data_6NCM
# 
_entry.id   6NCM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.319 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6NCM         
WWPDB D_1000238556 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.details        '6NCE contains the same protein bound to a different DNA sequence' 
_pdbx_database_related.db_id          6NCE 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6NCM 
_pdbx_database_status.recvd_initial_deposition_date   2018-12-11 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Rogers, J.M.'    1 0000-0001-6518-5470 
'Jarrett, S.M.'   2 0000-0003-3533-6148 
'Seegar, T.C.'    3 0000-0003-1258-6371 
'Waters, C.T.'    4 0000-0002-3096-0833 
'Hallworth, A.N.' 5 0000-0002-3180-9756 
'Blacklow, S.C.'  6 0000-0002-6904-1981 
'Bulyk, M.L.'     7 0000-0002-3456-4555 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Mol. Cell' 
_citation.journal_id_ASTM           MOCEFL 
_citation.journal_id_CSD            2168 
_citation.journal_id_ISSN           1097-4164 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            74 
_citation.language                  ? 
_citation.page_first                245 
_citation.page_last                 ? 
_citation.title                     
'Bispecific Forkhead Transcription Factor FoxN3 Recognizes Two Distinct Motifs with Different DNA Shapes.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2019.01.019 
_citation.pdbx_database_id_PubMed   30826165 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Rogers, J.M.'    1 ? 
primary 'Waters, C.T.'    2 ? 
primary 'Seegar, T.C.M.'  3 ? 
primary 'Jarrett, S.M.'   4 ? 
primary 'Hallworth, A.N.' 5 ? 
primary 'Blacklow, S.C.'  6 ? 
primary 'Bulyk, M.L.'     7 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6NCM 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     42.540 
_cell.length_a_esd                 ? 
_cell.length_b                     72.310 
_cell.length_b_esd                 ? 
_cell.length_c                     102.630 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6NCM 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Forkhead box protein N3'                                        11677.499 2  ? ? ? ? 
2 polymer     syn 
;DNA (5'-D(*AP*TP*AP*GP*CP*GP*TP*CP*TP*TP*AP*GP*CP*AP*TP*G)-3')
;
4913.202  1  ? ? ? ? 
3 polymer     syn 
;DNA (5'-D(*TP*CP*AP*TP*GP*CP*TP*AP*AP*GP*AP*CP*GP*CP*TP*A)-3')
;
4882.192  1  ? ? ? ? 
4 non-polymer syn 'MAGNESIUM ION'                                                  24.305    2  ? ? ? ? 
5 water       nat water                                                            18.015    13 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Checkpoint suppressor 1' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;GNCKPPYSFSCLIFMAIEDSPTKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKERSQSIGKGSLWC
IDPEYRQNLIQALKKTPYHP
;
;GNCKPPYSFSCLIFMAIEDSPTKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKERSQSIGKGSLWC
IDPEYRQNLIQALKKTPYHP
;
A,B ? 
2 polydeoxyribonucleotide no no '(DA)(DT)(DA)(DG)(DC)(DG)(DT)(DC)(DT)(DT)(DA)(DG)(DC)(DA)(DT)(DG)' ATAGCGTCTTAGCATG C   ? 
3 polydeoxyribonucleotide no no '(DT)(DC)(DA)(DT)(DG)(DC)(DT)(DA)(DA)(DG)(DA)(DC)(DG)(DC)(DT)(DA)' TCATGCTAAGACGCTA D   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ASN n 
1 3   CYS n 
1 4   LYS n 
1 5   PRO n 
1 6   PRO n 
1 7   TYR n 
1 8   SER n 
1 9   PHE n 
1 10  SER n 
1 11  CYS n 
1 12  LEU n 
1 13  ILE n 
1 14  PHE n 
1 15  MET n 
1 16  ALA n 
1 17  ILE n 
1 18  GLU n 
1 19  ASP n 
1 20  SER n 
1 21  PRO n 
1 22  THR n 
1 23  LYS n 
1 24  ARG n 
1 25  LEU n 
1 26  PRO n 
1 27  VAL n 
1 28  LYS n 
1 29  ASP n 
1 30  ILE n 
1 31  TYR n 
1 32  ASN n 
1 33  TRP n 
1 34  ILE n 
1 35  LEU n 
1 36  GLU n 
1 37  HIS n 
1 38  PHE n 
1 39  PRO n 
1 40  TYR n 
1 41  PHE n 
1 42  ALA n 
1 43  ASN n 
1 44  ALA n 
1 45  PRO n 
1 46  THR n 
1 47  GLY n 
1 48  TRP n 
1 49  LYS n 
1 50  ASN n 
1 51  SER n 
1 52  VAL n 
1 53  ARG n 
1 54  HIS n 
1 55  ASN n 
1 56  LEU n 
1 57  SER n 
1 58  LEU n 
1 59  ASN n 
1 60  LYS n 
1 61  CYS n 
1 62  PHE n 
1 63  LYS n 
1 64  LYS n 
1 65  VAL n 
1 66  ASP n 
1 67  LYS n 
1 68  GLU n 
1 69  ARG n 
1 70  SER n 
1 71  GLN n 
1 72  SER n 
1 73  ILE n 
1 74  GLY n 
1 75  LYS n 
1 76  GLY n 
1 77  SER n 
1 78  LEU n 
1 79  TRP n 
1 80  CYS n 
1 81  ILE n 
1 82  ASP n 
1 83  PRO n 
1 84  GLU n 
1 85  TYR n 
1 86  ARG n 
1 87  GLN n 
1 88  ASN n 
1 89  LEU n 
1 90  ILE n 
1 91  GLN n 
1 92  ALA n 
1 93  LEU n 
1 94  LYS n 
1 95  LYS n 
1 96  THR n 
1 97  PRO n 
1 98  TYR n 
1 99  HIS n 
1 100 PRO n 
2 1   DA  n 
2 2   DT  n 
2 3   DA  n 
2 4   DG  n 
2 5   DC  n 
2 6   DG  n 
2 7   DT  n 
2 8   DC  n 
2 9   DT  n 
2 10  DT  n 
2 11  DA  n 
2 12  DG  n 
2 13  DC  n 
2 14  DA  n 
2 15  DT  n 
2 16  DG  n 
3 1   DT  n 
3 2   DC  n 
3 3   DA  n 
3 4   DT  n 
3 5   DG  n 
3 6   DC  n 
3 7   DT  n 
3 8   DA  n 
3 9   DA  n 
3 10  DG  n 
3 11  DA  n 
3 12  DC  n 
3 13  DG  n 
3 14  DC  n 
3 15  DT  n 
3 16  DA  n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   100 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'FOXN3, C14orf116, CHES1' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_pdbx_entity_src_syn.entity_id 
_pdbx_entity_src_syn.pdbx_src_id 
_pdbx_entity_src_syn.pdbx_alt_source_flag 
_pdbx_entity_src_syn.pdbx_beg_seq_num 
_pdbx_entity_src_syn.pdbx_end_seq_num 
_pdbx_entity_src_syn.organism_scientific 
_pdbx_entity_src_syn.organism_common_name 
_pdbx_entity_src_syn.ncbi_taxonomy_id 
_pdbx_entity_src_syn.details 
2 1 sample 1 16 'synthetic construct' ? 32630 ? 
3 1 sample 1 16 'synthetic construct' ? 32630 ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP FOXN3_HUMAN O00409 ? 1 
;NCKPPYSFSCLIFMAIEDSPTKRLPVKDIYNWILEHFPYFANAPTGWKNSVRHNLSLNKCFKKVDKERSQSIGKGSLWCI
DPEYRQNLIQALKKTPYHP
;
112 
2 PDB 6NCM        6NCM   ? 2 ? 1   
3 PDB 6NCM        6NCM   ? 3 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6NCM A 2 ? 100 ? O00409 112 ? 210 ? 112 210 
2 2 6NCM C 1 ? 16  ? 6NCM   1   ? 16  ? 1   16  
3 3 6NCM D 1 ? 16  ? 6NCM   1   ? 16  ? 1   16  
4 1 6NCM B 2 ? 100 ? O00409 112 ? 210 ? 112 210 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6NCM GLY A 1 ? UNP O00409 ? ? 'expression tag' 111 1 
4 6NCM GLY B 1 ? UNP O00409 ? ? 'expression tag' 111 2 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'    121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'  307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'  156.162 
HOH non-polymer         . WATER                                ? 'H2 O'            18.015  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
MG  non-polymer         . 'MAGNESIUM ION'                      ? 'Mg 2'            24.305  
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6NCM 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            2.38 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         48.34 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.5 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            292 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '0.1 M BisTris pH 5.5, 0.2 M NaCl, 22% PEG 3350' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     PIXEL 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'DECTRIS EIGER X 16M' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2017-03-16 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.9790 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 24-ID-E' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        0.9790 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   24-ID-E 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            81.03 
_reflns.entry_id                         6NCM 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.704 
_reflns.d_resolution_low                 39.3 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       9108 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.16 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  6.5 
_reflns.pdbx_Rmerge_I_obs                .09034 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            11.66 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  .09872 
_reflns.pdbx_Rpim_I_all                  .03907 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     .999 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.704 
_reflns_shell.d_res_low                   2.801 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         0.85 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           873 
_reflns_shell.percent_possible_all        98.87 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                1.949 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             6.6 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             2.115 
_reflns_shell.pdbx_Rpim_I_all             ? 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                .34 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6NCM 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.704 
_refine.ls_d_res_low                             39.3 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     9054 
_refine.ls_number_reflns_R_free                  906 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.19 
_refine.ls_percent_reflns_R_free                 10.01 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2377 
_refine.ls_R_factor_R_free                       0.2755 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.2337 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.41 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      6NCE 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 34.43 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.54 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1476 
_refine_hist.pdbx_number_atoms_nucleic_acid   650 
_refine_hist.pdbx_number_atoms_ligand         2 
_refine_hist.number_atoms_solvent             13 
_refine_hist.number_atoms_total               2141 
_refine_hist.d_res_high                       2.704 
_refine_hist.d_res_low                        39.3 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003  ? 2253 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.484  ? 3188 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 19.717 ? 1231 ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.032  ? 340  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.004  ? 291  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.7041 2.8734  . . 147 1322 99.00  . . . 0.4358 . 0.3774 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8734 3.0952  . . 148 1337 100.00 . . . 0.4108 . 0.3404 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0952 3.4066  . . 147 1309 98.00  . . . 0.3171 . 0.2806 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4066 3.8992  . . 150 1345 98.00  . . . 0.3320 . 0.2483 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8992 4.9114  . . 151 1377 100.00 . . . 0.2372 . 0.2112 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.9114 41.8532 . . 163 1459 100.00 . . . 0.2367 . 0.2000 . . . . . . . . . . 
# 
_struct.entry_id                     6NCM 
_struct.title                        
'Crystal structure of the human FOXN3 DNA binding domain in complex with a forkhead-like (FHL) DNA sequence' 
_struct.pdbx_descriptor              'Forkhead box protein N3/DNA Complex' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6NCM 
_struct_keywords.text            
;sequence specific DNA binding, regulation of transcription DNA templated, DNA Binding Transcription Factor Activity, forkhead, DNA BINDING PROTEIN, DNA BINDING PROTEIN-DNA complex
;
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 1 ? 
E N N 4 ? 
F N N 4 ? 
G N N 5 ? 
H N N 5 ? 
I N N 5 ? 
J N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 SER A 8  ? ASP A 19 ? SER A 118 ASP A 129 1 ? 12 
HELX_P HELX_P2  AA2 VAL A 27 ? PHE A 38 ? VAL A 137 PHE A 148 1 ? 12 
HELX_P HELX_P3  AA3 PRO A 39 ? ASN A 43 ? PRO A 149 ASN A 153 5 ? 5  
HELX_P HELX_P4  AA4 THR A 46 ? ASN A 59 ? THR A 156 ASN A 169 1 ? 14 
HELX_P HELX_P5  AA5 TYR A 85 ? THR A 96 ? TYR A 195 THR A 206 1 ? 12 
HELX_P HELX_P6  AA6 SER D 8  ? ASP D 19 ? SER B 118 ASP B 129 1 ? 12 
HELX_P HELX_P7  AA7 VAL D 27 ? PHE D 38 ? VAL B 137 PHE B 148 1 ? 12 
HELX_P HELX_P8  AA8 PRO D 39 ? ASN D 43 ? PRO B 149 ASN B 153 5 ? 5  
HELX_P HELX_P9  AA9 GLY D 47 ? ASN D 59 ? GLY B 157 ASN B 169 1 ? 13 
HELX_P HELX_P10 AB1 TYR D 85 ? LYS D 95 ? TYR B 195 LYS B 205 1 ? 11 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A LEU 56 O  ? ? ? 1_555 E MG  .  MG ? ? A LEU 166 A MG  301 1_555 ? ? ? ? ? ? ?            2.280 ? 
metalc2  metalc ? ? A ASN 59 O  ? ? ? 1_555 E MG  .  MG ? ? A ASN 169 A MG  301 1_555 ? ? ? ? ? ? ?            2.257 ? 
metalc3  metalc ? ? A PHE 62 O  ? ? ? 1_555 E MG  .  MG ? ? A PHE 172 A MG  301 1_555 ? ? ? ? ? ? ?            2.396 ? 
metalc4  metalc ? ? D LEU 56 O  ? ? ? 1_555 F MG  .  MG ? ? B LEU 166 B MG  301 1_555 ? ? ? ? ? ? ?            2.897 ? 
metalc5  metalc ? ? D SER 57 O  ? ? ? 1_555 F MG  .  MG ? ? B SER 167 B MG  301 1_555 ? ? ? ? ? ? ?            2.710 ? 
metalc6  metalc ? ? D ASN 59 O  ? ? ? 1_555 F MG  .  MG ? ? B ASN 169 B MG  301 1_555 ? ? ? ? ? ? ?            2.818 ? 
metalc7  metalc ? ? D PHE 62 O  ? ? ? 1_555 F MG  .  MG ? ? B PHE 172 B MG  301 1_555 ? ? ? ? ? ? ?            2.540 ? 
metalc8  metalc ? ? E MG  .  MG ? ? ? 1_555 G HOH .  O  ? ? A MG  301 A HOH 404 1_555 ? ? ? ? ? ? ?            2.558 ? 
metalc9  metalc ? ? F MG  .  MG ? ? ? 1_555 J HOH .  O  ? ? B MG  301 B HOH 403 1_555 ? ? ? ? ? ? ?            2.644 ? 
hydrog1  hydrog ? ? B DT  2  N3 ? ? ? 1_555 C DA  16 N1 ? ? C DT  2   D DA  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog2  hydrog ? ? B DT  2  O4 ? ? ? 1_555 C DA  16 N6 ? ? C DT  2   D DA  16  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog3  hydrog ? ? B DA  3  N1 ? ? ? 1_555 C DT  15 N3 ? ? C DA  3   D DT  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog4  hydrog ? ? B DA  3  N6 ? ? ? 1_555 C DT  15 O4 ? ? C DA  3   D DT  15  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog5  hydrog ? ? B DG  4  N1 ? ? ? 1_555 C DC  14 N3 ? ? C DG  4   D DC  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog6  hydrog ? ? B DG  4  N2 ? ? ? 1_555 C DC  14 O2 ? ? C DG  4   D DC  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog7  hydrog ? ? B DG  4  O6 ? ? ? 1_555 C DC  14 N4 ? ? C DG  4   D DC  14  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog8  hydrog ? ? B DC  5  N3 ? ? ? 1_555 C DG  13 N1 ? ? C DC  5   D DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog9  hydrog ? ? B DC  5  N4 ? ? ? 1_555 C DG  13 O6 ? ? C DC  5   D DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog10 hydrog ? ? B DC  5  O2 ? ? ? 1_555 C DG  13 N2 ? ? C DC  5   D DG  13  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog11 hydrog ? ? B DG  6  N1 ? ? ? 1_555 C DC  12 N3 ? ? C DG  6   D DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog12 hydrog ? ? B DG  6  N2 ? ? ? 1_555 C DC  12 O2 ? ? C DG  6   D DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog13 hydrog ? ? B DG  6  O6 ? ? ? 1_555 C DC  12 N4 ? ? C DG  6   D DC  12  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog14 hydrog ? ? B DT  7  N3 ? ? ? 1_555 C DA  11 N1 ? ? C DT  7   D DA  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog15 hydrog ? ? B DT  7  O4 ? ? ? 1_555 C DA  11 N6 ? ? C DT  7   D DA  11  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog16 hydrog ? ? B DC  8  N3 ? ? ? 1_555 C DG  10 N1 ? ? C DC  8   D DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog17 hydrog ? ? B DC  8  N4 ? ? ? 1_555 C DG  10 O6 ? ? C DC  8   D DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog18 hydrog ? ? B DC  8  O2 ? ? ? 1_555 C DG  10 N2 ? ? C DC  8   D DG  10  1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog19 hydrog ? ? B DT  9  N3 ? ? ? 1_555 C DA  9  N1 ? ? C DT  9   D DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog20 hydrog ? ? B DT  9  O4 ? ? ? 1_555 C DA  9  N6 ? ? C DT  9   D DA  9   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog21 hydrog ? ? B DT  10 N3 ? ? ? 1_555 C DA  8  N1 ? ? C DT  10  D DA  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog22 hydrog ? ? B DT  10 O4 ? ? ? 1_555 C DA  8  N6 ? ? C DT  10  D DA  8   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog23 hydrog ? ? B DA  11 N1 ? ? ? 1_555 C DT  7  N3 ? ? C DA  11  D DT  7   1_555 ? ? ? ? ? ? 'DA-DT PAIR' ?     ? 
