176.064 1.00 35.24  ?  251  ASP A CA  1 
ATOM   1896 C  C   . ASP A 1 240 ? 127.651 -70.265 176.402 1.00 37.14  ?  251  ASP A C   1 
ATOM   1897 O  O   . ASP A 1 240 ? 126.809 -70.744 177.170 1.00 37.69  ?  251  ASP A O   1 
ATOM   1898 C  CB  . ASP A 1 240 ? 129.602 -71.508 177.355 1.00 37.41  ?  251  ASP A CB  1 
ATOM   1899 C  CG  . ASP A 1 240 ? 129.907 -70.346 178.285 1.00 50.01  ?  251  ASP A CG  1 
ATOM   1900 O  OD1 . ASP A 1 240 ? 130.120 -69.217 177.793 1.00 49.10  ?  251  ASP A OD1 1 
ATOM   1901 O  OD2 . ASP A 1 240 ? 129.936 -70.566 179.516 1.00 59.25  ?  251  ASP A OD2 1 
ATOM   1902 N  N   . GLY A 1 241 ? 127.515 -69.064 175.847 1.00 26.34  ?  252  GLY A N   1 
ATOM   1903 C  CA  . GLY A 1 241 ? 126.362 -68.227 176.111 1.00 25.72  ?  252  GLY A CA  1 
ATOM   1904 C  C   . GLY A 1 241 ? 126.519 -67.254 177.254 1.00 29.44  ?  252  GLY A C   1 
ATOM   1905 O  O   . GLY A 1 241 ? 125.507 -66.790 177.791 1.00 28.74  ?  252  GLY A O   1 
ATOM   1906 N  N   . SER A 1 242 ? 127.748 -66.924 177.641 1.00 28.11  ?  253  SER A N   1 
ATOM   1907 C  CA  . SER A 1 242 ? 128.014 -66.046 178.772 1.00 28.08  ?  253  SER A CA  1 
ATOM   1908 C  C   . SER A 1 242 ? 128.658 -64.747 178.302 1.00 33.58  ?  253  SER A C   1 
ATOM   1909 O  O   . SER A 1 242 ? 129.106 -64.620 177.160 1.00 33.85  ?  253  SER A O   1 
ATOM   1910 C  CB  . SER A 1 242 ? 128.916 -66.743 179.798 1.00 28.47  ?  253  SER A CB  1 
ATOM   1911 O  OG  . SER A 1 242 ? 130.178 -67.064 179.241 1.00 31.40  ?  253  SER A OG  1 
ATOM   1912 N  N   . TYR A 1 243 ? 128.695 -63.768 179.203 1.00 30.55  ?  254  TYR A N   1 
ATOM   1913 C  CA  . TYR A 1 243 ? 129.425 -62.540 178.931 1.00 31.20  ?  254  TYR A CA  1 
ATOM   1914 C  C   . TYR A 1 243 ? 130.037 -62.018 180.222 1.00 36.28  ?  254  TYR A C   1 
ATOM   1915 O  O   . TYR A 1 243 ? 129.399 -62.047 181.278 1.00 36.25  ?  254  TYR A O   1 
ATOM   1916 C  CB  . TYR A 1 243 ? 128.534 -61.476 178.268 1.00 32.43  ?  254  TYR A CB  1 
ATOM   1917 C  CG  . TYR A 1 243 ? 127.480 -60.848 179.150 1.00 34.83  ?  254  TYR A CG  1 
ATOM   1918 C  CD1 . TYR A 1 243 ? 127.746 -59.687 179.865 1.00 37.14  ?  254  TYR A CD1 1 
ATOM   1919 C  CD2 . TYR A 1 243 ? 126.207 -61.394 179.242 1.00 35.83  ?  254  TYR A CD2 1 
ATOM   1920 C  CE1 . TYR A 1 243 ? 126.783 -59.101 180.664 1.00 38.39  ?  254  TYR A CE1 1 
ATOM   1921 C  CE2 . TYR A 1 243 ? 125.236 -60.815 180.038 1.00 37.59  ?  254  TYR A CE2 1 
ATOM   1922 C  CZ  . TYR A 1 243 ? 125.529 -59.669 180.747 1.00 47.06  ?  254  TYR A CZ  1 
ATOM   1923 O  OH  . TYR A 1 243 ? 124.566 -59.089 181.541 1.00 49.50  ?  254  TYR A OH  1 
ATOM   1924 N  N   . CYS A 1 244 ? 131.284 -61.559 180.128 1.00 37.65  ?  255  CYS A N   1 
ATOM   1925 C  CA  . CYS A 1 244 ? 132.045 -61.072 181.269 1.00 38.50  ?  255  CYS A CA  1 
ATOM   1926 C  C   . CYS A 1 244 ? 132.347 -59.589 181.100 1.00 37.52  ?  255  CYS A C   1 
ATOM   1927 O  O   . CYS A 1 244 ? 132.273 -59.040 179.998 1.00 35.64  ?  255  CYS A O   1 
ATOM   1928 C  CB  . CYS A 1 244 ? 133.361 -61.847 181.439 1.00 40.70  ?  255  CYS A CB  1 
ATOM   1929 S  SG  . CYS A 1 244 ? 133.230 -63.638 181.228 1.00 45.63  ?  255  CYS A SG  1 
ATOM   1930 N  N   . GLN A 1 245 ? 132.695 -58.944 182.210 1.00 24.61  ?  256  GLN A N   1 
ATOM   1931 C  CA  . GLN A 1 245 ? 133.072 -57.538 182.221 1.00 23.22  ?  256  GLN A CA  1 
ATOM   1932 C  C   . GLN A 1 245 ? 134.462 -57.404 182.827 1.00 28.36  ?  256  GLN A C   1 
ATOM   1933 O  O   . GLN A 1 245 ? 134.735 -57.966 183.893 1.00 27.57  ?  256  GLN A O   1 
ATOM   1934 C  CB  . GLN A 1 245 ? 132.055 -56.702 183.003 1.00 24.23  ?  256  GLN A CB  1 
ATOM   1935 C  CG  . GLN A 1 245 ? 130.627 -56.856 182.496 1.00 41.30  ?  256  GLN A CG  1 
ATOM   1936 C  CD  . GLN A 1 245 ? 129.701 -55.760 182.990 1.00 68.49  ?  256  GLN A CD  1 
ATOM   1937 O  OE1 . GLN A 1 245 ? 129.731 -55.381 184.161 1.00 65.08  ?  256  GLN A OE1 1 
ATOM   1938 N  NE2 . GLN A 1 245 ? 128.874 -55.240 182.091 1.00 61.94  ?  256  GLN A NE2 1 
ATOM   1939 N  N   . TRP A 1 246 ? 135.338 -56.667 182.146 1.00 32.65  ?  257  TRP A N   1 
ATOM   1940 C  CA  . TRP A 1 246 ? 136.731 -56.552 182.550 1.00 33.03  ?  257  TRP A CA  1 
ATOM   1941 C  C   . TRP A 1 246 ? 137.113 -55.088 182.713 1.00 40.60  ?  257  TRP A C   1 
ATOM   1942 O  O   . TRP A 1 246 ? 136.758 -54.258 181.869 1.00 39.46  ?  257  TRP A O   1 
ATOM   1943 C  CB  . TRP A 1 246 ? 137.658 -57.204 181.514 1.00 30.70  ?  257  TRP A CB  1 
ATOM   1944 C  CG  . TRP A 1 246 ? 137.240 -58.575 181.087 1.00 30.74  ?  257  TRP A CG  1 
ATOM   1945 C  CD1 . TRP A 1 246 ? 136.233 -58.893 180.225 1.00 33.06  ?  257  TRP A CD1 1 
ATOM   1946 C  CD2 . TRP A 1 246 ? 137.835 -59.816 181.484 1.00 30.80  ?  257  TRP A CD2 1 
ATOM   1947 N  NE1 . TRP A 1 246 ? 136.156 -60.255 180.069 1.00 32.44  ?  257  TRP A NE1 1 
ATOM   1948 C  CE2 . TRP A 1 246 ? 137.129 -60.845 180.831 1.00 34.32  ?  257  TRP A CE2 1 
ATOM   1949 C  CE3 . TRP A 1 246 ? 138.892 -60.157 182.334 1.00 32.37  ?  257  TRP A CE3 1 
ATOM   1950 C  CZ2 . TRP A 1 246 ? 137.446 -62.191 180.999 1.00 34.06  ?  257  TRP A CZ2 1 
ATOM   1951 C  CZ3 . TRP A 1 246 ? 139.206 -61.494 182.499 1.00 33.84  ?  257  TRP A CZ3 1 
ATOM   1952 C  CH2 . TRP A 1 246 ? 138.485 -62.495 181.836 1.00 34.14  ?  257  TRP A CH2 1 
ATOM   1953 N  N   . PRO A 1 247 ? 137.831 -54.740 183.777 1.00 38.41  ?  258  PRO A N   1 
ATOM   1954 C  CA  . PRO A 1 247 ? 138.307 -53.364 183.921 1.00 39.30  ?  258  PRO A CA  1 
ATOM   1955 C  C   . PRO A 1 247 ? 139.608 -53.143 183.166 1.00 44.30  ?  258  PRO A C   1 
ATOM   1956 O  O   . PRO A 1 247 ? 140.429 -54.050 183.008 1.00 42.93  ?  258  PRO A O   1 
ATOM   1957 C  CB  . PRO A 1 247 ? 138.517 -53.228 185.432 1.00 41.88  ?  258  PRO A CB  1 
ATOM   1958 C  CG  . PRO A 1 247 ? 138.918 -54.605 185.852 1.00 46.21  ?  258  PRO A CG  1 
ATOM   1959 C  CD  . PRO A 1 247 ? 138.160 -55.563 184.954 1.00 40.78  ?  258  PRO A CD  1 
ATOM   1960 N  N   . VAL A 1 248 ? 139.785 -51.914 182.686 1.00 41.39  ?  259  VAL A N   1 
ATOM   1961 C  CA  . VAL A 1 248 ? 141.000 -51.502 181.989 1.00 41.65  ?  259  VAL A CA  1 
ATOM   1962 C  C   . VAL A 1 248 ? 141.641 -50.402 182.824 1.00 48.94  ?  259  VAL A C   1 
ATOM   1963 O  O   . VAL A 1 248 ? 141.180 -49.254 182.811 1.00 48.33  ?  259  VAL A O   1 
ATOM   1964 C  CB  . VAL A 1 248 ? 140.720 -51.028 180.559 1.00 44.49  ?  259  VAL A CB  1 
ATOM   1965 C  CG1 . VAL A 1 248 ? 142.025 -50.754 179.824 1.00 44.24  ?  259  VAL A CG1 1 
ATOM   1966 C  CG2 . VAL A 1 248 ? 139.890 -52.055 179.809 1.00 43.50  ?  259  VAL A CG2 1 
ATOM   1967 N  N   . SER A 1 249 ? 142.699 -50.751 183.553 1.00 53.37  ?  260  SER A N   1 
ATOM   1968 C  CA  . SER A 1 249 ? 143.412 -49.801 184.405 1.00 81.54  ?  260  SER A CA  1 
ATOM   1969 C  C   . SER A 1 249 ? 144.736 -50.386 184.884 1.00 106.20 ?  260  SER A C   1 
ATOM   1970 O  O   . SER A 1 249 ? 144.923 -51.603 184.890 1.00 68.14  ?  260  SER A O   1 
ATOM   1971 C  CB  . SER A 1 249 ? 142.550 -49.398 185.606 1.00 84.87  ?  260  SER A CB  1 
ATOM   1972 O  OG  . SER A 1 249 ? 142.033 -50.539 186.268 1.00 91.28  ?  260  SER A OG  1 
ATOM   1973 N  N   . GLN A 1 253 ? 148.101 -54.489 184.476 1.00 102.79 ?  264  GLN A N   1 
ATOM   1974 C  CA  . GLN A 1 253 ? 148.541 -55.874 184.344 1.00 102.40 ?  264  GLN A CA  1 
ATOM   1975 C  C   . GLN A 1 253 ? 147.412 -56.756 183.820 1.00 104.98 ?  264  GLN A C   1 
ATOM   1976 O  O   . GLN A 1 253 ? 146.667 -56.356 182.926 1.00 105.02 ?  264  GLN A O   1 
ATOM   1977 C  CB  . GLN A 1 253 ? 149.050 -56.407 185.685 1.00 104.15 ?  264  GLN A CB  1 
ATOM   1978 N  N   . GLN A 1 254 ? 147.294 -57.962 184.385 1.00 90.35  ?  265  GLN A N   1 
ATOM   1979 C  CA  . GLN A 1 254 ? 146.268 -58.916 183.985 1.00 88.39  ?  265  GLN A CA  1 
ATOM   1980 C  C   . GLN A 1 254 ? 145.145 -58.909 185.015 1.00 87.60  ?  265  GLN A C   1 
ATOM   1981 O  O   . GLN A 1 254 ? 145.306 -59.481 186.105 1.00 87.56  ?  265  GLN A O   1 
ATOM   1982 C  CB  . GLN A 1 254 ? 146.861 -60.322 183.843 1.00 89.69  ?  265  GLN A CB  1 
ATOM   1983 N  N   . PRO A 1 255 ? 144.009 -58.288 184.733 1.00 61.69  ?  266  PRO A N   1 
ATOM   1984 C  CA  . PRO A 1 255 ? 142.921 -58.217 185.710 1.00 59.80  ?  266  PRO A CA  1 
ATOM   1985 C  C   . PRO A 1 255 ? 142.052 -59.471 185.662 1.00 56.59  ?  266  PRO A C   1 
ATOM   1986 O  O   . PRO A 1 255 ? 142.243 -60.365 184.840 1.00 52.63  ?  266  PRO A O   1 
ATOM   1987 C  CB  . PRO A 1 255 ? 142.144 -56.980 185.255 1.00 61.87  ?  266  PRO A CB  1 
ATOM   1988 C  CG  . PRO A 1 255 ? 142.305 -57.002 183.768 1.00 66.23  ?  266  PRO A CG  1 
ATOM   1989 C  CD  . PRO A 1 255 ? 143.693 -57.543 183.500 1.00 62.19  ?  266  PRO A CD  1 
ATOM   1990 N  N   . GLU A 1 256 ? 141.084 -59.520 186.573 1.00 52.24  ?  267  GLU A N   1 
ATOM   1991 C  CA  . GLU A 1 256 ? 140.076 -60.569 186.640 1.00 50.28  ?  267  GLU A CA  1 
ATOM   1992 C  C   . GLU A 1 256 ? 138.716 -60.033 186.210 1.00 49.09  ?  267  GLU A C   1 
ATOM   1993 O  O   . GLU A 1 256 ? 138.488 -58.819 186.207 1.00 48.70  ?  267  GLU A O   1 
ATOM   1994 C  CB  . GLU A 1 256 ? 139.981 -61.136 188.064 1.00 52.15  ?  267  GLU A CB  1 
ATOM   1995 C  CG  . GLU A 1 256 ? 140.964 -62.256 188.339 1.00 63.49  ?  267  GLU A CG  1 
ATOM   1996 C  CD  . GLU A 1 256 ? 140.992 -62.666 189.796 1.00 89.95  ?  267  GLU A CD  1 
ATOM   1997 O  OE1 . GLU A 1 256 ? 139.981 -62.454 190.500 1.00 76.62  ?  267  GLU A OE1 1 
ATOM   1998 O  OE2 . GLU A 1 256 ? 142.033 -63.194 190.238 1.00 90.47  ?  267  GLU A OE2 1 
ATOM   1999 N  N   . PRO A 1 257 ? 137.785 -60.910 185.829 1.00 36.47  ?  268  PRO A N   1 
ATOM   2000 C  CA  . PRO A 1 257 ? 136.455 -60.435 185.418 1.00 35.80  ?  268  PRO A CA  1 
ATOM   2001 C  C   . PRO A 1 257 ? 135.670 -59.879 186.599 1.00 41.93  ?  268  PRO A C   1 
ATOM   2002 O  O   . PRO A 1 257 ? 135.580 -60.509 187.654 1.00 42.93  ?  268  PRO A O   1 
ATOM   2003 C  CB  . PRO A 1 257 ? 135.792 -61.693 184.840 1.00 36.65  ?  268  PRO A CB  1 
ATOM   2004 C  CG  . PRO A 1 257 ? 136.518 -62.831 185.474 1.00 41.23  ?  268  PRO A CG  1 
ATOM   2005 C  CD  . PRO A 1 257 ? 137.934 -62.363 185.631 1.00 37.21  ?  268  PRO A CD  1 
ATOM   2006 N  N   . LEU A 1 258 ? 135.103 -58.684 186.413 1.00 41.51  ?  269  LEU A N   1 
ATOM   2007 C  CA  . LEU A 1 258 ? 134.246 -58.102 187.441 1.00 40.19  ?  269  LEU A CA  1 
ATOM   2008 C  C   . LEU A 1 258 ? 133.023 -58.975 187.687 1.00 42.73  ?  269  LEU A C   1 
ATOM   2009 O  O   . LEU A 1 258 ? 132.670 -59.264 188.836 1.00 42.38  ?  269  LEU A O   1 
ATOM   2010 C  CB  . LEU A 1 258 ? 133.825 -56.688 187.036 1.00 39.58  ?  269  LEU A CB  1 
ATOM   2011 C  CG  . LEU A 1 258 ? 134.870 -55.579 187.175 1.00 43.63  ?  269  LEU A CG  1 
ATOM   2012 C  CD1 . LEU A 1 258 ? 134.410 -54.317 186.467 1.00 42.75  ?  269  LEU A CD1 1 
ATOM   2013 C  CD2 . LEU A 1 258 ? 135.145 -55.293 188.642 1.00 46.17  ?  269  LEU A CD2 1 
ATOM   2014 N  N   . ARG A 1 259 ? 132.362 -59.404 186.614 1.00 32.95  ?  270  ARG A N   1 
ATOM   2015 C  CA  . ARG A 1 259 ? 131.200 -60.272 186.716 1.00 32.09  ?  270  ARG A CA  1 
ATOM   2016 C  C   . ARG A 1 259 ? 131.094 -61.104 185.448 1.00 34.26  ?  270  ARG A C   1 
ATOM   2017 O  O   . ARG A 1 259 ? 131.498 -60.670 184.367 1.00 35.15  ?  270  ARG A O   1 
ATOM   2018 C  CB  . ARG A 1 259 ? 129.912 -59.473 186.952 1.00 34.89  ?  270  ARG A CB  1 
ATOM   2019 C  CG  . ARG A 1 259 ? 129.844 -58.146 186.214 1.00 52.46  ?  270  ARG A CG  1 
ATOM   2020 C  CD  . ARG A 1 259 ? 128.643 -57.319 186.665 1.00 67.14  ?  270  ARG A CD  1 
ATOM   2021 N  NE  . ARG A 1 259 ? 128.656 -57.053 188.103 1.00 78.31  ?  270  ARG A NE  1 
ATOM   2022 C  CZ  . ARG A 1 259 ? 127.889 -57.683 188.989 1.00 90.91  ?  270  ARG A CZ  1 
ATOM   2023 N  NH1 . ARG A 1 259 ? 127.041 -58.620 188.586 1.00 77.13  ?  270  ARG A NH1 1 
ATOM   2024 N  NH2 . ARG A 1 259 ? 127.969 -57.377 190.277 1.00 73.71  ?  270  ARG A NH2 1 
ATOM   2025 N  N   . SER A 1 260 ? 130.557 -62.312 185.600 1.00 36.22  ?  271  SER A N   1 
ATOM   2026 C  CA  . SER A 1 260 ? 130.392 -63.251 184.500 1.00 34.95  ?  271  SER A CA  1 
ATOM   2027 C  C   . SER A 1 260 ? 129.118 -64.048 184.737 1.00 41.10  ?  271  SER A C   1 
ATOM   2028 O  O   . SER A 1 260 ? 128.838 -64.454 185.868 1.00 42.00  ?  271  SER A O   1 
ATOM   2029 C  CB  . SER A 1 260 ? 131.595 -64.193 184.380 1.00 34.94  ?  271  SER A CB  1 
ATOM   2030 O  OG  . SER A 1 260 ? 131.395 -65.145 183.350 1.00 38.16  ?  271  SER A OG  1 
ATOM   2031 N  N   . LEU A 1 261 ? 128.355 -64.273 183.670 1.00 39.10  ?  272  LEU A N   1 
ATOM   2032 C  CA  . LEU A 1 261 ? 127.031 -64.858 183.819 1.00 39.26  ?  272  LEU A CA  1 
ATOM   2033 C  C   . LEU A 1 261 ? 126.553 -65.408 182.485 1.00 38.52  ?  272  LEU A C   1 
ATOM   2034 O  O   . LEU A 1 261 ? 126.863 -64.857 181.426 1.00 38.17  ?  272  LEU A O   1 
ATOM   2035 C  CB  . LEU A 1 261 ? 126.024 -63.826 184.341 1.00 40.72  ?  272  LEU A CB  1 
ATOM   2036 C  CG  . LEU A 1 261 ? 125.843 -62.583 183.460 1.00 46.84  ?  272  LEU A CG  1 
ATOM   2037 C  CD1 . LEU A 1 261 ? 124.393 -62.133 183.451 1.00 47.67  ?  272  LEU A CD1 1 
ATOM   2038 C  CD2 . LEU A 1 261 ? 126.752 -61.444 183.909 1.00 49.91  ?  272  LEU A CD2 1 
ATOM   2039 N  N   . VAL A 1 262 ? 125.791 -66.496 182.553 1.00 28.71  ?  273  VAL A N   1 
ATOM   2040 C  CA  . VAL A 1 262 ? 125.023 -66.984 181.411 1.00 27.78  ?  273  VAL A CA  1 
ATOM   2041 C  C   . VAL A 1 262 ? 123.599 -66.470 181.589 1.00 31.81  ?  273  VAL A C   1 
ATOM   2042 O  O   . VAL A 1 262 ? 122.836 -67.030 182.391 1.00 28.44  ?  273  VAL A O   1 
ATOM   2043 C  CB  . VAL A 1 262 ? 125.066 -68.517 181.305 1.00 31.00  ?  273  VAL A CB  1 
ATOM   2044 C  CG1 . VAL A 1 262 ? 124.324 -68.987 180.060 1.00 29.73  ?  273  VAL A CG1 1 
ATOM   2045 C  CG2 . VAL A 1 262 ? 126.504 -69.009 181.286 1.00 31.00  ?  273  VAL A CG2 1 
ATOM   2046 N  N   . PRO A 1 263 ? 123.197 -65.421 180.866 1.00 38.11  ?  274  PRO A N   1 
ATOM   2047 C  CA  . PRO A 1 263 ? 121.953 -64.711 181.213 1.00 38.93  ?  274  PRO A CA  1 
ATOM   2048 C  C   . PRO A 1 263 ? 120.684 -65.546 181.122 1.00 42.13  ?  274  PRO A C   1 
ATOM   2049 O  O   . PRO A 1 263 ? 119.647 -65.097 181.626 1.00 42.18  ?  274  PRO A O   1 
ATOM   2050 C  CB  . PRO A 1 263 ? 121.919 -63.548 180.210 1.00 40.52  ?  274  PRO A CB  1 
ATOM   2051 C  CG  . PRO A 1 263 ? 122.831 -63.965 179.099 1.00 44.95  ?  274  PRO A CG  1 
ATOM   2052 C  CD  . PRO A 1 263 ? 123.904 -64.783 179.744 1.00 40.28  ?  274  PRO A CD  1 
ATOM   2053 N  N   . TYR A 1 264 ? 120.711 -66.733 180.522 1.00 31.90  ?  275  TYR A N   1 
ATOM   2054 C  CA  . TYR A 1 264 ? 119.482 -67.497 180.292 1.00 32.14  ?  275  TYR A CA  1 
ATOM   2055 C  C   . TYR A 1 264 ? 119.565 -68.856 180.981 1.00 42.24  ?  275  TYR A C   1 
ATOM   2056 O  O   . TYR A 1 264 ? 119.899 -69.870 180.365 1.00 42.16  ?  275  TYR A O   1 
ATOM   2057 C  CB  . TYR A 1 264 ? 119.214 -67.614 178.795 1.00 31.13  ?  275  TYR A CB  1 
ATOM   2058 C  CG  . TYR A 1 264 ? 118.717 -66.307 178.230 1.00 29.42  ?  275  TYR A CG  1 
ATOM   2059 C  CD1 . TYR A 1 264 ? 117.848 -65.510 178.964 1.00 30.11  ?  275  TYR A CD1 1 
ATOM   2060 C  CD2 . TYR A 1 264 ? 119.137 -65.848 176.991 1.00 30.13  ?  275  TYR A CD2 1 
ATOM   2061 C  CE1 . TYR A 1 264 ? 117.394 -64.305 178.474 1.00 29.00  ?  275  TYR A CE1 1 
ATOM   2062 C  CE2 . TYR A 1 264 ? 118.688 -64.639 176.489 1.00 30.99  ?  275  TYR A CE2 1 
ATOM   2063 C  CZ  . TYR A 1 264 ? 117.817 -63.872 177.237 1.00 36.16  ?  275  TYR A CZ  1 
ATOM   2064 O  OH  . TYR A 1 264 ? 117.366 -62.669 176.745 1.00 34.12  ?  275  TYR A OH  1 
ATOM   2065 N  N   . GLY A 1 265 ? 119.242 -68.861 182.275 1.00 63.42  ?  276  GLY A N   1 
ATOM   2066 C  CA  . GLY A 1 265 ? 119.054 -70.073 183.037 1.00 62.75  ?  276  GLY A CA  1 
ATOM   2067 C  C   . GLY A 1 265 ? 120.303 -70.915 183.191 1.00 66.40  ?  276  GLY A C   1 
ATOM   2068 O  O   . GLY A 1 265 ? 121.395 -70.550 182.745 1.00 68.77  ?  276  GLY A O   1 
ATOM   2069 N  N   . PRO A 1 266 ? 120.157 -72.072 183.845 1.00 39.50  ?  277  PRO A N   1 
ATOM   2070 C  CA  . PRO A 1 266 ? 121.280 -73.003 183.989 1.00 38.17  ?  277  PRO A CA  1 
ATOM   2071 C  C   . PRO A 1 266 ? 121.394 -74.021 182.867 1.00 40.72  ?  277  PRO A C   1 
ATOM   2072 O  O   . PRO A 1 266 ? 122.378 -74.774 182.841 1.00 39.97  ?  277  PRO A O   1 
ATOM   2073 C  CB  . PRO A 1 266 ? 120.972 -73.705 185.329 1.00 39.88  ?  277  PRO A CB  1 
ATOM   2074 C  CG  . PRO A 1 266 ? 119.549 -73.279 185.716 1.00 44.95  ?  277  PRO A CG  1 
ATOM   2075 C  CD  . PRO A 1 266 ? 118.960 -72.560 184.544 1.00 40.74  ?  277  PRO A CD  1 
ATOM   2076 N  N   . PHE A 1 267 ? 120.421 -74.070 181.952 1.00 40.84  ?  278  PHE A N   1 
ATOM   2077 C  CA  . PHE A 1 267 ? 120.494 -74.970 180.814 1.00 40.26  ?  278  PHE A CA  1 
ATOM   2078 C  C   . PHE A 1 267 ? 121.690 -74.615 179.932 1.00 43.77  ?  278  PHE A C   1 
ATOM   2079 O  O   . PHE A 1 267 ? 122.163 -73.476 179.937 1.00 43.53  ?  278  PHE A O   1 
ATOM   2080 C  CB  . PHE A 1 267 ? 119.206 -74.898 179.992 1.00 41.95  ?  278  PHE A CB  1 
ATOM   2081 C  CG  . PHE A 1 267 ? 118.043 -75.618 180.616 1.00 43.42  ?  278  PHE A CG  1 
ATOM   2082 C  CD1 . PHE A 1 267 ? 117.795 -76.949 180.316 1.00 45.97  ?  278  PHE A CD1 1 
ATOM   2083 C  CD2 . PHE A 1 267 ? 117.193 -74.965 181.496 1.00 45.19  ?  278  PHE A CD2 1 
ATOM   2084 C  CE1 . PHE A 1 267 ? 116.726 -77.619 180.884 1.00 46.75  ?  278  PHE A CE1 1 
ATOM   2085 C  CE2 . PHE A 1 267 ? 116.120 -75.630 182.069 1.00 47.88  ?  278  PHE A CE2 1 
ATOM   2086 C  CZ  . PHE A 1 267 ? 115.887 -76.960 181.762 1.00 45.76  ?  278  PHE A CZ  1 
ATOM   2087 N  N   . PRO A 1 268 ? 122.203 -75.583 179.174 1.00 37.97  ?  279  PRO A N   1 
ATOM   2088 C  CA  . PRO A 1 268 ? 123.244 -75.266 178.188 1.00 36.51  ?  279  PRO A CA  1 
ATOM   2089 C  C   . PRO A 1 268 ? 122.717 -74.288 177.147 1.00 38.14  ?  279  PRO A C   1 
ATOM   2090 O  O   . PRO A 1 268 ? 121.625 -74.466 176.601 1.00 36.93  ?  279  PRO A O   1 
ATOM   2091 C  CB  . PRO A 1 268 ? 123.584 -76.631 177.576 1.00 37.85  ?  279  PRO A CB  1 
ATOM   2092 C  CG  . PRO A 1 268 ? 122.417 -77.508 177.903 1.00 42.46  ?  279  PRO A CG  1 
ATOM   2093 C  CD  . PRO A 1 268 ? 121.906 -77.024 179.220 1.00 38.98  ?  279  PRO A CD  1 
ATOM   2094 N  N   . CYS A 1 269 ? 123.497 -73.242 176.883 1.00 36.29  ?  280  CYS A N   1 
ATOM   2095 C  CA  . CYS A 1 269 ? 123.072 -72.154 176.013 1.00 33.33  ?  280  CYS A CA  1 
ATOM   2096 C  C   . CYS A 1 269 ? 123.996 -72.026 174.811 1.00 34.80  ?  280  CYS A C   1 
ATOM   2097 O  O   . CYS A 1 269 ? 125.194 -72.318 174.890 1.00 35.46  ?  280  CYS A O   1 
ATOM   2098 C  CB  . CYS A 1 269 ? 123.033 -70.820 176.766 1.00 32.05  ?  280  CYS A CB  1 
ATOM   2099 S  SG  . CYS A 1 269 ? 121.635 -70.645 177.884 1.00 35.29  ?  280  CYS A SG  1 
ATOM   2100 N  N   . LYS A 1 270 ? 123.423 -71.582 173.696 1.00 24.41  ?  281  LYS A N   1 
ATOM   2101 C  CA  . LYS A 1 270 ? 124.210 -71.287 172.513 1.00 23.08  ?  281  LYS A CA  1 
ATOM   2102 C  C   . LYS A 1 270 ? 125.017 -70.010 172.724 1.00 28.31  ?  281  LYS A C   1 
ATOM   2103 O  O   . LYS A 1 270 ? 124.748 -69.214 173.628 1.00 29.67  ?  281  LYS A O   1 
ATOM   2104 C  CB  . LYS A 1 270 ? 123.309 -71.139 171.288 1.00 24.94  ?  281  LYS A CB  1 
ATOM   2105 C  CG  . LYS A 1 270 ? 122.180 -72.146 171.231 1.00 35.90  ?  281  LYS A CG  1 
ATOM   2106 C  CD  . LYS A 1 270 ? 121.436 -72.078 169.912 1.00 44.39  ?  281  LYS A CD  1 
ATOM   2107 C  CE  . LYS A 1 270 ? 122.028 -73.028 168.886 1.00 58.60  ?  281  LYS A CE  1 
ATOM   2108 N  NZ  . LYS A 1 270 ? 121.060 -73.310 167.790 1.00 70.40  ?  281  LYS A NZ  1 
ATOM   2109 N  N   . ALA A 1 271 ? 126.011 -69.816 171.861 1.00 27.91  ?  282  ALA A N   1 
ATOM   2110 C  CA  . ALA A 1 271 ? 126.915 -68.682 171.986 1.00 26.65  ?  282  ALA A CA  1 
ATOM   2111 C  C   . ALA A 1 271 ? 126.164 -67.357 171.916 1.00 30.36  ?  282  ALA A C   1 
ATOM   2112 O  O   . ALA A 1 271 ? 125.157 -67.221 171.216 1.00 30.95  ?  282  ALA A O   1 
ATOM   2113 C  CB  . ALA A 1 271 ? 127.968 -68.727 170.879 1.00 26.87  ?  282  ALA A CB  1 
ATOM   2114 N  N   . ILE A 1 272 ? 126.659 -66.380 172.669 1.00 21.91  ?  283  ILE A N   1 
ATOM   2115 C  CA  . ILE A 1 272 ? 126.344 -64.976 172.435 1.00 20.12  ?  283  ILE A CA  1 
ATOM   2116 C  C   . ILE A 1 272 ? 127.380 -64.470 171.438 1.00 23.62  ?  283  ILE A C   1 
ATOM   2117 O  O   . ILE A 1 272 ? 128.567 -64.368 171.762 1.00 22.43  ?  283  ILE A O   1 
ATOM   2118 C  CB  . ILE A 1 272 ? 126.363 -64.156 173.731 1.00 22.50  ?  283  ILE A CB  1 
ATOM   2119 C  CG1 . ILE A 1 272 ? 125.244 -64.602 174.673 1.00 20.94  ?  283  ILE A CG1 1 
ATOM   2120 C  CG2 . ILE A 1 272 ? 126.224 -62.677 173.422 1.00 24.88  ?  283  ILE A CG2 1 
ATOM   2121 C  CD1 . ILE A 1 272 ? 125.236 -63.875 176.007 1.00 18.97  ?  283  ILE A CD1 1 
ATOM   2122 N  N   . THR A 1 273 ? 126.941 -64.175 170.217 1.00 25.26  ?  284  THR A N   1 
ATOM   2123 C  CA  . THR A 1 273 ? 127.872 -63.878 169.137 1.00 23.98  ?  284  THR A CA  1 
ATOM   2124 C  C   . THR A 1 273 ? 128.244 -62.404 169.044 1.00 26.83  ?  284  THR A C   1 
ATOM   2125 O  O   . THR A 1 273 ? 129.262 -62.076 168.423 1.00 26.97  ?  284  THR A O   1 
ATOM   2126 C  CB  . THR A 1 273 ? 127.289 -64.345 167.797 1.00 30.51  ?  284  THR A CB  1 
ATOM   2127 O  OG1 . THR A 1 273 ? 125.942 -63.877 167.668 1.00 32.28  ?  284  THR A OG1 1 
ATOM   2128 C  CG2 . THR A 1 273 ? 127.293 -65.861 167.721 1.00 23.89  ?  284  THR A CG2 1 
ATOM   2129 N  N   . ARG A 1 274 ? 127.460 -61.513 169.645 1.00 17.59  ?  285  ARG A N   1 
ATOM   2130 C  CA  . ARG A 1 274 ? 127.751 -60.088 169.597 1.00 17.99  ?  285  ARG A CA  1 
ATOM   2131 C  C   . ARG A 1 274 ? 127.112 -59.421 170.805 1.00 23.98  ?  285  ARG A C   1 
ATOM   2132 O  O   . ARG A 1 274 ? 126.003 -59.789 171.200 1.00 24.48  ?  285  ARG A O   1 
ATOM   2133 C  CB  . ARG A 1 274 ? 127.234 -59.457 168.301 1.00 18.78  ?  285  ARG A CB  1 
ATOM   2134 C  CG  . ARG A 1 274 ? 128.156 -58.397 167.739 1.00 23.11  ?  285  ARG A CG  1 
ATOM   2135 C  CD  . ARG A 1 274 ? 127.454 -57.514 166.733 1.00 21.75  ?  285  ARG A CD  1 
ATOM   2136 N  NE  . ARG A 1 274 ? 128.060 -56.188 166.690 1.00 25.30  ?  285  ARG A NE  1 
ATOM   2137 C  CZ  . ARG A 1 274 ? 127.490 -55.123 166.139 1.00 35.86  ?  285  ARG A CZ  1 
ATOM   2138 N  NH1 . ARG A 1 274 ? 126.292 -55.225 165.579 1.00 16.50  ?  285  ARG A NH1 1 
ATOM   2139 N  NH2 . ARG A 1 274 ? 128.116 -53.955 166.152 1.00 26.49  ?  285  ARG A NH2 1 
ATOM   2140 N  N   . ILE A 1 275 ? 127.812 -58.448 171.388 1.00 17.91  ?  286  ILE A N   1 
ATOM   2141 C  CA  . ILE A 1 275 ? 127.332 -57.757 172.581 1.00 17.03  ?  286  ILE A CA  1 
ATOM   2142 C  C   . ILE A 1 275 ? 127.736 -56.289 172.509 1.00 21.82  ?  286  ILE A C   1 
ATOM   2143 O  O   . ILE A 1 275 ? 128.807 -55.948 171.996 1.00 21.25  ?  286  ILE A O   1 
ATOM   2144 C  CB  . ILE A 1 275 ? 127.856 -58.421 173.874 1.00 19.37  ?  286  ILE A CB  1 
ATOM   2145 C  CG1 . ILE A 1 275 ? 127.172 -57.822 175.107 1.00 19.49  ?  286  ILE A CG1 1 
ATOM   2146 C  CG2 . ILE A 1 275 ? 129.374 -58.305 173.975 1.00 18.08  ?  286  ILE A CG2 1 
ATOM   2147 C  CD1 . ILE A 1 275 ? 127.103 -58.765 176.287 1.00 23.69  ?  286  ILE A CD1 1 
ATOM   2148 N  N   . LEU A 1 276 ? 126.857 -55.418 173.007 1.00 22.40  ?  287  LEU A N   1 
ATOM   2149 C  CA  . LEU A 1 276 ? 127.103 -53.986 173.086 1.00 22.57  ?  287  LEU A CA  1 
ATOM   2150 C  C   . LEU A 1 276 ? 126.818 -53.507 174.502 1.00 28.78  ?  287  LEU A C   1 
ATOM   2151 O  O   . LEU A 1 276 ? 125.820 -53.904 175.111 1.00 28.30  ?  287  LEU A O   1 
ATOM   2152 C  CB  . LEU A 1 276 ? 126.235 -53.203 172.090 1.00 21.58  ?  287  LEU A CB  1 
ATOM   2153 C  CG  . LEU A 1 276 ? 126.641 -53.174 170.615 1.00 25.98  ?  287  LEU A CG  1 
ATOM   2154 C  CD1 . LEU A 1 276 ? 126.363 -54.502 169.922 1.00 25.71  ?  287  LEU A CD1 1 
ATOM   2155 C  CD2 . LEU A 1 276 ? 125.937 -52.032 169.895 1.00 27.70  ?  287  LEU A CD2 1 
ATOM   2156 N  N   . TRP A 1 277 ? 127.698 -52.653 175.020 1.00 29.80  ?  288  TRP A N   1 
ATOM   2157 C  CA  . TRP A 1 277 ? 127.549 -52.061 176.346 1.00 31.84  ?  288  TRP A CA  1 
ATOM   2158 C  C   . TRP A 1 277 ? 127.543 -50.547 176.177 1.00 33.16  ?  288  TRP A C   1 
ATOM   2159 O  O   . TRP A 1 277 ? 128.581 -49.947 175.877 1.00 33.04  ?  288  TRP A O   1 
ATOM   2160 C  CB  . TRP A 1 277 ? 128.673 -52.517 177.278 1.00 33.31  ?  288  TRP A CB  1 
ATOM   2161 C  CG  . TRP A 1 277 ? 128.660 -51.864 178.629 1.00 36.16  ?  288  TRP A CG  1 
ATOM   2162 C  CD1 . TRP A 1 277 ? 129.391 -50.779 179.020 1.00 39.63  ?  288  TRP A CD1 1 
ATOM   2163 C  CD2 . TRP A 1 277 ? 127.886 -52.258 179.770 1.00 36.64  ?  288  TRP A CD2 1 
ATOM   2164 N  NE1 . TRP A 1 277 ? 129.118 -50.471 180.332 1.00 40.42  ?  288  TRP A NE1 1 
ATOM   2165 C  CE2 . TRP A 1 277 ? 128.197 -51.364 180.815 1.00 41.88  ?  288  TRP A CE2 1 
ATOM   2166 C  CE3 . TRP A 1 277 ? 126.959 -53.277 180.009 1.00 38.13  ?  288  TRP A CE3 1 
ATOM   2167 C  CZ2 . TRP A 1 277 ? 127.616 -51.459 182.078 1.00 41.79  ?  288  TRP A CZ2 1 
ATOM   2168 C  CZ3 . TRP A 1 277 ? 126.382 -53.369 181.264 1.00 40.66  ?  288  TRP A CZ3 1 
ATOM   2169 C  CH2 . TRP A 1 277 ? 126.713 -52.466 182.282 1.00 41.91  ?  288  TRP A CH2 1 
ATOM   2170 N  N   . LEU A 1 278 ? 126.377 -49.932 176.360 1.00 24.47  ?  289  LEU A N   1 
ATOM   2171 C  CA  . LEU A 1 278 ? 126.180 -48.520 176.061 1.00 24.51  ?  289  LEU A CA  1 
ATOM   2172 C  C   . LEU A 1 278 ? 125.701 -47.786 177.304 1.00 26.18  ?  289  LEU A C   1 
ATOM   2173 O  O   . LEU A 1 278 ? 124.697 -48.174 177.911 1.00 23.36  ?  289  LEU A O   1 
ATOM   2174 C  CB  . LEU A 1 278 ? 125.176 -48.349 174.922 1.00 23.97  ?  289  LEU A CB  1 
ATOM   2175 C  CG  . LEU A 1 278 ? 125.456 -49.242 173.710 1.00 27.14  ?  289  LEU A CG  1 
ATOM   2176 C  CD1 . LEU A 1 278 ? 124.350 -49.122 172.682 1.00 26.33  ?  289  LEU A CD1 1 
ATOM   2177 C  CD2 . LEU A 1 278 ? 126.808 -48.908 173.092 1.00 25.75  ?  289  LEU A CD2 1 
ATOM   2178 N  N   . THR A 1 279 ? 126.414 -46.726 177.673 1.00 34.33  ?  290  THR A N   1 
ATOM   2179 C  CA  . THR A 1 279 ? 126.058 -45.937 178.840 1.00 35.90  ?  290  THR A CA  1 
ATOM   2180 C  C   . THR A 1 279 ? 124.974 -44.920 178.495 1.00 41.82  ?  290  THR A C   1 
ATOM   2181 O  O   . THR A 1 279 ? 124.713 -44.619 177.327 1.00 42.15  ?  290  THR A O   1 
ATOM   2182 C  CB  . THR A 1 279 ? 127.281 -45.213 179.403 1.00 45.26  ?  290  THR A CB  1 
ATOM   2183 O  OG1 . THR A 1 279 ? 127.912 -44.454 178.363 1.00 45.64  ?  290  THR A OG1 1 
ATOM   2184 C  CG2 . THR A 1 279 ? 128.275 -46.210 179.979 1.00 44.47  ?  290  THR A CG2 1 
ATOM   2185 N  N   . THR A 1 280 ? 124.332 -44.397 179.537 1.00 31.69  ?  291  THR A N   1 
ATOM   2186 C  CA  . THR A 1 280 ? 123.350 -43.332 179.404 1.00 31.33  ?  291  THR A CA  1 
ATOM   2187 C  C   . THR A 1 280 ? 123.620 -42.271 180.459 1.00 34.95  ?  291  THR A C   1 
ATOM   2188 O  O   . THR A 1 280 ? 124.170 -42.559 181.527 1.00 33.25  ?  291  THR A O   1 
ATOM   2189 C  CB  . THR A 1 280 ? 121.901 -43.842 179.555 1.00 36.68  ?  291  THR A CB  1 
ATOM   2190 O  OG1 . THR A 1 280 ? 121.691 -44.318 180.889 1.00 34.07  ?  291  THR A OG1 1 
ATOM   2191 C  CG2 . THR A 1 280 ? 121.605 -44.960 178.565 1.00 33.06  ?  291  THR A CG2 1 
ATOM   2192 N  N   . ARG A 1 281 ? 123.224 -41.034 180.149 1.00 35.25  ?  292  ARG A N   1 
ATOM   2193 C  CA  . ARG A 1 281 ? 123.355 -39.950 181.116 1.00 35.82  ?  292  ARG A CA  1 
ATOM   2194 C  C   . ARG A 1 281 ? 122.538 -40.207 182.374 1.00 39.75  ?  292  ARG A C   1 
ATOM   2195 O  O   . ARG A 1 281 ? 122.844 -39.638 183.427 1.00 39.32  ?  292  ARG A O   1 
ATOM   2196 C  CB  . ARG A 1 281 ? 122.944 -38.623 180.472 1.00 34.91  ?  292  ARG A CB  1 
ATOM   2197 C  CG  . ARG A 1 281 ? 121.528 -38.606 179.914 1.00 35.34  ?  292  ARG A CG  1 
ATOM   2198 C  CD  . ARG A 1 281 ? 121.313 -37.407 179.000 1.00 48.03  ?  292  ARG A CD  1 
ATOM   2199 N  NE  . ARG A 1 281 ? 119.911 -37.235 178.627 1.00 61.67  ?  292  ARG A NE  1 
ATOM   2200 C  CZ  . ARG A 1 281 ? 119.366 -37.704 177.508 1.00 82.46  ?  292  ARG A CZ  1 
ATOM   2201 N  NH1 . ARG A 1 281 ? 120.102 -38.382 176.637 1.00 69.62  ?  292  ARG A NH1 1 
ATOM   2202 N  NH2 . ARG A 1 281 ? 118.081 -37.492 177.259 1.00 72.98  ?  292  ARG A NH2 1 
ATOM   2203 N  N   . GLN A 1 282 ? 121.513 -41.056 182.293 1.00 35.90  ?  293  GLN A N   1 
ATOM   2204 C  CA  . GLN A 1 282 ? 120.712 -41.423 183.455 1.00 35.83  ?  293  GLN A CA  1 
ATOM   2205 C  C   . GLN A 1 282 ? 121.405 -42.431 184.365 1.00 38.97  ?  293  GLN A C   1 
ATOM   2206 O  O   . GLN A 1 282 ? 120.845 -42.780 185.409 1.00 37.97  ?  293  GLN A O   1 
ATOM   2207 C  CB  . GLN A 1 282 ? 119.361 -41.992 183.009 1.00 36.51  ?  293  GLN A CB  1 
ATOM   2208 C  CG  . GLN A 1 282 ? 118.482 -41.017 182.242 1.00 45.11  ?  293  GLN A CG  1 
ATOM   2209 C  CD  . GLN A 1 282 ? 118.703 -41.078 180.741 1.00 60.29  ?  293  GLN A CD  1 
ATOM   2210 O  OE1 . GLN A 1 282 ? 119.717 -41.590 180.268 1.00 52.53  ?  293  GLN A OE1 1 
ATOM   2211 N  NE2 . GLN A 1 282 ? 117.745 -40.557 179.984 1.00 49.12  ?  293  GLN A NE2 1 
ATOM   2212 N  N   . GLY A 1 283 ? 122.594 -42.907 184.003 1.00 36.52  ?  294  GLY A N   1 
ATOM   2213 C  CA  . GLY A 1 283 ? 123.259 -43.916 184.804 1.00 37.34  ?  294  GLY A CA  1 
ATOM   2214 C  C   . GLY A 1 283 ? 122.637 -45.289 184.706 1.00 41.83  ?  294  GLY A C   1 
ATOM   2215 O  O   . GLY A 1 283 ? 122.737 -46.078 185.650 1.00 43.50  ?  294  GLY A O   1 
ATOM   2216 N  N   . LEU A 1 284 ? 121.989 -45.596 183.585 1.00 32.19  ?  295  LEU A N   1 
ATOM   2217 C  CA  . LEU A 1 284 ? 121.348 -46.892 183.363 1.00 31.67  ?  295  LEU A CA  1 
ATOM   2218 C  C   . LEU A 1 284 ? 121.870 -47.464 182.051 1.00 34.76  ?  295  LEU A C   1 
ATOM   2219 O  O   . LEU A 1 284 ? 121.383 -47.092 180.968 1.00 32.30  ?  295  LEU A O   1 
ATOM   2220 C  CB  . LEU A 1 284 ? 119.830 -46.760 183.336 1.00 31.16  ?  295  LEU A CB  1 
ATOM   2221 C  CG  . LEU A 1 284 ? 119.161 -46.371 184.653 1.00 35.98  ?  295  LEU A CG  1 
ATOM   2222 C  CD1 . LEU A 1 284 ? 117.709 -45.984 184.425 1.00 34.95  ?  295  LEU A CD1 1 
ATOM   2223 C  CD2 . LEU A 1 284 ? 119.260 -47.515 185.647 1.00 38.80  ?  295  LEU A CD2 1 
ATOM   2224 N  N   . PRO A 1 285 ? 122.849 -48.363 182.100 1.00 37.62  ?  296  PRO A N   1 
ATOM   2225 C  CA  . PRO A 1 285 ? 123.462 -48.849 180.860 1.00 36.27  ?  296  PRO A CA  1 
ATOM   2226 C  C   . PRO A 1 285 ? 122.554 -49.808 180.110 1.00 38.01  ?  296  PRO A C   1 
ATOM   2227 O  O   . PRO A 1 285 ? 121.748 -50.534 180.697 1.00 37.65  ?  296  PRO A O   1 
ATOM   2228 C  CB  . PRO A 1 285 ? 124.732 -49.564 181.343 1.00 37.96  ?  296  PRO A CB  1 
ATOM   2229 C  CG  . PRO A 1 285 ? 124.900 -49.172 182.784 1.00 42.73  ?  296  PRO A CG  1 
ATOM   2230 C  CD  . PRO A 1 285 ? 123.525 -48.894 183.292 1.00 39.04  ?  296  PRO A CD  1 
ATOM   2231 N  N   . PHE A 1 286 ? 122.698 -49.802 178.790 1.00 34.67  ?  297  PHE A N   1 
ATOM   2232 C  CA  . PHE A 1 286 ? 122.075 -50.804 177.941 1.00 33.44  ?  297  PHE A CA  1 
ATOM   2233 C  C   . PHE A 1 286 ? 123.029 -51.973 177.747 1.00 33.57  ?  297  PHE A C   1 
ATOM   2234 O  O   . PHE A 1 286 ? 124.225 -51.781 177.507 1.00 30.74  ?  297  PHE A O   1 
ATOM   2235 C  CB  . PHE A 1 286 ? 121.707 -50.220 176.575 1.00 35.25  ?  297  PHE A CB  1 
ATOM   2236 C  CG  . PHE A 1 286 ? 120.435 -49.423 176.566 1.00 37.50  ?  297  PHE A CG  1 
ATOM   2237 C  CD1 . PHE A 1 286 ? 120.438 -48.084 176.919 1.00 41.49  ?  297  PHE A CD1 1 
ATOM   2238 C  CD2 . PHE A 1 286 ? 119.240 -50.007 176.175 1.00 39.33  ?  297  PHE A CD2 1 
ATOM   2239 C  CE1 . PHE A 1 286 ? 119.271 -47.345 176.898 1.00 43.05  ?  297  PHE A CE1 1 
ATOM   2240 C  CE2 . PHE A 1 286 ? 118.069 -49.273 176.152 1.00 42.58  ?  297  PHE A CE2 1 
ATOM   2241 C  CZ  . PHE A 1 286 ? 118.084 -47.941 176.515 1.00 41.21  ?  297  PHE A CZ  1 
ATOM   2242 N  N   . THR A 1 287 ? 122.496 -53.185 177.851 1.00 29.90  ?  298  THR A N   1 
ATOM   2243 C  CA  . THR A 1 287 ? 123.223 -54.390 177.466 1.00 29.05  ?  298  THR A CA  1 
ATOM   2244 C  C   . THR A 1 287 ? 122.455 -55.046 176.328 1.00 29.66  ?  298  THR A C   1 
ATOM   2245 O  O   . THR A 1 287 ? 121.342 -55.545 176.528 1.00 26.90  ?  298  THR A O   1 
ATOM   2246 C  CB  . THR A 1 287 ? 123.396 -55.350 178.641 1.00 30.69  ?  298  THR A CB  1 
ATOM   2247 O  OG1 . THR A 1 287 ? 123.910 -54.635 179.769 1.00 38.49  ?  298  THR A OG1 1 
ATOM   2248 C  CG2 . THR A 1 287 ? 124.374 -56.450 178.266 1.00 22.28  ?  298  THR A CG2 1 
ATOM   2249 N  N   . ILE A 1 288 ? 123.042 -55.028 175.136 1.00 24.84  ?  299  ILE A N   1 
ATOM   2250 C  CA  . ILE A 1 288 ? 122.422 -55.562 173.930 1.00 23.93  ?  299  ILE A CA  1 
ATOM   2251 C  C   . ILE A 1 288 ? 123.306 -56.688 173.418 1.00 24.05  ?  299  ILE A C   1 
ATOM   2252 O  O   . ILE A 1 288 ? 124.484 -56.465 173.112 1.00 21.21  ?  299  ILE A O   1 
ATOM   2253 C  CB  . ILE A 1 288 ? 122.236 -54.475 172.859 1.00 27.00  ?  299  ILE A CB  1 
ATOM   2254 C  CG1 . ILE A 1 288 ? 121.333 -53.362 173.394 1.00 28.47  ?  299  ILE A CG1 1 
ATOM   2255 C  CG2 . ILE A 1 288 ? 121.663 -55.074 171.581 1.00 27.02  ?  299  ILE A CG2 1 
ATOM   2256 C  CD1 . ILE A 1 288 ? 121.600 -52.012 172.788 1.00 35.90  ?  299  ILE A CD1 1 
ATOM   2257 N  N   . PHE A 1 289 ? 122.752 -57.895 173.335 1.00 24.42  ?  300  PHE A N   1 
ATOM   2258 C  CA  . PHE A 1 289 ? 123.523 -59.030 172.857 1.00 24.00  ?  300  PHE A CA  1 
ATOM   2259 C  C   . PHE A 1 289 ? 122.663 -59.918 171.970 1.00 26.52  ?  300  PHE A C   1 
ATOM   2260 O  O   . PHE A 1 289 ? 121.442 -59.999 172.131 1.00 26.12  ?  300  PHE A O   1 
ATOM   2261 C  CB  . PHE A 1 289 ? 124.129 -59.847 174.015 1.00 25.91  ?  300  PHE A CB  1 
ATOM   2262 C  CG  . PHE A 1 289 ? 123.115 -60.504 174.912 1.00 27.52  ?  300  PHE A CG  1 
ATOM   2263 C  CD1 . PHE A 1 289 ? 122.606 -61.757 174.607 1.00 29.15  ?  300  PHE A CD1 1 
ATOM   2264 C  CD2 . PHE A 1 289 ? 122.699 -59.885 176.080 1.00 30.13  ?  300  PHE A CD2 1 
ATOM   2265 C  CE1 . PHE A 1 289 ? 121.685 -62.368 175.434 1.00 31.53  ?  300  PHE A CE1 1 
ATOM   2266 C  CE2 . PHE A 1 289 ? 121.777 -60.494 176.914 1.00 34.21  ?  300  PHE A CE2 1 
ATOM   2267 C  CZ  . PHE A 1 289 ? 121.272 -61.738 176.591 1.00 32.73  ?  300  PHE A CZ  1 
ATOM   2268 N  N   . GLN A 1 290 ? 123.326 -60.587 171.032 1.00 21.78  ?  301  GLN A N   1 
ATOM   2269 C  CA  . GLN A 1 290 ? 122.676 -61.450 170.057 1.00 21.57  ?  301  GLN A CA  1 
ATOM   2270 C  C   . GLN A 1 290 ? 122.857 -62.905 170.463 1.00 26.98  ?  301  GLN A C   1 
ATOM   2271 O  O   . GLN A 1 290 ? 123.972 -63.331 170.783 1.00 25.40  ?  301  GLN A O   1 
ATOM   2272 C  CB  . GLN A 1 290 ? 123.254 -61.211 168.659 1.00 21.60  ?  301  GLN A CB  1 
ATOM   2273 C  CG  . GLN A 1 290 ? 122.694 -62.120 167.574 1.00 21.28  ?  301  GLN A CG  1 
ATOM   2274 C  CD  . GLN A 1 290 ? 123.279 -61.821 166.205 1.00 31.92  ?  301  GLN A CD  1 
ATOM   2275 O  OE1 . GLN A 1 290 ? 123.896 -60.779 165.996 1.00 32.87  ?  301  GLN A OE1 1 
ATOM   2276 N  NE2 . GLN A 1 290 ? 123.089 -62.739 165.265 1.00 20.84  ?  301  GLN A NE2 1 
ATOM   2277 N  N   . GLY A 1 291 ? 121.760 -63.659 170.457 1.00 27.73  ?  302  GLY A N   1 
ATOM   2278 C  CA  . GLY A 1 291 ? 121.805 -65.077 170.763 1.00 28.77  ?  302  GLY A CA  1 
ATOM   2279 C  C   . GLY A 1 291 ? 121.744 -65.404 172.241 1.00 33.51  ?  302  GLY A C   1 
ATOM   2280 O  O   . GLY A 1 291 ? 121.016 -64.758 173.002 1.00 33.90  ?  302  GLY A O   1 
ATOM   2281 N  N   . GLY A 1 292 ? 122.503 -66.416 172.654 1.00 25.69  ?  303  GLY A N   1 
ATOM   2282 C  CA  . GLY A 1 292 ? 122.523 -66.831 174.042 1.00 26.87  ?  303  GLY A CA  1 
ATOM   2283 C  C   . GLY A 1 292 ? 121.343 -67.664 174.478 1.00 31.32  ?  303  GLY A C   1 
ATOM   2284 O  O   . GLY A 1 292 ? 121.120 -67.820 175.683 1.00 31.27  ?  303  GLY A O   1 
ATOM   2285 N  N   . MET A 1 293 ? 120.586 -68.213 173.539 1.00 28.65  ?  304  MET A N   1 
ATOM   2286 C  CA  . MET A 1 293 ? 119.359 -68.917 173.874 1.00 28.82  ?  304  MET A CA  1 
ATOM   2287 C  C   . MET A 1 293 ? 119.657 -70.321 174.396 1.00 33.60  ?  304  MET A C   1 
ATOM   2288 O  O   . MET A 1 293 ? 120.619 -70.962 173.961 1.00 32.36  ?  304  MET A O   1 
ATOM   2289 C  CB  . MET A 1 293 ? 118.449 -69.004 172.657 1.00 30.53  ?  304  MET A CB  1 
ATOM   2290 C  CG  . MET A 1 293 ? 118.105 -67.653 172.064 1.00 34.01  ?  304  MET A CG  1 
ATOM   2291 S  SD  . MET A 1 293 ? 117.348 -66.544 173.269 1.00 39.43  ?  304  MET A SD  1 
ATOM   2292 C  CE  . MET A 1 293 ? 115.747 -67.319 173.481 1.00 37.17  ?  304  MET A CE  1 
ATOM   2293 N  N   . PRO A 1 294 ? 118.850 -70.805 175.339 1.00 31.94  ?  305  PRO A N   1 
ATOM   2294 C  CA  . PRO A 1 294 ? 118.970 -72.201 175.777 1.00 32.25  ?  305  PRO A CA  1 
ATOM   2295 C  C   . PRO A 1 294 ? 118.871 -73.151 174.592 1.00 38.86  ?  305  PRO A C   1 
ATOM   2296 O  O   . PRO A 1 294 ? 117.921 -73.097 173.809 1.00 39.06  ?  305  PRO A O   1 
ATOM   2297 C  CB  . PRO A 1 294 ? 117.794 -72.366 176.743 1.00 34.12  ?  305  PRO A CB  1 
ATOM   2298 C  CG  . PRO A 1 294 ? 117.548 -70.979 177.255 1.00 38.62  ?  305  PRO A CG  1 
ATOM   2299 C  CD  . PRO A 1 294 ? 117.829 -70.068 176.097 1.00 33.77  ?  305  PRO A CD  1 
ATOM   2300 N  N   . ARG A 1 295 ? 119.867 -74.033 174.474 1.00 36.91  ?  306  ARG A N   1 
ATOM   2301 C  CA  . ARG A 1 295 ? 120.063 -74.782 173.236 1.00 36.95  ?  306  ARG A CA  1 
ATOM   2302 C  C   . ARG A 1 295 ? 118.897 -75.721 172.944 1.00 42.36  ?  306  ARG A C   1 
ATOM   2303 O  O   . ARG A 1 295 ? 118.476 -75.854 171.788 1.00 41.91  ?  306  ARG A O   1 
ATOM   2304 C  CB  . ARG A 1 295 ? 121.378 -75.558 173.305 1.00 37.41  ?  306  ARG A CB  1 
ATOM   2305 C  CG  . ARG A 1 295 ? 121.543 -76.593 172.202 1.00 52.37  ?  306  ARG A CG  1 
ATOM   2306 C  CD  . ARG A 1 295 ? 122.966 -77.124 172.120 1.00 60.57  ?  306  ARG A CD  1 
ATOM   2307 N  NE  . ARG A 1 295 ? 123.857 -76.203 171.419 1.00 63.31  ?  306  ARG A NE  1 
ATOM   2308 C  CZ  . ARG A 1 295 ? 124.690 -75.363 172.022 1.00 76.74  ?  306  ARG A CZ  1 
ATOM   2309 N  NH1 . ARG A 1 295 ? 124.755 -75.323 173.346 1.00 71.60  ?  306  ARG A NH1 1 
ATOM   2310 N  NH2 . ARG A 1 295 ? 125.462 -74.564 171.298 1.00 57.69  ?  306  ARG A NH2 1 
ATOM   2311 N  N   . ALA A 1 296 ? 118.355 -76.372 173.974 1.00 40.91  ?  307  ALA A N   1 
ATOM   2312 C  CA  . ALA A 1 296 ? 117.397 -77.450 173.743 1.00 40.91  ?  307  ALA A CA  1 
ATOM   2313 C  C   . ALA A 1 296 ? 116.065 -76.922 173.221 1.00 45.20  ?  307  ALA A C   1 
ATOM   2314 O  O   . ALA A 1 296 ? 115.537 -77.426 172.224 1.00 45.36  ?  307  ALA A O   1 
ATOM   2315 C  CB  . ALA A 1 296 ? 117.195 -78.254 175.028 1.00 42.25  ?  307  ALA A CB  1 
ATOM   2316 N  N   . SER A 1 297 ? 115.505 -75.906 173.878 1.00 46.03  ?  308  SER A N   1 
ATOM   2317 C  CA  . SER A 1 297 ? 114.149 -75.458 173.589 1.00 45.31  ?  308  SER A CA  1 
ATOM   2318 C  C   . SER A 1 297 ? 114.080 -74.122 172.860 1.00 48.13  ?  308  SER A C   1 
ATOM   2319 O  O   . SER A 1 297 ? 112.976 -73.667 172.541 1.00 48.43  ?  308  SER A O   1 
ATOM   2320 C  CB  . SER A 1 297 ? 113.338 -75.375 174.888 1.00 49.40  ?  308  SER A CB  1 
ATOM   2321 O  OG  . SER A 1 297 ? 114.024 -74.619 175.869 1.00 56.35  ?  308  SER A OG  1 
ATOM   2322 N  N   . TYR A 1 298 ? 115.219 -73.476 172.589 1.00 35.64  ?  309  TYR A N   1 
ATOM   2323 C  CA  . TYR A 1 298 ? 115.200 -72.206 171.872 1.00 34.64  ?  309  TYR A CA  1 
ATOM   2324 C  C   . TYR A 1 298 ? 116.358 -72.080 170.887 1.00 38.57  ?  309  TYR A C   1 
ATOM   2325 O  O   . TYR A 1 298 ? 116.679 -70.963 170.465 1.00 38.62  ?  309  TYR A O   1 
ATOM   2326 C  CB  . TYR A 1 298 ? 115.231 -71.021 172.845 1.00 35.51  ?  309  TYR A CB  1 
ATOM   2327 C  CG  . TYR A 1 298 ? 114.079 -70.995 173.824 1.00 36.63  ?  309  TYR A CG  1 
ATOM   2328 C  CD1 . TYR A 1 298 ? 112.827 -70.534 173.443 1.00 38.94  ?  309  TYR A CD1 1 
ATOM   2329 C  CD2 . TYR A 1 298 ? 114.246 -71.430 175.131 1.00 37.24  ?  309  TYR A CD2 1 
ATOM   2330 C  CE1 . TYR A 1 298 ? 111.772 -70.512 174.337 1.00 40.68  ?  309  TYR A CE1 1 
ATOM   2331 C  CE2 . TYR A 1 298 ? 113.198 -71.409 176.031 1.00 38.11  ?  309  TYR A CE2 1 
ATOM   2332 C  CZ  . TYR A 1 298 ? 111.964 -70.948 175.630 1.00 46.17  ?  309  TYR A CZ  1 
ATOM   2333 O  OH  . TYR A 1 298 ? 110.921 -70.927 176.527 1.00 47.87  ?  309  TYR A OH  1 
ATOM   2334 N  N   . GLY A 1 299 ? 116.992 -73.192 170.508 1.00 33.79  ?  310  GLY A N   1 
ATOM   2335 C  CA  . GLY A 1 299 ? 118.109 -73.117 169.583 1.00 33.62  ?  310  GLY A CA  1 
ATOM   2336 C  C   . GLY A 1 299 ? 117.724 -72.568 168.225 1.00 39.55  ?  310  GLY A C   1 
ATOM   2337 O  O   . GLY A 1 299 ? 118.564 -71.998 167.520 1.00 40.05  ?  310  GLY A O   1 
ATOM   2338 N  N   . ASP A 1 300 ? 116.457 -72.719 167.845 1.00 55.31  ?  311  ASP A N   1 
ATOM   2339 C  CA  . ASP A 1 300 ? 115.940 -72.255 166.565 1.00 55.25  ?  311  ASP A CA  1 
ATOM   2340 C  C   . ASP A 1 300 ? 115.509 -70.793 166.585 1.00 57.29  ?  311  ASP A C   1 
ATOM   2341 O  O   . ASP A 1 300 ? 115.096 -70.273 165.544 1.00 58.81  ?  311  ASP A O   1 
ATOM   2342 C  CB  . ASP A 1 300 ? 114.756 -73.130 166.134 1.00 57.77  ?  311  ASP A CB  1 
ATOM   2343 C  CG  . ASP A 1 300 ? 113.670 -73.213 167.199 1.00 73.33  ?  311  ASP A CG  1 
ATOM   2344 O  OD1 . ASP A 1 300 ? 114.010 -73.356 168.393 1.00 74.59  ?  311  ASP A OD1 1 
ATOM   2345 O  OD2 . ASP A 1 300 ? 112.474 -73.136 166.842 1.00 78.23  ?  311  ASP A OD2 1 
ATOM   2346 N  N   . ARG A 1 301 ? 115.589 -70.123 167.731 1.00 29.55  ?  312  ARG A N   1 
ATOM   2347 C  CA  . ARG A 1 301 ? 115.126 -68.747 167.834 1.00 27.06  ?  312  ARG A CA  1 
ATOM   2348 C  C   . ARG A 1 301 ? 116.199 -67.774 167.365 1.00 27.00  ?  312  ARG A C   1 
ATOM   2349 O  O   . ARG A 1 301 ? 117.391 -67.966 167.621 1.00 28.30  ?  312  ARG A O   1 
ATOM   2350 C  CB  . ARG A 1 301 ? 114.726 -68.425 169.275 1.00 27.17  ?  312  ARG A CB  1 
ATOM   2351 C  CG  . ARG A 1 301 ? 113.505 -69.188 169.772 1.00 32.74  ?  312  ARG A CG  1 
ATOM   2352 C  CD  . ARG A 1 301 ? 112.338 -69.047 168.804 1.00 29.37  ?  312  ARG A CD  1 
ATOM   2353 N  NE  . ARG A 1 301 ? 111.094 -69.573 169.355 1.00 46.43  ?  312  ARG A NE  1 
ATOM   2354 C  CZ  . ARG A 1 301 ? 110.154 -68.823 169.921 1.00 69.77  ?  312  ARG A CZ  1 
ATOM   2355 N  NH1 . ARG A 1 301 ? 110.317 -67.511 170.008 1.00 61.53  ?  312  ARG A NH1 1 
ATOM   2356 N  NH2 . ARG A 1 301 ? 109.050 -69.384 170.397 1.00 61.68  ?  312  ARG A NH2 1 
ATOM   2357 N  N   . HIS A 1 302 ? 115.764 -66.727 166.666 1.00 25.65  ?  313  HIS A N   1 
ATOM   2358 C  CA  . HIS A 1 302 ? 116.630 -65.638 166.218 1.00 22.36  ?  313  HIS A CA  1 
ATOM   2359 C  C   . HIS A 1 302 ? 116.344 -64.434 167.107 1.00 27.00  ?  313  HIS A C   1 
ATOM   2360 O  O   . HIS A 1 302 ? 115.286 -63.806 166.986 1.00 25.53  ?  313  HIS A O   1 
ATOM   2361 C  CB  . HIS A 1 302 ? 116.378 -65.314 164.747 1.00 20.93  ?  313  HIS A CB  1 
ATOM   2362 C  CG  . HIS A 1 302 ? 116.394 -66.515 163.857 1.00 23.32  ?  313  HIS A CG  1 
ATOM   2363 N  ND1 . HIS A 1 302 ? 117.504 -67.319 163.715 1.00 24.77  ?  313  HIS A ND1 1 
ATOM   2364 C  CD2 . HIS A 1 302 ? 115.437 -67.050 163.063 1.00 23.98  ?  313  HIS A CD2 1 
ATOM   2365 C  CE1 . HIS A 1 302 ? 117.231 -68.298 162.870 1.00 22.98  ?  313  HIS A CE1 1 
ATOM   2366 N  NE2 . HIS A 1 302 ? 115.983 -68.158 162.460 1.00 22.93  ?  313  HIS A NE2 1 
ATOM   2367 N  N   . CYS A 1 303 ? 117.281 -64.107 167.997 1.00 29.49  ?  314  CYS A N   1 
ATOM   2368 C  CA  . CYS A 1 303 ? 116.998 -63.180 169.082 1.00 31.04  ?  314  CYS A CA  1 
ATOM   2369 C  C   . CYS A 1 303 ? 118.082 -62.122 169.231 1.00 31.05  ?  314  CYS A C   1 
ATOM   2370 O  O   . CYS A 1 303 ? 119.273 -62.399 169.054 1.00 28.98  ?  314  CYS A O   1 
ATOM   2371 C  CB  . CYS A 1 303 ? 116.831 -63.932 170.405 1.00 33.43  ?  314  CYS A CB  1 
ATOM   2372 S  SG  . CYS A 1 303 ? 115.459 -65.108 170.404 1.00 38.37  ?  314  CYS A SG  1 
ATOM   2373 N  N   . ILE A 1 304 ? 117.645 -60.905 169.552 1.00 26.84  ?  315  ILE A N   1 
ATOM   2374 C  CA  . ILE A 1 304 ? 118.495 -59.833 170.061 1.00 26.70  ?  315  ILE A CA  1 
ATOM   2375 C  C   . ILE A 1 304 ? 117.914 -59.416 171.405 1.00 28.26  ?  315  ILE A C   1 
ATOM   2376 O  O   . ILE A 1 304 ? 116.766 -58.959 171.471 1.00 26.66  ?  315  ILE A O   1 
ATOM   2377 C  CB  . ILE A 1 304 ? 118.560 -58.628 169.105 1.00 29.66  ?  315  ILE A CB  1 
ATOM   2378 C  CG1 . ILE A 1 304 ? 118.991 -59.051 167.700 1.00 29.35  ?  315  ILE A CG1 1 
ATOM   2379 C  CG2 . ILE A 1 304 ? 119.502 -57.564 169.655 1.00 30.30  ?  315  ILE A CG2 1 
ATOM   2380 C  CD1 . ILE A 1 304 ? 120.473 -59.256 167.550 1.00 37.09  ?  315  ILE A CD1 1 
ATOM   2381 N  N   . SER A 1 305 ? 118.691 -59.577 172.473 1.00 20.90  ?  316  SER A N   1 
ATOM   2382 C  CA  . SER A 1 305 ? 118.234 -59.250 173.817 1.00 20.76  ?  316  SER A CA  1 
ATOM   2383 C  C   . SER A 1 305 ? 118.712 -57.858 174.212 1.00 24.19  ?  316  SER A C   1 
ATOM   2384 O  O   . SER A 1 305 ? 119.849 -57.475 173.921 1.00 22.29  ?  316  SER A O   1 
ATOM   2385 C  CB  . SER A 1 305 ? 118.731 -60.282 174.831 1.00 22.11  ?  316  SER A CB  1 
ATOM   2386 O  OG  . SER A 1 305 ? 118.295 -61.588 174.497 1.00 25.19  ?  316  SER A OG  1 
ATOM   2387 N  N   . VAL A 1 306 ? 117.832 -57.100 174.865 1.00 25.92  ?  317  VAL A N   1 
ATOM   2388 C  CA  . VAL A 1 306 ? 118.135 -55.755 175.343 1.00 26.01  ?  317  VAL A CA  1 
ATOM   2389 C  C   . VAL A 1 306 ? 117.864 -55.708 176.841 1.00 29.90  ?  317  VAL A C   1 
ATOM   2390 O  O   . VAL A 1 306 ? 116.768 -56.059 177.292 1.00 30.91  ?  317  VAL A O   1 
ATOM   2391 C  CB  . VAL A 1 306 ? 117.314 -54.682 174.602 1.00 27.74  ?  317  VAL A CB  1 
ATOM   2392 C  CG1 . VAL A 1 306 ? 117.736 -53.281 175.045 1.00 27.27  ?  317  VAL A CG1 1 
ATOM   2393 C  CG2 . VAL A 1 306 ? 117.472 -54.834 173.100 1.00 26.49  ?  317  VAL A CG2 1 
ATOM   2394 N  N   . ILE A 1 307 ? 118.867 -55.287 177.606 1.00 19.81  ?  318  ILE A N   1 
ATOM   2395 C  CA  . ILE A 1 307 ? 118.781 -55.159 179.056 1.00 20.21  ?  318  ILE A CA  1 
ATOM   2396 C  C   . ILE A 1 307 ? 118.946 -53.689 179.402 1.00 28.22  ?  318  ILE A C   1 
ATOM   2397 O  O   . ILE A 1 307 ? 119.890 -53.041 178.937 1.00 27.11  ?  318  ILE A O   1 
ATOM   2398 C  CB  . ILE A 1 307 ? 119.848 -56.011 179.768 1.00 21.61  ?  318  ILE A CB  1 
ATOM   2399 C  CG1 . ILE A 1 307 ? 119.708 -57.486 179.394 1.00 19.68  ?  318  ILE A CG1 1 
ATOM   2400 C  CG2 . ILE A 1 307 ? 119.770 -55.826 181.281 1.00 22.62  ?  318  ILE A CG2 1 
ATOM   2401 C  CD1 . ILE A 1 307 ? 120.722 -58.383 180.094 1.00 15.06  ?  318  ILE A CD1 1 
ATOM   2402 N  N   . HIS A 1 308 ? 118.028 -53.165 180.210 1.00 29.74  ?  319  HIS A N   1 
ATOM   2403 C  CA  . HIS A 1 308 ? 118.098 -51.763 180.609 1.00 30.78  ?  319  HIS A CA  1 
ATOM   2404 C  C   . HIS A 1 308 ? 117.156 -51.530 181.777 1.00 37.82  ?  319  HIS A C   1 
ATOM   2405 O  O   . HIS A 1 308 ? 115.954 -51.788 181.659 1.00 37.89  ?  319  HIS A O   1 
ATOM   2406 C  CB  . HIS A 1 308 ? 117.743 -50.845 179.440 1.00 31.22  ?  319  HIS A CB  1 
ATOM   2407 C  CG  . HIS A 1 308 ? 117.879 -49.391 179.760 1.00 35.26  ?  319  HIS A CG  1 
ATOM   2408 N  ND1 . HIS A 1 308 ? 116.791 -48.563 179.927 1.00 37.64  ?  319  HIS A ND1 1 
ATOM   2409 C  CD2 . HIS A 1 308 ? 118.973 -48.621 179.967 1.00 37.95  ?  319  HIS A CD2 1 
ATOM   2410 C  CE1 . HIS A 1 308 ? 117.208 -47.343 180.212 1.00 38.02  ?  319  HIS A CE1 1 
ATOM   2411 N  NE2 . HIS A 1 308 ? 118.529 -47.351 180.242 1.00 38.39  ?  319  HIS A NE2 1 
ATOM   2412 N  N   . ASP A 1 309 ? 117.705 -51.064 182.901 1.00 38.48  ?  320  ASP A N   1 
ATOM   2413 C  CA  . ASP A 1 309 ? 116.923 -50.591 184.042 1.00 38.47  ?  320  ASP A CA  1 
ATOM   2414 C  C   . ASP A 1 309 ? 115.953 -51.664 184.532 1.00 42.33  ?  320  ASP A C   1 
ATOM   2415 O  O   . ASP A 1 309 ? 114.746 -51.440 184.649 1.00 41.18  ?  320  ASP A O   1 
ATOM   2416 C  CB  . ASP A 1 309 ? 116.186 -49.296 183.685 1.00 40.31  ?  320  ASP A CB  1 
ATOM   2417 C  CG  . ASP A 1 309 ? 115.540 -48.632 184.887 1.00 52.81  ?  320  ASP A CG  1 
ATOM   2418 O  OD1 . ASP A 1 309 ? 115.965 -48.898 186.033 1.00 53.00  ?  320  ASP A OD1 1 
ATOM   2419 O  OD2 . ASP A 1 309 ? 114.595 -47.842 184.678 1.00 56.55  ?  320  ASP A OD2 1 
ATOM   2420 N  N   . GLY A 1 310 ? 116.493 -52.847 184.814 1.00 46.88  ?  321  GLY A N   1 
ATOM   2421 C  CA  . GLY A 1 310 ? 115.684 -53.963 185.258 1.00 47.74  ?  321  GLY A CA  1 
ATOM   2422 C  C   . GLY A 1 310 ? 114.742 -54.534 184.222 1.00 53.18  ?  321  GLY A C   1 
ATOM   2423 O  O   . GLY A 1 310 ? 113.987 -55.459 184.543 1.00 52.93  ?  321  GLY A O   1 
ATOM   2424 N  N   . GLN A 1 311 ? 114.755 -54.020 182.996 1.00 44.97  ?  322  GLN A N   1 
ATOM   2425 C  CA  . GLN A 1 311 ? 113.890 -54.496 181.926 1.00 44.47  ?  322  GLN A CA  1 
ATOM   2426 C  C   . GLN A 1 311 ? 114.723 -55.287 180.928 1.00 45.14  ?  322  GLN A C   1 
ATOM   2427 O  O   . GLN A 1 311 ? 115.776 -54.818 180.481 1.00 44.61  ?  322  GLN A O   1 
ATOM   2428 C  CB  . GLN A 1 311 ? 113.191 -53.329 181.226 1.00 46.26  ?  322  GLN A CB  1 
ATOM   2429 C  CG  . GLN A 1 311 ? 112.537 -52.336 182.176 1.00 69.85  ?  322  GLN A CG  1 
ATOM   2430 C  CD  . GLN A 1 311 ? 112.814 -50.892 181.796 1.00 88.22  ?  322  GLN A CD  1 
ATOM   2431 O  OE1 . GLN A 1 311 ? 113.165 -50.592 180.654 1.00 82.63  ?  322  GLN A OE1 1 
ATOM   2432 N  NE2 . GLN A 1 311 ? 112.665 -49.989 182.759 1.00 75.21  ?  322  GLN A NE2 1 
ATOM   2433 N  N   . GLN A 1 312 ? 114.253 -56.482 180.584 1.00 36.60  ?  323  GLN A N   1 
ATOM   2434 C  CA  . GLN A 1 312 ? 114.946 -57.330 179.626 1.00 34.24  ?  323  GLN A CA  1 
ATOM   2435 C  C   . GLN A 1 312 ? 113.934 -57.928 178.663 1.00 35.88  ?  323  GLN A C   1 
ATOM   2436 O  O   . GLN A 1 312 ? 112.880 -58.413 179.085 1.00 35.20  ?  323  GLN A O   1 
ATOM   2437 C  CB  . GLN A 1 312 ? 115.741 -58.435 180.332 1.00 35.08  ?  323  GLN A CB  1 
ATOM   2438 C  CG  . GLN A 1 312 ? 116.415 -59.403 179.376 1.00 43.27  ?  323  GLN A CG  1 
ATOM   2439 C  CD  . GLN A 1 312 ? 117.557 -60.160 180.017 1.00 54.13  ?  323  GLN A CD  1 
ATOM   2440 O  OE1 . GLN A 1 312 ? 117.989 -59.834 181.122 1.00 49.87  ?  323  GLN A OE1 1 
ATOM   2441 N  NE2 . GLN A 1 312 ? 118.057 -61.175 179.323 1.00 41.50  ?  323  GLN A NE2 1 
ATOM   2442 N  N   . THR A 1 313 ? 114.251 -57.874 177.372 1.00 29.75  ?  324  THR A N   1 
ATOM   2443 C  CA  . THR A 1 313 ? 113.391 -58.402 176.322 1.00 28.05  ?  324  THR A CA  1 
ATOM   2444 C  C   . THR A 1 313 ? 114.252 -59.101 175.284 1.00 28.13  ?  324  THR A C   1 
ATOM   2445 O  O   . THR A 1 313 ? 115.253 -58.542 174.826 1.00 26.01  ?  324  THR A O   1 
ATOM   2446 C  CB  . THR A 1 313 ? 112.568 -57.289 175.660 1.00 36.93  ?  324  THR A CB  1 
ATOM   2447 O  OG1 . THR A 1 313 ? 111.526 -56.867 176.546 1.00 42.73  ?  324  THR A OG1 1 
ATOM   2448 C  CG2 . THR A 1 313 ? 111.956 -57.776 174.354 1.00 33.10  ?  324  THR A CG2 1 
ATOM   2449 N  N   . ALA A 1 314 ? 113.867 -60.322 174.925 1.00 31.54  ?  325  ALA A N   1 
ATOM   2450 C  CA  . ALA A 1 314 ? 114.521 -61.079 173.861 1.00 29.96  ?  325  ALA A CA  1 
ATOM   2451 C  C   . ALA A 1 314 ? 113.692 -60.887 172.596 1.00 33.25  ?  325  ALA A C   1 
ATOM   2452 O  O   . ALA A 1 314 ? 112.771 -61.655 172.313 1.00 32.59  ?  325  ALA A O   1 
ATOM   2453 C  CB  . ALA A 1 314 ? 114.651 -62.550 174.236 1.00 30.11  ?  325  ALA A CB  1 
ATOM   2454 N  N   . PHE A 1 315 ? 114.015 -59.839 171.836 1.00 29.21  ?  326  PHE A N   1 
ATOM   2455 C  CA  . PHE A 1 315 ? 113.316 -59.585 170.582 1.00 28.34  ?  326  PHE A CA  1 
ATOM   2456 C  C   . PHE A 1 315 ? 113.448 -60.782 169.651 1.00 30.05  ?  326  PHE A C   1 
ATOM   2457 O  O   . PHE A 1 315 ? 114.556 -61.244 169.369 1.00 27.42  ?  326  PHE A O   1 
ATOM   2458 C  CB  . PHE A 1 315 ? 113.866 -58.329 169.915 1.00 30.15  ?  326  PHE A CB  1 
ATOM   2459 C  CG  . PHE A 1 315 ? 113.522 -57.065 170.640 1.00 33.31  ?  326  PHE A CG  1 
ATOM   2460 C  CD1 . PHE A 1 315 ? 112.257 -56.516 170.532 1.00 38.29  ?  326  PHE A CD1 1 
ATOM   2461 C  CD2 . PHE A 1 315 ? 114.461 -56.423 171.429 1.00 35.97  ?  326  PHE A CD2 1 
ATOM   2462 C  CE1 . PHE A 1 315 ? 111.932 -55.351 171.198 1.00 39.78  ?  326  PHE A CE1 1 
ATOM   2463 C  CE2 . PHE A 1 315 ? 114.141 -55.257 172.096 1.00 39.62  ?  326  PHE A CE2 1 
ATOM   2464 C  CZ  . PHE A 1 315 ? 112.875 -54.720 171.980 1.00 38.12  ?  326  PHE A CZ  1 
ATOM   2465 N  N   . ASP A 1 316 ? 112.310 -61.282 169.173 1.00 25.38  ?  327  ASP A N   1 
ATOM   2466 C  CA  . ASP A 1 316 ? 112.245 -62.527 168.421 1.00 24.22  ?  327  ASP A CA  1 
ATOM   2467 C  C   . ASP A 1 316 ? 111.819 -62.238 166.988 1.00 26.65  ?  327  ASP A C   1 
ATOM   2468 O  O   . ASP A 1 316 ? 110.772 -61.620 166.761 1.00 26.04  ?  327  ASP A O   1 
ATOM   2469 C  CB  . ASP A 1 316 ? 111.271 -63.505 169.093 1.00 26.33  ?  327  ASP A CB  1 
ATOM   2470 C  CG  . ASP A 1 316 ? 111.297 -64.888 168.464 1.00 35.91  ?  327  ASP A CG  1 
ATOM   2471 O  OD1 . ASP A 1 316 ? 112.399 -65.445 168.279 1.00 34.99  ?  327  ASP A OD1 1 
ATOM   2472 O  OD2 . ASP A 1 316 ? 110.208 -65.427 168.171 1.00 45.93  ?  327  ASP A OD2 1 
ATOM   2473 N  N   . PHE A 1 317 ? 112.628 -62.690 166.031 1.00 22.85  ?  328  PHE A N   1 
ATOM   2474 C  CA  . PHE A 1 317 ? 112.405 -62.451 164.613 1.00 20.97  ?  328  PHE A CA  1 
ATOM   2475 C  C   . PHE A 1 317 ? 112.178 -63.774 163.891 1.00 24.37  ?  328  PHE A C   1 
ATOM   2476 O  O   . PHE A 1 317 ? 112.757 -64.803 164.251 1.00 23.89  ?  328  PHE A O   1 
ATOM   2477 C  CB  . PHE A 1 317 ? 113.595 -61.712 163.977 1.00 22.33  ?  328  PHE A CB  1 
ATOM   2478 C  CG  . PHE A 1 317 ? 114.114 -60.562 164.800 1.00 24.20  ?  328  PHE A CG  1 
ATOM   2479 C  CD1 . PHE A 1 317 ? 115.057 -60.773 165.793 1.00 26.75  ?  328  PHE A CD1 1 
ATOM   2480 C  CD2 . PHE A 1 317 ? 113.667 -59.270 164.572 1.00 25.48  ?  328  PHE A CD2 1 
ATOM   2481 C  CE1 . PHE A 1 317 ? 115.537 -59.718 166.548 1.00 27.58  ?  328  PHE A CE1 1 
ATOM   2482 C  CE2 . PHE A 1 317 ? 114.146 -58.211 165.321 1.00 27.84  ?  328  PHE A CE2 1 
ATOM   2483 C  CZ  . PHE A 1 317 ? 115.079 -58.435 166.310 1.00 26.12  ?  328  PHE A CZ  1 
ATOM   2484 N  N   . THR A 1 318 ? 111.337 -63.735 162.855 1.00 19.59  ?  329  THR A N   1 
ATOM   2485 C  CA  . THR A 1 318 ? 110.954 -64.929 162.112 1.00 20.14  ?  329  THR A CA  1 
ATOM   2486 C  C   . THR A 1 318 ? 111.967 -65.323 161.039 1.00 25.74  ?  329  THR A C   1 
ATOM   2487 O  O   . THR A 1 318 ? 111.686 -66.237 160.254 1.00 26.72  ?  329  THR A O   1 
ATOM   2488 C  CB  . THR A 1 318 ? 109.575 -64.732 161.470 1.00 27.54  ?  329  THR A CB  1 
ATOM   2489 O  OG1 . THR A 1 318 ? 109.643 -63.688 160.492 1.00 32.15  ?  329  THR A OG1 1 
ATOM   2490 C  CG2 . THR A 1 318 ? 108.544 -64.357 162.523 1.00 24.95  ?  329  THR A CG2 1 
ATOM   2491 N  N   . SER A 1 319 ? 113.123 -64.666 160.981 1.00 21.51  ?  330  SER A N   1 
ATOM   2492 C  CA  . SER A 1 319 ? 114.162 -65.043 160.033 1.00 19.98  ?  330  SER A CA  1 
ATOM   2493 C  C   . SER A 1 319 ? 115.521 -64.714 160.635 1.00 22.43  ?  330  SER A C   1 
ATOM   2494 O  O   . SER A 1 319 ? 115.625 -64.000 161.634 1.00 20.39  ?  330  SER A O   1 
ATOM   2495 C  CB  . SER A 1 319 ? 113.970 -64.350 158.680 1.00 21.66  ?  330  SER A CB  1 
ATOM   2496 O  OG  . SER A 1 319 ? 113.942 -62.942 158.824 1.00 27.21  ?  330  SER A OG  1 
ATOM   2497 N  N   . ARG A 1 320 ? 116.567 -65.242 160.005 1.00 23.49  ?  331  ARG A N   1 
ATOM   2498 C  CA  . ARG A 1 320 ? 117.909 -65.159 160.567 1.00 22.30  ?  331  ARG A CA  1 
ATOM   2499 C  C   . ARG A 1 320 ? 118.409 -63.718 160.598 1.00 25.88  ?  331  ARG A C   1 
ATOM   2500 O  O   . ARG A 1 320 ? 118.214 -62.953 159.651 1.00 26.52  ?  331  ARG A O   1 
ATOM   2501 C  CB  . ARG A 1 320 ? 118.865 -66.035 159.756 1.00 19.62  ?  331  ARG A CB  1 
ATOM   2502 C  CG  . ARG A 1 320 ? 120.206 -66.281 160.422 1.00 36.87  ?  331  ARG A CG  1 
ATOM   2503 C  CD  . ARG A 1 320 ? 121.005 -67.307 159.647 1.00 46.24  ?  331  ARG A CD  1 
ATOM   2504 N  NE  . ARG A 1 320 ? 120.993 -67.024 158.216 1.00 57.74  ?  331  ARG A NE  1 
ATOM   2505 C  CZ  . ARG A 1 320 ? 121.843 -66.201 157.611 1.00 69.54  ?  331  ARG A CZ  1 
ATOM   2506 N  NH1 . ARG A 1 320 ? 122.778 -65.576 158.315 1.00 56.33  ?  331  ARG A NH1 1 
ATOM   2507 N  NH2 . ARG A 1 320 ? 121.759 -66.004 156.303 1.00 50.68  ?  331  ARG A NH2 1 
ATOM   2508 N  N   . VAL A 1 321 ? 119.057 -63.351 161.703 1.00 18.86  ?  332  VAL A N   1 
ATOM   2509 C  CA  . VAL A 1 321 ? 119.624 -62.014 161.846 1.00 18.90  ?  332  VAL A CA  1 
ATOM   2510 C  C   . VAL A 1 321 ? 120.874 -61.908 160.979 1.00 24.48  ?  332  VAL A C   1 
ATOM   2511 O  O   . VAL A 1 321 ? 121.844 -62.652 161.165 1.00 24.21  ?  332  VAL A O   1 
ATOM   2512 C  CB  . VAL A 1 321 ? 119.940 -61.704 163.315 1.00 21.99  ?  332  VAL A CB  1 
ATOM   2513 C  CG1 . VAL A 1 321 ? 120.727 -60.407 163.427 1.00 21.30  ?  332  VAL A CG1 1 
ATOM   2514 C  CG2 . VAL A 1 321 ? 118.660 -61.622 164.129 1.00 21.43  ?  332  VAL A CG2 1 
ATOM   2515 N  N   . ILE A 1 322 ? 120.852 -60.981 160.025 1.00 20.91  ?  333  ILE A N   1 
ATOM   2516 C  CA  . ILE A 1 322 ? 122.008 -60.731 159.170 1.00 20.05  ?  333  ILE A CA  1 
ATOM   2517 C  C   . ILE A 1 322 ? 122.963 -59.736 159.820 1.00 24.58  ?  333  ILE A C   1 
ATOM   2518 O  O   . ILE A 1 322 ? 124.184 -59.860 159.692 1.00 25.11  ?  333  ILE A O   1 
ATOM   2519 C  CB  . ILE A 1 322 ? 121.533 -60.244 157.786 1.00 22.25  ?  333  ILE A CB  1 
ATOM   2520 C  CG1 . ILE A 1 322 ? 120.661 -61.308 157.112 1.00 21.08  ?  333  ILE A CG1 1 
ATOM   2521 C  CG2 . ILE A 1 322 ? 122.708 -59.898 156.898 1.00 22.39  ?  333  ILE A CG2 1 
ATOM   2522 C  CD1 . ILE A 1 322 ? 121.366 -62.632 156.877 1.00 23.07  ?  333  ILE A CD1 1 
ATOM   2523 N  N   . GLY A 1 323 ? 122.423 -58.763 160.539 1.00 21.98  ?  334  GLY A N   1 
ATOM   2524 C  CA  . GLY A 1 323 ? 123.242 -57.789 161.226 1.00 21.35  ?  334  GLY A CA  1 
ATOM   2525 C  C   . GLY A 1 323 ? 122.350 -56.780 161.913 1.00 24.62  ?  334  GLY A C   1 
ATOM   2526 O  O   . GLY A 1 323 ? 121.169 -56.630 161.581 1.00 25.11  ?  334  GLY A O   1 
ATOM   2527 N  N   . PHE A 1 324 ? 122.936 -56.095 162.890 1.00 22.13  ?  335  PHE A N   1 
ATOM   2528 C  CA  . PHE A 1 324 ? 122.193 -55.083 163.623 1.00 22.72  ?  335  PHE A CA  1 
ATOM   2529 C  C   . PHE A 1 324 ? 123.137 -53.966 164.035 1.00 26.99  ?  335  PHE A C   1 
ATOM   2530 O  O   . PHE A 1 324 ? 124.356 -54.139 164.080 1.00 24.35  ?  335  PHE A O   1 
ATOM   2531 C  CB  . PHE A 1 324 ? 121.473 -55.671 164.847 1.00 24.43  ?  335  PHE A CB  1 
ATOM   2532 C  CG  . PHE A 1 324 ? 122.397 -56.146 165.933 1.00 26.08  ?  335  PHE A CG  1 
ATOM   2533 C  CD1 . PHE A 1 324 ? 123.011 -57.385 165.848 1.00 27.87  ?  335  PHE A CD1 1 
ATOM   2534 C  CD2 . PHE A 1 324 ? 122.631 -55.360 167.051 1.00 28.83  ?  335  PHE A CD2 1 
ATOM   2535 C  CE1 . PHE A 1 324 ? 123.854 -57.823 166.848 1.00 29.64  ?  335  PHE A CE1 1 
ATOM   2536 C  CE2 . PHE A 1 324 ? 123.472 -55.792 168.056 1.00 31.86  ?  335  PHE A CE2 1 
ATOM   2537 C  CZ  . PHE A 1 324 ? 124.085 -57.026 167.956 1.00 29.84  ?  335  PHE A CZ  1 
ATOM   2538 N  N   . THR A 1 325 ? 122.548 -52.807 164.315 1.00 24.41  ?  336  THR A N   1 
ATOM   2539 C  CA  . THR A 1 325 ? 123.278 -51.660 164.825 1.00 25.46  ?  336  THR A CA  1 
ATOM   2540 C  C   . THR A 1 325 ? 122.375 -50.922 165.801 1.00 30.90  ?  336  THR A C   1 
ATOM   2541 O  O   . THR A 1 325 ? 121.149 -51.066 165.773 1.00 29.37  ?  336  THR A O   1 
ATOM   2542 C  CB  . THR A 1 325 ? 123.741 -50.723 163.697 1.00 32.92  ?  336  THR A CB  1 
ATOM   2543 O  OG1 . THR A 1 325 ? 124.691 -49.784 164.210 1.00 37.28  ?  336  THR A OG1 1 
ATOM   2544 C  CG2 . THR A 1 325 ? 122.564 -49.962 163.112 1.00 29.45  ?  336  THR A CG2 1 
ATOM   2545 N  N   . VAL A 1 326 ? 122.993 -50.146 166.685 1.00 23.56  ?  337  VAL A N   1 
ATOM   2546 C  CA  . VAL A 1 326 ? 122.270 -49.347 167.666 1.00 23.32  ?  337  VAL A CA  1 
ATOM   2547 C  C   . VAL A 1 326 ? 122.641 -47.891 167.448 1.00 29.00  ?  337  VAL A C   1 
ATOM   2548 O  O   . VAL A 1 326 ? 123.808 -47.512 167.604 1.00 27.61  ?  337  VAL A O   1 
ATOM   2549 C  CB  . VAL A 1 326 ? 122.577 -49.782 169.106 1.00 26.27  ?  337  VAL A CB  1 
ATOM   2550 C  CG1 . VAL A 1 326 ? 121.941 -48.817 170.086 1.00 26.55  ?  337  VAL A CG1 1 
ATOM   2551 C  CG2 . VAL A 1 326 ? 122.066 -51.189 169.339 1.00 25.85  ?  337  VAL A CG2 1 
ATOM   2552 N  N   . LEU A 1 327 ? 121.653 -47.081 167.078 1.00 27.33  ?  338  LEU A N   1 
ATOM   2553 C  CA  . LEU A 1 327 ? 121.881 -45.654 166.899 1.00 27.79  ?  338  LEU A CA  1 
ATOM   2554 C  C   . LEU A 1 327 ? 122.033 -44.996 168.262 1.00 32.31  ?  338  LEU A C   1 
ATOM   2555 O  O   . LEU A 1 327 ? 121.132 -45.077 169.104 1.00 30.05  ?  338  LEU A O   1 
ATOM   2556 C  CB  . LEU A 1 327 ? 120.731 -45.020 166.121 1.00 27.65  ?  338  LEU A CB  1 
ATOM   2557 C  CG  . LEU A 1 327 ? 120.321 -45.708 164.817 1.00 30.74  ?  338  LEU A CG  1 
ATOM   2558 C  CD1 . LEU A 1 327 ? 119.437 -44.793 163.993 1.00 30.17  ?  338  LEU A CD1 1 
ATOM   2559 C  CD2 . LEU A 1 327 ? 121.532 -46.152 164.016 1.00 29.64  ?  338  LEU A CD2 1 
ATOM   2560 N  N   . THR A 1 328 ? 123.175 -44.359 168.484 1.00 37.77  ?  339  THR A N   1 
ATOM   2561 C  CA  . THR A 1 328 ? 123.452 -43.634 169.712 1.00 39.59  ?  339  THR A CA  1 
ATOM   2562 C  C   . THR A 1 328 ? 123.412 -42.137 169.440 1.00 47.70  ?  339  THR A C   1 
ATOM   2563 O  O   . THR A 1 328 ? 123.822 -41.682 168.368 1.00 47.35  ?  339  THR A O   1 
ATOM   2564 C  CB  . THR A 1 328 ? 124.820 -44.019 170.279 1.00 39.90  ?  339  THR A CB  1 
ATOM   2565 O  OG1 . THR A 1 328 ? 125.840 -43.674 169.333 1.00 39.87  ?  339  THR A OG1 1 
ATOM   2566 C  CG2 . THR A 1 328 ? 124.880 -45.511 170.555 1.00 36.14  ?  339  THR A CG2 1 
ATOM   2567 N  N   . GLU A 1 329 ? 122.909 -41.375 170.417 1.00 53.96  ?  340  GLU A N   1 
ATOM   2568 C  CA  . GLU A 1 329 ? 122.955 -39.918 170.331 1.00 55.35  ?  340  GLU A CA  1 
ATOM   2569 C  C   . GLU A 1 329 ? 124.379 -39.399 170.210 1.00 62.50  ?  340  GLU A C   1 
ATOM   2570 O  O   . GLU A 1 329 ? 124.591 -38.300 169.683 1.00 63.53  ?  340  GLU A O   1 
ATOM   2571 C  CB  . GLU A 1 329 ? 122.303 -39.283 171.559 1.00 57.14  ?  340  GLU A CB  1 
ATOM   2572 C  CG  . GLU A 1 329 ? 120.816 -39.528 171.715 1.00 64.09  ?  340  GLU A CG  1 
ATOM   2573 C  CD  . GLU A 1 329 ? 120.265 -38.904 172.981 1.00 91.55  ?  340  GLU A CD  1 
ATOM   2574 O  OE1 . GLU A 1 329 ? 120.608 -37.737 173.270 1.00 83.60  ?  340  GLU A OE1 1 
ATOM   2575 O  OE2 . GLU A 1 329 ? 119.500 -39.585 173.694 1.00 90.68  ?  340  GLU A OE2 1 
ATOM   2576 N  N   . ALA A 1 330 ? 125.355 -40.172 170.674 1.00 46.16  ?  341  ALA A N   1 
ATOM   2577 C  CA  . ALA A 1 330 ? 126.715 -39.701 170.855 1.00 46.89  ?  341  ALA A CA  1 
ATOM   2578 C  C   . ALA A 1 330 ? 127.467 -39.605 169.533 1.00 52.93  ?  341  ALA A C   1 
ATOM   2579 O  O   . ALA A 1 330 ? 127.156 -40.281 168.548 1.00 50.63  ?  341  ALA A O   1 
ATOM   2580 C  CB  . ALA A 1 330 ? 127.476 -40.630 171.802 1.00 47.42  ?  341  ALA A CB  1 
ATOM   2581 N  N   . ASP A 1 331 ? 128.469 -38.733 169.535 1.00 84.10  ?  342  ASP A N   1 
ATOM   2582 C  CA  . ASP A 1 331 ? 129.562 -38.686 168.575 1.00 84.79  ?  342  ASP A CA  1 
ATOM   2583 C  C   . ASP A 1 331 ? 130.819 -39.050 169.366 1.00 90.01  ?  342  ASP A C   1 
ATOM   2584 O  O   . ASP A 1 331 ? 130.742 -39.148 170.597 1.00 89.87  ?  342  ASP A O   1 
ATOM   2585 C  CB  . ASP A 1 331 ? 129.651 -37.304 167.922 1.00 87.45  ?  342  ASP A CB  1 
ATOM   2586 C  CG  . ASP A 1 331 ? 129.759 -36.188 168.935 1.00 104.85 ?  342  ASP A CG  1 
ATOM   2587 O  OD1 . ASP A 1 331 ? 128.744 -35.873 169.591 1.00 114.45 ?  342  ASP A OD1 1 
ATOM   2588 O  OD2 . ASP A 1 331 ? 130.869 -35.638 169.088 1.00 105.66 ?  342  ASP A OD2 1 
ATOM   2589 N  N   . PRO A 1 332 ? 131.985 -39.280 168.721 1.00 74.77  ?  343  PRO A N   1 
ATOM   2590 C  CA  . PRO A 1 332 ? 133.166 -39.750 169.471 1.00 74.58  ?  343  PRO A CA  1 
ATOM   2591 C  C   . PRO A 1 332 ? 133.556 -38.937 170.702 1.00 78.73  ?  343  PRO A C   1 
ATOM   2592 O  O   . PRO A 1 332 ? 134.191 -39.478 171.614 1.00 78.12  ?  343  PRO A O   1 
ATOM   2593 C  CB  . PRO A 1 332 ? 134.286 -39.707 168.415 1.00 76.24  ?  343  PRO A CB  1 
ATOM   2594 C  CG  . PRO A 1 332 ? 133.698 -38.995 167.215 1.00 80.75  ?  343  PRO A CG  1 
ATOM   2595 C  CD  . PRO A 1 332 ? 132.244 -39.291 167.271 1.00 76.17  ?  343  PRO A CD  1 
ATOM   2596 N  N   . ALA A 1 333 ? 133.183 -37.655 170.756 1.00 75.22  ?  344  ALA A N   1 
ATOM   2597 C  CA  . ALA A 1 333 ? 133.596 -36.781 171.850 1.00 74.97  ?  344  ALA A CA  1 
ATOM   2598 C  C   . ALA A 1 333 ? 132.711 -36.876 173.089 1.00 76.08  ?  344  ALA A C   1 
ATOM   2599 O  O   . ALA A 1 333 ? 133.167 -36.520 174.182 1.00 76.09  ?  344  ALA A O   1 
ATOM   2600 C  CB  . ALA A 1 333 ? 133.627 -35.326 171.375 1.00 76.14  ?  344  ALA A CB  1 
ATOM   2601 N  N   . ALA A 1 334 ? 131.471 -37.342 172.953 1.00 57.84  ?  345  ALA A N   1 
ATOM   2602 C  CA  . ALA A 1 334 ? 130.530 -37.327 174.065 1.00 56.52  ?  345  ALA A CA  1 
ATOM   2603 C  C   . ALA A 1 334 ? 130.972 -38.285 175.174 1.00 57.64  ?  345  ALA A C   1 
ATOM   2604 O  O   . ALA A 1 334 ? 131.844 -39.140 174.993 1.00 56.47  ?  345  ALA A O   1 
ATOM   2605 C  CB  . ALA A 1 334 ? 129.126 -37.692 173.585 1.00 57.13  ?  345  ALA A CB  1 
ATOM   2606 N  N   . THR A 1 335 ? 130.345 -38.129 176.341 1.00 52.51  ?  346  THR A N   1 
ATOM   2607 C  CA  . THR A 1 335 ? 130.648 -38.964 177.498 1.00 51.86  ?  346  THR A CA  1 
ATOM   2608 C  C   . THR A 1 335 ? 129.761 -40.202 177.572 1.00 52.18  ?  346  THR A C   1 
ATOM   2609 O  O   . THR A 1 335 ? 130.244 -41.288 177.915 1.00 51.72  ?  346  THR A O   1 
ATOM   2610 C  CB  . THR A 1 335 ? 130.515 -38.149 178.790 1.00 67.28  ?  346  THR A CB  1 
ATOM   2611 O  OG1 . THR A 1 335 ? 129.256 -37.463 178.803 1.00 71.01  ?  346  THR A OG1 1 
ATOM   2612 C  CG2 . THR A 1 335 ? 131.643 -37.132 178.901 1.00 67.50  ?  346  THR A CG2 1 
ATOM   2613 N  N   . PHE A 1 336 ? 128.476 -40.066 177.254 1.00 46.05  ?  347  PHE A N   1 
ATOM   2614 C  CA  . PHE A 1 336 ? 127.534 -41.174 177.282 1.00 44.33  ?  347  PHE A CA  1 
ATOM   2615 C  C   . PHE A 1 336 ? 127.102 -41.535 175.866 1.00 44.04  ?  347  PHE A C   1 
ATOM   2616 O  O   . PHE A 1 336 ? 127.123 -40.704 174.954 1.00 43.17  ?  347  PHE A O   1 
ATOM   2617 C  CB  . PHE A 1 336 ? 126.300 -40.830 178.127 1.00 47.17  ?  347  PHE A CB  1 
ATOM   2618 C  CG  . PHE A 1 336 ? 126.629 -40.285 179.489 1.00 49.24  ?  347  PHE A CG  1 
ATOM   2619 C  CD1 . PHE A 1 336 ? 126.984 -41.134 180.525 1.00 51.88  ?  347  PHE A CD1 1 
ATOM   2620 C  CD2 . PHE A 1 336 ? 126.572 -38.923 179.736 1.00 51.89  ?  347  PHE A CD2 1 
ATOM   2621 C  CE1 . PHE A 1 336 ? 127.284 -40.634 181.781 1.00 53.03  ?  347  PHE A CE1 1 
ATOM   2622 C  CE2 . PHE A 1 336 ? 126.870 -38.419 180.990 1.00 54.92  ?  347  PHE A CE2 1 
ATOM   2623 C  CZ  . PHE A 1 336 ? 127.227 -39.276 182.013 1.00 52.51  ?  347  PHE A CZ  1 
ATOM   2624 N  N   . ASP A 1 337 ? 126.703 -42.798 175.696 1.00 32.81  ?  348  ASP A N   1 
ATOM   2625 C  CA  . ASP A 1 337 ? 126.236 -43.276 174.399 1.00 30.75  ?  348  ASP A CA  1 
ATOM   2626 C  C   . ASP A 1 337 ? 124.834 -42.767 174.094 1.00 36.50  ?  348  ASP A C   1 
ATOM   2627 O  O   . ASP A 1 337 ? 124.578 -42.247 173.003 1.00 35.82  ?  348  ASP A O   1 
ATOM   2628 C  CB  . ASP A 1 337 ? 126.267 -44.804 174.362 1.00 30.53  ?  348  ASP A CB  1 
ATOM   2629 C  CG  . ASP A 1 337 ? 127.674 -45.354 174.341 1.00 33.87  ?  348  ASP A CG  1 
ATOM   2630 O  OD1 . ASP A 1 337 ? 128.377 -45.130 173.334 1.00 33.02  ?  348  ASP A OD1 1 
ATOM   2631 O  OD2 . ASP A 1 337 ? 128.081 -45.989 175.337 1.00 33.07  ?  348  ASP A OD2 1 
ATOM   2632 N  N   . ASP A 1 338 ? 123.919 -42.907 175.056 1.00 38.68  ?  349  ASP A N   1 
ATOM   2633 C  CA  . ASP A 1 338 ? 122.525 -42.499 174.930 1.00 39.32  ?  349  ASP A CA  1 
ATOM   2634 C  C   . ASP A 1 338 ? 121.892 -43.128 173.694 1.00 44.33  ?  349  ASP A C   1 
ATOM   2635 O  O   . ASP A 1 338 ? 121.616 -42.426 172.713 1.00 44.22  ?  349  ASP A O   1 
ATOM   2636 C  CB  . ASP A 1 338 ? 122.409 -40.974 174.876 1.00 41.41  ?  349  ASP A CB  1 
ATOM   2637 C  CG  . ASP A 1 338 ? 122.833 -40.308 176.175 1.00 45.40  ?  349  ASP A CG  1 
ATOM   2638 O  OD1 . ASP A 1 338 ? 122.534 -40.857 177.257 1.00 46.59  ?  349  ASP A OD1 1 
ATOM   2639 O  OD2 . ASP A 1 338 ? 123.467 -39.233 176.111 1.00 44.67  ?  349  ASP A OD2 1 
ATOM   2640 N  N   . PRO A 1 339 ? 121.650 -44.436 173.697 1.00 43.01  ?  350  PRO A N   1 
ATOM   2641 C  CA  . PRO A 1 339 ? 121.006 -45.066 172.542 1.00 41.73  ?  350  PRO A CA  1 
ATOM   2642 C  C   . PRO A 1 339 ? 119.571 -44.589 172.388 1.00 43.27  ?  350  PRO A C   1 
ATOM   2643 O  O   . PRO A 1 339 ? 118.930 -44.136 173.339 1.00 43.24  ?  350  PRO A O   1 
ATOM   2644 C  CB  . PRO A 1 339 ? 121.055 -46.563 172.872 1.00 43.43  ?  350  PRO A CB  1 
ATOM   2645 C  CG  . PRO A 1 339 ? 122.025 -46.691 174.008 1.00 48.03  ?  350  PRO A CG  1 
ATOM   2646 C  CD  . PRO A 1 339 ? 121.941 -45.409 174.761 1.00 44.33  ?  350  PRO A CD  1 
ATOM   2647 N  N   . TYR A 1 340 ? 119.065 -44.697 171.157 1.00 36.27  ?  351  TYR A N   1 
ATOM   2648 C  CA  . TYR A 1 340 ? 117.668 -44.380 170.898 1.00 34.16  ?  351  TYR A CA  1 
ATOM   2649 C  C   . TYR A 1 340 ? 117.018 -45.261 169.841 1.00 36.12  ?  351  TYR A C   1 
ATOM   2650 O  O   . TYR A 1 340 ? 115.816 -45.107 169.602 1.00 34.56  ?  351  TYR A O   1 
ATOM   2651 C  CB  . TYR A 1 340 ? 117.513 -42.902 170.494 1.00 33.65  ?  351  TYR A CB  1 
ATOM   2652 C  CG  . TYR A 1 340 ? 118.253 -42.485 169.242 1.00 31.50  ?  351  TYR A CG  1 
ATOM   2653 C  CD1 . TYR A 1 340 ? 117.657 -42.587 167.992 1.00 32.82  ?  351  TYR A CD1 1 
ATOM   2654 C  CD2 . TYR A 1 340 ? 119.536 -41.964 169.315 1.00 30.67  ?  351  TYR A CD2 1 
ATOM   2655 C  CE1 . TYR A 1 340 ? 118.325 -42.198 166.847 1.00 32.66  ?  351  TYR A CE1 1 
ATOM   2656 C  CE2 . TYR A 1 340 ? 120.215 -41.571 168.175 1.00 31.34  ?  351  TYR A CE2 1 
ATOM   2657 C  CZ  . TYR A 1 340 ? 119.605 -41.690 166.945 1.00 37.56  ?  351  TYR A CZ  1 
ATOM   2658 O  OH  . TYR A 1 340 ? 120.275 -41.301 165.809 1.00 37.97  ?  351  TYR A OH  1 
ATOM   2659 N  N   . ALA A 1 341 ? 117.755 -46.176 169.211 1.00 35.22  ?  352  ALA A N   1 
ATOM   2660 C  CA  . ALA A 1 341 ? 117.175 -47.032 168.187 1.00 34.39  ?  352  ALA A CA  1 
ATOM   2661 C  C   . ALA A 1 341 ? 118.040 -48.268 167.996 1.00 34.75  ?  352  ALA A C   1 
ATOM   2662 O  O   . ALA A 1 341 ? 119.268 -48.174 167.953 1.00 33.37  ?  352  ALA A O   1 
ATOM   2663 C  CB  . ALA A 1 341 ? 117.024 -46.288 166.855 1.00 34.98  ?  352  ALA A CB  1 
ATOM   2664 N  N   . LEU A 1 342 ? 117.383 -49.419 167.887 1.00 27.21  ?  353  LEU A N   1 
ATOM   2665 C  CA  . LEU A 1 342 ? 118.007 -50.674 167.488 1.00 25.30  ?  353  LEU A CA  1 
ATOM   2666 C  C   . LEU A 1 342 ? 117.553 -50.990 166.068 1.00 26.55  ?  353  LEU A C   1 
ATOM   2667 O  O   . LEU A 1 342 ? 116.351 -51.119 165.812 1.00 24.08  ?  353  LEU A O   1 
ATOM   2668 C  CB  . LEU A 1 342 ? 117.626 -51.803 168.449 1.00 25.36  ?  353  LEU A CB  1 
ATOM   2669 C  CG  . LEU A 1 342 ? 117.890 -53.254 168.029 1.00 28.97  ?  353  LEU A CG  1 
ATOM   2670 C  CD1 . LEU A 1 342 ? 119.380 -53.530 167.911 1.00 27.47  ?  353  LEU A CD1 1 
ATOM   2671 C  CD2 . LEU A 1 342 ? 117.233 -54.230 169.002 1.00 29.63  ?  353  LEU A CD2 1 
ATOM   2672 N  N   . VAL A 1 343 ? 118.507 -51.088 165.148 1.00 26.72  ?  354  VAL A N   1 
ATOM   2673 C  CA  . VAL A 1 343 ? 118.228 -51.366 163.743 1.00 26.41  ?  354  VAL A CA  1 
ATOM   2674 C  C   . VAL A 1 343 ? 118.680 -52.788 163.456 1.00 25.62  ?  354  VAL A C   1 
ATOM   2675 O  O   . VAL A 1 343 ? 119.865 -53.105 163.596 1.00 25.66  ?  354  VAL A O   1 
ATOM   2676 C  CB  . VAL A 1 343 ? 118.929 -50.363 162.815 1.00 30.35  ?  354  VAL A CB  1 
ATOM   2677 C  CG1 . VAL A 1 343 ? 118.636 -50.693 161.359 1.00 29.02  ?  354  VAL A CG1 1 
ATOM   2678 C  CG2 . VAL A 1 343 ? 118.496 -48.941 163.147 1.00 30.53  ?  354  VAL A CG2 1 
ATOM   2679 N  N   . VAL A 1 344 ? 117.744 -53.645 163.058 1.00 17.55  ?  355  VAL A N   1 
ATOM   2680 C  CA  . VAL A 1 344 ? 118.014 -55.062 162.840 1.00 16.30  ?  355  VAL A CA  1 
ATOM   2681 C  C   . VAL A 1 344 ? 117.731 -55.392 161.383 1.00 22.09  ?  355  VAL A C   1 
ATOM   2682 O  O   . VAL A 1 344 ? 116.613 -55.179 160.895 1.00 23.53  ?  355  VAL A O   1 
ATOM   2683 C  CB  . VAL A 1 344 ? 117.180 -55.955 163.774 1.00 17.93  ?  355  VAL A CB  1 
ATOM   2684 C  CG1 . VAL A 1 344 ? 117.436 -57.425 163.468 1.00 16.11  ?  355  VAL A CG1 1 
ATOM   2685 C  CG2 . VAL A 1 344 ? 117.501 -55.652 165.228 1.00 17.29  ?  355  VAL A CG2 1 
ATOM   2686 N  N   . LEU A 1 345 ? 118.737 -55.915 160.691 1.00 19.58  ?  356  LEU A N   1 
ATOM   2687 C  CA  . LEU A 1 345 ? 118.565 -56.421 159.333 1.00 19.45  ?  356  LEU A CA  1 
ATOM   2688 C  C   . LEU A 1 345 ? 118.366 -57.929 159.427 1.00 24.87  ?  356  LEU A C   1 
ATOM   2689 O  O   . LEU A 1 345 ? 119.322 -58.680 159.647 1.00 24.27  ?  356  LEU A O   1 
ATOM   2690 C  CB  . LEU A 1 345 ? 119.760 -56.066 158.450 1.00 18.78  ?  356  LEU A CB  1 
ATOM   2691 C  CG  . LEU A 1 345 ? 119.706 -56.621 157.021 1.00 20.67  ?  356  LEU A CG  1 
ATOM   2692 C  CD1 . LEU A 1 345 ? 118.466 -56.122 156.290 1.00 20.10  ?  356  LEU A CD1 1 
ATOM   2693 C  CD2 . LEU A 1 345 ? 120.969 -56.280 156.235 1.00 18.42  ?  356  LEU A CD2 1 
ATOM   2694 N  N   . ALA A 1 346 ? 117.121 -58.365 159.279 1.00 21.49  ?  357  ALA A N   1 
ATOM   2695 C  CA  . ALA A 1 346 ? 116.811 -59.781 159.194 1.00 21.73  ?  357  ALA A CA  1 
ATOM   2696 C  C   . ALA A 1 346 ? 116.860 -60.234 157.741 1.00 26.15  ?  357  ALA A C   1 
ATOM   2697 O  O   . ALA A 1 346 ? 116.803 -59.426 156.810 1.00 25.66  ?  357  ALA A O   1 
ATOM   2698 C  CB  . ALA A 1 346 ? 115.435 -60.074 159.796 1.00 22.41  ?  357  ALA A CB  1 
ATOM   2699 N  N   . GLU A 1 347 ? 116.969 -61.551 157.555 1.00 23.14  ?  358  GLU A N   1 
ATOM   2700 C  CA  . GLU A 1 347 ? 117.076 -62.098 156.209 1.00 23.10  ?  358  GLU A CA  1 
ATOM   2701 C  C   . GLU A 1 347 ? 115.835 -61.817 155.370 1.00 25.58  ?  358  GLU A C   1 
ATOM   2702 O  O   . GLU A 1 347 ? 115.912 -61.864 154.136 1.00 25.58  ?  358  GLU A O   1 
ATOM   2703 C  CB  . GLU A 1 347 ? 117.346 -63.605 156.278 1.00 24.71  ?  358  GLU A CB  1 
ATOM   2704 C  CG  . GLU A 1 347 ? 117.647 -64.251 154.932 1.00 38.64  ?  358  GLU A CG  1 
ATOM   2705 C  CD  . GLU A 1 347 ? 118.229 -65.644 155.057 1.00 67.86  ?  358  GLU A CD  1 
ATOM   2706 O  OE1 . GLU A 1 347 ? 119.441 -65.803 154.802 1.00 71.91  ?  358  GLU A OE1 1 
ATOM   2707 O  OE2 . GLU A 1 347 ? 117.476 -66.577 155.412 1.00 60.97  ?  358  GLU A OE2 1 
ATOM   2708 N  N   . GLU A 1 348 ? 114.702 -61.503 156.000 1.00 19.74  ?  359  GLU A N   1 
ATOM   2709 C  CA  . GLU A 1 348 ? 113.458 -61.271 155.276 1.00 18.22  ?  359  GLU A CA  1 
ATOM   2710 C  C   . GLU A 1 348 ? 112.835 -59.903 155.524 1.00 21.39  ?  359  GLU A C   1 
ATOM   2711 O  O   . GLU A 1 348 ? 111.798 -59.604 154.920 1.00 21.25  ?  359  GLU A O   1 
ATOM   2712 C  CB  . GLU A 1 348 ? 112.432 -62.361 155.618 1.00 18.88  ?  359  GLU A CB  1 
ATOM   2713 C  CG  . GLU A 1 348 ? 112.875 -63.784 155.296 1.00 24.85  ?  359  GLU A CG  1 
ATOM   2714 C  CD  . GLU A 1 348 ? 112.875 -64.094 153.809 1.00 38.49  ?  359  GLU A CD  1 
ATOM   2715 O  OE1 . GLU A 1 348 ? 113.313 -65.204 153.437 1.00 30.79  ?  359  GLU A OE1 1 
ATOM   2716 O  OE2 . GLU A 1 348 ? 112.435 -63.239 153.012 1.00 33.06  ?  359  GLU A OE2 1 
ATOM   2717 N  N   . GLU A 1 349 ? 113.420 -59.067 156.383 1.00 18.05  ?  360  GLU A N   1 
ATOM   2718 C  CA  . GLU A 1 349 ? 112.832 -57.760 156.671 1.00 17.55  ?  360  GLU A CA  1 
ATOM   2719 C  C   . GLU A 1 349 ? 113.807 -56.910 157.473 1.00 20.29  ?  360  GLU A C   1 
ATOM   2720 O  O   . GLU A 1 349 ? 114.809 -57.400 157.999 1.00 20.98  ?  360  GLU A O   1 
ATOM   2721 C  CB  . GLU A 1 349 ? 111.511 -57.891 157.434 1.00 18.21  ?  360  GLU A CB  1 
ATOM   2722 C  CG  . GLU A 1 349 ? 111.646 -58.517 158.802 1.00 17.82  ?  360  GLU A CG  1 
ATOM   2723 C  CD  . GLU A 1 349 ? 110.313 -58.638 159.503 1.00 29.08  ?  360  GLU A CD  1 
ATOM   2724 O  OE1 . GLU A 1 349 ? 109.535 -57.661 159.477 1.00 31.86  ?  360  GLU A OE1 1 
ATOM   2725 O  OE2 . GLU A 1 349 ? 110.036 -59.717 160.065 1.00 26.90  ?  360  GLU A OE2 1 
ATOM   2726 N  N   . LEU A 1 350 ? 113.482 -55.622 157.564 1.00 12.41  ?  361  LEU A N   1 
ATOM   2727 C  CA  . LEU A 1 350 ? 114.185 -54.660 158.400 1.00 12.12  ?  361  LEU A CA  1 
ATOM   2728 C  C   . LEU A 1 350 ? 113.271 -54.237 159.542 1.00 19.33  ?  361  LEU A C   1 
ATOM   2729 O  O   . LEU A 1 350 ? 112.089 -53.953 159.327 1.00 19.29  ?  361  LEU A O   1 
ATOM   2730 C  CB  . LEU A 1 350 ? 114.605 -53.431 157.587 1.00 12.23  ?  361  LEU A CB  1 
ATOM   2731 C  CG  . LEU A 1 350 ? 115.407 -52.340 158.300 1.00 16.74  ?  361  LEU A CG  1 
ATOM   2732 C  CD1 . LEU A 1 350 ? 116.860 -52.756 158.444 1.00 15.19  ?  361  LEU A CD1 1 
ATOM   2733 C  CD2 . LEU A 1 350 ? 115.294 -51.017 157.559 1.00 20.87  ?  361  LEU A CD2 1 
ATOM   2734 N  N   . VAL A 1 351 ? 113.816 -54.203 160.758 1.00 22.45  ?  362  VAL A N   1 
ATOM   2735 C  CA  . VAL A 1 351 ? 113.053 -53.869 161.957 1.00 21.91  ?  362  VAL A CA  1 
ATOM   2736 C  C   . VAL A 1 351 ? 113.800 -52.783 162.719 1.00 23.87  ?  362  VAL A C   1 
ATOM   2737 O  O   . VAL A 1 351 ? 115.017 -52.879 162.912 1.00 21.67  ?  362  VAL A O   1 
ATOM   2738 C  CB  . VAL A 1 351 ? 112.826 -55.101 162.855 1.00 24.60  ?  362  VAL A CB  1 
ATOM   2739 C  CG1 . VAL A 1 351 ? 111.945 -54.741 164.042 1.00 24.34  ?  362  VAL A CG1 1 
ATOM   2740 C  CG2 . VAL A 1 351 ? 112.211 -56.247 162.055 1.00 23.17  ?  362  VAL A CG2 1 
ATOM   2741 N  N   . VAL A 1 352 ? 113.075 -51.751 163.144 1.00 23.28  ?  363  VAL A N   1 
ATOM   2742 C  CA  . VAL A 1 352 ? 113.633 -50.648 163.920 1.00 22.90  ?  363  VAL A CA  1 
ATOM   2743 C  C   . VAL A 1 352 ? 112.837 -50.528 165.212 1.00 30.05  ?  363  VAL A C   1 
ATOM   2744 O  O   . VAL A 1 352 ? 111.605 -50.439 165.180 1.00 29.99  ?  363  VAL A O   1 
ATOM   2745 C  CB  . VAL A 1 352 ? 113.609 -49.323 163.133 1.00 24.08  ?  363  VAL A CB  1 
ATOM   2746 C  CG1 . VAL A 1 352 ? 114.213 -48.197 163.962 1.00 22.12  ?  363  VAL A CG1 1 
ATOM   2747 C  CG2 . VAL A 1 352 ? 114.352 -49.474 161.815 1.00 22.86  ?  363  VAL A CG2 1 
ATOM   2748 N  N   . ILE A 1 353 ? 113.540 -50.526 166.343 1.00 25.21  ?  364  ILE A N   1 
ATOM   2749 C  CA  . ILE A 1 353 ? 112.925 -50.496 167.665 1.00 24.41  ?  364  ILE A CA  1 
ATOM   2750 C  C   . ILE A 1 353 ? 113.243 -49.159 168.321 1.00 29.71  ?  364  ILE A C   1 
ATOM   2751 O  O   . ILE A 1 353 ? 114.392 -48.702 168.292 1.00 27.80  ?  364  ILE A O   1 
ATOM   2752 C  CB  . ILE A 1 353 ? 113.412 -51.665 168.540 1.00 26.73  ?  364  ILE A CB  1 
ATOM   2753 C  CG1 . ILE A 1 353 ? 113.119 -53.006 167.862 1.00 25.45  ?  364  ILE A CG1 1 
ATOM   2754 C  CG2 . ILE A 1 353 ? 112.763 -51.614 169.914 1.00 27.59  ?  364  ILE A CG2 1 
ATOM   2755 C  CD1 . ILE A 1 353 ? 111.648 -53.291 167.667 1.00 29.39  ?  364  ILE A CD1 1 
ATOM   2756 N  N   . ASP A 1 354 ? 112.227 -48.538 168.913 1.00 32.90  ?  365  ASP A N   1 
ATOM   2757 C  CA  . ASP A 1 354 ? 112.407 -47.291 169.647 1.00 34.77  ?  365  ASP A CA  1 
ATOM   2758 C  C   . ASP A 1 354 ? 112.916 -47.605 171.049 1.00 39.19  ?  365  ASP A C   1 
ATOM   2759 O  O   . ASP A 1 354 ? 112.244 -48.301 171.816 1.00 38.57  ?  365  ASP A O   1 
ATOM   2760 C  CB  . ASP A 1 354 ? 111.087 -46.523 169.704 1.00 37.59  ?  365  ASP A CB  1 
ATOM   2761 C  CG  . ASP A 1 354 ? 111.235 -45.131 170.290 1.00 49.70  ?  365  ASP A CG  1 
ATOM   2762 O  OD1 . ASP A 1 354 ? 112.335 -44.781 170.764 1.00 48.80  ?  365  ASP A OD1 1 
ATOM   2763 O  OD2 . ASP A 1 354 ? 110.237 -44.380 170.269 1.00 57.89  ?  365  ASP A OD2 1 
ATOM   2764 N  N   . LEU A 1 355 ? 114.098 -47.094 171.386 1.00 31.02  ?  366  LEU A N   1 
ATOM   2765 C  CA  . LEU A 1 355 ? 114.703 -47.339 172.689 1.00 32.11  ?  366  LEU A CA  1 
ATOM   2766 C  C   . LEU A 1 355 ? 114.519 -46.181 173.664 1.00 41.53  ?  366  LEU A C   1 
ATOM   2767 O  O   . LEU A 1 355 ? 114.999 -46.264 174.799 1.00 42.17  ?  366  LEU A O   1 
ATOM   2768 C  CB  . LEU A 1 355 ? 116.195 -47.653 172.528 1.00 30.94  ?  366  LEU A CB  1 
ATOM   2769 C  CG  . LEU A 1 355 ? 116.533 -48.949 171.782 1.00 32.91  ?  366  LEU A CG  1 
ATOM   2770 C  CD1 . LEU A 1 355 ? 118.040 -49.160 171.711 1.00 31.66  ?  366  LEU A CD1 1 
ATOM   2771 C  CD2 . LEU A 1 355 ? 115.855 -50.143 172.434 1.00 33.27  ?  366  LEU A CD2 1 
ATOM   2772 N  N   . GLN A 1 356 ? 113.838 -45.110 173.256 1.00 43.65  ?  367  GLN A N   1 
ATOM   2773 C  CA  . GLN A 1 356 ? 113.538 -43.993 174.144 1.00 45.95  ?  367  GLN A CA  1 
ATOM   2774 C  C   . GLN A 1 356 ? 112.221 -44.192 174.881 1.00 52.36  ?  367  GLN A C   1 
ATOM   2775 O  O   . GLN A 1 356 ? 112.109 -43.850 176.063 1.00 54.79  ?  367  GLN A O   1 
ATOM   2776 C  CB  . GLN A 1 356 ? 113.482 -42.682 173.353 1.00 47.90  ?  367  GLN A CB  1 
ATOM   2777 C  CG  . GLN A 1 356 ? 114.740 -42.361 172.570 1.00 63.38  ?  367  GLN A CG  1 
ATOM   2778 C  CD  . GLN A 1 356 ? 115.671 -41.422 173.310 1.00 86.37  ?  367  GLN A CD  1 
ATOM   2779 O  OE1 . GLN A 1 356 ? 115.462 -40.209 173.324 1.00 84.75  ?  367  GLN A OE1 1 
ATOM   2780 N  NE2 . GLN A 1 356 ? 116.707 -41.978 173.925 1.00 77.38  ?  367  GLN A NE2 1 
ATOM   2781 N  N   . THR A 1 357 ? 111.225 -44.749 174.198 1.00 39.58  ?  368  THR A N   1 
ATOM   2782 C  CA  . THR A 1 357 ? 109.886 -44.899 174.744 1.00 39.92  ?  368  THR A CA  1 
ATOM   2783 C  C   . THR A 1 357 ? 109.756 -46.219 175.491 1.00 45.46  ?  368  THR A C   1 
ATOM   2784 O  O   . THR A 1 357 ? 110.225 -47.261 175.023 1.00 45.22  ?  368  THR A O   1 
ATOM   2785 C  CB  . THR A 1 357 ? 108.848 -44.822 173.621 1.00 40.89  ?  368  THR A CB  1 
ATOM   2786 O  OG1 . THR A 1 357 ? 108.971 -43.563 172.949 1.00 39.55  ?  368  THR A OG1 1 
ATOM   2787 C  CG2 . THR A 1 357 ? 107.437 -44.962 174.172 1.00 37.73  ?  368  THR A CG2 1 
ATOM   2788 N  N   . ALA A 1 358 ? 109.123 -46.160 176.663 1.00 45.14  ?  369  ALA A N   1 
ATOM   2789 C  CA  . ALA A 1 358 ? 108.855 -47.360 177.442 1.00 44.94  ?  369  ALA A CA  1 
ATOM   2790 C  C   . ALA A 1 358 ? 108.031 -48.351 176.629 1.00 46.53  ?  369  ALA A C   1 
ATOM   2791 O  O   . ALA A 1 358 ? 107.178 -47.973 175.822 1.00 45.98  ?  369  ALA A O   1 
ATOM   2792 C  CB  . ALA A 1 358 ? 108.122 -47.002 178.736 1.00 46.41  ?  369  ALA A CB  1 
ATOM   2793 N  N   . GLY A 1 359 ? 108.294 -49.638 176.852 1.00 54.71  ?  370  GLY A N   1 
ATOM   2794 C  CA  . GLY A 1 359 ? 107.715 -50.692 176.053 1.00 53.44  ?  370  GLY A CA  1 
ATOM   2795 C  C   . GLY A 1 359 ? 108.478 -51.015 174.786 1.00 53.40  ?  370  GLY A C   1 
ATOM   2796 O  O   . GLY A 1 359 ? 108.252 -52.078 174.199 1.00 52.13  ?  370  GLY A O   1 
ATOM   2797 N  N   . TRP A 1 360 ? 109.379 -50.127 174.356 1.00 35.65  ?  371  TRP A N   1 
ATOM   2798 C  CA  . TRP A 1 360 ? 110.217 -50.299 173.174 1.00 33.80  ?  371  TRP A CA  1 
ATOM   2799 C  C   . TRP A 1 360 ? 109.361 -50.577 171.943 1.00 32.57  ?  371  TRP A C   1 
ATOM   2800 O  O   . TRP A 1 360 ? 109.358 -51.702 171.424 1.00 28.35  ?  371  TRP A O   1 
ATOM   2801 C  CB  . TRP A 1 360 ? 111.242 -51.412 173.409 1.00 32.47  ?  371  TRP A CB  1 
ATOM   2802 C  CG  . TRP A 1 360 ? 112.270 -51.037 174.444 1.00 33.63  ?  371  TRP A CG  1 
ATOM   2803 C  CD1 . TRP A 1 360 ? 112.648 -49.773 174.798 1.00 36.81  ?  371  TRP A CD1 1 
ATOM   2804 C  CD2 . TRP A 1 360 ? 113.034 -51.929 175.269 1.00 33.32  ?  371  TRP A CD2 1 
ATOM   2805 N  NE1 . TRP A 1 360 ? 113.604 -49.822 175.783 1.00 36.24  ?  371  TRP A NE1 1 
ATOM   2806 C  CE2 . TRP A 1 360 ? 113.858 -51.132 176.091 1.00 37.63  ?  371  TRP A CE2 1 
ATOM   2807 C  CE3 . TRP A 1 360 ? 113.104 -53.320 175.390 1.00 34.01  ?  371  TRP A CE3 1 
ATOM   2808 C  CZ2 . TRP A 1 360 ? 114.741 -51.682 177.020 1.00 36.71  ?  371  TRP A CZ2 1 
ATOM   2809 C  CZ3 . TRP A 1 360 ? 113.982 -53.864 176.315 1.00 35.13  ?  371  TRP A CZ3 1 
ATOM   2810 C  CH2 . TRP A 1 360 ? 114.787 -53.046 177.117 1.00 36.15  ?  371  TRP A CH2 1 
ATOM   2811 N  N   . PRO A 1 361 ? 108.634 -49.579 171.445 1.00 32.27  ?  372  PRO A N   1 
ATOM   2812 C  CA  . PRO A 1 361 ? 107.703 -49.809 170.336 1.00 31.00  ?  372  PRO A CA  1 
ATOM   2813 C  C   . PRO A 1 361 ? 108.418 -49.773 168.996 1.00 31.81  ?  372  PRO A C   1 
ATOM   2814 O  O   . PRO A 1 361 ? 109.518 -49.212 168.882 1.00 29.58  ?  372  PRO A O   1 
ATOM   2815 C  CB  . PRO A 1 361 ? 106.714 -48.642 170.472 1.00 33.52  ?  372  PRO A CB  1 
ATOM   2816 C  CG  . PRO A 1 361 ? 107.552 -47.536 171.030 1.00 38.88  ?  372  PRO A CG  1 
ATOM   2817 C  CD  . PRO A 1 361 ? 108.583 -48.187 171.929 1.00 34.66  ?  372  PRO A CD  1 
ATOM   2818 N  N   . PRO A 1 362 ? 107.824 -50.355 167.957 1.00 25.61  ?  373  PRO A N   1 
ATOM   2819 C  CA  . PRO A 1 362 ? 108.469 -50.358 166.641 1.00 24.07  ?  373  PRO A CA  1 
ATOM   2820 C  C   . PRO A 1 362 ? 108.318 -49.024 165.923 1.00 26.85  ?  373  PRO A C   1 
ATOM   2821 O  O   . PRO A 1 362 ? 107.435 -48.217 166.218 1.00 26.12  ?  373  PRO A O   1 
ATOM   2822 C  CB  . PRO A 1 362 ? 107.725 -51.469 165.892 1.00 25.17  ?  373  PRO A CB  1 
ATOM   2823 C  CG  . PRO A 1 362 ? 106.372 -51.477 166.507 1.00 30.29  ?  373  PRO A CG  1 
ATOM   2824 C  CD  . PRO A 1 362 ? 106.575 -51.136 167.962 1.00 26.91  ?  373  PRO A CD  1 
ATOM   2825 N  N   . VAL A 1 363 ? 109.211 -48.807 164.960 1.00 25.87  ?  374  VAL A N   1 
ATOM   2826 C  CA  . VAL A 1 363 ? 109.208 -47.616 164.118 1.00 25.90  ?  374  VAL A CA  1 
ATOM   2827 C  C   . VAL A 1 363 ? 108.803 -48.032 162.711 1.00 32.56  ?  374  VAL A C   1 
ATOM   2828 O  O   . VAL A 1 363 ? 109.301 -49.037 162.189 1.00 31.88  ?  374  VAL A O   1 
ATOM   2829 C  CB  . VAL A 1 363 ? 110.583 -46.925 164.117 1.00 28.63  ?  374  VAL A CB  1 
ATOM   2830 C  CG1 . VAL A 1 363 ? 110.521 -45.609 163.356 1.00 27.54  ?  374  VAL A CG1 1 
ATOM   2831 C  CG2 . VAL A 1 363 ? 111.059 -46.704 165.543 1.00 29.39  ?  374  VAL A CG2 1 
ATOM   2832 N  N   . GLN A 1 364 ? 107.896 -47.268 162.104 1.00 39.73  ?  375  GLN A N   1 
ATOM   2833 C  CA  . GLN A 1 364 ? 107.425 -47.583 160.762 1.00 38.88  ?  375  GLN A CA  1 
ATOM   2834 C  C   . GLN A 1 364 ? 108.533 -47.379 159.737 1.00 43.67  ?  375  GLN A C   1 
ATOM   2835 O  O   . GLN A 1 364 ? 109.450 -46.577 159.930 1.00 46.26  ?  375  GLN A O   1 
ATOM   2836 C  CB  . GLN A 1 364 ? 106.223 -46.713 160.395 1.00 41.05  ?  375  GLN A CB  1 
ATOM   2837 C  CG  . GLN A 1 364 ? 105.001 -46.942 161.258 1.00 65.05  ?  375  GLN A CG  1 
ATOM   2838 C  CD  . GLN A 1 364 ? 103.895 -45.951 160.969 1.00 83.18  ?  375  GLN A CD  1 
ATOM   2839 O  OE1 . GLN A 1 364 ? 103.558 -45.118 161.810 1.00 74.41  ?  375  GLN A OE1 1 
ATOM   2840 N  NE2 . GLN A 1 364 ? 103.321 -46.035 159.774 1.00 74.59  ?  375  GLN A NE2 1 
ATOM   2841 N  N   . LEU A 1 365 ? 108.438 -48.116 158.634 1.00 29.94  ?  376  LEU A N   1 
ATOM   2842 C  CA  . LEU A 1 365 ? 109.445 -47.927 157.601 1.00 27.88  ?  376  LEU A CA  1 
ATOM   2843 C  C   . LEU A 1 365 ? 108.944 -46.973 156.526 1.00 32.65  ?  376  LEU A C   1 
ATOM   2844 O  O   . LEU A 1 365 ? 107.802 -47.097 156.068 1.00 33.29  ?  376  LEU A O   1 
ATOM   2845 C  CB  . LEU A 1 365 ? 109.817 -49.258 156.946 1.00 26.41  ?  376  LEU A CB  1 
ATOM   2846 C  CG  . LEU A 1 365 ? 110.400 -50.370 157.819 1.00 28.52  ?  376  LEU A CG  1 
ATOM   2847 C  CD1 . LEU A 1 365 ? 110.737 -51.585 156.966 1.00 27.20  ?  376  LEU A CD1 1 
ATOM   2848 C  CD2 . LEU A 1 365 ? 111.626 -49.883 158.572 1.00 25.63  ?  376  LEU A CD2 1 
ATOM   2849 N  N   . PRO A 1 366 ? 109.771 -46.011 156.108 1.00 30.47  ?  377  PRO A N   1 
ATOM   2850 C  CA  . PRO A 1 366 ? 109.435 -45.211 154.925 1.00 30.14  ?  377  PRO A CA  1 
ATOM   2851 C  C   . PRO A 1 366 ? 109.819 -45.889 153.623 1.00 34.52  ?  377  PRO A C   1 
ATOM   2852 O  O   . PRO A 1 366 ? 109.372 -45.446 152.555 1.00 34.29  ?  377  PRO A O   1 
ATOM   2853 C  CB  . PRO A 1 366 ? 110.248 -43.931 155.140 1.00 31.88  ?  377  PRO A CB  1 
ATOM   2854 C  CG  . PRO A 1 366 ? 111.468 -44.416 155.849 1.00 35.05  ?  377  PRO A CG  1 
ATOM   2855 C  CD  . PRO A 1 366 ? 111.030 -45.568 156.729 1.00 30.58  ?  377  PRO A CD  1 
ATOM   2856 N  N   . TYR A 1 367 ? 110.628 -46.941 153.685 1.00 33.95  ?  378  TYR A N   1 
ATOM   2857 C  CA  . TYR A 1 367 ? 111.078 -47.685 152.516 1.00 33.04  ?  378  TYR A CA  1 
ATOM   2858 C  C   . TYR A 1 367 ? 111.570 -49.049 152.993 1.00 31.40  ?  378  TYR A C   1 
ATOM   2859 O  O   . TYR A 1 367 ? 111.414 -49.405 154.166 1.00 30.98  ?  378  TYR A O   1 
ATOM   2860 C  CB  . TYR A 1 367 ? 112.152 -46.904 151.747 1.00 35.33  ?  378  TYR A CB  1 
ATOM   2861 C  CG  . TYR A 1 367 ? 113.273 -46.365 152.609 1.00 39.20  ?  378  TYR A CG  1 
ATOM   2862 C  CD1 . TYR A 1 367 ? 114.167 -47.223 153.237 1.00 41.05  ?  378  TYR A CD1 1 
ATOM   2863 C  CD2 . TYR A 1 367 ? 113.449 -44.999 152.781 1.00 40.97  ?  378  TYR A CD2 1 
ATOM   2864 C  CE1 . TYR A 1 367 ? 115.192 -46.740 154.024 1.00 41.05  ?  378  TYR A CE1 1 
ATOM   2865 C  CE2 . TYR A 1 367 ? 114.476 -44.505 153.566 1.00 41.69  ?  378  TYR A CE2 1 
ATOM   2866 C  CZ  . TYR A 1 367 ? 115.344 -45.382 154.185 1.00 44.46  ?  378  TYR A CZ  1 
ATOM   2867 O  OH  . TYR A 1 367 ? 116.369 -44.903 154.968 1.00 39.51  ?  378  TYR A OH  1 
ATOM   2868 N  N   . LEU A 1 368 ? 112.174 -49.811 152.078 1.00 20.13  ?  379  LEU A N   1 
ATOM   2869 C  CA  . LEU A 1 368 ? 112.684 -51.156 152.365 1.00 18.50  ?  379  LEU A CA  1 
ATOM   2870 C  C   . LEU A 1 368 ? 111.608 -52.045 152.982 1.00 22.41  ?  379  LEU A C   1 
ATOM   2871 O  O   . LEU A 1 368 ? 111.890 -52.901 153.823 1.00 22.10  ?  379  LEU A O   1 
ATOM   2872 C  CB  . LEU A 1 368 ? 113.919 -51.102 153.269 1.00 17.96  ?  379  LEU A CB  1 
ATOM   2873 C  CG  . LEU A 1 368 ? 115.190 -50.530 152.645 1.00 21.13  ?  379  LEU A CG  1 
ATOM   2874 C  CD1 . LEU A 1 368 ? 116.241 -50.256 153.711 1.00 21.64  ?  379  LEU A CD1 1 
ATOM   2875 C  CD2 . LEU A 1 368 ? 115.735 -51.474 151.592 1.00 19.69  ?  379  LEU A CD2 1 
ATOM   2876 N  N   . ALA A 1 369 ? 110.362 -51.851 152.567 1.00 22.84  ?  380  ALA A N   1 
ATOM   2877 C  CA  . ALA A 1 369 ? 109.265 -52.636 153.111 1.00 23.29  ?  380  ALA A CA  1 
ATOM   2878 C  C   . ALA A 1 369 ? 109.266 -54.037 152.516 1.00 27.53  ?  380  ALA A C   1 
ATOM   2879 O  O   . ALA A 1 369 ? 109.471 -54.223 151.313 1.00 25.60  ?  380  ALA A O   1 
ATOM   2880 C  CB  . ALA A 1 369 ? 107.928 -51.946 152.840 1.00 24.67  ?  380  ALA A CB  1 
ATOM   2881 N  N   . SER A 1 370 ? 109.045 -55.028 153.374 1.00 28.61  ?  381  SER A N   1 
ATOM   2882 C  CA  . SER A 1 370 ? 108.935 -56.416 152.937 1.00 27.93  ?  381  SER A CA  1 
ATOM   2883 C  C   . SER A 1 370 ? 107.539 -56.615 152.368 1.00 32.07  ?  381  SER A C   1 
ATOM   2884 O  O   . SER A 1 370 ? 106.570 -56.796 153.109 1.00 32.10  ?  381  SER A O   1 
ATOM   2885 C  CB  . SER A 1 370 ? 109.214 -57.370 154.092 1.00 29.93  ?  381  SER A CB  1 
ATOM   2886 O  OG  . SER A 1 370 ? 110.576 -57.304 154.475 1.00 31.62  ?  381  SER A OG  1 
ATOM   2887 N  N   . LEU A 1 371 ? 107.433 -56.565 151.039 1.00 25.05  ?  382  LEU A N   1 
ATOM   2888 C  CA  . LEU A 1 371 ? 106.144 -56.723 150.384 1.00 23.66  ?  382  LEU A CA  1 
ATOM   2889 C  C   . LEU A 1 371 ? 105.605 -58.138 150.516 1.00 28.89  ?  382  LEU A C   1 
ATOM   2890 O  O   . LEU A 1 371 ? 104.413 -58.361 150.282 1.00 30.67  ?  382  LEU A O   1 
ATOM   2891 C  CB  . LEU A 1 371 ? 106.266 -56.348 148.909 1.00 23.13  ?  382  LEU A CB  1 
ATOM   2892 C  CG  . LEU A 1 371 ? 107.148 -55.135 148.620 1.00 26.96  ?  382  LEU A CG  1 
ATOM   2893 C  CD1 . LEU A 1 371 ? 107.386 -55.005 147.130 1.00 26.11  ?  382  LEU A CD1 1 
ATOM   2894 C  CD2 . LEU A 1 371 ? 106.529 -53.864 149.182 1.00 31.19  ?  382  LEU A CD2 1 
ATOM   2895 N  N   . HIS A 1 372 ? 106.453 -59.094 150.893 1.00 24.48  ?  383  HIS A N   1 
ATOM   2896 C  CA  . HIS A 1 372 ? 106.086 -60.500 150.960 1.00 22.77  ?  383  HIS A CA  1 
ATOM   2897 C  C   . HIS A 1 372 ? 105.829 -60.977 152.385 1.00 27.30  ?  383  HIS A C   1 
ATOM   2898 O  O   . HIS A 1 372 ? 105.903 -62.184 152.637 1.00 25.15  ?  383  HIS A O   1 
ATOM   2899 C  CB  . HIS A 1 372 ? 107.175 -61.359 150.315 1.00 22.00  ?  383  HIS A CB  1 
ATOM   2900 C  CG  . HIS A 1 372 ? 108.454 -61.397 151.093 1.00 23.79  ?  383  HIS A CG  1 
ATOM   2901 N  ND1 . HIS A 1 372 ? 108.907 -60.329 151.837 1.00 25.04  ?  383  HIS A ND1 1 
ATOM   2902 C  CD2 . HIS A 1 372 ? 109.374 -62.378 151.247 1.00 23.85  ?  383  HIS A CD2 1 
ATOM   2903 C  CE1 . HIS A 1 372 ? 110.053 -60.649 152.412 1.00 23.70  ?  383  HIS A CE1 1 
ATOM   2904 N  NE2 . HIS A 1 372 ? 110.358 -61.887 152.070 1.00 23.59  ?  383  HIS A NE2 1 
ATOM   2905 N  N   . CYS A 1 373 ? 105.555 -60.056 153.321 1.00 37.53  ?  384  CYS A N   1 
ATOM   2906 C  CA  . CYS A 1 373 ? 105.162 -60.448 154.674 1.00 40.84  ?  384  CYS A CA  1 
ATOM   2907 C  C   . CYS A 1 373 ? 104.108 -61.545 154.622 1.00 43.20  ?  384  CYS A C   1 
ATOM   2908 O  O   . CYS A 1 373 ? 104.224 -62.574 155.297 1.00 42.71  ?  384  CYS A O   1 
ATOM   2909 C  CB  . CYS A 1 373 ? 104.650 -59.234 155.454 1.00 44.14  ?  384  CYS A CB  1 
ATOM   2910 S  SG  . CYS A 1 373 ? 105.940 -58.070 155.962 1.00 50.49  ?  384  CYS A SG  1 
ATOM   2911 N  N   . SER A 1 374 ? 103.072 -61.336 153.817 1.00 28.07  ?  385  SER A N   1 
ATOM   2912 C  CA  . SER A 1 374 ? 102.288 -62.409 153.229 1.00 27.23  ?  385  SER A CA  1 
ATOM   2913 C  C   . SER A 1 374 ? 102.549 -62.382 151.731 1.00 29.40  ?  385  SER A C   1 
ATOM   2914 O  O   . SER A 1 374 ? 102.632 -61.303 151.135 1.00 28.62  ?  385  SER A O   1 
ATOM   2915 C  CB  . SER A 1 374 ? 100.792 -62.250 153.524 1.00 31.68  ?  385  SER A CB  1 
ATOM   2916 O  OG  . SER A 1 374 ? 100.040 -63.325 152.984 1.00 37.78  ?  385  SER A OG  1 
ATOM   2917 N  N   . ALA A 1 375 ? 102.713 -63.563 151.133 1.00 28.16  ?  386  ALA A N   1 
ATOM   2918 C  CA  . ALA A 1 375 ? 103.082 -63.647 149.723 1.00 26.69  ?  386  ALA A CA  1 
ATOM   2919 C  C   . ALA A 1 375 ? 102.115 -62.852 148.856 1.00 30.04  ?  386  ALA A C   1 
ATOM   2920 O  O   . ALA A 1 375 ? 100.902 -62.866 149.079 1.00 28.24  ?  386  ALA A O   1 
ATOM   2921 C  CB  . ALA A 1 375 ? 103.110 -65.110 149.271 1.00 26.60  ?  386  ALA A CB  1 
ATOM   2922 N  N   . ILE A 1 376 ? 102.666 -62.139 147.871 1.00 23.56  ?  387  ILE A N   1 
ATOM   2923 C  CA  . ILE A 1 376 ? 101.851 -61.338 146.966 1.00 23.45  ?  387  ILE A CA  1 
ATOM   2924 C  C   . ILE A 1 376 ? 101.104 -62.261 146.015 1.00 28.65  ?  387  ILE A C   1 
ATOM   2925 O  O   . ILE A 1 376 ? 101.703 -63.133 145.372 1.00 26.58  ?  387  ILE A O   1 
ATOM   2926 C  CB  . ILE A 1 376 ? 102.721 -60.330 146.196 1.00 25.38  ?  387  ILE A CB  1 
ATOM   2927 C  CG1 . ILE A 1 376 ? 103.377 -59.331 147.156 1.00 25.91  ?  387  ILE A CG1 1 
ATOM   2928 C  CG2 . ILE A 1 376 ? 101.893 -59.589 145.152 1.00 23.16  ?  387  ILE A CG2 1 
ATOM   2929 C  CD1 . ILE A 1 376 ? 104.284 -58.317 146.474 1.00 25.75  ?  387  ILE A CD1 1 
ATOM   2930 N  N   . THR A 1 377 ? 99.783  -62.080 145.931 1.00 31.51  ?  388  THR A N   1 
ATOM   2931 C  CA  . THR A 1 377 ? 98.950  -62.884 145.049 1.00 29.72  ?  388  THR A CA  1 
ATOM   2932 C  C   . THR A 1 377 ? 98.364  -62.101 143.882 1.00 33.22  ?  388  THR A C   1 
ATOM   2933 O  O   . THR A 1 377 ? 97.998  -62.716 142.875 1.00 32.27  ?  388  THR A O   1 
ATOM   2934 C  CB  . THR A 1 377 ? 97.811  -63.542 145.843 1.00 31.46  ?  388  THR A CB  1 
ATOM   2935 O  OG1 . THR A 1 377 ? 97.209  -62.576 146.712 1.00 35.96  ?  388  THR A OG1 1 
ATOM   2936 C  CG2 . THR A 1 377 ? 98.342  -64.696 146.676 1.00 22.44  ?  388  THR A CG2 1 
ATOM   2937 N  N   . CYS A 1 378 ? 98.275  -60.775 143.984 1.00 25.70  ?  389  CYS A N   1 
ATOM   2938 C  CA  . CYS A 1 378 ? 97.819  -59.954 142.870 1.00 25.76  ?  389  CYS A CA  1 
ATOM   2939 C  C   . CYS A 1 378 ? 98.202  -58.505 143.132 1.00 31.21  ?  389  CYS A C   1 
ATOM   2940 O  O   . CYS A 1 378 ? 98.536  -58.124 144.257 1.00 30.86  ?  389  CYS A O   1 
ATOM   2941 C  CB  . CYS A 1 378 ? 96.307  -60.076 142.653 1.00 26.21  ?  389  CYS A CB  1 
ATOM   2942 S  SG  . CYS A 1 378 ? 95.291  -59.263 143.905 1.00 31.06  ?  389  CYS A SG  1 
ATOM   2943 N  N   . SER A 1 379 ? 98.139  -57.700 142.072 1.00 28.42  ?  390  SER A N   1 
ATOM   2944 C  CA  . SER A 1 379 ? 98.481  -56.288 142.142 1.00 29.25  ?  390  SER A CA  1 
ATOM   2945 C  C   . SER A 1 379 ? 97.454  -55.484 141.358 1.00 32.47  ?  390  SER A C   1 
ATOM   2946 O  O   . SER A 1 379 ? 96.764  -56.007 140.479 1.00 30.18  ?  390  SER A O   1 
ATOM   2947 C  CB  . SER A 1 379 ? 99.893  -56.022 141.603 1.00 33.76  ?  390  SER A CB  1 
ATOM   2948 O  OG  . SER A 1 379 ? 100.854 -56.813 142.281 1.00 47.60  ?  390  SER A OG  1 
ATOM   2949 N  N   . HIS A 1 380 ? 97.366  -54.196 141.684 1.00 30.36  ?  391  HIS A N   1 
ATOM   2950 C  CA  . HIS A 1 380 ? 96.378  -53.308 141.075 1.00 30.40  ?  391  HIS A CA  1 
ATOM   2951 C  C   . HIS A 1 380 ? 96.850  -51.878 141.276 1.00 32.46  ?  391  HIS A C   1 
ATOM   2952 O  O   . HIS A 1 380 ? 97.020  -51.442 142.419 1.00 32.10  ?  391  HIS A O   1 
ATOM   2953 C  CB  . HIS A 1 380 ? 95.001  -53.523 141.705 1.00 32.44  ?  391  HIS A CB  1 
ATOM   2954 C  CG  . HIS A 1 380 ? 93.880  -52.867 140.962 1.00 37.39  ?  391  HIS A CG  1 
ATOM   2955 N  ND1 . HIS A 1 380 ? 93.412  -53.337 139.753 1.00 39.39  ?  391  HIS A ND1 1 
ATOM   2956 C  CD2 . HIS A 1 380 ? 93.126  -51.783 141.261 1.00 41.05  ?  391  HIS A CD2 1 
ATOM   2957 C  CE1 . HIS A 1 380 ? 92.421  -52.569 139.338 1.00 40.17  ?  391  HIS A CE1 1 
ATOM   2958 N  NE2 . HIS A 1 380 ? 92.228  -51.618 140.235 1.00 41.25  ?  391  HIS A NE2 1 
ATOM   2959 N  N   . HIS A 1 381 ? 97.064  -51.153 140.181 1.00 25.35  ?  392  HIS A N   1 
ATOM   2960 C  CA  . HIS A 1 381 ? 97.609  -49.801 140.226 1.00 25.15  ?  392  HIS A CA  1 
ATOM   2961 C  C   . HIS A 1 381 ? 96.551  -48.795 139.793 1.00 33.65  ?  392  HIS A C   1 
ATOM   2962 O  O   . HIS A 1 381 ? 95.923  -48.961 138.742 1.00 32.89  ?  392  HIS A O   1 
ATOM   2963 C  CB  . HIS A 1 381 ? 98.844  -49.680 139.330 1.00 23.54  ?  392  HIS A CB  1 
ATOM   2964 C  CG  . HIS A 1 381 ? 99.534  -48.356 139.428 1.00 26.13  ?  392  HIS A CG  1 
ATOM   2965 N  ND1 . HIS A 1 381 ? 99.021  -47.204 138.871 1.00 27.87  ?  392  HIS A ND1 1 
ATOM   2966 C  CD2 . HIS A 1 381 ? 100.701 -48.000 140.016 1.00 26.74  ?  392  HIS A CD2 1 
ATOM   2967 C  CE1 . HIS A 1 381 ? 99.839  -46.196 139.115 1.00 27.07  ?  392  HIS A CE1 1 
ATOM   2968 N  NE2 . HIS A 1 381 ? 100.867 -46.652 139.808 1.00 26.78  ?  392  HIS A NE2 1 
ATOM   2969 N  N   . VAL A 1 382 ? 96.367  -47.749 140.596 1.00 31.33  ?  393  VAL A N   1 
ATOM   2970 C  CA  . VAL A 1 382 ? 95.437  -46.665 140.295 1.00 32.43  ?  393  VAL A CA  1 
ATOM   2971 C  C   . VAL A 1 382 ? 96.230  -45.364 140.264 1.00 37.80  ?  393  VAL A C   1 
ATOM   2972 O  O   . VAL A 1 382 ? 96.841  -44.981 141.269 1.00 37.01  ?  393  VAL A O   1 
ATOM   2973 C  CB  . VAL A 1 382 ? 94.292  -46.587 141.319 1.00 36.72  ?  393  VAL A CB  1 
ATOM   2974 C  CG1 . VAL A 1 382 ? 93.225  -45.609 140.850 1.00 36.81  ?  393  VAL A CG1 1 
ATOM   2975 C  CG2 . VAL A 1 382 ? 93.689  -47.967 141.558 1.00 36.21  ?  393  VAL A CG2 1 
ATOM   2976 N  N   . SER A 1 383 ? 96.223  -44.691 139.115 1.00 37.74  ?  394  SER A N   1 
ATOM   2977 C  CA  . SER A 1 383 ? 96.965  -43.452 138.935 1.00 38.45  ?  394  SER A CA  1 
ATOM   2978 C  C   . SER A 1 383 ? 96.095  -42.239 139.249 1.00 47.06  ?  394  SER A C   1 
ATOM   2979 O  O   . SER A 1 383 ? 94.872  -42.270 139.090 1.00 48.38  ?  394  SER A O   1 
ATOM   2980 C  CB  . SER A 1 383 ? 97.498  -43.340 137.504 1.00 40.94  ?  394  SER A CB  1 
ATOM   2981 O  OG  . SER A 1 383 ? 98.582  -44.224 137.279 1.00 48.51  ?  394  SER A OG  1 
ATOM   2982 N  N   . ASN A 1 384 ? 96.752  -41.164 139.691 1.00 42.28  ?  395  ASN A N   1 
ATOM   2983 C  CA  . ASN A 1 384 ? 96.106  -39.885 139.975 1.00 43.73  ?  395  ASN A CA  1 
ATOM   2984 C  C   . ASN A 1 384 ? 94.935  -40.043 140.940 1.00 49.22  ?  395  ASN A C   1 
ATOM   2985 O  O   . ASN A 1 384 ? 93.776  -40.119 140.517 1.00 49.20  ?  395  ASN A O   1 
ATOM   2986 C  CB  . ASN A 1 384 ? 95.636  -39.223 138.675 1.00 43.34  ?  395  ASN A CB  1 
ATOM   2987 C  CG  . ASN A 1 384 ? 95.355  -37.739 138.842 1.00 72.06  ?  395  ASN A CG  1 
ATOM   2988 O  OD1 . ASN A 1 384 ? 96.022  -37.049 139.614 1.00 65.11  ?  395  ASN A OD1 1 
ATOM   2989 N  ND2 . ASN A 1 384 ? 94.360  -37.242 138.115 1.00 68.75  ?  395  ASN A ND2 1 
ATOM   2990 N  N   . ILE A 1 385 ? 95.225  -40.083 142.236 1.00 47.06  ?  396  ILE A N   1 
ATOM   2991 C  CA  . ILE A 1 385 ? 94.201  -40.274 143.260 1.00 48.34  ?  396  ILE A CA  1 
ATOM   2992 C  C   . ILE A 1 385 ? 93.622  -38.920 143.654 1.00 54.86  ?  396  ILE A C   1 
ATOM   2993 O  O   . ILE A 1 385 ? 94.379  -37.956 143.845 1.00 53.80  ?  396  ILE A O   1 
ATOM   2994 C  CB  . ILE A 1 385 ? 94.772  -41.013 144.482 1.00 51.00  ?  396  ILE A CB  1 
ATOM   2995 C  CG1 . ILE A 1 385 ? 95.316  -42.385 144.073 1.00 49.77  ?  396  ILE A CG1 1 
ATOM   2996 C  CG2 . ILE A 1 385 ? 93.718  -41.156 145.576 1.00 51.67  ?  396  ILE A CG2 1 
ATOM   2997 C  CD1 . ILE A 1 385 ? 94.271  -43.311 143.495 1.00 46.76  ?  396  ILE A CD1 1 
ATOM   2998 N  N   . PRO A 1 386 ? 92.299  -38.790 143.762 1.00 62.26  ?  397  PRO A N   1 
ATOM   2999 C  CA  . PRO A 1 386 ? 91.720  -37.544 144.283 1.00 63.42  ?  397  PRO A CA  1 
ATOM   3000 C  C   . PRO A 1 386 ? 92.223  -37.263 145.691 1.00 67.65  ?  397  PRO A C   1 
ATOM   3001 O  O   . PRO A 1 386 ? 92.225  -38.143 146.555 1.00 67.77  ?  397  PRO A O   1 
ATOM   3002 C  CB  . PRO A 1 386 ? 90.211  -37.817 144.255 1.00 65.67  ?  397  PRO A CB  1 
ATOM   3003 C  CG  . PRO A 1 386 ? 90.041  -38.861 143.194 1.00 68.54  ?  397  PRO A CG  1 
ATOM   3004 C  CD  . PRO A 1 386 ? 91.263  -39.729 143.296 1.00 63.47  ?  397  PRO A CD  1 
ATOM   3005 N  N   . LEU A 1 387 ? 92.647  -36.015 145.914 1.00 49.37  ?  398  LEU A N   1 
ATOM   3006 C  CA  . LEU A 1 387 ? 93.385  -35.673 147.128 1.00 49.81  ?  398  LEU A CA  1 
ATOM   3007 C  C   . LEU A 1 387 ? 92.578  -35.938 148.395 1.00 53.42  ?  398  LEU A C   1 
ATOM   3008 O  O   . LEU A 1 387 ? 93.159  -36.223 149.448 1.00 51.57  ?  398  LEU A O   1 
ATOM   3009 C  CB  . LEU A 1 387 ? 93.822  -34.206 147.065 1.00 50.59  ?  398  LEU A CB  1 
ATOM   3010 C  CG  . LEU A 1 387 ? 94.668  -33.659 148.213 1.00 55.83  ?  398  LEU A CG  1 
ATOM   3011 C  CD1 . LEU A 1 387 ? 95.935  -33.010 147.678 1.00 55.49  ?  398  LEU A CD1 1 
ATOM   3012 C  CD2 . LEU A 1 387 ? 93.855  -32.666 149.023 1.00 61.04  ?  398  LEU A CD2 1 
ATOM   3013 N  N   . LYS A 1 388 ? 91.249  -35.860 148.317 1.00 57.37  ?  399  LYS A N   1 
ATOM   3014 C  CA  . LYS A 1 388 ? 90.426  -36.110 149.496 1.00 58.20  ?  399  LYS A CA  1 
ATOM   3015 C  C   . LYS A 1 388 ? 90.472  -37.580 149.894 1.00 63.05  ?  399  LYS A C   1 
ATOM   3016 O  O   . LYS A 1 388 ? 90.758  -37.912 151.050 1.00 64.16  ?  399  LYS A O   1 
ATOM   3017 C  CB  . LYS A 1 388 ? 88.987  -35.663 149.240 1.00 61.56  ?  399  LYS A CB  1 
ATOM   3018 N  N   . LEU A 1 389 ? 90.191  -38.476 148.943 1.00 52.46  ?  400  LEU A N   1 
ATOM   3019 C  CA  . LEU A 1 389 ? 90.269  -39.908 149.215 1.00 52.01  ?  400  LEU A CA  1 
ATOM   3020 C  C   . LEU A 1 389 ? 91.672  -40.317 149.643 1.00 53.19  ?  400  LEU A C   1 
ATOM   3021 O  O   . LEU A 1 389 ? 91.831  -41.213 150.479 1.00 52.06  ?  400  LEU A O   1 
ATOM   3022 C  CB  . LEU A 1 389 ? 89.846  -40.697 147.976 1.00 51.88  ?  400  LEU A CB  1 
ATOM   3023 C  CG  . LEU A 1 389 ? 89.270  -42.098 148.191 1.00 56.95  ?  400  LEU A CG  1 
ATOM   3024 C  CD1 . LEU A 1 389 ? 87.764  -42.020 148.381 1.00 58.45  ?  400  LEU A CD1 1 
ATOM   3025 C  CD2 . LEU A 1 389 ? 89.625  -43.022 147.036 1.00 59.08  ?  400  LEU A CD2 1 
ATOM   3026 N  N   . TRP A 1 390 ? 92.694  -39.674 149.074 1.00 49.88  ?  401  TRP A N   1 
ATOM   3027 C  CA  . TRP A 1 390 ? 94.075  -39.934 149.468 1.00 49.00  ?  401  TRP A CA  1 
ATOM   3028 C  C   . TRP A 1 390 ? 94.276  -39.667 150.954 1.00 55.19  ?  401  TRP A C   1 
ATOM   3029 O  O   . TRP A 1 390 ? 94.797  -40.516 151.688 1.00 55.22  ?  401  TRP A O   1 
ATOM   3030 C  CB  . TRP A 1 390 ? 95.009  -39.067 148.622 1.00 47.01  ?  401  TRP A CB  1 
ATOM   3031 C  CG  . TRP A 1 390 ? 96.478  -39.319 148.793 1.00 46.89  ?  401  TRP A CG  1 
ATOM   3032 C  CD1 . TRP A 1 390 ? 97.353  -38.589 149.542 1.00 50.02  ?  401  TRP A CD1 1 
ATOM   3033 C  CD2 . TRP A 1 390 ? 97.252  -40.350 148.165 1.00 45.68  ?  401  TRP A CD2 1 
ATOM   3034 N  NE1 . TRP A 1 390 ? 98.621  -39.109 149.429 1.00 48.52  ?  401  TRP A NE1 1 
ATOM   3035 C  CE2 . TRP A 1 390 ? 98.585  -40.192 148.592 1.00 49.00  ?  401  TRP A CE2 1 
ATOM   3036 C  CE3 . TRP A 1 390 ? 96.944  -41.396 147.291 1.00 46.10  ?  401  TRP A CE3 1 
ATOM   3037 C  CZ2 . TRP A 1 390 ? 99.607  -41.039 148.175 1.00 47.16  ?  401  TRP A CZ2 1 
ATOM   3038 C  CZ3 . TRP A 1 390 ? 97.961  -42.237 146.878 1.00 46.38  ?  401  TRP A CZ3 1 
ATOM   3039 C  CH2 . TRP A 1 390 ? 99.276  -42.053 147.320 1.00 46.58  ?  401  TRP A CH2 1 
ATOM   3040 N  N   . GLU A 1 391 ? 93.855  -38.487 151.418 1.00 56.45  ?  402  GLU A N   1 
ATOM   3041 C  CA  . GLU A 1 391 ? 94.017  -38.140 152.826 1.00 55.18  ?  402  GLU A CA  1 
ATOM   3042 C  C   . GLU A 1 391 ? 93.166  -39.034 153.717 1.00 56.19  ?  402  GLU A C   1 
ATOM   3043 O  O   . GLU A 1 391 ? 93.575  -39.385 154.831 1.00 56.11  ?  402  GLU A O   1 
ATOM   3044 C  CB  . GLU A 1 391 ? 93.662  -36.669 153.046 1.00 57.28  ?  402  GLU A CB  1 
ATOM   3045 C  CG  . GLU A 1 391 ? 94.587  -35.694 152.334 1.00 65.23  ?  402  GLU A CG  1 
ATOM   3046 C  CD  . GLU A 1 391 ? 94.023  -34.287 152.276 1.00 79.68  ?  402  GLU A CD  1 
ATOM   3047 O  OE1 . GLU A 1 391 ? 92.796  -34.128 152.448 1.00 77.25  ?  402  GLU A OE1 1 
ATOM   3048 O  OE2 . GLU A 1 391 ? 94.809  -33.340 152.056 1.00 60.87  ?  402  GLU A OE2 1 
ATOM   3049 N  N   . ARG A 1 392 ? 91.976  -39.414 153.243 1.00 51.82  ?  403  ARG A N   1 
ATOM   3050 C  CA  . ARG A 1 392 ? 91.104  -40.278 154.033 1.00 51.42  ?  403  ARG A CA  1 
ATOM   3051 C  C   . ARG A 1 392 ? 91.723  -41.655 154.234 1.00 53.08  ?  403  ARG A C   1 
ATOM   3052 O  O   . ARG A 1 392 ? 91.682  -42.206 155.340 1.00 53.24  ?  403  ARG A O   1 
ATOM   3053 C  CB  . ARG A 1 392 ? 89.736  -40.402 153.359 1.00 51.90  ?  403  ARG A CB  1 
ATOM   3054 C  CG  . ARG A 1 392 ? 88.907  -39.128 153.357 1.00 60.60  ?  403  ARG A CG  1 
ATOM   3055 C  CD  . ARG A 1 392 ? 87.607  -39.351 152.604 1.00 60.34  ?  403  ARG A CD  1 
ATOM   3056 N  NE  . ARG A 1 392 ? 86.760  -40.333 153.275 1.00 63.41  ?  403  ARG A NE  1 
ATOM   3057 C  CZ  . ARG A 1 392 ? 85.862  -41.095 152.659 1.00 67.11  ?  403  ARG A CZ  1 
ATOM   3058 N  NH1 . ARG A 1 392 ? 85.696  -41.003 151.347 1.00 60.31  ?  403  ARG A NH1 1 
ATOM   3059 N  NH2 . ARG A 1 392 ? 85.136  -41.958 153.356 1.00 36.71  ?  403  ARG A NH2 1 
ATOM   3060 N  N   . ILE A 1 393 ? 92.298  -42.229 153.174 1.00 52.28  ?  404  ILE A N   1 
ATOM   3061 C  CA  . ILE A 1 393 ? 92.952  -43.529 153.294 1.00 49.72  ?  404  ILE A CA  1 
ATOM   3062 C  C   . ILE A 1 393 ? 94.194  -43.420 154.173 1.00 50.92  ?  404  ILE A C   1 
ATOM   3063 O  O   . ILE A 1 393 ? 94.466  -44.302 154.998 1.00 49.43  ?  404  ILE A O   1 
ATOM   3064 C  CB  . ILE A 1 393 ? 93.284  -44.091 151.898 1.00 51.64  ?  404  ILE A CB  1 
ATOM   3065 C  CG1 . ILE A 1 393 ? 92.000  -44.344 151.102 1.00 51.17  ?  404  ILE A CG1 1 
ATOM   3066 C  CG2 . ILE A 1 393 ? 94.091  -45.373 152.014 1.00 52.11  ?  404  ILE A CG2 1 
ATOM   3067 C  CD1 . ILE A 1 393 ? 92.236  -44.882 149.705 1.00 50.78  ?  404  ILE A CD1 1 
ATOM   3068 N  N   . ILE A 1 394 ? 94.959  -42.335 154.020 1.00 38.49  ?  405  ILE A N   1 
ATOM   3069 C  CA  . ILE A 1 394 ? 96.128  -42.115 154.869 1.00 38.09  ?  405  ILE A CA  1 
ATOM   3070 C  C   . ILE A 1 394 ? 95.707  -41.977 156.328 1.00 43.95  ?  405  ILE A C   1 
ATOM   3071 O  O   . ILE A 1 394 ? 96.325  -42.562 157.228 1.00 42.04  ?  405  ILE A O   1 
ATOM   3072 C  CB  . ILE A 1 394 ? 96.918  -40.882 154.387 1.00 40.80  ?  405  ILE A CB  1 
ATOM   3073 C  CG1 . ILE A 1 394 ? 97.613  -41.176 153.058 1.00 39.80  ?  405  ILE A CG1 1 
ATOM   3074 C  CG2 . ILE A 1 394 ? 97.931  -40.441 155.436 1.00 42.04  ?  405  ILE A CG2 1 
ATOM   3075 C  CD1 . ILE A 1 394 ? 98.419  -40.015 152.527 1.00 42.20  ?  405  ILE A CD1 1 
ATOM   3076 N  N   . ALA A 1 395 ? 94.641  -41.213 156.584 1.00 51.46  ?  406  ALA A N   1 
ATOM   3077 C  CA  . ALA A 1 395 ? 94.177  -41.008 157.954 1.00 52.45  ?  406  ALA A CA  1 
ATOM   3078 C  C   . ALA A 1 395 ? 93.765  -42.327 158.596 1.00 57.36  ?  406  ALA A C   1 
ATOM   3079 O  O   . ALA A 1 395 ? 94.139  -42.619 159.739 1.00 58.65  ?  406  ALA A O   1 
ATOM   3080 C  CB  . ALA A 1 395 ? 93.018  -40.012 157.973 1.00 54.10  ?  406  ALA A CB  1 
ATOM   3081 N  N   . ALA A 1 396 ? 93.000  -43.145 157.866 1.00 48.29  ?  407  ALA A N   1 
ATOM   3082 C  CA  . ALA A 1 396 ? 92.609  -44.453 158.382 1.00 48.15  ?  407  ALA A CA  1 
ATOM   3083 C  C   . ALA A 1 396 ? 93.817  -45.350 158.619 1.00 51.24  ?  407  ALA A C   1 
ATOM   3084 O  O   . ALA A 1 396 ? 93.771  -46.235 159.482 1.00 50.29  ?  407  ALA A O   1 
ATOM   3085 C  CB  . ALA A 1 396 ? 91.633  -45.126 157.414 1.00 48.92  ?  407  ALA A CB  1 
ATOM   3086 N  N   . GLY A 1 397 ? 94.898  -45.143 157.865 1.00 53.61  ?  408  GLY A N   1 
ATOM   3087 C  CA  . GLY A 1 397 ? 96.113  -45.899 158.116 1.00 52.87  ?  408  GLY A CA  1 
ATOM   3088 C  C   . GLY A 1 397 ? 96.788  -45.493 159.412 1.00 58.20  ?  408  GLY A C   1 
ATOM   3089 O  O   . GLY A 1 397 ? 97.379  -46.328 160.102 1.00 56.91  ?  408  GLY A O   1 
ATOM   3090 N  N   . SER A 1 398 ? 96.708  -44.206 159.762 1.00 52.61  ?  409  SER A N   1 
ATOM   3091 C  CA  . SER A 1 398 ? 97.259  -43.749 161.033 1.00 52.82  ?  409  SER A CA  1 
ATOM   3092 C  C   . SER A 1 398 ? 96.519  -44.365 162.211 1.00 56.95  ?  409  SER A C   1 
ATOM   3093 O  O   . SER A 1 398 ? 97.112  -44.582 163.274 1.00 57.24  ?  409  SER A O   1 
ATOM   3094 C  CB  . SER A 1 398 ? 97.196  -42.223 161.116 1.00 57.06  ?  409  SER A CB  1 
ATOM   3095 O  OG  . SER A 1 398 ? 97.777  -41.620 159.972 1.00 66.85  ?  409  SER A OG  1 
ATOM   3096 N  N   . ARG A 1 399 ? 95.229  -44.663 162.033 1.00 51.75  ?  410  ARG A N   1 
ATOM   3097 C  CA  . ARG A 1 399 ? 94.412  -45.191 163.120 1.00 52.25  ?  410  ARG A CA  1 
ATOM   3098 C  C   . ARG A 1 399 ? 94.821  -46.606 163.508 1.00 55.89  ?  410  ARG A C   1 
ATOM   3099 O  O   . ARG A 1 399 ? 94.687  -46.988 164.676 1.00 57.24  ?  410  ARG A O   1 
ATOM   3100 C  CB  . ARG A 1 399 ? 92.938  -45.154 162.716 1.00 54.50  ?  410  ARG A CB  1 
ATOM   3101 C  CG  . ARG A 1 399 ? 92.463  -43.787 162.234 1.00 68.82  ?  410  ARG A CG  1 
ATOM   3102 C  CD  . ARG A 1 399 ? 92.205  -42.830 163.389 1.00 81.69  ?  410  ARG A CD  1 
ATOM   3103 N  NE  . ARG A 1 399 ? 90.787  -42.772 163.733 1.00 87.85  ?  410  ARG A NE  1 
ATOM   3104 C  CZ  . ARG A 1 399 ? 90.196  -43.574 164.613 1.00 90.67  ?  410  ARG A CZ  1 
ATOM   3105 N  NH1 . ARG A 1 399 ? 88.899  -43.450 164.858 1.00 70.82  ?  410  ARG A NH1 1 
ATOM   3106 N  NH2 . ARG A 1 399 ? 90.902  -44.499 165.249 1.00 72.44  ?  410  ARG A NH2 1 
ATOM   3107 N  N   . GLN A 1 400 ? 95.315  -47.394 162.556 1.00 46.65  ?  411  GLN A N   1 
ATOM   3108 C  CA  . GLN A 1 400 ? 95.743  -48.762 162.822 1.00 44.60  ?  411  GLN A CA  1 
ATOM   3109 C  C   . GLN A 1 400 ? 97.220  -48.861 163.184 1.00 44.99  ?  411  GLN A C   1 
ATOM   3110 O  O   . GLN A 1 400 ? 97.721  -49.973 163.384 1.00 41.49  ?  411  GLN A O   1 
ATOM   3111 C  CB  . GLN A 1 400 ? 95.448  -49.647 161.606 1.00 45.04  ?  411  GLN A CB  1 
ATOM   3112 C  CG  . GLN A 1 400 ? 96.271  -49.282 160.385 1.00 54.31  ?  411  GLN A CG  1 
ATOM   3113 C  CD  . GLN A 1 400 ? 95.680  -49.804 159.093 1.00 63.67  ?  411  GLN A CD  1 
ATOM   3114 O  OE1 . GLN A 1 400 ? 95.882  -49.219 158.030 1.00 58.86  ?  411  GLN A OE1 1 
ATOM   3115 N  NE2 . GLN A 1 400 ? 94.951  -50.910 159.175 1.00 50.73  ?  411  GLN A NE2 1 
ATOM   3116 N  N   . ASN A 1 401 ? 97.924  -47.731 163.276 1.00 48.59  ?  412  ASN A N   1 
ATOM   3117 C  CA  . ASN A 1 401 ? 99.348  -47.705 163.585 1.00 49.11  ?  412  ASN A CA  1 
ATOM   3118 C  C   . ASN A 1 401 ? 99.639  -47.119 164.966 1.00 55.49  ?  412  ASN A C   1 
ATOM   3119 O  O   . ASN A 1 401 ? 100.748 -46.630 165.204 1.00 54.65  ?  412  ASN A O   1 
ATOM   3120 C  CB  . ASN A 1 401 ? 100.105 -46.920 162.511 1.00 49.51  ?  412  ASN A CB  1 
ATOM   3121 C  CG  . ASN A 1 401 ? 100.014 -47.563 161.136 1.00 64.19  ?  412  ASN A CG  1 
ATOM   3122 O  OD1 . ASN A 1 401 ? 100.021 -48.787 161.007 1.00 56.83  ?  412  ASN A OD1 1 
ATOM   3123 N  ND2 . ASN A 1 401 ? 99.930  -46.734 160.100 1.00 52.88  ?  412  ASN A ND2 1 
ATOM   3124 N  N   . ALA A 1 402 ? 98.666  -47.164 165.884 1.00 57.79  ?  413  ALA A N   1 
ATOM   3125 C  CA  . ALA A 1 402 ? 98.851  -46.572 167.209 1.00 59.11  ?  413  ALA A CA  1 
ATOM   3126 C  C   . ALA A 1 402 ? 99.956  -47.266 168.001 1.00 65.03  ?  413  ALA A C   1 
ATOM   3127 O  O   . ALA A 1 402 ? 100.671 -46.610 168.767 1.00 65.80  ?  413  ALA A O   1 
ATOM   3128 C  CB  . ALA A 1 402 ? 97.536  -46.610 167.987 1.00 60.52  ?  413  ALA A CB  1 
ATOM   3129 N  N   . HIS A 1 403 ? 100.118 -48.582 167.824 1.00 67.75  ?  414  HIS A N   1 
ATOM   3130 C  CA  . HIS A 1 403 ? 101.164 -49.323 168.524 1.00 66.92  ?  414  HIS A CA  1 
ATOM   3131 C  C   . HIS A 1 403 ? 102.563 -48.861 168.146 1.00 67.72  ?  414  HIS A C   1 
ATOM   3132 O  O   . HIS A 1 403 ? 103.514 -49.133 168.886 1.00 68.00  ?  414  HIS A O   1 
ATOM   3133 C  CB  . HIS A 1 403 ? 101.037 -50.822 168.237 1.00 67.91  ?  414  HIS A CB  1 
ATOM   3134 C  CG  . HIS A 1 403 ? 101.181 -51.171 166.788 1.00 71.56  ?  414  HIS A CG  1 
ATOM   3135 N  ND1 . HIS A 1 403 ? 100.217 -50.864 165.851 1.00 74.00  ?  414  HIS A ND1 1 
ATOM   3136 C  CD2 . HIS A 1 403 ? 102.172 -51.800 166.113 1.00 73.09  ?  414  HIS A CD2 1 
ATOM   3137 C  CE1 . HIS A 1 403 ? 100.609 -51.287 164.663 1.00 73.04  ?  414  HIS A CE1 1 
ATOM   3138 N  NE2 . HIS A 1 403 ? 101.792 -51.859 164.794 1.00 72.73  ?  414  HIS A NE2 1 
ATOM   3139 N  N   . PHE A 1 404 ? 102.713 -48.181 167.013 1.00 45.30  ?  415  PHE A N   1 
ATOM   3140 C  CA  . PHE A 1 404 ? 104.024 -47.768 166.542 1.00 44.18  ?  415  PHE A CA  1 
ATOM   3141 C  C   . PHE A 1 404 ? 104.565 -46.602 167.363 1.00 46.83  ?  415  PHE A C   1 
ATOM   3142 O  O   . PHE A 1 404 ? 103.835 -45.915 168.083 1.00 47.60  ?  415  PHE A O   1 
ATOM   3143 C  CB  . PHE A 1 404 ? 103.970 -47.376 165.067 1.00 45.93  ?  415  PHE A CB  1 
ATOM   3144 C  CG  . PHE A 1 404 ? 104.001 -48.544 164.131 1.00 47.15  ?  415  PHE A CG  1 
ATOM   3145 C  CD1 . PHE A 1 404 ? 105.147 -49.309 164.005 1.00 49.59  ?  415  PHE A CD1 1 
ATOM   3146 C  CD2 . PHE A 1 404 ? 102.894 -48.873 163.370 1.00 50.97  ?  415  PHE A CD2 1 
ATOM   3147 C  CE1 . PHE A 1 404 ? 105.187 -50.386 163.143 1.00 50.29  ?  415  PHE A CE1 1 
ATOM   3148 C  CE2 . PHE A 1 404 ? 102.929 -49.948 162.502 1.00 53.22  ?  415  PHE A CE2 1 
ATOM   3149 C  CZ  . PHE A 1 404 ? 104.077 -50.707 162.391 1.00 50.25  ?  415  PHE A CZ  1 
ATOM   3150 N  N   . SER A 1 405 ? 105.871 -46.386 167.238 1.00 35.99  ?  416  SER A N   1 
ATOM   3151 C  CA  . SER A 1 405 ? 106.537 -45.275 167.893 1.00 35.42  ?  416  SER A CA  1 
ATOM   3152 C  C   . SER A 1 405 ? 106.191 -43.956 167.207 1.00 39.94  ?  416  SER A C   1 
ATOM   3153 O  O   . SER A 1 405 ? 105.796 -43.912 166.040 1.00 39.44  ?  416  SER A O   1 
ATOM   3154 C  CB  . SER A 1 405 ? 108.052 -45.485 167.882 1.00 36.75  ?  416  SER A CB  1 
ATOM   3155 O  OG  . SER A 1 405 ? 108.741 -44.251 167.967 1.00 45.04  ?  416  SER A OG  1 
ATOM   3156 N  N   . THR A 1 406 ? 106.343 -42.870 167.958 1.00 45.59  ?  417  THR A N   1 
ATOM   3157 C  CA  . THR A 1 406 ? 106.181 -41.523 167.427 1.00 45.53  ?  417  THR A CA  1 
ATOM   3158 C  C   . THR A 1 406 ? 107.501 -40.916 166.974 1.00 46.81  ?  417  THR A C   1 
ATOM   3159 O  O   . THR A 1 406 ? 107.521 -39.763 166.529 1.00 45.97  ?  417  THR A O   1 
ATOM   3160 C  CB  . THR A 1 406 ? 105.529 -40.616 168.477 1.00 58.14  ?  417  THR A CB  1 
ATOM   3161 O  OG1 . THR A 1 406 ? 106.270 -40.691 169.702 1.00 58.73  ?  417  THR A OG1 1 
ATOM   3162 C  CG2 . THR A 1 406 ? 104.091 -41.044 168.732 1.00 56.42  ?  417  THR A CG2 1 
ATOM   3163 N  N   . MET A 1 407 ? 108.594 -41.668 167.073 1.00 39.00  ?  418  MET A N   1 
ATOM   3164 C  CA  . MET A 1 407 ? 109.910 -41.157 166.723 1.00 39.13  ?  418  MET A CA  1 
ATOM   3165 C  C   . MET A 1 407 ? 109.996 -40.855 165.232 1.00 41.76  ?  418  MET A C   1 
ATOM   3166 O  O   . MET A 1 407 ? 109.480 -41.606 164.400 1.00 41.07  ?  418  MET A O   1 
ATOM   3167 C  CB  . MET A 1 407 ? 110.977 -42.184 167.115 1.00 41.64  ?  418  MET A CB  1 
ATOM   3168 C  CG  . MET A 1 407 ? 112.411 -41.699 167.021 1.00 46.62  ?  418  MET A CG  1 
ATOM   3169 S  SD  . MET A 1 407 ? 113.583 -43.008 167.436 1.00 51.58  ?  418  MET A SD  1 
ATOM   3170 C  CE  . MET A 1 407 ? 113.502 -44.020 165.963 1.00 47.62  ?  418  MET A CE  1 
ATOM   3171 N  N   . GLU A 1 408 ? 110.646 -39.741 164.899 1.00 50.54  ?  419  GLU A N   1 
ATOM   3172 C  CA  . GLU A 1 408 ? 110.951 -39.443 163.507 1.00 49.09  ?  419  GLU A CA  1 
ATOM   3173 C  C   . GLU A 1 408 ? 111.899 -40.501 162.953 1.00 50.15  ?  419  GLU A C   1 
ATOM   3174 O  O   . GLU A 1 408 ? 112.642 -41.146 163.696 1.00 50.97  ?  419  GLU A O   1 
ATOM   3175 C  CB  . GLU A 1 408 ? 111.586 -38.058 163.377 1.00 50.84  ?  419  GLU A CB  1 
ATOM   3176 C  CG  . GLU A 1 408 ? 110.789 -36.924 164.000 1.00 66.02  ?  419  GLU A CG  1 
ATOM   3177 C  CD  . GLU A 1 408 ? 109.875 -36.233 163.009 1.00 92.27  ?  419  GLU A CD  1 
ATOM   3178 O  OE1 . GLU A 1 408 ? 108.652 -36.482 163.047 1.00 95.10  ?  419  GLU A OE1 1 
ATOM   3179 O  OE2 . GLU A 1 408 ? 110.384 -35.441 162.189 1.00 86.66  ?  419  GLU A OE2 1 
ATOM   3180 N  N   . TRP A 1 409 ? 111.871 -40.681 161.638 1.00 36.41  ?  420  TRP A N   1 
ATOM   3181 C  CA  . TRP A 1 409 ? 112.738 -41.670 161.010 1.00 33.55  ?  420  TRP A CA  1 
ATOM   3182 C  C   . TRP A 1 409 ? 114.200 -41.289 161.226 1.00 39.05  ?  420  TRP A C   1 
ATOM   3183 O  O   . TRP A 1 409 ? 114.635 -40.231 160.745 1.00 39.50  ?  420  TRP A O   1 
ATOM   3184 C  CB  . TRP A 1 409 ? 112.433 -41.795 159.520 1.00 30.62  ?  420  TRP A CB  1 
ATOM   3185 C  CG  . TRP A 1 409 ? 113.274 -42.827 158.833 1.00 29.10  ?  420  TRP A CG  1 
ATOM   3186 C  CD1 . TRP A 1 409 ? 114.230 -42.608 157.887 1.00 30.85  ?  420  TRP A CD1 1 
ATOM   3187 C  CD2 . TRP A 1 409 ? 113.243 -44.245 159.052 1.00 27.77  ?  420  TRP A CD2 1 
ATOM   3188 N  NE1 . TRP A 1 409 ? 114.793 -43.800 157.496 1.00 28.57  ?  420  TRP A NE1 1 
ATOM   3189 C  CE2 . TRP A 1 409 ? 114.204 -44.820 158.196 1.00 29.64  ?  420  TRP A CE2 1 
ATOM   3190 C  CE3 . TRP A 1 409 ? 112.494 -45.082 159.884 1.00 28.61  ?  420  TRP A CE3 1 
ATOM   3191 C  CZ2 . TRP A 1 409 ? 114.434 -46.192 158.148 1.00 27.86  ?  420  TRP A CZ2 1 
ATOM   3192 C  CZ3 . TRP A 1 409 ? 112.725 -46.445 159.836 1.00 29.19  ?  420  TRP A CZ3 1 
ATOM   3193 C  CH2 . TRP A 1 409 ? 113.689 -46.986 158.975 1.00 28.87  ?  420  TRP A CH2 1 
ATOM   3194 N  N   . PRO A 1 410 ? 114.988 -42.107 161.934 1.00 34.84  ?  421  PRO A N   1 
ATOM   3195 C  CA  . PRO A 1 410 ? 116.330 -41.670 162.340 1.00 33.25  ?  421  PRO A CA  1 
ATOM   3196 C  C   . PRO A 1 410 ? 117.379 -41.752 161.240 1.00 33.72  ?  421  PRO A C   1 
ATOM   3197 O  O   . PRO A 1 410 ? 118.317 -40.949 161.235 1.00 32.90  ?  421  PRO A O   1 
ATOM   3198 C  CB  . PRO A 1 410 ? 116.661 -42.618 163.497 1.00 35.41  ?  421  PRO A CB  1 
ATOM   3199 C  CG  . PRO A 1 410 ? 115.920 -43.866 163.166 1.00 39.62  ?  421  PRO A CG  1 
ATOM   3200 C  CD  . PRO A 1 410 ? 114.646 -43.433 162.479 1.00 36.04  ?  421  PRO A CD  1 
ATOM   3201 N  N   . ILE A 1 411 ? 117.258 -42.711 160.321 1.00 29.99  ?  422  ILE A N   1 
ATOM   3202 C  CA  . ILE A 1 411 ? 118.200 -42.811 159.208 1.00 27.57  ?  422  ILE A CA  1 
ATOM   3203 C  C   . ILE A 1 411 ? 117.794 -41.774 158.170 1.00 33.57  ?  422  ILE A C   1 
ATOM   3204 O  O   . ILE A 1 411 ? 117.232 -42.108 157.120 1.00 32.62  ?  422  ILE A O   1 
ATOM   3205 C  CB  . ILE A 1 411 ? 118.241 -44.235 158.616 1.00 28.86  ?  422  ILE A CB  1 
ATOM   3206 C  CG1 . ILE A 1 411 ? 118.524 -45.263 159.713 1.00 28.55  ?  422  ILE A CG1 1 
ATOM   3207 C  CG2 . ILE A 1 411 ? 119.312 -44.353 157.534 1.00 27.61  ?  422  ILE A CG2 1 
ATOM   3208 C  CD1 . ILE A 1 411 ? 117.305 -46.040 160.157 1.00 29.13  ?  422  ILE A CD1 1 
ATOM   3209 N  N   . ASP A 1 412 ? 118.065 -40.501 158.469 1.00 33.35  ?  423  ASP A N   1 
ATOM   3210 C  CA  . ASP A 1 412 ? 117.602 -39.378 157.663 1.00 33.37  ?  423  ASP A CA  1 
ATOM   3211 C  C   . ASP A 1 412 ? 118.756 -38.598 157.039 1.00 34.94  ?  423  ASP A C   1 
ATOM   3212 O  O   . ASP A 1 412 ? 118.633 -37.396 156.786 1.00 34.80  ?  423  ASP A O   1 
ATOM   3213 C  CB  . ASP A 1 412 ? 116.722 -38.448 158.501 1.00 36.69  ?  423  ASP A CB  1 
ATOM   3214 C  CG  . ASP A 1 412 ? 117.456 -37.859 159.699 1.00 49.46  ?  423  ASP A CG  1 
ATOM   3215 O  OD1 . ASP A 1 412 ? 118.614 -38.248 159.957 1.00 47.06  ?  423  ASP A OD1 1 
ATOM   3216 O  OD2 . ASP A 1 412 ? 116.867 -36.998 160.388 1.00 60.50  ?  423  ASP A OD2 1 
ATOM   3217 N  N   . GLY A 1 413 ? 119.879 -39.266 156.784 1.00 25.19  ?  424  GLY A N   1 
ATOM   3218 C  CA  . GLY A 1 413 ? 121.019 -38.588 156.207 1.00 25.94  ?  424  GLY A CA  1 
ATOM   3219 C  C   . GLY A 1 413 ? 120.792 -38.194 154.760 1.00 34.88  ?  424  GLY A C   1 
ATOM   3220 O  O   . GLY A 1 413 ? 119.922 -38.722 154.063 1.00 34.91  ?  424  GLY A O   1 
ATOM   3221 N  N   . GLY A 1 414 ? 121.594 -37.235 154.303 1.00 26.08  ?  425  GLY A N   1 
ATOM   3222 C  CA  . GLY A 1 414 ? 121.532 -36.789 152.927 1.00 26.39  ?  425  GLY A CA  1 
ATOM   3223 C  C   . GLY A 1 414 ? 120.364 -35.857 152.661 1.00 33.40  ?  425  GLY A C   1 
ATOM   3224 O  O   . GLY A 1 414 ? 119.535 -35.564 153.526 1.00 31.86  ?  425  GLY A O   1 
ATOM   3225 N  N   . THR A 1 415 ? 120.304 -35.384 151.416 1.00 38.57  ?  426  THR A N   1 
ATOM   3226 C  CA  . THR A 1 415 ? 119.271 -34.456 150.976 1.00 40.65  ?  426  THR A CA  1 
ATOM   3227 C  C   . THR A 1 415 ? 118.727 -34.910 149.630 1.00 44.17  ?  426  THR A C   1 
ATOM   3228 O  O   . THR A 1 415 ? 119.497 -35.158 148.698 1.00 42.10  ?  426  THR A O   1 
ATOM   3229 C  CB  . THR A 1 415 ? 119.818 -33.027 150.870 1.00 56.61  ?  426  THR A CB  1 
ATOM   3230 O  OG1 . THR A 1 415 ? 120.622 -32.731 152.020 1.00 55.47  ?  426  THR A OG1 1 
ATOM   3231 C  CG2 . THR A 1 415 ? 118.674 -32.028 150.787 1.00 59.15  ?  426  THR A CG2 1 
ATOM   3232 N  N   . SER A 1 416 ? 117.403 -35.016 149.532 1.00 47.34  ?  427  SER A N   1 
ATOM   3233 C  CA  . SER A 1 416 ? 116.740 -35.440 148.305 1.00 46.75  ?  427  SER A CA  1 
ATOM   3234 C  C   . SER A 1 416 ? 116.505 -34.231 147.405 1.00 53.09  ?  427  SER A C   1 
ATOM   3235 O  O   . SER A 1 416 ? 115.826 -33.277 147.802 1.00 53.96  ?  427  SER A O   1 
ATOM   3236 C  CB  . SER A 1 416 ? 115.418 -36.138 148.623 1.00 48.45  ?  427  SER A CB  1 
ATOM   3237 O  OG  . SER A 1 416 ? 114.637 -36.308 147.454 1.00 53.98  ?  427  SER A OG  1 
ATOM   3238 N  N   . LEU A 1 417 ? 117.060 -34.274 146.196 1.00 43.70  ?  428  LEU A N   1 
ATOM   3239 C  CA  . LEU A 1 417 ? 116.914 -33.201 145.224 1.00 43.48  ?  428  LEU A CA  1 
ATOM   3240 C  C   . LEU A 1 417 ? 115.683 -33.370 144.340 1.00 50.80  ?  428  LEU A C   1 
ATOM   3241 O  O   . LEU A 1 417 ? 115.559 -32.673 143.327 1.00 51.32  ?  428  LEU A O   1 
ATOM   3242 C  CB  . LEU A 1 417 ? 118.170 -33.104 144.354 1.00 42.13  ?  428  LEU A CB  1 
ATOM   3243 C  CG  . LEU A 1 417 ? 119.514 -33.042 145.087 1.00 44.96  ?  428  LEU A CG  1 
ATOM   3244 C  CD1 . LEU A 1 417 ? 120.663 -32.906 144.096 1.00 43.66  ?  428  LEU A CD1 1 
ATOM   3245 C  CD2 . LEU A 1 417 ? 119.538 -31.909 146.104 1.00 46.40  ?  428  LEU A CD2 1 
ATOM   3246 N  N   . THR A 1 418 ? 114.773 -34.270 144.699 1.00 50.51  ?  429  THR A N   1 
ATOM   3247 C  CA  . THR A 1 418 ? 113.590 -34.553 143.897 1.00 50.86  ?  429  THR A CA  1 
ATOM   3248 C  C   . THR A 1 418 ? 112.392 -33.788 144.438 1.00 59.06  ?  429  THR A C   1 
ATOM   3249 O  O   . THR A 1 418 ? 112.117 -33.856 145.646 1.00 58.66  ?  429  THR A O   1 
ATOM   3250 C  CB  . THR A 1 418 ? 113.297 -36.053 143.897 1.00 51.60  ?  429  THR A CB  1 
ATOM   3251 O  OG1 . THR A 1 418 ? 114.233 -36.722 143.041 1.00 45.40  ?  429  THR A OG1 1 
ATOM   3252 C  CG2 . THR A 1 418 ? 111.884 -36.341 143.415 1.00 51.61  ?  429  THR A CG2 1 
ATOM   3253 N  N   . PRO A 1 419 ? 111.675 -33.045 143.598 1.00 58.32  ?  430  PRO A N   1 
ATOM   3254 C  CA  . PRO A 1 419 ? 110.467 -32.358 144.067 1.00 59.71  ?  430  PRO A CA  1 
ATOM   3255 C  C   . PRO A 1 419 ? 109.379 -33.359 144.421 1.00 66.34  ?  430  PRO A C   1 
ATOM   3256 O  O   . PRO A 1 419 ? 109.373 -34.502 143.959 1.00 65.46  ?  430  PRO A O   1 
ATOM   3257 C  CB  . PRO A 1 419 ? 110.053 -31.492 142.869 1.00 61.45  ?  430  PRO A CB  1 
ATOM   3258 C  CG  . PRO A 1 419 ? 111.243 -31.488 141.943 1.00 65.20  ?  430  PRO A CG  1 
ATOM   3259 C  CD  . PRO A 1 419 ? 111.939 -32.789 142.174 1.00 59.77  ?  430  PRO A CD  1 
ATOM   3260 N  N   . ALA A 1 420 ? 108.451 -32.910 145.261 1.00 66.93  ?  431  ALA A N   1 
ATOM   3261 C  CA  . ALA A 1 420 ? 107.334 -33.758 145.652 1.00 67.38  ?  431  ALA A CA  1 
ATOM   3262 C  C   . ALA A 1 420 ? 106.590 -34.241 144.409 1.00 72.99  ?  431  ALA A C   1 
ATOM   3263 O  O   . ALA A 1 420 ? 106.452 -33.487 143.437 1.00 73.94  ?  431  ALA A O   1 
ATOM   3264 C  CB  . ALA A 1 420 ? 106.380 -33.000 146.577 1.00 68.91  ?  431  ALA A CB  1 
ATOM   3265 N  N   . PRO A 1 421 ? 106.123 -35.487 144.390 1.00 55.20  ?  432  PRO A N   1 
ATOM   3266 C  CA  . PRO A 1 421 ? 105.428 -36.007 143.207 1.00 54.22  ?  432  PRO A CA  1 
ATOM   3267 C  C   . PRO A 1 421 ? 104.217 -35.158 142.865 1.00 56.53  ?  432  PRO A C   1 
ATOM   3268 O  O   . PRO A 1 421 ? 103.415 -34.818 143.748 1.00 56.47  ?  432  PRO A O   1 
ATOM   3269 C  CB  . PRO A 1 421 ? 105.013 -37.423 143.636 1.00 56.27  ?  432  PRO A CB  1 
ATOM   3270 C  CG  . PRO A 1 421 ? 105.992 -37.789 144.703 1.00 60.81  ?  432  PRO A CG  1 
ATOM   3271 C  CD  . PRO A 1 421 ? 106.278 -36.512 145.437 1.00 56.73  ?  432  PRO A CD  1 
ATOM   3272 N  N   . PRO A 1 422 ? 104.054 -34.789 141.590 1.00 67.73  ?  433  PRO A N   1 
ATOM   3273 C  CA  . PRO A 1 422 ? 102.902 -33.947 141.228 1.00 67.05  ?  433  PRO A CA  1 
ATOM   3274 C  C   . PRO A 1 422 ? 101.571 -34.646 141.428 1.00 68.53  ?  433  PRO A C   1 
ATOM   3275 O  O   . PRO A 1 422 ? 100.640 -34.048 141.985 1.00 69.31  ?  433  PRO A O   1 
ATOM   3276 C  CB  . PRO A 1 422 ? 103.165 -33.617 139.752 1.00 68.38  ?  433  PRO A CB  1 
ATOM   3277 C  CG  . PRO A 1 422 ? 104.005 -34.750 139.260 1.00 72.63  ?  433  PRO A CG  1 
ATOM   3278 C  CD  . PRO A 1 422 ? 104.874 -35.148 140.420 1.00 68.46  ?  433  PRO A CD  1 
ATOM   3279 N  N   . GLN A 1 423 ? 101.453 -35.898 140.994 1.00 50.52  ?  434  GLN A N   1 
ATOM   3280 C  CA  . GLN A 1 423 ? 100.223 -36.658 141.144 1.00 49.01  ?  434  GLN A CA  1 
ATOM   3281 C  C   . GLN A 1 423 ? 100.432 -37.817 142.108 1.00 47.96  ?  434  GLN A C   1 
ATOM   3282 O  O   . GLN A 1 423 ? 101.542 -38.337 142.257 1.00 46.30  ?  434  GLN A O   1 
ATOM   3283 C  CB  . GLN A 1 423 ? 99.721  -37.182 139.795 1.00 49.84  ?  434  GLN A CB  1 
ATOM   3284 C  CG  . GLN A 1 423 ? 100.620 -38.208 139.128 1.00 56.83  ?  434  GLN A CG  1 
ATOM   3285 C  CD  . GLN A 1 423 ? 100.041 -38.709 137.818 1.00 62.29  ?  434  GLN A CD  1 
ATOM   3286 O  OE1 . GLN A 1 423 ? 100.173 -38.060 136.781 1.00 58.24  ?  434  GLN A OE1 1 
ATOM   3287 N  NE2 . GLN A 1 423 ? 99.390  -39.866 137.860 1.00 40.16  ?  434  GLN A NE2 1 
ATOM   3288 N  N   . ARG A 1 424 ? 99.343  -38.215 142.758 1.00 50.95  ?  435  ARG A N   1 
ATOM   3289 C  CA  . ARG A 1 424 ? 99.361  -39.271 143.763 1.00 49.51  ?  435  ARG A CA  1 
ATOM   3290 C  C   . ARG A 1 424 ? 98.985  -40.590 143.099 1.00 51.42  ?  435  ARG A C   1 
ATOM   3291 O  O   . ARG A 1 424 ? 97.834  -40.784 142.694 1.00 52.03  ?  435  ARG A O   1 
ATOM   3292 C  CB  . ARG A 1 424 ? 98.407  -38.929 144.903 1.00 45.63  ?  435  ARG A CB  1 
ATOM   3293 C  CG  . ARG A 1 424 ? 98.784  -37.652 145.635 1.00 55.17  ?  435  ARG A CG  1 
ATOM   3294 C  CD  . ARG A 1 424 ? 97.633  -37.092 146.450 1.00 62.00  ?  435  ARG A CD  1 
ATOM   3295 N  NE  . ARG A 1 424 ? 96.540  -36.616 145.608 1.00 58.16  ?  435  ARG A NE  1 
ATOM   3296 C  CZ  . ARG A 1 424 ? 96.535  -35.443 144.984 1.00 71.63  ?  435  ARG A CZ  1 
ATOM   3297 N  NH1 . ARG A 1 424 ? 97.572  -34.623 145.099 1.00 56.11  ?  435  ARG A NH1 1 
ATOM   3298 N  NH2 . ARG A 1 424 ? 95.496  -35.092 144.241 1.00 62.27  ?  435  ARG A NH2 1 
ATOM   3299 N  N   . ASP A 1 425 ? 99.955  -41.491 142.982 1.00 39.39  ?  436  ASP A N   1 
ATOM   3300 C  CA  . ASP A 1 425 ? 99.723  -42.816 142.430 1.00 37.27  ?  436  ASP A CA  1 
ATOM   3301 C  C   . ASP A 1 425 ? 99.654  -43.846 143.550 1.00 38.30  ?  436  ASP A C   1 
ATOM   3302 O  O   . ASP A 1 425 ? 100.342 -43.737 144.568 1.00 37.58  ?  436  ASP A O   1 
ATOM   3303 C  CB  . ASP A 1 425 ? 100.817 -43.197 141.429 1.00 37.90  ?  436  ASP A CB  1 
ATOM   3304 C  CG  . ASP A 1 425 ? 100.744 -42.385 140.145 1.00 38.98  ?  436  ASP A CG  1 
ATOM   3305 O  OD1 . ASP A 1 425 ? 99.674  -41.805 139.867 1.00 36.85  ?  436  ASP A OD1 1 
ATOM   3306 O  OD2 . ASP A 1 425 ? 101.755 -42.335 139.411 1.00 47.50  ?  436  ASP A OD2 1 
ATOM   3307 N  N   . LEU A 1 426 ? 98.810  -44.854 143.349 1.00 34.57  ?  437  LEU A N   1 
ATOM   3308 C  CA  . LEU A 1 426 ? 98.511  -45.845 144.373 1.00 34.08  ?  437  LEU A CA  1 
ATOM   3309 C  C   . LEU A 1 426 ? 98.751  -47.237 143.809 1.00 37.25  ?  437  LEU A C   1 
ATOM   3310 O  O   . LEU A 1 426 ? 98.311  -47.544 142.697 1.00 36.26  ?  437  LEU A O   1 
ATOM   3311 C  CB  . LEU A 1 426 ? 97.062  -45.697 144.851 1.00 34.06  ?  437  LEU A CB  1 
ATOM   3312 C  CG  . LEU A 1 426 ? 96.632  -46.276 146.198 1.00 38.19  ?  437  LEU A CG  1 
ATOM   3313 C  CD1 . LEU A 1 426 ? 97.512  -45.750 147.316 1.00 38.41  ?  437  LEU A CD1 1 
ATOM   3314 C  CD2 . LEU A 1 426 ? 95.179  -45.923 146.457 1.00 39.30  ?  437  LEU A CD2 1 
ATOM   3315 N  N   . LEU A 1 427 ? 99.458  -48.071 144.566 1.00 30.33  ?  438  LEU A N   1 
ATOM   3316 C  CA  . LEU A 1 427 ? 99.673  -49.466 144.207 1.00 29.95  ?  438  LEU A CA  1 
ATOM   3317 C  C   . LEU A 1 427 ? 99.054  -50.339 145.286 1.00 32.76  ?  438  LEU A C   1 
ATOM   3318 O  O   . LEU A 1 427 ? 99.364  -50.181 146.472 1.00 33.71  ?  438  LEU A O   1 
ATOM   3319 C  CB  . LEU A 1 427 ? 101.162 -49.788 144.047 1.00 29.84  ?  438  LEU A CB  1 
ATOM   3320 C  CG  . LEU A 1 427 ? 101.457 -51.255 143.712 1.00 34.03  ?  438  LEU A CG  1 
ATOM   3321 C  CD1 . LEU A 1 427 ? 100.726 -51.671 142.446 1.00 33.88  ?  438  LEU A CD1 1 
ATOM   3322 C  CD2 . LEU A 1 427 ? 102.952 -51.515 143.578 1.00 35.00  ?  438  LEU A CD2 1 
ATOM   3323 N  N   . LEU A 1 428 ? 98.178  -51.247 144.877 1.00 31.85  ?  439  LEU A N   1 
ATOM   3324 C  CA  . LEU A 1 428 ? 97.514  -52.164 145.790 1.00 31.16  ?  439  LEU A CA  1 
ATOM   3325 C  C   . LEU A 1 428 ? 98.046  -53.570 145.550 1.00 30.85  ?  439  LEU A C   1 
ATOM   3326 O  O   . LEU A 1 428 ? 98.175  -54.000 144.400 1.00 28.73  ?  439  LEU A O   1 
ATOM   3327 C  CB  . LEU A 1 428 ? 95.995  -52.131 145.600 1.00 31.70  ?  439  LEU A CB  1 
ATOM   3328 C  CG  . LEU A 1 428 ? 95.317  -50.757 145.535 1.00 35.45  ?  439  LEU A CG  1 
ATOM   3329 C  CD1 . LEU A 1 428 ? 93.803  -50.902 145.583 1.00 36.88  ?  439  LEU A CD1 1 
ATOM   3330 C  CD2 . LEU A 1 428 ? 95.803  -49.858 146.652 1.00 29.78  ?  439  LEU A CD2 1 
ATOM   3331 N  N   . THR A 1 429 ? 98.360  -54.276 146.629 1.00 24.89  ?  440  THR A N   1 
ATOM   3332 C  CA  . THR A 1 429 ? 98.848  -55.644 146.552 1.00 23.72  ?  440  THR A CA  1 
ATOM   3333 C  C   . THR A 1 429 ? 97.922  -56.551 147.347 1.00 28.20  ?  440  THR A C   1 
ATOM   3334 O  O   . THR A 1 429 ? 97.650  -56.289 148.523 1.00 28.11  ?  440  THR A O   1 
ATOM   3335 C  CB  . THR A 1 429 ? 100.279 -55.759 147.082 1.00 29.16  ?  440  THR A CB  1 
ATOM   3336 O  OG1 . THR A 1 429 ? 100.339 -55.247 148.420 1.00 29.66  ?  440  THR A OG1 1 
ATOM   3337 C  CG2 . THR A 1 429 ? 101.239 -54.977 146.200 1.00 21.94  ?  440  THR A CG2 1 
ATOM   3338 N  N   . GLY A 1 430 ? 97.426  -57.599 146.696 1.00 29.65  ?  441  GLY A N   1 
ATOM   3339 C  CA  . GLY A 1 430 ? 96.688  -58.637 147.382 1.00 29.43  ?  441  GLY A CA  1 
ATOM   3340 C  C   . GLY A 1 430 ? 97.622  -59.746 147.831 1.00 33.55  ?  441  GLY A C   1 
ATOM   3341 O  O   . GLY A 1 430 ? 98.600  -60.068 147.159 1.00 32.54  ?  441  GLY A O   1 
ATOM   3342 N  N   . HIS A 1 431 ? 97.312  -60.335 148.983 1.00 25.10  ?  442  HIS A N   1 
ATOM   3343 C  CA  . HIS A 1 431 ? 98.232  -61.250 149.636 1.00 25.18  ?  442  HIS A CA  1 
ATOM   3344 C  C   . HIS A 1 431 ? 97.545  -62.570 149.960 1.00 33.50  ?  442  HIS A C   1 
ATOM   3345 O  O   . HIS A 1 431 ? 96.325  -62.717 149.847 1.00 34.10  ?  442  HIS A O   1 
ATOM   3346 C  CB  . HIS A 1 431 ? 98.820  -60.616 150.900 1.00 24.80  ?  442  HIS A CB  1 
ATOM   3347 C  CG  . HIS A 1 431 ? 99.555  -59.340 150.635 1.00 27.20  ?  442  HIS A CG  1 
ATOM   3348 N  ND1 . HIS A 1 431 ? 100.930 -59.272 150.564 1.00 27.81  ?  442  HIS A ND1 1 
ATOM   3349 C  CD2 . HIS A 1 431 ? 99.104  -58.085 150.401 1.00 28.63  ?  442  HIS A CD2 1 
ATOM   3350 C  CE1 . HIS A 1 431 ? 101.294 -58.027 150.309 1.00 26.69  ?  442  HIS A CE1 1 
ATOM   3351 N  NE2 . HIS A 1 431 ? 100.205 -57.287 150.205 1.00 27.58  ?  442  HIS A NE2 1 
ATOM   3352 N  N   . GLU A 1 432 ? 98.366  -63.539 150.374 1.00 34.82  ?  443  GLU A N   1 
ATOM   3353 C  CA  . GLU A 1 432 ? 97.884  -64.903 150.563 1.00 36.80  ?  443  GLU A CA  1 
ATOM   3354 C  C   . GLU A 1 432 ? 96.975  -65.023 151.778 1.00 42.81  ?  443  GLU A C   1 
ATOM   3355 O  O   . GLU A 1 432 ? 96.081  -65.876 151.796 1.00 43.97  ?  443  GLU A O   1 
ATOM   3356 C  CB  . GLU A 1 432 ? 99.070  -65.859 150.696 1.00 38.34  ?  443  GLU A CB  1 
ATOM   3357 C  CG  . GLU A 1 432 ? 98.741  -67.312 150.392 1.00 51.74  ?  443  GLU A CG  1 
ATOM   3358 C  CD  . GLU A 1 432 ? 99.857  -68.261 150.790 1.00 80.92  ?  443  GLU A CD  1 
ATOM   3359 O  OE1 . GLU A 1 432 ? 99.792  -68.821 151.905 1.00 66.98  ?  443  GLU A OE1 1 
ATOM   3360 O  OE2 . GLU A 1 432 ? 100.803 -68.442 149.994 1.00 86.42  ?  443  GLU A OE2 1 
ATOM   3361 N  N   . ASP A 1 433 ? 97.187  -64.196 152.801 1.00 34.57  ?  444  ASP A N   1 
ATOM   3362 C  CA  . ASP A 1 433 ? 96.407  -64.269 154.028 1.00 34.46  ?  444  ASP A CA  1 
ATOM   3363 C  C   . ASP A 1 433 ? 95.137  -63.430 153.971 1.00 37.96  ?  444  ASP A C   1 
ATOM   3364 O  O   . ASP A 1 433 ? 94.463  -63.275 154.994 1.00 39.80  ?  444  ASP A O   1 
ATOM   3365 C  CB  . ASP A 1 433 ? 97.266  -63.855 155.231 1.00 35.97  ?  444  ASP A CB  1 
ATOM   3366 C  CG  . ASP A 1 433 ? 97.746  -62.408 155.162 1.00 44.51  ?  444  ASP A CG  1 
ATOM   3367 O  OD1 . ASP A 1 433 ? 97.397  -61.684 154.207 1.00 45.17  ?  444  ASP A OD1 1 
ATOM   3368 O  OD2 . ASP A 1 433 ? 98.484  -61.993 156.081 1.00 53.46  ?  444  ASP A OD2 1 
ATOM   3369 N  N   . GLY A 1 434 ? 94.798  -62.888 152.806 1.00 33.55  ?  445  GLY A N   1 
ATOM   3370 C  CA  . GLY A 1 434 ? 93.601  -62.094 152.648 1.00 33.56  ?  445  GLY A CA  1 
ATOM   3371 C  C   . GLY A 1 434 ? 93.759  -60.616 152.920 1.00 35.77  ?  445  GLY A C   1 
ATOM   3372 O  O   . GLY A 1 434 ? 92.746  -59.925 153.083 1.00 35.63  ?  445  GLY A O   1 
ATOM   3373 N  N   . THR A 1 435 ? 94.984  -60.103 152.967 1.00 36.67  ?  446  THR A N   1 
ATOM   3374 C  CA  . THR A 1 435 ? 95.199  -58.680 153.185 1.00 36.41  ?  446  THR A CA  1 
ATOM   3375 C  C   . THR A 1 435 ? 95.398  -57.943 151.862 1.00 38.72  ?  446  THR A C   1 
ATOM   3376 O  O   . THR A 1 435 ? 95.854  -58.513 150.866 1.00 38.03  ?  446  THR A O   1 
ATOM   3377 C  CB  . THR A 1 435 ? 96.404  -58.434 154.101 1.00 39.82  ?  446  THR A CB  1 
ATOM   3378 O  OG1 . THR A 1 435 ? 97.513  -59.233 153.671 1.00 27.75  ?  446  THR A OG1 1 
ATOM   3379 C  CG2 . THR A 1 435 ? 96.067  -58.772 155.550 1.00 37.80  ?  446  THR A CG2 1 
ATOM   3380 N  N   . VAL A 1 436 ? 95.036  -56.661 151.864 1.00 29.70  ?  447  VAL A N   1 
ATOM   3381 C  CA  . VAL A 1 436 ? 95.279  -55.750 150.748 1.00 28.35  ?  447  VAL A CA  1 
ATOM   3382 C  C   . VAL A 1 436 ? 96.030  -54.551 151.299 1.00 32.41  ?  447  VAL A C   1 
ATOM   3383 O  O   . VAL A 1 436 ? 95.547  -53.884 152.222 1.00 32.73  ?  447  VAL A O   1 
ATOM   3384 C  CB  . VAL A 1 436 ? 93.978  -55.297 150.059 1.00 31.87  ?  447  VAL A CB  1 
ATOM   3385 C  CG1 . VAL A 1 436 ? 94.247  -54.105 149.151 1.00 30.63  ?  447  VAL A CG1 1 
ATOM   3386 C  CG2 . VAL A 1 436 ? 93.382  -56.421 149.254 1.00 31.13  ?  447  VAL A CG2 1 
ATOM   3387 N  N   . ARG A 1 437 ? 97.200  -54.269 150.740 1.00 26.92  ?  448  ARG A N   1 
ATOM   3388 C  CA  . ARG A 1 437 ? 98.039  -53.187 151.230 1.00 27.28  ?  448  ARG A CA  1 
ATOM   3389 C  C   . ARG A 1 437 ? 98.059  -52.041 150.227 1.00 30.32  ?  448  ARG A C   1 
ATOM   3390 O  O   . ARG A 1 437 ? 98.284  -52.255 149.030 1.00 29.18  ?  448  ARG A O   1 
ATOM   3391 C  CB  . ARG A 1 437 ? 99.454  -53.697 151.522 1.00 26.30  ?  448  ARG A CB  1 
ATOM   3392 C  CG  . ARG A 1 437 ? 99.489  -54.588 152.759 1.00 29.03  ?  448  ARG A CG  1 
ATOM   3393 C  CD  . ARG A 1 437 ? 100.877 -55.111 153.086 1.00 31.49  ?  448  ARG A CD  1 
ATOM   3394 N  NE  . ARG A 1 437 ? 100.884 -55.790 154.380 1.00 25.25  ?  448  ARG A NE  1 
ATOM   3395 C  CZ  . ARG A 1 437 ? 100.495 -57.048 154.569 1.00 45.59  ?  448  ARG A CZ  1 
ATOM   3396 N  NH1 . ARG A 1 437 ? 100.069 -57.776 153.546 1.00 29.91  ?  448  ARG A NH1 1 
ATOM   3397 N  NH2 . ARG A 1 437 ? 100.532 -57.580 155.783 1.00 32.59  ?  448  ARG A NH2 1 
ATOM   3398 N  N   . PHE A 1 438 ? 97.810  -50.832 150.725 1.00 28.94  ?  449  PHE A N   1 
ATOM   3399 C  CA  . PHE A 1 438 ? 97.771  -49.621 149.915 1.00 28.25  ?  449  PHE A CA  1 
ATOM   3400 C  C   . PHE A 1 438 ? 99.132  -48.940 150.001 1.00 32.82  ?  449  PHE A C   1 
ATOM   3401 O  O   . PHE A 1 438 ? 99.564  -48.554 151.092 1.00 34.72  ?  449  PHE A O   1 
ATOM   3402 C  CB  . PHE A 1 438 ? 96.666  -48.677 150.396 1.00 30.04  ?  449  PHE A CB  1 
ATOM   3403 C  CG  . PHE A 1 438 ? 95.267  -49.142 150.069 1.00 31.12  ?  449  PHE A CG  1 
ATOM   3404 C  CD1 . PHE A 1 438 ? 94.813  -50.391 150.473 1.00 34.31  ?  449  PHE A CD1 1 
ATOM   3405 C  CD2 . PHE A 1 438 ? 94.393  -48.311 149.385 1.00 31.84  ?  449  PHE A CD2 1 
ATOM   3406 C  CE1 . PHE A 1 438 ? 93.526  -50.811 150.178 1.00 34.68  ?  449  PHE A CE1 1 
ATOM   3407 C  CE2 . PHE A 1 438 ? 93.105  -48.724 149.087 1.00 34.81  ?  449  PHE A CE2 1 
ATOM   3408 C  CZ  . PHE A 1 438 ? 92.671  -49.977 149.485 1.00 33.49  ?  449  PHE A CZ  1 
ATOM   3409 N  N   . TRP A 1 439 ? 99.803  -48.796 148.860 1.00 29.77  ?  450  TRP A N   1 
ATOM   3410 C  CA  . TRP A 1 439 ? 101.154 -48.252 148.801 1.00 29.27  ?  450  TRP A CA  1 
ATOM   3411 C  C   . TRP A 1 439 ? 101.160 -46.924 148.056 1.00 34.77  ?  450  TRP A C   1 
ATOM   3412 O  O   . TRP A 1 439 ? 100.514 -46.783 147.014 1.00 33.53  ?  450  TRP A O   1 
ATOM   3413 C  CB  . TRP A 1 439 ? 102.119 -49.215 148.100 1.00 26.71  ?  450  TRP A CB  1 
ATOM   3414 C  CG  . TRP A 1 439 ? 102.127 -50.610 148.644 1.00 27.11  ?  450  TRP A CG  1 
ATOM   3415 C  CD1 . TRP A 1 439 ? 101.382 -51.664 148.201 1.00 29.82  ?  450  TRP A CD1 1 
ATOM   3416 C  CD2 . TRP A 1 439 ? 102.929 -51.110 149.721 1.00 26.97  ?  450  TRP A CD2 1 
ATOM   3417 N  NE1 . TRP A 1 439 ? 101.664 -52.787 148.939 1.00 29.19  ?  450  TRP A NE1 1 
ATOM   3418 C  CE2 . TRP A 1 439 ? 102.610 -52.474 149.879 1.00 30.84  ?  450  TRP A CE2 1 
ATOM   3419 C  CE3 . TRP A 1 439 ? 103.881 -50.537 150.569 1.00 27.95  ?  450  TRP A CE3 1 
ATOM   3420 C  CZ2 . TRP A 1 439 ? 103.209 -53.272 150.851 1.00 30.27  ?  450  TRP A CZ2 1 
ATOM   3421 C  CZ3 . TRP A 1 439 ? 104.475 -51.332 151.534 1.00 29.71  ?  450  TRP A CZ3 1 
ATOM   3422 C  CH2 . TRP A 1 439 ? 104.137 -52.684 151.667 1.00 30.84  ?  450  TRP A CH2 1 
ATOM   3423 N  N   . ASP A 1 440 ? 101.913 -45.960 148.585 1.00 37.30  ?  451  ASP A N   1 
ATOM   3424 C  CA  . ASP A 1 440 ? 102.140 -44.681 147.914 1.00 37.00  ?  451  ASP A CA  1 
ATOM   3425 C  C   . ASP A 1 440 ? 103.155 -44.908 146.801 1.00 38.37  ?  451  ASP A C   1 
ATOM   3426 O  O   . ASP A 1 440 ? 104.368 -44.836 147.007 1.00 36.42  ?  451  ASP A O   1 
ATOM   3427 C  CB  . ASP A 1 440 ? 102.625 -43.627 148.903 1.00 39.86  ?  451  ASP A CB  1 
ATOM   3428 C  CG  . ASP A 1 440 ? 102.912 -42.290 148.242 1.00 51.11  ?  451  ASP A CG  1 
ATOM   3429 O  OD1 . ASP A 1 440 ? 102.428 -42.063 147.113 1.00 52.25  ?  451  ASP A OD1 1 
ATOM   3430 O  OD2 . ASP A 1 440 ? 103.627 -41.467 148.851 1.00 57.50  ?  451  ASP A OD2 1 
ATOM   3431 N  N   . ALA A 1 441 ? 102.645 -45.189 145.602 1.00 25.79  ?  452  ALA A N   1 
ATOM   3432 C  CA  . ALA A 1 441 ? 103.474 -45.438 144.432 1.00 24.77  ?  452  ALA A CA  1 
ATOM   3433 C  C   . ALA A 1 441 ? 103.800 -44.161 143.661 1.00 31.18  ?  452  ALA A C   1 
ATOM   3434 O  O   . ALA A 1 441 ? 104.170 -44.238 142.483 1.00 30.80  ?  452  ALA A O   1 
ATOM   3435 C  CB  . ALA A 1 441 ? 102.790 -46.456 143.514 1.00 25.20  ?  452  ALA A CB  1 
ATOM   3436 N  N   . SER A 1 442 ? 103.690 -42.995 144.308 1.00 36.01  ?  453  SER A N   1 
ATOM   3437 C  CA  . SER A 1 442 ? 103.869 -41.725 143.609 1.00 35.92  ?  453  SER A CA  1 
ATOM   3438 C  C   . SER A 1 442 ? 105.319 -41.500 143.196 1.00 37.47  ?  453  SER A C   1 
ATOM   3439 O  O   . SER A 1 442 ? 105.583 -41.039 142.080 1.00 36.66  ?  453  SER A O   1 
ATOM   3440 C  CB  . SER A 1 442 ? 103.378 -40.570 144.486 1.00 41.82  ?  453  SER A CB  1 
ATOM   3441 O  OG  . SER A 1 442 ? 102.044 -40.765 144.921 1.00 51.18  ?  453  SER A OG  1 
ATOM   3442 N  N   . GLY A 1 443 ? 106.272 -41.800 144.074 1.00 36.91  ?  454  GLY A N   1 
ATOM   3443 C  CA  . GLY A 1 443 ? 107.669 -41.557 143.736 1.00 35.03  ?  454  GLY A CA  1 
ATOM   3444 C  C   . GLY A 1 443 ? 108.666 -42.664 144.034 1.00 35.84  ?  454  GLY A C   1 
ATOM   3445 O  O   . GLY A 1 443 ? 108.410 -43.849 143.793 1.00 34.77  ?  454  GLY A O   1 
ATOM   3446 N  N   . VAL A 1 444 ? 109.822 -42.269 144.568 1.00 30.59  ?  455  VAL A N   1 
ATOM   3447 C  CA  . VAL A 1 444 ? 110.950 -43.182 144.685 1.00 29.21  ?  455  VAL A CA  1 
ATOM   3448 C  C   . VAL A 1 444 ? 110.754 -44.174 145.829 1.00 34.09  ?  455  VAL A C   1 
ATOM   3449 O  O   . VAL A 1 444 ? 111.236 -45.311 145.753 1.00 34.31  ?  455  VAL A O   1 
ATOM   3450 C  CB  . VAL A 1 444 ? 112.257 -42.368 144.828 1.00 31.31  ?  455  VAL A CB  1 
ATOM   3451 C  CG1 . VAL A 1 444 ? 113.425 -43.259 145.226 1.00 30.57  ?  455  VAL A CG1 1 
ATOM   3452 C  CG2 . VAL A 1 444 ? 112.569 -41.650 143.518 1.00 30.22  ?  455  VAL A CG2 1 
ATOM   3453 N  N   . CYS A 1 445 ? 110.029 -43.795 146.883 1.00 33.08  ?  456  CYS A N   1 
ATOM   3454 C  CA  . CYS A 1 445 ? 109.870 -44.637 148.065 1.00 33.28  ?  456  CYS A CA  1 
ATOM   3455 C  C   . CYS A 1 445 ? 108.454 -45.198 148.130 1.00 38.67  ?  456  CYS A C   1 
ATOM   3456 O  O   . CYS A 1 445 ? 107.482 -44.437 148.197 1.00 41.33  ?  456  CYS A O   1 
ATOM   3457 C  CB  . CYS A 1 445 ? 110.203 -43.856 149.336 1.00 33.87  ?  456  CYS A CB  1 
ATOM   3458 S  SG  . CYS A 1 445 ? 111.973 -43.535 149.527 1.00 36.95  ?  456  CYS A SG  1 
ATOM   3459 N  N   . LEU A 1 446 ? 108.347 -46.526 148.121 1.00 28.90  ?  457  LEU A N   1 
ATOM   3460 C  CA  . LEU A 1 446 ? 107.063 -47.223 148.202 1.00 28.54  ?  457  LEU A CA  1 
ATOM   3461 C  C   . LEU A 1 446 ? 106.687 -47.375 149.672 1.00 37.70  ?  457  LEU A C   1 
ATOM   3462 O  O   . LEU A 1 446 ? 107.085 -48.325 150.349 1.00 39.79  ?  457  LEU A O   1 
ATOM   3463 C  CB  . LEU A 1 446 ? 107.145 -48.576 147.506 1.00 26.75  ?  457  LEU A CB  1 
ATOM   3464 C  CG  . LEU A 1 446 ? 105.818 -49.281 147.224 1.00 29.92  ?  457  LEU A CG  1 
ATOM   3465 C  CD1 . LEU A 1 446 ? 105.024 -48.527 146.166 1.00 29.14  ?  457  LEU A CD1 1 
ATOM   3466 C  CD2 . LEU A 1 446 ? 106.052 -50.723 146.802 1.00 30.15  ?  457  LEU A CD2 1 
ATOM   3467 N  N   . ARG A 1 447 ? 105.901 -46.424 150.167 1.00 32.68  ?  458  ARG A N   1 
ATOM   3468 C  CA  . ARG A 1 447 ? 105.526 -46.353 151.571 1.00 32.26  ?  458  ARG A CA  1 
ATOM   3469 C  C   . ARG A 1 447 ? 104.111 -46.879 151.768 1.00 36.71  ?  458  ARG A C   1 
ATOM   3470 O  O   . ARG A 1 447 ? 103.212 -46.579 150.978 1.00 37.57  ?  458  ARG A O   1 
ATOM   3471 C  CB  . ARG A 1 447 ? 105.633 -44.910 152.071 1.00 32.96  ?  458  ARG A CB  1 
ATOM   3472 C  CG  . ARG A 1 447 ? 104.893 -44.611 153.361 1.00 43.31  ?  458  ARG A CG  1 
ATOM   3473 C  CD  . ARG A 1 447 ? 105.191 -43.196 153.831 1.00 56.07  ?  458  ARG A CD  1 
ATOM   3474 N  NE  . ARG A 1 447 ? 104.036 -42.570 154.467 1.00 68.73  ?  458  ARG A NE  1 
ATOM   3475 C  CZ  . ARG A 1 447 ? 103.210 -41.732 153.849 1.00 82.63  ?  458  ARG A CZ  1 
ATOM   3476 N  NH1 . ARG A 1 447 ? 103.412 -41.417 152.577 1.00 69.99  ?  458  ARG A NH1 1 
ATOM   3477 N  NH2 . ARG A 1 447 ? 102.181 -41.208 154.503 1.00 63.99  ?  458  ARG A NH2 1 
ATOM   3478 N  N   . LEU A 1 448 ? 103.922 -47.670 152.824 1.00 35.64  ?  459  LEU A N   1 
ATOM   3479 C  CA  . LEU A 1 448 ? 102.611 -48.222 153.142 1.00 35.51  ?  459  LEU A CA  1 
ATOM   3480 C  C   . LEU A 1 448 ? 101.725 -47.151 153.766 1.00 43.31  ?  459  LEU A C   1 
ATOM   3481 O  O   . LEU A 1 448 ? 102.142 -46.449 154.693 1.00 44.58  ?  459  LEU A O   1 
ATOM   3482 C  CB  . LEU A 1 448 ? 102.744 -49.412 154.093 1.00 34.88  ?  459  LEU A CB  1 
ATOM   3483 C  CG  . LEU A 1 448 ? 101.433 -50.014 154.608 1.00 38.18  ?  459  LEU A CG  1 
ATOM   3484 C  CD1 . LEU A 1 448 ? 100.644 -50.635 153.470 1.00 37.87  ?  459  LEU A CD1 1 
ATOM   3485 C  CD2 . LEU A 1 448 ? 101.699 -51.036 155.699 1.00 38.52  ?  459  LEU A CD2 1 
ATOM   3486 N  N   . LEU A 1 449 ? 100.501 -47.036 153.258 1.00 36.17  ?  460  LEU A N   1 
ATOM   3487 C  CA  . LEU A 1 449 ? 99.530  -46.062 153.737 1.00 36.07  ?  460  LEU A CA  1 
ATOM   3488 C  C   . LEU A 1 449 ? 98.401  -46.679 154.543 1.00 41.03  ?  460  LEU A C   1 
ATOM   3489 O  O   . LEU A 1 449 ? 97.931  -46.065 155.501 1.00 43.37  ?  460  LEU A O   1 
ATOM   3490 C  CB  . LEU A 1 449 ? 98.929  -45.293 152.552 1.00 35.24  ?  460  LEU A CB  1 
ATOM   3491 C  CG  . LEU A 1 449 ? 99.910  -44.553 151.644 1.00 37.08  ?  460  LEU A CG  1 
ATOM   3492 C  CD1 . LEU A 1 449 ? 99.209  -44.091 150.380 1.00 36.88  ?  460  LEU A CD1 1 
ATOM   3493 C  CD2 . LEU A 1 449 ? 100.522 -43.374 152.374 1.00 35.35  ?  460  LEU A CD2 1 
ATOM   3494 N  N   . TYR A 1 450 ? 97.960  -47.882 154.181 1.00 34.33  ?  461  TYR A N   1 
ATOM   3495 C  CA  . TYR A 1 450 ? 96.809  -48.507 154.816 1.00 34.13  ?  461  TYR A CA  1 
ATOM   3496 C  C   . TYR A 1 450 ? 96.829  -49.997 154.515 1.00 38.21  ?  461  TYR A C   1 
ATOM   3497 O  O   . TYR A 1 450 ? 97.254  -50.420 153.436 1.00 36.34  ?  461  TYR A O   1 
ATOM   3498 C  CB  . TYR A 1 450 ? 95.499  -47.874 154.328 1.00 35.46  ?  461  TYR A CB  1 
ATOM   3499 C  CG  . TYR A 1 450 ? 94.251  -48.661 154.662 1.00 37.83  ?  461  TYR A CG  1 
ATOM   3500 C  CD1 . TYR A 1 450 ? 93.662  -48.567 155.916 1.00 40.74  ?  461  TYR A CD1 1 
ATOM   3501 C  CD2 . TYR A 1 450 ? 93.652  -49.486 153.718 1.00 37.22  ?  461  TYR A CD2 1 
ATOM   3502 C  CE1 . TYR A 1 450 ? 92.518  -49.281 156.224 1.00 41.90  ?  461  TYR A CE1 1 
ATOM   3503 C  CE2 . TYR A 1 450 ? 92.508  -50.204 154.017 1.00 38.27  ?  461  TYR A CE2 1 
ATOM   3504 C  CZ  . TYR A 1 450 ? 91.946  -50.097 155.272 1.00 47.16  ?  461  TYR A CZ  1 
ATOM   3505 O  OH  . TYR A 1 450 ? 90.807  -50.808 155.574 1.00 47.37  ?  461  TYR A OH  1 
ATOM   3506 N  N   . LYS A 1 451 ? 96.364  -50.788 155.480 1.00 42.03  ?  462  LYS A N   1 
ATOM   3507 C  CA  . LYS A 1 451 ? 96.264  -52.233 155.325 1.00 42.09  ?  462  LYS A CA  1 
ATOM   3508 C  C   . LYS A 1 451 ? 94.838  -52.674 155.617 1.00 48.19  ?  462  LYS A C   1 
ATOM   3509 O  O   . LYS A 1 451 ? 94.259  -52.286 156.637 1.00 49.95  ?  462  LYS A O   1 
ATOM   3510 C  CB  . LYS A 1 451 ? 97.239  -52.970 156.250 1.00 42.83  ?  462  LYS A CB  1 
ATOM   3511 C  CG  . LYS A 1 451 ? 97.484  -54.413 155.838 1.00 43.75  ?  462  LYS A CG  1 
ATOM   3512 C  CD  . LYS A 1 451 ? 97.300  -55.392 156.987 1.00 52.77  ?  462  LYS A CD  1 
ATOM   3513 C  CE  . LYS A 1 451 ? 98.457  -55.341 157.968 1.00 44.54  ?  462  LYS A CE  1 
ATOM   3514 N  NZ  . LYS A 1 451 ? 98.479  -56.555 158.831 1.00 44.95  ?  462  LYS A NZ  1 
ATOM   3515 N  N   . LEU A 1 452 ? 94.280  -53.480 154.720 1.00 36.35  ?  463  LEU A N   1 
ATOM   3516 C  CA  . LEU A 1 452 ? 92.947  -54.044 154.865 1.00 36.91  ?  463  LEU A CA  1 
ATOM   3517 C  C   . LEU A 1 452 ? 93.066  -55.542 155.102 1.00 40.72  ?  463  LEU A C   1 
ATOM   3518 O  O   . LEU A 1 452 ? 93.859  -56.220 154.444 1.00 37.36  ?  463  LEU A O   1 
ATOM   3519 C  CB  . LEU A 1 452 ? 92.105  -53.778 153.613 1.00 37.13  ?  463  LEU A CB  1 
ATOM   3520 C  CG  . LEU A 1 452 ? 90.572  -53.846 153.642 1.00 43.45  ?  463  LEU A CG  1 
ATOM   3521 C  CD1 . LEU A 1 452 ? 90.048  -53.323 152.327 1.00 43.71  ?  463  LEU A CD1 1 
ATOM   3522 C  CD2 . LEU A 1 452 ? 90.028  -55.246 153.884 1.00 45.64  ?  463  LEU A CD2 1 
ATOM   3523 N  N   . SER A 1 453 ? 92.275  -56.056 156.039 1.00 46.32  ?  464  SER A N   1 
ATOM   3524 C  CA  . SER A 1 453 ? 92.227  -57.481 156.330 1.00 48.02  ?  464  SER A CA  1 
ATOM   3525 C  C   . SER A 1 453 ? 90.813  -57.992 156.088 1.00 55.70  ?  464  SER A C   1 
ATOM   3526 O  O   . SER A 1 453 ? 89.838  -57.377 156.536 1.00 56.97  ?  464  SER A O   1 
ATOM   3527 C  CB  . SER A 1 453 ? 92.672  -57.762 157.770 1.00 52.61  ?  464  SER A CB  1 
ATOM   3528 O  OG  . SER A 1 453 ? 93.050  -59.118 157.938 1.00 62.14  ?  464  SER A OG  1 
ATOM   3529 N  N   . THR A 1 454 ? 90.705  -59.109 155.367 1.00 49.64  ?  465  THR A N   1 
ATOM   3530 C  CA  . THR A 1 454 ? 89.417  -59.701 155.025 1.00 50.35  ?  465  THR A CA  1 
ATOM   3531 C  C   . THR A 1 454 ? 89.124  -60.990 155.778 1.00 57.22  ?  465  THR A C   1 
ATOM   3532 O  O   . THR A 1 454 ? 87.997  -61.490 155.696 1.00 56.95  ?  465  THR A O   1 
ATOM   3533 C  CB  . THR A 1 454 ? 89.332  -59.972 153.517 1.00 52.43  ?  465  THR A CB  1 
ATOM   3534 O  OG1 . THR A 1 454 ? 90.371  -60.882 153.131 1.00 49.27  ?  465  THR A OG1 1 
ATOM   3535 C  CG2 . THR A 1 454 ? 89.479  -58.681 152.732 1.00 48.37  ?  465  THR A CG2 1 
ATOM   3536 N  N   . VAL A 1 455 ? 90.100  -61.541 156.502 1.00 60.63  ?  466  VAL A N   1 
ATOM   3537 C  CA  . VAL A 1 455 ? 89.858  -62.696 157.358 1.00 61.83  ?  466  VAL A CA  1 
ATOM   3538 C  C   . VAL A 1 455 ? 88.851  -62.387 158.459 1.00 68.25  ?  466  VAL A C   1 
ATOM   3539 O  O   . VAL A 1 455 ? 88.330  -63.306 159.100 1.00 68.15  ?  466  VAL A O   1 
ATOM   3540 C  CB  . VAL A 1 455 ? 91.203  -63.192 157.936 1.00 65.65  ?  466  VAL A CB  1 
ATOM   3541 C  CG1 . VAL A 1 455 ? 91.820  -62.139 158.849 1.00 65.53  ?  466  VAL A CG1 1 
ATOM   3542 C  CG2 . VAL A 1 455 ? 91.047  -64.527 158.658 1.00 66.01  ?  466  VAL A CG2 1 
ATOM   3543 N  N   . ARG A 1 456 ? 88.537  -61.106 158.672 1.00 64.19  ?  467  ARG A N   1 
ATOM   3544 C  CA  . ARG A 1 456 ? 87.590  -60.735 159.718 1.00 65.85  ?  467  ARG A CA  1 
ATOM   3545 C  C   . ARG A 1 456 ? 86.158  -61.111 159.353 1.00 70.71  ?  467  ARG A C   1 
ATOM   3546 O  O   . ARG A 1 456 ? 85.334  -61.328 160.248 1.00 70.62  ?  467  ARG A O   1 
ATOM   3547 C  CB  . ARG A 1 456 ? 87.692  -59.235 159.994 1.00 67.55  ?  467  ARG A CB  1 
ATOM   3548 C  CG  . ARG A 1 456 ? 87.706  -58.887 161.463 1.00 86.85  ?  467  ARG A CG  1 
ATOM   3549 C  CD  . ARG A 1 456 ? 88.108  -57.443 161.684 1.00 104.37 ?  467  ARG A CD  1 
ATOM   3550 N  NE  . ARG A 1 456 ? 87.243  -56.813 162.673 1.00 118.30 ?  467  ARG A NE  1 
ATOM   3551 C  CZ  . ARG A 1 456 ? 87.306  -57.053 163.978 1.00 134.83 ?  467  ARG A CZ  1 
ATOM   3552 N  NH1 . ARG A 1 456 ? 88.197  -57.911 164.458 1.00 124.78 ?  467  ARG A NH1 1 
ATOM   3553 N  NH2 . ARG A 1 456 ? 86.473  -56.437 164.804 1.00 119.24 ?  467  ARG A NH2 1 
ATOM   3554 N  N   . VAL A 1 457 ? 85.839  -61.192 158.056 1.00 53.78  ?  468  VAL A N   1 
ATOM   3555 C  CA  . VAL A 1 457 ? 84.485  -61.550 157.631 1.00 54.43  ?  468  VAL A CA  1 
ATOM   3556 C  C   . VAL A 1 457 ? 84.232  -63.047 157.685 1.00 59.57  ?  468  VAL A C   1 
ATOM   3557 O  O   . VAL A 1 457 ? 83.102  -63.484 157.426 1.00 58.28  ?  468  VAL A O   1 
ATOM   3558 C  CB  . VAL A 1 457 ? 84.185  -61.046 156.204 1.00 57.21  ?  468  VAL A CB  1 
ATOM   3559 C  CG1 . VAL A 1 457 ? 84.608  -59.596 156.052 1.00 56.26  ?  468  VAL A CG1 1 
ATOM   3560 C  CG2 . VAL A 1 457 ? 84.869  -61.921 155.165 1.00 56.10  ?  468  VAL A CG2 1 
ATOM   3561 N  N   . PHE A 1 458 ? 85.242  -63.846 158.014 1.00 75.74  ?  469  PHE A N   1 
ATOM   3562 C  CA  . PHE A 1 458 ? 85.108  -65.291 158.109 1.00 76.92  ?  469  PHE A CA  1 
ATOM   3563 C  C   . PHE A 1 458 ? 85.345  -65.743 159.546 1.00 82.87  ?  469  PHE A C   1 
ATOM   3564 O  O   . PHE A 1 458 ? 85.873  -65.000 160.379 1.00 82.07  ?  469  PHE A O   1 
ATOM   3565 C  CB  . PHE A 1 458 ? 86.079  -66.001 157.154 1.00 78.20  ?  469  PHE A CB  1 
ATOM   3566 C  CG  . PHE A 1 458 ? 85.957  -65.556 155.722 1.00 79.74  ?  469  PHE A CG  1 
ATOM   3567 C  CD1 . PHE A 1 458 ? 84.818  -65.841 154.989 1.00 83.66  ?  469  PHE A CD1 1 
ATOM   3568 C  CD2 . PHE A 1 458 ? 86.985  -64.858 155.108 1.00 81.77  ?  469  PHE A CD2 1 
ATOM   3569 C  CE1 . PHE A 1 458 ? 84.701  -65.432 153.673 1.00 84.55  ?  469  PHE A CE1 1 
ATOM   3570 C  CE2 . PHE A 1 458 ? 86.875  -64.448 153.791 1.00 84.29  ?  469  PHE A CE2 1 
ATOM   3571 C  CZ  . PHE A 1 458 ? 85.731  -64.735 153.073 1.00 82.91  ?  469  PHE A CZ  1 
ATOM   3572 N  N   . LEU A 1 459 ? 84.939  -66.983 159.827 1.00 78.48  ?  470  LEU A N   1 
ATOM   3573 C  CA  . LEU A 1 459 ? 85.087  -67.592 161.145 1.00 79.44  ?  470  LEU A CA  1 
ATOM   3574 C  C   . LEU A 1 459 ? 86.381  -68.400 161.165 1.00 84.01  ?  470  LEU A C   1 
ATOM   3575 O  O   . LEU A 1 459 ? 86.452  -69.487 160.581 1.00 82.97  ?  470  LEU A O   1 
ATOM   3576 C  CB  . LEU A 1 459 ? 83.884  -68.473 161.476 1.00 80.16  ?  470  LEU A CB  1 
ATOM   3577 N  N   . THR A 1 460 ? 87.397  -67.870 161.837 1.00 85.69  ?  471  THR A N   1 
ATOM   3578 C  CA  . THR A 1 460 ? 88.701  -68.520 161.908 1.00 107.13 ?  471  THR A CA  1 
ATOM   3579 C  C   . THR A 1 460 ? 89.287  -68.443 163.315 1.00 129.31 ?  471  THR A C   1 
ATOM   3580 O  O   . THR A 1 460 ? 89.733  -69.448 163.871 1.00 91.06  ?  471  THR A O   1 
ATOM   3581 C  CB  . THR A 1 460 ? 89.693  -67.889 160.914 1.00 112.39 ?  471  THR A CB  1 
ATOM   3582 O  OG1 . THR A 1 460 ? 89.552  -66.464 160.939 1.00 110.60 ?  471  THR A OG1 1 
ATOM   3583 C  CG2 . THR A 1 460 ? 89.439  -68.399 159.503 1.00 109.34 ?  471  THR A CG2 1 
ATOM   3584 N  N   . GLU A 1 475 ? 107.683 -66.782 180.896 1.00 76.09  ?  486  GLU A N   1 
ATOM   3585 C  CA  . GLU A 1 475 ? 108.181 -65.524 180.352 1.00 74.16  ?  486  GLU A CA  1 
ATOM   3586 C  C   . GLU A 1 475 ? 109.701 -65.429 180.464 1.00 71.02  ?  486  GLU A C   1 
ATOM   3587 O  O   . GLU A 1 475 ? 110.257 -64.335 180.564 1.00 69.84  ?  486  GLU A O   1 
ATOM   3588 C  CB  . GLU A 1 475 ? 107.519 -64.338 181.060 1.00 76.50  ?  486  GLU A CB  1 
ATOM   3589 C  CG  . GLU A 1 475 ? 107.611 -64.386 182.579 1.00 87.96  ?  486  GLU A CG  1 
ATOM   3590 C  CD  . GLU A 1 475 ? 106.842 -63.262 183.249 1.00 115.32 ?  486  GLU A CD  1 
ATOM   3591 O  OE1 . GLU A 1 475 ? 105.994 -62.636 182.578 1.00 111.93 ?  486  GLU A OE1 1 
ATOM   3592 O  OE2 . GLU A 1 475 ? 107.087 -63.004 184.446 1.00 106.03 ?  486  GLU A OE2 1 
ATOM   3593 N  N   . TRP A 1 476 ? 110.370 -66.583 180.447 1.00 49.33  ?  487  TRP A N   1 
ATOM   3594 C  CA  . TRP A 1 476 ? 111.827 -66.620 180.463 1.00 46.29  ?  487  TRP A CA  1 
ATOM   3595 C  C   . TRP A 1 476 ? 112.332 -67.719 179.533 1.00 50.60  ?  487  TRP A C   1 
ATOM   3596 O  O   . TRP A 1 476 ? 111.964 -68.889 179.705 1.00 52.66  ?  487  TRP A O   1 
ATOM   3597 C  CB  . TRP A 1 476 ? 112.357 -66.827 181.882 1.00 43.64  ?  487  TRP A CB  1 
ATOM   3598 C  CG  . TRP A 1 476 ? 113.811 -66.494 182.002 1.00 42.35  ?  487  TRP A CG  1 
ATOM   3599 C  CD1 . TRP A 1 476 ? 114.853 -67.372 182.065 1.00 44.49  ?  487  TRP A CD1 1 
ATOM   3600 C  CD2 . TRP A 1 476 ? 114.388 -65.182 182.042 1.00 40.97  ?  487  TRP A CD2 1 
ATOM   3601 N  NE1 . TRP A 1 476 ? 116.044 -66.689 182.154 1.00 42.83  ?  487  TRP A NE1 1 
ATOM   3602 C  CE2 . TRP A 1 476 ? 115.785 -65.343 182.141 1.00 43.75  ?  487  TRP A CE2 1 
ATOM   3603 C  CE3 . TRP A 1 476 ? 113.859 -63.888 182.011 1.00 41.49  ?  487  TRP A CE3 1 
ATOM   3604 C  CZ2 . TRP A 1 476 ? 116.657 -64.258 182.209 1.00 42.19  ?  487  TRP A CZ2 1 
ATOM   3605 C  CZ3 . TRP A 1 476 ? 114.728 -62.813 182.077 1.00 41.76  ?  487  TRP A CZ3 1 
ATOM   3606 C  CH2 . TRP A 1 476 ? 116.111 -63.005 182.175 1.00 41.64  ?  487  TRP A CH2 1 
ATOM   3607 N  N   . PRO A 1 477 ? 113.164 -67.393 178.525 1.00 49.20  ?  488  PRO A N   1 
ATOM   3608 C  CA  . PRO A 1 477 ? 113.622 -66.048 178.146 1.00 47.28  ?  488  PRO A CA  1 
ATOM   3609 C  C   . PRO A 1 477 ? 112.489 -65.104 177.748 1.00 48.53  ?  488  PRO A C   1 
ATOM   3610 O  O   . PRO A 1 477 ? 111.494 -65.557 177.175 1.00 47.36  ?  488  PRO A O   1 
ATOM   3611 C  CB  . PRO A 1 477 ? 114.540 -66.321 176.949 1.00 48.35  ?  488  PRO A CB  1 
ATOM   3612 C  CG  . PRO A 1 477 ? 115.024 -67.707 177.162 1.00 52.97  ?  488  PRO A CG  1 
ATOM   3613 C  CD  . PRO A 1 477 ? 113.850 -68.437 177.745 1.00 49.87  ?  488  PRO A CD  1 
ATOM   3614 N  N   . PRO A 1 478 ? 112.628 -63.812 178.055 1.00 38.17  ?  489  PRO A N   1 
ATOM   3615 C  CA  . PRO A 1 478 ? 111.528 -62.866 177.802 1.00 37.18  ?  489  PRO A CA  1 
ATOM   3616 C  C   . PRO A 1 478 ? 111.330 -62.599 176.316 1.00 39.60  ?  489  PRO A C   1 
ATOM   3617 O  O   . PRO A 1 478 ? 111.597 -61.503 175.819 1.00 36.95  ?  489  PRO A O   1 
ATOM   3618 C  CB  . PRO A 1 478 ? 111.979 -61.611 178.562 1.00 38.66  ?  489  PRO A CB  1 
ATOM   3619 C  CG  . PRO A 1 478 ? 113.459 -61.670 178.508 1.00 42.60  ?  489  PRO A CG  1 
ATOM   3620 C  CD  . PRO A 1 478 ? 113.829 -63.132 178.576 1.00 38.31  ?  489  PRO A CD  1 
ATOM   3621 N  N   . LEU A 1 479 ? 110.841 -63.605 175.595 1.00 36.30  ?  490  LEU A N   1 
ATOM   3622 C  CA  . LEU A 1 479 ? 110.685 -63.488 174.149 1.00 36.36  ?  490  LEU A CA  1 
ATOM   3623 C  C   . LEU A 1 479 ? 109.564 -62.521 173.791 1.00 42.20  ?  490  LEU A C   1 
ATOM   3624 O  O   . LEU A 1 479 ? 108.489 -62.533 174.397 1.00 43.80  ?  490  LEU A O   1 
ATOM   3625 C  CB  . LEU A 1 479 ? 110.402 -64.855 173.532 1.00 36.21  ?  490  LEU A CB  1 
ATOM   3626 C  CG  . LEU A 1 479 ? 111.549 -65.859 173.599 1.00 40.82  ?  490  LEU A CG  1 
ATOM   3627 C  CD1 . LEU A 1 479 ? 111.005 -67.265 173.499 1.00 41.53  ?  490  LEU A CD1 1 
ATOM   3628 C  CD2 . LEU A 1 479 ? 112.544 -65.591 172.485 1.00 42.18  ?  490  LEU A CD2 1 
ATOM   3629 N  N   . ARG A 1 480 ? 109.823 -61.688 172.786 1.00 39.24  ?  491  ARG A N   1 
ATOM   3630 C  CA  . ARG A 1 480 ? 108.833 -60.755 172.263 1.00 39.11  ?  491  ARG A CA  1 
ATOM   3631 C  C   . ARG A 1 480 ? 108.929 -60.788 170.746 1.00 40.47  ?  491  ARG A C   1 
ATOM   3632 O  O   . ARG A 1 480 ? 109.934 -60.353 170.176 1.00 38.94  ?  491  ARG A O   1 
ATOM   3633 C  CB  . ARG A 1 480 ? 109.061 -59.340 172.792 1.00 40.57  ?  491  ARG A CB  1 
ATOM   3634 C  CG  . ARG A 1 480 ? 108.110 -58.316 172.209 1.00 41.96  ?  491  ARG A CG  1 
ATOM   3635 C  CD  . ARG A 1 480 ? 108.491 -56.906 172.615 1.00 48.92  ?  491  ARG A CD  1 
ATOM   3636 N  NE  . ARG A 1 480 ? 108.110 -55.942 171.587 1.00 52.06  ?  491  ARG A NE  1 
ATOM   3637 C  CZ  . ARG A 1 480 ? 108.324 -54.634 171.671 1.00 59.72  ?  491  ARG A CZ  1 
ATOM   3638 N  NH1 . ARG A 1 480 ? 108.915 -54.126 172.744 1.00 41.49  ?  491  ARG A NH1 1 
ATOM   3639 N  NH2 . ARG A 1 480 ? 107.945 -53.833 170.684 1.00 46.83  ?  491  ARG A NH2 1 
ATOM   3640 N  N   . LYS A 1 481 ? 107.893 -61.311 170.096 1.00 33.15  ?  492  LYS A N   1 
ATOM   3641 C  CA  . LYS A 1 481 ? 107.885 -61.411 168.643 1.00 30.97  ?  492  LYS A CA  1 
ATOM   3642 C  C   . LYS A 1 481 ? 107.720 -60.028 168.026 1.00 35.03  ?  492  LYS A C   1 
ATOM   3643 O  O   . LYS A 1 481 ? 106.743 -59.325 168.308 1.00 36.04  ?  492  LYS A O   1 
ATOM   3644 C  CB  . LYS A 1 481 ? 106.769 -62.346 168.186 1.00 32.57  ?  492  LYS A CB  1 
ATOM   3645 C  CG  . LYS A 1 481 ? 107.012 -63.808 168.525 1.00 45.05  ?  492  LYS A CG  1 
ATOM   3646 C  CD  . LYS A 1 481 ? 105.924 -64.696 167.944 1.00 54.48  ?  492  LYS A CD  1 
ATOM   3647 C  CE  . LYS A 1 481 ? 106.230 -66.165 168.174 1.00 69.88  ?  492  LYS A CE  1 
ATOM   3648 N  NZ  . LYS A 1 481 ? 106.328 -66.486 169.623 1.00 83.45  ?  492  LYS A NZ  1 
ATOM   3649 N  N   . VAL A 1 482 ? 108.683 -59.634 167.195 1.00 32.54  ?  493  VAL A N   1 
ATOM   3650 C  CA  . VAL A 1 482 ? 108.642 -58.382 166.458 1.00 31.39  ?  493  VAL A CA  1 
ATOM   3651 C  C   . VAL A 1 482 ? 108.843 -58.690 164.976 1.00 35.43  ?  493  VAL A C   1 
ATOM   3652 O  O   . VAL A 1 482 ? 109.054 -59.837 164.582 1.00 34.26  ?  493  VAL A O   1 
ATOM   3653 C  CB  . VAL A 1 482 ? 109.688 -57.366 166.962 1.00 33.69  ?  493  VAL A CB  1 
ATOM   3654 C  CG1 . VAL A 1 482 ? 109.381 -56.959 168.397 1.00 34.56  ?  493  VAL A CG1 1 
ATOM   3655 C  CG2 . VAL A 1 482 ? 111.081 -57.948 166.858 1.00 32.10  ?  493  VAL A CG2 1 
ATOM   3656 N  N   . GLY A 1 483 ? 108.778 -57.645 164.155 1.00 37.81  ?  494  GLY A N   1 
ATOM   3657 C  CA  . GLY A 1 483 ? 108.751 -57.824 162.719 1.00 37.09  ?  494  GLY A CA  1 
ATOM   3658 C  C   . GLY A 1 483 ? 107.357 -58.174 162.236 1.00 39.81  ?  494  GLY A C   1 
ATOM   3659 O  O   . GLY A 1 483 ? 106.400 -58.278 163.005 1.00 39.98  ?  494  GLY A O   1 
ATOM   3660 N  N   . SER A 1 484 ? 107.244 -58.365 160.921 1.00 33.55  ?  495  SER A N   1 
ATOM   3661 C  CA  . SER A 1 484 ? 105.957 -58.665 160.309 1.00 33.39  ?  495  SER A CA  1 
ATOM   3662 C  C   . SER A 1 484 ? 105.984 -59.838 159.342 1.00 35.82  ?  495  SER A C   1 
ATOM   3663 O  O   . SER A 1 484 ? 104.911 -60.276 158.909 1.00 34.69  ?  495  SER A O   1 
ATOM   3664 C  CB  . SER A 1 484 ? 105.413 -57.429 159.574 1.00 36.93  ?  495  SER A CB  1 
ATOM   3665 O  OG  . SER A 1 484 ? 105.265 -56.338 160.465 1.00 49.92  ?  495  SER A OG  1 
ATOM   3666 N  N   . PHE A 1 485 ? 107.155 -60.366 158.996 1.00 32.21  ?  496  PHE A N   1 
ATOM   3667 C  CA  . PHE A 1 485 ? 107.227 -61.443 158.018 1.00 31.36  ?  496  PHE A CA  1 
ATOM   3668 C  C   . PHE A 1 485 ? 106.699 -62.744 158.610 1.00 40.57  ?  496  PHE A C   1 
ATOM   3669 O  O   . PHE A 1 485 ? 107.157 -63.191 159.666 1.00 40.53  ?  496  PHE A O   1 
ATOM   3670 C  CB  . PHE A 1 485 ? 108.664 -61.631 157.535 1.00 30.40  ?  496  PHE A CB  1 
ATOM   3671 C  CG  . PHE A 1 485 ? 108.825 -62.753 156.549 1.00 29.20  ?  496  PHE A CG  1 
ATOM   3672 C  CD1 . PHE A 1 485 ? 108.408 -62.600 155.237 1.00 28.63  ?  496  PHE A CD1 1 
ATOM   3673 C  CD2 . PHE A 1 485 ? 109.388 -63.961 156.933 1.00 29.58  ?  496  PHE A CD2 1 
ATOM   3674 C  CE1 . PHE A 1 485 ? 108.549 -63.629 154.325 1.00 27.96  ?  496  PHE A CE1 1 
ATOM   3675 C  CE2 . PHE A 1 485 ? 109.532 -64.997 156.025 1.00 30.45  ?  496  PHE A CE2 1 
ATOM   3676 C  CZ  . PHE A 1 485 ? 109.113 -64.830 154.720 1.00 27.18  ?  496  PHE A CZ  1 
ATOM   3677 N  N   . ASP A 1 486 ? 105.733 -63.352 157.924 1.00 42.61  ?  497  ASP A N   1 
ATOM   3678 C  CA  . ASP A 1 486 ? 105.186 -64.642 158.324 1.00 45.48  ?  497  ASP A CA  1 
ATOM   3679 C  C   . ASP A 1 486 ? 105.685 -65.698 157.351 1.00 52.60  ?  497  ASP A C   1 
ATOM   3680 O  O   . ASP A 1 486 ? 105.344 -65.645 156.159 1.00 51.08  ?  497  ASP A O   1 
ATOM   3681 C  CB  . ASP A 1 486 ? 103.657 -64.604 158.343 1.00 48.77  ?  497  ASP A CB  1 
ATOM   3682 C  CG  . ASP A 1 486 ? 103.047 -65.784 159.085 1.00 67.04  ?  497  ASP A CG  1 
ATOM   3683 O  OD1 . ASP A 1 486 ? 103.742 -66.804 159.285 1.00 68.06  ?  497  ASP A OD1 1 
ATOM   3684 O  OD2 . ASP A 1 486 ? 101.861 -65.690 159.467 1.00 76.85  ?  497  ASP A OD2 1 
ATOM   3685 N  N   . PRO A 1 487 ? 106.497 -66.661 157.798 1.00 46.20  ?  498  PRO A N   1 
ATOM   3686 C  CA  . PRO A 1 487 ? 107.022 -67.675 156.875 1.00 47.10  ?  498  PRO A CA  1 
ATOM   3687 C  C   . PRO A 1 487 ? 106.033 -68.777 156.542 1.00 56.55  ?  498  PRO A C   1 
ATOM   3688 O  O   . PRO A 1 487 ? 106.308 -69.575 155.636 1.00 55.40  ?  498  PRO A O   1 
ATOM   3689 C  CB  . PRO A 1 487 ? 108.227 -68.237 157.636 1.00 48.07  ?  498  PRO A CB  1 
ATOM   3690 C  CG  . PRO A 1 487 ? 107.829 -68.107 159.073 1.00 52.38  ?  498  PRO A CG  1 
ATOM   3691 C  CD  . PRO A 1 487 ? 107.009 -66.841 159.168 1.00 48.04  ?  498  PRO A CD  1 
ATOM   3692 N  N   . TYR A 1 488 ? 104.902 -68.846 157.236 1.00 77.15  ?  499  TYR A N   1 
ATOM   3693 C  CA  . TYR A 1 488 ? 103.945 -69.926 157.060 1.00 79.43  ?  499  TYR A CA  1 
ATOM   3694 C  C   . TYR A 1 488 ? 102.818 -69.517 156.119 1.00 85.21  ?  499  TYR A C   1 
ATOM   3695 O  O   . TYR A 1 488 ? 102.638 -68.345 155.780 1.00 84.53  ?  499  TYR A O   1 
ATOM   3696 C  CB  . TYR A 1 488 ? 103.378 -70.364 158.414 1.00 82.87  ?  499  TYR A CB  1 
ATOM   3697 C  CG  . TYR A 1 488 ? 104.333 -71.207 159.228 1.00 86.58  ?  499  TYR A CG  1 
ATOM   3698 C  CD1 . TYR A 1 488 ? 104.449 -72.573 159.000 1.00 89.37  ?  499  TYR A CD1 1 
ATOM   3699 C  CD2 . TYR A 1 488 ? 105.118 -70.640 160.223 1.00 87.66  ?  499  TYR A CD2 1 
ATOM   3700 C  CE1 . TYR A 1 488 ? 105.322 -73.351 159.741 1.00 91.72  ?  499  TYR A CE1 1 
ATOM   3701 C  CE2 . TYR A 1 488 ? 105.993 -71.409 160.969 1.00 89.02  ?  499  TYR A CE2 1 
ATOM   3702 C  CZ  . TYR A 1 488 ? 106.091 -72.764 160.724 1.00 99.65  ?  499  TYR A CZ  1 
ATOM   3703 O  OH  . TYR A 1 488 ? 106.960 -73.535 161.463 1.00 102.69 ?  499  TYR A OH  1 
ATOM   3704 N  N   . SER A 1 489 ? 102.055 -70.521 155.693 1.00 86.85  ?  500  SER A N   1 
ATOM   3705 C  CA  . SER A 1 489 ? 100.899 -70.362 154.814 1.00 87.77  ?  500  SER A CA  1 
ATOM   3706 C  C   . SER A 1 489 ? 99.659  -70.758 155.617 1.00 93.08  ?  500  SER A C   1 
ATOM   3707 O  O   . SER A 1 489 ? 99.288  -71.934 155.665 1.00 92.57  ?  500  SER A O   1 
ATOM   3708 C  CB  . SER A 1 489 ? 101.059 -71.210 153.543 1.00 92.15  ?  500  SER A CB  1 
ATOM   3709 O  OG  . SER A 1 489 ? 102.272 -70.904 152.873 1.00 101.53 ?  500  SER A OG  1 
ATOM   3710 N  N   . ASP A 1 490 ? 99.022  -69.761 156.241 1.00 102.46 ?  501  ASP A N   1 
ATOM   3711 C  CA  . ASP A 1 490 ? 97.898  -70.013 157.142 1.00 103.47 ?  501  ASP A CA  1 
ATOM   3712 C  C   . ASP A 1 490 ? 96.737  -70.699 156.426 1.00 105.50 ?  501  ASP A C   1 
ATOM   3713 O  O   . ASP A 1 490 ? 96.374  -71.834 156.754 1.00 105.80 ?  501  ASP A O   1 
ATOM   3714 C  CB  . ASP A 1 490 ? 97.444  -68.695 157.786 1.00 106.48 ?  501  ASP A CB  1 
ATOM   3715 C  CG  . ASP A 1 490 ? 97.317  -67.552 156.783 1.00 120.42 ?  501  ASP A CG  1 
ATOM   3716 O  OD1 . ASP A 1 490 ? 97.558  -67.770 155.578 1.00 120.67 ?  501  ASP A OD1 1 
ATOM   3717 O  OD2 . ASP A 1 490 ? 96.972  -66.428 157.210 1.00 127.94 ?  501  ASP A OD2 1 
ATOM   3718 N  N   . ASP A 1 491 ? 96.133  -70.021 155.454 1.00 66.53  ?  502  ASP A N   1 
ATOM   3719 C  CA  . ASP A 1 491 ? 95.010  -70.594 154.718 1.00 65.15  ?  502  ASP A CA  1 
ATOM   3720 C  C   . ASP A 1 491 ? 94.991  -70.030 153.302 1.00 65.01  ?  502  ASP A C   1 
ATOM   3721 O  O   . ASP A 1 491 ? 94.707  -68.840 153.111 1.00 63.29  ?  502  ASP A O   1 
ATOM   3722 C  CB  . ASP A 1 491 ? 93.688  -70.308 155.435 1.00 67.50  ?  502  ASP A CB  1 
ATOM   3723 C  CG  . ASP A 1 491 ? 92.533  -71.138 154.896 1.00 74.14  ?  502  ASP A CG  1 
ATOM   3724 O  OD1 . ASP A 1 491 ? 92.761  -71.981 154.002 1.00 73.05  ?  502  ASP A OD1 1 
ATOM   3725 O  OD2 . ASP A 1 491 ? 91.394  -70.948 155.371 1.00 80.46  ?  502  ASP A OD2 1 
ATOM   3726 N  N   . PRO A 1 492 ? 95.283  -70.849 152.286 1.00 69.39  ?  503  PRO A N   1 
ATOM   3727 C  CA  . PRO A 1 492 ? 95.391  -70.305 150.923 1.00 68.25  ?  503  PRO A CA  1 
ATOM   3728 C  C   . PRO A 1 492 ? 94.071  -69.814 150.350 1.00 70.19  ?  503  PRO A C   1 
ATOM   3729 O  O   . PRO A 1 492 ? 94.085  -68.924 149.491 1.00 69.49  ?  503  PRO A O   1 
ATOM   3730 C  CB  . PRO A 1 492 ? 95.954  -71.486 150.120 1.00 69.69  ?  503  PRO A CB  1 
ATOM   3731 C  CG  . PRO A 1 492 ? 95.536  -72.695 150.885 1.00 74.54  ?  503  PRO A CG  1 
ATOM   3732 C  CD  . PRO A 1 492 ? 95.567  -72.294 152.334 1.00 70.47  ?  503  PRO A CD  1 
ATOM   3733 N  N   . ARG A 1 493 ? 92.934  -70.354 150.797 1.00 59.46  ?  504  ARG A N   1 
ATOM   3734 C  CA  . ARG A 1 493 ? 91.650  -69.937 150.245 1.00 58.78  ?  504  ARG A CA  1 
ATOM   3735 C  C   . ARG A 1 493 ? 91.310  -68.489 150.580 1.00 59.68  ?  504  ARG A C   1 
ATOM   3736 O  O   . ARG A 1 493 ? 90.412  -67.917 149.950 1.00 58.73  ?  504  ARG A O   1 
ATOM   3737 C  CB  . ARG A 1 493 ? 90.541  -70.875 150.730 1.00 60.03  ?  504  ARG A CB  1 
ATOM   3738 C  CG  . ARG A 1 493 ? 90.311  -70.871 152.227 1.00 76.25  ?  504  ARG A CG  1 
ATOM   3739 C  CD  . ARG A 1 493 ? 89.230  -71.866 152.610 1.00 89.74  ?  504  ARG A CD  1 
ATOM   3740 N  NE  . ARG A 1 493 ? 88.992  -71.892 154.050 1.00 101.67 ?  504  ARG A NE  1 
ATOM   3741 C  CZ  . ARG A 1 493 ? 88.074  -72.648 154.641 1.00 118.63 ?  504  ARG A CZ  1 
ATOM   3742 N  NH1 . ARG A 1 493 ? 87.927  -72.607 155.958 1.00 111.49 ?  504  ARG A NH1 1 
ATOM   3743 N  NH2 . ARG A 1 493 ? 87.301  -73.444 153.917 1.00 104.09 ?  504  ARG A NH2 1 
ATOM   3744 N  N   . LEU A 1 494 ? 92.009  -67.888 151.546 1.00 49.87  ?  505  LEU A N   1 
ATOM   3745 C  CA  . LEU A 1 494 ? 91.895  -66.469 151.860 1.00 48.42  ?  505  LEU A CA  1 
ATOM   3746 C  C   . LEU A 1 494 ? 92.582  -65.575 150.835 1.00 47.83  ?  505  LEU A C   1 
ATOM   3747 O  O   . LEU A 1 494 ? 92.295  -64.373 150.800 1.00 46.94  ?  505  LEU A O   1 
ATOM   3748 C  CB  . LEU A 1 494 ? 92.494  -66.184 153.241 1.00 48.59  ?  505  LEU A CB  1 
ATOM   3749 C  CG  . LEU A 1 494 ? 91.652  -66.353 154.508 1.00 54.00  ?  505  LEU A CG  1 
ATOM   3750 C  CD1 . LEU A 1 494 ? 91.106  -67.764 154.638 1.00 54.57  ?  505  LEU A CD1 1 
ATOM   3751 C  CD2 . LEU A 1 494 ? 92.484  -65.992 155.727 1.00 55.92  ?  505  LEU A CD2 1 
ATOM   3752 N  N   . GLY A 1 495 ? 93.470  -66.128 150.012 1.00 40.59  ?  506  GLY A N   1 
ATOM   3753 C  CA  . GLY A 1 495 ? 94.280  -65.293 149.140 1.00 38.66  ?  506  GLY A CA  1 
ATOM   3754 C  C   . GLY A 1 495 ? 93.428  -64.487 148.175 1.00 36.59  ?  506  GLY A C   1 
ATOM   3755 O  O   . GLY A 1 495 ? 92.409  -64.960 147.665 1.00 32.53  ?  506  GLY A O   1 
ATOM   3756 N  N   . ILE A 1 496 ? 93.869  -63.260 147.912 1.00 38.54  ?  507  ILE A N   1 
ATOM   3757 C  CA  . ILE A 1 496 ? 93.131  -62.301 147.099 1.00 38.18  ?  507  ILE A CA  1 
ATOM   3758 C  C   . ILE A 1 496 ? 93.645  -62.369 145.666 1.00 40.13  ?  507  ILE A C   1 
ATOM   3759 O  O   . ILE A 1 496 ? 94.846  -62.212 145.415 1.00 38.78  ?  507  ILE A O   1 
ATOM   3760 C  CB  . ILE A 1 496 ? 93.248  -60.884 147.681 1.00 41.78  ?  507  ILE A CB  1 
ATOM   3761 C  CG1 . ILE A 1 496 ? 92.297  -60.758 148.871 1.00 43.68  ?  507  ILE A CG1 1 
ATOM   3762 C  CG2 . ILE A 1 496 ? 92.947  -59.823 146.630 1.00 41.82  ?  507  ILE A CG2 1 
ATOM   3763 C  CD1 . ILE A 1 496 ? 92.709  -59.735 149.868 1.00 54.86  ?  507  ILE A CD1 1 
ATOM   3764 N  N   . GLN A 1 497 ? 92.728  -62.609 144.730 1.00 31.39  ?  508  GLN A N   1 
ATOM   3765 C  CA  . GLN A 1 497 ? 93.031  -62.792 143.318 1.00 28.76  ?  508  GLN A CA  1 
ATOM   3766 C  C   . GLN A 1 497 ? 92.815  -61.529 142.497 1.00 30.89  ?  508  GLN A C   1 
ATOM   3767 O  O   . GLN A 1 497 ? 93.563  -61.277 141.547 1.00 29.96  ?  508  GLN A O   1 
ATOM   3768 C  CB  . GLN A 1 497 ? 92.171  -63.921 142.741 1.00 30.07  ?  508  GLN A CB  1 
ATOM   3769 C  CG  . GLN A 1 497 ? 92.309  -65.250 143.468 1.00 37.32  ?  508  GLN A CG  1 
ATOM   3770 C  CD  . GLN A 1 497 ? 93.668  -65.881 143.264 1.00 41.43  ?  508  GLN A CD  1 
ATOM   3771 O  OE1 . GLN A 1 497 ? 94.228  -65.831 142.170 1.00 33.28  ?  508  GLN A OE1 1 
ATOM   3772 N  NE2 . GLN A 1 497 ? 94.211  -66.475 144.320 1.00 41.41  ?  508  GLN A NE2 1 
ATOM   3773 N  N   . LYS A 1 498 ? 91.805  -60.731 142.838 1.00 28.21  ?  509  LYS A N   1 
ATOM   3774 C  CA  . LYS A 1 498 ? 91.446  -59.560 142.053 1.00 27.42  ?  509  LYS A CA  1 
ATOM   3775 C  C   . LYS A 1 498 ? 91.152  -58.388 142.978 1.00 32.99  ?  509  LYS A C   1 
ATOM   3776 O  O   . LYS A 1 498 ? 90.623  -58.560 144.078 1.00 34.54  ?  509  LYS A O   1 
ATOM   3777 C  CB  . LYS A 1 498 ? 90.234  -59.841 141.156 1.00 27.82  ?  509  LYS A CB  1 
ATOM   3778 C  CG  . LYS A 1 498 ? 90.478  -60.900 140.094 1.00 27.15  ?  509  LYS A CG  1 
ATOM   3779 C  CD  . LYS A 1 498 ? 91.506  -60.428 139.079 1.00 28.40  ?  509  LYS A CD  1 
ATOM   3780 C  CE  . LYS A 1 498 ? 92.014  -61.579 138.224 1.00 29.98  ?  509  LYS A CE  1 
ATOM   3781 N  NZ  . LYS A 1 498 ? 93.056  -61.142 137.252 1.00 27.76  ?  509  LYS A NZ  1 
ATOM   3782 N  N   . ILE A 1 499 ? 91.504  -57.192 142.516 1.00 27.00  ?  510  ILE A N   1 
ATOM   3783 C  CA  . ILE A 1 499 ? 91.259  -55.953 143.244 1.00 28.01  ?  510  ILE A CA  1 
ATOM   3784 C  C   . ILE A 1 499 ? 90.724  -54.924 142.259 1.00 34.82  ?  510  ILE A C   1 
ATOM   3785 O  O   . ILE A 1 499 ? 91.232  -54.801 141.138 1.00 33.69  ?  510  ILE A O   1 
ATOM   3786 C  CB  . ILE A 1 499 ? 92.536  -55.429 143.933 1.00 30.82  ?  510  ILE A CB  1 
ATOM   3787 C  CG1 . ILE A 1 499 ? 93.014  -56.407 145.006 1.00 31.04  ?  510  ILE A CG1 1 
ATOM   3788 C  CG2 . ILE A 1 499 ? 92.298  -54.053 144.539 1.00 32.39  ?  510  ILE A CG2 1 
ATOM   3789 C  CD1 . ILE A 1 499 ? 94.387  -56.088 145.556 1.00 40.82  ?  510  ILE A CD1 1 
ATOM   3790 N  N   . PHE A 1 500 ? 89.689  -54.194 142.671 1.00 40.39  ?  511  PHE A N   1 
ATOM   3791 C  CA  . PHE A 1 500 ? 89.176  -53.069 141.896 1.00 41.19  ?  511  PHE A CA  1 
ATOM   3792 C  C   . PHE A 1 500 ? 88.825  -51.946 142.860 1.00 45.31  ?  511  PHE A C   1 
ATOM   3793 O  O   . PHE A 1 500 ? 87.917  -52.091 143.684 1.00 44.62  ?  511  PHE A O   1 
ATOM   3794 C  CB  . PHE A 1 500 ? 87.953  -53.463 141.062 1.00 43.62  ?  511  PHE A CB  1 
ATOM   3795 C  CG  . PHE A 1 500 ? 87.629  -52.485 139.963 1.00 45.33  ?  511  PHE A CG  1 
ATOM   3796 C  CD1 . PHE A 1 500 ? 87.141  -51.218 140.257 1.00 49.18  ?  511  PHE A CD1 1 
ATOM   3797 C  CD2 . PHE A 1 500 ? 87.807  -52.835 138.636 1.00 48.61  ?  511  PHE A CD2 1 
ATOM   3798 C  CE1 . PHE A 1 500 ? 86.846  -50.318 139.251 1.00 50.34  ?  511  PHE A CE1 1 
ATOM   3799 C  CE2 . PHE A 1 500 ? 87.510  -51.940 137.624 1.00 51.58  ?  511  PHE A CE2 1 
ATOM   3800 C  CZ  . PHE A 1 500 ? 87.029  -50.680 137.933 1.00 49.47  ?  511  PHE A CZ  1 
ATOM   3801 N  N   . LEU A 1 501 ? 89.542  -50.832 142.750 1.00 35.70  ?  512  LEU A N   1 
ATOM   3802 C  CA  . LEU A 1 501 ? 89.291  -49.644 143.555 1.00 36.10  ?  512  LEU A CA  1 
ATOM   3803 C  C   . LEU A 1 501 ? 88.747  -48.548 142.653 1.00 41.69  ?  512  LEU A C   1 
ATOM   3804 O  O   . LEU A 1 501 ? 89.409  -48.149 141.690 1.00 41.87  ?  512  LEU A O   1 
ATOM   3805 C  CB  . LEU A 1 501 ? 90.563  -49.164 144.250 1.00 35.75  ?  512  LEU A CB  1 
ATOM   3806 C  CG  . LEU A 1 501 ? 90.440  -47.807 144.948 1.00 40.08  ?  512  LEU A CG  1 
ATOM   3807 C  CD1 . LEU A 1 501 ? 89.775  -47.946 146.313 1.00 41.24  ?  512  LEU A CD1 1 
ATOM   3808 C  CD2 . LEU A 1 501 ? 91.796  -47.129 145.066 1.00 40.96  ?  512  LEU A CD2 1 
ATOM   3809 N  N   . CYS A 1 502 ? 87.550  -48.063 142.967 1.00 42.79  ?  513  CYS A N   1 
ATOM   3810 C  CA  . CYS A 1 502 ? 87.012  -46.872 142.323 1.00 42.95  ?  513  CYS A CA  1 
ATOM   3811 C  C   . CYS A 1 502 ? 87.500  -45.661 143.107 1.00 46.19  ?  513  CYS A C   1 
ATOM   3812 O  O   . CYS A 1 502 ? 87.045  -45.415 144.229 1.00 46.38  ?  513  CYS A O   1 
ATOM   3813 C  CB  . CYS A 1 502 ? 85.489  -46.915 142.265 1.00 44.61  ?  513  CYS A CB  1 
ATOM   3814 S  SG  . CYS A 1 502 ? 84.759  -45.382 141.645 1.00 49.00  ?  513  CYS A SG  1 
ATOM   3815 N  N   . LYS A 1 503 ? 88.435  -44.910 142.522 1.00 41.97  ?  514  LYS A N   1 
ATOM   3816 C  CA  . LYS A 1 503 ? 88.997  -43.752 143.204 1.00 42.46  ?  514  LYS A CA  1 
ATOM   3817 C  C   . LYS A 1 503 ? 87.993  -42.618 143.366 1.00 48.70  ?  514  LYS A C   1 
ATOM   3818 O  O   . LYS A 1 503 ? 88.268  -41.677 144.119 1.00 50.46  ?  514  LYS A O   1 
ATOM   3819 C  CB  . LYS A 1 503 ? 90.237  -43.249 142.459 1.00 43.60  ?  514  LYS A CB  1 
ATOM   3820 C  CG  . LYS A 1 503 ? 89.959  -42.657 141.087 1.00 44.81  ?  514  LYS A CG  1 
ATOM   3821 C  CD  . LYS A 1 503 ? 91.236  -42.139 140.448 1.00 49.45  ?  514  LYS A CD  1 
ATOM   3822 C  CE  . LYS A 1 503 ? 90.972  -41.546 139.078 1.00 57.56  ?  514  LYS A CE  1 
ATOM   3823 N  NZ  . LYS A 1 503 ? 92.221  -41.016 138.470 1.00 66.21  ?  514  LYS A NZ  1 
ATOM   3824 N  N   . TYR A 1 504 ? 86.839  -42.688 142.702 1.00 46.66  ?  515  TYR A N   1 
ATOM   3825 C  CA  . TYR A 1 504 ? 85.854  -41.617 142.778 1.00 46.46  ?  515  TYR A CA  1 
ATOM   3826 C  C   . TYR A 1 504 ? 84.822  -41.835 143.876 1.00 49.44  ?  515  TYR A C   1 
ATOM   3827 O  O   . TYR A 1 504 ? 84.369  -40.860 144.488 1.00 50.21  ?  515  TYR A O   1 
ATOM   3828 C  CB  . TYR A 1 504 ? 85.142  -41.461 141.430 1.00 46.93  ?  515  TYR A CB  1 
ATOM   3829 C  CG  . TYR A 1 504 ? 86.073  -41.149 140.275 1.00 48.01  ?  515  TYR A CG  1 
ATOM   3830 C  CD1 . TYR A 1 504 ? 86.659  -39.895 140.151 1.00 50.28  ?  515  TYR A CD1 1 
ATOM   3831 C  CD2 . TYR A 1 504 ? 86.361  -42.105 139.307 1.00 47.75  ?  515  TYR A CD2 1 
ATOM   3832 C  CE1 . TYR A 1 504 ? 87.511  -39.602 139.098 1.00 51.50  ?  515  TYR A CE1 1 
ATOM   3833 C  CE2 . TYR A 1 504 ? 87.211  -41.820 138.250 1.00 48.17  ?  515  TYR A CE2 1 
ATOM   3834 C  CZ  . TYR A 1 504 ? 87.783  -40.567 138.151 1.00 57.61  ?  515  TYR A CZ  1 
ATOM   3835 O  OH  . TYR A 1 504 ? 88.629  -40.275 137.104 1.00 59.61  ?  515  TYR A OH  1 
ATOM   3836 N  N   . SER A 1 505 ? 84.447  -43.084 144.148 1.00 42.08  ?  516  SER A N   1 
ATOM   3837 C  CA  . SER A 1 505 ? 83.365  -43.392 145.073 1.00 43.17  ?  516  SER A CA  1 
ATOM   3838 C  C   . SER A 1 505 ? 83.843  -44.021 146.371 1.00 48.85  ?  516  SER A C   1 
ATOM   3839 O  O   . SER A 1 505 ? 83.039  -44.190 147.295 1.00 50.09  ?  516  SER A O   1 
ATOM   3840 C  CB  . SER A 1 505 ? 82.351  -44.328 144.406 1.00 46.36  ?  516  SER A CB  1 
ATOM   3841 O  OG  . SER A 1 505 ? 82.888  -45.632 144.277 1.00 53.76  ?  516  SER A OG  1 
ATOM   3842 N  N   . GLY A 1 506 ? 85.119  -44.388 146.461 1.00 39.19  ?  517  GLY A N   1 
ATOM   3843 C  CA  . GLY A 1 506 ? 85.655  -44.978 147.669 1.00 39.20  ?  517  GLY A CA  1 
ATOM   3844 C  C   . GLY A 1 506 ? 85.153  -46.391 147.846 1.00 43.59  ?  517  GLY A C   1 
ATOM   3845 O  O   . GLY A 1 506 ? 85.324  -47.000 148.905 1.00 42.74  ?  517  GLY A O   1 
ATOM   3846 N  N   . TYR A 1 507 ? 84.508  -46.917 146.812 1.00 48.56  ?  518  TYR A N   1 
ATOM   3847 C  CA  . TYR A 1 507 ? 84.104  -48.309 146.820 1.00 48.83  ?  518  TYR A CA  1 
ATOM   3848 C  C   . TYR A 1 507 ? 85.282  -49.191 146.432 1.00 46.91  ?  518  TYR A C   1 
ATOM   3849 O  O   . TYR A 1 507 ? 86.204  -48.766 145.729 1.00 44.79  ?  518  TYR A O   1 
ATOM   3850 C  CB  . TYR A 1 507 ? 82.930  -48.544 145.869 1.00 52.26  ?  518  TYR A CB  1 
ATOM   3851 C  CG  . TYR A 1 507 ? 81.571  -48.218 146.454 1.00 58.40  ?  518  TYR A CG  1 
ATOM   3852 C  CD1 . TYR A 1 507 ? 81.119  -48.846 147.610 1.00 61.48  ?  518  TYR A CD1 1 
ATOM   3853 C  CD2 . TYR A 1 507 ? 80.728  -47.304 145.836 1.00 60.73  ?  518  TYR A CD2 1 
ATOM   3854 C  CE1 . TYR A 1 507 ? 79.871  -48.559 148.141 1.00 62.94  ?  518  TYR A CE1 1 
ATOM   3855 C  CE2 . TYR A 1 507 ? 79.480  -47.013 146.358 1.00 63.15  ?  518  TYR A CE2 1 
ATOM   3856 C  CZ  . TYR A 1 507 ? 79.058  -47.642 147.508 1.00 73.15  ?  518  TYR A CZ  1 
ATOM   3857 O  OH  . TYR A 1 507 ? 77.815  -47.347 148.020 1.00 79.23  ?  518  TYR A OH  1 
ATOM   3858 N  N   . LEU A 1 508 ? 85.252  -50.426 146.915 1.00 37.31  ?  519  LEU A N   1 
ATOM   3859 C  CA  . LEU A 1 508 ? 86.341  -51.357 146.667 1.00 36.64  ?  519  LEU A CA  1 
ATOM   3860 C  C   . LEU A 1 508 ? 85.784  -52.767 146.584 1.00 41.40  ?  519  LEU A C   1 
ATOM   3861 O  O   . LEU A 1 508 ? 85.026  -53.191 147.462 1.00 40.31  ?  519  LEU A O   1 
ATOM   3862 C  CB  . LEU A 1 508 ? 87.399  -51.277 147.768 1.00 36.67  ?  519  LEU A CB  1 
ATOM   3863 C  CG  . LEU A 1 508 ? 88.556  -52.266 147.626 1.00 40.80  ?  519  LEU A CG  1 
ATOM   3864 C  CD1 . LEU A 1 508 ? 89.631  -51.723 146.697 1.00 40.22  ?  519  LEU A CD1 1 
ATOM   3865 C  CD2 . LEU A 1 508 ? 89.134  -52.608 148.983 1.00 40.97  ?  519  LEU A CD2 1 
ATOM   3866 N  N   . ALA A 1 509 ? 86.162  -53.481 145.532 1.00 40.07  ?  520  ALA A N   1 
ATOM   3867 C  CA  . ALA A 1 509 ? 85.822  -54.884 145.364 1.00 39.84  ?  520  ALA A CA  1 
ATOM   3868 C  C   . ALA A 1 509 ? 87.094  -55.717 145.408 1.00 42.74  ?  520  ALA A C   1 
ATOM   3869 O  O   . ALA A 1 509 ? 88.096  -55.372 144.773 1.00 41.69  ?  520  ALA A O   1 
ATOM   3870 C  CB  . ALA A 1 509 ? 85.083  -55.118 144.045 1.00 40.04  ?  520  ALA A CB  1 
ATOM   3871 N  N   . VAL A 1 510 ? 87.059  -56.803 146.175 1.00 38.00  ?  521  VAL A N   1 
ATOM   3872 C  CA  . VAL A 1 510 ? 88.165  -57.749 146.237 1.00 38.06  ?  521  VAL A CA  1 
ATOM   3873 C  C   . VAL A 1 510 ? 87.600  -59.156 146.110 1.00 41.21  ?  521  VAL A C   1 
ATOM   3874 O  O   . VAL A 1 510 ? 86.502  -59.453 146.590 1.00 40.59  ?  521  VAL A O   1 
ATOM   3875 C  CB  . VAL A 1 510 ? 88.998  -57.604 147.533 1.00 42.33  ?  521  VAL A CB  1 
ATOM   3876 C  CG1 . VAL A 1 510 ? 89.652  -56.231 147.601 1.00 42.22  ?  521  VAL A CG1 1 
ATOM   3877 C  CG2 . VAL A 1 510 ? 88.141  -57.849 148.762 1.00 43.08  ?  521  VAL A CG2 1 
ATOM   3878 N  N   . ALA A 1 511 ? 88.356  -60.023 145.445 1.00 37.08  ?  522  ALA A N   1 
ATOM   3879 C  CA  . ALA A 1 511 ? 87.930  -61.391 145.197 1.00 36.50  ?  522  ALA A CA  1 
ATOM   3880 C  C   . ALA A 1 511 ? 89.033  -62.355 145.607 1.00 36.99  ?  522  ALA A C   1 
ATOM   3881 O  O   . ALA A 1 511 ? 90.222  -62.041 145.515 1.00 35.78  ?  522  ALA A O   1 
ATOM   3882 C  CB  . ALA A 1 511 ? 87.560  -61.602 143.727 1.00 36.85  ?  522  ALA A CB  1 
ATOM   3883 N  N   . GLY A 1 512 ? 88.624  -63.540 146.055 1.00 33.36  ?  523  GLY A N   1 
ATOM   3884 C  CA  . GLY A 1 512 ? 89.551  -64.476 146.657 1.00 32.51  ?  523  GLY A CA  1 
ATOM   3885 C  C   . GLY A 1 512 ? 89.699  -65.813 145.957 1.00 36.80  ?  523  GLY A C   1 
ATOM   3886 O  O   . GLY A 1 512 ? 89.170  -66.020 144.861 1.00 36.91  ?  523  GLY A O   1 
ATOM   3887 N  N   . THR A 1 513 ? 90.419  -66.732 146.600 1.00 32.41  ?  524  THR A N   1 
ATOM   3888 C  CA  . THR A 1 513 ? 90.757  -68.028 146.029 1.00 33.13  ?  524  THR A CA  1 
ATOM   3889 C  C   . THR A 1 513 ? 89.666  -69.075 146.232 1.00 40.23  ?  524  THR A C   1 
ATOM   3890 O  O   . THR A 1 513 ? 89.703  -70.121 145.572 1.00 39.60  ?  524  THR A O   1 
ATOM   3891 C  CB  . THR A 1 513 ? 92.082  -68.524 146.633 1.00 41.49  ?  524  THR A CB  1 
ATOM   3892 O  OG1 . THR A 1 513 ? 92.977  -67.415 146.785 1.00 41.57  ?  524  THR A OG1 1 
ATOM   3893 C  CG2 . THR A 1 513 ? 92.749  -69.557 145.735 1.00 37.96  ?  524  THR A CG2 1 
ATOM   3894 N  N   . ALA A 1 514 ? 88.695  -68.820 147.108 1.00 47.64  ?  525  ALA A N   1 
ATOM   3895 C  CA  . ALA A 1 514 ? 87.596  -69.743 147.375 1.00 48.80  ?  525  ALA A CA  1 
ATOM   3896 C  C   . ALA A 1 514 ? 86.255  -69.128 146.995 1.00 54.70  ?  525  ALA A C   1 
ATOM   3897 O  O   . ALA A 1 514 ? 85.245  -69.324 147.675 1.00 56.42  ?  525  ALA A O   1 
ATOM   3898 C  CB  . ALA A 1 514 ? 87.587  -70.173 148.841 1.00 49.88  ?  525  ALA A CB  1 
ATOM   3899 N  N   . GLY A 1 515 ? 86.236  -68.364 145.903 1.00 41.76  ?  526  GLY A N   1 
ATOM   3900 C  CA  . GLY A 1 515 ? 85.004  -67.796 145.391 1.00 41.34  ?  526  GLY A CA  1 
ATOM   3901 C  C   . GLY A 1 515 ? 84.402  -66.680 146.209 1.00 44.44  ?  526  GLY A C   1 
ATOM   3902 O  O   . GLY A 1 515 ? 83.246  -66.320 145.970 1.00 44.83  ?  526  GLY A O   1 
ATOM   3903 N  N   . GLN A 1 516 ? 85.135  -66.116 147.165 1.00 43.83  ?  527  GLN A N   1 
ATOM   3904 C  CA  . GLN A 1 516 ? 84.593  -65.024 147.960 1.00 44.22  ?  527  GLN A CA  1 
ATOM   3905 C  C   . GLN A 1 516 ? 84.739  -63.711 147.200 1.00 48.32  ?  527  GLN A C   1 
ATOM   3906 O  O   . GLN A 1 516 ? 85.810  -63.401 146.669 1.00 46.99  ?  527  GLN A O   1 
ATOM   3907 C  CB  . GLN A 1 516 ? 85.278  -64.942 149.329 1.00 45.10  ?  527  GLN A CB  1 
ATOM   3908 C  CG  . GLN A 1 516 ? 86.762  -64.587 149.329 1.00 43.00  ?  527  GLN A CG  1 
ATOM   3909 C  CD  . GLN A 1 516 ? 87.660  -65.788 149.103 1.00 48.43  ?  527  GLN A CD  1 
ATOM   3910 O  OE1 . GLN A 1 516 ? 87.383  -66.632 148.254 1.00 32.99  ?  527  GLN A OE1 1 
ATOM   3911 N  NE2 . GLN A 1 516 ? 88.747  -65.867 149.865 1.00 43.30  ?  527  GLN A NE2 1 
ATOM   3912 N  N   . VAL A 1 517 ? 83.647  -62.959 147.119 1.00 43.30  ?  528  VAL A N   1 
ATOM   3913 C  CA  . VAL A 1 517 ? 83.632  -61.642 146.494 1.00 42.86  ?  528  VAL A CA  1 
ATOM   3914 C  C   . VAL A 1 517 ? 83.123  -60.654 147.530 1.00 48.04  ?  528  VAL A C   1 
ATOM   3915 O  O   . VAL A 1 517 ? 82.025  -60.828 148.071 1.00 48.47  ?  528  VAL A O   1 
ATOM   3916 C  CB  . VAL A 1 517 ? 82.760  -61.609 145.229 1.00 46.39  ?  528  VAL A CB  1 
ATOM   3917 C  CG1 . VAL A 1 517 ? 82.904  -60.267 144.526 1.00 45.77  ?  528  VAL A CG1 1 
ATOM   3918 C  CG2 . VAL A 1 517 ? 83.125  -62.751 144.290 1.00 45.52  ?  528  VAL A CG2 1 
ATOM   3919 N  N   . LEU A 1 518 ? 83.920  -59.627 147.809 1.00 45.36  ?  529  LEU A N   1 
ATOM   3920 C  CA  . LEU A 1 518 ? 83.605  -58.644 148.835 1.00 45.46  ?  529  LEU A CA  1 
ATOM   3921 C  C   . LEU A 1 518 ? 83.576  -57.254 148.223 1.00 49.34  ?  529  LEU A C   1 
ATOM   3922 O  O   . LEU A 1 518 ? 84.493  -56.878 147.485 1.00 50.28  ?  529  LEU A O   1 
ATOM   3923 C  CB  . LEU A 1 518 ? 84.627  -58.694 149.973 1.00 45.38  ?  529  LEU A CB  1 
ATOM   3924 C  CG  . LEU A 1 518 ? 84.548  -59.899 150.910 1.00 50.20  ?  529  LEU A CG  1 
ATOM   3925 C  CD1 . LEU A 1 518 ? 85.825  -60.025 151.722 1.00 49.60  ?  529  LEU A CD1 1 
ATOM   3926 C  CD2 . LEU A 1 518 ? 83.340  -59.776 151.826 1.00 51.77  ?  529  LEU A CD2 1 
ATOM   3927 N  N   . VAL A 1 519 ? 82.525  -56.498 148.530 1.00 45.19  ?  530  VAL A N   1 
ATOM   3928 C  CA  . VAL A 1 519 ? 82.426  -55.089 148.170 1.00 43.93  ?  530  VAL A CA  1 
ATOM   3929 C  C   . VAL A 1 519 ? 82.508  -54.275 149.452 1.00 45.67  ?  530  VAL A C   1 
ATOM   3930 O  O   . VAL A 1 519 ? 81.836  -54.594 150.442 1.00 43.89  ?  530  VAL A O   1 
ATOM   3931 C  CB  . VAL A 1 519 ? 81.132  -54.783 147.398 1.00 46.81  ?  530  VAL A CB  1 
ATOM   3932 C  CG1 . VAL A 1 519 ? 81.233  -53.423 146.721 1.00 45.74  ?  530  VAL A CG1 1 
ATOM   3933 C  CG2 . VAL A 1 519 ? 80.855  -55.872 146.376 1.00 45.95  ?  530  VAL A CG2 1 
ATOM   3934 N  N   . LEU A 1 520 ? 83.335  -53.232 149.435 1.00 42.55  ?  531  LEU A N   1 
ATOM   3935 C  CA  . LEU A 1 520 ? 83.640  -52.446 150.621 1.00 42.41  ?  531  LEU A CA  1 
ATOM   3936 C  C   . LEU A 1 520 ? 83.510  -50.965 150.295 1.00 47.95  ?  531  LEU A C   1 
ATOM   3937 O  O   . LEU A 1 520 ? 83.489  -50.567 149.129 1.00 46.30  ?  531  LEU A O   1 
ATOM   3938 C  CB  . LEU A 1 520 ? 85.054  -52.749 151.148 1.00 41.60  ?  531  LEU A CB  1 
ATOM   3939 C  CG  . LEU A 1 520 ? 85.403  -54.197 151.524 1.00 46.36  ?  531  LEU A CG  1 
ATOM   3940 C  CD1 . LEU A 1 520 ? 85.757  -55.055 150.311 1.00 46.60  ?  531  LEU A CD1 1 
ATOM   3941 C  CD2 . LEU A 1 520 ? 86.526  -54.230 152.547 1.00 47.47  ?  531  LEU A CD2 1 
ATOM   3942 N  N   . GLU A 1 521 ? 83.422  -50.146 151.342 1.00 44.35  ?  532  GLU A N   1 
ATOM   3943 C  CA  . GLU A 1 521 ? 83.320  -48.703 151.180 1.00 44.95  ?  532  GLU A CA  1 
ATOM   3944 C  C   . GLU A 1 521 ? 84.198  -48.007 152.208 1.00 48.73  ?  532  GLU A C   1 
ATOM   3945 O  O   . GLU A 1 521 ? 84.320  -48.465 153.348 1.00 48.40  ?  532  GLU A O   1 
ATOM   3946 C  CB  . GLU A 1 521 ? 81.870  -48.219 151.317 1.00 47.50  ?  532  GLU A CB  1 
ATOM   3947 C  CG  . GLU A 1 521 ? 81.667  -46.774 150.883 1.00 60.49  ?  532  GLU A CG  1 
ATOM   3948 C  CD  . GLU A 1 521 ? 80.218  -46.336 150.944 1.00 84.49  ?  532  GLU A CD  1 
ATOM   3949 O  OE1 . GLU A 1 521 ? 79.938  -45.174 150.581 1.00 79.43  ?  532  GLU A OE1 1 
ATOM   3950 O  OE2 . GLU A 1 521 ? 79.361  -47.147 151.353 1.00 77.01  ?  532  GLU A OE2 1 
ATOM   3951 N  N   . LEU A 1 522 ? 84.809  -46.900 151.797 1.00 41.81  ?  533  LEU A N   1 
ATOM   3952 C  CA  . LEU A 1 522 ? 85.682  -46.146 152.687 1.00 42.71  ?  533  LEU A CA  1 
ATOM   3953 C  C   . LEU A 1 522 ? 84.856  -45.408 153.733 1.00 51.61  ?  533  LEU A C   1 
ATOM   3954 O  O   . LEU A 1 522 ? 83.928  -44.666 153.398 1.00 51.58  ?  533  LEU A O   1 
ATOM   3955 C  CB  . LEU A 1 522 ? 86.530  -45.162 151.886 1.00 41.94  ?  533  LEU A CB  1 
ATOM   3956 C  CG  . LEU A 1 522 ? 87.615  -44.404 152.654 1.00 45.73  ?  533  LEU A CG  1 
ATOM   3957 C  CD1 . LEU A 1 522 ? 88.560  -45.375 153.343 1.00 45.26  ?  533  LEU A CD1 1 
ATOM   3958 C  CD2 . LEU A 1 522 ? 88.376  -43.494 151.708 1.00 47.28  ?  533  LEU A CD2 1 
ATOM   3959 N  N   . ASN A 1 523 ? 85.201  -45.611 155.004 1.00 56.81  ?  534  ASN A N   1 
ATOM   3960 C  CA  . ASN A 1 523 ? 84.478  -45.022 156.126 1.00 58.46  ?  534  ASN A CA  1 
ATOM   3961 C  C   . ASN A 1 523 ? 85.486  -44.384 157.069 1.00 63.67  ?  534  ASN A C   1 
ATOM   3962 O  O   . ASN A 1 523 ? 86.426  -45.049 157.518 1.00 62.05  ?  534  ASN A O   1 
ATOM   3963 C  CB  . ASN A 1 523 ? 83.642  -46.083 156.851 1.00 60.27  ?  534  ASN A CB  1 
ATOM   3964 C  CG  . ASN A 1 523 ? 82.608  -45.483 157.790 1.00 74.80  ?  534  ASN A CG  1 
ATOM   3965 O  OD1 . ASN A 1 523 ? 82.708  -44.322 158.191 1.00 68.58  ?  534  ASN A OD1 1 
ATOM   3966 N  ND2 . ASN A 1 523 ? 81.610  -46.280 158.154 1.00 62.27  ?  534  ASN A ND2 1 
ATOM   3967 N  N   . ASP A 1 524 ? 85.288  -43.097 157.370 1.00 67.21  ?  535  ASP A N   1 
ATOM   3968 C  CA  . ASP A 1 524 ? 86.214  -42.371 158.232 1.00 68.14  ?  535  ASP A CA  1 
ATOM   3969 C  C   . ASP A 1 524 ? 86.168  -42.850 159.678 1.00 74.69  ?  535  ASP A C   1 
ATOM   3970 O  O   . ASP A 1 524 ? 87.137  -42.639 160.417 1.00 74.91  ?  535  ASP A O   1 
ATOM   3971 C  CB  . ASP A 1 524 ? 85.917  -40.870 158.181 1.00 70.32  ?  535  ASP A CB  1 
ATOM   3972 C  CG  . ASP A 1 524 ? 85.978  -40.309 156.773 1.00 82.96  ?  535  ASP A CG  1 
ATOM   3973 O  OD1 . ASP A 1 524 ? 84.999  -40.486 156.017 1.00 85.74  ?  535  ASP A OD1 1 
ATOM   3974 O  OD2 . ASP A 1 524 ? 87.005  -39.691 156.421 1.00 87.11  ?  535  ASP A OD2 1 
ATOM   3975 N  N   . GLU A 1 525 ? 85.076  -43.484 160.099 1.00 68.51  ?  536  GLU A N   1 
ATOM   3976 C  CA  . GLU A 1 525 ? 84.913  -43.933 161.472 1.00 69.70  ?  536  GLU A CA  1 
ATOM   3977 C  C   . GLU A 1 525 ? 84.502  -45.401 161.487 1.00 73.35  ?  536  GLU A C   1 
ATOM   3978 O  O   . GLU A 1 525 ? 84.238  -46.008 160.445 1.00 72.22  ?  536  GLU A O   1 
ATOM   3979 C  CB  . GLU A 1 525 ? 83.889  -43.065 162.220 1.00 72.15  ?  536  GLU A CB  1 
ATOM   3980 C  CG  . GLU A 1 525 ? 84.240  -41.577 162.242 1.00 84.68  ?  536  GLU A CG  1 
ATOM   3981 C  CD  . GLU A 1 525 ? 85.564  -41.292 162.934 1.00 103.71 ?  536  GLU A CD  1 
ATOM   3982 O  OE1 . GLU A 1 525 ? 85.883  -41.989 163.920 1.00 93.68  ?  536  GLU A OE1 1 
ATOM   3983 O  OE2 . GLU A 1 525 ? 86.288  -40.373 162.491 1.00 92.40  ?  536  GLU A OE2 1 
ATOM   3984 N  N   . ALA A 1 526 ? 84.454  -45.967 162.693 1.00 51.00  ?  537  ALA A N   1 
ATOM   3985 C  CA  . ALA A 1 526 ? 84.180  -47.381 162.898 1.00 51.32  ?  537  ALA A CA  1 
ATOM   3986 C  C   . ALA A 1 526 ? 82.702  -47.694 162.669 1.00 57.53  ?  537  ALA A C   1 
ATOM   3987 O  O   . ALA A 1 526 ? 81.857  -46.803 162.547 1.00 57.62  ?  537  ALA A O   1 
ATOM   3988 C  CB  . ALA A 1 526 ? 84.597  -47.806 164.305 1.00 52.31  ?  537  ALA A CB  1 
ATOM   3989 N  N   . ALA A 1 527 ? 82.396  -48.989 162.616 1.00 70.13  ?  538  ALA A N   1 
ATOM   3990 C  CA  . ALA A 1 527 ? 81.036  -49.461 162.395 1.00 71.36  ?  538  ALA A CA  1 
ATOM   3991 C  C   . ALA A 1 527 ? 80.928  -50.900 162.878 1.00 77.19  ?  538  ALA A C   1 
ATOM   3992 O  O   . ALA A 1 527 ? 81.898  -51.660 162.826 1.00 74.96  ?  538  ALA A O   1 
ATOM   3993 C  CB  . ALA A 1 527 ? 80.638  -49.361 160.918 1.00 71.72  ?  538  ALA A CB  1 
ATOM   3994 N  N   . GLU A 1 528 ? 79.734  -51.264 163.346 1.00 86.52  ?  539  GLU A N   1 
ATOM   3995 C  CA  . GLU A 1 528 ? 79.456  -52.591 163.880 1.00 87.42  ?  539  GLU A CA  1 
ATOM   3996 C  C   . GLU A 1 528 ? 78.326  -53.260 163.105 1.00 91.52  ?  539  GLU A C   1 
ATOM   3997 O  O   . GLU A 1 528 ? 77.463  -53.931 163.675 1.00 92.51  ?  539  GLU A O   1 
ATOM   3998 C  CB  . GLU A 1 528 ? 79.122  -52.515 165.368 1.00 89.62  ?  539  GLU A CB  1 
ATOM   3999 C  CG  . GLU A 1 528 ? 79.526  -53.742 166.168 1.00 102.52 ?  539  GLU A CG  1 
ATOM   4000 C  CD  . GLU A 1 528 ? 79.239  -53.586 167.648 1.00 128.73 ?  539  GLU A CD  1 
ATOM   4001 O  OE1 . GLU A 1 528 ? 78.198  -54.098 168.111 1.00 126.16 ?  539  GLU A OE1 1 
ATOM   4002 O  OE2 . GLU A 1 528 ? 80.048  -52.938 168.346 1.00 123.36 ?  539  GLU A OE2 1 
ATOM   4003 N  N   . GLN A 1 529 ? 78.327  -53.081 161.789 1.00 74.07  ?  540  GLN A N   1 
ATOM   4004 C  CA  . GLN A 1 529 ? 77.289  -53.626 160.933 1.00 73.51  ?  540  GLN A CA  1 
ATOM   4005 C  C   . GLN A 1 529 ? 77.552  -55.101 160.633 1.00 75.33  ?  540  GLN A C   1 
ATOM   4006 O  O   . GLN A 1 529 ? 78.616  -55.649 160.931 1.00 73.99  ?  540  GLN A O   1 
ATOM   4007 C  CB  . GLN A 1 529 ? 77.205  -52.829 159.634 1.00 74.58  ?  540  GLN A CB  1 
ATOM   4008 C  CG  . GLN A 1 529 ? 78.526  -52.746 158.886 1.00 90.35  ?  540  GLN A CG  1 
ATOM   4009 C  CD  . GLN A 1 529 ? 78.438  -51.895 157.636 1.00 112.79 ?  540  GLN A CD  1 
ATOM   4010 O  OE1 . GLN A 1 529 ? 77.941  -52.341 156.602 1.00 109.36 ?  540  GLN A OE1 1 
ATOM   4011 N  NE2 . GLN A 1 529 ? 78.919  -50.661 157.726 1.00 104.75 ?  540  GLN A NE2 1 
ATOM   4012 N  N   . ALA A 1 530 ? 76.557  -55.745 160.035 1.00 79.85  ?  541  ALA A N   1 
ATOM   4013 C  CA  . ALA A 1 530 ? 76.675  -57.117 159.569 1.00 79.12  ?  541  ALA A CA  1 
ATOM   4014 C  C   . ALA A 1 530 ? 76.960  -57.137 158.072 1.00 82.25  ?  541  ALA A C   1 
ATOM   4015 O  O   . ALA A 1 530 ? 76.737  -56.156 157.358 1.00 82.13  ?  541  ALA A O   1 
ATOM   4016 C  CB  . ALA A 1 530 ? 75.403  -57.911 159.875 1.00 80.25  ?  541  ALA A CB  1 
ATOM   4017 N  N   . VAL A 1 531 ? 77.464  -58.273 157.601 1.00 67.58  ?  542  VAL A N   1 
ATOM   4018 C  CA  . VAL A 1 531 ? 77.817  -58.461 156.199 1.00 66.22  ?  542  VAL A CA  1 
ATOM   4019 C  C   . VAL A 1 531 ? 76.831  -59.452 155.596 1.00 69.45  ?  542  VAL A C   1 
ATOM   4020 O  O   . VAL A 1 531 ? 76.706  -60.584 156.078 1.00 69.59  ?  542  VAL A O   1 
ATOM   4021 C  CB  . VAL A 1 531 ? 79.267  -58.946 156.041 1.00 69.04  ?  542  VAL A CB  1 
ATOM   4022 C  CG1 . VAL A 1 531 ? 79.678  -58.938 154.574 1.00 67.94  ?  542  VAL A CG1 1 
ATOM   4023 C  CG2 . VAL A 1 531 ? 80.206  -58.081 156.871 1.00 68.60  ?  542  VAL A CG2 1 
ATOM   4024 N  N   . GLU A 1 532 ? 76.130  -59.028 154.546 1.00 67.94  ?  543  GLU A N   1 
ATOM   4025 C  CA  . GLU A 1 532 ? 75.105  -59.864 153.932 1.00 67.39  ?  543  GLU A CA  1 
ATOM   4026 C  C   . GLU A 1 532 ? 75.742  -60.976 153.105 1.00 68.72  ?  543  GLU A C   1 
ATOM   4027 O  O   . GLU A 1 532 ? 76.481  -60.707 152.152 1.00 67.82  ?  543  GLU A O   1 
ATOM   4028 C  CB  . GLU A 1 532 ? 74.183  -59.018 153.058 1.00 68.88  ?  543  GLU A CB  1 
ATOM   4029 C  CG  . GLU A 1 532 ? 73.131  -58.241 153.831 1.00 79.98  ?  543  GLU A CG  1 
ATOM   4030 C  CD  . GLU A 1 532 ? 72.082  -57.625 152.926 1.00 94.44  ?  543  GLU A CD  1 
ATOM   4031 O  OE1 . GLU A 1 532 ? 72.136  -56.398 152.697 1.00 87.47  ?  543  GLU A OE1 1 
ATOM   4032 O  OE2 . GLU A 1 532 ? 71.206  -58.372 152.438 1.00 79.22  ?  543  GLU A OE2 1 
ATOM   4033 N  N   . GLN A 1 533 ? 75.449  -62.223 153.469 1.00 52.29  ?  544  GLN A N   1 
ATOM   4034 C  CA  . GLN A 1 533 ? 75.885  -63.373 152.687 1.00 51.05  ?  544  GLN A CA  1 
ATOM   4035 C  C   . GLN A 1 533 ? 74.907  -63.618 151.547 1.00 53.93  ?  544  GLN A C   1 
ATOM   4036 O  O   . GLN A 1 533 ? 73.701  -63.760 151.771 1.00 53.23  ?  544  GLN A O   1 
ATOM   4037 C  CB  . GLN A 1 533 ? 75.992  -64.621 153.562 1.00 52.83  ?  544  GLN A CB  1 
ATOM   4038 C  CG  . GLN A 1 533 ? 77.290  -64.743 154.342 1.00 68.78  ?  544  GLN A CG  1 
ATOM   4039 C  CD  . GLN A 1 533 ? 77.275  -63.968 155.645 1.00 89.56  ?  544  GLN A CD  1 
ATOM   4040 O  OE1 . GLN A 1 533 ? 78.062  -63.042 155.837 1.00 85.08  ?  544  GLN A OE1 1 
ATOM   4041 N  NE2 . GLN A 1 533 ? 76.389  -64.355 156.556 1.00 82.34  ?  544  GLN A NE2 1 
ATOM   4042 N  N   . VAL A 1 534 ? 75.428  -63.653 150.321 1.00 62.00  ?  545  VAL A N   1 
ATOM   4043 C  CA  . VAL A 1 534 ? 74.639  -63.929 149.127 1.00 61.38  ?  545  VAL A CA  1 
ATOM   4044 C  C   . VAL A 1 534 ? 75.369  -64.986 148.311 1.00 63.29  ?  545  VAL A C   1 
ATOM   4045 O  O   . VAL A 1 534 ? 76.582  -64.884 148.099 1.00 62.21  ?  545  VAL A O   1 
ATOM   4046 C  CB  . VAL A 1 534 ? 74.408  -62.664 148.278 1.00 65.16  ?  545  VAL A CB  1 
ATOM   4047 C  CG1 . VAL A 1 534 ? 73.416  -62.955 147.165 1.00 65.28  ?  545  VAL A CG1 1 
ATOM   4048 C  CG2 . VAL A 1 534 ? 73.928  -61.508 149.147 1.00 65.39  ?  545  VAL A CG2 1 
ATOM   4049 N  N   . GLU A 1 535 ? 74.635  -65.994 147.853 1.00 59.65  ?  546  GLU A N   1 
ATOM   4050 C  CA  . GLU A 1 535 ? 75.209  -67.066 147.058 1.00 59.09  ?  546  GLU A CA  1 
ATOM   4051 C  C   . GLU A 1 535 ? 74.991  -66.796 145.576 1.00 65.07  ?  546  GLU A C   1 
ATOM   4052 O  O   . GLU A 1 535 ? 74.056  -66.093 145.184 1.00 65.08  ?  546  GLU A O   1 
ATOM   4053 C  CB  . GLU A 1 535 ? 74.601  -68.419 147.433 1.00 60.69  ?  546  GLU A CB  1 
ATOM   4054 C  CG  . GLU A 1 535 ? 75.551  -69.592 147.242 1.00 71.62  ?  546  GLU A CG  1 
ATOM   4055 C  CD  . GLU A 1 535 ? 74.832  -70.923 147.148 1.00 97.00  ?  546  GLU A CD  1 
ATOM   4056 O  OE1 . GLU A 1 535 ? 74.155  -71.162 146.125 1.00 82.76  ?  546  GLU A OE1 1 
ATOM   4057 O  OE2 . GLU A 1 535 ? 74.943  -71.729 148.096 1.00 97.66  ?  546  GLU A OE2 1 
ATOM   4058 N  N   . ALA A 1 536 ? 75.871  -67.365 144.753 1.00 68.97  ?  547  ALA A N   1 
ATOM   4059 C  CA  . ALA A 1 536 ? 75.792  -67.240 143.297 1.00 68.79  ?  547  ALA A CA  1 
ATOM   4060 C  C   . ALA A 1 536 ? 76.142  -68.602 142.707 1.00 73.47  ?  547  ALA A C   1 
ATOM   4061 O  O   . ALA A 1 536 ? 77.321  -68.914 142.511 1.00 72.28  ?  547  ALA A O   1 
ATOM   4062 C  CB  . ALA A 1 536 ? 76.722  -66.149 142.781 1.00 68.78  ?  547  ALA A CB  1 
ATOM   4063 N  N   . ASP A 1 537 ? 75.119  -69.410 142.432 1.00 66.53  ?  548  ASP A N   1 
ATOM   4064 C  CA  . ASP A 1 537 ? 75.310  -70.767 141.930 1.00 66.51  ?  548  ASP A CA  1 
ATOM   4065 C  C   . ASP A 1 537 ? 75.472  -70.716 140.416 1.00 70.92  ?  548  ASP A C   1 
ATOM   4066 O  O   . ASP A 1 537 ? 74.502  -70.488 139.686 1.00 71.86  ?  548  ASP A O   1 
ATOM   4067 C  CB  . ASP A 1 537 ? 74.141  -71.664 142.329 1.00 69.11  ?  548  ASP A CB  1 
ATOM   4068 C  CG  . ASP A 1 537 ? 74.411  -73.127 142.040 1.00 80.54  ?  548  ASP A CG  1 
ATOM   4069 O  OD1 . ASP A 1 537 ? 75.464  -73.632 142.484 1.00 81.90  ?  548  ASP A OD1 1 
ATOM   4070 O  OD2 . ASP A 1 537 ? 73.573  -73.773 141.376 1.00 85.10  ?  548  ASP A OD2 1 
ATOM   4071 N  N   . LEU A 1 538 ? 76.699  -70.939 139.945 1.00 56.84  ?  549  LEU A N   1 
ATOM   4072 C  CA  . LEU A 1 538 ? 76.993  -70.869 138.521 1.00 56.01  ?  549  LEU A CA  1 
ATOM   4073 C  C   . LEU A 1 538 ? 76.599  -72.136 137.776 1.00 62.11  ?  549  LEU A C   1 
ATOM   4074 O  O   . LEU A 1 538 ? 76.456  -72.096 136.550 1.00 61.86  ?  549  LEU A O   1 
ATOM   4075 C  CB  . LEU A 1 538 ? 78.479  -70.575 138.313 1.00 54.80  ?  549  LEU A CB  1 
ATOM   4076 C  CG  . LEU A 1 538 ? 78.998  -69.362 139.093 1.00 57.91  ?  549  LEU A CG  1 
ATOM   4077 C  CD1 . LEU A 1 538 ? 80.509  -69.395 139.191 1.00 57.12  ?  549  LEU A CD1 1 
ATOM   4078 C  CD2 . LEU A 1 538 ? 78.536  -68.060 138.457 1.00 58.42  ?  549  LEU A CD2 1 
ATOM   4079 N  N   . LEU A 1 539 ? 76.418  -73.254 138.482 1.00 77.24  ?  550  LEU A N   1 
ATOM   4080 C  CA  . LEU A 1 539 ? 75.924  -74.488 137.884 1.00 78.49  ?  550  LEU A CA  1 
ATOM   4081 C  C   . LEU A 1 539 ? 74.417  -74.647 138.061 1.00 87.26  ?  550  LEU A C   1 
ATOM   4082 O  O   . LEU A 1 539 ? 73.922  -75.773 138.185 1.00 87.58  ?  550  LEU A O   1 
ATOM   4083 C  CB  . LEU A 1 539 ? 76.669  -75.695 138.463 1.00 78.15  ?  550  LEU A CB  1 
ATOM   4084 C  CG  . LEU A 1 539 ? 76.892  -75.802 139.976 1.00 82.82  ?  550  LEU A CG  1 
ATOM   4085 C  CD1 . LEU A 1 539 ? 75.684  -76.386 140.699 1.00 83.81  ?  550  LEU A CD1 1 
ATOM   4086 C  CD2 . LEU A 1 539 ? 78.138  -76.626 140.273 1.00 84.41  ?  550  LEU A CD2 1 
ATOM   4087 N  N   . GLN A 1 540 ? 73.678  -73.531 138.065 1.00 73.28  ?  551  GLN A N   1 
ATOM   4088 C  CA  . GLN A 1 540 ? 72.236  -73.584 138.300 1.00 74.85  ?  551  GLN A CA  1 
ATOM   4089 C  C   . GLN A 1 540 ? 71.534  -74.483 137.292 1.00 82.26  ?  551  GLN A C   1 
ATOM   4090 O  O   . GLN A 1 540 ? 70.580  -75.189 137.639 1.00 82.51  ?  551  GLN A O   1 
ATOM   4091 C  CB  . GLN A 1 540 ? 71.644  -72.174 138.253 1.00 76.12  ?  551  GLN A CB  1 
ATOM   4092 C  CG  . GLN A 1 540 ? 71.425  -71.545 139.618 1.00 86.05  ?  551  GLN A CG  1 
ATOM   4093 C  CD  . GLN A 1 540 ? 71.058  -70.079 139.526 1.00 101.54 ?  551  GLN A CD  1 
ATOM   4094 O  OE1 . GLN A 1 540 ? 70.540  -69.621 138.508 1.00 93.65  ?  551  GLN A OE1 1 
ATOM   4095 N  NE2 . GLN A 1 540 ? 71.337  -69.330 140.587 1.00 93.51  ?  551  GLN A NE2 1 
ATOM   4096 N  N   . ASP A 1 541 ? 71.991  -74.476 136.042 1.00 90.40  ?  552  ASP A N   1 
ATOM   4097 C  CA  . ASP A 1 541 ? 71.394  -75.275 134.974 1.00 91.48  ?  552  ASP A CA  1 
ATOM   4098 C  C   . ASP A 1 541 ? 72.209  -76.527 134.674 1.00 97.23  ?  552  ASP A C   1 
ATOM   4099 O  O   . ASP A 1 541 ? 72.389  -76.898 133.511 1.00 95.89  ?  552  ASP A O   1 
ATOM   4100 C  CB  . ASP A 1 541 ? 71.225  -74.426 133.719 1.00 93.34  ?  552  ASP A CB  1 