hydrog24 hydrog ? ? B DG  12 N1 ? ? ? 1_555 C DC  6  N3 ? ? C DG  12  D DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog25 hydrog ? ? B DG  12 N2 ? ? ? 1_555 C DC  6  O2 ? ? C DG  12  D DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog26 hydrog ? ? B DG  12 O6 ? ? ? 1_555 C DC  6  N4 ? ? C DG  12  D DC  6   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog27 hydrog ? ? B DC  13 N3 ? ? ? 1_555 C DG  5  N1 ? ? C DC  13  D DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog28 hydrog ? ? B DC  13 N4 ? ? ? 1_555 C DG  5  O6 ? ? C DC  13  D DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog29 hydrog ? ? B DC  13 O2 ? ? ? 1_555 C DG  5  N2 ? ? C DC  13  D DG  5   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog30 hydrog ? ? B DA  14 N1 ? ? ? 1_555 C DT  4  N3 ? ? C DA  14  D DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog31 hydrog ? ? B DA  14 N6 ? ? ? 1_555 C DT  4  O4 ? ? C DA  14  D DT  4   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog32 hydrog ? ? B DT  15 N3 ? ? ? 1_555 C DA  3  N1 ? ? C DT  15  D DA  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog33 hydrog ? ? B DT  15 O4 ? ? ? 1_555 C DA  3  N6 ? ? C DT  15  D DA  3   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog34 hydrog ? ? B DG  16 N1 ? ? ? 1_555 C DC  2  N3 ? ? C DG  16  D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog35 hydrog ? ? B DG  16 N2 ? ? ? 1_555 C DC  2  O2 ? ? C DG  16  D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
hydrog36 hydrog ? ? B DG  16 O6 ? ? ? 1_555 C DC  2  N4 ? ? C DG  16  D DC  2   1_555 ? ? ? ? ? ? WATSON-CRICK ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3 ? 
AA2 ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 25 ? PRO A 26 ? LEU A 135 PRO A 136 
AA1 2 LEU A 78 ? ILE A 81 ? LEU A 188 ILE A 191 
AA1 3 PHE A 62 ? VAL A 65 ? PHE A 172 VAL A 175 
AA2 1 ARG D 24 ? PRO D 26 ? ARG B 134 PRO B 136 
AA2 2 LEU D 78 ? ILE D 81 ? LEU B 188 ILE B 191 
AA2 3 PHE D 62 ? LYS D 64 ? PHE B 172 LYS B 174 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LEU A 25 ? N LEU A 135 O TRP A 79 ? O TRP A 189 
AA1 2 3 O CYS A 80 ? O CYS A 190 N LYS A 63 ? N LYS A 173 
AA2 1 2 N LEU D 25 ? N LEU B 135 O TRP D 79 ? O TRP B 189 
AA2 2 3 O CYS D 80 ? O CYS B 190 N LYS D 63 ? N LYS B 173 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A MG 301 ? 5 'binding site for residue MG A 301' 
AC2 Software B MG 301 ? 5 'binding site for residue MG B 301' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 LEU A 56 ? LEU A 166 . ? 1_555 ? 
2  AC1 5 SER A 57 ? SER A 167 . ? 1_555 ? 
3  AC1 5 ASN A 59 ? ASN A 169 . ? 1_555 ? 
4  AC1 5 PHE A 62 ? PHE A 172 . ? 1_555 ? 
5  AC1 5 HOH G .  ? HOH A 404 . ? 1_555 ? 
6  AC2 5 LEU D 56 ? LEU B 166 . ? 1_555 ? 
7  AC2 5 SER D 57 ? SER B 167 . ? 1_555 ? 
8  AC2 5 ASN D 59 ? ASN B 169 . ? 1_555 ? 
9  AC2 5 PHE D 62 ? PHE B 172 . ? 1_555 ? 
10 AC2 5 HOH J .  ? HOH B 403 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6NCM 
_atom_sites.fract_transf_matrix[1][1]   0.023507 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013829 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.009744 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . CYS A 1 3   ? -104.671 87.649  129.222 1.00 95.25  ?  113 CYS A N     1 
ATOM   2    C  CA    . CYS A 1 3   ? -105.528 88.735  128.758 1.00 98.90  ?  113 CYS A CA    1 
ATOM   3    C  C     . CYS A 1 3   ? -106.958 88.537  129.250 1.00 103.32 ?  113 CYS A C     1 
ATOM   4    O  O     . CYS A 1 3   ? -107.183 87.949  130.307 1.00 100.98 ?  113 CYS A O     1 
ATOM   5    C  CB    . CYS A 1 3   ? -105.495 88.831  127.229 1.00 102.79 ?  113 CYS A CB    1 
ATOM   6    S  SG    . CYS A 1 3   ? -105.738 90.505  126.572 1.00 129.65 ?  113 CYS A SG    1 
ATOM   7    N  N     . LYS A 1 4   ? -107.925 89.026  128.479 1.00 101.13 ?  114 LYS A N     1 
ATOM   8    C  CA    . LYS A 1 4   ? -109.320 88.916  128.895 1.00 91.01  ?  114 LYS A CA    1 
ATOM   9    C  C     . LYS A 1 4   ? -109.913 87.575  128.457 1.00 88.24  ?  114 LYS A C     1 
ATOM   10   O  O     . LYS A 1 4   ? -109.611 87.094  127.361 1.00 93.13  ?  114 LYS A O     1 
ATOM   11   C  CB    . LYS A 1 4   ? -110.146 90.060  128.303 1.00 98.59  ?  114 LYS A CB    1 
ATOM   12   C  CG    . LYS A 1 4   ? -111.609 90.055  128.725 1.00 96.93  ?  114 LYS A CG    1 
ATOM   13   C  CD    . LYS A 1 4   ? -112.394 91.189  128.090 1.00 95.79  ?  114 LYS A CD    1 
ATOM   14   C  CE    . LYS A 1 4   ? -113.855 91.136  128.502 1.00 85.42  ?  114 LYS A CE    1 
ATOM   15   N  NZ    . LYS A 1 4   ? -114.638 92.236  127.882 1.00 86.48  ?  114 LYS A NZ    1 
ATOM   16   N  N     . PRO A 1 5   ? -110.742 86.961  129.299 1.00 83.65  ?  115 PRO A N     1 
ATOM   17   C  CA    . PRO A 1 5   ? -111.433 85.744  128.887 1.00 86.47  ?  115 PRO A CA    1 
ATOM   18   C  C     . PRO A 1 5   ? -112.273 85.990  127.648 1.00 86.82  ?  115 PRO A C     1 
ATOM   19   O  O     . PRO A 1 5   ? -112.694 87.131  127.375 1.00 87.83  ?  115 PRO A O     1 
ATOM   20   C  CB    . PRO A 1 5   ? -112.300 85.401  130.106 1.00 84.97  ?  115 PRO A CB    1 
ATOM   21   C  CG    . PRO A 1 5   ? -111.540 85.984  131.260 1.00 76.96  ?  115 PRO A CG    1 
ATOM   22   C  CD    . PRO A 1 5   ? -110.938 87.250  130.733 1.00 85.10  ?  115 PRO A CD    1 
ATOM   23   N  N     . PRO A 1 6   ? -112.561 84.939  126.874 1.00 86.75  ?  116 PRO A N     1 
ATOM   24   C  CA    . PRO A 1 6   ? -113.166 85.140  125.551 1.00 84.78  ?  116 PRO A CA    1 
ATOM   25   C  C     . PRO A 1 6   ? -114.655 85.449  125.575 1.00 80.84  ?  116 PRO A C     1 
ATOM   26   O  O     . PRO A 1 6   ? -115.310 85.390  124.531 1.00 81.57  ?  116 PRO A O     1 
ATOM   27   C  CB    . PRO A 1 6   ? -112.893 83.806  124.843 1.00 83.55  ?  116 PRO A CB    1 
ATOM   28   C  CG    . PRO A 1 6   ? -112.861 82.816  125.958 1.00 83.02  ?  116 PRO A CG    1 
ATOM   29   C  CD    . PRO A 1 6   ? -112.216 83.527  127.111 1.00 81.16  ?  116 PRO A CD    1 
ATOM   30   N  N     . TYR A 1 7   ? -115.204 85.785  126.736 1.00 78.47  ?  117 TYR A N     1 
ATOM   31   C  CA    . TYR A 1 7   ? -116.625 86.074  126.873 1.00 68.67  ?  117 TYR A CA    1 
ATOM   32   C  C     . TYR A 1 7   ? -116.825 87.565  127.100 1.00 64.96  ?  117 TYR A C     1 
ATOM   33   O  O     . TYR A 1 7   ? -116.124 88.174  127.916 1.00 77.53  ?  117 TYR A O     1 
ATOM   34   C  CB    . TYR A 1 7   ? -117.238 85.273  128.023 1.00 74.16  ?  117 TYR A CB    1 
ATOM   35   C  CG    . TYR A 1 7   ? -117.045 83.778  127.900 1.00 81.46  ?  117 TYR A CG    1 
ATOM   36   C  CD1   . TYR A 1 7   ? -117.941 82.998  127.178 1.00 81.91  ?  117 TYR A CD1   1 
ATOM   37   C  CD2   . TYR A 1 7   ? -115.971 83.146  128.510 1.00 77.93  ?  117 TYR A CD2   1 
ATOM   38   C  CE1   . TYR A 1 7   ? -117.770 81.629  127.068 1.00 74.89  ?  117 TYR A CE1   1 
ATOM   39   C  CE2   . TYR A 1 7   ? -115.792 81.779  128.405 1.00 79.41  ?  117 TYR A CE2   1 
ATOM   40   C  CZ    . TYR A 1 7   ? -116.694 81.025  127.685 1.00 78.29  ?  117 TYR A CZ    1 
ATOM   41   O  OH    . TYR A 1 7   ? -116.512 79.665  127.583 1.00 84.04  ?  117 TYR A OH    1 
ATOM   42   N  N     . SER A 1 8   ? -117.772 88.149  126.370 1.00 63.85  ?  118 SER A N     1 
ATOM   43   C  CA    . SER A 1 8   ? -118.080 89.559  126.531 1.00 60.20  ?  118 SER A CA    1 
ATOM   44   C  C     . SER A 1 8   ? -118.789 89.803  127.861 1.00 59.65  ?  118 SER A C     1 
ATOM   45   O  O     . SER A 1 8   ? -119.334 88.888  128.484 1.00 62.84  ?  118 SER A O     1 
ATOM   46   C  CB    . SER A 1 8   ? -118.950 90.055  125.376 1.00 60.09  ?  118 SER A CB    1 
ATOM   47   O  OG    . SER A 1 8   ? -120.222 89.430  125.389 1.00 62.11  ?  118 SER A OG    1 
ATOM   48   N  N     . PHE A 1 9   ? -118.776 91.067  128.293 1.00 61.35  ?  119 PHE A N     1 
ATOM   49   C  CA    . PHE A 1 9   ? -119.410 91.419  129.561 1.00 67.58  ?  119 PHE A CA    1 
ATOM   50   C  C     . PHE A 1 9   ? -120.907 91.138  129.529 1.00 63.08  ?  119 PHE A C     1 
ATOM   51   O  O     . PHE A 1 9   ? -121.492 90.740  130.543 1.00 57.42  ?  119 PHE A O     1 
ATOM   52   C  CB    . PHE A 1 9   ? -119.146 92.886  129.898 1.00 60.97  ?  119 PHE A CB    1 
ATOM   53   C  CG    . PHE A 1 9   ? -117.820 93.125  130.563 1.00 58.11  ?  119 PHE A CG    1 
ATOM   54   C  CD1   . PHE A 1 9   ? -117.586 92.670  131.850 1.00 63.75  ?  119 PHE A CD1   1 
ATOM   55   C  CD2   . PHE A 1 9   ? -116.813 93.812  129.908 1.00 61.33  ?  119 PHE A CD2   1 
ATOM   56   C  CE1   . PHE A 1 9   ? -116.368 92.889  132.468 1.00 68.93  ?  119 PHE A CE1   1 
ATOM   57   C  CE2   . PHE A 1 9   ? -115.593 94.035  130.522 1.00 61.23  ?  119 PHE A CE2   1 
ATOM   58   C  CZ    . PHE A 1 9   ? -115.372 93.573  131.803 1.00 60.71  ?  119 PHE A CZ    1 
ATOM   59   N  N     . SER A 1 10  ? -121.545 91.340  128.374 1.00 64.26  ?  120 SER A N     1 
ATOM   60   C  CA    . SER A 1 10  ? -122.963 91.018  128.252 1.00 63.79  ?  120 SER A CA    1 
ATOM   61   C  C     . SER A 1 10  ? -123.199 89.521  128.401 1.00 69.01  ?  120 SER A C     1 
ATOM   62   O  O     . SER A 1 10  ? -124.187 89.097  129.013 1.00 64.30  ?  120 SER A O     1 
ATOM   63   C  CB    . SER A 1 10  ? -123.502 91.517  126.911 1.00 63.48  ?  120 SER A CB    1 
ATOM   64   O  OG    . SER A 1 10  ? -123.337 92.918  126.784 1.00 70.45  ?  120 SER A OG    1 
ATOM   65   N  N     . CYS A 1 11  ? -122.299 88.703  127.851 1.00 68.86  ?  121 CYS A N     1 
ATOM   66   C  CA    . CYS A 1 11  ? -122.429 87.256  127.990 1.00 64.34  ?  121 CYS A CA    1 
ATOM   67   C  C     . CYS A 1 11  ? -122.144 86.811  129.419 1.00 64.40  ?  121 CYS A C     1 
ATOM   68   O  O     . CYS A 1 11  ? -122.798 85.895  129.932 1.00 66.04  ?  121 CYS A O     1 
ATOM   69   C  CB    . CYS A 1 11  ? -121.494 86.550  127.008 1.00 69.87  ?  121 CYS A CB    1 
ATOM   70   S  SG    . CYS A 1 11  ? -121.554 84.746  127.081 1.00 77.64  ?  121 CYS A SG    1 
ATOM   71   N  N     . LEU A 1 12  ? -121.170 87.447  130.077 1.00 61.87  ?  122 LEU A N     1 
ATOM   72   C  CA    . LEU A 1 12  ? -120.870 87.109  131.465 1.00 62.63  ?  122 LEU A CA    1 
ATOM   73   C  C     . LEU A 1 12  ? -122.048 87.427  132.377 1.00 68.08  ?  122 LEU A C     1 
ATOM   74   O  O     . LEU A 1 12  ? -122.364 86.654  133.290 1.00 68.45  ?  122 LEU A O     1 
ATOM   75   C  CB    . LEU A 1 12  ? -119.620 87.858  131.928 1.00 58.68  ?  122 LEU A CB    1 
ATOM   76   C  CG    . LEU A 1 12  ? -118.299 87.508  131.242 1.00 62.64  ?  122 LEU A CG    1 
ATOM   77   C  CD1   . LEU A 1 12  ? -117.208 88.483  131.657 1.00 59.25  ?  122 LEU A CD1   1 
ATOM   78   C  CD2   . LEU A 1 12  ? -117.893 86.079  131.563 1.00 63.47  ?  122 LEU A CD2   1 
ATOM   79   N  N     . ILE A 1 13  ? -122.708 88.563  132.148 1.00 64.34  ?  123 ILE A N     1 
ATOM   80   C  CA    . ILE A 1 13  ? -123.870 88.924  132.952 1.00 62.61  ?  123 ILE A CA    1 
ATOM   81   C  C     . ILE A 1 13  ? -125.032 87.982  132.665 1.00 62.99  ?  123 ILE A C     1 
ATOM   82   O  O     . ILE A 1 13  ? -125.761 87.575  133.579 1.00 62.16  ?  123 ILE A O     1 
ATOM   83   C  CB    . ILE A 1 13  ? -124.254 90.394  132.699 1.00 57.85  ?  123 ILE A CB    1 