ATOM   4101 C  CG  . ASP A 1 541 ? 70.235  -73.295 133.914 1.00 106.51 ?  552  ASP A CG  1 
ATOM   4102 O  OD1 . ASP A 1 541 ? 69.056  -73.582 134.212 1.00 107.96 ?  552  ASP A OD1 1 
ATOM   4103 O  OD2 . ASP A 1 541 ? 70.639  -72.121 133.787 1.00 112.88 -1 552  ASP A OD2 1 
ATOM   4104 N  N   . GLN A 1 542 ? 72.708  -77.197 135.708 1.00 100.43 ?  553  GLN A N   1 
ATOM   4105 C  CA  . GLN A 1 542 ? 73.488  -78.417 135.533 1.00 101.07 ?  553  GLN A CA  1 
ATOM   4106 C  C   . GLN A 1 542 ? 73.245  -79.392 136.682 1.00 107.58 ?  553  GLN A C   1 
ATOM   4107 O  O   . GLN A 1 542 ? 73.630  -79.134 137.823 1.00 106.52 ?  553  GLN A O   1 
ATOM   4108 C  CB  . GLN A 1 542 ? 74.979  -78.091 135.425 1.00 41.15  ?  553  GLN A CB  1 
ATOM   4109 N  N   . TYR A 1 545 ? 76.322  -82.831 138.744 1.00 100.40 ?  556  TYR A N   1 
ATOM   4110 C  CA  . TYR A 1 545 ? 77.625  -82.209 138.951 1.00 99.91  ?  556  TYR A CA  1 
ATOM   4111 C  C   . TYR A 1 545 ? 77.926  -82.029 140.437 1.00 104.63 ?  556  TYR A C   1 
ATOM   4112 O  O   . TYR A 1 545 ? 77.024  -81.776 141.236 1.00 104.86 ?  556  TYR A O   1 
ATOM   4113 C  CB  . TYR A 1 545 ? 77.692  -80.858 138.234 1.00 100.68 ?  556  TYR A CB  1 
ATOM   4114 N  N   . ARG A 1 546 ? 79.201  -82.165 140.800 1.00 108.81 ?  557  ARG A N   1 
ATOM   4115 C  CA  . ARG A 1 546 ? 79.652  -81.987 142.173 1.00 108.83 ?  557  ARG A CA  1 
ATOM   4116 C  C   . ARG A 1 546 ? 80.924  -81.148 142.166 1.00 111.48 ?  557  ARG A C   1 
ATOM   4117 O  O   . ARG A 1 546 ? 81.366  -80.660 141.121 1.00 110.52 ?  557  ARG A O   1 
ATOM   4118 C  CB  . ARG A 1 546 ? 79.877  -83.337 142.865 1.00 109.75 ?  557  ARG A CB  1 
ATOM   4119 N  N   . TRP A 1 547 ? 81.520  -80.984 143.345 1.00 104.97 ?  558  TRP A N   1 
ATOM   4120 C  CA  . TRP A 1 547 ? 82.710  -80.154 143.516 1.00 103.92 ?  558  TRP A CA  1 
ATOM   4121 C  C   . TRP A 1 547 ? 83.712  -80.904 144.383 1.00 106.37 ?  558  TRP A C   1 
ATOM   4122 O  O   . TRP A 1 547 ? 83.457  -81.142 145.569 1.00 106.22 ?  558  TRP A O   1 
ATOM   4123 C  CB  . TRP A 1 547 ? 82.345  -78.801 144.135 1.00 102.88 ?  558  TRP A CB  1 
ATOM   4124 C  CG  . TRP A 1 547 ? 83.526  -77.980 144.563 1.00 103.59 ?  558  TRP A CG  1 
ATOM   4125 C  CD1 . TRP A 1 547 ? 83.885  -77.668 145.842 1.00 106.59 ?  558  TRP A CD1 1 
ATOM   4126 C  CD2 . TRP A 1 547 ? 84.505  -77.369 143.711 1.00 102.71 ?  558  TRP A CD2 1 
ATOM   4127 N  NE1 . TRP A 1 547 ? 85.024  -76.899 145.840 1.00 105.64 ?  558  TRP A NE1 1 
ATOM   4128 C  CE2 . TRP A 1 547 ? 85.426  -76.702 144.545 1.00 106.57 ?  558  TRP A CE2 1 
ATOM   4129 C  CE3 . TRP A 1 547 ? 84.694  -77.321 142.326 1.00 103.50 ?  558  TRP A CE3 1 
ATOM   4130 C  CZ2 . TRP A 1 547 ? 86.517  -75.997 144.040 1.00 105.26 ?  558  TRP A CZ2 1 
ATOM   4131 C  CZ3 . TRP A 1 547 ? 85.778  -76.619 141.827 1.00 104.29 ?  558  TRP A CZ3 1 
ATOM   4132 C  CH2 . TRP A 1 547 ? 86.675  -75.967 142.682 1.00 104.79 ?  558  TRP A CH2 1 
ATOM   4133 N  N   . LYS A 1 548 ? 84.842  -81.284 143.790 1.00 122.63 ?  559  LYS A N   1 
ATOM   4134 C  CA  . LYS A 1 548 ? 85.938  -81.934 144.509 1.00 121.75 ?  559  LYS A CA  1 
ATOM   4135 C  C   . LYS A 1 548 ? 87.025  -80.888 144.724 1.00 123.44 ?  559  LYS A C   1 
ATOM   4136 O  O   . LYS A 1 548 ? 87.910  -80.703 143.887 1.00 122.43 ?  559  LYS A O   1 
ATOM   4137 C  CB  . LYS A 1 548 ? 86.458  -83.144 143.740 1.00 123.93 ?  559  LYS A CB  1 
ATOM   4138 N  N   . GLY A 1 549 ? 86.943  -80.189 145.854 1.00 78.11  ?  560  GLY A N   1 
ATOM   4139 C  CA  . GLY A 1 549 ? 87.910  -79.146 146.158 1.00 76.94  ?  560  GLY A CA  1 
ATOM   4140 C  C   . GLY A 1 549 ? 87.631  -78.399 147.445 1.00 79.55  ?  560  GLY A C   1 
ATOM   4141 O  O   . GLY A 1 549 ? 87.079  -78.961 148.397 1.00 79.09  ?  560  GLY A O   1 
ATOM   4142 N  N   . HIS A 1 550 ? 88.007  -77.121 147.475 1.00 122.38 ?  561  HIS A N   1 
ATOM   4143 C  CA  . HIS A 1 550 ? 87.934  -76.340 148.704 1.00 121.96 ?  561  HIS A CA  1 
ATOM   4144 C  C   . HIS A 1 550 ? 86.488  -76.147 149.143 1.00 123.81 ?  561  HIS A C   1 
ATOM   4145 O  O   . HIS A 1 550 ? 85.627  -75.777 148.341 1.00 124.31 ?  561  HIS A O   1 
ATOM   4146 C  CB  . HIS A 1 550 ? 88.607  -74.984 148.503 1.00 122.44 ?  561  HIS A CB  1 
ATOM   4147 N  N   . GLU A 1 551 ? 86.223  -76.410 150.420 1.00 74.64  ?  562  GLU A N   1 
ATOM   4148 C  CA  . GLU A 1 551 ? 84.933  -76.065 150.997 1.00 73.70  ?  562  GLU A CA  1 
ATOM   4149 C  C   . GLU A 1 551 ? 84.858  -74.558 151.199 1.00 73.99  ?  562  GLU A C   1 
ATOM   4150 O  O   . GLU A 1 551 ? 85.866  -73.907 151.488 1.00 73.01  ?  562  GLU A O   1 
ATOM   4151 C  CB  . GLU A 1 551 ? 84.723  -76.794 152.324 1.00 75.55  ?  562  GLU A CB  1 
ATOM   4152 N  N   . ARG A 1 552 ? 83.657  -74.003 151.039 1.00 73.88  ?  563  ARG A N   1 
ATOM   4153 C  CA  . ARG A 1 552 ? 83.495  -72.555 151.089 1.00 72.22  ?  563  ARG A CA  1 
ATOM   4154 C  C   . ARG A 1 552 ? 83.941  -72.003 152.439 1.00 73.73  ?  563  ARG A C   1 
ATOM   4155 O  O   . ARG A 1 552 ? 83.849  -72.669 153.474 1.00 73.63  ?  563  ARG A O   1 
ATOM   4156 C  CB  . ARG A 1 552 ? 82.041  -72.160 150.823 1.00 71.53  ?  563  ARG A CB  1 
ATOM   4157 C  CG  . ARG A 1 552 ? 81.059  -72.567 151.912 1.00 80.03  ?  563  ARG A CG  1 
ATOM   4158 C  CD  . ARG A 1 552 ? 79.696  -71.917 151.699 1.00 90.90  ?  563  ARG A CD  1 
ATOM   4159 N  NE  . ARG A 1 552 ? 79.674  -70.519 152.124 1.00 98.01  ?  563  ARG A NE  1 
ATOM   4160 C  CZ  . ARG A 1 552 ? 78.673  -69.679 151.879 1.00 110.06 ?  563  ARG A CZ  1 
ATOM   4161 N  NH1 . ARG A 1 552 ? 77.611  -70.090 151.200 1.00 93.67  ?  563  ARG A NH1 1 
ATOM   4162 N  NH2 . ARG A 1 552 ? 78.736  -68.424 152.305 1.00 95.84  ?  563  ARG A NH2 1 
ATOM   4163 N  N   . LEU A 1 553 ? 84.447  -70.775 152.412 1.00 66.21  ?  564  LEU A N   1 
ATOM   4164 C  CA  . LEU A 1 553 ? 84.823  -70.093 153.639 1.00 65.50  ?  564  LEU A CA  1 
ATOM   4165 C  C   . LEU A 1 553 ? 83.578  -69.756 154.447 1.00 68.58  ?  564  LEU A C   1 
ATOM   4166 O  O   . LEU A 1 553 ? 82.645  -69.129 153.937 1.00 68.17  ?  564  LEU A O   1 
ATOM   4167 C  CB  . LEU A 1 553 ? 85.610  -68.823 153.318 1.00 65.30  ?  564  LEU A CB  1 
ATOM   4168 C  CG  . LEU A 1 553 ? 87.133  -68.906 153.433 1.00 69.61  ?  564  LEU A CG  1 
ATOM   4169 C  CD1 . LEU A 1 553 ? 87.797  -67.817 152.609 1.00 69.26  ?  564  LEU A CD1 1 
ATOM   4170 C  CD2 . LEU A 1 553 ? 87.557  -68.805 154.890 1.00 72.50  ?  564  LEU A CD2 1 
ATOM   4171 N  N   . ALA A 1 554 ? 83.561  -70.184 155.707 1.00 61.91  ?  565  ALA A N   1 
ATOM   4172 C  CA  . ALA A 1 554 ? 82.432  -69.913 156.585 1.00 61.58  ?  565  ALA A CA  1 
ATOM   4173 C  C   . ALA A 1 554 ? 82.458  -68.457 157.027 1.00 63.44  ?  565  ALA A C   1 
ATOM   4174 O  O   . ALA A 1 554 ? 83.463  -67.980 157.562 1.00 62.61  ?  565  ALA A O   1 
ATOM   4175 C  CB  . ALA A 1 554 ? 82.464  -70.840 157.799 1.00 62.65  ?  565  ALA A CB  1 
ATOM   4176 N  N   . ALA A 1 555 ? 81.354  -67.754 156.802 1.00 57.66  ?  566  ALA A N   1 
ATOM   4177 C  CA  . ALA A 1 555 ? 81.248  -66.344 157.141 1.00 57.56  ?  566  ALA A CA  1 
ATOM   4178 C  C   . ALA A 1 555 ? 80.667  -66.167 158.540 1.00 62.37  ?  566  ALA A C   1 
ATOM   4179 O  O   . ALA A 1 555 ? 79.989  -67.046 159.077 1.00 61.71  ?  566  ALA A O   1 
ATOM   4180 C  CB  . ALA A 1 555 ? 80.380  -65.608 156.121 1.00 58.28  ?  566  ALA A CB  1 
ATOM   4181 N  N   . ARG A 1 556 ? 80.938  -65.002 159.126 1.00 79.92  ?  567  ARG A N   1 
ATOM   4182 C  CA  . ARG A 1 556 ? 80.427  -64.673 160.450 1.00 81.20  ?  567  ARG A CA  1 
ATOM   4183 C  C   . ARG A 1 556 ? 78.985  -64.193 160.328 1.00 86.94  ?  567  ARG A C   1 
ATOM   4184 O  O   . ARG A 1 556 ? 78.702  -63.225 159.614 1.00 86.81  ?  567  ARG A O   1 
ATOM   4185 C  CB  . ARG A 1 556 ? 81.308  -63.623 161.123 1.00 81.90  ?  567  ARG A CB  1 
ATOM   4186 C  CG  . ARG A 1 556 ? 82.728  -64.108 161.391 1.00 91.26  ?  567  ARG A CG  1 
ATOM   4187 C  CD  . ARG A 1 556 ? 83.448  -63.244 162.414 1.00 97.99  ?  567  ARG A CD  1 
ATOM   4188 N  NE  . ARG A 1 556 ? 84.826  -63.683 162.620 1.00 106.36 ?  567  ARG A NE  1 
ATOM   4189 C  CZ  . ARG A 1 556 ? 85.191  -64.629 163.480 1.00 121.64 ?  567  ARG A CZ  1 
ATOM   4190 N  NH1 . ARG A 1 556 ? 84.279  -65.244 164.219 1.00 109.69 ?  567  ARG A NH1 1 
ATOM   4191 N  NH2 . ARG A 1 556 ? 86.469  -64.962 163.600 1.00 108.32 ?  567  ARG A NH2 1 
ATOM   4192 N  N   . SER A 1 557 ? 78.078  -64.874 161.034 1.00 98.49  ?  568  SER A N   1 
ATOM   4193 C  CA  . SER A 1 557 ? 76.648  -64.655 160.838 1.00 98.31  ?  568  SER A CA  1 
ATOM   4194 C  C   . SER A 1 557 ? 76.201  -63.312 161.405 1.00 101.65 ?  568  SER A C   1 
ATOM   4195 O  O   . SER A 1 557 ? 75.476  -62.561 160.744 1.00 102.09 ?  568  SER A O   1 
ATOM   4196 C  CB  . SER A 1 557 ? 75.861  -65.802 161.475 1.00 101.36 ?  568  SER A CB  1 
ATOM   4197 O  OG  . SER A 1 557 ? 76.290  -67.056 160.968 1.00 106.14 ?  568  SER A OG  1 
ATOM   4198 N  N   . GLY A 1 558 ? 76.623  -62.993 162.626 1.00 60.40  ?  569  GLY A N   1 
ATOM   4199 C  CA  . GLY A 1 558 ? 76.170  -61.796 163.296 1.00 60.01  ?  569  GLY A CA  1 
ATOM   4200 C  C   . GLY A 1 558 ? 76.857  -60.536 162.809 1.00 61.92  ?  569  GLY A C   1 
ATOM   4201 O  O   . GLY A 1 558 ? 77.609  -60.548 161.830 1.00 59.83  ?  569  GLY A O   1 
ATOM   4202 N  N   . PRO A 1 559 ? 76.594  -59.415 163.480 1.00 76.67  ?  570  PRO A N   1 
ATOM   4203 C  CA  . PRO A 1 559 ? 77.285  -58.167 163.135 1.00 76.16  ?  570  PRO A CA  1 
ATOM   4204 C  C   . PRO A 1 559 ? 78.712  -58.163 163.660 1.00 79.02  ?  570  PRO A C   1 
ATOM   4205 O  O   . PRO A 1 559 ? 78.991  -58.628 164.768 1.00 78.96  ?  570  PRO A O   1 
ATOM   4206 C  CB  . PRO A 1 559 ? 76.435  -57.093 163.825 1.00 78.47  ?  570  PRO A CB  1 
ATOM   4207 C  CG  . PRO A 1 559 ? 75.824  -57.800 164.988 1.00 83.65  ?  570  PRO A CG  1 
ATOM   4208 C  CD  . PRO A 1 559 ? 75.587  -59.220 164.538 1.00 79.22  ?  570  PRO A CD  1 
ATOM   4209 N  N   . VAL A 1 560 ? 79.620  -57.629 162.847 1.00 64.92  ?  571  VAL A N   1 
ATOM   4210 C  CA  . VAL A 1 560 ? 81.040  -57.568 163.170 1.00 63.25  ?  571  VAL A CA  1 
ATOM   4211 C  C   . VAL A 1 560 ? 81.466  -56.107 163.207 1.00 65.11  ?  571  VAL A C   1 
ATOM   4212 O  O   . VAL A 1 560 ? 80.998  -55.295 162.401 1.00 63.72  ?  571  VAL A O   1 
ATOM   4213 C  CB  . VAL A 1 560 ? 81.885  -58.366 162.152 1.00 66.07  ?  571  VAL A CB  1 
ATOM   4214 C  CG1 . VAL A 1 560 ? 83.361  -58.334 162.524 1.00 65.32  ?  571  VAL A CG1 1 
ATOM   4215 C  CG2 . VAL A 1 560 ? 81.389  -59.801 162.062 1.00 65.89  ?  571  VAL A CG2 1 
ATOM   4216 N  N   . ARG A 1 561 ? 82.343  -55.771 164.150 1.00 74.56  ?  572  ARG A N   1 
ATOM   4217 C  CA  . ARG A 1 561 ? 82.848  -54.412 164.276 1.00 74.12  ?  572  ARG A CA  1 
ATOM   4218 C  C   . ARG A 1 561 ? 84.098  -54.230 163.424 1.00 76.21  ?  572  ARG A C   1 
ATOM   4219 O  O   . ARG A 1 561 ? 84.991  -55.082 163.419 1.00 75.32  ?  572  ARG A O   1 
ATOM   4220 C  CB  . ARG A 1 561 ? 83.162  -54.081 165.737 1.00 75.36  ?  572  ARG A CB  1 
ATOM   4221 C  CG  . ARG A 1 561 ? 83.446  -52.607 165.983 1.00 85.06  ?  572  ARG A CG  1 
ATOM   4222 C  CD  . ARG A 1 561 ? 83.989  -52.366 167.383 1.00 99.46  ?  572  ARG A CD  1 
ATOM   4223 N  NE  . ARG A 1 561 ? 84.383  -50.973 167.574 1.00 107.67 ?  572  ARG A NE  1 
ATOM   4224 C  CZ  . ARG A 1 561 ? 83.670  -50.079 168.249 1.00 120.40 ?  572  ARG A CZ  1 
ATOM   4225 N  NH1 . ARG A 1 561 ? 82.522  -50.430 168.813 1.00 110.07 ?  572  ARG A NH1 1 
ATOM   4226 N  NH2 . ARG A 1 561 ? 84.109  -48.833 168.367 1.00 103.02 ?  572  ARG A NH2 1 
ATOM   4227 N  N   . PHE A 1 562 ? 84.152  -53.113 162.701 1.00 61.93  ?  573  PHE A N   1 
ATOM   4228 C  CA  . PHE A 1 562 ? 85.293  -52.776 161.861 1.00 60.30  ?  573  PHE A CA  1 
ATOM   4229 C  C   . PHE A 1 562 ? 85.815  -51.399 162.239 1.00 62.19  ?  573  PHE A C   1 
ATOM   4230 O  O   . PHE A 1 562 ? 85.035  -50.467 162.455 1.00 61.52  ?  573  PHE A O   1 
ATOM   4231 C  CB  . PHE A 1 562 ? 84.930  -52.789 160.367 1.00 61.46  ?  573  PHE A CB  1 
ATOM   4232 C  CG  . PHE A 1 562 ? 84.436  -54.118 159.872 1.00 62.38  ?  573  PHE A CG  1 
ATOM   4233 C  CD1 . PHE A 1 562 ? 85.308  -55.182 159.714 1.00 64.43  ?  573  PHE A CD1 1 
ATOM   4234 C  CD2 . PHE A 1 562 ? 83.101  -54.299 159.549 1.00 64.15  ?  573  PHE A CD2 1 
ATOM   4235 C  CE1 . PHE A 1 562 ? 84.857  -56.406 159.255 1.00 64.89  ?  573  PHE A CE1 1 
ATOM   4236 C  CE2 . PHE A 1 562 ? 82.644  -55.519 159.089 1.00 66.63  ?  573  PHE A CE2 1 
ATOM   4237 C  CZ  . PHE A 1 562 ? 83.523  -56.574 158.942 1.00 64.10  ?  573  PHE A CZ  1 
ATOM   4238 N  N   . GLU A 1 563 ? 87.135  -51.278 162.317 1.00 69.11  ?  574  GLU A N   1 
ATOM   4239 C  CA  . GLU A 1 563 ? 87.774  -49.991 162.539 1.00 68.57  ?  574  GLU A CA  1 
ATOM   4240 C  C   . GLU A 1 563 ? 87.726  -49.184 161.247 1.00 69.68  ?  574  GLU A C   1 
ATOM   4241 O  O   . GLU A 1 563 ? 87.412  -49.721 160.183 1.00 69.16  ?  574  GLU A O   1 
ATOM   4242 C  CB  . GLU A 1 563 ? 89.204  -50.206 163.031 1.00 69.83  ?  574  GLU A CB  1 
ATOM   4243 C  CG  . GLU A 1 563 ? 90.243  -50.342 161.933 1.00 83.69  ?  574  GLU A CG  1 
ATOM   4244 C  CD  . GLU A 1 563 ? 91.657  -50.211 162.465 1.00 110.68 ?  574  GLU A CD  1 
ATOM   4245 O  OE1 . GLU A 1 563 ? 92.277  -51.249 162.780 1.00 108.30 ?  574  GLU A OE1 1 
ATOM   4246 O  OE2 . GLU A 1 563 ? 92.141  -49.065 162.583 1.00 101.53 ?  574  GLU A OE2 1 
ATOM   4247 N  N   . PRO A 1 564 ? 88.004  -47.878 161.304 1.00 51.96  ?  575  PRO A N   1 
ATOM   4248 C  CA  . PRO A 1 564 ? 87.935  -47.066 160.084 1.00 51.41  ?  575  PRO A CA  1 
ATOM   4249 C  C   . PRO A 1 564 ? 88.821  -47.609 158.973 1.00 55.39  ?  575  PRO A C   1 
ATOM   4250 O  O   . PRO A 1 564 ? 89.885  -48.186 159.211 1.00 55.50  ?  575  PRO A O   1 
ATOM   4251 C  CB  . PRO A 1 564 ? 88.403  -45.678 160.547 1.00 52.84  ?  575  PRO A CB  1 
ATOM   4252 C  CG  . PRO A 1 564 ? 89.020  -45.889 161.882 1.00 56.71  ?  575  PRO A CG  1 
ATOM   4253 C  CD  . PRO A 1 564 ? 88.275  -47.034 162.480 1.00 52.93  ?  575  PRO A CD  1 
ATOM   4254 N  N   . GLY A 1 565 ? 88.354  -47.409 157.748 1.00 63.47  ?  576  GLY A N   1 
ATOM   4255 C  CA  . GLY A 1 565 ? 88.981  -47.882 156.535 1.00 61.60  ?  576  GLY A CA  1 
ATOM   4256 C  C   . GLY A 1 565 ? 87.920  -48.355 155.564 1.00 62.12  ?  576  GLY A C   1 
ATOM   4257 O  O   . GLY A 1 565 ? 86.781  -47.896 155.605 1.00 63.16  ?  576  GLY A O   1 
ATOM   4258 N  N   . PHE A 1 566 ? 88.304  -49.280 154.691 1.00 47.80  ?  577  PHE A N   1 
ATOM   4259 C  CA  . PHE A 1 566 ? 87.354  -49.908 153.782 1.00 45.79  ?  577  PHE A CA  1 
ATOM   4260 C  C   . PHE A 1 566 ? 86.642  -51.037 154.517 1.00 48.21  ?  577  PHE A C   1 
ATOM   4261 O  O   . PHE A 1 566 ? 87.286  -51.977 154.995 1.00 46.85  ?  577  PHE A O   1 
ATOM   4262 C  CB  . PHE A 1 566 ? 88.063  -50.432 152.536 1.00 45.84  ?  577  PHE A CB  1 
ATOM   4263 C  CG  . PHE A 1 566 ? 88.539  -49.354 151.608 1.00 45.36  ?  577  PHE A CG  1 
ATOM   4264 C  CD1 . PHE A 1 566 ? 89.783  -48.768 151.780 1.00 46.90  ?  577  PHE A CD1 1 
ATOM   4265 C  CD2 . PHE A 1 566 ? 87.744  -48.932 150.557 1.00 45.90  ?  577  PHE A CD2 1 
ATOM   4266 C  CE1 . PHE A 1 566 ? 90.222  -47.776 150.920 1.00 46.81  ?  577  PHE A CE1 1 
ATOM   4267 C  CE2 . PHE A 1 566 ? 88.177  -47.944 149.696 1.00 47.95  ?  577  PHE A CE2 1 
ATOM   4268 C  CZ  . PHE A 1 566 ? 89.416  -47.365 149.876 1.00 45.87  ?  577  PHE A CZ  1 
ATOM   4269 N  N   . GLN A 1 567 ? 85.319  -50.944 154.609 1.00 41.94  ?  578  GLN A N   1 
ATOM   4270 C  CA  . GLN A 1 567 ? 84.538  -51.854 155.419 1.00 41.76  ?  578  GLN A CA  1 
ATOM   4271 C  C   . GLN A 1 567 ? 83.595  -52.666 154.544 1.00 44.74  ?  578  GLN A C   1 
ATOM   4272 O  O   . GLN A 1 567 ? 82.843  -52.086 153.748 1.00 44.24  ?  578  GLN A O   1 
ATOM   4273 C  CB  . GLN A 1 567 ? 83.744  -51.076 156.475 1.00 44.12  ?  578  GLN A CB  1 
ATOM   4274 C  CG  . GLN A 1 567 ? 84.636  -50.341 157.465 1.00 63.04  ?  578  GLN A CG  1 
ATOM   4275 C  CD  . GLN A 1 567 ? 83.908  -49.249 158.224 1.00 70.83  ?  578  GLN A CD  1 
ATOM   4276 O  OE1 . GLN A 1 567 ? 82.721  -49.011 158.008 1.00 62.43  ?  578  GLN A OE1 1 
ATOM   4277 N  NE2 . GLN A 1 567 ? 84.624  -48.573 159.117 1.00 58.66  ?  578  GLN A NE2 1 
ATOM   4278 N  N   . PRO A 1 568 ? 83.593  -53.994 154.664 1.00 46.71  ?  579  PRO A N   1 
ATOM   4279 C  CA  . PRO A 1 568 ? 82.751  -54.824 153.794 1.00 46.77  ?  579  PRO A CA  1 
ATOM   4280 C  C   . PRO A 1 568 ? 81.294  -54.817 154.227 1.00 54.54  ?  579  PRO A C   1 
ATOM   4281 O  O   . PRO A 1 568 ? 80.977  -54.922 155.415 1.00 55.40  ?  579  PRO A O   1 
ATOM   4282 C  CB  . PRO A 1 568 ? 83.364  -56.221 153.950 1.00 48.10  ?  579  PRO A CB  1 
ATOM   4283 C  CG  . PRO A 1 568 ? 83.921  -56.210 155.335 1.00 52.71  ?  579  PRO A CG  1 
ATOM   4284 C  CD  . PRO A 1 568 ? 84.412  -54.806 155.581 1.00 48.29  ?  579  PRO A CD  1 
ATOM   4285 N  N   . PHE A 1 569 ? 80.400  -54.703 153.239 1.00 49.27  ?  580  PHE A N   1 
ATOM   4286 C  CA  . PHE A 1 569 ? 78.971  -54.746 153.501 1.00 50.60  ?  580  PHE A CA  1 
ATOM   4287 C  C   . PHE A 1 569 ? 78.242  -55.898 152.823 1.00 57.35  ?  580  PHE A C   1 
ATOM   4288 O  O   . PHE A 1 569 ? 77.091  -56.166 153.186 1.00 59.16  ?  580  PHE A O   1 
ATOM   4289 C  CB  . PHE A 1 569 ? 78.303  -53.417 153.101 1.00 52.47  ?  580  PHE A CB  1 
ATOM   4290 C  CG  . PHE A 1 569 ? 78.571  -52.981 151.684 1.00 54.09  ?  580  PHE A CG  1 
ATOM   4291 C  CD1 . PHE A 1 569 ? 77.770  -53.428 150.642 1.00 57.85  ?  580  PHE A CD1 1 
ATOM   4292 C  CD2 . PHE A 1 569 ? 79.594  -52.090 151.400 1.00 56.25  ?  580  PHE A CD2 1 
ATOM   4293 C  CE1 . PHE A 1 569 ? 78.001  -53.014 149.340 1.00 58.52  ?  580  PHE A CE1 1 
ATOM   4294 C  CE2 . PHE A 1 569 ? 79.831  -51.671 150.101 1.00 58.70  ?  580  PHE A CE2 1 
ATOM   4295 C  CZ  . PHE A 1 569 ? 79.031  -52.134 149.070 1.00 56.57  ?  580  PHE A CZ  1 
ATOM   4296 N  N   . VAL A 1 570 ? 78.861  -56.590 151.869 1.00 56.58  ?  581  VAL A N   1 
ATOM   4297 C  CA  . VAL A 1 570 ? 78.220  -57.739 151.232 1.00 56.69  ?  581  VAL A CA  1 
ATOM   4298 C  C   . VAL A 1 570 ? 79.293  -58.716 150.768 1.00 58.53  ?  581  VAL A C   1 
ATOM   4299 O  O   . VAL A 1 570 ? 80.344  -58.316 150.258 1.00 57.92  ?  581  VAL A O   1 
ATOM   4300 C  CB  . VAL A 1 570 ? 77.301  -57.308 150.064 1.00 61.01  ?  581  VAL A CB  1 
ATOM   4301 C  CG1 . VAL A 1 570 ? 78.088  -56.581 148.984 1.00 60.32  ?  581  VAL A CG1 1 
ATOM   4302 C  CG2 . VAL A 1 570 ? 76.564  -58.514 149.483 1.00 60.73  ?  581  VAL A CG2 1 
ATOM   4303 N  N   . LEU A 1 571 ? 79.019  -60.005 150.960 1.00 53.74  ?  582  LEU A N   1 
ATOM   4304 C  CA  . LEU A 1 571 ? 79.893  -61.090 150.531 1.00 52.47  ?  582  LEU A CA  1 
ATOM   4305 C  C   . LEU A 1 571 ? 79.126  -61.970 149.554 1.00 56.20  ?  582  LEU A C   1 
ATOM   4306 O  O   . LEU A 1 571 ? 78.100  -62.555 149.916 1.00 56.97  ?  582  LEU A O   1 
ATOM   4307 C  CB  . LEU A 1 571 ? 80.382  -61.910 151.728 1.00 52.45  ?  582  LEU A CB  1 
ATOM   4308 C  CG  . LEU A 1 571 ? 80.886  -63.333 151.462 1.00 56.66  ?  582  LEU A CG  1 
ATOM   4309 C  CD1 . LEU A 1 571 ? 82.117  -63.338 150.562 1.00 55.95  ?  582  LEU A CD1 1 
ATOM   4310 C  CD2 . LEU A 1 571 ? 81.174  -64.048 152.773 1.00 60.04  ?  582  LEU A CD2 1 
ATOM   4311 N  N   . VAL A 1 572 ? 79.618  -62.059 148.324 1.00 46.49  ?  583  VAL A N   1 
ATOM   4312 C  CA  . VAL A 1 572 ? 79.016  -62.895 147.294 1.00 46.68  ?  583  VAL A CA  1 
ATOM   4313 C  C   . VAL A 1 572 ? 79.852  -64.164 147.189 1.00 52.69  ?  583  VAL A C   1 
ATOM   4314 O  O   . VAL A 1 572 ? 80.955  -64.151 146.630 1.00 53.14  ?  583  VAL A O   1 
ATOM   4315 C  CB  . VAL A 1 572 ? 78.928  -62.167 145.947 1.00 49.79  ?  583  VAL A CB  1 
ATOM   4316 C  CG1 . VAL A 1 572 ? 78.095  -62.975 144.961 1.00 49.34  ?  583  VAL A CG1 1 
ATOM   4317 C  CG2 . VAL A 1 572 ? 78.345  -60.774 146.135 1.00 49.69  ?  583  VAL A CG2 1 
ATOM   4318 N  N   . GLN A 1 573 ? 79.332  -65.264 147.729 1.00 49.71  ?  584  GLN A N   1 
ATOM   4319 C  CA  . GLN A 1 573 ? 80.035  -66.540 147.728 1.00 49.49  ?  584  GLN A CA  1 
ATOM   4320 C  C   . GLN A 1 573 ? 79.658  -67.327 146.478 1.00 55.78  ?  584  GLN A C   1 
ATOM   4321 O  O   . GLN A 1 573 ? 78.502  -67.733 146.316 1.00 57.27  ?  584  GLN A O   1 
ATOM   4322 C  CB  . GLN A 1 573 ? 79.709  -67.340 148.986 1.00 50.86  ?  584  GLN A CB  1 
ATOM   4323 C  CG  . GLN A 1 573 ? 80.328  -68.727 149.003 1.00 55.75  ?  584  GLN A CG  1 
ATOM   4324 C  CD  . GLN A 1 573 ? 81.839  -68.691 148.895 1.00 65.83  ?  584  GLN A CD  1 
ATOM   4325 O  OE1 . GLN A 1 573 ? 82.434  -69.423 148.106 1.00 60.14  ?  584  GLN A OE1 1 
ATOM   4326 N  NE2 . GLN A 1 573 ? 82.468  -67.836 149.693 1.00 49.60  ?  584  GLN A NE2 1 
ATOM   4327 N  N   . CYS A 1 574 ? 80.635  -67.545 145.602 1.00 58.39  ?  585  CYS A N   1 
ATOM   4328 C  CA  . CYS A 1 574 ? 80.399  -68.303 144.382 1.00 57.77  ?  585  CYS A CA  1 
ATOM   4329 C  C   . CYS A 1 574 ? 80.234  -69.787 144.690 1.00 61.97  ?  585  CYS A C   1 
ATOM   4330 O  O   . CYS A 1 574 ? 80.944  -70.350 145.528 1.00 60.39  ?  585  CYS A O   1 
ATOM   4331 C  CB  . CYS A 1 574 ? 81.553  -68.102 143.400 1.00 57.32  ?  585  CYS A CB  1 
ATOM   4332 S  SG  . CYS A 1 574 ? 81.684  -66.431 142.731 1.00 61.08  ?  585  CYS A SG  1 
ATOM   4333 N  N   . GLN A 1 575 ? 79.285  -70.418 144.003 1.00 60.44  ?  586  GLN A N   1 
ATOM   4334 C  CA  . GLN A 1 575 ? 79.087  -71.859 144.079 1.00 60.87  ?  586  GLN A CA  1 
ATOM   4335 C  C   . GLN A 1 575 ? 79.322  -72.446 142.696 1.00 64.90  ?  586  GLN A C   1 
ATOM   4336 O  O   . GLN A 1 575 ? 78.569  -72.125 141.763 1.00 65.06  ?  586  GLN A O   1 
ATOM   4337 C  CB  . GLN A 1 575 ? 77.685  -72.205 144.582 1.00 62.95  ?  586  GLN A CB  1 
ATOM   4338 C  CG  . GLN A 1 575 ? 77.649  -73.395 145.525 1.00 77.53  ?  586  GLN A CG  1 
ATOM   4339 C  CD  . GLN A 1 575 ? 78.505  -73.176 146.761 1.00 90.90  ?  586  GLN A CD  1 
ATOM   4340 O  OE1 . GLN A 1 575 ? 79.501  -73.868 146.971 1.00 83.17  ?  586  GLN A OE1 1 
ATOM   4341 N  NE2 . GLN A 1 575 ? 78.119  -72.208 147.586 1.00 78.18  ?  586  GLN A NE2 1 
ATOM   4342 N  N   . PRO A 1 576 ? 80.344  -73.294 142.495 1.00 58.87  ?  587  PRO A N   1 
ATOM   4343 C  CA  . PRO A 1 576 ? 81.321  -73.782 143.480 1.00 58.65  ?  587  PRO A CA  1 
ATOM   4344 C  C   . PRO A 1 576 ? 82.260  -72.693 144.006 1.00 62.41  ?  587  PRO A C   1 
ATOM   4345 O  O   . PRO A 1 576 ? 82.427  -71.667 143.346 1.00 60.44  ?  587  PRO A O   1 
ATOM   4346 C  CB  . PRO A 1 576 ? 82.117  -74.833 142.691 1.00 60.01  ?  587  PRO A CB  1 
ATOM   4347 C  CG  . PRO A 1 576 ? 81.275  -75.166 141.508 1.00 64.71  ?  587  PRO A CG  1 
ATOM   4348 C  CD  . PRO A 1 576 ? 80.557  -73.905 141.173 1.00 60.24  ?  587  PRO A CD  1 
ATOM   4349 N  N   . PRO A 1 577 ? 82.866  -72.913 145.182 1.00 73.69  ?  588  PRO A N   1 
ATOM   4350 C  CA  . PRO A 1 577 ? 83.824  -71.921 145.713 1.00 73.22  ?  588  PRO A CA  1 
ATOM   4351 C  C   . PRO A 1 577 ? 85.203  -72.067 145.080 1.00 76.00  ?  588  PRO A C   1 
ATOM   4352 O  O   . PRO A 1 577 ? 86.192  -72.459 145.711 1.00 76.75  ?  588  PRO A O   1 
ATOM   4353 C  CB  . PRO A 1 577 ? 83.816  -72.226 147.216 1.00 75.29  ?  588  PRO A CB  1 
ATOM   4354 C  CG  . PRO A 1 577 ? 83.321  -73.647 147.352 1.00 79.94  ?  588  PRO A CG  1 
ATOM   4355 C  CD  . PRO A 1 577 ? 82.800  -74.119 146.024 1.00 75.56  ?  588  PRO A CD  1 
ATOM   4356 N  N   . ALA A 1 578 ? 85.279  -71.739 143.793 1.00 55.96  ?  589  ALA A N   1 
ATOM   4357 C  CA  . ALA A 1 578 ? 86.502  -71.853 143.017 1.00 53.60  ?  589  ALA A CA  1 
ATOM   4358 C  C   . ALA A 1 578 ? 87.233  -70.513 142.986 1.00 52.80  ?  589  ALA A C   1 
ATOM   4359 O  O   . ALA A 1 578 ? 86.799  -69.522 143.577 1.00 52.20  ?  589  ALA A O   1 
ATOM   4360 C  CB  . ALA A 1 578 ? 86.190  -72.348 141.603 1.00 53.82  ?  589  ALA A CB  1 
ATOM   4361 N  N   . VAL A 1 579 ? 88.367  -70.487 142.284 1.00 47.20  ?  590  VAL A N   1 
ATOM   4362 C  CA  . VAL A 1 579 ? 89.159  -69.268 142.170 1.00 44.79  ?  590  VAL A CA  1 
ATOM   4363 C  C   . VAL A 1 579 ? 88.412  -68.254 141.313 1.00 46.25  ?  590  VAL A C   1 
ATOM   4364 O  O   . VAL A 1 579 ? 87.916  -68.581 140.227 1.00 44.56  ?  590  VAL A O   1 
ATOM   4365 C  CB  . VAL A 1 579 ? 90.544  -69.582 141.582 1.00 47.16  ?  590  VAL A CB  1 
ATOM   4366 C  CG1 . VAL A 1 579 ? 91.326  -68.302 141.325 1.00 46.05  ?  590  VAL A CG1 1 
ATOM   4367 C  CG2 . VAL A 1 579 ? 91.318  -70.506 142.511 1.00 46.89  ?  590  VAL A CG2 1 
ATOM   4368 N  N   . VAL A 1 580 ? 88.315  -67.021 141.803 1.00 42.17  ?  591  VAL A N   1 
ATOM   4369 C  CA  . VAL A 1 580 ? 87.761  -65.933 141.004 1.00 41.75  ?  591  VAL A CA  1 
ATOM   4370 C  C   . VAL A 1 580 ? 88.830  -65.487 140.014 1.00 45.73  ?  591  VAL A C   1 
ATOM   4371 O  O   . VAL A 1 580 ? 89.935  -65.101 140.408 1.00 46.07  ?  591  VAL A O   1 
ATOM   4372 C  CB  . VAL A 1 580 ? 87.294  -64.767 141.885 1.00 46.61  ?  591  VAL A CB  1 
ATOM   4373 C  CG1 . VAL A 1 580 ? 86.756  -63.640 141.013 1.00 46.97  ?  591  VAL A CG1 1 
ATOM   4374 C  CG2 . VAL A 1 580 ? 86.230  -65.238 142.869 1.00 47.18  ?  591  VAL A CG2 1 
ATOM   4375 N  N   . THR A 1 581 ? 88.503  -65.546 138.726 1.00 41.13  ?  592  THR A N   1 
ATOM   4376 C  CA  . THR A 1 581 ? 89.482  -65.358 137.666 1.00 39.07  ?  592  THR A CA  1 
ATOM   4377 C  C   . THR A 1 581 ? 89.327  -64.036 136.927 1.00 41.41  ?  592  THR A C   1 
ATOM   4378 O  O   . THR A 1 581 ? 90.140  -63.738 136.045 1.00 40.57  ?  592  THR A O   1 
ATOM   4379 C  CB  . THR A 1 581 ? 89.397  -66.522 136.674 1.00 45.85  ?  592  THR A CB  1 
ATOM   4380 O  OG1 . THR A 1 581 ? 88.121  -66.505 136.023 1.00 50.49  ?  592  THR A OG1 1 
ATOM   4381 C  CG2 . THR A 1 581 ? 89.561  -67.846 137.407 1.00 41.79  ?  592  THR A CG2 1 
ATOM   4382 N  N   . SER A 1 582 ? 88.311  -63.242 137.258 1.00 39.69  ?  593  SER A N   1 
ATOM   4383 C  CA  . SER A 1 582 ? 88.137  -61.915 136.685 1.00 39.09  ?  593  SER A CA  1 
ATOM   4384 C  C   . SER A 1 582 ? 87.144  -61.149 137.546 1.00 40.47  ?  593  SER A C   1 
ATOM   4385 O  O   . SER A 1 582 ? 86.301  -61.739 138.227 1.00 41.08  ?  593  SER A O   1 
ATOM   4386 C  CB  . SER A 1 582 ? 87.667  -61.978 135.227 1.00 42.39  ?  593  SER A CB  1 
ATOM   4387 O  OG  . SER A 1 582 ? 86.689  -62.984 135.044 1.00 55.16  ?  593  SER A OG  1 
ATOM   4388 N  N   . LEU A 1 583 ? 87.257  -59.821 137.509 1.00 26.88  ?  594  LEU A N   1 
ATOM   4389 C  CA  . LEU A 1 583 ? 86.451  -58.972 138.376 1.00 26.42  ?  594  LEU A CA  1 
ATOM   4390 C  C   . LEU A 1 583 ? 86.301  -57.597 137.746 1.00 32.18  ?  594  LEU A C   1 
ATOM   4391 O  O   . LEU A 1 583 ? 87.284  -57.008 137.293 1.00 33.76  ?  594  LEU A O   1 
ATOM   4392 C  CB  . LEU A 1 583 ? 87.088  -58.845 139.763 1.00 26.54  ?  594  LEU A CB  1 
ATOM   4393 C  CG  . LEU A 1 583 ? 86.346  -57.986 140.787 1.00 31.28  ?  594  LEU A CG  1 
ATOM   4394 C  CD1 . LEU A 1 583 ? 85.168  -58.743 141.383 1.00 31.70  ?  594  LEU A CD1 1 
ATOM   4395 C  CD2 . LEU A 1 583 ? 87.295  -57.508 141.876 1.00 32.45  ?  594  LEU A CD2 1 
ATOM   4396 N  N   . ALA A 1 584 ? 85.072  -57.091 137.730 1.00 31.06  ?  595  ALA A N   1 
ATOM   4397 C  CA  . ALA A 1 584 ? 84.776  -55.741 137.278 1.00 30.56  ?  595  ALA A CA  1 
ATOM   4398 C  C   . ALA A 1 584 ? 83.742  -55.130 138.212 1.00 36.70  ?  595  ALA A C   1 
ATOM   4399 O  O   . ALA A 1 584 ? 82.842  -55.816 138.706 1.00 34.90  ?  595  ALA A O   1 
ATOM   4400 C  CB  . ALA A 1 584 ? 84.259  -55.720 135.834 1.00 30.31  ?  595  ALA A CB  1 
ATOM   4401 N  N   . LEU A 1 585 ? 83.881  -53.829 138.451 1.00 31.68  ?  596  LEU A N   1 
ATOM   4402 C  CA  . LEU A 1 585 ? 83.020  -53.110 139.382 1.00 32.40  ?  596  LEU A CA  1 
ATOM   4403 C  C   . LEU A 1 585 ? 82.637  -51.775 138.766 1.00 38.84  ?  596  LEU A C   1 
ATOM   4404 O  O   . LEU A 1 585 ? 83.509  -50.944 138.493 1.00 36.84  ?  596  LEU A O   1 
ATOM   4405 C  CB  . LEU A 1 585 ? 83.725  -52.903 140.726 1.00 32.21  ?  596  LEU A CB  1 
ATOM   4406 C  CG  . LEU A 1 585 ? 83.174  -51.839 141.677 1.00 37.70  ?  596  LEU A CG  1 
ATOM   4407 C  CD1 . LEU A 1 585 ? 81.853  -52.273 142.290 1.00 37.07  ?  596  LEU A CD1 1 
ATOM   4408 C  CD2 . LEU A 1 585 ? 84.194  -51.516 142.760 1.00 42.24  ?  596  LEU A CD2 1 
ATOM   4409 N  N   . HIS A 1 586 ? 81.340  -51.571 138.539 1.00 43.85  ?  597  HIS A N   1 
ATOM   4410 C  CA  . HIS A 1 586 ? 80.818  -50.292 138.071 1.00 45.19  ?  597  HIS A CA  1 
ATOM   4411 C  C   . HIS A 1 586 ? 80.234  -49.561 139.273 1.00 51.66  ?  597  HIS A C   1 
ATOM   4412 O  O   . HIS A 1 586 ? 79.242  -50.008 139.858 1.00 51.15  ?  597  HIS A O   1 
ATOM   4413 C  CB  . HIS A 1 586 ? 79.769  -50.481 136.978 1.00 46.24  ?  597  HIS A CB  1 
ATOM   4414 C  CG  . HIS A 1 586 ? 79.607  -49.284 136.094 1.00 50.10  ?  597  HIS A CG  1 
ATOM   4415 N  ND1 . HIS A 1 586 ? 79.136  -48.074 136.556 1.00 52.36  ?  597  HIS A ND1 1 
ATOM   4416 C  CD2 . HIS A 1 586 ? 79.865  -49.107 134.776 1.00 51.97  ?  597  HIS A CD2 1 
ATOM   4417 C  CE1 . HIS A 1 586 ? 79.107  -47.205 135.561 1.00 51.88  ?  597  HIS A CE1 1 
ATOM   4418 N  NE2 . HIS A 1 586 ? 79.544  -47.807 134.470 1.00 51.95  ?  597  HIS A NE2 1 
ATOM   4419 N  N   . SER A 1 587 ? 80.855  -48.439 139.642 1.00 54.25  ?  598  SER A N   1 
ATOM   4420 C  CA  . SER A 1 587 ? 80.436  -47.713 140.835 1.00 55.83  ?  598  SER A CA  1 
ATOM   4421 C  C   . SER A 1 587 ? 79.156  -46.923 140.596 1.00 62.01  ?  598  SER A C   1 
ATOM   4422 O  O   . SER A 1 587 ? 78.300  -46.844 141.484 1.00 64.02  ?  598  SER A O   1 
ATOM   4423 C  CB  . SER A 1 587 ? 81.555  -46.784 141.299 1.00 59.42  ?  598  SER A CB  1 
ATOM   4424 O  OG  . SER A 1 587 ? 81.989  -45.954 140.238 1.00 67.05  ?  598  SER A OG  1 
ATOM   4425 N  N   . GLU A 1 588 ? 79.010  -46.333 139.408 1.00 43.73  ?  599  GLU A N   1 
ATOM   4426 C  CA  . GLU A 1 588 ? 77.810  -45.560 139.106 1.00 43.45  ?  599  GLU A CA  1 
ATOM   4427 C  C   . GLU A 1 588 ? 76.576  -46.452 139.080 1.00 45.95  ?  599  GLU A C   1 
ATOM   4428 O  O   . GLU A 1 588 ? 75.576  -46.167 139.747 1.00 46.46  ?  599  GLU A O   1 
ATOM   4429 C  CB  . GLU A 1 588 ? 77.980  -44.834 137.773 1.00 44.55  ?  599  GLU A CB  1 
ATOM   4430 C  CG  . GLU A 1 588 ? 77.013  -43.685 137.560 1.00 58.10  ?  599  GLU A CG  1 
ATOM   4431 C  CD  . GLU A 1 588 ? 77.225  -42.992 136.229 1.00 84.16  ?  599  GLU A CD  1 
ATOM   4432 O  OE1 . GLU A 1 588 ? 76.887  -43.590 135.186 1.00 85.24  ?  599  GLU A OE1 1 
ATOM   4433 O  OE2 . GLU A 1 588 ? 77.741  -41.854 136.225 1.00 75.02  ?  599  GLU A OE2 1 
ATOM   4434 N  N   . TRP A 1 589 ? 76.629  -47.544 138.318 1.00 56.00  ?  600  TRP A N   1 
ATOM   4435 C  CA  . TRP A 1 589 ? 75.513  -48.480 138.246 1.00 56.25  ?  600  TRP A CA  1 
ATOM   4436 C  C   . TRP A 1 589 ? 75.437  -49.389 139.465 1.00 57.63  ?  600  TRP A C   1 
ATOM   4437 O  O   . TRP A 1 589 ? 74.452  -50.122 139.611 1.00 56.32  ?  600  TRP A O   1 
ATOM   4438 C  CB  . TRP A 1 589 ? 75.614  -49.329 136.971 1.00 55.04  ?  600  TRP A CB  1 
ATOM   4439 C  CG  . TRP A 1 589 ? 75.856  -48.525 135.718 1.00 56.28  ?  600  TRP A CG  1 
ATOM   4440 C  CD1 . TRP A 1 589 ? 75.629  -47.188 135.541 1.00 59.46  ?  600  TRP A CD1 1 
ATOM   4441 C  CD2 . TRP A 1 589 ? 76.387  -49.007 134.475 1.00 55.55  ?  600  TRP A CD2 1 
ATOM   4442 N  NE1 . TRP A 1 589 ? 75.981  -46.811 134.267 1.00 58.46  ?  600  TRP A NE1 1 
ATOM   4443 C  CE2 . TRP A 1 589 ? 76.449  -47.908 133.592 1.00 59.20  ?  600  TRP A CE2 1 
ATOM   4444 C  CE3 . TRP A 1 589 ? 76.812  -50.259 134.022 1.00 56.25  ?  600  TRP A CE3 1 
ATOM   4445 C  CZ2 . TRP A 1 589 ? 76.918  -48.026 132.284 1.00 57.50  ?  600  TRP A CZ2 1 
ATOM   4446 C  CZ3 . TRP A 1 589 ? 77.279  -50.373 132.721 1.00 56.80  ?  600  TRP A CZ3 1 
ATOM   4447 C  CH2 . TRP A 1 589 ? 77.328  -49.263 131.870 1.00 57.07  ?  600  TRP A CH2 1 
ATOM   4448 N  N   . ARG A 1 590 ? 76.446  -49.348 140.334 1.00 46.31  ?  601  ARG A N   1 
ATOM   4449 C  CA  . ARG A 1 590 ? 76.510  -50.151 141.554 1.00 45.50  ?  601  ARG A CA  1 
ATOM   4450 C  C   . ARG A 1 590 ? 76.306  -51.637 141.254 1.00 46.01  ?  601  ARG A C   1 
ATOM   4451 O  O   . ARG A 1 590 ? 75.431  -52.307 141.807 1.00 44.17  ?  601  ARG A O   1 
ATOM   4452 C  CB  . ARG A 1 590 ? 75.515  -49.635 142.596 1.00 46.39  ?  601  ARG A CB  1 
ATOM   4453 C  CG  . ARG A 1 590 ? 75.874  -48.246 143.112 1.00 60.36  ?  601  ARG A CG  1 
ATOM   4454 C  CD  . ARG A 1 590 ? 75.428  -48.037 144.550 1.00 82.01  ?  601  ARG A CD  1 
ATOM   4455 N  NE  . ARG A 1 590 ? 76.133  -46.924 145.183 1.00 102.49 ?  601  ARG A NE  1 
ATOM   4456 C  CZ  . ARG A 1 590 ? 75.684  -45.674 145.221 1.00 123.83 ?  601  ARG A CZ  1 
ATOM   4457 N  NH1 . ARG A 1 590 ? 74.521  -45.367 144.663 1.00 115.78 ?  601  ARG A NH1 1 
ATOM   4458 N  NH2 . ARG A 1 590 ? 76.397  -44.729 145.818 1.00 113.12 ?  601  ARG A NH2 1 
ATOM   4459 N  N   . LEU A 1 591 ? 77.157  -52.146 140.365 1.00 41.37  ?  602  LEU A N   1 
ATOM   4460 C  CA  . LEU A 1 591 ? 77.133  -53.537 139.944 1.00 41.38  ?  602  LEU A CA  1 
ATOM   4461 C  C   . LEU A 1 591 ? 78.516  -54.146 140.127 1.00 44.58  ?  602  LEU A C   1 
ATOM   4462 O  O   . LEU A 1 591 ? 79.532  -53.444 140.129 1.00 43.93  ?  602  LEU A O   1 
ATOM   4463 C  CB  . LEU A 1 591 ? 76.697  -53.677 138.478 1.00 41.42  ?  602  LEU A CB  1 
ATOM   4464 C  CG  . LEU A 1 591 ? 75.366  -53.053 138.047 1.00 46.82  ?  602  LEU A CG  1 
ATOM   4465 C  CD1 . LEU A 1 591 ? 75.237  -53.077 136.531 1.00 46.45  ?  602  LEU A CD1 1 
ATOM   4466 C  CD2 . LEU A 1 591 ? 74.189  -53.765 138.696 1.00 48.75  ?  602  LEU A CD2 1 
ATOM   4467 N  N   . VAL A 1 592 ? 78.543  -55.469 140.278 1.00 41.24  ?  603  VAL A N   1 
ATOM   4468 C  CA  . VAL A 1 592 ? 79.784  -56.221 140.419 1.00 40.59  ?  603  VAL A CA  1 
ATOM   4469 C  C   . VAL A 1 592 ? 79.699  -57.444 139.519 1.00 42.85  ?  603  VAL A C   1 
ATOM   4470 O  O   . VAL A 1 592 ? 78.786  -58.266 139.665 1.00 42.85  ?  603  VAL A O   1 
ATOM   4471 C  CB  . VAL A 1 592 ? 80.054  -56.647 141.872 1.00 46.12  ?  603  VAL A CB  1 
ATOM   4472 C  CG1 . VAL A 1 592 ? 81.294  -57.528 141.941 1.00 45.28  ?  603  VAL A CG1 1 
ATOM   4473 C  CG2 . VAL A 1 592 ? 80.223  -55.428 142.759 1.00 46.73  ?  603  VAL A CG2 1 
ATOM   4474 N  N   . ALA A 1 593 ? 80.639  -57.560 138.588 1.00 42.21  ?  604  ALA A N   1 
ATOM   4475 C  CA  . ALA A 1 593 ? 80.778  -58.739 137.750 1.00 40.93  ?  604  ALA A CA  1 
ATOM   4476 C  C   . ALA A 1 593 ? 81.991  -59.539 138.206 1.00 43.55  ?  604  ALA A C   1 
ATOM   4477 O  O   . ALA A 1 593 ? 82.995  -58.977 138.652 1.00 40.27  ?  604  ALA A O   1 
ATOM   4478 C  CB  . ALA A 1 593 ? 80.917  -58.357 136.275 1.00 40.93  ?  604  ALA A CB  1 
ATOM   4479 N  N   . PHE A 1 594 ? 81.887  -60.859 138.095 1.00 36.53  ?  605  PHE A N   1 
ATOM   4480 C  CA  . PHE A 1 594 ? 82.948  -61.749 138.543 1.00 36.65  ?  605  PHE A CA  1 
ATOM   4481 C  C   . PHE A 1 594 ? 82.835  -63.055 137.776 1.00 40.76  ?  605  PHE A C   1 
ATOM   4482 O  O   . PHE A 1 594 ? 81.735  -63.494 137.436 1.00 40.23  ?  605  PHE A O   1 
ATOM   4483 C  CB  . PHE A 1 594 ? 82.867  -61.998 140.053 1.00 39.16  ?  605  PHE A CB  1 
ATOM   4484 C  CG  . PHE A 1 594 ? 81.466  -62.183 140.556 1.00 41.40  ?  605  PHE A CG  1 
ATOM   4485 C  CD1 . PHE A 1 594 ? 80.857  -63.427 140.514 1.00 44.37  ?  605  PHE A CD1 1 
ATOM   4486 C  CD2 . PHE A 1 594 ? 80.756  -61.109 141.064 1.00 43.66  ?  605  PHE A CD2 1 
ATOM   4487 C  CE1 . PHE A 1 594 ? 79.564  -63.596 140.971 1.00 45.60  ?  605  PHE A CE1 1 
ATOM   4488 C  CE2 . PHE A 1 594 ? 79.466  -61.271 141.521 1.00 46.96  ?  605  PHE A CE2 1 
ATOM   4489 C  CZ  . PHE A 1 594 ? 78.868  -62.516 141.475 1.00 45.16  ?  605  PHE A CZ  1 
ATOM   4490 N  N   . GLY A 1 595 ? 83.987  -63.668 137.506 1.00 38.05  ?  606  GLY A N   1 
ATOM   4491 C  CA  . GLY A 1 595 ? 84.024  -64.902 136.758 1.00 37.58  ?  606  GLY A CA  1 
ATOM   4492 C  C   . GLY A 1 595 ? 84.865  -65.949 137.462 1.00 42.74  ?  606  GLY A C   1 
ATOM   4493 O  O   . GLY A 1 595 ? 85.708  -65.646 138.307 1.00 41.70  ?  606  GLY A O   1 
ATOM   4494 N  N   . THR A 1 596 ? 84.597  -67.206 137.108 1.00 39.67  ?  607  THR A N   1 
ATOM   4495 C  CA  . THR A 1 596 ? 85.380  -68.344 137.571 1.00 40.67  ?  607  THR A CA  1 
ATOM   4496 C  C   . THR A 1 596 ? 85.711  -69.247 136.393 1.00 47.45  ?  607  THR A C   1 
ATOM   4497 O  O   . THR A 1 596 ? 85.473  -68.885 135.237 1.00 46.97  ?  607  THR A O   1 
ATOM   4498 C  CB  . THR A 1 596 ? 84.627  -69.149 138.630 1.00 48.60  ?  607  THR A CB  1 
ATOM   4499 O  OG1 . THR A 1 596 ? 83.440  -69.699 138.041 1.00 49.52  ?  607  THR A OG1 1 
ATOM   4500 C  CG2 . THR A 1 596 ? 84.244  -68.281 139.817 1.00 44.87  ?  607  THR A CG2 1 
ATOM   4501 N  N   . SER A 1 597 ? 86.236  -70.438 136.678 1.00 46.94  ?  608  SER A N   1 
ATOM   4502 C  CA  . SER A 1 597 ? 86.435  -71.418 135.618 1.00 47.97  ?  608  SER A CA  1 
ATOM   4503 C  C   . SER A 1 597 ? 85.114  -71.995 135.119 1.00 53.48  ?  608  SER A C   1 
ATOM   4504 O  O   . SER A 1 597 ? 85.058  -72.493 133.990 1.00 52.77  ?  608  SER A O   1 
ATOM   4505 C  CB  . SER A 1 597 ? 87.359  -72.534 136.104 1.00 52.04  ?  608  SER A CB  1 
ATOM   4506 O  OG  . SER A 1 597 ? 86.882  -73.106 137.311 1.00 62.49  ?  608  SER A OG  1 
ATOM   4507 N  N   . HIS A 1 598 ? 84.058  -71.920 135.933 1.00 64.29  ?  609  HIS A N   1 
ATOM   4508 C  CA  . HIS A 1 598 ? 82.733  -72.455 135.622 1.00 65.36  ?  609  HIS A CA  1 
ATOM   4509 C  C   . HIS A 1 598 ? 81.897  -71.481 134.796 1.00 66.93  ?  609  HIS A C   1 
ATOM   4510 O  O   . HIS A 1 598 ? 81.467  -71.807 133.686 1.00 66.88  ?  609  HIS A O   1 
ATOM   4511 C  CB  . HIS A 1 598 ? 82.000  -72.802 136.923 1.00 67.60  ?  609  HIS A CB  1 
ATOM   4512 C  CG  . HIS A 1 598 ? 82.833  -73.578 137.890 1.00 71.82  ?  609  HIS A CG  1 
ATOM   4513 N  ND1 . HIS A 1 598 ? 83.067  -74.929 137.749 1.00 74.04  ?  609  HIS A ND1 1 
ATOM   4514 C  CD2 . HIS A 1 598 ? 83.500  -73.194 139.003 1.00 74.72  ?  609  HIS A CD2 1 
ATOM   4515 C  CE1 . HIS A 1 598 ? 83.838  -75.344 138.738 1.00 74.16  ?  609  HIS A CE1 1 
ATOM   4516 N  NE2 . HIS A 1 598 ? 84.115  -74.311 139.513 1.00 74.77  ?  609  HIS A NE2 1 
ATOM   4517 N  N   . GLY A 1 599 ? 81.641  -70.299 135.332 1.00 62.67  ?  610  GLY A N   1 
ATOM   4518 C  CA  . GLY A 1 599 ? 80.927  -69.284 134.594 1.00 61.14  ?  610  GLY A CA  1 
ATOM   4519 C  C   . GLY A 1 599 ? 81.181  -67.903 135.157 1.00 61.30  ?  610  GLY A C   1 
ATOM   4520 O  O   . GLY A 1 599 ? 82.243  -67.624 135.715 1.00 61.19  ?  610  GLY A O   1 
ATOM   4521 N  N   . PHE A 1 600 ? 80.187  -67.031 135.005 1.00 39.74  ?  611  PHE A N   1 
ATOM   4522 C  CA  . PHE A 1 600 ? 80.285  -65.686 135.548 1.00 38.12  ?  611  PHE A CA  1 
ATOM   4523 C  C   . PHE A 1 600 ? 78.892  -65.182 135.892 1.00 42.55  ?  611  PHE A C   1 
ATOM   4524 O  O   . PHE A 1 600 ? 77.880  -65.788 135.531 1.00 41.45  ?  611  PHE A O   1 
ATOM   4525 C  CB  . PHE A 1 600 ? 80.996  -64.734 134.576 1.00 38.52  ?  611  PHE A CB  1 
ATOM   4526 C  CG  . PHE A 1 600 ? 80.179  -64.359 133.372 1.00 39.00  ?  611  PHE A CG  1 
ATOM   4527 C  CD1 . PHE A 1 600 ? 80.125  -65.192 132.267 1.00 40.14  ?  611  PHE A CD1 1 
ATOM   4528 C  CD2 . PHE A 1 600 ? 79.483  -63.161 133.339 1.00 40.28  ?  611  PHE A CD2 1 
ATOM   4529 C  CE1 . PHE A 1 600 ? 79.379  -64.844 131.155 1.00 41.00  ?  611  PHE A CE1 1 
ATOM   4530 C  CE2 . PHE A 1 600 ? 78.736  -62.807 132.233 1.00 42.81  ?  611  PHE A CE2 1 
ATOM   4531 C  CZ  . PHE A 1 600 ? 78.684  -63.648 131.139 1.00 40.53  ?  611  PHE A CZ  1 
ATOM   4532 N  N   . GLY A 1 601 ? 78.852  -64.057 136.605 1.00 40.42  ?  612  GLY A N   1 
ATOM   4533 C  CA  . GLY A 1 601 ? 77.588  -63.489 137.036 1.00 40.18  ?  612  GLY A CA  1 
ATOM   4534 C  C   . GLY A 1 601 ? 77.705  -62.005 137.299 1.00 44.83  ?  612  GLY A C   1 
ATOM   4535 O  O   . GLY A 1 601 ? 78.799  -61.441 137.374 1.00 42.84  ?  612  GLY A O   1 
ATOM   4536 N  N   . LEU A 1 602 ? 76.538  -61.377 137.434 1.00 44.11  ?  613  LEU A N   1 
ATOM   4537 C  CA  . LEU A 1 602 ? 76.416  -59.957 137.726 1.00 44.55  ?  613  LEU A CA  1 
ATOM   4538 C  C   . LEU A 1 602 ? 75.614  -59.782 139.006 1.00 51.71  ?  613  LEU A C   1 
ATOM   4539 O  O   . LEU A 1 602 ? 74.624  -60.487 139.231 1.00 52.01  ?  613  LEU A O   1 
ATOM   4540 C  CB  . LEU A 1 602 ? 75.738  -59.207 136.575 1.00 44.09  ?  613  LEU A CB  1 
ATOM   4541 C  CG  . LEU A 1 602 ? 75.526  -57.702 136.740 1.00 47.60  ?  613  LEU A CG  1 
ATOM   4542 C  CD1 . LEU A 1 602 ? 76.859  -56.980 136.861 1.00 46.64  ?  613  LEU A CD1 1 
ATOM   4543 C  CD2 . LEU A 1 602 ? 74.716  -57.147 135.581 1.00 49.08  ?  613  LEU A CD2 1 
ATOM   4544 N  N   . PHE A 1 603 ? 76.039  -58.832 139.835 1.00 49.67  ?  614  PHE A N   1 
ATOM   4545 C  CA  . PHE A 1 603 ? 75.499  -58.679 141.177 1.00 50.68  ?  614  PHE A CA  1 
ATOM   4546 C  C   . PHE A 1 603 ? 75.237  -57.209 141.469 1.00 53.16  ?  614  PHE A C   1 
ATOM   4547 O  O   . PHE A 1 603 ? 76.107  -56.361 141.246 1.00 50.83  ?  614  PHE A O   1 
ATOM   4548 C  CB  . PHE A 1 603 ? 76.468  -59.268 142.210 1.00 53.30  ?  614  PHE A CB  1 
ATOM   4549 C  CG  . PHE A 1 603 ? 75.957  -59.226 143.618 1.00 57.02  ?  614  PHE A CG  1 
ATOM   4550 C  CD1 . PHE A 1 603 ? 75.120  -60.222 144.093 1.00 61.47  ?  614  PHE A CD1 1 
ATOM   4551 C  CD2 . PHE A 1 603 ? 76.326  -58.200 144.473 1.00 60.69  ?  614  PHE A CD2 1 
ATOM   4552 C  CE1 . PHE A 1 603 ? 74.651  -60.191 145.392 1.00 63.52  ?  614  PHE A CE1 1 
ATOM   4553 C  CE2 . PHE A 1 603 ? 75.861  -58.162 145.775 1.00 64.79  ?  614  PHE A CE2 1 
ATOM   4554 C  CZ  . PHE A 1 603 ? 75.022  -59.160 146.235 1.00 63.37  ?  614  PHE A CZ  1 
ATOM   4555 N  N   . ASP A 1 604 ? 74.035  -56.918 141.961 1.00 58.73  ?  615  ASP A N   1 
ATOM   4556 C  CA  . ASP A 1 604 ? 73.660  -55.576 142.395 1.00 59.55  ?  615  ASP A CA  1 
ATOM   4557 C  C   . ASP A 1 604 ? 74.162  -55.381 143.821 1.00 65.44  ?  615  ASP A C   1 
ATOM   4558 O  O   . ASP A 1 604 ? 73.639  -56.000 144.753 1.00 66.60  ?  615  ASP A O   1 
ATOM   4559 C  CB  . ASP A 1 604 ? 72.143  -55.408 142.311 1.00 61.56  ?  615  ASP A CB  1 
ATOM   4560 C  CG  . ASP A 1 604 ? 71.686  -53.969 142.504 1.00 71.78  ?  615  ASP A CG  1 
ATOM   4561 O  OD1 . ASP A 1 604 ? 72.332  -53.216 143.261 1.00 71.26  ?  615  ASP A OD1 1 
ATOM   4562 O  OD2 . ASP A 1 604 ? 70.662  -53.592 141.895 1.00 80.17  ?  615  ASP A OD2 1 
ATOM   4563 N  N   . HIS A 1 605 ? 75.176  -54.534 144.002 1.00 51.38  ?  616  HIS A N   1 
ATOM   4564 C  CA  . HIS A 1 605 ? 75.693  -54.265 145.337 1.00 50.80  ?  616  HIS A CA  1 
ATOM   4565 C  C   . HIS A 1 605 ? 74.977  -53.103 146.020 1.00 57.16  ?  616  HIS A C   1 
ATOM   4566 O  O   . HIS A 1 605 ? 75.403  -52.672 147.097 1.00 56.73  ?  616  HIS A O   1 
ATOM   4567 C  CB  . HIS A 1 605 ? 77.218  -54.037 145.295 1.00 49.54  ?  616  HIS A CB  1 
ATOM   4568 C  CG  . HIS A 1 605 ? 77.646  -52.663 144.871 1.00 51.75  ?  616  HIS A CG  1 
ATOM   4569 N  ND1 . HIS A 1 605 ? 77.410  -51.537 145.628 1.00 53.51  ?  616  HIS A ND1 1 
ATOM   4570 C  CD2 . HIS A 1 605 ? 78.356  -52.247 143.796 1.00 52.86  ?  616  HIS A CD2 1 
ATOM   4571 C  CE1 . HIS A 1 605 ? 77.923  -50.482 145.022 1.00 52.47  ?  616  HIS A CE1 1 
ATOM   4572 N  NE2 . HIS A 1 605 ? 78.508  -50.886 143.909 1.00 52.40  ?  616  HIS A NE2 1 
ATOM   4573 N  N   . GLN A 1 606 ? 73.896  -52.595 145.425 1.00 49.70  ?  617  GLN A N   1 
ATOM   4574 C  CA  . GLN A 1 606 ? 73.010  -51.668 146.120 1.00 50.29  ?  617  GLN A CA  1 
ATOM   4575 C  C   . GLN A 1 606 ? 71.838  -52.405 146.759 1.00 55.43  ?  617  GLN A C   1 
ATOM   4576 O  O   . GLN A 1 606 ? 71.568  -52.232 147.951 1.00 55.55  ?  617  GLN A O   1 
ATOM   4577 C  CB  . GLN A 1 606 ? 72.500  -50.587 145.161 1.00 51.39  ?  617  GLN A CB  1 
ATOM   4578 C  CG  . GLN A 1 606 ? 71.641  -49.520 145.830 1.00 61.63  ?  617  GLN A CG  1 
ATOM   4579 C  CD  . GLN A 1 606 ? 72.403  -48.714 146.868 1.00 83.92  ?  617  GLN A CD  1 
ATOM   4580 O  OE1 . GLN A 1 606 ? 72.591  -49.155 148.003 1.00 77.20  ?  617  GLN A OE1 1 
ATOM   4581 N  NE2 . GLN A 1 606 ? 72.844  -47.522 146.483 1.00 80.76  ?  617  GLN A NE2 1 
ATOM   4582 N  N   . GLN A 1 607 ? 71.139  -53.232 145.980 1.00 53.88  ?  618  GLN A N   1 
ATOM   4583 C  CA  . GLN A 1 607 ? 70.089  -54.086 146.518 1.00 54.90  ?  618  GLN A CA  1 
ATOM   4584 C  C   . GLN A 1 607 ? 70.634  -55.349 147.169 1.00 60.72  ?  618  GLN A C   1 
ATOM   4585 O  O   . GLN A 1 607 ? 69.861  -56.085 147.794 1.00 61.10  ?  618  GLN A O   1 
ATOM   4586 C  CB  . GLN A 1 607 ? 69.098  -54.473 145.415 1.00 56.22  ?  618  GLN A CB  1 
ATOM   4587 C  CG  . GLN A 1 607 ? 68.328  -53.305 144.821 1.00 65.92  ?  618  GLN A CG  1 
ATOM   4588 C  CD  . GLN A 1 607 ? 67.174  -53.760 143.951 1.00 77.67  ?  618  GLN A CD  1 
ATOM   4589 O  OE1 . GLN A 1 607 ? 66.633  -54.849 144.139 1.00 75.89  ?  618  GLN A OE1 1 
ATOM   4590 N  NE2 . GLN A 1 607 ? 66.794  -52.928 142.988 1.00 64.63  ?  618  GLN A NE2 1 
ATOM   4591 N  N   . ARG A 1 608 ? 71.937  -55.608 147.041 1.00 60.15  ?  619  ARG A N   1 
ATOM   4592 C  CA  . ARG A 1 608 ? 72.564  -56.828 147.557 1.00 59.83  ?  619  ARG A CA  1 
ATOM   4593 C  C   . ARG A 1 608 ? 71.862  -58.074 147.019 1.00 63.97  ?  619  ARG A C   1 
ATOM   4594 O  O   . ARG A 1 608 ? 71.686  -59.070 147.724 1.00 64.22  ?  619  ARG A O   1 
ATOM   4595 C  CB  . ARG A 1 608 ? 72.603  -56.832 149.087 1.00 58.58  ?  619  ARG A CB  1 
ATOM   4596 C  CG  . ARG A 1 608 ? 73.558  -55.810 149.702 1.00 63.17  ?  619  ARG A CG  1 
ATOM   4597 C  CD  . ARG A 1 608 ? 72.889  -54.457 149.890 1.00 69.37  ?  619  ARG A CD  1 
ATOM   4598 N  NE  . ARG A 1 608 ? 73.802  -53.457 150.436 1.00 73.75  ?  619  ARG A NE  1 
ATOM   4599 C  CZ  . ARG A 1 608 ? 74.029  -53.283 151.734 1.00 95.76  ?  619  ARG A CZ  1 
ATOM   4600 N  NH1 . ARG A 1 608 ? 73.412  -54.046 152.626 1.00 87.43  ?  619  ARG A NH1 1 
ATOM   4601 N  NH2 . ARG A 1 608 ? 74.874  -52.346 152.141 1.00 87.11  ?  619  ARG A NH2 1 
ATOM   4602 N  N   . ARG A 1 609 ? 71.462  -58.017 145.748 1.00 53.50  ?  620  ARG A N   1 
ATOM   4603 C  CA  . ARG A 1 609 ? 70.759  -59.112 145.097 1.00 53.43  ?  620  ARG A CA  1 
ATOM   4604 C  C   . ARG A 1 609 ? 71.444  -59.467 143.786 1.00 54.89  ?  620  ARG A C   1 
ATOM   4605 O  O   . ARG A 1 609 ? 71.985  -58.603 143.093 1.00 53.85  ?  620  ARG A O   1 
ATOM   4606 C  CB  . ARG A 1 609 ? 69.284  -58.769 144.829 1.00 55.80  ?  620  ARG A CB  1 
ATOM   4607 C  CG  . ARG A 1 609 ? 68.343  -59.145 145.962 1.00 72.66  ?  620  ARG A CG  1 
ATOM   4608 C  CD  . ARG A 1 609 ? 66.904  -59.288 145.476 1.00 88.52  ?  620  ARG A CD  1 
ATOM   4609 N  NE  . ARG A 1 609 ? 66.220  -58.003 145.356 1.00 98.59  ?  620  ARG A NE  1 
ATOM   4610 C  CZ  . ARG A 1 609 ? 65.370  -57.523 146.259 1.00 110.38 ?  620  ARG A CZ  1 
ATOM   4611 N  NH1 . ARG A 1 609 ? 65.093  -58.223 147.350 1.00 93.75  ?  620  ARG A NH1 1 
ATOM   4612 N  NH2 . ARG A 1 609 ? 64.793  -56.343 146.069 1.00 96.76  ?  620  ARG A NH2 1 
ATOM   4613 N  N   . GLN A 1 610 ? 71.401  -60.754 143.453 1.00 50.32  ?  621  GLN A N   1 
ATOM   4614 C  CA  . GLN A 1 610 ? 72.028  -61.246 142.234 1.00 49.02  ?  621  GLN A CA  1 
ATOM   4615 C  C   . GLN A 1 610 ? 71.171  -60.885 141.029 1.00 52.33  ?  621  GLN A C   1 
ATOM   4616 O  O   . GLN A 1 610 ? 69.973  -61.183 140.997 1.00 53.18  ?  621  GLN A O   1 
ATOM   4617 C  CB  . GLN A 1 610 ? 72.219  -62.756 142.314 1.00 50.30  ?  621  GLN A CB  1 
ATOM   4618 C  CG  . GLN A 1 610 ? 73.271  -63.299 141.366 1.00 65.90  ?  621  GLN A CG  1 
ATOM   4619 C  CD  . GLN A 1 610 ? 74.682  -63.057 141.869 1.00 81.65  ?  621  GLN A CD  1 
ATOM   4620 O  OE1 . GLN A 1 610 ? 75.542  -62.576 141.132 1.00 76.95  ?  621  GLN A OE1 1 
ATOM   4621 N  NE2 . GLN A 1 610 ? 74.928  -63.400 143.129 1.00 69.00  ?  621  GLN A NE2 1 
ATOM   4622 N  N   . VAL A 1 611 ? 71.781  -60.240 140.036 1.00 53.97  ?  622  VAL A N   1 
ATOM   4623 C  CA  . VAL A 1 611 ? 71.052  -59.907 138.815 1.00 51.90  ?  622  VAL A CA  1 
ATOM   4624 C  C   . VAL A 1 611 ? 70.915  -61.136 137.925 1.00 55.68  ?  622  VAL A C   1 
ATOM   4625 O  O   . VAL A 1 611 ? 69.802  -61.579 137.617 1.00 55.99  ?  622  VAL A O   1 
ATOM   4626 C  CB  . VAL A 1 611 ? 71.732  -58.741 138.077 1.00 53.77  ?  622  VAL A CB  1 
ATOM   4627 C  CG1 . VAL A 1 611 ? 70.976  -58.421 136.802 1.00 53.69  ?  622  VAL A CG1 1 
ATOM   4628 C  CG2 . VAL A 1 611 ? 71.794  -57.518 138.974 1.00 53.32  ?  622  VAL A CG2 1 
ATOM   4629 N  N   . PHE A 1 612 ? 72.041  -61.713 137.506 1.00 47.32  ?  623  PHE A N   1 
ATOM   4630 C  CA  . PHE A 1 612 ? 71.998  -62.935 136.718 1.00 46.18  ?  623  PHE A CA  1 
ATOM   4631 C  C   . PHE A 1 612 ? 73.265  -63.748 136.952 1.00 50.86  ?  623  PHE A C   1 
ATOM   4632 O  O   . PHE A 1 612 ? 74.219  -63.296 137.591 1.00 49.50  ?  623  PHE A O   1 
ATOM   4633 C  CB  . PHE A 1 612 ? 71.799  -62.639 135.222 1.00 47.01  ?  623  PHE A CB  1 
ATOM   4634 C  CG  . PHE A 1 612 ? 73.043  -62.187 134.503 1.00 46.72  ?  623  PHE A CG  1 
ATOM   4635 C  CD1 . PHE A 1 612 ? 73.915  -63.112 133.944 1.00 48.22  ?  623  PHE A CD1 1 
ATOM   4636 C  CD2 . PHE A 1 612 ? 73.323  -60.839 134.354 1.00 47.41  ?  623  PHE A CD2 1 
ATOM   4637 C  CE1 . PHE A 1 612 ? 75.054  -62.702 133.277 1.00 48.38  ?  623  PHE A CE1 1 
ATOM   4638 C  CE2 . PHE A 1 612 ? 74.457  -60.422 133.679 1.00 49.22  ?  623  PHE A CE2 1 
ATOM   4639 C  CZ  . PHE A 1 612 ? 75.325  -61.355 133.143 1.00 47.00  ?  623  PHE A CZ  1 
ATOM   4640 N  N   . VAL A 1 613 ? 73.246  -64.967 136.417 1.00 64.11  ?  624  VAL A N   1 
ATOM   4641 C  CA  . VAL A 1 613 ? 74.346  -65.922 136.489 1.00 65.14  ?  624  VAL A CA  1 
ATOM   4642 C  C   . VAL A 1 613 ? 74.374  -66.686 135.171 1.00 71.80  ?  624  VAL A C   1 
ATOM   4643 O  O   . VAL A 1 613 ? 73.323  -67.070 134.650 1.00 73.81  ?  624  VAL A O   1 
ATOM   4644 C  CB  . VAL A 1 613 ? 74.180  -66.883 137.689 1.00 69.47  ?  624  VAL A CB  1 
ATOM   4645 C  CG1 . VAL A 1 613 ? 75.052  -68.107 137.523 1.00 69.05  ?  624  VAL A CG1 1 
ATOM   4646 C  CG2 . VAL A 1 613 ? 74.495  -66.177 139.003 1.00 69.03  ?  624  VAL A CG2 1 
ATOM   4647 N  N   . LYS A 1 614 ? 75.570  -66.894 134.619 1.00 43.65  ?  625  LYS A N   1 
ATOM   4648 C  CA  . LYS A 1 614 ? 75.713  -67.610 133.353 1.00 42.91  ?  625  LYS A CA  1 
ATOM   4649 C  C   . LYS A 1 614 ? 76.837  -68.629 133.459 1.00 48.78  ?  625  LYS A C   1 
ATOM   4650 O  O   . LYS A 1 614 ? 77.981  -68.268 133.747 1.00 48.69  ?  625  LYS A O   1 
ATOM   4651 C  CB  . LYS A 1 614 ? 75.980  -66.647 132.192 1.00 43.82  ?  625  LYS A CB  1 
ATOM   4652 C  CG  . LYS A 1 614 ? 76.285  -67.349 130.879 1.00 50.73  ?  625  LYS A CG  1 
ATOM   4653 C  CD  . LYS A 1 614 ? 75.775  -66.555 129.690 1.00 55.82  ?  625  LYS A CD  1 
ATOM   4654 C  CE  . LYS A 1 614 ? 76.168  -67.211 128.378 1.00 61.11  ?  625  LYS A CE  1 
ATOM   4655 N  NZ  . LYS A 1 614 ? 75.494  -68.525 128.199 1.00 67.07  ?  625  LYS A NZ  1 
ATOM   4656 N  N   . CYS A 1 615 ? 76.507  -69.897 133.214 1.00 56.17  ?  626  CYS A N   1 
ATOM   4657 C  CA  . CYS A 1 615 ? 77.499  -70.963 133.170 1.00 56.48  ?  626  CYS A CA  1 
ATOM   4658 C  C   . CYS A 1 615 ? 78.170  -70.991 131.804 1.00 63.62  ?  626  CYS A C   1 
ATOM   4659 O  O   . CYS A 1 615 ? 77.497  -70.929 130.771 1.00 63.11  ?  626  CYS A O   1 
ATOM   4660 C  CB  . CYS A 1 615 ? 76.849  -72.314 133.457 1.00 56.92  ?  626  CYS A CB  1 
ATOM   4661 S  SG  . CYS A 1 615 ? 77.973  -73.721 133.320 1.00 60.54  ?  626  CYS A SG  1 
ATOM   4662 N  N   . THR A 1 616 ? 79.494  -71.095 131.799 1.00 55.95  ?  627  THR A N   1 
ATOM   4663 C  CA  . THR A 1 616 ? 80.278  -71.153 130.569 1.00 56.49  ?  627  THR A CA  1 
ATOM   4664 C  C   . THR A 1 616 ? 81.094  -72.443 130.571 1.00 65.58  ?  627  THR A C   1 
ATOM   4665 O  O   . THR A 1 616 ? 82.292  -72.436 130.857 1.00 65.03  ?  627  THR A O   1 
ATOM   4666 C  CB  . THR A 1 616 ? 81.179  -69.918 130.431 1.00 55.50  ?  627  THR A CB  1 
ATOM   4667 O  OG1 . THR A 1 616 ? 82.135  -69.902 131.497 1.00 50.64  ?  627  THR A OG1 1 
ATOM   4668 C  CG2 . THR A 1 616 ? 80.351  -68.642 130.481 1.00 51.90  ?  627  THR A CG2 1 
ATOM   4669 N  N   . LEU A 1 617 ? 80.433  -73.560 130.268 1.00 80.55  ?  628  LEU A N   1 
ATOM   4670 C  CA  . LEU A 1 617 ? 81.113  -74.829 130.043 1.00 82.30  ?  628  LEU A CA  1 
ATOM   4671 C  C   . LEU A 1 617 ? 80.602  -75.519 128.785 1.00 90.29  ?  628  LEU A C   1 
ATOM   4672 O  O   . LEU A 1 617 ? 80.985  -76.664 128.516 1.00 88.82  ?  628  LEU A O   1 
ATOM   4673 C  CB  . LEU A 1 617 ? 80.969  -75.751 131.260 1.00 82.80  ?  628  LEU A CB  1 
ATOM   4674 C  CG  . LEU A 1 617 ? 81.901  -75.402 132.426 1.00 87.64  ?  628  LEU A CG  1 
ATOM   4675 C  CD1 . LEU A 1 617 ? 81.126  -75.220 133.719 1.00 88.07  ?  628  LEU A CD1 1 
ATOM   4676 C  CD2 . LEU A 1 617 ? 82.991  -76.454 132.598 1.00 90.02  ?  628  LEU A CD2 1 
ATOM   4677 N  N   . HIS A 1 618 ? 79.741  -74.849 128.019 1.00 91.49  ?  629  HIS A N   1 
ATOM   4678 C  CA  . HIS A 1 618 ? 79.273  -75.334 126.724 1.00 92.84  ?  629  HIS A CA  1 
ATOM   4679 C  C   . HIS A 1 618 ? 79.220  -74.117 125.808 1.00 99.26  ?  629  HIS A C   1 
ATOM   4680 O  O   . HIS A 1 618 ? 78.264  -73.326 125.875 1.00 99.38  ?  629  HIS A O   1 
ATOM   4681 C  CB  . HIS A 1 618 ? 77.902  -76.003 126.810 1.00 94.43  ?  629  HIS A CB  1 
ATOM   4682 C  CG  . HIS A 1 618 ? 77.644  -76.720 128.100 1.00 98.46  ?  629  HIS A CG  1 
ATOM   4683 N  ND1 . HIS A 1 618 ? 77.492  -76.061 129.301 1.00 100.62 ?  629  HIS A ND1 1 
ATOM   4684 C  CD2 . HIS A 1 618 ? 77.480  -78.036 128.370 1.00 100.53 ?  629  HIS A CD2 1 
ATOM   4685 C  CE1 . HIS A 1 618 ? 77.264  -76.942 130.259 1.00 100.36 ?  629  HIS A CE1 1 
ATOM   4686 N  NE2 . HIS A 1 618 ? 77.250  -78.148 129.720 1.00 100.69 ?  629  HIS A NE2 1 
ATOM   4687 N  N   . PRO A 1 619 ? 80.235  -73.917 124.953 1.00 100.08 ?  630  PRO A N   1 
ATOM   4688 C  CA  . PRO A 1 619 ? 80.299  -72.755 124.056 1.00 104.14 ?  630  PRO A CA  1 
ATOM   4689 C  C   . PRO A 1 619 ? 79.072  -72.613 123.159 1.00 140.87 ?  630  PRO A C   1 
ATOM   4690 O  O   . PRO A 1 619 ? 78.981  -73.320 122.157 1.00 104.85 ?  630  PRO A O   1 
ATOM   4691 C  CB  . PRO A 1 619 ? 81.549  -73.032 123.218 1.00 104.66 ?  630  PRO A CB  1 
ATOM   4692 C  CG  . PRO A 1 619 ? 82.395  -73.896 124.086 1.00 107.56 ?  630  PRO A CG  1 
ATOM   4693 C  CD  . PRO A 1 619 ? 81.433  -74.766 124.841 1.00 102.67 ?  630  PRO A CD  1 
ATOM   4694 N  N   . PHE A 1 698 ? 90.056  -75.506 129.969 1.00 85.82  ?  709  PHE A N   1 
ATOM   4695 C  CA  . PHE A 1 698 ? 88.633  -75.192 129.937 1.00 86.29  ?  709  PHE A CA  1 
ATOM   4696 C  C   . PHE A 1 698 ? 88.385  -73.890 129.175 1.00 89.38  ?  709  PHE A C   1 
ATOM   4697 O  O   . PHE A 1 698 ? 88.865  -72.826 129.572 1.00 89.72  ?  709  PHE A O   1 
ATOM   4698 C  CB  . PHE A 1 698 ? 88.072  -75.099 131.359 1.00 88.55  ?  709  PHE A CB  1 
ATOM   4699 N  N   . THR A 1 699 ? 87.635  -73.988 128.074 1.00 86.45  ?  710  THR A N   1 
ATOM   4700 C  CA  . THR A 1 699 ? 87.365  -72.848 127.204 1.00 85.23  ?  710  THR A CA  1 
ATOM   4701 C  C   . THR A 1 699 ? 86.331  -71.887 127.777 1.00 86.25  ?  710  THR A C   1 
ATOM   4702 O  O   . THR A 1 699 ? 86.125  -70.811 127.203 1.00 85.48  ?  710  THR A O   1 
ATOM   4703 C  CB  . THR A 1 699 ? 86.905  -73.328 125.820 1.00 95.27  ?  710  THR A CB  1 
ATOM   4704 O  OG1 . THR A 1 699 ? 85.769  -74.193 125.955 1.00 95.94  ?  710  THR A OG1 1 
ATOM   4705 C  CG2 . THR A 1 699 ? 88.028  -74.068 125.105 1.00 92.34  ?  710  THR A CG2 1 
ATOM   4706 N  N   . GLY A 1 700 ? 85.682  -72.239 128.884 1.00 70.34  ?  711  GLY A N   1 
ATOM   4707 C  CA  . GLY A 1 700 ? 84.740  -71.360 129.538 1.00 68.80  ?  711  GLY A CA  1 
ATOM   4708 C  C   . GLY A 1 700 ? 85.288  -70.580 130.711 1.00 68.21  ?  711  GLY A C   1 
ATOM   4709 O  O   . GLY A 1 700 ? 84.554  -69.780 131.301 1.00 67.91  ?  711  GLY A O   1 
ATOM   4710 N  N   . PHE A 1 701 ? 86.543  -70.819 131.091 1.00 69.50  ?  712  PHE A N   1 
ATOM   4711 C  CA  . PHE A 1 701 ? 87.291  -69.967 132.009 1.00 67.19  ?  712  PHE A CA  1 
ATOM   4712 C  C   . PHE A 1 701 ? 87.073  -68.498 131.661 1.00 64.41  ?  712  PHE A C   1 
ATOM   4713 O  O   . PHE A 1 701 ? 87.570  -68.021 130.636 1.00 61.84  ?  712  PHE A O   1 
ATOM   4714 C  CB  . PHE A 1 701 ? 88.773  -70.347 131.926 1.00 69.00  ?  712  PHE A CB  1 
ATOM   4715 C  CG  . PHE A 1 701 ? 89.681  -69.569 132.843 1.00 71.38  ?  712  PHE A CG  1 
ATOM   4716 C  CD1 . PHE A 1 701 ? 90.079  -68.277 132.533 1.00 75.21  ?  712  PHE A CD1 1 
ATOM   4717 C  CD2 . PHE A 1 701 ? 90.197  -70.166 133.980 1.00 74.60  ?  712  PHE A CD2 1 
ATOM   4718 C  CE1 . PHE A 1 701 ? 90.934  -67.578 133.364 1.00 76.24  ?  712  PHE A CE1 1 
ATOM   4719 C  CE2 . PHE A 1 701 ? 91.058  -69.476 134.811 1.00 77.81  ?  712  PHE A CE2 1 
ATOM   4720 C  CZ  . PHE A 1 701 ? 91.429  -68.180 134.502 1.00 75.65  ?  712  PHE A CZ  1 
ATOM   4721 N  N   . VAL A 1 702 ? 86.323  -67.779 132.494 1.00 49.52  ?  713  VAL A N   1 
ATOM   4722 C  CA  . VAL A 1 702 ? 86.040  -66.365 132.255 1.00 47.65  ?  713  VAL A CA  1 
ATOM   4723 C  C   . VAL A 1 702 ? 87.254  -65.554 132.695 1.00 46.65  ?  713  VAL A C   1 
ATOM   4724 O  O   . VAL A 1 702 ? 87.580  -65.505 133.884 1.00 44.12  ?  713  VAL A O   1 
ATOM   4725 C  CB  . VAL A 1 702 ? 84.775  -65.908 132.991 1.00 51.78  ?  713  VAL A CB  1 
ATOM   4726 C  CG1 . VAL A 1 702 ? 84.491  -64.440 132.706 1.00 51.36  ?  713  VAL A CG1 1 
ATOM   4727 C  CG2 . VAL A 1 702 ? 83.590  -66.775 132.592 1.00 52.24  ?  713  VAL A CG2 1 
ATOM   4728 N  N   . ARG A 1 703 ? 87.923  -64.906 131.737 1.00 43.48  ?  714  ARG A N   1 
ATOM   4729 C  CA  . ARG A 1 703 ? 89.151  -64.181 132.022 1.00 41.95  ?  714  ARG A CA  1 
ATOM   4730 C  C   . ARG A 1 703 ? 89.014  -62.666 131.952 1.00 42.27  ?  714  ARG A C   1 
ATOM   4731 O  O   . ARG A 1 703 ? 89.850  -61.966 132.531 1.00 41.08  ?  714  ARG A O   1 
ATOM   4732 C  CB  . ARG A 1 703 ? 90.268  -64.619 131.061 1.00 44.31  ?  714  ARG A CB  1 
ATOM   4733 C  CG  . ARG A 1 703 ? 91.663  -64.461 131.654 1.00 56.42  ?  714  ARG A CG  1 
ATOM   4734 C  CD  . ARG A 1 703 ? 92.769  -64.542 130.611 1.00 62.62  ?  714  ARG A CD  1 
ATOM   4735 N  NE  . ARG A 1 703 ? 93.203  -65.911 130.349 1.00 67.03  ?  714  ARG A NE  1 
ATOM   4736 C  CZ  . ARG A 1 703 ? 94.392  -66.227 129.845 1.00 77.52  ?  714  ARG A CZ  1 
ATOM   4737 N  NH1 . ARG A 1 703 ? 95.266  -65.271 129.560 1.00 57.60  ?  714  ARG A NH1 1 
ATOM   4738 N  NH2 . ARG A 1 703 ? 94.713  -67.496 129.633 1.00 67.91  ?  714  ARG A NH2 1 
ATOM   4739 N  N   . THR A 1 704 ? 87.993  -62.139 131.276 1.00 41.13  ?  715  THR A N   1 
ATOM   4740 C  CA  . THR A 1 704 ? 87.877  -60.701 131.085 1.00 40.15  ?  715  THR A CA  1 
ATOM   4741 C  C   . THR A 1 704 ? 86.440  -60.251 131.300 1.00 43.31  ?  715  THR A C   1 
ATOM   4742 O  O   . THR A 1 704 ? 85.500  -60.919 130.859 1.00 45.43  ?  715  THR A O   1 
ATOM   4743 C  CB  . THR A 1 704 ? 88.346  -60.290 129.683 1.00 43.64  ?  715  THR A CB  1 
ATOM   4744 O  OG1 . THR A 1 704 ? 89.624  -60.880 129.415 1.00 41.69  ?  715  THR A OG1 1 
ATOM   4745 C  CG2 . THR A 1 704 ? 88.470  -58.778 129.582 1.00 39.77  ?  715  THR A CG2 1 
ATOM   4746 N  N   . LEU A 1 705 ? 86.280  -59.115 131.983 1.00 30.97  ?  716  LEU A N   1 
ATOM   4747 C  CA  . LEU A 1 705 ? 84.982  -58.486 132.193 1.00 30.83  ?  716  LEU A CA  1 
ATOM   4748 C  C   . LEU A 1 705 ? 85.123  -56.986 131.981 1.00 33.22  ?  716  LEU A C   1 
ATOM   4749 O  O   . LEU A 1 705 ? 86.152  -56.401 132.330 1.00 33.96  ?  716  LEU A O   1 
ATOM   4750 C  CB  . LEU A 1 705 ? 84.437  -58.772 133.597 1.00 30.96  ?  716  LEU A CB  1 
ATOM   4751 C  CG  . LEU A 1 705 ? 84.184  -60.251 133.893 1.00 34.41  ?  716  LEU A CG  1 
ATOM   4752 C  CD1 . LEU A 1 705 ? 84.064  -60.479 135.385 1.00 33.90  ?  716  LEU A CD1 1 
ATOM   4753 C  CD2 . LEU A 1 705 ? 82.939  -60.738 133.168 1.00 35.92  ?  716  LEU A CD2 1 
ATOM   4754 N  N   . TYR A 1 706 ? 84.088  -56.369 131.414 1.00 30.54  ?  717  TYR A N   1 
ATOM   4755 C  CA  . TYR A 1 706 ? 84.175  -54.969 131.002 1.00 29.75  ?  717  TYR A CA  1 
ATOM   4756 C  C   . TYR A 1 706 ? 82.775  -54.388 130.898 1.00 38.02  ?  717  TYR A C   1 
ATOM   4757 O  O   . TYR A 1 706 ? 81.965  -54.868 130.099 1.00 37.60  ?  717  TYR A O   1 
ATOM   4758 C  CB  . TYR A 1 706 ? 84.917  -54.857 129.665 1.00 27.93  ?  717  TYR A CB  1 
ATOM   4759 C  CG  . TYR A 1 706 ? 85.095  -53.450 129.129 1.00 26.93  ?  717  TYR A CG  1 
ATOM   4760 C  CD1 . TYR A 1 706 ? 86.075  -52.610 129.640 1.00 27.66  ?  717  TYR A CD1 1 
ATOM   4761 C  CD2 . TYR A 1 706 ? 84.305  -52.974 128.090 1.00 28.07  ?  717  TYR A CD2 1 
ATOM   4762 C  CE1 . TYR A 1 706 ? 86.252  -51.327 129.145 1.00 27.16  ?  717  TYR A CE1 1 
ATOM   4763 C  CE2 . TYR A 1 706 ? 84.475  -51.690 127.588 1.00 28.74  ?  717  TYR A CE2 1 
ATOM   4764 C  CZ  . TYR A 1 706 ? 85.450  -50.872 128.120 1.00 33.74  ?  717  TYR A CZ  1 
ATOM   4765 O  OH  . TYR A 1 706 ? 85.628  -49.597 127.630 1.00 33.69  ?  717  TYR A OH  1 
ATOM   4766 N  N   . PHE A 1 707 ? 82.487  -53.367 131.701 1.00 35.13  ?  718  PHE A N   1 
ATOM   4767 C  CA  . PHE A 1 707 ? 81.248  -52.611 131.580 1.00 36.63  ?  718  PHE A CA  1 
ATOM   4768 C  C   . PHE A 1 707 ? 81.407  -51.535 130.514 1.00 40.98  ?  718  PHE A C   1 
ATOM   4769 O  O   . PHE A 1 707 ? 82.480  -50.940 130.373 1.00 38.63  ?  718  PHE A O   1 
ATOM   4770 C  CB  . PHE A 1 707 ? 80.865  -51.964 132.913 1.00 39.02  ?  718  PHE A CB  1 
ATOM   4771 C  CG  . PHE A 1 707 ? 80.369  -52.935 133.943 1.00 41.66  ?  718  PHE A CG  1 
ATOM   4772 C  CD1 . PHE A 1 707 ? 79.103  -53.486 133.838 1.00 47.02  ?  718  PHE A CD1 1 
ATOM   4773 C  CD2 . PHE A 1 707 ? 81.160  -53.286 135.023 1.00 43.28  ?  718  PHE A CD2 1 
ATOM   4774 C  CE1 . PHE A 1 707 ? 78.638  -54.378 134.787 1.00 48.48  ?  718  PHE A CE1 1 
ATOM   4775 C  CE2 . PHE A 1 707 ? 80.700  -54.178 135.976 1.00 46.92  ?  718  PHE A CE2 1 
ATOM   4776 C  CZ  . PHE A 1 707 ? 79.437  -54.723 135.857 1.00 45.93  ?  718  PHE A CZ  1 
ATOM   4777 N  N   . ALA A 1 708 ? 80.333  -51.284 129.767 1.00 47.64  ?  719  ALA A N   1 
ATOM   4778 C  CA  . ALA A 1 708 ? 80.374  -50.291 128.703 1.00 47.24  ?  719  ALA A CA  1 
ATOM   4779 C  C   . ALA A 1 708 ? 78.978  -49.742 128.453 1.00 47.97  ?  719  ALA A C   1 
ATOM   4780 O  O   . ALA A 1 708 ? 78.024  -50.511 128.303 1.00 44.99  ?  719  ALA A O   1 
ATOM   4781 C  CB  . ALA A 1 708 ? 80.942  -50.886 127.410 1.00 47.42  ?  719  ALA A CB  1 
ATOM   4782 N  N   . ASP A 1 709 ? 78.866  -48.418 128.410 1.00 41.58  ?  720  ASP A N   1 
ATOM   4783 C  CA  . ASP A 1 709 ? 77.636  -47.755 127.987 1.00 43.54  ?  720  ASP A CA  1 
ATOM   4784 C  C   . ASP A 1 709 ? 77.826  -47.400 126.516 1.00 48.15  ?  720  ASP A C   1 
ATOM   4785 O  O   . ASP A 1 709 ? 78.387  -46.356 126.176 1.00 46.48  ?  720  ASP A O   1 
ATOM   4786 C  CB  . ASP A 1 709 ? 77.345  -46.534 128.854 1.00 46.13  ?  720  ASP A CB  1 
ATOM   4787 C  CG  . ASP A 1 709 ? 76.161  -45.733 128.352 1.00 55.13  ?  720  ASP A CG  1 
ATOM   4788 O  OD1 . ASP A 1 709 ? 75.129  -46.342 127.999 1.00 54.30  ?  720  ASP A OD1 1 
ATOM   4789 O  OD2 . ASP A 1 709 ? 76.262  -44.487 128.322 1.00 61.15  ?  720  ASP A OD2 1 
ATOM   4790 N  N   . THR A 1 710 ? 77.366  -48.292 125.638 1.00 41.76  ?  721  THR A N   1 
ATOM   4791 C  CA  . THR A 1 710 ? 77.661  -48.189 124.217 1.00 42.27  ?  721  THR A CA  1 
ATOM   4792 C  C   . THR A 1 710 ? 76.459  -48.677 123.416 1.00 49.56  ?  721  THR A C   1 
ATOM   4793 O  O   . THR A 1 710 ? 75.408  -49.009 123.970 1.00 49.46  ?  721  THR A O   1 
ATOM   4794 C  CB  . THR A 1 710 ? 78.926  -48.980 123.864 1.00 38.69  ?  721  THR A CB  1 
ATOM   4795 O  OG1 . THR A 1 710 ? 79.239  -48.796 122.479 1.00 33.80  ?  721  THR A OG1 1 
ATOM   4796 C  CG2 . THR A 1 710 ? 78.725  -50.466 124.141 1.00 31.50  ?  721  THR A CG2 1 
ATOM   4797 N  N   . TYR A 1 711 ? 76.628  -48.717 122.094 1.00 48.52  ?  722  TYR A N   1 
ATOM   4798 C  CA  . TYR A 1 711 ? 75.564  -49.104 121.172 1.00 49.15  ?  722  TYR A CA  1 
ATOM   4799 C  C   . TYR A 1 711 ? 75.573  -50.619 121.008 1.00 57.93  ?  722  TYR A C   1 
ATOM   4800 O  O   . TYR A 1 711 ? 76.487  -51.181 120.397 1.00 57.48  ?  722  TYR A O   1 
ATOM   4801 C  CB  . TYR A 1 711 ? 75.745  -48.402 119.830 1.00 48.48  ?  722  TYR A CB  1 
ATOM   4802 C  CG  . TYR A 1 711 ? 75.669  -46.901 119.939 1.00 49.28  ?  722  TYR A CG  1 
ATOM   4803 C  CD1 . TYR A 1 711 ? 74.442  -46.254 119.979 1.00 52.15  ?  722  TYR A CD1 1 
ATOM   4804 C  CD2 . TYR A 1 711 ? 76.820  -46.130 120.020 1.00 49.30  ?  722  TYR A CD2 1 
ATOM   4805 C  CE1 . TYR A 1 711 ? 74.362  -44.882 120.087 1.00 51.82  ?  722  TYR A CE1 1 
ATOM   4806 C  CE2 . TYR A 1 711 ? 76.751  -44.756 120.128 1.00 50.41  ?  722  TYR A CE2 1 
ATOM   4807 C  CZ  . TYR A 1 711 ? 75.518  -44.138 120.161 1.00 56.00  ?  722  TYR A CZ  1 
ATOM   4808 O  OH  . TYR A 1 711 ? 75.438  -42.770 120.268 1.00 55.12  ?  722  TYR A OH  1 
ATOM   4809 N  N   . LEU A 1 712 ? 74.544  -51.279 121.539 1.00 64.32  ?  723  LEU A N   1 
ATOM   4810 C  CA  . LEU A 1 712 ? 74.481  -52.732 121.531 1.00 65.60  ?  723  LEU A CA  1 
ATOM   4811 C  C   . LEU A 1 712 ? 73.468  -53.306 120.550 1.00 72.42  ?  723  LEU A C   1 
ATOM   4812 O  O   . LEU A 1 712 ? 73.611  -54.467 120.155 1.00 71.65  ?  723  LEU A O   1 
ATOM   4813 C  CB  . LEU A 1 712 ? 74.164  -53.255 122.940 1.00 66.17  ?  723  LEU A CB  1 
ATOM   4814 C  CG  . LEU A 1 712 ? 74.671  -54.661 123.267 1.00 70.81  ?  723  LEU A CG  1 
ATOM   4815 C  CD1 . LEU A 1 712 ? 76.125  -54.795 122.864 1.00 69.37  ?  723  LEU A CD1 1 
ATOM   4816 C  CD2 . LEU A 1 712 ? 74.497  -54.974 124.744 1.00 74.08  ?  723  LEU A CD2 1 
ATOM   4817 N  N   . LYS A 1 713 ? 72.457  -52.537 120.143 1.00 66.76  ?  724  LYS A N   1 
ATOM   4818 C  CA  . LYS A 1 713 ? 71.443  -53.075 119.240 1.00 67.73  ?  724  LYS A CA  1 
ATOM   4819 C  C   . LYS A 1 713 ? 71.071  -52.103 118.126 1.00 71.58  ?  724  LYS A C   1 
ATOM   4820 O  O   . LYS A 1 713 ? 70.889  -52.522 116.979 1.00 70.54  ?  724  LYS A O   1 
ATOM   4821 C  CB  . LYS A 1 713 ? 70.188  -53.478 120.031 1.00 71.24  ?  724  LYS A CB  1 
ATOM   4822 C  CG  . LYS A 1 713 ? 70.380  -54.748 120.852 1.00 83.26  ?  724  LYS A CG  1 
ATOM   4823 C  CD  . LYS A 1 713 ? 69.072  -55.275 121.417 1.00 90.74  ?  724  LYS A CD  1 
ATOM   4824 C  CE  . LYS A 1 713 ? 69.284  -56.613 122.110 1.00 93.56  ?  724  LYS A CE  1 
ATOM   4825 N  NZ  . LYS A 1 713 ? 68.001  -57.204 122.575 1.00 100.03 ?  724  LYS A NZ  1 
ATOM   4826 N  N   . ASP A 1 714 ? 70.959  -50.812 118.440 1.00 68.39  ?  725  ASP A N   1 
ATOM   4827 C  CA  . ASP A 1 714 ? 70.572  -49.806 117.460 1.00 68.90  ?  725  ASP A CA  1 
ATOM   4828 C  C   . ASP A 1 714 ? 71.583  -48.670 117.454 1.00 70.46  ?  725  ASP A C   1 
ATOM   4829 O  O   . ASP A 1 714 ? 72.112  -48.290 118.503 1.00 69.95  ?  725  ASP A O   1 
ATOM   4830 C  CB  . ASP A 1 714 ? 69.171  -49.253 117.753 1.00 72.19  ?  725  ASP A CB  1 
ATOM   4831 N  N   . SER A 1 715 ? 71.840  -48.125 116.262 1.00 59.54  ?  726  SER A N   1 
ATOM   4832 C  CA  . SER A 1 715 ? 72.798  -47.035 116.105 1.00 58.59  ?  726  SER A CA  1 
ATOM   4833 C  C   . SER A 1 715 ? 72.365  -45.759 116.813 1.00 61.16  ?  726  SER A C   1 
ATOM   4834 O  O   . SER A 1 715 ? 73.190  -44.853 116.979 1.00 57.94  ?  726  SER A O   1 
ATOM   4835 C  CB  . SER A 1 715 ? 73.023  -46.746 114.617 1.00 62.34  ?  726  SER A CB  1 
ATOM   4836 O  OG  . SER A 1 715 ? 73.593  -47.864 113.956 1.00 73.15  ?  726  SER A OG  1 
ATOM   4837 N  N   . SER A 1 716 ? 71.102  -45.664 117.227 1.00 59.66  ?  727  SER A N   1 
ATOM   4838 C  CA  . SER A 1 716 ? 70.603  -44.500 117.948 1.00 60.51  ?  727  SER A CA  1 
ATOM   4839 C  C   . SER A 1 716 ? 70.507  -44.723 119.450 1.00 64.90  ?  727  SER A C   1 
ATOM   4840 O  O   . SER A 1 716 ? 70.736  -43.784 120.218 1.00 64.23  ?  727  SER A O   1 
ATOM   4841 C  CB  . SER A 1 716 ? 69.225  -44.096 117.414 1.00 64.95  ?  727  SER A CB  1 
ATOM   4842 O  OG  . SER A 1 716 ? 69.256  -43.909 116.010 1.00 75.02  ?  727  SER A OG  1 
ATOM   4843 N  N   . ARG A 1 717 ? 70.185  -45.940 119.885 1.00 72.21  ?  728  ARG A N   1 
ATOM   4844 C  CA  . ARG A 1 717 ? 69.994  -46.253 121.296 1.00 72.83  ?  728  ARG A CA  1 
ATOM   4845 C  C   . ARG A 1 717 ? 71.249  -46.919 121.854 1.00 75.94  ?  728  ARG A C   1 
ATOM   4846 O  O   . ARG A 1 717 ? 71.693  -47.953 121.340 1.00 75.29  ?  728  ARG A O   1 
ATOM   4847 C  CB  . ARG A 1 717 ? 68.776  -47.156 121.489 1.00 74.22  ?  728  ARG A CB  1 
ATOM   4848 N  N   . HIS A 1 718 ? 71.815  -46.325 122.902 1.00 68.05  ?  729  HIS A N   1 
ATOM   4849 C  CA  . HIS A 1 718 ? 72.943  -46.901 123.623 1.00 66.64  ?  729  HIS A CA  1 
ATOM   4850 C  C   . HIS A 1 718 ? 72.530  -47.142 125.068 1.00 69.69  ?  729  HIS A C   1 
ATOM   4851 O  O   . HIS A 1 718 ? 71.951  -46.259 125.710 1.00 70.70  ?  729  HIS A O   1 
ATOM   4852 C  CB  . HIS A 1 718 ? 74.181  -45.996 123.546 1.00 66.33  ?  729  HIS A CB  1 
ATOM   4853 C  CG  . HIS A 1 718 ? 74.019  -44.673 124.228 1.00 69.87  ?  729  HIS A CG  1 
ATOM   4854 N  ND1 . HIS A 1 718 ? 73.997  -44.540 125.599 1.00 71.66  ?  729  HIS A ND1 1 
ATOM   4855 C  CD2 . HIS A 1 718 ? 73.889  -43.422 123.727 1.00 72.24  ?  729  HIS A CD2 1 
ATOM   4856 C  CE1 . HIS A 1 718 ? 73.851  -43.266 125.915 1.00 71.71  ?  729  HIS A CE1 1 
ATOM   4857 N  NE2 . HIS A 1 718 ? 73.784  -42.566 124.797 1.00 72.36  ?  729  HIS A NE2 1 
ATOM   4858 N  N   . CYS A 1 719 ? 72.819  -48.332 125.572 1.00 63.54  ?  730  CYS A N   1 
ATOM   4859 C  CA  . CYS A 1 719 ? 72.381  -48.773 126.885 1.00 62.76  ?  730  CYS A CA  1 
ATOM   4860 C  C   . CYS A 1 719 ? 73.569  -49.292 127.678 1.00 62.57  ?  730  CYS A C   1 
ATOM   4861 O  O   . CYS A 1 719 ? 74.636  -49.559 127.111 1.00 59.72  ?  730  CYS A O   1 
ATOM   4862 C  CB  . CYS A 1 719 ? 71.319  -49.875 126.757 1.00 63.93  ?  730  CYS A CB  1 
ATOM   4863 S  SG  . CYS A 1 719 ? 71.926  -51.387 125.976 1.00 67.45  ?  730  CYS A SG  1 
ATOM   4864 N  N   . PRO A 1 720 ? 73.426  -49.428 128.998 1.00 49.35  ?  731  PRO A N   1 
ATOM   4865 C  CA  . PRO A 1 720 ? 74.475  -50.089 129.781 1.00 47.15  ?  731  PRO A CA  1 
ATOM   4866 C  C   . PRO A 1 720 ? 74.692  -51.517 129.303 1.00 47.48  ?  731  PRO A C   1 
ATOM   4867 O  O   . PRO A 1 720 ? 73.786  -52.163 128.771 1.00 47.21  ?  731  PRO A O   1 
ATOM   4868 C  CB  . PRO A 1 720 ? 73.927  -50.052 131.211 1.00 49.23  ?  731  PRO A CB  1 
ATOM   4869 C  CG  . PRO A 1 720 ? 73.000  -48.890 131.223 1.00 54.34  ?  731  PRO A CG  1 
ATOM   4870 C  CD  . PRO A 1 720 ? 72.379  -48.849 129.860 1.00 50.66  ?  731  PRO A CD  1 
ATOM   4871 N  N   . SER A 1 721 ? 75.915  -52.008 129.488 1.00 44.31  ?  732  SER A N   1 
ATOM   4872 C  CA  . SER A 1 721 ? 76.245  -53.336 128.992 1.00 41.77  ?  732  SER A CA  1 
ATOM   4873 C  C   . SER A 1 721 ? 77.413  -53.909 129.780 1.00 41.89  ?  732  SER A C   1 
ATOM   4874 O  O   . SER A 1 721 ? 78.279  -53.175 130.261 1.00 37.94  ?  732  SER A O   1 
ATOM   4875 C  CB  . SER A 1 721 ? 76.585  -53.307 127.498 1.00 43.26  ?  732  SER A CB  1 
ATOM   4876 O  OG  . SER A 1 721 ? 77.748  -52.533 127.259 1.00 44.26  ?  732  SER A OG  1 
ATOM   4877 N  N   . LEU A 1 722 ? 77.417  -55.233 129.903 1.00 40.27  ?  733  LEU A N   1 
ATOM   4878 C  CA  . LEU A 1 722 ? 78.528  -55.981 130.468 1.00 39.63  ?  733  LEU A CA  1 
ATOM   4879 C  C   . LEU A 1 722 ? 79.081  -56.916 129.406 1.00 41.99  ?  733  LEU A C   1 
ATOM   4880 O  O   . LEU A 1 722 ? 78.320  -57.588 128.702 1.00 42.17  ?  733  LEU A O   1 
ATOM   4881 C  CB  . LEU A 1 722 ? 78.101  -56.791 131.697 1.00 40.53  ?  733  LEU A CB  1 
ATOM   4882 C  CG  . LEU A 1 722 ? 79.146  -57.781 132.220 1.00 44.07  ?  733  LEU A CG  1 
ATOM   4883 C  CD1 . LEU A 1 722 ? 80.367  -57.049 132.759 1.00 43.22  ?  733  LEU A CD1 1 
ATOM   4884 C  CD2 . LEU A 1 722 ? 78.554  -58.703 133.276 1.00 47.34  ?  733  LEU A CD2 1 
ATOM   4885 N  N   . TRP A 1 723 ? 80.405  -56.953 129.289 1.00 37.97  ?  734  TRP A N   1 
ATOM   4886 C  CA  . TRP A 1 723 ? 81.084  -57.804 128.324 1.00 35.77  ?  734  TRP A CA  1 
ATOM   4887 C  C   . TRP A 1 723 ? 81.946  -58.821 129.056 1.00 37.54  ?  734  TRP A C   1 
ATOM   4888 O  O   . TRP A 1 723 ? 82.621  -58.487 130.035 1.00 36.50  ?  734  TRP A O   1 
ATOM   4889 C  CB  . TRP A 1 723 ? 81.946  -56.978 127.369 1.00 33.32  ?  734  TRP A CB  1 
ATOM   4890 C  CG  . TRP A 1 723 ? 81.149  -56.035 126.529 1.00 34.04  ?  734  TRP A CG  1 
ATOM   4891 C  CD1 . TRP A 1 723 ? 80.621  -54.840 126.918 1.00 37.41  ?  734  TRP A CD1 1 
ATOM   4892 C  CD2 . TRP A 1 723 ? 80.790  -56.205 125.153 1.00 33.57  ?  734  TRP A CD2 1 
ATOM   4893 N  NE1 . TRP A 1 723 ? 79.952  -54.255 125.871 1.00 37.29  ?  734  TRP A NE1 1 
ATOM   4894 C  CE2 . TRP A 1 723 ? 80.042  -55.073 124.775 1.00 38.17  ?  734  TRP A CE2 1 
ATOM   4895 C  CE3 . TRP A 1 723 ? 81.028  -57.204 124.205 1.00 34.08  ?  734  TRP A CE3 1 
ATOM   4896 C  CZ2 . TRP A 1 723 ? 79.531  -54.912 123.489 1.00 37.34  ?  734  TRP A CZ2 1 
ATOM   4897 C  CZ3 . TRP A 1 723 ? 80.519  -57.042 122.929 1.00 35.54  ?  734  TRP A CZ3 1 
ATOM   4898 C  CH2 . TRP A 1 723 ? 79.778  -55.906 122.583 1.00 36.78  ?  734  TRP A CH2 1 
ATOM   4899 N  N   . ALA A 1 724 ? 81.919  -60.061 128.576 1.00 30.48  ?  735  ALA A N   1 
ATOM   4900 C  CA  . ALA A 1 724 ? 82.683  -61.148 129.170 1.00 28.55  ?  735  ALA A CA  1 
ATOM   4901 C  C   . ALA A 1 724 ? 83.433  -61.886 128.074 1.00 32.63  ?  735  ALA A C   1 
ATOM   4902 O  O   . ALA A 1 724 ? 82.836  -62.272 127.064 1.00 33.57  ?  735  ALA A O   1 
ATOM   4903 C  CB  . ALA A 1 724 ? 81.776  -62.112 129.937 1.00 29.31  ?  735  ALA A CB  1 
ATOM   4904 N  N   . GLY A 1 725 ? 84.732  -62.074 128.273 1.00 26.23  ?  736  GLY A N   1 
ATOM   4905 C  CA  . GLY A 1 725 ? 85.565  -62.843 127.361 1.00 23.73  ?  736  GLY A CA  1 
ATOM   4906 C  C   . GLY A 1 725 ? 86.066  -64.097 128.063 1.00 26.47  ?  736  GLY A C   1 
ATOM   4907 O  O   . GLY A 1 725 ? 86.375  -64.065 129.257 1.00 24.00  ?  736  GLY A O   1 
ATOM   4908 N  N   . THR A 1 726 ? 86.146  -65.190 127.313 1.00 36.44  ?  737  THR A N   1 
ATOM   4909 C  CA  . THR A 1 726 ? 86.466  -66.497 127.867 1.00 37.70  ?  737  THR A CA  1 
ATOM   4910 C  C   . THR A 1 726 ? 87.753  -67.035 127.253 1.00 44.20  ?  737  THR A C   1 
ATOM   4911 O  O   . THR A 1 726 ? 88.299  -66.482 126.294 1.00 42.70  ?  737  THR A O   1 
ATOM   4912 C  CB  . THR A 1 726 ? 85.323  -67.492 127.634 1.00 46.69  ?  737  THR A CB  1 
ATOM   4913 O  OG1 . THR A 1 726 ? 85.150  -67.702 126.228 1.00 48.70  ?  737  THR A OG1 1 
ATOM   4914 C  CG2 . THR A 1 726 ? 84.023  -66.965 128.226 1.00 43.45  ?  737  THR A CG2 1 
ATOM   4915 N  N   . ASN A 1 727 ? 88.229  -68.143 127.829 1.00 43.81  ?  738  ASN A N   1 
ATOM   4916 C  CA  . ASN A 1 727 ? 89.449  -68.785 127.353 1.00 42.80  ?  738  ASN A CA  1 
ATOM   4917 C  C   . ASN A 1 727 ? 89.288  -69.395 125.967 1.00 47.20  ?  738  ASN A C   1 
ATOM   4918 O  O   . ASN A 1 727 ? 90.294  -69.620 125.286 1.00 47.34  ?  738  ASN A O   1 
ATOM   4919 C  CB  . ASN A 1 727 ? 89.898  -69.865 128.339 1.00 42.37  ?  738  ASN A CB  1 
ATOM   4920 C  CG  . ASN A 1 727 ? 90.933  -69.364 129.328 1.00 64.82  ?  738  ASN A CG  1 
ATOM   4921 O  OD1 . ASN A 1 727 ? 91.062  -68.162 129.557 1.00 60.44  ?  738  ASN A OD1 1 
ATOM   4922 N  ND2 . ASN A 1 727 ? 91.679  -70.290 129.919 1.00 57.13  ?  738  ASN A ND2 1 
ATOM   4923 N  N   . GLY A 1 728 ? 88.061  -69.672 125.538 1.00 38.02  ?  739  GLY A N   1 
ATOM   4924 C  CA  . GLY A 1 728 ? 87.809  -70.239 124.230 1.00 37.70  ?  739  GLY A CA  1 
ATOM   4925 C  C   . GLY A 1 728 ? 87.598  -69.230 123.125 1.00 41.97  ?  739  GLY A C   1 
ATOM   4926 O  O   . GLY A 1 728 ? 87.248  -69.617 122.005 1.00 42.14  ?  739  GLY A O   1 
ATOM   4927 N  N   . GLY A 1 729 ? 87.802  -67.945 123.401 1.00 36.98  ?  740  GLY A N   1 
ATOM   4928 C  CA  . GLY A 1 729 ? 87.586  -66.920 122.403 1.00 36.52  ?  740  GLY A CA  1 
ATOM   4929 C  C   . GLY A 1 729 ? 86.153  -66.476 122.243 1.00 40.21  ?  740  GLY A C   1 
ATOM   4930 O  O   . GLY A 1 729 ? 85.809  -65.903 121.204 1.00 39.04  ?  740  GLY A O   1 
ATOM   4931 N  N   . THR A 1 730 ? 85.302  -66.723 123.236 1.00 41.97  ?  741  THR A N   1 
ATOM   4932 C  CA  . THR A 1 730 ? 83.903  -66.319 123.189 1.00 41.95  ?  741  THR A CA  1 
ATOM   4933 C  C   . THR A 1 730 ? 83.735  -64.997 123.926 1.00 43.95  ?  741  THR A C   1 
ATOM   4934 O  O   . THR A 1 730 ? 84.281  -64.817 125.020 1.00 43.86  ?  741  THR A O   1 
ATOM   4935 C  CB  . THR A 1 730 ? 82.997  -67.386 123.812 1.00 48.67  ?  741  THR A CB  1 
ATOM   4936 O  OG1 . THR A 1 730 ? 83.370  -68.682 123.331 1.00 48.15  ?  741  THR A OG1 1 
ATOM   4937 C  CG2 . THR A 1 730 ? 81.541  -67.124 123.454 1.00 47.21  ?  741  THR A CG2 1 
ATOM   4938 N  N   . ILE A 1 731 ? 82.992  -64.076 123.322 1.00 35.88  ?  742  ILE A N   1 
ATOM   4939 C  CA  . ILE A 1 731 ? 82.654  -62.799 123.937 1.00 35.66  ?  742  ILE A CA  1 
ATOM   4940 C  C   . ILE A 1 731 ? 81.144  -62.760 124.115 1.00 44.06  ?  742  ILE A C   1 
ATOM   4941 O  O   . ILE A 1 731 ? 80.397  -62.782 123.129 1.00 44.35  ?  742  ILE A O   1 
ATOM   4942 C  CB  . ILE A 1 731 ? 83.133  -61.602 123.099 1.00 37.33  ?  742  ILE A CB  1 
ATOM   4943 C  CG1 . ILE A 1 731 ? 84.647  -61.651 122.885 1.00 36.68  ?  742  ILE A CG1 1 
ATOM   4944 C  CG2 . ILE A 1 731 ? 82.742  -60.296 123.772 1.00 36.51  ?  742  ILE A CG2 1 
ATOM   4945 C  CD1 . ILE A 1 731 ? 85.064  -62.307 121.586 1.00 37.57  ?  742  ILE A CD1 1 
ATOM   4946 N  N   . TYR A 1 732 ? 80.695  -62.717 125.364 1.00 42.39  ?  743  TYR A N   1 
ATOM   4947 C  CA  . TYR A 1 732 ? 79.286  -62.537 125.679 1.00 43.26  ?  743  TYR A CA  1 
ATOM   4948 C  C   . TYR A 1 732 ? 79.032  -61.071 125.998 1.00 47.62  ?  743  TYR A C   1 
ATOM   4949 O  O   . TYR A 1 732 ? 79.783  -60.455 126.762 1.00 46.31  ?  743  TYR A O   1 
ATOM   4950 C  CB  . TYR A 1 732 ? 78.864  -63.413 126.860 1.00 45.42  ?  743  TYR A CB  1 
ATOM   4951 C  CG  . TYR A 1 732 ? 79.173  -64.885 126.696 1.00 48.15  ?  743  TYR A CG  1 
ATOM   4952 C  CD1 . TYR A 1 732 ? 78.364  -65.704 125.918 1.00 50.74  ?  743  TYR A CD1 1 
ATOM   4953 C  CD2 . TYR A 1 732 ? 80.266  -65.458 127.334 1.00 49.50  ?  743  TYR A CD2 1 
ATOM   4954 C  CE1 . TYR A 1 732 ? 78.643  -67.051 125.772 1.00 52.37  ?  743  TYR A CE1 1 
ATOM   4955 C  CE2 . TYR A 1 732 ? 80.552  -66.804 127.195 1.00 51.13  ?  743  TYR A CE2 1 
ATOM   4956 C  CZ  . TYR A 1 732 ? 79.737  -67.595 126.414 1.00 60.10  ?  743  TYR A CZ  1 
ATOM   4957 O  OH  . TYR A 1 732 ? 80.021  -68.934 126.274 1.00 61.32  ?  743  TYR A OH  1 
ATOM   4958 N  N   . ALA A 1 733 ? 77.985  -60.512 125.404 1.00 46.08  ?  744  ALA A N   1 
ATOM   4959 C  CA  . ALA A 1 733 ? 77.557  -59.150 125.682 1.00 46.22  ?  744  ALA A CA  1 
ATOM   4960 C  C   . ALA A 1 733 ? 76.149  -59.182 126.255 1.00 50.98  ?  744  ALA A C   1 
ATOM   4961 O  O   . ALA A 1 733 ? 75.277  -59.894 125.746 1.00 51.13  ?  744  ALA A O   1 
ATOM   4962 C  CB  . ALA A 1 733 ? 77.596  -58.284 124.421 1.00 46.77  ?  744  ALA A CB  1 
ATOM   4963 N  N   . PHE A 1 734 ? 75.934  -58.417 127.321 1.00 43.74  ?  745  PHE A N   1 
ATOM   4964 C  CA  . PHE A 1 734 ? 74.658  -58.392 128.024 1.00 43.63  ?  745  PHE A CA  1 
ATOM   4965 C  C   . PHE A 1 734 ? 74.147  -56.963 128.091 1.00 47.63  ?  745  PHE A C   1 
ATOM   4966 O  O   . PHE A 1 734 ? 74.838  -56.077 128.602 1.00 45.28  ?  745  PHE A O   1 
ATOM   4967 C  CB  . PHE A 1 734 ? 74.796  -58.975 129.432 1.00 44.73  ?  745  PHE A CB  1 
ATOM   4968 C  CG  . PHE A 1 734 ? 74.780  -60.473 129.470 1.00 45.74  ?  745  PHE A CG  1 
ATOM   4969 C  CD1 . PHE A 1 734 ? 75.897  -61.202 129.096 1.00 46.97  ?  745  PHE A CD1 1 
ATOM   4970 C  CD2 . PHE A 1 734 ? 73.646  -61.155 129.884 1.00 47.89  ?  745  PHE A CD2 1 
ATOM   4971 C  CE1 . PHE A 1 734 ? 75.884  -62.584 129.130 1.00 47.46  ?  745  PHE A CE1 1 
ATOM   4972 C  CE2 . PHE A 1 734 ? 73.624  -62.537 129.923 1.00 50.06  ?  745  PHE A CE2 1 
ATOM   4973 C  CZ  . PHE A 1 734 ? 74.744  -63.252 129.544 1.00 47.47  ?  745  PHE A CZ  1 
ATOM   4974 N  N   . SER A 1 735 ? 72.941  -56.742 127.575 1.00 44.65  ?  746  SER A N   1 
ATOM   4975 C  CA  . SER A 1 735 ? 72.286  -55.455 127.747 1.00 45.67  ?  746  SER A CA  1 
ATOM   4976 C  C   . SER A 1 735 ? 71.827  -55.315 129.192 1.00 51.54  ?  746  SER A C   1 
ATOM   4977 O  O   . SER A 1 735 ? 71.357  -56.277 129.806 1.00 50.54  ?  746  SER A O   1 
ATOM   4978 C  CB  . SER A 1 735 ? 71.099  -55.326 126.792 1.00 49.27  ?  746  SER A CB  1 
ATOM   4979 O  OG  . SER A 1 735 ? 70.700  -53.974 126.646 1.00 53.37  ?  746  SER A OG  1 
ATOM   4980 N  N   . LEU A 1 736 ? 71.980  -54.115 129.745 1.00 47.78  ?  747  LEU A N   1 
ATOM   4981 C  CA  . LEU A 1 736 ? 71.688  -53.864 131.151 1.00 49.54  ?  747  LEU A CA  1 
ATOM   4982 C  C   . LEU A 1 736 ? 70.664  -52.747 131.269 1.00 57.59  ?  747  LEU A C   1 
ATOM   4983 O  O   . LEU A 1 736 ? 70.908  -51.624 130.813 1.00 56.72  ?  747  LEU A O   1 
ATOM   4984 C  CB  . LEU A 1 736 ? 72.960  -53.503 131.922 1.00 48.70  ?  747  LEU A CB  1 
ATOM   4985 C  CG  . LEU A 1 736 ? 74.055  -54.570 131.960 1.00 51.58  ?  747  LEU A CG  1 
ATOM   4986 C  CD1 . LEU A 1 736 ? 75.195  -54.138 132.866 1.00 50.70  ?  747  LEU A CD1 1 
ATOM   4987 C  CD2 . LEU A 1 736 ? 73.486  -55.903 132.407 1.00 53.07  ?  747  LEU A CD2 1 
ATOM   4988 N  N   . ARG A 1 737 ? 69.526  -53.055 131.883 1.00 64.68  ?  748  ARG A N   1 
ATOM   4989 C  CA  . ARG A 1 737 ? 68.517  -52.057 132.226 1.00 66.15  ?  748  ARG A CA  1 
ATOM   4990 C  C   . ARG A 1 737 ? 68.683  -51.747 133.709 1.00 69.91  ?  748  ARG A C   1 
ATOM   4991 O  O   . ARG A 1 737 ? 68.246  -52.516 134.570 1.00 69.40  ?  748  ARG A O   1 
ATOM   4992 C  CB  . ARG A 1 737 ? 67.114  -52.561 131.902 1.00 67.42  ?  748  ARG A CB  1 
ATOM   4993 N  N   . VAL A 1 738 ? 69.337  -50.634 134.006 1.00 47.45  ?  749  VAL A N   1 
ATOM   4994 C  CA  . VAL A 1 738 ? 69.592  -50.196 135.376 1.00 48.22  ?  749  VAL A CA  1 
ATOM   4995 C  C   . VAL A 1 738 ? 68.711  -48.986 135.658 1.00 56.95  ?  749  VAL A C   1 
ATOM   4996 O  O   . VAL A 1 738 ? 68.712  -48.034 134.869 1.00 56.32  ?  749  VAL A O   1 
ATOM   4997 C  CB  . VAL A 1 738 ? 71.081  -49.866 135.611 1.00 51.15  ?  749  VAL A CB  1 
ATOM   4998 C  CG1 . VAL A 1 738 ? 71.603  -48.877 134.574 1.00 50.89  ?  749  VAL A CG1 1 
ATOM   4999 C  CG2 . VAL A 1 738 ? 71.301  -49.345 137.026 1.00 50.71  ?  749  VAL A CG2 1 
ATOM   5000 N  N   . PRO A 1 739 ? 67.939  -48.990 136.741 1.00 68.23  ?  750  PRO A N   1 
ATOM   5001 C  CA  . PRO A 1 739 ? 67.018  -47.881 137.007 1.00 69.33  ?  750  PRO A CA  1 
ATOM   5002 C  C   . PRO A 1 739 ? 67.768  -46.640 137.456 1.00 73.59  ?  750  PRO A C   1 
ATOM   5003 O  O   . PRO A 1 739 ? 68.941  -46.718 137.853 1.00 71.53  ?  750  PRO A O   1 
ATOM   5004 C  CB  . PRO A 1 739 ? 66.122  -48.429 138.130 1.00 72.09  ?  750  PRO A CB  1 
ATOM   5005 C  CG  . PRO A 1 739 ? 66.345  -49.918 138.127 1.00 76.09  ?  750  PRO A CG  1 
ATOM   5006 C  CD  . PRO A 1 739 ? 67.759  -50.096 137.692 1.00 70.28  ?  750  PRO A CD  1 
ATOM   5007 N  N   . PRO A 1 740 ? 67.121  -45.466 137.406 1.00 67.33  ?  751  PRO A N   1 
ATOM   5008 C  CA  . PRO A 1 740 ? 67.763  -44.243 137.904 1.00 68.14  ?  751  PRO A CA  1 
ATOM   5009 C  C   . PRO A 1 740 ? 67.867  -44.234 139.420 1.00 76.12  ?  751  PRO A C   1 
ATOM   5010 O  O   . PRO A 1 740 ? 67.522  -45.218 140.081 1.00 75.61  ?  751  PRO A O   1 
ATOM   5011 C  CB  . PRO A 1 740 ? 66.839  -43.123 137.399 1.00 70.46  ?  751  PRO A CB  1 
ATOM   5012 C  CG  . PRO A 1 740 ? 65.953  -43.765 136.370 1.00 74.96  ?  751  PRO A CG  1 
ATOM   5013 C  CD  . PRO A 1 740 ? 65.813  -45.188 136.794 1.00 70.18  ?  751  PRO A CD  1 
ATOM   5014 N  N   . ALA A 1 741 ? 68.323  -43.110 139.980 1.00 93.16  ?  752  ALA A N   1 
ATOM   5015 C  CA  . ALA A 1 741 ? 68.625  -43.054 141.408 1.00 94.22  ?  752  ALA A CA  1 
ATOM   5016 C  C   . ALA A 1 741 ? 67.390  -43.340 142.257 1.00 101.76 ?  752  ALA A C   1 
ATOM   5017 O  O   . ALA A 1 741 ? 67.490  -43.980 143.310 1.00 101.83 ?  752  ALA A O   1 
ATOM   5018 C  CB  . ALA A 1 741 ? 69.222  -41.694 141.764 1.00 94.70  ?  752  ALA A CB  1 
ATOM   5019 N  N   . GLU A 1 742 ? 66.215  -42.890 141.807 1.00 103.07 ?  753  GLU A N   1 
ATOM   5020 C  CA  . GLU A 1 742 ? 65.000  -43.034 142.607 1.00 104.41 ?  753  GLU A CA  1 
ATOM   5021 C  C   . GLU A 1 742 ? 64.543  -44.488 142.676 1.00 106.93 ?  753  GLU A C   1 
ATOM   5022 O  O   . GLU A 1 742 ? 64.303  -45.024 143.764 1.00 106.27 ?  753  GLU A O   1 
ATOM   5023 C  CB  . GLU A 1 742 ? 63.891  -42.150 142.035 1.00 59.61  ?  753  GLU A CB  1 
ATOM   5024 N  N   . ARG A 1 743 ? 64.406  -45.139 141.521 1.00 92.70  ?  754  ARG A N   1 
ATOM   5025 C  CA  . ARG A 1 743 ? 63.968  -46.527 141.446 1.00 92.35  ?  754  ARG A CA  1 
ATOM   5026 C  C   . ARG A 1 743 ? 65.109  -47.522 141.647 1.00 93.50  ?  754  ARG A C   1 
ATOM   5027 O  O   . ARG A 1 743 ? 64.978  -48.684 141.245 1.00 91.77  ?  754  ARG A O   1 
ATOM   5028 C  CB  . ARG A 1 743 ? 63.279  -46.784 140.104 1.00 49.55  ?  754  ARG A CB  1 
ATOM   5029 N  N   . ARG A 1 744 ? 66.209  -47.090 142.271 1.00 84.42  ?  755  ARG A N   1 
ATOM   5030 C  CA  . ARG A 1 744 ? 67.391  -47.938 142.394 1.00 82.74  ?  755  ARG A CA  1 
ATOM   5031 C  C   . ARG A 1 744 ? 67.139  -49.159 143.272 1.00 86.36  ?  755  ARG A C   1 
ATOM   5032 O  O   . ARG A 1 744 ? 67.689  -50.234 143.004 1.00 84.52  ?  755  ARG A O   1 
ATOM   5033 C  CB  . ARG A 1 744 ? 68.560  -47.121 142.945 1.00 80.97  ?  755  ARG A CB  1 
ATOM   5034 C  CG  . ARG A 1 744 ? 69.897  -47.831 142.865 1.00 86.59  ?  755  ARG A CG  1 
ATOM   5035 C  CD  . ARG A 1 744 ? 70.244  -48.179 141.427 1.00 85.02  ?  755  ARG A CD  1 
ATOM   5036 N  NE  . ARG A 1 744 ? 71.416  -49.046 141.347 1.00 76.69  ?  755  ARG A NE  1 
ATOM   5037 C  CZ  . ARG A 1 744 ? 71.363  -50.373 141.379 1.00 79.96  ?  755  ARG A CZ  1 
ATOM   5038 N  NH1 . ARG A 1 744 ? 72.478  -51.086 141.305 1.00 71.57  ?  755  ARG A NH1 1 
ATOM   5039 N  NH2 . ARG A 1 744 ? 70.194  -50.989 141.486 1.00 55.14  ?  755  ARG A NH2 1 
ATOM   5040 N  N   . MET A 1 745 ? 66.325  -49.022 144.320 1.00 80.79  ?  756  MET A N   1 
ATOM   5041 C  CA  . MET A 1 745 ? 66.005  -50.145 145.194 1.00 80.85  ?  756  MET A CA  1 
ATOM   5042 C  C   . MET A 1 745 ? 64.627  -50.736 144.940 1.00 87.50  ?  756  MET A C   1 
ATOM   5043 O  O   . MET A 1 745 ? 64.370  -51.871 145.358 1.00 87.22  ?  756  MET A O   1 
ATOM   5044 C  CB  . MET A 1 745 ? 66.087  -49.719 146.665 1.00 82.97  ?  756  MET A CB  1 
ATOM   5045 C  CG  . MET A 1 745 ? 67.492  -49.479 147.191 1.00 84.93  ?  756  MET A CG  1 
ATOM   5046 S  SD  . MET A 1 745 ? 68.175  -50.928 148.016 1.00 87.56  ?  756  MET A SD  1 
ATOM   5047 C  CE  . MET A 1 745 ? 69.164  -50.153 149.294 1.00 83.89  ?  756  MET A CE  1 
ATOM   5048 N  N   . ASP A 1 746 ? 63.740  -49.995 144.278 1.00 99.16  ?  757  ASP A N   1 
ATOM   5049 C  CA  . ASP A 1 746 ? 62.373  -50.442 144.043 1.00 100.40 ?  757  ASP A CA  1 
ATOM   5050 C  C   . ASP A 1 746 ? 62.333  -51.517 142.965 1.00 103.17 ?  757  ASP A C   1 
ATOM   5051 O  O   . ASP A 1 746 ? 62.105  -52.694 143.260 1.00 102.85 ?  757  ASP A O   1 
ATOM   5052 C  CB  . ASP A 1 746 ? 61.492  -49.255 143.648 1.00 103.43 ?  757  ASP A CB  1 
ATOM   5053 C  CG  . ASP A 1 746 ? 61.750  -48.029 144.503 1.00 119.20 ?  757  ASP A CG  1 
ATOM   5054 O  OD1 . ASP A 1 746 ? 61.956  -48.184 145.726 1.00 120.10 ?  757  ASP A OD1 1 
ATOM   5055 O  OD2 . ASP A 1 746 ? 61.752  -46.908 143.951 1.00 127.21 ?  757  ASP A OD2 1 
ATOM   5056 N  N   . GLU A 1 747 ? 62.550  -51.118 141.713 1.00 85.78  ?  758  GLU A N   1 
ATOM   5057 C  CA  . GLU A 1 747 ? 62.574  -52.088 140.624 1.00 84.64  ?  758  GLU A CA  1 
ATOM   5058 C  C   . GLU A 1 747 ? 63.985  -52.646 140.443 1.00 86.30  ?  758  GLU A C   1 
ATOM   5059 O  O   . GLU A 1 747 ? 64.967  -51.909 140.578 1.00 84.77  ?  758  GLU A O   1 
ATOM   5060 C  CB  . GLU A 1 747 ? 62.101  -51.452 139.318 1.00 86.04  ?  758  GLU A CB  1 
ATOM   5061 C  CG  . GLU A 1 747 ? 62.811  -50.156 138.962 1.00 95.89  ?  758  GLU A CG  1 
ATOM   5062 C  CD  . GLU A 1 747 ? 62.436  -49.637 137.587 1.00 115.53 ?  758  GLU A CD  1 
ATOM   5063 O  OE1 . GLU A 1 747 ? 62.342  -50.454 136.647 1.00 110.12 ?  758  GLU A OE1 1 
ATOM   5064 O  OE2 . GLU A 1 747 ? 62.234  -48.412 137.447 1.00 107.60 ?  758  GLU A OE2 1 
ATOM   5065 N  N   . PRO A 1 748 ? 64.111  -53.935 140.146 1.00 87.53  ?  759  PRO A N   1 
ATOM   5066 C  CA  . PRO A 1 748 ? 65.437  -54.548 140.044 1.00 85.82  ?  759  PRO A CA  1 
ATOM   5067 C  C   . PRO A 1 748 ? 66.089  -54.301 138.690 1.00 87.34  ?  759  PRO A C   1 
ATOM   5068 O  O   . PRO A 1 748 ? 65.434  -53.992 137.693 1.00 87.45  ?  759  PRO A O   1 
ATOM   5069 C  CB  . PRO A 1 748 ? 65.144  -56.037 140.247 1.00 87.90  ?  759  PRO A CB  1 
ATOM   5070 C  CG  . PRO A 1 748 ? 63.772  -56.206 139.684 1.00 93.64  ?  759  PRO A CG  1 
ATOM   5071 C  CD  . PRO A 1 748 ? 63.030  -54.926 139.993 1.00 90.23  ?  759  PRO A CD  1 
ATOM   5072 N  N   . VAL A 1 749 ? 67.415  -54.449 138.677 1.00 81.29  ?  760  VAL A N   1 
ATOM   5073 C  CA  . VAL A 1 749 ? 68.178  -54.346 137.440 1.00 78.88  ?  760  VAL A CA  1 
ATOM   5074 C  C   . VAL A 1 749 ? 67.941  -55.591 136.595 1.00 79.69  ?  760  VAL A C   1 
ATOM   5075 O  O   . VAL A 1 749 ? 67.952  -56.721 137.103 1.00 78.73  ?  760  VAL A O   1 
ATOM   5076 C  CB  . VAL A 1 749 ? 69.673  -54.154 137.748 1.00 81.43  ?  760  VAL A CB  1 
ATOM   5077 C  CG1 . VAL A 1 749 ? 70.482  -54.041 136.461 1.00 80.28  ?  760  VAL A CG1 1 
ATOM   5078 C  CG2 . VAL A 1 749 ? 69.884  -52.930 138.628 1.00 81.22  ?  760  VAL A CG2 1 
ATOM   5079 N  N   . ARG A 1 750 ? 67.719  -55.391 135.296 1.00 65.75  ?  761  ARG A N   1 
ATOM   5080 C  CA  . ARG A 1 750 ? 67.438  -56.482 134.374 1.00 64.86  ?  761  ARG A CA  1 
ATOM   5081 C  C   . ARG A 1 750 ? 68.571  -56.622 133.366 1.00 65.27  ?  761  ARG A C   1 
ATOM   5082 O  O   . ARG A 1 750 ? 69.249  -55.647 133.027 1.00 63.80  ?  761  ARG A O   1 
ATOM   5083 C  CB  . ARG A 1 750 ? 66.109  -56.264 133.638 1.00 65.70  ?  761  ARG A CB  1 
ATOM   5084 N  N   . ALA A 1 751 ? 68.764  -57.847 132.883 1.00 62.35  ?  762  ALA A N   1 
ATOM   5085 C  CA  . ALA A 1 751 ? 69.855  -58.137 131.967 1.00 60.18  ?  762  ALA A CA  1 
ATOM   5086 C  C   . ALA A 1 751 ? 69.431  -59.222 130.991 1.00 61.77  ?  762  ALA A C   1 
ATOM   5087 O  O   . ALA A 1 751 ? 68.799  -60.207 131.383 1.00 62.29  ?  762  ALA A O   1 
ATOM   5088 C  CB  . ALA A 1 751 ? 71.113  -58.575 132.725 1.00 59.96  ?  762  ALA A CB  1 
ATOM   5089 N  N   . GLU A 1 752 ? 69.785  -59.036 129.721 1.00 55.66  ?  763  GLU A N   1 
ATOM   5090 C  CA  . GLU A 1 752 ? 69.539  -60.028 128.685 1.00 54.03  ?  763  GLU A CA  1 
ATOM   5091 C  C   . GLU A 1 752 ? 70.787  -60.179 127.829 1.00 53.50  ?  763  GLU A C   1 
ATOM   5092 O  O   . GLU A 1 752 ? 71.418  -59.185 127.460 1.00 50.74  ?  763  GLU A O   1 
ATOM   5093 C  CB  . GLU A 1 752 ? 68.343  -59.646 127.799 1.00 56.27  ?  763  GLU A CB  1 
ATOM   5094 C  CG  . GLU A 1 752 ? 68.077  -60.637 126.671 1.00 66.46  ?  763  GLU A CG  1 
ATOM   5095 C  CD  . GLU A 1 752 ? 66.782  -60.365 125.930 1.00 90.48  ?  763  GLU A CD  1 
ATOM   5096 O  OE1 . GLU A 1 752 ? 65.932  -59.621 126.462 1.00 81.38  ?  763  GLU A OE1 1 
ATOM   5097 O  OE2 . GLU A 1 752 ? 66.615  -60.900 124.813 1.00 82.44  ?  763  GLU A OE2 1 
ATOM   5098 N  N   . GLN A 1 753 ? 71.140  -61.425 127.518 1.00 54.87  ?  764  GLN A N   1 
ATOM   5099 C  CA  . GLN A 1 753 ? 72.269  -61.713 126.640 1.00 53.59  ?  764  GLN A CA  1 
ATOM   5100 C  C   . GLN A 1 753 ? 71.960  -61.204 125.236 1.00 59.44  ?  764  GLN A C   1 
ATOM   5101 O  O   . GLN A 1 753 ? 71.168  -61.809 124.506 1.00 60.52  ?  764  GLN A O   1 
ATOM   5102 C  CB  . GLN A 1 753 ? 72.561  -63.209 126.635 1.00 54.21  ?  764  GLN A CB  1 
ATOM   5103 C  CG  . GLN A 1 753 ? 73.759  -63.611 125.792 1.00 56.28  ?  764  GLN A CG  1 
ATOM   5104 C  CD  . GLN A 1 753 ? 74.053  -65.093 125.876 1.00 69.67  ?  764  GLN A CD  1 
ATOM   5105 O  OE1 . GLN A 1 753 ? 73.636  -65.766 126.818 1.00 64.28  ?  764  GLN A OE1 1 
ATOM   5106 N  NE2 . GLN A 1 753 ? 74.769  -65.613 124.887 1.00 58.45  ?  764  GLN A NE2 1 
ATOM   5107 N  N   . ALA A 1 754 ? 72.585  -60.087 124.855 1.00 56.16  ?  765  ALA A N   1 
ATOM   5108 C  CA  . ALA A 1 754 ? 72.365  -59.473 123.548 1.00 54.91  ?  765  ALA A CA  1 
ATOM   5109 C  C   . ALA A 1 754 ? 73.243  -60.060 122.452 1.00 57.36  ?  765  ALA A C   1 
ATOM   5110 O  O   . ALA A 1 754 ? 72.818  -60.106 121.292 1.00 58.46  ?  765  ALA A O   1 
ATOM   5111 C  CB  . ALA A 1 754 ? 72.603  -57.964 123.625 1.00 55.09  ?  765  ALA A CB  1 
ATOM   5112 N  N   . LYS A 1 755 ? 74.457  -60.504 122.780 1.00 51.24  ?  766  LYS A N   1 
ATOM   5113 C  CA  . LYS A 1 755 ? 75.395  -60.974 121.770 1.00 49.62  ?  766  LYS A CA  1 
ATOM   5114 C  C   . LYS A 1 755 ? 76.208  -62.149 122.290 1.00 51.40  ?  766  LYS A C   1 
ATOM   5115 O  O   . LYS A 1 755 ? 76.445  -62.287 123.494 1.00 49.77  ?  766  LYS A O   1 
ATOM   5116 C  CB  . LYS A 1 755 ? 76.351  -59.862 121.323 1.00 50.73  ?  766  LYS A CB  1 
ATOM   5117 C  CG  . LYS A 1 755 ? 75.802  -58.996 120.212 1.00 59.46  ?  766  LYS A CG  1 
ATOM   5118 C  CD  . LYS A 1 755 ? 76.212  -57.550 120.387 1.00 66.23  ?  766  LYS A CD  1 
ATOM   5119 C  CE  . LYS A 1 755 ? 75.636  -56.702 119.273 1.00 80.52  ?  766  LYS A CE  1 
ATOM   5120 N  NZ  . LYS A 1 755 ? 75.924  -55.253 119.461 1.00 91.81  ?  766  LYS A NZ  1 
ATOM   5121 N  N   . GLU A 1 756 ? 76.628  -62.995 121.353 1.00 51.88  ?  767  GLU A N   1 
ATOM   5122 C  CA  . GLU A 1 756 ? 77.599  -64.055 121.601 1.00 51.34  ?  767  GLU A CA  1 
ATOM   5123 C  C   . GLU A 1 756 ? 78.521  -64.090 120.392 1.00 54.96  ?  767  GLU A C   1 
ATOM   5124 O  O   . GLU A 1 756 ? 78.124  -64.554 119.319 1.00 55.89  ?  767  GLU A O   1 
ATOM   5125 C  CB  . GLU A 1 756 ? 76.923  -65.407 121.823 1.00 53.32  ?  767  GLU A CB  1 
ATOM   5126 C  CG  . GLU A 1 756 ? 77.890  -66.513 122.217 1.00 67.00  ?  767  GLU A CG  1 
ATOM   5127 C  CD  . GLU A 1 756 ? 77.186  -67.787 122.644 1.00 93.99  ?  767  GLU A CD  1 
ATOM   5128 O  OE1 . GLU A 1 756 ? 76.041  -67.703 123.135 1.00 85.05  ?  767  GLU A OE1 1 
ATOM   5129 O  OE2 . GLU A 1 756 ? 77.781  -68.874 122.486 1.00 87.61  ?  767  GLU A OE2 1 
ATOM   5130 N  N   . ILE A 1 757 ? 79.736  -63.578 120.559 1.00 41.66  ?  768  ILE A N   1 
ATOM   5131 C  CA  . ILE A 1 757 ? 80.702  -63.447 119.476 1.00 39.33  ?  768  ILE A CA  1 
ATOM   5132 C  C   . ILE A 1 757 ? 81.759  -64.524 119.652 1.00 41.65  ?  768  ILE A C   1 
ATOM   5133 O  O   . ILE A 1 757 ? 82.337  -64.663 120.736 1.00 41.44  ?  768  ILE A O   1 
ATOM   5134 C  CB  . ILE A 1 757 ? 81.336  -62.046 119.462 1.00 41.44  ?  768  ILE A CB  1 
ATOM   5135 C  CG1 . ILE A 1 757 ? 80.261  -60.983 119.233 1.00 42.51  ?  768  ILE A CG1 1 
ATOM   5136 C  CG2 . ILE A 1 757 ? 82.424  -61.958 118.401 1.00 40.17  ?  768  ILE A CG2 1 
ATOM   5137 C  CD1 . ILE A 1 757 ? 80.386  -59.785 120.145 1.00 45.37  ?  768  ILE A CD1 1 
ATOM   5138 N  N   . GLN A 1 758 ? 82.005  -65.287 118.594 1.00 40.44  ?  769  GLN A N   1 
ATOM   5139 C  CA  . GLN A 1 758 ? 83.033  -66.315 118.595 1.00 40.02  ?  769  GLN A CA  1 
ATOM   5140 C  C   . GLN A 1 758 ? 84.197  -65.868 117.723 1.00 44.11  ?  769  GLN A C   1 
ATOM   5141 O  O   . GLN A 1 758 ? 83.996  -65.443 116.580 1.00 43.40  ?  769  GLN A O   1 
ATOM   5142 C  CB  . GLN A 1 758 ? 82.480  -67.650 118.092 1.00 41.68  ?  769  GLN A CB  1 
ATOM   5143 C  CG  . GLN A 1 758 ? 83.524  -68.751 118.026 1.00 49.32  ?  769  GLN A CG  1 
ATOM   5144 C  CD  . GLN A 1 758 ? 84.148  -69.039 119.377 1.00 63.93  ?  769  GLN A CD  1 
ATOM   5145 O  OE1 . GLN A 1 758 ? 83.455  -69.392 120.330 1.00 62.25  ?  769  GLN A OE1 1 
ATOM   5146 N  NE2 . GLN A 1 758 ? 85.465  -68.884 119.467 1.00 50.25  ?  769  GLN A NE2 1 
ATOM   5147 N  N   . LEU A 1 759 ? 85.408  -65.952 118.268 1.00 42.99  ?  770  LEU A N   1 
ATOM   5148 C  CA  . LEU A 1 759 ? 86.624  -65.723 117.501 1.00 42.29  ?  770  LEU A CA  1 
ATOM   5149 C  C   . LEU A 1 759 ? 87.063  -67.037 116.867 1.00 46.98  ?  770  LEU A C   1 
ATOM   5150 O  O   . LEU A 1 759 ? 87.223  -68.044 117.564 1.00 46.13  ?  770  LEU A O   1 
ATOM   5151 C  CB  . LEU A 1 759 ? 87.732  -65.165 118.395 1.00 41.49  ?  770  LEU A CB  1 
ATOM   5152 C  CG  . LEU A 1 759 ? 87.410  -63.878 119.159 1.00 45.56  ?  770  LEU A CG  1 
ATOM   5153 C  CD1 . LEU A 1 759 ? 88.498  -63.570 120.175 1.00 45.52  ?  770  LEU A CD1 1 
ATOM   5154 C  CD2 . LEU A 1 759 ? 87.223  -62.711 118.203 1.00 45.77  ?  770  LEU A CD2 1 
ATOM   5155 N  N   . MET A 1 760 ? 87.262  -67.022 115.547 1.00 57.05  ?  771  MET A N   1 
ATOM   5156 C  CA  . MET A 1 760 ? 87.559  -68.263 114.838 1.00 58.36  ?  771  MET A CA  1 
ATOM   5157 C  C   . MET A 1 760 ? 88.920  -68.837 115.226 1.00 61.39  ?  771  MET A C   1 
ATOM   5158 O  O   . MET A 1 760 ? 89.076  -70.062 115.274 1.00 61.45  ?  771  MET A O   1 
ATOM   5159 C  CB  . MET A 1 760 ? 87.479  -68.037 113.327 1.00 61.74  ?  771  MET A CB  1 
ATOM   5160 C  CG  . MET A 1 760 ? 86.602  -69.051 112.599 1.00 67.17  ?  771  MET A CG  1 
ATOM   5161 S  SD  . MET A 1 760 ? 84.989  -69.275 113.383 1.00 73.67  ?  771  MET A SD  1 
ATOM   5162 C  CE  . MET A 1 760 ? 84.295  -67.626 113.251 1.00 70.72  ?  771  MET A CE  1 
ATOM   5163 N  N   . HIS A 1 761 ? 89.908  -67.985 115.518 1.00 49.02  ?  772  HIS A N   1 
ATOM   5164 C  CA  . HIS A 1 761 ? 91.217  -68.499 115.916 1.00 47.56  ?  772  HIS A CA  1 
ATOM   5165 C  C   . HIS A 1 761 ? 91.213  -69.063 117.335 1.00 50.13  ?  772  HIS A C   1 
ATOM   5166 O  O   . HIS A 1 761 ? 92.144  -69.791 117.699 1.00 49.10  ?  772  HIS A O   1 
ATOM   5167 C  CB  . HIS A 1 761 ? 92.291  -67.413 115.774 1.00 47.63  ?  772  HIS A CB  1 
ATOM   5168 C  CG  . HIS A 1 761 ? 92.119  -66.252 116.704 1.00 50.91  ?  772  HIS A CG  1 
ATOM   5169 N  ND1 . HIS A 1 761 ? 91.400  -65.125 116.365 1.00 52.78  ?  772  HIS A ND1 1 
ATOM   5170 C  CD2 . HIS A 1 761 ? 92.593  -66.033 117.953 1.00 51.59  ?  772  HIS A CD2 1 
ATOM   5171 C  CE1 . HIS A 1 761 ? 91.427  -64.269 117.371 1.00 51.81  ?  772  HIS A CE1 1 
ATOM   5172 N  NE2 . HIS A 1 761 ? 92.145  -64.796 118.347 1.00 51.54  ?  772  HIS A NE2 1 
ATOM   5173 N  N   . ARG A 1 762 ? 90.195  -68.732 118.138 1.00 47.02  ?  773  ARG A N   1 
ATOM   5174 C  CA  . ARG A 1 762 ? 89.929  -69.371 119.435 1.00 47.04  ?  773  ARG A CA  1 
ATOM   5175 C  C   . ARG A 1 762 ? 91.099  -69.239 120.411 1.00 48.99  ?  773  ARG A C   1 
ATOM   5176 O  O   . ARG A 1 762 ? 91.528  -70.210 121.039 1.00 47.93  ?  773  ARG A O   1 
ATOM   5177 C  CB  . ARG A 1 762 ? 89.538  -70.839 119.252 1.00 48.16  ?  773  ARG A CB  1 
ATOM   5178 C  CG  . ARG A 1 762 ? 88.107  -71.021 118.782 1.00 57.23  ?  773  ARG A CG  1 
ATOM   5179 C  CD  . ARG A 1 762 ? 87.850  -72.426 118.279 1.00 66.97  ?  773  ARG A CD  1 
ATOM   5180 N  NE  . ARG A 1 762 ? 86.815  -72.423 117.251 1.00 73.79  ?  773  ARG A NE  1 
ATOM   5181 C  CZ  . ARG A 1 762 ? 85.518  -72.568 117.494 1.00 79.33  ?  773  ARG A CZ  1 
ATOM   5182 N  NH1 . ARG A 1 762 ? 85.087  -72.740 118.736 1.00 55.36  ?  773  ARG A NH1 1 
ATOM   5183 N  NH2 . ARG A 1 762 ? 84.651  -72.544 116.490 1.00 65.37  ?  773  ARG A NH2 1 
ATOM   5184 N  N   . ALA A 1 763 ? 91.600  -68.024 120.552 1.00 51.09  ?  774  ALA A N   1 
ATOM   5185 C  CA  . ALA A 1 763 ? 92.558  -67.767 121.613 1.00 48.91  ?  774  ALA A CA  1 
ATOM   5186 C  C   . ALA A 1 763 ? 91.855  -67.137 122.811 1.00 48.67  ?  774  ALA A C   1 
ATOM   5187 O  O   . ALA A 1 763 ? 90.812  -66.496 122.654 1.00 49.27  ?  774  ALA A O   1 
ATOM   5188 C  CB  . ALA A 1 763 ? 93.675  -66.839 121.125 1.00 48.96  ?  774  ALA A CB  1 
ATOM   5189 N  N   . PRO A 1 764 ? 92.380  -67.318 124.024 1.00 32.43  ?  775  PRO A N   1 
ATOM   5190 C  CA  . PRO A 1 764 ? 91.729  -66.727 125.200 1.00 31.62  ?  775  PRO A CA  1 
ATOM   5191 C  C   . PRO A 1 764 ? 91.632  -65.213 125.091 1.00 36.15  ?  775  PRO A C   1 
ATOM   5192 O  O   . PRO A 1 764 ? 92.587  -64.534 124.709 1.00 36.01  ?  775  PRO A O   1 
ATOM   5193 C  CB  . PRO A 1 764 ? 92.640  -67.148 126.357 1.00 31.91  ?  775  PRO A CB  1 
ATOM   5194 C  CG  . PRO A 1 764 ? 93.317  -68.382 125.870 1.00 35.12  ?  775  PRO A CG  1 
ATOM   5195 C  CD  . PRO A 1 764 ? 93.516  -68.178 124.397 1.00 31.71  ?  775  PRO A CD  1 
ATOM   5196 N  N   . VAL A 1 765 ? 90.457  -64.686 125.425 1.00 30.54  ?  776  VAL A N   1 
ATOM   5197 C  CA  . VAL A 1 765 ? 90.229  -63.245 125.411 1.00 29.23  ?  776  VAL A CA  1 
ATOM   5198 C  C   . VAL A 1 765 ? 90.880  -62.654 126.656 1.00 32.17  ?  776  VAL A C   1 
ATOM   5199 O  O   . VAL A 1 765 ? 90.453  -62.930 127.780 1.00 33.72  ?  776  VAL A O   1 
ATOM   5200 C  CB  . VAL A 1 765 ? 88.736  -62.909 125.353 1.00 32.77  ?  776  VAL A CB  1 
ATOM   5201 C  CG1 . VAL A 1 765 ? 88.533  -61.405 125.402 1.00 32.45  ?  776  VAL A CG1 1 
ATOM   5202 C  CG2 . VAL A 1 765 ? 88.110  -63.490 124.095 1.00 32.67  ?  776  VAL A CG2 1 
ATOM   5203 N  N   . VAL A 1 766 ? 91.926  -61.847 126.457 1.00 33.50  ?  777  VAL A N   1 