ATOM   84   C  CG1   . ILE A 1 13  ? -123.153 91.327  133.208 1.00 58.40  ?  123 ILE A CG1   1 
ATOM   85   C  CG2   . ILE A 1 13  ? -125.583 90.721  133.354 1.00 57.49  ?  123 ILE A CG2   1 
ATOM   86   C  CD1   . ILE A 1 13  ? -123.393 92.786  132.891 1.00 57.65  ?  123 ILE A CD1   1 
ATOM   87   N  N     . PHE A 1 14  ? -125.217 87.610  131.397 1.00 65.77  ?  124 PHE A N     1 
ATOM   88   C  CA    . PHE A 1 14  ? -126.328 86.737  131.033 1.00 67.70  ?  124 PHE A CA    1 
ATOM   89   C  C     . PHE A 1 14  ? -126.171 85.349  131.642 1.00 74.45  ?  124 PHE A C     1 
ATOM   90   O  O     . PHE A 1 14  ? -127.144 84.771  132.140 1.00 75.03  ?  124 PHE A O     1 
ATOM   91   C  CB    . PHE A 1 14  ? -126.445 86.648  129.512 1.00 67.99  ?  124 PHE A CB    1 
ATOM   92   C  CG    . PHE A 1 14  ? -127.462 85.651  129.043 1.00 75.77  ?  124 PHE A CG    1 
ATOM   93   C  CD1   . PHE A 1 14  ? -128.813 85.939  129.113 1.00 83.53  ?  124 PHE A CD1   1 
ATOM   94   C  CD2   . PHE A 1 14  ? -127.067 84.427  128.530 1.00 78.06  ?  124 PHE A CD2   1 
ATOM   95   C  CE1   . PHE A 1 14  ? -129.753 85.024  128.684 1.00 83.12  ?  124 PHE A CE1   1 
ATOM   96   C  CE2   . PHE A 1 14  ? -128.002 83.508  128.098 1.00 75.91  ?  124 PHE A CE2   1 
ATOM   97   C  CZ    . PHE A 1 14  ? -129.347 83.808  128.178 1.00 76.82  ?  124 PHE A CZ    1 
ATOM   98   N  N     . MET A 1 15  ? -124.956 84.796  131.612 1.00 74.41  ?  125 MET A N     1 
ATOM   99   C  CA    . MET A 1 15  ? -124.736 83.472  132.184 1.00 70.10  ?  125 MET A CA    1 
ATOM   100  C  C     . MET A 1 15  ? -124.878 83.482  133.701 1.00 75.05  ?  125 MET A C     1 
ATOM   101  O  O     . MET A 1 15  ? -125.237 82.459  134.294 1.00 81.79  ?  125 MET A O     1 
ATOM   102  C  CB    . MET A 1 15  ? -123.357 82.947  131.784 1.00 69.02  ?  125 MET A CB    1 
ATOM   103  C  CG    . MET A 1 15  ? -123.195 82.691  130.294 1.00 75.28  ?  125 MET A CG    1 
ATOM   104  S  SD    . MET A 1 15  ? -121.572 82.026  129.876 1.00 79.75  ?  125 MET A SD    1 
ATOM   105  C  CE    . MET A 1 15  ? -120.506 83.358  130.420 1.00 72.63  ?  125 MET A CE    1 
ATOM   106  N  N     . ALA A 1 16  ? -124.606 84.620  134.343 1.00 69.52  ?  126 ALA A N     1 
ATOM   107  C  CA    . ALA A 1 16  ? -124.722 84.700  135.795 1.00 68.89  ?  126 ALA A CA    1 
ATOM   108  C  C     . ALA A 1 16  ? -126.177 84.778  136.240 1.00 71.42  ?  126 ALA A C     1 
ATOM   109  O  O     . ALA A 1 16  ? -126.557 84.152  137.236 1.00 79.96  ?  126 ALA A O     1 
ATOM   110  C  CB    . ALA A 1 16  ? -123.940 85.906  136.318 1.00 63.93  ?  126 ALA A CB    1 
ATOM   111  N  N     . ILE A 1 17  ? -127.003 85.536  135.514 1.00 64.90  ?  127 ILE A N     1 
ATOM   112  C  CA    . ILE A 1 17  ? -128.403 85.690  135.900 1.00 69.46  ?  127 ILE A CA    1 
ATOM   113  C  C     . ILE A 1 17  ? -129.176 84.405  135.636 1.00 74.27  ?  127 ILE A C     1 
ATOM   114  O  O     . ILE A 1 17  ? -129.954 83.948  136.482 1.00 81.77  ?  127 ILE A O     1 
ATOM   115  C  CB    . ILE A 1 17  ? -129.030 86.889  135.165 1.00 64.88  ?  127 ILE A CB    1 
ATOM   116  C  CG1   . ILE A 1 17  ? -128.332 88.189  135.569 1.00 65.51  ?  127 ILE A CG1   1 
ATOM   117  C  CG2   . ILE A 1 17  ? -130.519 86.971  135.454 1.00 64.64  ?  127 ILE A CG2   1 
ATOM   118  C  CD1   . ILE A 1 17  ? -128.868 89.413  134.861 1.00 67.20  ?  127 ILE A CD1   1 
ATOM   119  N  N     . GLU A 1 18  ? -128.974 83.800  134.463 1.00 72.45  ?  128 GLU A N     1 
ATOM   120  C  CA    . GLU A 1 18  ? -129.689 82.574  134.123 1.00 71.14  ?  128 GLU A CA    1 
ATOM   121  C  C     . GLU A 1 18  ? -129.314 81.418  135.042 1.00 78.33  ?  128 GLU A C     1 
ATOM   122  O  O     . GLU A 1 18  ? -130.120 80.502  135.240 1.00 88.52  ?  128 GLU A O     1 
ATOM   123  C  CB    . GLU A 1 18  ? -129.416 82.194  132.668 1.00 77.31  ?  128 GLU A CB    1 
ATOM   124  C  CG    . GLU A 1 18  ? -130.071 83.106  131.641 1.00 76.55  ?  128 GLU A CG    1 
ATOM   125  C  CD    . GLU A 1 18  ? -131.458 82.638  131.241 1.00 79.40  ?  128 GLU A CD    1 
ATOM   126  O  OE1   . GLU A 1 18  ? -132.413 83.438  131.335 1.00 78.77  ?  128 GLU A OE1   1 
ATOM   127  O  OE2   . GLU A 1 18  ? -131.592 81.466  130.830 1.00 82.34  -1 128 GLU A OE2   1 
ATOM   128  N  N     . ASP A 1 19  ? -128.106 81.433  135.604 1.00 76.77  ?  129 ASP A N     1 
ATOM   129  C  CA    . ASP A 1 19  ? -127.661 80.378  136.507 1.00 73.45  ?  129 ASP A CA    1 
ATOM   130  C  C     . ASP A 1 19  ? -128.233 80.521  137.913 1.00 76.57  ?  129 ASP A C     1 
ATOM   131  O  O     . ASP A 1 19  ? -128.001 79.643  138.752 1.00 86.85  ?  129 ASP A O     1 
ATOM   132  C  CB    . ASP A 1 19  ? -126.130 80.352  136.567 1.00 78.20  ?  129 ASP A CB    1 
ATOM   133  C  CG    . ASP A 1 19  ? -125.586 79.029  137.069 1.00 82.05  ?  129 ASP A CG    1 
ATOM   134  O  OD1   . ASP A 1 19  ? -125.773 78.009  136.374 1.00 93.53  ?  129 ASP A OD1   1 
ATOM   135  O  OD2   . ASP A 1 19  ? -124.969 79.012  138.154 1.00 85.05  -1 129 ASP A OD2   1 
ATOM   136  N  N     . SER A 1 20  ? -128.978 81.607  138.193 1.00 73.23  ?  130 SER A N     1 
ATOM   137  C  CA    . SER A 1 20  ? -129.606 81.817  139.487 1.00 81.70  ?  130 SER A CA    1 
ATOM   138  C  C     . SER A 1 20  ? -130.997 81.190  139.512 1.00 84.00  ?  130 SER A C     1 
ATOM   139  O  O     . SER A 1 20  ? -131.647 81.061  138.469 1.00 79.88  ?  130 SER A O     1 
ATOM   140  C  CB    . SER A 1 20  ? -129.711 83.309  139.793 1.00 76.43  ?  130 SER A CB    1 
ATOM   141  O  OG    . SER A 1 20  ? -130.592 83.955  138.891 1.00 73.66  ?  130 SER A OG    1 
ATOM   142  N  N     . PRO A 1 21  ? -131.482 80.785  140.691 1.00 85.40  ?  131 PRO A N     1 
ATOM   143  C  CA    . PRO A 1 21  ? -132.808 80.150  140.744 1.00 82.06  ?  131 PRO A CA    1 
ATOM   144  C  C     . PRO A 1 21  ? -133.952 81.110  140.469 1.00 84.25  ?  131 PRO A C     1 
ATOM   145  O  O     . PRO A 1 21  ? -134.978 80.686  139.924 1.00 95.42  ?  131 PRO A O     1 
ATOM   146  C  CB    . PRO A 1 21  ? -132.870 79.592  142.173 1.00 82.19  ?  131 PRO A CB    1 
ATOM   147  C  CG    . PRO A 1 21  ? -131.953 80.473  142.952 1.00 96.26  ?  131 PRO A CG    1 
ATOM   148  C  CD    . PRO A 1 21  ? -130.833 80.822  142.013 1.00 88.32  ?  131 PRO A CD    1 
ATOM   149  N  N     . THR A 1 22  ? -133.811 82.385  140.824 1.00 88.45  ?  132 THR A N     1 
ATOM   150  C  CA    . THR A 1 22  ? -134.876 83.364  140.659 1.00 89.95  ?  132 THR A CA    1 
ATOM   151  C  C     . THR A 1 22  ? -134.738 84.195  139.390 1.00 83.17  ?  132 THR A C     1 
ATOM   152  O  O     . THR A 1 22  ? -135.579 85.067  139.146 1.00 80.05  ?  132 THR A O     1 
ATOM   153  C  CB    . THR A 1 22  ? -134.930 84.296  141.874 1.00 84.43  ?  132 THR A CB    1 
ATOM   154  O  OG1   . THR A 1 22  ? -135.872 85.348  141.631 1.00 94.16  ?  132 THR A OG1   1 
ATOM   155  C  CG2   . THR A 1 22  ? -133.559 84.898  142.143 1.00 81.36  ?  132 THR A CG2   1 
ATOM   156  N  N     . LYS A 1 23  ? -133.706 83.947  138.581 1.00 86.98  ?  133 LYS A N     1 
ATOM   157  C  CA    . LYS A 1 23  ? -133.433 84.696  137.353 1.00 82.77  ?  133 LYS A CA    1 
ATOM   158  C  C     . LYS A 1 23  ? -133.283 86.194  137.611 1.00 80.98  ?  133 LYS A C     1 
ATOM   159  O  O     . LYS A 1 23  ? -133.507 87.009  136.710 1.00 76.57  ?  133 LYS A O     1 
ATOM   160  C  CB    . LYS A 1 23  ? -134.514 84.446  136.292 1.00 78.46  ?  133 LYS A CB    1 
ATOM   161  C  CG    . LYS A 1 23  ? -135.005 83.004  136.218 1.00 86.89  ?  133 LYS A CG    1 
ATOM   162  C  CD    . LYS A 1 23  ? -133.920 82.044  135.755 1.00 82.37  ?  133 LYS A CD    1 
ATOM   163  C  CE    . LYS A 1 23  ? -133.791 82.037  134.241 1.00 90.73  ?  133 LYS A CE    1 
ATOM   164  N  NZ    . LYS A 1 23  ? -132.905 80.936  133.767 1.00 87.92  ?  133 LYS A NZ    1 
ATOM   165  N  N     . ARG A 1 24  ? -132.915 86.568  138.836 1.00 80.12  ?  134 ARG A N     1 
ATOM   166  C  CA    . ARG A 1 24  ? -132.717 87.955  139.229 1.00 74.87  ?  134 ARG A CA    1 
ATOM   167  C  C     . ARG A 1 24  ? -131.553 88.017  140.205 1.00 79.72  ?  134 ARG A C     1 
ATOM   168  O  O     . ARG A 1 24  ? -131.435 87.165  141.090 1.00 83.60  ?  134 ARG A O     1 
ATOM   169  C  CB    . ARG A 1 24  ? -133.977 88.547  139.879 1.00 79.12  ?  134 ARG A CB    1 
ATOM   170  C  CG    . ARG A 1 24  ? -135.178 88.659  138.952 1.00 88.64  ?  134 ARG A CG    1 
ATOM   171  C  CD    . ARG A 1 24  ? -136.453 88.187  139.638 1.00 88.23  ?  134 ARG A CD    1 
ATOM   172  N  NE    . ARG A 1 24  ? -136.777 88.984  140.818 1.00 94.76  ?  134 ARG A NE    1 
ATOM   173  C  CZ    . ARG A 1 24  ? -137.653 89.984  140.827 1.00 96.01  ?  134 ARG A CZ    1 
ATOM   174  N  NH1   . ARG A 1 24  ? -137.886 90.654  141.947 1.00 94.77  ?  134 ARG A NH1   1 
ATOM   175  N  NH2   . ARG A 1 24  ? -138.297 90.312  139.716 1.00 88.55  ?  134 ARG A NH2   1 
ATOM   176  N  N     . LEU A 1 25  ? -130.696 89.023  140.046 1.00 71.36  ?  135 LEU A N     1 
ATOM   177  C  CA    . LEU A 1 25  ? -129.498 89.125  140.865 1.00 73.33  ?  135 LEU A CA    1 
ATOM   178  C  C     . LEU A 1 25  ? -129.175 90.586  141.128 1.00 71.92  ?  135 LEU A C     1 
ATOM   179  O  O     . LEU A 1 25  ? -129.435 91.442  140.274 1.00 72.31  ?  135 LEU A O     1 
ATOM   180  C  CB    . LEU A 1 25  ? -128.295 88.447  140.192 1.00 70.54  ?  135 LEU A CB    1 
ATOM   181  C  CG    . LEU A 1 25  ? -128.228 86.920  140.211 1.00 72.69  ?  135 LEU A CG    1 
ATOM   182  C  CD1   . LEU A 1 25  ? -126.966 86.440  139.514 1.00 71.02  ?  135 LEU A CD1   1 
ATOM   183  C  CD2   . LEU A 1 25  ? -128.283 86.403  141.639 1.00 75.36  ?  135 LEU A CD2   1 
ATOM   184  N  N     . PRO A 1 26  ? -128.617 90.903  142.291 1.00 70.59  ?  136 PRO A N     1 
ATOM   185  C  CA    . PRO A 1 26  ? -128.009 92.219  142.494 1.00 67.41  ?  136 PRO A CA    1 
ATOM   186  C  C     . PRO A 1 26  ? -126.616 92.253  141.878 1.00 68.12  ?  136 PRO A C     1 
ATOM   187  O  O     . PRO A 1 26  ? -126.048 91.228  141.499 1.00 65.85  ?  136 PRO A O     1 
ATOM   188  C  CB    . PRO A 1 26  ? -127.949 92.366  144.022 1.00 74.32  ?  136 PRO A CB    1 
ATOM   189  C  CG    . PRO A 1 26  ? -128.514 91.072  144.593 1.00 79.16  ?  136 PRO A CG    1 
ATOM   190  C  CD    . PRO A 1 26  ? -128.513 90.063  143.493 1.00 71.68  ?  136 PRO A CD    1 
ATOM   191  N  N     . VAL A 1 27  ? -126.067 93.465  141.785 1.00 69.64  ?  137 VAL A N     1 
ATOM   192  C  CA    . VAL A 1 27  ? -124.792 93.632  141.094 1.00 65.92  ?  137 VAL A CA    1 
ATOM   193  C  C     . VAL A 1 27  ? -123.656 92.972  141.868 1.00 65.33  ?  137 VAL A C     1 
ATOM   194  O  O     . VAL A 1 27  ? -122.665 92.531  141.271 1.00 68.93  ?  137 VAL A O     1 
ATOM   195  C  CB    . VAL A 1 27  ? -124.515 95.126  140.834 1.00 59.33  ?  137 VAL A CB    1 
ATOM   196  C  CG1   . VAL A 1 27  ? -124.233 95.864  142.137 1.00 58.31  ?  137 VAL A CG1   1 
ATOM   197  C  CG2   . VAL A 1 27  ? -123.367 95.290  139.851 1.00 52.53  ?  137 VAL A CG2   1 
ATOM   198  N  N     . LYS A 1 28  ? -123.776 92.873  143.194 1.00 69.20  ?  138 LYS A N     1 