ATOM   5204 C  CA  . VAL A 1 766 ? 92.626  -61.206 127.565 1.00 32.47  ?  777  VAL A CA  1 
ATOM   5205 C  C   . VAL A 1 766 ? 92.257  -59.736 127.728 1.00 34.56  ?  777  VAL A C   1 
ATOM   5206 O  O   . VAL A 1 766 ? 92.598  -59.138 128.761 1.00 36.40  ?  777  VAL A O   1 
ATOM   5207 C  CB  . VAL A 1 766 ? 94.158  -61.333 127.411 1.00 34.69  ?  777  VAL A CB  1 
ATOM   5208 C  CG1 . VAL A 1 766 ? 94.555  -62.790 127.235 1.00 34.03  ?  777  VAL A CG1 1 
ATOM   5209 C  CG2 . VAL A 1 766 ? 94.649  -60.493 126.241 1.00 34.03  ?  777  VAL A CG2 1 
ATOM   5210 N  N   . GLY A 1 767 ? 91.584  -59.133 126.750 1.00 26.76  ?  778  GLY A N   1 
ATOM   5211 C  CA  . GLY A 1 767 ? 91.230  -57.732 126.838 1.00 25.29  ?  778  GLY A CA  1 
ATOM   5212 C  C   . GLY A 1 767 ? 90.024  -57.346 126.006 1.00 28.84  ?  778  GLY A C   1 
ATOM   5213 O  O   . GLY A 1 767 ? 89.913  -57.736 124.838 1.00 26.40  ?  778  GLY A O   1 
ATOM   5214 N  N   . ILE A 1 768 ? 89.109  -56.583 126.605 1.00 22.64  ?  779  ILE A N   1 
ATOM   5215 C  CA  . ILE A 1 768 ? 87.934  -56.054 125.920 1.00 24.23  ?  779  ILE A CA  1 
ATOM   5216 C  C   . ILE A 1 768 ? 87.810  -54.579 126.271 1.00 28.10  ?  779  ILE A C   1 
ATOM   5217 O  O   . ILE A 1 768 ? 87.957  -54.204 127.440 1.00 26.08  ?  779  ILE A O   1 
ATOM   5218 C  CB  . ILE A 1 768 ? 86.643  -56.801 126.311 1.00 28.02  ?  779  ILE A CB  1 
ATOM   5219 C  CG1 . ILE A 1 768 ? 86.777  -58.304 126.057 1.00 27.46  ?  779  ILE A CG1 1 
ATOM   5220 C  CG2 . ILE A 1 768 ? 85.452  -56.240 125.547 1.00 30.06  ?  779  ILE A CG2 1 
ATOM   5221 C  CD1 . ILE A 1 768 ? 85.566  -59.099 126.498 1.00 32.13  ?  779  ILE A CD1 1 
ATOM   5222 N  N   . LEU A 1 769 ? 87.544  -53.746 125.267 1.00 29.10  ?  780  LEU A N   1 
ATOM   5223 C  CA  . LEU A 1 769 ? 87.260  -52.339 125.516 1.00 30.56  ?  780  LEU A CA  1 
ATOM   5224 C  C   . LEU A 1 769 ? 86.507  -51.775 124.321 1.00 35.17  ?  780  LEU A C   1 
ATOM   5225 O  O   . LEU A 1 769 ? 86.445  -52.388 123.251 1.00 33.97  ?  780  LEU A O   1 
ATOM   5226 C  CB  . LEU A 1 769 ? 88.537  -51.543 125.806 1.00 30.06  ?  780  LEU A CB  1 
ATOM   5227 C  CG  . LEU A 1 769 ? 89.527  -51.266 124.681 1.00 35.94  ?  780  LEU A CG  1 
ATOM   5228 C  CD1 . LEU A 1 769 ? 89.231  -49.933 124.013 1.00 37.84  ?  780  LEU A CD1 1 
ATOM   5229 C  CD2 . LEU A 1 769 ? 90.943  -51.285 125.217 1.00 38.66  ?  780  LEU A CD2 1 
ATOM   5230 N  N   . VAL A 1 770 ? 85.936  -50.587 124.520 1.00 28.72  ?  781  VAL A N   1 
ATOM   5231 C  CA  . VAL A 1 770 ? 85.120  -49.914 123.517 1.00 28.58  ?  781  VAL A CA  1 
ATOM   5232 C  C   . VAL A 1 770 ? 85.674  -48.512 123.297 1.00 35.98  ?  781  VAL A C   1 
ATOM   5233 O  O   . VAL A 1 770 ? 86.044  -47.824 124.254 1.00 36.72  ?  781  VAL A O   1 
ATOM   5234 C  CB  . VAL A 1 770 ? 83.635  -49.864 123.940 1.00 30.63  ?  781  VAL A CB  1 
ATOM   5235 C  CG1 . VAL A 1 770 ? 82.801  -49.147 122.894 1.00 30.43  ?  781  VAL A CG1 1 
ATOM   5236 C  CG2 . VAL A 1 770 ? 83.100  -51.272 124.171 1.00 29.80  ?  781  VAL A CG2 1 
ATOM   5237 N  N   . LEU A 1 771 ? 85.746  -48.100 122.032 1.00 38.83  ?  782  LEU A N   1 
ATOM   5238 C  CA  . LEU A 1 771 ? 86.202  -46.773 121.643 1.00 39.08  ?  782  LEU A CA  1 
ATOM   5239 C  C   . LEU A 1 771 ? 85.015  -45.922 121.199 1.00 46.45  ?  782  LEU A C   1 
ATOM   5240 O  O   . LEU A 1 771 ? 84.000  -46.444 120.727 1.00 45.68  ?  782  LEU A O   1 
ATOM   5241 C  CB  . LEU A 1 771 ? 87.235  -46.855 120.514 1.00 37.79  ?  782  LEU A CB  1 
ATOM   5242 C  CG  . LEU A 1 771 ? 88.462  -47.746 120.728 1.00 40.22  ?  782  LEU A CG  1 
ATOM   5243 C  CD1 . LEU A 1 771 ? 89.169  -47.984 119.405 1.00 39.26  ?  782  LEU A CD1 1 
ATOM   5244 C  CD2 . LEU A 1 771 ? 89.417  -47.126 121.730 1.00 39.90  ?  782  LEU A CD2 1 
ATOM   5245 N  N   . ASP A 1 772 ? 85.152  -44.604 121.347 1.00 45.69  ?  783  ASP A N   1 
ATOM   5246 C  CA  . ASP A 1 772 ? 84.062  -43.685 121.054 1.00 47.12  ?  783  ASP A CA  1 
ATOM   5247 C  C   . ASP A 1 772 ? 84.140  -43.231 119.592 1.00 55.79  ?  783  ASP A C   1 
ATOM   5248 O  O   . ASP A 1 772 ? 84.952  -43.728 118.806 1.00 55.81  ?  783  ASP A O   1 
ATOM   5249 C  CB  . ASP A 1 772 ? 84.069  -42.521 122.055 1.00 46.96  ?  783  ASP A CB  1 
ATOM   5250 C  CG  . ASP A 1 772 ? 85.222  -41.538 121.845 1.00 45.91  ?  783  ASP A CG  1 
ATOM   5251 O  OD1 . ASP A 1 772 ? 86.073  -41.753 120.958 1.00 43.94  ?  783  ASP A OD1 1 
ATOM   5252 O  OD2 . ASP A 1 772 ? 85.273  -40.530 122.584 1.00 50.93  ?  783  ASP A OD2 1 
ATOM   5253 N  N   . GLY A 1 773 ? 83.289  -42.275 119.213 1.00 52.59  ?  784  GLY A N   1 
ATOM   5254 C  CA  . GLY A 1 773 ? 83.252  -41.764 117.848 1.00 52.83  ?  784  GLY A CA  1 
ATOM   5255 C  C   . GLY A 1 773 ? 84.530  -41.091 117.388 1.00 57.60  ?  784  GLY A C   1 
ATOM   5256 O  O   . GLY A 1 773 ? 84.668  -40.819 116.189 1.00 56.91  ?  784  GLY A O   1 
ATOM   5257 N  N   . HIS A 1 774 ? 85.455  -40.798 118.302 1.00 61.71  ?  785  HIS A N   1 
ATOM   5258 C  CA  . HIS A 1 774 ? 86.785  -40.321 117.945 1.00 61.82  ?  785  HIS A CA  1 
ATOM   5259 C  C   . HIS A 1 774 ? 87.851  -41.388 118.154 1.00 61.39  ?  785  HIS A C   1 
ATOM   5260 O  O   . HIS A 1 774 ? 89.044  -41.066 118.161 1.00 59.21  ?  785  HIS A O   1 
ATOM   5261 C  CB  . HIS A 1 774 ? 87.139  -39.064 118.744 1.00 63.97  ?  785  HIS A CB  1 
ATOM   5262 C  CG  . HIS A 1 774 ? 86.507  -37.814 118.216 1.00 69.40  ?  785  HIS A CG  1 
ATOM   5263 N  ND1 . HIS A 1 774 ? 85.230  -37.422 118.559 1.00 72.80  ?  785  HIS A ND1 1 
ATOM   5264 C  CD2 . HIS A 1 774 ? 86.973  -36.872 117.363 1.00 71.91  ?  785  HIS A CD2 1 
ATOM   5265 C  CE1 . HIS A 1 774 ? 84.939  -36.291 117.943 1.00 72.93  ?  785  HIS A CE1 1 
ATOM   5266 N  NE2 . HIS A 1 774 ? 85.979  -35.936 117.211 1.00 72.72  ?  785  HIS A NE2 1 
ATOM   5267 N  N   . SER A 1 775 ? 87.442  -42.648 118.329 1.00 51.63  ?  786  SER A N   1 
ATOM   5268 C  CA  . SER A 1 775 ? 88.354  -43.767 118.574 1.00 49.29  ?  786  SER A CA  1 
ATOM   5269 C  C   . SER A 1 775 ? 89.172  -43.561 119.850 1.00 49.78  ?  786  SER A C   1 
ATOM   5270 O  O   . SER A 1 775 ? 90.365  -43.867 119.906 1.00 49.40  ?  786  SER A O   1 
ATOM   5271 C  CB  . SER A 1 775 ? 89.268  -44.011 117.369 1.00 51.21  ?  786  SER A CB  1 
ATOM   5272 O  OG  . SER A 1 775 ? 88.508  -44.352 116.223 1.00 52.46  ?  786  SER A OG  1 
ATOM   5273 N  N   . VAL A 1 776 ? 88.520  -43.046 120.888 1.00 45.32  ?  787  VAL A N   1 
ATOM   5274 C  CA  . VAL A 1 776 ? 89.119  -42.889 122.211 1.00 42.60  ?  787  VAL A CA  1 
ATOM   5275 C  C   . VAL A 1 776 ? 88.423  -43.870 123.147 1.00 46.06  ?  787  VAL A C   1 
ATOM   5276 O  O   . VAL A 1 776 ? 87.191  -43.996 123.091 1.00 46.87  ?  787  VAL A O   1 
ATOM   5277 C  CB  . VAL A 1 776 ? 88.991  -41.441 122.713 1.00 44.94  ?  787  VAL A CB  1 
ATOM   5278 C  CG1 . VAL A 1 776 ? 89.489  -41.317 124.144 1.00 43.96  ?  787  VAL A CG1 1 
ATOM   5279 C  CG2 . VAL A 1 776 ? 89.748  -40.494 121.794 1.00 43.99  ?  787  VAL A CG2 1 
ATOM   5280 N  N   . PRO A 1 777 ? 89.152  -44.593 124.000 1.00 31.73  ?  788  PRO A N   1 
ATOM   5281 C  CA  . PRO A 1 777 ? 88.498  -45.571 124.879 1.00 31.32  ?  788  PRO A CA  1 
ATOM   5282 C  C   . PRO A 1 777 ? 87.450  -44.919 125.767 1.00 36.89  ?  788  PRO A C   1 
ATOM   5283 O  O   . PRO A 1 777 ? 87.574  -43.758 126.163 1.00 36.14  ?  788  PRO A O   1 
ATOM   5284 C  CB  . PRO A 1 777 ? 89.656  -46.136 125.707 1.00 32.06  ?  788  PRO A CB  1 
ATOM   5285 C  CG  . PRO A 1 777 ? 90.861  -45.921 124.863 1.00 35.52  ?  788  PRO A CG  1 
ATOM   5286 C  CD  . PRO A 1 777 ? 90.620  -44.642 124.115 1.00 31.48  ?  788  PRO A CD  1 
ATOM   5287 N  N   . LEU A 1 778 ? 86.401  -45.682 126.066 1.00 34.18  ?  789  LEU A N   1 
ATOM   5288 C  CA  . LEU A 1 778 ? 85.366  -45.188 126.958 1.00 35.52  ?  789  LEU A CA  1 
ATOM   5289 C  C   . LEU A 1 778 ? 85.958  -44.922 128.342 1.00 42.95  ?  789  LEU A C   1 
ATOM   5290 O  O   . LEU A 1 778 ? 86.876  -45.622 128.782 1.00 41.58  ?  789  LEU A O   1 
ATOM   5291 C  CB  . LEU A 1 778 ? 84.211  -46.186 127.059 1.00 35.43  ?  789  LEU A CB  1 
ATOM   5292 C  CG  . LEU A 1 778 ? 83.432  -46.495 125.778 1.00 39.33  ?  789  LEU A CG  1 
ATOM   5293 C  CD1 . LEU A 1 778 ? 82.155  -47.258 126.106 1.00 39.48  ?  789  LEU A CD1 1 
ATOM   5294 C  CD2 . LEU A 1 778 ? 83.122  -45.226 124.992 1.00 40.07  ?  789  LEU A CD2 1 
ATOM   5295 N  N   . PRO A 1 779 ? 85.463  -43.906 129.040 1.00 55.22  ?  790  PRO A N   1 
ATOM   5296 C  CA  . PRO A 1 779 ? 86.037  -43.542 130.337 1.00 54.47  ?  790  PRO A CA  1 
ATOM   5297 C  C   . PRO A 1 779 ? 85.577  -44.474 131.449 1.00 57.57  ?  790  PRO A C   1 
ATOM   5298 O  O   . PRO A 1 779 ? 84.592  -45.205 131.328 1.00 58.31  ?  790  PRO A O   1 
ATOM   5299 C  CB  . PRO A 1 779 ? 85.516  -42.116 130.570 1.00 56.90  ?  790  PRO A CB  1 
ATOM   5300 C  CG  . PRO A 1 779 ? 84.897  -41.689 129.258 1.00 62.34  ?  790  PRO A CG  1 
ATOM   5301 C  CD  . PRO A 1 779 ? 84.446  -42.942 128.600 1.00 58.19  ?  790  PRO A CD  1 
ATOM   5302 N  N   . GLU A 1 780 ? 86.320  -44.423 132.557 1.00 40.89  ?  791  GLU A N   1 
ATOM   5303 C  CA  . GLU A 1 780 ? 86.013  -45.233 133.723 1.00 41.07  ?  791  GLU A CA  1 
ATOM   5304 C  C   . GLU A 1 780 ? 84.667  -44.827 134.323 1.00 45.89  ?  791  GLU A C   1 
ATOM   5305 O  O   . GLU A 1 780 ? 84.170  -43.728 134.069 1.00 45.13  ?  791  GLU A O   1 
ATOM   5306 C  CB  . GLU A 1 780 ? 87.122  -45.086 134.765 1.00 41.81  ?  791  GLU A CB  1 
ATOM   5307 C  CG  . GLU A 1 780 ? 88.389  -45.837 134.412 1.00 52.17  ?  791  GLU A CG  1 
ATOM   5308 C  CD  . GLU A 1 780 ? 89.602  -45.318 135.154 1.00 76.74  ?  791  GLU A CD  1 
ATOM   5309 O  OE1 . GLU A 1 780 ? 90.733  -45.589 134.698 1.00 69.40  ?  791  GLU A OE1 1 
ATOM   5310 O  OE2 . GLU A 1 780 ? 89.426  -44.635 136.186 1.00 70.53  ?  791  GLU A OE2 1 
ATOM   5311 N  N   . PRO A 1 781 ? 84.048  -45.710 135.110 1.00 38.60  ?  792  PRO A N   1 
ATOM   5312 C  CA  . PRO A 1 781 ? 82.806  -45.331 135.792 1.00 39.16  ?  792  PRO A CA  1 
ATOM   5313 C  C   . PRO A 1 781 ? 83.028  -44.140 136.711 1.00 45.64  ?  792  PRO A C   1 
ATOM   5314 O  O   . PRO A 1 781 ? 84.064  -44.025 137.370 1.00 45.00  ?  792  PRO A O   1 
ATOM   5315 C  CB  . PRO A 1 781 ? 82.433  -46.591 136.579 1.00 40.75  ?  792  PRO A CB  1 
ATOM   5316 C  CG  . PRO A 1 781 ? 83.085  -47.703 135.833 1.00 44.24  ?  792  PRO A CG  1 
ATOM   5317 C  CD  . PRO A 1 781 ? 84.370  -47.134 135.308 1.00 39.15  ?  792  PRO A CD  1 
ATOM   5318 N  N   . LEU A 1 782 ? 82.044  -43.241 136.733 1.00 53.61  ?  793  LEU A N   1 
ATOM   5319 C  CA  . LEU A 1 782 ? 82.058  -41.999 137.501 1.00 54.92  ?  793  LEU A CA  1 
ATOM   5320 C  C   . LEU A 1 782 ? 83.161  -41.040 137.065 1.00 58.64  ?  793  LEU A C   1 
ATOM   5321 O  O   . LEU A 1 782 ? 83.360  -40.001 137.707 1.00 58.27  ?  793  LEU A O   1 
ATOM   5322 C  CB  . LEU A 1 782 ? 82.165  -42.265 139.010 1.00 55.30  ?  793  LEU A CB  1 
ATOM   5323 C  CG  . LEU A 1 782 ? 80.920  -42.857 139.672 1.00 61.54  ?  793  LEU A CG  1 
ATOM   5324 C  CD1 . LEU A 1 782 ? 81.123  -42.998 141.171 1.00 61.47  ?  793  LEU A CD1 1 
ATOM   5325 C  CD2 . LEU A 1 782 ? 79.702  -41.999 139.374 1.00 65.00  ?  793  LEU A CD2 1 
ATOM   5326 N  N   . GLU A 1 783 ? 83.883  -41.353 135.985 1.00 46.46  ?  794  GLU A N   1 
ATOM   5327 C  CA  . GLU A 1 783 ? 84.872  -40.414 135.466 1.00 46.93  ?  794  GLU A CA  1 
ATOM   5328 C  C   . GLU A 1 783 ? 84.196  -39.241 134.769 1.00 55.59  ?  794  GLU A C   1 
ATOM   5329 O  O   . GLU A 1 783 ? 84.630  -38.093 134.912 1.00 53.34  ?  794  GLU A O   1 
ATOM   5330 C  CB  . GLU A 1 783 ? 85.829  -41.130 134.513 1.00 47.08  ?  794  GLU A CB  1 
ATOM   5331 C  CG  . GLU A 1 783 ? 86.935  -40.249 133.957 1.00 56.49  ?  794  GLU A CG  1 
ATOM   5332 C  CD  . GLU A 1 783 ? 87.844  -40.992 132.995 1.00 75.09  ?  794  GLU A CD  1 
ATOM   5333 O  OE1 . GLU A 1 783 ? 87.744  -42.235 132.917 1.00 68.16  ?  794  GLU A OE1 1 
ATOM   5334 O  OE2 . GLU A 1 783 ? 88.656  -40.331 132.315 1.00 63.90  ?  794  GLU A OE2 1 
ATOM   5335 N  N   . VAL A 1 784 ? 83.129  -39.513 134.011 1.00 77.00  ?  795  VAL A N   1 
ATOM   5336 C  CA  . VAL A 1 784 ? 82.371  -38.440 133.376 1.00 79.42  ?  795  VAL A CA  1 
ATOM   5337 C  C   . VAL A 1 784 ? 81.624  -37.622 134.424 1.00 87.10  ?  795  VAL A C   1 
ATOM   5338 O  O   . VAL A 1 784 ? 81.552  -36.391 134.334 1.00 87.60  ?  795  VAL A O   1 
ATOM   5339 C  CB  . VAL A 1 784 ? 81.416  -39.018 132.314 1.00 84.35  ?  795  VAL A CB  1 
ATOM   5340 C  CG1 . VAL A 1 784 ? 80.508  -37.932 131.755 1.00 84.62  ?  795  VAL A CG1 1 
ATOM   5341 C  CG2 . VAL A 1 784 ? 82.207  -39.683 131.195 1.00 83.75  ?  795  VAL A CG2 1 
ATOM   5342 N  N   . ALA A 1 785 ? 81.067  -38.289 135.441 1.00 77.23  ?  796  ALA A N   1 
ATOM   5343 C  CA  . ALA A 1 785 ? 80.378  -37.580 136.514 1.00 78.82  ?  796  ALA A CA  1 
ATOM   5344 C  C   . ALA A 1 785 ? 81.312  -36.676 137.309 1.00 84.72  ?  796  ALA A C   1 
ATOM   5345 O  O   . ALA A 1 785 ? 80.843  -35.725 137.943 1.00 85.15  ?  796  ALA A O   1 
ATOM   5346 C  CB  . ALA A 1 785 ? 79.696  -38.578 137.451 1.00 79.92  ?  796  ALA A CB  1 
ATOM   5347 N  N   . HIS A 1 786 ? 82.615  -36.951 137.293 1.00 87.49  ?  797  HIS A N   1 
ATOM   5348 C  CA  . HIS A 1 786 ? 83.610  -36.102 137.933 1.00 87.72  ?  797  HIS A CA  1 
ATOM   5349 C  C   . HIS A 1 786 ? 84.389  -35.256 136.935 1.00 91.08  ?  797  HIS A C   1 
ATOM   5350 O  O   . HIS A 1 786 ? 85.300  -34.526 137.342 1.00 90.03  ?  797  HIS A O   1 
ATOM   5351 C  CB  . HIS A 1 786 ? 84.582  -36.952 138.761 1.00 88.31  ?  797  HIS A CB  1 
ATOM   5352 C  CG  . HIS A 1 786 ? 84.017  -37.413 140.068 1.00 92.61  ?  797  HIS A CG  1 
ATOM   5353 N  ND1 . HIS A 1 786 ? 83.105  -38.443 140.164 1.00 94.98  ?  797  HIS A ND1 1 
ATOM   5354 C  CD2 . HIS A 1 786 ? 84.230  -36.980 141.333 1.00 94.80  ?  797  HIS A CD2 1 
ATOM   5355 C  CE1 . HIS A 1 786 ? 82.783  -38.626 141.433 1.00 94.96  ?  797  HIS A CE1 1 
ATOM   5356 N  NE2 . HIS A 1 786 ? 83.452  -37.752 142.163 1.00 95.16  ?  797  HIS A NE2 1 
ATOM   5357 N  N   . ASP A 1 787 ? 84.049  -35.338 135.646 1.00 77.71  ?  798  ASP A N   1 
ATOM   5358 C  CA  . ASP A 1 787 ? 84.716  -34.569 134.601 1.00 77.47  ?  798  ASP A CA  1 
ATOM   5359 C  C   . ASP A 1 787 ? 83.963  -34.706 133.283 1.00 82.09  ?  798  ASP A C   1 
ATOM   5360 O  O   . ASP A 1 787 ? 84.141  -35.693 132.561 1.00 81.23  ?  798  ASP A O   1 
ATOM   5361 C  CB  . ASP A 1 787 ? 86.167  -35.029 134.432 1.00 78.34  ?  798  ASP A CB  1 
ATOM   5362 C  CG  . ASP A 1 787 ? 87.057  -33.950 133.851 1.00 86.25  ?  798  ASP A CG  1 
ATOM   5363 O  OD1 . ASP A 1 787 ? 86.576  -33.169 133.003 1.00 85.94  ?  798  ASP A OD1 1 
ATOM   5364 O  OD2 . ASP A 1 787 ? 88.239  -33.881 134.247 1.00 92.28  ?  798  ASP A OD2 1 
ATOM   5365 N  N   . LEU A 1 788 ? 83.118  -33.721 132.960 1.00 105.28 ?  799  LEU A N   1 
ATOM   5366 C  CA  . LEU A 1 788 ? 82.334  -33.782 131.731 1.00 105.71 ?  799  LEU A CA  1 
ATOM   5367 C  C   . LEU A 1 788 ? 83.186  -33.601 130.481 1.00 108.91 ?  799  LEU A C   1 
ATOM   5368 O  O   . LEU A 1 788 ? 82.749  -33.988 129.392 1.00 109.03 ?  799  LEU A O   1 
ATOM   5369 C  CB  . LEU A 1 788 ? 81.224  -32.729 131.759 1.00 106.64 ?  799  LEU A CB  1 
ATOM   5370 C  CG  . LEU A 1 788 ? 80.008  -33.037 132.635 1.00 112.04 ?  799  LEU A CG  1 
ATOM   5371 C  CD1 . LEU A 1 788 ? 79.356  -31.753 133.122 1.00 112.56 ?  799  LEU A CD1 1 
ATOM   5372 C  CD2 . LEU A 1 788 ? 79.003  -33.889 131.874 1.00 114.83 ?  799  LEU A CD2 1 
ATOM   5373 N  N   . SER A 1 789 ? 84.387  -33.028 130.610 1.00 71.76  ?  800  SER A N   1 
ATOM   5374 C  CA  . SER A 1 789 ? 85.269  -32.878 129.457 1.00 70.10  ?  800  SER A CA  1 
ATOM   5375 C  C   . SER A 1 789 ? 85.680  -34.222 128.873 1.00 71.11  ?  800  SER A C   1 
ATOM   5376 O  O   . SER A 1 789 ? 86.123  -34.278 127.721 1.00 69.55  ?  800  SER A O   1 
ATOM   5377 C  CB  . SER A 1 789 ? 86.515  -32.076 129.842 1.00 72.86  ?  800  SER A CB  1 
ATOM   5378 O  OG  . SER A 1 789 ? 87.300  -32.776 130.791 1.00 80.00  ?  800  SER A OG  1 
ATOM   5379 N  N   . LYS A 1 790 ? 85.543  -35.300 129.641 1.00 84.55  ?  801  LYS A N   1 
ATOM   5380 C  CA  . LYS A 1 790 ? 85.825  -36.655 129.175 1.00 83.27  ?  801  LYS A CA  1 
ATOM   5381 C  C   . LYS A 1 790 ? 84.550  -37.404 128.809 1.00 87.55  ?  801  LYS A C   1 
ATOM   5382 O  O   . LYS A 1 790 ? 84.439  -38.610 129.038 1.00 87.70  ?  801  LYS A O   1 
ATOM   5383 C  CB  . LYS A 1 790 ? 86.622  -37.417 130.230 1.00 84.33  ?  801  LYS A CB  1 
ATOM   5384 C  CG  . LYS A 1 790 ? 88.132  -37.320 130.051 1.00 89.16  ?  801  LYS A CG  1 
ATOM   5385 C  CD  . LYS A 1 790 ? 88.854  -37.062 131.367 1.00 94.45  ?  801  LYS A CD  1 
ATOM   5386 C  CE  . LYS A 1 790 ? 89.174  -35.584 131.536 1.00 105.82 ?  801  LYS A CE  1 
ATOM   5387 N  NZ  . LYS A 1 790 ? 89.999  -35.315 132.748 1.00 120.05 ?  801  LYS A NZ  1 
ATOM   5388 N  N   . SER A 1 791 ? 83.569  -36.712 128.243 1.00 68.23  ?  802  SER A N   1 
ATOM   5389 C  CA  . SER A 1 791 ? 82.364  -37.387 127.772 1.00 67.25  ?  802  SER A CA  1 
ATOM   5390 C  C   . SER A 1 791 ? 82.652  -38.080 126.445 1.00 66.30  ?  802  SER A C   1 
ATOM   5391 O  O   . SER A 1 791 ? 83.225  -37.462 125.543 1.00 64.55  ?  802  SER A O   1 
ATOM   5392 C  CB  . SER A 1 791 ? 81.214  -36.397 127.611 1.00 72.37  ?  802  SER A CB  1 
ATOM   5393 O  OG  . SER A 1 791 ? 80.560  -36.166 128.847 1.00 82.05  ?  802  SER A OG  1 
ATOM   5394 N  N   . PRO A 1 792 ? 82.277  -39.348 126.290 1.00 62.97  ?  803  PRO A N   1 
ATOM   5395 C  CA  . PRO A 1 792 ? 82.605  -40.060 125.049 1.00 62.67  ?  803  PRO A CA  1 
ATOM   5396 C  C   . PRO A 1 792 ? 81.765  -39.571 123.878 1.00 67.95  ?  803  PRO A C   1 
ATOM   5397 O  O   . PRO A 1 792 ? 80.588  -39.234 124.031 1.00 68.16  ?  803  PRO A O   1 
ATOM   5398 C  CB  . PRO A 1 792 ? 82.291  -41.521 125.392 1.00 63.82  ?  803  PRO A CB  1 
ATOM   5399 C  CG  . PRO A 1 792 ? 81.215  -41.428 126.425 1.00 68.14  ?  803  PRO A CG  1 
ATOM   5400 C  CD  . PRO A 1 792 ? 81.524  -40.193 127.234 1.00 64.01  ?  803  PRO A CD  1 
ATOM   5401 N  N   . ASP A 1 793 ? 82.388  -39.535 122.699 1.00 58.09  ?  804  ASP A N   1 
ATOM   5402 C  CA  . ASP A 1 793 ? 81.695  -39.135 121.478 1.00 57.86  ?  804  ASP A CA  1 
ATOM   5403 C  C   . ASP A 1 793 ? 80.658  -40.184 121.096 1.00 59.09  ?  804  ASP A C   1 
ATOM   5404 O  O   . ASP A 1 793 ? 81.002  -41.333 120.796 1.00 56.13  ?  804  ASP A O   1 
ATOM   5405 C  CB  . ASP A 1 793 ? 82.693  -38.936 120.336 1.00 60.23  ?  804  ASP A CB  1 
ATOM   5406 C  CG  . ASP A 1 793 ? 82.031  -38.447 119.050 1.00 77.25  ?  804  ASP A CG  1 
ATOM   5407 O  OD1 . ASP A 1 793 ? 80.884  -37.956 119.116 1.00 79.58  ?  804  ASP A OD1 1 
ATOM   5408 O  OD2 . ASP A 1 793 ? 82.655  -38.555 117.973 1.00 85.00  ?  804  ASP A OD2 1 
ATOM   5409 N  N   . MET A 1 794 ? 79.388  -39.785 121.104 1.00 65.88  ?  805  MET A N   1 
ATOM   5410 C  CA  . MET A 1 794 ? 78.295  -40.653 120.692 1.00 65.63  ?  805  MET A CA  1 
ATOM   5411 C  C   . MET A 1 794 ? 77.834  -40.386 119.264 1.00 71.11  ?  805  MET A C   1 
ATOM   5412 O  O   . MET A 1 794 ? 77.083  -41.198 118.709 1.00 70.69  ?  805  MET A O   1 
ATOM   5413 C  CB  . MET A 1 794 ? 77.108  -40.494 121.652 1.00 67.90  ?  805  MET A CB  1 
ATOM   5414 C  CG  . MET A 1 794 ? 77.506  -40.381 123.116 1.00 70.32  ?  805  MET A CG  1 
ATOM   5415 S  SD  . MET A 1 794 ? 78.547  -41.739 123.683 1.00 72.42  ?  805  MET A SD  1 
ATOM   5416 C  CE  . MET A 1 794 ? 77.388  -43.103 123.647 1.00 68.50  ?  805  MET A CE  1 
ATOM   5417 N  N   . GLN A 1 795 ? 78.270  -39.278 118.658 1.00 85.82  ?  806  GLN A N   1 
ATOM   5418 C  CA  . GLN A 1 795 ? 77.862  -38.954 117.294 1.00 85.74  ?  806  GLN A CA  1 
ATOM   5419 C  C   . GLN A 1 795 ? 78.474  -39.922 116.289 1.00 86.56  ?  806  GLN A C   1 
ATOM   5420 O  O   . GLN A 1 795 ? 77.778  -40.443 115.410 1.00 86.66  ?  806  GLN A O   1 
ATOM   5421 C  CB  . GLN A 1 795 ? 78.248  -37.510 116.966 1.00 88.21  ?  806  GLN A CB  1 
ATOM   5422 C  CG  . GLN A 1 795 ? 77.360  -36.471 117.633 1.00 111.30 ?  806  GLN A CG  1 
ATOM   5423 C  CD  . GLN A 1 795 ? 75.964  -36.437 117.040 1.00 130.73 ?  806  GLN A CD  1 
ATOM   5424 O  OE1 . GLN A 1 795 ? 75.708  -35.725 116.069 1.00 130.17 ?  806  GLN A OE1 1 
ATOM   5425 N  NE2 . GLN A 1 795 ? 75.053  -37.210 117.620 1.00 114.50 ?  806  GLN A NE2 1 
ATOM   5426 N  N   . GLY A 1 796 ? 79.779  -40.169 116.397 1.00 64.40  ?  807  GLY A N   1 
ATOM   5427 C  CA  . GLY A 1 796 ? 80.412  -41.166 115.564 1.00 62.34  ?  807  GLY A CA  1 
ATOM   5428 C  C   . GLY A 1 796 ? 80.059  -42.576 115.996 1.00 62.31  ?  807  GLY A C   1 
ATOM   5429 O  O   . GLY A 1 796 ? 79.450  -42.806 117.040 1.00 61.08  ?  807  GLY A O   1 
ATOM   5430 N  N   . SER A 1 797 ? 80.451  -43.539 115.168 1.00 59.42  ?  808  SER A N   1 
ATOM   5431 C  CA  . SER A 1 797 ? 80.193  -44.937 115.476 1.00 58.11  ?  808  SER A CA  1 
ATOM   5432 C  C   . SER A 1 797 ? 81.163  -45.440 116.542 1.00 57.81  ?  808  SER A C   1 
ATOM   5433 O  O   . SER A 1 797 ? 82.325  -45.027 116.603 1.00 56.46  ?  808  SER A O   1 
ATOM   5434 C  CB  . SER A 1 797 ? 80.306  -45.793 114.211 1.00 62.68  ?  808  SER A CB  1 
ATOM   5435 O  OG  . SER A 1 797 ? 79.538  -46.979 114.319 1.00 72.90  ?  808  SER A OG  1 
ATOM   5436 N  N   . HIS A 1 798 ? 80.668  -46.331 117.396 1.00 46.63  ?  809  HIS A N   1 
ATOM   5437 C  CA  . HIS A 1 798 ? 81.492  -46.957 118.419 1.00 43.80  ?  809  HIS A CA  1 
ATOM   5438 C  C   . HIS A 1 798 ? 82.132  -48.228 117.877 1.00 43.55  ?  809  HIS A C   1 
ATOM   5439 O  O   . HIS A 1 798 ? 81.556  -48.929 117.040 1.00 41.84  ?  809  HIS A O   1 
ATOM   5440 C  CB  . HIS A 1 798 ? 80.666  -47.283 119.664 1.00 43.41  ?  809  HIS A CB  1 
ATOM   5441 C  CG  . HIS A 1 798 ? 80.516  -46.132 120.607 1.00 46.31  ?  809  HIS A CG  1 
ATOM   5442 N  ND1 . HIS A 1 798 ? 80.108  -46.290 121.913 1.00 47.32  ?  809  HIS A ND1 1 
ATOM   5443 C  CD2 . HIS A 1 798 ? 80.724  -44.806 120.434 1.00 48.50  ?  809  HIS A CD2 1 
ATOM   5444 C  CE1 . HIS A 1 798 ? 80.068  -45.110 122.505 1.00 47.41  ?  809  HIS A CE1 1 
ATOM   5445 N  NE2 . HIS A 1 798 ? 80.438  -44.192 121.630 1.00 48.48  ?  809  HIS A NE2 1 
ATOM   5446 N  N   . GLN A 1 799 ? 83.335  -48.521 118.364 1.00 34.62  ?  810  GLN A N   1 
ATOM   5447 C  CA  . GLN A 1 799 ? 84.077  -49.704 117.952 1.00 31.79  ?  810  GLN A CA  1 
ATOM   5448 C  C   . GLN A 1 799 ? 84.398  -50.560 119.167 1.00 30.09  ?  810  GLN A C   1 
ATOM   5449 O  O   . GLN A 1 799 ? 84.699  -50.039 120.244 1.00 28.79  ?  810  GLN A O   1 
ATOM   5450 C  CB  . GLN A 1 799 ? 85.371  -49.329 117.223 1.00 32.80  ?  810  GLN A CB  1 
ATOM   5451 C  CG  . GLN A 1 799 ? 85.165  -48.491 115.974 1.00 45.84  ?  810  GLN A CG  1 
ATOM   5452 C  CD  . GLN A 1 799 ? 86.043  -47.257 115.962 1.00 59.79  ?  810  GLN A CD  1 
ATOM   5453 O  OE1 . GLN A 1 799 ? 87.211  -47.315 115.578 1.00 53.89  ?  810  GLN A OE1 1 
ATOM   5454 N  NE2 . GLN A 1 799 ? 85.485  -46.130 116.394 1.00 45.56  ?  810  GLN A NE2 1 
ATOM   5455 N  N   . LEU A 1 800 ? 84.330  -51.874 118.984 1.00 28.53  ?  811  LEU A N   1 
ATOM   5456 C  CA  . LEU A 1 800 ? 84.648  -52.838 120.028 1.00 26.94  ?  811  LEU A CA  1 
ATOM   5457 C  C   . LEU A 1 800 ? 86.026  -53.424 119.757 1.00 30.07  ?  811  LEU A C   1 
ATOM   5458 O  O   . LEU A 1 800 ? 86.266  -53.984 118.683 1.00 28.38  ?  811  LEU A O   1 
ATOM   5459 C  CB  . LEU A 1 800 ? 83.600  -53.948 120.082 1.00 26.40  ?  811  LEU A CB  1 
ATOM   5460 C  CG  . LEU A 1 800 ? 83.952  -55.154 120.958 1.00 29.64  ?  811  LEU A CG  1 
ATOM   5461 C  CD1 . LEU A 1 800 ? 83.720  -54.848 122.432 1.00 29.16  ?  811  LEU A CD1 1 
ATOM   5462 C  CD2 . LEU A 1 800 ? 83.175  -56.388 120.523 1.00 29.18  ?  811  LEU A CD2 1 
ATOM   5463 N  N   . LEU A 1 801 ? 86.925  -53.297 120.727 1.00 31.30  ?  812  LEU A N   1 
ATOM   5464 C  CA  . LEU A 1 801 ? 88.263  -53.862 120.636 1.00 29.38  ?  812  LEU A CA  1 
ATOM   5465 C  C   . LEU A 1 801 ? 88.321  -55.140 121.461 1.00 29.63  ?  812  LEU A C   1 
ATOM   5466 O  O   . LEU A 1 801 ? 87.991  -55.131 122.651 1.00 27.89  ?  812  LEU A O   1 
ATOM   5467 C  CB  . LEU A 1 801 ? 89.313  -52.861 121.122 1.00 29.48  ?  812  LEU A CB  1 
ATOM   5468 C  CG  . LEU A 1 801 ? 90.754  -53.362 121.263 1.00 32.76  ?  812  LEU A CG  1 
ATOM   5469 C  CD1 . LEU A 1 801 ? 91.257  -53.956 119.958 1.00 31.87  ?  812  LEU A CD1 1 
ATOM   5470 C  CD2 . LEU A 1 801 ? 91.665  -52.237 121.721 1.00 35.12  ?  812  LEU A CD2 1 
ATOM   5471 N  N   . VAL A 1 802 ? 88.725  -56.234 120.826 1.00 27.32  ?  813  VAL A N   1 
ATOM   5472 C  CA  . VAL A 1 802 ? 88.857  -57.530 121.481 1.00 26.41  ?  813  VAL A CA  1 
ATOM   5473 C  C   . VAL A 1 802 ? 90.294  -57.993 121.294 1.00 31.12  ?  813  VAL A C   1 
ATOM   5474 O  O   . VAL A 1 802 ? 90.731  -58.241 120.163 1.00 30.73  ?  813  VAL A O   1 
ATOM   5475 C  CB  . VAL A 1 802 ? 87.865  -58.561 120.924 1.00 30.05  ?  813  VAL A CB  1 
ATOM   5476 C  CG1 . VAL A 1 802 ? 88.235  -59.962 121.388 1.00 28.99  ?  813  VAL A CG1 1 
ATOM   5477 C  CG2 . VAL A 1 802 ? 86.448  -58.216 121.352 1.00 30.13  ?  813  VAL A CG2 1 
ATOM   5478 N  N   . VAL A 1 803 ? 91.030  -58.098 122.394 1.00 24.42  ?  814  VAL A N   1 
ATOM   5479 C  CA  . VAL A 1 803 ? 92.406  -58.577 122.385 1.00 22.94  ?  814  VAL A CA  1 
ATOM   5480 C  C   . VAL A 1 803 ? 92.411  -60.003 122.917 1.00 25.76  ?  814  VAL A C   1 
ATOM   5481 O  O   . VAL A 1 803 ? 91.968  -60.255 124.044 1.00 24.75  ?  814  VAL A O   1 
ATOM   5482 C  CB  . VAL A 1 803 ? 93.325  -57.673 123.224 1.00 26.25  ?  814  VAL A CB  1 
ATOM   5483 C  CG1 . VAL A 1 803 ? 94.755  -58.195 123.198 1.00 25.82  ?  814  VAL A CG1 1 
ATOM   5484 C  CG2 . VAL A 1 803 ? 93.268  -56.242 122.721 1.00 26.55  ?  814  VAL A CG2 1 
ATOM   5485 N  N   . SER A 1 804 ? 92.894  -60.937 122.108 1.00 28.68  ?  815  SER A N   1 
ATOM   5486 C  CA  . SER A 1 804 ? 93.117  -62.308 122.535 1.00 28.14  ?  815  SER A CA  1 
ATOM   5487 C  C   . SER A 1 804 ? 94.614  -62.539 122.684 1.00 33.23  ?  815  SER A C   1 
ATOM   5488 O  O   . SER A 1 804 ? 95.432  -61.657 122.403 1.00 33.57  ?  815  SER A O   1 
ATOM   5489 C  CB  . SER A 1 804 ? 92.507  -63.302 121.544 1.00 29.79  ?  815  SER A CB  1 
ATOM   5490 O  OG  . SER A 1 804 ? 93.381  -63.528 120.452 1.00 30.51  ?  815  SER A OG  1 
ATOM   5491 N  N   . GLU A 1 805 ? 94.974  -63.747 123.122 1.00 25.06  ?  816  GLU A N   1 
ATOM   5492 C  CA  . GLU A 1 805 ? 96.386  -64.081 123.265 1.00 23.26  ?  816  GLU A CA  1 
ATOM   5493 C  C   . GLU A 1 805 ? 97.126  -64.051 121.934 1.00 27.38  ?  816  GLU A C   1 
ATOM   5494 O  O   . GLU A 1 805 ? 98.352  -63.904 121.927 1.00 27.35  ?  816  GLU A O   1 
ATOM   5495 C  CB  . GLU A 1 805 ? 96.546  -65.457 123.910 1.00 23.83  ?  816  GLU A CB  1 
ATOM   5496 C  CG  . GLU A 1 805 ? 96.205  -65.506 125.389 1.00 33.64  ?  816  GLU A CG  1 
ATOM   5497 C  CD  . GLU A 1 805 ? 96.507  -66.858 126.008 1.00 49.19  ?  816  GLU A CD  1 
ATOM   5498 O  OE1 . GLU A 1 805 ? 96.594  -67.855 125.261 1.00 41.64  ?  816  GLU A OE1 1 
ATOM   5499 O  OE2 . GLU A 1 805 ? 96.666  -66.925 127.244 1.00 41.13  ?  816  GLU A OE2 1 
ATOM   5500 N  N   . GLU A 1 806 ? 96.418  -64.172 120.811 1.00 30.33  ?  817  GLU A N   1 
ATOM   5501 C  CA  . GLU A 1 806 ? 97.055  -64.242 119.502 1.00 28.15  ?  817  GLU A CA  1 
ATOM   5502 C  C   . GLU A 1 806 ? 96.799  -63.038 118.610 1.00 29.45  ?  817  GLU A C   1 
ATOM   5503 O  O   . GLU A 1 806 ? 97.639  -62.734 117.761 1.00 28.81  ?  817  GLU A O   1 
ATOM   5504 C  CB  . GLU A 1 806 ? 96.601  -65.502 118.754 1.00 29.54  ?  817  GLU A CB  1 
ATOM   5505 C  CG  . GLU A 1 806 ? 97.220  -66.789 119.271 1.00 42.64  ?  817  GLU A CG  1 
ATOM   5506 C  CD  . GLU A 1 806 ? 96.726  -68.013 118.522 1.00 63.92  ?  817  GLU A CD  1 
ATOM   5507 O  OE1 . GLU A 1 806 ? 96.046  -67.846 117.488 1.00 75.16  ?  817  GLU A OE1 1 
ATOM   5508 O  OE2 . GLU A 1 806 ? 97.014  -69.143 118.970 1.00 37.00  ?  817  GLU A OE2 1 
ATOM   5509 N  N   . GLN A 1 807 ? 95.670  -62.347 118.765 1.00 20.09  ?  818  GLN A N   1 
ATOM   5510 C  CA  . GLN A 1 807 ? 95.287  -61.300 117.825 1.00 20.84  ?  818  GLN A CA  1 
ATOM   5511 C  C   . GLN A 1 807 ? 94.627  -60.129 118.542 1.00 28.61  ?  818  GLN A C   1 
ATOM   5512 O  O   . GLN A 1 807 ? 94.066  -60.266 119.633 1.00 28.60  ?  818  GLN A O   1 
ATOM   5513 C  CB  . GLN A 1 807 ? 94.315  -61.821 116.754 1.00 21.47  ?  818  GLN A CB  1 
ATOM   5514 C  CG  . GLN A 1 807 ? 94.861  -62.928 115.875 1.00 35.19  ?  818  GLN A CG  1 
ATOM   5515 C  CD  . GLN A 1 807 ? 93.841  -63.436 114.869 1.00 48.50  ?  818  GLN A CD  1 
ATOM   5516 O  OE1 . GLN A 1 807 ? 92.845  -62.770 114.578 1.00 33.29  ?  818  GLN A OE1 1 
ATOM   5517 N  NE2 . GLN A 1 807 ? 94.087  -64.625 114.334 1.00 47.80  ?  818  GLN A NE2 1 
ATOM   5518 N  N   . PHE A 1 808 ? 94.694  -58.972 117.887 1.00 23.47  ?  819  PHE A N   1 
ATOM   5519 C  CA  . PHE A 1 808 ? 93.928  -57.779 118.231 1.00 24.20  ?  819  PHE A CA  1 
ATOM   5520 C  C   . PHE A 1 808 ? 92.874  -57.594 117.146 1.00 29.04  ?  819  PHE A C   1 
ATOM   5521 O  O   . PHE A 1 808 ? 93.221  -57.488 115.966 1.00 28.60  ?  819  PHE A O   1 
ATOM   5522 C  CB  . PHE A 1 808 ? 94.825  -56.538 118.305 1.00 26.59  ?  819  PHE A CB  1 
ATOM   5523 C  CG  . PHE A 1 808 ? 95.939  -56.624 119.321 1.00 28.17  ?  819  PHE A CG  1 
ATOM   5524 C  CD1 . PHE A 1 808 ? 96.974  -57.534 119.171 1.00 30.81  ?  819  PHE A CD1 1 
ATOM   5525 C  CD2 . PHE A 1 808 ? 95.969  -55.757 120.402 1.00 30.72  ?  819  PHE A CD2 1 
ATOM   5526 C  CE1 . PHE A 1 808 ? 97.998  -57.603 120.096 1.00 31.09  ?  819  PHE A CE1 1 
ATOM   5527 C  CE2 . PHE A 1 808 ? 96.993  -55.818 121.331 1.00 33.77  ?  819  PHE A CE2 1 
ATOM   5528 C  CZ  . PHE A 1 808 ? 98.009  -56.742 121.177 1.00 31.05  ?  819  PHE A CZ  1 
ATOM   5529 N  N   . LYS A 1 809 ? 91.599  -57.565 117.529 1.00 29.20  ?  820  LYS A N   1 
ATOM   5530 C  CA  . LYS A 1 809 ? 90.513  -57.393 116.570 1.00 29.31  ?  820  LYS A CA  1 
ATOM   5531 C  C   . LYS A 1 809 ? 89.673  -56.178 116.933 1.00 33.57  ?  820  LYS A C   1 
ATOM   5532 O  O   . LYS A 1 809 ? 89.380  -55.941 118.109 1.00 33.83  ?  820  LYS A O   1 
ATOM   5533 C  CB  . LYS A 1 809 ? 89.613  -58.636 116.495 1.00 31.19  ?  820  LYS A CB  1 
ATOM   5534 C  CG  . LYS A 1 809 ? 90.148  -59.759 115.612 1.00 44.37  ?  820  LYS A CG  1 
ATOM   5535 C  CD  . LYS A 1 809 ? 89.048  -60.766 115.286 1.00 55.22  ?  820  LYS A CD  1 
ATOM   5536 C  CE  . LYS A 1 809 ? 89.611  -62.079 114.758 1.00 57.63  ?  820  LYS A CE  1 
ATOM   5537 N  NZ  . LYS A 1 809 ? 88.533  -63.036 114.368 1.00 45.63  ?  820  LYS A NZ  1 
ATOM   5538 N  N   . VAL A 1 810 ? 89.288  -55.412 115.914 1.00 28.69  ?  821  VAL A N   1 
ATOM   5539 C  CA  . VAL A 1 810 ? 88.395  -54.269 116.066 1.00 29.48  ?  821  VAL A CA  1 
ATOM   5540 C  C   . VAL A 1 810 ? 87.133  -54.537 115.259 1.00 34.89  ?  821  VAL A C   1 
ATOM   5541 O  O   . VAL A 1 810 ? 87.207  -54.842 114.064 1.00 35.84  ?  821  VAL A O   1 
ATOM   5542 C  CB  . VAL A 1 810 ? 89.063  -52.955 115.618 1.00 33.07  ?  821  VAL A CB  1 
ATOM   5543 C  CG1 . VAL A 1 810 ? 88.027  -51.850 115.485 1.00 33.67  ?  821  VAL A CG1 1 
ATOM   5544 C  CG2 . VAL A 1 810 ? 90.138  -52.551 116.608 1.00 31.87  ?  821  VAL A CG2 1 
ATOM   5545 N  N   . PHE A 1 811 ? 85.982  -54.439 115.919 1.00 31.44  ?  822  PHE A N   1 
ATOM   5546 C  CA  . PHE A 1 811 ? 84.679  -54.558 115.285 1.00 31.07  ?  822  PHE A CA  1 
ATOM   5547 C  C   . PHE A 1 811 ? 83.940  -53.235 115.431 1.00 37.47  ?  822  PHE A C   1 
ATOM   5548 O  O   . PHE A 1 811 ? 84.198  -52.463 116.358 1.00 35.96  ?  822  PHE A O   1 
ATOM   5549 C  CB  . PHE A 1 811 ? 83.828  -55.678 115.916 1.00 32.14  ?  822  PHE A CB  1 
ATOM   5550 C  CG  . PHE A 1 811 ? 84.540  -56.996 116.055 1.00 32.90  ?  822  PHE A CG  1 
ATOM   5551 C  CD1 . PHE A 1 811 ? 85.446  -57.205 117.081 1.00 35.40  ?  822  PHE A CD1 1 
ATOM   5552 C  CD2 . PHE A 1 811 ? 84.277  -58.038 115.179 1.00 34.16  ?  822  PHE A CD2 1 
ATOM   5553 C  CE1 . PHE A 1 811 ? 86.096  -58.417 117.217 1.00 35.51  ?  822  PHE A CE1 1 
ATOM   5554 C  CE2 . PHE A 1 811 ? 84.923  -59.256 115.312 1.00 36.30  ?  822  PHE A CE2 1 
ATOM   5555 C  CZ  . PHE A 1 811 ? 85.832  -59.445 116.331 1.00 33.67  ?  822  PHE A CZ  1 
ATOM   5556 N  N   . THR A 1 812 ? 83.015  -52.975 114.516 1.00 44.53  ?  823  THR A N   1 
ATOM   5557 C  CA  . THR A 1 812 ? 82.177  -51.791 114.628 1.00 46.57  ?  823  THR A CA  1 
ATOM   5558 C  C   . THR A 1 812 ? 80.878  -52.139 115.345 1.00 49.71  ?  823  THR A C   1 
ATOM   5559 O  O   . THR A 1 812 ? 80.379  -53.263 115.256 1.00 48.29  ?  823  THR A O   1 
ATOM   5560 C  CB  . THR A 1 812 ? 81.874  -51.194 113.253 1.00 62.74  ?  823  THR A CB  1 
ATOM   5561 O  OG1 . THR A 1 812 ? 81.017  -50.056 113.409 1.00 63.81  ?  823  THR A OG1 1 
ATOM   5562 C  CG2 . THR A 1 812 ? 81.194  -52.217 112.364 1.00 63.52  ?  823  THR A CG2 1 
ATOM   5563 N  N   . LEU A 1 813 ? 80.341  -51.164 116.068 1.00 35.52  ?  824  LEU A N   1 
ATOM   5564 C  CA  . LEU A 1 813 ? 79.130  -51.373 116.845 1.00 36.09  ?  824  LEU A CA  1 
ATOM   5565 C  C   . LEU A 1 813 ? 77.959  -50.612 116.229 1.00 43.70  ?  824  LEU A C   1 
ATOM   5566 O  O   . LEU A 1 813 ? 78.149  -49.529 115.666 1.00 44.00  ?  824  LEU A O   1 
ATOM   5567 C  CB  . LEU A 1 813 ? 79.329  -50.923 118.298 1.00 35.01  ?  824  LEU A CB  1 
ATOM   5568 C  CG  . LEU A 1 813 ? 80.269  -51.804 119.126 1.00 37.51  ?  824  LEU A CG  1 
ATOM   5569 C  CD1 . LEU A 1 813 ? 80.607  -51.146 120.454 1.00 35.95  ?  824  LEU A CD1 1 
ATOM   5570 C  CD2 . LEU A 1 813 ? 79.656  -53.182 119.347 1.00 39.31  ?  824  LEU A CD2 1 
ATOM   5571 N  N   . PRO A 1 814 ? 76.726  -51.138 116.335 1.00 41.50  ?  825  PRO A N   1 
ATOM   5572 C  CA  . PRO A 1 814 ? 76.336  -52.341 117.078 1.00 41.36  ?  825  PRO A CA  1 
ATOM   5573 C  C   . PRO A 1 814 ? 76.384  -53.653 116.287 1.00 45.85  ?  825  PRO A C   1 
ATOM   5574 O  O   . PRO A 1 814 ? 76.087  -54.703 116.852 1.00 44.86  ?  825  PRO A O   1 
ATOM   5575 C  CB  . PRO A 1 814 ? 74.894  -52.025 117.477 1.00 43.99  ?  825  PRO A CB  1 
ATOM   5576 C  CG  . PRO A 1 814 ? 74.380  -51.235 116.314 1.00 49.11  ?  825  PRO A CG  1 
ATOM   5577 C  CD  . PRO A 1 814 ? 75.553  -50.425 115.798 1.00 44.25  ?  825  PRO A CD  1 
ATOM   5578 N  N   . LYS A 1 815 ? 76.763  -53.597 115.008 1.00 49.65  ?  826  LYS A N   1 
ATOM   5579 C  CA  . LYS A 1 815 ? 76.671  -54.778 114.150 1.00 49.37  ?  826  LYS A CA  1 
ATOM   5580 C  C   . LYS A 1 815 ? 77.724  -55.832 114.490 1.00 50.61  ?  826  LYS A C   1 
ATOM   5581 O  O   . LYS A 1 815 ? 77.482  -57.028 114.286 1.00 49.14  ?  826  LYS A O   1 
ATOM   5582 C  CB  . LYS A 1 815 ? 76.781  -54.371 112.679 1.00 52.84  ?  826  LYS A CB  1 
ATOM   5583 C  CG  . LYS A 1 815 ? 77.684  -53.168 112.412 1.00 63.15  ?  826  LYS A CG  1 
ATOM   5584 C  CD  . LYS A 1 815 ? 76.891  -51.865 112.411 1.00 69.46  ?  826  LYS A CD  1 
ATOM   5585 C  CE  . LYS A 1 815 ? 77.800  -50.649 112.507 1.00 67.98  ?  826  LYS A CE  1 
ATOM   5586 N  NZ  . LYS A 1 815 ? 78.592  -50.434 111.265 1.00 73.49  ?  826  LYS A NZ  1 
ATOM   5587 N  N   . VAL A 1 816 ? 78.881  -55.416 115.009 1.00 44.61  ?  827  VAL A N   1 
ATOM   5588 C  CA  . VAL A 1 816 ? 80.006  -56.298 115.331 1.00 43.38  ?  827  VAL A CA  1 
ATOM   5589 C  C   . VAL A 1 816 ? 80.517  -56.966 114.058 1.00 46.11  ?  827  VAL A C   1 
ATOM   5590 O  O   . VAL A 1 816 ? 80.587  -58.197 113.968 1.00 43.90  ?  827  VAL A O   1 
ATOM   5591 C  CB  . VAL A 1 816 ? 79.637  -57.340 116.409 1.00 47.13  ?  827  VAL A CB  1 
ATOM   5592 C  CG1 . VAL A 1 816 ? 80.891  -57.986 116.989 1.00 46.69  ?  827  VAL A CG1 1 
ATOM   5593 C  CG2 . VAL A 1 816 ? 78.827  -56.692 117.519 1.00 46.97  ?  827  VAL A CG2 1 
ATOM   5594 N  N   . SER A 1 817 ? 80.881  -56.160 113.064 1.00 51.23  ?  828  SER A N   1 
ATOM   5595 C  CA  . SER A 1 817 ? 81.545  -56.647 111.864 1.00 51.73  ?  828  SER A CA  1 
ATOM   5596 C  C   . SER A 1 817 ? 83.004  -56.210 111.894 1.00 53.13  ?  828  SER A C   1 
ATOM   5597 O  O   . SER A 1 817 ? 83.322  -55.110 112.355 1.00 51.86  ?  828  SER A O   1 
ATOM   5598 C  CB  . SER A 1 817 ? 80.854  -56.135 110.592 1.00 56.85  ?  828  SER A CB  1 
ATOM   5599 O  OG  . SER A 1 817 ? 80.822  -54.720 110.537 1.00 67.76  ?  828  SER A OG  1 
ATOM   5600 N  N   . ALA A 1 818 ? 83.889  -57.078 111.414 1.00 41.49  ?  829  ALA A N   1 
ATOM   5601 C  CA  . ALA A 1 818 ? 85.319  -56.831 111.536 1.00 40.09  ?  829  ALA A CA  1 
ATOM   5602 C  C   . ALA A 1 818 ? 85.751  -55.645 110.681 1.00 42.28  ?  829  ALA A C   1 
ATOM   5603 O  O   . ALA A 1 818 ? 85.290  -55.472 109.550 1.00 42.39  ?  829  ALA A O   1 
ATOM   5604 C  CB  . ALA A 1 818 ? 86.105  -58.079 111.137 1.00 39.89  ?  829  ALA A CB  1 
ATOM   5605 N  N   . LYS A 1 819 ? 86.655  -54.827 111.227 1.00 35.17  ?  830  LYS A N   1 
ATOM   5606 C  CA  . LYS A 1 819 ? 87.202  -53.667 110.525 1.00 35.13  ?  830  LYS A CA  1 
ATOM   5607 C  C   . LYS A 1 819 ? 88.726  -53.632 110.514 1.00 39.97  ?  830  LYS A C   1 
ATOM   5608 O  O   . LYS A 1 819 ? 89.314  -53.216 109.510 1.00 40.94  ?  830  LYS A O   1 
ATOM   5609 C  CB  . LYS A 1 819 ? 86.665  -52.361 111.140 1.00 31.32  ?  830  LYS A CB  1 
ATOM   5610 N  N   . LEU A 1 820 ? 89.380  -54.044 111.601 1.00 36.17  ?  831  LEU A N   1 
ATOM   5611 C  CA  . LEU A 1 820 ? 90.835  -54.009 111.688 1.00 34.63  ?  831  LEU A CA  1 
ATOM   5612 C  C   . LEU A 1 820 ? 91.321  -55.235 112.446 1.00 35.71  ?  831  LEU A C   1 
ATOM   5613 O  O   . LEU A 1 820 ? 90.561  -55.879 113.172 1.00 34.12  ?  831  LEU A O   1 
ATOM   5614 C  CB  . LEU A 1 820 ? 91.329  -52.729 112.374 1.00 35.21  ?  831  LEU A CB  1 
ATOM   5615 C  CG  . LEU A 1 820 ? 91.047  -51.416 111.637 1.00 41.11  ?  831  LEU A CG  1 
ATOM   5616 C  CD1 . LEU A 1 820 ? 91.284  -50.208 112.527 1.00 42.12  ?  831  LEU A CD1 1 
ATOM   5617 C  CD2 . LEU A 1 820 ? 91.893  -51.325 110.382 1.00 42.38  ?  831  LEU A CD2 1 
ATOM   5618 N  N   . LYS A 1 821 ? 92.606  -55.546 112.282 1.00 34.01  ?  832  LYS A N   1 
ATOM   5619 C  CA  . LYS A 1 821 ? 93.154  -56.749 112.889 1.00 32.50  ?  832  LYS A CA  1 
ATOM   5620 C  C   . LYS A 1 821 ? 94.672  -56.642 112.955 1.00 33.19  ?  832  LYS A C   1 
ATOM   5621 O  O   . LYS A 1 821 ? 95.295  -56.041 112.078 1.00 35.03  ?  832  LYS A O   1 
ATOM   5622 C  CB  . LYS A 1 821 ? 92.738  -57.996 112.096 1.00 35.64  ?  832  LYS A CB  1 
ATOM   5623 C  CG  . LYS A 1 821 ? 92.939  -59.310 112.840 1.00 52.72  ?  832  LYS A CG  1 
ATOM   5624 C  CD  . LYS A 1 821 ? 92.847  -60.509 111.904 1.00 58.51  ?  832  LYS A CD  1 
ATOM   5625 C  CE  . LYS A 1 821 ? 91.458  -61.125 111.902 1.00 58.41  ?  832  LYS A CE  1 
ATOM   5626 N  NZ  . LYS A 1 821 ? 91.520  -62.607 112.068 1.00 50.30  ?  832  LYS A NZ  1 
ATOM   5627 N  N   . LEU A 1 822 ? 95.254  -57.219 114.005 1.00 25.25  ?  833  LEU A N   1 
ATOM   5628 C  CA  . LEU A 1 822 ? 96.695  -57.430 114.098 1.00 22.03  ?  833  LEU A CA  1 
ATOM   5629 C  C   . LEU A 1 822 ? 96.927  -58.844 114.604 1.00 28.34  ?  833  LEU A C   1 
ATOM   5630 O  O   . LEU A 1 822 ? 96.549  -59.168 115.734 1.00 27.70  ?  833  LEU A O   1 
ATOM   5631 C  CB  . LEU A 1 822 ? 97.372  -56.414 115.026 1.00 21.01  ?  833  LEU A CB  1 
ATOM   5632 C  CG  . LEU A 1 822 ? 98.843  -56.726 115.344 1.00 23.12  ?  833  LEU A CG  1 
ATOM   5633 C  CD1 . LEU A 1 822 ? 99.699  -56.670 114.087 1.00 22.31  ?  833  LEU A CD1 1 
ATOM   5634 C  CD2 . LEU A 1 822 ? 99.405  -55.803 116.417 1.00 21.55  ?  833  LEU A CD2 1 
ATOM   5635 N  N   . LYS A 1 823 ? 97.536  -59.686 113.767 1.00 31.99  ?  834  LYS A N   1 
ATOM   5636 C  CA  . LYS A 1 823 ? 97.788  -61.085 114.116 1.00 30.86  ?  834  LYS A CA  1 
ATOM   5637 C  C   . LYS A 1 823 ? 99.177  -61.192 114.738 1.00 35.07  ?  834  LYS A C   1 
ATOM   5638 O  O   . LYS A 1 823 ? 100.166 -61.510 114.078 1.00 36.04  ?  834  LYS A O   1 
ATOM   5639 C  CB  . LYS A 1 823 ? 97.654  -61.977 112.888 1.00 32.67  ?  834  LYS A CB  1 
ATOM   5640 C  CG  . LYS A 1 823 ? 96.233  -62.156 112.389 1.00 39.47  ?  834  LYS A CG  1 
ATOM   5641 C  CD  . LYS A 1 823 ? 96.164  -63.266 111.351 1.00 41.40  ?  834  LYS A CD  1 
ATOM   5642 C  CE  . LYS A 1 823 ? 94.732  -63.547 110.928 1.00 65.71  ?  834  LYS A CE  1 
ATOM   5643 N  NZ  . LYS A 1 823 ? 94.645  -64.737 110.037 1.00 79.89  ?  834  LYS A NZ  1 
ATOM   5644 N  N   . LEU A 1 824 ? 99.241  -60.936 116.047 1.00 22.94  ?  835  LEU A N   1 
ATOM   5645 C  CA  . LEU A 1 824 ? 100.531 -60.857 116.726 1.00 21.33  ?  835  LEU A CA  1 
ATOM   5646 C  C   . LEU A 1 824 ? 101.287 -62.180 116.647 1.00 26.82  ?  835  LEU A C   1 
ATOM   5647 O  O   . LEU A 1 824 ? 102.440 -62.224 116.201 1.00 24.72  ?  835  LEU A O   1 
ATOM   5648 C  CB  . LEU A 1 824 ? 100.336 -60.435 118.184 1.00 20.57  ?  835  LEU A CB  1 
ATOM   5649 C  CG  . LEU A 1 824 ? 101.647 -60.215 118.947 1.00 22.47  ?  835  LEU A CG  1 
ATOM   5650 C  CD1 . LEU A 1 824 ? 102.433 -59.073 118.326 1.00 21.69  ?  835  LEU A CD1 1 
ATOM   5651 C  CD2 . LEU A 1 824 ? 101.400 -59.953 120.425 1.00 21.17  ?  835  LEU A CD2 1 
ATOM   5652 N  N   . THR A 1 825 ? 100.650 -63.274 117.075 1.00 32.56  ?  836  THR A N   1 
ATOM   5653 C  CA  . THR A 1 825 ? 101.350 -64.554 117.148 1.00 32.68  ?  836  THR A CA  1 
ATOM   5654 C  C   . THR A 1 825 ? 101.748 -65.056 115.765 1.00 39.64  ?  836  THR A C   1 
ATOM   5655 O  O   . THR A 1 825 ? 102.833 -65.624 115.596 1.00 38.78  ?  836  THR A O   1 
ATOM   5656 C  CB  . THR A 1 825 ? 100.482 -65.588 117.870 1.00 36.37  ?  836  THR A CB  1 
ATOM   5657 O  OG1 . THR A 1 825 ? 100.143 -65.100 119.174 1.00 32.28  ?  836  THR A OG1 1 
ATOM   5658 C  CG2 . THR A 1 825 ? 101.231 -66.909 118.017 1.00 32.93  ?  836  THR A CG2 1 
ATOM   5659 N  N   . ALA A 1 826 ? 100.892 -64.849 114.762 1.00 43.20  ?  837  ALA A N   1 
ATOM   5660 C  CA  . ALA A 1 826 ? 101.244 -65.238 113.401 1.00 44.54  ?  837  ALA A CA  1 
ATOM   5661 C  C   . ALA A 1 826 ? 102.433 -64.441 112.878 1.00 51.59  ?  837  ALA A C   1 
ATOM   5662 O  O   . ALA A 1 826 ? 103.235 -64.966 112.099 1.00 52.55  ?  837  ALA A O   1 
ATOM   5663 C  CB  . ALA A 1 826 ? 100.041 -65.062 112.475 1.00 45.90  ?  837  ALA A CB  1 
ATOM   5664 N  N   . LEU A 1 827 ? 102.573 -63.186 113.303 1.00 49.28  ?  838  LEU A N   1 
ATOM   5665 C  CA  . LEU A 1 827 ? 103.676 -62.358 112.825 1.00 49.22  ?  838  LEU A CA  1 
ATOM   5666 C  C   . LEU A 1 827 ? 104.994 -62.748 113.487 1.00 52.52  ?  838  LEU A C   1 
ATOM   5667 O  O   . LEU A 1 827 ? 105.926 -63.211 112.819 1.00 52.51  ?  838  LEU A O   1 
ATOM   5668 C  CB  . LEU A 1 827 ? 103.369 -60.878 113.071 1.00 50.34  ?  838  LEU A CB  1 
ATOM   5669 C  CG  . LEU A 1 827 ? 102.808 -60.033 111.921 1.00 57.02  ?  838  LEU A CG  1 
ATOM   5670 C  CD1 . LEU A 1 827 ? 101.483 -60.580 111.418 1.00 56.36  ?  838  LEU A CD1 1 
ATOM   5671 C  CD2 . LEU A 1 827 ? 102.660 -58.578 112.353 1.00 62.74  ?  838  LEU A CD2 1 
ATOM   5672 N  N   . GLU A 1 828 ? 105.094 -62.567 114.806 1.00 45.36  ?  839  GLU A N   1 
ATOM   5673 C  CA  . GLU A 1 828 ? 106.375 -62.659 115.499 1.00 44.11  ?  839  GLU A CA  1 
ATOM   5674 C  C   . GLU A 1 828 ? 106.426 -63.767 116.547 1.00 45.88  ?  839  GLU A C   1 
ATOM   5675 O  O   . GLU A 1 828 ? 107.378 -63.814 117.334 1.00 46.45  ?  839  GLU A O   1 
ATOM   5676 C  CB  . GLU A 1 828 ? 106.717 -61.310 116.141 1.00 45.72  ?  839  GLU A CB  1 
ATOM   5677 C  CG  . GLU A 1 828 ? 105.591 -60.707 116.961 1.00 57.94  ?  839  GLU A CG  1 
ATOM   5678 C  CD  . GLU A 1 828 ? 105.938 -59.337 117.515 1.00 89.69  ?  839  GLU A CD  1 
ATOM   5679 O  OE1 . GLU A 1 828 ? 105.816 -58.339 116.772 1.00 92.76  ?  839  GLU A OE1 1 
ATOM   5680 O  OE2 . GLU A 1 828 ? 106.342 -59.260 118.694 1.00 79.49  ?  839  GLU A OE2 1 
ATOM   5681 N  N   . GLY A 1 829 ? 105.436 -64.657 116.580 1.00 39.36  ?  840  GLY A N   1 
ATOM   5682 C  CA  . GLY A 1 829 ? 105.481 -65.806 117.462 1.00 37.62  ?  840  GLY A CA  1 
ATOM   5683 C  C   . GLY A 1 829 ? 105.325 -65.517 118.937 1.00 38.94  ?  840  GLY A C   1 
ATOM   5684 O  O   . GLY A 1 829 ? 105.595 -66.403 119.755 1.00 39.17  ?  840  GLY A O   1 
ATOM   5685 N  N   . SER A 1 830 ? 104.905 -64.313 119.308 1.00 29.72  ?  841  SER A N   1 
ATOM   5686 C  CA  . SER A 1 830 ? 104.649 -63.964 120.698 1.00 27.94  ?  841  SER A CA  1 
ATOM   5687 C  C   . SER A 1 830 ? 103.152 -64.013 120.990 1.00 30.02  ?  841  SER A C   1 
ATOM   5688 O  O   . SER A 1 830 ? 102.316 -64.004 120.084 1.00 30.58  ?  841  SER A O   1 
ATOM   5689 C  CB  . SER A 1 830 ? 105.211 -62.576 121.021 1.00 30.43  ?  841  SER A CB  1 
ATOM   5690 O  OG  . SER A 1 830 ? 104.726 -61.599 120.114 1.00 38.28  ?  841  SER A OG  1 
ATOM   5691 N  N   . ARG A 1 831 ? 102.821 -64.078 122.277 1.00 25.60  ?  842  ARG A N   1 
ATOM   5692 C  CA  . ARG A 1 831 ? 101.437 -64.135 122.724 1.00 23.83  ?  842  ARG A CA  1 
ATOM   5693 C  C   . ARG A 1 831 ? 101.174 -63.016 123.717 1.00 25.45  ?  842  ARG A C   1 
ATOM   5694 O  O   . ARG A 1 831 ? 102.036 -62.691 124.537 1.00 24.42  ?  842  ARG A O   1 
ATOM   5695 C  CB  . ARG A 1 831 ? 101.110 -65.483 123.372 1.00 21.24  ?  842  ARG A CB  1 
ATOM   5696 C  CG  . ARG A 1 831 ? 101.065 -66.645 122.401 1.00 22.72  ?  842  ARG A CG  1 
ATOM   5697 C  CD  . ARG A 1 831 ? 100.642 -67.925 123.108 1.00 34.75  ?  842  ARG A CD  1 
ATOM   5698 N  NE  . ARG A 1 831 ? 99.937  -68.831 122.204 1.00 51.87  ?  842  ARG A NE  1 
ATOM   5699 C  CZ  . ARG A 1 831 ? 98.615  -68.952 122.153 1.00 59.03  ?  842  ARG A CZ  1 
ATOM   5700 N  NH1 . ARG A 1 831 ? 97.851  -68.233 122.960 1.00 35.33  ?  842  ARG A NH1 1 
ATOM   5701 N  NH2 . ARG A 1 831 ? 98.054  -69.795 121.297 1.00 53.65  ?  842  ARG A NH2 1 
ATOM   5702 N  N   . VAL A 1 832 ? 99.982  -62.429 123.642 1.00 20.38  ?  843  VAL A N   1 
ATOM   5703 C  CA  . VAL A 1 832 ? 99.609  -61.388 124.592 1.00 20.27  ?  843  VAL A CA  1 
ATOM   5704 C  C   . VAL A 1 832 ? 99.380  -62.033 125.951 1.00 23.90  ?  843  VAL A C   1 
ATOM   5705 O  O   . VAL A 1 832 ? 98.547  -62.936 126.093 1.00 22.23  ?  843  VAL A O   1 
ATOM   5706 C  CB  . VAL A 1 832 ? 98.364  -60.626 124.118 1.00 23.62  ?  843  VAL A CB  1 
ATOM   5707 C  CG1 . VAL A 1 832 ? 97.986  -59.545 125.121 1.00 23.66  ?  843  VAL A CG1 1 
ATOM   5708 C  CG2 . VAL A 1 832 ? 98.602  -60.017 122.750 1.00 22.57  ?  843  VAL A CG2 1 
ATOM   5709 N  N   . ARG A 1 833 ? 100.134 -61.591 126.952 1.00 23.06  ?  844  ARG A N   1 
ATOM   5710 C  CA  . ARG A 1 833 ? 99.926  -62.038 128.323 1.00 22.10  ?  844  ARG A CA  1 
ATOM   5711 C  C   . ARG A 1 833 ? 99.094  -61.052 129.129 1.00 27.40  ?  844  ARG A C   1 
ATOM   5712 O  O   . ARG A 1 833 ? 98.285  -61.465 129.965 1.00 29.18  ?  844  ARG A O   1 
ATOM   5713 C  CB  . ARG A 1 833 ? 101.272 -62.272 129.017 1.00 18.76  ?  844  ARG A CB  1 
ATOM   5714 C  CG  . ARG A 1 833 ? 101.158 -62.877 130.406 1.00 34.56  ?  844  ARG A CG  1 
ATOM   5715 C  CD  . ARG A 1 833 ? 100.472 -64.238 130.378 1.00 48.44  ?  844  ARG A CD  1 
ATOM   5716 N  NE  . ARG A 1 833 ? 101.351 -65.310 129.912 1.00 51.88  ?  844  ARG A NE  1 
ATOM   5717 C  CZ  . ARG A 1 833 ? 101.244 -65.917 128.734 1.00 72.36  ?  844  ARG A CZ  1 
ATOM   5718 N  NH1 . ARG A 1 833 ? 100.291 -65.565 127.880 1.00 56.23  ?  844  ARG A NH1 1 
ATOM   5719 N  NH2 . ARG A 1 833 ? 102.091 -66.885 128.413 1.00 62.53  ?  844  ARG A NH2 1 
ATOM   5720 N  N   . ARG A 1 834 ? 99.256  -59.757 128.867 1.00 21.24  ?  845  ARG A N   1 
ATOM   5721 C  CA  . ARG A 1 834 ? 98.514  -58.714 129.559 1.00 20.17  ?  845  ARG A CA  1 
ATOM   5722 C  C   . ARG A 1 834 ? 98.526  -57.470 128.681 1.00 25.04  ?  845  ARG A C   1 
ATOM   5723 O  O   . ARG A 1 834 ? 99.555  -57.138 128.088 1.00 24.99  ?  845  ARG A O   1 
ATOM   5724 C  CB  . ARG A 1 834 ? 99.133  -58.427 130.933 1.00 19.53  ?  845  ARG A CB  1 
ATOM   5725 C  CG  . ARG A 1 834 ? 98.314  -57.524 131.835 1.00 28.96  ?  845  ARG A CG  1 
ATOM   5726 C  CD  . ARG A 1 834 ? 98.781  -57.621 133.288 1.00 40.78  ?  845  ARG A CD  1 
ATOM   5727 N  NE  . ARG A 1 834 ? 98.562  -58.953 133.852 1.00 55.17  ?  845  ARG A NE  1 
ATOM   5728 C  CZ  . ARG A 1 834 ? 99.528  -59.824 134.136 1.00 65.94  ?  845  ARG A CZ  1 
ATOM   5729 N  NH1 . ARG A 1 834 ? 100.799 -59.509 133.921 1.00 45.68  ?  845  ARG A NH1 1 
ATOM   5730 N  NH2 . ARG A 1 834 ? 99.224  -61.011 134.645 1.00 54.54  ?  845  ARG A NH2 1 
ATOM   5731 N  N   . VAL A 1 835 ? 97.380  -56.800 128.585 1.00 19.37  ?  846  VAL A N   1 
ATOM   5732 C  CA  . VAL A 1 835 ? 97.252  -55.592 127.777 1.00 19.28  ?  846  VAL A CA  1 
ATOM   5733 C  C   . VAL A 1 835 ? 96.469  -54.552 128.566 1.00 24.82  ?  846  VAL A C   1 
ATOM   5734 O  O   . VAL A 1 835 ? 95.466  -54.867 129.215 1.00 23.36  ?  846  VAL A O   1 
ATOM   5735 C  CB  . VAL A 1 835 ? 96.592  -55.881 126.411 1.00 23.12  ?  846  VAL A CB  1 
ATOM   5736 C  CG1 . VAL A 1 835 ? 95.167  -56.397 126.579 1.00 22.61  ?  846  VAL A CG1 1 
ATOM   5737 C  CG2 . VAL A 1 835 ? 96.627  -54.641 125.524 1.00 23.42  ?  846  VAL A CG2 1 
ATOM   5738 N  N   . SER A 1 836 ? 96.943  -53.309 128.523 1.00 25.35  ?  847  SER A N   1 
ATOM   5739 C  CA  . SER A 1 836 ? 96.315  -52.206 129.232 1.00 25.82  ?  847  SER A CA  1 
ATOM   5740 C  C   . SER A 1 836 ? 96.342  -50.969 128.351 1.00 31.19  ?  847  SER A C   1 
ATOM   5741 O  O   . SER A 1 836 ? 97.242  -50.797 127.525 1.00 30.54  ?  847  SER A O   1 
ATOM   5742 C  CB  . SER A 1 836 ? 97.024  -51.910 130.559 1.00 29.53  ?  847  SER A CB  1 
ATOM   5743 O  OG  . SER A 1 836 ? 97.132  -53.080 131.350 1.00 43.11  ?  847  SER A OG  1 
ATOM   5744 N  N   . VAL A 1 837 ? 95.344  -50.110 128.535 1.00 22.86  ?  848  VAL A N   1 
ATOM   5745 C  CA  . VAL A 1 837 ? 95.320  -48.821 127.856 1.00 24.44  ?  848  VAL A CA  1 
ATOM   5746 C  C   . VAL A 1 837 ? 96.268  -47.870 128.571 1.00 28.41  ?  848  VAL A C   1 
ATOM   5747 O  O   . VAL A 1 837 ? 96.301  -47.812 129.806 1.00 28.07  ?  848  VAL A O   1 
ATOM   5748 C  CB  . VAL A 1 837 ? 93.891  -48.254 127.813 1.00 29.38  ?  848  VAL A CB  1 
ATOM   5749 C  CG1 . VAL A 1 837 ? 93.817  -47.086 126.840 1.00 29.46  ?  848  VAL A CG1 1 
ATOM   5750 C  CG2 . VAL A 1 837 ? 92.909  -49.344 127.435 1.00 29.32  ?  848  VAL A CG2 1 
ATOM   5751 N  N   . ALA A 1 838 ? 97.053  -47.129 127.798 1.00 29.51  ?  849  ALA A N   1 
ATOM   5752 C  CA  . ALA A 1 838 ? 98.026  -46.207 128.359 1.00 30.40  ?  849  ALA A CA  1 
ATOM   5753 C  C   . ALA A 1 838 ? 97.991  -44.906 127.580 1.00 38.66  ?  849  ALA A C   1 
ATOM   5754 O  O   . ALA A 1 838 ? 98.032  -44.915 126.347 1.00 38.07  ?  849  ALA A O   1 
ATOM   5755 C  CB  . ALA A 1 838 ? 99.441  -46.798 128.333 1.00 30.31  ?  849  ALA A CB  1 
ATOM   5756 N  N   . HIS A 1 839 ? 97.907  -43.795 128.303 1.00 41.79  ?  850  HIS A N   1 
ATOM   5757 C  CA  . HIS A 1 839 ? 97.980  -42.471 127.704 1.00 42.34  ?  850  HIS A CA  1 
ATOM   5758 C  C   . HIS A 1 839 ? 99.438  -42.034 127.664 1.00 41.01  ?  850  HIS A C   1 
ATOM   5759 O  O   . HIS A 1 839 ? 100.091 -41.940 128.709 1.00 41.10  ?  850  HIS A O   1 
ATOM   5760 C  CB  . HIS A 1 839 ? 97.139  -41.472 128.494 1.00 45.04  ?  850  HIS A CB  1 
ATOM   5761 C  CG  . HIS A 1 839 ? 97.151  -40.092 127.918 1.00 50.46  ?  850  HIS A CG  1 
ATOM   5762 N  ND1 . HIS A 1 839 ? 96.185  -39.644 127.043 1.00 53.62  ?  850  HIS A ND1 1 
ATOM   5763 C  CD2 . HIS A 1 839 ? 98.017  -39.065 128.081 1.00 53.12  ?  850  HIS A CD2 1 
ATOM   5764 C  CE1 . HIS A 1 839 ? 96.451  -38.397 126.698 1.00 53.96  ?  850  HIS A CE1 1 
ATOM   5765 N  NE2 . HIS A 1 839 ? 97.559  -38.022 127.313 1.00 53.84  ?  850  HIS A NE2 1 
ATOM   5766 N  N   . PHE A 1 840 ? 99.949  -41.781 126.465 1.00 30.22  ?  851  PHE A N   1 
ATOM   5767 C  CA  . PHE A 1 840 ? 101.322 -41.340 126.267 1.00 28.19  ?  851  PHE A CA  1 
ATOM   5768 C  C   . PHE A 1 840 ? 101.319 -39.862 125.913 1.00 39.81  ?  851  PHE A C   1 
ATOM   5769 O  O   . PHE A 1 840 ? 100.580 -39.435 125.019 1.00 40.41  ?  851  PHE A O   1 
ATOM   5770 C  CB  . PHE A 1 840 ? 102.013 -42.145 125.163 1.00 26.61  ?  851  PHE A CB  1 
ATOM   5771 C  CG  . PHE A 1 840 ? 102.143 -43.608 125.469 1.00 24.22  ?  851  PHE A CG  1 
ATOM   5772 C  CD1 . PHE A 1 840 ? 103.263 -44.095 126.122 1.00 25.15  ?  851  PHE A CD1 1 
ATOM   5773 C  CD2 . PHE A 1 840 ? 101.142 -44.497 125.110 1.00 23.72  ?  851  PHE A CD2 1 
ATOM   5774 C  CE1 . PHE A 1 840 ? 103.389 -45.439 126.413 1.00 24.02  ?  851  PHE A CE1 1 
ATOM   5775 C  CE2 . PHE A 1 840 ? 101.262 -45.844 125.397 1.00 25.24  ?  851  PHE A CE2 1 
ATOM   5776 C  CZ  . PHE A 1 840 ? 102.389 -46.315 126.051 1.00 22.97  ?  851  PHE A CZ  1 
ATOM   5777 N  N   . GLY A 1 841 ? 102.135 -39.089 126.615 1.00 41.07  ?  852  GLY A N   1 
ATOM   5778 C  CA  . GLY A 1 841 ? 102.266 -37.671 126.358 1.00 43.22  ?  852  GLY A CA  1 
ATOM   5779 C  C   . GLY A 1 841 ? 103.525 -37.365 125.571 1.00 51.18  ?  852  GLY A C   1 
ATOM   5780 O  O   . GLY A 1 841 ? 104.543 -38.040 125.709 1.00 50.36  ?  852  GLY A O   1 
ATOM   5781 N  N   . SER A 1 842 ? 103.435 -36.347 124.723 1.00 43.25  ?  853  SER A N   1 
ATOM   5782 C  CA  . SER A 1 842 ? 104.604 -35.851 124.016 1.00 45.26  ?  853  SER A CA  1 
ATOM   5783 C  C   . SER A 1 842 ? 105.421 -34.960 124.942 1.00 53.67  ?  853  SER A C   1 
ATOM   5784 O  O   . SER A 1 842 ? 104.877 -34.272 125.813 1.00 53.40  ?  853  SER A O   1 
ATOM   5785 C  CB  . SER A 1 842 ? 104.187 -35.078 122.762 1.00 50.17  ?  853  SER A CB  1 
ATOM   5786 O  OG  . SER A 1 842 ? 105.315 -34.672 122.007 1.00 59.92  ?  853  SER A OG  1 
ATOM   5787 N  N   . ARG A 1 843 ? 106.742 -34.994 124.769 1.00 70.78  ?  854  ARG A N   1 
ATOM   5788 C  CA  . ARG A 1 843 ? 107.621 -34.128 125.544 1.00 72.90  ?  854  ARG A CA  1 
ATOM   5789 C  C   . ARG A 1 843 ? 108.230 -33.017 124.700 1.00 82.31  ?  854  ARG A C   1 
ATOM   5790 O  O   . ARG A 1 843 ? 109.088 -32.276 125.192 1.00 82.45  ?  854  ARG A O   1 
ATOM   5791 C  CB  . ARG A 1 843 ? 108.720 -34.947 126.237 1.00 72.42  ?  854  ARG A CB  1 
ATOM   5792 C  CG  . ARG A 1 843 ? 109.857 -35.435 125.359 1.00 84.50  ?  854  ARG A CG  1 
ATOM   5793 C  CD  . ARG A 1 843 ? 110.888 -36.142 126.231 1.00 100.03 ?  854  ARG A CD  1 
ATOM   5794 N  NE  . ARG A 1 843 ? 111.952 -36.788 125.470 1.00 108.85 ?  854  ARG A NE  1 
ATOM   5795 C  CZ  . ARG A 1 843 ? 112.751 -37.728 125.967 1.00 115.16 ?  854  ARG A CZ  1 
ATOM   5796 N  NH1 . ARG A 1 843 ? 112.596 -38.136 127.219 1.00 94.60  ?  854  ARG A NH1 1 
ATOM   5797 N  NH2 . ARG A 1 843 ? 113.699 -38.266 125.212 1.00 101.99 ?  854  ARG A NH2 1 
ATOM   5798 N  N   . ARG A 1 844 ? 107.804 -32.878 123.444 1.00 84.10  ?  855  ARG A N   1 
ATOM   5799 C  CA  . ARG A 1 844 ? 108.090 -31.689 122.656 1.00 85.79  ?  855  ARG A CA  1 
ATOM   5800 C  C   . ARG A 1 844 ? 106.869 -30.792 122.497 1.00 93.71  ?  855  ARG A C   1 
ATOM   5801 O  O   . ARG A 1 844 ? 107.015 -29.635 122.088 1.00 94.15  ?  855  ARG A O   1 
ATOM   5802 C  CB  . ARG A 1 844 ? 108.637 -32.074 121.273 1.00 84.71  ?  855  ARG A CB  1 
ATOM   5803 C  CG  . ARG A 1 844 ? 107.594 -32.554 120.275 1.00 91.62  ?  855  ARG A CG  1 
ATOM   5804 C  CD  . ARG A 1 844 ? 107.984 -32.141 118.859 1.00 98.71  ?  855  ARG A CD  1 
ATOM   5805 N  NE  . ARG A 1 844 ? 109.291 -32.666 118.467 1.00 102.81 ?  855  ARG A NE  1 
ATOM   5806 C  CZ  . ARG A 1 844 ? 109.487 -33.512 117.460 1.00 114.07 ?  855  ARG A CZ  1 
ATOM   5807 N  NH1 . ARG A 1 844 ? 108.462 -33.927 116.729 1.00 97.96  ?  855  ARG A NH1 1 
ATOM   5808 N  NH2 . ARG A 1 844 ? 110.712 -33.937 117.179 1.00 100.15 ?  855  ARG A NH2 1 
ATOM   5809 N  N   . ALA A 1 845 ? 105.677 -31.302 122.812 1.00 80.10  ?  856  ALA A N   1 
ATOM   5810 C  CA  . ALA A 1 845 ? 104.441 -30.525 122.845 1.00 81.27  ?  856  ALA A CA  1 
ATOM   5811 C  C   . ALA A 1 845 ? 103.757 -30.814 124.176 1.00 87.00  ?  856  ALA A C   1 
ATOM   5812 O  O   . ALA A 1 845 ? 103.296 -31.936 124.410 1.00 86.48  ?  856  ALA A O   1 
ATOM   5813 C  CB  . ALA A 1 845 ? 103.532 -30.871 121.665 1.00 82.22  ?  856  ALA A CB  1 
ATOM   5814 N  N   . GLU A 1 846 ? 103.682 -29.797 125.039 1.00 103.83 ?  857  GLU A N   1 
ATOM   5815 C  CA  . GLU A 1 846 ? 103.317 -30.022 126.436 1.00 104.28 ?  857  GLU A CA  1 
ATOM   5816 C  C   . GLU A 1 846 ? 101.855 -30.431 126.593 1.00 110.03 ?  857  GLU A C   1 
ATOM   5817 O  O   . GLU A 1 846 ? 101.543 -31.339 127.373 1.00 109.53 ?  857  GLU A O   1 
ATOM   5818 C  CB  . GLU A 1 846 ? 103.613 -28.767 127.258 1.00 52.74  ?  857  GLU A CB  1 
ATOM   5819 N  N   . ASP A 1 847 ? 100.942 -29.772 125.881 1.00 141.26 ?  858  ASP A N   1 
ATOM   5820 C  CA  . ASP A 1 847 ? 99.506  -30.036 126.015 1.00 141.08 ?  858  ASP A CA  1 
ATOM   5821 C  C   . ASP A 1 847 ? 99.079  -30.963 124.882 1.00 141.91 ?  858  ASP A C   1 
ATOM   5822 O  O   . ASP A 1 847 ? 98.601  -30.517 123.837 1.00 142.04 ?  858  ASP A O   1 
ATOM   5823 C  CB  . ASP A 1 847 ? 98.711  -28.733 126.007 1.00 88.08  ?  858  ASP A CB  1 
ATOM   5824 N  N   . TYR A 1 848 ? 99.237  -32.267 125.101 1.00 93.84  ?  859  TYR A N   1 
ATOM   5825 C  CA  . TYR A 1 848 ? 98.968  -33.257 124.064 1.00 91.56  ?  859  TYR A CA  1 
ATOM   5826 C  C   . TYR A 1 848 ? 99.003  -34.650 124.685 1.00 88.71  ?  859  TYR A C   1 
ATOM   5827 O  O   . TYR A 1 848 ? 99.434  -34.833 125.827 1.00 88.29  ?  859  TYR A O   1 
ATOM   5828 C  CB  . TYR A 1 848 ? 99.976  -33.140 122.917 1.00 93.07  ?  859  TYR A CB  1 
ATOM   5829 C  CG  . TYR A 1 848 ? 99.672  -34.021 121.731 1.00 95.22  ?  859  TYR A CG  1 
ATOM   5830 C  CD1 . TYR A 1 848 ? 98.457  -33.927 121.065 1.00 97.96  ?  859  TYR A CD1 1 
ATOM   5831 C  CD2 . TYR A 1 848 ? 100.601 -34.947 121.275 1.00 95.32  ?  859  TYR A CD2 1 
ATOM   5832 C  CE1 . TYR A 1 848 ? 98.174  -34.731 119.981 1.00 98.74  ?  859  TYR A CE1 1 
ATOM   5833 C  CE2 . TYR A 1 848 ? 100.328 -35.755 120.190 1.00 96.11  ?  859  TYR A CE2 1 
ATOM   5834 C  CZ  . TYR A 1 848 ? 99.113  -35.643 119.547 1.00 104.82 ?  859  TYR A CZ  1 
ATOM   5835 O  OH  . TYR A 1 848 ? 98.838  -36.447 118.465 1.00 105.82 ?  859  TYR A OH  1 
ATOM   5836 N  N   . GLY A 1 849 ? 98.540  -35.632 123.910 1.00 67.59  ?  860  GLY A N   1 
ATOM   5837 C  CA  . GLY A 1 849 ? 98.563  -37.023 124.315 1.00 64.38  ?  860  GLY A CA  1 
ATOM   5838 C  C   . GLY A 1 849 ? 97.622  -37.893 123.505 1.00 62.95  ?  860  GLY A C   1 
ATOM   5839 O  O   . GLY A 1 849 ? 96.561  -37.431 123.073 1.00 62.93  ?  860  GLY A O   1 
ATOM   5840 N  N   . GLU A 1 850 ? 97.998  -39.156 123.289 1.00 46.13  ?  861  GLU A N   1 
ATOM   5841 C  CA  . GLU A 1 850 ? 97.169  -40.099 122.550 1.00 43.31  ?  861  GLU A CA  1 
ATOM   5842 C  C   . GLU A 1 850 ? 97.226  -41.468 123.212 1.00 40.97  ?  861  GLU A C   1 
ATOM   5843 O  O   . GLU A 1 850 ? 98.299  -41.932 123.607 1.00 39.34  ?  861  GLU A O   1 
ATOM   5844 C  CB  . GLU A 1 850 ? 97.603  -40.202 121.079 1.00 44.64  ?  861  GLU A CB  1 
ATOM   5845 C  CG  . GLU A 1 850 ? 99.100  -40.065 120.837 1.00 54.20  ?  861  GLU A CG  1 
ATOM   5846 C  CD  . GLU A 1 850 ? 99.456  -40.085 119.358 1.00 74.98  ?  861  GLU A CD  1 
ATOM   5847 O  OE1 . GLU A 1 850 ? 99.455  -41.178 118.756 1.00 68.66  ?  861  GLU A OE1 1 
ATOM   5848 O  OE2 . GLU A 1 850 ? 99.723  -39.003 118.793 1.00 72.72  ?  861  GLU A OE2 1 
ATOM   5849 N  N   . HIS A 1 851 ? 96.063  -42.106 123.324 1.00 42.49  ?  862  HIS A N   1 
ATOM   5850 C  CA  . HIS A 1 851 ? 95.973  -43.424 123.937 1.00 40.69  ?  862  HIS A CA  1 
ATOM   5851 C  C   . HIS A 1 851 ? 96.531  -44.497 123.009 1.00 41.00  ?  862  HIS A C   1 
ATOM   5852 O  O   . HIS A 1 851 ? 96.336  -44.454 121.792 1.00 41.12  ?  862  HIS A O   1 
ATOM   5853 C  CB  . HIS A 1 851 ? 94.521  -43.759 124.278 1.00 41.86  ?  862  HIS A CB  1 
ATOM   5854 C  CG  . HIS A 1 851 ? 93.911  -42.863 125.309 1.00 46.12  ?  862  HIS A CG  1 
ATOM   5855 N  ND1 . HIS A 1 851 ? 93.380  -41.629 125.003 1.00 48.24  ?  862  HIS A ND1 1 
ATOM   5856 C  CD2 . HIS A 1 851 ? 93.736  -43.029 126.641 1.00 47.79  ?  862  HIS A CD2 1 
ATOM   5857 C  CE1 . HIS A 1 851 ? 92.909  -41.070 126.104 1.00 47.70  ?  862  HIS A CE1 1 
ATOM   5858 N  NE2 . HIS A 1 851 ? 93.113  -41.899 127.112 1.00 47.76  ?  862  HIS A NE2 1 
ATOM   5859 N  N   . HIS A 1 852 ? 97.217  -45.471 123.599 1.00 35.37  ?  863  HIS A N   1 
ATOM   5860 C  CA  . HIS A 1 852 ? 97.701  -46.637 122.879 1.00 32.36  ?  863  HIS A CA  1 
ATOM   5861 C  C   . HIS A 1 852 ? 97.643  -47.834 123.816 1.00 29.90  ?  863  HIS A C   1 
ATOM   5862 O  O   . HIS A 1 852 ? 97.362  -47.702 125.009 1.00 27.69  ?  863  HIS A O   1 
ATOM   5863 C  CB  . HIS A 1 852 ? 99.123  -46.426 122.343 1.00 32.82  ?  863  HIS A CB  1 
ATOM   5864 C  CG  . HIS A 1 852 ? 99.234  -45.310 121.352 1.00 36.32  ?  863  HIS A CG  1 
ATOM   5865 N  ND1 . HIS A 1 852 ? 98.609  -45.340 120.124 1.00 38.54  ?  863  HIS A ND1 1 
ATOM   5866 C  CD2 . HIS A 1 852 ? 99.895  -44.130 121.409 1.00 37.67  ?  863  HIS A CD2 1 
ATOM   5867 C  CE1 . HIS A 1 852 ? 98.881  -44.228 119.466 1.00 37.67  ?  863  HIS A CE1 1 
ATOM   5868 N  NE2 . HIS A 1 852 ? 99.659  -43.477 120.223 1.00 37.83  ?  863  HIS A NE2 1 
ATOM   5869 N  N   . LEU A 1 853 ? 97.909  -49.013 123.263 1.00 23.01  ?  864  LEU A N   1 
ATOM   5870 C  CA  . LEU A 1 853 ? 97.853  -50.259 124.014 1.00 21.74  ?  864  LEU A CA  1 
ATOM   5871 C  C   . LEU A 1 853 ? 99.248  -50.634 124.498 1.00 25.24  ?  864  LEU A C   1 
ATOM   5872 O  O   . LEU A 1 853 ? 100.182 -50.736 123.697 1.00 25.99  ?  864  LEU A O   1 
ATOM   5873 C  CB  . LEU A 1 853 ? 97.277  -51.387 123.156 1.00 21.10  ?  864  LEU A CB  1 
ATOM   5874 C  CG  . LEU A 1 853 ? 95.829  -51.250 122.674 1.00 23.80  ?  864  LEU A CG  1 
ATOM   5875 C  CD1 . LEU A 1 853 ? 95.423  -52.462 121.848 1.00 20.90  ?  864  LEU A CD1 1 
ATOM   5876 C  CD2 . LEU A 1 853 ? 94.885  -51.061 123.850 1.00 24.19  ?  864  LEU A CD2 1 
ATOM   5877 N  N   . ALA A 1 854 ? 99.382  -50.830 125.807 1.00 17.00  ?  865  ALA A N   1 
ATOM   5878 C  CA  . ALA A 1 854 ? 100.600 -51.370 126.391 1.00 15.20  ?  865  ALA A CA  1 
ATOM   5879 C  C   . ALA A 1 854 ? 100.450 -52.880 126.518 1.00 14.93  ?  865  ALA A C   1 
ATOM   5880 O  O   . ALA A 1 854 ? 99.488  -53.365 127.120 1.00 12.55  ?  865  ALA A O   1 
ATOM   5881 C  CB  . ALA A 1 854 ? 100.880 -50.737 127.752 1.00 16.37  ?  865  ALA A CB  1 
ATOM   5882 N  N   . VAL A 1 855 ? 101.389 -53.623 125.941 1.00 16.92  ?  866  VAL A N   1 
ATOM   5883 C  CA  . VAL A 1 855 ? 101.266 -55.068 125.804 1.00 16.18  ?  866  VAL A CA  1 
ATOM   5884 C  C   . VAL A 1 855 ? 102.450 -55.729 126.489 1.00 19.97  ?  866  VAL A C   1 
ATOM   5885 O  O   . VAL A 1 855 ? 103.602 -55.358 126.243 1.00 20.81  ?  866  VAL A O   1 
ATOM   5886 C  CB  . VAL A 1 855 ? 101.197 -55.487 124.324 1.00 18.74  ?  866  VAL A CB  1 
ATOM   5887 C  CG1 . VAL A 1 855 ? 101.041 -56.993 124.209 1.00 17.78  ?  866  VAL A CG1 1 
ATOM   5888 C  CG2 . VAL A 1 855 ? 100.059 -54.764 123.617 1.00 18.61  ?  866  VAL A CG2 1 
ATOM   5889 N  N   . LEU A 1 856 ? 102.166 -56.704 127.344 1.00 14.84  ?  867  LEU A N   1 
ATOM   5890 C  CA  . LEU A 1 856 ? 103.179 -57.589 127.902 1.00 14.29  ?  867  LEU A CA  1 
ATOM   5891 C  C   . LEU A 1 856 ? 103.024 -58.951 127.241 1.00 20.07  ?  867  LEU A C   1 
ATOM   5892 O  O   . LEU A 1 856 ? 101.960 -59.572 127.342 1.00 18.69  ?  867  LEU A O   1 
ATOM   5893 C  CB  . LEU A 1 856 ? 103.039 -57.709 129.420 1.00 14.33  ?  867  LEU A CB  1 
ATOM   5894 C  CG  . LEU A 1 856 ? 103.923 -58.784 130.061 1.00 19.49  ?  867  LEU A CG  1 
ATOM   5895 C  CD1 . LEU A 1 856 ? 105.390 -58.375 130.025 1.00 17.58  ?  867  LEU A CD1 1 
ATOM   5896 C  CD2 . LEU A 1 856 ? 103.471 -59.086 131.480 1.00 24.22  ?  867  LEU A CD2 1 
ATOM   5897 N  N   . THR A 1 857 ? 104.070 -59.407 126.560 1.00 17.80  ?  868  THR A N   1 
ATOM   5898 C  CA  . THR A 1 857 ? 104.002 -60.685 125.871 1.00 17.84  ?  868  THR A CA  1 
ATOM   5899 C  C   . THR A 1 857 ? 104.516 -61.811 126.766 1.00 23.12  ?  868  THR A C   1 
ATOM   5900 O  O   . THR A 1 857 ? 105.077 -61.586 127.840 1.00 23.62  ?  868  THR A O   1 
ATOM   5901 C  CB  . THR A 1 857 ? 104.791 -60.641 124.562 1.00 22.07  ?  868  THR A CB  1 
ATOM   5902 O  OG1 . THR A 1 857 ? 106.194 -60.647 124.845 1.00 23.48  ?  868  THR A OG1 1 
ATOM   5903 C  CG2 . THR A 1 857 ? 104.444 -59.387 123.776 1.00 18.75  ?  868  THR A CG2 1 
ATOM   5904 N  N   . ASN A 1 858 ? 104.307 -63.048 126.306 1.00 27.57  ?  869  ASN A N   1 
ATOM   5905 C  CA  . ASN A 1 858 ? 104.765 -64.211 127.057 1.00 26.94  ?  869  ASN A CA  1 
ATOM   5906 C  C   . ASN A 1 858 ? 106.282 -64.309 127.096 1.00 30.81  ?  869  ASN A C   1 
ATOM   5907 O  O   . ASN A 1 858 ? 106.825 -65.009 127.957 1.00 32.77  ?  869  ASN A O   1 
ATOM   5908 C  CB  . ASN A 1 858 ? 104.177 -65.493 126.464 1.00 22.27  ?  869  ASN A CB  1 
ATOM   5909 C  CG  . ASN A 1 858 ? 104.563 -65.701 125.010 1.00 37.78  ?  869  ASN A CG  1 
ATOM   5910 O  OD1 . ASN A 1 858 ? 104.749 -64.744 124.259 1.00 28.44  ?  869  ASN A OD1 1 
ATOM   5911 N  ND2 . ASN A 1 858 ? 104.676 -66.962 124.604 1.00 29.77  ?  869  ASN A ND2 1 
ATOM   5912 N  N   . LEU A 1 859 ? 106.970 -63.625 126.187 1.00 20.62  ?  870  LEU A N   1 
ATOM   5913 C  CA  . LEU A 1 859 ? 108.424 -63.624 126.134 1.00 19.30  ?  870  LEU A CA  1 
ATOM   5914 C  C   . LEU A 1 859 ? 109.038 -62.530 126.999 1.00 21.71  ?  870  LEU A C   1 
ATOM   5915 O  O   . LEU A 1 859 ? 110.243 -62.281 126.901 1.00 22.60  ?  870  LEU A O   1 
ATOM   5916 C  CB  . LEU A 1 859 ? 108.891 -63.472 124.684 1.00 18.63  ?  870  LEU A CB  1 
ATOM   5917 C  CG  . LEU A 1 859 ? 108.234 -64.390 123.646 1.00 21.28  ?  870  LEU A CG  1 
ATOM   5918 C  CD1 . LEU A 1 859 ? 108.767 -64.079 122.255 1.00 20.10  ?  870  LEU A CD1 1 
ATOM   5919 C  CD2 . LEU A 1 859 ? 108.444 -65.860 123.990 1.00 23.69  ?  870  LEU A CD2 1 
ATOM   5920 N  N   . GLY A 1 860 ? 108.240 -61.876 127.840 1.00 18.88  ?  871  GLY A N   1 
ATOM   5921 C  CA  . GLY A 1 860 ? 108.717 -60.800 128.678 1.00 18.14  ?  871  GLY A CA  1 
ATOM   5922 C  C   . GLY A 1 860 ? 108.878 -59.468 127.981 1.00 20.29  ?  871  GLY A C   1 
ATOM   5923 O  O   . GLY A 1 860 ? 109.330 -58.506 128.614 1.00 20.39  ?  871  GLY A O   1 
ATOM   5924 N  N   . ASP A 1 861 ? 108.528 -59.373 126.703 1.00 15.61  ?  872  ASP A N   1 
ATOM   5925 C  CA  . ASP A 1 861 ? 108.655 -58.114 125.994 1.00 15.97  ?  872  ASP A CA  1 
ATOM   5926 C  C   . ASP A 1 861 ? 107.477 -57.198 126.308 1.00 20.93  ?  872  ASP A C   1 
ATOM   5927 O  O   . ASP A 1 861 ? 106.399 -57.638 126.724 1.00 15.67  ?  872  ASP A O   1 
ATOM   5928 C  CB  . ASP A 1 861 ? 108.744 -58.343 124.486 1.00 17.44  ?  872  ASP A CB  1 
ATOM   5929 C  CG  . ASP A 1 861 ? 110.051 -58.985 124.069 1.00 32.97  ?  872  ASP A CG  1 
ATOM   5930 O  OD1 . ASP A 1 861 ? 110.871 -59.316 124.954 1.00 32.15  ?  872  ASP A OD1 1 
ATOM   5931 O  OD2 . ASP A 1 861 ? 110.256 -59.154 122.848 1.00 44.03  ?  872  ASP A OD2 1 
ATOM   5932 N  N   . ILE A 1 862 ? 107.699 -55.904 126.103 1.00 22.70  ?  873  ILE A N   1 
ATOM   5933 C  CA  . ILE A 1 862 ? 106.668 -54.889 126.274 1.00 23.01  ?  873  ILE A CA  1 
ATOM   5934 C  C   . ILE A 1 862 ? 106.521 -54.145 124.957 1.00 27.32  ?  873  ILE A C   1 
ATOM   5935 O  O   . ILE A 1 862 ? 107.476 -53.519 124.481 1.00 26.69  ?  873  ILE A O   1 
ATOM   5936 C  CB  . ILE A 1 862 ? 106.996 -53.926 127.422 1.00 25.92  ?  873  ILE A CB  1 
ATOM   5937 C  CG1 . ILE A 1 862 ? 107.016 -54.693 128.739 1.00 25.44  ?  873  ILE A CG1 1 
ATOM   5938 C  CG2 . ILE A 1 862 ? 105.982 -52.798 127.471 1.00 26.45  ?  873  ILE A CG2 1 
ATOM   5939 C  CD1 . ILE A 1 862 ? 107.407 -53.858 129.899 1.00 33.08  ?  873  ILE A CD1 1 
ATOM   5940 N  N   . GLN A 1 863 ? 105.330 -54.216 124.369 1.00 25.59  ?  874  GLN A N   1 
ATOM   5941 C  CA  . GLN A 1 863 ? 105.054 -53.609 123.078 1.00 25.50  ?  874  GLN A CA  1 
ATOM   5942 C  C   . GLN A 1 863 ? 103.993 -52.529 123.211 1.00 29.28  ?  874  GLN A C   1 
ATOM   5943 O  O   . GLN A 1 863 ? 103.134 -52.581 124.096 1.00 28.85  ?  874  GLN A O   1 
ATOM   5944 C  CB  . GLN A 1 863 ? 104.579 -54.645 122.061 1.00 26.61  ?  874  GLN A CB  1 
ATOM   5945 C  CG  . GLN A 1 863 ? 105.638 -55.624 121.630 1.00 41.69  ?  874  GLN A CG  1 
ATOM   5946 C  CD  . GLN A 1 863 ? 105.279 -56.309 120.334 1.00 47.64  ?  874  GLN A CD  1 
ATOM   5947 O  OE1 . GLN A 1 863 ? 105.049 -57.516 120.303 1.00 39.36  ?  874  GLN A OE1 1 
ATOM   5948 N  NE2 . GLN A 1 863 ? 105.223 -55.539 119.253 1.00 34.68  ?  874  GLN A NE2 1 
ATOM   5949 N  N   . VAL A 1 864 ? 104.059 -51.553 122.314 1.00 23.22  ?  875  VAL A N   1 
ATOM   5950 C  CA  . VAL A 1 864 ? 103.023 -50.541 122.171 1.00 22.67  ?  875  VAL A CA  1 
ATOM   5951 C  C   . VAL A 1 864 ? 102.335 -50.779 120.835 1.00 26.28  ?  875  VAL A C   1 
ATOM   5952 O  O   . VAL A 1 864 ? 102.964 -50.669 119.776 1.00 27.08  ?  875  VAL A O   1 
ATOM   5953 C  CB  . VAL A 1 864 ? 103.594 -49.119 122.257 1.00 25.71  ?  875  VAL A CB  1 
ATOM   5954 C  CG1 . VAL A 1 864 ? 102.487 -48.100 122.057 1.00 26.35  ?  875  VAL A CG1 1 
ATOM   5955 C  CG2 . VAL A 1 864 ? 104.279 -48.904 123.595 1.00 24.61  ?  875  VAL A CG2 1 
ATOM   5956 N  N   . VAL A 1 865 ? 101.053 -51.129 120.888 1.00 21.82  ?  876  VAL A N   1 
ATOM   5957 C  CA  . VAL A 1 865 ? 100.214 -51.284 119.706 1.00 21.55  ?  876  VAL A CA  1 
ATOM   5958 C  C   . VAL A 1 865 ? 99.316  -50.059 119.614 1.00 25.74  ?  876  VAL A C   1 
ATOM   5959 O  O   . VAL A 1 865 ? 98.650  -49.695 120.591 1.00 25.58  ?  876  VAL A O   1 
ATOM   5960 C  CB  . VAL A 1 865 ? 99.388  -52.580 119.763 1.00 25.16  ?  876  VAL A CB  1 
ATOM   5961 C  CG1 . VAL A 1 865 ? 98.444  -52.661 118.581 1.00 24.45  ?  876  VAL A CG1 1 
ATOM   5962 C  CG2 . VAL A 1 865 ? 100.309 -53.794 119.795 1.00 24.57  ?  876  VAL A CG2 1 
ATOM   5963 N  N   . SER A 1 866 ? 99.303  -49.422 118.447 1.00 26.43  ?  877  SER A N   1 
ATOM   5964 C  CA  . SER A 1 866 ? 98.626  -48.142 118.305 1.00 26.47  ?  877  SER A CA  1 
ATOM   5965 C  C   . SER A 1 866 ? 97.112  -48.315 118.290 1.00 29.05  ?  877  SER A C   1 
ATOM   5966 O  O   . SER A 1 866 ? 96.581  -49.356 117.893 1.00 27.60  ?  877  SER A O   1 
ATOM   5967 C  CB  . SER A 1 866 ? 99.073  -47.437 117.025 1.00 28.52  ?  877  SER A CB  1 
ATOM   5968 O  OG  . SER A 1 866 ? 98.496  -48.045 115.885 1.00 33.09  ?  877  SER A OG  1 
ATOM   5969 N  N   . LEU A 1 867 ? 96.423  -47.278 118.740 1.00 25.74  ?  878  LEU A N   1 
ATOM   5970 C  CA  . LEU A 1 867 ? 94.987  -47.138 118.610 1.00 26.66  ?  878  LEU A CA  1 
ATOM   5971 C  C   . LEU A 1 867 ? 94.668  -46.034 117.609 1.00 33.38  ?  878  LEU A C   1 
ATOM   5972 O  O   . LEU A 1 867 ? 95.346  -44.999 117.594 1.00 34.49  ?  878  LEU A O   1 
ATOM   5973 C  CB  . LEU A 1 867 ? 94.332  -46.812 119.958 1.00 26.34  ?  878  LEU A CB  1 
ATOM   5974 C  CG  . LEU A 1 867 ? 94.295  -47.929 121.003 1.00 28.34  ?  878  LEU A CG  1 
ATOM   5975 C  CD1 . LEU A 1 867 ? 93.788  -47.403 122.338 1.00 27.53  ?  878  LEU A CD1 1 
ATOM   5976 C  CD2 . LEU A 1 867 ? 93.432  -49.086 120.522 1.00 29.64  ?  878  LEU A CD2 1 
ATOM   5977 N  N   . PRO A 1 868 ? 93.649  -46.217 116.756 1.00 32.42  ?  879  PRO A N   1 
ATOM   5978 C  CA  . PRO A 1 868 ? 92.787  -47.399 116.701 1.00 32.15  ?  879  PRO A CA  1 
ATOM   5979 C  C   . PRO A 1 868 ? 93.167  -48.394 115.605 1.00 34.91  ?  879  PRO A C   1 
ATOM   5980 O  O   . PRO A 1 868 ? 92.405  -49.326 115.356 1.00 34.79  ?  879  PRO A O   1 
ATOM   5981 C  CB  . PRO A 1 868 ? 91.422  -46.791 116.401 1.00 34.19  ?  879  PRO A CB  1 
ATOM   5982 C  CG  . PRO A 1 868 ? 91.764  -45.662 115.464 1.00 38.73  ?  879  PRO A CG  1 
ATOM   5983 C  CD  . PRO A 1 868 ? 93.125  -45.136 115.903 1.00 34.49  ?  879  PRO A CD  1 
ATOM   5984 N  N   . LEU A 1 869 ? 94.324  -48.204 114.968 1.00 27.77  ?  880  LEU A N   1 
ATOM   5985 C  CA  . LEU A 1 869 ? 94.676  -48.954 113.768 1.00 27.12  ?  880  LEU A CA  1 
ATOM   5986 C  C   . LEU A 1 869 ? 95.402  -50.265 114.050 1.00 30.63  ?  880  LEU A C   1 
ATOM   5987 O  O   . LEU A 1 869 ? 95.604  -51.049 113.115 1.00 28.05  ?  880  LEU A O   1 
ATOM   5988 C  CB  . LEU A 1 869 ? 95.537  -48.088 112.842 1.00 27.08  ?  880  LEU A CB  1 
ATOM   5989 C  CG  . LEU A 1 869 ? 94.864  -46.821 112.309 1.00 32.53  ?  880  LEU A CG  1 
ATOM   5990 C  CD1 . LEU A 1 869 ? 95.764  -46.122 111.300 1.00 33.51  ?  880  LEU A CD1 1 
ATOM   5991 C  CD2 . LEU A 1 869 ? 93.504  -47.139 111.698 1.00 34.14  ?  880  LEU A CD2 1 
ATOM   5992 N  N   . LEU A 1 870 ? 95.798  -50.519 115.299 1.00 29.53  ?  881  LEU A N   1 
ATOM   5993 C  CA  . LEU A 1 870 ? 96.450  -51.772 115.688 1.00 28.40  ?  881  LEU A CA  1 
ATOM   5994 C  C   . LEU A 1 870 ? 97.742  -52.002 114.902 1.00 30.60  ?  881  LEU A C   1 
ATOM   5995 O  O   . LEU A 1 870 ? 97.977  -53.077 114.344 1.00 30.64  ?  881  LEU A O   1 
ATOM   5996 C  CB  . LEU A 1 870 ? 95.501  -52.965 115.531 1.00 28.03  ?  881  LEU A CB  1 
ATOM   5997 C  CG  . LEU A 1 870 ? 94.107  -52.856 116.150 1.00 31.98  ?  881  LEU A CG  1 
ATOM   5998 C  CD1 . LEU A 1 870 ? 93.336  -54.148 115.933 1.00 31.88  ?  881  LEU A CD1 1 
ATOM   5999 C  CD2 . LEU A 1 870 ? 94.183  -52.515 117.631 1.00 32.45  ?  881  LEU A CD2 1 
ATOM   6000 N  N   . LYS A 1 871 ? 98.591  -50.979 114.866 1.00 26.39  ?  882  LYS A N   1 
ATOM   6001 C  CA  . LYS A 1 871 ? 99.893  -51.097 114.228 1.00 25.42  ?  882  LYS A CA  1 
ATOM   6002 C  C   . LYS A 1 871 ? 100.984 -51.140 115.285 1.00 28.83  ?  882  LYS A C   1 
ATOM   6003 O  O   . LYS A 1 871 ? 101.028 -50.256 116.152 1.00 27.99  ?  882  LYS A O   1 
ATOM   6004 C  CB  . LYS A 1 871 ? 100.137 -49.925 113.270 1.00 27.64  ?  882  LYS A CB  1 
ATOM   6005 C  CG  . LYS A 1 871 ? 99.167  -49.861 112.097 1.00 39.17  ?  882  LYS A CG  1 
ATOM   6006 C  CD  . LYS A 1 871 ? 99.350  -51.043 111.158 1.00 47.07  ?  882  LYS A CD  1 
ATOM   6007 C  CE  . LYS A 1 871 ? 98.403  -50.961 109.970 1.00 50.82  ?  882  LYS A CE  1 
ATOM   6008 N  NZ  . LYS A 1 871 ? 98.655  -52.041 108.972 1.00 45.12  ?  882  LYS A NZ  1 
ATOM   6009 N  N   . PRO A 1 872 ? 101.869 -52.137 115.260 1.00 18.95  ?  883  PRO A N   1 
ATOM   6010 C  CA  . PRO A 1 872 ? 102.935 -52.198 116.268 1.00 17.96  ?  883  PRO A CA  1 
ATOM   6011 C  C   . PRO A 1 872 ? 103.850 -50.987 116.167 1.00 21.62  ?  883  PRO A C   1 
ATOM   6012 O  O   . PRO A 1 872 ? 104.330 -50.639 115.086 1.00 21.44  ?  883  PRO A O   1 
ATOM   6013 C  CB  . PRO A 1 872 ? 103.670 -53.499 115.926 1.00 19.06  ?  883  PRO A CB  1 
ATOM   6014 C  CG  . PRO A 1 872 ? 103.366 -53.736 114.488 1.00 23.37  ?  883  PRO A CG  1 
ATOM   6015 C  CD  . PRO A 1 872 ? 101.974 -53.225 114.276 1.00 19.67  ?  883  PRO A CD  1 
ATOM   6016 N  N   . GLN A 1 873 ? 104.082 -50.335 117.308 1.00 21.84  ?  884  GLN A N   1 
ATOM   6017 C  CA  . GLN A 1 873 ? 104.870 -49.106 117.351 1.00 21.34  ?  884  GLN A CA  1 
ATOM   6018 C  C   . GLN A 1 873 ? 106.299 -49.351 117.825 1.00 24.41  ?  884  GLN A C   1 
ATOM   6019 O  O   . GLN A 1 873 ? 107.252 -49.070 117.092 1.00 24.72  ?  884  GLN A O   1 
ATOM   6020 C  CB  . GLN A 1 873 ? 104.171 -48.068 118.239 1.00 22.81  ?  884  GLN A CB  1 
ATOM   6021 C  CG  . GLN A 1 873 ? 102.822 -47.625 117.694 1.00 15.37  ?  884  GLN A CG  1 
ATOM   6022 C  CD  . GLN A 1 873 ? 102.918 -47.108 116.270 1.00 38.21  ?  884  GLN A CD  1 
ATOM   6023 O  OE1 . GLN A 1 873 ? 103.587 -46.111 116.006 1.00 33.40  ?  884  GLN A OE1 1 
ATOM   6024 N  NE2 . GLN A 1 873 ? 102.256 -47.792 115.343 1.00 35.64  ?  884  GLN A NE2 1 
ATOM   6025 N  N   . VAL A 1 874 ? 106.470 -49.867 119.042 1.00 19.51  ?  885  VAL A N   1 
ATOM   6026 C  CA  . VAL A 1 874 ? 107.794 -50.151 119.585 1.00 19.63  ?  885  VAL A CA  1 
ATOM   6027 C  C   . VAL A 1 874 ? 107.742 -51.455 120.371 1.00 24.12  ?  885  VAL A C   1 
ATOM   6028 O  O   . VAL A 1 874 ? 106.700 -51.838 120.910 1.00 24.18  ?  885  VAL A O   1 
ATOM   6029 C  CB  . VAL A 1 874 ? 108.320 -49.005 120.482 1.00 21.84  ?  885  VAL A CB  1 
ATOM   6030 C  CG1 . VAL A 1 874 ? 108.733 -47.801 119.640 1.00 21.15  ?  885  VAL A CG1 1 
ATOM   6031 C  CG2 . VAL A 1 874 ? 107.273 -48.611 121.515 1.00 20.91  ?  885  VAL A CG2 1 
ATOM   6032 N  N   . ARG A 1 875 ? 108.886 -52.137 120.432 1.00 19.71  ?  886  ARG A N   1 
ATOM   6033 C  CA  . ARG A 1 875 ? 109.028 -53.388 121.168 1.00 17.97  ?  886  ARG A CA  1 
ATOM   6034 C  C   . ARG A 1 875 ? 110.284 -53.307 122.019 1.00 19.92  ?  886  ARG A C   1 
ATOM   6035 O  O   . ARG A 1 875 ? 111.362 -52.997 121.504 1.00 20.20  ?  886  ARG A O   1 
ATOM   6036 C  CB  . ARG A 1 875 ? 109.102 -54.589 120.216 1.00 16.69  ?  886  ARG A CB  1 
ATOM   6037 C  CG  . ARG A 1 875 ? 109.170 -55.941 120.914 1.00 24.16  ?  886  ARG A CG  1 
ATOM   6038 C  CD  . ARG A 1 875 ? 109.173 -57.099 119.917 1.00 33.69  ?  886  ARG A CD  1 
ATOM   6039 N  NE  . ARG A 1 875 ? 110.471 -57.271 119.268 1.00 46.10  ?  886  ARG A NE  1 
ATOM   6040 C  CZ  . ARG A 1 875 ? 110.762 -56.849 118.040 1.00 64.50  ?  886  ARG A CZ  1 
ATOM   6041 N  NH1 . ARG A 1 875 ? 109.843 -56.227 117.313 1.00 59.19  ?  886  ARG A NH1 1 
ATOM   6042 N  NH2 . ARG A 1 875 ? 111.973 -57.051 117.537 1.00 38.64  ?  886  ARG A NH2 1 
ATOM   6043 N  N   . TYR A 1 876 ? 110.152 -53.582 123.315 1.00 18.02  ?  887  TYR A N   1 
ATOM   6044 C  CA  . TYR A 1 876 ? 111.257 -53.436 124.252 1.00 17.25  ?  887  TYR A CA  1 
ATOM   6045 C  C   . TYR A 1 876 ? 111.515 -54.735 125.002 1.00 23.21  ?  887  TYR A C   1 
ATOM   6046 O  O   . TYR A 1 876 ? 110.584 -55.475 125.330 1.00 22.91  ?  887  TYR A O   1 
ATOM   6047 C  CB  . TYR A 1 876 ? 110.985 -52.316 125.262 1.00 18.21  ?  887  TYR A CB  1 
ATOM   6048 C  CG  . TYR A 1 876 ? 110.811 -50.958 124.627 1.00 19.31  ?  887  TYR A CG  1 
ATOM   6049 C  CD1 . TYR A 1 876 ? 111.831 -50.385 123.881 1.00 20.82  ?  887  TYR A CD1 1 
ATOM   6050 C  CD2 . TYR A 1 876 ? 109.630 -50.244 124.780 1.00 19.50  ?  887  TYR A CD2 1 
ATOM   6051 C  CE1 . TYR A 1 876 ? 111.677 -49.145 123.298 1.00 20.17  ?  887  TYR A CE1 1 
ATOM   6052 C  CE2 . TYR A 1 876 ? 109.469 -49.001 124.203 1.00 19.38  ?  887  TYR A CE2 1 
ATOM   6053 C  CZ  . TYR A 1 876 ? 110.495 -48.457 123.464 1.00 21.43  ?  887  TYR A CZ  1 
ATOM   6054 O  OH  . TYR A 1 876 ? 110.335 -47.220 122.888 1.00 22.23  ?  887  TYR A OH  1 
ATOM   6055 N  N   . SER A 1 877 ? 112.787 -55.000 125.273 1.00 23.51  ?  888  SER A N   1 
ATOM   6056 C  CA  . SER A 1 877 ? 113.167 -56.093 126.154 1.00 23.71  ?  888  SER A CA  1 
ATOM   6057 C  C   . SER A 1 877 ? 113.030 -55.627 127.598 1.00 26.94  ?  888  SER A C   1 
ATOM   6058 O  O   . SER A 1 877 ? 113.507 -54.546 127.956 1.00 28.94  ?  888  SER A O   1 
ATOM   6059 C  CB  . SER A 1 877 ? 114.600 -56.537 125.861 1.00 28.32  ?  888  SER A CB  1 
ATOM   6060 O  OG  . SER A 1 877 ? 114.874 -57.813 126.421 1.00 33.62  ?  888  SER A OG  1 
ATOM   6061 N  N   . CYS A 1 878 ? 112.368 -56.430 128.427 1.00 18.81  ?  889  CYS A N   1 
ATOM   6062 C  CA  . CYS A 1 878 ? 112.132 -56.015 129.807 1.00 18.52  ?  889  CYS A CA  1 
ATOM   6063 C  C   . CYS A 1 878 ? 112.309 -57.169 130.786 1.00 23.76  ?  889  CYS A C   1 
ATOM   6064 O  O   . CYS A 1 878 ? 113.276 -57.197 131.553 1.00 24.75  ?  889  CYS A O   1 
ATOM   6065 C  CB  . CYS A 1 878 ? 110.731 -55.413 129.949 1.00 18.54  ?  889  CYS A CB  1 
ATOM   6066 S  SG  . CYS A 1 878 ? 110.368 -54.721 131.588 1.00 22.60  ?  889  CYS A SG  1 
ATOM   6067 N  N   . ILE A 1 879 ? 111.381 -58.115 130.780 1.00 20.07  ?  890  ILE A N   1 
ATOM   6068 C  CA  . ILE A 1 879 ? 111.413 -59.253 131.690 1.00 18.52  ?  890  ILE A CA  1 
ATOM   6069 C  C   . ILE A 1 879 ? 111.975 -60.454 130.944 1.00 22.80  ?  890  ILE A C   1 
ATOM   6070 O  O   . ILE A 1 879 ? 111.698 -60.647 129.752 1.00 20.10  ?  890  ILE A O   1 
ATOM   6071 C  CB  . ILE A 1 879 ? 110.011 -59.547 132.254 1.00 20.23  ?  890  ILE A CB  1 
ATOM   6072 C  CG1 . ILE A 1 879 ? 109.357 -58.245 132.726 1.00 20.04  ?  890  ILE A CG1 1 
ATOM   6073 C  CG2 . ILE A 1 879 ? 110.094 -60.557 133.390 1.00 18.74  ?  890  ILE A CG2 1 
ATOM   6074 C  CD1 . ILE A 1 879 ? 107.956 -58.416 133.269 1.00 18.70  ?  890  ILE A CD1 1 
ATOM   6075 N  N   . ARG A 1 880 ? 112.772 -61.259 131.638 1.00 22.24  ?  891  ARG A N   1 
ATOM   6076 C  CA  . ARG A 1 880 ? 113.402 -62.402 130.993 1.00 22.79  ?  891  ARG A CA  1 
ATOM   6077 C  C   . ARG A 1 880 ? 112.375 -63.474 130.651 1.00 27.67  ?  891  ARG A C   1 
ATOM   6078 O  O   . ARG A 1 880 ? 111.383 -63.662 131.361 1.00 28.20  ?  891  ARG A O   1 
ATOM   6079 C  CB  . ARG A 1 880 ? 114.501 -62.984 131.882 1.00 23.24  ?  891  ARG A CB  1 
ATOM   6080 C  CG  . ARG A 1 880 ? 115.766 -62.149 131.871 1.00 38.93  ?  891  ARG A CG  1 
ATOM   6081 C  CD  . ARG A 1 880 ? 116.833 -62.723 132.777 1.00 63.56  ?  891  ARG A CD  1 
ATOM   6082 N  NE  . ARG A 1 880 ? 117.926 -61.773 132.962 1.00 81.62  ?  891  ARG A NE  1 
ATOM   6083 C  CZ  . ARG A 1 880 ? 118.858 -61.885 133.901 1.00 90.89  ?  891  ARG A CZ  1 
ATOM   6084 N  NH1 . ARG A 1 880 ? 118.832 -62.900 134.749 1.00 68.28  ?  891  ARG A NH1 1 
ATOM   6085 N  NH2 . ARG A 1 880 ? 119.814 -60.969 133.998 1.00 75.84  ?  891  ARG A NH2 1 
ATOM   6086 N  N   . ARG A 1 881 ? 112.634 -64.173 129.544 1.00 30.29  ?  892  ARG A N   1 
ATOM   6087 C  CA  . ARG A 1 881 ? 111.724 -65.197 129.042 1.00 30.96  ?  892  ARG A CA  1 
ATOM   6088 C  C   . ARG A 1 881 ? 111.435 -66.259 130.095 1.00 38.55  ?  892  ARG A C   1 
ATOM   6089 O  O   . ARG A 1 881 ? 110.297 -66.720 130.232 1.00 39.53  ?  892  ARG A O   1 
ATOM   6090 C  CB  . ARG A 1 881 ? 112.337 -65.825 127.789 1.00 29.97  ?  892  ARG A CB  1 
ATOM   6091 C  CG  . ARG A 1 881 ? 111.356 -66.494 126.861 1.00 34.37  ?  892  ARG A CG  1 
ATOM   6092 C  CD  . ARG A 1 881 ? 111.957 -66.639 125.472 1.00 40.78  ?  892  ARG A CD  1 
ATOM   6093 N  NE  . ARG A 1 881 ? 112.225 -65.344 124.853 1.00 33.34  ?  892  ARG A NE  1 
ATOM   6094 C  CZ  . ARG A 1 881 ? 112.513 -65.178 123.567 1.00 38.73  ?  892  ARG A CZ  1 
ATOM   6095 N  NH1 . ARG A 1 881 ? 112.570 -66.228 122.761 1.00 32.38  ?  892  ARG A NH1 1 
ATOM   6096 N  NH2 . ARG A 1 881 ? 112.741 -63.962 123.085 1.00 30.67  ?  892  ARG A NH2 1 
ATOM   6097 N  N   . GLU A 1 882 ? 112.457 -66.647 130.859 1.00 31.20  ?  893  GLU A N   1 
ATOM   6098 C  CA  . GLU A 1 882 ? 112.329 -67.695 131.863 1.00 31.35  ?  893  GLU A CA  1 
ATOM   6099 C  C   . GLU A 1 882 ? 111.660 -67.217 133.148 1.00 35.85  ?  893  GLU A C   1 
ATOM   6100 O  O   . GLU A 1 882 ? 111.239 -68.053 133.955 1.00 36.03  ?  893  GLU A O   1 
ATOM   6101 C  CB  . GLU A 1 882 ? 113.711 -68.264 132.199 1.00 32.95  ?  893  GLU A CB  1 
ATOM   6102 C  CG  . GLU A 1 882 ? 114.573 -68.630 130.992 1.00 45.73  ?  893  GLU A CG  1 
ATOM   6103 C  CD  . GLU A 1 882 ? 115.281 -67.433 130.383 1.00 69.23  ?  893  GLU A CD  1 
ATOM   6104 O  OE1 . GLU A 1 882 ? 115.174 -67.243 129.153 1.00 56.05  ?  893  GLU A OE1 1 
ATOM   6105 O  OE2 . GLU A 1 882 ? 115.932 -66.678 131.136 1.00 65.75  ?  893  GLU A OE2 1 
ATOM   6106 N  N   . ASP A 1 883 ? 111.554 -65.903 133.359 1.00 24.46  ?  894  ASP A N   1 
ATOM   6107 C  CA  . ASP A 1 883 ? 111.064 -65.343 134.622 1.00 23.44  ?  894  ASP A CA  1 
ATOM   6108 C  C   . ASP A 1 883 ? 109.533 -65.347 134.623 1.00 28.31  ?  894  ASP A C   1 
ATOM   6109 O  O   . ASP A 1 883 ? 108.868 -64.319 134.479 1.00 27.37  ?  894  ASP A O   1 
ATOM   6110 C  CB  . ASP A 1 883 ? 111.634 -63.944 134.828 1.00 24.72  ?  894  ASP A CB  1 
ATOM   6111 C  CG  . ASP A 1 883 ? 111.368 -63.388 136.221 1.00 32.16  ?  894  ASP A CG  1 
ATOM   6112 O  OD1 . ASP A 1 883 ? 110.780 -64.100 137.063 1.00 34.41  ?  894  ASP A OD1 1 
ATOM   6113 O  OD2 . ASP A 1 883 ? 111.756 -62.225 136.472 1.00 37.98  ?  894  ASP A OD2 1 
ATOM   6114 N  N   . VAL A 1 884 ? 108.976 -66.549 134.800 1.00 34.47  ?  895  VAL A N   1 
ATOM   6115 C  CA  . VAL A 1 884 ? 107.523 -66.719 134.787 1.00 35.52  ?  895  VAL A CA  1 
ATOM   6116 C  C   . VAL A 1 884 ? 106.870 -65.906 135.901 1.00 38.70  ?  895  VAL A C   1 
ATOM   6117 O  O   . VAL A 1 884 ? 105.797 -65.320 135.715 1.00 39.54  ?  895  VAL A O   1 
ATOM   6118 C  CB  . VAL A 1 884 ? 107.156 -68.213 134.886 1.00 40.12  ?  895  VAL A CB  1 
ATOM   6119 C  CG1 . VAL A 1 884 ? 107.350 -68.903 133.543 1.00 39.53  ?  895  VAL A CG1 1 
ATOM   6120 C  CG2 . VAL A 1 884 ? 107.990 -68.901 135.961 1.00 40.30  ?  895  VAL A CG2 1 
ATOM   6121 N  N   . SER A 1 885 ? 107.506 -65.856 137.074 1.00 30.72  ?  896  SER A N   1 
ATOM   6122 C  CA  . SER A 1 885 ? 106.936 -65.114 138.194 1.00 29.50  ?  896  SER A CA  1 
ATOM   6123 C  C   . SER A 1 885 ? 106.954 -63.613 137.933 1.00 28.91  ?  896  SER A C   1 
ATOM   6124 O  O   . SER A 1 885 ? 105.979 -62.913 138.232 1.00 27.77  ?  896  SER A O   1 
ATOM   6125 C  CB  . SER A 1 885 ? 107.698 -65.445 139.476 1.00 34.29  ?  896  SER A CB  1 
ATOM   6126 O  OG  . SER A 1 885 ? 107.869 -66.844 139.614 1.00 46.83  ?  896  SER A OG  1 
ATOM   6127 N  N   . GLY A 1 886 ? 108.057 -63.099 137.384 1.00 23.22  ?  897  GLY A N   1 
ATOM   6128 C  CA  . GLY A 1 886 ? 108.122 -61.680 137.077 1.00 22.27  ?  897  GLY A CA  1 
ATOM   6129 C  C   . GLY A 1 886 ? 107.108 -61.265 136.030 1.00 24.51  ?  897  GLY A C   1 
ATOM   6130 O  O   . GLY A 1 886 ? 106.525 -60.182 136.111 1.00 24.17  ?  897  GLY A O   1 
ATOM   6131 N  N   . ILE A 1 887 ? 106.882 -62.124 135.035 1.00 19.50  ?  898  ILE A N   1 
ATOM   6132 C  CA  . ILE A 1 887 ? 105.875 -61.840 134.017 1.00 18.10  ?  898  ILE A CA  1 
ATOM   6133 C  C   . ILE A 1 887 ? 104.480 -61.885 134.628 1.00 22.94  ?  898  ILE A C   1 
ATOM   6134 O  O   . ILE A 1 887 ? 103.651 -61.000 134.388 1.00 24.30  ?  898  ILE A O   1 
ATOM   6135 C  CB  . ILE A 1 887 ? 106.014 -62.826 132.842 1.00 20.97  ?  898  ILE A CB  1 
ATOM   6136 C  CG1 . ILE A 1 887 ? 107.302 -62.550 132.057 1.00 21.56  ?  898  ILE A CG1 1 
ATOM   6137 C  CG2 . ILE A 1 887 ? 104.798 -62.751 131.931 1.00 21.62  ?  898  ILE A CG2 1 
ATOM   6138 C  CD1 . ILE A 1 887 ? 107.664 -63.635 131.056 1.00 25.59  ?  898  ILE A CD1 1 
ATOM   6139 N  N   . ALA A 1 888 ? 104.209 -62.911 135.442 1.00 19.34  ?  899  ALA A N   1 
ATOM   6140 C  CA  . ALA A 1 888 ? 102.895 -63.055 136.063 1.00 19.10  ?  899  ALA A CA  1 
ATOM   6141 C  C   . ALA A 1 888 ? 102.558 -61.871 136.958 1.00 24.34  ?  899  ALA A C   1 
ATOM   6142 O  O   . ALA A 1 888 ? 101.379 -61.546 137.136 1.00 25.47  ?  899  ALA A O   1 
ATOM   6143 C  CB  . ALA A 1 888 ? 102.830 -64.352 136.866 1.00 19.20  ?  899  ALA A CB  1 
ATOM   6144 N  N   . SER A 1 889 ? 103.570 -61.213 137.520 1.00 21.70  ?  900  SER A N   1 
ATOM   6145 C  CA  . SER A 1 889 ? 103.361 -60.113 138.452 1.00 20.92  ?  900  SER A CA  1 
ATOM   6146 C  C   . SER A 1 889 ? 103.367 -58.742 137.788 1.00 23.02  ?  900  SER A C   1 
ATOM   6147 O  O   . SER A 1 889 ? 103.038 -57.755 138.454 1.00 23.18  ?  900  SER A O   1 
ATOM   6148 C  CB  . SER A 1 889 ? 104.435 -60.137 139.543 1.00 22.63  ?  900  SER A CB  1 
ATOM   6149 O  OG  . SER A 1 889 ? 105.689 -59.723 139.025 1.00 31.55  ?  900  SER A OG  1 
ATOM   6150 N  N   . CYS A 1 890 ? 103.734 -58.650 136.511 1.00 17.83  ?  901  CYS A N   1 
ATOM   6151 C  CA  . CYS A 1 890 ? 103.894 -57.349 135.873 1.00 17.83  ?  901  CYS A CA  1 
ATOM   6152 C  C   . CYS A 1 890 ? 102.552 -56.636 135.757 1.00 22.48  ?  901  CYS A C   1 
ATOM   6153 O  O   . CYS A 1 890 ? 101.518 -57.257 135.494 1.00 21.94  ?  901  CYS A O   1 
ATOM   6154 C  CB  . CYS A 1 890 ? 104.536 -57.504 134.494 1.00 18.17  ?  901  CYS A CB  1 
ATOM   6155 S  SG  . CYS A 1 890 ? 104.826 -55.953 133.593 1.00 22.51  ?  901  CYS A SG  1 
ATOM   6156 N  N   . VAL A 1 891 ? 102.574 -55.321 135.963 1.00 18.87  ?  902  VAL A N   1 
ATOM   6157 C  CA  . VAL A 1 891 ? 101.359 -54.511 135.956 1.00 18.18  ?  902  VAL A CA  1 
ATOM   6158 C  C   . VAL A 1 891 ? 101.710 -53.126 135.424 1.00 22.07  ?  902  VAL A C   1 
ATOM   6159 O  O   . VAL A 1 891 ? 102.773 -52.578 135.732 1.00 20.36  ?  902  VAL A O   1 
ATOM   6160 C  CB  . VAL A 1 891 ? 100.717 -54.457 137.364 1.00 22.82  ?  902  VAL A CB  1 
ATOM   6161 C  CG1 . VAL A 1 891 ? 101.584 -53.669 138.344 1.00 23.01  ?  902  VAL A CG1 1 
ATOM   6162 C  CG2 . VAL A 1 891 ? 99.312  -53.889 137.297 1.00 22.32  ?  902  VAL A CG2 1 
ATOM   6163 N  N   . PHE A 1 892 ? 100.824 -52.570 134.603 1.00 19.49  ?  903  PHE A N   1 
ATOM   6164 C  CA  . PHE A 1 892 ? 101.040 -51.277 133.970 1.00 19.26  ?  903  PHE A CA  1 
ATOM   6165 C  C   . PHE A 1 892 ? 100.329 -50.165 134.732 1.00 25.11  ?  903  PHE A C   1 
ATOM   6166 O  O   . PHE A 1 892 ? 99.427  -50.405 135.539 1.00 22.94  ?  903  PHE A O   1 
ATOM   6167 C  CB  . PHE A 1 892 ? 100.546 -51.285 132.521 1.00 20.03  ?  903  PHE A CB  1 
ATOM   6168 C  CG  . PHE A 1 892 ? 101.346 -52.163 131.603 1.00 20.92  ?  903  PHE A CG  1 
ATOM   6169 C  CD1 . PHE A 1 892 ? 102.632 -51.809 131.230 1.00 21.76  ?  903  PHE A CD1 1 
ATOM   6170 C  CD2 . PHE A 1 892 ? 100.800 -53.326 131.087 1.00 22.30  ?  903  PHE A CD2 1 
ATOM   6171 C  CE1 . PHE A 1 892 ? 103.367 -52.609 130.374 1.00 21.11  ?  903  PHE A CE1 1 
ATOM   6172 C  CE2 . PHE A 1 892 ? 101.529 -54.130 130.231 1.00 23.40  ?  903  PHE A CE2 1 
ATOM   6173 C  CZ  . PHE A 1 892 ? 102.814 -53.770 129.874 1.00 20.26  ?  903  PHE A CZ  1 
ATOM   6174 N  N   . THR A 1 893 ? 100.751 -48.933 134.456 1.00 28.84  ?  904  THR A N   1 
ATOM   6175 C  CA  . THR A 1 893 ? 100.060 -47.736 134.903 1.00 30.02  ?  904  THR A CA  1 
ATOM   6176 C  C   . THR A 1 893 ? 99.405  -47.068 133.703 1.00 36.59  ?  904  THR A C   1 
ATOM   6177 O  O   . THR A 1 893 ? 99.813  -47.270 132.557 1.00 36.73  ?  904  THR A O   1 
ATOM   6178 C  CB  . THR A 1 893 ? 101.012 -46.755 135.599 1.00 32.38  ?  904  THR A CB  1 
ATOM   6179 O  OG1 . THR A 1 893 ? 101.764 -46.026 134.619 1.00 32.29  ?  904  THR A OG1 1 
ATOM   6180 C  CG2 . THR A 1 893 ? 101.967 -47.499 136.522 1.00 28.41  ?  904  THR A CG2 1 
ATOM   6181 N  N   . LYS A 1 894 ? 98.376  -46.263 133.980 1.00 43.24  ?  905  LYS A N   1 
ATOM   6182 C  CA  . LYS A 1 894 ? 97.588  -45.643 132.919 1.00 43.79  ?  905  LYS A CA  1 
ATOM   6183 C  C   . LYS A 1 894 ? 98.369  -44.618 132.108 1.00 46.59  ?  905  LYS A C   1 
ATOM   6184 O  O   . LYS A 1 894 ? 97.849  -44.141 131.095 1.00 46.51  ?  905  LYS A O   1 
ATOM   6185 C  CB  . LYS A 1 894 ? 96.340  -44.979 133.512 1.00 41.29  ?  905  LYS A CB  1 
ATOM   6186 N  N   . TYR A 1 895 ? 99.597  -44.277 132.507 1.00 39.37  ?  906  TYR A N   1 
ATOM   6187 C  CA  . TYR A 1 895 ? 100.341 -43.205 131.854 1.00 39.89  ?  906  TYR A CA  1 
ATOM   6188 C  C   . TYR A 1 895 ? 101.724 -43.645 131.379 1.00 39.22  ?  906  TYR A C   1 
ATOM   6189 O  O   . TYR A 1 895 ? 102.596 -42.798 131.155 1.00 39.28  ?  906  TYR A O   1 
ATOM   6190 C  CB  . TYR A 1 895 ? 100.445 -41.996 132.787 1.00 44.39  ?  906  TYR A CB  1 
ATOM   6191 C  CG  . TYR A 1 895 ? 99.095  -41.385 133.090 1.00 49.35  ?  906  TYR A CG  1 
ATOM   6192 C  CD1 . TYR A 1 895 ? 98.567  -40.385 132.284 1.00 52.23  ?  906  TYR A CD1 1 
ATOM   6193 C  CD2 . TYR A 1 895 ? 98.339  -41.826 134.167 1.00 51.46  ?  906  TYR A CD2 1 
ATOM   6194 C  CE1 . TYR A 1 895 ? 97.327  -39.830 132.551 1.00 54.32  ?  906  TYR A CE1 1 
ATOM   6195 C  CE2 . TYR A 1 895 ? 97.099  -41.279 134.442 1.00 55.85  ?  906  TYR A CE2 1 
ATOM   6196 C  CZ  . TYR A 1 895 ? 96.598  -40.282 133.631 1.00 65.09  ?  906  TYR A CZ  1 
ATOM   6197 O  OH  . TYR A 1 895 ? 95.365  -39.735 133.902 1.00 68.42  ?  906  TYR A OH  1 
ATOM   6198 N  N   . GLY A 1 896 ? 101.940 -44.944 131.204 1.00 23.02  ?  907  GLY A N   1 
ATOM   6199 C  CA  . GLY A 1 896 ? 103.132 -45.432 130.547 1.00 21.30  ?  907  GLY A CA  1 
ATOM   6200 C  C   . GLY A 1 896 ? 104.215 -45.994 131.441 1.00 22.84  ?  907  GLY A C   1 
ATOM   6201 O  O   . GLY A 1 896 ? 105.311 -46.271 130.945 1.00 21.81  ?  907  GLY A O   1 
ATOM   6202 N  N   . GLN A 1 897 ? 103.958 -46.160 132.733 1.00 16.44  ?  908  GLN A N   1 
ATOM   6203 C  CA  . GLN A 1 897 ? 104.907 -46.797 133.629 1.00 16.09  ?  908  GLN A CA  1 
ATOM   6204 C  C   . GLN A 1 897 ? 104.467 -48.231 133.896 1.00 21.16  ?  908  GLN A C   1 
ATOM   6205 O  O   . GLN A 1 897 ? 103.461 -48.709 133.367 1.00 19.22  ?  908  GLN A O   1 
ATOM   6206 C  CB  . GLN A 1 897 ? 105.045 -46.008 134.931 1.00 17.09  ?  908  GLN A CB  1 
ATOM   6207 C  CG  . GLN A 1 897 ? 105.800 -44.705 134.779 1.00 27.50  ?  908  GLN A CG  1 
ATOM   6208 C  CD  . GLN A 1 897 ? 106.034 -44.015 136.103 1.00 37.10  ?  908  GLN A CD  1 
ATOM   6209 O  OE1 . GLN A 1 897 ? 107.173 -43.862 136.541 1.00 28.48  ?  908  GLN A OE1 1 
ATOM   6210 N  NE2 . GLN A 1 897 ? 104.953 -43.588 136.748 1.00 25.02  ?  908  GLN A NE2 1 
ATOM   6211 N  N   . GLY A 1 898 ? 105.234 -48.925 134.730 1.00 25.33  ?  909  GLY A N   1 
ATOM   6212 C  CA  . GLY A 1 898 ? 104.913 -50.306 135.040 1.00 24.77  ?  909  GLY A CA  1 
ATOM   6213 C  C   . GLY A 1 898 ? 105.783 -50.829 136.159 1.00 24.96  ?  909  GLY A C   1 
ATOM   6214 O  O   . GLY A 1 898 ? 106.818 -50.250 136.499 1.00 21.99  ?  909  GLY A O   1 
ATOM   6215 N  N   . PHE A 1 899 ? 105.336 -51.945 136.731 1.00 19.02  ?  910  PHE A N   1 
ATOM   6216 C  CA  . PHE A 1 899 ? 106.034 -52.608 137.820 1.00 18.29  ?  910  PHE A CA  1 
ATOM   6217 C  C   . PHE A 1 899 ? 106.027 -54.107 137.570 1.00 19.93  ?  910  PHE A C   1 
ATOM   6218 O  O   . PHE A 1 899 ? 105.067 -54.652 137.021 1.00 19.88  ?  910  PHE A O   1 
ATOM   6219 C  CB  . PHE A 1 899 ? 105.383 -52.324 139.183 1.00 20.48  ?  910  PHE A CB  1 
ATOM   6220 C  CG  . PHE A 1 899 ? 105.269 -50.865 139.517 1.00 22.97  ?  910  PHE A CG  1 
ATOM   6221 C  CD1 . PHE A 1 899 ? 104.219 -50.111 139.027 1.00 26.74  ?  910  PHE A CD1 1 
ATOM   6222 C  CD2 . PHE A 1 899 ? 106.203 -50.251 140.334 1.00 25.90  ?  910  PHE A CD2 1 
ATOM   6223 C  CE1 . PHE A 1 899 ? 104.107 -48.768 139.333 1.00 27.59  ?  910  PHE A CE1 1 
ATOM   6224 C  CE2 . PHE A 1 899 ? 106.094 -48.906 140.646 1.00 29.46  ?  910  PHE A CE2 1 
ATOM   6225 C  CZ  . PHE A 1 899 ? 105.044 -48.166 140.143 1.00 26.94  ?  910  PHE A CZ  1 
ATOM   6226 N  N   . TYR A 1 900 ? 107.105 -54.770 137.979 1.00 15.59  ?  911  TYR A N   1 
ATOM   6227 C  CA  . TYR A 1 900 ? 107.133 -56.223 137.999 1.00 15.50  ?  911  TYR A CA  1 
ATOM   6228 C  C   . TYR A 1 900 ? 108.097 -56.671 139.085 1.00 20.65  ?  911  TYR A C   1 
ATOM   6229 O  O   . TYR A 1 900 ? 109.006 -55.935 139.480 1.00 19.79  ?  911  TYR A O   1 
ATOM   6230 C  CB  . TYR A 1 900 ? 107.518 -56.815 136.633 1.00 15.35  ?  911  TYR A CB  1 
ATOM   6231 C  CG  . TYR A 1 900 ? 108.979 -56.687 136.259 1.00 16.17  ?  911  TYR A CG  1 
ATOM   6232 C  CD1 . TYR A 1 900 ? 109.449 -55.565 135.589 1.00 18.95  ?  911  TYR A CD1 1 
ATOM   6233 C  CD2 . TYR A 1 900 ? 109.885 -57.701 136.552 1.00 15.22  ?  911  TYR A CD2 1 
ATOM   6234 C  CE1 . TYR A 1 900 ? 110.781 -55.449 135.236 1.00 19.79  ?  911  TYR A CE1 1 
ATOM   6235 C  CE2 . TYR A 1 900 ? 111.218 -57.593 136.205 1.00 15.76  ?  911  TYR A CE2 1 
ATOM   6236 C  CZ  . TYR A 1 900 ? 111.660 -56.465 135.546 1.00 26.64  ?  911  TYR A CZ  1 
ATOM   6237 O  OH  . TYR A 1 900 ? 112.986 -56.352 135.196 1.00 30.19  ?  911  TYR A OH  1 
ATOM   6238 N  N   . LEU A 1 901 ? 107.880 -57.891 139.571 1.00 18.91  ?  912  LEU A N   1 
ATOM   6239 C  CA  . LEU A 1 901 ? 108.674 -58.424 140.669 1.00 18.01  ?  912  LEU A CA  1 
ATOM   6240 C  C   . LEU A 1 901 ? 109.966 -59.037 140.144 1.00 21.10  ?  912  LEU A C   1 
ATOM   6241 O  O   . LEU A 1 901 ? 109.940 -59.919 139.279 1.00 20.29  ?  912  LEU A O   1 
ATOM   6242 C  CB  . LEU A 1 901 ? 107.872 -59.466 141.452 1.00 17.44  ?  912  LEU A CB  1 
ATOM   6243 C  CG  . LEU A 1 901 ? 106.716 -58.945 142.312 1.00 21.48  ?  912  LEU A CG  1 
ATOM   6244 C  CD1 . LEU A 1 901 ? 105.917 -60.097 142.896 1.00 20.27  ?  912  LEU A CD1 1 
ATOM   6245 C  CD2 . LEU A 1 901 ? 107.239 -58.046 143.421 1.00 24.19  ?  912  LEU A CD2 1 
ATOM   6246 N  N   . ILE A 1 902 ? 111.099 -58.546 140.655 1.00 16.48  ?  913  ILE A N   1 
ATOM   6247 C  CA  . ILE A 1 902 ? 112.383 -59.206 140.455 1.00 14.90  ?  913  ILE A CA  1 
ATOM   6248 C  C   . ILE A 1 902 ? 112.663 -60.227 141.547 1.00 16.89  ?  913  ILE A C   1 
ATOM   6249 O  O   . ILE A 1 902 ? 113.596 -61.034 141.408 1.00 17.00  ?  913  ILE A O   1 
ATOM   6250 C  CB  . ILE A 1 902 ? 113.530 -58.178 140.392 1.00 17.80  ?  913  ILE A CB  1 
ATOM   6251 C  CG1 . ILE A 1 902 ? 113.547 -57.325 141.664 1.00 18.29  ?  913  ILE A CG1 1 
ATOM   6252 C  CG2 . ILE A 1 902 ? 113.401 -57.303 139.151 1.00 17.78  ?  913  ILE A CG2 1 
ATOM   6253 C  CD1 . ILE A 1 902 ? 114.655 -56.290 141.710 1.00 19.57  ?  913  ILE A CD1 1 
ATOM   6254 N  N   . SER A 1 903 ? 111.880 -60.222 142.620 1.00 16.02  ?  914  SER A N   1 
ATOM   6255 C  CA  . SER A 1 903 ? 112.015 -61.161 143.726 1.00 16.24  ?  914  SER A CA  1 
ATOM   6256 C  C   . SER A 1 903 ? 110.705 -61.138 144.504 1.00 21.67  ?  914  SER A C   1 
ATOM   6257 O  O   . SER A 1 903 ? 109.852 -60.273 144.263 1.00 20.50  ?  914  SER A O   1 
ATOM   6258 C  CB  . SER A 1 903 ? 113.205 -60.788 144.628 1.00 20.17  ?  914  SER A CB  1 
ATOM   6259 O  OG  . SER A 1 903 ? 112.885 -59.677 145.445 1.00 25.69  ?  914  SER A OG  1 
ATOM   6260 N  N   . PRO A 1 904 ? 110.501 -62.076 145.438 1.00 23.00  ?  915  PRO A N   1 
ATOM   6261 C  CA  . PRO A 1 904 ? 109.231 -62.079 146.190 1.00 22.56  ?  915  PRO A CA  1 
ATOM   6262 C  C   . PRO A 1 904 ? 108.949 -60.788 146.942 1.00 28.41  ?  915  PRO A C   1 
ATOM   6263 O  O   . PRO A 1 904 ? 107.783 -60.517 147.254 1.00 30.19  ?  915  PRO A O   1 
ATOM   6264 C  CB  . PRO A 1 904 ? 109.403 -63.251 147.164 1.00 24.34  ?  915  PRO A CB  1 
ATOM   6265 C  CG  . PRO A 1 904 ? 110.374 -64.150 146.494 1.00 29.68  ?  915  PRO A CG  1 
ATOM   6266 C  CD  . PRO A 1 904 ? 111.329 -63.251 145.772 1.00 25.06  ?  915  PRO A CD  1 
ATOM   6267 N  N   . SER A 1 905 ? 109.970 -59.984 147.235 1.00 19.39  ?  916  SER A N   1 
ATOM   6268 C  CA  . SER A 1 905 ? 109.830 -58.846 148.133 1.00 19.08  ?  916  SER A CA  1 
ATOM   6269 C  C   . SER A 1 905 ? 110.207 -57.515 147.495 1.00 22.94  ?  916  SER A C   1 
ATOM   6270 O  O   . SER A 1 905 ? 110.268 -56.506 148.205 1.00 21.69  ?  916  SER A O   1 
ATOM   6271 C  CB  . SER A 1 905 ? 110.690 -59.061 149.384 1.00 22.53  ?  916  SER A CB  1 
ATOM   6272 O  OG  . SER A 1 905 ? 112.051 -59.251 149.033 1.00 28.64  ?  916  SER A OG  1 
ATOM   6273 N  N   . GLU A 1 906 ? 110.465 -57.474 146.190 1.00 22.07  ?  917  GLU A N   1 
ATOM   6274 C  CA  . GLU A 1 906 ? 110.972 -56.251 145.582 1.00 21.44  ?  917  GLU A CA  1 
ATOM   6275 C  C   . GLU A 1 906 ? 110.415 -56.085 144.175 1.00 23.67  ?  917  GLU A C   1 
ATOM   6276 O  O   . GLU A 1 906 ? 110.467 -57.017 143.368 1.00 22.99  ?  917  GLU A O   1 
ATOM   6277 C  CB  . GLU A 1 906 ? 112.505 -56.257 145.553 1.00 22.61  ?  917  GLU A CB  1 
ATOM   6278 C  CG  . GLU A 1 906 ? 113.132 -54.931 145.151 1.00 30.92  ?  917  GLU A CG  1 
ATOM   6279 C  CD  . GLU A 1 906 ? 114.631 -54.908 145.377 1.00 50.35  ?  917  GLU A CD  1 
ATOM   6280 O  OE1 . GLU A 1 906 ? 115.185 -53.811 145.604 1.00 39.09  ?  917  GLU A OE1 1 
ATOM   6281 O  OE2 . GLU A 1 906 ? 115.254 -55.989 145.334 1.00 45.73  ?  917  GLU A OE2 1 
ATOM   6282 N  N   . PHE A 1 907 ? 109.886 -54.895 143.895 1.00 19.00  ?  918  PHE A N   1 
ATOM   6283 C  CA  . PHE A 1 907 ? 109.425 -54.526 142.564 1.00 18.80  ?  918  PHE A CA  1 
ATOM   6284 C  C   . PHE A 1 907 ? 110.521 -53.793 141.806 1.00 21.34  ?  918  PHE A C   1 
ATOM   6285 O  O   . PHE A 1 907 ? 111.380 -53.135 142.397 1.00 19.60  ?  918  PHE A O   1 
ATOM   6286 C  CB  . PHE A 1 907 ? 108.193 -53.621 142.628 1.00 20.71  ?  918  PHE A CB  1 
ATOM   6287 C  CG  . PHE A 1 907 ? 106.891 -54.355 142.761 1.00 22.26  ?  918  PHE A CG  1 
ATOM   6288 C  CD1 . PHE A 1 907 ? 106.349 -55.033 141.684 1.00 24.46  ?  918  PHE A CD1 1 
ATOM   6289 C  CD2 . PHE A 1 907 ? 106.189 -54.331 143.955 1.00 24.11  ?  918  PHE A CD2 1 
ATOM   6290 C  CE1 . PHE A 1 907 ? 105.141 -55.696 141.803 1.00 25.33  ?  918  PHE A CE1 1 
ATOM   6291 C  CE2 . PHE A 1 907 ? 104.980 -54.993 144.083 1.00 26.63  ?  918  PHE A CE2 1 
ATOM   6292 C  CZ  . PHE A 1 907 ? 104.455 -55.676 143.006 1.00 23.67  ?  918  PHE A CZ  1 
ATOM   6293 N  N   . GLU A 1 908 ? 110.473 -53.909 140.484 1.00 20.00  ?  919  GLU A N   1 
ATOM   6294 C  CA  . GLU A 1 908 ? 111.251 -53.079 139.577 1.00 18.65  ?  919  GLU A CA  1 
ATOM   6295 C  C   . GLU A 1 908 ? 110.289 -52.143 138.865 1.00 20.80  ?  919  GLU A C   1 
ATOM   6296 O  O   . GLU A 1 908 ? 109.246 -52.583 138.374 1.00 17.97  ?  919  GLU A O   1 
ATOM   6297 C  CB  . GLU A 1 908 ? 112.015 -53.931 138.562 1.00 19.67  ?  919  GLU A CB  1 
ATOM   6298 C  CG  . GLU A 1 908 ? 112.796 -53.137 137.517 1.00 29.05  ?  919  GLU A CG  1 
ATOM   6299 C  CD  . GLU A 1 908 ? 114.131 -52.634 138.034 1.00 44.00  ?  919  GLU A CD  1 
ATOM   6300 O  OE1 . GLU A 1 908 ? 114.283 -51.405 138.201 1.00 34.46  ?  919  GLU A OE1 1 
ATOM   6301 O  OE2 . GLU A 1 908 ? 115.028 -53.469 138.273 1.00 43.29  ?  919  GLU A OE2 1 
ATOM   6302 N  N   . ARG A 1 909 ? 110.623 -50.858 138.829 1.00 21.94  ?  920  ARG A N   1 
ATOM   6303 C  CA  . ARG A 1 909 ? 109.812 -49.871 138.130 1.00 21.74  ?  920  ARG A CA  1 
ATOM   6304 C  C   . ARG A 1 909 ? 110.466 -49.523 136.801 1.00 23.60  ?  920  ARG A C   1 
ATOM   6305 O  O   . ARG A 1 909 ? 111.679 -49.296 136.740 1.00 23.29  ?  920  ARG A O   1 