ATOM   199  C  CA    . LYS A 1 28  ? -122.719 92.239  143.977 1.00 72.40  ?  138 LYS A CA    1 
ATOM   200  C  C     . LYS A 1 28  ? -122.683 90.735  143.738 1.00 73.33  ?  138 LYS A C     1 
ATOM   201  O  O     . LYS A 1 28  ? -121.603 90.135  143.683 1.00 72.98  ?  138 LYS A O     1 
ATOM   202  C  CB    . LYS A 1 28  ? -122.905 92.547  145.463 1.00 67.81  ?  138 LYS A CB    1 
ATOM   203  C  CG    . LYS A 1 28  ? -121.823 91.960  146.358 1.00 72.42  ?  138 LYS A CG    1 
ATOM   204  C  CD    . LYS A 1 28  ? -120.436 92.437  145.946 1.00 76.36  ?  138 LYS A CD    1 
ATOM   205  C  CE    . LYS A 1 28  ? -120.270 93.934  146.163 1.00 73.22  ?  138 LYS A CE    1 
ATOM   206  N  NZ    . LYS A 1 28  ? -118.919 94.409  145.751 1.00 64.38  ?  138 LYS A NZ    1 
ATOM   207  N  N     . ASP A 1 29  ? -123.853 90.108  143.590 1.00 70.36  ?  139 ASP A N     1 
ATOM   208  C  CA    . ASP A 1 29  ? -123.890 88.681  143.290 1.00 65.60  ?  139 ASP A CA    1 
ATOM   209  C  C     . ASP A 1 29  ? -123.377 88.389  141.886 1.00 72.92  ?  139 ASP A C     1 
ATOM   210  O  O     . ASP A 1 29  ? -122.816 87.313  141.646 1.00 81.85  ?  139 ASP A O     1 
ATOM   211  C  CB    . ASP A 1 29  ? -125.310 88.141  143.460 1.00 69.72  ?  139 ASP A CB    1 
ATOM   212  C  CG    . ASP A 1 29  ? -125.728 88.053  144.914 1.00 72.16  ?  139 ASP A CG    1 
ATOM   213  O  OD1   . ASP A 1 29  ? -124.874 88.282  145.795 1.00 72.47  ?  139 ASP A OD1   1 
ATOM   214  O  OD2   . ASP A 1 29  ? -126.912 87.753  145.175 1.00 74.54  -1 139 ASP A OD2   1 
ATOM   215  N  N     . ILE A 1 30  ? -123.561 89.323  140.950 1.00 72.85  ?  140 ILE A N     1 
ATOM   216  C  CA    . ILE A 1 30  ? -123.000 89.151  139.613 1.00 66.96  ?  140 ILE A CA    1 
ATOM   217  C  C     . ILE A 1 30  ? -121.479 89.133  139.681 1.00 68.90  ?  140 ILE A C     1 
ATOM   218  O  O     . ILE A 1 30  ? -120.818 88.386  138.949 1.00 73.03  ?  140 ILE A O     1 
ATOM   219  C  CB    . ILE A 1 30  ? -123.519 90.251  138.668 1.00 64.66  ?  140 ILE A CB    1 
ATOM   220  C  CG1   . ILE A 1 30  ? -125.042 90.170  138.545 1.00 71.31  ?  140 ILE A CG1   1 
ATOM   221  C  CG2   . ILE A 1 30  ? -122.872 90.134  137.295 1.00 57.67  ?  140 ILE A CG2   1 
ATOM   222  C  CD1   . ILE A 1 30  ? -125.634 91.175  137.582 1.00 65.62  ?  140 ILE A CD1   1 
ATOM   223  N  N     . TYR A 1 31  ? -120.900 89.947  140.568 1.00 69.56  ?  141 TYR A N     1 
ATOM   224  C  CA    . TYR A 1 31  ? -119.461 89.886  140.796 1.00 69.07  ?  141 TYR A CA    1 
ATOM   225  C  C     . TYR A 1 31  ? -119.044 88.506  141.290 1.00 74.59  ?  141 TYR A C     1 
ATOM   226  O  O     . TYR A 1 31  ? -118.046 87.946  140.823 1.00 72.49  ?  141 TYR A O     1 
ATOM   227  C  CB    . TYR A 1 31  ? -119.037 90.950  141.809 1.00 66.60  ?  141 TYR A CB    1 
ATOM   228  C  CG    . TYR A 1 31  ? -119.370 92.372  141.423 1.00 67.48  ?  141 TYR A CG    1 
ATOM   229  C  CD1   . TYR A 1 31  ? -119.434 92.760  140.091 1.00 66.02  ?  141 TYR A CD1   1 
ATOM   230  C  CD2   . TYR A 1 31  ? -119.614 93.331  142.398 1.00 62.21  ?  141 TYR A CD2   1 
ATOM   231  C  CE1   . TYR A 1 31  ? -119.736 94.062  139.743 1.00 60.27  ?  141 TYR A CE1   1 
ATOM   232  C  CE2   . TYR A 1 31  ? -119.916 94.632  142.059 1.00 60.07  ?  141 TYR A CE2   1 
ATOM   233  C  CZ    . TYR A 1 31  ? -119.975 94.992  140.732 1.00 62.17  ?  141 TYR A CZ    1 
ATOM   234  O  OH    . TYR A 1 31  ? -120.275 96.290  140.396 1.00 61.49  ?  141 TYR A OH    1 
ATOM   235  N  N     . ASN A 1 32  ? -119.806 87.940  142.229 1.00 74.19  ?  142 ASN A N     1 
ATOM   236  C  CA    . ASN A 1 32  ? -119.413 86.678  142.846 1.00 75.07  ?  142 ASN A CA    1 
ATOM   237  C  C     . ASN A 1 32  ? -119.525 85.509  141.875 1.00 82.44  ?  142 ASN A C     1 
ATOM   238  O  O     . ASN A 1 32  ? -118.718 84.575  141.941 1.00 87.19  ?  142 ASN A O     1 
ATOM   239  C  CB    . ASN A 1 32  ? -120.258 86.418  144.093 1.00 71.90  ?  142 ASN A CB    1 
ATOM   240  C  CG    . ASN A 1 32  ? -120.189 87.558  145.092 1.00 84.81  ?  142 ASN A CG    1 
ATOM   241  O  OD1   . ASN A 1 32  ? -121.158 87.841  145.797 1.00 78.24  ?  142 ASN A OD1   1 
ATOM   242  N  ND2   . ASN A 1 32  ? -119.042 88.226  145.150 1.00 89.21  ?  142 ASN A ND2   1 
ATOM   243  N  N     . TRP A 1 33  ? -120.509 85.536  140.972 1.00 77.04  ?  143 TRP A N     1 
ATOM   244  C  CA    . TRP A 1 33  ? -120.623 84.463  139.989 1.00 77.50  ?  143 TRP A CA    1 
ATOM   245  C  C     . TRP A 1 33  ? -119.468 84.502  138.997 1.00 79.97  ?  143 TRP A C     1 
ATOM   246  O  O     . TRP A 1 33  ? -118.916 83.456  138.638 1.00 83.54  ?  143 TRP A O     1 
ATOM   247  C  CB    . TRP A 1 33  ? -121.960 84.556  139.253 1.00 72.23  ?  143 TRP A CB    1 
ATOM   248  C  CG    . TRP A 1 33  ? -122.233 83.383  138.351 1.00 72.14  ?  143 TRP A CG    1 
ATOM   249  C  CD1   . TRP A 1 33  ? -122.987 82.284  138.645 1.00 80.29  ?  143 TRP A CD1   1 
ATOM   250  C  CD2   . TRP A 1 33  ? -121.751 83.191  137.013 1.00 77.80  ?  143 TRP A CD2   1 
ATOM   251  N  NE1   . TRP A 1 33  ? -123.007 81.422  137.574 1.00 82.04  ?  143 TRP A NE1   1 
ATOM   252  C  CE2   . TRP A 1 33  ? -122.255 81.956  136.561 1.00 75.78  ?  143 TRP A CE2   1 
ATOM   253  C  CE3   . TRP A 1 33  ? -120.944 83.945  136.155 1.00 79.05  ?  143 TRP A CE3   1 
ATOM   254  C  CZ2   . TRP A 1 33  ? -121.979 81.457  135.289 1.00 74.06  ?  143 TRP A CZ2   1 
ATOM   255  C  CZ3   . TRP A 1 33  ? -120.670 83.448  134.894 1.00 73.98  ?  143 TRP A CZ3   1 
ATOM   256  C  CH2   . TRP A 1 33  ? -121.185 82.216  134.473 1.00 73.15  ?  143 TRP A CH2   1 
ATOM   257  N  N     . ILE A 1 34  ? -119.093 85.699  138.542 1.00 78.06  ?  144 ILE A N     1 
ATOM   258  C  CA    . ILE A 1 34  ? -118.023 85.822  137.558 1.00 78.79  ?  144 ILE A CA    1 
ATOM   259  C  C     . ILE A 1 34  ? -116.679 85.459  138.179 1.00 79.29  ?  144 ILE A C     1 
ATOM   260  O  O     . ILE A 1 34  ? -115.823 84.849  137.527 1.00 79.01  ?  144 ILE A O     1 
ATOM   261  C  CB    . ILE A 1 34  ? -118.014 87.242  136.962 1.00 74.58  ?  144 ILE A CB    1 
ATOM   262  C  CG1   . ILE A 1 34  ? -119.336 87.526  136.245 1.00 74.82  ?  144 ILE A CG1   1 
ATOM   263  C  CG2   . ILE A 1 34  ? -116.848 87.421  136.005 1.00 70.47  ?  144 ILE A CG2   1 
ATOM   264  C  CD1   . ILE A 1 34  ? -119.443 88.931  135.694 1.00 61.99  ?  144 ILE A CD1   1 
ATOM   265  N  N     . LEU A 1 35  ? -116.474 85.817  139.449 1.00 76.13  ?  145 LEU A N     1 
ATOM   266  C  CA    . LEU A 1 35  ? -115.205 85.518  140.106 1.00 78.80  ?  145 LEU A CA    1 
ATOM   267  C  C     . LEU A 1 35  ? -115.010 84.018  140.288 1.00 76.68  ?  145 LEU A C     1 
ATOM   268  O  O     . LEU A 1 35  ? -113.907 83.501  140.078 1.00 77.98  ?  145 LEU A O     1 
ATOM   269  C  CB    . LEU A 1 35  ? -115.130 86.233  141.456 1.00 79.07  ?  145 LEU A CB    1 
ATOM   270  C  CG    . LEU A 1 35  ? -114.882 87.742  141.428 1.00 71.24  ?  145 LEU A CG    1 
ATOM   271  C  CD1   . LEU A 1 35  ? -114.947 88.321  142.833 1.00 66.98  ?  145 LEU A CD1   1 
ATOM   272  C  CD2   . LEU A 1 35  ? -113.541 88.045  140.785 1.00 75.13  ?  145 LEU A CD2   1 
ATOM   273  N  N     . GLU A 1 36  ? -116.067 83.303  140.676 1.00 81.25  ?  146 GLU A N     1 
ATOM   274  C  CA    . GLU A 1 36  ? -115.939 81.874  140.940 1.00 90.39  ?  146 GLU A CA    1 
ATOM   275  C  C     . GLU A 1 36  ? -115.897 81.051  139.659 1.00 86.83  ?  146 GLU A C     1 
ATOM   276  O  O     . GLU A 1 36  ? -115.276 79.982  139.637 1.00 89.09  ?  146 GLU A O     1 
ATOM   277  C  CB    . GLU A 1 36  ? -117.084 81.405  141.838 1.00 85.40  ?  146 GLU A CB    1 
ATOM   278  C  CG    . GLU A 1 36  ? -117.080 82.055  143.214 1.00 93.30  ?  146 GLU A CG    1 
ATOM   279  C  CD    . GLU A 1 36  ? -118.292 81.682  144.044 1.00 111.17 ?  146 GLU A CD    1 
ATOM   280  O  OE1   . GLU A 1 36  ? -118.434 82.220  145.162 1.00 110.74 ?  146 GLU A OE1   1 
ATOM   281  O  OE2   . GLU A 1 36  ? -119.102 80.854  143.578 1.00 114.37 ?  146 GLU A OE2   1 
ATOM   282  N  N     . HIS A 1 37  ? -116.541 81.521  138.590 1.00 78.40  ?  147 HIS A N     1 
ATOM   283  C  CA    . HIS A 1 37  ? -116.488 80.827  137.311 1.00 72.02  ?  147 HIS A CA    1 
ATOM   284  C  C     . HIS A 1 37  ? -115.320 81.269  136.441 1.00 78.79  ?  147 HIS A C     1 
ATOM   285  O  O     . HIS A 1 37  ? -114.961 80.552  135.500 1.00 84.38  ?  147 HIS A O     1 
ATOM   286  C  CB    . HIS A 1 37  ? -117.798 81.026  136.540 1.00 74.38  ?  147 HIS A CB    1 
ATOM   287  C  CG    . HIS A 1 37  ? -118.918 80.156  137.018 1.00 80.94  ?  147 HIS A CG    1 
ATOM   288  N  ND1   . HIS A 1 37  ? -119.625 80.417  138.172 1.00 76.35  ?  147 HIS A ND1   1 
ATOM   289  C  CD2   . HIS A 1 37  ? -119.452 79.025  136.498 1.00 81.43  ?  147 HIS A CD2   1 
ATOM   290  C  CE1   . HIS A 1 37  ? -120.547 79.486  138.341 1.00 75.75  ?  147 HIS A CE1   1 
ATOM   291  N  NE2   . HIS A 1 37  ? -120.463 78.629  137.339 1.00 79.75  ?  147 HIS A NE2   1 
ATOM   292  N  N     . PHE A 1 38  ? -114.721 82.423  136.729 1.00 85.55  ?  148 PHE A N     1 
ATOM   293  C  CA    . PHE A 1 38  ? -113.577 82.927  135.970 1.00 83.80  ?  148 PHE A CA    1 
ATOM   294  C  C     . PHE A 1 38  ? -112.582 83.542  136.946 1.00 86.93  ?  148 PHE A C     1 
ATOM   295  O  O     . PHE A 1 38  ? -112.739 84.704  137.357 1.00 80.35  ?  148 PHE A O     1 
ATOM   296  C  CB    . PHE A 1 38  ? -114.012 83.938  134.912 1.00 73.90  ?  148 PHE A CB    1 
ATOM   297  C  CG    . PHE A 1 38  ? -114.916 83.359  133.862 1.00 67.68  ?  148 PHE A CG    1 
ATOM   298  C  CD1   . PHE A 1 38  ? -114.388 82.749  132.737 1.00 74.43  ?  148 PHE A CD1   1 
ATOM   299  C  CD2   . PHE A 1 38  ? -116.293 83.418  134.002 1.00 74.50  ?  148 PHE A CD2   1 
ATOM   300  C  CE1   . PHE A 1 38  ? -115.215 82.211  131.770 1.00 80.96  ?  148 PHE A CE1   1 
ATOM   301  C  CE2   . PHE A 1 38  ? -117.126 82.882  133.038 1.00 67.42  ?  148 PHE A CE2   1 
ATOM   302  C  CZ    . PHE A 1 38  ? -116.587 82.278  131.920 1.00 77.24  ?  148 PHE A CZ    1 
ATOM   303  N  N     . PRO A 1 39  ? -111.544 82.797  137.340 1.00 94.96  ?  149 PRO A N     1 
ATOM   304  C  CA    . PRO A 1 39  ? -110.610 83.302  138.360 1.00 85.72  ?  149 PRO A CA    1 
ATOM   305  C  C     . PRO A 1 39  ? -109.722 84.441  137.886 1.00 86.10  ?  149 PRO A C     1 
ATOM   306  O  O     . PRO A 1 39  ? -108.984 85.000  138.708 1.00 91.85  ?  149 PRO A O     1 
ATOM   307  C  CB    . PRO A 1 39  ? -109.769 82.065  138.713 1.00 83.58  ?  149 PRO A CB    1 
ATOM   308  C  CG    . PRO A 1 39  ? -110.539 80.890  138.174 1.00 86.98  ?  149 PRO A CG    1 
ATOM   309  C  CD    . PRO A 1 39  ? -111.254 81.403  136.968 1.00 87.80  ?  149 PRO A CD    1 
ATOM   310  N  N     . TYR A 1 40  ? -109.759 84.801  136.600 1.00 83.58  ?  150 TYR A N     1 
ATOM   311  C  CA    . TYR A 1 40  ? -108.902 85.876  136.109 1.00 82.14  ?  150 TYR A CA    1 
ATOM   312  C  C     . TYR A 1 40  ? -109.238 87.211  136.760 1.00 85.37  ?  150 TYR A C     1 
ATOM   313  O  O     . TYR A 1 40  ? -108.341 88.027  136.999 1.00 83.23  ?  150 TYR A O     1 
ATOM   314  C  CB    . TYR A 1 40  ? -109.016 85.986  134.588 1.00 78.01  ?  150 TYR A CB    1 
ATOM   315  C  CG    . TYR A 1 40  ? -108.485 87.287  134.025 1.00 79.81  ?  150 TYR A CG    1 
ATOM   316  C  CD1   . TYR A 1 40  ? -109.348 88.314  133.663 1.00 81.68  ?  150 TYR A CD1   1 
ATOM   317  C  CD2   . TYR A 1 40  ? -107.121 87.492  133.861 1.00 87.28  ?  150 TYR A CD2   1 
ATOM   318  C  CE1   . TYR A 1 40  ? -108.870 89.504  133.149 1.00 78.32  ?  150 TYR A CE1   1 
ATOM   319  C  CE2   . TYR A 1 40  ? -106.633 88.681  133.349 1.00 90.27  ?  150 TYR A CE2   1 
ATOM   320  C  CZ    . TYR A 1 40  ? -107.512 89.683  132.994 1.00 81.70  ?  150 TYR A CZ    1 
ATOM   321  O  OH    . TYR A 1 40  ? -107.033 90.867  132.484 1.00 83.53  ?  150 TYR A OH    1 
ATOM   322  N  N     . PHE A 1 41  ? -110.515 87.451  137.056 1.00 88.50  ?  151 PHE A N     1 
ATOM   323  C  CA    . PHE A 1 41  ? -110.941 88.731  137.605 1.00 86.96  ?  151 PHE A CA    1 
ATOM   324  C  C     . PHE A 1 41  ? -110.607 88.894  139.082 1.00 89.44  ?  151 PHE A C     1 
ATOM   325  O  O     . PHE A 1 41  ? -110.829 89.978  139.631 1.00 87.92  ?  151 PHE A O     1 
ATOM   326  C  CB    . PHE A 1 41  ? -112.445 88.916  137.393 1.00 86.41  ?  151 PHE A CB    1 
ATOM   327  C  CG    . PHE A 1 41  ? -112.861 88.877  135.950 1.00 81.11  ?  151 PHE A CG    1 
ATOM   328  C  CD1   . PHE A 1 41  ? -112.750 90.004  135.154 1.00 69.04  ?  151 PHE A CD1   1 
ATOM   329  C  CD2   . PHE A 1 41  ? -113.359 87.713  135.391 1.00 81.49  ?  151 PHE A CD2   1 
ATOM   330  C  CE1   . PHE A 1 41  ? -113.130 89.971  133.826 1.00 68.24  ?  151 PHE A CE1   1 
ATOM   331  C  CE2   . PHE A 1 41  ? -113.742 87.674  134.063 1.00 77.17  ?  151 PHE A CE2   1 
ATOM   332  C  CZ    . PHE A 1 41  ? -113.627 88.805  133.280 1.00 74.67  ?  151 PHE A CZ    1 
ATOM   333  N  N     . ALA A 1 42  ? -110.085 87.854  139.737 1.00 88.47  ?  152 ALA A N     1 
ATOM   334  C  CA    . ALA A 1 42  ? -109.720 87.980  141.143 1.00 90.26  ?  152 ALA A CA    1 
ATOM   335  C  C     . ALA A 1 42  ? -108.523 88.903  141.333 1.00 91.65  ?  152 ALA A C     1 
ATOM   336  O  O     . ALA A 1 42  ? -108.443 89.611  142.344 1.00 90.90  ?  152 ALA A O     1 
ATOM   337  C  CB    . ALA A 1 42  ? -109.429 86.603  141.738 1.00 91.60  ?  152 ALA A CB    1 
ATOM   338  N  N     . ASN A 1 43  ? -107.590 88.913  140.379 1.00 93.91  ?  153 ASN A N     1 
ATOM   339  C  CA    . ASN A 1 43  ? -106.419 89.781  140.433 1.00 94.09  ?  153 ASN A CA    1 
ATOM   340  C  C     . ASN A 1 43  ? -106.354 90.727  139.238 1.00 95.15  ?  153 ASN A C     1 
ATOM   341  O  O     . ASN A 1 43  ? -105.290 91.285  138.950 1.00 99.36  ?  153 ASN A O     1 
ATOM   342  C  CB    . ASN A 1 43  ? -105.138 88.948  140.522 1.00 99.61  ?  153 ASN A CB    1 
ATOM   343  C  CG    . ASN A 1 43  ? -104.994 88.243  141.856 1.00 109.47 ?  153 ASN A CG    1 
ATOM   344  O  OD1   . ASN A 1 43  ? -105.534 87.156  142.060 1.00 113.62 ?  153 ASN A OD1   1 
ATOM   345  N  ND2   . ASN A 1 43  ? -104.258 88.860  142.774 1.00 109.54 ?  153 ASN A ND2   1 
ATOM   346  N  N     . ALA A 1 44  ? -107.467 90.916  138.539 1.00 94.29  ?  154 ALA A N     1 
ATOM   347  C  CA    . ALA A 1 44  ? -107.518 91.819  137.403 1.00 91.79  ?  154 ALA A CA    1 
ATOM   348  C  C     . ALA A 1 44  ? -107.619 93.265  137.877 1.00 95.49  ?  154 ALA A C     1 
ATOM   349  O  O     . ALA A 1 44  ? -107.955 93.525  139.035 1.00 96.05  ?  154 ALA A O     1 
ATOM   350  C  CB    . ALA A 1 44  ? -108.707 91.468  136.513 1.00 92.80  ?  154 ALA A CB    1 
ATOM   351  N  N     . PRO A 1 45  ? -107.306 94.229  137.006 1.00 91.04  ?  155 PRO A N     1 
ATOM   352  C  CA    . PRO A 1 45  ? -107.522 95.636  137.363 1.00 86.73  ?  155 PRO A CA    1 
ATOM   353  C  C     . PRO A 1 45  ? -108.966 95.887  137.775 1.00 94.47  ?  155 PRO A C     1 
ATOM   354  O  O     . PRO A 1 45  ? -109.903 95.331  137.198 1.00 89.31  ?  155 PRO A O     1 
ATOM   355  C  CB    . PRO A 1 45  ? -107.161 96.385  136.076 1.00 87.13  ?  155 PRO A CB    1 
ATOM   356  C  CG    . PRO A 1 45  ? -106.156 95.506  135.421 1.00 99.79  ?  155 PRO A CG    1 
ATOM   357  C  CD    . PRO A 1 45  ? -106.575 94.092  135.733 1.00 91.21  ?  155 PRO A CD    1 
ATOM   358  N  N     . THR A 1 46  ? -109.136 96.743  138.786 1.00 94.16  ?  156 THR A N     1 
ATOM   359  C  CA    . THR A 1 46  ? -110.431 96.928  139.433 1.00 92.87  ?  156 THR A CA    1 
ATOM   360  C  C     . THR A 1 46  ? -111.492 97.518  138.511 1.00 82.49  ?  156 THR A C     1 
ATOM   361  O  O     . THR A 1 46  ? -112.667 97.550  138.895 1.00 77.83  ?  156 THR A O     1 
ATOM   362  C  CB    . THR A 1 46  ? -110.276 97.828  140.661 1.00 94.23  ?  156 THR A CB    1 
ATOM   363  O  OG1   . THR A 1 46  ? -110.055 99.180  140.239 1.00 103.60 ?  156 THR A OG1   1 
ATOM   364  C  CG2   . THR A 1 46  ? -109.097 97.371  141.506 1.00 91.01  ?  156 THR A CG2   1 
ATOM   365  N  N     . GLY A 1 47  ? -111.119 97.978  137.318 1.00 71.65  ?  157 GLY A N     1 
ATOM   366  C  CA    . GLY A 1 47  ? -112.083 98.591  136.422 1.00 69.91  ?  157 GLY A CA    1 
ATOM   367  C  C     . GLY A 1 47  ? -113.106 97.638  135.835 1.00 63.96  ?  157 GLY A C     1 
ATOM   368  O  O     . GLY A 1 47  ? -114.062 98.105  135.206 1.00 61.39  ?  157 GLY A O     1 
ATOM   369  N  N     . TRP A 1 48  ? -112.937 96.327  136.027 1.00 64.34  ?  158 TRP A N     1 
ATOM   370  C  CA    . TRP A 1 48  ? -113.865 95.375  135.422 1.00 55.43  ?  158 TRP A CA    1 
ATOM   371  C  C     . TRP A 1 48  ? -115.246 95.447  136.062 1.00 63.67  ?  158 TRP A C     1 
ATOM   372  O  O     . TRP A 1 48  ? -116.254 95.257  135.372 1.00 63.13  ?  158 TRP A O     1 
ATOM   373  C  CB    . TRP A 1 48  ? -113.305 93.954  135.510 1.00 61.32  ?  158 TRP A CB    1 
ATOM   374  C  CG    . TRP A 1 48  ? -113.245 93.387  136.896 1.00 61.83  ?  158 TRP A CG    1 
ATOM   375  C  CD1   . TRP A 1 48  ? -112.220 93.510  137.787 1.00 71.23  ?  158 TRP A CD1   1 
ATOM   376  C  CD2   . TRP A 1 48  ? -114.247 92.594  137.545 1.00 64.72  ?  158 TRP A CD2   1 
ATOM   377  N  NE1   . TRP A 1 48  ? -112.523 92.849  138.952 1.00 80.14  ?  158 TRP A NE1   1 
ATOM   378  C  CE2   . TRP A 1 48  ? -113.762 92.278  138.830 1.00 69.57  ?  158 TRP A CE2   1 
ATOM   379  C  CE3   . TRP A 1 48  ? -115.508 92.124  137.166 1.00 68.44  ?  158 TRP A CE3   1 
ATOM   380  C  CZ2   . TRP A 1 48  ? -114.493 91.514  139.737 1.00 75.12  ?  158 TRP A CZ2   1 
ATOM   381  C  CZ3   . TRP A 1 48  ? -116.233 91.365  138.069 1.00 71.62  ?  158 TRP A CZ3   1 
ATOM   382  C  CH2   . TRP A 1 48  ? -115.723 91.068  139.340 1.00 76.41  ?  158 TRP A CH2   1 
ATOM   383  N  N     . LYS A 1 49  ? -115.317 95.719  137.368 1.00 68.45  ?  159 LYS A N     1 
ATOM   384  C  CA    . LYS A 1 49  ? -116.617 95.901  138.005 1.00 60.04  ?  159 LYS A CA    1 
ATOM   385  C  C     . LYS A 1 49  ? -117.337 97.123  137.452 1.00 60.25  ?  159 LYS A C     1 
ATOM   386  O  O     . LYS A 1 49  ? -118.570 97.127  137.356 1.00 60.23  ?  159 LYS A O     1 
ATOM   387  C  CB    . LYS A 1 49  ? -116.453 96.020  139.521 1.00 58.16  ?  159 LYS A CB    1 
ATOM   388  C  CG    . LYS A 1 49  ? -116.046 94.727  140.208 1.00 60.07  ?  159 LYS A CG    1 
ATOM   389  C  CD    . LYS A 1 49  ? -115.918 94.913  141.713 1.00 62.17  ?  159 LYS A CD    1 
ATOM   390  C  CE    . LYS A 1 49  ? -115.540 93.610  142.399 1.00 62.87  ?  159 LYS A CE    1 
ATOM   391  N  NZ    . LYS A 1 49  ? -115.359 93.777  143.867 1.00 62.13  ?  159 LYS A NZ    1 
ATOM   392  N  N     . ASN A 1 50  ? -116.587 98.163  137.078 1.00 60.79  ?  160 ASN A N     1 
ATOM   393  C  CA    . ASN A 1 50  ? -117.202 99.345  136.484 1.00 53.31  ?  160 ASN A CA    1 
ATOM   394  C  C     . ASN A 1 50  ? -117.818 99.022  135.128 1.00 57.82  ?  160 ASN A C     1 
ATOM   395  O  O     . ASN A 1 50  ? -118.908 99.507  134.804 1.00 56.84  ?  160 ASN A O     1 
ATOM   396  C  CB    . ASN A 1 50  ? -116.168 100.463 136.350 1.00 50.53  ?  160 ASN A CB    1 
ATOM   397  C  CG    . ASN A 1 50  ? -115.579 100.875 137.684 1.00 49.71  ?  160 ASN A CG    1 
ATOM   398  O  OD1   . ASN A 1 50  ? -114.662 100.233 138.196 1.00 56.04  ?  160 ASN A OD1   1 
ATOM   399  N  ND2   . ASN A 1 50  ? -116.099 101.957 138.251 1.00 52.72  ?  160 ASN A ND2   1 
ATOM   400  N  N     . SER A 1 51  ? -117.135 98.204  134.324 1.00 59.52  ?  161 SER A N     1 
ATOM   401  C  CA    . SER A 1 51  ? -117.675 97.828  133.021 1.00 55.41  ?  161 SER A CA    1 
ATOM   402  C  C     . SER A 1 51  ? -118.902 96.936  133.157 1.00 58.18  ?  161 SER A C     1 
ATOM   403  O  O     . SER A 1 51  ? -119.762 96.929  132.268 1.00 59.44  ?  161 SER A O     1 
ATOM   404  C  CB    . SER A 1 51  ? -116.600 97.131  132.187 1.00 53.93  ?  161 SER A CB    1 
ATOM   405  O  OG    . SER A 1 51  ? -115.497 97.989  131.954 1.00 58.28  ?  161 SER A OG    1 
ATOM   406  N  N     . VAL A 1 52  ? -119.000 96.179  134.251 1.00 61.31  ?  162 VAL A N     1 
ATOM   407  C  CA    . VAL A 1 52  ? -120.182 95.353  134.479 1.00 58.91  ?  162 VAL A CA    1 
ATOM   408  C  C     . VAL A 1 52  ? -121.400 96.232  134.739 1.00 57.80  ?  162 VAL A C     1 
ATOM   409  O  O     . VAL A 1 52  ? -122.466 96.036  134.143 1.00 58.22  ?  162 VAL A O     1 
ATOM   410  C  CB    . VAL A 1 52  ? -119.936 94.370  135.638 1.00 64.40  ?  162 VAL A CB    1 
ATOM   411  C  CG1   . VAL A 1 52  ? -121.231 93.676  136.031 1.00 51.14  ?  162 VAL A CG1   1 
ATOM   412  C  CG2   . VAL A 1 52  ? -118.879 93.348  135.249 1.00 64.68  ?  162 VAL A CG2   1 
ATOM   413  N  N     . ARG A 1 53  ? -121.259 97.217  135.630 1.00 54.71  ?  163 ARG A N     1 
ATOM   414  C  CA    . ARG A 1 53  ? -122.367 98.124  135.906 1.00 56.10  ?  163 ARG A CA    1 
ATOM   415  C  C     . ARG A 1 53  ? -122.688 99.002  134.705 1.00 58.45  ?  163 ARG A C     1 
ATOM   416  O  O     . ARG A 1 53  ? -123.852 99.365  134.499 1.00 59.91  ?  163 ARG A O     1 
ATOM   417  C  CB    . ARG A 1 53  ? -122.050 98.990  137.125 1.00 61.82  ?  163 ARG A CB    1 
ATOM   418  C  CG    . ARG A 1 53  ? -121.780 98.197  138.389 1.00 59.98  ?  163 ARG A CG    1 
ATOM   419  C  CD    . ARG A 1 53  ? -121.712 99.094  139.614 1.00 60.15  ?  163 ARG A CD    1 
ATOM   420  N  NE    . ARG A 1 53  ? -120.665 100.106 139.504 1.00 58.39  ?  163 ARG A NE    1 
ATOM   421  C  CZ    . ARG A 1 53  ? -119.402 99.918  139.872 1.00 53.75  ?  163 ARG A CZ    1 
ATOM   422  N  NH1   . ARG A 1 53  ? -119.021 98.751  140.374 1.00 49.44  ?  163 ARG A NH1   1 
ATOM   423  N  NH2   . ARG A 1 53  ? -118.518 100.897 139.738 1.00 51.34  ?  163 ARG A NH2   1 
ATOM   424  N  N     . HIS A 1 54  ? -121.678 99.354  133.906 1.00 55.76  ?  164 HIS A N     1 
ATOM   425  C  CA    . HIS A 1 54  ? -121.927 100.149 132.709 1.00 56.29  ?  164 HIS A CA    1 
ATOM   426  C  C     . HIS A 1 54  ? -122.759 99.374  131.695 1.00 60.02  ?  164 HIS A C     1 
ATOM   427  O  O     . HIS A 1 54  ? -123.617 99.951  131.017 1.00 62.23  ?  164 HIS A O     1 
ATOM   428  C  CB    . HIS A 1 54  ? -120.604 100.593 132.087 1.00 61.98  ?  164 HIS A CB    1 
ATOM   429  C  CG    . HIS A 1 54  ? -120.751 101.186 130.720 1.00 56.50  ?  164 HIS A CG    1 
ATOM   430  N  ND1   . HIS A 1 54  ? -121.576 102.258 130.459 1.00 64.73  ?  164 HIS A ND1   1 