ATOM   6306 C  CB  . ARG A 1 909 ? 109.621 -48.607 138.968 1.00 23.10  ?  920  ARG A CB  1 
ATOM   6307 C  CG  . ARG A 1 909 ? 108.656 -47.605 138.336 1.00 25.51  ?  920  ARG A CG  1 
ATOM   6308 C  CD  . ARG A 1 909 ? 108.779 -46.220 138.954 1.00 26.32  ?  920  ARG A CD  1 
ATOM   6309 N  NE  . ARG A 1 909 ? 108.185 -46.140 140.285 1.00 26.08  ?  920  ARG A NE  1 
ATOM   6310 C  CZ  . ARG A 1 909 ? 107.091 -45.444 140.575 1.00 37.56  ?  920  ARG A CZ  1 
ATOM   6311 N  NH1 . ARG A 1 909 ? 106.467 -44.757 139.627 1.00 29.34  ?  920  ARG A NH1 1 
ATOM   6312 N  NH2 . ARG A 1 909 ? 106.624 -45.428 141.816 1.00 22.56  ?  920  ARG A NH2 1 
ATOM   6313 N  N   . PHE A 1 910 ? 109.662 -49.491 135.743 1.00 16.24  ?  921  PHE A N   1 
ATOM   6314 C  CA  . PHE A 1 910 ? 110.115 -49.100 134.419 1.00 16.26  ?  921  PHE A CA  1 
ATOM   6315 C  C   . PHE A 1 910 ? 109.139 -48.083 133.848 1.00 20.80  ?  921  PHE A C   1 
ATOM   6316 O  O   . PHE A 1 910 ? 108.026 -47.910 134.351 1.00 20.49  ?  921  PHE A O   1 
ATOM   6317 C  CB  . PHE A 1 910 ? 110.236 -50.307 133.473 1.00 16.78  ?  921  PHE A CB  1 
ATOM   6318 C  CG  . PHE A 1 910 ? 108.946 -51.055 133.276 1.00 16.80  ?  921  PHE A CG  1 
ATOM   6319 C  CD1 . PHE A 1 910 ? 108.037 -50.658 132.308 1.00 18.29  ?  921  PHE A CD1 1 
ATOM   6320 C  CD2 . PHE A 1 910 ? 108.645 -52.159 134.056 1.00 18.48  ?  921  PHE A CD2 1 
ATOM   6321 C  CE1 . PHE A 1 910 ? 106.850 -51.337 132.130 1.00 19.40  ?  921  PHE A CE1 1 
ATOM   6322 C  CE2 . PHE A 1 910 ? 107.459 -52.845 133.878 1.00 21.76  ?  921  PHE A CE2 1 
ATOM   6323 C  CZ  . PHE A 1 910 ? 106.562 -52.435 132.912 1.00 20.24  ?  921  PHE A CZ  1 
ATOM   6324 N  N   . SER A 1 911 ? 109.567 -47.418 132.778 1.00 18.33  ?  922  SER A N   1 
ATOM   6325 C  CA  . SER A 1 911 ? 108.751 -46.428 132.090 1.00 18.01  ?  922  SER A CA  1 
ATOM   6326 C  C   . SER A 1 911 ? 108.806 -46.677 130.591 1.00 21.48  ?  922  SER A C   1 
ATOM   6327 O  O   . SER A 1 911 ? 109.889 -46.877 130.028 1.00 17.49  ?  922  SER A O   1 
ATOM   6328 C  CB  . SER A 1 911 ? 109.225 -45.003 132.404 1.00 21.56  ?  922  SER A CB  1 
ATOM   6329 O  OG  . SER A 1 911 ? 108.521 -44.046 131.631 1.00 32.89  ?  922  SER A OG  1 
ATOM   6330 N  N   . LEU A 1 912 ? 107.634 -46.681 129.955 1.00 23.20  ?  923  LEU A N   1 
ATOM   6331 C  CA  . LEU A 1 912 ? 107.529 -46.662 128.502 1.00 24.42  ?  923  LEU A CA  1 
ATOM   6332 C  C   . LEU A 1 912 ? 107.443 -45.250 127.945 1.00 30.04  ?  923  LEU A C   1 
ATOM   6333 O  O   . LEU A 1 912 ? 107.651 -45.058 126.742 1.00 29.88  ?  923  LEU A O   1 
ATOM   6334 C  CB  . LEU A 1 912 ? 106.282 -47.420 128.029 1.00 25.49  ?  923  LEU A CB  1 
ATOM   6335 C  CG  . LEU A 1 912 ? 106.020 -48.901 128.284 1.00 30.87  ?  923  LEU A CG  1 
ATOM   6336 C  CD1 . LEU A 1 912 ? 105.617 -49.169 129.718 1.00 31.23  ?  923  LEU A CD1 1 
ATOM   6337 C  CD2 . LEU A 1 912 ? 104.923 -49.360 127.343 1.00 31.95  ?  923  LEU A CD2 1 
ATOM   6338 N  N   . SER A 1 913 ? 107.135 -44.269 128.790 1.00 29.54  ?  924  SER A N   1 
ATOM   6339 C  CA  . SER A 1 913 ? 106.739 -42.935 128.362 1.00 29.19  ?  924  SER A CA  1 
ATOM   6340 C  C   . SER A 1 913 ? 107.854 -41.922 128.585 1.00 32.62  ?  924  SER A C   1 
ATOM   6341 O  O   . SER A 1 913 ? 108.568 -41.971 129.592 1.00 33.08  ?  924  SER A O   1 
ATOM   6342 C  CB  . SER A 1 913 ? 105.483 -42.481 129.111 1.00 31.46  ?  924  SER A CB  1 
ATOM   6343 O  OG  . SER A 1 913 ? 105.158 -41.143 128.786 1.00 36.93  ?  924  SER A OG  1 
ATOM   6344 N  N   . THR A 1 914 ? 107.980 -40.989 127.640 1.00 25.14  ?  925  THR A N   1 
ATOM   6345 C  CA  . THR A 1 914 ? 108.925 -39.889 127.758 1.00 25.19  ?  925  THR A CA  1 
ATOM   6346 C  C   . THR A 1 914 ? 108.515 -38.872 128.815 1.00 31.57  ?  925  THR A C   1 
ATOM   6347 O  O   . THR A 1 914 ? 109.322 -38.003 129.161 1.00 31.64  ?  925  THR A O   1 
ATOM   6348 C  CB  . THR A 1 914 ? 109.075 -39.190 126.408 1.00 24.75  ?  925  THR A CB  1 
ATOM   6349 O  OG1 . THR A 1 914 ? 107.788 -38.757 125.952 1.00 28.14  ?  925  THR A OG1 1 
ATOM   6350 C  CG2 . THR A 1 914 ? 109.671 -40.137 125.381 1.00 18.00  ?  925  THR A CG2 1 
ATOM   6351 N  N   . LYS A 1 915 ? 107.291 -38.958 129.330 1.00 37.75  ?  926  LYS A N   1 
ATOM   6352 C  CA  . LYS A 1 915 ? 106.783 -38.042 130.344 1.00 39.62  ?  926  LYS A CA  1 
ATOM   6353 C  C   . LYS A 1 915 ? 107.054 -38.514 131.768 1.00 47.39  ?  926  LYS A C   1 
ATOM   6354 O  O   . LYS A 1 915 ? 106.715 -37.796 132.715 1.00 49.68  ?  926  LYS A O   1 
ATOM   6355 C  CB  . LYS A 1 915 ? 105.275 -37.835 130.153 1.00 41.85  ?  926  LYS A CB  1 
ATOM   6356 C  CG  . LYS A 1 915 ? 104.903 -37.129 128.857 1.00 56.99  ?  926  LYS A CG  1 
ATOM   6357 C  CD  . LYS A 1 915 ? 105.094 -35.623 128.970 1.00 65.66  ?  926  LYS A CD  1 
ATOM   6358 C  CE  . LYS A 1 915 ? 103.762 -34.896 129.117 1.00 75.89  ?  926  LYS A CE  1 
ATOM   6359 N  NZ  . LYS A 1 915 ? 103.065 -34.738 127.809 1.00 79.56  ?  926  LYS A NZ  1 
ATOM   6360 N  N   . TRP A 1 916 ? 107.653 -39.691 131.946 1.00 34.80  ?  927  TRP A N   1 
ATOM   6361 C  CA  . TRP A 1 916 ? 107.898 -40.253 133.266 1.00 33.82  ?  927  TRP A CA  1 
ATOM   6362 C  C   . TRP A 1 916 ? 109.316 -40.796 133.359 1.00 35.57  ?  927  TRP A C   1 
ATOM   6363 O  O   . TRP A 1 916 ? 109.797 -41.469 132.443 1.00 35.01  ?  927  TRP A O   1 
ATOM   6364 C  CB  . TRP A 1 916 ? 106.897 -41.369 133.588 1.00 32.54  ?  927  TRP A CB  1 
ATOM   6365 C  CG  . TRP A 1 916 ? 105.496 -40.880 133.766 1.00 34.06  ?  927  TRP A CG  1 
ATOM   6366 C  CD1 . TRP A 1 916 ? 104.507 -40.856 132.825 1.00 36.81  ?  927  TRP A CD1 1 
ATOM   6367 C  CD2 . TRP A 1 916 ? 104.923 -40.338 134.963 1.00 34.65  ?  927  TRP A CD2 1 
ATOM   6368 N  NE1 . TRP A 1 916 ? 103.353 -40.335 133.362 1.00 36.43  ?  927  TRP A NE1 1 
ATOM   6369 C  CE2 . TRP A 1 916 ? 103.582 -40.009 134.674 1.00 38.55  ?  927  TRP A CE2 1 
ATOM   6370 C  CE3 . TRP A 1 916 ? 105.414 -40.100 136.251 1.00 36.07  ?  927  TRP A CE3 1 
ATOM   6371 C  CZ2 . TRP A 1 916 ? 102.729 -39.455 135.626 1.00 38.25  ?  927  TRP A CZ2 1 
ATOM   6372 C  CZ3 . TRP A 1 916 ? 104.563 -39.550 137.195 1.00 37.65  ?  927  TRP A CZ3 1 
ATOM   6373 C  CH2 . TRP A 1 916 ? 103.237 -39.234 136.877 1.00 38.46  ?  927  TRP A CH2 1 
ATOM   6374 N  N   . LEU A 1 917 ? 109.978 -40.498 134.478 1.00 33.41  ?  928  LEU A N   1 
ATOM   6375 C  CA  . LEU A 1 917 ? 111.295 -41.043 134.784 1.00 31.99  ?  928  LEU A CA  1 
ATOM   6376 C  C   . LEU A 1 917 ? 111.554 -40.941 136.282 1.00 36.83  ?  928  LEU A C   1 
ATOM   6377 O  O   . LEU A 1 917 ? 112.364 -40.122 136.727 1.00 38.06  ?  928  LEU A O   1 
ATOM   6378 C  CB  . LEU A 1 917 ? 112.388 -40.316 133.999 1.00 31.46  ?  928  LEU A CB  1 
ATOM   6379 C  CG  . LEU A 1 917 ? 113.747 -41.019 133.973 1.00 35.48  ?  928  LEU A CG  1 
ATOM   6380 C  CD1 . LEU A 1 917 ? 113.666 -42.319 133.185 1.00 35.34  ?  928  LEU A CD1 1 
ATOM   6381 C  CD2 . LEU A 1 917 ? 114.818 -40.109 133.403 1.00 36.51  ?  928  LEU A CD2 1 
ATOM   6382 N  N   . VAL A 1 918 ? 110.861 -41.766 137.067 1.00 26.27  ?  929  VAL A N   1 
ATOM   6383 C  CA  . VAL A 1 918 ? 110.944 -41.709 138.522 1.00 25.52  ?  929  VAL A CA  1 
ATOM   6384 C  C   . VAL A 1 918 ? 112.228 -42.381 138.988 1.00 28.47  ?  929  VAL A C   1 
ATOM   6385 O  O   . VAL A 1 918 ? 112.240 -43.580 139.291 1.00 27.12  ?  929  VAL A O   1 
ATOM   6386 C  CB  . VAL A 1 918 ? 109.710 -42.361 139.173 1.00 28.18  ?  929  VAL A CB  1 
ATOM   6387 C  CG1 . VAL A 1 918 ? 109.784 -42.256 140.689 1.00 27.57  ?  929  VAL A CG1 1 
ATOM   6388 C  CG2 . VAL A 1 918 ? 108.436 -41.714 138.655 1.00 27.69  ?  929  VAL A CG2 1 
ATOM   6389 N  N   . GLU A 1 919 ? 113.323 -41.623 139.029 1.00 28.75  ?  930  GLU A N   1 
ATOM   6390 C  CA  . GLU A 1 919 ? 114.595 -42.130 139.511 1.00 29.65  ?  930  GLU A CA  1 
ATOM   6391 C  C   . GLU A 1 919 ? 115.122 -41.234 140.625 1.00 36.47  ?  930  GLU A C   1 
ATOM   6392 O  O   . GLU A 1 919 ? 114.794 -40.044 140.675 1.00 35.03  ?  930  GLU A O   1 
ATOM   6393 C  CB  . GLU A 1 919 ? 115.636 -42.217 138.385 1.00 30.84  ?  930  GLU A CB  1 
ATOM   6394 C  CG  . GLU A 1 919 ? 116.007 -40.886 137.755 1.00 39.21  ?  930  GLU A CG  1 
ATOM   6395 C  CD  . GLU A 1 919 ? 117.249 -40.979 136.887 1.00 50.36  ?  930  GLU A CD  1 
ATOM   6396 O  OE1 . GLU A 1 919 ? 117.524 -40.019 136.136 1.00 44.91  ?  930  GLU A OE1 1 
ATOM   6397 O  OE2 . GLU A 1 919 ? 117.952 -42.010 136.960 1.00 28.57  ?  930  GLU A OE2 1 
ATOM   6398 N  N   . PRO A 1 920 ? 115.928 -41.775 141.540 1.00 33.25  ?  931  PRO A N   1 
ATOM   6399 C  CA  . PRO A 1 920 ? 116.398 -40.971 142.673 1.00 33.51  ?  931  PRO A CA  1 
ATOM   6400 C  C   . PRO A 1 920 ? 117.470 -39.974 142.264 1.00 37.87  ?  931  PRO A C   1 
ATOM   6401 O  O   . PRO A 1 920 ? 118.340 -40.263 141.439 1.00 37.28  ?  931  PRO A O   1 
ATOM   6402 C  CB  . PRO A 1 920 ? 116.967 -42.019 143.643 1.00 34.93  ?  931  PRO A CB  1 
ATOM   6403 C  CG  . PRO A 1 920 ? 116.463 -43.343 143.149 1.00 38.72  ?  931  PRO A CG  1 
ATOM   6404 C  CD  . PRO A 1 920 ? 116.318 -43.188 141.673 1.00 34.26  ?  931  PRO A CD  1 
ATOM   6405 N  N   . ARG A 1 921 ? 117.392 -38.785 142.859 1.00 37.92  ?  932  ARG A N   1 
ATOM   6406 C  CA  . ARG A 1 921 ? 118.423 -37.763 142.721 1.00 39.09  ?  932  ARG A CA  1 
ATOM   6407 C  C   . ARG A 1 921 ? 118.615 -37.119 144.083 1.00 45.53  ?  932  ARG A C   1 
ATOM   6408 O  O   . ARG A 1 921 ? 117.657 -36.599 144.663 1.00 44.31  ?  932  ARG A O   1 
ATOM   6409 C  CB  . ARG A 1 921 ? 118.038 -36.713 141.674 1.00 38.33  ?  932  ARG A CB  1 
ATOM   6410 C  CG  . ARG A 1 921 ? 119.165 -35.758 141.320 1.00 42.26  ?  932  ARG A CG  1 
ATOM   6411 C  CD  . ARG A 1 921 ? 118.748 -34.782 140.230 1.00 45.24  ?  932  ARG A CD  1 
ATOM   6412 N  NE  . ARG A 1 921 ? 119.833 -34.537 139.284 1.00 52.65  ?  932  ARG A NE  1 
ATOM   6413 C  CZ  . ARG A 1 921 ? 120.750 -33.585 139.423 1.00 67.94  ?  932  ARG A CZ  1 
ATOM   6414 N  NH1 . ARG A 1 921 ? 120.718 -32.776 140.473 1.00 51.71  ?  932  ARG A NH1 1 
ATOM   6415 N  NH2 . ARG A 1 921 ? 121.702 -33.441 138.509 1.00 56.96  ?  932  ARG A NH2 1 
ATOM   6416 N  N   . CYS A 1 922 ? 119.841 -37.158 144.598 1.00 44.56  ?  933  CYS A N   1 
ATOM   6417 C  CA  . CYS A 1 922 ? 120.082 -36.713 145.963 1.00 46.35  ?  933  CYS A CA  1 
ATOM   6418 C  C   . CYS A 1 922 ? 121.528 -36.263 146.111 1.00 51.52  ?  933  CYS A C   1 
ATOM   6419 O  O   . CYS A 1 922 ? 122.343 -36.395 145.195 1.00 49.08  ?  933  CYS A O   1 
ATOM   6420 C  CB  . CYS A 1 922 ? 119.755 -37.822 146.965 1.00 46.82  ?  933  CYS A CB  1 
ATOM   6421 S  SG  . CYS A 1 922 ? 120.679 -39.339 146.672 1.00 50.48  ?  933  CYS A SG  1 
ATOM   6422 N  N   . LEU A 1 923 ? 121.834 -35.736 147.296 1.00 47.24  ?  934  LEU A N   1 
ATOM   6423 C  CA  . LEU A 1 923 ? 123.147 -35.189 147.609 1.00 49.14  ?  934  LEU A CA  1 
ATOM   6424 C  C   . LEU A 1 923 ? 123.529 -35.581 149.028 1.00 56.27  ?  934  LEU A C   1 
ATOM   6425 O  O   . LEU A 1 923 ? 122.746 -35.378 149.961 1.00 55.53  ?  934  LEU A O   1 
ATOM   6426 C  CB  . LEU A 1 923 ? 123.150 -33.662 147.464 1.00 49.55  ?  934  LEU A CB  1 
ATOM   6427 C  CG  . LEU A 1 923 ? 124.473 -32.920 147.656 1.00 54.69  ?  934  LEU A CG  1 
ATOM   6428 C  CD1 . LEU A 1 923 ? 125.264 -32.872 146.356 1.00 54.35  ?  934  LEU A CD1 1 
ATOM   6429 C  CD2 . LEU A 1 923 ? 124.223 -31.520 148.195 1.00 57.04  ?  934  LEU A CD2 1 
ATOM   6430 N  N   . VAL A 1 924 ? 124.726 -36.142 149.188 1.00 63.63  ?  935  VAL A N   1 
ATOM   6431 C  CA  . VAL A 1 924 ? 125.276 -36.476 150.499 1.00 65.42  ?  935  VAL A CA  1 
ATOM   6432 C  C   . VAL A 1 924 ? 126.607 -35.747 150.637 1.00 71.67  ?  935  VAL A C   1 
ATOM   6433 O  O   . VAL A 1 924 ? 127.567 -36.041 149.911 1.00 71.05  ?  935  VAL A O   1 
ATOM   6434 C  CB  . VAL A 1 924 ? 125.439 -37.990 150.698 1.00 69.30  ?  935  VAL A CB  1 
ATOM   6435 C  CG1 . VAL A 1 924 ? 124.097 -38.622 151.024 1.00 69.01  ?  935  VAL A CG1 1 
ATOM   6436 C  CG2 . VAL A 1 924 ? 126.035 -38.642 149.461 1.00 68.75  ?  935  VAL A CG2 1 
ATOM   6437 N  N   . ASP A 1 925 ? 126.665 -34.794 151.560 1.00 65.49  ?  936  ASP A N   1 
ATOM   6438 C  CA  . ASP A 1 925 ? 127.837 -33.955 151.755 1.00 66.93  ?  936  ASP A CA  1 
ATOM   6439 C  C   . ASP A 1 925 ? 128.544 -34.312 153.058 1.00 70.55  ?  936  ASP A C   1 
ATOM   6440 O  O   . ASP A 1 925 ? 128.022 -35.047 153.902 1.00 68.53  ?  936  ASP A O   1 
ATOM   6441 C  CB  . ASP A 1 925 ? 127.449 -32.470 151.744 1.00 69.71  ?  936  ASP A CB  1 
ATOM   6442 C  CG  . ASP A 1 925 ? 126.118 -32.207 152.424 1.00 83.07  ?  936  ASP A CG  1 
ATOM   6443 O  OD1 . ASP A 1 925 ? 125.067 -32.536 151.832 1.00 92.34  ?  936  ASP A OD1 1 
ATOM   6444 O  OD2 . ASP A 1 925 ? 126.121 -31.681 153.556 1.00 83.45  ?  936  ASP A OD2 1 
ATOM   6445 N  N   . SER A 1 926 ? 129.751 -33.768 153.207 1.00 66.71  ?  937  SER A N   1 
ATOM   6446 C  CA  . SER A 1 926 ? 130.612 -34.037 154.356 1.00 99.74  ?  937  SER A CA  1 
ATOM   6447 C  C   . SER A 1 926 ? 129.917 -33.738 155.681 1.00 121.64 ?  937  SER A C   1 
ATOM   6448 O  O   . SER A 1 926 ? 130.438 -34.058 156.749 1.00 85.87  ?  937  SER A O   1 
ATOM   6449 C  CB  . SER A 1 926 ? 131.902 -33.218 154.256 1.00 104.02 ?  937  SER A CB  1 
ATOM   6450 O  OG  . SER A 1 926 ? 132.610 -33.513 153.064 1.00 112.38 ?  937  SER A OG  1 
HETATM 6451 CL CL  . CL  B 2 .   ? 114.165 -46.336 123.752 0.50 44.22  ?  1001 CL  A CL  1 
HETATM 6452 C  C1  . GOL C 3 .   ? 112.875 -48.016 148.042 1.00 26.08  ?  1002 GOL A C1  1 
HETATM 6453 O  O1  . GOL C 3 .   ? 113.031 -47.188 146.933 1.00 28.24  ?  1002 GOL A O1  1 
HETATM 6454 C  C2  . GOL C 3 .   ? 111.379 -47.998 148.424 1.00 24.99  ?  1002 GOL A C2  1 
HETATM 6455 O  O2  . GOL C 3 .   ? 110.550 -47.903 147.319 1.00 27.29  ?  1002 GOL A O2  1 
HETATM 6456 C  C3  . GOL C 3 .   ? 111.160 -49.309 149.189 1.00 26.99  ?  1002 GOL A C3  1 
HETATM 6457 O  O3  . GOL C 3 .   ? 109.944 -49.197 149.880 1.00 27.22  ?  1002 GOL A O3  1 
HETATM 6458 O  O   . HOH D 4 .   ? 120.679 -58.619 144.555 1.00 44.17  ?  1101 HOH A O   1 
HETATM 6459 O  O   . HOH D 4 .   ? 114.459 -49.021 179.593 1.00 44.17  ?  1102 HOH A O   1 
HETATM 6460 O  O   . HOH D 4 .   ? 81.427  -70.519 127.204 1.00 45.60  ?  1103 HOH A O   1 
HETATM 6461 O  O   . HOH D 4 .   ? 115.182 -58.312 145.238 1.00 17.56  ?  1104 HOH A O   1 
HETATM 6462 O  O   . HOH D 4 .   ? 97.072  -37.085 141.692 1.00 44.17  ?  1105 HOH A O   1 
HETATM 6463 O  O   . HOH D 4 .   ? 106.916 -56.313 116.235 1.00 44.17  ?  1106 HOH A O   1 
HETATM 6464 O  O   . HOH D 4 .   ? 120.735 -63.908 146.059 1.00 26.93  ?  1107 HOH A O   1 
HETATM 6465 O  O   . HOH D 4 .   ? 109.502 -44.035 136.017 1.00 44.87  ?  1108 HOH A O   1 
HETATM 6466 O  O   . HOH D 4 .   ? 92.512  -42.808 120.090 1.00 44.87  ?  1109 HOH A O   1 
HETATM 6467 O  O   . HOH D 4 .   ? 154.871 -52.406 177.834 1.00 45.23  ?  1110 HOH A O   1 
HETATM 6468 O  O   . HOH D 4 .   ? 82.847  -48.517 130.076 1.00 45.23  ?  1111 HOH A O   1 
HETATM 6469 O  O   . HOH D 4 .   ? 84.454  -70.563 125.402 1.00 42.21  ?  1112 HOH A O   1 
HETATM 6470 O  O   . HOH D 4 .   ? 80.690  -51.595 154.859 1.00 31.51  ?  1113 HOH A O   1 
HETATM 6471 O  O   . HOH D 4 .   ? 78.530  -64.331 163.499 1.00 45.23  ?  1114 HOH A O   1 
HETATM 6472 O  O   . HOH D 4 .   ? 130.751 -42.483 157.193 1.00 35.43  ?  1115 HOH A O   1 
HETATM 6473 O  O   . HOH D 4 .   ? 112.253 -46.504 121.462 1.00 16.23  ?  1116 HOH A O   1 
HETATM 6474 O  O   . HOH D 4 .   ? 142.882 -68.581 169.527 1.00 22.47  ?  1117 HOH A O   1 
HETATM 6475 O  O   . HOH D 4 .   ? 99.804  -59.858 156.534 1.00 44.17  ?  1118 HOH A O   1 
HETATM 6476 O  O   . HOH D 4 .   ? 112.454 -62.412 125.036 1.00 28.34  ?  1119 HOH A O   1 
HETATM 6477 O  O   . HOH D 4 .   ? 102.902 -45.202 140.111 1.00 33.84  ?  1120 HOH A O   1 
HETATM 6478 O  O   . HOH D 4 .   ? 132.023 -52.003 140.892 1.00 41.86  ?  1121 HOH A O   1 
HETATM 6479 O  O   . HOH D 4 .   ? 111.588 -62.347 159.513 1.00 25.88  ?  1122 HOH A O   1 
HETATM 6480 O  O   . HOH D 4 .   ? 113.550 -60.467 133.929 1.00 52.95  ?  1123 HOH A O   1 
HETATM 6481 O  O   . HOH D 4 .   ? 143.726 -73.712 165.308 1.00 45.60  ?  1124 HOH A O   1 
HETATM 6482 O  O   . HOH D 4 .   ? 75.251  -40.607 125.550 1.00 45.60  ?  1125 HOH A O   1 
HETATM 6483 O  O   . HOH D 4 .   ? 107.218 -39.133 141.567 1.00 37.97  ?  1126 HOH A O   1 
HETATM 6484 O  O   . HOH D 4 .   ? 114.456 -53.064 125.502 1.00 24.17  ?  1127 HOH A O   1 
HETATM 6485 O  O   . HOH D 4 .   ? 70.191  -45.936 135.011 1.00 44.17  ?  1128 HOH A O   1 
HETATM 6486 O  O   . HOH D 4 .   ? 99.263  -54.209 110.213 1.00 45.23  ?  1129 HOH A O   1 
HETATM 6487 O  O   . HOH D 4 .   ? 132.938 -64.205 166.350 1.00 33.04  ?  1130 HOH A O   1 
HETATM 6488 O  O   . HOH D 4 .   ? 122.485 -66.916 177.689 1.00 21.25  ?  1131 HOH A O   1 
HETATM 6489 O  O   . HOH D 4 .   ? 95.930  -66.333 115.381 1.00 23.21  ?  1132 HOH A O   1 
HETATM 6490 O  O   . HOH D 4 .   ? 123.990 -67.993 169.018 1.00 44.17  ?  1133 HOH A O   1 
HETATM 6491 O  O   . HOH D 4 .   ? 124.361 -75.682 184.276 1.00 44.17  ?  1134 HOH A O   1 
HETATM 6492 O  O   . HOH D 4 .   ? 103.576 -40.104 111.680 1.00 35.27  ?  1135 HOH A O   1 
HETATM 6493 O  O   . HOH D 4 .   ? 149.467 -65.107 158.244 1.00 38.55  ?  1136 HOH A O   1 
HETATM 6494 O  O   . HOH D 4 .   ? 80.999  -47.182 129.343 1.00 45.60  ?  1137 HOH A O   1 
HETATM 6495 O  O   . HOH D 4 .   ? 147.714 -60.669 166.218 1.00 44.17  ?  1138 HOH A O   1 
HETATM 6496 O  O   . HOH D 4 .   ? 99.549  -29.523 121.586 1.00 45.60  ?  1139 HOH A O   1 
HETATM 6497 O  O   . HOH D 4 .   ? 110.237 -60.931 162.494 1.00 20.28  ?  1140 HOH A O   1 
HETATM 6498 O  O   . HOH D 4 .   ? 120.376 -50.106 182.915 1.00 23.95  ?  1141 HOH A O   1 
HETATM 6499 O  O   . HOH D 4 .   ? 110.947 -48.212 115.709 1.00 23.87  ?  1142 HOH A O   1 
HETATM 6500 O  O   . HOH D 4 .   ? 103.268 -45.857 170.679 1.00 28.02  ?  1143 HOH A O   1 
HETATM 6501 O  O   . HOH D 4 .   ? 118.876 -69.515 169.200 1.00 31.18  ?  1144 HOH A O   1 
HETATM 6502 O  O   . HOH D 4 .   ? 106.748 -44.891 163.747 1.00 44.17  ?  1145 HOH A O   1 
HETATM 6503 O  O   . HOH D 4 .   ? 112.890 -66.830 166.049 1.00 26.90  ?  1146 HOH A O   1 
HETATM 6504 O  O   . HOH D 4 .   ? 115.041 -35.353 159.342 1.00 44.17  ?  1147 HOH A O   1 
HETATM 6505 O  O   . HOH D 4 .   ? 101.312 -44.345 167.495 1.00 45.60  ?  1148 HOH A O   1 
HETATM 6506 O  O   . HOH D 4 .   ? 111.237 -54.746 155.651 1.00 21.83  ?  1149 HOH A O   1 
HETATM 6507 O  O   . HOH D 4 .   ? 130.288 -58.594 136.387 1.00 26.67  ?  1150 HOH A O   1 
HETATM 6508 O  O   . HOH D 4 .   ? 134.557 -58.434 166.433 1.00 25.50  ?  1151 HOH A O   1 
HETATM 6509 O  O   . HOH D 4 .   ? 116.020 -66.999 158.038 1.00 29.39  ?  1152 HOH A O   1 
HETATM 6510 O  O   . HOH D 4 .   ? 121.510 -38.821 143.287 1.00 45.60  ?  1153 HOH A O   1 
HETATM 6511 O  O   . HOH D 4 .   ? 126.230 -65.506 146.223 1.00 45.23  ?  1154 HOH A O   1 
HETATM 6512 O  O   . HOH D 4 .   ? 130.595 -63.357 166.458 1.00 45.23  ?  1155 HOH A O   1 
HETATM 6513 O  O   . HOH D 4 .   ? 109.031 -43.948 160.370 1.00 28.15  ?  1156 HOH A O   1 
HETATM 6514 O  O   . HOH D 4 .   ? 113.339 -61.819 149.516 1.00 31.67  ?  1157 HOH A O   1 
HETATM 6515 O  O   . HOH D 4 .   ? 141.613 -58.514 150.836 1.00 28.25  ?  1158 HOH A O   1 
HETATM 6516 O  O   . HOH D 4 .   ? 116.441 -65.554 127.440 1.00 44.17  ?  1159 HOH A O   1 
HETATM 6517 O  O   . HOH D 4 .   ? 120.413 -63.899 153.102 1.00 37.34  ?  1160 HOH A O   1 
HETATM 6518 O  O   . HOH D 4 .   ? 109.560 -54.935 159.127 1.00 44.17  ?  1161 HOH A O   1 
HETATM 6519 O  O   . HOH D 4 .   ? 90.351  -47.161 165.444 1.00 38.05  ?  1162 HOH A O   1 
HETATM 6520 O  O   . HOH D 4 .   ? 151.592 -64.200 147.112 1.00 44.17  ?  1163 HOH A O   1 
HETATM 6521 O  O   . HOH D 4 .   ? 133.950 -55.027 142.275 1.00 27.06  ?  1164 HOH A O   1 
HETATM 6522 O  O   . HOH D 4 .   ? 128.966 -55.374 158.084 1.00 26.30  ?  1165 HOH A O   1 
HETATM 6523 O  O   . HOH D 4 .   ? 124.703 -44.202 166.228 1.00 44.87  ?  1166 HOH A O   1 
HETATM 6524 O  O   . HOH D 4 .   ? 143.727 -54.054 184.999 1.00 40.76  ?  1167 HOH A O   1 
HETATM 6525 O  O   . HOH D 4 .   ? 109.288 -55.171 175.240 1.00 41.18  ?  1168 HOH A O   1 
HETATM 6526 O  O   . HOH D 4 .   ? 105.724 -62.318 147.176 1.00 23.42  ?  1169 HOH A O   1 
HETATM 6527 O  O   . HOH D 4 .   ? 119.933 -61.585 181.935 1.00 44.17  ?  1170 HOH A O   1 
HETATM 6528 O  O   . HOH D 4 .   ? 98.253  -64.192 115.122 1.00 18.15  ?  1171 HOH A O   1 
HETATM 6529 O  O   . HOH D 4 .   ? 73.038  -47.137 140.187 1.00 44.17  ?  1172 HOH A O   1 
HETATM 6530 O  O   . HOH D 4 .   ? 143.254 -64.530 150.153 1.00 44.17  ?  1173 HOH A O   1 
HETATM 6531 O  O   . HOH D 4 .   ? 125.556 -46.563 165.693 1.00 38.02  ?  1174 HOH A O   1 
HETATM 6532 O  O   . HOH D 4 .   ? 114.696 -59.936 128.173 1.00 38.16  ?  1175 HOH A O   1 
HETATM 6533 O  O   . HOH D 4 .   ? 129.047 -65.605 146.996 1.00 40.84  ?  1176 HOH A O   1 
HETATM 6534 O  O   . HOH D 4 .   ? 151.333 -51.752 163.060 1.00 33.04  ?  1177 HOH A O   1 
HETATM 6535 O  O   . HOH D 4 .   ? 115.441 -62.291 151.348 1.00 23.95  ?  1178 HOH A O   1 
HETATM 6536 O  O   . HOH D 4 .   ? 89.646  -53.457 129.502 1.00 38.87  ?  1179 HOH A O   1 
HETATM 6537 O  O   . HOH D 4 .   ? 91.124  -60.647 118.838 1.00 26.52  ?  1180 HOH A O   1 
HETATM 6538 O  O   . HOH D 4 .   ? 125.622 -57.402 163.992 1.00 22.25  ?  1181 HOH A O   1 
HETATM 6539 O  O   . HOH D 4 .   ? 105.440 -61.735 171.335 1.00 23.72  ?  1182 HOH A O   1 
HETATM 6540 O  O   . HOH D 4 .   ? 130.424 -42.482 169.512 1.00 52.05  ?  1183 HOH A O   1 
HETATM 6541 O  O   . HOH D 4 .   ? 118.196 -55.752 142.318 1.00 44.87  ?  1184 HOH A O   1 
HETATM 6542 O  O   . HOH D 4 .   ? 97.531  -54.294 111.869 1.00 31.24  ?  1185 HOH A O   1 
HETATM 6543 O  O   . HOH D 4 .   ? 131.578 -31.523 157.040 1.00 36.62  ?  1186 HOH A O   1 
HETATM 6544 O  O   . HOH D 4 .   ? 104.149 -66.107 133.594 1.00 44.17  ?  1187 HOH A O   1 
HETATM 6545 O  O   . HOH D 4 .   ? 116.552 -75.441 176.748 1.00 31.40  ?  1188 HOH A O   1 
HETATM 6546 O  O   . HOH D 4 .   ? 155.045 -55.455 176.941 1.00 45.60  ?  1189 HOH A O   1 
HETATM 6547 O  O   . HOH D 4 .   ? 116.158 -48.619 143.696 1.00 44.87  ?  1190 HOH A O   1 
HETATM 6548 O  O   . HOH D 4 .   ? 126.646 -47.345 141.449 1.00 37.21  ?  1191 HOH A O   1 
HETATM 6549 O  O   . HOH D 4 .   ? 139.765 -61.867 145.167 1.00 45.23  ?  1192 HOH A O   1 
HETATM 6550 O  O   . HOH D 4 .   ? 126.180 -71.786 169.863 1.00 36.88  ?  1193 HOH A O   1 
HETATM 6551 O  O   . HOH D 4 .   ? 109.890 -51.749 161.738 1.00 27.65  ?  1194 HOH A O   1 
HETATM 6552 O  O   . HOH D 4 .   ? 133.850 -61.638 165.429 1.00 44.87  ?  1195 HOH A O   1 
HETATM 6553 O  O   . HOH D 4 .   ? 133.710 -48.256 159.955 1.00 44.87  ?  1196 HOH A O   1 
HETATM 6554 O  O   . HOH D 4 .   ? 111.748 -67.466 152.786 1.00 44.17  ?  1197 HOH A O   1 
HETATM 6555 O  O   . HOH D 4 .   ? 89.758  -63.200 151.241 1.00 24.97  ?  1198 HOH A O   1 
HETATM 6556 O  O   . HOH D 4 .   ? 134.489 -62.347 154.044 1.00 30.05  ?  1199 HOH A O   1 
HETATM 6557 O  O   . HOH D 4 .   ? 97.249  -46.651 136.550 1.00 31.59  ?  1200 HOH A O   1 
HETATM 6558 O  O   . HOH D 4 .   ? 108.044 -43.060 162.438 1.00 35.04  ?  1201 HOH A O   1 
HETATM 6559 O  O   . HOH D 4 .   ? 134.493 -56.547 161.175 1.00 39.93  ?  1202 HOH A O   1 
HETATM 6560 O  O   . HOH D 4 .   ? 92.568  -65.455 139.412 1.00 34.00  ?  1203 HOH A O   1 
HETATM 6561 O  O   . HOH D 4 .   ? 130.732 -56.956 170.168 1.00 26.04  ?  1204 HOH A O   1 
HETATM 6562 O  O   . HOH D 4 .   ? 107.511 -60.574 122.326 1.00 22.42  ?  1205 HOH A O   1 
HETATM 6563 O  O   . HOH D 4 .   ? 116.833 -50.202 138.598 1.00 44.17  ?  1206 HOH A O   1 
HETATM 6564 O  O   . HOH D 4 .   ? 124.836 -45.689 182.025 1.00 28.26  ?  1207 HOH A O   1 
HETATM 6565 O  O   . HOH D 4 .   ? 126.454 -61.968 165.577 1.00 20.12  ?  1208 HOH A O   1 
HETATM 6566 O  O   . HOH D 4 .   ? 144.859 -57.479 145.109 1.00 44.17  ?  1209 HOH A O   1 
HETATM 6567 O  O   . HOH D 4 .   ? 135.971 -54.115 165.237 1.00 26.81  ?  1210 HOH A O   1 
HETATM 6568 O  O   . HOH D 4 .   ? 119.239 -41.792 177.454 1.00 45.23  ?  1211 HOH A O   1 
HETATM 6569 O  O   . HOH D 4 .   ? 124.887 -43.982 142.220 1.00 44.87  ?  1212 HOH A O   1 
HETATM 6570 O  O   . HOH D 4 .   ? 105.666 -41.839 150.861 1.00 44.17  ?  1213 HOH A O   1 
HETATM 6571 O  O   . HOH D 4 .   ? 147.224 -42.197 154.031 1.00 44.17  ?  1214 HOH A O   1 
HETATM 6572 O  O   . HOH D 4 .   ? 98.642  -70.444 116.999 1.00 45.60  ?  1215 HOH A O   1 
HETATM 6573 O  O   . HOH D 4 .   ? 121.000 -61.238 146.636 1.00 27.95  ?  1216 HOH A O   1 
HETATM 6574 O  O   . HOH D 4 .   ? 88.748  -51.841 107.045 1.00 45.60  ?  1217 HOH A O   1 
HETATM 6575 O  O   . HOH D 4 .   ? 101.287 -42.939 136.635 1.00 37.45  ?  1218 HOH A O   1 
HETATM 6576 O  O   . HOH D 4 .   ? 114.864 -58.498 134.785 1.00 31.15  ?  1219 HOH A O   1 
HETATM 6577 O  O   . HOH D 4 .   ? 114.961 -38.520 145.293 1.00 36.88  ?  1220 HOH A O   1 
HETATM 6578 O  O   . HOH D 4 .   ? 104.648 -42.454 139.499 1.00 18.78  ?  1221 HOH A O   1 
HETATM 6579 O  O   . HOH D 4 .   ? 125.057 -56.200 181.929 1.00 48.47  ?  1222 HOH A O   1 
HETATM 6580 O  O   . HOH D 4 .   ? 108.508 -54.438 156.167 1.00 20.91  ?  1223 HOH A O   1 
HETATM 6581 O  O   . HOH D 4 .   ? 115.426 -65.368 151.447 1.00 45.23  ?  1224 HOH A O   1 
HETATM 6582 O  O   . HOH D 4 .   ? 124.754 -60.058 163.307 1.00 31.43  ?  1225 HOH A O   1 
HETATM 6583 O  O   . HOH D 4 .   ? 137.603 -40.021 162.713 1.00 44.17  ?  1226 HOH A O   1 
HETATM 6584 O  O   . HOH D 4 .   ? 140.475 -71.373 166.628 1.00 45.23  ?  1227 HOH A O   1 
HETATM 6585 O  O   . HOH D 4 .   ? 133.684 -51.150 170.881 1.00 23.85  ?  1228 HOH A O   1 
HETATM 6586 O  O   . HOH D 4 .   ? 110.750 -44.093 120.369 1.00 20.95  ?  1229 HOH A O   1 
HETATM 6587 O  O   . HOH D 4 .   ? 102.323 -61.523 159.506 1.00 45.23  ?  1230 HOH A O   1 
HETATM 6588 O  O   . HOH D 4 .   ? 123.692 -65.694 167.100 1.00 31.57  ?  1231 HOH A O   1 
HETATM 6589 O  O   . HOH D 4 .   ? 137.018 -49.696 167.438 1.00 19.69  ?  1232 HOH A O   1 
HETATM 6590 O  O   . HOH D 4 .   ? 107.221 -64.247 176.452 1.00 44.17  ?  1233 HOH A O   1 
HETATM 6591 O  O   . HOH D 4 .   ? 136.556 -55.172 141.994 1.00 45.57  ?  1234 HOH A O   1 
HETATM 6592 O  O   . HOH D 4 .   ? 121.131 -68.521 170.629 1.00 23.93  ?  1235 HOH A O   1 
HETATM 6593 O  O   . HOH D 4 .   ? 91.019  -38.508 136.917 1.00 45.60  ?  1236 HOH A O   1 
HETATM 6594 O  O   . HOH D 4 .   ? 88.134  -51.976 158.375 1.00 49.64  ?  1237 HOH A O   1 
HETATM 6595 O  O   . HOH D 4 .   ? 106.563 -50.404 158.988 1.00 30.09  ?  1238 HOH A O   1 
HETATM 6596 O  O   . HOH D 4 .   ? 88.599  -58.212 133.622 1.00 22.46  ?  1239 HOH A O   1 
HETATM 6597 O  O   . HOH D 4 .   ? 122.561 -45.649 142.215 1.00 44.17  ?  1240 HOH A O   1 
HETATM 6598 O  O   . HOH D 4 .   ? 99.553  -42.099 115.917 1.00 44.17  ?  1241 HOH A O   1 
HETATM 6599 O  O   . HOH D 4 .   ? 93.224  -41.333 122.032 1.00 44.87  ?  1242 HOH A O   1 
HETATM 6600 O  O   . HOH D 4 .   ? 68.667  -55.932 140.955 1.00 45.60  ?  1243 HOH A O   1 
HETATM 6601 O  O   . HOH D 4 .   ? 126.955 -47.824 164.123 1.00 34.38  ?  1244 HOH A O   1 
HETATM 6602 O  O   . HOH D 4 .   ? 118.194 -55.987 144.656 1.00 43.97  ?  1245 HOH A O   1 
HETATM 6603 O  O   . HOH D 4 .   ? 129.578 -67.570 183.378 1.00 33.74  ?  1246 HOH A O   1 
HETATM 6604 O  O   . HOH D 4 .   ? 85.407  -46.314 138.833 1.00 29.61  ?  1247 HOH A O   1 
HETATM 6605 O  O   . HOH D 4 .   ? 81.606  -42.081 133.475 1.00 44.87  ?  1248 HOH A O   1 
HETATM 6606 O  O   . HOH D 4 .   ? 115.831 -68.866 154.262 1.00 44.17  ?  1249 HOH A O   1 
HETATM 6607 O  O   . HOH D 4 .   ? 103.213 -57.359 153.183 1.00 45.46  ?  1250 HOH A O   1 
HETATM 6608 O  O   . HOH D 4 .   ? 115.502 -43.503 150.258 1.00 44.44  ?  1251 HOH A O   1 
HETATM 6609 O  O   . HOH D 4 .   ? 119.858 -65.364 163.863 1.00 26.76  ?  1252 HOH A O   1 
HETATM 6610 O  O   . HOH D 4 .   ? 115.841 -55.659 136.054 1.00 44.52  ?  1253 HOH A O   1 
HETATM 6611 O  O   . HOH D 4 .   ? 104.766 -63.252 145.285 1.00 44.87  ?  1254 HOH A O   1 
HETATM 6612 O  O   . HOH D 4 .   ? 135.978 -56.375 166.655 1.00 21.81  ?  1255 HOH A O   1 
HETATM 6613 O  O   . HOH D 4 .   ? 132.592 -67.027 181.139 1.00 39.40  ?  1256 HOH A O   1 
HETATM 6614 O  O   . HOH D 4 .   ? 111.924 -67.418 157.415 1.00 44.17  ?  1257 HOH A O   1 
HETATM 6615 O  O   . HOH D 4 .   ? 128.257 -39.595 165.742 1.00 44.17  ?  1258 HOH A O   1 
HETATM 6616 O  O   . HOH D 4 .   ? 120.012 -68.221 165.282 1.00 35.65  ?  1259 HOH A O   1 
HETATM 6617 O  O   . HOH D 4 .   ? 125.728 -64.373 142.302 1.00 36.17  ?  1260 HOH A O   1 
HETATM 6618 O  O   . HOH D 4 .   ? 116.968 -35.255 155.290 1.00 44.17  ?  1261 HOH A O   1 
HETATM 6619 O  O   . HOH D 4 .   ? 149.793 -45.225 174.346 1.00 44.17  ?  1262 HOH A O   1 
HETATM 6620 O  O   . HOH D 4 .   ? 106.103 -49.169 154.470 1.00 33.24  ?  1263 HOH A O   1 
HETATM 6621 O  O   . HOH D 4 .   ? 98.011  -59.015 139.229 1.00 29.21  ?  1264 HOH A O   1 
HETATM 6622 O  O   . HOH D 4 .   ? 119.044 -58.166 146.030 1.00 35.74  ?  1265 HOH A O   1 
HETATM 6623 O  O   . HOH D 4 .   ? 93.504  -57.335 140.105 1.00 34.18  ?  1266 HOH A O   1 
HETATM 6624 O  O   . HOH D 4 .   ? 94.145  -46.014 137.171 1.00 44.17  ?  1267 HOH A O   1 
HETATM 6625 O  O   . HOH D 4 .   ? 105.356 -65.273 152.974 1.00 44.87  ?  1268 HOH A O   1 
HETATM 6626 O  O   . HOH D 4 .   ? 95.691  -62.659 139.668 1.00 45.03  ?  1269 HOH A O   1 
HETATM 6627 O  O   . HOH D 4 .   ? 114.547 -63.004 127.314 1.00 45.23  ?  1270 HOH A O   1 
HETATM 6628 O  O   . HOH D 4 .   ? 111.861 -38.876 140.878 1.00 44.87  ?  1271 HOH A O   1 
HETATM 6629 O  O   . HOH D 4 .   ? 144.351 -51.058 144.178 1.00 45.60  ?  1272 HOH A O   1 
HETATM 6630 O  O   . HOH D 4 .   ? 114.359 -47.089 177.810 1.00 44.17  ?  1273 HOH A O   1 
HETATM 6631 O  O   . HOH D 4 .   ? 127.821 -57.910 158.629 1.00 28.85  ?  1274 HOH A O   1 
HETATM 6632 O  O   . HOH D 4 .   ? 89.815  -58.776 135.920 1.00 34.55  ?  1275 HOH A O   1 
HETATM 6633 O  O   . HOH D 4 .   ? 114.263 -67.040 155.889 1.00 34.91  ?  1276 HOH A O   1 
HETATM 6634 O  O   . HOH D 4 .   ? 110.684 -51.522 177.888 1.00 45.23  ?  1277 HOH A O   1 
HETATM 6635 O  O   . HOH D 4 .   ? 140.981 -71.798 159.762 1.00 45.23  ?  1278 HOH A O   1 
HETATM 6636 O  O   . HOH D 4 .   ? 152.767 -61.890 150.385 1.00 45.23  ?  1279 HOH A O   1 
HETATM 6637 O  O   . HOH D 4 .   ? 112.190 -69.314 123.782 1.00 45.23  ?  1280 HOH A O   1 
HETATM 6638 O  O   . HOH D 4 .   ? 111.986 -58.835 114.791 1.00 45.23  ?  1281 HOH A O   1 
HETATM 6639 O  O   . HOH D 4 .   ? 115.433 -37.087 112.221 1.00 45.60  ?  1282 HOH A O   1 
HETATM 6640 O  O   . HOH D 4 .   ? 117.819 -52.064 137.152 1.00 34.48  ?  1283 HOH A O   1 
HETATM 6641 O  O   . HOH D 4 .   ? 110.413 -64.626 118.593 1.00 44.17  ?  1284 HOH A O   1 
HETATM 6642 O  O   . HOH D 4 .   ? 120.224 -64.447 165.860 1.00 46.08  ?  1285 HOH A O   1 
HETATM 6643 O  O   . HOH D 4 .   ? 108.782 -40.241 147.140 1.00 45.60  ?  1286 HOH A O   1 
HETATM 6644 O  O   . HOH D 4 .   ? 126.589 -55.036 161.566 1.00 45.60  ?  1287 HOH A O   1 
HETATM 6645 O  O   . HOH D 4 .   ? 95.411  -59.408 139.288 1.00 45.26  ?  1288 HOH A O   1 
HETATM 6646 O  O   . HOH D 4 .   ? 93.567  -57.787 136.506 1.00 51.58  ?  1289 HOH A O   1 
HETATM 6647 O  O   . HOH D 4 .   ? 111.996 -47.398 178.313 1.00 44.87  ?  1290 HOH A O   1 
HETATM 6648 O  O   . HOH D 4 .   ? 129.409 -60.854 164.801 1.00 45.23  ?  1291 HOH A O   1 
HETATM 6649 O  O   . HOH D 4 .   ? 72.104  -46.129 136.279 1.00 44.17  ?  1292 HOH A O   1 
HETATM 6650 O  O   . HOH D 4 .   ? 118.584 -50.174 135.984 1.00 30.86  ?  1293 HOH A O   1 
HETATM 6651 O  O   . HOH D 4 .   ? 109.482 -50.575 114.092 1.00 44.17  ?  1294 HOH A O   1 
HETATM 6652 O  O   . HOH D 4 .   ? 120.228 -45.285 142.738 1.00 44.17  ?  1295 HOH A O   1 
HETATM 6653 O  O   . HOH D 4 .   ? 113.765 -35.380 112.182 1.00 45.60  ?  1296 HOH A O   1 
HETATM 6654 O  O   . HOH D 4 .   ? 120.763 -66.267 167.082 1.00 45.23  ?  1297 HOH A O   1 
HETATM 6655 O  O   . HOH D 4 .   ? 135.223 -49.324 170.364 1.00 44.17  ?  1298 HOH A O   1 
HETATM 6656 O  O   . HOH D 4 .   ? 111.613 -68.729 164.679 1.00 44.17  ?  1299 HOH A O   1 
HETATM 6657 O  O   . HOH D 4 .   ? 100.072 -48.954 106.794 1.00 45.23  ?  1300 HOH A O   1 
HETATM 6658 O  O   . HOH D 4 .   ? 129.271 -55.192 162.485 1.00 45.60  ?  1301 HOH A O   1 
HETATM 6659 O  O   . HOH D 4 .   ? 91.345  -57.225 137.214 1.00 33.84  ?  1302 HOH A O   1 
HETATM 6660 O  O   . HOH D 4 .   ? 105.845 -42.977 158.090 1.00 44.87  ?  1303 HOH A O   1 
HETATM 6661 O  O   . HOH D 4 .   ? 109.591 -52.271 115.985 1.00 45.60  ?  1304 HOH A O   1 
HETATM 6662 O  O   . HOH D 4 .   ? 108.087 -53.470 161.620 1.00 45.88  ?  1305 HOH A O   1 
HETATM 6663 O  O   . HOH D 4 .   ? 132.150 -43.886 168.784 1.00 44.87  ?  1306 HOH A O   1 
HETATM 6664 O  O   . HOH D 4 .   ? 81.153  -44.520 128.998 1.00 45.60  ?  1307 HOH A O   1 
HETATM 6665 O  O   . HOH D 4 .   ? 115.915 -58.469 137.396 1.00 41.13  ?  1308 HOH A O   1 
HETATM 6666 O  O   . HOH D 4 .   ? 120.381 -62.288 141.821 1.00 45.60  ?  1309 HOH A O   1 
HETATM 6667 O  O   . HOH D 4 .   ? 109.848 -39.164 148.878 1.00 45.60  ?  1310 HOH A O   1 
HETATM 6668 O  O   . HOH D 4 .   ? 135.123 -52.065 166.558 1.00 37.77  ?  1311 HOH A O   1 
HETATM 6669 O  O   . HOH D 4 .   ? 120.272 -56.224 143.174 1.00 44.87  ?  1312 HOH A O   1 
HETATM 6670 O  O   . HOH D 4 .   ? 133.376 -59.330 163.372 1.00 45.23  ?  1313 HOH A O   1 
HETATM 6671 O  O   . HOH D 4 .   ? 108.195 -42.560 158.453 1.00 34.24  ?  1314 HOH A O   1 
HETATM 6672 O  O   . HOH D 4 .   ? 119.255 -62.933 143.810 1.00 44.17  ?  1315 HOH A O   1 
HETATM 6673 O  O   . HOH D 4 .   ? 80.527  -43.176 131.267 1.00 45.60  ?  1316 HOH A O   1 
HETATM 6674 O  O   . HOH D 4 .   ? 76.771  -87.100 140.505 1.00 45.60  ?  1317 HOH A O   1 
HETATM 6675 O  O   . HOH D 4 .   ? 106.138 -51.558 155.993 1.00 45.23  ?  1318 HOH A O   1 
HETATM 6676 O  O   . HOH D 4 .   ? 100.743 -40.414 113.783 1.00 44.87  ?  1319 HOH A O   1 
HETATM 6677 O  O   . HOH D 4 .   ? 118.010 -58.133 141.404 1.00 44.87  ?  1320 HOH A O   1 
HETATM 6678 O  O   . HOH D 4 .   ? 118.246 -62.330 140.434 1.00 45.60  ?  1321 HOH A O   1 
HETATM 6679 O  O   . HOH D 4 .   ? 139.893 -73.588 160.962 1.00 45.60  ?  1322 HOH A O   1 
HETATM 6680 O  O   . HOH D 4 .   ? 77.655  -40.755 142.550 1.00 45.60  ?  1323 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . MET A 1   ? 0.6760 0.3647 0.4233 0.0051  -0.1408 -0.0022 12  MET A N   
2    C CA  . MET A 1   ? 0.6829 0.3594 0.4215 0.0033  -0.1477 -0.0015 12  MET A CA  
3    C C   . MET A 1   ? 0.7222 0.3944 0.4537 -0.0019 -0.1450 0.0008  12  MET A C   
4    O O   . MET A 1   ? 0.6972 0.3770 0.4318 -0.0037 -0.1377 0.0015  12  MET A O   
5    C CB  . MET A 1   ? 0.7101 0.3866 0.4524 0.0053  -0.1515 -0.0024 12  MET A CB  
6    C CG  . MET A 1   ? 0.7491 0.4322 0.4955 0.0031  -0.1464 -0.0014 12  MET A CG  
7    S SD  . MET A 1   ? 0.7983 0.4834 0.5508 0.0062  -0.1502 -0.0028 12  MET A SD  
8    C CE  . MET A 1   ? 0.7462 0.4433 0.5104 0.0112  -0.1475 -0.0053 12  MET A CE  
9    N N   . ARG A 2   ? 0.7410 0.4007 0.4625 -0.0043 -0.1510 0.0018  13  ARG A N   
10   C CA  . ARG A 2   ? 0.7465 0.4014 0.4608 -0.0096 -0.1492 0.0040  13  ARG A CA  
11   C C   . ARG A 2   ? 0.7698 0.4309 0.4887 -0.0114 -0.1453 0.0048  13  ARG A C   
12   O O   . ARG A 2   ? 0.7743 0.4395 0.4994 -0.0088 -0.1464 0.0038  13  ARG A O   
13   C CB  . ARG A 2   ? 0.7999 0.4396 0.5025 -0.0119 -0.1572 0.0051  13  ARG A CB  
14   C CG  . ARG A 2   ? 1.0094 0.6416 0.7040 -0.0133 -0.1589 0.0055  13  ARG A CG  
15   C CD  . ARG A 2   ? 1.2254 0.8422 0.9074 -0.0166 -0.1661 0.0070  13  ARG A CD  
16   N NE  . ARG A 2   ? 1.4437 1.0520 1.1223 -0.0131 -0.1742 0.0056  13  ARG A NE  
17   C CZ  . ARG A 2   ? 1.6749 1.2774 1.3489 -0.0117 -0.1775 0.0050  13  ARG A CZ  
18   N NH1 . ARG A 2   ? 1.4700 1.0741 1.1422 -0.0137 -0.1734 0.0057  13  ARG A NH1 
19   N NH2 . ARG A 2   ? 1.5683 1.1630 1.2394 -0.0083 -0.1851 0.0036  13  ARG A NH2 
20   N N   . GLU A 3   ? 0.6137 0.2754 0.3295 -0.0158 -0.1406 0.0064  14  GLU A N   
21   C CA  . GLU A 3   ? 0.6038 0.2712 0.3235 -0.0178 -0.1367 0.0072  14  GLU A CA  
22   C C   . GLU A 3   ? 0.6734 0.3332 0.3892 -0.0192 -0.1429 0.0079  14  GLU A C   
23   O O   . GLU A 3   ? 0.6631 0.3283 0.3842 -0.0191 -0.1412 0.0080  14  GLU A O   
24   C CB  . GLU A 3   ? 0.6157 0.2836 0.3316 -0.0225 -0.1313 0.0087  14  GLU A CB  
25   C CG  . GLU A 3   ? 0.6204 0.2961 0.3400 -0.0212 -0.1242 0.0079  14  GLU A CG  
26   C CD  . GLU A 3   ? 0.7460 0.4346 0.4769 -0.0174 -0.1185 0.0065  14  GLU A CD  
27   O OE1 . GLU A 3   ? 0.6129 0.3065 0.3477 -0.0143 -0.1160 0.0053  14  GLU A OE1 
28   O OE2 . GLU A 3   ? 0.5746 0.2681 0.3101 -0.0178 -0.1167 0.0067  14  GLU A OE2 
29   N N   . ARG A 4   ? 0.6841 0.3309 0.3900 -0.0207 -0.1502 0.0086  15  ARG A N   
30   C CA  . ARG A 4   ? 0.7046 0.3428 0.4056 -0.0218 -0.1566 0.0093  15  ARG A CA  
31   C C   . ARG A 4   ? 0.7436 0.3856 0.4519 -0.0165 -0.1592 0.0073  15  ARG A C   
32   O O   . ARG A 4   ? 0.7328 0.3743 0.4423 -0.0168 -0.1608 0.0075  15  ARG A O   
33   C CB  . ARG A 4   ? 0.7512 0.3740 0.4395 -0.0240 -0.1640 0.0103  15  ARG A CB  
34   C CG  . ARG A 4   ? 0.9353 0.5470 0.6155 -0.0270 -0.1702 0.0116  15  ARG A CG  
35   C CD  . ARG A 4   ? 1.1234 0.7347 0.7997 -0.0335 -0.1671 0.0141  15  ARG A CD  
36   N NE  . ARG A 4   ? 1.2583 0.8789 0.9427 -0.0335 -0.1630 0.0142  15  ARG A NE  
37   C CZ  . ARG A 4   ? 1.4347 1.0573 1.1181 -0.0387 -0.1597 0.0161  15  ARG A CZ  
38   N NH1 . ARG A 4   ? 1.2372 0.8534 0.9119 -0.0444 -0.1599 0.0181  15  ARG A NH1 
39   N NH2 . ARG A 4   ? 1.2512 0.8823 0.9422 -0.0383 -0.1563 0.0160  15  ARG A NH2 
40   N N   . LEU A 5   ? 0.7489 0.3944 0.4619 -0.0117 -0.1597 0.0052  16  LEU A N   
41   C CA  . LEU A 5   ? 0.7437 0.3935 0.4643 -0.0065 -0.1620 0.0030  16  LEU A CA  
42   C C   . LEU A 5   ? 0.7103 0.3739 0.4420 -0.0055 -0.1551 0.0026  16  LEU A C   
43   O O   . LEU A 5   ? 0.6763 0.3423 0.4128 -0.0033 -0.1568 0.0016  16  LEU A O   
44   C CB  . LEU A 5   ? 0.7549 0.4054 0.4779 -0.0020 -0.1642 0.0010  16  LEU A CB  
45   C CG  . LEU A 5   ? 0.8666 0.5033 0.5802 -0.0009 -0.1728 0.0005  16  LEU A CG  
46   C CD1 . LEU A 5   ? 0.8858 0.5127 0.5881 -0.0056 -0.1739 0.0026  16  LEU A CD1 
47   C CD2 . LEU A 5   ? 0.9338 0.5738 0.6525 0.0043  -0.1745 -0.0019 16  LEU A CD2 
48   N N   . LYS A 6   ? 0.6484 0.3209 0.3841 -0.0071 -0.1474 0.0032  17  LYS A N   
49   C CA  . LYS A 6   ? 0.6153 0.3004 0.3606 -0.0064 -0.1406 0.0029  17  LYS A CA  
50   C C   . LYS A 6   ? 0.6578 0.3416 0.4021 -0.0093 -0.1409 0.0041  17  LYS A C   
51   O O   . LYS A 6   ? 0.6533 0.3443 0.4051 -0.0074 -0.1390 0.0034  17  LYS A O   
52   C CB  . LYS A 6   ? 0.6019 0.2944 0.3492 -0.0081 -0.1326 0.0035  17  LYS A CB  
53   C CG  . LYS A 6   ? 0.4822 0.1778 0.2317 -0.0052 -0.1312 0.0022  17  LYS A CG  
54   C CD  . LYS A 6   ? 0.4761 0.1791 0.2275 -0.0067 -0.1228 0.0027  17  LYS A CD  
55   C CE  . LYS A 6   ? 0.4549 0.1588 0.2061 -0.0047 -0.1217 0.0019  17  LYS A CE  
56   N NZ  . LYS A 6   ? 0.4607 0.1704 0.2125 -0.0062 -0.1136 0.0024  17  LYS A NZ  
57   N N   . ARG A 7   ? 0.6059 0.2804 0.3408 -0.0140 -0.1433 0.0061  18  ARG A N   
58   C CA  . ARG A 7   ? 0.6084 0.2811 0.3416 -0.0173 -0.1436 0.0076  18  ARG A CA  
59   C C   . ARG A 7   ? 0.6880 0.3545 0.4200 -0.0153 -0.1505 0.0069  18  ARG A C   
60   O O   . ARG A 7   ? 0.7031 0.3708 0.4365 -0.0167 -0.1503 0.0076  18  ARG A O   
61   C CB  . ARG A 7   ? 0.5710 0.2352 0.2941 -0.0234 -0.1445 0.0100  18  ARG A CB  
62   C CG  . ARG A 7   ? 0.4620 0.1330 0.1868 -0.0259 -0.1371 0.0107  18  ARG A CG  
63   C CD  . ARG A 7   ? 0.6111 0.2756 0.3274 -0.0324 -0.1373 0.0131  18  ARG A CD  
64   N NE  . ARG A 7   ? 0.5829 0.2563 0.3035 -0.0345 -0.1293 0.0135  18  ARG A NE  
65   C CZ  . ARG A 7   ? 0.7362 0.4075 0.4533 -0.0400 -0.1269 0.0154  18  ARG A CZ  
66   N NH1 . ARG A 7   ? 0.5104 0.1917 0.2354 -0.0408 -0.1181 0.0155  18  ARG A NH1 
67   N NH2 . ARG A 7   ? 0.7046 0.3635 0.4101 -0.0445 -0.1333 0.0172  18  ARG A NH2 
68   N N   . ASP A 8   ? 0.6668 0.3266 0.3960 -0.0118 -0.1566 0.0055  19  ASP A N   
69   C CA  . ASP A 8   ? 0.6735 0.3275 0.4019 -0.0090 -0.1632 0.0043  19  ASP A CA  
70   C C   . ASP A 8   ? 0.6691 0.3344 0.4095 -0.0041 -0.1606 0.0021  19  ASP A C   
71   O O   . ASP A 8   ? 0.6651 0.3288 0.4069 -0.0026 -0.1638 0.0014  19  ASP A O   
72   C CB  . ASP A 8   ? 0.7209 0.3629 0.4415 -0.0069 -0.1710 0.0034  19  ASP A CB  
73   C CG  . ASP A 8   ? 0.9240 0.5537 0.6319 -0.0117 -0.1741 0.0056  19  ASP A CG  
74   O OD1 . ASP A 8   ? 0.8976 0.5257 0.6014 -0.0170 -0.1720 0.0079  19  ASP A OD1 
75   O OD2 . ASP A 8   ? 1.0939 0.7153 0.7958 -0.0104 -0.1789 0.0050  19  ASP A OD2 
76   N N   . LEU A 9   ? 0.5678 0.2442 0.3165 -0.0018 -0.1550 0.0009  20  LEU A N   
77   C CA  . LEU A 9   ? 0.5476 0.2348 0.3076 0.0027  -0.1527 -0.0012 20  LEU A CA  
78   C C   . LEU A 9   ? 0.5554 0.2552 0.3236 0.0016  -0.1445 -0.0007 20  LEU A C   
79   O O   . LEU A 9   ? 0.5202 0.2261 0.2955 0.0038  -0.1437 -0.0018 20  LEU A O   
80   C CB  . LEU A 9   ? 0.5505 0.2414 0.3142 0.0064  -0.1525 -0.0030 20  LEU A CB  
81   C CG  . LEU A 9   ? 0.6394 0.3192 0.3966 0.0087  -0.1607 -0.0042 20  LEU A CG  
82   C CD1 . LEU A 9   ? 0.6238 0.3076 0.3840 0.0112  -0.1593 -0.0054 20  LEU A CD1 
83   C CD2 . LEU A 9   ? 0.6980 0.3744 0.4570 0.0126  -0.1668 -0.0063 20  LEU A CD2 
84   N N   . PHE A 10  ? 0.5312 0.2348 0.2984 -0.0018 -0.1384 0.0009  21  PHE A N   
85   C CA  . PHE A 10  ? 0.4970 0.2128 0.2720 -0.0022 -0.1302 0.0010  21  PHE A CA  
86   C C   . PHE A 10  ? 0.5436 0.2586 0.3152 -0.0071 -0.1271 0.0032  21  PHE A C   
87   O O   . PHE A 10  ? 0.5503 0.2574 0.3133 -0.0109 -0.1287 0.0048  21  PHE A O   
88   C CB  . PHE A 10  ? 0.4988 0.2211 0.2767 -0.0012 -0.1248 0.0006  21  PHE A CB  
89   C CG  . PHE A 10  ? 0.5145 0.2361 0.2940 0.0027  -0.1283 -0.0012 21  PHE A CG  
90   C CD1 . PHE A 10  ? 0.5333 0.2608 0.3209 0.0069  -0.1294 -0.0032 21  PHE A CD1 
91   C CD2 . PHE A 10  ? 0.5348 0.2498 0.3080 0.0023  -0.1306 -0.0010 21  PHE A CD2 
92   C CE1 . PHE A 10  ? 0.5383 0.2652 0.3276 0.0105  -0.1327 -0.0050 21  PHE A CE1 
93   C CE2 . PHE A 10  ? 0.5665 0.2808 0.3412 0.0059  -0.1339 -0.0027 21  PHE A CE2 
94   C CZ  . PHE A 10  ? 0.5349 0.2552 0.3178 0.0100  -0.1350 -0.0047 21  PHE A CZ  
95   N N   . GLN A 11  ? 0.5597 0.2840 0.3402 -0.0072 -0.1215 0.0031  22  GLN A N   
96   C CA  . GLN A 11  ? 0.5392 0.2664 0.3207 -0.0114 -0.1163 0.0048  22  GLN A CA  
97   C C   . GLN A 11  ? 0.5578 0.2973 0.3510 -0.0099 -0.1097 0.0040  22  GLN A C   
98   O O   . GLN A 11  ? 0.5700 0.3110 0.3676 -0.0074 -0.1121 0.0030  22  GLN A O   
99   C CB  . GLN A 11  ? 0.5658 0.2822 0.3391 -0.0150 -0.1223 0.0064  22  GLN A CB  
100  C CG  . GLN A 11  ? 0.5011 0.2181 0.2729 -0.0204 -0.1180 0.0085  22  GLN A CG  
101  C CD  . GLN A 11  ? 0.5964 0.3010 0.3577 -0.0246 -0.1247 0.0104  22  GLN A CD  
102  O OE1 . GLN A 11  ? 0.5923 0.2892 0.3496 -0.0234 -0.1316 0.0101  22  GLN A OE1 
103  N NE2 . GLN A 11  ? 0.4648 0.1669 0.2215 -0.0299 -0.1227 0.0124  22  GLN A NE2 
104  N N   . PHE A 12  ? 0.4130 0.1611 0.2111 -0.0112 -0.1013 0.0045  23  PHE A N   
105  C CA  . PHE A 12  ? 0.3775 0.1377 0.1865 -0.0094 -0.0944 0.0037  23  PHE A CA  
106  C C   . PHE A 12  ? 0.4482 0.2103 0.2597 -0.0125 -0.0921 0.0049  23  PHE A C   
107  O O   . PHE A 12  ? 0.4566 0.2159 0.2641 -0.0165 -0.0906 0.0065  23  PHE A O   
108  C CB  . PHE A 12  ? 0.3671 0.1355 0.1802 -0.0087 -0.0864 0.0033  23  PHE A CB  
109  C CG  . PHE A 12  ? 0.3552 0.1354 0.1786 -0.0068 -0.0796 0.0025  23  PHE A CG  
110  C CD1 . PHE A 12  ? 0.3703 0.1553 0.1992 -0.0030 -0.0801 0.0009  23  PHE A CD1 
111  C CD2 . PHE A 12  ? 0.3706 0.1569 0.1984 -0.0088 -0.0728 0.0033  23  PHE A CD2 
112  C CE1 . PHE A 12  ? 0.3830 0.1783 0.2208 -0.0015 -0.0740 0.0002  23  PHE A CE1 
113  C CE2 . PHE A 12  ? 0.3910 0.1875 0.2277 -0.0070 -0.0667 0.0026  23  PHE A CE2 
114  C CZ  . PHE A 12  ? 0.3635 0.1644 0.2050 -0.0035 -0.0673 0.0011  23  PHE A CZ  
115  N N   . ASN A 13  ? 0.3825 0.1494 0.2006 -0.0107 -0.0917 0.0041  24  ASN A N   
116  C CA  . ASN A 13  ? 0.3788 0.1484 0.2001 -0.0133 -0.0895 0.0050  24  ASN A CA  
117  C C   . ASN A 13  ? 0.4016 0.1812 0.2332 -0.0103 -0.0854 0.0036  24  ASN A C   
118  O O   . ASN A 13  ? 0.3883 0.1685 0.2225 -0.0067 -0.0884 0.0020  24  ASN A O   
119  C CB  . ASN A 13  ? 0.4042 0.1631 0.2182 -0.0156 -0.0972 0.0061  24  ASN A CB  
120  C CG  . ASN A 13  ? 0.5869 0.3353 0.3902 -0.0193 -0.1013 0.0078  24  ASN A CG  
121  O OD1 . ASN A 13  ? 0.4841 0.2248 0.2808 -0.0181 -0.1068 0.0074  24  ASN A OD1 
122  N ND2 . ASN A 13  ? 0.5069 0.2549 0.3083 -0.0240 -0.0988 0.0097  24  ASN A ND2 
123  N N   . LYS A 14  ? 0.4183 0.2056 0.2557 -0.0118 -0.0788 0.0042  25  LYS A N   
124  C CA  . LYS A 14  ? 0.3990 0.1947 0.2453 -0.0099 -0.0754 0.0032  25  LYS A CA  
125  C C   . LYS A 14  ? 0.4456 0.2369 0.2903 -0.0122 -0.0792 0.0040  25  LYS A C   
126  O O   . LYS A 14  ? 0.4236 0.2117 0.2646 -0.0162 -0.0790 0.0058  25  LYS A O   
127  C CB  . LYS A 14  ? 0.4122 0.2183 0.2652 -0.0101 -0.0661 0.0033  25  LYS A CB  
128  C CG  . LYS A 14  ? 0.5119 0.3226 0.3665 -0.0076 -0.0619 0.0024  25  LYS A CG  
129  C CD  . LYS A 14  ? 0.5884 0.4081 0.4485 -0.0078 -0.0529 0.0027  25  LYS A CD  
130  C CE  . LYS A 14  ? 0.6714 0.4953 0.5325 -0.0054 -0.0487 0.0019  25  LYS A CE  
131  N NZ  . LYS A 14  ? 0.7595 0.5912 0.6250 -0.0053 -0.0399 0.0021  25  LYS A NZ  
132  N N   . THR A 15  ? 0.4330 0.2239 0.2806 -0.0098 -0.0826 0.0028  26  THR A N   
133  C CA  . THR A 15  ? 0.4539 0.2367 0.2970 -0.0115 -0.0886 0.0034  26  THR A CA  
134  C C   . THR A 15  ? 0.4724 0.2606 0.3221 -0.0116 -0.0862 0.0030  26  THR A C   
135  O O   . THR A 15  ? 0.4750 0.2582 0.3209 -0.0149 -0.0886 0.0044  26  THR A O   
136  C CB  . THR A 15  ? 0.6441 0.4184 0.4826 -0.0088 -0.0965 0.0021  26  THR A CB  
137  O OG1 . THR A 15  ? 0.8295 0.5944 0.6623 -0.0106 -0.1025 0.0028  26  THR A OG1 
138  C CG2 . THR A 15  ? 0.5541 0.3351 0.4008 -0.0039 -0.0956 -0.0005 26  THR A CG2 
139  N N   . VAL A 16  ? 0.3979 0.1957 0.2567 -0.0083 -0.0817 0.0013  27  VAL A N   
140  C CA  . VAL A 16  ? 0.3862 0.1890 0.2513 -0.0083 -0.0795 0.0008  27  VAL A CA  
141  C C   . VAL A 16  ? 0.4512 0.2657 0.3260 -0.0052 -0.0730 -0.0007 27  VAL A C   
142  O O   . VAL A 16  ? 0.4411 0.2582 0.3174 -0.0026 -0.0721 -0.0018 27  VAL A O   
143  C CB  . VAL A 16  ? 0.4289 0.2241 0.2916 -0.0070 -0.0865 -0.0003 27  VAL A CB  
144  C CG1 . VAL A 16  ? 0.4061 0.2022 0.2721 -0.0022 -0.0891 -0.0028 27  VAL A CG1 
145  C CG2 . VAL A 16  ? 0.4200 0.2183 0.2872 -0.0081 -0.0847 -0.0004 27  VAL A CG2 
146  N N   . GLU A 17  ? 0.4421 0.2633 0.3229 -0.0058 -0.0685 -0.0008 28  GLU A N   
147  C CA  . GLU A 17  ? 0.4209 0.2528 0.3106 -0.0033 -0.0624 -0.0021 28  GLU A CA  
148  C C   . GLU A 17  ? 0.4519 0.2850 0.3466 -0.0013 -0.0645 -0.0039 28  GLU A C   
149  O O   . GLU A 17  ? 0.4708 0.2989 0.3633 -0.0027 -0.0679 -0.0037 28  GLU A O   
150  C CB  . GLU A 17  ? 0.4267 0.2660 0.3200 -0.0053 -0.0550 -0.0009 28  GLU A CB  
151  C CG  . GLU A 17  ? 0.4854 0.3239 0.3746 -0.0071 -0.0524 0.0006  28  GLU A CG  
152  C CD  . GLU A 17  ? 0.9375 0.7801 0.8285 -0.0098 -0.0472 0.0020  28  GLU A CD  
153  O OE1 . GLU A 17  ? 0.9657 0.8087 0.8584 -0.0114 -0.0477 0.0024  28  GLU A OE1 
154  O OE2 . GLU A 17  ? 1.0383 0.8836 0.9290 -0.0103 -0.0426 0.0027  28  GLU A OE2 
155  N N   . HIS A 18  ? 0.3638 0.2033 0.2649 0.0019  -0.0623 -0.0058 29  HIS A N   
156  C CA  . HIS A 18  ? 0.3462 0.1879 0.2530 0.0040  -0.0637 -0.0079 29  HIS A CA  
157  C C   . HIS A 18  ? 0.4033 0.2559 0.3183 0.0047  -0.0564 -0.0085 29  HIS A C   
158  O O   . HIS A 18  ? 0.4023 0.2606 0.3194 0.0053  -0.0519 -0.0082 29  HIS A O   
159  C CB  . HIS A 18  ? 0.3563 0.1949 0.2632 0.0074  -0.0691 -0.0101 29  HIS A CB  
160  C CG  . HIS A 18  ? 0.4065 0.2340 0.3048 0.0072  -0.0764 -0.0096 29  HIS A CG  
161  N ND1 . HIS A 18  ? 0.4294 0.2481 0.3231 0.0065  -0.0821 -0.0097 29  HIS A ND1 
162  C CD2 . HIS A 18  ? 0.4214 0.2444 0.3143 0.0076  -0.0792 -0.0091 29  HIS A CD2 
163  C CE1 . HIS A 18  ? 0.4319 0.2412 0.3177 0.0064  -0.0881 -0.0092 29  HIS A CE1 
164  N NE2 . HIS A 18  ? 0.4342 0.2461 0.3195 0.0071  -0.0864 -0.0088 29  HIS A NE2 
165  N N   . GLY A 19  ? 0.3624 0.2176 0.2817 0.0045  -0.0554 -0.0093 30  GLY A N   
166  C CA  . GLY A 19  ? 0.3483 0.2132 0.2753 0.0051  -0.0491 -0.0100 30  GLY A CA  
167  C C   . GLY A 19  ? 0.3705 0.2387 0.2987 0.0025  -0.0445 -0.0085 30  GLY A C   
168  O O   . GLY A 19  ? 0.3654 0.2281 0.2892 0.0002  -0.0470 -0.0073 30  GLY A O   
169  N N   . PHE A 20  ? 0.3533 0.2302 0.2872 0.0028  -0.0380 -0.0086 31  PHE A N   
170  C CA  . PHE A 20  ? 0.3327 0.2139 0.2686 0.0008  -0.0331 -0.0074 31  PHE A CA  
171  C C   . PHE A 20  ? 0.4145 0.2983 0.3482 -0.0004 -0.0286 -0.0054 31  PHE A C   
172  O O   . PHE A 20  ? 0.4156 0.3035 0.3505 0.0009  -0.0250 -0.0054 31  PHE A O   
173  C CB  . PHE A 20  ? 0.3226 0.2115 0.2659 0.0020  -0.0289 -0.0088 31  PHE A CB  
174  C CG  . PHE A 20  ? 0.3170 0.2098 0.2626 0.0002  -0.0249 -0.0079 31  PHE A CG  
175  C CD1 . PHE A 20  ? 0.3413 0.2305 0.2864 -0.0011 -0.0278 -0.0083 31  PHE A CD1 
176  C CD2 . PHE A 20  ? 0.3233 0.2229 0.2712 -0.0001 -0.0185 -0.0068 31  PHE A CD2 
177  C CE1 . PHE A 20  ? 0.3356 0.2283 0.2826 -0.0028 -0.0244 -0.0075 31  PHE A CE1 
178  C CE2 . PHE A 20  ? 0.3531 0.2562 0.3031 -0.0014 -0.0153 -0.0060 31  PHE A CE2 
179  C CZ  . PHE A 20  ? 0.3344 0.2342 0.2841 -0.0028 -0.0182 -0.0064 31  PHE A CZ  
180  N N   . PRO A 21  ? 0.3880 0.2692 0.3183 -0.0029 -0.0285 -0.0038 32  PRO A N   
181  C CA  . PRO A 21  ? 0.3779 0.2610 0.3061 -0.0039 -0.0244 -0.0022 32  PRO A CA  
182  C C   . PRO A 21  ? 0.4202 0.3122 0.3533 -0.0029 -0.0171 -0.0021 32  PRO A C   
183  O O   . PRO A 21  ? 0.4061 0.3026 0.3437 -0.0028 -0.0149 -0.0025 32  PRO A O   
184  C CB  . PRO A 21  ? 0.4000 0.2788 0.3248 -0.0071 -0.0263 -0.0007 32  PRO A CB  
185  C CG  . PRO A 21  ? 0.4652 0.3372 0.3876 -0.0077 -0.0331 -0.0013 32  PRO A CG  
186  C CD  . PRO A 21  ? 0.4104 0.2862 0.3382 -0.0051 -0.0326 -0.0033 32  PRO A CD  
187  N N   . HIS A 22  ? 0.3780 0.2720 0.3094 -0.0022 -0.0134 -0.0015 33  HIS A N   
188  C CA  . HIS A 22  ? 0.3540 0.2556 0.2880 -0.0010 -0.0067 -0.0013 33  HIS A CA  
189  C C   . HIS A 22  ? 0.3930 0.2981 0.3284 -0.0021 -0.0028 -0.0003 33  HIS A C   
190  O O   . HIS A 22  ? 0.3759 0.2781 0.3093 -0.0036 -0.0033 0.0006  33  HIS A O   
191  C CB  . HIS A 22  ? 0.3552 0.2570 0.2854 0.0000  -0.0040 -0.0008 33  HIS A CB  
192  C CG  . HIS A 22  ? 0.3890 0.2977 0.3194 0.0012  0.0029  -0.0005 33  HIS A CG  
193  N ND1 . HIS A 22  ? 0.4053 0.3185 0.3391 0.0021  0.0043  -0.0010 33  HIS A ND1 
194  C CD2 . HIS A 22  ? 0.4151 0.3264 0.3418 0.0018  0.0090  0.0002  33  HIS A CD2 
195  C CE1 . HIS A 22  ? 0.3985 0.3166 0.3297 0.0028  0.0111  -0.0001 33  HIS A CE1 
196  N NE2 . HIS A 22  ? 0.4061 0.3233 0.3329 0.0028  0.0143  0.0004  33  HIS A NE2 
197  N N   . GLN A 23  ? 0.3170 0.2283 0.2560 -0.0013 0.0010  -0.0006 34  GLN A N   
198  C CA  . GLN A 23  ? 0.3022 0.2179 0.2426 -0.0016 0.0055  0.0001  34  GLN A CA  
199  C C   . GLN A 23  ? 0.3371 0.2492 0.2788 -0.0039 0.0020  0.0007  34  GLN A C   
200  O O   . GLN A 23  ? 0.3310 0.2418 0.2716 -0.0049 0.0030  0.0018  34  GLN A O   
201  C CB  . GLN A 23  ? 0.3058 0.2242 0.2428 -0.0005 0.0118  0.0007  34  GLN A CB  
202  C CG  . GLN A 23  ? 0.3890 0.3117 0.3234 0.0013  0.0169  0.0005  34  GLN A CG  
203  C CD  . GLN A 23  ? 0.5894 0.5173 0.5240 0.0027  0.0232  0.0008  34  GLN A CD  
204  O OE1 . GLN A 23  ? 0.4876 0.4114 0.4185 0.0029  0.0240  0.0009  34  GLN A OE1 
205  N NE2 . GLN A 23  ? 0.5465 0.4871 0.4932 0.0034  0.0239  0.0012  34  GLN A NE2 
206  N N   . PRO A 24  ? 0.2932 0.2033 0.2369 -0.0050 -0.0021 0.0002  35  PRO A N   
207  C CA  . PRO A 24  ? 0.2967 0.2036 0.2405 -0.0077 -0.0050 0.0011  35  PRO A CA  
208  C C   . PRO A 24  ? 0.3176 0.2299 0.2647 -0.0079 -0.0006 0.0019  35  PRO A C   
209  O O   . PRO A 24  ? 0.2894 0.2079 0.2386 -0.0059 0.0041  0.0013  35  PRO A O   
210  C CB  . PRO A 24  ? 0.3234 0.2271 0.2677 -0.0082 -0.0096 -0.0001 35  PRO A CB  
211  C CG  . PRO A 24  ? 0.3578 0.2665 0.3058 -0.0055 -0.0071 -0.0016 35  PRO A CG  
212  C CD  . PRO A 24  ? 0.3070 0.2175 0.2531 -0.0039 -0.0042 -0.0014 35  PRO A CD  
213  N N   . SER A 25  ? 0.2608 0.1709 0.2081 -0.0106 -0.0022 0.0037  36  SER A N   
214  C CA  . SER A 25  ? 0.2486 0.1636 0.2002 -0.0109 0.0015  0.0051  36  SER A CA  
215  C C   . SER A 25  ? 0.2992 0.2124 0.2520 -0.0147 -0.0019 0.0067  36  SER A C   
216  O O   . SER A 25  ? 0.2845 0.2024 0.2419 -0.0150 0.0007  0.0083  36  SER A O   
217  C CB  . SER A 25  ? 0.2825 0.1987 0.2350 -0.0104 0.0044  0.0069  36  SER A CB  
218  O OG  . SER A 25  ? 0.4007 0.3111 0.3510 -0.0137 0.0004  0.0089  36  SER A OG  
219  N N   . ALA A 26  ? 0.2803 0.1869 0.2284 -0.0176 -0.0076 0.0066  37  ALA A N   
220  C CA  . ALA A 26  ? 0.2683 0.1727 0.2151 -0.0219 -0.0111 0.0081  37  ALA A CA  
221  C C   . ALA A 26  ? 0.3356 0.2327 0.2766 -0.0235 -0.0172 0.0068  37  ALA A C   
222  O O   . ALA A 26  ? 0.3451 0.2376 0.2826 -0.0220 -0.0196 0.0057  37  ALA A O   
223  C CB  . ALA A 26  ? 0.2676 0.1711 0.2139 -0.0260 -0.0121 0.0118  37  ALA A CB  
224  N N   . LEU A 27  ? 0.2916 0.1875 0.2317 -0.0263 -0.0197 0.0072  38  LEU A N   
225  C CA  . LEU A 27  ? 0.3080 0.1966 0.2430 -0.0279 -0.0255 0.0063  38  LEU A CA  
226  C C   . LEU A 27  ? 0.3336 0.2184 0.2639 -0.0340 -0.0298 0.0089  38  LEU A C   
227  O O   . LEU A 27  ? 0.2891 0.1791 0.2222 -0.0366 -0.0279 0.0106  38  LEU A O   
228  C CB  . LEU A 27  ? 0.3149 0.2055 0.2536 -0.0250 -0.0243 0.0035  38  LEU A CB  
229  C CG  . LEU A 27  ? 0.4115 0.2947 0.3462 -0.0265 -0.0297 0.0025  38  LEU A CG  
230  C CD1 . LEU A 27  ? 0.4384 0.3142 0.3687 -0.0251 -0.0341 0.0017  38  LEU A CD1 
231  C CD2 . LEU A 27  ? 0.4694 0.3561 0.4093 -0.0241 -0.0277 -0.0002 38  LEU A CD2 
232  N N   . GLY A 28  ? 0.3458 0.2218 0.2688 -0.0366 -0.0357 0.0096  39  GLY A N   
233  C CA  . GLY A 28  ? 0.3487 0.2201 0.2660 -0.0429 -0.0404 0.0121  39  GLY A CA  
234  C C   . GLY A 28  ? 0.4203 0.2821 0.3319 -0.0432 -0.0458 0.0107  39  GLY A C   
235  O O   . GLY A 28  ? 0.3844 0.2426 0.2960 -0.0388 -0.0466 0.0082  39  GLY A O   
236  N N   . TYR A 29  ? 0.4358 0.2936 0.3426 -0.0486 -0.0495 0.0124  40  TYR A N   
237  C CA  . TYR A 29  ? 0.4590 0.3065 0.3600 -0.0493 -0.0547 0.0111  40  TYR A CA  
238  C C   . TYR A 29  ? 0.5485 0.3904 0.4414 -0.0571 -0.0594 0.0144  40  TYR A C   
239  O O   . TYR A 29  ? 0.5459 0.3936 0.4399 -0.0615 -0.0581 0.0165  40  TYR A O   
240  C CB  . TYR A 29  ? 0.4750 0.3242 0.3812 -0.0457 -0.0528 0.0075  40  TYR A CB  
241  C CG  . TYR A 29  ? 0.5071 0.3457 0.4082 -0.0460 -0.0580 0.0057  40  TYR A CG  
242  C CD1 . TYR A 29  ? 0.5319 0.3641 0.4312 -0.0420 -0.0608 0.0037  40  TYR A CD1 
243  C CD2 . TYR A 29  ? 0.5199 0.3548 0.4177 -0.0505 -0.0603 0.0059  40  TYR A CD2 
244  C CE1 . TYR A 29  ? 0.5641 0.3863 0.4588 -0.0420 -0.0657 0.0018  40  TYR A CE1 
245  C CE2 . TYR A 29  ? 0.5469 0.3715 0.4398 -0.0507 -0.0650 0.0039  40  TYR A CE2 
246  C CZ  . TYR A 29  ? 0.7010 0.5191 0.5924 -0.0462 -0.0677 0.0018  40  TYR A CZ  
247  O OH  . TYR A 29  ? 0.7682 0.5758 0.6547 -0.0462 -0.0726 -0.0003 40  TYR A OH  
248  N N   . SER A 30  ? 0.4797 0.3103 0.3640 -0.0590 -0.0651 0.0149  41  SER A N   
249  C CA  . SER A 30  ? 0.5043 0.3279 0.3796 -0.0666 -0.0702 0.0178  41  SER A CA  
250  C C   . SER A 30  ? 0.5812 0.3967 0.4538 -0.0661 -0.0730 0.0152  41  SER A C   
251  O O   . SER A 30  ? 0.5663 0.3735 0.4367 -0.0622 -0.0758 0.0126  41  SER A O   
252  C CB  . SER A 30  ? 0.5537 0.3689 0.4201 -0.0696 -0.0748 0.0201  41  SER A CB  
253  O OG  . SER A 30  ? 0.6271 0.4336 0.4836 -0.0768 -0.0802 0.0226  41  SER A OG  
254  N N   . PRO A 31  ? 0.6068 0.4245 0.4797 -0.0701 -0.0726 0.0155  42  PRO A N   
255  C CA  . PRO A 31  ? 0.6162 0.4255 0.4863 -0.0700 -0.0755 0.0127  42  PRO A CA  
256  C C   . PRO A 31  ? 0.6736 0.4691 0.5315 -0.0751 -0.0823 0.0144  42  PRO A C   
257  O O   . PRO A 31  ? 0.6584 0.4441 0.5131 -0.0730 -0.0856 0.0114  42  PRO A O   
258  C CB  . PRO A 31  ? 0.6290 0.4457 0.5027 -0.0735 -0.0728 0.0130  42  PRO A CB  
259  C CG  . PRO A 31  ? 0.6649 0.4949 0.5451 -0.0735 -0.0678 0.0154  42  PRO A CG  
260  C CD  . PRO A 31  ? 0.6196 0.4483 0.4962 -0.0743 -0.0693 0.0182  42  PRO A CD  
261  N N   . SER A 32  ? 0.5836 0.3780 0.4345 -0.0817 -0.0847 0.0190  43  SER A N   
262  C CA  . SER A 32  ? 0.6182 0.3989 0.4565 -0.0870 -0.0913 0.0210  43  SER A CA  
263  C C   . SER A 32  ? 0.7126 0.4842 0.5475 -0.0820 -0.0943 0.0194  43  SER A C   
264  O O   . SER A 32  ? 0.7480 0.5063 0.5745 -0.0827 -0.0996 0.0185  43  SER A O   
265  C CB  . SER A 32  ? 0.6609 0.4444 0.4930 -0.0960 -0.0929 0.0265  43  SER A CB  
266  O OG  . SER A 32  ? 0.7568 0.5522 0.5958 -0.0945 -0.0887 0.0281  43  SER A OG  
267  N N   . LEU A 33  ? 0.6888 0.4674 0.5300 -0.0770 -0.0911 0.0190  44  LEU A N   
268  C CA  . LEU A 33  ? 0.6886 0.4601 0.5268 -0.0725 -0.0937 0.0178  44  LEU A CA  
269  C C   . LEU A 33  ? 0.7167 0.4903 0.5631 -0.0634 -0.0914 0.0131  44  LEU A C   
270  O O   . LEU A 33  ? 0.7209 0.4880 0.5648 -0.0595 -0.0943 0.0117  44  LEU A O   
271  C CB  . LEU A 33  ? 0.6817 0.4588 0.5203 -0.0736 -0.0921 0.0206  44  LEU A CB  
272  C CG  . LEU A 33  ? 0.7604 0.5356 0.5905 -0.0828 -0.0949 0.0255  44  LEU A CG  
273  C CD1 . LEU A 33  ? 0.7559 0.5408 0.5901 -0.0832 -0.0915 0.0276  44  LEU A CD1 
274  C CD2 . LEU A 33  ? 0.8282 0.5876 0.6450 -0.0862 -0.1020 0.0267  44  LEU A CD2 
275  N N   . ARG A 34  ? 0.6471 0.4299 0.5032 -0.0603 -0.0866 0.0106  45  ARG A N   
276  C CA  . ARG A 34  ? 0.6272 0.4143 0.4921 -0.0522 -0.0838 0.0063  45  ARG A CA  
277  C C   . ARG A 34  ? 0.6572 0.4483 0.5252 -0.0477 -0.0822 0.0063  45  ARG A C   
278  O O   . ARG A 34  ? 0.6766 0.4631 0.5442 -0.0429 -0.0845 0.0040  45  ARG A O   
279  C CB  . ARG A 34  ? 0.6440 0.4208 0.5058 -0.0497 -0.0882 0.0028  45  ARG A CB  
280  C CG  . ARG A 34  ? 0.7815 0.5552 0.6417 -0.0533 -0.0890 0.0018  45  ARG A CG  
281  C CD  . ARG A 34  ? 1.0028 0.7686 0.8626 -0.0491 -0.0921 -0.0027 45  ARG A CD  
282  N NE  . ARG A 34  ? 1.2565 1.0160 1.1118 -0.0536 -0.0943 -0.0036 45  ARG A NE  
283  C CZ  . ARG A 34  ? 1.4807 1.2329 1.3349 -0.0511 -0.0970 -0.0076 45  ARG A CZ  
284  N NH1 . ARG A 34  ? 1.3245 1.0750 1.1820 -0.0441 -0.0981 -0.0111 45  ARG A NH1 
285  N NH2 . ARG A 34  ? 1.3195 1.0659 1.1690 -0.0557 -0.0988 -0.0083 45  ARG A NH2 
286  N N   . ILE A 35  ? 0.5501 0.3499 0.4209 -0.0494 -0.0783 0.0088  46  ILE A N   
287  C CA  . ILE A 35  ? 0.5270 0.3311 0.4003 -0.0461 -0.0762 0.0090  46  ILE A CA  
288  C C   . ILE A 35  ? 0.5346 0.3526 0.4185 -0.0431 -0.0689 0.0082  46  ILE A C   
289  O O   . ILE A 35  ? 0.5146 0.3388 0.4010 -0.0463 -0.0660 0.0097  46  ILE A O   
290  C CB  . ILE A 35  ? 0.5696 0.3699 0.4351 -0.0513 -0.0788 0.0129  46  ILE A CB  
291  C CG1 . ILE A 35  ? 0.5952 0.3808 0.4492 -0.0543 -0.0862 0.0138  46  ILE A CG1 
292  C CG2 . ILE A 35  ? 0.5517 0.3572 0.4205 -0.0480 -0.0759 0.0128  46  ILE A CG2 
293  C CD1 . ILE A 35  ? 0.6451 0.4240 0.4977 -0.0487 -0.0893 0.0112  46  ILE A CD1 
294  N N   . LEU A 36  ? 0.5743 0.3969 0.4640 -0.0371 -0.0662 0.0059  47  LEU A N   
295  C CA  . LEU A 36  ? 0.5438 0.3785 0.4428 -0.0339 -0.0593 0.0050  47  LEU A CA  
296  C C   . LEU A 36  ? 0.5778 0.4164 0.4766 -0.0344 -0.0569 0.0069  47  LEU A C   
297  O O   . LEU A 36  ? 0.5964 0.4293 0.4903 -0.0340 -0.0599 0.0073  47  LEU A O   
298  C CB  . LEU A 36  ? 0.5370 0.3750 0.4425 -0.0277 -0.0574 0.0013  47  LEU A CB  
299  C CG  . LEU A 36  ? 0.5873 0.4370 0.5022 -0.0249 -0.0505 -0.0001 47  LEU A CG  
300  C CD1 . LEU A 36  ? 0.6005 0.4523 0.5179 -0.0267 -0.0493 -0.0007 47  LEU A CD1 
301  C CD2 . LEU A 36  ? 0.5864 0.4395 0.5066 -0.0193 -0.0490 -0.0030 47  LEU A CD2 
302  N N   . ALA A 37  ? 0.3973 0.2452 0.3014 -0.0351 -0.0514 0.0079  48  ALA A N   
303  C CA  . ALA A 37  ? 0.3812 0.2333 0.2862 -0.0355 -0.0484 0.0094  48  ALA A CA  
304  C C   . ALA A 37  ? 0.4409 0.3032 0.3547 -0.0309 -0.0414 0.0077  48  ALA A C   
305  O O   . ALA A 37  ? 0.4457 0.3141 0.3648 -0.0302 -0.0380 0.0070  48  ALA A O   
306  C CB  . ALA A 37  ? 0.3900 0.2432 0.2926 -0.0417 -0.0489 0.0129  48  ALA A CB  
307  N N   . ILE A 38  ? 0.4102 0.2740 0.3249 -0.0279 -0.0393 0.0071  49  ILE A N   
308  C CA  . ILE A 38  ? 0.3734 0.2460 0.2952 -0.0238 -0.0327 0.0057  49  ILE A CA  
309  C C   . ILE A 38  ? 0.4091 0.2844 0.3314 -0.0245 -0.0294 0.0073  49  ILE A C   
310  O O   . ILE A 38  ? 0.4384 0.3083 0.3556 -0.0257 -0.0322 0.0081  49  ILE A O   
311  C CB  . ILE A 38  ? 0.3963 0.2687 0.3195 -0.0192 -0.0329 0.0032  49  ILE A CB  
312  C CG1 . ILE A 38  ? 0.3865 0.2574 0.3113 -0.0181 -0.0353 0.0013  49  ILE A CG1 
313  C CG2 . ILE A 38  ? 0.3768 0.2578 0.3059 -0.0158 -0.0262 0.0023  49  ILE A CG2 
314  C CD1 . ILE A 38  ? 0.4630 0.3348 0.3905 -0.0139 -0.0355 -0.0011 49  ILE A CD1 
315  N N   . GLY A 39  ? 0.3856 0.2689 0.3142 -0.0236 -0.0235 0.0077  50  GLY A N   
316  C CA  . GLY A 39  ? 0.3592 0.2459 0.2902 -0.0230 -0.0192 0.0089  50  GLY A CA  
317  C C   . GLY A 39  ? 0.3737 0.2662 0.3090 -0.0180 -0.0136 0.0070  50  GLY A C   
318  O O   . GLY A 39  ? 0.3486 0.2447 0.2867 -0.0156 -0.0120 0.0053  50  GLY A O   
319  N N   . THR A 40  ? 0.3193 0.2128 0.2548 -0.0166 -0.0107 0.0075  51  THR A N   
320  C CA  . THR A 40  ? 0.3140 0.2123 0.2514 -0.0124 -0.0057 0.0059  51  THR A CA  
321  C C   . THR A 40  ? 0.3838 0.2872 0.3252 -0.0112 0.0001  0.0073  51  THR A C   
322  O O   . THR A 40  ? 0.3897 0.2927 0.3334 -0.0135 -0.0001 0.0100  51  THR A O   
323  C CB  . THR A 40  ? 0.3685 0.2623 0.3008 -0.0113 -0.0080 0.0048  51  THR A CB  
324  O OG1 . THR A 40  ? 0.4125 0.3022 0.3418 -0.0130 -0.0090 0.0064  51  THR A OG1 
325  C CG2 . THR A 40  ? 0.2750 0.1632 0.2039 -0.0121 -0.0144 0.0038  51  THR A CG2 
326  N N   . ARG A 41  ? 0.3485 0.2568 0.2902 -0.0076 0.0053  0.0057  52  ARG A N   
327  C CA  . ARG A 41  ? 0.3376 0.2504 0.2815 -0.0055 0.0113  0.0065  52  ARG A CA  
328  C C   . ARG A 41  ? 0.3737 0.2825 0.3157 -0.0061 0.0109  0.0080  52  ARG A C   
329  O O   . ARG A 41  ? 0.3590 0.2702 0.3044 -0.0054 0.0141  0.0101  52  ARG A O   
330  C CB  . ARG A 41  ? 0.3281 0.2462 0.2697 -0.0015 0.0179  0.0040  52  ARG A CB  
331  C CG  . ARG A 41  ? 0.4057 0.3286 0.3491 -0.0007 0.0197  0.0029  52  ARG A CG  
332  C CD  . ARG A 41  ? 0.4867 0.4155 0.4274 0.0028  0.0277  0.0013  52  ARG A CD  
333  N NE  . ARG A 41  ? 0.4621 0.3968 0.4071 0.0026  0.0270  0.0010  52  ARG A NE  
334  C CZ  . ARG A 41  ? 0.7375 0.6839 0.6925 0.0035  0.0259  0.0012  52  ARG A CZ  
335  N NH1 . ARG A 41  ? 0.6149 0.5679 0.5750 0.0044  0.0256  0.0015  52  ARG A NH1 
336  N NH2 . ARG A 41  ? 0.6563 0.6068 0.6146 0.0030  0.0247  0.0011  52  ARG A NH2 
337  N N   . SER A 42  ? 0.3652 0.2683 0.3022 -0.0073 0.0068  0.0073  53  SER A N   
338  C CA  . SER A 42  ? 0.3689 0.2677 0.3031 -0.0081 0.0062  0.0085  53  SER A CA  
339  C C   . SER A 42  ? 0.4100 0.3045 0.3454 -0.0123 0.0019  0.0117  53  SER A C   
340  O O   . SER A 42  ? 0.4162 0.3070 0.3493 -0.0135 0.0012  0.0131  53  SER A O   
341  C CB  . SER A 42  ? 0.4123 0.3066 0.3400 -0.0075 0.0035  0.0066  53  SER A CB  
342  O OG  . SER A 42  ? 0.5795 0.4693 0.5050 -0.0094 -0.0028 0.0061  53  SER A OG  
343  N N   . GLY A 43  ? 0.2827 0.1775 0.2205 -0.0150 -0.0007 0.0129  54  GLY A N   
344  C CA  . GLY A 43  ? 0.2862 0.1774 0.2234 -0.0199 -0.0045 0.0162  54  GLY A CA  
345  C C   . GLY A 43  ? 0.3376 0.2205 0.2663 -0.0233 -0.0118 0.0151  54  GLY A C   
346  O O   . GLY A 43  ? 0.3558 0.2348 0.2817 -0.0281 -0.0157 0.0176  54  GLY A O   
347  N N   . ALA A 44  ? 0.2988 0.1792 0.2235 -0.0212 -0.0141 0.0119  55  ALA A N   
348  C CA  . ALA A 44  ? 0.3271 0.1994 0.2442 -0.0236 -0.0214 0.0113  55  ALA A CA  
349  C C   . ALA A 44  ? 0.4294 0.3011 0.3464 -0.0263 -0.0248 0.0118  55  ALA A C   
350  O O   . ALA A 44  ? 0.4194 0.2971 0.3420 -0.0249 -0.0216 0.0112  55  ALA A O   
351  C CB  . ALA A 44  ? 0.3340 0.2046 0.2484 -0.0199 -0.0227 0.0085  55  ALA A CB  
352  N N   . ILE A 45  ? 0.4207 0.2847 0.3306 -0.0304 -0.0315 0.0130  56  ILE A N   
353  C CA  . ILE A 45  ? 0.4349 0.2962 0.3425 -0.0332 -0.0358 0.0134  56  ILE A CA  
354  C C   . ILE A 45  ? 0.5075 0.3600 0.4079 -0.0327 -0.0422 0.0121  56  ILE A C   
355  O O   . ILE A 45  ? 0.5205 0.3659 0.4142 -0.0345 -0.0463 0.0129  56  ILE A O   
356  C CB  . ILE A 45  ? 0.4995 0.3598 0.4052 -0.0396 -0.0381 0.0168  56  ILE A CB  
357  C CG1 . ILE A 45  ? 0.5112 0.3677 0.4130 -0.0430 -0.0431 0.0173  56  ILE A CG1 
358  C CG2 . ILE A 45  ? 0.5361 0.3906 0.4359 -0.0430 -0.0411 0.0189  56  ILE A CG2 
359  C CD1 . ILE A 45  ? 0.4747 0.3385 0.3832 -0.0416 -0.0396 0.0166  56  ILE A CD1 
360  N N   . LYS A 46  ? 0.4519 0.3049 0.3541 -0.0299 -0.0430 0.0100  57  LYS A N   
361  C CA  . LYS A 46  ? 0.4541 0.2995 0.3514 -0.0283 -0.0485 0.0087  57  LYS A CA  
362  C C   . LYS A 46  ? 0.5392 0.3802 0.4342 -0.0305 -0.0527 0.0089  57  LYS A C   
363  O O   . LYS A 46  ? 0.5358 0.3823 0.4363 -0.0294 -0.0499 0.0079  57  LYS A O   
364  C CB  . LYS A 46  ? 0.4569 0.3066 0.3590 -0.0227 -0.0458 0.0060  57  LYS A CB  
365  C CG  . LYS A 46  ? 0.4743 0.3273 0.3774 -0.0206 -0.0420 0.0058  57  LYS A CG  
366  C CD  . LYS A 46  ? 0.5022 0.3568 0.4075 -0.0161 -0.0416 0.0035  57  LYS A CD  
367  C CE  . LYS A 46  ? 0.5120 0.3671 0.4157 -0.0148 -0.0397 0.0036  57  LYS A CE  
368  N NZ  . LYS A 46  ? 0.4213 0.2749 0.3246 -0.0114 -0.0420 0.0019  57  LYS A NZ  
369  N N   . LEU A 47  ? 0.5169 0.3477 0.4034 -0.0336 -0.0593 0.0101  58  LEU A N   
370  C CA  . LEU A 47  ? 0.5235 0.3481 0.4062 -0.0361 -0.0639 0.0104  58  LEU A CA  
371  C C   . LEU A 47  ? 0.5749 0.3927 0.4556 -0.0323 -0.0682 0.0080  58  LEU A C   
372  O O   . LEU A 47  ? 0.5639 0.3774 0.4414 -0.0302 -0.0707 0.0075  58  LEU A O   
373  C CB  . LEU A 47  ? 0.5369 0.3539 0.4107 -0.0428 -0.0686 0.0136  58  LEU A CB  
374  C CG  . LEU A 47  ? 0.5939 0.4161 0.4689 -0.0483 -0.0664 0.0163  58  LEU A CG  
375  C CD1 . LEU A 47  ? 0.5787 0.4127 0.4627 -0.0463 -0.0592 0.0162  58  LEU A CD1 
376  C CD2 . LEU A 47  ? 0.6371 0.4522 0.5030 -0.0550 -0.0711 0.0197  58  LEU A CD2 
377  N N   . TYR A 48  ? 0.5198 0.3369 0.4027 -0.0314 -0.0690 0.0065  59  TYR A N   
378  C CA  . TYR A 48  ? 0.5131 0.3245 0.3955 -0.0276 -0.0729 0.0039  59  TYR A CA  
379  C C   . TYR A 48  ? 0.5654 0.3691 0.4436 -0.0302 -0.0771 0.0038  59  TYR A C   
380  O O   . TYR A 48  ? 0.5795 0.3869 0.4600 -0.0329 -0.0747 0.0044  59  TYR A O   
381  C CB  . TYR A 48  ? 0.5069 0.3275 0.3992 -0.0221 -0.0684 0.0009  59  TYR A CB  
382  C CG  . TYR A 48  ? 0.5123 0.3402 0.4085 -0.0195 -0.0641 0.0008  59  TYR A CG  
383  C CD1 . TYR A 48  ? 0.5293 0.3542 0.4238 -0.0165 -0.0666 -0.0002 59  TYR A CD1 
384  C CD2 . TYR A 48  ? 0.5087 0.3462 0.4100 -0.0201 -0.0575 0.0017  59  TYR A CD2 
385  C CE1 . TYR A 48  ? 0.5219 0.3531 0.4194 -0.0145 -0.0626 -0.0003 59  TYR A CE1 
386  C CE2 . TYR A 48  ? 0.5096 0.3531 0.4140 -0.0179 -0.0534 0.0015  59  TYR A CE2 
387  C CZ  . TYR A 48  ? 0.5995 0.4398 0.5018 -0.0152 -0.0559 0.0006  59  TYR A CZ  
388  O OH  . TYR A 48  ? 0.5962 0.4421 0.5011 -0.0133 -0.0518 0.0004  59  TYR A OH  
389  N N   . GLY A 49  ? 0.4523 0.2450 0.3239 -0.0295 -0.0834 0.0029  60  GLY A N   
390  C CA  . GLY A 49  ? 0.4558 0.2398 0.3232 -0.0310 -0.0877 0.0021  60  GLY A CA  
391  C C   . GLY A 49  ? 0.5190 0.2990 0.3880 -0.0255 -0.0908 -0.0016 60  GLY A C   
392  O O   . GLY A 49  ? 0.5024 0.2905 0.3798 -0.0205 -0.0876 -0.0040 60  GLY A O   
393  N N   . ALA A 50  ? 0.6565 0.4237 0.5173 -0.0266 -0.0973 -0.0020 61  ALA A N   
394  C CA  . ALA A 50  ? 0.6717 0.4335 0.5327 -0.0214 -0.1013 -0.0054 61  ALA A CA  
395  C C   . ALA A 50  ? 0.7089 0.4724 0.5706 -0.0178 -0.1020 -0.0056 61  ALA A C   
396  O O   . ALA A 50  ? 0.7258 0.4883 0.5828 -0.0205 -0.1022 -0.0027 61  ALA A O   
397  C CB  . ALA A 50  ? 0.7102 0.4563 0.5603 -0.0237 -0.1086 -0.0055 61  ALA A CB  
398  N N   . PRO A 51  ? 0.5218 0.2884 0.3894 -0.0120 -0.1025 -0.0090 62  PRO A N   
399  C CA  . PRO A 51  ? 0.5201 0.2885 0.3884 -0.0086 -0.1034 -0.0093 62  PRO A CA  
400  C C   . PRO A 51  ? 0.6062 0.3630 0.4630 -0.0110 -0.1090 -0.0069 62  PRO A C   
401  O O   . PRO A 51  ? 0.6363 0.3804 0.4846 -0.0116 -0.1154 -0.0072 62  PRO A O   
402  C CB  . PRO A 51  ? 0.5335 0.3021 0.4067 -0.0028 -0.1057 -0.0135 62  PRO A CB  
403  C CG  . PRO A 51  ? 0.5719 0.3466 0.4523 -0.0027 -0.1019 -0.0155 62  PRO A CG  
404  C CD  . PRO A 51  ? 0.5253 0.2946 0.3996 -0.0084 -0.1019 -0.0129 62  PRO A CD  
405  N N   . GLY A 52  ? 0.5908 0.3516 0.4468 -0.0124 -0.1066 -0.0046 63  GLY A N   
406  C CA  . GLY A 52  ? 0.5987 0.3499 0.4439 -0.0155 -0.1110 -0.0019 63  GLY A CA  
407  C C   . GLY A 52  ? 0.6440 0.3952 0.4849 -0.0220 -0.1088 0.0018  63  GLY A C   
408  O O   . GLY A 52  ? 0.6342 0.3801 0.4675 -0.0250 -0.1109 0.0042  63  GLY A O   
409  N N   . VAL A 53  ? 0.5550 0.3121 0.4004 -0.0243 -0.1047 0.0022  64  VAL A N   
410  C CA  . VAL A 53  ? 0.5446 0.3038 0.3875 -0.0303 -0.1021 0.0055  64  VAL A CA  
411  C C   . VAL A 53  ? 0.5749 0.3487 0.4275 -0.0290 -0.0943 0.0056  64  VAL A C   
412  O O   . VAL A 53  ? 0.5674 0.3504 0.4292 -0.0265 -0.0896 0.0038  64  VAL A O   
413  C CB  . VAL A 53  ? 0.5945 0.3506 0.4356 -0.0342 -0.1027 0.0061  64  VAL A CB  
414  C CG1 . VAL A 53  ? 0.5844 0.3420 0.4218 -0.0411 -0.1011 0.0099  64  VAL A CG1 
415  C CG2 . VAL A 53  ? 0.6104 0.3519 0.4425 -0.0345 -0.1102 0.0053  64  VAL A CG2 
416  N N   . GLU A 54  ? 0.5506 0.3261 0.4010 -0.0307 -0.0929 0.0075  65  GLU A N   
417  C CA  . GLU A 54  ? 0.5404 0.3284 0.3989 -0.0291 -0.0859 0.0073  65  GLU A CA  
418  C C   . GLU A 54  ? 0.6034 0.3916 0.4578 -0.0338 -0.0846 0.0103  65  GLU A C   
419  O O   . GLU A 54  ? 0.6211 0.4000 0.4663 -0.0366 -0.0895 0.0119  65  GLU A O   
420  C CB  . GLU A 54  ? 0.5549 0.3461 0.4174 -0.0234 -0.0850 0.0050  65  GLU A CB  
421  C CG  . GLU A 54  ? 0.6920 0.4892 0.5631 -0.0185 -0.0830 0.0020  65  GLU A CG  
422  C CD  . GLU A 54  ? 0.9413 0.7416 0.8157 -0.0137 -0.0827 0.0000  65  GLU A CD  
423  O OE1 . GLU A 54  ? 0.8081 0.6110 0.6816 -0.0139 -0.0804 0.0009  65  GLU A OE1 
424  O OE2 . GLU A 54  ? 0.9136 0.7136 0.7913 -0.0099 -0.0847 -0.0026 65  GLU A OE2 
425  N N   . PHE A 55  ? 0.5236 0.3225 0.3847 -0.0346 -0.0781 0.0109  66  PHE A N   
426  C CA  . PHE A 55  ? 0.5280 0.3289 0.3872 -0.0387 -0.0760 0.0133  66  PHE A CA  
427  C C   . PHE A 55  ? 0.5738 0.3868 0.4424 -0.0359 -0.0681 0.0124  66  PHE A C   
428  O O   . PHE A 55  ? 0.5549 0.3759 0.4310 -0.0342 -0.0637 0.0114  66  PHE A O   
429  C CB  . PHE A 55  ? 0.5601 0.3592 0.4158 -0.0452 -0.0774 0.0161  66  PHE A CB  
430  C CG  . PHE A 55  ? 0.6055 0.3918 0.4507 -0.0488 -0.0850 0.0173  66  PHE A CG  
431  C CD1 . PHE A 55  ? 0.6670 0.4440 0.5025 -0.0521 -0.0898 0.0191  66  PHE A CD1 
432  C CD2 . PHE A 55  ? 0.6334 0.4164 0.4781 -0.0490 -0.0873 0.0167  66  PHE A CD2 
433  C CE1 . PHE A 55  ? 0.6986 0.4629 0.5236 -0.0555 -0.0969 0.0203  66  PHE A CE1 
434  C CE2 . PHE A 55  ? 0.6922 0.4626 0.5268 -0.0523 -0.0941 0.0177  66  PHE A CE2 
435  C CZ  . PHE A 55  ? 0.6857 0.4465 0.5102 -0.0556 -0.0990 0.0196  66  PHE A CZ  
436  N N   . MET A 56  ? 0.6389 0.4527 0.5066 -0.0353 -0.0664 0.0126  67  MET A N   
437  C CA  . MET A 56  ? 0.6310 0.4549 0.5065 -0.0327 -0.0590 0.0118  67  MET A CA  
438  C C   . MET A 56  ? 0.6162 0.4416 0.4911 -0.0370 -0.0567 0.0143  67  MET A C   
439  O O   . MET A 56  ? 0.6295 0.4479 0.4972 -0.0401 -0.0605 0.0158  67  MET A O   
440  C CB  . MET A 56  ? 0.6764 0.5004 0.5522 -0.0281 -0.0582 0.0099  67  MET A CB  
441  C CG  . MET A 56  ? 0.7326 0.5635 0.6156 -0.0230 -0.0549 0.0074  67  MET A CG  
442  S SD  . MET A 56  ? 0.8161 0.6435 0.6994 -0.0218 -0.0597 0.0061  67  MET A SD  
443  C CE  . MET A 56  ? 0.8021 0.6159 0.6751 -0.0225 -0.0687 0.0064  67  MET A CE  
444  N N   . GLY A 57  ? 0.4679 0.3024 0.3505 -0.0372 -0.0507 0.0148  68  GLY A N   
445  C CA  . GLY A 57  ? 0.4478 0.2853 0.3321 -0.0407 -0.0478 0.0173  68  GLY A CA  
446  C C   . GLY A 57  ? 0.4617 0.3087 0.3552 -0.0368 -0.0396 0.0165  68  GLY A C   
447  O O   . GLY A 57  ? 0.4437 0.2957 0.3420 -0.0321 -0.0361 0.0141  68  GLY A O   
448  N N   . LEU A 58  ? 0.4869 0.3363 0.3828 -0.0388 -0.0365 0.0188  69  LEU A N   
449  C CA  . LEU A 58  ? 0.4693 0.3266 0.3735 -0.0349 -0.0286 0.0186  69  LEU A CA  
450  C C   . LEU A 58  ? 0.5123 0.3741 0.4218 -0.0381 -0.0254 0.0228  69  LEU A C   
451  O O   . LEU A 58  ? 0.5280 0.3857 0.4333 -0.0427 -0.0284 0.0254  69  LEU A O   
452  C CB  . LEU A 58  ? 0.4680 0.3225 0.3693 -0.0317 -0.0274 0.0171  69  LEU A CB  
453  C CG  . LEU A 58  ? 0.5149 0.3760 0.4219 -0.0259 -0.0207 0.0149  69  LEU A CG  
454  C CD1 . LEU A 58  ? 0.5080 0.3715 0.4160 -0.0229 -0.0211 0.0121  69  LEU A CD1 
455  C CD2 . LEU A 58  ? 0.5150 0.3727 0.4178 -0.0241 -0.0201 0.0140  69  LEU A CD2 
456  N N   . HIS A 59  ? 0.4003 0.2710 0.3193 -0.0358 -0.0194 0.0238  70  HIS A N   
457  C CA  . HIS A 59  ? 0.3786 0.2554 0.3045 -0.0378 -0.0156 0.0289  70  HIS A CA  
458  C C   . HIS A 59  ? 0.4474 0.3258 0.3764 -0.0348 -0.0107 0.0304  70  HIS A C   
459  O O   . HIS A 59  ? 0.4334 0.3118 0.3628 -0.0297 -0.0078 0.0272  70  HIS A O   
460  C CB  . HIS A 59  ? 0.3513 0.2372 0.2864 -0.0356 -0.0110 0.0301  70  HIS A CB  
461  C CG  . HIS A 59  ? 0.3830 0.2682 0.3155 -0.0393 -0.0155 0.0295  70  HIS A CG  
462  N ND1 . HIS A 59  ? 0.4020 0.2834 0.3303 -0.0377 -0.0186 0.0249  70  HIS A ND1 
463  C CD2 . HIS A 59  ? 0.4010 0.2892 0.3343 -0.0447 -0.0176 0.0332  70  HIS A CD2 
464  C CE1 . HIS A 59  ? 0.3908 0.2722 0.3175 -0.0416 -0.0223 0.0257  70  HIS A CE1 
465  N NE2 . HIS A 59  ? 0.3972 0.2828 0.3266 -0.0462 -0.0219 0.0305  70  HIS A NE2 
466  N N   . GLN A 60  ? 0.4871 0.3671 0.4178 -0.0382 -0.0098 0.0356  71  GLN A N   
467  C CA  . GLN A 60  ? 0.4899 0.3712 0.4234 -0.0355 -0.0053 0.0380  71  GLN A CA  
468  C C   . GLN A 60  ? 0.5067 0.3969 0.4503 -0.0288 0.0020  0.0389  71  GLN A C   
469  O O   . GLN A 60  ? 0.4842 0.3742 0.4282 -0.0252 0.0047  0.0382  71  GLN A O   
470  C CB  . GLN A 60  ? 0.5224 0.4057 0.4566 -0.0405 -0.0053 0.0444  71  GLN A CB  
471  C CG  . GLN A 60  ? 0.7427 0.6173 0.6662 -0.0480 -0.0135 0.0437  71  GLN A CG  
472  C CD  . GLN A 60  ? 1.0043 0.8834 0.9283 -0.0549 -0.0154 0.0492  71  GLN A CD  
473  O OE1 . GLN A 60  ? 0.9163 0.8048 0.8479 -0.0542 -0.0098 0.0547  71  GLN A OE1 
474  N NE2 . GLN A 60  ? 0.9270 0.7999 0.8424 -0.0615 -0.0235 0.0480  71  GLN A NE2 
475  N N   A GLU A 61  ? 0.5726 0.4703 0.5233 -0.0273 0.0045  0.0405  72  GLU A N   
476  N N   B GLU A 61  ? 0.5797 0.4773 0.5304 -0.0273 0.0044  0.0404  72  GLU A N   
477  C CA  A GLU A 61  ? 0.5608 0.4669 0.5196 -0.0216 0.0090  0.0409  72  GLU A CA  
478  C CA  B GLU A 61  ? 0.5713 0.4774 0.5301 -0.0216 0.0090  0.0408  72  GLU A CA  
479  C C   A GLU A 61  ? 0.6300 0.5329 0.5845 -0.0190 0.0079  0.0333  72  GLU A C   
480  C C   B GLU A 61  ? 0.6379 0.5408 0.5923 -0.0190 0.0079  0.0333  72  GLU A C   
481  O O   A GLU A 61  ? 0.6474 0.5472 0.5987 -0.0213 0.0046  0.0309  72  GLU A O   
482  O O   B GLU A 61  ? 0.6593 0.5587 0.6103 -0.0213 0.0044  0.0307  72  GLU A O   
483  C CB  A GLU A 61  ? 0.5680 0.4856 0.5369 -0.0214 0.0119  0.0480  72  GLU A CB  
484  C CB  B GLU A 61  ? 0.5814 0.4989 0.5503 -0.0214 0.0119  0.0479  72  GLU A CB  
485  C CG  A GLU A 61  ? 0.6269 0.5528 0.6013 -0.0215 0.0148  0.0558  72  GLU A CG  
486  C CG  B GLU A 61  ? 0.6805 0.5961 0.6469 -0.0252 0.0106  0.0476  72  GLU A CG  
487  C CD  A GLU A 61  ? 0.7388 0.6666 0.7097 -0.0208 0.0129  0.0552  72  GLU A CD  
488  C CD  B GLU A 61  ? 0.9083 0.8195 0.8677 -0.0320 0.0076  0.0503  72  GLU A CD  
489  O OE1 A GLU A 61  ? 0.5785 0.5017 0.5440 -0.0161 0.0157  0.0479  72  GLU A OE1 
490  O OE1 B GLU A 61  ? 0.9386 0.8542 0.8999 -0.0321 0.0117  0.0562  72  GLU A OE1 
491  O OE2 A GLU A 61  ? 0.6320 0.5623 0.6015 -0.0226 0.0128  0.0592  72  GLU A OE2 
492  O OE2 B GLU A 61  ? 0.7758 0.6797 0.7271 -0.0376 0.0004  0.0467  72  GLU A OE2 
493  N N   . ASN A 62  ? 0.6191 0.5228 0.5716 -0.0142 0.0111  0.0294  73  ASN A N   
494  C CA  . ASN A 62  ? 0.6083 0.5103 0.5559 -0.0113 0.0118  0.0227  73  ASN A CA  
495  C C   . ASN A 62  ? 0.6564 0.5655 0.6088 -0.0087 0.0150  0.0223  73  ASN A C   
496  O O   . ASN A 62  ? 0.6664 0.5785 0.6173 -0.0037 0.0210  0.0187  73  ASN A O   
497  C CB  . ASN A 62  ? 0.6242 0.5235 0.5652 -0.0076 0.0149  0.0184  73  ASN A CB  
498  C CG  . ASN A 62  ? 0.9041 0.7957 0.8392 -0.0103 0.0107  0.0183  73  ASN A CG  
499  O OD1 . ASN A 62  ? 0.6788 0.5687 0.6146 -0.0118 0.0106  0.0217  73  ASN A OD1 
500  N ND2 . ASN A 62  ? 0.8038 0.6909 0.7327 -0.0109 0.0069  0.0149  73  ASN A ND2 
501  N N   . ASN A 63  ? 0.5057 0.4174 0.4634 -0.0121 0.0119  0.0258  74  ASN A N   
502  C CA  . ASN A 63  ? 0.4750 0.3929 0.4372 -0.0108 0.0136  0.0262  74  ASN A CA  
503  C C   . ASN A 63  ? 0.4512 0.3666 0.4118 -0.0126 0.0103  0.0233  74  ASN A C   
504  O O   . ASN A 63  ? 0.4325 0.3418 0.3891 -0.0162 0.0060  0.0228  74  ASN A O   
505  C CB  . ASN A 63  ? 0.4808 0.4061 0.4507 -0.0138 0.0128  0.0345  74  ASN A CB  
506  C CG  . ASN A 63  ? 0.8083 0.7368 0.7773 -0.0106 0.0174  0.0361  74  ASN A CG  
507  O OD1 . ASN A 63  ? 0.6996 0.6255 0.6666 -0.0104 0.0180  0.0370  74  ASN A OD1 
508  N ND2 . ASN A 63  ? 0.8050 0.7394 0.7761 -0.0068 0.0219  0.0360  74  ASN A ND2 
509  N N   . ALA A 64  ? 0.4220 0.3414 0.3837 -0.0101 0.0126  0.0207  75  ALA A N   
510  C CA  . ALA A 64  ? 0.4086 0.3261 0.3683 -0.0113 0.0098  0.0176  75  ALA A CA  
511  C C   . ALA A 64  ? 0.4429 0.3595 0.4054 -0.0162 0.0058  0.0213  75  ALA A C   
512  O O   . ALA A 64  ? 0.4311 0.3530 0.4001 -0.0179 0.0069  0.0270  75  ALA A O   
513  C CB  . ALA A 64  ? 0.4020 0.3247 0.3623 -0.0075 0.0141  0.0146  75  ALA A CB  
514  N N   . VAL A 65  ? 0.2992 0.2096 0.2553 -0.0187 0.0013  0.0183  76  VAL A N   
515  C CA  . VAL A 65  ? 0.3043 0.2128 0.2588 -0.0236 -0.0028 0.0198  76  VAL A CA  
516  C C   . VAL A 65  ? 0.3540 0.2673 0.3124 -0.0223 -0.0012 0.0188  76  VAL A C   
517  O O   . VAL A 65  ? 0.3498 0.2626 0.3063 -0.0196 -0.0011 0.0147  76  VAL A O   
518  C CB  . VAL A 65  ? 0.3471 0.2465 0.2918 -0.0267 -0.0095 0.0173  76  VAL A CB  
519  C CG1 . VAL A 65  ? 0.3413 0.2385 0.2828 -0.0326 -0.0146 0.0193  76  VAL A CG1 
520  C CG2 . VAL A 65  ? 0.3489 0.2432 0.2892 -0.0273 -0.0110 0.0178  76  VAL A CG2 
521  N N   . THR A 66  ? 0.3439 0.2626 0.3078 -0.0243 0.0003  0.0230  77  THR A N   
522  C CA  . THR A 66  ? 0.3341 0.2580 0.3022 -0.0231 0.0019  0.0226  77  THR A CA  
523  C C   . THR A 66  ? 0.3939 0.3148 0.3572 -0.0284 -0.0030 0.0221  77  THR A C   
524  O O   . THR A 66  ? 0.3904 0.3127 0.3543 -0.0273 -0.0028 0.0198  77  THR A O   
525  C CB  . THR A 66  ? 0.3277 0.2615 0.3056 -0.0210 0.0070  0.0286  77  THR A CB  
526  O OG1 . THR A 66  ? 0.2768 0.2118 0.2541 -0.0254 0.0071  0.0338  77  THR A OG1 
527  C CG2 . THR A 66  ? 0.2486 0.1858 0.2292 -0.0169 0.0090  0.0292  77  THR A CG2 
528  N N   . GLN A 67  ? 0.3241 0.2413 0.2822 -0.0342 -0.0078 0.0243  78  GLN A N   
529  C CA  . GLN A 67  ? 0.3294 0.2437 0.2818 -0.0399 -0.0137 0.0241  78  GLN A CA  
530  C C   . GLN A 67  ? 0.3766 0.2825 0.3200 -0.0443 -0.0202 0.0241  78  GLN A C   
531  O O   . GLN A 67  ? 0.3624 0.2673 0.3051 -0.0455 -0.0202 0.0263  78  GLN A O   
532  C CB  . GLN A 67  ? 0.3493 0.2718 0.3056 -0.0442 -0.0132 0.0290  78  GLN A CB  
533  C CG  . GLN A 67  ? 0.4696 0.3998 0.4335 -0.0402 -0.0076 0.0293  78  GLN A CG  
534  C CD  . GLN A 67  ? 0.5138 0.4534 0.4808 -0.0445 -0.0074 0.0347  78  GLN A CD  
535  O OE1 . GLN A 67  ? 0.4134 0.3536 0.3761 -0.0517 -0.0129 0.0370  78  GLN A OE1 
536  N NE2 . GLN A 67  ? 0.3834 0.3311 0.3574 -0.0400 -0.0010 0.0370  78  GLN A NE2 
537  N N   . ILE A 68  ? 0.3727 0.2722 0.3092 -0.0466 -0.0256 0.0221  79  ILE A N   
538  C CA  . ILE A 68  ? 0.3934 0.2838 0.3205 -0.0507 -0.0322 0.0225  79  ILE A CA  
539  C C   . ILE A 68  ? 0.4825 0.3711 0.4048 -0.0565 -0.0371 0.0239  79  ILE A C   
540  O O   . ILE A 68  ? 0.5038 0.3918 0.4264 -0.0548 -0.0370 0.0216  79  ILE A O   
541  C CB  . ILE A 68  ? 0.4318 0.3143 0.3544 -0.0462 -0.0339 0.0186  79  ILE A CB  
542  C CG1 . ILE A 68  ? 0.4147 0.2998 0.3417 -0.0408 -0.0291 0.0172  79  ILE A CG1 
543  C CG2 . ILE A 68  ? 0.4792 0.3517 0.3920 -0.0504 -0.0410 0.0197  79  ILE A CG2 
544  C CD1 . ILE A 68  ? 0.4359 0.3171 0.3611 -0.0356 -0.0294 0.0135  79  ILE A CD1 
545  N N   . HIS A 69  ? 0.4337 0.3215 0.3513 -0.0636 -0.0412 0.0278  80  HIS A N   
546  C CA  . HIS A 69  ? 0.4311 0.3174 0.3432 -0.0701 -0.0459 0.0298  80  HIS A CA  
547  C C   . HIS A 69  ? 0.5141 0.3898 0.4153 -0.0750 -0.0525 0.0311  80  HIS A C   
548  O O   . HIS A 69  ? 0.4867 0.3636 0.3857 -0.0799 -0.0543 0.0346  80  HIS A O   
549  C CB  . HIS A 69  ? 0.4215 0.3198 0.3389 -0.0752 -0.0444 0.0343  80  HIS A CB  
550  C CG  . HIS A 69  ? 0.4375 0.3458 0.3652 -0.0705 -0.0380 0.0336  80  HIS A CG  
551  N ND1 . HIS A 69  ? 0.4448 0.3554 0.3739 -0.0699 -0.0374 0.0320  80  HIS A ND1 
552  C CD2 . HIS A 69  ? 0.4367 0.3528 0.3738 -0.0659 -0.0318 0.0345  80  HIS A CD2 
553  C CE1 . HIS A 69  ? 0.4199 0.3393 0.3584 -0.0653 -0.0313 0.0319  80  HIS A CE1 
554  N NE2 . HIS A 69  ? 0.4201 0.3427 0.3635 -0.0627 -0.0277 0.0335  80  HIS A NE2 
555  N N   . LEU A 70  ? 0.4692 0.3346 0.3638 -0.0737 -0.0561 0.0286  81  LEU A N   
556  C CA  . LEU A 70  ? 0.4987 0.3530 0.3822 -0.0787 -0.0626 0.0301  81  LEU A CA  
557  C C   . LEU A 70  ? 0.6037 0.4592 0.4824 -0.0872 -0.0660 0.0337  81  LEU A C   
558  O O   . LEU A 70  ? 0.6088 0.4678 0.4898 -0.0878 -0.0650 0.0332  81  LEU A O   
559  C CB  . LEU A 70  ? 0.5086 0.3516 0.3877 -0.0741 -0.0652 0.0265  81  LEU A CB  
560  C CG  . LEU A 70  ? 0.5529 0.3936 0.4344 -0.0669 -0.0634 0.0235  81  LEU A CG  
561  C CD1 . LEU A 70  ? 0.5384 0.3827 0.4274 -0.0595 -0.0593 0.0195  81  LEU A CD1 
562  C CD2 . LEU A 70  ? 0.5869 0.4147 0.4588 -0.0675 -0.0693 0.0234  81  LEU A CD2 
563  N N   . LEU A 71  ? 0.5127 0.3659 0.3846 -0.0943 -0.0700 0.0375  82  LEU A N   
564  C CA  . LEU A 71  ? 0.5011 0.3571 0.3681 -0.1033 -0.0733 0.0416  82  LEU A CA  
565  C C   . LEU A 71  ? 0.5796 0.4238 0.4378 -0.1052 -0.0776 0.0404  82  LEU A C   
566  O O   . LEU A 71  ? 0.5803 0.4118 0.4327 -0.1020 -0.0803 0.0379  82  LEU A O   
567  C CB  . LEU A 71  ? 0.5023 0.3587 0.3639 -0.1106 -0.0767 0.0459  82  LEU A CB  
568  C CG  . LEU A 71  ? 0.5381 0.4064 0.4091 -0.1094 -0.0724 0.0476  82  LEU A CG  
569  C CD1 . LEU A 71  ? 0.5438 0.4145 0.4099 -0.1181 -0.0759 0.0526  82  LEU A CD1 
570  C CD2 . LEU A 71  ? 0.5468 0.4304 0.4300 -0.1073 -0.0669 0.0482  82  LEU A CD2 
571  N N   . PRO A 72  ? 0.5522 0.4006 0.4095 -0.1103 -0.0783 0.0421  83  PRO A N   
572  C CA  . PRO A 72  ? 0.5687 0.4058 0.4187 -0.1117 -0.0816 0.0405  83  PRO A CA  
573  C C   . PRO A 72  ? 0.6517 0.4748 0.4886 -0.1170 -0.0880 0.0421  83  PRO A C   
574  O O   . PRO A 72  ? 0.6659 0.4908 0.4968 -0.1250 -0.0910 0.0466  83  PRO A O   
575  C CB  . PRO A 72  ? 0.5899 0.4366 0.4414 -0.1177 -0.0810 0.0429  83  PRO A CB  
576  C CG  . PRO A 72  ? 0.6334 0.4942 0.4888 -0.1224 -0.0798 0.0475  83  PRO A CG  
577  C CD  . PRO A 72  ? 0.5629 0.4269 0.4260 -0.1152 -0.0761 0.0456  83  PRO A CD  
578  N N   . GLY A 73  ? 0.6357 0.4453 0.4684 -0.1123 -0.0902 0.0386  84  GLY A N   
579  C CA  . GLY A 73  ? 0.6683 0.4628 0.4882 -0.1163 -0.0965 0.0397  84  GLY A CA  
580  C C   . GLY A 73  ? 0.7540 0.5455 0.5703 -0.1163 -0.0982 0.0412  84  GLY A C   
581  O O   . GLY A 73  ? 0.7664 0.5445 0.5747 -0.1151 -0.1023 0.0402  84  GLY A O   
582  N N   . GLN A 74  ? 0.7688 0.5729 0.5912 -0.1176 -0.0950 0.0435  85  GLN A N   
583  C CA  . GLN A 74  ? 0.7668 0.5692 0.5862 -0.1185 -0.0964 0.0451  85  GLN A CA  
584  C C   . GLN A 74  ? 0.8120 0.6108 0.6359 -0.1088 -0.0943 0.0410  85  GLN A C   
585  O O   . GLN A 74  ? 0.8090 0.6116 0.6416 -0.1012 -0.0903 0.0373  85  GLN A O   
586  C CB  . GLN A 74  ? 0.7714 0.5894 0.5975 -0.1226 -0.0934 0.0485  85  GLN A CB  
587  C CG  . GLN A 74  ? 0.9906 0.8138 0.8116 -0.1334 -0.0962 0.0534  85  GLN A CG  
588  C CD  . GLN A 74  ? 1.2613 1.0966 1.0859 -0.1386 -0.0953 0.0575  85  GLN A CD  
589  O OE1 . GLN A 74  ? 1.1972 1.0390 1.0305 -0.1336 -0.0914 0.0564  85  GLN A OE1 
590  N NE2 . GLN A 74  ? 1.1716 1.0104 0.9898 -0.1489 -0.0989 0.0622  85  GLN A NE2 
591  N N   . CYS A 75  ? 0.7903 0.5819 0.6080 -0.1094 -0.0973 0.0417  86  CYS A N   
592  C CA  . CYS A 75  ? 0.7685 0.5584 0.5900 -0.1014 -0.0954 0.0386  86  CYS A CA  
593  C C   . CYS A 75  ? 0.7646 0.5672 0.5954 -0.1000 -0.0902 0.0393  86  CYS A C   
594  O O   . CYS A 75  ? 0.7500 0.5505 0.5804 -0.0975 -0.0900 0.0387  86  CYS A O   
595  C CB  . CYS A 75  ? 0.7887 0.5637 0.5984 -0.1026 -0.1013 0.0390  86  CYS A CB  
596  S SG  . CYS A 75  ? 0.8530 0.6122 0.6557 -0.0984 -0.1060 0.0358  86  CYS A SG  
597  N N   . GLN A 76  ? 0.6484 0.4644 0.4879 -0.1016 -0.0859 0.0406  87  GLN A N   
598  C CA  . GLN A 76  ? 0.6189 0.4477 0.4687 -0.1000 -0.0805 0.0413  87  GLN A CA  
599  C C   . GLN A 76  ? 0.6322 0.4708 0.4937 -0.0936 -0.0744 0.0386  87  GLN A C   
600  O O   . GLN A 76  ? 0.6381 0.4754 0.4998 -0.0921 -0.0745 0.0370  87  GLN A O   
601  C CB  . GLN A 76  ? 0.6359 0.4732 0.4855 -0.1090 -0.0813 0.0464  87  GLN A CB  
602  C CG  . GLN A 76  ? 0.8408 0.6699 0.6795 -0.1158 -0.0867 0.0493  87  GLN A CG  
603  C CD  . GLN A 76  ? 1.0760 0.9164 0.9175 -0.1235 -0.0862 0.0542  87  GLN A CD  
604  O OE1 . GLN A 76  ? 1.0159 0.8573 0.8581 -0.1245 -0.0857 0.0556  87  GLN A OE1 
605  N NE2 . GLN A 76  ? 0.9314 0.7812 0.7751 -0.1291 -0.0863 0.0572  87  GLN A NE2 
606  N N   . LEU A 77  ? 0.5307 0.3788 0.4020 -0.0897 -0.0687 0.0382  88  LEU A N   
607  C CA  . LEU A 77  ? 0.4920 0.3496 0.3744 -0.0838 -0.0625 0.0361  88  LEU A CA  
608  C C   . LEU A 77  ? 0.5064 0.3761 0.3987 -0.0835 -0.0571 0.0383  88  LEU A C   
609  O O   . LEU A 77  ? 0.4847 0.3539 0.3762 -0.0851 -0.0572 0.0401  88  LEU A O   
610  C CB  . LEU A 77  ? 0.4801 0.3328 0.3642 -0.0750 -0.0605 0.0311  88  LEU A CB  
611  C CG  . LEU A 77  ? 0.5237 0.3726 0.4074 -0.0705 -0.0595 0.0294  88  LEU A CG  
612  C CD1 . LEU A 77  ? 0.5059 0.3649 0.4006 -0.0655 -0.0521 0.0285  88  LEU A CD1 
613  C CD2 . LEU A 77  ? 0.5108 0.3503 0.3900 -0.0654 -0.0620 0.0258  88  LEU A CD2 
614  N N   . VAL A 78  ? 0.5118 0.3920 0.4136 -0.0812 -0.0521 0.0384  89  VAL A N   
615  C CA  . VAL A 78  ? 0.4970 0.3892 0.4096 -0.0798 -0.0460 0.0411  89  VAL A CA  
616  C C   . VAL A 78  ? 0.5223 0.4173 0.4431 -0.0707 -0.0395 0.0373  89  VAL A C   
617  O O   . VAL A 78  ? 0.5081 0.4031 0.4299 -0.0680 -0.0389 0.0346  89  VAL A O   
618  C CB  . VAL A 78  ? 0.5523 0.4566 0.4692 -0.0857 -0.0459 0.0459  89  VAL A CB  
619  C CG1 . VAL A 78  ? 0.5383 0.4557 0.4670 -0.0830 -0.0390 0.0495  89  VAL A CG1 
620  C CG2 . VAL A 78  ? 0.5733 0.4754 0.4814 -0.0953 -0.0525 0.0497  89  VAL A CG2 
621  N N   . THR A 79  ? 0.4177 0.3148 0.3437 -0.0662 -0.0347 0.0374  90  THR A N   
622  C CA  . THR A 79  ? 0.3961 0.2962 0.3295 -0.0579 -0.0280 0.0344  90  THR A CA  
623  C C   . THR A 79  ? 0.4087 0.3203 0.3525 -0.0560 -0.0211 0.0387  90  THR A C   
624  O O   . THR A 79  ? 0.3971 0.3144 0.3424 -0.0603 -0.0211 0.0440  90  THR A O   
625  C CB  . THR A 79  ? 0.4842 0.3771 0.4149 -0.0531 -0.0272 0.0311  90  THR A CB  
626  O OG1 . THR A 79  ? 0.4946 0.3877 0.4251 -0.0552 -0.0267 0.0344  90  THR A OG1 
627  C CG2 . THR A 79  ? 0.4547 0.3369 0.3753 -0.0538 -0.0336 0.0275  90  THR A CG2 
628  N N   . LEU A 80  ? 0.3741 0.2896 0.3247 -0.0492 -0.0151 0.0368  91  LEU A N   
629  C CA  . LEU A 80  ? 0.3577 0.2833 0.3176 -0.0452 -0.0075 0.0409  91  LEU A CA  
630  C C   . LEU A 80  ? 0.3720 0.2962 0.3360 -0.0368 -0.0016 0.0381  91  LEU A C   
631  O O   . LEU A 80  ? 0.3473 0.2676 0.3101 -0.0338 -0.0024 0.0328  91  LEU A O   
632  C CB  . LEU A 80  ? 0.3529 0.2864 0.3167 -0.0460 -0.0062 0.0426  91  LEU A CB  
633  C CG  . LEU A 80  ? 0.4054 0.3487 0.3768 -0.0408 0.0019  0.0465  91  LEU A CG  
634  C CD1 . LEU A 80  ? 0.3987 0.3490 0.3710 -0.0433 0.0034  0.0529  91  LEU A CD1 
635  C CD2 . LEU A 80  ? 0.4441 0.3938 0.4179 -0.0414 0.0021  0.0468  91  LEU A CD2 
636  N N   . LEU A 81  ? 0.3354 0.2633 0.3040 -0.0332 0.0041  0.0418  92  LEU A N   
637  C CA  . LEU A 81  ? 0.3324 0.2611 0.3062 -0.0258 0.0088  0.0403  92  LEU A CA  
638  C C   . LEU A 81  ? 0.3516 0.2921 0.3352 -0.0199 0.0148  0.0438  92  LEU A C   
639  O O   . LEU A 81  ? 0.3540 0.2954 0.3328 -0.0207 0.0191  0.0458  92  LEU A O   
640  C CB  . LEU A 81  ? 0.3417 0.2675 0.3141 -0.0256 0.0092  0.0419  92  LEU A CB  
641  C CG  . LEU A 81  ? 0.4090 0.3249 0.3712 -0.0315 0.0021  0.0389  92  LEU A CG  
642  C CD1 . LEU A 81  ? 0.4170 0.3298 0.3779 -0.0303 0.0032  0.0398  92  LEU A CD1 
643  C CD2 . LEU A 81  ? 0.4190 0.3277 0.3746 -0.0319 -0.0030 0.0321  92  LEU A CD2 
644  N N   . ASP A 82  ? 0.2981 0.2427 0.2838 -0.0182 0.0103  0.0415  93  ASP A N   
645  C CA  . ASP A 82  ? 0.3030 0.2489 0.2813 -0.0179 0.0112  0.0404  93  ASP A CA  
646  C C   . ASP A 82  ? 0.3959 0.3435 0.3700 -0.0174 0.0152  0.0436  93  ASP A C   
647  O O   . ASP A 82  ? 0.4238 0.3788 0.4031 -0.0107 0.0215  0.0436  93  ASP A O   
648  C CB  . ASP A 82  ? 0.3171 0.2596 0.2943 -0.0091 0.0177  0.0316  93  ASP A CB  
649  C CG  . ASP A 82  ? 0.5232 0.4614 0.4974 -0.0053 0.0211  0.0283  93  ASP A CG  
650  O OD1 . ASP A 82  ? 0.5846 0.5201 0.5581 -0.0096 0.0171  0.0320  93  ASP A OD1 
651  O OD2 . ASP A 82  ? 0.5701 0.5087 0.5431 0.0017  0.0281  0.0225  93  ASP A OD2 
652  N N   . ASP A 83  ? 0.3765 0.3213 0.3466 -0.0216 0.0126  0.0459  94  ASP A N   
653  C CA  . ASP A 83  ? 0.3887 0.3348 0.3550 -0.0216 0.0177  0.0504  94  ASP A CA  
654  C C   . ASP A 83  ? 0.4532 0.3988 0.4153 -0.0250 0.0212  0.0532  94  ASP A C   
655  O O   . ASP A 83  ? 0.4796 0.4331 0.4452 -0.0253 0.0232  0.0590  94  ASP A O   
656  C CB  . ASP A 83  ? 0.4065 0.3491 0.3712 -0.0222 0.0166  0.0512  94  ASP A CB  
657  C CG  . ASP A 83  ? 0.4985 0.4274 0.4504 -0.0280 0.0130  0.0462  94  ASP A CG  
658  O OD1 . ASP A 83  ? 0.4949 0.4296 0.4657 -0.0196 0.0238  0.0506  94  ASP A OD1 
659  O OD2 . ASP A 83  ? 0.5444 0.4947 0.5257 -0.0253 0.0077  0.0564  94  ASP A OD2 
660  N N   . ASN A 84  ? 0.3658 0.3095 0.3293 -0.0253 0.0219  0.0515  95  ASN A N   
661  C CA  . ASN A 84  ? 0.3574 0.3125 0.3279 -0.0292 0.0208  0.0576  95  ASN A CA  
662  C C   . ASN A 84  ? 0.4211 0.3784 0.3934 -0.0351 0.0167  0.0617  95  ASN A C   
663  O O   . ASN A 84  ? 0.4260 0.3950 0.4014 -0.0406 0.0134  0.0669  95  ASN A O   
664  C CB  . ASN A 84  ? 0.3755 0.3471 0.3519 -0.0279 0.0215  0.0627  95  ASN A CB  
665  C CG  . ASN A 84  ? 0.5924 0.5773 0.5748 -0.0319 0.0189  0.0671  95  ASN A CG  
666  O OD1 . ASN A 84  ? 0.4870 0.4715 0.4701 -0.0319 0.0179  0.0646  95  ASN A OD1 
667  N ND2 . ASN A 84  ? 0.5505 0.5480 0.5368 -0.0358 0.0171  0.0737  95  ASN A ND2 
668  N N   . SER A 85  ? 0.3814 0.3290 0.3516 -0.0351 0.0154  0.0594  96  SER A N   
669  C CA  . SER A 85  ? 0.3812 0.3289 0.3498 -0.0425 0.0094  0.0621  96  SER A CA  
670  C C   . SER A 85  ? 0.4455 0.3881 0.4109 -0.0488 0.0010  0.0586  96  SER A C   
671  O O   . SER A 85  ? 0.4456 0.3814 0.4102 -0.0460 -0.0001 0.0531  96  SER A O   
672  C CB  . SER A 85  ? 0.4029 0.3431 0.3693 -0.0400 0.0113  0.0615  96  SER A CB  
673  O OG  . SER A 85  ? 0.4475 0.3791 0.4140 -0.0356 0.0111  0.0559  96  SER A OG  
674  N N   . LEU A 86  ? 0.4045 0.3502 0.3668 -0.0575 -0.0053 0.0618  97  LEU A N   
675  C CA  . LEU A 86  ? 0.4189 0.3580 0.3746 -0.0644 -0.0138 0.0588  97  LEU A CA  
676  C C   . LEU A 86  ? 0.5053 0.4343 0.4532 -0.0684 -0.0188 0.0576  97  LEU A C   
677  O O   . LEU A 86  ? 0.5258 0.4569 0.4743 -0.0693 -0.0171 0.0612  97  LEU A O   
678  C CB  . LEU A 86  ? 0.4203 0.3694 0.3761 -0.0721 -0.0179 0.0630  97  LEU A CB  
679  C CG  . LEU A 86  ? 0.4665 0.4247 0.4278 -0.0699 -0.0153 0.0635  97  LEU A CG  
680  C CD1 . LEU A 86  ? 0.4703 0.4425 0.4333 -0.0772 -0.0183 0.0694  97  LEU A CD1 
681  C CD2 . LEU A 86  ? 0.4759 0.4247 0.4332 -0.0693 -0.0187 0.0573  97  LEU A CD2 
682  N N   . HIS A 87  ? 0.4205 0.3382 0.3602 -0.0705 -0.0251 0.0526  98  HIS A N   
683  C CA  . HIS A 87  ? 0.4172 0.3238 0.3480 -0.0733 -0.0301 0.0508  98  HIS A CA  
684  C C   . HIS A 87  ? 0.5011 0.3996 0.4214 -0.0795 -0.0385 0.0488  98  HIS A C   
685  O O   . HIS A 87  ? 0.4917 0.3870 0.4104 -0.0773 -0.0398 0.0452  98  HIS A O   
686  C CB  . HIS A 87  ? 0.4164 0.3152 0.3468 -0.0657 -0.0273 0.0458  98  HIS A CB  
687  C CG  . HIS A 87  ? 0.4425 0.3477 0.3818 -0.0592 -0.0188 0.0477  98  HIS A CG  
688  N ND1 . HIS A 87  ? 0.4591 0.3631 0.3982 -0.0586 -0.0167 0.0499  98  HIS A ND1 
689  C CD2 . HIS A 87  ? 0.4433 0.3558 0.3914 -0.0527 -0.0116 0.0480  98  HIS A CD2 
690  C CE1 . HIS A 87  ? 0.4375 0.3476 0.3847 -0.0518 -0.0085 0.0516  98  HIS A CE1 
691  N NE2 . HIS A 87  ? 0.4315 0.3467 0.3840 -0.0480 -0.0053 0.0506  98  HIS A NE2 
692  N N   . LEU A 88  ? 0.5056 0.4005 0.4184 -0.0869 -0.0440 0.0516  99  LEU A N   
693  C CA  . LEU A 88  ? 0.5151 0.4007 0.4161 -0.0929 -0.0521 0.0506  99  LEU A CA  
694  C C   . LEU A 88  ? 0.5482 0.4194 0.4397 -0.0909 -0.0558 0.0470  99  LEU A C   
695  O O   . LEU A 88  ? 0.5632 0.4314 0.4516 -0.0930 -0.0567 0.0486  99  LEU A O   
696  C CB  . LEU A 88  ? 0.5251 0.4161 0.4227 -0.1030 -0.0561 0.0562  99  LEU A CB  
697  C CG  . LEU A 88  ? 0.5914 0.4721 0.4752 -0.1103 -0.0645 0.0563  99  LEU A CG  
698  C CD1 . LEU A 88  ? 0.5819 0.4607 0.4637 -0.1096 -0.0663 0.0540  99  LEU A CD1 
699  C CD2 . LEU A 88  ? 0.6018 0.4891 0.4827 -0.1204 -0.0678 0.0622  99  LEU A CD2 
700  N N   . TRP A 89  ? 0.4748 0.3377 0.3618 -0.0867 -0.0578 0.0424  100 TRP A N   
701  C CA  . TRP A 89  ? 0.4823 0.3322 0.3602 -0.0842 -0.0617 0.0393  100 TRP A CA  
702  C C   . TRP A 89  ? 0.5907 0.4302 0.4561 -0.0899 -0.0695 0.0401  100 TRP A C   
703  O O   . TRP A 89  ? 0.5826 0.4243 0.4469 -0.0939 -0.0713 0.0416  100 TRP A O   
704  C CB  . TRP A 89  ? 0.4518 0.3002 0.3333 -0.0751 -0.0585 0.0343  100 TRP A CB  
705  C CG  . TRP A 89  ? 0.4457 0.3014 0.3371 -0.0692 -0.0512 0.0332  100 TRP A CG  
706  C CD1 . TRP A 89  ? 0.4676 0.3347 0.3700 -0.0672 -0.0447 0.0345  100 TRP A CD1 
707  C CD2 . TRP A 89  ? 0.4444 0.2962 0.3350 -0.0643 -0.0495 0.0309  100 TRP A CD2 
708  N NE1 . TRP A 89  ? 0.4515 0.3214 0.3599 -0.0612 -0.0389 0.0332  100 TRP A NE1 
709  C CE2 . TRP A 89  ? 0.4733 0.3342 0.3746 -0.0596 -0.0417 0.0308  100 TRP A CE2 
710  C CE3 . TRP A 89  ? 0.4746 0.3162 0.3565 -0.0634 -0.0538 0.0292  100 TRP A CE3 
711  C CZ2 . TRP A 89  ? 0.4533 0.3133 0.3562 -0.0545 -0.0382 0.0290  100 TRP A CZ2 
712  C CZ3 . TRP A 89  ? 0.4865 0.3279 0.3704 -0.0584 -0.0505 0.0273  100 TRP A CZ3 
713  C CH2 . TRP A 89  ? 0.4792 0.3297 0.3733 -0.0542 -0.0427 0.0271  100 TRP A CH2 
714  N N   . SER A 90  ? 0.6320 0.4598 0.4878 -0.0901 -0.0741 0.0393  101 SER A N   
715  C CA  . SER A 90  ? 0.6666 0.4828 0.5096 -0.0955 -0.0815 0.0405  101 SER A CA  
716  C C   . SER A 90  ? 0.7241 0.5277 0.5601 -0.0904 -0.0848 0.0374  101 SER A C   
717  O O   . SER A 90  ? 0.6856 0.4891 0.5246 -0.0846 -0.0824 0.0351  101 SER A O   
718  C CB  . SER A 90  ? 0.7493 0.5640 0.5853 -0.1047 -0.0852 0.0450  101 SER A CB  
719  O OG  . SER A 90  ? 0.9453 0.7509 0.7697 -0.1111 -0.0917 0.0469  101 SER A OG  
720  N N   . LEU A 91  ? 0.6855 0.4785 0.5120 -0.0926 -0.0905 0.0375  102 LEU A N   
721  C CA  . LEU A 91  ? 0.7247 0.5043 0.5429 -0.0891 -0.0952 0.0355  102 LEU A CA  
722  C C   . LEU A 91  ? 0.8515 0.6197 0.6560 -0.0970 -0.1020 0.0387  102 LEU A C   
723  O O   . LEU A 91  ? 0.8556 0.6193 0.6537 -0.1027 -0.1056 0.0407  102 LEU A O   
724  C CB  . LEU A 91  ? 0.7290 0.5053 0.5486 -0.0843 -0.0958 0.0327  102 LEU A CB  
725  C CG  . LEU A 91  ? 0.7830 0.5679 0.6144 -0.0756 -0.0899 0.0289  102 LEU A CG  
726  C CD1 . LEU A 91  ? 0.7926 0.5775 0.6269 -0.0731 -0.0897 0.0270  102 LEU A CD1 
727  C CD2 . LEU A 91  ? 0.8201 0.6005 0.6508 -0.0694 -0.0906 0.0264  102 LEU A CD2 
728  N N   . LYS A 92  ? 0.9055 0.6687 0.7050 -0.0976 -0.1038 0.0392  103 LYS A N   
729  C CA  . LYS A 92  ? 0.9437 0.6960 0.7298 -0.1052 -0.1101 0.0424  103 LYS A CA  
730  C C   . LYS A 92  ? 1.0235 0.7612 0.8003 -0.1015 -0.1153 0.0406  103 LYS A C   
731  O O   . LYS A 92  ? 1.0045 0.7429 0.7856 -0.0944 -0.1133 0.0377  103 LYS A O   
732  C CB  . LYS A 92  ? 0.6420 0.4007 0.4293 -0.1103 -0.1083 0.0451  103 LYS A CB  
733  N N   . VAL A 93  ? 0.9504 0.6747 0.7141 -0.1066 -0.1220 0.0423  104 VAL A N   
734  C CA  . VAL A 93  ? 0.9747 0.6839 0.7286 -0.1037 -0.1277 0.0410  104 VAL A CA  
735  C C   . VAL A 93  ? 1.0551 0.7588 0.8010 -0.1073 -0.1303 0.0428  104 VAL A C   
736  O O   . VAL A 93  ? 1.0655 0.7674 0.8042 -0.1161 -0.1326 0.0464  104 VAL A O   
737  C CB  . VAL A 93  ? 1.0411 0.7371 0.7840 -0.1073 -0.1337 0.0419  104 VAL A CB  
738  C CG1 . VAL A 93  ? 1.0583 0.7374 0.7892 -0.1055 -0.1404 0.0411  104 VAL A CG1 
739  C CG2 . VAL A 93  ? 1.0244 0.7246 0.7754 -0.1023 -0.1312 0.0393  104 VAL A CG2 
740  N N   . LYS A 94  ? 1.0764 0.7781 0.8238 -0.1008 -0.1300 0.0403  105 LYS A N   
741  C CA  . LYS A 94  ? 1.0937 0.7888 0.8332 -0.1032 -0.1328 0.0415  105 LYS A CA  
742  C C   . LYS A 94  ? 1.1691 0.8541 0.9044 -0.0962 -0.1364 0.0387  105 LYS A C   
743  O O   . LYS A 94  ? 1.1496 0.8409 0.8945 -0.0881 -0.1329 0.0354  105 LYS A O   
744  C CB  . LYS A 94  ? 0.6749 0.3831 0.4239 -0.1032 -0.1265 0.0417  105 LYS A CB  
745  N N   . GLY A 95  ? 1.3453 1.0149 1.0661 -0.0997 -0.1435 0.0401  106 GLY A N   
746  C CA  . GLY A 95  ? 1.3486 1.0075 1.0645 -0.0933 -0.1479 0.0377  106 GLY A CA  
747  C C   . GLY A 95  ? 1.3920 1.0456 1.1083 -0.0888 -0.1504 0.0356  106 GLY A C   
748  O O   . GLY A 95  ? 1.3934 1.0451 1.1128 -0.0811 -0.1513 0.0324  106 GLY A O   
749  N N   . GLY A 96  ? 1.1190 0.7705 0.8325 -0.0937 -0.1514 0.0371  107 GLY A N   
750  C CA  . GLY A 96  ? 1.1142 0.7604 0.8281 -0.0900 -0.1535 0.0351  107 GLY A CA  
751  C C   . GLY A 96  ? 1.1225 0.7822 0.8522 -0.0827 -0.1474 0.0319  107 GLY A C   
752  O O   . GLY A 96  ? 1.1175 0.7735 0.8486 -0.0790 -0.1489 0.0297  107 GLY A O   
753  N N   . ALA A 97  ? 1.0234 0.6983 0.7649 -0.0805 -0.1406 0.0313  108 ALA A N   
754  C CA  . ALA A 97  ? 0.9830 0.6709 0.7392 -0.0737 -0.1346 0.0283  108 ALA A CA  
755  C C   . ALA A 97  ? 0.9892 0.6922 0.7547 -0.0766 -0.1275 0.0297  108 ALA A C   
756  O O   . ALA A 97  ? 0.9782 0.6832 0.7407 -0.0821 -0.1268 0.0323  108 ALA A O   
757  C CB  . ALA A 97  ? 0.9785 0.6692 0.7404 -0.0654 -0.1335 0.0251  108 ALA A CB  
758  N N   . SER A 98  ? 0.8316 0.5454 0.6087 -0.0727 -0.1224 0.0277  109 SER A N   
759  C CA  . SER A 98  ? 0.7953 0.5231 0.5814 -0.0752 -0.1160 0.0289  109 SER A CA  
760  C C   . SER A 98  ? 0.7769 0.5158 0.5724 -0.0709 -0.1100 0.0275  109 SER A C   
761  O O   . SER A 98  ? 0.7580 0.4974 0.5570 -0.0642 -0.1094 0.0248  109 SER A O   
762  C CB  . SER A 98  ? 0.8277 0.5615 0.6214 -0.0732 -0.1131 0.0274  109 SER A CB  
763  O OG  . SER A 98  ? 0.9398 0.6643 0.7250 -0.0784 -0.1178 0.0291  109 SER A OG  
764  N N   . GLU A 99  ? 0.7765 0.5248 0.5764 -0.0750 -0.1057 0.0295  110 GLU A N   
765  C CA  . GLU A 99  ? 0.7447 0.5036 0.5535 -0.0717 -0.0995 0.0285  110 GLU A CA  
766  C C   . GLU A 99  ? 0.7354 0.5077 0.5545 -0.0731 -0.0933 0.0292  110 GLU A C   
767  O O   . GLU A 99  ? 0.7283 0.5018 0.5452 -0.0798 -0.0943 0.0321  110 GLU A O   
768  C CB  . GLU A 99  ? 0.7733 0.5284 0.5759 -0.0756 -0.1011 0.0304  110 GLU A CB  
769  C CG  . GLU A 99  ? 0.9959 0.7378 0.7881 -0.0741 -0.1073 0.0298  110 GLU A CG  
770  C CD  . GLU A 99  ? 1.3545 1.0905 1.1381 -0.0800 -0.1100 0.0324  110 GLU A CD  
771  O OE1 . GLU A 99  ? 1.3278 1.0688 1.1122 -0.0864 -0.1083 0.0352  110 GLU A OE1 
772  O OE2 . GLU A 99  ? 1.3274 1.0542 1.1036 -0.0784 -0.1140 0.0318  110 GLU A OE2 
773  N N   . LEU A 100 ? 0.6387 0.4213 0.4688 -0.0670 -0.0869 0.0267  111 LEU A N   
774  C CA  . LEU A 100 ? 0.5986 0.3940 0.4391 -0.0674 -0.0804 0.0272  111 LEU A CA  
775  C C   . LEU A 100 ? 0.6141 0.4152 0.4577 -0.0699 -0.0769 0.0291  111 LEU A C   
776  O O   . LEU A 100 ? 0.6094 0.4084 0.4519 -0.0674 -0.0761 0.0281  111 LEU A O   
777  C CB  . LEU A 100 ? 0.5757 0.3788 0.4260 -0.0597 -0.0751 0.0238  111 LEU A CB  
778  C CG  . LEU A 100 ? 0.5988 0.4150 0.4603 -0.0589 -0.0681 0.0238  111 LEU A CG  
779  C CD1 . LEU A 100 ? 0.5937 0.4117 0.4551 -0.0638 -0.0694 0.0258  111 LEU A CD1 
780  C CD2 . LEU A 100 ? 0.5852 0.4076 0.4549 -0.0513 -0.0632 0.0203  111 LEU A CD2 
781  N N   . GLN A 101 ? 0.6632 0.4716 0.5109 -0.0749 -0.0746 0.0319  112 GLN A N   
782  C CA  . GLN A 101 ? 0.6584 0.4720 0.5091 -0.0785 -0.0718 0.0345  112 GLN A CA  
783  C C   . GLN A 101 ? 0.6842 0.5102 0.5447 -0.0808 -0.0671 0.0369  112 GLN A C   
784  O O   . GLN A 101 ? 0.7019 0.5296 0.5619 -0.0838 -0.0689 0.0378  112 GLN A O   
785  C CB  . GLN A 101 ? 0.7057 0.5104 0.5450 -0.0861 -0.0782 0.0376  112 GLN A CB  
786  C CG  . GLN A 101 ? 1.0258 0.8248 0.8568 -0.0922 -0.0842 0.0396  112 GLN A CG  
787  C CD  . GLN A 101 ? 1.3311 1.1209 1.1498 -0.1002 -0.0905 0.0428  112 GLN A CD  