ATOM   431  C  CD2   . HIS A 1 54  ? -120.183 100.852 129.537 1.00 63.47  ?  164 HIS A CD2   1 
ATOM   432  C  CE1   . HIS A 1 54  ? -121.508 102.562 129.175 1.00 65.87  ?  164 HIS A CE1   1 
ATOM   433  N  NE2   . HIS A 1 54  ? -120.669 101.723 128.593 1.00 64.97  ?  164 HIS A NE2   1 
ATOM   434  N  N     . ASN A 1 55  ? -122.521 98.066  131.579 1.00 66.03  ?  165 ASN A N     1 
ATOM   435  C  CA    . ASN A 1 55  ? -123.274 97.259  130.625 1.00 60.75  ?  165 ASN A CA    1 
ATOM   436  C  C     . ASN A 1 55  ? -124.716 97.062  131.073 1.00 63.52  ?  165 ASN A C     1 
ATOM   437  O  O     . ASN A 1 55  ? -125.618 96.971  130.231 1.00 61.35  ?  165 ASN A O     1 
ATOM   438  C  CB    . ASN A 1 55  ? -122.589 95.906  130.430 1.00 59.99  ?  165 ASN A CB    1 
ATOM   439  C  CG    . ASN A 1 55  ? -123.010 95.218  129.147 1.00 65.24  ?  165 ASN A CG    1 
ATOM   440  O  OD1   . ASN A 1 55  ? -124.107 94.667  129.055 1.00 68.56  ?  165 ASN A OD1   1 
ATOM   441  N  ND2   . ASN A 1 55  ? -122.134 95.242  128.149 1.00 72.66  ?  165 ASN A ND2   1 
ATOM   442  N  N     . LEU A 1 56  ? -124.954 96.998  132.385 1.00 61.50  ?  166 LEU A N     1 
ATOM   443  C  CA    . LEU A 1 56  ? -126.311 96.808  132.888 1.00 59.52  ?  166 LEU A CA    1 
ATOM   444  C  C     . LEU A 1 56  ? -127.186 98.021  132.600 1.00 65.65  ?  166 LEU A C     1 
ATOM   445  O  O     . LEU A 1 56  ? -128.344 97.876  132.191 1.00 62.44  ?  166 LEU A O     1 
ATOM   446  C  CB    . LEU A 1 56  ? -126.276 96.520  134.388 1.00 58.28  ?  166 LEU A CB    1 
ATOM   447  C  CG    . LEU A 1 56  ? -125.675 95.182  134.814 1.00 57.66  ?  166 LEU A CG    1 
ATOM   448  C  CD1   . LEU A 1 56  ? -125.484 95.136  136.322 1.00 52.45  ?  166 LEU A CD1   1 
ATOM   449  C  CD2   . LEU A 1 56  ? -126.568 94.045  134.355 1.00 58.64  ?  166 LEU A CD2   1 
ATOM   450  N  N     . SER A 1 57  ? -126.653 99.225  132.811 1.00 64.51  ?  167 SER A N     1 
ATOM   451  C  CA    . SER A 1 57  ? -127.436 100.436 132.603 1.00 61.11  ?  167 SER A CA    1 
ATOM   452  C  C     . SER A 1 57  ? -127.607 100.766 131.126 1.00 62.47  ?  167 SER A C     1 
ATOM   453  O  O     . SER A 1 57  ? -128.625 101.353 130.742 1.00 69.75  ?  167 SER A O     1 
ATOM   454  C  CB    . SER A 1 57  ? -126.781 101.615 133.325 1.00 57.70  ?  167 SER A CB    1 
ATOM   455  O  OG    . SER A 1 57  ? -126.604 101.335 134.704 1.00 66.00  ?  167 SER A OG    1 
ATOM   456  N  N     . LEU A 1 58  ? -126.637 100.397 130.289 1.00 59.80  ?  168 LEU A N     1 
ATOM   457  C  CA    . LEU A 1 58  ? -126.680 100.782 128.882 1.00 60.90  ?  168 LEU A CA    1 
ATOM   458  C  C     . LEU A 1 58  ? -127.548 99.832  128.064 1.00 61.27  ?  168 LEU A C     1 
ATOM   459  O  O     . LEU A 1 58  ? -128.400 100.274 127.286 1.00 66.17  ?  168 LEU A O     1 
ATOM   460  C  CB    . LEU A 1 58  ? -125.262 100.832 128.309 1.00 68.86  ?  168 LEU A CB    1 
ATOM   461  C  CG    . LEU A 1 58  ? -125.124 101.365 126.881 1.00 66.15  ?  168 LEU A CG    1 
ATOM   462  C  CD1   . LEU A 1 58  ? -125.301 102.876 126.851 1.00 71.72  ?  168 LEU A CD1   1 
ATOM   463  C  CD2   . LEU A 1 58  ? -123.788 100.960 126.276 1.00 69.43  ?  168 LEU A CD2   1 
ATOM   464  N  N     . ASN A 1 59  ? -127.342 98.526  128.222 1.00 63.26  ?  169 ASN A N     1 
ATOM   465  C  CA    . ASN A 1 59  ? -128.059 97.549  127.413 1.00 69.38  ?  169 ASN A CA    1 
ATOM   466  C  C     . ASN A 1 59  ? -129.536 97.512  127.787 1.00 73.59  ?  169 ASN A C     1 
ATOM   467  O  O     . ASN A 1 59  ? -129.889 97.448  128.969 1.00 71.63  ?  169 ASN A O     1 
ATOM   468  C  CB    . ASN A 1 59  ? -127.437 96.163  127.582 1.00 65.24  ?  169 ASN A CB    1 
ATOM   469  C  CG    . ASN A 1 59  ? -126.347 95.886  126.567 1.00 67.23  ?  169 ASN A CG    1 
ATOM   470  O  OD1   . ASN A 1 59  ? -125.981 96.757  125.776 1.00 79.48  ?  169 ASN A OD1   1 
ATOM   471  N  ND2   . ASN A 1 59  ? -125.819 94.668  126.583 1.00 73.78  ?  169 ASN A ND2   1 
ATOM   472  N  N     . LYS A 1 60  ? -130.399 97.552  126.770 1.00 72.91  ?  170 LYS A N     1 
ATOM   473  C  CA    . LYS A 1 60  ? -131.836 97.462  126.996 1.00 75.70  ?  170 LYS A CA    1 
ATOM   474  C  C     . LYS A 1 60  ? -132.268 96.071  127.437 1.00 75.52  ?  170 LYS A C     1 
ATOM   475  O  O     . LYS A 1 60  ? -133.352 95.926  128.014 1.00 75.42  ?  170 LYS A O     1 
ATOM   476  C  CB    . LYS A 1 60  ? -132.594 97.860  125.729 1.00 83.66  ?  170 LYS A CB    1 
ATOM   477  C  CG    . LYS A 1 60  ? -132.987 99.326  125.670 1.00 92.33  ?  170 LYS A CG    1 
ATOM   478  C  CD    . LYS A 1 60  ? -134.038 99.650  126.720 1.00 95.20  ?  170 LYS A CD    1 
ATOM   479  C  CE    . LYS A 1 60  ? -134.560 101.068 126.563 1.00 87.71  ?  170 LYS A CE    1 
ATOM   480  N  NZ    . LYS A 1 60  ? -135.647 101.366 127.536 1.00 85.85  ?  170 LYS A NZ    1 
ATOM   481  N  N     . CYS A 1 61  ? -131.450 95.051  127.183 1.00 72.41  ?  171 CYS A N     1 
ATOM   482  C  CA    . CYS A 1 61  ? -131.793 93.678  127.531 1.00 75.14  ?  171 CYS A CA    1 
ATOM   483  C  C     . CYS A 1 61  ? -131.646 93.380  129.017 1.00 73.24  ?  171 CYS A C     1 
ATOM   484  O  O     . CYS A 1 61  ? -131.984 92.270  129.443 1.00 75.43  ?  171 CYS A O     1 
ATOM   485  C  CB    . CYS A 1 61  ? -130.934 92.702  126.721 1.00 68.33  ?  171 CYS A CB    1 
ATOM   486  S  SG    . CYS A 1 61  ? -129.159 93.036  126.778 1.00 80.36  ?  171 CYS A SG    1 
ATOM   487  N  N     . PHE A 1 62  ? -131.156 94.328  129.813 1.00 67.30  ?  172 PHE A N     1 
ATOM   488  C  CA    . PHE A 1 62  ? -131.028 94.159  131.257 1.00 68.47  ?  172 PHE A CA    1 
ATOM   489  C  C     . PHE A 1 62  ? -131.952 95.159  131.939 1.00 70.58  ?  172 PHE A C     1 
ATOM   490  O  O     . PHE A 1 62  ? -131.707 96.370  131.896 1.00 73.07  ?  172 PHE A O     1 
ATOM   491  C  CB    . PHE A 1 62  ? -129.580 94.339  131.708 1.00 67.18  ?  172 PHE A CB    1 
ATOM   492  C  CG    . PHE A 1 62  ? -128.632 93.343  131.104 1.00 67.86  ?  172 PHE A CG    1 
ATOM   493  C  CD1   . PHE A 1 62  ? -127.552 93.762  130.345 1.00 66.79  ?  172 PHE A CD1   1 
ATOM   494  C  CD2   . PHE A 1 62  ? -128.833 91.984  131.282 1.00 67.23  ?  172 PHE A CD2   1 
ATOM   495  C  CE1   . PHE A 1 62  ? -126.683 92.844  129.785 1.00 65.93  ?  172 PHE A CE1   1 
ATOM   496  C  CE2   . PHE A 1 62  ? -127.969 91.062  130.723 1.00 68.44  ?  172 PHE A CE2   1 
ATOM   497  C  CZ    . PHE A 1 62  ? -126.892 91.492  129.974 1.00 68.37  ?  172 PHE A CZ    1 
ATOM   498  N  N     . LYS A 1 63  ? -133.010 94.651  132.565 1.00 71.60  ?  173 LYS A N     1 
ATOM   499  C  CA    . LYS A 1 63  ? -134.023 95.476  133.205 1.00 69.03  ?  173 LYS A CA    1 
ATOM   500  C  C     . LYS A 1 63  ? -133.777 95.537  134.707 1.00 67.03  ?  173 LYS A C     1 
ATOM   501  O  O     . LYS A 1 63  ? -133.356 94.551  135.319 1.00 64.11  ?  173 LYS A O     1 
ATOM   502  C  CB    . LYS A 1 63  ? -135.423 94.923  132.928 1.00 73.67  ?  173 LYS A CB    1 
ATOM   503  C  CG    . LYS A 1 63  ? -136.561 95.866  133.281 1.00 83.05  ?  173 LYS A CG    1 
ATOM   504  C  CD    . LYS A 1 63  ? -137.906 95.168  133.139 1.00 86.00  ?  173 LYS A CD    1 
ATOM   505  C  CE    . LYS A 1 63  ? -139.014 96.150  132.793 1.00 83.04  ?  173 LYS A CE    1 
ATOM   506  N  NZ    . LYS A 1 63  ? -139.149 97.235  133.802 1.00 80.39  ?  173 LYS A NZ    1 
ATOM   507  N  N     . LYS A 1 64  ? -134.044 96.700  135.294 1.00 71.29  ?  174 LYS A N     1 
ATOM   508  C  CA    . LYS A 1 64  ? -133.905 96.897  136.730 1.00 71.83  ?  174 LYS A CA    1 
ATOM   509  C  C     . LYS A 1 64  ? -135.218 96.554  137.420 1.00 73.76  ?  174 LYS A C     1 
ATOM   510  O  O     . LYS A 1 64  ? -136.275 97.077  137.051 1.00 75.16  ?  174 LYS A O     1 
ATOM   511  C  CB    . LYS A 1 64  ? -133.503 98.340  137.038 1.00 66.83  ?  174 LYS A CB    1 
ATOM   512  C  CG    . LYS A 1 64  ? -133.229 98.613  138.508 1.00 75.69  ?  174 LYS A CG    1 
ATOM   513  C  CD    . LYS A 1 64  ? -133.196 100.107 138.793 1.00 80.30  ?  174 LYS A CD    1 
ATOM   514  C  CE    . LYS A 1 64  ? -132.209 100.827 137.888 1.00 68.30  ?  174 LYS A CE    1 
ATOM   515  N  NZ    . LYS A 1 64  ? -132.212 102.298 138.123 1.00 61.75  ?  174 LYS A NZ    1 
ATOM   516  N  N     . VAL A 1 65  ? -135.151 95.674  138.417 1.00 72.54  ?  175 VAL A N     1 
ATOM   517  C  CA    . VAL A 1 65  ? -136.322 95.279  139.188 1.00 80.38  ?  175 VAL A CA    1 
ATOM   518  C  C     . VAL A 1 65  ? -136.034 95.482  140.669 1.00 82.26  ?  175 VAL A C     1 
ATOM   519  O  O     . VAL A 1 65  ? -134.884 95.419  141.114 1.00 85.04  ?  175 VAL A O     1 
ATOM   520  C  CB    . VAL A 1 65  ? -136.746 93.821  138.906 1.00 88.69  ?  175 VAL A CB    1 
ATOM   521  C  CG1   . VAL A 1 65  ? -137.248 93.685  137.476 1.00 80.87  ?  175 VAL A CG1   1 
ATOM   522  C  CG2   . VAL A 1 65  ? -135.591 92.870  139.161 1.00 85.33  ?  175 VAL A CG2   1 
ATOM   523  N  N     . ASP A 1 66  ? -137.094 95.731  141.432 1.00 90.11  ?  176 ASP A N     1 
ATOM   524  C  CA    . ASP A 1 66  ? -136.979 96.026  142.852 1.00 93.76  ?  176 ASP A CA    1 
ATOM   525  C  C     . ASP A 1 66  ? -136.933 94.742  143.676 1.00 86.50  ?  176 ASP A C     1 
ATOM   526  O  O     . ASP A 1 66  ? -137.199 93.642  143.187 1.00 88.51  ?  176 ASP A O     1 
ATOM   527  C  CB    . ASP A 1 66  ? -138.142 96.903  143.314 1.00 82.50  ?  176 ASP A CB    1 
ATOM   528  C  CG    . ASP A 1 66  ? -138.170 98.247  142.621 1.00 85.43  ?  176 ASP A CG    1 
ATOM   529  O  OD1   . ASP A 1 66  ? -137.085 98.806  142.355 1.00 85.30  ?  176 ASP A OD1   1 
ATOM   530  O  OD2   . ASP A 1 66  ? -139.281 98.743  142.341 1.00 81.25  ?  176 ASP A OD2   1 
ATOM   531  N  N     . LYS A 1 67  ? -136.594 94.900  144.951 1.00 83.29  ?  177 LYS A N     1 
ATOM   532  C  CA    . LYS A 1 67  ? -136.545 93.781  145.881 1.00 78.11  ?  177 LYS A CA    1 
ATOM   533  C  C     . LYS A 1 67  ? -137.933 93.483  146.439 1.00 79.76  ?  177 LYS A C     1 
ATOM   534  O  O     . LYS A 1 67  ? -138.073 93.038  147.578 1.00 79.04  ?  177 LYS A O     1 
ATOM   535  C  CB    . LYS A 1 67  ? -135.567 94.072  147.021 1.00 72.69  ?  177 LYS A CB    1 
ATOM   536  C  CG    . LYS A 1 67  ? -134.151 94.376  146.559 1.00 76.81  ?  177 LYS A CG    1 
ATOM   537  C  CD    . LYS A 1 67  ? -133.192 94.481  147.734 1.00 86.55  ?  177 LYS A CD    1 
ATOM   538  C  CE    . LYS A 1 67  ? -131.766 94.716  147.260 1.00 84.96  ?  177 LYS A CE    1 
ATOM   539  N  NZ    . LYS A 1 67  ? -130.789 94.687  148.384 1.00 89.94  ?  177 LYS A NZ    1 
ATOM   540  N  N     . LYS A 1 75  ? -127.525 99.194  149.892 1.00 77.39  ?  185 LYS A N     1 
ATOM   541  C  CA    . LYS A 1 75  ? -128.675 98.468  149.367 1.00 82.02  ?  185 LYS A CA    1 
ATOM   542  C  C     . LYS A 1 75  ? -128.990 98.922  147.945 1.00 89.34  ?  185 LYS A C     1 
ATOM   543  O  O     . LYS A 1 75  ? -129.519 100.014 147.735 1.00 93.38  ?  185 LYS A O     1 
ATOM   544  C  CB    . LYS A 1 75  ? -129.895 98.666  150.269 1.00 85.35  ?  185 LYS A CB    1 
ATOM   545  C  CG    . LYS A 1 75  ? -130.715 97.406  150.496 1.00 84.53  ?  185 LYS A CG    1 
ATOM   546  C  CD    . LYS A 1 75  ? -131.997 97.714  151.253 1.00 93.52  ?  185 LYS A CD    1 
ATOM   547  C  CE    . LYS A 1 75  ? -131.715 98.460  152.548 1.00 88.85  ?  185 LYS A CE    1 
ATOM   548  N  NZ    . LYS A 1 75  ? -132.971 98.827  153.260 1.00 90.44  ?  185 LYS A NZ    1 
ATOM   549  N  N     . GLY A 1 76  ? -128.661 98.078  146.971 1.00 81.25  ?  186 GLY A N     1 
ATOM   550  C  CA    . GLY A 1 76  ? -128.881 98.413  145.578 1.00 76.85  ?  186 GLY A CA    1 
ATOM   551  C  C     . GLY A 1 76  ? -130.221 97.949  145.048 1.00 83.57  ?  186 GLY A C     1 
ATOM   552  O  O     . GLY A 1 76  ? -131.269 98.265  145.621 1.00 73.37  ?  186 GLY A O     1 
ATOM   553  N  N     . SER A 1 77  ? -130.199 97.197  143.950 1.00 84.57  ?  187 SER A N     1 
ATOM   554  C  CA    . SER A 1 77  ? -131.422 96.713  143.327 1.00 76.79  ?  187 SER A CA    1 
ATOM   555  C  C     . SER A 1 77  ? -131.103 95.455  142.534 1.00 73.57  ?  187 SER A C     1 
ATOM   556  O  O     . SER A 1 77  ? -129.945 95.182  142.208 1.00 70.24  ?  187 SER A O     1 
ATOM   557  C  CB    . SER A 1 77  ? -132.052 97.779  142.423 1.00 71.76  ?  187 SER A CB    1 
ATOM   558  O  OG    . SER A 1 77  ? -133.171 97.261  141.725 1.00 83.63  ?  187 SER A OG    1 
ATOM   559  N  N     . LEU A 1 78  ? -132.148 94.693  142.228 1.00 74.48  ?  188 LEU A N     1 
ATOM   560  C  CA    . LEU A 1 78  ? -131.989 93.470  141.458 1.00 74.18  ?  188 LEU A CA    1 
ATOM   561  C  C     . LEU A 1 78  ? -131.944 93.777  139.966 1.00 73.20  ?  188 LEU A C     1 
ATOM   562  O  O     . LEU A 1 78  ? -132.518 94.762  139.492 1.00 70.78  ?  188 LEU A O     1 
ATOM   563  C  CB    . LEU A 1 78  ? -133.129 92.494  141.751 1.00 75.38  ?  188 LEU A CB    1 
ATOM   564  C  CG    . LEU A 1 78  ? -133.334 92.057  143.202 1.00 73.01  ?  188 LEU A CG    1 
ATOM   565  C  CD1   . LEU A 1 78  ? -134.475 91.057  143.299 1.00 70.80  ?  188 LEU A CD1   1 
ATOM   566  C  CD2   . LEU A 1 78  ? -132.054 91.472  143.773 1.00 72.21  ?  188 LEU A CD2   1 
ATOM   567  N  N     . TRP A 1 79  ? -131.250 92.917  139.224 1.00 73.56  ?  189 TRP A N     1 
ATOM   568  C  CA    . TRP A 1 79  ? -131.149 93.027  137.777 1.00 65.17  ?  189 TRP A CA    1 
ATOM   569  C  C     . TRP A 1 79  ? -131.607 91.725  137.139 1.00 67.59  ?  189 TRP A C     1 
ATOM   570  O  O     . TRP A 1 79  ? -131.237 90.638  137.592 1.00 69.20  ?  189 TRP A O     1 
ATOM   571  C  CB    . TRP A 1 79  ? -129.714 93.353  137.339 1.00 63.64  ?  189 TRP A CB    1 
ATOM   572  C  CG    . TRP A 1 79  ? -129.267 94.730  137.728 1.00 62.14  ?  189 TRP A CG    1 
ATOM   573  C  CD1   . TRP A 1 79  ? -128.607 95.087  138.868 1.00 60.23  ?  189 TRP A CD1   1 
ATOM   574  C  CD2   . TRP A 1 79  ? -129.450 95.936  136.976 1.00 62.03  ?  189 TRP A CD2   1 
ATOM   575  N  NE1   . TRP A 1 79  ? -128.368 96.440  138.872 1.00 59.16  ?  189 TRP A NE1   1 
ATOM   576  C  CE2   . TRP A 1 79  ? -128.875 96.984  137.722 1.00 59.45  ?  189 TRP A CE2   1 
ATOM   577  C  CE3   . TRP A 1 79  ? -130.043 96.231  135.745 1.00 63.45  ?  189 TRP A CE3   1 
ATOM   578  C  CZ2   . TRP A 1 79  ? -128.877 98.305  137.277 1.00 68.48  ?  189 TRP A CZ2   1 
ATOM   579  C  CZ3   . TRP A 1 79  ? -130.044 97.543  135.305 1.00 67.34  ?  189 TRP A CZ3   1 
ATOM   580  C  CH2   . TRP A 1 79  ? -129.464 98.563  136.069 1.00 68.30  ?  189 TRP A CH2   1 
ATOM   581  N  N     . CYS A 1 80  ? -132.417 91.840  136.087 1.00 69.77  ?  190 CYS A N     1 
ATOM   582  C  CA    . CYS A 1 80  ? -132.939 90.682  135.375 1.00 75.94  ?  190 CYS A CA    1 
ATOM   583  C  C     . CYS A 1 80  ? -132.780 90.909  133.878 1.00 70.82  ?  190 CYS A C     1 
ATOM   584  O  O     . CYS A 1 80  ? -132.188 91.898  133.434 1.00 69.35  ?  190 CYS A O     1 
ATOM   585  C  CB    . CYS A 1 80  ? -134.406 90.420  135.735 1.00 74.35  ?  190 CYS A CB    1 
ATOM   586  S  SG    . CYS A 1 80  ? -135.566 91.614  135.024 1.00 75.41  ?  190 CYS A SG    1 
ATOM   587  N  N     . ILE A 1 81  ? -133.325 89.982  133.095 1.00 66.32  ?  191 ILE A N     1 
ATOM   588  C  CA    . ILE A 1 81  ? -133.260 90.024  131.639 1.00 73.29  ?  191 ILE A CA    1 
ATOM   589  C  C     . ILE A 1 81  ? -134.650 90.353  131.116 1.00 78.68  ?  191 ILE A C     1 
ATOM   590  O  O     . ILE A 1 81  ? -135.623 89.656  131.434 1.00 83.39  ?  191 ILE A O     1 
ATOM   591  C  CB    . ILE A 1 81  ? -132.752 88.695  131.060 1.00 72.63  ?  191 ILE A CB    1 
ATOM   592  C  CG1   . ILE A 1 81  ? -131.425 88.310  131.716 1.00 73.81  ?  191 ILE A CG1   1 
ATOM   593  C  CG2   . ILE A 1 81  ? -132.601 88.797  129.552 1.00 67.47  ?  191 ILE A CG2   1 
ATOM   594  C  CD1   . ILE A 1 81  ? -131.089 86.843  131.593 1.00 77.91  ?  191 ILE A CD1   1 
ATOM   595  N  N     . ASP A 1 82  ? -134.745 91.414  130.324 1.00 72.96  ?  192 ASP A N     1 
ATOM   596  C  CA    . ASP A 1 82  ? -136.021 91.796  129.739 1.00 75.77  ?  192 ASP A CA    1 
ATOM   597  C  C     . ASP A 1 82  ? -136.508 90.684  128.815 1.00 80.05  ?  192 ASP A C     1 
ATOM   598  O  O     . ASP A 1 82  ? -135.767 90.264  127.914 1.00 87.01  ?  192 ASP A O     1 
ATOM   599  C  CB    . ASP A 1 82  ? -135.881 93.111  128.971 1.00 80.62  ?  192 ASP A CB    1 
ATOM   600  C  CG    . ASP A 1 82  ? -137.213 93.804  128.745 1.00 85.67  ?  192 ASP A CG    1 
ATOM   601  O  OD1   . ASP A 1 82  ? -138.180 93.133  128.332 1.00 88.07  ?  192 ASP A OD1   1 
ATOM   602  O  OD2   . ASP A 1 82  ? -137.295 95.027  128.984 1.00 91.97  -1 192 ASP A OD2   1 
ATOM   603  N  N     . PRO A 1 83  ? -137.730 90.176  129.005 1.00 77.41  ?  193 PRO A N     1 
ATOM   604  C  CA    . PRO A 1 83  ? -138.172 89.021  128.203 1.00 85.06  ?  193 PRO A CA    1 
ATOM   605  C  C     . PRO A 1 83  ? -138.251 89.297  126.711 1.00 85.98  ?  193 PRO A C     1 
ATOM   606  O  O     . PRO A 1 83  ? -137.872 88.431  125.912 1.00 87.31  ?  193 PRO A O     1 
ATOM   607  C  CB    . PRO A 1 83  ? -139.551 88.693  128.798 1.00 83.48  ?  193 PRO A CB    1 
ATOM   608  C  CG    . PRO A 1 83  ? -139.984 89.946  129.493 1.00 81.45  ?  193 PRO A CG    1 
ATOM   609  C  CD    . PRO A 1 83  ? -138.726 90.561  130.018 1.00 79.24  ?  193 PRO A CD    1 
ATOM   610  N  N     . GLU A 1 84  ? -138.731 90.474  126.303 1.00 82.40  ?  194 GLU A N     1 
ATOM   611  C  CA    . GLU A 1 84  ? -138.862 90.751  124.877 1.00 89.46  ?  194 GLU A CA    1 
ATOM   612  C  C     . GLU A 1 84  ? -137.526 91.025  124.198 1.00 88.77  ?  194 GLU A C     1 
ATOM   613  O  O     . GLU A 1 84  ? -137.470 91.031  122.964 1.00 96.07  ?  194 GLU A O     1 
ATOM   614  C  CB    . GLU A 1 84  ? -139.815 91.927  124.645 1.00 97.65  ?  194 GLU A CB    1 
ATOM   615  C  CG    . GLU A 1 84  ? -139.490 93.177  125.439 1.00 92.29  ?  194 GLU A CG    1 
ATOM   616  C  CD    . GLU A 1 84  ? -140.427 94.325  125.116 1.00 98.64  ?  194 GLU A CD    1 
ATOM   617  O  OE1   . GLU A 1 84  ? -140.209 95.003  124.090 1.00 97.03  ?  194 GLU A OE1   1 
ATOM   618  O  OE2   . GLU A 1 84  ? -141.389 94.542  125.883 1.00 102.38 -1 194 GLU A OE2   1 
ATOM   619  N  N     . TYR A 1 85  ? -136.457 91.247  124.962 1.00 84.62  ?  195 TYR A N     1 
ATOM   620  C  CA    . TYR A 1 85  ? -135.116 91.390  124.412 1.00 86.42  ?  195 TYR A CA    1 
ATOM   621  C  C     . TYR A 1 85  ? -134.248 90.169  124.688 1.00 83.40  ?  195 TYR A C     1 
ATOM   622  O  O     . TYR A 1 85  ? -133.032 90.223  124.475 1.00 88.26  ?  195 TYR A O     1 
ATOM   623  C  CB    . TYR A 1 85  ? -134.439 92.644  124.971 1.00 80.01  ?  195 TYR A CB    1 
ATOM   624  C  CG    . TYR A 1 85  ? -135.154 93.936  124.648 1.00 84.59  ?  195 TYR A CG    1 
ATOM   625  C  CD1   . TYR A 1 85  ? -136.095 94.468  125.519 1.00 89.66  ?  195 TYR A CD1   1 
ATOM   626  C  CD2   . TYR A 1 85  ? -134.883 94.628  123.474 1.00 97.52  ?  195 TYR A CD2   1 
ATOM   627  C  CE1   . TYR A 1 85  ? -136.751 95.651  125.229 1.00 92.69  ?  195 TYR A CE1   1 
ATOM   628  C  CE2   . TYR A 1 85  ? -135.533 95.811  123.175 1.00 95.31  ?  195 TYR A CE2   1 
ATOM   629  C  CZ    . TYR A 1 85  ? -136.466 96.318  124.056 1.00 87.77  ?  195 TYR A CZ    1 
ATOM   630  O  OH    . TYR A 1 85  ? -137.116 97.495  123.764 1.00 92.30  ?  195 TYR A OH    1 
ATOM   631  N  N     . ARG A 1 86  ? -134.843 89.068  125.149 1.00 81.01  ?  196 ARG A N     1 
ATOM   632  C  CA    . ARG A 1 86  ? -134.057 87.918  125.582 1.00 77.58  ?  196 ARG A CA    1 
ATOM   633  C  C     . ARG A 1 86  ? -133.608 87.061  124.403 1.00 84.81  ?  196 ARG A C     1 
ATOM   634  O  O     . ARG A 1 86  ? -132.413 86.789  124.248 1.00 87.74  ?  196 ARG A O     1 
ATOM   635  C  CB    . ARG A 1 86  ? -134.859 87.082  126.580 1.00 73.88  ?  196 ARG A CB    1 
ATOM   636  C  CG    . ARG A 1 86  ? -134.076 85.933  127.192 1.00 77.35  ?  196 ARG A CG    1 
ATOM   637  C  CD    . ARG A 1 86  ? -134.891 85.212  128.251 1.00 79.99  ?  196 ARG A CD    1 
ATOM   638  N  NE    . ARG A 1 86  ? -134.192 84.042  128.773 1.00 78.30  ?  196 ARG A NE    1 
ATOM   639  C  CZ    . ARG A 1 86  ? -134.278 82.825  128.247 1.00 75.25  ?  196 ARG A CZ    1 
ATOM   640  N  NH1   . ARG A 1 86  ? -135.035 82.615  127.178 1.00 73.75  ?  196 ARG A NH1   1 
ATOM   641  N  NH2   . ARG A 1 86  ? -133.607 81.817  128.787 1.00 71.87  ?  196 ARG A NH2   1 
ATOM   642  N  N     . GLN A 1 87  ? -134.548 86.621  123.563 1.00 87.10  ?  197 GLN A N     1 
ATOM   643  C  CA    . GLN A 1 87  ? -134.172 85.757  122.449 1.00 88.52  ?  197 GLN A CA    1 
ATOM   644  C  C     . GLN A 1 87  ? -133.443 86.519  121.350 1.00 95.72  ?  197 GLN A C     1 
ATOM   645  O  O     . GLN A 1 87  ? -132.793 85.892  120.507 1.00 97.20  ?  197 GLN A O     1 
ATOM   646  C  CB    . GLN A 1 87  ? -135.402 85.043  121.882 1.00 86.29  ?  197 GLN A CB    1 
ATOM   647  C  CG    . GLN A 1 87  ? -136.156 85.804  120.809 1.00 100.31 ?  197 GLN A CG    1 
ATOM   648  C  CD    . GLN A 1 87  ? -137.240 84.958  120.167 1.00 101.27 ?  197 GLN A CD    1 
ATOM   649  O  OE1   . GLN A 1 87  ? -137.346 83.761  120.434 1.00 97.25  ?  197 GLN A OE1   1 
ATOM   650  N  NE2   . GLN A 1 87  ? -138.050 85.577  119.317 1.00 96.45  ?  197 GLN A NE2   1 
ATOM   651  N  N     . ASN A 1 88  ? -133.536 87.852  121.335 1.00 92.49  ?  198 ASN A N     1 
ATOM   652  C  CA    . ASN A 1 88  ? -132.618 88.635  120.514 1.00 88.09  ?  198 ASN A CA    1 
ATOM   653  C  C     . ASN A 1 88  ? -131.200 88.549  121.062 1.00 94.47  ?  198 ASN A C     1 
ATOM   654  O  O     . ASN A 1 88  ? -130.232 88.477  120.295 1.00 92.05  ?  198 ASN A O     1 
ATOM   655  C  CB    . ASN A 1 88  ? -133.073 90.094  120.441 1.00 90.52  ?  198 ASN A CB    1 
ATOM   656  C  CG    . ASN A 1 88  ? -134.088 90.337  119.342 1.00 104.46 ?  198 ASN A CG    1 
ATOM   657  O  OD1   . ASN A 1 88  ? -134.755 91.372  119.315 1.00 110.09 ?  198 ASN A OD1   1 
ATOM   658  N  ND2   . ASN A 1 88  ? -134.214 89.381  118.430 1.00 99.52  ?  198 ASN A ND2   1 
ATOM   659  N  N     . LEU A 1 89  ? -131.062 88.554  122.390 1.00 92.66  ?  199 LEU A N     1 
ATOM   660  C  CA    . LEU A 1 89  ? -129.753 88.383  123.009 1.00 85.32  ?  199 LEU A CA    1 
ATOM   661  C  C     . LEU A 1 89  ? -129.237 86.960  122.843 1.00 86.27  ?  199 LEU A C     1 