788  O OE1 . GLN A 101 ? 1.3273 1.1062 1.1373 -0.0992 -0.0945 0.0418  112 GLN A OE1 
789  N NE2 . GLN A 101 ? 1.1659 0.9604 0.9838 -0.1084 -0.0916 0.0468  112 GLN A NE2 
790  N N   . GLU A 102 ? 0.5240 0.3586 0.3933 -0.0794 -0.0609 0.0381  113 GLU A N   
791  C CA  . GLU A 102 ? 0.4921 0.3394 0.3717 -0.0812 -0.0560 0.0413  113 GLU A CA  
792  C C   . GLU A 102 ? 0.5848 0.4345 0.4620 -0.0898 -0.0583 0.0466  113 GLU A C   
793  O O   . GLU A 102 ? 0.5997 0.4463 0.4742 -0.0913 -0.0585 0.0480  113 GLU A O   
794  C CB  . GLU A 102 ? 0.4792 0.3348 0.3704 -0.0742 -0.0475 0.0405  113 GLU A CB  
795  C CG  . GLU A 102 ? 0.5161 0.3849 0.4182 -0.0752 -0.0420 0.0445  113 GLU A CG  
796  C CD  . GLU A 102 ? 0.5614 0.4374 0.4743 -0.0675 -0.0332 0.0441  113 GLU A CD  
797  O OE1 . GLU A 102 ? 0.4844 0.3558 0.3967 -0.0613 -0.0314 0.0398  113 GLU A OE1 
798  O OE2 . GLU A 102 ? 0.4622 0.3490 0.3839 -0.0675 -0.0279 0.0486  113 GLU A OE2 
799  N N   . ASP A 103 ? 0.5256 0.3815 0.4037 -0.0957 -0.0599 0.0498  114 ASP A N   
800  C CA  . ASP A 103 ? 0.5295 0.3891 0.4048 -0.1048 -0.0627 0.0553  114 ASP A CA  
801  C C   . ASP A 103 ? 0.5835 0.4580 0.4710 -0.1048 -0.0559 0.0599  114 ASP A C   
802  O O   . ASP A 103 ? 0.5878 0.4640 0.4749 -0.1080 -0.0554 0.0633  114 ASP A O   
803  C CB  . ASP A 103 ? 0.5582 0.4177 0.4275 -0.1118 -0.0682 0.0569  114 ASP A CB  
804  C CG  . ASP A 103 ? 0.6916 0.5362 0.5487 -0.1113 -0.0744 0.0532  114 ASP A CG  
805  O OD1 . ASP A 103 ? 0.7011 0.5341 0.5495 -0.1108 -0.0778 0.0517  114 ASP A OD1 
806  O OD2 . ASP A 103 ? 0.7883 0.6329 0.6447 -0.1111 -0.0758 0.0521  114 ASP A OD2 
807  N N   . GLU A 104 ? 0.5697 0.4551 0.4677 -0.1009 -0.0506 0.0604  115 GLU A N   
808  C CA  . GLU A 104 ? 0.5629 0.4633 0.4721 -0.1002 -0.0440 0.0657  115 GLU A CA  
809  C C   . GLU A 104 ? 0.5940 0.5019 0.5136 -0.0923 -0.0373 0.0643  115 GLU A C   
810  O O   . GLU A 104 ? 0.5746 0.4771 0.4930 -0.0886 -0.0382 0.0595  115 GLU A O   
811  C CB  . GLU A 104 ? 0.5942 0.5046 0.5026 -0.1099 -0.0474 0.0717  115 GLU A CB  
812  C CG  . GLU A 104 ? 0.8068 0.7194 0.7130 -0.1137 -0.0514 0.0711  115 GLU A CG  
813  C CD  . GLU A 104 ? 1.2305 1.1459 1.1292 -0.1251 -0.0580 0.0753  115 GLU A CD  
814  O OE1 . GLU A 104 ? 1.3162 1.2183 1.2023 -0.1297 -0.0650 0.0731  115 GLU A OE1 
815  O OE2 . GLU A 104 ? 1.1689 1.1000 1.0740 -0.1292 -0.0561 0.0811  115 GLU A OE2 
816  N N   . SER A 105 ? 0.5655 0.4862 0.4950 -0.0894 -0.0303 0.0690  116 SER A N   
817  C CA  . SER A 105 ? 0.5505 0.4788 0.4894 -0.0815 -0.0231 0.0686  116 SER A CA  
818  C C   . SER A 105 ? 0.6386 0.5840 0.5847 -0.0835 -0.0199 0.0754  116 SER A C   
819  O O   . SER A 105 ? 0.6556 0.6078 0.6006 -0.0900 -0.0219 0.0805  116 SER A O   
820  C CB  . SER A 105 ? 0.5834 0.5077 0.5260 -0.0721 -0.0161 0.0665  116 SER A CB  
821  O OG  . SER A 105 ? 0.7291 0.6562 0.6724 -0.0726 -0.0133 0.0708  116 SER A OG  
822  N N   . PHE A 106 ? 0.5911 0.5440 0.5442 -0.0779 -0.0149 0.0754  117 PHE A N   
823  C CA  . PHE A 106 ? 0.5741 0.5444 0.5338 -0.0789 -0.0121 0.0814  117 PHE A CA  
824  C C   . PHE A 106 ? 0.5804 0.5550 0.5465 -0.0695 -0.0049 0.0803  117 PHE A C   
825  O O   . PHE A 106 ? 0.5683 0.5363 0.5341 -0.0664 -0.0051 0.0753  117 PHE A O   
826  C CB  . PHE A 106 ? 0.6078 0.5847 0.5653 -0.0881 -0.0192 0.0832  117 PHE A CB  
827  C CG  . PHE A 106 ? 0.6282 0.6249 0.5929 -0.0892 -0.0172 0.0893  117 PHE A CG  
828  C CD1 . PHE A 106 ? 0.6694 0.6788 0.6357 -0.0942 -0.0177 0.0958  117 PHE A CD1 
829  C CD2 . PHE A 106 ? 0.6560 0.6593 0.6256 -0.0854 -0.0151 0.0884  117 PHE A CD2 
830  C CE1 . PHE A 106 ? 0.6883 0.7179 0.6615 -0.0949 -0.0164 0.1015  117 PHE A CE1 
831  C CE2 . PHE A 106 ? 0.6967 0.7193 0.6729 -0.0862 -0.0138 0.0940  117 PHE A CE2 
832  C CZ  . PHE A 106 ? 0.6795 0.7158 0.6577 -0.0907 -0.0146 0.1006  117 PHE A CZ  
833  N N   . THR A 107 ? 0.4534 0.4388 0.4244 -0.0653 0.0010  0.0848  118 THR A N   
834  C CA  . THR A 107 ? 0.4404 0.4310 0.4162 -0.0569 0.0071  0.0842  118 THR A CA  
835  C C   . THR A 107 ? 0.4974 0.5079 0.4794 -0.0594 0.0063  0.0900  118 THR A C   
836  O O   . THR A 107 ? 0.4862 0.5092 0.4710 -0.0616 0.0065  0.0960  118 THR A O   
837  C CB  . THR A 107 ? 0.5375 0.5239 0.5126 -0.0492 0.0139  0.0837  118 THR A CB  
838  O OG1 . THR A 107 ? 0.5769 0.5456 0.5464 -0.0467 0.0147  0.0782  118 THR A OG1 
839  C CG2 . THR A 107 ? 0.4841 0.4762 0.4629 -0.0417 0.0185  0.0828  118 THR A CG2 
840  N N   . LEU A 108 ? 0.5121 0.5265 0.4967 -0.0589 0.0052  0.0885  119 LEU A N   
841  C CA  . LEU A 108 ? 0.5195 0.5539 0.5107 -0.0601 0.0044  0.0939  119 LEU A CA  
842  C C   . LEU A 108 ? 0.6189 0.6633 0.6161 -0.0512 0.0105  0.0966  119 LEU A C   
843  O O   . LEU A 108 ? 0.6147 0.6507 0.6115 -0.0435 0.0147  0.0923  119 LEU A O   
844  C CB  . LEU A 108 ? 0.5104 0.5449 0.5020 -0.0616 0.0017  0.0911  119 LEU A CB  
845  C CG  . LEU A 108 ? 0.5559 0.6106 0.5538 -0.0635 0.0000  0.0960  119 LEU A CG  
846  C CD1 . LEU A 108 ? 0.5572 0.6227 0.5542 -0.0738 -0.0060 0.1011  119 LEU A CD1 
847  C CD2 . LEU A 108 ? 0.5677 0.6190 0.5653 -0.0629 -0.0012 0.0920  119 LEU A CD2 
848  N N   . ARG A 109 ? 0.6843 0.7473 0.6870 -0.0523 0.0104  0.1036  120 ARG A N   
849  C CA  . ARG A 109 ? 0.7032 0.7780 0.7126 -0.0435 0.0153  0.1070  120 ARG A CA  
850  C C   . ARG A 109 ? 0.7920 0.8915 0.8090 -0.0452 0.0134  0.1146  120 ARG A C   
851  O O   . ARG A 109 ? 0.7895 0.8971 0.8057 -0.0538 0.0092  0.1184  120 ARG A O   
852  C CB  . ARG A 109 ? 0.7299 0.7986 0.7369 -0.0405 0.0188  0.1075  120 ARG A CB  
853  C CG  . ARG A 109 ? 0.9155 1.0000 0.9301 -0.0326 0.0228  0.1129  120 ARG A CG  
854  C CD  . ARG A 109 ? 1.0661 1.1545 1.0866 -0.0223 0.0261  0.1115  120 ARG A CD  
855  N NE  . ARG A 109 ? 1.1935 1.2628 1.2095 -0.0176 0.0286  0.1041  120 ARG A NE  
856  C CZ  . ARG A 109 ? 1.4010 1.4708 1.4215 -0.0083 0.0316  0.1020  120 ARG A CZ  
857  N NH1 . ARG A 109 ? 1.2177 1.3049 1.2470 -0.0021 0.0327  0.1069  120 ARG A NH1 
858  N NH2 . ARG A 109 ? 1.2782 1.3315 1.2946 -0.0048 0.0333  0.0951  120 ARG A NH2 
859  N N   . GLY A 110 ? 0.8108 0.9223 0.8350 -0.0371 0.0160  0.1166  121 GLY A N   
860  C CA  . GLY A 110 ? 0.8467 0.9826 0.8786 -0.0368 0.0146  0.1240  121 GLY A CA  
861  C C   . GLY A 110 ? 0.9865 1.1350 1.0231 -0.0319 0.0176  0.1299  121 GLY A C   
862  O O   . GLY A 110 ? 0.9917 1.1302 1.0248 -0.0313 0.0200  0.1287  121 GLY A O   
863  N N   . PRO A 111 ? 1.1222 1.2931 1.1667 -0.0280 0.0176  0.1366  122 PRO A N   
864  C CA  . PRO A 111 ? 1.1412 1.3258 1.1906 -0.0228 0.0204  0.1428  122 PRO A CA  
865  C C   . PRO A 111 ? 1.2268 1.4033 1.2782 -0.0103 0.0262  0.1407  122 PRO A C   
866  O O   . PRO A 111 ? 1.2163 1.3846 1.2684 -0.0040 0.0279  0.1365  122 PRO A O   
867  C CB  . PRO A 111 ? 1.1629 1.3735 1.2200 -0.0217 0.0181  0.1500  122 PRO A CB  
868  C CG  . PRO A 111 ? 1.2076 1.4154 1.2653 -0.0204 0.0167  0.1466  122 PRO A CG  
869  C CD  . PRO A 111 ? 1.1444 1.3296 1.1936 -0.0281 0.0149  0.1388  122 PRO A CD  
870  N N   . PRO A 112 ? 1.2713 1.4498 1.3235 -0.0065 0.0293  0.1435  123 PRO A N   
871  C CA  . PRO A 112 ? 1.2729 1.4444 1.3271 0.0059  0.0347  0.1419  123 PRO A CA  
872  C C   . PRO A 112 ? 1.3353 1.5206 1.3975 0.0168  0.0363  0.1455  123 PRO A C   
873  O O   . PRO A 112 ? 1.3404 1.5468 1.4081 0.0173  0.0346  0.1525  123 PRO A O   
874  C CB  . PRO A 112 ? 1.3000 1.4759 1.3540 0.0066  0.0370  0.1461  123 PRO A CB  
875  C CG  . PRO A 112 ? 1.3596 1.5527 1.4147 -0.0028 0.0330  0.1521  123 PRO A CG  
876  C CD  . PRO A 112 ? 1.3024 1.4894 1.3533 -0.0132 0.0281  0.1483  123 PRO A CD  
877  N N   . GLY A 113 ? 1.4584 1.6314 1.5209 0.0255  0.0393  0.1407  124 GLY A N   
878  C CA  . GLY A 113 ? 1.4510 1.6334 1.5198 0.0358  0.0405  0.1432  124 GLY A CA  
879  C C   . GLY A 113 ? 1.4939 1.6689 1.5611 0.0332  0.0384  0.1381  124 GLY A C   
880  O O   . GLY A 113 ? 1.4873 1.6578 1.5568 0.0422  0.0406  0.1360  124 GLY A O   
881  N N   . ALA A 114 ? 0.9339 1.1071 0.9969 0.0209  0.0340  0.1361  125 ALA A N   
882  C CA  . ALA A 114 ? 0.9194 1.0836 0.9797 0.0174  0.0319  0.1306  125 ALA A CA  
883  C C   . ALA A 114 ? 0.9411 1.0820 0.9963 0.0200  0.0346  0.1222  125 ALA A C   
884  O O   . ALA A 114 ? 0.9345 1.0628 0.9844 0.0164  0.0354  0.1190  125 ALA A O   
885  C CB  . ALA A 114 ? 0.9326 1.0986 0.9887 0.0037  0.0266  0.1303  125 ALA A CB  
886  N N   . ALA A 115 ? 0.9418 1.0774 0.9983 0.0262  0.0359  0.1187  126 ALA A N   
887  C CA  . ALA A 115 ? 0.9232 1.0388 0.9758 0.0299  0.0386  0.1109  126 ALA A CA  
888  C C   . ALA A 115 ? 0.9371 1.0372 0.9812 0.0188  0.0358  0.1045  126 ALA A C   
889  O O   . ALA A 115 ? 0.9287 1.0324 0.9704 0.0097  0.0317  0.1051  126 ALA A O   
890  C CB  . ALA A 115 ? 0.9257 1.0400 0.9815 0.0383  0.0402  0.1089  126 ALA A CB  
891  N N   . PRO A 116 ? 1.0466 1.1294 1.0857 0.0196  0.0377  0.0985  127 PRO A N   
892  C CA  . PRO A 116 ? 1.0374 1.1045 1.0676 0.0100  0.0349  0.0924  127 PRO A CA  
893  C C   . PRO A 116 ? 1.0413 1.1033 1.0699 0.0085  0.0333  0.0879  127 PRO A C   
894  O O   . PRO A 116 ? 1.0309 1.0842 1.0526 -0.0005 0.0299  0.0846  127 PRO A O   
895  C CB  . PRO A 116 ? 1.0620 1.1141 1.0885 0.0136  0.0378  0.0873  127 PRO A CB  
896  C CG  . PRO A 116 ? 1.1154 1.1724 1.1494 0.0267  0.0427  0.0884  127 PRO A CG  
897  C CD  . PRO A 116 ? 1.0619 1.1386 1.1031 0.0297  0.0426  0.0969  127 PRO A CD  
898  N N   . SER A 117 ? 1.1699 1.2364 1.2042 0.0174  0.0356  0.0877  128 SER A N   
899  C CA  . SER A 117 ? 1.1447 1.2065 1.1775 0.0166  0.0345  0.0835  128 SER A CA  
900  C C   . SER A 117 ? 1.1429 1.2164 1.1764 0.0095  0.0305  0.0874  128 SER A C   
901  O O   . SER A 117 ? 1.1438 1.2176 1.1774 0.0093  0.0294  0.0855  128 SER A O   
902  C CB  . SER A 117 ? 1.1782 1.2409 1.2168 0.0286  0.0384  0.0825  128 SER A CB  
903  O OG  . SER A 117 ? 1.2599 1.3378 1.3057 0.0358  0.0400  0.0897  128 SER A OG  
904  N N   . ALA A 118 ? 0.7698 0.8535 0.8039 0.0037  0.0282  0.0929  129 ALA A N   
905  C CA  . ALA A 118 ? 0.7416 0.8367 0.7762 -0.0039 0.0240  0.0965  129 ALA A CA  
906  C C   . ALA A 118 ? 0.7394 0.8274 0.7672 -0.0153 0.0203  0.0953  129 ALA A C   
907  O O   . ALA A 118 ? 0.7301 0.8208 0.7561 -0.0224 0.0164  0.0953  129 ALA A O   
908  C CB  . ALA A 118 ? 0.7497 0.8674 0.7923 -0.0006 0.0238  0.1052  129 ALA A CB  
909  N N   . THR A 119 ? 0.7302 0.8089 0.7540 -0.0170 0.0212  0.0942  130 THR A N   
910  C CA  . THR A 119 ? 0.7149 0.7843 0.7317 -0.0268 0.0177  0.0927  130 THR A CA  
911  C C   . THR A 119 ? 0.7024 0.7491 0.7108 -0.0281 0.0180  0.0846  130 THR A C   
912  O O   . THR A 119 ? 0.7006 0.7371 0.7029 -0.0347 0.0154  0.0828  130 THR A O   
913  C CB  . THR A 119 ? 0.8820 0.9554 0.8989 -0.0284 0.0181  0.0970  130 THR A CB  
914  O OG1 . THR A 119 ? 0.9159 0.9814 0.9265 -0.0381 0.0142  0.0961  130 THR A OG1 
915  C CG2 . THR A 119 ? 0.8385 0.9017 0.8542 -0.0211 0.0228  0.0942  130 THR A CG2 
916  N N   . GLN A 120 ? 0.4656 0.5051 0.4739 -0.0216 0.0208  0.0798  131 GLN A N   
917  C CA  . GLN A 120 ? 0.4427 0.4623 0.4431 -0.0226 0.0209  0.0720  131 GLN A CA  
918  C C   . GLN A 120 ? 0.4635 0.4787 0.4603 -0.0296 0.0170  0.0700  131 GLN A C   
919  O O   . GLN A 120 ? 0.4705 0.4944 0.4708 -0.0301 0.0158  0.0711  131 GLN A O   
920  C CB  . GLN A 120 ? 0.4474 0.4640 0.4501 -0.0143 0.0240  0.0679  131 GLN A CB  
921  C CG  . GLN A 120 ? 0.6314 0.6471 0.6370 -0.0068 0.0276  0.0676  131 GLN A CG  
922  C CD  . GLN A 120 ? 0.8653 0.8660 0.8627 -0.0104 0.0267  0.0639  131 GLN A CD  
923  O OE1 . GLN A 120 ? 0.8920 0.8942 0.8888 -0.0116 0.0271  0.0671  131 GLN A OE1 
924  N NE2 . GLN A 120 ? 0.6275 0.6144 0.6184 -0.0122 0.0252  0.0572  131 GLN A NE2 
925  N N   . ILE A 121 ? 0.3652 0.3678 0.3560 -0.0345 0.0147  0.0673  132 ILE A N   
926  C CA  . ILE A 121 ? 0.3474 0.3467 0.3362 -0.0411 0.0097  0.0656  132 ILE A CA  
927  C C   . ILE A 121 ? 0.3721 0.3615 0.3588 -0.0377 0.0111  0.0593  132 ILE A C   
928  O O   . ILE A 121 ? 0.3853 0.3618 0.3683 -0.0329 0.0143  0.0542  132 ILE A O   
929  C CB  . ILE A 121 ? 0.3870 0.3775 0.3713 -0.0467 0.0055  0.0650  132 ILE A CB  
930  C CG1 . ILE A 121 ? 0.3884 0.3901 0.3744 -0.0516 0.0035  0.0716  132 ILE A CG1 
931  C CG2 . ILE A 121 ? 0.3818 0.3665 0.3626 -0.0529 -0.0009 0.0617  132 ILE A CG2 
932  C CD1 . ILE A 121 ? 0.4004 0.3929 0.3814 -0.0565 -0.0001 0.0711  132 ILE A CD1 
933  N N   . THR A 122 ? 0.3524 0.3482 0.3410 -0.0402 0.0086  0.0596  133 THR A N   
934  C CA  . THR A 122 ? 0.3332 0.3209 0.3202 -0.0379 0.0094  0.0540  133 THR A CA  
935  C C   . THR A 122 ? 0.3803 0.3607 0.3637 -0.0442 0.0030  0.0509  133 THR A C   
936  O O   . THR A 122 ? 0.4002 0.3685 0.3806 -0.0424 0.0025  0.0457  133 THR A O   
937  C CB  . THR A 122 ? 0.3419 0.3408 0.3327 -0.0364 0.0105  0.0557  133 THR A CB  
938  O OG1 . THR A 122 ? 0.3458 0.3583 0.3393 -0.0431 0.0057  0.0609  133 THR A OG1 
939  C CG2 . THR A 122 ? 0.2927 0.2985 0.2870 -0.0293 0.0152  0.0577  133 THR A CG2 
940  N N   . VAL A 123 ? 0.3736 0.3617 0.3563 -0.0519 -0.0026 0.0539  134 VAL A N   
941  C CA  . VAL A 123 ? 0.3766 0.3573 0.3531 -0.0586 -0.0096 0.0509  134 VAL A CA  
942  C C   . VAL A 123 ? 0.4571 0.4378 0.4296 -0.0658 -0.0149 0.0540  134 VAL A C   
943  O O   . VAL A 123 ? 0.4493 0.4426 0.4247 -0.0693 -0.0154 0.0600  134 VAL A O   
944  C CB  . VAL A 123 ? 0.4233 0.4110 0.3998 -0.0625 -0.0122 0.0513  134 VAL A CB  
945  C CG1 . VAL A 123 ? 0.4299 0.4079 0.3977 -0.0689 -0.0192 0.0478  134 VAL A CG1 
946  C CG2 . VAL A 123 ? 0.4069 0.3950 0.3874 -0.0555 -0.0068 0.0485  134 VAL A CG2 
947  N N   . VAL A 124 ? 0.3771 0.3442 0.3424 -0.0677 -0.0189 0.0500  135 VAL A N   
948  C CA  . VAL A 124 ? 0.3725 0.3368 0.3314 -0.0752 -0.0249 0.0522  135 VAL A CA  
949  C C   . VAL A 124 ? 0.4425 0.4013 0.3929 -0.0817 -0.0317 0.0503  135 VAL A C   
950  O O   . VAL A 124 ? 0.4205 0.3686 0.3665 -0.0790 -0.0326 0.0449  135 VAL A O   
951  C CB  . VAL A 124 ? 0.3991 0.3516 0.3543 -0.0726 -0.0250 0.0495  135 VAL A CB  
952  C CG1 . VAL A 124 ? 0.4074 0.3561 0.3548 -0.0807 -0.0316 0.0517  135 VAL A CG1 
953  C CG2 . VAL A 124 ? 0.3796 0.3369 0.3424 -0.0661 -0.0179 0.0516  135 VAL A CG2 
954  N N   . LEU A 125 ? 0.4117 0.3781 0.3593 -0.0899 -0.0361 0.0549  136 LEU A N   
955  C CA  . LEU A 125 ? 0.4268 0.3880 0.3652 -0.0966 -0.0422 0.0540  136 LEU A CA  
956  C C   . LEU A 125 ? 0.5219 0.4783 0.4513 -0.1044 -0.0482 0.0567  136 LEU A C   
957  O O   . LEU A 125 ? 0.5269 0.4953 0.4579 -0.1105 -0.0498 0.0623  136 LEU A O   
958  C CB  . LEU A 125 ? 0.4237 0.3989 0.3655 -0.1000 -0.0423 0.0572  136 LEU A CB  
959  C CG  . LEU A 125 ? 0.4820 0.4535 0.4138 -0.1080 -0.0484 0.0575  136 LEU A CG  
960  C CD1 . LEU A 125 ? 0.4693 0.4244 0.3942 -0.1049 -0.0492 0.0513  136 LEU A CD1 
961  C CD2 . LEU A 125 ? 0.5001 0.4883 0.4359 -0.1119 -0.0485 0.0616  136 LEU A CD2 
962  N N   . PRO A 126 ? 0.4156 0.3555 0.3356 -0.1044 -0.0516 0.0530  137 PRO A N   
963  C CA  . PRO A 126 ? 0.4381 0.3720 0.3477 -0.1124 -0.0578 0.0556  137 PRO A CA  
964  C C   . PRO A 126 ? 0.5535 0.4879 0.4556 -0.1199 -0.0623 0.0575  137 PRO A C   
965  O O   . PRO A 126 ? 0.5414 0.4680 0.4397 -0.1181 -0.0628 0.0541  137 PRO A O   
966  C CB  . PRO A 126 ? 0.4602 0.3758 0.3623 -0.1083 -0.0595 0.0509  137 PRO A CB  
967  C CG  . PRO A 126 ? 0.4899 0.4050 0.4003 -0.0982 -0.0536 0.0465  137 PRO A CG  
968  C CD  . PRO A 126 ? 0.4153 0.3420 0.3338 -0.0966 -0.0498 0.0469  137 PRO A CD  
969  N N   . HIS A 127 ? 0.5677 0.5891 0.6408 -0.1523 0.0178  0.0867  138 HIS A N   
970  C CA  . HIS A 127 ? 0.5898 0.6126 0.6669 -0.1571 0.0122  0.0841  138 HIS A CA  
971  C C   . HIS A 127 ? 0.6658 0.6713 0.7389 -0.1578 0.0118  0.0819  138 HIS A C   
972  O O   . HIS A 127 ? 0.6695 0.6702 0.7407 -0.1556 0.0159  0.0812  138 HIS A O   
973  C CB  . HIS A 127 ? 0.6057 0.6552 0.6941 -0.1617 0.0108  0.0819  138 HIS A CB  
974  C CG  . HIS A 127 ? 0.6612 0.7150 0.7533 -0.1627 0.0049  0.0777  138 HIS A CG  
975  N ND1 . HIS A 127 ? 0.6944 0.7464 0.7910 -0.1739 0.0017  0.0787  138 HIS A ND1 
976  C CD2 . HIS A 127 ? 0.6926 0.7523 0.7841 -0.1538 0.0016  0.0725  138 HIS A CD2 
977  C CE1 . HIS A 127 ? 0.6933 0.7502 0.7923 -0.1720 -0.0033 0.0742  138 HIS A CE1 
978  N NE2 . HIS A 127 ? 0.6961 0.7576 0.7920 -0.1598 -0.0035 0.0703  138 HIS A NE2 
979  N N   . SER A 128 ? 0.5932 0.5903 0.6654 -0.1596 0.0070  0.0801  139 SER A N   
980  C CA  . SER A 128 ? 0.6040 0.5864 0.6728 -0.1586 0.0069  0.0773  139 SER A CA  
981  C C   . SER A 128 ? 0.6927 0.6864 0.7687 -0.1646 0.0080  0.0766  139 SER A C   
982  O O   . SER A 128 ? 0.6918 0.6749 0.7654 -0.1632 0.0094  0.0748  139 SER A O   
983  C CB  . SER A 128 ? 0.6381 0.6114 0.7051 -0.1595 0.0014  0.0755  139 SER A CB  
984  O OG  . SER A 128 ? 0.7585 0.7493 0.8349 -0.1679 -0.0033 0.0754  139 SER A OG  
985  N N   . SER A 129 ? 0.6478 0.6634 0.7327 -0.1707 0.0078  0.0778  140 SER A N   
986  C CA  . SER A 129 ? 0.6537 0.6808 0.7455 -0.1762 0.0091  0.0772  140 SER A CA  
987  C C   . SER A 129 ? 0.7023 0.7286 0.7925 -0.1730 0.0148  0.0782  140 SER A C   
988  O O   . SER A 129 ? 0.7049 0.7378 0.7997 -0.1768 0.0162  0.0778  140 SER A O   
989  C CB  . SER A 129 ? 0.6994 0.7519 0.8019 -0.1834 0.0066  0.0773  140 SER A CB  
990  O OG  . SER A 129 ? 0.7717 0.8383 0.8767 -0.1817 0.0090  0.0793  140 SER A OG  
991  N N   . CYS A 130 ? 0.9084 0.9268 0.9922 -0.1662 0.0180  0.0794  141 CYS A N   
992  C CA  . CYS A 130 ? 0.9056 0.9226 0.9875 -0.1624 0.0233  0.0801  141 CYS A CA  
993  C C   . CYS A 130 ? 0.9283 0.9668 1.0183 -0.1672 0.0250  0.0814  141 CYS A C   
994  O O   . CYS A 130 ? 0.9265 0.9652 1.0160 -0.1652 0.0291  0.0818  141 CYS A O   
995  C CB  . CYS A 130 ? 0.9209 0.9236 0.9996 -0.1602 0.0253  0.0783  141 CYS A CB  
996  S SG  . CYS A 130 ? 0.9750 0.9534 1.0443 -0.1526 0.0248  0.0761  141 CYS A SG  
997  N N   . GLU A 131 ? 0.6981 0.7554 0.7958 -0.1730 0.0220  0.0817  142 GLU A N   
998  C CA  . GLU A 131 ? 0.6781 0.7580 0.7843 -0.1770 0.0235  0.0823  142 GLU A CA  
999  C C   . GLU A 131 ? 0.6591 0.7539 0.7673 -0.1745 0.0250  0.0839  142 GLU A C   
1000 O O   . GLU A 131 ? 0.6458 0.7588 0.7600 -0.1759 0.0273  0.0842  142 GLU A O   
1001 C CB  . GLU A 131 ? 0.7032 0.7978 0.8183 -0.1848 0.0197  0.0806  142 GLU A CB  
1002 C CG  . GLU A 131 ? 0.8733 0.9567 0.9879 -0.1879 0.0186  0.0792  142 GLU A CG  
1003 C CD  . GLU A 131 ? 1.1017 1.2011 1.2254 -0.1955 0.0154  0.0775  142 GLU A CD  
1004 O OE1 . GLU A 131 ? 0.9133 1.0316 1.0442 -0.1986 0.0167  0.0775  142 GLU A OE1 
1005 O OE2 . GLU A 131 ? 1.0139 1.1071 1.1377 -0.1981 0.0115  0.0760  142 GLU A OE2 
1006 N N   . LEU A 132 ? 0.5665 0.6544 0.6699 -0.1705 0.0238  0.0849  143 LEU A N   
1007 C CA  . LEU A 132 ? 0.5345 0.6386 0.6407 -0.1680 0.0250  0.0865  143 LEU A CA  
1008 C C   . LEU A 132 ? 0.5266 0.6134 0.6229 -0.1603 0.0269  0.0885  143 LEU A C   
1009 O O   . LEU A 132 ? 0.5168 0.5812 0.6053 -0.1578 0.0252  0.0880  143 LEU A O   
1010 C CB  . LEU A 132 ? 0.5296 0.6492 0.6421 -0.1682 0.0203  0.0832  143 LEU A CB  
1011 C CG  . LEU A 132 ? 0.5841 0.7273 0.7085 -0.1763 0.0185  0.0816  143 LEU A CG  
1012 C CD1 . LEU A 132 ? 0.5833 0.7362 0.7104 -0.1707 0.0135  0.0757  143 LEU A CD1 
1013 C CD2 . LEU A 132 ? 0.5962 0.7594 0.7265 -0.1771 0.0230  0.0829  143 LEU A CD2 
1014 N N   . LEU A 133 ? 0.4269 0.5227 0.5222 -0.1529 0.0306  0.0885  144 LEU A N   
1015 C CA  . LEU A 133 ? 0.3961 0.4777 0.4813 -0.1407 0.0322  0.0875  144 LEU A CA  
1016 C C   . LEU A 133 ? 0.4321 0.5269 0.5181 -0.1300 0.0306  0.0821  144 LEU A C   
1017 O O   . LEU A 133 ? 0.4242 0.5410 0.5172 -0.1294 0.0320  0.0808  144 LEU A O   
1018 C CB  . LEU A 133 ? 0.3782 0.4566 0.4599 -0.1390 0.0383  0.0913  144 LEU A CB  
1019 C CG  . LEU A 133 ? 0.3991 0.4562 0.4742 -0.1391 0.0403  0.0915  144 LEU A CG  
1020 C CD1 . LEU A 133 ? 0.3771 0.4317 0.4475 -0.1324 0.0459  0.0920  144 LEU A CD1 
1021 C CD2 . LEU A 133 ? 0.3940 0.4259 0.4603 -0.1360 0.0379  0.0903  144 LEU A CD2 
1022 N N   . TYR A 134 ? 0.4043 0.4859 0.4833 -0.1217 0.0276  0.0789  145 TYR A N   
1023 C CA  . TYR A 134 ? 0.3907 0.4812 0.4683 -0.1098 0.0264  0.0739  145 TYR A CA  
1024 C C   . TYR A 134 ? 0.4125 0.4921 0.4808 -0.0990 0.0306  0.0745  145 TYR A C   
1025 O O   . TYR A 134 ? 0.4047 0.4620 0.4646 -0.0976 0.0316  0.0766  145 TYR A O   
1026 C CB  . TYR A 134 ? 0.4022 0.4855 0.4776 -0.1067 0.0206  0.0699  145 TYR A CB  
1027 C CG  . TYR A 134 ? 0.4429 0.5402 0.5281 -0.1160 0.0163  0.0684  145 TYR A CG  
1028 C CD1 . TYR A 134 ? 0.4514 0.5716 0.5441 -0.1136 0.0143  0.0643  145 TYR A CD1 
1029 C CD2 . TYR A 134 ? 0.4801 0.5676 0.5670 -0.1271 0.0141  0.0710  145 TYR A CD2 
1030 C CE1 . TYR A 134 ? 0.4705 0.6037 0.5722 -0.1221 0.0104  0.0628  145 TYR A CE1 
1031 C CE2 . TYR A 134 ? 0.4973 0.5974 0.5931 -0.1357 0.0103  0.0696  145 TYR A CE2 
1032 C CZ  . TYR A 134 ? 0.6114 0.7343 0.7146 -0.1333 0.0085  0.0655  145 TYR A CZ  
1033 O OH  . TYR A 134 ? 0.6715 0.8071 0.7837 -0.1420 0.0047  0.0639  145 TYR A OH  
1034 N N   . LEU A 135 ? 0.2945 0.3899 0.3645 -0.0916 0.0331  0.0726  146 LEU A N   
1035 C CA  . LEU A 135 ? 0.2812 0.3693 0.3436 -0.0823 0.0379  0.0735  146 LEU A CA  
1036 C C   . LEU A 135 ? 0.3292 0.4213 0.3876 -0.0689 0.0368  0.0685  146 LEU A C   
1037 O O   . LEU A 135 ? 0.3278 0.4412 0.3924 -0.0660 0.0365  0.0657  146 LEU A O   
1038 C CB  . LEU A 135 ? 0.2712 0.3738 0.3387 -0.0860 0.0430  0.0766  146 LEU A CB  
1039 C CG  . LEU A 135 ? 0.3238 0.4238 0.3954 -0.0992 0.0444  0.0817  146 LEU A CG  
1040 C CD1 . LEU A 135 ? 0.3171 0.4330 0.3939 -0.1019 0.0494  0.0844  146 LEU A CD1 
1041 C CD2 . LEU A 135 ? 0.3236 0.3969 0.3863 -0.1004 0.0454  0.0849  146 LEU A CD2 
1042 N N   . GLY A 136 ? 0.3165 0.3883 0.3648 -0.0608 0.0362  0.0673  147 GLY A N   
1043 C CA  . GLY A 136 ? 0.3141 0.3871 0.3570 -0.0474 0.0360  0.0631  147 GLY A CA  
1044 C C   . GLY A 136 ? 0.3625 0.4367 0.4012 -0.0401 0.0418  0.0643  147 GLY A C   
1045 O O   . GLY A 136 ? 0.3530 0.4160 0.3881 -0.0428 0.0458  0.0683  147 GLY A O   
1046 N N   . THR A 137 ? 0.2961 0.3843 0.3353 -0.0306 0.0423  0.0607  148 THR A N   
1047 C CA  . THR A 137 ? 0.2883 0.3814 0.3247 -0.0235 0.0477  0.0613  148 THR A CA  
1048 C C   . THR A 137 ? 0.3346 0.4207 0.3622 -0.0092 0.0478  0.0574  148 THR A C   
1049 O O   . THR A 137 ? 0.3276 0.4076 0.3521 -0.0047 0.0435  0.0540  148 THR A O   
1050 C CB  . THR A 137 ? 0.4048 0.5252 0.4514 -0.0265 0.0493  0.0612  148 THR A CB  
1051 O OG1 . THR A 137 ? 0.4151 0.5513 0.4672 -0.0243 0.0448  0.0567  148 THR A OG1 
1052 C CG2 . THR A 137 ? 0.3517 0.4777 0.4061 -0.0404 0.0503  0.0656  148 THR A CG2 
1053 N N   . GLU A 138 ? 0.3353 0.4224 0.3588 -0.0019 0.0528  0.0581  149 GLU A N   
1054 C CA  . GLU A 138 ? 0.3433 0.4242 0.3583 0.0120  0.0536  0.0546  149 GLU A CA  
1055 C C   . GLU A 138 ? 0.4500 0.5504 0.4693 0.0183  0.0508  0.0497  149 GLU A C   
1056 O O   . GLU A 138 ? 0.4569 0.5511 0.4693 0.0290  0.0495  0.0461  149 GLU A O   
1057 C CB  . GLU A 138 ? 0.3567 0.4342 0.3665 0.0174  0.0600  0.0566  149 GLU A CB  
1058 C CG  . GLU A 138 ? 0.4801 0.5360 0.4838 0.0134  0.0629  0.0609  149 GLU A CG  
1059 C CD  . GLU A 138 ? 0.7563 0.8080 0.7542 0.0199  0.0690  0.0625  149 GLU A CD  
1060 O OE1 . GLU A 138 ? 0.6944 0.7636 0.6956 0.0242  0.0716  0.0615  149 GLU A OE1 
1061 O OE2 . GLU A 138 ? 0.6638 0.6948 0.6539 0.0207  0.0713  0.0647  149 GLU A OE2 
1062 N N   . SER A 139 ? 0.4473 0.5709 0.4775 0.0121  0.0500  0.0496  150 SER A N   
1063 C CA  . SER A 139 ? 0.4503 0.5934 0.4852 0.0176  0.0472  0.0450  150 SER A CA  
1064 C C   . SER A 139 ? 0.5240 0.6625 0.5586 0.0180  0.0409  0.0415  150 SER A C   
1065 O O   . SER A 139 ? 0.5321 0.6780 0.5657 0.0266  0.0383  0.0370  150 SER A O   
1066 C CB  . SER A 139 ? 0.4763 0.6452 0.5235 0.0099  0.0477  0.0458  150 SER A CB  
1067 O OG  . SER A 139 ? 0.5312 0.7032 0.5858 -0.0022 0.0441  0.0470  150 SER A OG  
1068 N N   . GLY A 140 ? 0.6385 0.7648 0.6738 0.0088  0.0383  0.0436  151 GLY A N   
1069 C CA  . GLY A 140 ? 0.6320 0.7556 0.6686 0.0071  0.0321  0.0407  151 GLY A CA  
1070 C C   . GLY A 140 ? 0.6515 0.7905 0.6997 -0.0052 0.0291  0.0413  151 GLY A C   
1071 O O   . GLY A 140 ? 0.6545 0.7932 0.7048 -0.0075 0.0238  0.0388  151 GLY A O   
1072 N N   . ASN A 141 ? 0.3967 0.5490 0.4524 -0.0132 0.0322  0.0445  152 ASN A N   
1073 C CA  . ASN A 141 ? 0.3848 0.5525 0.4518 -0.0253 0.0298  0.0454  152 ASN A CA  
1074 C C   . ASN A 141 ? 0.4147 0.5680 0.4818 -0.0369 0.0305  0.0503  152 ASN A C   
1075 O O   . ASN A 141 ? 0.4165 0.5555 0.4777 -0.0369 0.0346  0.0539  152 ASN A O   
1076 C CB  . ASN A 141 ? 0.4079 0.6007 0.4836 -0.0271 0.0328  0.0457  152 ASN A CB  
1077 C CG  . ASN A 141 ? 0.7074 0.9152 0.7831 -0.0156 0.0324  0.0410  152 ASN A CG  
1078 O OD1 . ASN A 141 ? 0.6282 0.8369 0.7029 -0.0102 0.0280  0.0366  152 ASN A OD1 
1079 N ND2 . ASN A 141 ? 0.5944 0.8140 0.6713 -0.0117 0.0370  0.0417  152 ASN A ND2 
1080 N N   . VAL A 142 ? 0.3541 0.5113 0.4278 -0.0468 0.0264  0.0502  153 VAL A N   
1081 C CA  . VAL A 142 ? 0.3533 0.4984 0.4281 -0.0586 0.0263  0.0546  153 VAL A CA  
1082 C C   . VAL A 142 ? 0.4200 0.5849 0.5062 -0.0699 0.0275  0.0568  153 VAL A C   
1083 O O   . VAL A 142 ? 0.4229 0.6066 0.5177 -0.0729 0.0244  0.0540  153 VAL A O   
1084 C CB  . VAL A 142 ? 0.3990 0.5310 0.4719 -0.0616 0.0208  0.0530  153 VAL A CB  
1085 C CG1 . VAL A 142 ? 0.3912 0.5114 0.4656 -0.0742 0.0208  0.0576  153 VAL A CG1 
1086 C CG2 . VAL A 142 ? 0.3956 0.5077 0.4570 -0.0503 0.0198  0.0508  153 VAL A CG2 
1087 N N   . PHE A 143 ? 0.3483 0.5091 0.4346 -0.0760 0.0319  0.0617  154 PHE A N   
1088 C CA  . PHE A 143 ? 0.3308 0.5084 0.4270 -0.0871 0.0336  0.0644  154 PHE A CA  
1089 C C   . PHE A 143 ? 0.4167 0.5826 0.5145 -0.0996 0.0323  0.0681  154 PHE A C   
1090 O O   . PHE A 143 ? 0.3997 0.5428 0.4898 -0.0996 0.0317  0.0698  154 PHE A O   
1091 C CB  . PHE A 143 ? 0.3281 0.5114 0.4238 -0.0852 0.0398  0.0674  154 PHE A CB  
1092 C CG  . PHE A 143 ? 0.3347 0.5307 0.4294 -0.0734 0.0415  0.0640  154 PHE A CG  
1093 C CD1 . PHE A 143 ? 0.3513 0.5332 0.4357 -0.0614 0.0428  0.0627  154 PHE A CD1 
1094 C CD2 . PHE A 143 ? 0.3720 0.5940 0.4759 -0.0742 0.0417  0.0620  154 PHE A CD2 
1095 C CE1 . PHE A 143 ? 0.3569 0.5502 0.4401 -0.0504 0.0444  0.0595  154 PHE A CE1 
1096 C CE2 . PHE A 143 ? 0.4044 0.6381 0.5073 -0.0632 0.0432  0.0589  154 PHE A CE2 
1097 C CZ  . PHE A 143 ? 0.3682 0.5874 0.4606 -0.0512 0.0446  0.0577  154 PHE A CZ  
1098 N N   . VAL A 144 ? 0.4458 0.6278 0.5538 -0.1105 0.0318  0.0693  155 VAL A N   
1099 C CA  . VAL A 144 ? 0.4531 0.6269 0.5638 -0.1233 0.0304  0.0727  155 VAL A CA  
1100 C C   . VAL A 144 ? 0.5059 0.6872 0.6212 -0.1318 0.0351  0.0774  155 VAL A C   
1101 O O   . VAL A 144 ? 0.5083 0.7103 0.6301 -0.1317 0.0374  0.0768  155 VAL A O   
1102 C CB  . VAL A 144 ? 0.4994 0.6841 0.6180 -0.1297 0.0250  0.0697  155 VAL A CB  
1103 C CG1 . VAL A 144 ? 0.4912 0.6633 0.6108 -0.1418 0.0233  0.0729  155 VAL A CG1 
1104 C CG2 . VAL A 144 ? 0.5035 0.6852 0.6183 -0.1200 0.0206  0.0644  155 VAL A CG2 
1105 N N   . VAL A 145 ? 0.4181 0.5824 0.5300 -0.1392 0.0365  0.0820  156 VAL A N   
1106 C CA  . VAL A 145 ? 0.4173 0.5859 0.5329 -0.1479 0.0409  0.0869  156 VAL A CA  
1107 C C   . VAL A 145 ? 0.5084 0.6679 0.6261 -0.1595 0.0385  0.0889  156 VAL A C   
1108 O O   . VAL A 145 ? 0.4855 0.6267 0.5982 -0.1605 0.0356  0.0890  156 VAL A O   
1109 C CB  . VAL A 145 ? 0.4663 0.6206 0.5733 -0.1427 0.0459  0.0902  156 VAL A CB  
1110 C CG1 . VAL A 145 ? 0.4727 0.6216 0.5793 -0.1463 0.0488  0.0914  156 VAL A CG1 
1111 C CG2 . VAL A 145 ? 0.4565 0.6205 0.5614 -0.1305 0.0484  0.0876  156 VAL A CG2 
1112 N N   . GLN A 146 ? 0.6153 0.7825 0.7379 -0.1635 0.0394  0.0876  157 GLN A N   
1113 C CA  . GLN A 146 ? 0.6474 0.8030 0.7699 -0.1691 0.0371  0.0865  157 GLN A CA  
1114 C C   . GLN A 146 ? 0.7282 0.8590 0.8414 -0.1656 0.0397  0.0872  157 GLN A C   
1115 O O   . GLN A 146 ? 0.7058 0.8323 0.8145 -0.1601 0.0438  0.0882  157 GLN A O   
1116 C CB  . GLN A 146 ? 0.6769 0.8509 0.8083 -0.1745 0.0372  0.0850  157 GLN A CB  
1117 C CG  . GLN A 146 ? 0.9795 1.1490 1.1138 -0.1813 0.0337  0.0835  157 GLN A CG  
1118 C CD  . GLN A 146 ? 1.2879 1.4803 1.4326 -0.1868 0.0327  0.0816  157 GLN A CD  
1119 O OE1 . GLN A 146 ? 1.2488 1.4507 1.3964 -0.1867 0.0357  0.0818  157 GLN A OE1 
1120 N NE2 . GLN A 146 ? 1.1962 1.3974 1.3465 -0.1914 0.0282  0.0797  157 GLN A NE2 
1121 N N   . LEU A 147 ? 0.6457 0.7608 0.7564 -0.1684 0.0375  0.0862  158 LEU A N   
1122 C CA  . LEU A 147 ? 0.6593 0.7519 0.7621 -0.1648 0.0397  0.0860  158 LEU A CA  
1123 C C   . LEU A 147 ? 0.7562 0.8462 0.8623 -0.1701 0.0384  0.0847  158 LEU A C   
1124 O O   . LEU A 147 ? 0.7648 0.8590 0.8750 -0.1754 0.0345  0.0838  158 LEU A O   
1125 C CB  . LEU A 147 ? 0.6589 0.7311 0.7532 -0.1600 0.0384  0.0859  158 LEU A CB  
1126 C CG  . LEU A 147 ? 0.7159 0.7659 0.8013 -0.1534 0.0414  0.0852  158 LEU A CG  
1127 C CD1 . LEU A 147 ? 0.7115 0.7476 0.7889 -0.1471 0.0412  0.0853  158 LEU A CD1 
1128 C CD2 . LEU A 147 ? 0.7669 0.8048 0.8516 -0.1554 0.0404  0.0834  158 LEU A CD2 
1129 N N   . PRO A 148 ? 0.7801 0.8636 0.8846 -0.1688 0.0416  0.0847  159 PRO A N   
1130 C CA  . PRO A 148 ? 0.7811 0.8587 0.8808 -0.1626 0.0461  0.0853  159 PRO A CA  
1131 C C   . PRO A 148 ? 0.8373 0.9330 0.9424 -0.1638 0.0487  0.0861  159 PRO A C   
1132 O O   . PRO A 148 ? 0.8402 0.9315 0.9435 -0.1614 0.0521  0.0862  159 PRO A O   
1133 C CB  . PRO A 148 ? 0.8085 0.8692 0.9044 -0.1611 0.0476  0.0843  159 PRO A CB  
1134 C CG  . PRO A 148 ? 0.8699 0.9374 0.9722 -0.1684 0.0452  0.0838  159 PRO A CG  
1135 C CD  . PRO A 148 ? 0.8124 0.8910 0.9191 -0.1730 0.0409  0.0837  159 PRO A CD  
1136 N N   . ALA A 149 ? 0.6949 0.8108 0.8066 -0.1671 0.0472  0.0865  160 ALA A N   
1137 C CA  . ALA A 149 ? 0.6968 0.8309 0.8137 -0.1673 0.0498  0.0869  160 ALA A CA  
1138 C C   . ALA A 149 ? 0.7476 0.8849 0.8611 -0.1606 0.0526  0.0879  160 ALA A C   
1139 O O   . ALA A 149 ? 0.7429 0.8877 0.8574 -0.1585 0.0559  0.0882  160 ALA A O   
1140 C CB  . ALA A 149 ? 0.7109 0.8676 0.8375 -0.1735 0.0471  0.0861  160 ALA A CB  
1141 N N   . PHE A 150 ? 0.8345 0.9656 0.9437 -0.1572 0.0514  0.0883  161 PHE A N   
1142 C CA  . PHE A 150 ? 0.8203 0.9550 0.9263 -0.1506 0.0540  0.0894  161 PHE A CA  
1143 C C   . PHE A 150 ? 0.8459 1.0071 0.9598 -0.1510 0.0552  0.0893  161 PHE A C   
1144 O O   . PHE A 150 ? 0.8370 1.0035 0.9505 -0.1474 0.0588  0.0895  161 PHE A O   
1145 C CB  . PHE A 150 ? 0.8430 0.9603 0.9405 -0.1442 0.0579  0.0895  161 PHE A CB  
1146 C CG  . PHE A 150 ? 0.8602 0.9556 0.9486 -0.1395 0.0576  0.0895  161 PHE A CG  
1147 C CD1 . PHE A 150 ? 0.8997 0.9882 0.9874 -0.1420 0.0536  0.0893  161 PHE A CD1 
1148 C CD2 . PHE A 150 ? 0.8801 0.9617 0.9606 -0.1323 0.0612  0.0892  161 PHE A CD2 
1149 C CE1 . PHE A 150 ? 0.9064 0.9743 0.9855 -0.1372 0.0533  0.0890  161 PHE A CE1 
1150 C CE2 . PHE A 150 ? 0.9143 0.9759 0.9863 -0.1275 0.0609  0.0886  161 PHE A CE2 
1151 C CZ  . PHE A 150 ? 0.8918 0.9464 0.9630 -0.1298 0.0570  0.0885  161 PHE A CZ  
1152 N N   . ARG A 151 ? 0.6985 0.8763 0.8197 -0.1553 0.0519  0.0886  162 ARG A N   
1153 C CA  . ARG A 151 ? 0.6846 0.8895 0.8142 -0.1551 0.0524  0.0876  162 ARG A CA  
1154 C C   . ARG A 151 ? 0.6825 0.8991 0.8154 -0.1542 0.0498  0.0872  162 ARG A C   
1155 O O   . ARG A 151 ? 0.6696 0.8787 0.8023 -0.1580 0.0459  0.0870  162 ARG A O   
1156 C CB  . ARG A 151 ? 0.7149 0.9330 0.8527 -0.1620 0.0510  0.0860  162 ARG A CB  
1157 C CG  . ARG A 151 ? 0.8789 1.0904 1.0187 -0.1691 0.0468  0.0851  162 ARG A CG  
1158 C CD  . ARG A 151 ? 0.9537 1.1840 1.1032 -0.1753 0.0450  0.0832  162 ARG A CD  
1159 N NE  . ARG A 151 ? 1.0102 1.2643 1.1675 -0.1751 0.0431  0.0812  162 ARG A NE  
1160 C CZ  . ARG A 151 ? 1.1280 1.4030 1.2905 -0.1722 0.0451  0.0800  162 ARG A CZ  
1161 N NH1 . ARG A 151 ? 0.9500 1.2245 1.1106 -0.1698 0.0490  0.0810  162 ARG A NH1 
1162 N NH2 . ARG A 151 ? 0.8898 1.1863 1.0594 -0.1712 0.0430  0.0775  162 ARG A NH2 
1163 N N   . ALA A 152 ? 0.5126 0.7477 0.6485 -0.1486 0.0519  0.0868  163 ALA A N   
1164 C CA  . ALA A 152 ? 0.5014 0.7432 0.6378 -0.1421 0.0487  0.0832  163 ALA A CA  
1165 C C   . ALA A 152 ? 0.5376 0.7983 0.6840 -0.1473 0.0445  0.0797  163 ALA A C   
1166 O O   . ALA A 152 ? 0.5219 0.8013 0.6774 -0.1550 0.0457  0.0805  163 ALA A O   
1167 C CB  . ALA A 152 ? 0.5063 0.7552 0.6393 -0.1293 0.0515  0.0810  163 ALA A CB  
1168 N N   . LEU A 153 ? 0.4494 0.7050 0.5938 -0.1430 0.0395  0.0758  164 LEU A N   
1169 C CA  . LEU A 153 ? 0.4397 0.7108 0.5926 -0.1472 0.0348  0.0719  164 LEU A CA  
1170 C C   . LEU A 153 ? 0.5217 0.8010 0.6733 -0.1348 0.0324  0.0663  164 LEU A C   
1171 O O   . LEU A 153 ? 0.5315 0.7980 0.6773 -0.1290 0.0287  0.0636  164 LEU A O   
1172 C CB  . LEU A 153 ? 0.4341 0.6905 0.5862 -0.1551 0.0306  0.0726  164 LEU A CB  
1173 C CG  . LEU A 153 ? 0.4770 0.7230 0.6295 -0.1672 0.0329  0.0784  164 LEU A CG  
1174 C CD1 . LEU A 153 ? 0.4823 0.7080 0.6307 -0.1720 0.0291  0.0791  164 LEU A CD1 
1175 C CD2 . LEU A 153 ? 0.4837 0.7473 0.6458 -0.1759 0.0337  0.0785  164 LEU A CD2 
1176 N N   . GLU A 154 ? 0.7251 1.0259 0.8819 -0.1307 0.0344  0.0644  165 GLU A N   
1177 C CA  . GLU A 154 ? 0.7317 1.0408 0.8867 -0.1180 0.0328  0.0593  165 GLU A CA  
1178 C C   . GLU A 154 ? 0.8097 1.1273 0.9694 -0.1180 0.0268  0.0542  165 GLU A C   
1179 O O   . GLU A 154 ? 0.8166 1.1363 0.9732 -0.1071 0.0246  0.0498  165 GLU A O   
1180 C CB  . GLU A 154 ? 0.7463 1.0767 0.9062 -0.1144 0.0368  0.0588  165 GLU A CB  
1181 C CG  . GLU A 154 ? 0.9080 1.2295 1.0619 -0.1116 0.0427  0.0630  165 GLU A CG  
1182 C CD  . GLU A 154 ? 1.1830 1.5257 1.3441 -0.1143 0.0469  0.0644  165 GLU A CD  
1183 O OE1 . GLU A 154 ? 1.1296 1.4914 1.2949 -0.1080 0.0467  0.0607  165 GLU A OE1 
1184 O OE2 . GLU A 154 ? 1.0683 1.4086 1.2311 -0.1228 0.0504  0.0692  165 GLU A OE2 
1185 N N   . ASP A 155 ? 0.7651 1.0878 0.9322 -0.1298 0.0242  0.0547  166 ASP A N   
1186 C CA  . ASP A 155 ? 0.7654 1.0951 0.9370 -0.1305 0.0183  0.0501  166 ASP A CA  
1187 C C   . ASP A 155 ? 0.7960 1.1024 0.9592 -0.1274 0.0145  0.0492  166 ASP A C   
1188 O O   . ASP A 155 ? 0.7974 1.1073 0.9625 -0.1257 0.0094  0.0450  166 ASP A O   
1189 C CB  . ASP A 155 ? 0.7957 1.1391 0.9783 -0.1445 0.0169  0.0509  166 ASP A CB  
1190 C CG  . ASP A 155 ? 0.9701 1.3396 1.1622 -0.1473 0.0198  0.0506  166 ASP A CG  
1191 O OD1 . ASP A 155 ? 0.9824 1.3648 1.1748 -0.1375 0.0207  0.0475  166 ASP A OD1 
1192 O OD2 . ASP A 155 ? 1.0605 1.4377 1.2598 -0.1593 0.0212  0.0534  166 ASP A OD2 
1193 N N   . ARG A 156 ? 0.5793 0.8623 0.7333 -0.1265 0.0167  0.0531  167 ARG A N   
1194 C CA  . ARG A 156 ? 0.5586 0.8182 0.7042 -0.1239 0.0135  0.0526  167 ARG A CA  
1195 C C   . ARG A 156 ? 0.5640 0.8090 0.6984 -0.1102 0.0149  0.0517  167 ARG A C   
1196 O O   . ARG A 156 ? 0.5681 0.7909 0.6941 -0.1076 0.0133  0.0522  167 ARG A O   
1197 C CB  . ARG A 156 ? 0.5394 0.7817 0.6832 -0.1349 0.0143  0.0577  167 ARG A CB  
1198 C CG  . ARG A 156 ? 0.6033 0.8561 0.7570 -0.1484 0.0119  0.0583  167 ARG A CG  
1199 C CD  . ARG A 156 ? 0.7256 0.9637 0.8780 -0.1594 0.0139  0.0640  167 ARG A CD  
1200 N NE  . ARG A 156 ? 0.9012 1.1441 1.0611 -0.1717 0.0107  0.0641  167 ARG A NE  
1201 C CZ  . ARG A 156 ? 1.1157 1.3435 1.2729 -0.1752 0.0066  0.0637  167 ARG A CZ  
1202 N NH1 . ARG A 156 ? 0.9493 1.1562 1.0964 -0.1673 0.0052  0.0632  167 ARG A NH1 
1203 N NH2 . ARG A 156 ? 0.9692 1.2027 1.1336 -0.1866 0.0039  0.0638  167 ARG A NH2 
1204 N N   . THR A 157 ? 0.3974 0.6544 0.5314 -0.1014 0.0179  0.0503  168 THR A N   
1205 C CA  . THR A 157 ? 0.3777 0.6217 0.5012 -0.0883 0.0197  0.0494  168 THR A CA  
1206 C C   . THR A 157 ? 0.4135 0.6522 0.5327 -0.0796 0.0147  0.0443  168 THR A C   
1207 O O   . THR A 157 ? 0.4393 0.6951 0.5649 -0.0785 0.0112  0.0400  168 THR A O   
1208 C CB  . THR A 157 ? 0.3982 0.6582 0.5232 -0.0814 0.0240  0.0489  168 THR A CB  
1209 O OG1 . THR A 157 ? 0.4322 0.6953 0.5602 -0.0891 0.0288  0.0538  168 THR A OG1 
1210 C CG2 . THR A 157 ? 0.3171 0.5641 0.4310 -0.0675 0.0257  0.0476  168 THR A CG2 
1211 N N   . ILE A 158 ? 0.3102 0.5252 0.4186 -0.0735 0.0144  0.0447  169 ILE A N   
1212 C CA  . ILE A 158 ? 0.2942 0.5016 0.3968 -0.0639 0.0102  0.0402  169 ILE A CA  
1213 C C   . ILE A 158 ? 0.3520 0.5559 0.4465 -0.0500 0.0133  0.0388  169 ILE A C   
1214 O O   . ILE A 158 ? 0.3363 0.5198 0.4212 -0.0455 0.0158  0.0409  169 ILE A O   
1215 C CB  . ILE A 158 ? 0.3193 0.5022 0.4155 -0.0670 0.0073  0.0414  169 ILE A CB  
1216 C CG1 . ILE A 158 ? 0.3186 0.5044 0.4228 -0.0815 0.0049  0.0434  169 ILE A CG1 
1217 C CG2 . ILE A 158 ? 0.3062 0.4824 0.3971 -0.0575 0.0027  0.0365  169 ILE A CG2 
1218 C CD1 . ILE A 158 ? 0.3400 0.5012 0.4383 -0.0876 0.0048  0.0472  169 ILE A CD1 
1219 N N   . SER A 159 ? 0.5028 0.7267 0.6012 -0.0432 0.0131  0.0351  170 SER A N   
1220 C CA  . SER A 159 ? 0.5107 0.7340 0.6023 -0.0302 0.0163  0.0337  170 SER A CA  
1221 C C   . SER A 159 ? 0.5593 0.7686 0.6417 -0.0190 0.0131  0.0299  170 SER A C   
1222 O O   . SER A 159 ? 0.5591 0.7624 0.6415 -0.0209 0.0082  0.0277  170 SER A O   
1223 C CB  . SER A 159 ? 0.5744 0.8249 0.6738 -0.0273 0.0175  0.0313  170 SER A CB  
1224 O OG  . SER A 159 ? 0.7129 0.9787 0.8188 -0.0273 0.0124  0.0267  170 SER A OG  
1225 N N   . SER A 160 ? 0.5333 0.7372 0.6077 -0.0072 0.0162  0.0290  171 SER A N   
1226 C CA  . SER A 160 ? 0.5379 0.7290 0.6030 0.0044  0.0137  0.0252  171 SER A CA  
1227 C C   . SER A 160 ? 0.6082 0.8177 0.6780 0.0099  0.0094  0.0197  171 SER A C   
1228 O O   . SER A 160 ? 0.6188 0.8208 0.6852 0.0139  0.0048  0.0164  171 SER A O   
1229 C CB  . SER A 160 ? 0.5856 0.7655 0.6407 0.0152  0.0185  0.0260  171 SER A CB  
1230 O OG  . SER A 160 ? 0.7355 0.9034 0.7815 0.0267  0.0163  0.0223  171 SER A OG  
1231 N N   . ASP A 161 ? 0.5154 0.7491 0.5930 0.0104  0.0109  0.0185  172 ASP A N   
1232 C CA  . ASP A 161 ? 0.4984 0.7514 0.5813 0.0153  0.0070  0.0131  172 ASP A CA  
1233 C C   . ASP A 161 ? 0.5497 0.8083 0.6401 0.0063  0.0013  0.0115  172 ASP A C   
1234 O O   . ASP A 161 ? 0.5563 0.8206 0.6473 0.0114  -0.0033 0.0068  172 ASP A O   
1235 C CB  . ASP A 161 ? 0.5053 0.7835 0.5958 0.0162  0.0100  0.0126  172 ASP A CB  
1236 C CG  . ASP A 161 ? 0.5851 0.8603 0.6680 0.0275  0.0149  0.0129  172 ASP A CG  
1237 O OD1 . ASP A 161 ? 0.6116 0.8698 0.6839 0.0376  0.0147  0.0115  172 ASP A OD1 
1238 O OD2 . ASP A 161 ? 0.5848 0.8749 0.6726 0.0263  0.0189  0.0144  172 ASP A OD2 
1239 N N   . ALA A 162 ? 0.4193 0.6762 0.5153 -0.0070 0.0017  0.0153  173 ALA A N   
1240 C CA  . ALA A 162 ? 0.4063 0.6673 0.5093 -0.0164 -0.0035 0.0141  173 ALA A CA  
1241 C C   . ALA A 162 ? 0.4596 0.6982 0.5547 -0.0142 -0.0074 0.0130  173 ALA A C   
1242 O O   . ALA A 162 ? 0.4281 0.6711 0.5267 -0.0160 -0.0127 0.0097  173 ALA A O   
1243 C CB  . ALA A 162 ? 0.4079 0.6726 0.5185 -0.0312 -0.0017 0.0187  173 ALA A CB  
1244 N N   . VAL A 163 ? 0.4649 0.6796 0.5493 -0.0104 -0.0049 0.0157  174 VAL A N   
1245 C CA  . VAL A 163 ? 0.4699 0.6622 0.5461 -0.0080 -0.0084 0.0148  174 VAL A CA  
1246 C C   . VAL A 163 ? 0.5497 0.7411 0.6197 0.0057  -0.0110 0.0096  174 VAL A C   
1247 O O   . VAL A 163 ? 0.5553 0.7434 0.6248 0.0067  -0.0162 0.0064  174 VAL A O   
1248 C CB  . VAL A 163 ? 0.5087 0.6758 0.5760 -0.0090 -0.0047 0.0195  174 VAL A CB  
1249 C CG1 . VAL A 163 ? 0.5028 0.6465 0.5602 -0.0039 -0.0078 0.0181  174 VAL A CG1 
1250 C CG2 . VAL A 163 ? 0.5012 0.6670 0.5744 -0.0235 -0.0033 0.0244  174 VAL A CG2 
1251 N N   . LEU A 164 ? 0.5116 0.7060 0.5767 0.0165  -0.0074 0.0087  175 LEU A N   
1252 C CA  . LEU A 164 ? 0.5202 0.7146 0.5792 0.0301  -0.0094 0.0039  175 LEU A CA  
1253 C C   . LEU A 164 ? 0.6138 0.8311 0.6811 0.0312  -0.0140 -0.0011 175 LEU A C   
1254 O O   . LEU A 164 ? 0.6094 0.8261 0.6721 0.0413  -0.0169 -0.0055 175 LEU A O   
1255 C CB  . LEU A 164 ? 0.5165 0.7110 0.5693 0.0404  -0.0041 0.0043  175 LEU A CB  
1256 C CG  . LEU A 164 ? 0.5723 0.7438 0.6158 0.0412  0.0006  0.0087  175 LEU A CG  
1257 C CD1 . LEU A 164 ? 0.5646 0.7404 0.6042 0.0499  0.0062  0.0093  175 LEU A CD1 
1258 C CD2 . LEU A 164 ? 0.6076 0.7540 0.6402 0.0467  -0.0017 0.0076  175 LEU A CD2 
1259 N N   . GLN A 165 ? 0.6218 0.8592 0.7011 0.0210  -0.0145 -0.0004 176 GLN A N   
1260 C CA  . GLN A 165 ? 0.6443 0.9044 0.7325 0.0211  -0.0189 -0.0051 176 GLN A CA  
1261 C C   . GLN A 165 ? 0.7519 1.0055 0.8408 0.0175  -0.0251 -0.0076 176 GLN A C   
1262 O O   . GLN A 165 ? 0.7516 1.0161 0.8426 0.0229  -0.0294 -0.0126 176 GLN A O   
1263 C CB  . GLN A 165 ? 0.6576 0.9407 0.7584 0.0109  -0.0172 -0.0035 176 GLN A CB  
1264 C CG  . GLN A 165 ? 0.8979 1.2079 1.0080 0.0125  -0.0202 -0.0082 176 GLN A CG  
1265 C CD  . GLN A 165 ? 1.1495 1.4815 1.2714 0.0029  -0.0178 -0.0063 176 GLN A CD  
1266 O OE1 . GLN A 165 ? 1.0861 1.4261 1.2083 0.0057  -0.0130 -0.0047 176 GLN A OE1 
1267 N NE2 . GLN A 165 ? 1.0197 1.3613 1.1512 -0.0087 -0.0209 -0.0065 176 GLN A NE2 
1268 N N   . ARG A 166 ? 0.8688 1.1051 0.9562 0.0086  -0.0257 -0.0042 177 ARG A N   
1269 C CA  . ARG A 166 ? 0.8852 1.1137 0.9731 0.0043  -0.0314 -0.0061 177 ARG A CA  
1270 C C   . ARG A 166 ? 0.9622 1.1708 1.0385 0.0151  -0.0338 -0.0086 177 ARG A C   
1271 O O   . ARG A 166 ? 0.9795 1.1822 1.0556 0.0133  -0.0389 -0.0108 177 ARG A O   
1272 C CB  . ARG A 166 ? 0.8787 1.0954 0.9690 -0.0094 -0.0310 -0.0013 177 ARG A CB  
1273 C CG  . ARG A 166 ? 0.9831 1.2194 1.0867 -0.0226 -0.0314 -0.0001 177 ARG A CG  
1274 C CD  . ARG A 166 ? 1.1082 1.3612 1.2171 -0.0240 -0.0262 0.0021  177 ARG A CD  
1275 N NE  . ARG A 166 ? 1.1128 1.3747 1.2313 -0.0384 -0.0251 0.0055  177 ARG A NE  
1276 C CZ  . ARG A 166 ? 1.1501 1.4293 1.2756 -0.0425 -0.0212 0.0074  177 ARG A CZ  
1277 N NH1 . ARG A 166 ? 0.9034 1.1893 1.0372 -0.0558 -0.0204 0.0105  177 ARG A NH1 
1278 N NH2 . ARG A 166 ? 0.9178 1.2075 1.0419 -0.0331 -0.0182 0.0061  177 ARG A NH2 
1279 N N   . LEU A 167 ? 0.6510 0.8491 0.7175 0.0261  -0.0303 -0.0083 178 LEU A N   
1280 C CA  . LEU A 167 ? 0.6472 0.8231 0.7014 0.0359  -0.0315 -0.0098 178 LEU A CA  
1281 C C   . LEU A 167 ? 0.7019 0.8864 0.7526 0.0496  -0.0333 -0.0151 178 LEU A C   
1282 O O   . LEU A 167 ? 0.6969 0.9026 0.7530 0.0529  -0.0321 -0.0169 178 LEU A O   
1283 C CB  . LEU A 167 ? 0.6415 0.7969 0.6861 0.0386  -0.0260 -0.0055 178 LEU A CB  
1284 C CG  . LEU A 167 ? 0.6885 0.8348 0.7356 0.0261  -0.0233 0.0002  178 LEU A CG  
1285 C CD1 . LEU A 167 ? 0.6823 0.8163 0.7219 0.0301  -0.0170 0.0039  178 LEU A CD1 
1286 C CD2 . LEU A 167 ? 0.7145 0.8417 0.7588 0.0200  -0.0269 0.0011  178 LEU A CD2 
1287 N N   . PRO A 168 ? 0.6569 0.8252 0.6983 0.0579  -0.0362 -0.0178 179 PRO A N   
1288 C CA  . PRO A 168 ? 0.6586 0.8327 0.6952 0.0719  -0.0375 -0.0226 179 PRO A CA  
1289 C C   . PRO A 168 ? 0.7133 0.8860 0.7435 0.0812  -0.0317 -0.0215 179 PRO A C   
1290 O O   . PRO A 168 ? 0.6998 0.8623 0.7270 0.0782  -0.0268 -0.0170 179 PRO A O   
1291 C CB  . PRO A 168 ? 0.6867 0.8390 0.7136 0.0771  -0.0412 -0.0246 179 PRO A CB  
1292 C CG  . PRO A 168 ? 0.7418 0.8861 0.7731 0.0642  -0.0439 -0.0223 179 PRO A CG  
1293 C CD  . PRO A 168 ? 0.6808 0.8271 0.7171 0.0540  -0.0392 -0.0169 179 PRO A CD  
1294 N N   . GLU A 169 ? 0.8884 1.0715 0.9162 0.0930  -0.0325 -0.0258 180 GLU A N   
1295 C CA  . GLU A 169 ? 0.8877 1.0712 0.9094 0.1031  -0.0273 -0.0254 180 GLU A CA  
1296 C C   . GLU A 169 ? 0.9271 1.0829 0.9353 0.1095  -0.0242 -0.0234 180 GLU A C   
1297 O O   . GLU A 169 ? 0.9100 1.0625 0.9136 0.1140  -0.0188 -0.0212 180 GLU A O   
1298 C CB  . GLU A 169 ? 0.9089 1.1085 0.9305 0.1147  -0.0295 -0.0309 180 GLU A CB  
1299 C CG  . GLU A 169 ? 1.0605 1.2641 1.0769 0.1253  -0.0244 -0.0310 180 GLU A CG  
1300 C CD  . GLU A 169 ? 1.4283 1.6493 1.4534 0.1189  -0.0200 -0.0280 180 GLU A CD  
1301 O OE1 . GLU A 169 ? 1.3874 1.6003 1.4075 0.1211  -0.0144 -0.0248 180 GLU A OE1 
1302 O OE2 . GLU A 169 ? 1.3781 1.6210 1.4151 0.1116  -0.0222 -0.0290 180 GLU A OE2 
1303 N N   . GLU A 170 ? 0.8344 0.9703 0.8360 0.1099  -0.0275 -0.0240 181 GLU A N   
1304 C CA  . GLU A 170 ? 0.8296 0.9387 0.8182 0.1159  -0.0246 -0.0222 181 GLU A CA  
1305 C C   . GLU A 170 ? 0.8657 0.9641 0.8542 0.1076  -0.0197 -0.0164 181 GLU A C   
1306 O O   . GLU A 170 ? 0.8591 0.9403 0.8379 0.1132  -0.0155 -0.0145 181 GLU A O   
1307 C CB  . GLU A 170 ? 0.8520 0.9428 0.8347 0.1169  -0.0294 -0.0241 181 GLU A CB  
1308 C CG  . GLU A 170 ? 1.0118 1.1019 0.9877 0.1301  -0.0326 -0.0294 181 GLU A CG  
1309 C CD  . GLU A 170 ? 1.2923 1.4082 1.2775 0.1309  -0.0369 -0.0337 181 GLU A CD  
1310 O OE1 . GLU A 170 ? 1.1868 1.3176 1.1834 0.1198  -0.0390 -0.0330 181 GLU A OE1 
1311 O OE2 . GLU A 170 ? 1.1839 1.3052 1.1647 0.1427  -0.0380 -0.0379 181 GLU A OE2 
1312 N N   . ALA A 171 ? 0.8190 0.9270 0.8178 0.0944  -0.0201 -0.0136 182 ALA A N   
1313 C CA  . ALA A 171 ? 0.8071 0.9059 0.8066 0.0854  -0.0158 -0.0081 182 ALA A CA  
1314 C C   . ALA A 171 ? 0.8528 0.9725 0.8612 0.0805  -0.0120 -0.0059 182 ALA A C   
1315 O O   . ALA A 171 ? 0.8570 0.9797 0.8723 0.0687  -0.0107 -0.0021 182 ALA A O   
1316 C CB  . ALA A 171 ? 0.8158 0.9049 0.8187 0.0733  -0.0190 -0.0059 182 ALA A CB  
1317 N N   . ARG A 172 ? 0.5832 0.7174 0.5916 0.0897  -0.0100 -0.0083 183 ARG A N   
1318 C CA  . ARG A 172 ? 0.5677 0.7222 0.5841 0.0863  -0.0063 -0.0066 183 ARG A CA  
1319 C C   . ARG A 172 ? 0.6066 0.7572 0.6158 0.0955  -0.0003 -0.0054 183 ARG A C   
1320 O O   . ARG A 172 ? 0.5871 0.7538 0.6021 0.0937  0.0032  -0.0040 183 ARG A O   
1321 C CB  . ARG A 172 ? 0.5643 0.7461 0.5904 0.0871  -0.0096 -0.0107 183 ARG A CB  
1322 C CG  . ARG A 172 ? 0.7014 0.8928 0.7376 0.0757  -0.0146 -0.0112 183 ARG A CG  
1323 C CD  . ARG A 172 ? 0.7990 1.0166 0.8439 0.0780  -0.0180 -0.0158 183 ARG A CD  
1324 N NE  . ARG A 172 ? 0.8959 1.1242 0.9511 0.0666  -0.0226 -0.0164 183 ARG A NE  
1325 C CZ  . ARG A 172 ? 1.0702 1.3198 1.1336 0.0668  -0.0266 -0.0206 183 ARG A CZ  
1326 N NH1 . ARG A 172 ? 0.9377 1.2000 0.9999 0.0779  -0.0268 -0.0246 183 ARG A NH1 
1327 N NH2 . ARG A 172 ? 0.8403 1.0984 0.9129 0.0558  -0.0304 -0.0209 183 ARG A NH2 
1328 N N   . HIS A 173 ? 0.8850 1.0146 0.8818 0.1051  0.0009  -0.0061 184 HIS A N   
1329 C CA  . HIS A 173 ? 0.8879 1.0122 0.8769 0.1144  0.0066  -0.0052 184 HIS A CA  
1330 C C   . HIS A 173 ? 0.9149 1.0303 0.9039 0.1067  0.0117  0.0004  184 HIS A C   
1331 O O   . HIS A 173 ? 0.8998 0.9923 0.8801 0.1076  0.0139  0.0027  184 HIS A O   
1332 C CB  . HIS A 173 ? 0.9136 1.0175 0.8894 0.1265  0.0061  -0.0077 184 HIS A CB  
1333 C CG  . HIS A 173 ? 0.9717 1.0827 0.9469 0.1340  0.0009  -0.0132 184 HIS A CG  
1334 N ND1 . HIS A 173 ? 1.0034 1.1049 0.9775 0.1319  -0.0046 -0.0150 184 HIS A ND1 
1335 C CD2 . HIS A 173 ? 0.9992 1.1261 0.9749 0.1436  0.0001  -0.0172 184 HIS A CD2 
1336 C CE1 . HIS A 173 ? 1.0020 1.1130 0.9757 0.1399  -0.0084 -0.0199 184 HIS A CE1 
1337 N NE2 . HIS A 173 ? 1.0041 1.1307 0.9788 0.1471  -0.0057 -0.0214 184 HIS A NE2 
1338 N N   . ARG A 174 ? 0.7582 0.8927 0.7573 0.0991  0.0137  0.0025  185 ARG A N   
1339 C CA  . ARG A 174 ? 0.7392 0.8688 0.7406 0.0899  0.0180  0.0079  185 ARG A CA  
1340 C C   . ARG A 174 ? 0.7751 0.9007 0.7703 0.0969  0.0244  0.0096  185 ARG A C   
1341 O O   . ARG A 174 ? 0.7690 0.9040 0.7619 0.1071  0.0259  0.0069  185 ARG A O   
1342 C CB  . ARG A 174 ? 0.7139 0.8659 0.7289 0.0783  0.0174  0.0094  185 ARG A CB  
1343 C CG  . ARG A 174 ? 0.8064 0.9840 0.8278 0.0826  0.0188  0.0073  185 ARG A CG  
1344 C CD  . ARG A 174 ? 0.8387 1.0355 0.8726 0.0704  0.0196  0.0099  185 ARG A CD  
1345 N NE  . ARG A 174 ? 0.8599 1.0488 0.8928 0.0646  0.0250  0.0152  185 ARG A NE  
1346 C CZ  . ARG A 174 ? 0.9875 1.1828 1.0287 0.0518  0.0258  0.0188  185 ARG A CZ  
1347 N NH1 . ARG A 174 ? 0.8240 1.0336 0.8752 0.0433  0.0216  0.0178  185 ARG A NH1 
1348 N NH2 . ARG A 174 ? 0.7406 0.9279 0.7801 0.0475  0.0307  0.0235  185 ARG A NH2 
1349 N N   . ARG A 175 ? 0.6466 0.7579 0.6390 0.0913  0.0282  0.0142  186 ARG A N   
1350 C CA  . ARG A 175 ? 0.6278 0.7371 0.6162 0.0954  0.0346  0.0167  186 ARG A CA  
1351 C C   . ARG A 175 ? 0.6609 0.7925 0.6601 0.0879  0.0371  0.0189  186 ARG A C   
1352 O O   . ARG A 175 ? 0.6493 0.7945 0.6587 0.0781  0.0342  0.0194  186 ARG A O   
1353 C CB  . ARG A 175 ? 0.6061 0.6902 0.5866 0.0927  0.0376  0.0205  186 ARG A CB  
1354 C CG  . ARG A 175 ? 0.6229 0.6838 0.5936 0.0977  0.0349  0.0188  186 ARG A CG  
1355 C CD  . ARG A 175 ? 0.6597 0.6969 0.6236 0.0940  0.0378  0.0228  186 ARG A CD  
1356 N NE  . ARG A 175 ? 0.7119 0.7263 0.6653 0.1003  0.0359  0.0209  186 ARG A NE  
1357 C CZ  . ARG A 175 ? 0.7739 0.7651 0.7197 0.0990  0.0379  0.0235  186 ARG A CZ  
1358 N NH1 . ARG A 175 ? 0.5204 0.5082 0.4681 0.0917  0.0419  0.0281  186 ARG A NH1 
1359 N NH2 . ARG A 175 ? 0.5731 0.5447 0.5096 0.1051  0.0360  0.0215  186 ARG A NH2 
1360 N N   . VAL A 176 ? 0.8087 0.9442 0.8056 0.0928  0.0426  0.0202  187 VAL A N   
1361 C CA  . VAL A 176 ? 0.8034 0.9583 0.8098 0.0858  0.0456  0.0228  187 VAL A CA  
1362 C C   . VAL A 176 ? 0.8276 0.9764 0.8386 0.0721  0.0462  0.0276  187 VAL A C   
1363 O O   . VAL A 176 ? 0.8118 0.9772 0.8335 0.0623  0.0452  0.0290  187 VAL A O   
1364 C CB  . VAL A 176 ? 0.8539 1.0109 0.8558 0.0939  0.0517  0.0236  187 VAL A CB  
1365 C CG1 . VAL A 176 ? 0.8453 1.0238 0.8573 0.0870  0.0546  0.0260  187 VAL A CG1 
1366 C CG2 . VAL A 176 ? 0.8544 1.0155 0.8508 0.1079  0.0510  0.0188  187 VAL A CG2 
1367 N N   . PHE A 177 ? 0.7063 0.8310 0.7092 0.0712  0.0478  0.0302  188 PHE A N   
1368 C CA  . PHE A 177 ? 0.6892 0.8043 0.6949 0.0588  0.0478  0.0346  188 PHE A CA  
1369 C C   . PHE A 177 ? 0.6950 0.7923 0.6963 0.0575  0.0430  0.0335  188 PHE A C   
1370 O O   . PHE A 177 ? 0.6788 0.7549 0.6696 0.0641  0.0437  0.0331  188 PHE A O   
1371 C CB  . PHE A 177 ? 0.7074 0.8093 0.7076 0.0583  0.0537  0.0388  188 PHE A CB  
1372 C CG  . PHE A 177 ? 0.7222 0.8396 0.7251 0.0614  0.0587  0.0397  188 PHE A CG  
1373 C CD1 . PHE A 177 ? 0.7597 0.8959 0.7731 0.0522  0.0600  0.0422  188 PHE A CD1 
1374 C CD2 . PHE A 177 ? 0.7489 0.8620 0.7437 0.0735  0.0623  0.0381  188 PHE A CD2 
1375 C CE1 . PHE A 177 ? 0.7666 0.9171 0.7825 0.0549  0.0646  0.0430  188 PHE A CE1 
1376 C CE2 . PHE A 177 ? 0.7774 0.9048 0.7747 0.0763  0.0669  0.0389  188 PHE A CE2 
1377 C CZ  . PHE A 177 ? 0.7507 0.8968 0.7585 0.0671  0.0680  0.0413  188 PHE A CZ  
1378 N N   . GLU A 178 ? 0.6522 0.7580 0.6616 0.0490  0.0382  0.0328  189 GLU A N   
1379 C CA  . GLU A 178 ? 0.6388 0.7288 0.6447 0.0472  0.0334  0.0316  189 GLU A CA  
1380 C C   . GLU A 178 ? 0.6300 0.6969 0.6307 0.0411  0.0349  0.0358  189 GLU A C   
1381 O O   . GLU A 178 ? 0.6421 0.6905 0.6363 0.0426  0.0321  0.0349  189 GLU A O   
1382 C CB  . GLU A 178 ? 0.6585 0.7641 0.6748 0.0389  0.0281  0.0301  189 GLU A CB  
1383 C CG  . GLU A 178 ? 0.7352 0.8573 0.7541 0.0467  0.0247  0.0248  189 GLU A CG  
1384 C CD  . GLU A 178 ? 0.7245 0.8310 0.7340 0.0564  0.0215  0.0211  189 GLU A CD  
1385 O OE1 . GLU A 178 ? 0.5174 0.6214 0.5288 0.0530  0.0162  0.0192  189 GLU A OE1 
1386 O OE2 . GLU A 178 ? 0.4903 0.5866 0.4904 0.0672  0.0243  0.0201  189 GLU A OE2 
1387 N N   . MET A 179 ? 0.5203 0.5878 0.5234 0.0343  0.0393  0.0403  190 MET A N   
1388 C CA  . MET A 179 ? 0.4870 0.5329 0.4846 0.0296  0.0416  0.0444  190 MET A CA  
1389 C C   . MET A 179 ? 0.4613 0.4957 0.4602 0.0208  0.0370  0.0453  190 MET A C   
1390 O O   . MET A 179 ? 0.4421 0.4591 0.4336 0.0252  0.0344  0.0435  190 MET A O   
1391 C CB  . MET A 179 ? 0.5209 0.5471 0.5060 0.0408  0.0445  0.0436  190 MET A CB  
1392 C CG  . MET A 179 ? 0.5788 0.5846 0.5580 0.0371  0.0481  0.0480  190 MET A CG  
1393 S SD  . MET A 179 ? 0.6375 0.6546 0.6218 0.0315  0.0543  0.0525  190 MET A SD  
1394 C CE  . MET A 179 ? 0.6024 0.5917 0.5782 0.0283  0.0574  0.0568  190 MET A CE  
1395 N N   . VAL A 180 ? 0.2742 0.3180 0.2822 0.0084  0.0361  0.0480  191 VAL A N   
1396 C CA  . VAL A 180 ? 0.2614 0.2947 0.2710 -0.0008 0.0320  0.0492  191 VAL A CA  
1397 C C   . VAL A 180 ? 0.3339 0.3405 0.3342 -0.0012 0.0339  0.0521  191 VAL A C   
1398 O O   . VAL A 180 ? 0.3112 0.3132 0.3110 -0.0055 0.0382  0.0563  191 VAL A O   
1399 C CB  . VAL A 180 ? 0.2786 0.3273 0.2997 -0.0142 0.0313  0.0518  191 VAL A CB  
1400 C CG1 . VAL A 180 ? 0.2737 0.3094 0.2956 -0.0239 0.0275  0.0535  191 VAL A CG1 
1401 C CG2 . VAL A 180 ? 0.2652 0.3400 0.2955 -0.0139 0.0289  0.0485  191 VAL A CG2 
1402 N N   . GLU A 181 ? 0.4289 0.4178 0.4218 0.0036  0.0309  0.0500  192 GLU A N   
1403 C CA  . GLU A 181 ? 0.4306 0.3935 0.4144 0.0035  0.0323  0.0524  192 GLU A CA  
1404 C C   . GLU A 181 ? 0.4827 0.4351 0.4688 -0.0075 0.0289  0.0546  192 GLU A C   
1405 O O   . GLU A 181 ? 0.4873 0.4215 0.4686 -0.0111 0.0308  0.0580  192 GLU A O   
1406 C CB  . GLU A 181 ? 0.4459 0.3934 0.4190 0.0160  0.0317  0.0489  192 GLU A CB  
1407 C CG  . GLU A 181 ? 0.5269 0.4799 0.4955 0.0277  0.0358  0.0471  192 GLU A CG  
1408 C CD  . GLU A 181 ? 0.6080 0.5512 0.5717 0.0284  0.0419  0.0507  192 GLU A CD  
1409 O OE1 . GLU A 181 ? 0.6668 0.5987 0.6304 0.0200  0.0429  0.0547  192 GLU A OE1 
1410 O OE2 . GLU A 181 ? 0.4496 0.3962 0.4093 0.0377  0.0456  0.0496  192 GLU A OE2 
1411 N N   . ALA A 182 ? 0.3259 0.2894 0.3193 -0.0130 0.0239  0.0528  193 ALA A N   
1412 C CA  . ALA A 182 ? 0.3193 0.2740 0.3153 -0.0236 0.0204  0.0547  193 ALA A CA  
1413 C C   . ALA A 182 ? 0.3593 0.3359 0.3676 -0.0331 0.0179  0.0547  193 ALA A C   
1414 O O   . ALA A 182 ? 0.3329 0.3285 0.3463 -0.0295 0.0163  0.0513  193 ALA A O   
1415 C CB  . ALA A 182 ? 0.3270 0.2654 0.3166 -0.0193 0.0158  0.0517  193 ALA A CB  
1416 N N   . LEU A 183 ? 0.3246 0.2984 0.3374 -0.0454 0.0177  0.0585  194 LEU A N   
1417 C CA  . LEU A 183 ? 0.3264 0.3198 0.3509 -0.0557 0.0155  0.0589  194 LEU A CA  
1418 C C   . LEU A 183 ? 0.3678 0.3484 0.3934 -0.0673 0.0135  0.0622  194 LEU A C   
1419 O O   . LEU A 183 ? 0.3382 0.3117 0.3633 -0.0736 0.0169  0.0668  194 LEU A O   
1420 C CB  . LEU A 183 ? 0.3247 0.3368 0.3556 -0.0583 0.0199  0.0611  194 LEU A CB  
1421 C CG  . LEU A 183 ? 0.3777 0.4126 0.4210 -0.0680 0.0182  0.0611  194 LEU A CG  
1422 C CD1 . LEU A 183 ? 0.3771 0.4290 0.4247 -0.0626 0.0143  0.0558  194 LEU A CD1 
1423 C CD2 . LEU A 183 ? 0.3825 0.4312 0.4308 -0.0718 0.0233  0.0644  194 LEU A CD2 
1424 N N   . GLN A 184 ? 0.3682 0.3458 0.3953 -0.0700 0.0081  0.0599  195 GLN A N   
1425 C CA  . GLN A 184 ? 0.3781 0.3407 0.4048 -0.0797 0.0058  0.0625  195 GLN A CA  
1426 C C   . GLN A 184 ? 0.4838 0.4600 0.5199 -0.0883 0.0010  0.0609  195 GLN A C   
1427 O O   . GLN A 184 ? 0.4742 0.4684 0.5156 -0.0851 -0.0013 0.0571  195 GLN A O   
1428 C CB  . GLN A 184 ? 0.3896 0.3271 0.4056 -0.0736 0.0039  0.0614  195 GLN A CB  
1429 C CG  . GLN A 184 ? 0.4423 0.3654 0.4486 -0.0648 0.0086  0.0626  195 GLN A CG  
1430 C CD  . GLN A 184 ? 0.4947 0.3944 0.4905 -0.0577 0.0067  0.0609  195 GLN A CD  
1431 O OE1 . GLN A 184 ? 0.3288 0.2186 0.3239 -0.0617 0.0024  0.0602  195 GLN A OE1 
1432 N NE2 . GLN A 184 ? 0.4575 0.3483 0.4449 -0.0471 0.0101  0.0601  195 GLN A NE2 
1433 N N   . GLU A 185 ? 0.4820 0.4489 0.5199 -0.0992 -0.0005 0.0639  196 GLU A N   
1434 C CA  . GLU A 185 ? 0.4971 0.4741 0.5436 -0.1087 -0.0049 0.0630  196 GLU A CA  
1435 C C   . GLU A 185 ? 0.5616 0.5227 0.6034 -0.1075 -0.0101 0.0606  196 GLU A C   
1436 O O   . GLU A 185 ? 0.5678 0.5064 0.6002 -0.1037 -0.0097 0.0616  196 GLU A O   
1437 C CB  . GLU A 185 ? 0.5198 0.4973 0.5716 -0.1223 -0.0032 0.0680  196 GLU A CB  
1438 C CG  . GLU A 185 ? 0.6544 0.6487 0.7170 -0.1327 -0.0065 0.0673  196 GLU A CG  
1439 C CD  . GLU A 185 ? 0.7904 0.7793 0.8564 -0.1461 -0.0056 0.0722  196 GLU A CD  
1440 O OE1 . GLU A 185 ? 0.5546 0.5380 0.6226 -0.1535 -0.0095 0.0720  196 GLU A OE1 
1441 O OE2 . GLU A 185 ? 0.6878 0.6776 0.7540 -0.1492 -0.0008 0.0761  196 GLU A OE2 
1442 N N   . HIS A 186 ? 0.4808 0.4537 0.5291 -0.1107 -0.0148 0.0574  197 HIS A N   
1443 C CA  . HIS A 186 ? 0.4782 0.4371 0.5229 -0.1106 -0.0199 0.0552  197 HIS A CA  
1444 C C   . HIS A 186 ? 0.5241 0.4656 0.5673 -0.1209 -0.0202 0.0595  197 HIS A C   
1445 O O   . HIS A 186 ? 0.4968 0.4465 0.5473 -0.1322 -0.0195 0.0624  197 HIS A O   
1446 C CB  . HIS A 186 ? 0.4886 0.4651 0.5414 -0.1128 -0.0249 0.0510  197 HIS A CB  
1447 C CG  . HIS A 186 ? 0.5352 0.4990 0.5838 -0.1100 -0.0302 0.0478  197 HIS A CG  
1448 N ND1 . HIS A 186 ? 0.5612 0.5062 0.6068 -0.1169 -0.0324 0.0499  197 HIS A ND1 
1449 C CD2 . HIS A 186 ? 0.5566 0.5238 0.6034 -0.1012 -0.0339 0.0427  197 HIS A CD2 
1450 C CE1 . HIS A 186 ? 0.5563 0.4937 0.5984 -0.1124 -0.0371 0.0462  197 HIS A CE1 
1451 N NE2 . HIS A 186 ? 0.5564 0.5070 0.5992 -0.1029 -0.0381 0.0418  197 HIS A NE2 
1452 N N   . PRO A 187 ? 0.5257 0.4430 0.5595 -0.1176 -0.0210 0.0600  198 PRO A N   
1453 C CA  . PRO A 187 ? 0.5445 0.4443 0.5762 -0.1271 -0.0209 0.0643  198 PRO A CA  
1454 C C   . PRO A 187 ? 0.6494 0.5536 0.6883 -0.1384 -0.0252 0.0643  198 PRO A C   
1455 O O   . PRO A 187 ? 0.6474 0.5455 0.6858 -0.1419 -0.0228 0.0651  198 PRO A O   
1456 C CB  . PRO A 187 ? 0.5626 0.4372 0.5826 -0.1192 -0.0216 0.0637  198 PRO A CB  
1457 C CG  . PRO A 187 ? 0.6053 0.4840 0.6206 -0.1057 -0.0200 0.0604  198 PRO A CG  
1458 C CD  . PRO A 187 ? 0.5452 0.4497 0.5693 -0.1048 -0.0217 0.0569  198 PRO A CD  
1459 N N   . ARG A 188 ? 0.8041 0.7229 0.8487 -0.1376 -0.0294 0.0600  199 ARG A N   
1460 C CA  . ARG A 188 ? 0.8084 0.7319 0.8599 -0.1480 -0.0338 0.0595  199 ARG A CA  
1461 C C   . ARG A 188 ? 0.8498 0.8011 0.9124 -0.1509 -0.0350 0.0569  199 ARG A C   
1462 O O   . ARG A 188 ? 0.8730 0.8312 0.9411 -0.1559 -0.0395 0.0544  199 ARG A O   
1463 C CB  . ARG A 188 ? 0.8121 0.7206 0.8584 -0.1447 -0.0389 0.0565  199 ARG A CB  
1464 C CG  . ARG A 188 ? 0.9123 0.7938 0.9483 -0.1426 -0.0378 0.0586  199 ARG A CG  
1465 C CD  . ARG A 188 ? 1.0967 0.9796 1.1335 -0.1432 -0.0324 0.0577  199 ARG A CD  
1466 N NE  . ARG A 188 ? 1.2570 1.1259 1.2851 -0.1328 -0.0264 0.0563  199 ARG A NE  
1467 C CZ  . ARG A 188 ? 1.4501 1.3074 1.4727 -0.1265 -0.0261 0.0533  199 ARG A CZ  
1468 N NH1 . ARG A 188 ? 1.3409 1.1963 1.3646 -0.1294 -0.0317 0.0515  199 ARG A NH1 
1469 N NH2 . ARG A 188 ? 1.2295 1.0787 1.2466 -0.1174 -0.0200 0.0518  199 ARG A NH2 
1470 N N   . ASP A 189 ? 0.6056 0.5731 0.6715 -0.1480 -0.0311 0.0573  200 ASP A N   
1471 C CA  . ASP A 189 ? 0.5887 0.5833 0.6653 -0.1508 -0.0318 0.0550  200 ASP A CA  
1472 C C   . ASP A 189 ? 0.6233 0.6314 0.7029 -0.1501 -0.0263 0.0573  200 ASP A C   
1473 O O   . ASP A 189 ? 0.6026 0.6135 0.6781 -0.1394 -0.0239 0.0558  200 ASP A O   
1474 C CB  . ASP A 189 ? 0.6053 0.6094 0.6821 -0.1412 -0.0356 0.0489  200 ASP A CB  
1475 C CG  . ASP A 189 ? 0.6440 0.6752 0.7324 -0.1454 -0.0375 0.0460  200 ASP A CG  
1476 O OD1 . ASP A 189 ? 0.6266 0.6699 0.7229 -0.1554 -0.0356 0.0487  200 ASP A OD1 
1477 O OD2 . ASP A 189 ? 0.6815 0.7220 0.7712 -0.1387 -0.0411 0.0409  200 ASP A OD2 
1478 N N   . PRO A 190 ? 0.5868 0.6036 0.6734 -0.1613 -0.0240 0.0609  201 PRO A N   
1479 C CA  . PRO A 190 ? 0.5720 0.6021 0.6617 -0.1611 -0.0188 0.0632  201 PRO A CA  
1480 C C   . PRO A 190 ? 0.6046 0.6602 0.7011 -0.1559 -0.0188 0.0593  201 PRO A C   
1481 O O   . PRO A 190 ? 0.6028 0.6705 0.7019 -0.1549 -0.0145 0.0608  201 PRO A O   
1482 C CB  . PRO A 190 ? 0.5965 0.6295 0.6926 -0.1755 -0.0173 0.0677  201 PRO A CB  
1483 C CG  . PRO A 190 ? 0.6604 0.6741 0.7531 -0.1816 -0.0208 0.0688  201 PRO A CG  
1484 C CD  . PRO A 190 ? 0.6114 0.6235 0.7022 -0.1746 -0.0260 0.0635  201 PRO A CD  
1485 N N   . ASN A 191 ? 0.5028 0.5671 0.6022 -0.1526 -0.0236 0.0542  202 ASN A N   
1486 C CA  . ASN A 191 ? 0.4904 0.5788 0.5959 -0.1470 -0.0239 0.0502  202 ASN A CA  
1487 C C   . ASN A 191 ? 0.5218 0.6069 0.6197 -0.1319 -0.0233 0.0471  202 ASN A C   
1488 O O   . ASN A 191 ? 0.5179 0.6216 0.6195 -0.1260 -0.0221 0.0446  202 ASN A O   
1489 C CB  . ASN A 191 ? 0.4931 0.5945 0.6064 -0.1514 -0.0294 0.0461  202 ASN A CB  
1490 C CG  . ASN A 191 ? 0.5980 0.7258 0.7187 -0.1468 -0.0299 0.0419  202 ASN A CG  
1491 O OD1 . ASN A 191 ? 0.5228 0.6662 0.6486 -0.1483 -0.0261 0.0433  202 ASN A OD1 
1492 N ND2 . ASN A 191 ? 0.3875 0.5205 0.5088 -0.1410 -0.0347 0.0366  202 ASN A ND2 
1493 N N   . GLN A 192 ? 0.5191 0.5811 0.6065 -0.1256 -0.0240 0.0472  203 GLN A N   
1494 C CA  . GLN A 192 ? 0.5053 0.5619 0.5846 -0.1112 -0.0235 0.0443  203 GLN A CA  
1495 C C   . GLN A 192 ? 0.5224 0.5659 0.5940 -0.1068 -0.0179 0.0481  203 GLN A C   
1496 O O   . GLN A 192 ? 0.5126 0.5391 0.5804 -0.1126 -0.0163 0.0523  203 GLN A O   
1497 C CB  . GLN A 192 ? 0.5231 0.5630 0.5956 -0.1060 -0.0282 0.0413  203 GLN A CB  
1498 C CG  . GLN A 192 ? 0.5264 0.5776 0.6057 -0.1097 -0.0340 0.0373  203 GLN A CG  
1499 C CD  . GLN A 192 ? 0.6894 0.7233 0.7614 -0.1041 -0.0385 0.0345  203 GLN A CD  
1500 O OE1 . GLN A 192 ? 0.5711 0.5961 0.6348 -0.0923 -0.0382 0.0324  203 GLN A OE1 
1501 N NE2 . GLN A 192 ? 0.5241 0.5527 0.5990 -0.1127 -0.0425 0.0344  203 GLN A NE2 
1502 N N   . ILE A 193 ? 0.4469 0.4985 0.5162 -0.0966 -0.0151 0.0464  204 ILE A N   
1503 C CA  . ILE A 193 ? 0.4284 0.4677 0.4896 -0.0905 -0.0099 0.0492  204 ILE A CA  
1504 C C   . ILE A 193 ? 0.4186 0.4531 0.4718 -0.0758 -0.0102 0.0453  204 ILE A C   
1505 O O   . ILE A 193 ? 0.4031 0.4515 0.4593 -0.0700 -0.0131 0.0407  204 ILE A O   
1506 C CB  . ILE A 193 ? 0.4640 0.5188 0.5307 -0.0936 -0.0047 0.0522  204 ILE A CB  
1507 C CG1 . ILE A 193 ? 0.4711 0.5511 0.5440 -0.0881 -0.0048 0.0483  204 ILE A CG1 
1508 C CG2 . ILE A 193 ? 0.4804 0.5389 0.5544 -0.1083 -0.0042 0.0562  204 ILE A CG2 
1509 C CD1 . ILE A 193 ? 0.5694 0.6623 0.6451 -0.0876 0.0007  0.0507  204 ILE A CD1 
1510 N N   . LEU A 194 ? 0.3564 0.3710 0.3995 -0.0697 -0.0073 0.0471  205 LEU A N   
1511 C CA  . LEU A 194 ? 0.3411 0.3490 0.3755 -0.0556 -0.0068 0.0440  205 LEU A CA  
1512 C C   . LEU A 194 ? 0.3730 0.3892 0.4064 -0.0496 -0.0011 0.0451  205 LEU A C   
1513 O O   . LEU A 194 ? 0.3605 0.3746 0.3946 -0.0550 0.0031  0.0495  205 LEU A O   
1514 C CB  . LEU A 194 ? 0.3352 0.3148 0.3586 -0.0521 -0.0073 0.0448  205 LEU A CB  
1515 C CG  . LEU A 194 ? 0.3832 0.3520 0.3964 -0.0378 -0.0070 0.0415  205 LEU A CG  
1516 C CD1 . LEU A 194 ? 0.3862 0.3329 0.3921 -0.0365 -0.0107 0.0405  205 LEU A CD1 
1517 C CD2 . LEU A 194 ? 0.3943 0.3553 0.4008 -0.0317 -0.0010 0.0440  205 LEU A CD2 
1518 N N   . ILE A 195 ? 0.2902 0.3158 0.3217 -0.0384 -0.0011 0.0411  206 ILE A N   
1519 C CA  . ILE A 195 ? 0.2882 0.3208 0.3176 -0.0310 0.0040  0.0416  206 ILE A CA  
1520 C C   . ILE A 195 ? 0.3566 0.3764 0.3752 -0.0171 0.0043  0.0386  206 ILE A C   
1521 O O   . ILE A 195 ? 0.3781 0.4005 0.3955 -0.0108 0.0002  0.0341  206 ILE A O   
1522 C CB  . ILE A 195 ? 0.3261 0.3874 0.3654 -0.0315 0.0043  0.0398  206 ILE A CB  
1523 C CG1 . ILE A 195 ? 0.3365 0.4110 0.3870 -0.0455 0.0027  0.0418  206 ILE A CG1 
1524 C CG2 . ILE A 195 ? 0.3141 0.3821 0.3520 -0.0263 0.0102  0.0414  206 ILE A CG2 
1525 C CD1 . ILE A 195 ? 0.4031 0.5063 0.4640 -0.0467 0.0026  0.0397  206 ILE A CD1 
1526 N N   . GLY A 196 ? 0.3439 0.3498 0.3546 -0.0122 0.0090  0.0410  207 GLY A N   
1527 C CA  . GLY A 196 ? 0.3339 0.3267 0.3338 0.0010  0.0100  0.0385  207 GLY A CA  
1528 C C   . GLY A 196 ? 0.3912 0.3926 0.3893 0.0085  0.0154  0.0387  207 GLY A C   
1529 O O   . GLY A 196 ? 0.3797 0.3841 0.3802 0.0035  0.0197  0.0426  207 GLY A O   
1530 N N   . TYR A 197 ? 0.3686 0.3736 0.3623 0.0206  0.0151  0.0346  208 TYR A N   
1531 C CA  . TYR A 197 ? 0.3676 0.3817 0.3595 0.0288  0.0198  0.0343  208 TYR A CA  
1532 C C   . TYR A 197 ? 0.4191 0.4130 0.3982 0.0402  0.0222  0.0333  208 TYR A C   
1533 O O   . TYR A 197 ? 0.3988 0.3758 0.3709 0.0439  0.0193  0.0316  208 TYR A O   
1534 C CB  . TYR A 197 ? 0.3827 0.4210 0.3808 0.0337  0.0178  0.0301  208 TYR A CB  
1535 C CG  . TYR A 197 ? 0.4196 0.4783 0.4304 0.0228  0.0150  0.0304  208 TYR A CG  
1536 C CD1 . TYR A 197 ? 0.4368 0.5106 0.4555 0.0155  0.0183  0.0335  208 TYR A CD1 
1537 C CD2 . TYR A 197 ? 0.4449 0.5076 0.4598 0.0198  0.0090  0.0276  208 TYR A CD2 
1538 C CE1 . TYR A 197 ? 0.4258 0.5180 0.4560 0.0054  0.0159  0.0338  208 TYR A CE1 
1539 C CE2 . TYR A 197 ? 0.4668 0.5480 0.4933 0.0097  0.0065  0.0277  208 TYR A CE2 
1540 C CZ  . TYR A 197 ? 0.5432 0.6392 0.5774 0.0025  0.0100  0.0308  208 TYR A CZ  
1541 O OH  . TYR A 197 ? 0.5254 0.6398 0.5712 -0.0076 0.0077  0.0309  208 TYR A OH  
1542 N N   . SER A 198 ? 0.4609 0.4573 0.4370 0.0458  0.0276  0.0345  209 SER A N   
1543 C CA  . SER A 198 ? 0.4609 0.4378 0.4249 0.0557  0.0309  0.0342  209 SER A CA  
1544 C C   . SER A 198 ? 0.5397 0.5117 0.4970 0.0673  0.0279  0.0292  209 SER A C   
1545 O O   . SER A 198 ? 0.5455 0.4958 0.4930 0.0723  0.0276  0.0285  209 SER A O   
1546 C CB  . SER A 198 ? 0.4684 0.4522 0.4315 0.0599  0.0371  0.0358  209 SER A CB  
1547 O OG  . SER A 198 ? 0.5155 0.4804 0.4671 0.0691  0.0405  0.0357  209 SER A OG  
1548 N N   . ARG A 199 ? 0.4499 0.4418 0.4122 0.0717  0.0256  0.0255  210 ARG A N   
1549 C CA  . ARG A 199 ? 0.4523 0.4408 0.4079 0.0834  0.0230  0.0207  210 ARG A CA  
1550 C C   . ARG A 199 ? 0.5321 0.5053 0.4844 0.0819  0.0178  0.0191  210 ARG A C   
1551 O O   . ARG A 199 ? 0.5491 0.5101 0.4925 0.0916  0.0165  0.0160  210 ARG A O   
1552 C CB  . ARG A 199 ? 0.4301 0.4442 0.3929 0.0873  0.0212  0.0171  210 ARG A CB  
1553 C CG  . ARG A 199 ? 0.4924 0.5241 0.4672 0.0770  0.0167  0.0168  210 ARG A CG  
1554 C CD  . ARG A 199 ? 0.5167 0.5736 0.4979 0.0817  0.0152  0.0131  210 ARG A CD  
1555 N NE  . ARG A 199 ? 0.7633 0.8231 0.7451 0.0848  0.0091  0.0087  210 ARG A NE  
1556 C CZ  . ARG A 199 ? 0.8734 0.9502 0.8654 0.0779  0.0048  0.0072  210 ARG A CZ  
1557 N NH1 . ARG A 199 ? 0.5941 0.6867 0.5965 0.0674  0.0059  0.0099  210 ARG A NH1 
1558 N NH2 . ARG A 199 ? 0.6944 0.7726 0.6860 0.0814  -0.0007 0.0030  210 ARG A NH2 
1559 N N   . GLY A 200 ? 0.4753 0.4487 0.4342 0.0700  0.0148  0.0212  211 GLY A N   
1560 C CA  . GLY A 200 ? 0.4568 0.4147 0.4124 0.0678  0.0100  0.0201  211 GLY A CA  
1561 C C   . GLY A 200 ? 0.4750 0.4466 0.4405 0.0593  0.0045  0.0188  211 GLY A C   
1562 O O   . GLY A 200 ? 0.4785 0.4384 0.4426 0.0559  0.0003  0.0182  211 GLY A O   
1563 N N   . LEU A 201 ? 0.3395 0.3359 0.3153 0.0557  0.0044  0.0184  212 LEU A N   
1564 C CA  . LEU A 201 ? 0.3365 0.3475 0.3224 0.0473  -0.0007 0.0172  212 LEU A CA  
1565 C C   . LEU A 201 ? 0.3999 0.4058 0.3910 0.0332  -0.0008 0.0217  212 LEU A C   
1566 O O   . LEU A 201 ? 0.3991 0.4067 0.3925 0.0277  0.0036  0.0257  212 LEU A O   
1567 C CB  . LEU A 201 ? 0.3270 0.3665 0.3222 0.0479  -0.0005 0.0153  212 LEU A CB  
1568 C CG  . LEU A 201 ? 0.3637 0.4208 0.3704 0.0387  -0.0054 0.0140  212 LEU A CG  
1569 C CD1 . LEU A 201 ? 0.3570 0.4129 0.3619 0.0440  -0.0113 0.0091  212 LEU A CD1 
1570 C CD2 . LEU A 201 ? 0.3763 0.4608 0.3931 0.0366  -0.0038 0.0136  212 LEU A CD2 
1571 N N   . VAL A 202 ? 0.3645 0.3638 0.3571 0.0273  -0.0058 0.0209  213 VAL A N   
1572 C CA  . VAL A 202 ? 0.3634 0.3596 0.3619 0.0135  -0.0068 0.0246  213 VAL A CA  
1573 C C   . VAL A 202 ? 0.4383 0.4520 0.4469 0.0070  -0.0120 0.0222  213 VAL A C   
1574 O O   . VAL A 202 ? 0.4400 0.4563 0.4476 0.0128  -0.0163 0.0178  213 VAL A O   
1575 C CB  . VAL A 202 ? 0.4051 0.3735 0.3952 0.0118  -0.0076 0.0265  213 VAL A CB  
1576 C CG1 . VAL A 202 ? 0.4005 0.3659 0.3966 -0.0026 -0.0085 0.0304  213 VAL A CG1 
1577 C CG2 . VAL A 202 ? 0.3979 0.3491 0.3776 0.0191  -0.0025 0.0283  213 VAL A CG2 
1578 N N   . VAL A 203 ? 0.3658 0.3921 0.3843 -0.0050 -0.0116 0.0250  214 VAL A N   
1579 C CA  . VAL A 203 ? 0.3634 0.4068 0.3923 -0.0125 -0.0162 0.0231  214 VAL A CA  
1580 C C   . VAL A 203 ? 0.4257 0.4639 0.4596 -0.0268 -0.0169 0.0271  214 VAL A C   
1581 O O   . VAL A 203 ? 0.4265 0.4548 0.4584 -0.0317 -0.0129 0.0317  214 VAL A O   
1582 C CB  . VAL A 203 ? 0.3994 0.4713 0.4376 -0.0120 -0.0152 0.0214  214 VAL A CB  
1583 C CG1 . VAL A 203 ? 0.3895 0.4669 0.4225 0.0024  -0.0142 0.0176  214 VAL A CG1 
1584 C CG2 . VAL A 203 ? 0.3923 0.4719 0.4357 -0.0197 -0.0101 0.0261  214 VAL A CG2 
1585 N N   . ILE A 204 ? 0.3846 0.4293 0.4249 -0.0335 -0.0220 0.0253  215 ILE A N   
1586 C CA  . ILE A 204 ? 0.3775 0.4219 0.4245 -0.0478 -0.0231 0.0285  215 ILE A CA  
1587 C C   . ILE A 204 ? 0.4458 0.5176 0.5054 -0.0542 -0.0245 0.0271  215 ILE A C   
1588 O O   . ILE A 204 ? 0.4352 0.5193 0.4987 -0.0513 -0.0287 0.0225  215 ILE A O   
1589 C CB  . ILE A 204 ? 0.4187 0.4455 0.4622 -0.0512 -0.0278 0.0278  215 ILE A CB  
1590 C CG1 . ILE A 204 ? 0.4151 0.4145 0.4462 -0.0452 -0.0261 0.0295  215 ILE A CG1 
1591 C CG2 . ILE A 204 ? 0.4344 0.4628 0.4856 -0.0661 -0.0291 0.0310  215 ILE A CG2 
1592 C CD1 . ILE A 204 ? 0.3347 0.3147 0.3620 -0.0494 -0.0302 0.0296  215 ILE A CD1 
1593 N N   . TRP A 205 ? 0.4415 0.5230 0.5076 -0.0628 -0.0209 0.0309  216 TRP A N   
1594 C CA  . TRP A 205 ? 0.4525 0.5612 0.5299 -0.0672 -0.0207 0.0298  216 TRP A CA  
1595 C C   . TRP A 205 ? 0.5412 0.6560 0.6277 -0.0819 -0.0228 0.0317  216 TRP A C   
1596 O O   . TRP A 205 ? 0.5277 0.6308 0.6135 -0.0904 -0.0208 0.0364  216 TRP A O   
1597 C CB  . TRP A 205 ? 0.4349 0.5515 0.5127 -0.0652 -0.0145 0.0326  216 TRP A CB  
1598 C CG  . TRP A 205 ? 0.4454 0.5890 0.5347 -0.0707 -0.0134 0.0323  216 TRP A CG  
1599 C CD1 . TRP A 205 ? 0.4790 0.6308 0.5763 -0.0832 -0.0118 0.0359  216 TRP A CD1 
1600 C CD2 . TRP A 205 ? 0.4448 0.6104 0.5386 -0.0636 -0.0136 0.0284  216 TRP A CD2 
1601 N NE1 . TRP A 205 ? 0.4714 0.6492 0.5781 -0.0846 -0.0110 0.0343  216 TRP A NE1 
1602 C CE2 . TRP A 205 ? 0.4903 0.6772 0.5952 -0.0727 -0.0122 0.0297  216 TRP A CE2 
1603 C CE3 . TRP A 205 ? 0.4612 0.6306 0.5507 -0.0505 -0.0150 0.0238  216 TRP A CE3 
1604 C CZ2 . TRP A 205 ? 0.4745 0.6863 0.5864 -0.0690 -0.0120 0.0265  216 TRP A CZ2 
1605 C CZ3 . TRP A 205 ? 0.4762 0.6704 0.5726 -0.0469 -0.0148 0.0207  216 TRP A CZ3 
1606 C CH2 . TRP A 205 ? 0.4800 0.6951 0.5875 -0.0561 -0.0134 0.0220  216 TRP A CH2 
1607 N N   . ASP A 206 ? 0.6550 0.7881 0.7501 -0.0846 -0.0269 0.0280  217 ASP A N   
1608 C CA  . ASP A 206 ? 0.6634 0.8060 0.7683 -0.0984 -0.0289 0.0292  217 ASP A CA  
1609 C C   . ASP A 206 ? 0.7159 0.8767 0.8287 -0.1046 -0.0245 0.0320  217 ASP A C   
1610 O O   . ASP A 206 ? 0.7177 0.8998 0.8361 -0.1006 -0.0239 0.0293  217 ASP A O   
1611 C CB  . ASP A 206 ? 0.6962 0.8525 0.8073 -0.0984 -0.0347 0.0239  217 ASP A CB  
1612 C CG  . ASP A 206 ? 0.8625 1.0243 0.9823 -0.1126 -0.0374 0.0249  217 ASP A CG  
1613 O OD1 . ASP A 206 ? 0.8858 1.0546 1.0117 -0.1225 -0.0344 0.0287  217 ASP A OD1 
1614 O OD2 . ASP A 206 ? 0.9559 1.1148 1.0765 -0.1139 -0.0426 0.0219  217 ASP A OD2 
1615 N N   . LEU A 207 ? 0.5324 0.6845 0.6455 -0.1141 -0.0214 0.0373  218 LEU A N   
1616 C CA  . LEU A 207 ? 0.5250 0.6918 0.6445 -0.1197 -0.0167 0.0404  218 LEU A CA  
1617 C C   . LEU A 207 ? 0.6038 0.7963 0.7359 -0.1273 -0.0186 0.0383  218 LEU A C   
1618 O O   . LEU A 207 ? 0.5942 0.8068 0.7319 -0.1253 -0.0162 0.0374  218 LEU A O   
1619 C CB  . LEU A 207 ? 0.5144 0.6653 0.6313 -0.1288 -0.0135 0.0465  218 LEU A CB  
1620 C CG  . LEU A 207 ? 0.5552 0.6853 0.6610 -0.1219 -0.0097 0.0494  218 LEU A CG  
1621 C CD1 . LEU A 207 ? 0.5616 0.6759 0.6655 -0.1319 -0.0074 0.0551  218 LEU A CD1 
1622 C CD2 . LEU A 207 ? 0.5447 0.6866 0.6502 -0.1141 -0.0050 0.0495  218 LEU A CD2 
1623 N N   . GLN A 208 ? 0.7005 0.8927 0.8374 -0.1362 -0.0228 0.0375  219 GLN A N   
1624 C CA  . GLN A 208 ? 0.7121 0.9282 0.8614 -0.1445 -0.0246 0.0357  219 GLN A CA  
1625 C C   . GLN A 208 ? 0.7656 1.0000 0.9185 -0.1360 -0.0277 0.0295  219 GLN A C   
1626 O O   . GLN A 208 ? 0.7719 1.0300 0.9336 -0.1376 -0.0268 0.0279  219 GLN A O   
1627 C CB  . GLN A 208 ? 0.7389 0.9486 0.8919 -0.1565 -0.0281 0.0367  219 GLN A CB  
1628 C CG  . GLN A 208 ? 1.0200 1.2529 1.1858 -0.1671 -0.0291 0.0357  219 GLN A CG  
1629 C CD  . GLN A 208 ? 1.3537 1.5789 1.5228 -0.1798 -0.0318 0.0374  219 GLN A CD  
1630 O OE1 . GLN A 208 ? 1.2979 1.5079 1.4623 -0.1790 -0.0358 0.0361  219 GLN A OE1 
1631 N NE2 . GLN A 208 ? 1.2908 1.5266 1.4678 -0.1917 -0.0296 0.0403  219 GLN A NE2 
1632 N N   . GLY A 209 ? 0.4964 0.7203 0.6428 -0.1270 -0.0315 0.0260  220 GLY A N   
1633 C CA  . GLY A 209 ? 0.4853 0.7251 0.6343 -0.1185 -0.0348 0.0200  220 GLY A CA  
1634 C C   . GLY A 209 ? 0.5181 0.7655 0.6636 -0.1060 -0.0318 0.0184  220 GLY A C   
1635 O O   . GLY A 209 ? 0.5003 0.7647 0.6494 -0.0994 -0.0340 0.0136  220 GLY A O   
1636 N N   . SER A 210 ? 0.5814 0.8166 0.7199 -0.1025 -0.0268 0.0224  221 SER A N   
1637 C CA  . SER A 210 ? 0.5762 0.8168 0.7106 -0.0908 -0.0233 0.0214  221 SER A CA  
1638 C C   . SER A 210 ? 0.6375 0.8752 0.7658 -0.0775 -0.0266 0.0163  221 SER A C   
1639 O O   . SER A 210 ? 0.6397 0.8952 0.7709 -0.0701 -0.0271 0.0124  221 SER A O   
1640 C CB  . SER A 210 ? 0.6127 0.8805 0.7571 -0.0934 -0.0208 0.0209  221 SER A CB  
1641 O OG  . SER A 210 ? 0.7584 1.0283 0.9079 -0.1053 -0.0174 0.0259  221 SER A OG  
1642 N N   . ARG A 211 ? 0.5875 0.8023 0.7069 -0.0744 -0.0290 0.0162  222 ARG A N   
1643 C CA  . ARG A 211 ? 0.5759 0.7856 0.6888 -0.0622 -0.0324 0.0115  222 ARG A CA  
1644 C C   . ARG A 211 ? 0.5818 0.7623 0.6823 -0.0575 -0.0320 0.0133  222 ARG A C   
1645 O O   . ARG A 211 ? 0.5716 0.7361 0.6699 -0.0655 -0.0311 0.0174  222 ARG A O   
1646 C CB  . ARG A 211 ? 0.5997 0.8198 0.7189 -0.0650 -0.0387 0.0069  222 ARG A CB  
1647 C CG  . ARG A 211 ? 0.7054 0.9159 0.8276 -0.0774 -0.0415 0.0089  222 ARG A CG  
1648 C CD  . ARG A 211 ? 0.8287 1.0536 0.9588 -0.0808 -0.0473 0.0042  222 ARG A CD  
1649 N NE  . ARG A 211 ? 1.0107 1.2278 1.1442 -0.0932 -0.0499 0.0061  222 ARG A NE  
1650 C CZ  . ARG A 211 ? 1.2111 1.4093 1.3388 -0.0931 -0.0536 0.0054  222 ARG A CZ  
1651 N NH1 . ARG A 211 ? 1.0236 1.2089 1.1417 -0.0811 -0.0552 0.0029  222 ARG A NH1 
1652 N NH2 . ARG A 211 ? 1.0379 1.2301 1.1693 -0.1049 -0.0558 0.0073  222 ARG A NH2 
1653 N N   . VAL A 212 ? 0.5041 0.6778 0.5962 -0.0442 -0.0328 0.0101  223 VAL A N   
1654 C CA  . VAL A 212 ? 0.4896 0.6361 0.5695 -0.0382 -0.0326 0.0111  223 VAL A CA  
1655 C C   . VAL A 212 ? 0.5335 0.6699 0.6121 -0.0402 -0.0386 0.0087  223 VAL A C   
1656 O O   . VAL A 212 ? 0.5392 0.6879 0.6216 -0.0371 -0.0430 0.0039  223 VAL A O   
1657 C CB  . VAL A 212 ? 0.5246 0.6681 0.5959 -0.0230 -0.0306 0.0088  223 VAL A CB  
1658 C CG1 . VAL A 212 ? 0.5229 0.6382 0.5814 -0.0167 -0.0306 0.0095  223 VAL A CG1 
1659 C CG2 . VAL A 212 ? 0.5128 0.6658 0.5854 -0.0214 -0.0246 0.0114  223 VAL A CG2 
1660 N N   . LEU A 213 ? 0.5382 0.6522 0.6115 -0.0454 -0.0387 0.0119  224 LEU A N   
1661 C CA  . LEU A 213 ? 0.5268 0.6286 0.5981 -0.0479 -0.0440 0.0101  224 LEU A CA  
1662 C C   . LEU A 213 ? 0.5659 0.6454 0.6246 -0.0370 -0.0450 0.0086  224 LEU A C   
1663 O O   . LEU A 213 ? 0.5646 0.6363 0.6212 -0.0360 -0.0499 0.0059  224 LEU A O   
1664 C CB  . LEU A 213 ? 0.5174 0.6086 0.5914 -0.0616 -0.0441 0.0146  224 LEU A CB  
1665 C CG  . LEU A 213 ? 0.5570 0.6659 0.6424 -0.0739 -0.0423 0.0173  224 LEU A CG  
1666 C CD1 . LEU A 213 ? 0.5642 0.6572 0.6489 -0.0853 -0.0409 0.0225  224 LEU A CD1 
1667 C CD2 . LEU A 213 ? 0.5564 0.6863 0.6522 -0.0786 -0.0469 0.0134  224 LEU A CD2 
1668 N N   . TYR A 214 ? 0.4902 0.5598 0.5407 -0.0287 -0.0405 0.0102  225 TYR A N   
1669 C CA  . TYR A 214 ? 0.4709 0.5160 0.5088 -0.0200 -0.0402 0.0100  225 TYR A CA  
1670 C C   . TYR A 214 ? 0.4875 0.5304 0.5191 -0.0106 -0.0347 0.0111  225 TYR A C   
1671 O O   . TYR A 214 ? 0.4579 0.5104 0.4937 -0.0145 -0.0304 0.0142  225 TYR A O   
1672 C CB  . TYR A 214 ? 0.4919 0.5146 0.5261 -0.0284 -0.0404 0.0140  225 TYR A CB  
1673 C CG  . TYR A 214 ? 0.5149 0.5107 0.5361 -0.0209 -0.0391 0.0148  225 TYR A CG  
1674 C CD1 . TYR A 214 ? 0.5394 0.5252 0.5543 -0.0172 -0.0334 0.0181  225 TYR A CD1 
1675 C CD2 . TYR A 214 ? 0.5325 0.5127 0.5478 -0.0180 -0.0435 0.0125  225 TYR A CD2 
1676 C CE1 . TYR A 214 ? 0.5552 0.5166 0.5584 -0.0107 -0.0321 0.0188  225 TYR A CE1 
1677 C CE2 . TYR A 214 ? 0.5493 0.5050 0.5529 -0.0115 -0.0422 0.0133  225 TYR A CE2 
1678 C CZ  . TYR A 214 ? 0.6249 0.5712 0.6225 -0.0078 -0.0365 0.0164  225 TYR A CZ  
1679 O OH  . TYR A 214 ? 0.6332 0.5552 0.6192 -0.0014 -0.0351 0.0171  225 TYR A OH  
1680 N N   . HIS A 215 ? 0.4999 0.5301 0.5212 0.0016  -0.0348 0.0087  226 HIS A N   
1681 C CA  . HIS A 215 ? 0.5015 0.5286 0.5162 0.0111  -0.0296 0.0095  226 HIS A CA  
1682 C C   . HIS A 215 ? 0.5533 0.5606 0.5555 0.0231  -0.0302 0.0071  226 HIS A C   
1683 O O   . HIS A 215 ? 0.5560 0.5572 0.5557 0.0257  -0.0351 0.0039  226 HIS A O   
1684 C CB  . HIS A 215 ? 0.5119 0.5645 0.5328 0.0158  -0.0282 0.0071  226 HIS A CB  
1685 C CG  . HIS A 215 ? 0.5608 0.6200 0.5789 0.0273  -0.0315 0.0015  226 HIS A CG  
1686 N ND1 . HIS A 215 ? 0.5847 0.6383 0.5938 0.0406  -0.0291 -0.0003 226 HIS A ND1 
1687 C CD2 . HIS A 215 ? 0.5848 0.6554 0.6077 0.0276  -0.0370 -0.0028 226 HIS A CD2 
1688 C CE1 . HIS A 215 ? 0.5767 0.6381 0.5852 0.0486  -0.0330 -0.0054 226 HIS A CE1 
1689 N NE2 . HIS A 215 ? 0.5834 0.6552 0.6002 0.0410  -0.0379 -0.0070 226 HIS A NE2 
1690 N N   . PHE A 216 ? 0.4884 0.4859 0.4827 0.0303  -0.0252 0.0088  227 PHE A N   
1691 C CA  . PHE A 216 ? 0.4866 0.4685 0.4690 0.0434  -0.0248 0.0063  227 PHE A CA  
1692 C C   . PHE A 216 ? 0.5215 0.5043 0.4993 0.0509  -0.0187 0.0076  227 PHE A C   
1693 O O   . PHE A 216 ? 0.4960 0.4861 0.4785 0.0451  -0.0146 0.0111  227 PHE A O   
1694 C CB  . PHE A 216 ? 0.5127 0.4669 0.4864 0.0423  -0.0260 0.0077  227 PHE A CB  
1695 C CG  . PHE A 216 ? 0.5321 0.4722 0.5040 0.0350  -0.0218 0.0131  227 PHE A CG  
1696 C CD1 . PHE A 216 ? 0.5534 0.4826 0.5174 0.0412  -0.0163 0.0151  227 PHE A CD1 
1697 C CD2 . PHE A 216 ? 0.5559 0.4930 0.5335 0.0220  -0.0235 0.0162  227 PHE A CD2 
1698 C CE1 . PHE A 216 ? 0.5689 0.4851 0.5311 0.0346  -0.0126 0.0199  227 PHE A CE1 
1699 C CE2 . PHE A 216 ? 0.5862 0.5102 0.5618 0.0154  -0.0198 0.0211  227 PHE A CE2 
1700 C CZ  . PHE A 216 ? 0.5635 0.4770 0.5315 0.0217  -0.0144 0.0230  227 PHE A CZ  
1701 N N   . LEU A 217 ? 0.5946 0.5697 0.5632 0.0639  -0.0181 0.0046  228 LEU A N   
1702 C CA  . LEU A 217 ? 0.5959 0.5703 0.5587 0.0727  -0.0125 0.0052  228 LEU A CA  
1703 C C   . LEU A 217 ? 0.6548 0.6017 0.6044 0.0796  -0.0107 0.0057  228 LEU A C   
1704 O O   . LEU A 217 ? 0.6704 0.6089 0.6127 0.0890  -0.0130 0.0021  228 LEU A O   
1705 C CB  . LEU A 217 ? 0.6004 0.5935 0.5646 0.0826  -0.0131 0.0008  228 LEU A CB  
1706 C CG  . LEU A 217 ? 0.6717 0.6713 0.6327 0.0913  -0.0076 0.0010  228 LEU A CG  
1707 C CD1 . LEU A 217 ? 0.6690 0.6476 0.6162 0.1032  -0.0052 -0.0001 228 LEU A CD1 
1708 C CD2 . LEU A 217 ? 0.7395 0.7443 0.7056 0.0830  -0.0027 0.0059  228 LEU A CD2 
1709 N N   . SER A 218 ? 0.4231 0.2688 0.3957 -0.0141 -0.0248 0.0590  229 SER A N   
1710 C CA  . SER A 218 ? 0.4175 0.2657 0.3863 -0.0121 -0.0217 0.0570  229 SER A CA  
1711 C C   . SER A 218 ? 0.4787 0.3326 0.4554 -0.0119 -0.0188 0.0622  229 SER A C   
1712 O O   . SER A 218 ? 0.4639 0.3186 0.4498 -0.0123 -0.0181 0.0661  229 SER A O   
1713 C CB  . SER A 218 ? 0.4515 0.2951 0.4179 -0.0091 -0.0189 0.0511  229 SER A CB  
1714 O OG  . SER A 218 ? 0.5274 0.3693 0.5028 -0.0078 -0.0164 0.0519  229 SER A OG  
1715 N N   . SER A 219 ? 0.5029 0.3607 0.4757 -0.0112 -0.0172 0.0622  230 SER A N   
1716 C CA  . SER A 219 ? 0.5011 0.3646 0.4805 -0.0111 -0.0147 0.0671  230 SER A CA  
1717 C C   . SER A 219 ? 0.5267 0.3895 0.5124 -0.0084 -0.0102 0.0662  230 SER A C   
1718 O O   . SER A 219 ? 0.5236 0.3895 0.5180 -0.0084 -0.0085 0.0708  230 SER A O   
1719 C CB  . SER A 219 ? 0.5715 0.4397 0.5445 -0.0114 -0.0147 0.0675  230 SER A CB  
1720 O OG  . SER A 219 ? 0.7449 0.6111 0.7100 -0.0092 -0.0132 0.0617  230 SER A OG  
1721 N N   . GLN A 220 ? 0.5672 0.4260 0.5487 -0.0060 -0.0083 0.0605  231 GLN A N   
1722 C CA  . GLN A 220 ? 0.5381 0.3958 0.5250 -0.0033 -0.0040 0.0591  231 GLN A CA  
1723 C C   . GLN A 220 ? 0.5485 0.4008 0.5399 -0.0027 -0.0040 0.0574  231 GLN A C   
1724 O O   . GLN A 220 ? 0.5225 0.3711 0.5107 -0.0038 -0.0071 0.0555  231 GLN A O   
1725 C CB  . GLN A 220 ? 0.5498 0.4069 0.5296 -0.0009 -0.0015 0.0540  231 GLN A CB  
1726 C CG  . GLN A 220 ? 0.5142 0.3761 0.4876 -0.0015 -0.0018 0.0548  231 GLN A CG  
1727 C CD  . GLN A 220 ? 0.5588 0.4268 0.5386 -0.0017 0.0003  0.0602  231 GLN A CD  
1728 O OE1 . GLN A 220 ? 0.4558 0.3242 0.4433 -0.0003 0.0034  0.0616  231 GLN A OE1 
1729 N NE2 . GLN A 220 ? 0.6870 0.5599 0.6638 -0.0035 -0.0015 0.0633  231 GLN A NE2 
1730 N N   . GLN A 221 ? 0.4378 0.2898 0.4369 -0.0008 -0.0005 0.0580  232 GLN A N   
1731 C CA  . GLN A 221 ? 0.4305 0.2777 0.4345 0.0001  0.0000  0.0563  232 GLN A CA  
1732 C C   . GLN A 221 ? 0.4458 0.2873 0.4421 0.0014  -0.0004 0.0496  232 GLN A C   
1733 O O   . GLN A 221 ? 0.4176 0.2590 0.4073 0.0029  0.0011  0.0458  232 GLN A O   
1734 C CB  . GLN A 221 ? 0.4424 0.2905 0.4550 0.0021  0.0042  0.0577  232 GLN A CB  
1735 C CG  . GLN A 221 ? 0.6043 0.4482 0.6237 0.0029  0.0048  0.0573  232 GLN A CG  
1736 C CD  . GLN A 221 ? 0.8299 0.6756 0.8587 0.0045  0.0086  0.0598  232 GLN A CD  
1737 O OE1 . GLN A 221 ? 0.7850 0.6336 0.8200 0.0037  0.0079  0.0623  232 GLN A OE1 
1738 N NE2 . GLN A 221 ? 0.7130 0.5596 0.7406 0.0068  0.0121  0.0577  232 GLN A NE2 
1739 N N   . LEU A 222 ? 0.4684 0.3054 0.4656 0.0007  -0.0025 0.0482  233 LEU A N   
1740 C CA  . LEU A 222 ? 0.4679 0.2994 0.4576 0.0016  -0.0037 0.0420  233 LEU A CA  
1741 C C   . LEU A 222 ? 0.4837 0.3113 0.4762 0.0044  -0.0002 0.0382  233 LEU A C   
1742 O O   . LEU A 222 ? 0.4564 0.2834 0.4576 0.0049  0.0014  0.0403  233 LEU A O   
1743 C CB  . LEU A 222 ? 0.4732 0.3016 0.4618 -0.0007 -0.0080 0.0423  233 LEU A CB  
1744 C CG  . LEU A 222 ? 0.5223 0.3446 0.5030 -0.0001 -0.0097 0.0361  233 LEU A CG  
1745 C CD1 . LEU A 222 ? 0.5162 0.3390 0.4861 -0.0001 -0.0109 0.0329  233 LEU A CD1 
1746 C CD2 . LEU A 222 ? 0.5199 0.3390 0.5017 -0.0023 -0.0137 0.0370  233 LEU A CD2 
1747 N N   . GLU A 223 ? 0.4361 0.2610 0.4211 0.0063  0.0010  0.0326  234 GLU A N   
1748 C CA  . GLU A 223 ? 0.4289 0.2497 0.4151 0.0090  0.0041  0.0282  234 GLU A CA  
1749 C C   . GLU A 223 ? 0.4895 0.3040 0.4705 0.0091  0.0019  0.0231  234 GLU A C   
1750 O O   . GLU A 223 ? 0.4836 0.2943 0.4691 0.0101  0.0029  0.0216  234 GLU A O   
1751 C CB  . GLU A 223 ? 0.4396 0.2621 0.4219 0.0114  0.0075  0.0254  234 GLU A CB  
1752 C CG  . GLU A 223 ? 0.5235 0.3514 0.5122 0.0119  0.0107  0.0298  234 GLU A CG  
1753 C CD  . GLU A 223 ? 0.6162 0.4429 0.6139 0.0137  0.0141  0.0304  234 GLU A CD  
1754 O OE1 . GLU A 223 ? 0.5945 0.4161 0.5925 0.0150  0.0147  0.0266  234 GLU A OE1 
1755 O OE2 . GLU A 223 ? 0.3988 0.2296 0.4034 0.0138  0.0162  0.0348  234 GLU A OE2 
1756 N N   . ASN A 224 ? 0.3648 0.1780 0.3364 0.0081  -0.0012 0.0205  235 ASN A N   
1757 C CA  . ASN A 224 ? 0.3615 0.1685 0.3273 0.0083  -0.0033 0.0154  235 ASN A CA  
1758 C C   . ASN A 224 ? 0.4178 0.2246 0.3747 0.0064  -0.0076 0.0145  235 ASN A C   
1759 O O   . ASN A 224 ? 0.4113 0.2227 0.3660 0.0051  -0.0085 0.0174  235 ASN A O   
1760 C CB  . ASN A 224 ? 0.3442 0.1479 0.3063 0.0114  -0.0002 0.0095  235 ASN A CB  
1761 C CG  . ASN A 224 ? 0.4437 0.2415 0.4081 0.0123  -0.0002 0.0063  235 ASN A CG  
1762 O OD1 . ASN A 224 ? 0.3205 0.1149 0.2835 0.0106  -0.0037 0.0058  235 ASN A OD1 
1763 N ND2 . ASN A 224 ? 0.3605 0.1568 0.3283 0.0149  0.0038  0.0041  235 ASN A ND2 
1764 N N   . ILE A 225 ? 0.4293 0.2305 0.3808 0.0061  -0.0102 0.0103  236 ILE A N   
1765 C CA  . ILE A 225 ? 0.4416 0.2416 0.3848 0.0042  -0.0147 0.0091  236 ILE A CA  
1766 C C   . ILE A 225 ? 0.4715 0.2655 0.4064 0.0057  -0.0153 0.0022  236 ILE A C   
1767 O O   . ILE A 225 ? 0.4631 0.2531 0.4005 0.0074  -0.0136 -0.0008 236 ILE A O   
1768 C CB  . ILE A 225 ? 0.4828 0.2823 0.4302 0.0012  -0.0185 0.0131  236 ILE A CB  
1769 C CG1 . ILE A 225 ? 0.4876 0.2934 0.4415 -0.0006 -0.0184 0.0200  236 ILE A CG1 
1770 C CG2 . ILE A 225 ? 0.4999 0.2962 0.4384 -0.0007 -0.0233 0.0108  236 ILE A CG2 
1771 C CD1 . ILE A 225 ? 0.5421 0.3515 0.4898 -0.0025 -0.0211 0.0218  236 ILE A CD1 
1772 N N   . TRP A 226 ? 0.4129 0.2065 0.3379 0.0052  -0.0178 -0.0004 237 TRP A N   
1773 C CA  . TRP A 226 ? 0.4214 0.2091 0.3380 0.0062  -0.0195 -0.0067 237 TRP A CA  
1774 C C   . TRP A 226 ? 0.4934 0.2798 0.4031 0.0037  -0.0247 -0.0067 237 TRP A C   
1775 O O   . TRP A 226 ? 0.4732 0.2638 0.3801 0.0022  -0.0262 -0.0040 237 TRP A O   
1776 C CB  . TRP A 226 ? 0.4082 0.1960 0.3180 0.0090  -0.0167 -0.0114 237 TRP A CB  
1777 C CG  . TRP A 226 ? 0.4261 0.2072 0.3295 0.0105  -0.0175 -0.0179 237 TRP A CG  
1778 C CD1 . TRP A 226 ? 0.4736 0.2517 0.3666 0.0104  -0.0206 -0.0221 237 TRP A CD1 
1779 C CD2 . TRP A 226 ? 0.4189 0.1955 0.3259 0.0124  -0.0154 -0.0210 237 TRP A CD2 
1780 N NE1 . TRP A 226 ? 0.4751 0.2470 0.3650 0.0121  -0.0204 -0.0276 237 TRP A NE1 
1781 C CE2 . TRP A 226 ? 0.4837 0.2547 0.3821 0.0133  -0.0173 -0.0270 237 TRP A CE2 
1782 C CE3 . TRP A 226 ? 0.4203 0.1971 0.3369 0.0134  -0.0120 -0.0193 237 TRP A CE3 
1783 C CZ2 . TRP A 226 ? 0.4711 0.2366 0.3702 0.0151  -0.0159 -0.0313 237 TRP A CZ2 
1784 C CZ3 . TRP A 226 ? 0.4346 0.2061 0.3519 0.0152  -0.0107 -0.0235 237 TRP A CZ3 
1785 C CH2 . TRP A 226 ? 0.4495 0.2177 0.3593 0.0159  -0.0124 -0.0292 237 TRP A CH2 
1786 N N   . TRP A 227 ? 0.4580 0.2383 0.3649 0.0032  -0.0275 -0.0099 238 TRP A N   
1787 C CA  . TRP A 227 ? 0.4759 0.2541 0.3771 0.0006  -0.0327 -0.0099 238 TRP A CA  
1788 C C   . TRP A 227 ? 0.5643 0.3380 0.4542 0.0020  -0.0342 -0.0165 238 TRP A C   
1789 O O   . TRP A 227 ? 0.5700 0.3385 0.4585 0.0036  -0.0335 -0.0211 238 TRP A O   
1790 C CB  . TRP A 227 ? 0.4593 0.2341 0.3662 -0.0013 -0.0352 -0.0080 238 TRP A CB  
1791 C CG  . TRP A 227 ? 0.4854 0.2608 0.3904 -0.0047 -0.0402 -0.0049 238 TRP A CG  
1792 C CD1 . TRP A 227 ? 0.5314 0.3078 0.4279 -0.0059 -0.0433 -0.0054 238 TRP A CD1 
1793 C CD2 . TRP A 227 ? 0.4832 0.2582 0.3949 -0.0072 -0.0427 -0.0007 238 TRP A CD2 
1794 N NE1 . TRP A 227 ? 0.5312 0.3078 0.4288 -0.0092 -0.0475 -0.0018 238 TRP A NE1 
1795 C CE2 . TRP A 227 ? 0.5414 0.3172 0.4483 -0.0100 -0.0472 0.0012  238 TRP A CE2 
1796 C CE3 . TRP A 227 ? 0.4922 0.2664 0.4135 -0.0074 -0.0415 0.0017  238 TRP A CE3 
1797 C CZ2 . TRP A 227 ? 0.5314 0.3073 0.4429 -0.0130 -0.0506 0.0054  238 TRP A CZ2 
1798 C CZ3 . TRP A 227 ? 0.5116 0.2859 0.4374 -0.0103 -0.0448 0.0059  238 TRP A CZ3 
1799 C CH2 . TRP A 227 ? 0.5259 0.3011 0.4468 -0.0130 -0.0493 0.0077  238 TRP A CH2 
1800 N N   . GLN A 228 ? 0.6006 0.3764 0.4825 0.0013  -0.0362 -0.0169 239 GLN A N   
1801 C CA  . GLN A 228 ? 0.6118 0.3838 0.4826 0.0026  -0.0377 -0.0230 239 GLN A CA  
1802 C C   . GLN A 228 ? 0.6807 0.4457 0.5484 0.0017  -0.0414 -0.0262 239 GLN A C   
1803 O O   . GLN A 228 ? 0.6580 0.4218 0.5308 -0.0007 -0.0439 -0.0231 239 GLN A O   
1804 C CB  . GLN A 228 ? 0.6356 0.4114 0.4990 0.0014  -0.0399 -0.0220 239 GLN A CB  
1805 C CG  . GLN A 228 ? 0.6304 0.4039 0.4822 0.0033  -0.0405 -0.0280 239 GLN A CG  
1806 C CD  . GLN A 228 ? 0.7538 0.5317 0.5993 0.0021  -0.0424 -0.0264 239 GLN A CD  
1807 O OE1 . GLN A 228 ? 0.6771 0.4586 0.5189 0.0039  -0.0399 -0.0276 239 GLN A OE1 
1808 N NE2 . GLN A 228 ? 0.6927 0.4705 0.5370 -0.0010 -0.0469 -0.0237 239 GLN A NE2 
1809 N N   . ARG A 229 ? 0.6866 0.4469 0.5458 0.0036  -0.0418 -0.0325 240 ARG A N   
1810 C CA  . ARG A 229 ? 0.7059 0.4590 0.5617 0.0032  -0.0449 -0.0364 240 ARG A CA  
1811 C C   . ARG A 229 ? 0.7796 0.5314 0.6335 -0.0002 -0.0504 -0.0339 240 ARG A C   
1812 O O   . ARG A 229 ? 0.7938 0.5422 0.6519 -0.0018 -0.0525 -0.0328 240 ARG A O   
1813 C CB  . ARG A 229 ? 0.7579 0.5069 0.6034 0.0057  -0.0449 -0.0434 240 ARG A CB  
1814 C CG  . ARG A 229 ? 0.8973 0.6456 0.7444 0.0091  -0.0400 -0.0469 240 ARG A CG  
1815 C CD  . ARG A 229 ? 0.9771 0.7193 0.8148 0.0111  -0.0410 -0.0540 240 ARG A CD  
1816 N NE  . ARG A 229 ? 0.9977 0.7381 0.8374 0.0096  -0.0440 -0.0547 240 ARG A NE  
1817 C CZ  . ARG A 229 ? 1.0807 0.8274 0.9315 0.0099  -0.0412 -0.0537 240 ARG A CZ  
1818 N NH1 . ARG A 229 ? 0.7855 0.5378 0.6449 0.0117  -0.0359 -0.0528 240 ARG A NH1 
1819 N NH2 . ARG A 229 ? 1.0250 0.7725 0.8783 0.0084  -0.0437 -0.0537 240 ARG A NH2 
1820 N N   . ASP A 230 ? 0.7083 0.4630 0.5559 -0.0014 -0.0527 -0.0329 241 ASP A N   
1821 C CA  . ASP A 230 ? 0.7013 0.4548 0.5463 -0.0047 -0.0581 -0.0308 241 ASP A CA  
1822 C C   . ASP A 230 ? 0.7181 0.4759 0.5724 -0.0074 -0.0586 -0.0236 241 ASP A C   
1823 O O   . ASP A 230 ? 0.7259 0.4833 0.5791 -0.0103 -0.0630 -0.0212 241 ASP A O   
1824 C CB  . ASP A 230 ? 0.7380 0.4929 0.5726 -0.0050 -0.0604 -0.0324 241 ASP A CB  
1825 C CG  . ASP A 230 ? 0.8868 0.6490 0.7221 -0.0041 -0.0572 -0.0299 241 ASP A CG  
1826 O OD1 . ASP A 230 ? 0.9099 0.6765 0.7544 -0.0039 -0.0538 -0.0257 241 ASP A OD1 
1827 O OD2 . ASP A 230 ? 0.9110 0.6744 0.7376 -0.0035 -0.0581 -0.0321 241 ASP A OD2 
1828 N N   . GLY A 231 ? 0.6112 0.3732 0.4747 -0.0066 -0.0544 -0.0203 242 GLY A N   
1829 C CA  . GLY A 231 ? 0.5871 0.3534 0.4599 -0.0089 -0.0546 -0.0135 242 GLY A CA  
1830 C C   . GLY A 231 ? 0.5958 0.3681 0.4674 -0.0107 -0.0558 -0.0091 242 GLY A C   
1831 O O   . GLY A 231 ? 0.5719 0.3478 0.4508 -0.0128 -0.0564 -0.0033 242 GLY A O   
1832 N N   . ARG A 232 ? 0.5842 0.3577 0.4468 -0.0099 -0.0562 -0.0117 243 ARG A N   
1833 C CA  . ARG A 232 ? 0.5802 0.3591 0.4405 -0.0117 -0.0578 -0.0079 243 ARG A CA  
1834 C C   . ARG A 232 ? 0.6285 0.4140 0.4917 -0.0102 -0.0535 -0.0057 243 ARG A C   
1835 O O   . ARG A 232 ? 0.6372 0.4275 0.4979 -0.0114 -0.0544 -0.0030 243 ARG A O   
1836 C CB  . ARG A 232 ? 0.5517 0.3281 0.3999 -0.0121 -0.0615 -0.0119 243 ARG A CB  
1837 C CG  . ARG A 232 ? 0.6814 0.4525 0.5267 -0.0145 -0.0668 -0.0126 243 ARG A CG  
1838 C CD  . ARG A 232 ? 0.9033 0.6720 0.7366 -0.0148 -0.0705 -0.0164 243 ARG A CD  
1839 N NE  . ARG A 232 ? 1.0441 0.8186 0.8741 -0.0157 -0.0709 -0.0136 243 ARG A NE  
1840 C CZ  . ARG A 232 ? 1.1642 0.9417 0.9959 -0.0188 -0.0740 -0.0086 243 ARG A CZ  
1841 N NH1 . ARG A 232 ? 0.9878 0.7631 0.8244 -0.0214 -0.0769 -0.0058 243 ARG A NH1 
1842 N NH2 . ARG A 232 ? 0.9291 0.7120 0.7576 -0.0195 -0.0742 -0.0064 243 ARG A NH2 
1843 N N   . LEU A 233 ? 0.4851 0.2709 0.3536 -0.0077 -0.0488 -0.0067 244 LEU A N   
1844 C CA  . LEU A 233 ? 0.4650 0.2570 0.3372 -0.0064 -0.0446 -0.0042 244 LEU A CA  
1845 C C   . LEU A 233 ? 0.4670 0.2594 0.3495 -0.0050 -0.0406 -0.0026 244 LEU A C   
1846 O O   . LEU A 233 ? 0.4277 0.2150 0.3114 -0.0036 -0.0397 -0.0060 244 LEU A O   
1847 C CB  . LEU A 233 ? 0.4696 0.2621 0.3332 -0.0037 -0.0426 -0.0090 244 LEU A CB  
1848 C CG  . LEU A 233 ? 0.5174 0.3167 0.3837 -0.0025 -0.0386 -0.0064 244 LEU A CG  
1849 C CD1 . LEU A 233 ? 0.5243 0.3291 0.3890 -0.0049 -0.0408 -0.0019 244 LEU A CD1 
1850 C CD2 . LEU A 233 ? 0.5366 0.3355 0.3964 0.0008  -0.0357 -0.0118 244 LEU A CD2 
1851 N N   . LEU A 234 ? 0.5431 0.3414 0.4331 -0.0055 -0.0383 0.0027  245 LEU A N   
1852 C CA  . LEU A 234 ? 0.5350 0.3344 0.4349 -0.0042 -0.0342 0.0047  245 LEU A CA  
1853 C C   . LEU A 234 ? 0.5634 0.3679 0.4642 -0.0022 -0.0299 0.0054  245 LEU A C   
1854 O O   . LEU A 234 ? 0.5378 0.3470 0.4353 -0.0030 -0.0304 0.0074  245 LEU A O   
1855 C CB  . LEU A 234 ? 0.5311 0.3329 0.4406 -0.0067 -0.0354 0.0111  245 LEU A CB  
1856 C CG  . LEU A 234 ? 0.5785 0.3751 0.4899 -0.0083 -0.0386 0.0109  245 LEU A CG  
1857 C CD1 . LEU A 234 ? 0.5735 0.3735 0.4935 -0.0110 -0.0401 0.0175  245 LEU A CD1 
1858 C CD2 . LEU A 234 ? 0.5816 0.3734 0.4962 -0.0061 -0.0362 0.0072  245 LEU A CD2 
1859 N N   . VAL A 235 ? 0.4393 0.2429 0.3445 0.0003  -0.0258 0.0036  246 VAL A N   
1860 C CA  . VAL A 235 ? 0.4235 0.2317 0.3308 0.0023  -0.0214 0.0045  246 VAL A CA  
1861 C C   . VAL A 235 ? 0.4479 0.2578 0.3669 0.0027  -0.0183 0.0083  246 VAL A C   
1862 O O   . VAL A 235 ? 0.4586 0.2642 0.3816 0.0037  -0.0173 0.0064  246 VAL A O   
1863 C CB  . VAL A 235 ? 0.4671 0.2729 0.3676 0.0054  -0.0189 -0.0018 246 VAL A CB  
1864 C CG1 . VAL A 235 ? 0.4610 0.2720 0.3642 0.0073  -0.0144 -0.0006 246 VAL A CG1 
1865 C CG2 . VAL A 235 ? 0.4709 0.2751 0.3597 0.0051  -0.0220 -0.0057 246 VAL A CG2 
1866 N N   . SER A 236 ? 0.4685 0.2844 0.3929 0.0019  -0.0169 0.0136  247 SER A N   
1867 C CA  . SER A 236 ? 0.4432 0.2613 0.3787 0.0022  -0.0139 0.0176  247 SER A CA  
1868 C C   . SER A 236 ? 0.4754 0.2973 0.4122 0.0045  -0.0094 0.0176  247 SER A C   
1869 O O   . SER A 236 ? 0.4601 0.2857 0.3914 0.0046  -0.0092 0.0175  247 SER A O   
1870 C CB  . SER A 236 ? 0.4453 0.2673 0.3870 -0.0006 -0.0160 0.0243  247 SER A CB  
1871 O OG  . SER A 236 ? 0.4750 0.3025 0.4136 -0.0016 -0.0165 0.0270  247 SER A OG  
1872 N N   . CYS A 237 ? 0.4236 0.2447 0.3677 0.0063  -0.0058 0.0176  248 CYS A N   
1873 C CA  . CYS A 237 ? 0.4116 0.2366 0.3587 0.0083  -0.0014 0.0185  248 CYS A CA  
1874 C C   . CYS A 237 ? 0.4506 0.2788 0.4091 0.0076  0.0002  0.0243  248 CYS A C   
1875 O O   . CYS A 237 ? 0.4069 0.2330 0.3713 0.0065  -0.0011 0.0264  248 CYS A O   
1876 C CB  . CYS A 237 ? 0.4049 0.2261 0.3500 0.0114  0.0018  0.0129  248 CYS A CB  
1877 S SG  . CYS A 237 ? 0.4428 0.2577 0.3941 0.0124  0.0025  0.0108  248 CYS A SG  
1878 N N   . HIS A 238 ? 0.3372 0.1706 0.2985 0.0083  0.0031  0.0271  249 HIS A N   
1879 C CA  . HIS A 238 ? 0.3277 0.1653 0.2985 0.0071  0.0038  0.0335  249 HIS A CA  
1880 C C   . HIS A 238 ? 0.4203 0.2602 0.3969 0.0093  0.0085  0.0344  249 HIS A C   
1881 O O   . HIS A 238 ? 0.4259 0.2649 0.3987 0.0117  0.0112  0.0303  249 HIS A O   
1882 C CB  . HIS A 238 ? 0.3386 0.1814 0.3072 0.0046  0.0012  0.0377  249 HIS A CB  
1883 C CG  . HIS A 238 ? 0.3784 0.2191 0.3415 0.0024  -0.0035 0.0371  249 HIS A CG  
1884 N ND1 . HIS A 238 ? 0.3942 0.2348 0.3622 -0.0001 -0.0063 0.0412  249 HIS A ND1 
1885 C CD2 . HIS A 238 ? 0.4026 0.2409 0.3556 0.0022  -0.0059 0.0329  249 HIS A CD2 
1886 C CE1 . HIS A 238 ? 0.3909 0.2293 0.3521 -0.0017 -0.0103 0.0395  249 HIS A CE1 
1887 N NE2 . HIS A 238 ? 0.4026 0.2394 0.3547 -0.0004 -0.0101 0.0345  249 HIS A NE2 
1888 N N   . SER A 239 ? 0.4495 0.2925 0.4355 0.0085  0.0094  0.0398  250 SER A N   
1889 C CA  . SER A 239 ? 0.4442 0.2889 0.4373 0.0105  0.0137  0.0412  250 SER A CA  
1890 C C   . SER A 239 ? 0.5043 0.3542 0.4952 0.0112  0.0159  0.0424  250 SER A C   
1891 O O   . SER A 239 ? 0.4778 0.3286 0.4723 0.0132  0.0196  0.0420  250 SER A O   
1892 C CB  . SER A 239 ? 0.4718 0.3180 0.4757 0.0094  0.0137  0.0467  250 SER A CB  
1893 O OG  . SER A 239 ? 0.5412 0.3827 0.5477 0.0089  0.0119  0.0457  250 SER A OG  
1894 N N   . ASP A 240 ? 0.5024 0.3559 0.4877 0.0095  0.0136  0.0439  251 ASP A N   
1895 C CA  . ASP A 240 ? 0.4992 0.3578 0.4818 0.0100  0.0155  0.0449  251 ASP A CA  
1896 C C   . ASP A 240 ? 0.5269 0.3841 0.5000 0.0119  0.0166  0.0390  251 ASP A C   
1897 O O   . ASP A 240 ? 0.5336 0.3950 0.5034 0.0125  0.0180  0.0394  251 ASP A O   
1898 C CB  . ASP A 240 ? 0.5255 0.3892 0.5067 0.0073  0.0127  0.0496  251 ASP A CB  
1899 C CG  . ASP A 240 ? 0.6887 0.5510 0.6604 0.0059  0.0089  0.0470  251 ASP A CG  
1900 O OD1 . ASP A 240 ? 0.6801 0.5369 0.6486 0.0062  0.0074  0.0430  251 ASP A OD1 
1901 O OD2 . ASP A 240 ? 0.8058 0.6724 0.7733 0.0045  0.0073  0.0491  251 ASP A OD2 
1902 N N   . GLY A 241 ? 0.3935 0.2449 0.3622 0.0129  0.0159  0.0337  252 GLY A N   
1903 C CA  . GLY A 241 ? 0.3893 0.2389 0.3490 0.0148  0.0168  0.0279  252 GLY A CA  
1904 C C   . GLY A 241 ? 0.4399 0.2893 0.3896 0.0136  0.0132  0.0257  252 GLY A C   
1905 O O   . GLY A 241 ? 0.4335 0.2832 0.3753 0.0150  0.0140  0.0218  252 GLY A O   
1906 N N   . SER A 242 ? 0.4232 0.2720 0.3729 0.0110  0.0093  0.0281  253 SER A N   
1907 C CA  . SER A 242 ? 0.4259 0.2746 0.3665 0.0095  0.0056  0.0265  253 SER A CA  
1908 C C   . SER A 242 ? 0.4986 0.3409 0.4362 0.0090  0.0026  0.0230  253 SER A C   
1909 O O   . SER A 242 ? 0.5014 0.3400 0.4449 0.0093  0.0031  0.0228  253 SER A O   
1910 C CB  . SER A 242 ? 0.4285 0.2824 0.3709 0.0067  0.0032  0.0324  253 SER A CB  
1911 O OG  . SER A 242 ? 0.4631 0.3163 0.4136 0.0049  0.0016  0.0365  253 SER A OG  
1912 N N   . TYR A 243 ? 0.4638 0.3050 0.3920 0.0082  -0.0005 0.0203  254 TYR A N   
1913 C CA  . TYR A 243 ? 0.4750 0.3104 0.3999 0.0073  -0.0040 0.0175  254 TYR A CA  
1914 C C   . TYR A 243 ? 0.5413 0.3781 0.4591 0.0049  -0.0082 0.0183  254 TYR A C   
1915 O O   . TYR A 243 ? 0.5421 0.3821 0.4532 0.0052  -0.0083 0.0175  254 TYR A O   
1916 C CB  . TYR A 243 ? 0.4943 0.3240 0.4138 0.0098  -0.0028 0.0106  254 TYR A CB  
1917 C CG  . TYR A 243 ? 0.5281 0.3582 0.4369 0.0112  -0.0028 0.0060  254 TYR A CG  
1918 C CD1 . TYR A 243 ? 0.5614 0.3887 0.4611 0.0103  -0.0066 0.0030  254 TYR A CD1 
1919 C CD2 . TYR A 243 ? 0.5402 0.3733 0.4478 0.0135  0.0010  0.0047  254 TYR A CD2 
1920 C CE1 . TYR A 243 ? 0.5804 0.4080 0.4702 0.0116  -0.0066 -0.0013 254 TYR A CE1 
1921 C CE2 . TYR A 243 ? 0.5656 0.3992 0.4633 0.0149  0.0011  0.0005  254 TYR A CE2 
1922 C CZ  . TYR A 243 ? 0.6895 0.5203 0.5783 0.0140  -0.0027 -0.0025 254 TYR A CZ  
1923 O OH  . TYR A 243 ? 0.7234 0.5547 0.6025 0.0154  -0.0027 -0.0067 254 TYR A OH  
1924 N N   . CYS A 244 ? 0.5589 0.3932 0.4783 0.0026  -0.0119 0.0200  255 CYS A N   
1925 C CA  . CYS A 244 ? 0.5713 0.4065 0.4849 0.0001  -0.0163 0.0212  255 CYS A CA  
1926 C C   . CYS A 244 ? 0.5633 0.3920 0.4704 -0.0002 -0.0196 0.0165  255 CYS A C   
1927 O O   . CYS A 244 ? 0.5405 0.3641 0.4496 0.0011  -0.0188 0.0134  255 CYS A O   
1928 C CB  . CYS A 244 ? 0.5956 0.4340 0.5167 -0.0028 -0.0182 0.0279  255 CYS A CB  
1929 S SG  . CYS A 244 ? 0.6524 0.4973 0.5840 -0.0025 -0.0143 0.0340  255 CYS A SG  
1930 N N   . GLN A 245 ? 0.4023 0.2312 0.3016 -0.0018 -0.0233 0.0159  256 GLN A N   
1931 C CA  . GLN A 245 ? 0.3889 0.2119 0.2815 -0.0024 -0.0270 0.0118  256 GLN A CA  
1932 C C   . GLN A 245 ? 0.4536 0.2773 0.3467 -0.0059 -0.0315 0.0158  256 GLN A C   
1933 O O   . GLN A 245 ? 0.4423 0.2710 0.3343 -0.0075 -0.0327 0.0194  256 GLN A O   
1934 C CB  . GLN A 245 ? 0.4060 0.2278 0.2870 -0.0009 -0.0274 0.0063  256 GLN A CB  
1935 C CG  . GLN A 245 ? 0.6225 0.4441 0.5025 0.0026  -0.0229 0.0024  256 GLN A CG  
1936 C CD  . GLN A 245 ? 0.9716 0.7903 0.8402 0.0043  -0.0237 -0.0040 256 GLN A CD  
1937 O OE1 . GLN A 245 ? 0.9305 0.7508 0.7914 0.0034  -0.0263 -0.0045 256 GLN A OE1 
1938 N NE2 . GLN A 245 ? 0.8905 0.7049 0.7580 0.0070  -0.0214 -0.0089 256 GLN A NE2 
1939 N N   . TRP A 246 ? 0.5089 0.3276 0.4039 -0.0070 -0.0341 0.0152  257 TRP A N   
1940 C CA  . TRP A 246 ? 0.5132 0.3322 0.4098 -0.0103 -0.0383 0.0192  257 TRP A CA  
1941 C C   . TRP A 246 ? 0.6135 0.4267 0.5023 -0.0112 -0.0426 0.0152  257 TRP A C   
1942 O O   . TRP A 246 ? 0.6015 0.4091 0.4886 -0.0097 -0.0422 0.0105  257 TRP A O   
1943 C CB  . TRP A 246 ? 0.4797 0.2989 0.3878 -0.0113 -0.0376 0.0237  257 TRP A CB  
1944 C CG  . TRP A 246 ? 0.4759 0.2998 0.3924 -0.0101 -0.0331 0.0271  257 TRP A CG  
1945 C CD1 . TRP A 246 ? 0.5046 0.3277 0.4238 -0.0072 -0.0288 0.0246  257 TRP A CD1 
1946 C CD2 . TRP A 246 ? 0.4724 0.3022 0.3957 -0.0117 -0.0327 0.0336  257 TRP A CD2 
1947 N NE1 . TRP A 246 ? 0.4924 0.3206 0.4197 -0.0069 -0.0257 0.0292  257 TRP A NE1 
1948 C CE2 . TRP A 246 ? 0.5139 0.3463 0.4438 -0.0096 -0.0280 0.0347  257 TRP A CE2 
1949 C CE3 . TRP A 246 ? 0.4907 0.3241 0.4151 -0.0147 -0.0358 0.0386  257 TRP A CE3 
1950 C CZ2 . TRP A 246 ? 0.5062 0.3444 0.4437 -0.0104 -0.0264 0.0406  257 TRP A CZ2 
1951 C CZ3 . TRP A 246 ? 0.5048 0.3440 0.4369 -0.0155 -0.0342 0.0445  257 TRP A CZ3 
1952 C CH2 . TRP A 246 ? 0.5057 0.3472 0.4442 -0.0134 -0.0296 0.0454  257 TRP A CH2 
1953 N N   . PRO A 247 ? 0.5872 0.4013 0.4711 -0.0137 -0.0467 0.0168  258 PRO A N   
1954 C CA  . PRO A 247 ? 0.6026 0.4111 0.4795 -0.0148 -0.0511 0.0133  258 PRO A CA  
1955 C C   . PRO A 247 ? 0.6647 0.4704 0.5481 -0.0170 -0.0536 0.0161  258 PRO A C   
1956 O O   . PRO A 247 ? 0.6433 0.4526 0.5351 -0.0187 -0.0533 0.0218  258 PRO A O   
1957 C CB  . PRO A 247 ? 0.6369 0.4483 0.5062 -0.0166 -0.0543 0.0144  258 PRO A CB  
1958 C CG  . PRO A 247 ? 0.6869 0.5054 0.5633 -0.0179 -0.0529 0.0210  258 PRO A CG  
1959 C CD  . PRO A 247 ? 0.6150 0.4356 0.4989 -0.0155 -0.0476 0.0216  258 PRO A CD  
1960 N N   . VAL A 248 ? 0.6313 0.4305 0.5107 -0.0170 -0.0560 0.0119  259 VAL A N   
1961 C CA  . VAL A 248 ? 0.6342 0.4300 0.5185 -0.0191 -0.0589 0.0139  259 VAL A CA  
1962 C C   . VAL A 248 ? 0.7302 0.5231 0.6062 -0.0214 -0.0643 0.0125  259 VAL A C   
1963 O O   . VAL A 248 ? 0.7269 0.5144 0.5950 -0.0204 -0.0659 0.0069  259 VAL A O   
1964 C CB  . VAL A 248 ? 0.6707 0.4613 0.5584 -0.0173 -0.0570 0.0105  259 VAL A CB  
1965 C CG1 . VAL A 248 ? 0.6663 0.4543 0.5602 -0.0195 -0.0597 0.0133  259 VAL A CG1 
1966 C CG2 . VAL A 248 ? 0.6550 0.4484 0.5496 -0.0147 -0.0515 0.0110  259 VAL A CG2 
1967 N N   . SER A 249 ? 0.7846 0.5807 0.6623 -0.0244 -0.0673 0.0175  260 SER A N   
1968 C CA  . SER A 249 ? 1.1448 0.9385 1.0151 -0.0268 -0.0726 0.0169  260 SER A CA  
1969 C C   . SER A 249 ? 1.4540 1.2517 1.3295 -0.0302 -0.0753 0.0236  260 SER A C   
1970 O O   . SER A 249 ? 0.9676 0.7708 0.8505 -0.0305 -0.0729 0.0285  260 SER A O   
1971 C CB  . SER A 249 ? 1.1903 0.9847 1.0496 -0.0259 -0.0733 0.0134  260 SER A CB  
1972 O OG  . SER A 249 ? 1.2688 1.0699 1.1297 -0.0252 -0.0704 0.0162  260 SER A OG  
1973 N N   . GLN A 253 ? 1.3927 1.2088 1.3041 -0.0368 -0.0734 0.0488  264 GLN A N   
1974 C CA  . GLN A 253 ? 1.3825 1.2045 1.3037 -0.0373 -0.0711 0.0549  264 GLN A CA  
1975 C C   . GLN A 253 ? 1.4132 1.2374 1.3382 -0.0342 -0.0656 0.0540  264 GLN A C   
1976 O O   . GLN A 253 ? 1.4150 1.2353 1.3398 -0.0318 -0.0633 0.0496  264 GLN A O   
1977 C CB  . GLN A 253 ? 1.4036 1.2308 1.3229 -0.0397 -0.0733 0.0593  264 GLN A CB  
1978 N N   . GLN A 254 ? 1.2246 1.0551 1.1533 -0.0343 -0.0636 0.0582  265 GLN A N   
1979 C CA  . GLN A 254 ? 1.1975 1.0307 1.1301 -0.0316 -0.0585 0.0580  265 GLN A CA  
1980 C C   . GLN A 254 ? 1.1896 1.0249 1.1138 -0.0304 -0.0574 0.0552  265 GLN A C   
1981 O O   . GLN A 254 ? 1.1880 1.0282 1.1107 -0.0318 -0.0583 0.0585  265 GLN A O   
1982 C CB  . GLN A 254 ? 1.2086 1.0475 1.1516 -0.0325 -0.0567 0.0647  265 GLN A CB  
1983 N N   . PRO A 255 ? 0.8646 0.6964 0.7831 -0.0277 -0.0556 0.0492  266 PRO A N   
1984 C CA  . PRO A 255 ? 0.8429 0.6765 0.7528 -0.0264 -0.0546 0.0463  266 PRO A CA  
1985 C C   . PRO A 255 ? 0.7990 0.6377 0.7135 -0.0245 -0.0499 0.0481  266 PRO A C   
1986 O O   . PRO A 255 ? 0.7450 0.5855 0.6691 -0.0241 -0.0472 0.0513  266 PRO A O   
1987 C CB  . PRO A 255 ? 0.8735 0.7008 0.7763 -0.0244 -0.0547 0.0391  266 PRO A CB  
1988 C CG  . PRO A 255 ? 0.9273 0.7512 0.8379 -0.0233 -0.0527 0.0387  266 PRO A CG  
1989 C CD  . PRO A 255 ? 0.8727 0.6985 0.7919 -0.0259 -0.0544 0.0448  266 PRO A CD  
1990 N N   . GLU A 256 ? 0.7454 0.5866 0.6528 -0.0234 -0.0489 0.0460  267 GLU A N   
1991 C CA  . GLU A 256 ? 0.7183 0.5641 0.6282 -0.0214 -0.0445 0.0468  267 GLU A CA  
1992 C C   . GLU A 256 ? 0.7059 0.5485 0.6107 -0.0182 -0.0416 0.0405  267 GLU A C   
1993 O O   . GLU A 256 ? 0.7052 0.5427 0.6024 -0.0176 -0.0435 0.0354  267 GLU A O   
1994 C CB  . GLU A 256 ? 0.7412 0.5930 0.6473 -0.0227 -0.0453 0.0497  267 GLU A CB  
1995 C CG  . GLU A 256 ? 0.8804 0.7374 0.7945 -0.0251 -0.0459 0.0570  267 GLU A CG  
1996 C CD  . GLU A 256 ? 1.2152 1.0777 1.1248 -0.0266 -0.0474 0.0597  267 GLU A CD  
1997 O OE1 . GLU A 256 ? 1.0486 0.9122 0.9505 -0.0253 -0.0465 0.0565  267 GLU A OE1 
1998 O OE2 . GLU A 256 ? 1.2193 1.0850 1.1330 -0.0293 -0.0495 0.0651  267 GLU A OE2 
1999 N N   . PRO A 257 ? 0.5439 0.3893 0.4526 -0.0159 -0.0371 0.0407  268 PRO A N   
2000 C CA  . PRO A 257 ? 0.5380 0.3806 0.4418 -0.0128 -0.0342 0.0347  268 PRO A CA  
2001 C C   . PRO A 257 ? 0.6190 0.4626 0.5117 -0.0122 -0.0352 0.0313  268 PRO A C   
2002 O O   . PRO A 257 ? 0.6304 0.4795 0.5213 -0.0131 -0.0354 0.0341  268 PRO A O   
2003 C CB  . PRO A 257 ? 0.5448 0.3911 0.4564 -0.0110 -0.0293 0.0370  268 PRO A CB  
2004 C CG  . PRO A 257 ? 0.5989 0.4514 0.5162 -0.0132 -0.0299 0.0438  268 PRO A CG  
2005 C CD  . PRO A 257 ? 0.5482 0.3990 0.4664 -0.0161 -0.0343 0.0463  268 PRO A CD  
2006 N N   . LEU A 258 ? 0.6180 0.4563 0.5031 -0.0107 -0.0360 0.0250  269 LEU A N   
2007 C CA  . LEU A 258 ? 0.6046 0.4435 0.4788 -0.0097 -0.0366 0.0211  269 LEU A CA  
2008 C C   . LEU A 258 ? 0.6352 0.4789 0.5094 -0.0075 -0.0323 0.0210  269 LEU A C   
2009 O O   . LEU A 258 ? 0.6309 0.4792 0.5002 -0.0078 -0.0327 0.0220  269 LEU A O   
2010 C CB  . LEU A 258 ? 0.6018 0.4336 0.4686 -0.0081 -0.0379 0.0142  269 LEU A CB  
2011 C CG  . LEU A 258 ? 0.6559 0.4829 0.5189 -0.0103 -0.0429 0.0132  269 LEU A CG  
2012 C CD1 . LEU A 258 ? 0.6489 0.4687 0.5067 -0.0085 -0.0434 0.0067  269 LEU A CD1 
2013 C CD2 . LEU A 258 ? 0.6899 0.5195 0.5449 -0.0121 -0.0465 0.0140  269 LEU A CD2 
2014 N N   . ARG A 259 ? 0.5098 0.3527 0.3897 -0.0052 -0.0283 0.0199  270 ARG A N   
2015 C CA  . ARG A 259 ? 0.4970 0.3444 0.3778 -0.0031 -0.0240 0.0200  270 ARG A CA  
2016 C C   . ARG A 259 ? 0.5211 0.3683 0.4124 -0.0019 -0.0203 0.0219  270 ARG A C   
2017 O O   . ARG A 259 ? 0.5327 0.3750 0.4279 -0.0016 -0.0204 0.0206  270 ARG A O   
2018 C CB  . ARG A 259 ? 0.5363 0.3817 0.4076 -0.0004 -0.0228 0.0135  270 ARG A CB  
2019 C CG  . ARG A 259 ? 0.7628 0.6005 0.6298 0.0007  -0.0241 0.0077  270 ARG A CG  
2020 C CD  . ARG A 259 ? 0.9528 0.7889 0.8093 0.0032  -0.0235 0.0015  270 ARG A CD  
2021 N NE  . ARG A 259 ? 1.0960 0.9351 0.9441 0.0020  -0.0262 0.0016  270 ARG A NE  
2022 C CZ  . ARG A 259 ? 1.2546 1.0996 1.0998 0.0027  -0.0244 0.0025  270 ARG A CZ  
2023 N NH1 . ARG A 259 ? 1.0775 0.9259 0.9274 0.0045  -0.0200 0.0035  270 ARG A NH1 
2024 N NH2 . ARG A 259 ? 1.0387 0.8861 0.8760 0.0016  -0.0272 0.0025  270 ARG A NH2 
2025 N N   . SER A 260 ? 0.5425 0.3953 0.4382 -0.0013 -0.0170 0.0251  271 SER A N   
2026 C CA  . SER A 260 ? 0.5230 0.3764 0.4286 -0.0001 -0.0132 0.0273  271 SER A CA  
2027 C C   . SER A 260 ? 0.5995 0.4574 0.5047 0.0020  -0.0092 0.0271  271 SER A C   
2028 O O   . SER A 260 ? 0.6105 0.4735 0.5119 0.0013  -0.0095 0.0288  271 SER A O   
2029 C CB  . SER A 260 ? 0.5187 0.3750 0.4338 -0.0026 -0.0142 0.0341  271 SER A CB  
2030 O OG  . SER A 260 ? 0.5560 0.4132 0.4806 -0.0013 -0.0105 0.0363  271 SER A OG  
2031 N N   . LEU A 261 ? 0.5735 0.4296 0.4827 0.0044  -0.0054 0.0250  272 LEU A N   
2032 C CA  . LEU A 261 ? 0.5747 0.4342 0.4826 0.0067  -0.0016 0.0238  272 LEU A CA  
2033 C C   . LEU A 261 ? 0.5634 0.4213 0.4791 0.0088  0.0024  0.0235  272 LEU A C   
2034 O O   . LEU A 261 ? 0.5598 0.4123 0.4783 0.0093  0.0023  0.0213  272 LEU A O   
2035 C CB  . LEU A 261 ? 0.5977 0.4553 0.4943 0.0085  -0.0018 0.0176  272 LEU A CB  
2036 C CG  . LEU A 261 ? 0.6787 0.5290 0.5720 0.0101  -0.0022 0.0116  272 LEU A CG  
2037 C CD1 . LEU A 261 ? 0.6918 0.5411 0.5783 0.0131  0.0004  0.0060  272 LEU A CD1 
2038 C CD2 . LEU A 261 ? 0.7209 0.5673 0.6084 0.0082  -0.0071 0.0101  272 LEU A CD2 
2039 N N   . VAL A 262 ? 0.4364 0.2991 0.3556 0.0098  0.0059  0.0257  273 VAL A N   
2040 C CA  . VAL A 262 ? 0.4231 0.2846 0.3480 0.0122  0.0101  0.0246  273 VAL A CA  
2041 C C   . VAL A 262 ? 0.4769 0.3379 0.3940 0.0149  0.0123  0.0191  273 VAL A C   
2042 O O   . VAL A 262 ? 0.4334 0.2995 0.3477 0.0153  0.0138  0.0200  273 VAL A O   
2043 C CB  . VAL A 262 ? 0.4590 0.3258 0.3930 0.0118  0.0126  0.0304  273 VAL A CB  
2044 C CG1 . VAL A 262 ? 0.4415 0.3066 0.3815 0.0142  0.0168  0.0292  273 VAL A CG1 
2045 C CG2 . VAL A 262 ? 0.4564 0.3241 0.3973 0.0091  0.0101  0.0360  273 VAL A CG2 
2046 N N   . PRO A 263 ? 0.5598 0.4149 0.4732 0.0167  0.0126  0.0134  274 PRO A N   
2047 C CA  . PRO A 263 ? 0.5735 0.4278 0.4777 0.0190  0.0138  0.0078  274 PRO A CA  
2048 C C   . PRO A 263 ? 0.6123 0.4705 0.5180 0.0211  0.0182  0.0077  274 PRO A C   
2049 O O   . PRO A 263 ? 0.6153 0.4743 0.5132 0.0228  0.0191  0.0038  274 PRO A O   
2050 C CB  . PRO A 263 ? 0.5968 0.4437 0.4992 0.0204  0.0134  0.0023  274 PRO A CB  
2051 C CG  . PRO A 263 ? 0.6504 0.4948 0.5629 0.0195  0.0136  0.0053  274 PRO A CG  
2052 C CD  . PRO A 263 ? 0.5882 0.4370 0.5053 0.0166  0.0115  0.0118  274 PRO A CD  
2053 N N   . TYR A 264 ? 0.4787 0.3394 0.3938 0.0212  0.0209  0.0118  275 TYR A N   
2054 C CA  . TYR A 264 ? 0.4801 0.3439 0.3969 0.0234  0.0252  0.0116  275 TYR A CA  
2055 C C   . TYR A 264 ? 0.6042 0.4751 0.5256 0.0220  0.0261  0.0177  275 TYR A C   
2056 O O   . TYR A 264 ? 0.5996 0.4720 0.5304 0.0216  0.0277  0.0219  275 TYR A O   
2057 C CB  . TYR A 264 ? 0.4665 0.3262 0.3901 0.0252  0.0281  0.0100  275 TYR A CB  
2058 C CG  . TYR A 264 ? 0.4490 0.3025 0.3665 0.0272  0.0281  0.0032  275 TYR A CG  
2059 C CD1 . TYR A 264 ? 0.4610 0.3146 0.3683 0.0284  0.0278  -0.0014 275 TYR A CD1 
2060 C CD2 . TYR A 264 ? 0.4585 0.3060 0.3803 0.0277  0.0282  0.0013  275 TYR A CD2 
2061 C CE1 . TYR A 264 ? 0.4508 0.2986 0.3523 0.0302  0.0276  -0.0076 275 TYR A CE1 
2062 C CE2 . TYR A 264 ? 0.4732 0.3150 0.3894 0.0294  0.0280  -0.0049 275 TYR A CE2 
2063 C CZ  . TYR A 264 ? 0.5419 0.3839 0.4480 0.0307  0.0277  -0.0093 275 TYR A CZ  
2064 O OH  . TYR A 264 ? 0.5199 0.3561 0.4204 0.0325  0.0275  -0.0155 275 TYR A OH  
2065 N N   . GLY A 265 ? 0.8732 0.7487 0.7879 0.0214  0.0250  0.0181  276 GLY A N   
2066 C CA  . GLY A 265 ? 0.8614 0.7440 0.7787 0.0204  0.0261  0.0232  276 GLY A CA  
2067 C C   . GLY A 265 ? 0.9043 0.7893 0.8292 0.0176  0.0242  0.0297  276 GLY A C   
2068 O O   . GLY A 265 ? 0.9346 0.8159 0.8626 0.0163  0.0219  0.0305  276 GLY A O   
2069 N N   . PRO A 266 ? 0.5605 0.4520 0.4884 0.0167  0.0252  0.0345  277 PRO A N   
2070 C CA  . PRO A 266 ? 0.5401 0.4344 0.4758 0.0142  0.0238  0.0410  277 PRO A CA  
2071 C C   . PRO A 266 ? 0.5689 0.4629 0.5155 0.0147  0.0265  0.0441  277 PRO A C   
2072 O O   . PRO A 266 ? 0.5565 0.4521 0.5101 0.0128  0.0254  0.0494  277 PRO A O   
2073 C CB  . PRO A 266 ? 0.5604 0.4619 0.4930 0.0130  0.0235  0.0444  277 PRO A CB  
2074 C CG  . PRO A 266 ? 0.6269 0.5297 0.5514 0.0154  0.0256  0.0397  277 PRO A CG  
2075 C CD  . PRO A 266 ? 0.5757 0.4724 0.4998 0.0179  0.0276  0.0343  277 PRO A CD  
2076 N N   . PHE A 267 ? 0.5705 0.4624 0.5187 0.0173  0.0300  0.0411  278 PHE A N   
2077 C CA  . PHE A 267 ? 0.5602 0.4511 0.5185 0.0181  0.0327  0.0436  278 PHE A CA  
2078 C C   . PHE A 267 ? 0.6045 0.4904 0.5681 0.0171  0.0308  0.0441  278 PHE A C   
2079 O O   . PHE A 267 ? 0.6044 0.4862 0.5632 0.0167  0.0283  0.0409  278 PHE A O   
2080 C CB  . PHE A 267 ? 0.5824 0.4714 0.5403 0.0211  0.0366  0.0394  278 PHE A CB  
2081 C CG  . PHE A 267 ? 0.5998 0.4944 0.5556 0.0221  0.0392  0.0402  278 PHE A CG  
2082 C CD1 . PHE A 267 ? 0.6283 0.5264 0.5920 0.0222  0.0417  0.0445  278 PHE A CD1 
2083 C CD2 . PHE A 267 ? 0.6250 0.5212 0.5710 0.0229  0.0390  0.0366  278 PHE A CD2 
2084 C CE1 . PHE A 267 ? 0.6371 0.5404 0.5989 0.0230  0.0441  0.0454  278 PHE A CE1 
2085 C CE2 . PHE A 267 ? 0.6579 0.5594 0.6019 0.0238  0.0414  0.0374  278 PHE A CE2 
2086 C CZ  . PHE A 267 ? 0.6272 0.5322 0.5792 0.0238  0.0439  0.0419  278 PHE A CZ  
2087 N N   . PRO A 268 ? 0.5275 0.4138 0.5012 0.0168  0.0320  0.0482  279 PRO A N   
2088 C CA  . PRO A 268 ? 0.5088 0.3902 0.4880 0.0163  0.0308  0.0485  279 PRO A CA  
2089 C C   . PRO A 268 ? 0.5322 0.4075 0.5093 0.0186  0.0321  0.0424  279 PRO A C   
2090 O O   . PRO A 268 ? 0.5171 0.3918 0.4944 0.0209  0.0355  0.0399  279 PRO A O   
2091 C CB  . PRO A 268 ? 0.5214 0.4052 0.5117 0.0160  0.0326  0.0538  279 PRO A CB  
2092 C CG  . PRO A 268 ? 0.5783 0.4666 0.5685 0.0173  0.0358  0.0547  279 PRO A CG  
2093 C CD  . PRO A 268 ? 0.5364 0.4278 0.5168 0.0167  0.0344  0.0531  279 PRO A CD  
2094 N N   . CYS A 269 ? 0.5111 0.3816 0.4860 0.0179  0.0294  0.0401  280 CYS A N   
2095 C CA  . CYS A 269 ? 0.4767 0.3411 0.4484 0.0198  0.0301  0.0341  280 CYS A CA  
2096 C C   . CYS A 269 ? 0.4945 0.3544 0.4735 0.0196  0.0296  0.0347  280 CYS A C   
2097 O O   . CYS A 269 ? 0.5011 0.3617 0.4847 0.0174  0.0272  0.0389  280 CYS A O   
2098 C CB  . CYS A 269 ? 0.4649 0.3270 0.4259 0.0194  0.0272  0.0297  280 CYS A CB  
2099 S SG  . CYS A 269 ? 0.5079 0.3738 0.4590 0.0207  0.0284  0.0267  280 CYS A SG  
2100 N N   . LYS A 270 ? 0.3641 0.2194 0.3440 0.0218  0.0318  0.0306  281 LYS A N   
2101 C CA  . LYS A 270 ? 0.3468 0.1973 0.3327 0.0218  0.0314  0.0303  281 LYS A CA  
2102 C C   . LYS A 270 ? 0.4162 0.2627 0.3966 0.0204  0.0274  0.0278  281 LYS A C   
2103 O O   . LYS A 270 ? 0.4365 0.2829 0.4079 0.0201  0.0255  0.0251  281 LYS A O   
2104 C CB  . LYS A 270 ? 0.3711 0.2177 0.3589 0.0247  0.0349  0.0263  281 LYS A CB  
2105 C CG  . LYS A 270 ? 0.5079 0.3582 0.4981 0.0264  0.0389  0.0271  281 LYS A CG  
2106 C CD  . LYS A 270 ? 0.6156 0.4620 0.6091 0.0291  0.0423  0.0237  281 LYS A CD  
2107 C CE  . LYS A 270 ? 0.7920 0.6382 0.7966 0.0291  0.0438  0.0277  281 LYS A CE  
2108 N NZ  . LYS A 270 ? 0.9391 0.7888 0.9468 0.0306  0.0459  0.0243  281 LYS A NZ  
2109 N N   . ALA A 271 ? 0.4104 0.2535 0.3966 0.0197  0.0262  0.0289  282 ALA A N   
2110 C CA  . ALA A 271 ? 0.3970 0.2364 0.3793 0.0182  0.0223  0.0272  282 ALA A CA  
2111 C C   . ALA A 271 ? 0.4486 0.2833 0.4219 0.0197  0.0220  0.0204  282 ALA A C   
2112 O O   . ALA A 271 ? 0.4569 0.2895 0.4297 0.0222  0.0251  0.0166  282 ALA A O   
2113 C CB  . ALA A 271 ? 0.3980 0.2343 0.3885 0.0175  0.0216  0.0291  282 ALA A CB  
2114 N N   . ILE A 272 ? 0.3444 0.1776 0.3106 0.0181  0.0182  0.0188  283 ILE A N   
2115 C CA  . ILE A 272 ? 0.3260 0.1536 0.2848 0.0191  0.0170  0.0127  283 ILE A CA  
2116 C C   . ILE A 272 ? 0.3703 0.1931 0.3340 0.0183  0.0152  0.0128  283 ILE A C   
2117 O O   . ILE A 272 ? 0.3546 0.1778 0.3198 0.0158  0.0119  0.0159  283 ILE A O   
2118 C CB  . ILE A 272 ? 0.3594 0.1876 0.3080 0.0179  0.0136  0.0108  283 ILE A CB  
2119 C CG1 . ILE A 272 ? 0.3398 0.1726 0.2832 0.0190  0.0156  0.0103  283 ILE A CG1 
2120 C CG2 . ILE A 272 ? 0.3939 0.2158 0.3355 0.0186  0.0119  0.0048  283 ILE A CG2 
2121 C CD1 . ILE A 272 ? 0.3179 0.1517 0.2512 0.0178  0.0124  0.0087  283 ILE A CD1 
2122 N N   . THR A 273 ? 0.3915 0.2102 0.3579 0.0203  0.0175  0.0095  284 THR A N   
2123 C CA  . THR A 273 ? 0.3747 0.1893 0.3471 0.0197  0.0165  0.0100  284 THR A CA  
2124 C C   . THR A 273 ? 0.4147 0.2237 0.3809 0.0192  0.0132  0.0057  284 THR A C   
2125 O O   . THR A 273 ? 0.4160 0.2223 0.3863 0.0179  0.0113  0.0069  284 THR A O   
2126 C CB  . THR A 273 ? 0.4557 0.2686 0.4350 0.0221  0.0206  0.0090  284 THR A CB  
2127 O OG1 . THR A 273 ? 0.4807 0.2918 0.4542 0.0247  0.0230  0.0036  284 THR A OG1 
2128 C CG2 . THR A 273 ? 0.3673 0.1854 0.3549 0.0222  0.0232  0.0143  284 THR A CG2 
2129 N N   . ARG A 274 ? 0.3016 0.1089 0.2579 0.0201  0.0126  0.0009  285 ARG A N   
2130 C CA  . ARG A 274 ? 0.3106 0.1124 0.2605 0.0196  0.0094  -0.0034 285 ARG A CA  
2131 C C   . ARG A 274 ? 0.3899 0.1923 0.3288 0.0198  0.0078  -0.0067 285 ARG A C   
2132 O O   . ARG A 274 ? 0.3964 0.2015 0.3321 0.0215  0.0105  -0.0081 285 ARG A O   
2133 C CB  . ARG A 274 ? 0.3221 0.1183 0.2731 0.0219  0.0113  -0.0081 285 ARG A CB  
2134 C CG  . ARG A 274 ? 0.3786 0.1699 0.3296 0.0206  0.0080  -0.0097 285 ARG A CG  
2135 C CD  . ARG A 274 ? 0.3577 0.1560 0.3128 0.0215  0.0085  -0.0149 285 ARG A CD  
2136 N NE  . ARG A 274 ? 0.4048 0.2003 0.3563 0.0202  0.0050  -0.0176 285 ARG A NE  
2137 C CZ  . ARG A 274 ? 0.5372 0.3364 0.4888 0.0208  0.0048  -0.0225 285 ARG A CZ  
2138 N NH1 . ARG A 274 ? 0.2886 0.0945 0.2436 0.0226  0.0075  -0.0251 285 ARG A NH1 
2139 N NH2 . ARG A 274 ? 0.4206 0.2171 0.3689 0.0195  0.0018  -0.0244 285 ARG A NH2 
2140 N N   . ILE A 275 ? 0.3158 0.1158 0.2487 0.0179  0.0035  -0.0078 286 ILE A N   
2141 C CA  . ILE A 275 ? 0.3082 0.1085 0.2303 0.0179  0.0015  -0.0107 286 ILE A CA  
2142 C C   . ILE A 275 ? 0.3731 0.1673 0.2888 0.0173  -0.0022 -0.0150 286 ILE A C   
2143 O O   . ILE A 275 ? 0.3655 0.1569 0.2850 0.0156  -0.0046 -0.0135 286 ILE A O   
2144 C CB  . ILE A 275 ? 0.3362 0.1424 0.2574 0.0156  -0.0004 -0.0059 286 ILE A CB  
2145 C CG1 . ILE A 275 ? 0.3411 0.1482 0.2512 0.0159  -0.0017 -0.0091 286 ILE A CG1 
2146 C CG2 . ILE A 275 ? 0.3189 0.1246 0.2436 0.0125  -0.0043 -0.0020 286 ILE A CG2 
2147 C CD1 . ILE A 275 ? 0.3921 0.2062 0.3017 0.0149  -0.0015 -0.0049 286 ILE A CD1 
2148 N N   . LEU A 276 ? 0.3843 0.1764 0.2903 0.0187  -0.0025 -0.0203 287 LEU A N   
2149 C CA  . LEU A 276 ? 0.3909 0.1772 0.2894 0.0183  -0.0061 -0.0247 287 LEU A CA  
2150 C C   . LEU A 276 ? 0.4725 0.2604 0.3607 0.0178  -0.0086 -0.0263 287 LEU A C   
2151 O O   . LEU A 276 ? 0.4664 0.2579 0.3509 0.0193  -0.0063 -0.0273 287 LEU A O   
2152 C CB  . LEU A 276 ? 0.3809 0.1617 0.2773 0.0210  -0.0042 -0.0307 287 LEU A CB  
2153 C CG  . LEU A 276 ? 0.4352 0.2122 0.3397 0.0213  -0.0030 -0.0306 287 LEU A CG  
2154 C CD1 . LEU A 276 ? 0.4272 0.2081 0.3414 0.0224  0.0014  -0.0271 287 LEU A CD1 
2155 C CD2 . LEU A 276 ? 0.4584 0.2335 0.3605 0.0230  -0.0025 -0.0366 287 LEU A CD2 
2156 N N   . TRP A 277 ? 0.4877 0.2731 0.3714 0.0156  -0.0132 -0.0266 288 TRP A N   
2157 C CA  . TRP A 277 ? 0.5167 0.3029 0.3902 0.0150  -0.0161 -0.0284 288 TRP A CA  
2158 C C   . TRP A 277 ? 0.5382 0.3175 0.4041 0.0154  -0.0191 -0.0341 288 TRP A C   
2159 O O   . TRP A 277 ? 0.5375 0.3131 0.4047 0.0134  -0.0225 -0.0334 288 TRP A O   
2160 C CB  . TRP A 277 ? 0.5335 0.3238 0.4085 0.0118  -0.0193 -0.0228 288 TRP A CB  
2161 C CG  . TRP A 277 ? 0.5728 0.3636 0.4375 0.0109  -0.0227 -0.0244 288 TRP A CG  
2162 C CD1 . TRP A 277 ? 0.6200 0.4068 0.4789 0.0091  -0.0274 -0.0261 288 TRP A CD1 
2163 C CD2 . TRP A 277 ? 0.5792 0.3750 0.4382 0.0116  -0.0217 -0.0245 288 TRP A CD2 
2164 N NE1 . TRP A 277 ? 0.6324 0.4212 0.4823 0.0088  -0.0294 -0.0272 288 TRP A NE1 
2165 C CE2 . TRP A 277 ? 0.6490 0.4435 0.4988 0.0103  -0.0259 -0.0263 288 TRP A CE2 
2166 C CE3 . TRP A 277 ? 0.5955 0.3968 0.4563 0.0132  -0.0176 -0.0232 288 TRP A CE3 
2167 C CZ2 . TRP A 277 ? 0.6490 0.4474 0.4913 0.0106  -0.0262 -0.0268 288 TRP A CZ2 
2168 C CZ3 . TRP A 277 ? 0.6287 0.4340 0.4822 0.0135  -0.0179 -0.0237 288 TRP A CZ3 
2169 C CH2 . TRP A 277 ? 0.6480 0.4520 0.4924 0.0122  -0.0222 -0.0255 288 TRP A CH2 
2170 N N   . LEU A 278 ? 0.4314 0.2088 0.2895 0.0179  -0.0179 -0.0396 289 LEU A N   
2171 C CA  . LEU A 278 ? 0.4366 0.2071 0.2876 0.0188  -0.0200 -0.0456 289 LEU A CA  
2172 C C   . LEU A 278 ? 0.4616 0.2321 0.3009 0.0192  -0.0224 -0.0490 289 LEU A C   
2173 O O   . LEU A 278 ? 0.4260 0.2002 0.2615 0.0210  -0.0199 -0.0502 289 LEU A O   
2174 C CB  . LEU A 278 ? 0.4302 0.1975 0.2829 0.0219  -0.0162 -0.0498 289 LEU A CB  
2175 C CG  . LEU A 278 ? 0.4662 0.2343 0.3306 0.0220  -0.0131 -0.0464 289 LEU A CG  
2176 C CD1 . LEU A 278 ? 0.4565 0.2219 0.3219 0.0251  -0.0092 -0.0507 289 LEU A CD1 
2177 C CD2 . LEU A 278 ? 0.4480 0.2128 0.3177 0.0195  -0.0162 -0.0440 289 LEU A CD2 
2178 N N   . THR A 279 ? 0.5682 0.3345 0.4018 0.0175  -0.0271 -0.0507 290 THR A N   
2179 C CA  . THR A 279 ? 0.5920 0.3577 0.4142 0.0178  -0.0298 -0.0541 290 THR A CA  
2180 C C   . THR A 279 ? 0.6711 0.4317 0.4860 0.0208  -0.0289 -0.0613 290 THR A C   
2181 O O   . THR A 279 ? 0.6756 0.4321 0.4939 0.0222  -0.0272 -0.0638 290 THR A O   
2182 C CB  . THR A 279 ? 0.7125 0.4757 0.5316 0.0147  -0.0354 -0.0529 290 THR A CB  
2183 O OG1 . THR A 279 ? 0.7185 0.4753 0.5403 0.0140  -0.0372 -0.0543 290 THR A OG1 
2184 C CG2 . THR A 279 ? 0.6986 0.4674 0.5235 0.0118  -0.0365 -0.0458 290 THR A CG2 
2185 N N   . THR A 280 ? 0.5460 0.3072 0.3508 0.0218  -0.0301 -0.0646 291 THR A N   
2186 C CA  . THR A 280 ? 0.5459 0.3022 0.3422 0.0245  -0.0300 -0.0717 291 THR A CA  
2187 C C   . THR A 280 ? 0.5962 0.3500 0.3819 0.0236  -0.0348 -0.0744 291 THR A C   
2188 O O   . THR A 280 ? 0.5740 0.3316 0.3576 0.0216  -0.0371 -0.0712 291 THR A O   
2189 C CB  . THR A 280 ? 0.6131 0.3732 0.4072 0.0277  -0.0253 -0.0739 291 THR A CB  
2190 O OG1 . THR A 280 ? 0.5797 0.3457 0.3692 0.0273  -0.0257 -0.0720 291 THR A OG1 
2191 C CG2 . THR A 280 ? 0.5628 0.3258 0.3675 0.0286  -0.0205 -0.0710 291 THR A CG2 
2192 N N   . ARG A 281 ? 0.5990 0.3550 0.3855 0.0243  -0.0351 -0.0774 292 ARG A N   
2193 C CA  . ARG A 281 ? 0.6091 0.3647 0.3874 0.0236  -0.0391 -0.0797 292 ARG A CA  
2194 C C   . ARG A 281 ? 0.6615 0.4190 0.4299 0.0252  -0.0387 -0.0816 292 ARG A C   
2195 O O   . ARG A 281 ? 0.6594 0.4154 0.4191 0.0243  -0.0426 -0.0829 292 ARG A O   
2196 C CB  . ARG A 281 ? 0.5937 0.3545 0.3781 0.0241  -0.0383 -0.0815 292 ARG A CB  
2197 C CG  . ARG A 281 ? 0.5945 0.3632 0.3851 0.0265  -0.0330 -0.0829 292 ARG A CG  
2198 C CD  . ARG A 281 ? 0.7511 0.5242 0.5496 0.0263  -0.0322 -0.0839 292 ARG A CD  
2199 N NE  . ARG A 281 ? 0.9196 0.7004 0.7231 0.0282  -0.0278 -0.0856 292 ARG A NE  
2200 C CZ  . ARG A 281 ? 1.1780 0.9635 0.9914 0.0288  -0.0237 -0.0845 292 ARG A CZ  
2201 N NH1 . ARG A 281 ? 1.0141 0.7975 0.8338 0.0278  -0.0231 -0.0818 292 ARG A NH1 
2202 N NH2 . ARG A 281 ? 1.0543 0.8468 0.8717 0.0301  -0.0201 -0.0861 292 ARG A NH2 
2203 N N   . GLN A 282 ? 0.6110 0.3724 0.3809 0.0274  -0.0341 -0.0817 293 GLN A N   
2204 C CA  . GLN A 282 ? 0.6121 0.3761 0.3731 0.0290  -0.0333 -0.0832 293 GLN A CA  
2205 C C   . GLN A 282 ? 0.6514 0.4179 0.4114 0.0269  -0.0346 -0.0785 293 GLN A C   
2206 O O   . GLN A 282 ? 0.6387 0.4103 0.3937 0.0276  -0.0339 -0.0782 293 GLN A O   
2207 C CB  . GLN A 282 ? 0.6167 0.3873 0.3832 0.0317  -0.0275 -0.0837 293 GLN A CB  
2208 C CG  . GLN A 282 ? 0.7206 0.4979 0.4956 0.0327  -0.0250 -0.0854 293 GLN A CG  
2209 C CD  . GLN A 282 ? 0.9086 0.6866 0.6957 0.0321  -0.0229 -0.0837 293 GLN A CD  
2210 O OE1 . GLN A 282 ? 0.8112 0.5839 0.6007 0.0307  -0.0241 -0.0813 293 GLN A OE1 
2211 N NE2 . GLN A 282 ? 0.7620 0.5470 0.5573 0.0331  -0.0197 -0.0849 293 GLN A NE2 
2212 N N   . GLY A 283 ? 0.6175 0.3844 0.3857 0.0239  -0.0360 -0.0733 294 GLY A N   
2213 C CA  . GLY A 283 ? 0.6244 0.3979 0.3965 0.0215  -0.0365 -0.0670 294 GLY A CA  
2214 C C   . GLY A 283 ? 0.6768 0.4571 0.4555 0.0225  -0.0315 -0.0635 294 GLY A C   
2215 O O   . GLY A 283 ? 0.6958 0.4825 0.4746 0.0214  -0.0314 -0.0596 294 GLY A O   
2216 N N   . LEU A 284 ? 0.5532 0.3324 0.3374 0.0245  -0.0275 -0.0648 295 LEU A N   
2217 C CA  . LEU A 284 ? 0.5424 0.3277 0.3333 0.0256  -0.0226 -0.0616 295 LEU A CA  
2218 C C   . LEU A 284 ? 0.5781 0.3620 0.3805 0.0250  -0.0207 -0.0587 295 LEU A C   
2219 O O   . LEU A 284 ? 0.5478 0.3274 0.3520 0.0269  -0.0187 -0.0621 295 LEU A O   
2220 C CB  . LEU A 284 ? 0.5374 0.3233 0.3232 0.0293  -0.0191 -0.0665 295 LEU A CB  
2221 C CG  . LEU A 284 ? 0.6013 0.3897 0.3762 0.0303  -0.0202 -0.0692 295 LEU A CG  
2222 C CD1 . LEU A 284 ? 0.5903 0.3777 0.3598 0.0341  -0.0171 -0.0749 295 LEU A CD1 
2223 C CD2 . LEU A 284 ? 0.6335 0.4302 0.4104 0.0289  -0.0194 -0.0638 295 LEU A CD2 
2224 N N   . PRO A 285 ? 0.6106 0.3980 0.4209 0.0224  -0.0212 -0.0524 296 PRO A N   
2225 C CA  . PRO A 285 ? 0.5905 0.3763 0.4115 0.0216  -0.0198 -0.0495 296 PRO A CA  
2226 C C   . PRO A 285 ? 0.6093 0.3980 0.4368 0.0238  -0.0144 -0.0488 296 PRO A C   
2227 O O   . PRO A 285 ? 0.6033 0.3975 0.4297 0.0250  -0.0117 -0.0479 296 PRO A O   
2228 C CB  . PRO A 285 ? 0.6087 0.3983 0.4352 0.0182  -0.0221 -0.0428 296 PRO A CB  
2229 C CG  . PRO A 285 ? 0.6715 0.4631 0.4891 0.0169  -0.0256 -0.0430 296 PRO A CG  
2230 C CD  . PRO A 285 ? 0.6270 0.4197 0.4364 0.0198  -0.0235 -0.0477 296 PRO A CD  
2231 N N   . PHE A 286 ? 0.5853 0.3559 0.3760 0.0054  -0.0453 -0.0327 297 PHE A N   
2232 C CA  . PHE A 286 ? 0.5670 0.3396 0.3640 0.0053  -0.0411 -0.0305 297 PHE A CA  
2233 C C   . PHE A 286 ? 0.5676 0.3396 0.3682 -0.0007 -0.0398 -0.0191 297 PHE A C   
2234 O O   . PHE A 286 ? 0.5354 0.2975 0.3350 -0.0030 -0.0440 -0.0137 297 PHE A O   
2235 C CB  . PHE A 286 ? 0.5830 0.3606 0.3955 0.0101  -0.0415 -0.0304 297 PHE A CB  
2236 C CG  . PHE A 286 ? 0.6073 0.3931 0.4243 0.0156  -0.0402 -0.0394 297 PHE A CG  
2237 C CD1 . PHE A 286 ? 0.6570 0.4447 0.4749 0.0186  -0.0434 -0.0442 297 PHE A CD1 
2238 C CD2 . PHE A 286 ? 0.6270 0.4189 0.4483 0.0175  -0.0357 -0.0428 297 PHE A CD2 
2239 C CE1 . PHE A 286 ? 0.6721 0.4678 0.4957 0.0231  -0.0421 -0.0521 297 PHE A CE1 
2240 C CE2 . PHE A 286 ? 0.6636 0.4639 0.4905 0.0221  -0.0345 -0.0507 297 PHE A CE2 
2241 C CZ  . PHE A 286 ? 0.6451 0.4473 0.4733 0.0247  -0.0377 -0.0553 297 PHE A CZ  
2242 N N   . THR A 287 ? 0.5162 0.2987 0.3213 -0.0033 -0.0339 -0.0154 298 THR A N   
2243 C CA  . THR A 287 ? 0.5034 0.2859 0.3144 -0.0084 -0.0320 -0.0049 298 THR A CA  
2244 C C   . THR A 287 ? 0.5069 0.2922 0.3278 -0.0066 -0.0283 -0.0046 298 THR A C   
2245 O O   . THR A 287 ? 0.4675 0.2636 0.2908 -0.0055 -0.0233 -0.0078 298 THR A O   
2246 C CB  . THR A 287 ? 0.5219 0.3143 0.3298 -0.0140 -0.0286 0.0004  298 THR A CB  
2247 O OG1 . THR A 287 ? 0.6246 0.4155 0.4223 -0.0152 -0.0320 -0.0016 298 THR A OG1 
2248 C CG2 . THR A 287 ? 0.4141 0.2043 0.2282 -0.0195 -0.0280 0.0115  298 THR A CG2 
2249 N N   . ILE A 288 ? 0.4449 0.2252 0.2738 -0.0062 -0.0302 -0.0009 299 ILE A N   
2250 C CA  . ILE A 288 ? 0.4255 0.2157 0.2680 -0.0043 -0.0267 -0.0005 299 ILE A CA  
2251 C C   . ILE A 288 ? 0.4177 0.2213 0.2746 -0.0087 -0.0241 0.0076  299 ILE A C   
2252 O O   . ILE A 288 ? 0.3763 0.1879 0.2416 -0.0099 -0.0261 0.0101  299 ILE A O   
2253 C CB  . ILE A 288 ? 0.4593 0.2557 0.3108 0.0007  -0.0291 -0.0048 299 ILE A CB  
2254 C CG1 . ILE A 288 ? 0.4830 0.2731 0.3255 0.0056  -0.0312 -0.0138 299 ILE A CG1 
2255 C CG2 . ILE A 288 ? 0.4514 0.2582 0.3170 0.0017  -0.0255 -0.0039 299 ILE A CG2 
2256 C CD1 . ILE A 288 ? 0.5737 0.3680 0.4224 0.0090  -0.0352 -0.0159 299 ILE A CD1 
2257 N N   . PHE A 289 ? 0.4197 0.2274 0.2809 -0.0107 -0.0192 0.0106  300 PHE A N   
2258 C CA  . PHE A 289 ? 0.4033 0.2270 0.2815 -0.0139 -0.0164 0.0166  300 PHE A CA  
2259 C C   . PHE A 289 ? 0.4293 0.2603 0.3181 -0.0130 -0.0119 0.0169  300 PHE A C   
2260 O O   . PHE A 289 ? 0.4300 0.2525 0.3099 -0.0116 -0.0096 0.0142  300 PHE A O   
2261 C CB  . PHE A 289 ? 0.4277 0.2535 0.3032 -0.0190 -0.0153 0.0223  300 PHE A CB  
2262 C CG  . PHE A 289 ? 0.4543 0.2735 0.3177 -0.0215 -0.0117 0.0241  300 PHE A CG  
2263 C CD1 . PHE A 289 ? 0.4683 0.2974 0.3418 -0.0231 -0.0066 0.0273  300 PHE A CD1 
2264 C CD2 . PHE A 289 ? 0.4971 0.3059 0.3417 -0.0220 -0.0128 0.0218  300 PHE A CD2 
2265 C CE1 . PHE A 289 ? 0.5033 0.3289 0.3658 -0.0260 -0.0022 0.0296  300 PHE A CE1 
2266 C CE2 . PHE A 289 ? 0.5448 0.3666 0.3885 -0.0229 -0.0079 0.0204  300 PHE A CE2 
2267 C CZ  . PHE A 289 ? 0.5204 0.3504 0.3729 -0.0249 -0.0026 0.0245  300 PHE A CZ  
2268 N N   . GLN A 290 ? 0.3578 0.2042 0.2656 -0.0135 -0.0102 0.0198  301 GLN A N   
2269 C CA  . GLN A 290 ? 0.3480 0.2031 0.2682 -0.0127 -0.0065 0.0203  301 GLN A CA  
2270 C C   . GLN A 290 ? 0.4107 0.2749 0.3395 -0.0159 -0.0029 0.0258  301 GLN A C   
2271 O O   . GLN A 290 ? 0.3853 0.2576 0.3222 -0.0176 -0.0030 0.0295  301 GLN A O   
2272 C CB  . GLN A 290 ? 0.3394 0.2058 0.2754 -0.0107 -0.0068 0.0196  301 GLN A CB  
2273 C CG  . GLN A 290 ? 0.3293 0.2032 0.2762 -0.0103 -0.0038 0.0201  301 GLN A CG  
2274 C CD  . GLN A 290 ? 0.4623 0.3381 0.4124 -0.0096 -0.0053 0.0189  301 GLN A CD  
2275 O OE1 . GLN A 290 ? 0.4774 0.3493 0.4221 -0.0088 -0.0087 0.0171  301 GLN A OE1 
2276 N NE2 . GLN A 290 ? 0.3170 0.1989 0.2757 -0.0099 -0.0030 0.0200  301 GLN A NE2 
2277 N N   . GLY A 291 ? 0.4209 0.2844 0.3485 -0.0164 0.0006  0.0262  302 GLY A N   
2278 C CA  . GLY A 291 ? 0.4273 0.3013 0.3648 -0.0192 0.0040  0.0315  302 GLY A CA  
2279 C C   . GLY A 291 ? 0.4926 0.3622 0.4182 -0.0230 0.0053  0.0347  302 GLY A C   
2280 O O   . GLY A 291 ? 0.5087 0.3644 0.4148 -0.0237 0.0057  0.0325  302 GLY A O   
2281 N N   . GLY A 292 ? 0.3856 0.2675 0.3232 -0.0250 0.0063  0.0400  303 GLY A N   
2282 C CA  . GLY A 292 ? 0.4036 0.2850 0.3326 -0.0289 0.0075  0.0438  303 GLY A CA  
2283 C C   . GLY A 292 ? 0.4606 0.3440 0.3855 -0.0314 0.0123  0.0456  303 GLY A C   
2284 O O   . GLY A 292 ? 0.4639 0.3464 0.3778 -0.0350 0.0138  0.0480  303 GLY A O   
2285 N N   . MET A 293 ? 0.4224 0.3100 0.3562 -0.0297 0.0148  0.0445  304 MET A N   
2286 C CA  . MET A 293 ? 0.4255 0.3148 0.3547 -0.0318 0.0204  0.0453  304 MET A CA  
2287 C C   . MET A 293 ? 0.4760 0.3814 0.4194 -0.0340 0.0217  0.0515  304 MET A C   
2288 O O   . MET A 293 ? 0.4508 0.3662 0.4126 -0.0320 0.0196  0.0545  304 MET A O   
2289 C CB  . MET A 293 ? 0.4459 0.3340 0.3801 -0.0288 0.0227  0.0415  304 MET A CB  
2290 C CG  . MET A 293 ? 0.4990 0.3716 0.4215 -0.0251 0.0214  0.0352  304 MET A CG  
2291 S SD  . MET A 293 ? 0.5772 0.4422 0.4789 -0.0238 0.0223  0.0294  304 MET A SD  
2292 C CE  . MET A 293 ? 0.5419 0.4220 0.4484 -0.0222 0.0292  0.0258  304 MET A CE  
2293 N N   . PRO A 294 ? 0.4566 0.3648 0.3921 -0.0373 0.0262  0.0533  305 PRO A N   
2294 C CA  . PRO A 294 ? 0.4506 0.3741 0.4007 -0.0384 0.0278  0.0590  305 PRO A CA  
2295 C C   . PRO A 294 ? 0.5244 0.4577 0.4943 -0.0360 0.0267  0.0602  305 PRO A C   
2296 O O   . PRO A 294 ? 0.5287 0.4594 0.4959 -0.0360 0.0279  0.0563  305 PRO A O   
2297 C CB  . PRO A 294 ? 0.4782 0.4032 0.4148 -0.0420 0.0334  0.0587  305 PRO A CB  
2298 C CG  . PRO A 294 ? 0.5478 0.4588 0.4609 -0.0434 0.0338  0.0542  305 PRO A CG  
2299 C CD  . PRO A 294 ? 0.4906 0.3891 0.4033 -0.0394 0.0307  0.0500  305 PRO A CD  
2300 N N   . ARG A 295 ? 0.4908 0.4341 0.4776 -0.0320 0.0253  0.0610  306 ARG A N   
2301 C CA  . ARG A 295 ? 0.4850 0.4355 0.4836 -0.0321 0.0194  0.0598  306 ARG A CA  
2302 C C   . ARG A 295 ? 0.5588 0.5083 0.5422 -0.0413 0.0156  0.0559  306 ARG A C   
2303 O O   . ARG A 295 ? 0.5554 0.4996 0.5374 -0.0402 0.0173  0.0517  306 ARG A O   
2304 C CB  . ARG A 295 ? 0.5059 0.4310 0.4845 -0.0297 0.0341  0.0493  306 ARG A CB  
2305 C CG  . ARG A 295 ? 0.7002 0.6221 0.6677 -0.0391 0.0250  0.0457  306 ARG A CG  
2306 C CD  . ARG A 295 ? 0.8012 0.7237 0.7766 -0.0378 0.0254  0.0482  306 ARG A CD  
2307 N NE  . ARG A 295 ? 0.8372 0.7554 0.8129 -0.0347 0.0240  0.0464  306 ARG A NE  
2308 C CZ  . ARG A 295 ? 1.0066 0.9239 0.9853 -0.0319 0.0248  0.0487  306 ARG A CZ  
2309 N NH1 . ARG A 295 ? 0.9408 0.8600 0.9197 -0.0328 0.0255  0.0530  306 ARG A NH1 
2310 N NH2 . ARG A 295 ? 0.7652 0.6807 0.7463 -0.0296 0.0227  0.0476  306 ARG A NH2 
2311 N N   . ALA A 296 ? 0.5400 0.4948 0.5195 -0.0448 0.0177  0.0576  307 ALA A N   
2312 C CA  . ALA A 296 ? 0.5429 0.4953 0.5163 -0.0473 0.0238  0.0531  307 ALA A CA  
2313 C C   . ALA A 296 ? 0.5930 0.5502 0.5742 -0.0434 0.0286  0.0551  307 ALA A C   
2314 O O   . ALA A 296 ? 0.5938 0.5512 0.5786 -0.0423 0.0299  0.0520  307 ALA A O   
2315 C CB  . ALA A 296 ? 0.5644 0.5130 0.5280 -0.0503 0.0310  0.0509  307 ALA A CB  
2316 N N   . SER A 297 ? 0.6060 0.5603 0.5828 -0.0416 0.0352  0.0576  308 SER A N   
2317 C CA  . SER A 297 ? 0.5998 0.5501 0.5715 -0.0383 0.0439  0.0525  308 SER A CA  
2318 C C   . SER A 297 ? 0.6431 0.5786 0.6069 -0.0343 0.0456  0.0473  308 SER A C   
2319 O O   . SER A 297 ? 0.6503 0.5810 0.6087 -0.0318 0.0526  0.0426  308 SER A O   
2320 C CB  . SER A 297 ? 0.6535 0.6079 0.6156 -0.0400 0.0510  0.0530  308 SER A CB  
2321 O OG  . SER A 297 ? 0.7474 0.6961 0.6977 -0.0418 0.0499  0.0546  308 SER A OG  
2322 N N   . TYR A 298 ? 0.4875 0.4161 0.4506 -0.0338 0.0391  0.0478  309 TYR A N   
2323 C CA  . TYR A 298 ? 0.4823 0.3965 0.4375 -0.0302 0.0391  0.0427  309 TYR A CA  
2324 C C   . TYR A 298 ? 0.5282 0.4436 0.4937 -0.0287 0.0304  0.0430  309 TYR A C   
2325 O O   . TYR A 298 ? 0.5340 0.4392 0.4939 -0.0262 0.0282  0.0397  309 TYR A O   
2326 C CB  . TYR A 298 ? 0.5042 0.4054 0.4395 -0.0310 0.0411  0.0412  309 TYR A CB  
2327 C CG  . TYR A 298 ? 0.5169 0.4285 0.4464 -0.0299 0.0450  0.0368  309 TYR A CG  
2328 C CD1 . TYR A 298 ? 0.5449 0.4602 0.4744 -0.0245 0.0471  0.0282  309 TYR A CD1 
2329 C CD2 . TYR A 298 ? 0.5237 0.4426 0.4485 -0.0342 0.0462  0.0409  309 TYR A CD2 
2330 C CE1 . TYR A 298 ? 0.5648 0.4908 0.4900 -0.0233 0.0504  0.0236  309 TYR A CE1 
2331 C CE2 . TYR A 298 ? 0.5328 0.4626 0.4528 -0.0332 0.0495  0.0364  309 TYR A CE2 
2332 C CZ  . TYR A 298 ? 0.6335 0.5668 0.5538 -0.0277 0.0517  0.0276  309 TYR A CZ  
2333 O OH  . TYR A 298 ? 0.6529 0.5972 0.5687 -0.0268 0.0552  0.0229  309 TYR A OH  
2334 N N   . GLY A 299 ? 0.4592 0.3867 0.4378 -0.0308 0.0247  0.0464  310 GLY A N   
2335 C CA  . GLY A 299 ? 0.4538 0.3838 0.4398 -0.0303 0.0163  0.0460  310 GLY A CA  
2336 C C   . GLY A 299 ? 0.5303 0.4554 0.5169 -0.0268 0.0160  0.0409  310 GLY A C   
2337 O O   . GLY A 299 ? 0.5373 0.4589 0.5254 -0.0252 0.0129  0.0396  310 GLY A O   
2338 N N   . ASP A 300 ? 0.7313 0.6543 0.7159 -0.0248 0.0225  0.0376  311 ASP A N   
2339 C CA  . ASP A 300 ? 0.7312 0.6507 0.7172 -0.0211 0.0229  0.0328  311 ASP A CA  
2340 C C   . ASP A 300 ? 0.7644 0.6710 0.7412 -0.0176 0.0256  0.0288  311 ASP A C   
2341 O O   . ASP A 300 ? 0.7843 0.6881 0.7621 -0.0145 0.0249  0.0246  311 ASP A O   
2342 C CB  . ASP A 300 ? 0.7603 0.6843 0.7503 -0.0202 0.0288  0.0311  311 ASP A CB  
2343 C CG  . ASP A 300 ? 0.9597 0.8816 0.9450 -0.0204 0.0377  0.0316  311 ASP A CG  
2344 O OD1 . ASP A 300 ? 0.9765 0.8997 0.9577 -0.0234 0.0382  0.0353  311 ASP A OD1 
2345 O OD2 . ASP A 300 ? 1.0225 0.9421 1.0079 -0.0179 0.0444  0.0283  311 ASP A OD2 
2346 N N   . ARG A 301 ? 0.4196 0.3176 0.3855 -0.0183 0.0278  0.0294  312 ARG A N   
2347 C CA  . ARG A 301 ? 0.3978 0.2803 0.3500 -0.0150 0.0292  0.0243  312 ARG A CA  
2348 C C   . ARG A 301 ? 0.3970 0.2781 0.3506 -0.0136 0.0214  0.0231  312 ARG A C   
2349 O O   . ARG A 301 ? 0.4091 0.2972 0.3690 -0.0158 0.0171  0.0270  312 ARG A O   
2350 C CB  . ARG A 301 ? 0.4073 0.2812 0.3438 -0.0165 0.0337  0.0245  312 ARG A CB  
2351 C CG  . ARG A 301 ? 0.4722 0.3597 0.4121 -0.0162 0.0395  0.0227  312 ARG A CG  
2352 C CD  . ARG A 301 ? 0.4270 0.3168 0.3721 -0.0113 0.0416  0.0163  312 ARG A CD  
2353 N NE  . ARG A 301 ? 0.6382 0.5407 0.5851 -0.0103 0.0467  0.0132  312 ARG A NE  
2354 C CZ  . ARG A 301 ? 0.9345 0.8412 0.8751 -0.0063 0.0471  0.0055  312 ARG A CZ  
2355 N NH1 . ARG A 301 ? 0.8356 0.7345 0.7678 -0.0028 0.0424  0.0000  312 ARG A NH1 
2356 N NH2 . ARG A 301 ? 0.8273 0.7459 0.7704 -0.0057 0.0521  0.0031  312 ARG A NH2 
2357 N N   . HIS A 302 ? 0.3837 0.2577 0.3334 -0.0095 0.0198  0.0175  313 HIS A N   
2358 C CA  . HIS A 302 ? 0.3416 0.2152 0.2927 -0.0079 0.0134  0.0158  313 HIS A CA  
2359 C C   . HIS A 302 ? 0.4113 0.2697 0.3449 -0.0056 0.0129  0.0115  313 HIS A C   
2360 O O   . HIS A 302 ? 0.3975 0.2484 0.3243 -0.0015 0.0141  0.0054  313 HIS A O   
2361 C CB  . HIS A 302 ? 0.3181 0.1979 0.2793 -0.0053 0.0107  0.0129  313 HIS A CB  
2362 C CG  . HIS A 302 ? 0.3398 0.2318 0.3144 -0.0071 0.0105  0.0157  313 HIS A CG  
2363 N ND1 . HIS A 302 ? 0.3527 0.2531 0.3353 -0.0101 0.0084  0.0203  313 HIS A ND1 
2364 C CD2 . HIS A 302 ? 0.3462 0.2410 0.3240 -0.0060 0.0126  0.0139  313 HIS A CD2 
2365 C CE1 . HIS A 302 ? 0.3272 0.2323 0.3137 -0.0109 0.0095  0.0207  313 HIS A CE1 
2366 N NE2 . HIS A 302 ? 0.3272 0.2311 0.3128 -0.0087 0.0113  0.0173  313 HIS A NE2 
2367 N N   . CYS A 303 ? 0.4460 0.3012 0.3734 -0.0078 0.0105  0.0140  314 CYS A N   
2368 C CA  . CYS A 303 ? 0.4770 0.3167 0.3857 -0.0064 0.0099  0.0103  314 CYS A CA  
2369 C C   . CYS A 303 ? 0.4784 0.3166 0.3848 -0.0060 0.0037  0.0099  314 CYS A C   
2370 O O   . CYS A 303 ? 0.4455 0.2935 0.3620 -0.0086 0.0017  0.0145  314 CYS A O   
2371 C CB  . CYS A 303 ? 0.5089 0.3504 0.4108 -0.0102 0.0140  0.0137  314 CYS A CB  
2372 S SG  . CYS A 303 ? 0.5639 0.4202 0.4739 -0.0100 0.0215  0.0128  314 CYS A SG  
2373 N N   . ILE A 304 ? 0.4326 0.2599 0.3273 -0.0021 0.0010  0.0033  315 ILE A N   
2374 C CA  . ILE A 304 ? 0.4347 0.2572 0.3225 -0.0018 -0.0043 0.0023  315 ILE A CA  
2375 C C   . ILE A 304 ? 0.4623 0.2768 0.3345 -0.0007 -0.0038 -0.0026 315 ILE A C   
2376 O O   . ILE A 304 ? 0.4407 0.2600 0.3121 0.0038  -0.0025 -0.0104 315 ILE A O   
2377 C CB  . ILE A 304 ? 0.4687 0.2955 0.3629 0.0021  -0.0085 -0.0019 315 ILE A CB  
2378 C CG1 . ILE A 304 ? 0.4540 0.2950 0.3662 0.0010  -0.0079 0.0016  315 ILE A CG1 
2379 C CG2 . ILE A 304 ? 0.4804 0.3027 0.3680 0.0021  -0.0135 -0.0023 315 ILE A CG2 
2380 C CD1 . ILE A 304 ? 0.5465 0.3958 0.4670 -0.0023 -0.0091 0.0067  315 ILE A CD1 
2381 N N   . SER A 305 ? 0.3706 0.1861 0.2372 -0.0047 -0.0046 0.0015  316 SER A N   
2382 C CA  . SER A 305 ? 0.3692 0.1919 0.2276 -0.0044 -0.0037 -0.0028 316 SER A CA  
2383 C C   . SER A 305 ? 0.4185 0.2325 0.2679 -0.0019 -0.0095 -0.0077 316 SER A C   
2384 O O   . SER A 305 ? 0.3986 0.2020 0.2463 -0.0034 -0.0141 -0.0038 316 SER A O   
2385 C CB  . SER A 305 ? 0.3843 0.2143 0.2416 -0.0105 -0.0009 0.0045  316 SER A CB  
2386 O OG  . SER A 305 ? 0.4176 0.2557 0.2837 -0.0129 0.0044  0.0091  316 SER A OG  
2387 N N   . VAL A 306 ? 0.4408 0.2593 0.2846 0.0018  -0.0093 -0.0163 317 VAL A N   
2388 C CA  . VAL A 306 ? 0.4471 0.2586 0.2824 0.0045  -0.0145 -0.0221 317 VAL A CA  
2389 C C   . VAL A 306 ? 0.4961 0.3166 0.3234 0.0029  -0.0126 -0.0250 317 VAL A C   
2390 O O   . VAL A 306 ? 0.5049 0.3366 0.3328 0.0040  -0.0079 -0.0291 317 VAL A O   
2391 C CB  . VAL A 306 ? 0.4699 0.2771 0.3068 0.0112  -0.0167 -0.0312 317 VAL A CB  
2392 C CG1 . VAL A 306 ? 0.4694 0.2684 0.2982 0.0138  -0.0226 -0.0367 317 VAL A CG1 
2393 C CG2 . VAL A 306 ? 0.4539 0.2537 0.2990 0.0124  -0.0180 -0.0282 317 VAL A CG2 
2394 N N   . ILE A 307 ? 0.3725 0.1882 0.1921 0.0002  -0.0163 -0.0227 318 ILE A N   
2395 C CA  . ILE A 307 ? 0.3780 0.2011 0.1888 -0.0018 -0.0154 -0.0250 318 ILE A CA  
2396 C C   . ILE A 307 ? 0.4843 0.3003 0.2876 0.0019  -0.0206 -0.0327 318 ILE A C   
2397 O O   . ILE A 307 ? 0.4747 0.2786 0.2768 0.0023  -0.0260 -0.0309 318 ILE A O   
2398 C CB  . ILE A 307 ? 0.3962 0.2207 0.2044 -0.0088 -0.0152 -0.0151 318 ILE A CB  
2399 C CG1 . ILE A 307 ? 0.3665 0.1979 0.1833 -0.0124 -0.0102 -0.0073 318 ILE A CG1 
2400 C CG2 . ILE A 307 ? 0.4096 0.2418 0.2079 -0.0110 -0.0145 -0.0176 318 ILE A CG2 
2401 C CD1 . ILE A 307 ? 0.3079 0.1411 0.1232 -0.0194 -0.0100 0.0027  318 ILE A CD1 
2402 N N   . HIS A 308 ? 0.5027 0.3263 0.3011 0.0045  -0.0189 -0.0415 319 HIS A N   
2403 C CA  . HIS A 308 ? 0.5201 0.3379 0.3117 0.0081  -0.0236 -0.0497 319 HIS A CA  
2404 C C   . HIS A 308 ? 0.6073 0.4366 0.3930 0.0091  -0.0203 -0.0577 319 HIS A C   
2405 O O   . HIS A 308 ? 0.6039 0.4419 0.3938 0.0117  -0.0158 -0.0627 319 HIS A O   
2406 C CB  . HIS A 308 ? 0.5270 0.3356 0.3237 0.0143  -0.0270 -0.0553 319 HIS A CB  
2407 C CG  . HIS A 308 ? 0.5791 0.3856 0.3751 0.0177  -0.0315 -0.0615 319 HIS A CG  
2408 N ND1 . HIS A 308 ? 0.6040 0.4200 0.4063 0.0222  -0.0302 -0.0701 319 HIS A ND1 
2409 C CD2 . HIS A 308 ? 0.6160 0.4158 0.4100 0.0167  -0.0367 -0.0589 319 HIS A CD2 
2410 C CE1 . HIS A 308 ? 0.6087 0.4234 0.4125 0.0237  -0.0342 -0.0725 319 HIS A CE1 
2411 N NE2 . HIS A 308 ? 0.6182 0.4233 0.4170 0.0206  -0.0382 -0.0659 319 HIS A NE2 
2412 N N   . ASP A 309 ? 0.6187 0.4484 0.3950 0.0068  -0.0224 -0.0589 320 ASP A N   
2413 C CA  . ASP A 309 ? 0.6177 0.4569 0.3873 0.0079  -0.0202 -0.0679 320 ASP A CA  
2414 C C   . ASP A 309 ? 0.6609 0.5153 0.4322 0.0057  -0.0129 -0.0673 320 ASP A C   
2415 O O   . ASP A 309 ? 0.6432 0.5054 0.4161 0.0093  -0.0096 -0.0758 320 ASP A O   
2416 C CB  . ASP A 309 ? 0.6413 0.4772 0.4130 0.0149  -0.0226 -0.0793 320 ASP A CB  
2417 C CG  . ASP A 309 ? 0.7969 0.6442 0.5655 0.0157  -0.0208 -0.0879 320 ASP A CG  
2418 O OD1 . ASP A 309 ? 0.8020 0.6525 0.5592 0.0113  -0.0202 -0.0867 320 ASP A OD1 
2419 O OD2 . ASP A 309 ? 0.8390 0.6925 0.6172 0.0202  -0.0199 -0.0956 320 ASP A OD2 
2420 N N   . GLY A 310 ? 0.7170 0.5757 0.4884 -0.0005 -0.0105 -0.0572 321 GLY A N   
2421 C CA  . GLY A 310 ? 0.7226 0.5953 0.4961 -0.0032 -0.0037 -0.0552 321 GLY A CA  
2422 C C   . GLY A 310 ? 0.7868 0.6627 0.5709 -0.0002 0.0001  -0.0558 321 GLY A C   
2423 O O   . GLY A 310 ? 0.7789 0.6667 0.5654 -0.0021 0.0059  -0.0545 321 GLY A O   
2424 N N   . GLN A 311 ? 0.6841 0.5499 0.4746 0.0045  -0.0030 -0.0575 322 GLN A N   
2425 C CA  . GLN A 311 ? 0.6738 0.5416 0.4744 0.0076  0.0001  -0.0582 322 GLN A CA  
2426 C C   . GLN A 311 ? 0.6823 0.5429 0.4898 0.0049  -0.0009 -0.0478 322 GLN A C   
2427 O O   . GLN A 311 ? 0.6799 0.5286 0.4864 0.0046  -0.0062 -0.0444 322 GLN A O   
2428 C CB  . GLN A 311 ? 0.6975 0.5596 0.5007 0.0148  -0.0025 -0.0683 322 GLN A CB  
2429 C CG  . GLN A 311 ? 0.9969 0.8637 0.7934 0.0178  -0.0026 -0.0793 322 GLN A CG  
2430 C CD  . GLN A 311 ? 1.2340 1.0890 1.0288 0.0228  -0.0091 -0.0859 322 GLN A CD  
2431 O OE1 . GLN A 311 ? 1.1636 1.0098 0.9661 0.0248  -0.0126 -0.0831 322 GLN A OE1 
2432 N NE2 . GLN A 311 ? 1.0688 0.9287 0.8601 0.0235  -0.0101 -0.0926 322 GLN A NE2 
2433 N N   . GLN A 312 ? 0.5693 0.4375 0.3839 0.0029  0.0042  -0.0429 323 GLN A N   
2434 C CA  . GLN A 312 ? 0.5387 0.4015 0.3609 0.0003  0.0039  -0.0335 323 GLN A CA  
2435 C C   . GLN A 312 ? 0.5545 0.4219 0.3868 0.0030  0.0080  -0.0347 323 GLN A C   
2436 O O   . GLN A 312 ? 0.5415 0.4207 0.3752 0.0034  0.0132  -0.0378 323 GLN A O   
2437 C CB  . GLN A 312 ? 0.5483 0.4156 0.3691 -0.0069 0.0057  -0.0233 323 GLN A CB  
2438 C CG  . GLN A 312 ? 0.6505 0.5134 0.4803 -0.0099 0.0059  -0.0136 323 GLN A CG  
2439 C CD  . GLN A 312 ? 0.7887 0.6516 0.6164 -0.0167 0.0052  -0.0036 323 GLN A CD  
2440 O OE1 . GLN A 312 ? 0.7373 0.6015 0.5560 -0.0192 0.0036  -0.0036 323 GLN A OE1 
2441 N NE2 . GLN A 312 ? 0.6265 0.4878 0.4627 -0.0199 0.0064  0.0050  323 GLN A NE2 
2442 N N   . THR A 313 ? 0.4777 0.3358 0.3167 0.0048  0.0056  -0.0324 324 THR A N   
2443 C CA  . THR A 313 ? 0.4520 0.3130 0.3008 0.0073  0.0089  -0.0332 324 THR A CA  
2444 C C   . THR A 313 ? 0.4530 0.3070 0.3089 0.0046  0.0079  -0.0243 324 THR A C   
2445 O O   . THR A 313 ? 0.4306 0.2729 0.2849 0.0044  0.0028  -0.0219 324 THR A O   
2446 C CB  . THR A 313 ? 0.5655 0.4223 0.4155 0.0142  0.0067  -0.0430 324 THR A CB  
2447 O OG1 . THR A 313 ? 0.6372 0.5031 0.4831 0.0169  0.0091  -0.0516 324 THR A OG1 
2448 C CG2 . THR A 313 ? 0.5136 0.3702 0.3739 0.0165  0.0086  -0.0424 324 THR A CG2 
2449 N N   . ALA A 314 ? 0.4912 0.3524 0.3550 0.0023  0.0128  -0.0196 325 ALA A N   
2450 C CA  . ALA A 314 ? 0.4701 0.3261 0.3421 -0.0001 0.0127  -0.0120 325 ALA A CA  
2451 C C   . ALA A 314 ? 0.5101 0.3641 0.3893 0.0047  0.0132  -0.0165 325 ALA A C   
2452 O O   . ALA A 314 ? 0.4965 0.3592 0.3824 0.0052  0.0181  -0.0171 325 ALA A O   
2453 C CB  . ALA A 314 ? 0.4674 0.3323 0.3443 -0.0057 0.0175  -0.0038 325 ALA A CB  
2454 N N   . PHE A 315 ? 0.4630 0.3058 0.3410 0.0081  0.0080  -0.0198 326 PHE A N   
2455 C CA  . PHE A 315 ? 0.4508 0.2907 0.3353 0.0125  0.0078  -0.0237 326 PHE A CA  
2456 C C   . PHE A 315 ? 0.4687 0.3102 0.3630 0.0096  0.0110  -0.0169 326 PHE A C   
2457 O O   . PHE A 315 ? 0.4366 0.2727 0.3326 0.0055  0.0097  -0.0094 326 PHE A O   
2458 C CB  . PHE A 315 ? 0.4792 0.3057 0.3606 0.0156  0.0012  -0.0266 326 PHE A CB  
2459 C CG  . PHE A 315 ? 0.5225 0.3474 0.3960 0.0195  -0.0020 -0.0348 326 PHE A CG  
2460 C CD1 . PHE A 315 ? 0.5823 0.4137 0.4587 0.0245  -0.0011 -0.0431 326 PHE A CD1 
2461 C CD2 . PHE A 315 ? 0.5607 0.3800 0.4260 0.0180  -0.0059 -0.0340 326 PHE A CD2 
2462 C CE1 . PHE A 315 ? 0.6014 0.4356 0.4746 0.0275  -0.0038 -0.0498 326 PHE A CE1 
2463 C CE2 . PHE A 315 ? 0.6094 0.4278 0.4681 0.0216  -0.0088 -0.0418 326 PHE A CE2 
2464 C CZ  . PHE A 315 ? 0.5854 0.4132 0.4497 0.0261  -0.0076 -0.0492 326 PHE A CZ  
2465 N N   . ASP A 316 ? 0.4048 0.2539 0.3057 0.0118  0.0151  -0.0199 327 ASP A N   
2466 C CA  . ASP A 316 ? 0.3856 0.2386 0.2962 0.0091  0.0192  -0.0141 327 ASP A CA  
2467 C C   . ASP A 316 ? 0.4160 0.2638 0.3327 0.0126  0.0179  -0.0170 327 ASP A C   
2468 O O   . ASP A 316 ? 0.4076 0.2573 0.3244 0.0176  0.0178  -0.0245 327 ASP A O   
2469 C CB  . ASP A 316 ? 0.4065 0.2737 0.3203 0.0080  0.0256  -0.0144 327 ASP A CB  
2470 C CG  . ASP A 316 ? 0.5229 0.3948 0.4468 0.0045  0.0299  -0.0078 327 ASP A CG  
2471 O OD1 . ASP A 316 ? 0.5119 0.3795 0.4382 0.0000  0.0290  -0.0001 327 ASP A OD1 
2472 O OD2 . ASP A 316 ? 0.6450 0.5252 0.5750 0.0062  0.0342  -0.0104 327 ASP A OD2 
2473 N N   . PHE A 317 ? 0.3647 0.2135 0.2901 0.0095  0.0161  -0.0104 328 PHE A N   
2474 C CA  . PHE A 317 ? 0.3333 0.1917 0.2717 0.0107  0.0130  -0.0110 328 PHE A CA  
2475 C C   . PHE A 317 ? 0.3706 0.2364 0.3190 0.0083  0.0168  -0.0069 328 PHE A C   
2476 O O   . PHE A 317 ? 0.3636 0.2308 0.3134 0.0042  0.0195  -0.0011 328 PHE A O   
2477 C CB  . PHE A 317 ? 0.3472 0.2095 0.2916 0.0090  0.0070  -0.0081 328 PHE A CB  
2478 C CG  . PHE A 317 ? 0.3767 0.2317 0.3111 0.0102  0.0035  -0.0102 328 PHE A CG  
2479 C CD1 . PHE A 317 ? 0.4135 0.2629 0.3401 0.0073  0.0033  -0.0065 328 PHE A CD1 
2480 C CD2 . PHE A 317 ? 0.3933 0.2481 0.3269 0.0139  0.0003  -0.0157 328 PHE A CD2 
2481 C CE1 . PHE A 317 ? 0.4294 0.2719 0.3465 0.0083  -0.0004 -0.0086 328 PHE A CE1 
2482 C CE2 . PHE A 317 ? 0.4279 0.2768 0.3530 0.0149  -0.0032 -0.0177 328 PHE A CE2 
2483 C CZ  . PHE A 317 ? 0.4113 0.2536 0.3276 0.0124  -0.0037 -0.0144 328 PHE A CZ  
2484 N N   . THR A 318 ? 0.3053 0.1774 0.2616 0.0106  0.0162  -0.0099 329 THR A N   
2485 C CA  . THR A 318 ? 0.3071 0.1864 0.2719 0.0089  0.0194  -0.0071 329 THR A CA  
2486 C C   . THR A 318 ? 0.3718 0.2596 0.3467 0.0054  0.0147  -0.0021 329 THR A C   
2487 O O   . THR A 318 ? 0.3799 0.2744 0.3612 0.0042  0.0158  -0.0005 329 THR A O   
2488 C CB  . THR A 318 ? 0.3985 0.2814 0.3667 0.0129  0.0203  -0.0128 329 THR A CB  
2489 O OG1 . THR A 318 ? 0.4540 0.3402 0.4276 0.0143  0.0135  -0.0151 329 THR A OG1 
2490 C CG2 . THR A 318 ? 0.3697 0.2485 0.3299 0.0169  0.0245  -0.0193 329 THR A CG2 
2491 N N   . SER A 319 ? 0.3172 0.2060 0.2940 0.0041  0.0097  -0.0002 330 SER A N   
2492 C CA  . SER A 319 ? 0.2929 0.1888 0.2774 0.0013  0.0066  0.0037  330 SER A CA  
2493 C C   . SER A 319 ? 0.3251 0.2195 0.3077 -0.0006 0.0053  0.0068  330 SER A C   
2494 O O   . SER A 319 ? 0.3024 0.1922 0.2801 0.0002  0.0048  0.0056  330 SER A O   
2495 C CB  . SER A 319 ? 0.3131 0.2098 0.3002 0.0030  0.0047  0.0014  330 SER A CB  
2496 O OG  . SER A 319 ? 0.3856 0.2783 0.3699 0.0053  0.0031  -0.0018 330 SER A OG  
2497 N N   . ARG A 320 ? 0.3361 0.2343 0.3222 -0.0030 0.0046  0.0101  331 ARG A N   
2498 C CA  . ARG A 320 ? 0.3214 0.2194 0.3068 -0.0049 0.0038  0.0132  331 ARG A CA  
2499 C C   . ARG A 320 ? 0.3701 0.2630 0.3501 -0.0033 0.0020  0.0111  331 ARG A C   
2500 O O   . ARG A 320 ? 0.3788 0.2707 0.3583 -0.0017 0.0008  0.0087  331 ARG A O   
2501 C CB  . ARG A 320 ? 0.2835 0.1871 0.2748 -0.0072 0.0032  0.0162  331 ARG A CB  
2502 C CG  . ARG A 320 ? 0.5012 0.4060 0.4937 -0.0092 0.0029  0.0195  331 ARG A CG  
2503 C CD  . ARG A 320 ? 0.6158 0.5268 0.6141 -0.0112 0.0019  0.0217  331 ARG A CD  
2504 N NE  . ARG A 320 ? 0.7604 0.6728 0.7605 -0.0103 0.0011  0.0198  331 ARG A NE  
2505 C CZ  . ARG A 320 ? 0.9097 0.8217 0.9109 -0.0094 0.0014  0.0192  331 ARG A CZ  
2506 N NH1 . ARG A 320 ? 0.7449 0.6529 0.7425 -0.0094 0.0020  0.0200  331 ARG A NH1 
2507 N NH2 . ARG A 320 ? 0.6695 0.5833 0.6726 -0.0087 0.0010  0.0177  331 ARG A NH2 
2508 N N   . VAL A 321 ? 0.2841 0.1736 0.2589 -0.0039 0.0013  0.0121  332 VAL A N   
2509 C CA  . VAL A 321 ? 0.2889 0.1729 0.2562 -0.0028 -0.0014 0.0102  332 VAL A CA  
2510 C C   . VAL A 321 ? 0.3585 0.2446 0.3270 -0.0041 -0.0028 0.0119  332 VAL A C   
2511 O O   . VAL A 321 ? 0.3529 0.2422 0.3247 -0.0063 -0.0021 0.0150  332 VAL A O   
2512 C CB  . VAL A 321 ? 0.3318 0.2113 0.2925 -0.0033 -0.0021 0.0108  332 VAL A CB  
2513 C CG1 . VAL A 321 ? 0.3273 0.2017 0.2804 -0.0025 -0.0058 0.0094  332 VAL A CG1 
2514 C CG2 . VAL A 321 ? 0.3264 0.2030 0.2849 -0.0015 -0.0008 0.0081  332 VAL A CG2 
2515 N N   . ILE A 322 ? 0.3146 0.1990 0.2808 -0.0026 -0.0048 0.0097  333 ILE A N   
2516 C CA  . ILE A 322 ? 0.3034 0.1890 0.2695 -0.0037 -0.0066 0.0108  333 ILE A CA  
2517 C C   . ILE A 322 ? 0.3650 0.2457 0.3231 -0.0039 -0.0102 0.0106  333 ILE A C   
2518 O O   . ILE A 322 ? 0.3713 0.2532 0.3295 -0.0057 -0.0113 0.0124  333 ILE A O   
2519 C CB  . ILE A 322 ? 0.3307 0.2169 0.2979 -0.0025 -0.0074 0.0089  333 ILE A CB  
2520 C CG1 . ILE A 322 ? 0.3113 0.2027 0.2871 -0.0025 -0.0039 0.0092  333 ILE A CG1 
2521 C CG2 . ILE A 322 ? 0.3325 0.2194 0.2987 -0.0036 -0.0095 0.0098  333 ILE A CG2 
2522 C CD1 . ILE A 322 ? 0.3319 0.2293 0.3155 -0.0048 -0.0016 0.0123  333 ILE A CD1 
2523 N N   . GLY A 323 ? 0.3362 0.2114 0.2877 -0.0021 -0.0123 0.0083  334 GLY A N   
2524 C CA  . GLY A 323 ? 0.3322 0.2027 0.2761 -0.0021 -0.0160 0.0080  334 GLY A CA  
2525 C C   . GLY A 323 ? 0.3775 0.2424 0.3155 0.0006  -0.0177 0.0048  334 GLY A C   
2526 O O   . GLY A 323 ? 0.3830 0.2480 0.3229 0.0027  -0.0166 0.0024  334 GLY A O   
2527 N N   . PHE A 324 ? 0.3496 0.2100 0.2811 0.0005  -0.0203 0.0046  335 PHE A N   
2528 C CA  . PHE A 324 ? 0.3607 0.2158 0.2867 0.0033  -0.0221 0.0012  335 PHE A CA  
2529 C C   . PHE A 324 ? 0.4187 0.2692 0.3376 0.0034  -0.0268 0.0009  335 PHE A C   
2530 O O   . PHE A 324 ? 0.3853 0.2365 0.3032 0.0010  -0.0281 0.0035  335 PHE A O   
2531 C CB  . PHE A 324 ? 0.3828 0.2368 0.3087 0.0035  -0.0190 0.0005  335 PHE A CB  
2532 C CG  . PHE A 324 ? 0.4049 0.2578 0.3281 0.0008  -0.0188 0.0034  335 PHE A CG  
2533 C CD1 . PHE A 324 ? 0.4242 0.2820 0.3525 -0.0022 -0.0163 0.0076  335 PHE A CD1 
2534 C CD2 . PHE A 324 ? 0.4445 0.2912 0.3597 0.0014  -0.0213 0.0020  335 PHE A CD2 
2535 C CE1 . PHE A 324 ? 0.4475 0.3049 0.3738 -0.0048 -0.0162 0.0105  335 PHE A CE1 
2536 C CE2 . PHE A 324 ? 0.4854 0.3294 0.3958 -0.0013 -0.0217 0.0049  335 PHE A CE2 
2537 C CZ  . PHE A 324 ? 0.4546 0.3062 0.3731 -0.0044 -0.0186 0.0093  335 PHE A CZ  
2538 N N   . THR A 325 ? 0.3889 0.2351 0.3036 0.0064  -0.0294 -0.0026 336 THR A N   
2539 C CA  . THR A 325 ? 0.4061 0.2475 0.3140 0.0070  -0.0339 -0.0033 336 THR A CA  
2540 C C   . THR A 325 ? 0.4774 0.3145 0.3820 0.0100  -0.0343 -0.0075 336 THR A C   
2541 O O   . THR A 325 ? 0.4567 0.2950 0.3644 0.0121  -0.0318 -0.0105 336 THR A O   
2542 C CB  . THR A 325 ? 0.5008 0.3421 0.4080 0.0076  -0.0382 -0.0034 336 THR A CB  
2543 O OG1 . THR A 325 ? 0.5594 0.3966 0.4605 0.0075  -0.0426 -0.0033 336 THR A OG1 
2544 C CG2 . THR A 325 ? 0.4565 0.2972 0.3651 0.0110  -0.0392 -0.0067 336 THR A CG2 
2545 N N   . VAL A 326 ? 0.3880 0.2206 0.2865 0.0103  -0.0373 -0.0081 337 VAL A N   
2546 C CA  . VAL A 326 ? 0.3887 0.2156 0.2817 0.0133  -0.0388 -0.0127 337 VAL A CA  
2547 C C   . VAL A 326 ? 0.4616 0.2870 0.3532 0.0152  -0.0433 -0.0142 337 VAL A C   
2548 O O   . VAL A 326 ? 0.4461 0.2692 0.3336 0.0137  -0.0466 -0.0117 337 VAL A O   
2549 C CB  . VAL A 326 ? 0.4326 0.2511 0.3144 0.0122  -0.0396 -0.0126 337 VAL A CB  
2550 C CG1 . VAL A 326 ? 0.4417 0.2525 0.3146 0.0158  -0.0424 -0.0184 337 VAL A CG1 
2551 C CG2 . VAL A 326 ? 0.4275 0.2457 0.3088 0.0105  -0.0354 -0.0113 337 VAL A CG2 
2552 N N   . LEU A 327 ? 0.4398 0.2653 0.3334 0.0186  -0.0443 -0.0183 338 LEU A N   
2553 C CA  . LEU A 327 ? 0.4475 0.2699 0.3385 0.0209  -0.0495 -0.0199 338 LEU A CA  
2554 C C   . LEU A 327 ? 0.5081 0.3258 0.3936 0.0220  -0.0509 -0.0230 338 LEU A C   
2555 O O   . LEU A 327 ? 0.4821 0.2963 0.3634 0.0243  -0.0502 -0.0276 338 LEU A O   
2556 C CB  . LEU A 327 ? 0.4438 0.2678 0.3389 0.0241  -0.0502 -0.0235 338 LEU A CB  
2557 C CG  . LEU A 327 ? 0.4797 0.3081 0.3800 0.0233  -0.0485 -0.0214 338 LEU A CG  
2558 C CD1 . LEU A 327 ? 0.4715 0.3003 0.3746 0.0264  -0.0510 -0.0243 338 LEU A CD1 
2559 C CD2 . LEU A 327 ? 0.4657 0.2952 0.3652 0.0200  -0.0498 -0.0162 338 LEU A CD2 
2560 N N   . THR A 328 ? 0.5797 0.3944 0.4610 0.0211  -0.0548 -0.0207 339 THR A N   
2561 C CA  . THR A 328 ? 0.6073 0.4156 0.4813 0.0224  -0.0577 -0.0233 339 THR A CA  
2562 C C   . THR A 328 ? 0.7095 0.5175 0.5854 0.0251  -0.0614 -0.0258 339 THR A C   
2563 O O   . THR A 328 ? 0.7046 0.5129 0.5815 0.0252  -0.0650 -0.0233 339 THR A O   
2564 C CB  . THR A 328 ? 0.6141 0.4195 0.4825 0.0190  -0.0590 -0.0189 339 THR A CB  
2565 O OG1 . THR A 328 ? 0.6119 0.4201 0.4827 0.0174  -0.0616 -0.0150 339 THR A OG1 
2566 C CG2 . THR A 328 ? 0.5671 0.3725 0.4336 0.0160  -0.0554 -0.0161 339 THR A CG2 
2567 N N   . GLU A 329 ? 0.7917 0.5953 0.6634 0.0280  -0.0632 -0.0312 340 GLU A N   
2568 C CA  . GLU A 329 ? 0.8089 0.6118 0.6822 0.0305  -0.0669 -0.0337 340 GLU A CA  
2569 C C   . GLU A 329 ? 0.9019 0.7015 0.7713 0.0289  -0.0716 -0.0292 340 GLU A C   
2570 O O   . GLU A 329 ? 0.9155 0.7134 0.7851 0.0308  -0.0764 -0.0294 340 GLU A O   
2571 C CB  . GLU A 329 ? 0.8344 0.6334 0.7031 0.0335  -0.0678 -0.0407 340 GLU A CB  
2572 C CG  . GLU A 329 ? 0.9205 0.7227 0.7919 0.0358  -0.0645 -0.0468 340 GLU A CG  
2573 C CD  . GLU A 329 ? 1.2702 1.0708 1.1374 0.0382  -0.0648 -0.0544 340 GLU A CD  
2574 O OE1 . GLU A 329 ? 1.1704 0.9689 1.0371 0.0397  -0.0682 -0.0563 340 GLU A OE1 
2575 O OE2 . GLU A 329 ? 1.2596 1.0618 1.1238 0.0385  -0.0613 -0.0588 340 GLU A OE2 
2576 N N   . ALA A 330 ? 0.6965 0.4952 0.5622 0.0255  -0.0705 -0.0252 341 ALA A N   
2577 C CA  . ALA A 330 ? 0.7085 0.5037 0.5693 0.0240  -0.0748 -0.0218 341 ALA A CA  
2578 C C   . ALA A 330 ? 0.7842 0.5811 0.6458 0.0226  -0.0781 -0.0177 341 ALA A C   
2579 O O   . ALA A 330 ? 0.7524 0.5535 0.6179 0.0216  -0.0762 -0.0162 341 ALA A O   
2580 C CB  . ALA A 330 ? 0.7175 0.5108 0.5733 0.0207  -0.0729 -0.0192 341 ALA A CB  
2581 N N   . ASP A 331 ? 1.1810 0.9751 1.0392 0.0224  -0.0832 -0.0165 342 ASP A N   
2582 C CA  . ASP A 331 ? 1.1895 0.9851 1.0469 0.0198  -0.0864 -0.0129 342 ASP A CA  
2583 C C   . ASP A 331 ? 1.2578 1.0517 1.1103 0.0167  -0.0869 -0.0103 342 ASP A C   
2584 O O   . ASP A 331 ? 1.2580 1.0489 1.1076 0.0170  -0.0854 -0.0113 342 ASP A O   
2585 C CB  . ASP A 331 ? 1.2238 1.0176 1.0815 0.0222  -0.0921 -0.0142 342 ASP A CB  
2586 C CG  . ASP A 331 ? 1.4468 1.2355 1.3014 0.0248  -0.0953 -0.0166 342 ASP A CG  
2587 O OD1 . ASP A 331 ? 1.5683 1.3556 1.4245 0.0278  -0.0936 -0.0205 342 ASP A OD1 
2588 O OD2 . ASP A 331 ? 1.4592 1.2455 1.3101 0.0236  -0.0993 -0.0150 342 ASP A OD2 
2589 N N   . PRO A 332 ? 1.0645 0.8604 0.9163 0.0134  -0.0889 -0.0075 343 PRO A N   
2590 C CA  . PRO A 332 ? 1.0636 0.8587 0.9116 0.0100  -0.0890 -0.0053 343 PRO A CA  
2591 C C   . PRO A 332 ? 1.1198 0.9092 0.9623 0.0113  -0.0918 -0.0061 343 PRO A C   
2592 O O   . PRO A 332 ? 1.1136 0.9018 0.9528 0.0089  -0.0907 -0.0047 343 PRO A O   
2593 C CB  . PRO A 332 ? 1.0832 0.8811 0.9324 0.0073  -0.0918 -0.0035 343 PRO A CB  
2594 C CG  . PRO A 332 ? 1.1389 0.9379 0.9912 0.0095  -0.0939 -0.0047 343 PRO A CG  
2595 C CD  . PRO A 332 ? 1.0797 0.8795 0.9350 0.0122  -0.0903 -0.0064 343 PRO A CD  
2596 N N   . ALA A 333 ? 1.0767 0.8627 0.9185 0.0149  -0.0954 -0.0085 344 ALA A N   
2597 C CA  . ALA A 333 ? 1.0769 0.8574 0.9141 0.0163  -0.0983 -0.0095 344 ALA A CA  
2598 C C   . ALA A 333 ? 1.0922 0.8699 0.9285 0.0184  -0.0949 -0.0123 344 ALA A C   
2599 O O   . ALA A 333 ? 1.0952 0.8687 0.9273 0.0183  -0.0960 -0.0128 344 ALA A O   
2600 C CB  . ALA A 333 ? 1.0923 0.8706 0.9300 0.0193  -0.1037 -0.0112 344 ALA A CB  
2601 N N   . ALA A 334 ? 0.8591 0.6390 0.6995 0.0199  -0.0907 -0.0147 345 ALA A N   
2602 C CA  . ALA A 334 ? 0.8437 0.6209 0.6830 0.0219  -0.0880 -0.0191 345 ALA A CA  
2603 C C   . ALA A 334 ? 0.8627 0.6343 0.6931 0.0193  -0.0874 -0.0173 345 ALA A C   
2604 O O   . ALA A 334 ? 0.8474 0.6213 0.6770 0.0153  -0.0865 -0.0126 345 ALA A O   
2605 C CB  . ALA A 334 ? 0.8487 0.6291 0.6930 0.0240  -0.0845 -0.0224 345 ALA A CB  
2606 N N   . THR A 335 ? 0.8020 0.5671 0.6260 0.0212  -0.0876 -0.0219 346 THR A N   
2607 C CA  . THR A 335 ? 0.7992 0.5580 0.6134 0.0185  -0.0871 -0.0209 346 THR A CA  
2608 C C   . THR A 335 ? 0.8033 0.5629 0.6162 0.0173  -0.0826 -0.0217 346 THR A C   
2609 O O   . THR A 335 ? 0.8002 0.5573 0.6076 0.0134  -0.0816 -0.0175 346 THR A O   
2610 C CB  . THR A 335 ? 0.9986 0.7515 0.8063 0.0202  -0.0890 -0.0265 346 THR A CB  
2611 O OG1 . THR A 335 ? 1.0431 0.7997 0.8554 0.0242  -0.0875 -0.0344 346 THR A OG1 
2612 C CG2 . THR A 335 ? 1.0025 0.7528 0.8093 0.0204  -0.0937 -0.0244 346 THR A CG2 
2613 N N   . PHE A 336 ? 0.7227 0.4862 0.5407 0.0204  -0.0800 -0.0271 347 PHE A N   
2614 C CA  . PHE A 336 ? 0.7006 0.4658 0.5180 0.0197  -0.0756 -0.0286 347 PHE A CA  
2615 C C   . PHE A 336 ? 0.6912 0.4635 0.5188 0.0203  -0.0733 -0.0262 347 PHE A C   
2616 O O   . PHE A 336 ? 0.6761 0.4528 0.5113 0.0222  -0.0747 -0.0260 347 PHE A O   
2617 C CB  . PHE A 336 ? 0.7368 0.5035 0.5520 0.0225  -0.0736 -0.0378 347 PHE A CB  
2618 C CG  . PHE A 336 ? 0.7671 0.5302 0.5737 0.0220  -0.0754 -0.0419 347 PHE A CG  
2619 C CD1 . PHE A 336 ? 0.8054 0.5647 0.6013 0.0181  -0.0745 -0.0410 347 PHE A CD1 
2620 C CD2 . PHE A 336 ? 0.7995 0.5636 0.6086 0.0250  -0.0779 -0.0468 347 PHE A CD2 
2621 C CE1 . PHE A 336 ? 0.8230 0.5809 0.6111 0.0171  -0.0760 -0.0449 347 PHE A CE1 
2622 C CE2 . PHE A 336 ? 0.8410 0.6031 0.6428 0.0244  -0.0794 -0.0509 347 PHE A CE2 
2623 C CZ  . PHE A 336 ? 0.8147 0.5743 0.6060 0.0204  -0.0783 -0.0500 347 PHE A CZ  
2624 N N   . ASP A 337 ? 0.5486 0.3222 0.3759 0.0183  -0.0696 -0.0244 348 ASP A N   
2625 C CA  . ASP A 337 ? 0.5168 0.2977 0.3538 0.0184  -0.0668 -0.0224 348 ASP A CA  
2626 C C   . ASP A 337 ? 0.5866 0.3711 0.4290 0.0225  -0.0651 -0.0289 348 ASP A C   
2627 O O   . ASP A 337 ? 0.5733 0.3633 0.4245 0.0240  -0.0653 -0.0286 348 ASP A O   
2628 C CB  . ASP A 337 ? 0.5144 0.2958 0.3499 0.0148  -0.0632 -0.0186 348 ASP A CB  
2629 C CG  . ASP A 337 ? 0.5568 0.3389 0.3913 0.0102  -0.0641 -0.0121 348 ASP A CG  
2630 O OD1 . ASP A 337 ? 0.5406 0.3303 0.3837 0.0092  -0.0643 -0.0093 348 ASP A OD1 
2631 O OD2 . ASP A 337 ? 0.5518 0.3276 0.3772 0.0073  -0.0643 -0.0103 348 ASP A OD2 
2632 N N   . ASP A 338 ? 0.6165 0.3994 0.4539 0.0240  -0.0633 -0.0351 349 ASP A N   
2633 C CA  . ASP A 338 ? 0.6212 0.4092 0.4636 0.0277  -0.0612 -0.0422 349 ASP A CA  
2634 C C   . ASP A 338 ? 0.6799 0.4734 0.5310 0.0278  -0.0583 -0.0400 349 ASP A C   
2635 O O   . ASP A 338 ? 0.6744 0.4720 0.5337 0.0296  -0.0592 -0.0401 349 ASP A O   
2636 C CB  . ASP A 338 ? 0.6460 0.4350 0.4922 0.0309  -0.0644 -0.0462 349 ASP A CB  
2637 C CG  . ASP A 338 ? 0.7006 0.4855 0.5390 0.0311  -0.0667 -0.0500 349 ASP A CG  
2638 O OD1 . ASP A 338 ? 0.7184 0.5027 0.5492 0.0300  -0.0645 -0.0537 349 ASP A OD1 
2639 O OD2 . ASP A 338 ? 0.6916 0.4745 0.5312 0.0320  -0.0705 -0.0493 349 ASP A OD2 
2640 N N   . PRO A 339 ? 0.6637 0.4574 0.5130 0.0257  -0.0547 -0.0381 350 PRO A N   
2641 C CA  . PRO A 339 ? 0.6427 0.4422 0.5006 0.0258  -0.0517 -0.0363 350 PRO A CA  
2642 C C   . PRO A 339 ? 0.6588 0.4634 0.5220 0.0296  -0.0499 -0.0434 350 PRO A C   
2643 O O   . PRO A 339 ? 0.6597 0.4644 0.5190 0.0317  -0.0495 -0.0503 350 PRO A O   
2644 C CB  . PRO A 339 ? 0.6665 0.4640 0.5197 0.0228  -0.0483 -0.0334 350 PRO A CB  
2645 C CG  . PRO A 339 ? 0.7310 0.5210 0.5732 0.0202  -0.0503 -0.0316 350 PRO A CG  
2646 C CD  . PRO A 339 ? 0.6856 0.4742 0.5245 0.0229  -0.0533 -0.0373 350 PRO A CD  
2647 N N   . TYR A 340 ? 0.5653 0.3752 0.4377 0.0301  -0.0484 -0.0419 351 TYR A N   
2648 C CA  . TYR A 340 ? 0.5350 0.3500 0.4130 0.0332  -0.0464 -0.0479 351 TYR A CA  
2649 C C   . TYR A 340 ? 0.5556 0.3757 0.4409 0.0326  -0.0429 -0.0458 351 TYR A C   
2650 O O   . TYR A 340 ? 0.5329 0.3574 0.4229 0.0349  -0.0409 -0.0505 351 TYR A O   
2651 C CB  . TYR A 340 ? 0.5266 0.3428 0.4092 0.0357  -0.0497 -0.0503 351 TYR A CB  
2652 C CG  . TYR A 340 ? 0.4972 0.3144 0.3852 0.0344  -0.0521 -0.0444 351 TYR A CG  
2653 C CD1 . TYR A 340 ? 0.5095 0.3318 0.4055 0.0345  -0.0506 -0.0431 351 TYR A CD1 
2654 C CD2 . TYR A 340 ? 0.4888 0.3027 0.3738 0.0329  -0.0557 -0.0404 351 TYR A CD2 
2655 C CE1 . TYR A 340 ? 0.5071 0.3290 0.4047 0.0338  -0.0542 -0.0383 351 TYR A CE1 
2656 C CE2 . TYR A 340 ? 0.4958 0.3109 0.3841 0.0318  -0.0583 -0.0357 351 TYR A CE2 
2657 C CZ  . TYR A 340 ? 0.5720 0.3900 0.4650 0.0326  -0.0584 -0.0348 351 TYR A CZ  
2658 O OH  . TYR A 340 ? 0.5775 0.3949 0.4705 0.0319  -0.0626 -0.0308 351 TYR A OH  
2659 N N   . ALA A 341 ? 0.5438 0.3640 0.4305 0.0294  -0.0419 -0.0391 352 ALA A N   
2660 C CA  . ALA A 341 ? 0.5290 0.3546 0.4231 0.0285  -0.0384 -0.0371 352 ALA A CA  
2661 C C   . ALA A 341 ? 0.5339 0.3591 0.4273 0.0246  -0.0366 -0.0306 352 ALA A C   
2662 O O   . ALA A 341 ? 0.5175 0.3412 0.4093 0.0221  -0.0387 -0.0260 352 ALA A O   
2663 C CB  . ALA A 341 ? 0.5321 0.3624 0.4348 0.0290  -0.0396 -0.0358 352 ALA A CB  
2664 N N   . LEU A 342 ? 0.4372 0.2644 0.3324 0.0240  -0.0326 -0.0306 353 LEU A N   
2665 C CA  . LEU A 342 ? 0.4116 0.2405 0.3091 0.0203  -0.0300 -0.0245 353 LEU A CA  
2666 C C   . LEU A 342 ? 0.4210 0.2580 0.3300 0.0198  -0.0277 -0.0230 353 LEU A C   
2667 O O   . LEU A 342 ? 0.3877 0.2271 0.3000 0.0221  -0.0256 -0.0267 353 LEU A O   
2668 C CB  . LEU A 342 ? 0.4162 0.2408 0.3067 0.0196  -0.0270 -0.0253 353 LEU A CB  
2669 C CG  . LEU A 342 ? 0.4596 0.2868 0.3542 0.0160  -0.0232 -0.0198 353 LEU A CG  
2670 C CD1 . LEU A 342 ? 0.4397 0.2681 0.3358 0.0119  -0.0244 -0.0132 353 LEU A CD1 
2671 C CD2 . LEU A 342 ? 0.4725 0.2945 0.3588 0.0159  -0.0198 -0.0218 353 LEU A CD2 
2672 N N   . VAL A 343 ? 0.4194 0.2614 0.3346 0.0170  -0.0278 -0.0179 354 VAL A N   
2673 C CA  . VAL A 343 ? 0.4120 0.2582 0.3330 0.0168  -0.0272 -0.0163 354 VAL A CA  
2674 C C   . VAL A 343 ? 0.3995 0.2494 0.3244 0.0135  -0.0237 -0.0119 354 VAL A C   
2675 O O   . VAL A 343 ? 0.4008 0.2504 0.3237 0.0108  -0.0246 -0.0081 354 VAL A O   
2676 C CB  . VAL A 343 ? 0.4633 0.3079 0.3819 0.0170  -0.0322 -0.0148 354 VAL A CB  
2677 C CG1 . VAL A 343 ? 0.4435 0.2920 0.3671 0.0166  -0.0317 -0.0135 354 VAL A CG1 
2678 C CG2 . VAL A 343 ? 0.4679 0.3089 0.3833 0.0204  -0.0360 -0.0190 354 VAL A CG2 
2679 N N   . VAL A 344 ? 0.2941 0.1480 0.2249 0.0137  -0.0199 -0.0126 355 VAL A N   
2680 C CA  . VAL A 344 ? 0.2753 0.1332 0.2110 0.0108  -0.0163 -0.0088 355 VAL A CA  
2681 C C   . VAL A 344 ? 0.3452 0.2074 0.2866 0.0106  -0.0156 -0.0078 355 VAL A C   
2682 O O   . VAL A 344 ? 0.3622 0.2255 0.3063 0.0128  -0.0149 -0.0108 355 VAL A O   
2683 C CB  . VAL A 344 ? 0.2959 0.1533 0.2319 0.0111  -0.0126 -0.0103 355 VAL A CB  
2684 C CG1 . VAL A 344 ? 0.2685 0.1318 0.2120 0.0080  -0.0090 -0.0059 355 VAL A CG1 
2685 C CG2 . VAL A 344 ? 0.2953 0.1431 0.2184 0.0115  -0.0147 -0.0114 355 VAL A CG2 
2686 N N   . LEU A 345 ? 0.3121 0.1768 0.2552 0.0079  -0.0157 -0.0038 356 LEU A N   
2687 C CA  . LEU A 345 ? 0.3069 0.1762 0.2558 0.0071  -0.0145 -0.0027 356 LEU A CA  
2688 C C   . LEU A 345 ? 0.3718 0.2459 0.3274 0.0053  -0.0099 -0.0006 356 LEU A C   
2689 O O   . LEU A 345 ? 0.3629 0.2391 0.3200 0.0027  -0.0090 0.0027  356 LEU A O   
2690 C CB  . LEU A 345 ? 0.2988 0.1685 0.2461 0.0055  -0.0173 -0.0006 356 LEU A CB  
2691 C CG  . LEU A 345 ? 0.3193 0.1937 0.2723 0.0045  -0.0160 0.0006  356 LEU A CG  
2692 C CD1 . LEU A 345 ? 0.3117 0.1859 0.2661 0.0069  -0.0163 -0.0022 356 LEU A CD1 
2693 C CD2 . LEU A 345 ? 0.2913 0.1661 0.2425 0.0028  -0.0188 0.0023  356 LEU A CD2 
2694 N N   . ALA A 346 ? 0.3268 0.2029 0.2870 0.0067  -0.0074 -0.0026 357 ALA A N   
2695 C CA  . ALA A 346 ? 0.3256 0.2068 0.2931 0.0051  -0.0038 -0.0007 357 ALA A CA  
2696 C C   . ALA A 346 ? 0.3782 0.2639 0.3515 0.0042  -0.0031 0.0005  357 ALA A C   
2697 O O   . ALA A 346 ? 0.3729 0.2576 0.3446 0.0052  -0.0050 -0.0008 357 ALA A O   
2698 C CB  . ALA A 346 ? 0.3336 0.2149 0.3031 0.0071  -0.0017 -0.0039 357 ALA A CB  
2699 N N   . GLU A 347 ? 0.3362 0.2270 0.3162 0.0022  -0.0008 0.0031  358 GLU A N   
2700 C CA  . GLU A 347 ? 0.3320 0.2276 0.3180 0.0012  -0.0003 0.0042  358 GLU A CA  
2701 C C   . GLU A 347 ? 0.3624 0.2586 0.3508 0.0032  -0.0002 0.0013  358 GLU A C   
2702 O O   . GLU A 347 ? 0.3607 0.2592 0.3522 0.0028  -0.0003 0.0016  358 GLU A O   
2703 C CB  . GLU A 347 ? 0.3486 0.2495 0.3407 -0.0012 0.0009  0.0073  358 GLU A CB  
2704 C CG  . GLU A 347 ? 0.5215 0.4272 0.5192 -0.0025 0.0005  0.0085  358 GLU A CG  
2705 C CD  . GLU A 347 ? 0.8897 0.7993 0.8892 -0.0051 0.0004  0.0115  358 GLU A CD  
2706 O OE1 . GLU A 347 ? 0.9394 0.8518 0.9409 -0.0065 -0.0002 0.0134  358 GLU A OE1 
2707 O OE2 . GLU A 347 ? 0.8031 0.7132 0.8004 -0.0055 0.0021  0.0115  358 GLU A OE2 
2708 N N   . GLU A 348 ? 0.2897 0.1837 0.2766 0.0055  0.0001  -0.0019 359 GLU A N   
2709 C CA  . GLU A 348 ? 0.2692 0.1642 0.2591 0.0076  0.0004  -0.0052 359 GLU A CA  
2710 C C   . GLU A 348 ? 0.3125 0.2030 0.2972 0.0105  -0.0008 -0.0091 359 GLU A C   
2711 O O   . GLU A 348 ? 0.3097 0.2010 0.2966 0.0124  -0.0004 -0.0120 359 GLU A O   
2712 C CB  . GLU A 348 ? 0.2752 0.1732 0.2688 0.0081  0.0016  -0.0063 359 GLU A CB  
2713 C CG  . GLU A 348 ? 0.3492 0.2508 0.3443 0.0053  0.0021  -0.0024 359 GLU A CG  
2714 C CD  . GLU A 348 ? 0.5199 0.4245 0.5179 0.0045  0.0011  -0.0017 359 GLU A CD  
2715 O OE1 . GLU A 348 ? 0.4217 0.3290 0.4191 0.0022  0.0025  0.0011  359 GLU A OE1 
2716 O OE2 . GLU A 348 ? 0.4503 0.3548 0.4509 0.0061  0.0001  -0.0040 359 GLU A OE2 
2717 N N   . GLU A 349 ? 0.2740 0.1599 0.2518 0.0110  -0.0026 -0.0094 360 GLU A N   
2718 C CA  . GLU A 349 ? 0.2708 0.1526 0.2434 0.0140  -0.0048 -0.0133 360 GLU A CA  
2719 C C   . GLU A 349 ? 0.3097 0.1866 0.2747 0.0139  -0.0078 -0.0126 360 GLU A C   
2720 O O   . GLU A 349 ? 0.3189 0.1956 0.2826 0.0117  -0.0076 -0.0095 360 GLU A O   
2721 C CB  . GLU A 349 ? 0.2781 0.1608 0.2529 0.0164  -0.0025 -0.0179 360 GLU A CB  
2722 C CG  . GLU A 349 ? 0.2735 0.1560 0.2475 0.0159  -0.0008 -0.0181 360 GLU A CG  
2723 C CD  . GLU A 349 ? 0.4147 0.2993 0.3908 0.0185  0.0015  -0.0237 360 GLU A CD  
2724 O OE1 . GLU A 349 ? 0.4508 0.3345 0.4253 0.0211  0.0011  -0.0281 360 GLU A OE1 
2725 O OE2 . GLU A 349 ? 0.3881 0.2719 0.3623 0.0185  0.0035  -0.0234 360 GLU A OE2 
2726 N N   . LEU A 350 ? 0.2126 0.0859 0.1730 0.0164  -0.0110 -0.0156 361 LEU A N   
2727 C CA  . LEU A 350 ? 0.2129 0.0814 0.1663 0.0170  -0.0144 -0.0161 361 LEU A CA  
2728 C C   . LEU A 350 ? 0.3052 0.1721 0.2571 0.0197  -0.0135 -0.0210 361 LEU A C   
2729 O O   . LEU A 350 ? 0.3033 0.1717 0.2578 0.0221  -0.0126 -0.0248 361 LEU A O   
2730 C CB  . LEU A 350 ? 0.2164 0.0822 0.1660 0.0178  -0.0194 -0.0159 361 LEU A CB  
2731 C CG  . LEU A 350 ? 0.2774 0.1384 0.2201 0.0185  -0.0237 -0.0161 361 LEU A CG  
2732 C CD1 . LEU A 350 ? 0.2587 0.1194 0.1990 0.0153  -0.0242 -0.0119 361 LEU A CD1 
2733 C CD2 . LEU A 350 ? 0.3313 0.1900 0.2717 0.0204  -0.0287 -0.0175 361 LEU A CD2 
2734 N N   . VAL A 351 ? 0.3469 0.2112 0.2947 0.0193  -0.0136 -0.0211 362 VAL A N   
2735 C CA  . VAL A 351 ? 0.3410 0.2045 0.2871 0.0215  -0.0123 -0.0263 362 VAL A CA  
2736 C C   . VAL A 351 ? 0.3702 0.2282 0.3086 0.0222  -0.0163 -0.0270 362 VAL A C   
2737 O O   . VAL A 351 ? 0.3439 0.2000 0.2795 0.0199  -0.0178 -0.0228 362 VAL A O   
2738 C CB  . VAL A 351 ? 0.3770 0.2383 0.3193 0.0211  -0.0094 -0.0264 362 VAL A CB  
2739 C CG1 . VAL A 351 ? 0.3777 0.2350 0.3121 0.0247  -0.0092 -0.0330 362 VAL A CG1 
2740 C CG2 . VAL A 351 ? 0.3542 0.2213 0.3050 0.0201  -0.0057 -0.0251 362 VAL A CG2 
2741 N N   . VAL A 352 ? 0.3645 0.2204 0.2998 0.0255  -0.0181 -0.0323 363 VAL A N   
2742 C CA  . VAL A 352 ? 0.3636 0.2145 0.2921 0.0267  -0.0220 -0.0339 363 VAL A CA  
2743 C C   . VAL A 352 ? 0.4572 0.3052 0.3793 0.0296  -0.0214 -0.0402 363 VAL A C   
2744 O O   . VAL A 352 ? 0.4544 0.3058 0.3794 0.0320  -0.0195 -0.0451 363 VAL A O   
2745 C CB  . VAL A 352 ? 0.3781 0.2287 0.3079 0.0283  -0.0261 -0.0344 363 VAL A CB  
2746 C CG1 . VAL A 352 ? 0.3568 0.2029 0.2808 0.0294  -0.0299 -0.0360 363 VAL A CG1 
2747 C CG2 . VAL A 352 ? 0.3624 0.2131 0.2933 0.0265  -0.0284 -0.0290 363 VAL A CG2 
2748 N N   . ILE A 353 ? 0.4007 0.2432 0.3140 0.0292  -0.0228 -0.0403 364 ILE A N   
2749 C CA  . ILE A 353 ? 0.3938 0.2343 0.2996 0.0315  -0.0218 -0.0465 364 ILE A CA  
2750 C C   . ILE A 353 ? 0.4634 0.3008 0.3648 0.0331  -0.0257 -0.0497 364 ILE A C   
2751 O O   . ILE A 353 ? 0.4413 0.2747 0.3402 0.0316  -0.0292 -0.0456 364 ILE A O   
2752 C CB  . ILE A 353 ? 0.4274 0.2634 0.3249 0.0294  -0.0196 -0.0444 364 ILE A CB  
2753 C CG1 . ILE A 353 ? 0.4085 0.2474 0.3110 0.0276  -0.0156 -0.0408 364 ILE A CG1 
2754 C CG2 . ILE A 353 ? 0.4413 0.2769 0.3300 0.0314  -0.0180 -0.0514 364 ILE A CG2 
2755 C CD1 . ILE A 353 ? 0.4545 0.3000 0.3620 0.0303  -0.0119 -0.0462 364 ILE A CD1 
2756 N N   . ASP A 354 ? 0.5029 0.3432 0.4038 0.0362  -0.0250 -0.0570 365 ASP A N   
2757 C CA  . ASP A 354 ? 0.5286 0.3667 0.4257 0.0378  -0.0283 -0.0609 365 ASP A CA  
2758 C C   . ASP A 354 ? 0.5895 0.4239 0.4757 0.0370  -0.0281 -0.0628 365 ASP A C   
2759 O O   . ASP A 354 ? 0.5821 0.4194 0.4641 0.0374  -0.0243 -0.0669 365 ASP A O   
2760 C CB  . ASP A 354 ? 0.5611 0.4044 0.4626 0.0410  -0.0271 -0.0680 365 ASP A CB  
2761 C CG  . ASP A 354 ? 0.7160 0.5573 0.6152 0.0428  -0.0306 -0.0719 365 ASP A CG  
2762 O OD1 . ASP A 354 ? 0.7081 0.5443 0.6017 0.0417  -0.0338 -0.0696 365 ASP A OD1 
2763 O OD2 . ASP A 354 ? 0.8171 0.6620 0.7203 0.0452  -0.0302 -0.0771 365 ASP A OD2 
2764 N N   . LEU A 355 ? 0.4897 0.3180 0.3707 0.0357  -0.0319 -0.0597 366 LEU A N   
2765 C CA  . LEU A 355 ? 0.5088 0.3328 0.3786 0.0344  -0.0323 -0.0607 366 LEU A CA  
2766 C C   . LEU A 355 ? 0.6290 0.4538 0.4951 0.0363  -0.0341 -0.0673 366 LEU A C   
2767 O O   . LEU A 355 ? 0.6413 0.4634 0.4977 0.0351  -0.0345 -0.0688 366 LEU A O   
2768 C CB  . LEU A 355 ? 0.4978 0.3143 0.3635 0.0310  -0.0351 -0.0525 366 LEU A CB  
2769 C CG  . LEU A 355 ? 0.5222 0.3378 0.3902 0.0280  -0.0328 -0.0456 366 LEU A CG  
2770 C CD1 . LEU A 355 ? 0.5095 0.3192 0.3743 0.0243  -0.0355 -0.0379 366 LEU A CD1 
2771 C CD2 . LEU A 355 ? 0.5285 0.3447 0.3908 0.0274  -0.0280 -0.0480 366 LEU A CD2 
2772 N N   . GLN A 356 ? 0.6523 0.4807 0.5256 0.0391  -0.0352 -0.0713 367 GLN A N   
2773 C CA  . GLN A 356 ? 0.6816 0.5114 0.5527 0.0410  -0.0364 -0.0781 367 GLN A CA  
2774 C C   . GLN A 356 ? 0.7605 0.5980 0.6311 0.0425  -0.0319 -0.0861 367 GLN A C   
2775 O O   . GLN A 356 ? 0.7927 0.6321 0.6570 0.0426  -0.0312 -0.0917 367 GLN A O   
2776 C CB  . GLN A 356 ? 0.7041 0.5333 0.5827 0.0431  -0.0400 -0.0780 367 GLN A CB  
2777 C CG  . GLN A 356 ? 0.9016 0.7251 0.7813 0.0417  -0.0443 -0.0703 367 GLN A CG  
2778 C CD  . GLN A 356 ? 1.1962 1.0149 1.0705 0.0417  -0.0483 -0.0708 367 GLN A CD  
2779 O OE1 . GLN A 356 ? 1.1747 0.9937 1.0519 0.0438  -0.0508 -0.0741 367 GLN A OE1 
2780 N NE2 . GLN A 356 ? 1.0865 0.9004 0.9530 0.0391  -0.0492 -0.0672 367 GLN A NE2 
2781 N N   . THR A 357 ? 0.5947 0.4372 0.4718 0.0434  -0.0285 -0.0868 368 THR A N   
2782 C CA  . THR A 357 ? 0.5961 0.4466 0.4742 0.0448  -0.0239 -0.0940 368 THR A CA  
2783 C C   . THR A 357 ? 0.6675 0.5214 0.5385 0.0430  -0.0195 -0.0947 368 THR A C   
2784 O O   . THR A 357 ? 0.6657 0.5169 0.5356 0.0413  -0.0188 -0.0889 368 THR A O   
2785 C CB  . THR A 357 ? 0.6037 0.4577 0.4921 0.0467  -0.0225 -0.0941 368 THR A CB  
2786 O OG1 . THR A 357 ? 0.5860 0.4369 0.4798 0.0482  -0.0268 -0.0934 368 THR A OG1 
2787 C CG2 . THR A 357 ? 0.5606 0.4226 0.4503 0.0481  -0.0177 -0.1013 368 THR A CG2 
2788 N N   . ALA A 358 ? 0.6631 0.5232 0.5289 0.0432  -0.0164 -0.1015 369 ALA A N   
2789 C CA  . ALA A 358 ? 0.6612 0.5266 0.5198 0.0414  -0.0117 -0.1027 369 ALA A CA  
2790 C C   . ALA A 358 ? 0.6778 0.5474 0.5428 0.0420  -0.0077 -0.1011 369 ALA A C   
2791 O O   . ALA A 358 ? 0.6668 0.5387 0.5415 0.0441  -0.0071 -0.1025 369 ALA A O   
2792 C CB  . ALA A 358 ? 0.6787 0.5522 0.5324 0.0415  -0.0085 -0.1108 369 ALA A CB  
2793 N N   . GLY A 359 ? 0.7833 0.6534 0.6422 0.0400  -0.0049 -0.0978 370 GLY A N   
2794 C CA  . GLY A 359 ? 0.7644 0.6373 0.6287 0.0403  -0.0014 -0.0951 370 GLY A CA  
2795 C C   . GLY A 359 ? 0.7651 0.6295 0.6343 0.0396  -0.0043 -0.0872 370 GLY A C   
2796 O O   . GLY A 359 ? 0.7479 0.6132 0.6197 0.0391  -0.0014 -0.0838 370 GLY A O   
2797 N N   . TRP A 360 ? 0.5422 0.3992 0.4130 0.0394  -0.0098 -0.0840 371 TRP A N   
2798 C CA  . TRP A 360 ? 0.5196 0.3694 0.3952 0.0382  -0.0129 -0.0761 371 TRP A CA  
2799 C C   . TRP A 360 ? 0.4987 0.3529 0.3859 0.0394  -0.0110 -0.0752 371 TRP A C   
2800 O O   . TRP A 360 ? 0.4447 0.2989 0.3335 0.0381  -0.0084 -0.0711 371 TRP A O   
2801 C CB  . TRP A 360 ? 0.5081 0.3508 0.3748 0.0348  -0.0124 -0.0697 371 TRP A CB  
2802 C CG  . TRP A 360 ? 0.5286 0.3652 0.3840 0.0329  -0.0153 -0.0691 371 TRP A CG  
2803 C CD1 . TRP A 360 ? 0.5695 0.4047 0.4245 0.0339  -0.0194 -0.0716 371 TRP A CD1 
2804 C CD2 . TRP A 360 ? 0.5309 0.3619 0.3733 0.0292  -0.0140 -0.0656 371 TRP A CD2 
2805 N NE1 . TRP A 360 ? 0.5680 0.3976 0.4112 0.0313  -0.0211 -0.0700 371 TRP A NE1 
2806 C CE2 . TRP A 360 ? 0.5893 0.4161 0.4242 0.0281  -0.0179 -0.0662 371 TRP A CE2 
2807 C CE3 . TRP A 360 ? 0.5415 0.3718 0.3788 0.0259  -0.0095 -0.0611 371 TRP A CE3 
2808 C CZ2 . TRP A 360 ? 0.5842 0.4052 0.4054 0.0238  -0.0180 -0.0630 371 TRP A CZ2 
2809 C CZ3 . TRP A 360 ? 0.5569 0.3894 0.3886 0.0203  -0.0088 -0.0547 371 TRP A CZ3 
2810 C CH2 . TRP A 360 ? 0.5745 0.4016 0.3974 0.0193  -0.0131 -0.0559 371 TRP A CH2 
2811 N N   . PRO A 361 ? 0.4912 0.3489 0.3862 0.0416  -0.0121 -0.0785 372 PRO A N   
2812 C CA  . PRO A 361 ? 0.4702 0.3324 0.3753 0.0425  -0.0100 -0.0780 372 PRO A CA  
2813 C C   . PRO A 361 ? 0.4797 0.3380 0.3908 0.0410  -0.0130 -0.0708 372 PRO A C   
2814 O O   . PRO A 361 ? 0.4542 0.3069 0.3629 0.0398  -0.0171 -0.0669 372 PRO A O   
2815 C CB  . PRO A 361 ? 0.4996 0.3656 0.4084 0.0451  -0.0104 -0.0843 372 PRO A CB  
2816 C CG  . PRO A 361 ? 0.5708 0.4317 0.4747 0.0453  -0.0149 -0.0850 372 PRO A CG  
2817 C CD  . PRO A 361 ? 0.5218 0.3791 0.4161 0.0432  -0.0151 -0.0830 372 PRO A CD  
2818 N N   . PRO A 362 ? 0.3975 0.2594 0.3163 0.0407  -0.0108 -0.0687 373 PRO A N   
2819 C CA  . PRO A 362 ? 0.3767 0.2365 0.3012 0.0388  -0.0130 -0.0619 373 PRO A CA  
2820 C C   . PRO A 362 ? 0.4105 0.2701 0.3394 0.0400  -0.0164 -0.0623 373 PRO A C   
2821 O O   . PRO A 362 ? 0.4004 0.2620 0.3301 0.0425  -0.0165 -0.0677 373 PRO A O   
2822 C CB  . PRO A 362 ? 0.3869 0.2517 0.3179 0.0381  -0.0088 -0.0607 373 PRO A CB  
2823 C CG  . PRO A 362 ? 0.4499 0.3199 0.3812 0.0407  -0.0053 -0.0676 373 PRO A CG  
2824 C CD  . PRO A 362 ? 0.4106 0.2791 0.3329 0.0417  -0.0057 -0.0722 373 PRO A CD  
2825 N N   . VAL A 363 ? 0.3980 0.2555 0.3294 0.0380  -0.0192 -0.0563 374 VAL A N   
2826 C CA  . VAL A 363 ? 0.3973 0.2544 0.3322 0.0387  -0.0226 -0.0556 374 VAL A CA  
2827 C C   . VAL A 363 ? 0.4788 0.3387 0.4198 0.0381  -0.0219 -0.0524 374 VAL A C   
2828 O O   . VAL A 363 ? 0.4692 0.3301 0.4119 0.0355  -0.0202 -0.0478 374 VAL A O   
2829 C CB  . VAL A 363 ? 0.4346 0.2873 0.3661 0.0374  -0.0269 -0.0516 374 VAL A CB  
2830 C CG1 . VAL A 363 ? 0.4215 0.2716 0.3532 0.0398  -0.0326 -0.0519 374 VAL A CG1 
2831 C CG2 . VAL A 363 ? 0.4482 0.2968 0.3718 0.0381  -0.0281 -0.0544 374 VAL A CG2 
2832 N N   . GLN A 364 ? 0.5685 0.4291 0.5120 0.0408  -0.0240 -0.0550 375 GLN A N   
2833 C CA  . GLN A 364 ? 0.5557 0.4181 0.5035 0.0407  -0.0243 -0.0527 375 GLN A CA  
2834 C C   . GLN A 364 ? 0.6177 0.4773 0.5644 0.0390  -0.0287 -0.0469 375 GLN A C   
2835 O O   . GLN A 364 ? 0.6531 0.5088 0.5957 0.0390  -0.0329 -0.0456 375 GLN A O   
2836 C CB  . GLN A 364 ? 0.5819 0.4453 0.5323 0.0441  -0.0262 -0.0569 375 GLN A CB  
2837 C CG  . GLN A 364 ? 0.8842 0.7514 0.8362 0.0458  -0.0216 -0.0627 375 GLN A CG  
2838 C CD  . GLN A 364 ? 1.1127 0.9807 1.0671 0.0493  -0.0243 -0.0670 375 GLN A CD  
2839 O OE1 . GLN A 364 ? 1.0023 0.8697 0.9551 0.0514  -0.0252 -0.0717 375 GLN A OE1 
2840 N NE2 . GLN A 364 ? 1.0022 0.8715 0.9606 0.0499  -0.0255 -0.0655 375 GLN A NE2 
2841 N N   . LEU A 365 ? 0.4420 0.3037 0.3919 0.0375  -0.0275 -0.0437 376 LEU A N   
2842 C CA  . LEU A 365 ? 0.4170 0.2768 0.3656 0.0357  -0.0314 -0.0387 376 LEU A CA  
2843 C C   . LEU A 365 ? 0.4772 0.3364 0.4271 0.0375  -0.0360 -0.0395 376 LEU A C   
2844 O O   . LEU A 365 ? 0.4830 0.3449 0.4370 0.0390  -0.0347 -0.0418 376 LEU A O   
2845 C CB  . LEU A 365 ? 0.3966 0.2592 0.3478 0.0324  -0.0278 -0.0345 376 LEU A CB  
2846 C CG  . LEU A 365 ? 0.4231 0.2867 0.3740 0.0301  -0.0235 -0.0328 376 LEU A CG  
2847 C CD1 . LEU A 365 ? 0.4040 0.2707 0.3586 0.0271  -0.0206 -0.0286 376 LEU A CD1 
2848 C CD2 . LEU A 365 ? 0.3896 0.2493 0.3349 0.0292  -0.0262 -0.0311 376 LEU A CD2 
2849 N N   . PRO A 366 ? 0.4517 0.3075 0.3984 0.0375  -0.0417 -0.0377 377 PRO A N   
2850 C CA  . PRO A 366 ? 0.4472 0.3026 0.3954 0.0386  -0.0464 -0.0376 377 PRO A CA  
2851 C C   . PRO A 366 ? 0.5017 0.3589 0.4512 0.0358  -0.0461 -0.0335 377 PRO A C   
2852 O O   . PRO A 366 ? 0.4980 0.3556 0.4494 0.0364  -0.0490 -0.0336 377 PRO A O   
2853 C CB  . PRO A 366 ? 0.4721 0.3232 0.4161 0.0394  -0.0524 -0.0375 377 PRO A CB  
2854 C CG  . PRO A 366 ? 0.5140 0.3637 0.4539 0.0370  -0.0508 -0.0346 377 PRO A CG  
2855 C CD  . PRO A 366 ? 0.4561 0.3083 0.3977 0.0364  -0.0442 -0.0357 377 PRO A CD  
2856 N N   . TYR A 367 ? 0.4943 0.3527 0.4431 0.0327  -0.0426 -0.0300 378 TYR A N   
2857 C CA  . TYR A 367 ? 0.4814 0.3421 0.4318 0.0298  -0.0417 -0.0263 378 TYR A CA  
2858 C C   . TYR A 367 ? 0.4595 0.3225 0.4109 0.0272  -0.0361 -0.0240 378 TYR A C   
2859 O O   . TYR A 367 ? 0.4543 0.3173 0.4054 0.0277  -0.0330 -0.0255 378 TYR A O   
2860 C CB  . TYR A 367 ? 0.5125 0.3708 0.4592 0.0285  -0.0471 -0.0237 378 TYR A CB  
2861 C CG  . TYR A 367 ? 0.5643 0.4192 0.5059 0.0280  -0.0495 -0.0227 378 TYR A CG  
2862 C CD1 . TYR A 367 ? 0.5880 0.4436 0.5281 0.0256  -0.0462 -0.0203 378 TYR A CD1 
2863 C CD2 . TYR A 367 ? 0.5889 0.4402 0.5275 0.0299  -0.0552 -0.0242 378 TYR A CD2 
2864 C CE1 . TYR A 367 ? 0.5905 0.4431 0.5260 0.0251  -0.0485 -0.0195 378 TYR A CE1 
2865 C CE2 . TYR A 367 ? 0.6006 0.4488 0.5345 0.0295  -0.0574 -0.0234 378 TYR A CE2 
2866 C CZ  . TYR A 367 ? 0.6360 0.4848 0.5682 0.0270  -0.0540 -0.0210 378 TYR A CZ  
2867 O OH  . TYR A 367 ? 0.5760 0.4217 0.5034 0.0265  -0.0562 -0.0202 378 TYR A OH  
2868 N N   . LEU A 368 ? 0.3156 0.1809 0.2684 0.0243  -0.0348 -0.0205 379 LEU A N   
2869 C CA  . LEU A 368 ? 0.2933 0.1614 0.2481 0.0216  -0.0297 -0.0180 379 LEU A CA  
2870 C C   . LEU A 368 ? 0.3405 0.2112 0.2997 0.0225  -0.0244 -0.0202 379 LEU A C   
2871 O O   . LEU A 368 ? 0.3359 0.2077 0.2961 0.0212  -0.0207 -0.0194 379 LEU A O   
2872 C CB  . LEU A 368 ? 0.2886 0.1545 0.2391 0.0201  -0.0305 -0.0162 379 LEU A CB  
2873 C CG  . LEU A 368 ? 0.3306 0.1949 0.2773 0.0183  -0.0348 -0.0135 379 LEU A CG  
2874 C CD1 . LEU A 368 ? 0.3396 0.2011 0.2815 0.0176  -0.0361 -0.0126 379 LEU A CD1 
2875 C CD2 . LEU A 368 ? 0.3101 0.1782 0.2599 0.0153  -0.0326 -0.0105 379 LEU A CD2 
2876 N N   . ALA A 369 ? 0.3446 0.2164 0.3067 0.0246  -0.0240 -0.0230 380 ALA A N   
2877 C CA  . ALA A 369 ? 0.3480 0.2227 0.3144 0.0256  -0.0190 -0.0256 380 ALA A CA  
2878 C C   . ALA A 369 ? 0.3985 0.2774 0.3701 0.0231  -0.0144 -0.0231 380 ALA A C   
2879 O O   . ALA A 369 ? 0.3732 0.2534 0.3462 0.0216  -0.0151 -0.0209 380 ALA A O   
2880 C CB  . ALA A 369 ? 0.3649 0.2397 0.3327 0.0288  -0.0203 -0.0296 380 ALA A CB  
2881 N N   . SER A 370 ? 0.4104 0.2916 0.3851 0.0225  -0.0097 -0.0236 381 SER A N   
2882 C CA  . SER A 370 ? 0.3981 0.2840 0.3792 0.0203  -0.0053 -0.0217 381 SER A CA  
2883 C C   . SER A 370 ? 0.4484 0.3367 0.4336 0.0219  -0.0030 -0.0244 381 SER A C   
2884 O O   . SER A 370 ? 0.4477 0.3373 0.4347 0.0236  -0.0004 -0.0279 381 SER A O   
2885 C CB  . SER A 370 ? 0.4220 0.3096 0.4055 0.0191  -0.0021 -0.0213 381 SER A CB  
2886 O OG  . SER A 370 ? 0.4454 0.3309 0.4250 0.0172  -0.0040 -0.0180 381 SER A OG  
2887 N N   . LEU A 371 ? 0.3589 0.2479 0.3451 0.0213  -0.0042 -0.0230 382 LEU A N   
2888 C CA  . LEU A 371 ? 0.3396 0.2305 0.3289 0.0227  -0.0024 -0.0252 382 LEU A CA  
2889 C C   . LEU A 371 ? 0.4020 0.2976 0.3981 0.0215  0.0035  -0.0253 382 LEU A C   
2890 O O   . LEU A 371 ? 0.4234 0.3205 0.4214 0.0229  0.0060  -0.0275 382 LEU A O   
2891 C CB  . LEU A 371 ? 0.3333 0.2237 0.3219 0.0221  -0.0055 -0.0235 382 LEU A CB  
2892 C CG  . LEU A 371 ? 0.3849 0.2715 0.3679 0.0222  -0.0116 -0.0224 382 LEU A CG  
2893 C CD1 . LEU A 371 ? 0.3740 0.2610 0.3571 0.0209  -0.0140 -0.0204 382 LEU A CD1 
2894 C CD2 . LEU A 371 ? 0.4406 0.3242 0.4204 0.0256  -0.0155 -0.0259 382 LEU A CD2 
2895 N N   . HIS A 372 ? 0.3437 0.2426 0.3438 0.0189  0.0049  -0.0227 383 HIS A N   
2896 C CA  . HIS A 372 ? 0.3161 0.2241 0.3250 0.0174  0.0063  -0.0223 383 HIS A CA  
2897 C C   . HIS A 372 ? 0.3721 0.2825 0.3825 0.0188  0.0051  -0.0248 383 HIS A C   
2898 O O   . HIS A 372 ? 0.3452 0.2571 0.3531 0.0193  0.0011  -0.0237 383 HIS A O   
2899 C CB  . HIS A 372 ? 0.3042 0.2155 0.3162 0.0147  0.0030  -0.0183 383 HIS A CB  
2900 C CG  . HIS A 372 ? 0.3292 0.2373 0.3375 0.0134  0.0020  -0.0157 383 HIS A CG  
2901 N ND1 . HIS A 372 ? 0.3492 0.2506 0.3515 0.0143  0.0027  -0.0163 383 HIS A ND1 
2902 C CD2 . HIS A 372 ? 0.3303 0.2390 0.3369 0.0114  -0.0003 -0.0122 383 HIS A CD2 
2903 C CE1 . HIS A 372 ? 0.3332 0.2334 0.3338 0.0125  0.0017  -0.0135 383 HIS A CE1 
2904 N NE2 . HIS A 372 ? 0.3291 0.2342 0.3332 0.0105  0.0007  -0.0108 383 HIS A NE2 
2905 N N   . CYS A 373 ? 0.5049 0.4106 0.5103 0.0206  0.0073  -0.0276 384 CYS A N   
2906 C CA  . CYS A 373 ? 0.5458 0.4540 0.5518 0.0220  0.0075  -0.0308 384 CYS A CA  
2907 C C   . CYS A 373 ? 0.5722 0.4876 0.5817 0.0240  0.0052  -0.0331 384 CYS A C   
2908 O O   . CYS A 373 ? 0.5687 0.4826 0.5715 0.0252  0.0043  -0.0320 384 CYS A O   
2909 C CB  . CYS A 373 ? 0.5913 0.4943 0.5913 0.0244  0.0097  -0.0348 384 CYS A CB  
2910 S SG  . CYS A 373 ? 0.6775 0.5720 0.6689 0.0244  0.0061  -0.0334 384 CYS A SG  
2911 N N   . SER A 374 ? 0.3776 0.2969 0.3922 0.0244  0.0070  -0.0351 385 SER A N   
2912 C CA  . SER A 374 ? 0.3711 0.2895 0.3741 0.0289  0.0007  -0.0345 385 SER A CA  
2913 C C   . SER A 374 ? 0.3999 0.3159 0.4012 0.0276  -0.0017 -0.0312 385 SER A C   
2914 O O   . SER A 374 ? 0.3842 0.3022 0.4010 0.0209  0.0133  -0.0298 385 SER A O   
2915 C CB  . SER A 374 ? 0.4302 0.3486 0.4249 0.0344  0.0008  -0.0379 385 SER A CB  
2916 O OG  . SER A 374 ? 0.5086 0.4268 0.5001 0.0349  0.0062  -0.0358 385 SER A OG  
2917 N N   . ALA A 375 ? 0.3863 0.3000 0.3835 0.0260  0.0022  -0.0273 386 ALA A N   
2918 C CA  . ALA A 375 ? 0.3684 0.2806 0.3650 0.0238  0.0013  -0.0243 386 ALA A CA  
2919 C C   . ALA A 375 ? 0.4147 0.3232 0.4033 0.0267  0.0003  -0.0253 386 ALA A C   
2920 O O   . ALA A 375 ? 0.3926 0.3013 0.3790 0.0295  0.0037  -0.0273 386 ALA A O   
2921 C CB  . ALA A 375 ? 0.3646 0.2803 0.3659 0.0209  0.0069  -0.0215 386 ALA A CB  
2922 N N   . ILE A 376 ? 0.2767 0.3042 0.3145 0.0142  0.0024  -0.0905 387 ILE A N   
2923 C CA  . ILE A 376 ? 0.2733 0.3037 0.3139 0.0224  0.0009  -0.0940 387 ILE A CA  
2924 C C   . ILE A 376 ? 0.3289 0.3777 0.3822 0.0203  0.0059  -0.0927 387 ILE A C   
2925 O O   . ILE A 376 ? 0.2995 0.3501 0.3604 0.0123  0.0069  -0.0871 387 ILE A O   
2926 C CB  . ILE A 376 ? 0.3049 0.3167 0.3427 0.0238  -0.0067 -0.0918 387 ILE A CB  
2927 C CG1 . ILE A 376 ? 0.3220 0.3157 0.3469 0.0267  -0.0120 -0.0936 387 ILE A CG1 
2928 C CG2 . ILE A 376 ? 0.2743 0.2896 0.3159 0.0316  -0.0084 -0.0949 387 ILE A CG2 
2929 C CD1 . ILE A 376 ? 0.3275 0.3019 0.3489 0.0278  -0.0197 -0.0914 387 ILE A CD1 
2930 N N   . THR A 377 ? 0.3597 0.4223 0.4153 0.0274  0.0092  -0.0980 388 THR A N   
2931 C CA  . THR A 377 ? 0.3271 0.4077 0.3944 0.0264  0.0140  -0.0974 388 THR A CA  
2932 C C   . THR A 377 ? 0.3699 0.4510 0.4412 0.0334  0.0113  -0.0995 388 THR A C   
2933 O O   . THR A 377 ? 0.3509 0.4428 0.4326 0.0312  0.0137  -0.0973 388 THR A O   
2934 C CB  . THR A 377 ? 0.3424 0.4418 0.4111 0.0279  0.0210  -0.1013 388 THR A CB  
2935 O OG1 . THR A 377 ? 0.4033 0.5004 0.4627 0.0366  0.0201  -0.1079 388 THR A OG1 
2936 C CG2 . THR A 377 ? 0.2270 0.3299 0.2956 0.0187  0.0248  -0.0978 388 THR A CG2 
2937 N N   . CYS A 378 ? 0.2812 0.3507 0.3446 0.0416  0.0062  -0.1035 389 CYS A N   
2938 C CA  . CYS A 378 ? 0.2815 0.3492 0.3479 0.0482  0.0027  -0.1052 389 CYS A CA  
2939 C C   . CYS A 378 ? 0.3604 0.4094 0.4159 0.0549  -0.0043 -0.1080 389 CYS A C   
2940 O O   . CYS A 378 ? 0.3620 0.4027 0.4079 0.0560  -0.0056 -0.1099 389 CYS A O   
2941 C CB  . CYS A 378 ? 0.2789 0.3657 0.3510 0.0547  0.0074  -0.1104 389 CYS A CB  
2942 S SG  . CYS A 378 ? 0.3423 0.4328 0.4050 0.0649  0.0085  -0.1190 389 CYS A SG  
2943 N N   . SER A 379 ? 0.3267 0.3692 0.3838 0.0594  -0.0090 -0.1083 390 SER A N   
2944 C CA  . SER A 379 ? 0.3466 0.3709 0.3939 0.0659  -0.0162 -0.1107 390 SER A CA  
2945 C C   . SER A 379 ? 0.3852 0.4137 0.4347 0.0753  -0.0180 -0.1153 390 SER A C   
2946 O O   . SER A 379 ? 0.3484 0.3906 0.4078 0.0752  -0.0148 -0.1149 390 SER A O   
2947 C CB  . SER A 379 ? 0.4105 0.4163 0.4560 0.0600  -0.0221 -0.1046 390 SER A CB  
2948 O OG  . SER A 379 ? 0.5873 0.5897 0.6315 0.0511  -0.0204 -0.1002 390 SER A OG  
2949 N N   . HIS A 380 ? 0.3657 0.3819 0.4058 0.0834  -0.0234 -0.1197 391 HIS A N   
2950 C CA  . HIS A 380 ? 0.3652 0.3839 0.4058 0.0933  -0.0257 -0.1248 391 HIS A CA  
2951 C C   . HIS A 380 ? 0.4019 0.4001 0.4314 0.0993  -0.0337 -0.1270 391 HIS A C   
2952 O O   . HIS A 380 ? 0.4029 0.3941 0.4228 0.1018  -0.0348 -0.1299 391 HIS A O   
2953 C CB  . HIS A 380 ? 0.3844 0.4215 0.4267 0.0996  -0.0199 -0.1313 391 HIS A CB  
2954 C CG  . HIS A 380 ? 0.4438 0.4875 0.4894 0.1089  -0.0211 -0.1362 391 HIS A CG  
2955 N ND1 . HIS A 380 ? 0.4620 0.5163 0.5185 0.1077  -0.0193 -0.1342 391 HIS A ND1 
2956 C CD2 . HIS A 380 ? 0.4929 0.5343 0.5325 0.1196  -0.0239 -0.1430 391 HIS A CD2 
2957 C CE1 . HIS A 380 ? 0.4704 0.5284 0.5273 0.1172  -0.0210 -0.1396 391 HIS A CE1 
2958 N NE2 . HIS A 380 ? 0.4899 0.5404 0.5368 0.1246  -0.0239 -0.1450 391 HIS A NE2 
2959 N N   . HIS A 381 ? 0.3149 0.3031 0.3451 0.1016  -0.0393 -0.1256 392 HIS A N   
2960 C CA  . HIS A 381 ? 0.3227 0.2901 0.3427 0.1065  -0.0476 -0.1268 392 HIS A CA  
2961 C C   . HIS A 381 ? 0.4303 0.3992 0.4491 0.1177  -0.0505 -0.1330 392 HIS A C   
2962 O O   . HIS A 381 ? 0.4149 0.3929 0.4420 0.1192  -0.0495 -0.1329 392 HIS A O   
2963 C CB  . HIS A 381 ? 0.3071 0.2594 0.3278 0.0997  -0.0526 -0.1199 392 HIS A CB  
2964 C CG  . HIS A 381 ? 0.3509 0.2810 0.3608 0.1035  -0.0612 -0.1205 392 HIS A CG  
2965 N ND1 . HIS A 381 ? 0.3763 0.2996 0.3829 0.1122  -0.0666 -0.1242 392 HIS A ND1 
2966 C CD2 . HIS A 381 ? 0.3672 0.2801 0.3687 0.0996  -0.0654 -0.1177 392 HIS A CD2 
2967 C CE1 . HIS A 381 ? 0.3765 0.2792 0.3729 0.1135  -0.0738 -0.1237 392 HIS A CE1 
2968 N NE2 . HIS A 381 ? 0.3760 0.2721 0.3693 0.1059  -0.0732 -0.1198 392 HIS A NE2 
2969 N N   . VAL A 382 ? 0.4076 0.3670 0.4159 0.1255  -0.0544 -0.1383 393 VAL A N   
2970 C CA  . VAL A 382 ? 0.4229 0.3811 0.4284 0.1367  -0.0581 -0.1445 393 VAL A CA  
2971 C C   . VAL A 382 ? 0.5023 0.4366 0.4971 0.1398  -0.0673 -0.1444 393 VAL A C   
2972 O O   . VAL A 382 ? 0.4994 0.4223 0.4846 0.1395  -0.0696 -0.1449 393 VAL A O   
2973 C CB  . VAL A 382 ? 0.4738 0.4447 0.4767 0.1445  -0.0540 -0.1522 393 VAL A CB  
2974 C CG1 . VAL A 382 ? 0.4741 0.4482 0.4764 0.1524  -0.0567 -0.1550 393 VAL A CG1 
2975 C CG2 . VAL A 382 ? 0.4567 0.4501 0.4690 0.1398  -0.0446 -0.1517 393 VAL A CG2 
2976 N N   . SER A 383 ? 0.5032 0.4312 0.4995 0.1409  -0.0723 -0.1417 394 SER A N   
2977 C CA  . SER A 383 ? 0.5220 0.4299 0.5091 0.1411  -0.0805 -0.1386 394 SER A CA  
2978 C C   . SER A 383 ? 0.6335 0.5407 0.6138 0.1496  -0.0837 -0.1428 394 SER A C   
2979 O O   . SER A 383 ? 0.6438 0.5656 0.6286 0.1550  -0.0806 -0.1468 394 SER A O   
2980 C CB  . SER A 383 ? 0.5542 0.4553 0.5460 0.1368  -0.0844 -0.1330 394 SER A CB  
2981 O OG  . SER A 383 ? 0.6503 0.5467 0.6462 0.1281  -0.0833 -0.1282 394 SER A OG  
2982 N N   . ASN A 384 ? 0.5822 0.4724 0.5518 0.1503  -0.0901 -0.1415 395 ASN A N   
2983 C CA  . ASN A 384 ? 0.6042 0.4907 0.5665 0.1579  -0.0944 -0.1449 395 ASN A CA  
2984 C C   . ASN A 384 ? 0.6690 0.5701 0.6311 0.1644  -0.0894 -0.1516 395 ASN A C   
2985 O O   . ASN A 384 ? 0.6620 0.5772 0.6301 0.1689  -0.0867 -0.1547 395 ASN A O   
2986 C CB  . ASN A 384 ? 0.5983 0.4845 0.5637 0.1604  -0.0983 -0.1437 395 ASN A CB  
2987 C CG  . ASN A 384 ? 0.9683 0.8450 0.9246 0.1666  -0.1049 -0.1456 395 ASN A CG  
2988 O OD1 . ASN A 384 ? 0.8878 0.7516 0.8347 0.1665  -0.1089 -0.1450 395 ASN A OD1 
2989 N ND2 . ASN A 384 ? 0.9233 0.8065 0.8825 0.1718  -0.1062 -0.1479 395 ASN A ND2 
2990 N N   . ILE A 385 ? 0.6449 0.5429 0.6002 0.1646  -0.0880 -0.1536 396 ILE A N   
2991 C CA  . ILE A 385 ? 0.6568 0.5686 0.6114 0.1700  -0.0829 -0.1596 396 ILE A CA  
2992 C C   . ILE A 385 ? 0.7437 0.6502 0.6904 0.1777  -0.0878 -0.1631 396 ILE A C   
2993 O O   . ILE A 385 ? 0.7390 0.6283 0.6768 0.1777  -0.0944 -0.1611 396 ILE A O   
2994 C CB  . ILE A 385 ? 0.6918 0.6033 0.6428 0.1662  -0.0789 -0.1602 396 ILE A CB  
2995 C CG1 . ILE A 385 ? 0.6715 0.5888 0.6307 0.1585  -0.0740 -0.1571 396 ILE A CG1 
2996 C CG2 . ILE A 385 ? 0.6960 0.6216 0.6456 0.1715  -0.0736 -0.1663 396 ILE A CG2 
2997 C CD1 . ILE A 385 ? 0.6222 0.5611 0.5933 0.1592  -0.0673 -0.1590 396 ILE A CD1 
2998 N N   . PRO A 386 ? 0.8317 0.7526 0.7813 0.1841  -0.0850 -0.1680 397 PRO A N   
2999 C CA  . PRO A 386 ? 0.8504 0.7670 0.7923 0.1916  -0.0893 -0.1718 397 PRO A CA  
3000 C C   . PRO A 386 ? 0.9099 0.8184 0.8419 0.1922  -0.0898 -0.1734 397 PRO A C   
3001 O O   . PRO A 386 ? 0.9085 0.8249 0.8413 0.1900  -0.0838 -0.1749 397 PRO A O   
3002 C CB  . PRO A 386 ? 0.8699 0.8067 0.8185 0.1968  -0.0841 -0.1767 397 PRO A CB  
3003 C CG  . PRO A 386 ? 0.8987 0.8468 0.8588 0.1923  -0.0798 -0.1741 397 PRO A CG  
3004 C CD  . PRO A 386 ? 0.8364 0.7781 0.7971 0.1844  -0.0781 -0.1698 397 PRO A CD  
3005 N N   . LEU A 387 ? 0.6869 0.5795 0.6095 0.1950  -0.0972 -0.1731 398 LEU A N   
3006 C CA  . LEU A 387 ? 0.6996 0.5807 0.6121 0.1944  -0.0990 -0.1733 398 LEU A CA  
3007 C C   . LEU A 387 ? 0.7421 0.6350 0.6527 0.1986  -0.0935 -0.1789 398 LEU A C   
3008 O O   . LEU A 387 ? 0.7220 0.6105 0.6270 0.1962  -0.0919 -0.1791 398 LEU A O   
3009 C CB  . LEU A 387 ? 0.7183 0.5820 0.6217 0.1974  -0.1080 -0.1721 398 LEU A CB  
3010 C CG  . LEU A 387 ? 0.7931 0.6426 0.6854 0.1968  -0.1113 -0.1716 398 LEU A CG  
3011 C CD1 . LEU A 387 ? 0.7967 0.6272 0.6843 0.1920  -0.1186 -0.1654 398 LEU A CD1 
3012 C CD2 . LEU A 387 ? 0.8610 0.7114 0.7468 0.2053  -0.1134 -0.1771 398 LEU A CD2 
3013 N N   . LYS A 388 ? 0.7857 0.6936 0.7007 0.2046  -0.0907 -0.1835 399 LYS A N   
3014 C CA  . LYS A 388 ? 0.7925 0.7127 0.7061 0.2083  -0.0853 -0.1888 399 LYS A CA  
3015 C C   . LYS A 388 ? 0.8478 0.7808 0.7672 0.2028  -0.0767 -0.1885 399 LYS A C   
3016 O O   . LYS A 388 ? 0.8636 0.7963 0.7778 0.2014  -0.0738 -0.1898 399 LYS A O   
3017 C CB  . LYS A 388 ? 0.8293 0.7627 0.7469 0.2156  -0.0845 -0.1934 399 LYS A CB  
3018 N N   . LEU A 389 ? 0.7064 0.6508 0.6363 0.1994  -0.0727 -0.1866 400 LEU A N   
3019 C CA  . LEU A 389 ? 0.6944 0.6513 0.6304 0.1936  -0.0648 -0.1859 400 LEU A CA  
3020 C C   . LEU A 389 ? 0.7156 0.6589 0.6464 0.1869  -0.0658 -0.1823 400 LEU A C   
3021 O O   . LEU A 389 ? 0.6993 0.6490 0.6298 0.1833  -0.0602 -0.1830 400 LEU A O   
3022 C CB  . LEU A 389 ? 0.6846 0.6539 0.6327 0.1909  -0.0616 -0.1838 400 LEU A CB  
3023 C CG  . LEU A 389 ? 0.7390 0.7289 0.6958 0.1872  -0.0522 -0.1846 400 LEU A CG  
3024 C CD1 . LEU A 389 ? 0.7508 0.7584 0.7116 0.1928  -0.0483 -0.1890 400 LEU A CD1 
3025 C CD2 . LEU A 389 ? 0.7613 0.7554 0.7279 0.1812  -0.0502 -0.1804 400 LEU A CD2 
3026 N N   . TRP A 390 ? 0.6812 0.6059 0.6080 0.1848  -0.0730 -0.1782 401 TRP A N   
3027 C CA  . TRP A 390 ? 0.6769 0.5869 0.5982 0.1783  -0.0749 -0.1743 401 TRP A CA  
3028 C C   . TRP A 390 ? 0.7603 0.6653 0.6716 0.1797  -0.0745 -0.1769 401 TRP A C   
3029 O O   . TRP A 390 ? 0.7608 0.6667 0.6705 0.1747  -0.0705 -0.1764 401 TRP A O   
3030 C CB  . TRP A 390 ? 0.6590 0.5500 0.5771 0.1765  -0.0832 -0.1694 401 TRP A CB  
3031 C CG  . TRP A 390 ? 0.6641 0.5396 0.5780 0.1688  -0.0858 -0.1642 401 TRP A CG  
3032 C CD1 . TRP A 390 ? 0.7128 0.5716 0.6162 0.1679  -0.0908 -0.1626 401 TRP A CD1 
3033 C CD2 . TRP A 390 ? 0.6467 0.5219 0.5670 0.1608  -0.0837 -0.1597 401 TRP A CD2 
3034 N NE1 . TRP A 390 ? 0.6974 0.5458 0.6005 0.1596  -0.0919 -0.1572 401 TRP A NE1 
3035 C CE2 . TRP A 390 ? 0.6969 0.5548 0.6101 0.1551  -0.0877 -0.1554 401 TRP A CE2 
3036 C CE3 . TRP A 390 ? 0.6441 0.5321 0.5756 0.1577  -0.0789 -0.1588 401 TRP A CE3 
3037 C CZ2 . TRP A 390 ? 0.6739 0.5270 0.5910 0.1464  -0.0870 -0.1502 401 TRP A CZ2 
3038 C CZ3 . TRP A 390 ? 0.6480 0.5310 0.5832 0.1493  -0.0783 -0.1540 401 TRP A CZ3 
3039 C CH2 . TRP A 390 ? 0.6587 0.5243 0.5868 0.1437  -0.0824 -0.1497 401 TRP A CH2 
3040 N N   . GLU A 391 ? 0.7804 0.6800 0.6846 0.1865  -0.0787 -0.1799 402 GLU A N   
3041 C CA  . GLU A 391 ? 0.7693 0.6637 0.6637 0.1883  -0.0788 -0.1825 402 GLU A CA  
3042 C C   . GLU A 391 ? 0.7751 0.6879 0.6720 0.1891  -0.0702 -0.1869 402 GLU A C   
3043 O O   . GLU A 391 ? 0.7768 0.6874 0.6677 0.1868  -0.0677 -0.1877 402 GLU A O   
3044 C CB  . GLU A 391 ? 0.8011 0.6871 0.6882 0.1958  -0.0851 -0.1849 402 GLU A CB  
3045 C CG  . GLU A 391 ? 0.9096 0.7763 0.7925 0.1947  -0.0940 -0.1804 402 GLU A CG  
3046 C CD  . GLU A 391 ? 1.0960 0.9575 0.9739 0.2025  -0.1001 -0.1830 402 GLU A CD  
3047 O OE1 . GLU A 391 ? 1.0601 0.9348 0.9404 0.2089  -0.0974 -0.1881 402 GLU A OE1 
3048 O OE2 . GLU A 391 ? 0.8655 0.7102 0.7372 0.2021  -0.1076 -0.1798 402 GLU A OE2 
3049 N N   . ARG A 392 ? 0.7107 0.6419 0.6164 0.1921  -0.0655 -0.1896 403 ARG A N   
3050 C CA  . ARG A 392 ? 0.6982 0.6484 0.6072 0.1924  -0.0571 -0.1933 403 ARG A CA  
3051 C C   . ARG A 392 ? 0.7165 0.6717 0.6288 0.1843  -0.0513 -0.1909 403 ARG A C   
3052 O O   . ARG A 392 ? 0.7178 0.6786 0.6265 0.1826  -0.0465 -0.1928 403 ARG A O   
3053 C CB  . ARG A 392 ? 0.6949 0.6635 0.6135 0.1965  -0.0536 -0.1958 403 ARG A CB  
3054 C CG  . ARG A 392 ? 0.8067 0.7738 0.7221 0.2051  -0.0582 -0.1994 403 ARG A CG  
3055 C CD  . ARG A 392 ? 0.7940 0.7792 0.7195 0.2082  -0.0548 -0.2013 403 ARG A CD  
3056 N NE  . ARG A 392 ? 0.8246 0.8298 0.7550 0.2070  -0.0460 -0.2038 403 ARG A NE  
3057 C CZ  . ARG A 392 ? 0.8618 0.8851 0.8029 0.2059  -0.0407 -0.2039 403 ARG A CZ  
3058 N NH1 . ARG A 392 ? 0.7731 0.7971 0.7212 0.2060  -0.0432 -0.2017 403 ARG A NH1 
3059 N NH2 . ARG A 392 ? 0.4698 0.5104 0.4145 0.2044  -0.0329 -0.2058 403 ARG A NH2 
3060 N N   . ILE A 393 ? 0.7047 0.6580 0.6237 0.1790  -0.0518 -0.1866 404 ILE A N   
3061 C CA  . ILE A 393 ? 0.6700 0.6271 0.5923 0.1710  -0.0469 -0.1842 404 ILE A CA  
3062 C C   . ILE A 393 ? 0.6944 0.6341 0.6063 0.1671  -0.0500 -0.1824 404 ILE A C   
3063 O O   . ILE A 393 ? 0.6746 0.6188 0.5847 0.1626  -0.0451 -0.1828 404 ILE A O   
3064 C CB  . ILE A 393 ? 0.6905 0.6489 0.6226 0.1667  -0.0473 -0.1800 404 ILE A CB  
3065 C CG1 . ILE A 393 ? 0.6746 0.6522 0.6174 0.1699  -0.0433 -0.1817 404 ILE A CG1 
3066 C CG2 . ILE A 393 ? 0.6949 0.6552 0.6299 0.1582  -0.0431 -0.1774 404 ILE A CG2 
3067 C CD1 . ILE A 393 ? 0.6656 0.6455 0.6184 0.1660  -0.0435 -0.1778 404 ILE A CD1 
3068 N N   . ILE A 394 ? 0.5460 0.4656 0.4507 0.1683  -0.0581 -0.1802 405 ILE A N   
3069 C CA  . ILE A 394 ? 0.5502 0.4524 0.4446 0.1646  -0.0617 -0.1781 405 ILE A CA  
3070 C C   . ILE A 394 ? 0.6258 0.5318 0.5123 0.1678  -0.0588 -0.1825 405 ILE A C   
3071 O O   . ILE A 394 ? 0.6044 0.5072 0.4859 0.1631  -0.0565 -0.1821 405 ILE A O   
3072 C CB  . ILE A 394 ? 0.5933 0.4749 0.4822 0.1657  -0.0711 -0.1746 405 ILE A CB  
3073 C CG1 . ILE A 394 ? 0.5801 0.4560 0.4759 0.1603  -0.0737 -0.1691 405 ILE A CG1 
3074 C CG2 . ILE A 394 ? 0.6184 0.4831 0.4959 0.1633  -0.0749 -0.1731 405 ILE A CG2 
3075 C CD1 . ILE A 394 ? 0.6186 0.4752 0.5095 0.1603  -0.0826 -0.1649 405 ILE A CD1 
3076 N N   . ALA A 395 ? 0.7190 0.6319 0.6044 0.1757  -0.0588 -0.1869 406 ALA A N   
3077 C CA  . ALA A 395 ? 0.7327 0.6493 0.6107 0.1792  -0.0562 -0.1913 406 ALA A CA  
3078 C C   . ALA A 395 ? 0.7880 0.7219 0.6697 0.1753  -0.0471 -0.1930 406 ALA A C   
3079 O O   . ALA A 395 ? 0.8076 0.7388 0.6820 0.1729  -0.0450 -0.1939 406 ALA A O   
3080 C CB  . ALA A 395 ? 0.7517 0.6744 0.6296 0.1882  -0.0576 -0.1956 406 ALA A CB  
3081 N N   . ALA A 396 ? 0.6634 0.6152 0.5563 0.1744  -0.0416 -0.1933 407 ALA A N   
3082 C CA  . ALA A 396 ? 0.6542 0.6236 0.5515 0.1700  -0.0328 -0.1943 407 ALA A CA  
3083 C C   . ALA A 396 ? 0.6968 0.6585 0.5916 0.1614  -0.0319 -0.1909 407 ALA A C   
3084 O O   . ALA A 396 ? 0.6822 0.6528 0.5758 0.1575  -0.0260 -0.1919 407 ALA A O   
3085 C CB  . ALA A 396 ? 0.6530 0.6421 0.5635 0.1700  -0.0278 -0.1944 407 ALA A CB  
3086 N N   . GLY A 397 ? 0.7323 0.6778 0.6268 0.1580  -0.0379 -0.1866 408 GLY A N   
3087 C CA  . GLY A 397 ? 0.7271 0.6632 0.6186 0.1498  -0.0381 -0.1832 408 GLY A CA  
3088 C C   . GLY A 397 ? 0.8035 0.7258 0.6821 0.1491  -0.0405 -0.1837 408 GLY A C   
3089 O O   . GLY A 397 ? 0.7885 0.7101 0.6639 0.1428  -0.0377 -0.1826 408 GLY A O   
3090 N N   . SER A 398 ? 0.7388 0.6501 0.6100 0.1552  -0.0460 -0.1851 409 SER A N   
3091 C CA  . SER A 398 ? 0.7496 0.6487 0.6087 0.1552  -0.0482 -0.1858 409 SER A CA  
3092 C C   . SER A 398 ? 0.7978 0.7117 0.6544 0.1557  -0.0408 -0.1901 409 SER A C   
3093 O O   . SER A 398 ? 0.8065 0.7137 0.6546 0.1524  -0.0403 -0.1900 409 SER A O   
3094 C CB  . SER A 398 ? 0.8096 0.6960 0.6622 0.1622  -0.0553 -0.1868 409 SER A CB  
3095 O OG  . SER A 398 ? 0.9368 0.8110 0.7921 0.1617  -0.0620 -0.1827 409 SER A OG  
3096 N N   . ARG A 399 ? 0.7226 0.6570 0.5867 0.1596  -0.0350 -0.1935 410 ARG A N   
3097 C CA  . ARG A 399 ? 0.7242 0.6741 0.5867 0.1603  -0.0277 -0.1974 410 ARG A CA  
3098 C C   . ARG A 399 ? 0.7674 0.7250 0.6314 0.1518  -0.0217 -0.1958 410 ARG A C   
3099 O O   . ARG A 399 ? 0.7848 0.7471 0.6430 0.1503  -0.0175 -0.1977 410 ARG A O   
3100 C CB  . ARG A 399 ? 0.7432 0.7130 0.6145 0.1659  -0.0233 -0.2007 410 ARG A CB  
3101 C CG  . ARG A 399 ? 0.9269 0.8903 0.7975 0.1742  -0.0294 -0.2024 410 ARG A CG  
3102 C CD  . ARG A 399 ? 1.0954 1.0528 0.9557 0.1799  -0.0315 -0.2062 410 ARG A CD  
3103 N NE  . ARG A 399 ? 1.1661 1.1417 1.0302 0.1853  -0.0265 -0.2107 410 ARG A NE  
3104 C CZ  . ARG A 399 ? 1.1967 1.1873 1.0612 0.1833  -0.0189 -0.2128 410 ARG A CZ  
3105 N NH1 . ARG A 399 ? 0.9387 0.9451 0.8070 0.1881  -0.0150 -0.2167 410 ARG A NH1 
3106 N NH2 . ARG A 399 ? 0.9673 0.9569 0.8283 0.1761  -0.0155 -0.2110 410 ARG A NH2 
3107 N N   . GLN A 400 ? 0.6472 0.6063 0.5188 0.1462  -0.0211 -0.1922 411 GLN A N   
3108 C CA  . GLN A 400 ? 0.6176 0.5844 0.4925 0.1364  -0.0156 -0.1887 411 GLN A CA  
3109 C C   . GLN A 400 ? 0.6310 0.5786 0.4997 0.1282  -0.0201 -0.1824 411 GLN A C   
3110 O O   . GLN A 400 ? 0.5839 0.5361 0.4563 0.1183  -0.0163 -0.1770 411 GLN A O   
3111 C CB  . GLN A 400 ? 0.6134 0.5944 0.5033 0.1316  -0.0119 -0.1844 411 GLN A CB  
3112 C CG  . GLN A 400 ? 0.7340 0.7013 0.6282 0.1293  -0.0184 -0.1791 411 GLN A CG  
3113 C CD  . GLN A 400 ? 0.8432 0.8247 0.7513 0.1284  -0.0156 -0.1772 411 GLN A CD  
3114 O OE1 . GLN A 400 ? 0.7838 0.7574 0.6954 0.1308  -0.0207 -0.1758 411 GLN A OE1 
3115 N NE2 . GLN A 400 ? 0.6696 0.6722 0.5857 0.1249  -0.0075 -0.1772 411 GLN A NE2 
3116 N N   . ASN A 401 ? 0.6868 0.6132 0.5463 0.1321  -0.0282 -0.1830 412 ASN A N   
3117 C CA  . ASN A 401 ? 0.7019 0.6088 0.5552 0.1249  -0.0332 -0.1772 412 ASN A CA  
3118 C C   . ASN A 401 ? 0.7915 0.6867 0.6302 0.1278  -0.0354 -0.1808 412 ASN A C   
3119 O O   . ASN A 401 ? 0.7901 0.6652 0.6213 0.1253  -0.0418 -0.1778 412 ASN A O   
3120 C CB  . ASN A 401 ? 0.7122 0.6021 0.5667 0.1256  -0.0413 -0.1738 412 ASN A CB  
3121 C CG  . ASN A 401 ? 0.8902 0.7898 0.7588 0.1212  -0.0394 -0.1691 412 ASN A CG  
3122 O OD1 . ASN A 401 ? 0.7899 0.7024 0.6669 0.1133  -0.0335 -0.1651 412 ASN A OD1 
3123 N ND2 . ASN A 401 ? 0.7484 0.6413 0.6195 0.1265  -0.0446 -0.1697 412 ASN A ND2 
3124 N N   . ALA A 402 ? 0.8179 0.7254 0.6524 0.1330  -0.0303 -0.1873 413 ALA A N   
3125 C CA  . ALA A 402 ? 0.8420 0.7400 0.6638 0.1355  -0.0320 -0.1899 413 ALA A CA  
3126 C C   . ALA A 402 ? 0.9223 0.8108 0.7378 0.1263  -0.0321 -0.1858 413 ALA A C   
3127 O O   . ALA A 402 ? 0.9416 0.8127 0.7457 0.1271  -0.0371 -0.1861 413 ALA A O   
3128 C CB  . ALA A 402 ? 0.8539 0.7701 0.6755 0.1407  -0.0254 -0.1953 413 ALA A CB  
3129 N N   . HIS A 403 ? 0.9499 0.8501 0.7741 0.1166  -0.0265 -0.1804 414 HIS A N   
3130 C CA  . HIS A 403 ? 0.9431 0.8359 0.7637 0.1065  -0.0262 -0.1748 414 HIS A CA  
3131 C C   . HIS A 403 ? 0.9618 0.8319 0.7794 0.1023  -0.0343 -0.1692 414 HIS A C   
3132 O O   . HIS A 403 ? 0.9711 0.8302 0.7824 0.0958  -0.0360 -0.1657 414 HIS A O   
3133 C CB  . HIS A 403 ? 0.9461 0.8563 0.7780 0.0970  -0.0189 -0.1700 414 HIS A CB  
3134 C CG  . HIS A 403 ? 0.9867 0.9007 0.8316 0.0937  -0.0196 -0.1652 414 HIS A CG  
3135 N ND1 . HIS A 403 ? 1.0113 0.9363 0.8640 0.1003  -0.0184 -0.1684 414 HIS A ND1 
3136 C CD2 . HIS A 403 ? 1.0057 0.9140 0.8572 0.0844  -0.0213 -0.1574 414 HIS A CD2 
3137 C CE1 . HIS A 403 ? 0.9955 0.9212 0.8587 0.0953  -0.0193 -0.1628 414 HIS A CE1 
3138 N NE2 . HIS A 403 ? 0.9949 0.9108 0.8577 0.0856  -0.0210 -0.1561 414 HIS A NE2 
3139 N N   . PHE A 404 ? 0.6788 0.5417 0.5009 0.1056  -0.0395 -0.1681 415 PHE A N   
3140 C CA  . PHE A 404 ? 0.6720 0.5144 0.4923 0.1013  -0.0470 -0.1624 415 PHE A CA  
3141 C C   . PHE A 404 ? 0.7172 0.5391 0.5231 0.1063  -0.0540 -0.1653 415 PHE A C   
3142 O O   . PHE A 404 ? 0.7294 0.5523 0.5271 0.1149  -0.0538 -0.1723 415 PHE A O   
3143 C CB  . PHE A 404 ? 0.6914 0.5328 0.5208 0.1034  -0.0503 -0.1606 415 PHE A CB  
3144 C CG  . PHE A 404 ? 0.6978 0.5525 0.5412 0.0954  -0.0457 -0.1550 415 PHE A CG  
3145 C CD1 . PHE A 404 ? 0.7297 0.5780 0.5763 0.0846  -0.0465 -0.1474 415 PHE A CD1 
3146 C CD2 . PHE A 404 ? 0.7366 0.6099 0.5900 0.0988  -0.0408 -0.1572 415 PHE A CD2 
3147 C CE1 . PHE A 404 ? 0.7303 0.5907 0.5897 0.0773  -0.0424 -0.1423 415 PHE A CE1 
3148 C CE2 . PHE A 404 ? 0.7568 0.6421 0.6230 0.0914  -0.0367 -0.1520 415 PHE A CE2 
3149 C CZ  . PHE A 404 ? 0.7205 0.5992 0.5896 0.0807  -0.0375 -0.1446 415 PHE A CZ  
3150 N N   . SER A 405 ? 0.5872 0.3902 0.3900 0.1007  -0.0602 -0.1598 416 SER A N   
3151 C CA  . SER A 405 ? 0.5902 0.3738 0.3817 0.1036  -0.0671 -0.1600 416 SER A CA  
3152 C C   . SER A 405 ? 0.6483 0.4278 0.4416 0.1114  -0.0719 -0.1606 416 SER A C   
3153 O O   . SER A 405 ? 0.6371 0.4225 0.4390 0.1134  -0.0721 -0.1603 416 SER A O   
3154 C CB  . SER A 405 ? 0.6130 0.3801 0.4032 0.0942  -0.0718 -0.1524 416 SER A CB  
3155 O OG  . SER A 405 ? 0.7247 0.4762 0.5106 0.0961  -0.0789 -0.1491 416 SER A OG  
3156 N N   . THR A 406 ? 0.7260 0.4954 0.5109 0.1158  -0.0761 -0.1614 417 THR A N   
3157 C CA  . THR A 406 ? 0.7275 0.4902 0.5123 0.1225  -0.0818 -0.1613 417 THR A CA  
3158 C C   . THR A 406 ? 0.7497 0.4946 0.5341 0.1177  -0.0893 -0.1539 417 THR A C   
3159 O O   . THR A 406 ? 0.7416 0.4795 0.5254 0.1225  -0.0947 -0.1530 417 THR A O   
3160 C CB  . THR A 406 ? 0.8901 0.6528 0.6662 0.1305  -0.0822 -0.1666 417 THR A CB  
3161 O OG1 . THR A 406 ? 0.9038 0.6570 0.6707 0.1267  -0.0830 -0.1654 417 THR A OG1 
3162 C CG2 . THR A 406 ? 0.8610 0.6434 0.6394 0.1362  -0.0749 -0.1737 417 THR A CG2 
3163 N N   . MET A 407 ? 0.6529 0.3911 0.4378 0.1083  -0.0896 -0.1484 418 MET A N   
3164 C CA  . MET A 407 ? 0.6596 0.3824 0.4447 0.1030  -0.0961 -0.1407 418 MET A CA  
3165 C C   . MET A 407 ? 0.6899 0.4128 0.4841 0.1028  -0.0989 -0.1372 418 MET A C   
3166 O O   . MET A 407 ? 0.6748 0.4084 0.4772 0.1020  -0.0951 -0.1382 418 MET A O   
3167 C CB  . MET A 407 ? 0.6928 0.4112 0.4782 0.0925  -0.0948 -0.1356 418 MET A CB  
3168 C CG  . MET A 407 ? 0.7609 0.4647 0.5458 0.0865  -0.1008 -0.1275 418 MET A CG  
3169 S SD  . MET A 407 ? 0.8239 0.5252 0.6109 0.0740  -0.0986 -0.1214 418 MET A SD  
3170 C CE  . MET A 407 ? 0.7660 0.4768 0.5665 0.0688  -0.0956 -0.1186 418 MET A CE  
3171 N N   . GLU A 408 ? 0.8055 0.5167 0.5979 0.1037  -0.1056 -0.1330 419 GLU A N   
3172 C CA  . GLU A 408 ? 0.7850 0.4947 0.5854 0.1021  -0.1087 -0.1283 419 GLU A CA  
3173 C C   . GLU A 408 ? 0.7959 0.5056 0.6038 0.0916  -0.1072 -0.1218 419 GLU A C   
3174 O O   . GLU A 408 ? 0.8082 0.5146 0.6139 0.0851  -0.1059 -0.1191 419 GLU A O   
3175 C CB  . GLU A 408 ? 0.8128 0.5100 0.6089 0.1042  -0.1162 -0.1247 419 GLU A CB  
3176 C CG  . GLU A 408 ? 1.0084 0.7037 0.7964 0.1141  -0.1186 -0.1305 419 GLU A CG  
3177 C CD  . GLU A 408 ? 1.3378 1.0383 1.1297 0.1212  -0.1202 -0.1333 419 GLU A CD  
3178 O OE1 . GLU A 408 ? 1.3693 1.0814 1.1627 0.1273  -0.1159 -0.1399 419 GLU A OE1 
3179 O OE2 . GLU A 408 ? 1.2685 0.9620 1.0620 0.1206  -0.1256 -0.1288 419 GLU A OE2 
3180 N N   . TRP A 409 ? 0.6175 0.3314 0.4347 0.0898  -0.1073 -0.1190 420 TRP A N   
3181 C CA  . TRP A 409 ? 0.5782 0.2931 0.4036 0.0800  -0.1058 -0.1126 420 TRP A CA  
3182 C C   . TRP A 409 ? 0.6523 0.3558 0.4758 0.0733  -0.1102 -0.1048 420 TRP A C   
3183 O O   . TRP A 409 ? 0.6604 0.3573 0.4831 0.0748  -0.1154 -0.1015 420 TRP A O   
3184 C CB  . TRP A 409 ? 0.5356 0.2567 0.3710 0.0798  -0.1055 -0.1111 420 TRP A CB  
3185 C CG  . TRP A 409 ? 0.5127 0.2360 0.3571 0.0698  -0.1037 -0.1046 420 TRP A CG  
3186 C CD1 . TRP A 409 ? 0.5340 0.2536 0.3845 0.0642  -0.1066 -0.0969 420 TRP A CD1 
3187 C CD2 . TRP A 409 ? 0.4920 0.2226 0.3406 0.0641  -0.0982 -0.1050 420 TRP A CD2 
3188 N NE1 . TRP A 409 ? 0.5009 0.2253 0.3594 0.0555  -0.1032 -0.0925 420 TRP A NE1 
3189 C CE2 . TRP A 409 ? 0.5127 0.2433 0.3702 0.0551  -0.0983 -0.0973 420 TRP A CE2 
3190 C CE3 . TRP A 409 ? 0.5012 0.2391 0.3466 0.0655  -0.0932 -0.1112 420 TRP A CE3 
3191 C CZ2 . TRP A 409 ? 0.4861 0.2230 0.3497 0.0476  -0.0939 -0.0955 420 TRP A CZ2 
3192 C CZ3 . TRP A 409 ? 0.5048 0.2487 0.3557 0.0579  -0.0889 -0.1096 420 TRP A CZ3 
3193 C CH2 . TRP A 409 ? 0.4980 0.2409 0.3580 0.0489  -0.0895 -0.1017 420 TRP A CH2 
3194 N N   . PRO A 410 ? 0.5997 0.3015 0.4226 0.0659  -0.1082 -0.1016 421 PRO A N   
3195 C CA  . PRO A 410 ? 0.5837 0.2757 0.4038 0.0606  -0.1122 -0.0949 421 PRO A CA  
3196 C C   . PRO A 410 ? 0.5867 0.2788 0.4159 0.0534  -0.1138 -0.0865 421 PRO A C   
3197 O O   . PRO A 410 ? 0.5792 0.2644 0.4064 0.0518  -0.1182 -0.0816 421 PRO A O   
3198 C CB  . PRO A 410 ? 0.6122 0.3043 0.4289 0.0556  -0.1088 -0.0951 421 PRO A CB  
3199 C CG  . PRO A 410 ? 0.6599 0.3629 0.4825 0.0538  -0.1029 -0.0983 421 PRO A CG  
3200 C CD  . PRO A 410 ? 0.6121 0.3212 0.4359 0.0624  -0.1023 -0.1045 421 PRO A CD  
3201 N N   . ILE A 411 ? 0.5332 0.2339 0.3723 0.0491  -0.1101 -0.0848 422 ILE A N   
3202 C CA  . ILE A 411 ? 0.4989 0.2015 0.3471 0.0426  -0.1110 -0.0771 422 ILE A CA  
3203 C C   . ILE A 411 ? 0.5748 0.2764 0.4242 0.0480  -0.1147 -0.0776 422 ILE A C   
3204 O O   . ILE A 411 ? 0.5582 0.2666 0.4148 0.0486  -0.1128 -0.0783 422 ILE A O   
3205 C CB  . ILE A 411 ? 0.5086 0.2209 0.3671 0.0357  -0.1058 -0.0749 422 ILE A CB  
3206 C CG1 . ILE A 411 ? 0.5051 0.2183 0.3615 0.0307  -0.1023 -0.0751 422 ILE A CG1 
3207 C CG2 . ILE A 411 ? 0.4886 0.2040 0.3565 0.0288  -0.1062 -0.0666 422 ILE A CG2 
3208 C CD1 . ILE A 411 ? 0.5112 0.2300 0.3655 0.0339  -0.0980 -0.0827 422 ILE A CD1 
3209 N N   . ASP A 412 ? 0.5773 0.2705 0.4193 0.0521  -0.1199 -0.0774 423 ASP A N   
3210 C CA  . ASP A 412 ? 0.5786 0.2696 0.4196 0.0582  -0.1240 -0.0787 423 ASP A CA  
3211 C C   . ASP A 412 ? 0.5995 0.2863 0.4419 0.0542  -0.1284 -0.0717 423 ASP A C   
3212 O O   . ASP A 412 ? 0.6010 0.2823 0.4388 0.0591  -0.1333 -0.0725 423 ASP A O   
3213 C CB  . ASP A 412 ? 0.6259 0.3115 0.4566 0.0677  -0.1266 -0.0856 423 ASP A CB  
3214 C CG  . ASP A 412 ? 0.7937 0.4700 0.6153 0.0674  -0.1298 -0.0844 423 ASP A CG  
3215 O OD1 . ASP A 412 ? 0.7635 0.4380 0.5867 0.0598  -0.1296 -0.0786 423 ASP A OD1 
3216 O OD2 . ASP A 412 ? 0.9382 0.6095 0.7511 0.0749  -0.1324 -0.0893 423 ASP A OD2 
3217 N N   . GLY A 413 ? 0.4727 0.1627 0.3215 0.0455  -0.1266 -0.0651 424 GLY A N   
3218 C CA  . GLY A 413 ? 0.4824 0.1703 0.3327 0.0416  -0.1300 -0.0589 424 GLY A CA  
3219 C C   . GLY A 413 ? 0.5926 0.2841 0.4486 0.0424  -0.1312 -0.0575 424 GLY A C   
3220 O O   . GLY A 413 ? 0.5892 0.2866 0.4507 0.0440  -0.1285 -0.0600 424 GLY A O   
3221 N N   . GLY A 414 ? 0.4828 0.1707 0.3374 0.0412  -0.1356 -0.0536 425 GLY A N   
3222 C CA  . GLY A 414 ? 0.4842 0.1750 0.3437 0.0413  -0.1371 -0.0518 425 GLY A CA  
3223 C C   . GLY A 414 ? 0.5761 0.2626 0.4305 0.0500  -0.1407 -0.0572 425 GLY A C   
3224 O O   . GLY A 414 ? 0.5604 0.2425 0.4078 0.0565  -0.1417 -0.0628 425 GLY A O   
3225 N N   . THR A 415 ? 0.6395 0.3281 0.4977 0.0502  -0.1425 -0.0555 426 THR A N   
3226 C CA  . THR A 415 ? 0.6683 0.3537 0.5227 0.0580  -0.1462 -0.0600 426 THR A CA  
3227 C C   . THR A 415 ? 0.7073 0.4005 0.5705 0.0574  -0.1438 -0.0597 426 THR A C   
3228 O O   . THR A 415 ? 0.6775 0.3750 0.5472 0.0512  -0.1428 -0.0543 426 THR A O   
3229 C CB  . THR A 415 ? 0.8754 0.5527 0.7229 0.0596  -0.1528 -0.0584 426 THR A CB  
3230 O OG1 . THR A 415 ? 0.8652 0.5362 0.7060 0.0581  -0.1547 -0.0571 426 THR A OG1 
3231 C CG2 . THR A 415 ? 0.9111 0.5838 0.7526 0.0689  -0.1569 -0.0641 426 THR A CG2 
3232 N N   . SER A 416 ? 0.7467 0.4421 0.6099 0.0641  -0.1428 -0.0655 427 SER A N   
3233 C CA  . SER A 416 ? 0.7341 0.4369 0.6053 0.0645  -0.1406 -0.0660 427 SER A CA  
3234 C C   . SER A 416 ? 0.8164 0.5157 0.6852 0.0684  -0.1459 -0.0661 427 SER A C   
3235 O O   . SER A 416 ? 0.8317 0.5255 0.6931 0.0759  -0.1498 -0.0707 427 SER A O   
3236 C CB  . SER A 416 ? 0.7533 0.4615 0.6261 0.0701  -0.1367 -0.0726 427 SER A CB  
3237 O OG  . SER A 416 ? 0.8190 0.5336 0.6983 0.0723  -0.1357 -0.0740 427 SER A OG  
3238 N N   . LEU A 417 ? 0.6942 0.3969 0.5693 0.0632  -0.1459 -0.0612 428 LEU A N   
3239 C CA  . LEU A 417 ? 0.6930 0.3928 0.5664 0.0658  -0.1507 -0.0608 428 LEU A CA  
3240 C C   . LEU A 417 ? 0.7823 0.4875 0.6603 0.0707  -0.1495 -0.0646 428 LEU A C   
3241 O O   . LEU A 417 ? 0.7890 0.4934 0.6674 0.0717  -0.1527 -0.0637 428 LEU A O   
3242 C CB  . LEU A 417 ? 0.6740 0.3751 0.5514 0.0578  -0.1512 -0.0538 428 LEU A CB  
3243 C CG  . LEU A 417 ? 0.7119 0.4099 0.5865 0.0521  -0.1517 -0.0495 428 LEU A CG  
3244 C CD1 . LEU A 417 ? 0.6929 0.3939 0.5720 0.0451  -0.1520 -0.0434 428 LEU A CD1 
3245 C CD2 . LEU A 417 ? 0.7373 0.4250 0.6008 0.0570  -0.1571 -0.0521 428 LEU A CD2 
3246 N N   . THR A 418 ? 0.7757 0.4867 0.6570 0.0736  -0.1451 -0.0689 429 THR A N   
3247 C CA  . THR A 418 ? 0.7761 0.4937 0.6626 0.0783  -0.1434 -0.0727 429 THR A CA  
3248 C C   . THR A 418 ? 0.8829 0.5983 0.7629 0.0887  -0.1459 -0.0800 429 THR A C   
3249 O O   . THR A 418 ? 0.8802 0.5938 0.7550 0.0922  -0.1450 -0.0838 429 THR A O   
3250 C CB  . THR A 418 ? 0.7795 0.5065 0.6745 0.0752  -0.1366 -0.0732 429 THR A CB  
3251 O OG1 . THR A 418 ? 0.6971 0.4280 0.5997 0.0663  -0.1343 -0.0666 429 THR A OG1 
3252 C CG2 . THR A 418 ? 0.7758 0.5101 0.6749 0.0819  -0.1345 -0.0790 429 THR A CG2 
3253 N N   . PRO A 419 ? 0.8734 0.5890 0.7532 0.0938  -0.1490 -0.0821 430 PRO A N   
3254 C CA  . PRO A 419 ? 0.8930 0.6082 0.7674 0.1040  -0.1510 -0.0892 430 PRO A CA  
3255 C C   . PRO A 419 ? 0.9720 0.6973 0.8512 0.1082  -0.1451 -0.0949 430 PRO A C   
3256 O O   . PRO A 419 ? 0.9554 0.6885 0.8431 0.1039  -0.1401 -0.0934 430 PRO A O   
3257 C CB  . PRO A 419 ? 0.9151 0.6296 0.7901 0.1069  -0.1552 -0.0891 430 PRO A CB  
3258 C CG  . PRO A 419 ? 0.9624 0.6744 0.8407 0.0980  -0.1564 -0.0816 430 PRO A CG  
3259 C CD  . PRO A 419 ? 0.8899 0.6067 0.7745 0.0904  -0.1508 -0.0780 430 PRO A CD  
3260 N N   . ALA A 420 ? 0.9812 0.7069 0.8548 0.1167  -0.1456 -0.1015 431 ALA A N   
3261 C CA  . ALA A 420 ? 0.9819 0.7186 0.8595 0.1216  -0.1399 -0.1076 431 ALA A CA  
3262 C C   . ALA A 420 ? 1.0466 0.7932 0.9335 0.1225  -0.1375 -0.1084 431 ALA A C   
3263 O O   . ALA A 420 ? 1.0592 0.8037 0.9466 0.1239  -0.1415 -0.1071 431 ALA A O   
3264 C CB  . ALA A 420 ? 1.0037 0.7404 0.8739 0.1313  -0.1413 -0.1147 431 ALA A CB  
3265 N N   . PRO A 421 ? 0.7514 0.6755 0.6706 0.1174  -0.0485 -0.0967 432 PRO A N   
3266 C CA  . PRO A 421 ? 0.7379 0.6602 0.6622 0.1158  -0.0494 -0.0957 432 PRO A CA  
3267 C C   . PRO A 421 ? 0.7629 0.6938 0.6912 0.1196  -0.0495 -0.0994 432 PRO A C   
3268 O O   . PRO A 421 ? 0.7590 0.7007 0.6860 0.1254  -0.0483 -0.1045 432 PRO A O   
3269 C CB  . PRO A 421 ? 0.7639 0.6879 0.6861 0.1179  -0.0486 -0.0973 432 PRO A CB  
3270 C CG  . PRO A 421 ? 0.8246 0.7457 0.7403 0.1174  -0.0478 -0.0965 432 PRO A CG  
3271 C CD  . PRO A 421 ? 0.7720 0.6977 0.6858 0.1195  -0.0472 -0.0982 432 PRO A CD  
3272 N N   . PRO A 422 ? 0.9043 0.8314 0.8376 0.1162  -0.0506 -0.0969 433 PRO A N   
3273 C CA  . PRO A 422 ? 0.8921 0.8267 0.8290 0.1196  -0.0509 -0.1003 433 PRO A CA  
3274 C C   . PRO A 422 ? 0.9071 0.8509 0.8459 0.1246  -0.0501 -0.1047 433 PRO A C   
3275 O O   . PRO A 422 ? 0.9131 0.8679 0.8523 0.1299  -0.0493 -0.1095 433 PRO A O   
3276 C CB  . PRO A 422 ? 0.9097 0.8374 0.8510 0.1140  -0.0520 -0.0959 433 PRO A CB  
3277 C CG  . PRO A 422 ? 0.9664 0.8854 0.9076 0.1087  -0.0521 -0.0911 433 PRO A CG  
3278 C CD  . PRO A 422 ? 0.9161 0.8332 0.8518 0.1092  -0.0515 -0.0909 433 PRO A CD  
3279 N N   . GLN A 423 ? 0.6795 0.6201 0.6198 0.1231  -0.0502 -0.1033 434 GLN A N   
3280 C CA  . GLN A 423 ? 0.6565 0.6066 0.5992 0.1277  -0.0493 -0.1072 434 GLN A CA  
3281 C C   . GLN A 423 ? 0.6438 0.5964 0.5823 0.1296  -0.0478 -0.1083 434 GLN A C   
3282 O O   . GLN A 423 ? 0.6273 0.5699 0.5621 0.1259  -0.0483 -0.1047 434 GLN A O   
3283 C CB  . GLN A 423 ? 0.6664 0.6121 0.6150 0.1248  -0.0506 -0.1050 434 GLN A CB  
3284 C CG  . GLN A 423 ? 0.7592 0.6922 0.7079 0.1187  -0.0518 -0.0994 434 GLN A CG  
3285 C CD  . GLN A 423 ? 0.8273 0.7571 0.7822 0.1160  -0.0529 -0.0973 434 GLN A CD  
3286 O OE1 . GLN A 423 ? 0.7764 0.7022 0.7341 0.1121  -0.0537 -0.0945 434 GLN A OE1 
3287 N NE2 . GLN A 423 ? 0.5453 0.4778 0.5025 0.1182  -0.0529 -0.0986 434 GLN A NE2 
3288 N N   . ARG A 424 ? 0.6765 0.6437 0.6156 0.1355  -0.0456 -0.1132 435 ARG A N   
3289 C CA  . ARG A 424 ? 0.6566 0.6318 0.5926 0.1357  -0.0431 -0.1128 435 ARG A CA  
3290 C C   . ARG A 424 ? 0.6784 0.6544 0.6209 0.1280  -0.0430 -0.1052 435 ARG A C   
3291 O O   . ARG A 424 ? 0.6805 0.6669 0.6296 0.1279  -0.0422 -0.1048 435 ARG A O   
3292 C CB  . ARG A 424 ? 0.6002 0.5970 0.5365 0.1389  -0.0395 -0.1152 435 ARG A CB  
3293 C CG  . ARG A 424 ? 0.7230 0.7198 0.6532 0.1454  -0.0395 -0.1217 435 ARG A CG  
3294 C CD  . ARG A 424 ? 0.8024 0.8197 0.7338 0.1510  -0.0366 -0.1266 435 ARG A CD  
3295 N NE  . ARG A 424 ? 0.7499 0.7718 0.6882 0.1525  -0.0375 -0.1282 435 ARG A NE  
3296 C CZ  . ARG A 424 ? 0.9220 0.9372 0.8625 0.1514  -0.0400 -0.1277 435 ARG A CZ  
3297 N NH1 . ARG A 424 ? 0.7302 0.7344 0.6672 0.1488  -0.0418 -0.1255 435 ARG A NH1 
3298 N NH2 . ARG A 424 ? 0.7999 0.8199 0.7462 0.1528  -0.0406 -0.1292 435 ARG A NH2 
3299 N N   . ASP A 425 ? 0.5303 0.4953 0.4710 0.1217  -0.0440 -0.0992 436 ASP A N   
3300 C CA  . ASP A 425 ? 0.5016 0.4666 0.4479 0.1139  -0.0440 -0.0916 436 ASP A CA  
3301 C C   . ASP A 425 ? 0.5105 0.4885 0.4564 0.1079  -0.0408 -0.0851 436 ASP A C   
3302 O O   . ASP A 425 ? 0.5030 0.4820 0.4429 0.1080  -0.0396 -0.0851 436 ASP A O   
3303 C CB  . ASP A 425 ? 0.5172 0.4606 0.4623 0.1106  -0.0474 -0.0890 436 ASP A CB  
3304 C CG  . ASP A 425 ? 0.5343 0.4654 0.4813 0.1155  -0.0507 -0.0942 436 ASP A CG  
3305 O OD1 . ASP A 425 ? 0.5029 0.4431 0.4540 0.1198  -0.0502 -0.0983 436 ASP A OD1 
3306 O OD2 . ASP A 425 ? 0.6485 0.5626 0.5936 0.1131  -0.0533 -0.0925 436 ASP A OD2 
3307 N N   . LEU A 426 ? 0.4577 0.4457 0.4102 0.1025  -0.0395 -0.0796 437 LEU A N   
3308 C CA  . LEU A 426 ? 0.4461 0.4490 0.3996 0.0968  -0.0364 -0.0734 437 LEU A CA  
3309 C C   . LEU A 426 ? 0.4870 0.4840 0.4443 0.0882  -0.0373 -0.0650 437 LEU A C   
3310 O O   . LEU A 426 ? 0.4741 0.4666 0.4371 0.0867  -0.0390 -0.0638 437 LEU A O   
3311 C CB  . LEU A 426 ? 0.4370 0.4618 0.3952 0.0989  -0.0334 -0.0748 437 LEU A CB  
3312 C CG  . LEU A 426 ? 0.4832 0.5270 0.4410 0.0957  -0.0296 -0.0710 437 LEU A CG  
3313 C CD1 . LEU A 426 ? 0.4890 0.5319 0.4386 0.0982  -0.0286 -0.0734 437 LEU A CD1 
3314 C CD2 . LEU A 426 ? 0.4890 0.5527 0.4517 0.0991  -0.0272 -0.0737 437 LEU A CD2 
3315 N N   . LEU A 427 ? 0.4005 0.3974 0.3546 0.0825  -0.0362 -0.0594 438 LEU A N   
3316 C CA  . LEU A 427 ? 0.3958 0.3890 0.3533 0.0739  -0.0368 -0.0510 438 LEU A CA  
3317 C C   . LEU A 427 ? 0.4244 0.4365 0.3838 0.0690  -0.0333 -0.0455 438 LEU A C   
3318 O O   . LEU A 427 ? 0.4357 0.4550 0.3902 0.0697  -0.0311 -0.0458 438 LEU A O   
3319 C CB  . LEU A 427 ? 0.4025 0.3767 0.3546 0.0709  -0.0391 -0.0486 438 LEU A CB  
3320 C CG  . LEU A 427 ? 0.4560 0.4258 0.4112 0.0619  -0.0398 -0.0398 438 LEU A CG  
3321 C CD1 . LEU A 427 ? 0.4524 0.4198 0.4153 0.0601  -0.0415 -0.0382 438 LEU A CD1 
3322 C CD2 . LEU A 427 ? 0.4764 0.4274 0.4260 0.0592  -0.0420 -0.0378 438 LEU A CD2 
3323 N N   . LEU A 428 ? 0.4078 0.4280 0.3744 0.0642  -0.0328 -0.0405 439 LEU A N   
3324 C CA  . LEU A 428 ? 0.3920 0.4304 0.3615 0.0590  -0.0297 -0.0347 439 LEU A CA  
3325 C C   . LEU A 428 ? 0.3898 0.4213 0.3610 0.0501  -0.0306 -0.0261 439 LEU A C   
3326 O O   . LEU A 428 ? 0.3657 0.3854 0.3405 0.0476  -0.0333 -0.0241 439 LEU A O   
3327 C CB  . LEU A 428 ? 0.3909 0.4460 0.3675 0.0603  -0.0280 -0.0355 439 LEU A CB  
3328 C CG  . LEU A 428 ? 0.4366 0.4974 0.4130 0.0693  -0.0276 -0.0442 439 LEU A CG  
3329 C CD1 . LEU A 428 ? 0.4460 0.5261 0.4293 0.0695  -0.0254 -0.0439 439 LEU A CD1 
3330 C CD2 . LEU A 428 ? 0.3661 0.4303 0.3351 0.0744  -0.0261 -0.0491 439 LEU A CD2 
3331 N N   . THR A 429 ? 0.3127 0.3517 0.2814 0.0454  -0.0286 -0.0211 440 THR A N   
3332 C CA  . THR A 429 ? 0.2990 0.3332 0.2692 0.0367  -0.0293 -0.0126 440 THR A CA  
3333 C C   . THR A 429 ? 0.3475 0.4019 0.3221 0.0316  -0.0262 -0.0068 440 THR A C   
3334 O O   . THR A 429 ? 0.3424 0.4111 0.3144 0.0332  -0.0232 -0.0077 440 THR A O   
3335 C CB  . THR A 429 ? 0.3745 0.3964 0.3372 0.0349  -0.0300 -0.0112 440 THR A CB  
3336 O OG1 . THR A 429 ? 0.3787 0.4120 0.3363 0.0378  -0.0271 -0.0135 440 THR A OG1 
3337 C CG2 . THR A 429 ? 0.2914 0.2923 0.2501 0.0392  -0.0333 -0.0162 440 THR A CG2 
3338 N N   . GLY A 430 ? 0.3632 0.4187 0.3444 0.0256  -0.0270 -0.0009 441 GLY A N   
3339 C CA  . GLY A 430 ? 0.3535 0.4260 0.3388 0.0196  -0.0245 0.0058  441 GLY A CA  
3340 C C   . GLY A 430 ? 0.4084 0.4751 0.3913 0.0120  -0.0249 0.0131  441 GLY A C   
3341 O O   . GLY A 430 ? 0.4022 0.4508 0.3833 0.0097  -0.0277 0.0148  441 GLY A O   
3342 N N   . HIS A 431 ? 0.2962 0.3786 0.2789 0.0083  -0.0220 0.0176  442 HIS A N   
3343 C CA  . HIS A 431 ? 0.2996 0.3781 0.2789 0.0019  -0.0218 0.0238  442 HIS A CA  
3344 C C   . HIS A 431 ? 0.3987 0.4903 0.3837 -0.0060 -0.0205 0.0322  442 HIS A C   
3345 O O   . HIS A 431 ? 0.3995 0.5053 0.3907 -0.0062 -0.0192 0.0329  442 HIS A O   
3346 C CB  . HIS A 431 ? 0.2959 0.3787 0.2675 0.0051  -0.0197 0.0209  442 HIS A CB  
3347 C CG  . HIS A 431 ? 0.3328 0.4024 0.2985 0.0126  -0.0211 0.0129  442 HIS A CG  
3348 N ND1 . HIS A 431 ? 0.3484 0.4003 0.3079 0.0122  -0.0231 0.0127  442 HIS A ND1 
3349 C CD2 . HIS A 431 ? 0.3504 0.4218 0.3155 0.0207  -0.0209 0.0049  442 HIS A CD2 
3350 C CE1 . HIS A 431 ? 0.3385 0.3819 0.2939 0.0197  -0.0241 0.0049  442 HIS A CE1 
3351 N NE2 . HIS A 431 ? 0.3449 0.3997 0.3035 0.0250  -0.0228 0.0001  442 HIS A NE2 
3352 N N   . GLU A 432 ? 0.4178 0.5044 0.4006 -0.0126 -0.0209 0.0386  443 GLU A N   
3353 C CA  . GLU A 432 ? 0.4380 0.5339 0.4262 -0.0209 -0.0202 0.0472  443 GLU A CA  
3354 C C   . GLU A 432 ? 0.5059 0.6252 0.4954 -0.0216 -0.0164 0.0490  443 GLU A C   
3355 O O   . GLU A 432 ? 0.5145 0.6460 0.5102 -0.0265 -0.0155 0.0543  443 GLU A O   
3356 C CB  . GLU A 432 ? 0.4627 0.5461 0.4478 -0.0275 -0.0218 0.0533  443 GLU A CB  
3357 C CG  . GLU A 432 ? 0.6296 0.7155 0.6209 -0.0362 -0.0227 0.0621  443 GLU A CG  
3358 C CD  . GLU A 432 ? 1.0033 1.0801 0.9911 -0.0427 -0.0237 0.0683  443 GLU A CD  
3359 O OE1 . GLU A 432 ? 0.8230 0.9122 0.8098 -0.0467 -0.0213 0.0728  443 GLU A OE1 
3360 O OE2 . GLU A 432 ? 1.0799 1.1376 1.0660 -0.0439 -0.0268 0.0687  443 GLU A OE2 
3361 N N   . ASP A 433 ? 0.4013 0.5273 0.3849 -0.0169 -0.0141 0.0446  444 ASP A N   
3362 C CA  . ASP A 433 ? 0.3923 0.5405 0.3764 -0.0174 -0.0103 0.0461  444 ASP A CA  
3363 C C   . ASP A 433 ? 0.4307 0.5934 0.4183 -0.0114 -0.0085 0.0406  444 ASP A C   
3364 O O   . ASP A 433 ? 0.4477 0.6293 0.4353 -0.0104 -0.0053 0.0404  444 ASP A O   
3365 C CB  . ASP A 433 ? 0.4139 0.5629 0.3898 -0.0157 -0.0086 0.0445  444 ASP A CB  
3366 C CG  . ASP A 433 ? 0.5269 0.6676 0.4969 -0.0068 -0.0090 0.0353  444 ASP A CG  
3367 O OD1 . ASP A 433 ? 0.5364 0.6711 0.5086 -0.0017 -0.0106 0.0299  444 ASP A OD1 
3368 O OD2 . ASP A 433 ? 0.6426 0.7827 0.6058 -0.0049 -0.0078 0.0334  444 ASP A OD2 
3369 N N   . GLY A 434 ? 0.3765 0.5312 0.3673 -0.0074 -0.0106 0.0362  445 GLY A N   
3370 C CA  . GLY A 434 ? 0.3711 0.5385 0.3656 -0.0017 -0.0092 0.0309  445 GLY A CA  
3371 C C   . GLY A 434 ? 0.4012 0.5676 0.3902 0.0075  -0.0085 0.0217  445 GLY A C   
3372 O O   . GLY A 434 ? 0.3942 0.5743 0.3855 0.0124  -0.0067 0.0173  445 GLY A O   
3373 N N   . THR A 435 ? 0.4201 0.5709 0.4022 0.0100  -0.0099 0.0187  446 THR A N   
3374 C CA  . THR A 435 ? 0.4194 0.5679 0.3962 0.0188  -0.0096 0.0098  446 THR A CA  
3375 C C   . THR A 435 ? 0.4540 0.5857 0.4314 0.0236  -0.0128 0.0043  446 THR A C   
3376 O O   . THR A 435 ? 0.4495 0.5663 0.4290 0.0200  -0.0156 0.0073  446 THR A O   
3377 C CB  . THR A 435 ? 0.4675 0.6097 0.4358 0.0194  -0.0091 0.0091  446 THR A CB  
3378 O OG1 . THR A 435 ? 0.3210 0.4459 0.2876 0.0138  -0.0116 0.0140  446 THR A OG1 
3379 C CG2 . THR A 435 ? 0.4359 0.5974 0.4028 0.0171  -0.0054 0.0122  446 THR A CG2 
3380 N N   . VAL A 436 ? 0.3393 0.4740 0.3150 0.0319  -0.0123 -0.0039 447 VAL A N   
3381 C CA  . VAL A 436 ? 0.3276 0.4469 0.3028 0.0377  -0.0151 -0.0103 447 VAL A CA  
3382 C C   . VAL A 436 ? 0.3835 0.4972 0.3508 0.0446  -0.0150 -0.0173 447 VAL A C   
3383 O O   . VAL A 436 ? 0.3835 0.5115 0.3488 0.0490  -0.0124 -0.0211 447 VAL A O   
3384 C CB  . VAL A 436 ? 0.3670 0.4951 0.3487 0.0415  -0.0150 -0.0139 447 VAL A CB  
3385 C CG1 . VAL A 436 ? 0.3566 0.4707 0.3365 0.0489  -0.0175 -0.0218 447 VAL A CG1 
3386 C CG2 . VAL A 436 ? 0.3547 0.4839 0.3441 0.0350  -0.0159 -0.0074 447 VAL A CG2 
3387 N N   . ARG A 437 ? 0.3222 0.4155 0.2851 0.0456  -0.0179 -0.0191 448 ARG A N   
3388 C CA  . ARG A 437 ? 0.3318 0.4178 0.2869 0.0517  -0.0181 -0.0253 448 ARG A CA  
3389 C C   . ARG A 437 ? 0.3742 0.4485 0.3291 0.0589  -0.0205 -0.0330 448 ARG A C   
3390 O O   . ARG A 437 ? 0.3636 0.4238 0.3212 0.0575  -0.0235 -0.0322 448 ARG A O   
3391 C CB  . ARG A 437 ? 0.3260 0.3981 0.2753 0.0474  -0.0192 -0.0216 448 ARG A CB  
3392 C CG  . ARG A 437 ? 0.3567 0.4417 0.3048 0.0417  -0.0164 -0.0153 448 ARG A CG  
3393 C CD  . ARG A 437 ? 0.3942 0.4659 0.3366 0.0374  -0.0174 -0.0115 448 ARG A CD  
3394 N NE  . ARG A 437 ? 0.3112 0.3964 0.2519 0.0330  -0.0145 -0.0065 448 ARG A NE  
3395 C CZ  . ARG A 437 ? 0.5644 0.6581 0.5096 0.0254  -0.0134 0.0014  448 ARG A CZ  
3396 N NH1 . ARG A 437 ? 0.3650 0.4548 0.3166 0.0213  -0.0152 0.0053  448 ARG A NH1 
3397 N NH2 . ARG A 437 ? 0.3963 0.5023 0.3395 0.0218  -0.0108 0.0056  448 ARG A NH2 
3398 N N   . PHE A 438 ? 0.3558 0.4363 0.3074 0.0665  -0.0194 -0.0403 449 PHE A N   
3399 C CA  . PHE A 438 ? 0.3504 0.4216 0.3014 0.0741  -0.0215 -0.0483 449 PHE A CA  
3400 C C   . PHE A 438 ? 0.4166 0.4707 0.3596 0.0772  -0.0234 -0.0519 449 PHE A C   
3401 O O   . PHE A 438 ? 0.4410 0.4998 0.3782 0.0793  -0.0217 -0.0537 449 PHE A O   
3402 C CB  . PHE A 438 ? 0.3670 0.4551 0.3192 0.0808  -0.0193 -0.0544 449 PHE A CB  
3403 C CG  . PHE A 438 ? 0.3730 0.4761 0.3334 0.0790  -0.0180 -0.0522 449 PHE A CG  
3404 C CD1 . PHE A 438 ? 0.4081 0.5228 0.3726 0.0716  -0.0161 -0.0443 449 PHE A CD1 
3405 C CD2 . PHE A 438 ? 0.3800 0.4859 0.3440 0.0849  -0.0187 -0.0580 449 PHE A CD2 
3406 C CE1 . PHE A 438 ? 0.4057 0.5342 0.3777 0.0699  -0.0149 -0.0423 449 PHE A CE1 
3407 C CE2 . PHE A 438 ? 0.4104 0.5302 0.3820 0.0834  -0.0174 -0.0561 449 PHE A CE2 
3408 C CZ  . PHE A 438 ? 0.3886 0.5197 0.3642 0.0759  -0.0155 -0.0482 449 PHE A CZ  
3409 N N   . TRP A 439 ? 0.3847 0.4193 0.3274 0.0776  -0.0269 -0.0530 450 TRP A N   
3410 C CA  . TRP A 439 ? 0.3866 0.4033 0.3222 0.0799  -0.0291 -0.0558 450 TRP A CA  
3411 C C   . TRP A 439 ? 0.4599 0.4672 0.3942 0.0880  -0.0313 -0.0642 450 TRP A C   
3412 O O   . TRP A 439 ? 0.4431 0.4482 0.3828 0.0894  -0.0328 -0.0658 450 TRP A O   
3413 C CB  . TRP A 439 ? 0.3599 0.3597 0.2954 0.0733  -0.0315 -0.0498 450 TRP A CB  
3414 C CG  . TRP A 439 ? 0.3619 0.3688 0.2993 0.0648  -0.0299 -0.0411 450 TRP A CG  
3415 C CD1 . TRP A 439 ? 0.3917 0.4051 0.3362 0.0589  -0.0296 -0.0352 450 TRP A CD1 
3416 C CD2 . TRP A 439 ? 0.3615 0.3696 0.2937 0.0610  -0.0284 -0.0372 450 TRP A CD2 
3417 N NE1 . TRP A 439 ? 0.3821 0.4007 0.3262 0.0518  -0.0281 -0.0279 450 TRP A NE1 
3418 C CE2 . TRP A 439 ? 0.4065 0.4221 0.3431 0.0529  -0.0273 -0.0290 450 TRP A CE2 
3419 C CE3 . TRP A 439 ? 0.3779 0.3817 0.3022 0.0637  -0.0280 -0.0400 450 TRP A CE3 
3420 C CZ2 . TRP A 439 ? 0.3994 0.4181 0.3327 0.0475  -0.0258 -0.0234 450 TRP A CZ2 
3421 C CZ3 . TRP A 439 ? 0.4003 0.4072 0.3213 0.0583  -0.0264 -0.0344 450 TRP A CZ3 
3422 C CH2 . TRP A 439 ? 0.4107 0.4250 0.3362 0.0503  -0.0253 -0.0262 450 TRP A CH2 
3423 N N   . ASP A 440 ? 0.4962 0.4977 0.4235 0.0933  -0.0316 -0.0695 451 ASP A N   
3424 C CA  . ASP A 440 ? 0.4968 0.4871 0.4219 0.1008  -0.0341 -0.0774 451 ASP A CA  
3425 C C   . ASP A 440 ? 0.5219 0.4898 0.4460 0.0985  -0.0378 -0.0759 451 ASP A C   
3426 O O   . ASP A 440 ? 0.5036 0.4587 0.4216 0.0979  -0.0390 -0.0756 451 ASP A O   
3427 C CB  . ASP A 440 ? 0.5350 0.5269 0.4528 0.1069  -0.0332 -0.0833 451 ASP A CB  
3428 C CG  . ASP A 440 ? 0.6823 0.6620 0.5975 0.1147  -0.0359 -0.0914 451 ASP A CG  
3429 O OD1 . ASP A 440 ? 0.6970 0.6716 0.6168 0.1164  -0.0378 -0.0933 451 ASP A OD1 
3430 O OD2 . ASP A 440 ? 0.7670 0.7423 0.6755 0.1191  -0.0361 -0.0958 451 ASP A OD2 
3431 N N   . ALA A 441 ? 0.3621 0.3255 0.2924 0.0973  -0.0396 -0.0748 452 ALA A N   
3432 C CA  . ALA A 441 ? 0.3559 0.2989 0.2862 0.0951  -0.0432 -0.0733 452 ALA A CA  
3433 C C   . ALA A 441 ? 0.4422 0.3721 0.3702 0.1024  -0.0460 -0.0809 452 ALA A C   
3434 O O   . ALA A 441 ? 0.4418 0.3567 0.3716 0.1016  -0.0491 -0.0806 452 ALA A O   
3435 C CB  . ALA A 441 ? 0.3583 0.3028 0.2966 0.0896  -0.0438 -0.0679 452 ALA A CB  
3436 N N   . SER A 442 ? 0.5030 0.4381 0.4271 0.1094  -0.0451 -0.0877 453 SER A N   
3437 C CA  . SER A 442 ? 0.5060 0.4303 0.4283 0.1168  -0.0477 -0.0953 453 SER A CA  
3438 C C   . SER A 442 ? 0.5322 0.4397 0.4515 0.1126  -0.0499 -0.0918 453 SER A C   
3439 O O   . SER A 442 ? 0.5222 0.4242 0.4467 0.1079  -0.0512 -0.0880 453 SER A O   
3440 C CB  . SER A 442 ? 0.5778 0.5138 0.4972 0.1242  -0.0460 -0.1023 453 SER A CB  
3441 O OG  . SER A 442 ? 0.6879 0.6443 0.6124 0.1243  -0.0431 -0.1019 453 SER A OG  
3442 N N   . GLY A 443 ? 0.5288 0.4321 0.4414 0.1115  -0.0494 -0.0907 454 GLY A N   
3443 C CA  . GLY A 443 ? 0.5088 0.4013 0.4210 0.1048  -0.0504 -0.0847 454 GLY A CA  
3444 C C   . GLY A 443 ? 0.5240 0.4063 0.4315 0.1006  -0.0509 -0.0806 454 GLY A C   
3445 O O   . GLY A 443 ? 0.5122 0.3895 0.4194 0.0994  -0.0519 -0.0794 454 GLY A O   
3446 N N   . VAL A 444 ? 0.4599 0.3388 0.3637 0.0981  -0.0505 -0.0783 455 VAL A N   
3447 C CA  . VAL A 444 ? 0.4468 0.3156 0.3473 0.0927  -0.0511 -0.0732 455 VAL A CA  
3448 C C   . VAL A 444 ? 0.5119 0.3797 0.4036 0.0960  -0.0506 -0.0761 455 VAL A C   
3449 O O   . VAL A 444 ? 0.5162 0.3791 0.4083 0.0892  -0.0508 -0.0695 455 VAL A O   
3450 C CB  . VAL A 444 ? 0.4742 0.3412 0.3744 0.0891  -0.0505 -0.0699 455 VAL A CB  
3451 C CG1 . VAL A 444 ? 0.4690 0.3277 0.3648 0.0844  -0.0507 -0.0654 455 VAL A CG1 
3452 C CG2 . VAL A 444 ? 0.4574 0.3251 0.3656 0.0844  -0.0507 -0.0663 455 VAL A CG2 
3453 N N   . CYS A 445 ? 0.4938 0.3784 0.3847 0.0992  -0.0475 -0.0787 456 CYS A N   
3454 C CA  . CYS A 445 ? 0.4919 0.3905 0.3822 0.0944  -0.0442 -0.0735 456 CYS A CA  
3455 C C   . CYS A 445 ? 0.5515 0.4686 0.4492 0.0923  -0.0418 -0.0709 456 CYS A C   
3456 O O   . CYS A 445 ? 0.5807 0.5087 0.4808 0.0977  -0.0408 -0.0759 456 CYS A O   
3457 C CB  . CYS A 445 ? 0.4994 0.4044 0.3831 0.0988  -0.0423 -0.0776 456 CYS A CB  
3458 S SG  . CYS A 445 ? 0.5481 0.4332 0.4226 0.0992  -0.0445 -0.0784 456 CYS A SG  
3459 N N   . LEU A 446 ? 0.4253 0.3459 0.3267 0.0845  -0.0410 -0.0631 457 LEU A N   
3460 C CA  . LEU A 446 ? 0.4128 0.3505 0.3212 0.0813  -0.0388 -0.0596 457 LEU A CA  
3461 C C   . LEU A 446 ? 0.5232 0.4794 0.4298 0.0807  -0.0349 -0.0583 457 LEU A C   
3462 O O   . LEU A 446 ? 0.5491 0.5084 0.4543 0.0746  -0.0336 -0.0521 457 LEU A O   
3463 C CB  . LEU A 446 ? 0.3902 0.3228 0.3034 0.0732  -0.0399 -0.0517 457 LEU A CB  
3464 C CG  . LEU A 446 ? 0.4228 0.3698 0.3444 0.0701  -0.0384 -0.0482 457 LEU A CG  
3465 C CD1 . LEU A 446 ? 0.4119 0.3574 0.3380 0.0753  -0.0400 -0.0535 457 LEU A CD1 
3466 C CD2 . LEU A 446 ? 0.4260 0.3685 0.3512 0.0613  -0.0392 -0.0397 457 LEU A CD2 
3467 N N   . ARG A 447 ? 0.4555 0.4242 0.3619 0.0871  -0.0332 -0.0642 458 ARG A N   
3468 C CA  . ARG A 447 ? 0.4450 0.4315 0.3492 0.0879  -0.0297 -0.0643 458 ARG A CA  
3469 C C   . ARG A 447 ? 0.4923 0.4988 0.4035 0.0858  -0.0271 -0.0617 458 ARG A C   
3470 O O   . ARG A 447 ? 0.5004 0.5099 0.4170 0.0884  -0.0277 -0.0643 458 ARG A O   
3471 C CB  . ARG A 447 ? 0.4553 0.4427 0.3543 0.0966  -0.0295 -0.0729 458 ARG A CB  
3472 C CG  . ARG A 447 ? 0.5798 0.5881 0.4778 0.0992  -0.0258 -0.0747 458 ARG A CG  
3473 C CD  . ARG A 447 ? 0.7439 0.7505 0.6360 0.1076  -0.0260 -0.0831 458 ARG A CD  
3474 N NE  . ARG A 447 ? 0.8972 0.9231 0.7912 0.1126  -0.0235 -0.0874 458 ARG A NE  
3475 C CZ  . ARG A 447 ? 1.0712 1.0998 0.9686 0.1185  -0.0243 -0.0933 458 ARG A CZ  
3476 N NH1 . ARG A 447 ? 0.9156 0.9288 0.8148 0.1201  -0.0276 -0.0954 458 ARG A NH1 
3477 N NH2 . ARG A 447 ? 0.8286 0.8753 0.7276 0.1228  -0.0218 -0.0969 458 ARG A NH2 
3478 N N   . LEU A 448 ? 0.4743 0.4946 0.3854 0.0812  -0.0241 -0.0566 459 LEU A N   
3479 C CA  . LEU A 448 ? 0.4638 0.5043 0.3812 0.0788  -0.0214 -0.0536 459 LEU A CA  
3480 C C   . LEU A 448 ? 0.5576 0.6133 0.4746 0.0862  -0.0193 -0.0604 459 LEU A C   
3481 O O   . LEU A 448 ? 0.5748 0.6332 0.4858 0.0902  -0.0181 -0.0642 459 LEU A O   
3482 C CB  . LEU A 448 ? 0.4527 0.5026 0.3699 0.0713  -0.0190 -0.0458 459 LEU A CB  
3483 C CG  . LEU A 448 ? 0.4852 0.5574 0.4083 0.0686  -0.0159 -0.0423 459 LEU A CG  
3484 C CD1 . LEU A 448 ? 0.4786 0.5505 0.4098 0.0654  -0.0172 -0.0392 459 LEU A CD1 
3485 C CD2 . LEU A 448 ? 0.4869 0.5681 0.4084 0.0619  -0.0135 -0.0353 459 LEU A CD2 
3486 N N   . LEU A 449 ? 0.4616 0.5274 0.3852 0.0879  -0.0188 -0.0619 460 LEU A N   
3487 C CA  . LEU A 449 ? 0.4552 0.5361 0.3794 0.0948  -0.0170 -0.0682 460 LEU A CA  
3488 C C   . LEU A 449 ? 0.5087 0.6128 0.4373 0.0919  -0.0134 -0.0645 460 LEU A C   
3489 O O   . LEU A 449 ? 0.5342 0.6528 0.4608 0.0963  -0.0109 -0.0683 460 LEU A O   
3490 C CB  . LEU A 449 ? 0.4451 0.5205 0.3733 0.1001  -0.0192 -0.0737 460 LEU A CB  
3491 C CG  . LEU A 449 ? 0.4771 0.5302 0.4016 0.1038  -0.0229 -0.0781 460 LEU A CG  
3492 C CD1 . LEU A 449 ? 0.4742 0.5230 0.4042 0.1071  -0.0250 -0.0818 460 LEU A CD1 
3493 C CD2 . LEU A 449 ? 0.4585 0.5090 0.3755 0.1106  -0.0228 -0.0849 460 LEU A CD2 
3494 N N   . TYR A 450 ? 0.4206 0.5287 0.3550 0.0847  -0.0130 -0.0573 461 TYR A N   
3495 C CA  . TYR A 450 ? 0.4091 0.5391 0.3484 0.0817  -0.0098 -0.0535 461 TYR A CA  
3496 C C   . TYR A 450 ? 0.4596 0.5887 0.4034 0.0723  -0.0100 -0.0442 461 TYR A C   
3497 O O   . TYR A 450 ? 0.4405 0.5541 0.3863 0.0694  -0.0128 -0.0418 461 TYR A O   
3498 C CB  . TYR A 450 ? 0.4206 0.5612 0.3655 0.0868  -0.0094 -0.0583 461 TYR A CB  
3499 C CG  . TYR A 450 ? 0.4416 0.6027 0.3931 0.0828  -0.0067 -0.0536 461 TYR A CG  
3500 C CD1 . TYR A 450 ? 0.4721 0.6534 0.4226 0.0839  -0.0032 -0.0539 461 TYR A CD1 
3501 C CD2 . TYR A 450 ? 0.4317 0.5922 0.3904 0.0781  -0.0077 -0.0489 461 TYR A CD2 
3502 C CE1 . TYR A 450 ? 0.4784 0.6786 0.4348 0.0802  -0.0007 -0.0495 461 TYR A CE1 
3503 C CE2 . TYR A 450 ? 0.4367 0.6159 0.4014 0.0744  -0.0052 -0.0446 461 TYR A CE2 
3504 C CZ  . TYR A 450 ? 0.5431 0.7421 0.5066 0.0755  -0.0018 -0.0449 461 TYR A CZ  
3505 O OH  . TYR A 450 ? 0.5374 0.7554 0.5071 0.0718  0.0006  -0.0405 461 TYR A OH  
3506 N N   . LYS A 451 ? 0.5020 0.6479 0.4472 0.0676  -0.0070 -0.0388 462 LYS A N   
3507 C CA  . LYS A 451 ? 0.5006 0.6484 0.4503 0.0585  -0.0068 -0.0297 462 LYS A CA  
3508 C C   . LYS A 451 ? 0.5684 0.7379 0.5248 0.0568  -0.0041 -0.0272 462 LYS A C   
3509 O O   . LYS A 451 ? 0.5852 0.7720 0.5405 0.0596  -0.0012 -0.0293 462 LYS A O   
3510 C CB  . LYS A 451 ? 0.5123 0.6581 0.4570 0.0531  -0.0059 -0.0242 462 LYS A CB  
3511 C CG  . LYS A 451 ? 0.5244 0.6651 0.4729 0.0438  -0.0069 -0.0152 462 LYS A CG  
3512 C CD  . LYS A 451 ? 0.6334 0.7894 0.5821 0.0376  -0.0039 -0.0083 462 LYS A CD  
3513 C CE  . LYS A 451 ? 0.5334 0.6846 0.4743 0.0369  -0.0033 -0.0078 462 LYS A CE  
3514 N NZ  . LYS A 451 ? 0.5349 0.6963 0.4766 0.0291  -0.0013 0.0006  462 LYS A NZ  
3515 N N   . LEU A 452 ? 0.4164 0.5851 0.3797 0.0521  -0.0052 -0.0226 463 LEU A N   
3516 C CA  . LEU A 452 ? 0.4147 0.6027 0.3850 0.0495  -0.0031 -0.0193 463 LEU A CA  
3517 C C   . LEU A 452 ? 0.4610 0.6520 0.4340 0.0398  -0.0025 -0.0095 463 LEU A C   
3518 O O   . LEU A 452 ? 0.4238 0.5988 0.3968 0.0350  -0.0050 -0.0053 463 LEU A O   
3519 C CB  . LEU A 452 ? 0.4162 0.6018 0.3929 0.0519  -0.0048 -0.0219 463 LEU A CB  
3520 C CG  . LEU A 452 ? 0.4873 0.6928 0.4708 0.0526  -0.0027 -0.0219 463 LEU A CG  
3521 C CD1 . LEU A 452 ? 0.4916 0.6896 0.4796 0.0564  -0.0050 -0.0261 463 LEU A CD1 
3522 C CD2 . LEU A 452 ? 0.5094 0.7263 0.4983 0.0439  -0.0012 -0.0128 463 LEU A CD2 
3523 N N   . SER A 453 ? 0.5243 0.7358 0.4998 0.0369  0.0006  -0.0057 464 SER A N   
3524 C CA  . SER A 453 ? 0.5430 0.7600 0.5216 0.0277  0.0014  0.0037  464 SER A CA  
3525 C C   . SER A 453 ? 0.6320 0.8654 0.6189 0.0254  0.0027  0.0066  464 SER A C   
3526 O O   . SER A 453 ? 0.6421 0.8919 0.6305 0.0299  0.0050  0.0028  464 SER A O   
3527 C CB  . SER A 453 ? 0.5996 0.8262 0.5732 0.0253  0.0040  0.0066  464 SER A CB  
3528 O OG  . SER A 453 ? 0.7203 0.9455 0.6953 0.0163  0.0038  0.0156  464 SER A OG  
3529 N N   . THR A 454 ? 0.5551 0.7838 0.5473 0.0184  0.0012  0.0134  465 THR A N   
3530 C CA  . THR A 454 ? 0.5567 0.7992 0.5572 0.0154  0.0020  0.0169  465 THR A CA  
3531 C C   . THR A 454 ? 0.6383 0.8940 0.6416 0.0071  0.0039  0.0258  465 THR A C   
3532 O O   . THR A 454 ? 0.6279 0.8979 0.6378 0.0045  0.0051  0.0290  465 THR A O   
3533 C CB  . THR A 454 ? 0.5861 0.8143 0.5917 0.0141  -0.0012 0.0175  465 THR A CB  
3534 O OG1 . THR A 454 ? 0.5519 0.7638 0.5562 0.0077  -0.0036 0.0232  465 THR A OG1 
3535 C CG2 . THR A 454 ? 0.5393 0.7559 0.5428 0.0225  -0.0031 0.0086  465 THR A CG2 
3536 N N   . VAL A 455 ? 0.6846 0.9359 0.6832 0.0028  0.0042  0.0301  466 VAL A N   
3537 C CA  . VAL A 455 ? 0.6947 0.9594 0.6952 -0.0048 0.0062  0.0383  466 VAL A CA  
3538 C C   . VAL A 455 ? 0.7675 1.0567 0.7688 -0.0025 0.0100  0.0371  466 VAL A C   
3539 O O   . VAL A 455 ? 0.7603 1.0642 0.7648 -0.0085 0.0119  0.0437  466 VAL A O   
3540 C CB  . VAL A 455 ? 0.7487 1.0026 0.7430 -0.0090 0.0056  0.0421  466 VAL A CB  
3541 C CG1 . VAL A 455 ? 0.7497 1.0040 0.7360 -0.0027 0.0071  0.0359  466 VAL A CG1 
3542 C CG2 . VAL A 455 ? 0.7487 1.0137 0.7456 -0.0178 0.0070  0.0515  466 VAL A CG2 
3543 N N   . ARG A 456 ? 0.7154 1.0095 0.7141 0.0060  0.0111  0.0288  467 ARG A N   
3544 C CA  . ARG A 456 ? 0.7285 1.0458 0.7276 0.0087  0.0148  0.0270  467 ARG A CA  
3545 C C   . ARG A 456 ? 0.7822 1.1149 0.7897 0.0072  0.0158  0.0291  467 ARG A C   
3546 O O   . ARG A 456 ? 0.7734 1.1270 0.7828 0.0060  0.0188  0.0313  467 ARG A O   
3547 C CB  . ARG A 456 ? 0.7519 1.0690 0.7458 0.0185  0.0154  0.0172  467 ARG A CB  
3548 C CG  . ARG A 456 ? 0.9928 1.3251 0.9818 0.0205  0.0187  0.0159  467 ARG A CG  
3549 C CD  . ARG A 456 ? 1.2184 1.5459 1.2012 0.0298  0.0187  0.0064  467 ARG A CD  
3550 N NE  . ARG A 456 ? 1.3879 1.7368 1.3703 0.0344  0.0220  0.0027  467 ARG A NE  
3551 C CZ  . ARG A 456 ? 1.5936 1.9563 1.5729 0.0326  0.0249  0.0052  467 ARG A CZ  
3552 N NH1 . ARG A 456 ? 1.4691 1.8263 1.4455 0.0262  0.0248  0.0115  467 ARG A NH1 
3553 N NH2 . ARG A 456 ? 1.3897 1.7718 1.3689 0.0373  0.0278  0.0014  467 ARG A NH2 
3554 N N   . VAL A 457 ? 0.5693 0.8923 0.5818 0.0072  0.0133  0.0287  468 VAL A N   
3555 C CA  . VAL A 457 ? 0.5703 0.9070 0.5910 0.0057  0.0140  0.0307  468 VAL A CA  
3556 C C   . VAL A 457 ? 0.6318 0.9742 0.6576 -0.0041 0.0141  0.0407  468 VAL A C   
3557 O O   . VAL A 457 ? 0.6088 0.9638 0.6416 -0.0062 0.0149  0.0434  468 VAL A O   
3558 C CB  . VAL A 457 ? 0.6082 0.9329 0.6325 0.0095  0.0113  0.0261  468 VAL A CB  
3559 C CG1 . VAL A 457 ? 0.6009 0.9167 0.6198 0.0188  0.0107  0.0164  468 VAL A CG1 
3560 C CG2 . VAL A 457 ? 0.5998 0.9054 0.6262 0.0037  0.0080  0.0312  468 VAL A CG2 
3561 N N   . PHE A 458 ? 0.8406 1.1741 0.8632 -0.0100 0.0133  0.0464  469 PHE A N   
3562 C CA  . PHE A 458 ? 0.8526 1.1904 0.8796 -0.0195 0.0133  0.0561  469 PHE A CA  
3563 C C   . PHE A 458 ? 0.9248 1.2755 0.9483 -0.0231 0.0160  0.0604  469 PHE A C   
3564 O O   . PHE A 458 ? 0.9164 1.2684 0.9333 -0.0187 0.0175  0.0562  469 PHE A O   
3565 C CB  . PHE A 458 ? 0.8763 1.1917 0.9034 -0.0243 0.0096  0.0600  469 PHE A CB  
3566 C CG  . PHE A 458 ? 0.8995 1.2008 0.9296 -0.0208 0.0067  0.0558  469 PHE A CG  
3567 C CD1 . PHE A 458 ? 0.9440 1.2527 0.9820 -0.0219 0.0064  0.0570  469 PHE A CD1 
3568 C CD2 . PHE A 458 ? 0.9337 1.2144 0.9589 -0.0166 0.0042  0.0506  469 PHE A CD2 
3569 C CE1 . PHE A 458 ? 0.9586 1.2544 0.9994 -0.0187 0.0038  0.0532  469 PHE A CE1 
3570 C CE2 . PHE A 458 ? 0.9689 1.2367 0.9969 -0.0135 0.0016  0.0468  469 PHE A CE2 
3571 C CZ  . PHE A 458 ? 0.9463 1.2217 0.9821 -0.0145 0.0014  0.0480  469 PHE A CZ  
3572 N N   . LEU A 459 ? 0.8645 1.2249 0.8926 -0.0312 0.0167  0.0691  470 LEU A N   
3573 C CA  . LEU A 459 ? 0.8730 1.2464 0.8988 -0.0358 0.0192  0.0744  470 LEU A CA  
3574 C C   . LEU A 459 ? 0.9375 1.2947 0.9597 -0.0418 0.0172  0.0798  470 LEU A C   
3575 O O   . LEU A 459 ? 0.9250 1.2759 0.9515 -0.0488 0.0152  0.0865  470 LEU A O   
3576 C CB  . LEU A 459 ? 0.8730 1.2670 0.9058 -0.0412 0.0210  0.0808  470 LEU A CB  
3577 N N   . THR A 460 ? 0.9637 1.3142 0.9780 -0.0390 0.0176  0.0767  471 THR A N   
3578 C CA  . THR A 460 ? 1.2418 1.5765 1.2520 -0.0440 0.0158  0.0811  471 THR A CA  
3579 C C   . THR A 460 ? 1.5224 1.8645 1.5261 -0.0443 0.0182  0.0818  471 THR A C   
3580 O O   . THR A 460 ? 1.0378 1.3810 1.0409 -0.0514 0.0184  0.0891  471 THR A O   
3581 C CB  . THR A 460 ? 1.3179 1.6281 1.3244 -0.0399 0.0126  0.0758  471 THR A CB  
3582 O OG1 . THR A 460 ? 1.2961 1.6070 1.2991 -0.0304 0.0134  0.0663  471 THR A OG1 
3583 C CG2 . THR A 460 ? 1.2810 1.5799 1.2937 -0.0426 0.0095  0.0779  471 THR A CG2 
3584 N N   . GLU A 475 ? 0.9109 1.1986 0.7817 -0.0483 0.0352  0.0853  486 GLU A N   
3585 C CA  . GLU A 475 ? 0.8925 1.1662 0.7590 -0.0400 0.0337  0.0763  486 GLU A CA  
3586 C C   . GLU A 475 ? 0.8617 1.1161 0.7206 -0.0402 0.0321  0.0758  486 GLU A C   
3587 O O   . GLU A 475 ? 0.8511 1.0980 0.7043 -0.0333 0.0319  0.0685  486 GLU A O   
3588 C CB  . GLU A 475 ? 0.9177 1.2067 0.7821 -0.0319 0.0365  0.0689  486 GLU A CB  
3589 C CG  . GLU A 475 ? 1.0591 1.3636 0.9193 -0.0326 0.0398  0.0704  486 GLU A CG  
3590 C CD  . GLU A 475 ? 1.4005 1.7216 1.2594 -0.0247 0.0425  0.0632  486 GLU A CD  
3591 O OE1 . GLU A 475 ? 1.3552 1.6796 1.2180 -0.0198 0.0421  0.0584  486 GLU A OE1 
3592 O OE2 . GLU A 475 ? 1.2813 1.6122 1.1353 -0.0233 0.0449  0.0624  486 GLU A OE2 
3593 N N   . TRP A 476 ? 0.5895 0.8362 0.4487 -0.0483 0.0309  0.0835  487 TRP A N   
3594 C CA  . TRP A 476 ? 0.5595 0.7870 0.4121 -0.0493 0.0291  0.0837  487 TRP A CA  
3595 C C   . TRP A 476 ? 0.6183 0.8303 0.4740 -0.0566 0.0259  0.0902  487 TRP A C   
3596 O O   . TRP A 476 ? 0.6402 0.8601 0.5004 -0.0642 0.0263  0.0982  487 TRP A O   
3597 C CB  . TRP A 476 ? 0.5249 0.7610 0.3721 -0.0514 0.0316  0.0863  487 TRP A CB  
3598 C CG  . TRP A 476 ? 0.5173 0.7351 0.3566 -0.0500 0.0301  0.0841  487 TRP A CG  
3599 C CD1 . TRP A 476 ? 0.5494 0.7549 0.3862 -0.0564 0.0286  0.0900  487 TRP A CD1 
3600 C CD2 . TRP A 476 ? 0.5048 0.7139 0.3378 -0.0417 0.0298  0.0754  487 TRP A CD2 
3601 N NE1 . TRP A 476 ? 0.5360 0.7261 0.3652 -0.0525 0.0276  0.0855  487 TRP A NE1 
3602 C CE2 . TRP A 476 ? 0.5478 0.7397 0.3746 -0.0435 0.0282  0.0766  487 TRP A CE2 
3603 C CE3 . TRP A 476 ? 0.5100 0.7243 0.3420 -0.0328 0.0307  0.0668  487 TRP A CE3 
3604 C CZ2 . TRP A 476 ? 0.5346 0.7144 0.3542 -0.0369 0.0275  0.0695  487 TRP A CZ2 
3605 C CZ3 . TRP A 476 ? 0.5199 0.7220 0.3447 -0.0262 0.0299  0.0597  487 TRP A CZ3 
3606 C CH2 . TRP A 476 ? 0.5261 0.7113 0.3449 -0.0283 0.0283  0.0611  487 TRP A CH2 
3607 N N   . PRO A 477 ? 0.6087 0.7986 0.4622 -0.0545 0.0227  0.0872  488 PRO A N   
3608 C CA  . PRO A 477 ? 0.5898 0.7682 0.4385 -0.0459 0.0217  0.0780  488 PRO A CA  
3609 C C   . PRO A 477 ? 0.6012 0.7892 0.4535 -0.0389 0.0225  0.0714  488 PRO A C   
3610 O O   . PRO A 477 ? 0.5815 0.7769 0.4410 -0.0412 0.0223  0.0739  488 PRO A O   
3611 C CB  . PRO A 477 ? 0.6115 0.7656 0.4598 -0.0478 0.0177  0.0788  488 PRO A CB  
3612 C CG  . PRO A 477 ? 0.6706 0.8221 0.5200 -0.0571 0.0171  0.0880  488 PRO A CG  
3613 C CD  . PRO A 477 ? 0.6220 0.7957 0.4772 -0.0615 0.0197  0.0933  488 PRO A CD  
3614 N N   . PRO A 478 ? 0.4716 0.6596 0.3190 -0.0306 0.0233  0.0631  489 PRO A N   
3615 C CA  . PRO A 478 ? 0.4546 0.6532 0.3051 -0.0237 0.0242  0.0566  489 PRO A CA  
3616 C C   . PRO A 478 ? 0.4884 0.6734 0.3428 -0.0215 0.0212  0.0537  489 PRO A C   
3617 O O   . PRO A 478 ? 0.4592 0.6341 0.3107 -0.0144 0.0198  0.0462  489 PRO A O   
3618 C CB  . PRO A 478 ? 0.4756 0.6748 0.3187 -0.0159 0.0255  0.0489  489 PRO A CB  
3619 C CG  . PRO A 478 ? 0.5342 0.7135 0.3709 -0.0172 0.0235  0.0494  489 PRO A CG  
3620 C CD  . PRO A 478 ? 0.4799 0.6569 0.3187 -0.0270 0.0230  0.0591  489 PRO A CD  
3621 N N   . LEU A 479 ? 0.4443 0.6293 0.3055 -0.0276 0.0200  0.0598  490 LEU A N   
3622 C CA  . LEU A 479 ? 0.4482 0.6198 0.3135 -0.0264 0.0169  0.0579  490 LEU A CA  
3623 C C   . LEU A 479 ? 0.5179 0.6992 0.3866 -0.0194 0.0177  0.0512  490 LEU A C   
3624 O O   . LEU A 479 ? 0.5302 0.7319 0.4022 -0.0189 0.0205  0.0516  490 LEU A O   
3625 C CB  . LEU A 479 ? 0.4445 0.6148 0.3163 -0.0350 0.0156  0.0663  490 LEU A CB  
3626 C CG  . LEU A 479 ? 0.5081 0.6654 0.3774 -0.0421 0.0140  0.0730  490 LEU A CG  
3627 C CD1 . LEU A 479 ? 0.5125 0.6773 0.3883 -0.0509 0.0140  0.0820  490 LEU A CD1 
3628 C CD2 . LEU A 479 ? 0.5344 0.6670 0.4013 -0.0406 0.0103  0.0703  490 LEU A CD2 
3629 N N   . ARG A 480 ? 0.4856 0.6519 0.3534 -0.0139 0.0152  0.0450  491 ARG A N   
3630 C CA  . ARG A 480 ? 0.4807 0.6533 0.3519 -0.0071 0.0154  0.0385  491 ARG A CA  
3631 C C   . ARG A 480 ? 0.5024 0.6580 0.3772 -0.0071 0.0118  0.0376  491 ARG A C   
3632 O O   . ARG A 480 ? 0.4910 0.6271 0.3616 -0.0048 0.0093  0.0345  491 ARG A O   
3633 C CB  . ARG A 480 ? 0.5010 0.6743 0.3660 0.0019  0.0164  0.0296  491 ARG A CB  
3634 C CG  . ARG A 480 ? 0.5160 0.6943 0.3842 0.0092  0.0163  0.0224  491 ARG A CG  
3635 C CD  . ARG A 480 ? 0.6071 0.7828 0.4688 0.0181  0.0166  0.0134  491 ARG A CD  
3636 N NE  . ARG A 480 ? 0.6486 0.8171 0.5122 0.0247  0.0147  0.0064  491 ARG A NE  
3637 C CZ  . ARG A 480 ? 0.7485 0.9132 0.6075 0.0331  0.0144  -0.0020 491 ARG A CZ  
3638 N NH1 . ARG A 480 ? 0.5189 0.6864 0.3712 0.0359  0.0159  -0.0046 491 ARG A NH1 
3639 N NH2 . ARG A 480 ? 0.5866 0.7447 0.4479 0.0386  0.0125  -0.0079 491 ARG A NH2 
3640 N N   . LYS A 481 ? 0.4047 0.5675 0.2872 -0.0097 0.0117  0.0404  492 LYS A N   
3641 C CA  . LYS A 481 ? 0.3807 0.5286 0.2673 -0.0100 0.0084  0.0400  492 LYS A CA  
3642 C C   . LYS A 481 ? 0.4346 0.5766 0.3199 -0.0009 0.0073  0.0306  492 LYS A C   
3643 O O   . LYS A 481 ? 0.4420 0.5985 0.3290 0.0042  0.0092  0.0261  492 LYS A O   
3644 C CB  . LYS A 481 ? 0.3945 0.5532 0.2898 -0.0152 0.0086  0.0456  492 LYS A CB  
3645 C CG  . LYS A 481 ? 0.5512 0.7120 0.4485 -0.0249 0.0088  0.0554  492 LYS A CG  
3646 C CD  . LYS A 481 ? 0.6647 0.8345 0.5709 -0.0298 0.0087  0.0606  492 LYS A CD  
3647 C CE  . LYS A 481 ? 0.8591 1.0288 0.7672 -0.0395 0.0084  0.0703  492 LYS A CE  
3648 N NZ  . LYS A 481 ? 1.0273 1.2113 0.9322 -0.0422 0.0114  0.0737  492 LYS A NZ  
3649 N N   . VAL A 482 ? 0.4113 0.5319 0.2933 0.0012  0.0042  0.0277  493 VAL A N   
3650 C CA  . VAL A 482 ? 0.3999 0.5119 0.2808 0.0094  0.0026  0.0192  493 VAL A CA  
3651 C C   . VAL A 482 ? 0.4556 0.5504 0.3402 0.0076  -0.0010 0.0202  493 VAL A C   
3652 O O   . VAL A 482 ? 0.4414 0.5311 0.3291 0.0003  -0.0022 0.0273  493 VAL A O   
3653 C CB  . VAL A 482 ? 0.4352 0.5376 0.3074 0.0151  0.0023  0.0132  493 VAL A CB  
3654 C CG1 . VAL A 482 ? 0.4413 0.5618 0.3101 0.0177  0.0059  0.0114  493 VAL A CG1 
3655 C CG2 . VAL A 482 ? 0.4225 0.5069 0.2901 0.0105  0.0003  0.0171  493 VAL A CG2 
3656 N N   . GLY A 483 ? 0.4888 0.5748 0.3731 0.0144  -0.0028 0.0130  494 GLY A N   
3657 C CA  . GLY A 483 ? 0.4828 0.5550 0.3714 0.0135  -0.0060 0.0133  494 GLY A CA  
3658 C C   . GLY A 483 ? 0.5100 0.5954 0.4072 0.0123  -0.0052 0.0149  494 GLY A C   
3659 O O   . GLY A 483 ? 0.5047 0.6100 0.4044 0.0121  -0.0022 0.0158  494 GLY A O   
3660 N N   . SER A 484 ? 0.4331 0.5070 0.3346 0.0114  -0.0080 0.0152  495 SER A N   
3661 C CA  . SER A 484 ? 0.4249 0.5092 0.3346 0.0105  -0.0077 0.0164  495 SER A CA  
3662 C C   . SER A 484 ? 0.4566 0.5325 0.3718 0.0034  -0.0100 0.0232  495 SER A C   
3663 O O   . SER A 484 ? 0.4367 0.5222 0.3590 0.0014  -0.0096 0.0254  495 SER A O   
3664 C CB  . SER A 484 ? 0.4700 0.5523 0.3809 0.0188  -0.0087 0.0081  495 SER A CB  
3665 O OG  . SER A 484 ? 0.6329 0.7245 0.5393 0.0256  -0.0066 0.0017  495 SER A OG  
3666 N N   . PHE A 485 ? 0.4177 0.4762 0.3299 -0.0006 -0.0124 0.0264  496 PHE A N   
3667 C CA  . PHE A 485 ? 0.4083 0.4576 0.3256 -0.0070 -0.0148 0.0324  496 PHE A CA  
3668 C C   . PHE A 485 ? 0.5189 0.5821 0.4405 -0.0150 -0.0130 0.0409  496 PHE A C   
3669 O O   . PHE A 485 ? 0.5179 0.5863 0.4358 -0.0184 -0.0113 0.0445  496 PHE A O   
3670 C CB  . PHE A 485 ? 0.4052 0.4322 0.3177 -0.0089 -0.0178 0.0334  496 PHE A CB  
3671 C CG  . PHE A 485 ? 0.3918 0.4085 0.3092 -0.0156 -0.0204 0.0396  496 PHE A CG  
3672 C CD1 . PHE A 485 ? 0.3855 0.3945 0.3078 -0.0140 -0.0228 0.0377  496 PHE A CD1 
3673 C CD2 . PHE A 485 ? 0.3973 0.4122 0.3143 -0.0235 -0.0206 0.0474  496 PHE A CD2 
3674 C CE1 . PHE A 485 ? 0.3787 0.3784 0.3054 -0.0201 -0.0253 0.0433  496 PHE A CE1 
3675 C CE2 . PHE A 485 ? 0.4101 0.4155 0.3315 -0.0296 -0.0231 0.0530  496 PHE A CE2 
3676 C CZ  . PHE A 485 ? 0.3695 0.3673 0.2958 -0.0278 -0.0255 0.0509  496 PHE A CZ  
3677 N N   . ASP A 486 ? 0.5402 0.6093 0.4695 -0.0180 -0.0134 0.0441  497 ASP A N   
3678 C CA  . ASP A 486 ? 0.5709 0.6521 0.5051 -0.0259 -0.0121 0.0524  497 ASP A CA  
3679 C C   . ASP A 486 ? 0.6649 0.7314 0.6022 -0.0324 -0.0153 0.0582  497 ASP A C   
3680 O O   . ASP A 486 ? 0.6466 0.7056 0.5885 -0.0315 -0.0176 0.0569  497 ASP A O   
3681 C CB  . ASP A 486 ? 0.6038 0.7043 0.5447 -0.0249 -0.0101 0.0521  497 ASP A CB  
3682 C CG  . ASP A 486 ? 0.8284 0.9453 0.7734 -0.0323 -0.0080 0.0601  497 ASP A CG  
3683 O OD1 . ASP A 486 ? 0.8436 0.9548 0.7877 -0.0391 -0.0088 0.0668  497 ASP A OD1 
3684 O OD2 . ASP A 486 ? 0.9451 1.0808 0.8942 -0.0312 -0.0056 0.0598  497 ASP A OD2 
3685 N N   . PRO A 487 ? 0.5862 0.6480 0.5212 -0.0390 -0.0157 0.0646  498 PRO A N   
3686 C CA  . PRO A 487 ? 0.6015 0.6488 0.5394 -0.0452 -0.0189 0.0701  498 PRO A CA  
3687 C C   . PRO A 487 ? 0.7150 0.7723 0.6612 -0.0514 -0.0189 0.0767  498 PRO A C   
3688 O O   . PRO A 487 ? 0.7032 0.7489 0.6527 -0.0560 -0.0217 0.0807  498 PRO A O   
3689 C CB  . PRO A 487 ? 0.6180 0.6583 0.5500 -0.0495 -0.0190 0.0743  498 PRO A CB  
3690 C CG  . PRO A 487 ? 0.6671 0.7263 0.5968 -0.0492 -0.0151 0.0748  498 PRO A CG  
3691 C CD  . PRO A 487 ? 0.6088 0.6779 0.5385 -0.0409 -0.0133 0.0669  498 PRO A CD  
3692 N N   . TYR A 488 ? 0.9678 1.0459 0.9175 -0.0516 -0.0159 0.0778  499 TYR A N   
3693 C CA  . TYR A 488 ? 0.9904 1.0798 0.9480 -0.0578 -0.0156 0.0844  499 TYR A CA  
3694 C C   . TYR A 488 ? 1.0600 1.1537 1.0240 -0.0543 -0.0161 0.0810  499 TYR A C   
3695 O O   . TYR A 488 ? 1.0526 1.1441 1.0150 -0.0468 -0.0160 0.0734  499 TYR A O   
3696 C CB  . TYR A 488 ? 1.0268 1.1372 0.9847 -0.0610 -0.0120 0.0885  499 TYR A CB  
3697 C CG  . TYR A 488 ? 1.0762 1.1834 1.0300 -0.0671 -0.0119 0.0945  499 TYR A CG  
3698 C CD1 . TYR A 488 ? 1.1111 1.2157 1.0688 -0.0756 -0.0134 0.1029  499 TYR A CD1 
3699 C CD2 . TYR A 488 ? 1.0925 1.1994 1.0386 -0.0643 -0.0103 0.0918  499 TYR A CD2 
3700 C CE1 . TYR A 488 ? 1.1431 1.2447 1.0970 -0.0812 -0.0133 0.1084  499 TYR A CE1 
3701 C CE2 . TYR A 488 ? 1.1121 1.2160 1.0543 -0.0699 -0.0101 0.0973  499 TYR A CE2 
3702 C CZ  . TYR A 488 ? 1.2462 1.3476 1.1925 -0.0783 -0.0116 0.1056  499 TYR A CZ  
3703 O OH  . TYR A 488 ? 1.2869 1.3854 1.2295 -0.0839 -0.0116 0.1111  499 TYR A OH  
3704 N N   . SER A 489 ? 1.0762 1.1761 1.0476 -0.0601 -0.0166 0.0869  500 SER A N   
3705 C CA  . SER A 489 ? 1.0836 1.1891 1.0620 -0.0582 -0.0170 0.0852  500 SER A CA  
3706 C C   . SER A 489 ? 1.1413 1.2707 1.1244 -0.0605 -0.0138 0.0885  500 SER A C   
3707 O O   . SER A 489 ? 1.1312 1.2667 1.1192 -0.0678 -0.0139 0.0961  500 SER A O   
3708 C CB  . SER A 489 ? 1.1422 1.2337 1.1255 -0.0629 -0.0206 0.0892  500 SER A CB  
3709 O OG  . SER A 489 ? 1.2697 1.3394 1.2485 -0.0611 -0.0235 0.0865  500 SER A OG  
3710 N N   . ASP A 490 ? 1.2562 1.3991 1.2379 -0.0543 -0.0110 0.0829  501 ASP A N   
3711 C CA  . ASP A 490 ? 1.2600 1.4264 1.2451 -0.0558 -0.0076 0.0854  501 ASP A CA  
3712 C C   . ASP A 490 ? 1.2800 1.4545 1.2741 -0.0593 -0.0081 0.0892  501 ASP A C   
3713 O O   . ASP A 490 ? 1.2795 1.4629 1.2777 -0.0665 -0.0076 0.0969  501 ASP A O   
3714 C CB  . ASP A 490 ? 1.2954 1.4730 1.2772 -0.0475 -0.0049 0.0776  501 ASP A CB  
3715 C CG  . ASP A 490 ? 1.4752 1.6432 1.4570 -0.0397 -0.0065 0.0694  501 ASP A CG  
3716 O OD1 . ASP A 490 ? 1.4825 1.6354 1.4670 -0.0407 -0.0096 0.0697  501 ASP A OD1 
3717 O OD2 . ASP A 490 ? 1.5687 1.7443 1.5479 -0.0326 -0.0046 0.0626  501 ASP A OD2 
3718 N N   . ASP A 491 ? 0.7862 0.9579 0.7837 -0.0543 -0.0092 0.0840  502 ASP A N   
3719 C CA  . ASP A 491 ? 0.7634 0.9423 0.7695 -0.0571 -0.0097 0.0870  502 ASP A CA  
3720 C C   . ASP A 491 ? 0.7658 0.9301 0.7741 -0.0528 -0.0126 0.0821  502 ASP A C   
3721 O O   . ASP A 491 ? 0.7443 0.9092 0.7510 -0.0451 -0.0120 0.0743  502 ASP A O   
3722 C CB  . ASP A 491 ? 0.7842 0.9870 0.7936 -0.0551 -0.0062 0.0861  502 ASP A CB  
3723 C CG  . ASP A 491 ? 0.8620 1.0747 0.8804 -0.0596 -0.0064 0.0910  502 ASP A CG  
3724 O OD1 . ASP A 491 ? 0.8508 1.0521 0.8728 -0.0647 -0.0093 0.0955  502 ASP A OD1 
3725 O OD2 . ASP A 491 ? 0.9344 1.1666 0.9562 -0.0582 -0.0038 0.0904  502 ASP A OD2 
3726 N N   . PRO A 492 ? 0.7958 1.0837 0.7569 0.0187  -0.0077 0.0262  503 PRO A N   
3727 C CA  . PRO A 492 ? 0.7828 1.0626 0.7477 0.0222  -0.0090 0.0230  503 PRO A CA  
3728 C C   . PRO A 492 ? 0.8015 1.0923 0.7732 0.0233  -0.0074 0.0228  503 PRO A C   
3729 O O   . PRO A 492 ? 0.7926 1.0800 0.7676 0.0282  -0.0071 0.0186  503 PRO A O   
3730 C CB  . PRO A 492 ? 0.8064 1.0725 0.7691 0.0176  -0.0137 0.0267  503 PRO A CB  
3731 C CG  . PRO A 492 ? 0.8669 1.1384 0.8270 0.0106  -0.0145 0.0330  503 PRO A CG  
3732 C CD  . PRO A 492 ? 0.8130 1.0943 0.7703 0.0118  -0.0111 0.0319  503 PRO A CD  
3733 N N   . ARG A 493 ? 0.6605 0.9644 0.6343 0.0189  -0.0064 0.0273  504 ARG A N   
3734 C CA  . ARG A 493 ? 0.6459 0.9610 0.6264 0.0197  -0.0050 0.0275  504 ARG A CA  
3735 C C   . ARG A 493 ? 0.6535 0.9777 0.6364 0.0269  -0.0009 0.0219  504 ARG A C   
3736 O O   . ARG A 493 ? 0.6373 0.9685 0.6256 0.0293  0.0003  0.0207  504 ARG A O   
3737 C CB  . ARG A 493 ? 0.6571 0.9849 0.6389 0.0130  -0.0048 0.0338  504 ARG A CB  
3738 C CG  . ARG A 493 ? 0.8594 1.1994 0.8384 0.0121  -0.0018 0.0350  504 ARG A CG  
3739 C CD  . ARG A 493 ? 1.0259 1.3778 1.0062 0.0049  -0.0021 0.0416  504 ARG A CD  
3740 N NE  . ARG A 493 ? 1.1738 1.5377 1.1515 0.0039  0.0007  0.0429  504 ARG A NE  
3741 C CZ  . ARG A 493 ? 1.3843 1.7606 1.3626 -0.0021 0.0011  0.0484  504 ARG A CZ  
3742 N NH1 . ARG A 493 ? 1.2912 1.6781 1.2669 -0.0025 0.0038  0.0492  504 ARG A NH1 
3743 N NH2 . ARG A 493 ? 1.1985 1.5767 1.1798 -0.0076 -0.0012 0.0532  504 ARG A NH2 
3744 N N   . LEU A 494 ? 0.5307 0.8548 0.5094 0.0306  0.0013  0.0185  505 LEU A N   
3745 C CA  . LEU A 494 ? 0.5100 0.8399 0.4897 0.0380  0.0048  0.0126  505 LEU A CA  
3746 C C   . LEU A 494 ? 0.5063 0.8240 0.4868 0.0436  0.0038  0.0072  505 LEU A C   
3747 O O   . LEU A 494 ? 0.4930 0.8152 0.4753 0.0497  0.0064  0.0024  505 LEU A O   
3748 C CB  . LEU A 494 ? 0.5132 0.8457 0.4874 0.0396  0.0071  0.0110  505 LEU A CB  
3749 C CG  . LEU A 494 ? 0.5763 0.9254 0.5501 0.0376  0.0101  0.0137  505 LEU A CG  
3750 C CD1 . LEU A 494 ? 0.5819 0.9354 0.5561 0.0293  0.0082  0.0209  505 LEU A CD1 
3751 C CD2 . LEU A 494 ? 0.6029 0.9511 0.5707 0.0399  0.0119  0.0113  505 LEU A CD2 
3752 N N   . GLY A 495 ? 0.4201 0.7227 0.3992 0.0417  0.0002  0.0078  506 GLY A N   
3753 C CA  . GLY A 495 ? 0.3998 0.6902 0.3789 0.0469  -0.0008 0.0025  506 GLY A CA  
3754 C C   . GLY A 495 ? 0.3702 0.6646 0.3552 0.0506  0.0001  0.0000  506 GLY A C   
3755 O O   . GLY A 495 ? 0.3150 0.6161 0.3047 0.0476  -0.0004 0.0034  506 GLY A O   
3756 N N   . ILE A 496 ? 0.3965 0.6865 0.3813 0.0572  0.0013  -0.0061 507 ILE A N   
3757 C CA  . ILE A 496 ? 0.3890 0.6827 0.3788 0.0619  0.0025  -0.0094 507 ILE A CA  
3758 C C   . ILE A 496 ? 0.4177 0.6977 0.4095 0.0622  -0.0008 -0.0105 507 ILE A C   
3759 O O   . ILE A 496 ? 0.4062 0.6729 0.3944 0.0637  -0.0026 -0.0130 507 ILE A O   
3760 C CB  . ILE A 496 ? 0.4341 0.7312 0.4220 0.0691  0.0058  -0.0154 507 ILE A CB  
3761 C CG1 . ILE A 496 ? 0.4526 0.7667 0.4405 0.0692  0.0093  -0.0141 507 ILE A CG1 
3762 C CG2 . ILE A 496 ? 0.4343 0.7289 0.4259 0.0746  0.0060  -0.0200 507 ILE A CG2 
3763 C CD1 . ILE A 496 ? 0.5949 0.9111 0.5784 0.0745  0.0122  -0.0188 507 ILE A CD1 
3764 N N   . GLN A 497 ? 0.3041 0.5874 0.3014 0.0607  -0.0017 -0.0084 508 GLN A N   
3765 C CA  . GLN A 497 ? 0.2737 0.5454 0.2736 0.0604  -0.0049 -0.0087 508 GLN A CA  
3766 C C   . GLN A 497 ? 0.3001 0.5705 0.3032 0.0668  -0.0039 -0.0141 508 GLN A C   
3767 O O   . GLN A 497 ? 0.2925 0.5502 0.2956 0.0687  -0.0061 -0.0166 508 GLN A O   
3768 C CB  . GLN A 497 ? 0.2879 0.5632 0.2916 0.0543  -0.0069 -0.0028 508 GLN A CB  
3769 C CG  . GLN A 497 ? 0.3805 0.6567 0.3809 0.0474  -0.0083 0.0030  508 GLN A CG  
3770 C CD  . GLN A 497 ? 0.4396 0.6997 0.4351 0.0455  -0.0115 0.0035  508 GLN A CD  
3771 O OE1 . GLN A 497 ? 0.3400 0.5882 0.3363 0.0467  -0.0141 0.0019  508 GLN A OE1 
3772 N NE2 . GLN A 497 ? 0.4410 0.7011 0.4314 0.0427  -0.0115 0.0056  508 GLN A NE2 
3773 N N   . LYS A 498 ? 0.2609 0.5442 0.2668 0.0703  -0.0006 -0.0159 509 LYS A N   
3774 C CA  . LYS A 498 ? 0.2498 0.5330 0.2590 0.0763  0.0005  -0.0207 509 LYS A CA  
3775 C C   . LYS A 498 ? 0.3179 0.6102 0.3253 0.0822  0.0044  -0.0250 509 LYS A C   
3776 O O   . LYS A 498 ? 0.3339 0.6381 0.3402 0.0811  0.0068  -0.0230 509 LYS A O   
3777 C CB  . LYS A 498 ? 0.2503 0.5406 0.2662 0.0747  0.0000  -0.0180 509 LYS A CB  
3778 C CG  . LYS A 498 ? 0.2444 0.5249 0.2622 0.0694  -0.0040 -0.0143 509 LYS A CG  
3779 C CD  . LYS A 498 ? 0.2659 0.5303 0.2828 0.0725  -0.0063 -0.0182 509 LYS A CD  
3780 C CE  . LYS A 498 ? 0.2897 0.5427 0.3067 0.0673  -0.0104 -0.0144 509 LYS A CE  
3781 N NZ  . LYS A 498 ? 0.2671 0.5046 0.2831 0.0703  -0.0127 -0.0181 509 LYS A NZ  
3782 N N   . ILE A 499 ? 0.2443 0.5304 0.2511 0.0885  0.0049  -0.0308 510 ILE A N   
3783 C CA  . ILE A 499 ? 0.2557 0.5485 0.2603 0.0948  0.0083  -0.0355 510 ILE A CA  
3784 C C   . ILE A 499 ? 0.3408 0.6332 0.3491 0.1003  0.0088  -0.0396 510 ILE A C   
3785 O O   . ILE A 499 ? 0.3299 0.6105 0.3395 0.1009  0.0063  -0.0412 510 ILE A O   
3786 C CB  . ILE A 499 ? 0.2967 0.5802 0.2943 0.0973  0.0085  -0.0393 510 ILE A CB  
3787 C CG1 . ILE A 499 ? 0.3001 0.5852 0.2940 0.0922  0.0083  -0.0353 510 ILE A CG1 
3788 C CG2 . ILE A 499 ? 0.3156 0.6043 0.3107 0.1043  0.0117  -0.0446 510 ILE A CG2 
3789 C CD1 . ILE A 499 ? 0.4298 0.7042 0.4170 0.0936  0.0077  -0.0383 510 ILE A CD1 
3790 N N   . PHE A 500 ? 0.4065 0.7119 0.4164 0.1044  0.0120  -0.0412 511 PHE A N   
3791 C CA  . PHE A 500 ? 0.4157 0.7213 0.4281 0.1106  0.0129  -0.0457 511 PHE A CA  
3792 C C   . PHE A 500 ? 0.4663 0.7802 0.4753 0.1169  0.0166  -0.0498 511 PHE A C   
3793 O O   . PHE A 500 ? 0.4521 0.7810 0.4621 0.1166  0.0192  -0.0476 511 PHE A O   
3794 C CB  . PHE A 500 ? 0.4412 0.7555 0.4609 0.1088  0.0127  -0.0425 511 PHE A CB  
3795 C CG  . PHE A 500 ? 0.4630 0.7737 0.4856 0.1143  0.0126  -0.0467 511 PHE A CG  
3796 C CD1 . PHE A 500 ? 0.5102 0.8268 0.5316 0.1215  0.0154  -0.0515 511 PHE A CD1 
3797 C CD2 . PHE A 500 ? 0.5064 0.8077 0.5327 0.1122  0.0095  -0.0459 511 PHE A CD2 
3798 C CE1 . PHE A 500 ? 0.5254 0.8383 0.5492 0.1265  0.0152  -0.0554 511 PHE A CE1 
3799 C CE2 . PHE A 500 ? 0.5443 0.8422 0.5733 0.1171  0.0094  -0.0497 511 PHE A CE2 
3800 C CZ  . PHE A 500 ? 0.5161 0.8197 0.5438 0.1243  0.0122  -0.0545 511 PHE A CZ  
3801 N N   . LEU A 501 ? 0.3491 0.6534 0.3540 0.1225  0.0167  -0.0556 512 LEU A N   
3802 C CA  . LEU A 501 ? 0.3536 0.6635 0.3545 0.1291  0.0198  -0.0602 512 LEU A CA  
3803 C C   . LEU A 501 ? 0.4240 0.7328 0.4271 0.1354  0.0203  -0.0646 512 LEU A C   
3804 O O   . LEU A 501 ? 0.4308 0.7264 0.4336 0.1368  0.0180  -0.0675 512 LEU A O   
3805 C CB  . LEU A 501 ? 0.3552 0.6546 0.3484 0.1308  0.0196  -0.0637 512 LEU A CB  
3806 C CG  . LEU A 501 ? 0.4109 0.7130 0.3991 0.1382  0.0224  -0.0693 512 LEU A CG  
3807 C CD1 . LEU A 501 ? 0.4211 0.7383 0.4077 0.1384  0.0256  -0.0675 512 LEU A CD1 
3808 C CD2 . LEU A 501 ? 0.4292 0.7164 0.4107 0.1404  0.0211  -0.0737 512 LEU A CD2 
3809 N N   . CYS A 502 ? 0.4326 0.7556 0.4377 0.1392  0.0232  -0.0652 513 CYS A N   
3810 C CA  . CYS A 502 ? 0.4344 0.7573 0.4403 0.1463  0.0242  -0.0699 513 CYS A CA  
3811 C C   . CYS A 502 ? 0.4791 0.7983 0.4775 0.1527  0.0259  -0.0757 513 CYS A C   
3812 O O   . CYS A 502 ? 0.4789 0.8089 0.4745 0.1550  0.0288  -0.0759 513 CYS A O   
3813 C CB  . CYS A 502 ? 0.4478 0.7878 0.4593 0.1476  0.0264  -0.0678 513 CYS A CB  
3814 S SG  . CYS A 502 ? 0.5036 0.8432 0.5149 0.1561  0.0275  -0.0733 513 CYS A SG  
3815 N N   . LYS A 503 ? 0.4321 0.7358 0.4269 0.1555  0.0241  -0.0802 514 LYS A N   
3816 C CA  . LYS A 503 ? 0.4445 0.7379 0.4309 0.1584  0.0237  -0.0840 514 LYS A CA  
3817 C C   . LYS A 503 ? 0.5233 0.8188 0.5082 0.1621  0.0244  -0.0854 514 LYS A C   
3818 O O   . LYS A 503 ? 0.5497 0.8395 0.5280 0.1644  0.0245  -0.0879 514 LYS A O   
3819 C CB  . LYS A 503 ? 0.4665 0.7403 0.4496 0.1583  0.0205  -0.0871 514 LYS A CB  
3820 C CG  . LYS A 503 ? 0.4840 0.7487 0.4700 0.1593  0.0182  -0.0885 514 LYS A CG  
3821 C CD  . LYS A 503 ? 0.5503 0.7959 0.5324 0.1586  0.0150  -0.0912 514 LYS A CD  
3822 C CE  . LYS A 503 ? 0.6552 0.8917 0.6401 0.1592  0.0127  -0.0923 514 LYS A CE  
3823 N NZ  . LYS A 503 ? 0.7721 0.9904 0.7532 0.1582  0.0095  -0.0946 514 LYS A NZ  
3824 N N   . TYR A 504 ? 0.4928 0.7966 0.4835 0.1627  0.0249  -0.0838 515 TYR A N   
3825 C CA  . TYR A 504 ? 0.4902 0.7959 0.4794 0.1664  0.0255  -0.0851 515 TYR A CA  
3826 C C   . TYR A 504 ? 0.5218 0.8453 0.5116 0.1673  0.0286  -0.0828 515 TYR A C   
3827 O O   . TYR A 504 ? 0.5329 0.8566 0.5183 0.1708  0.0293  -0.0845 515 TYR A O   
3828 C CB  . TYR A 504 ? 0.4948 0.7990 0.4894 0.1668  0.0242  -0.0849 515 TYR A CB  
3829 C CG  . TYR A 504 ? 0.5145 0.8009 0.5086 0.1660  0.0210  -0.0871 515 TYR A CG  
3830 C CD1 . TYR A 504 ? 0.5505 0.8214 0.5384 0.1682  0.0192  -0.0908 515 TYR A CD1 
3831 C CD2 . TYR A 504 ? 0.5096 0.7950 0.5096 0.1629  0.0197  -0.0854 515 TYR A CD2 
3832 C CE1 . TYR A 504 ? 0.5714 0.8265 0.5588 0.1670  0.0162  -0.0926 515 TYR A CE1 
3833 C CE2 . TYR A 504 ? 0.5205 0.7896 0.5200 0.1621  0.0167  -0.0873 515 TYR A CE2 
3834 C CZ  . TYR A 504 ? 0.6472 0.9014 0.6403 0.1640  0.0150  -0.0909 515 TYR A CZ  
3835 O OH  . TYR A 504 ? 0.6780 0.9164 0.6706 0.1628  0.0120  -0.0925 515 TYR A OH  
3836 N N   . SER A 505 ? 0.4218 0.7601 0.4168 0.1640  0.0303  -0.0787 516 SER A N   
3837 C CA  . SER A 505 ? 0.4291 0.7856 0.4256 0.1641  0.0332  -0.0757 516 SER A CA  
3838 C C   . SER A 505 ? 0.4997 0.8631 0.4932 0.1620  0.0350  -0.0741 516 SER A C   
3839 O O   . SER A 505 ? 0.5107 0.8883 0.5044 0.1621  0.0374  -0.0719 516 SER A O   
3840 C CB  . SER A 505 ? 0.4618 0.8324 0.4672 0.1614  0.0339  -0.0715 516 SER A CB  
3841 O OG  . SER A 505 ? 0.5528 0.9276 0.5623 0.1566  0.0340  -0.0683 516 SER A OG  
3842 N N   . GLY A 506 ? 0.3815 0.7352 0.3722 0.1600  0.0340  -0.0751 517 GLY A N   
3843 C CA  . GLY A 506 ? 0.3810 0.7401 0.3683 0.1579  0.0357  -0.0737 517 GLY A CA  
3844 C C   . GLY A 506 ? 0.4293 0.8044 0.4227 0.1528  0.0372  -0.0681 517 GLY A C   
3845 O O   . GLY A 506 ? 0.4173 0.7981 0.4085 0.1493  0.0382  -0.0653 517 GLY A O   
3846 N N   . TYR A 507 ? 0.4888 0.8669 0.4894 0.1500  0.0359  -0.0651 518 TYR A N   
3847 C CA  . TYR A 507 ? 0.4878 0.8738 0.4935 0.1421  0.0351  -0.0582 518 TYR A CA  
3848 C C   . TYR A 507 ? 0.4688 0.8400 0.4737 0.1356  0.0316  -0.0560 518 TYR A C   
3849 O O   . TYR A 507 ? 0.4478 0.8033 0.4507 0.1371  0.0294  -0.0594 518 TYR A O   
3850 C CB  . TYR A 507 ? 0.5257 0.9207 0.5391 0.1415  0.0350  -0.0558 518 TYR A CB  
3851 C CG  . TYR A 507 ? 0.5962 1.0110 0.6118 0.1450  0.0385  -0.0550 518 TYR A CG  
3852 C CD1 . TYR A 507 ? 0.6306 1.0595 0.6458 0.1419  0.0406  -0.0511 518 TYR A CD1 
3853 C CD2 . TYR A 507 ? 0.6238 1.0423 0.6415 0.1509  0.0394  -0.0579 518 TYR A CD2 
3854 C CE1 . TYR A 507 ? 0.6421 1.0898 0.6593 0.1451  0.0438  -0.0503 518 TYR A CE1 
3855 C CE2 . TYR A 507 ? 0.6497 1.0815 0.6682 0.1523  0.0412  -0.0563 518 TYR A CE2 
3856 C CZ  . TYR A 507 ? 0.7713 1.2183 0.7897 0.1498  0.0435  -0.0526 518 TYR A CZ  
3857 O OH  . TYR A 507 ? 0.8437 1.3040 0.8628 0.1513  0.0451  -0.0510 518 TYR A OH  
3858 N N   . LEU A 508 ? 0.3450 0.7214 0.3513 0.1284  0.0310  -0.0503 519 LEU A N   
3859 C CA  . LEU A 508 ? 0.3411 0.7046 0.3463 0.1221  0.0277  -0.0477 519 LEU A CA  
3860 C C   . LEU A 508 ? 0.3973 0.7684 0.4073 0.1142  0.0266  -0.0406 519 LEU A C   
3861 O O   . LEU A 508 ? 0.3783 0.7641 0.3891 0.1122  0.0287  -0.0372 519 LEU A O   
3862 C CB  . LEU A 508 ? 0.3459 0.7035 0.3438 0.1221  0.0282  -0.0492 519 LEU A CB  
3863 C CG  . LEU A 508 ? 0.4030 0.7479 0.3992 0.1157  0.0249  -0.0465 519 LEU A CG  
3864 C CD1 . LEU A 508 ? 0.4023 0.7294 0.3966 0.1180  0.0223  -0.0506 519 LEU A CD1 
3865 C CD2 . LEU A 508 ? 0.4064 0.7532 0.3971 0.1137  0.0260  -0.0453 519 LEU A CD2 
3866 N N   . ALA A 509 ? 0.3828 0.7438 0.3957 0.1098  0.0232  -0.0383 520 ALA A N   
3867 C CA  . ALA A 509 ? 0.3774 0.7424 0.3940 0.1017  0.0214  -0.0316 520 ALA A CA  
3868 C C   . ALA A 509 ? 0.4200 0.7709 0.4329 0.0966  0.0184  -0.0298 520 ALA A C   
3869 O O   . ALA A 509 ? 0.4125 0.7482 0.4233 0.0984  0.0164  -0.0330 520 ALA A O   
3870 C CB  . ALA A 509 ? 0.3775 0.7431 0.4007 0.1004  0.0198  -0.0299 520 ALA A CB  
3871 N N   . VAL A 510 ? 0.3587 0.7148 0.3705 0.0905  0.0182  -0.0246 521 VAL A N   
3872 C CA  . VAL A 510 ? 0.3645 0.7086 0.3730 0.0851  0.0153  -0.0221 521 VAL A CA  
3873 C C   . VAL A 510 ? 0.4016 0.7509 0.4132 0.0771  0.0136  -0.0150 521 VAL A C   
3874 O O   . VAL A 510 ? 0.3877 0.7524 0.4020 0.0752  0.0154  -0.0117 521 VAL A O   
3875 C CB  . VAL A 510 ? 0.4213 0.7639 0.4231 0.0859  0.0166  -0.0235 521 VAL A CB  
3876 C CG1 . VAL A 510 ? 0.4235 0.7591 0.4216 0.0934  0.0179  -0.0305 521 VAL A CG1 
3877 C CG2 . VAL A 510 ? 0.4252 0.7848 0.4267 0.0844  0.0196  -0.0207 521 VAL A CG2 
3878 N N   . ALA A 511 ? 0.3539 0.6903 0.3649 0.0725  0.0099  -0.0126 522 ALA A N   
3879 C CA  . ALA A 511 ? 0.3449 0.6836 0.3583 0.0647  0.0076  -0.0060 522 ALA A CA  
3880 C C   . ALA A 511 ? 0.3564 0.6845 0.3647 0.0598  0.0052  -0.0034 522 ALA A C   
3881 O O   . ALA A 511 ? 0.3468 0.6616 0.3510 0.0622  0.0040  -0.0067 522 ALA A O   
3882 C CB  . ALA A 511 ? 0.3493 0.6828 0.3679 0.0636  0.0051  -0.0051 522 ALA A CB  
3883 N N   . GLY A 512 ? 0.3085 0.6424 0.3166 0.0530  0.0043  0.0027  523 GLY A N   
3884 C CA  . GLY A 512 ? 0.3021 0.6282 0.3048 0.0483  0.0024  0.0055  523 GLY A CA  
3885 C C   . GLY A 512 ? 0.3591 0.6771 0.3621 0.0413  -0.0017 0.0108  523 GLY A C   
3886 O O   . GLY A 512 ? 0.3595 0.6760 0.3670 0.0400  -0.0034 0.0121  523 GLY A O   
3887 N N   . THR A 513 ? 0.3070 0.6195 0.3049 0.0368  -0.0033 0.0139  524 THR A N   
3888 C CA  . THR A 513 ? 0.3199 0.6224 0.3164 0.0305  -0.0074 0.0187  524 THR A CA  
3889 C C   . THR A 513 ? 0.4056 0.7188 0.4042 0.0235  -0.0079 0.0253  524 THR A C   
3890 O O   . THR A 513 ? 0.4002 0.7060 0.3985 0.0181  -0.0115 0.0295  524 THR A O   
3891 C CB  . THR A 513 ? 0.4318 0.7230 0.4215 0.0291  -0.0089 0.0189  524 THR A CB  
3892 O OG1 . THR A 513 ? 0.4355 0.7210 0.4231 0.0358  -0.0075 0.0127  524 THR A OG1 
3893 C CG2 . THR A 513 ? 0.3927 0.6690 0.3806 0.0250  -0.0135 0.0218  524 THR A CG2 
3894 N N   . ALA A 514 ? 0.4932 0.8233 0.4935 0.0234  -0.0046 0.0264  525 ALA A N   
3895 C CA  . ALA A 514 ? 0.5033 0.8453 0.5057 0.0167  -0.0049 0.0327  525 ALA A CA  
3896 C C   . ALA A 514 ? 0.5709 0.9274 0.5800 0.0187  -0.0026 0.0323  525 ALA A C   
3897 O O   . ALA A 514 ? 0.5869 0.9592 0.5977 0.0161  -0.0006 0.0355  525 ALA A O   
3898 C CB  . ALA A 514 ? 0.5155 0.8660 0.5137 0.0137  -0.0032 0.0353  525 ALA A CB  
3899 N N   . GLY A 515 ? 0.4075 0.7588 0.4203 0.0235  -0.0029 0.0284  526 GLY A N   
3900 C CA  . GLY A 515 ? 0.3960 0.7596 0.4153 0.0255  -0.0011 0.0279  526 GLY A CA  
3901 C C   . GLY A 515 ? 0.4297 0.8083 0.4505 0.0314  0.0036  0.0244  526 GLY A C   
3902 O O   . GLY A 515 ? 0.4286 0.8202 0.4545 0.0325  0.0054  0.0249  526 GLY A O   
3903 N N   . GLN A 516 ? 0.4240 0.8011 0.4402 0.0352  0.0056  0.0209  527 GLN A N   
3904 C CA  . GLN A 516 ? 0.4241 0.8148 0.4411 0.0412  0.0100  0.0174  527 GLN A CA  
3905 C C   . GLN A 516 ? 0.4771 0.8629 0.4962 0.0493  0.0111  0.0108  527 GLN A C   
3906 O O   . GLN A 516 ? 0.4662 0.8362 0.4829 0.0519  0.0093  0.0072  527 GLN A O   
3907 C CB  . GLN A 516 ? 0.4370 0.8285 0.4481 0.0420  0.0118  0.0163  527 GLN A CB  
3908 C CG  . GLN A 516 ? 0.4179 0.7923 0.4238 0.0451  0.0106  0.0120  527 GLN A CG  
3909 C CD  . GLN A 516 ? 0.4924 0.8531 0.4948 0.0389  0.0066  0.0157  527 GLN A CD  
3910 O OE1 . GLN A 516 ? 0.2972 0.6541 0.3020 0.0340  0.0037  0.0196  527 GLN A OE1 
3911 N NE2 . GLN A 516 ? 0.4319 0.7849 0.4284 0.0392  0.0065  0.0145  527 GLN A NE2 
3912 N N   . VAL A 517 ? 0.4074 0.8068 0.4309 0.0532  0.0138  0.0093  528 VAL A N   
3913 C CA  . VAL A 517 ? 0.4020 0.7989 0.4274 0.0612  0.0152  0.0031  528 VAL A CA  
3914 C C   . VAL A 517 ? 0.4635 0.8740 0.4878 0.0671  0.0196  0.0000  528 VAL A C   
3915 O O   . VAL A 517 ? 0.4624 0.8900 0.4893 0.0656  0.0218  0.0030  528 VAL A O   
3916 C CB  . VAL A 517 ? 0.4437 0.8431 0.4756 0.0611  0.0141  0.0040  528 VAL A CB  
3917 C CG1 . VAL A 517 ? 0.4372 0.8314 0.4704 0.0694  0.0152  -0.0027 528 VAL A CG1 
3918 C CG2 . VAL A 517 ? 0.4364 0.8240 0.4692 0.0544  0.0098  0.0081  528 VAL A CG2 
3919 N N   . LEU A 518 ? 0.4334 0.8365 0.4538 0.0736  0.0209  -0.0060 529 LEU A N   
3920 C CA  . LEU A 518 ? 0.4318 0.8455 0.4499 0.0796  0.0249  -0.0096 529 LEU A CA  
3921 C C   . LEU A 518 ? 0.4818 0.8921 0.5007 0.0881  0.0261  -0.0161 529 LEU A C   
3922 O O   . LEU A 518 ? 0.4995 0.8939 0.5169 0.0903  0.0241  -0.0197 529 LEU A O   
3923 C CB  . LEU A 518 ? 0.4349 0.8433 0.4462 0.0794  0.0254  -0.0106 529 LEU A CB  
3924 C CG  . LEU A 518 ? 0.4943 0.9093 0.5039 0.0720  0.0251  -0.0046 529 LEU A CG  
3925 C CD1 . LEU A 518 ? 0.4924 0.8970 0.4952 0.0715  0.0246  -0.0059 529 LEU A CD1 
3926 C CD2 . LEU A 518 ? 0.5066 0.9424 0.5179 0.0726  0.0287  -0.0027 529 LEU A CD2 
3927 N N   . VAL A 519 ? 0.4237 0.8487 0.4447 0.0929  0.0294  -0.0177 530 VAL A N   
3928 C CA  . VAL A 519 ? 0.4083 0.8317 0.4291 0.1017  0.0311  -0.0241 530 VAL A CA  
3929 C C   . VAL A 519 ? 0.4300 0.8599 0.4455 0.1070  0.0345  -0.0275 530 VAL A C   
3930 O O   . VAL A 519 ? 0.4024 0.8473 0.4179 0.1054  0.0368  -0.0246 530 VAL A O   
3931 C CB  . VAL A 519 ? 0.4389 0.8736 0.4662 0.1039  0.0320  -0.0236 530 VAL A CB  
3932 C CG1 . VAL A 519 ? 0.4276 0.8558 0.4545 0.1124  0.0327  -0.0304 530 VAL A CG1 
3933 C CG2 . VAL A 519 ? 0.4270 0.8593 0.4597 0.0968  0.0289  -0.0185 530 VAL A CG2 
3934 N N   . LEU A 520 ? 0.3958 0.8143 0.4067 0.1132  0.0347  -0.0337 531 LEU A N   
3935 C CA  . LEU A 520 ? 0.3952 0.8163 0.4000 0.1181  0.0374  -0.0374 531 LEU A CA  
3936 C C   . LEU A 520 ? 0.4666 0.8854 0.4699 0.1273  0.0390  -0.0441 531 LEU A C   
3937 O O   . LEU A 520 ? 0.4473 0.8586 0.4533 0.1295  0.0375  -0.0463 531 LEU A O   
3938 C CB  . LEU A 520 ? 0.3915 0.7988 0.3902 0.1155  0.0358  -0.0380 531 LEU A CB  
3939 C CG  . LEU A 520 ? 0.4519 0.8588 0.4508 0.1066  0.0340  -0.0318 531 LEU A CG  
3940 C CD1 . LEU A 520 ? 0.4574 0.8533 0.4599 0.1012  0.0301  -0.0289 531 LEU A CD1 
3941 C CD2 . LEU A 520 ? 0.4707 0.8704 0.4626 0.1061  0.0340  -0.0330 531 LEU A CD2 
3942 N N   . GLU A 521 ? 0.4206 0.8455 0.4190 0.1328  0.0420  -0.0474 532 GLU A N   
3943 C CA  . GLU A 521 ? 0.4299 0.8524 0.4256 0.1419  0.0436  -0.0539 532 GLU A CA  
3944 C C   . GLU A 521 ? 0.4827 0.8989 0.4700 0.1456  0.0448  -0.0581 532 GLU A C   
3945 O O   . GLU A 521 ? 0.4773 0.8998 0.4618 0.1430  0.0461  -0.0558 532 GLU A O   
3946 C CB  . GLU A 521 ? 0.4551 0.8957 0.4541 0.1465  0.0467  -0.0540 532 GLU A CB  
3947 C CG  . GLU A 521 ? 0.6241 1.0540 0.6202 0.1530  0.0455  -0.0591 532 GLU A CG  
3948 C CD  . GLU A 521 ? 0.9232 1.3651 0.9219 0.1554  0.0466  -0.0579 532 GLU A CD  
3949 O OE1 . GLU A 521 ? 0.8625 1.2965 0.8589 0.1605  0.0456  -0.0616 532 GLU A OE1 
3950 O OE2 . GLU A 521 ? 0.8213 1.2805 0.8242 0.1521  0.0483  -0.0531 532 GLU A OE2 
3951 N N   . LEU A 522 ? 0.4009 0.8036 0.3841 0.1512  0.0439  -0.0639 533 LEU A N   
3952 C CA  . LEU A 522 ? 0.4186 0.8107 0.3936 0.1535  0.0436  -0.0675 533 LEU A CA  
3953 C C   . LEU A 522 ? 0.5297 0.9294 0.5017 0.1569  0.0452  -0.0679 533 LEU A C   
3954 O O   . LEU A 522 ? 0.5280 0.9302 0.5017 0.1604  0.0451  -0.0689 533 LEU A O   
3955 C CB  . LEU A 522 ? 0.4166 0.7888 0.3882 0.1567  0.0408  -0.0725 533 LEU A CB  
3956 C CG  . LEU A 522 ? 0.4719 0.8308 0.4350 0.1585  0.0399  -0.0761 533 LEU A CG  
3957 C CD1 . LEU A 522 ? 0.4664 0.8263 0.4271 0.1543  0.0406  -0.0743 533 LEU A CD1 
3958 C CD2 . LEU A 522 ? 0.4985 0.8385 0.4592 0.1608  0.0370  -0.0803 533 LEU A CD2 
3959 N N   . ASN A 523 ? 0.5958 0.9994 0.5634 0.1557  0.0466  -0.0671 534 ASN A N   
3960 C CA  . ASN A 523 ? 0.6150 1.0266 0.5797 0.1586  0.0482  -0.0672 534 ASN A CA  
3961 C C   . ASN A 523 ? 0.6872 1.0879 0.6439 0.1603  0.0478  -0.0704 534 ASN A C   
3962 O O   . ASN A 523 ? 0.6685 1.0664 0.6227 0.1568  0.0479  -0.0695 534 ASN A O   
3963 C CB  . ASN A 523 ? 0.6300 1.0616 0.5985 0.1547  0.0507  -0.0617 534 ASN A CB  
3964 C CG  . ASN A 523 ? 0.8109 1.2531 0.7781 0.1580  0.0523  -0.0615 534 ASN A CG  
3965 O OD1 . ASN A 523 ? 0.7365 1.1707 0.6985 0.1630  0.0518  -0.0653 534 ASN A OD1 
3966 N ND2 . ASN A 523 ? 0.6447 1.1050 0.6164 0.1551  0.0541  -0.0567 534 ASN A ND2 
3967 N N   . ASP A 524 ? 0.7357 1.1301 0.6881 0.1655  0.0473  -0.0739 535 ASP A N   
3968 C CA  . ASP A 524 ? 0.7536 1.1369 0.6984 0.1674  0.0468  -0.0771 535 ASP A CA  
3969 C C   . ASP A 524 ? 0.8340 1.2277 0.7762 0.1657  0.0489  -0.0748 535 ASP A C   
3970 O O   . ASP A 524 ? 0.8415 1.2269 0.7780 0.1654  0.0486  -0.0764 535 ASP A O   
3971 C CB  . ASP A 524 ? 0.7853 1.1602 0.7264 0.1733  0.0457  -0.0811 535 ASP A CB  
3972 C CG  . ASP A 524 ? 0.9484 1.3121 0.8914 0.1749  0.0435  -0.0834 535 ASP A CG  
3973 O OD1 . ASP A 524 ? 0.9792 1.3507 0.9279 0.1753  0.0437  -0.0819 535 ASP A OD1 
3974 O OD2 . ASP A 524 ? 1.0079 1.3549 0.9468 0.1755  0.0413  -0.0867 535 ASP A OD2 
3975 N N   . GLU A 525 ? 0.7483 1.1599 0.6948 0.1644  0.0510  -0.0709 536 GLU A N   
3976 C CA  . GLU A 525 ? 0.7604 1.1829 0.7049 0.1627  0.0531  -0.0684 536 GLU A CA  
3977 C C   . GLU A 525 ? 0.7998 1.2375 0.7498 0.1568  0.0546  -0.0628 536 GLU A C   
3978 O O   . GLU A 525 ? 0.7826 1.2231 0.7382 0.1544  0.0542  -0.0609 536 GLU A O   
3979 C CB  . GLU A 525 ? 0.7894 1.2196 0.7324 0.1675  0.0543  -0.0692 536 GLU A CB  
3980 C CG  . GLU A 525 ? 0.9549 1.3704 0.8920 0.1733  0.0528  -0.0745 536 GLU A CG  
3981 C CD  . GLU A 525 ? 1.2026 1.6051 1.1329 0.1729  0.0520  -0.0769 536 GLU A CD  
3982 O OE1 . GLU A 525 ? 1.0739 1.4825 1.0028 0.1698  0.0534  -0.0747 536 GLU A OE1 
3983 O OE2 . GLU A 525 ? 1.0660 1.4524 0.9925 0.1754  0.0500  -0.0809 536 GLU A OE2 
3984 N N   . ALA A 526 ? 0.5141 0.9614 0.4624 0.1542  0.0563  -0.0600 537 ALA A N   
3985 C CA  . ALA A 526 ? 0.5120 0.9732 0.4645 0.1479  0.0577  -0.0544 537 ALA A CA  
3986 C C   . ALA A 526 ? 0.5829 1.0611 0.5419 0.1474  0.0590  -0.0508 537 ALA A C   
3987 O O   . ALA A 526 ? 0.5831 1.0636 0.5428 0.1524  0.0590  -0.0526 537 ALA A O   
3988 C CB  . ALA A 526 ? 0.5247 0.9901 0.4729 0.1454  0.0590  -0.0527 537 ALA A CB  
3989 N N   . ALA A 527 ? 0.7369 1.2273 0.7005 0.1412  0.0599  -0.0453 538 ALA A N   
3990 C CA  . ALA A 527 ? 0.7446 1.2520 0.7147 0.1394  0.0609  -0.0411 538 ALA A CA  
3991 C C   . ALA A 527 ? 0.8132 1.3335 0.7859 0.1317  0.0621  -0.0348 538 ALA A C   
3992 O O   . ALA A 527 ? 0.7874 1.3020 0.7586 0.1273  0.0617  -0.0336 538 ALA A O   
3993 C CB  . ALA A 527 ? 0.7482 1.2531 0.7238 0.1403  0.0597  -0.0416 538 ALA A CB  
3994 N N   . GLU A 528 ? 0.9245 1.4621 0.9008 0.1300  0.0635  -0.0307 539 GLU A N   
3995 C CA  . GLU A 528 ? 0.9305 1.4818 0.9093 0.1223  0.0645  -0.0242 539 GLU A CA  
3996 C C   . GLU A 528 ? 0.9753 1.5401 0.9619 0.1187  0.0646  -0.0194 539 GLU A C   
3997 O O   . GLU A 528 ? 0.9816 1.5623 0.9710 0.1146  0.0656  -0.0143 539 GLU A O   
3998 C CB  . GLU A 528 ? 0.9565 1.5169 0.9319 0.1227  0.0660  -0.0229 539 GLU A CB  
3999 C CG  . GLU A 528 ? 1.1182 1.6847 1.0924 0.1152  0.0667  -0.0179 539 GLU A CG  
4000 C CD  . GLU A 528 ? 1.4487 2.0231 1.4194 0.1160  0.0681  -0.0172 539 GLU A CD  
4001 O OE1 . GLU A 528 ? 1.4095 2.0004 1.3837 0.1130  0.0690  -0.0126 539 GLU A OE1 
4002 O OE2 . GLU A 528 ? 1.3860 1.9503 1.3506 0.1195  0.0681  -0.0212 539 GLU A OE2 
4003 N N   . GLN A 529 ? 0.7551 1.3136 0.7455 0.1199  0.0633  -0.0209 540 GLN A N   
4004 C CA  . GLN A 529 ? 0.7417 1.3115 0.7397 0.1168  0.0631  -0.0168 540 GLN A CA  
4005 C C   . GLN A 529 ? 0.7640 1.3333 0.7651 0.1067  0.0610  -0.0105 540 GLN A C   
4006 O O   . GLN A 529 ? 0.7525 1.3092 0.7497 0.1024  0.0590  -0.0098 540 GLN A O   
4007 C CB  . GLN A 529 ? 0.7577 1.3179 0.7581 0.1217  0.0617  -0.0209 540 GLN A CB  
4008 C CG  . GLN A 529 ? 0.9645 1.5056 0.9628 0.1220  0.0598  -0.0244 540 GLN A CG  
4009 C CD  . GLN A 529 ? 1.2509 1.7833 1.2514 0.1274  0.0587  -0.0287 540 GLN A CD  
4010 O OE1 . GLN A 529 ? 1.2049 1.7388 1.2116 0.1244  0.0572  -0.0261 540 GLN A OE1 
4011 N NE2 . GLN A 529 ? 1.1553 1.6744 1.1504 0.1342  0.0581  -0.0349 540 GLN A NE2 
4012 N N   . ALA A 530 ? 0.8154 1.3955 0.8231 0.1023  0.0604  -0.0057 541 ALA A N   
4013 C CA  . ALA A 530 ? 0.8064 1.3827 0.8172 0.0922  0.0571  0.0006  541 ALA A CA  
4014 C C   . ALA A 530 ? 0.8496 1.4117 0.8638 0.0916  0.0539  -0.0005 541 ALA A C   
4015 O O   . ALA A 530 ? 0.8483 1.4082 0.8640 0.0985  0.0545  -0.0052 541 ALA A O   
4016 C CB  . ALA A 530 ? 0.8122 1.4094 0.8277 0.0869  0.0582  0.0071  541 ALA A CB  
4017 N N   . VAL A 531 ? 0.6668 1.2190 0.6819 0.0833  0.0503  0.0038  542 VAL A N   
4018 C CA  . VAL A 531 ? 0.6533 1.1912 0.6714 0.0817  0.0469  0.0034  542 VAL A CA  
4019 C C   . VAL A 531 ? 0.6889 1.2366 0.7133 0.0746  0.0454  0.0099  542 VAL A C   
4020 O O   . VAL A 531 ? 0.6891 1.2416 0.7133 0.0667  0.0443  0.0158  542 VAL A O   
4021 C CB  . VAL A 531 ? 0.6975 1.2144 0.7112 0.0782  0.0436  0.0028  542 VAL A CB  
4022 C CG1 . VAL A 531 ? 0.6879 1.1894 0.7042 0.0781  0.0403  0.0013  542 VAL A CG1 
4023 C CG2 . VAL A 531 ? 0.6967 1.2061 0.7036 0.0842  0.0453  -0.0028 542 VAL A CG2 
4024 N N   . GLU A 532 ? 0.6671 1.2176 0.6967 0.0774  0.0452  0.0088  543 GLU A N   
4025 C CA  . GLU A 532 ? 0.6547 1.2155 0.6905 0.0712  0.0440  0.0147  543 GLU A CA  
4026 C C   . GLU A 532 ? 0.6764 1.2219 0.7127 0.0632  0.0394  0.0184  543 GLU A C   
4027 O O   . GLU A 532 ? 0.6707 1.1994 0.7068 0.0652  0.0371  0.0151  543 GLU A O   
4028 C CB  . GLU A 532 ? 0.6693 1.2376 0.7104 0.0771  0.0452  0.0121  543 GLU A CB  
4029 C CG  . GLU A 532 ? 0.8026 1.3917 0.8447 0.0830  0.0496  0.0109  543 GLU A CG  
4030 C CD  . GLU A 532 ? 0.9807 1.5790 1.0287 0.0874  0.0506  0.0097  543 GLU A CD  
4031 O OE1 . GLU A 532 ? 0.8937 1.4892 0.9407 0.0965  0.0523  0.0034  543 GLU A OE1 
4032 O OE2 . GLU A 532 ? 0.7828 1.3909 0.8362 0.0817  0.0495  0.0151  543 GLU A OE2 
4033 N N   . GLN A 533 ? 0.4662 1.0177 0.5029 0.0543  0.0380  0.0252  544 GLN A N   
4034 C CA  . GLN A 533 ? 0.4545 0.9934 0.4919 0.0462  0.0336  0.0295  544 GLN A CA  
4035 C C   . GLN A 533 ? 0.4868 1.0314 0.5309 0.0439  0.0322  0.0322  544 GLN A C   
4036 O O   . GLN A 533 ? 0.4704 1.0337 0.5183 0.0422  0.0339  0.0357  544 GLN A O   
4037 C CB  . GLN A 533 ? 0.4769 1.0189 0.5113 0.0375  0.0324  0.0357  544 GLN A CB  
4038 C CG  . GLN A 533 ? 0.6856 1.2146 0.7130 0.0375  0.0319  0.0338  544 GLN A CG  
4039 C CD  . GLN A 533 ? 0.9465 1.4857 0.9707 0.0430  0.0360  0.0308  544 GLN A CD  
4040 O OE1 . GLN A 533 ? 0.8939 1.4243 0.9146 0.0498  0.0372  0.0247  544 GLN A OE1 
4041 N NE2 . GLN A 533 ? 0.8486 1.4063 0.8736 0.0398  0.0381  0.0350  544 GLN A NE2 
4042 N N   . VAL A 534 ? 0.5939 1.1224 0.6392 0.0438  0.0292  0.0307  545 VAL A N   
4043 C CA  . VAL A 534 ? 0.5833 1.1142 0.6346 0.0413  0.0274  0.0332  545 VAL A CA  
4044 C C   . VAL A 534 ? 0.6137 1.1271 0.6639 0.0343  0.0226  0.0362  545 VAL A C   
4045 O O   . VAL A 534 ? 0.6074 1.1026 0.6537 0.0360  0.0208  0.0330  545 VAL A O   
4046 C CB  . VAL A 534 ? 0.6305 1.1602 0.6852 0.0501  0.0288  0.0271  545 VAL A CB  
4047 C CG1 . VAL A 534 ? 0.6277 1.1635 0.6891 0.0474  0.0274  0.0302  545 VAL A CG1 
4048 C CG2 . VAL A 534 ? 0.6289 1.1726 0.6830 0.0583  0.0334  0.0230  545 VAL A CG2 
4049 N N   . GLU A 535 ? 0.5646 1.0835 0.6182 0.0266  0.0204  0.0425  546 GLU A N   
4050 C CA  . GLU A 535 ? 0.5632 1.0663 0.6156 0.0196  0.0157  0.0459  546 GLU A CA  
4051 C C   . GLU A 535 ? 0.6396 1.1358 0.6969 0.0214  0.0138  0.0444  546 GLU A C   
4052 O O   . GLU A 535 ? 0.6341 1.1420 0.6965 0.0254  0.0158  0.0429  546 GLU A O   
4053 C CB  . GLU A 535 ? 0.5806 1.0921 0.6330 0.0094  0.0140  0.0540  546 GLU A CB  
4054 C CG  . GLU A 535 ? 0.7265 1.2204 0.7742 0.0024  0.0096  0.0574  546 GLU A CG  
4055 C CD  . GLU A 535 ? 1.0457 1.5454 1.0942 -0.0079 0.0069  0.0654  546 GLU A CD  
4056 O OE1 . GLU A 535 ? 0.8634 1.3646 0.9165 -0.0104 0.0052  0.0676  546 GLU A OE1 
4057 O OE2 . GLU A 535 ? 1.0544 1.5572 1.0989 -0.0136 0.0065  0.0695  546 GLU A OE2 
4058 N N   . ALA A 536 ? 0.6961 1.1731 0.7515 0.0184  0.0098  0.0447  547 ALA A N   
4059 C CA  . ALA A 536 ? 0.6955 1.1635 0.7548 0.0193  0.0075  0.0435  547 ALA A CA  
4060 C C   . ALA A 536 ? 0.7593 1.2152 0.8169 0.0105  0.0027  0.0489  547 ALA A C   
4061 O O   . ALA A 536 ? 0.7518 1.1897 0.8050 0.0100  0.0002  0.0476  547 ALA A O   
4062 C CB  . ALA A 536 ? 0.7003 1.1543 0.7585 0.0277  0.0079  0.0360  547 ALA A CB  
4063 N N   . ASP A 537 ? 0.6671 1.1329 0.7280 0.0037  0.0014  0.0549  548 ASP A N   
4064 C CA  . ASP A 537 ? 0.6708 1.1265 0.7298 -0.0052 -0.0032 0.0606  548 ASP A CA  
4065 C C   . ASP A 537 ? 0.7300 1.1728 0.7919 -0.0043 -0.0061 0.0592  548 ASP A C   
4066 O O   . ASP A 537 ? 0.7370 1.1885 0.8048 -0.0041 -0.0058 0.0600  548 ASP A O   
4067 C CB  . ASP A 537 ? 0.6977 1.1698 0.7585 -0.0133 -0.0034 0.0679  548 ASP A CB  
4068 C CG  . ASP A 537 ? 0.8472 1.3085 0.9044 -0.0230 -0.0081 0.0741  548 ASP A CG  
4069 O OD1 . ASP A 537 ? 0.8708 1.3191 0.9219 -0.0247 -0.0098 0.0742  548 ASP A OD1 
4070 O OD2 . ASP A 537 ? 0.9024 1.3682 0.9628 -0.0288 -0.0103 0.0789  548 ASP A OD2 
4071 N N   . LEU A 538 ? 0.5147 1.0073 0.6376 -0.0443 0.0200  0.0743  549 LEU A N   
4072 C CA  . LEU A 538 ? 0.5069 0.9900 0.6314 -0.0461 0.0189  0.0721  549 LEU A CA  
4073 C C   . LEU A 538 ? 0.5845 1.0663 0.7090 -0.0511 0.0162  0.0766  549 LEU A C   
4074 O O   . LEU A 538 ? 0.5825 1.0599 0.7081 -0.0527 0.0151  0.0766  549 LEU A O   
4075 C CB  . LEU A 538 ? 0.4952 0.9681 0.6188 -0.0457 0.0186  0.0658  549 LEU A CB  
4076 C CG  . LEU A 538 ? 0.5344 1.0089 0.6572 -0.0408 0.0210  0.0613  549 LEU A CG  
4077 C CD1 . LEU A 538 ? 0.5276 0.9939 0.6488 -0.0411 0.0203  0.0560  549 LEU A CD1 
4078 C CD2 . LEU A 538 ? 0.5403 1.0141 0.6653 -0.0374 0.0228  0.0593  549 LEU A CD2 
4079 N N   . LEU A 539 ? 0.7754 1.2608 0.8985 -0.0536 0.0150  0.0804  550 LEU A N   
4080 C CA  . LEU A 539 ? 0.7913 1.2767 0.9143 -0.0583 0.0124  0.0852  550 LEU A CA  
4081 C C   . LEU A 539 ? 0.8987 1.3943 1.0226 -0.0583 0.0128  0.0914  550 LEU A C   
4082 O O   . LEU A 539 ? 0.9019 1.4006 1.0252 -0.0617 0.0110  0.0963  550 LEU A O   
4083 C CB  . LEU A 539 ? 0.7888 1.2712 0.9096 -0.0615 0.0107  0.0857  550 LEU A CB  
4084 C CG  . LEU A 539 ? 0.8465 1.3348 0.9657 -0.0598 0.0117  0.0859  550 LEU A CG  
4085 C CD1 . LEU A 539 ? 0.8553 1.3549 0.9743 -0.0605 0.0117  0.0925  550 LEU A CD1 
4086 C CD2 . LEU A 539 ? 0.8695 1.3513 0.9865 -0.0623 0.0101  0.0836  550 LEU A CD2 
4087 N N   . GLN A 540 ? 0.7192 1.2201 0.8448 -0.0546 0.0149  0.0914  551 GLN A N   
4088 C CA  . GLN A 540 ? 0.7355 1.2466 0.8620 -0.0542 0.0155  0.0971  551 GLN A CA  
4089 C C   . GLN A 540 ? 0.8292 1.3400 0.9563 -0.0584 0.0131  0.1018  551 GLN A C   
4090 O O   . GLN A 540 ? 0.8300 1.3480 0.9570 -0.0599 0.0124  0.1075  551 GLN A O   
4091 C CB  . GLN A 540 ? 0.7496 1.2648 0.8778 -0.0496 0.0181  0.0958  551 GLN A CB  
4092 C CG  . GLN A 540 ? 0.8730 1.3957 1.0008 -0.0455 0.0206  0.0955  551 GLN A CG  
4093 C CD  . GLN A 540 ? 1.0680 1.5930 1.1972 -0.0407 0.0232  0.0931  551 GLN A CD  
4094 O OE1 . GLN A 540 ? 0.9678 1.4919 1.0987 -0.0407 0.0232  0.0936  551 GLN A OE1 
4095 N NE2 . GLN A 540 ? 0.9655 1.4939 1.0937 -0.0367 0.0254  0.0907  551 GLN A NE2 
4096 N N   . ASP A 541 ? 0.9350 1.4374 1.0626 -0.0602 0.0118  0.0996  552 ASP A N   
4097 C CA  . ASP A 541 ? 0.9490 1.4500 1.0769 -0.0641 0.0096  0.1035  552 ASP A CA  
4098 C C   . ASP A 541 ? 1.0249 1.5185 1.1510 -0.0686 0.0069  0.1035  552 ASP A C   
4099 O O   . ASP A 541 ? 1.0101 1.4971 1.1363 -0.0713 0.0051  0.1033  552 ASP A O   
4100 C CB  . ASP A 541 ? 0.9732 1.4704 1.1030 -0.0632 0.0100  0.1016  552 ASP A CB  
4101 C CG  . ASP A 541 ? 1.1368 1.6418 1.2684 -0.0592 0.0124  0.1026  552 ASP A CG  
4102 O OD1 . ASP A 541 ? 1.1520 1.6658 1.2841 -0.0594 0.0124  0.1081  552 ASP A OD1 
4103 O OD2 . ASP A 541 ? 1.2179 1.7205 1.3504 -0.0557 0.0142  0.0980  552 ASP A OD2 
4104 N N   . GLN A 542 ? 1.0657 1.5602 1.1901 -0.0694 0.0065  0.1037  553 GLN A N   
4105 C CA  . GLN A 542 ? 1.0767 1.5644 1.1991 -0.0735 0.0040  0.1038  553 GLN A CA  
4106 C C   . GLN A 542 ? 1.1577 1.6513 1.2786 -0.0750 0.0033  0.1077  553 GLN A C   
4107 O O   . GLN A 542 ? 1.1435 1.6400 1.2638 -0.0727 0.0048  0.1060  553 GLN A O   
4108 C CB  . GLN A 542 ? 0.3213 0.7992 0.4430 -0.0728 0.0042  0.0971  553 GLN A CB  
4109 N N   . TYR A 545 ? 1.0739 1.5539 1.1871 -0.0833 -0.0016 0.1058  556 TYR A N   
4110 C CA  . TYR A 545 ? 1.0700 1.5433 1.1828 -0.0813 -0.0006 0.0993  556 TYR A CA  
4111 C C   . TYR A 545 ? 1.1285 1.6068 1.2404 -0.0789 0.0010  0.0983  556 TYR A C   
4112 O O   . TYR A 545 ? 1.1278 1.6163 1.2402 -0.0770 0.0023  0.1015  556 TYR A O   
4113 C CB  . TYR A 545 ? 1.0800 1.5508 1.1947 -0.0781 0.0012  0.0952  556 TYR A CB  
4114 N N   . ARG A 546 ? 1.1840 1.6557 1.2945 -0.0790 0.0008  0.0940  557 ARG A N   
4115 C CA  . ARG A 546 ? 1.1827 1.6608 1.2914 -0.0771 0.0019  0.0933  557 ARG A CA  
4116 C C   . ARG A 546 ? 1.2187 1.6902 1.3270 -0.0748 0.0030  0.0864  557 ARG A C   
4117 O O   . ARG A 546 ? 1.2090 1.6717 1.3186 -0.0744 0.0029  0.0826  557 ARG A O   
4118 C CB  . ARG A 546 ? 1.1947 1.6740 1.3012 -0.0806 0.0000  0.0965  557 ARG A CB  
4119 N N   . TRP A 547 ? 1.1354 1.6113 1.2418 -0.0731 0.0039  0.0850  558 TRP A N   
4120 C CA  . TRP A 547 ? 1.1239 1.5948 1.2296 -0.0706 0.0050  0.0786  558 TRP A CA  
4121 C C   . TRP A 547 ? 1.1564 1.6259 1.2595 -0.0722 0.0040  0.0776  558 TRP A C   
4122 O O   . TRP A 547 ? 1.1518 1.6305 1.2535 -0.0716 0.0045  0.0803  558 TRP A O   
4123 C CB  . TRP A 547 ? 1.1079 1.5869 1.2143 -0.0656 0.0078  0.0770  558 TRP A CB  
4124 C CG  . TRP A 547 ? 1.1184 1.5941 1.2236 -0.0627 0.0090  0.0709  558 TRP A CG  
4125 C CD1 . TRP A 547 ? 1.1548 1.6370 1.2581 -0.0602 0.0104  0.0698  558 TRP A CD1 
4126 C CD2 . TRP A 547 ? 1.1106 1.5756 1.2165 -0.0619 0.0090  0.0650  558 TRP A CD2 
4127 N NE1 . TRP A 547 ? 1.1451 1.6213 1.2476 -0.0580 0.0111  0.0635  558 TRP A NE1 
4128 C CE2 . TRP A 547 ? 1.1599 1.6255 1.2640 -0.0590 0.0103  0.0605  558 TRP A CE2 
4129 C CE3 . TRP A 547 ? 1.1233 1.5782 1.2309 -0.0634 0.0080  0.0631  558 TRP A CE3 
4130 C CZ2 . TRP A 547 ? 1.1462 1.6028 1.2504 -0.0575 0.0106  0.0543  558 TRP A CZ2 
4131 C CZ3 . TRP A 547 ? 1.1363 1.5821 1.2440 -0.0619 0.0083  0.0570  558 TRP A CZ3 
4132 C CH2 . TRP A 547 ? 1.1429 1.5898 1.2489 -0.0590 0.0096  0.0527  558 TRP A CH2 
4133 N N   . LYS A 548 ? 1.3663 1.8244 1.4687 -0.0742 0.0026  0.0739  559 LYS A N   
4134 C CA  . LYS A 548 ? 1.3570 1.8122 1.4569 -0.0757 0.0016  0.0722  559 LYS A CA  
4135 C C   . LYS A 548 ? 1.3797 1.8314 1.4792 -0.0724 0.0031  0.0658  559 LYS A C   
4136 O O   . LYS A 548 ? 1.3703 1.8112 1.4702 -0.0728 0.0024  0.0613  559 LYS A O   
4137 C CB  . LYS A 548 ? 1.3882 1.8329 1.4877 -0.0801 -0.0010 0.0727  559 LYS A CB  
4138 N N   . GLY A 549 ? 0.8029 1.2637 0.9014 -0.0690 0.0050  0.0652  560 GLY A N   
4139 C CA  . GLY A 549 ? 0.7890 1.2475 0.8868 -0.0655 0.0065  0.0591  560 GLY A CA  
4140 C C   . GLY A 549 ? 0.8188 1.2884 0.9154 -0.0616 0.0088  0.0591  560 GLY A C   
4141 O O   . GLY A 549 ? 0.8103 1.2889 0.9058 -0.0621 0.0088  0.0634  560 GLY A O   
4142 N N   . HIS A 550 ? 1.3614 1.8305 1.4582 -0.0574 0.0107  0.0543  561 HIS A N   
4143 C CA  . HIS A 550 ? 1.3534 1.8317 1.4489 -0.0532 0.0129  0.0533  561 HIS A CA  
4144 C C   . HIS A 550 ? 1.3726 1.8623 1.4691 -0.0516 0.0142  0.0584  561 HIS A C   
4145 O O   . HIS A 550 ? 1.3782 1.8680 1.4770 -0.0512 0.0146  0.0601  561 HIS A O   
4146 C CB  . HIS A 550 ? 1.3608 1.8351 1.4564 -0.0491 0.0145  0.0469  561 HIS A CB  
4147 N N   . GLU A 551 ? 0.7474 1.2465 0.8421 -0.0507 0.0148  0.0610  562 GLU A N   
4148 C CA  . GLU A 551 ? 0.7314 1.2418 0.8269 -0.0482 0.0164  0.0653  562 GLU A CA  
4149 C C   . GLU A 551 ? 0.7342 1.2471 0.8301 -0.0427 0.0191  0.0615  562 GLU A C   
4150 O O   . GLU A 551 ? 0.7235 1.2326 0.8179 -0.0403 0.0199  0.0560  562 GLU A O   
4151 C CB  . GLU A 551 ? 0.7525 1.2720 0.8459 -0.0488 0.0162  0.0691  562 GLU A CB  
4152 N N   . ARG A 552 ? 0.7301 1.2490 0.8278 -0.0406 0.0204  0.0643  563 ARG A N   
4153 C CA  . ARG A 552 ? 0.7085 1.2289 0.8068 -0.0354 0.0229  0.0609  563 ARG A CA  
4154 C C   . ARG A 552 ? 0.7266 1.2525 0.8223 -0.0315 0.0246  0.0585  563 ARG A C   
4155 O O   . ARG A 552 ? 0.7236 1.2562 0.8177 -0.0322 0.0244  0.0613  563 ARG A O   
4156 C CB  . ARG A 552 ? 0.6968 1.2237 0.7973 -0.0339 0.0241  0.0652  563 ARG A CB  
4157 C CG  . ARG A 552 ? 0.8007 1.3396 0.9005 -0.0333 0.0247  0.0707  563 ARG A CG  
4158 C CD  . ARG A 552 ? 0.9356 1.4809 1.0375 -0.0309 0.0263  0.0739  563 ARG A CD  
4159 N NE  . ARG A 552 ? 1.0248 1.5724 1.1265 -0.0253 0.0290  0.0703  563 ARG A NE  
4160 C CZ  . ARG A 552 ? 1.1757 1.7272 1.2791 -0.0223 0.0307  0.0716  563 ARG A CZ  
4161 N NH1 . ARG A 552 ? 0.9665 1.5203 1.0721 -0.0246 0.0300  0.0764  563 ARG A NH1 
4162 N NH2 . ARG A 552 ? 0.9953 1.5481 1.0981 -0.0172 0.0331  0.0681  563 ARG A NH2 
4163 N N   . LEU A 553 ? 0.6326 1.1552 0.7280 -0.0273 0.0264  0.0531  564 LEU A N   
4164 C CA  . LEU A 553 ? 0.6228 1.1503 0.7158 -0.0230 0.0282  0.0503  564 LEU A CA  
4165 C C   . LEU A 553 ? 0.6579 1.1967 0.7512 -0.0200 0.0301  0.0546  564 LEU A C   
4166 O O   . LEU A 553 ? 0.6513 1.1920 0.7466 -0.0183 0.0312  0.0561  564 LEU A O   
4167 C CB  . LEU A 553 ? 0.6226 1.1433 0.7153 -0.0193 0.0295  0.0436  564 LEU A CB  
4168 C CG  . LEU A 553 ? 0.6805 1.1934 0.7710 -0.0199 0.0286  0.0380  564 LEU A CG  
4169 C CD1 . LEU A 553 ? 0.6789 1.1828 0.7700 -0.0176 0.0292  0.0320  564 LEU A CD1 
4170 C CD2 . LEU A 553 ? 0.7161 1.2350 0.8036 -0.0172 0.0296  0.0368  564 LEU A CD2 
4171 N N   . ALA A 554 ? 0.5716 1.1179 0.6627 -0.0194 0.0304  0.0565  565 ALA A N   
4172 C CA  . ALA A 554 ? 0.5638 1.1210 0.6549 -0.0165 0.0321  0.0605  565 ALA A CA  
4173 C C   . ALA A 554 ? 0.5873 1.1456 0.6776 -0.0105 0.0348  0.0564  565 ALA A C   
4174 O O   . ALA A 554 ? 0.5785 1.1337 0.6666 -0.0081 0.0355  0.0514  565 ALA A O   
4175 C CB  . ALA A 554 ? 0.5756 1.1401 0.6646 -0.0178 0.0315  0.0638  565 ALA A CB  
4176 N N   . ALA A 555 ? 0.5120 1.0745 0.6042 -0.0079 0.0364  0.0585  566 ALA A N   
4177 C CA  . ALA A 555 ? 0.5107 1.0739 0.6024 -0.0022 0.0391  0.0550  566 ALA A CA  
4178 C C   . ALA A 555 ? 0.5688 1.1423 0.6587 0.0012  0.0408  0.0574  566 ALA A C   
4179 O O   . ALA A 555 ? 0.5579 1.1391 0.6478 -0.0007 0.0402  0.0628  566 ALA A O   
4180 C CB  . ALA A 555 ? 0.5194 1.0811 0.6139 -0.0011 0.0400  0.0557  566 ALA A CB  
4181 N N   . ARG A 556 ? 0.7917 1.3649 0.8800 0.0064  0.0430  0.0532  567 ARG A N   
4182 C CA  . ARG A 556 ? 0.8055 1.3876 0.8920 0.0102  0.0450  0.0548  567 ARG A CA  
4183 C C   . ARG A 556 ? 0.8753 1.4641 0.9639 0.0123  0.0465  0.0589  567 ARG A C   
4184 O O   . ARG A 556 ? 0.8744 1.4595 0.9645 0.0145  0.0477  0.0569  567 ARG A O   
4185 C CB  . ARG A 556 ? 0.8164 1.3951 0.9003 0.0150  0.0466  0.0486  567 ARG A CB  
4186 C CG  . ARG A 556 ? 0.9376 1.5106 1.0191 0.0132  0.0451  0.0446  567 ARG A CG  
4187 C CD  . ARG A 556 ? 1.0242 1.5964 1.1026 0.0179  0.0468  0.0396  567 ARG A CD  
4188 N NE  . ARG A 556 ? 1.1327 1.6993 1.2090 0.0162  0.0453  0.0356  567 ARG A NE  
4189 C CZ  . ARG A 556 ? 1.3255 1.8963 1.4000 0.0143  0.0443  0.0373  567 ARG A CZ  
4190 N NH1 . ARG A 556 ? 1.1708 1.7515 1.2454 0.0138  0.0446  0.0430  567 ARG A NH1 
4191 N NH2 . ARG A 556 ? 1.1594 1.7244 1.2319 0.0128  0.0430  0.0333  567 ARG A NH2 
4192 N N   . SER A 557 ? 1.0183 1.6168 1.1070 0.0115  0.0465  0.0647  568 SER A N   
4193 C CA  . SER A 557 ? 1.0130 1.6182 1.1040 0.0125  0.0475  0.0696  568 SER A CA  
4194 C C   . SER A 557 ? 1.0547 1.6627 1.1449 0.0186  0.0505  0.0676  568 SER A C   
4195 O O   . SER A 557 ? 1.0598 1.6673 1.1520 0.0203  0.0517  0.0679  568 SER A O   
4196 C CB  . SER A 557 ? 1.0485 1.6632 1.1396 0.0099  0.0465  0.0763  568 SER A CB  
4197 O OG  . SER A 557 ? 1.1098 1.7214 1.2014 0.0042  0.0437  0.0781  568 SER A OG  
4198 N N   . GLY A 558 ? 0.5323 1.1432 0.6196 0.0219  0.0518  0.0655  569 GLY A N   
4199 C CA  . GLY A 558 ? 0.5266 1.1407 0.6129 0.0276  0.0547  0.0640  569 GLY A CA  
4200 C C   . GLY A 558 ? 0.5539 1.1589 0.6397 0.0308  0.0559  0.0575  569 GLY A C   
4201 O O   . GLY A 558 ? 0.5301 1.1263 0.6167 0.0286  0.0546  0.0542  569 GLY A O   
4202 N N   . PRO A 559 ? 0.7406 1.3475 0.8250 0.0362  0.0585  0.0555  570 PRO A N   
4203 C CA  . PRO A 559 ? 0.7373 1.3355 0.8209 0.0395  0.0597  0.0491  570 PRO A CA  
4204 C C   . PRO A 559 ? 0.7765 1.3687 0.8570 0.0400  0.0591  0.0437  570 PRO A C   
4205 O O   . PRO A 559 ? 0.7751 1.3719 0.8532 0.0404  0.0591  0.0443  570 PRO A O   
4206 C CB  . PRO A 559 ? 0.7652 1.3684 0.8481 0.0449  0.0626  0.0495  570 PRO A CB  
4207 C CG  . PRO A 559 ? 0.8276 1.4414 0.9095 0.0450  0.0629  0.0543  570 PRO A CG  
4208 C CD  . PRO A 559 ? 0.7697 1.3867 0.8535 0.0393  0.0603  0.0592  570 PRO A CD  
4209 N N   . VAL A 560 ? 0.6014 1.1834 0.6820 0.0399  0.0586  0.0384  571 VAL A N   
4210 C CA  . VAL A 560 ? 0.5834 1.1584 0.6613 0.0402  0.0579  0.0328  571 VAL A CA  
4211 C C   . VAL A 560 ? 0.6096 1.1780 0.6861 0.0450  0.0598  0.0271  571 VAL A C   
4212 O O   . VAL A 560 ? 0.5926 1.1577 0.6709 0.0464  0.0607  0.0264  571 VAL A O   
4213 C CB  . VAL A 560 ? 0.6211 1.1890 0.7002 0.0352  0.0552  0.0315  571 VAL A CB  
4214 C CG1 . VAL A 560 ? 0.6149 1.1759 0.6911 0.0354  0.0544  0.0259  571 VAL A CG1 
4215 C CG2 . VAL A 560 ? 0.6162 1.1903 0.6969 0.0302  0.0533  0.0375  571 VAL A CG2 
4216 N N   . ARG A 561 ? 0.7312 1.2974 0.8042 0.0476  0.0603  0.0231  572 ARG A N   
4217 C CA  . ARG A 561 ? 0.7285 1.2879 0.7998 0.0522  0.0620  0.0174  572 ARG A CA  
4218 C C   . ARG A 561 ? 0.7589 1.3069 0.8300 0.0506  0.0604  0.0119  572 ARG A C   
4219 O O   . ARG A 561 ? 0.7487 1.2942 0.8190 0.0475  0.0584  0.0108  572 ARG A O   
4220 C CB  . ARG A 561 ? 0.7444 1.3068 0.8120 0.0559  0.0634  0.0157  572 ARG A CB  
4221 C CG  . ARG A 561 ? 0.8699 1.4264 0.9356 0.0610  0.0654  0.0106  572 ARG A CG  
4222 C CD  . ARG A 561 ? 1.0532 1.6111 1.1149 0.0642  0.0663  0.0083  572 ARG A CD  
4223 N NE  . ARG A 561 ? 1.1601 1.7110 1.2198 0.0688  0.0680  0.0031  572 ARG A NE  
4224 C CZ  . ARG A 561 ? 1.3205 1.8748 1.3792 0.0731  0.0705  0.0036  572 ARG A CZ  
4225 N NH1 . ARG A 561 ? 1.1860 1.7508 1.2454 0.0737  0.0716  0.0089  572 ARG A NH1 
4226 N NH2 . ARG A 561 ? 1.1035 1.6505 1.1604 0.0769  0.0718  -0.0013 572 ARG A NH2 
4227 N N   . PHE A 562 ? 0.5800 1.1209 0.6519 0.0529  0.0614  0.0086  573 PHE A N   
4228 C CA  . PHE A 562 ? 0.5633 1.0928 0.6351 0.0519  0.0601  0.0032  573 PHE A CA  
4229 C C   . PHE A 562 ? 0.5902 1.1133 0.6596 0.0568  0.0617  -0.0022 573 PHE A C   
4230 O O   . PHE A 562 ? 0.5810 1.1061 0.6505 0.0604  0.0639  -0.0017 573 PHE A O   
4231 C CB  . PHE A 562 ? 0.5781 1.1037 0.6536 0.0492  0.0592  0.0043  573 PHE A CB  
4232 C CG  . PHE A 562 ? 0.5872 1.1179 0.6651 0.0442  0.0574  0.0095  573 PHE A CG  
4233 C CD1 . PHE A 562 ? 0.6141 1.1424 0.6916 0.0401  0.0550  0.0090  573 PHE A CD1 
4234 C CD2 . PHE A 562 ? 0.6064 1.1440 0.6870 0.0435  0.0581  0.0149  573 PHE A CD2 
4235 C CE1 . PHE A 562 ? 0.6178 1.1503 0.6975 0.0353  0.0534  0.0139  573 PHE A CE1 
4236 C CE2 . PHE A 562 ? 0.6357 1.1776 0.7185 0.0387  0.0563  0.0198  573 PHE A CE2 
4237 C CZ  . PHE A 562 ? 0.6047 1.1439 0.6870 0.0346  0.0540  0.0193  573 PHE A CZ  
4238 N N   . GLU A 563 ? 0.6812 1.1962 0.7483 0.0567  0.0606  -0.0074 574 GLU A N   
4239 C CA  . GLU A 563 ? 0.6778 1.1849 0.7426 0.0608  0.0618  -0.0130 574 GLU A CA  
4240 C C   . GLU A 563 ? 0.6936 1.1930 0.7609 0.0609  0.0619  -0.0150 574 GLU A C   
4241 O O   . GLU A 563 ? 0.6861 1.1853 0.7564 0.0574  0.0607  -0.0127 574 GLU A O   
4242 C CB  . GLU A 563 ? 0.6967 1.1980 0.7585 0.0605  0.0604  -0.0176 574 GLU A CB  
4243 C CG  . GLU A 563 ? 0.8753 1.3666 0.9379 0.0576  0.0582  -0.0213 574 GLU A CG  
4244 C CD  . GLU A 563 ? 1.2206 1.7049 1.2799 0.0584  0.0572  -0.0267 574 GLU A CD  
4245 O OE1 . GLU A 563 ? 1.1902 1.6761 1.2486 0.0555  0.0555  -0.0264 574 GLU A OE1 
4246 O OE2 . GLU A 563 ? 1.1076 1.5847 1.1652 0.0618  0.0581  -0.0311 574 GLU A OE2 
4247 N N   . PRO A 564 ? 0.4719 0.9646 0.5378 0.0648  0.0632  -0.0191 575 PRO A N   
4248 C CA  . PRO A 564 ? 0.4666 0.9519 0.5347 0.0649  0.0633  -0.0209 575 PRO A CA  
4249 C C   . PRO A 564 ? 0.5191 0.9969 0.5886 0.0609  0.0608  -0.0230 575 PRO A C   
4250 O O   . PRO A 564 ? 0.5222 0.9968 0.5899 0.0592  0.0591  -0.0254 575 PRO A O   
4251 C CB  . PRO A 564 ? 0.4879 0.9663 0.5534 0.0695  0.0649  -0.0257 575 PRO A CB  
4252 C CG  . PRO A 564 ? 0.5376 1.0180 0.5993 0.0710  0.0650  -0.0272 575 PRO A CG  
4253 C CD  . PRO A 564 ? 0.4856 0.9775 0.5478 0.0692  0.0649  -0.0219 575 PRO A CD  
4254 N N   . GLY A 565 ? 0.6213 1.0964 0.6940 0.0595  0.0606  -0.0219 576 GLY A N   
4255 C CA  . GLY A 565 ? 0.5992 1.0677 0.6738 0.0556  0.0583  -0.0232 576 GLY A CA  
4256 C C   . GLY A 565 ? 0.6029 1.0757 0.6816 0.0529  0.0582  -0.0185 576 GLY A C   
4257 O O   . GLY A 565 ? 0.6139 1.0920 0.6940 0.0548  0.0600  -0.0155 576 GLY A O   
4258 N N   . PHE A 566 ? 0.4218 0.8921 0.5022 0.0484  0.0559  -0.0179 577 PHE A N   
4259 C CA  . PHE A 566 ? 0.3938 0.8681 0.4779 0.0452  0.0554  -0.0131 577 PHE A CA  
4260 C C   . PHE A 566 ? 0.4207 0.9060 0.5050 0.0433  0.0552  -0.0077 577 PHE A C   
4261 O O   . PHE A 566 ? 0.4036 0.8902 0.4863 0.0410  0.0537  -0.0077 577 PHE A O   
4262 C CB  . PHE A 566 ? 0.3964 0.8631 0.4823 0.0411  0.0530  -0.0146 577 PHE A CB  
4263 C CG  . PHE A 566 ? 0.3935 0.8500 0.4801 0.0425  0.0531  -0.0189 577 PHE A CG  
4264 C CD1 . PHE A 566 ? 0.4167 0.8646 0.5006 0.0441  0.0526  -0.0246 577 PHE A CD1 
4265 C CD2 . PHE A 566 ? 0.3996 0.8549 0.4894 0.0422  0.0536  -0.0172 577 PHE A CD2 
4266 C CE1 . PHE A 566 ? 0.4186 0.8570 0.5031 0.0454  0.0526  -0.0284 577 PHE A CE1 
4267 C CE2 . PHE A 566 ? 0.4284 0.8744 0.5188 0.0434  0.0537  -0.0210 577 PHE A CE2 
4268 C CZ  . PHE A 566 ? 0.4059 0.8434 0.4937 0.0450  0.0532  -0.0265 577 PHE A CZ  
4269 N N   . GLN A 567 ? 0.3382 0.8313 0.4242 0.0442  0.0567  -0.0030 578 GLN A N   
4270 C CA  . GLN A 567 ? 0.3322 0.8363 0.4181 0.0431  0.0569  0.0023  578 GLN A CA  
4271 C C   . GLN A 567 ? 0.3674 0.8757 0.4569 0.0392  0.0559  0.0076  578 GLN A C   
4272 O O   . GLN A 567 ? 0.3605 0.8680 0.4525 0.0399  0.0567  0.0087  578 GLN A O   
4273 C CB  . GLN A 567 ? 0.3604 0.8711 0.4449 0.0478  0.0595  0.0034  578 GLN A CB  
4274 C CG  . GLN A 567 ? 0.6025 1.1095 0.6832 0.0516  0.0605  -0.0015 578 GLN A CG  
4275 C CD  . GLN A 567 ? 0.7003 1.2110 0.7799 0.0567  0.0632  -0.0014 578 GLN A CD  
4276 O OE1 . GLN A 567 ? 0.5915 1.1075 0.6732 0.0575  0.0645  0.0023  578 GLN A OE1 
4277 N NE2 . GLN A 567 ? 0.5484 1.0559 0.6246 0.0601  0.0641  -0.0055 578 GLN A NE2 
4278 N N   . PRO A 568 ? 0.3908 0.9034 0.4806 0.0352  0.0542  0.0111  579 PRO A N   
4279 C CA  . PRO A 568 ? 0.3894 0.9052 0.4826 0.0311  0.0530  0.0161  579 PRO A CA  
4280 C C   . PRO A 568 ? 0.4840 1.0101 0.5783 0.0324  0.0545  0.0217  579 PRO A C   
4281 O O   . PRO A 568 ? 0.4930 1.0266 0.5854 0.0344  0.0556  0.0235  579 PRO A O   
4282 C CB  . PRO A 568 ? 0.4061 0.9227 0.4986 0.0266  0.0506  0.0176  579 PRO A CB  
4283 C CG  . PRO A 568 ? 0.4646 0.9844 0.5535 0.0290  0.0513  0.0158  579 PRO A CG  
4284 C CD  . PRO A 568 ? 0.4112 0.9254 0.4983 0.0339  0.0530  0.0103  579 PRO A CD  
4285 N N   . PHE A 569 ? 0.4161 0.9425 0.5136 0.0313  0.0546  0.0245  580 PHE A N   
4286 C CA  . PHE A 569 ? 0.4292 0.9652 0.5281 0.0321  0.0558  0.0300  580 PHE A CA  
4287 C C   . PHE A 569 ? 0.5125 1.0523 0.6142 0.0273  0.0541  0.0356  580 PHE A C   
4288 O O   . PHE A 569 ? 0.5321 1.0809 0.6347 0.0274  0.0547  0.0408  580 PHE A O   
4289 C CB  . PHE A 569 ? 0.4529 0.9875 0.5531 0.0359  0.0580  0.0289  580 PHE A CB  
4290 C CG  . PHE A 569 ? 0.4757 1.0013 0.5783 0.0346  0.0573  0.0263  580 PHE A CG  
4291 C CD1 . PHE A 569 ? 0.5218 1.0485 0.6278 0.0315  0.0563  0.0301  580 PHE A CD1 
4292 C CD2 . PHE A 569 ? 0.5066 1.0226 0.6081 0.0366  0.0575  0.0202  580 PHE A CD2 
4293 C CE1 . PHE A 569 ? 0.5323 1.0507 0.6404 0.0304  0.0557  0.0278  580 PHE A CE1 
4294 C CE2 . PHE A 569 ? 0.5396 1.0473 0.6433 0.0355  0.0569  0.0179  580 PHE A CE2 
4295 C CZ  . PHE A 569 ? 0.5111 1.0200 0.6181 0.0324  0.0560  0.0217  580 PHE A CZ  
4296 N N   . VAL A 570 ? 0.5046 1.0379 0.6074 0.0230  0.0518  0.0348  581 VAL A N   
4297 C CA  . VAL A 570 ? 0.5041 1.0404 0.6093 0.0182  0.0499  0.0400  581 VAL A CA  
4298 C C   . VAL A 570 ? 0.5297 1.0595 0.6345 0.0137  0.0473  0.0385  581 VAL A C   
4299 O O   . VAL A 570 ? 0.5252 1.0458 0.6296 0.0138  0.0468  0.0333  581 VAL A O   
4300 C CB  . VAL A 570 ? 0.5583 1.0933 0.6667 0.0178  0.0502  0.0419  581 VAL A CB  
4301 C CG1 . VAL A 570 ? 0.5528 1.0767 0.6623 0.0180  0.0499  0.0367  581 VAL A CG1 
4302 C CG2 . VAL A 570 ? 0.5527 1.0913 0.6634 0.0129  0.0483  0.0477  581 VAL A CG2 
4303 N N   . LEU A 571 ? 0.4674 1.0019 0.5724 0.0097  0.0456  0.0430  582 LEU A N   
4304 C CA  . LEU A 571 ? 0.4532 0.9823 0.5579 0.0050  0.0430  0.0425  582 LEU A CA  
4305 C C   . LEU A 571 ? 0.4994 1.0290 0.6069 0.0004  0.0413  0.0474  582 LEU A C   
4306 O O   . LEU A 571 ? 0.5062 1.0442 0.6143 -0.0006 0.0413  0.0530  582 LEU A O   
4307 C CB  . LEU A 571 ? 0.4523 0.9860 0.5543 0.0041  0.0424  0.0434  582 LEU A CB  
4308 C CG  . LEU A 571 ? 0.5065 1.0379 0.6084 -0.0015 0.0396  0.0453  582 LEU A CG  
4309 C CD1 . LEU A 571 ? 0.5013 1.0212 0.6033 -0.0035 0.0381  0.0403  582 LEU A CD1 
4310 C CD2 . LEU A 571 ? 0.5481 1.0858 0.6473 -0.0018 0.0393  0.0468  582 LEU A CD2 
4311 N N   . VAL A 572 ? 0.3790 0.8994 0.4881 -0.0022 0.0399  0.0452  583 VAL A N   
4312 C CA  . VAL A 572 ? 0.3810 0.9003 0.4926 -0.0066 0.0380  0.0492  583 VAL A CA  
4313 C C   . VAL A 572 ? 0.4587 0.9739 0.5694 -0.0114 0.0354  0.0495  583 VAL A C   
4314 O O   . VAL A 572 ? 0.4677 0.9736 0.5780 -0.0126 0.0344  0.0450  583 VAL A O   
4315 C CB  . VAL A 572 ? 0.4220 0.9338 0.5361 -0.0064 0.0382  0.0470  583 VAL A CB  
4316 C CG1 . VAL A 572 ? 0.4153 0.9273 0.5320 -0.0105 0.0365  0.0517  583 VAL A CG1 
4317 C CG2 . VAL A 572 ? 0.4196 0.9342 0.5341 -0.0012 0.0409  0.0456  583 VAL A CG2 
4318 N N   . GLN A 573 ? 0.4188 0.9408 0.5290 -0.0141 0.0344  0.0546  584 GLN A N   
4319 C CA  . GLN A 573 ? 0.4175 0.9363 0.5267 -0.0187 0.0319  0.0554  584 GLN A CA  
4320 C C   . GLN A 573 ? 0.4979 1.0121 0.6094 -0.0233 0.0298  0.0583  584 GLN A C   
4321 O O   . GLN A 573 ? 0.5144 1.0343 0.6273 -0.0246 0.0296  0.0636  584 GLN A O   
4322 C CB  . GLN A 573 ? 0.4323 0.9604 0.5396 -0.0193 0.0318  0.0595  584 GLN A CB  
4323 C CG  . GLN A 573 ? 0.4956 1.0209 0.6018 -0.0243 0.0292  0.0610  584 GLN A CG  
4324 C CD  . GLN A 573 ? 0.6268 1.1430 0.7315 -0.0248 0.0284  0.0552  584 GLN A CD  
4325 O OE1 . GLN A 573 ? 0.5571 1.0656 0.6622 -0.0288 0.0263  0.0545  584 GLN A OE1 
4326 N NE2 . GLN A 573 ? 0.4217 0.9386 0.5245 -0.0207 0.0301  0.0509  584 GLN A NE2 
4327 N N   . CYS A 574 ? 0.5343 1.0380 0.6461 -0.0257 0.0283  0.0547  585 CYS A N   
4328 C CA  . CYS A 574 ? 0.5277 1.0258 0.6414 -0.0301 0.0262  0.0569  585 CYS A CA  
4329 C C   . CYS A 574 ? 0.5803 1.0811 0.6932 -0.0346 0.0241  0.0616  585 CYS A C   
4330 O O   . CYS A 574 ? 0.5608 1.0624 0.6713 -0.0354 0.0235  0.0610  585 CYS A O   
4331 C CB  . CYS A 574 ? 0.5261 1.0117 0.6402 -0.0312 0.0252  0.0515  585 CYS A CB  
4332 S SG  . CYS A 574 ? 0.5748 1.0556 0.6904 -0.0266 0.0272  0.0463  585 CYS A SG  
4333 N N   . GLN A 575 ? 0.5599 1.0619 0.6745 -0.0375 0.0230  0.0663  586 GLN A N   
4334 C CA  . GLN A 575 ? 0.5651 1.0684 0.6792 -0.0421 0.0207  0.0709  586 GLN A CA  
4335 C C   . GLN A 575 ? 0.6191 1.1123 0.7346 -0.0460 0.0185  0.0706  586 GLN A C   
4336 O O   . GLN A 575 ? 0.6207 1.1128 0.7385 -0.0461 0.0187  0.0718  586 GLN A O   
4337 C CB  . GLN A 575 ? 0.5877 1.1020 0.7023 -0.0422 0.0211  0.0774  586 GLN A CB  
4338 C CG  . GLN A 575 ? 0.7711 1.2909 0.8837 -0.0448 0.0198  0.0814  586 GLN A CG  
4339 C CD  . GLN A 575 ? 0.9404 1.4628 1.0505 -0.0425 0.0208  0.0785  586 GLN A CD  
4340 O OE1 . GLN A 575 ? 0.8447 1.3624 0.9531 -0.0448 0.0194  0.0768  586 GLN A OE1 
4341 N NE2 . GLN A 575 ? 0.7769 1.3068 0.8867 -0.0378 0.0232  0.0779  586 GLN A NE2 
4342 N N   . PRO A 576 ? 0.5457 1.0312 0.6600 -0.0493 0.0166  0.0688  587 PRO A N   
4343 C CA  . PRO A 576 ? 0.5437 1.0293 0.6553 -0.0499 0.0161  0.0672  587 PRO A CA  
4344 C C   . PRO A 576 ? 0.5923 1.0763 0.7027 -0.0458 0.0179  0.0613  587 PRO A C   
4345 O O   . PRO A 576 ? 0.5684 1.0479 0.6802 -0.0433 0.0189  0.0576  587 PRO A O   
4346 C CB  . PRO A 576 ? 0.5646 1.0397 0.6759 -0.0545 0.0134  0.0664  587 PRO A CB  
4347 C CG  . PRO A 576 ? 0.6243 1.0966 0.7378 -0.0568 0.0123  0.0694  587 PRO A CG  
4348 C CD  . PRO A 576 ? 0.5659 1.0414 0.6814 -0.0531 0.0145  0.0686  587 PRO A CD  
4349 N N   . PRO A 577 ? 0.7347 1.2224 0.8427 -0.0451 0.0181  0.0604  588 PRO A N   
4350 C CA  . PRO A 577 ? 0.7299 1.2158 0.8364 -0.0413 0.0197  0.0546  588 PRO A CA  
4351 C C   . PRO A 577 ? 0.7692 1.2432 0.8751 -0.0430 0.0183  0.0495  588 PRO A C   
4352 O O   . PRO A 577 ? 0.7801 1.2521 0.8838 -0.0437 0.0176  0.0473  588 PRO A O   
4353 C CB  . PRO A 577 ? 0.7538 1.2488 0.8579 -0.0402 0.0203  0.0564  588 PRO A CB  
4354 C CG  . PRO A 577 ? 0.8118 1.3099 0.9156 -0.0447 0.0184  0.0622  588 PRO A CG  
4355 C CD  . PRO A 577 ? 0.7573 1.2500 0.8635 -0.0479 0.0168  0.0645  588 PRO A CD  
4356 N N   . ALA A 578 ? 0.5175 0.9832 0.6254 -0.0437 0.0178  0.0476  589 ALA A N   
4357 C CA  . ALA A 578 ? 0.4916 0.9453 0.5994 -0.0453 0.0164  0.0429  589 ALA A CA  
4358 C C   . ALA A 578 ? 0.4829 0.9328 0.5904 -0.0411 0.0180  0.0368  589 ALA A C   
4359 O O   . ALA A 578 ? 0.4731 0.9296 0.5806 -0.0369 0.0202  0.0361  589 ALA A O   
4360 C CB  . ALA A 578 ? 0.4961 0.9424 0.6063 -0.0486 0.0147  0.0445  589 ALA A CB  
4361 N N   . VAL A 579 ? 0.4157 0.8547 0.5231 -0.0422 0.0169  0.0323  590 VAL A N   
4362 C CA  . VAL A 579 ? 0.3868 0.8211 0.4938 -0.0385 0.0181  0.0262  590 VAL A CA  
4363 C C   . VAL A 579 ? 0.4047 0.8384 0.5144 -0.0361 0.0194  0.0259  590 VAL A C   
4364 O O   . VAL A 579 ? 0.3838 0.8135 0.4957 -0.0385 0.0184  0.0280  590 VAL A O   
4365 C CB  . VAL A 579 ? 0.4210 0.8435 0.5273 -0.0405 0.0164  0.0218  590 VAL A CB  
4366 C CG1 . VAL A 579 ? 0.4089 0.8258 0.5150 -0.0368 0.0175  0.0156  590 VAL A CG1 
4367 C CG2 . VAL A 579 ? 0.4183 0.8416 0.5219 -0.0425 0.0153  0.0218  590 VAL A CG2 
4368 N N   . VAL A 580 ? 0.3519 0.7894 0.4611 -0.0314 0.0217  0.0