ATOM   662  O  O     . LEU A 1 89  ? -128.025 86.753  122.710 1.00 86.34  ?  199 LEU A O     1 
ATOM   663  C  CB    . LEU A 1 89  ? -129.829 88.757  124.490 1.00 78.66  ?  199 LEU A CB    1 
ATOM   664  C  CG    . LEU A 1 89  ? -128.580 88.557  125.351 1.00 85.02  ?  199 LEU A CG    1 
ATOM   665  C  CD1   . LEU A 1 89  ? -127.426 89.397  124.830 1.00 86.44  ?  199 LEU A CD1   1 
ATOM   666  C  CD2   . LEU A 1 89  ? -128.878 88.891  126.804 1.00 69.56  ?  199 LEU A CD2   1 
ATOM   667  N  N     . ILE A 1 90  ? -130.136 85.972  122.845 1.00 87.27  ?  200 ILE A N     1 
ATOM   668  C  CA    . ILE A 1 90  ? -129.726 84.583  122.651 1.00 86.89  ?  200 ILE A CA    1 
ATOM   669  C  C     . ILE A 1 90  ? -129.104 84.403  121.272 1.00 87.94  ?  200 ILE A C     1 
ATOM   670  O  O     . ILE A 1 90  ? -127.991 83.881  121.137 1.00 90.69  ?  200 ILE A O     1 
ATOM   671  C  CB    . ILE A 1 90  ? -130.922 83.636  122.854 1.00 92.82  ?  200 ILE A CB    1 
ATOM   672  C  CG1   . ILE A 1 90  ? -131.292 83.542  124.334 1.00 81.57  ?  200 ILE A CG1   1 
ATOM   673  C  CG2   . ILE A 1 90  ? -130.607 82.253  122.294 1.00 88.39  ?  200 ILE A CG2   1 
ATOM   674  C  CD1   . ILE A 1 90  ? -130.370 82.652  125.132 1.00 86.51  ?  200 ILE A CD1   1 
ATOM   675  N  N     . GLN A 1 91  ? -129.814 84.837  120.228 1.00 87.98  ?  201 GLN A N     1 
ATOM   676  C  CA    . GLN A 1 91  ? -129.310 84.673  118.868 1.00 88.09  ?  201 GLN A CA    1 
ATOM   677  C  C     . GLN A 1 91  ? -128.023 85.455  118.645 1.00 83.63  ?  201 GLN A C     1 
ATOM   678  O  O     . GLN A 1 91  ? -127.177 85.039  117.846 1.00 86.40  ?  201 GLN A O     1 
ATOM   679  C  CB    . GLN A 1 91  ? -130.377 85.096  117.859 1.00 96.83  ?  201 GLN A CB    1 
ATOM   680  C  CG    . GLN A 1 91  ? -131.548 84.131  117.765 1.00 103.19 ?  201 GLN A CG    1 
ATOM   681  C  CD    . GLN A 1 91  ? -131.156 82.798  117.155 1.00 101.88 ?  201 GLN A CD    1 
ATOM   682  O  OE1   . GLN A 1 91  ? -130.228 82.719  116.350 1.00 104.57 ?  201 GLN A OE1   1 
ATOM   683  N  NE2   . GLN A 1 91  ? -131.862 81.741  117.539 1.00 90.58  ?  201 GLN A NE2   1 
ATOM   684  N  N     . ALA A 1 92  ? -127.855 86.585  119.336 1.00 85.99  ?  202 ALA A N     1 
ATOM   685  C  CA    . ALA A 1 92  ? -126.591 87.309  119.258 1.00 86.87  ?  202 ALA A CA    1 
ATOM   686  C  C     . ALA A 1 92  ? -125.472 86.551  119.959 1.00 83.11  ?  202 ALA A C     1 
ATOM   687  O  O     . ALA A 1 92  ? -124.303 86.674  119.574 1.00 79.33  ?  202 ALA A O     1 
ATOM   688  C  CB    . ALA A 1 92  ? -126.745 88.706  119.858 1.00 88.22  ?  202 ALA A CB    1 
ATOM   689  N  N     . LEU A 1 93  ? -125.807 85.764  120.982 1.00 84.13  ?  203 LEU A N     1 
ATOM   690  C  CA    . LEU A 1 93  ? -124.820 84.972  121.701 1.00 82.06  ?  203 LEU A CA    1 
ATOM   691  C  C     . LEU A 1 93  ? -124.574 83.610  121.070 1.00 82.00  ?  203 LEU A C     1 
ATOM   692  O  O     . LEU A 1 93  ? -123.507 83.027  121.289 1.00 88.66  ?  203 LEU A O     1 
ATOM   693  C  CB    . LEU A 1 93  ? -125.248 84.787  123.160 1.00 83.14  ?  203 LEU A CB    1 
ATOM   694  C  CG    . LEU A 1 93  ? -124.591 85.718  124.181 1.00 77.41  ?  203 LEU A CG    1 
ATOM   695  C  CD1   . LEU A 1 93  ? -124.685 87.171  123.741 1.00 84.97  ?  203 LEU A CD1   1 
ATOM   696  C  CD2   . LEU A 1 93  ? -125.221 85.531  125.552 1.00 77.87  ?  203 LEU A CD2   1 
ATOM   697  N  N     . LYS A 1 94  ? -125.528 83.083  120.303 1.00 78.19  ?  204 LYS A N     1 
ATOM   698  C  CA    . LYS A 1 94  ? -125.279 81.854  119.562 1.00 81.09  ?  204 LYS A CA    1 
ATOM   699  C  C     . LYS A 1 94  ? -124.615 82.123  118.220 1.00 80.54  ?  204 LYS A C     1 
ATOM   700  O  O     . LYS A 1 94  ? -123.995 81.217  117.654 1.00 79.53  ?  204 LYS A O     1 
ATOM   701  C  CB    . LYS A 1 94  ? -126.583 81.078  119.356 1.00 79.99  ?  204 LYS A CB    1 
ATOM   702  C  CG    . LYS A 1 94  ? -127.343 80.801  120.646 1.00 91.01  ?  204 LYS A CG    1 
ATOM   703  C  CD    . LYS A 1 94  ? -126.408 80.328  121.750 1.00 97.25  ?  204 LYS A CD    1 
ATOM   704  C  CE    . LYS A 1 94  ? -126.863 80.839  123.108 1.00 92.06  ?  204 LYS A CE    1 
ATOM   705  N  NZ    . LYS A 1 94  ? -125.766 80.793  124.115 1.00 91.24  ?  204 LYS A NZ    1 
ATOM   706  N  N     . LYS A 1 95  ? -124.730 83.348  117.707 1.00 86.78  ?  205 LYS A N     1 
ATOM   707  C  CA    . LYS A 1 95  ? -124.020 83.732  116.493 1.00 86.03  ?  205 LYS A CA    1 
ATOM   708  C  C     . LYS A 1 95  ? -122.548 84.007  116.780 1.00 84.26  ?  205 LYS A C     1 
ATOM   709  O  O     . LYS A 1 95  ? -121.666 83.524  116.061 1.00 85.38  ?  205 LYS A O     1 
ATOM   710  C  CB    . LYS A 1 95  ? -124.694 84.956  115.868 1.00 80.25  ?  205 LYS A CB    1 
ATOM   711  C  CG    . LYS A 1 95  ? -123.793 85.784  114.978 1.00 86.72  ?  205 LYS A CG    1 
ATOM   712  C  CD    . LYS A 1 95  ? -123.424 85.043  113.711 1.00 93.25  ?  205 LYS A CD    1 
ATOM   713  C  CE    . LYS A 1 95  ? -122.104 85.552  113.173 1.00 92.49  ?  205 LYS A CE    1 
ATOM   714  N  NZ    . LYS A 1 95  ? -121.788 84.954  111.857 1.00 85.64  ?  205 LYS A NZ    1 
ATOM   715  N  N     . THR A 1 96  ? -122.265 84.777  117.830 1.00 78.12  ?  206 THR A N     1 
ATOM   716  C  CA    . THR A 1 96  ? -120.899 85.109  118.235 1.00 73.54  ?  206 THR A CA    1 
ATOM   717  C  C     . THR A 1 96  ? -120.730 84.717  119.697 1.00 80.45  ?  206 THR A C     1 
ATOM   718  O  O     . THR A 1 96  ? -120.821 85.564  120.597 1.00 82.82  ?  206 THR A O     1 
ATOM   719  C  CB    . THR A 1 96  ? -120.598 86.593  118.018 1.00 67.67  ?  206 THR A CB    1 
ATOM   720  O  OG1   . THR A 1 96  ? -121.003 86.976  116.698 1.00 76.90  ?  206 THR A OG1   1 
ATOM   721  C  CG2   . THR A 1 96  ? -119.109 86.865  118.180 1.00 68.96  ?  206 THR A CG2   1 
ATOM   722  N  N     . PRO A 1 97  ? -120.486 83.432  119.974 1.00 78.48  ?  207 PRO A N     1 
ATOM   723  C  CA    . PRO A 1 97  ? -120.372 82.992  121.374 1.00 75.00  ?  207 PRO A CA    1 
ATOM   724  C  C     . PRO A 1 97  ? -119.073 83.386  122.052 1.00 71.40  ?  207 PRO A C     1 
ATOM   725  O  O     . PRO A 1 97  ? -119.008 83.339  123.288 1.00 77.78  ?  207 PRO A O     1 
ATOM   726  C  CB    . PRO A 1 97  ? -120.497 81.465  121.272 1.00 70.22  ?  207 PRO A CB    1 
ATOM   727  C  CG    . PRO A 1 97  ? -119.997 81.149  119.904 1.00 69.57  ?  207 PRO A CG    1 
ATOM   728  C  CD    . PRO A 1 97  ? -120.407 82.303  119.030 1.00 73.93  ?  207 PRO A CD    1 
ATOM   729  N  N     . TYR A 1 98  ? -118.045 83.774  121.302 1.00 68.11  ?  208 TYR A N     1 
ATOM   730  C  CA    . TYR A 1 98  ? -116.748 84.111  121.875 1.00 69.54  ?  208 TYR A CA    1 
ATOM   731  C  C     . TYR A 1 98  ? -116.309 85.475  121.366 1.00 72.41  ?  208 TYR A C     1 
ATOM   732  O  O     . TYR A 1 98  ? -116.256 85.699  120.153 1.00 76.54  ?  208 TYR A O     1 
ATOM   733  C  CB    . TYR A 1 98  ? -115.697 83.048  121.529 1.00 64.56  ?  208 TYR A CB    1 
ATOM   734  C  CG    . TYR A 1 98  ? -116.102 81.642  121.912 1.00 67.32  ?  208 TYR A CG    1 
ATOM   735  C  CD1   . TYR A 1 98  ? -116.608 80.761  120.966 1.00 67.76  ?  208 TYR A CD1   1 
ATOM   736  C  CD2   . TYR A 1 98  ? -115.983 81.197  123.223 1.00 80.91  ?  208 TYR A CD2   1 
ATOM   737  C  CE1   . TYR A 1 98  ? -116.981 79.476  121.312 1.00 70.54  ?  208 TYR A CE1   1 
ATOM   738  C  CE2   . TYR A 1 98  ? -116.354 79.912  123.579 1.00 76.56  ?  208 TYR A CE2   1 
ATOM   739  C  CZ    . TYR A 1 98  ? -116.853 79.057  122.619 1.00 75.61  ?  208 TYR A CZ    1 
ATOM   740  O  OH    . TYR A 1 98  ? -117.224 77.778  122.969 1.00 78.40  ?  208 TYR A OH    1 
ATOM   741  N  N     . HIS A 1 99  ? -115.997 86.378  122.293 1.00 72.56  ?  209 HIS A N     1 
ATOM   742  C  CA    . HIS A 1 99  ? -115.510 87.715  121.955 1.00 79.44  ?  209 HIS A CA    1 
ATOM   743  C  C     . HIS A 1 99  ? -114.461 88.130  122.979 1.00 80.32  ?  209 HIS A C     1 
ATOM   744  O  O     . HIS A 1 99  ? -114.806 88.618  124.068 1.00 82.25  ?  209 HIS A O     1 
ATOM   745  C  CB    . HIS A 1 99  ? -116.646 88.732  121.900 1.00 88.90  ?  209 HIS A CB    1 
ATOM   746  C  CG    . HIS A 1 99  ? -116.185 90.135  121.648 1.00 86.88  ?  209 HIS A CG    1 
ATOM   747  N  ND1   . HIS A 1 99  ? -115.808 90.989  122.663 1.00 79.74  ?  209 HIS A ND1   1 
ATOM   748  C  CD2   . HIS A 1 99  ? -116.031 90.830  120.496 1.00 77.99  ?  209 HIS A CD2   1 
ATOM   749  C  CE1   . HIS A 1 99  ? -115.446 92.150  122.147 1.00 81.38  ?  209 HIS A CE1   1 
ATOM   750  N  NE2   . HIS A 1 99  ? -115.572 92.080  120.834 1.00 73.58  ?  209 HIS A NE2   1 
ATOM   751  N  N     . PRO A 1 100 ? -113.168 87.953  122.670 1.00 85.47  ?  210 PRO A N     1 
ATOM   752  C  CA    . PRO A 1 100 ? -112.081 88.367  123.563 1.00 89.87  ?  210 PRO A CA    1 
ATOM   753  C  C     . PRO A 1 100 ? -111.971 89.885  123.678 1.00 88.33  ?  210 PRO A C     1 
ATOM   754  O  O     . PRO A 1 100 ? -112.576 90.502  124.555 1.00 90.59  ?  210 PRO A O     1 
ATOM   755  C  CB    . PRO A 1 100 ? -110.830 87.782  122.893 1.00 94.20  ?  210 PRO A CB    1 
ATOM   756  C  CG    . PRO A 1 100 ? -111.341 86.732  121.953 1.00 79.69  ?  210 PRO A CG    1 
ATOM   757  C  CD    . PRO A 1 100 ? -112.665 87.238  121.487 1.00 80.45  ?  210 PRO A CD    1 
ATOM   758  O  OXT   . PRO A 1 100 ? -111.277 90.530  122.892 1.00 97.41  ?  210 PRO A OXT   1 
ATOM   759  O  "O5'" . DA  B 2 1   ? -112.232 100.790 149.725 1.00 75.89  ?  1   DA  C "O5'" 1 
ATOM   760  C  "C5'" . DA  B 2 1   ? -113.309 100.267 148.954 1.00 79.35  ?  1   DA  C "C5'" 1 
ATOM   761  C  "C4'" . DA  B 2 1   ? -114.467 99.859  149.849 1.00 60.07  ?  1   DA  C "C4'" 1 
ATOM   762  O  "O4'" . DA  B 2 1   ? -114.670 100.872 150.864 1.00 71.04  ?  1   DA  C "O4'" 1 
ATOM   763  C  "C3'" . DA  B 2 1   ? -115.802 99.676  149.127 1.00 69.05  ?  1   DA  C "C3'" 1 
ATOM   764  O  "O3'" . DA  B 2 1   ? -116.099 98.286  149.018 1.00 84.35  ?  1   DA  C "O3'" 1 
ATOM   765  C  "C2'" . DA  B 2 1   ? -116.819 100.390 150.020 1.00 64.92  ?  1   DA  C "C2'" 1 
ATOM   766  C  "C1'" . DA  B 2 1   ? -115.968 101.410 150.767 1.00 75.32  ?  1   DA  C "C1'" 1 
ATOM   767  N  N9    . DA  B 2 1   ? -115.883 102.718 150.117 1.00 70.23  ?  1   DA  C N9    1 
ATOM   768  C  C8    . DA  B 2 1   ? -114.746 103.372 149.730 1.00 64.82  ?  1   DA  C C8    1 
ATOM   769  N  N7    . DA  B 2 1   ? -114.967 104.542 149.180 1.00 55.38  ?  1   DA  C N7    1 
ATOM   770  C  C5    . DA  B 2 1   ? -116.345 104.668 149.211 1.00 57.87  ?  1   DA  C C5    1 
ATOM   771  C  C6    . DA  B 2 1   ? -117.214 105.689 148.776 1.00 60.52  ?  1   DA  C C6    1 
ATOM   772  N  N6    . DA  B 2 1   ? -116.791 106.820 148.201 1.00 59.46  ?  1   DA  C N6    1 
ATOM   773  N  N1    . DA  B 2 1   ? -118.538 105.501 148.955 1.00 58.59  ?  1   DA  C N1    1 
ATOM   774  C  C2    . DA  B 2 1   ? -118.957 104.368 149.530 1.00 63.29  ?  1   DA  C C2    1 
ATOM   775  N  N3    . DA  B 2 1   ? -118.238 103.340 149.980 1.00 63.24  ?  1   DA  C N3    1 
ATOM   776  C  C4    . DA  B 2 1   ? -116.927 103.555 149.788 1.00 59.59  ?  1   DA  C C4    1 
ATOM   777  P  P     . DT  B 2 2   ? -116.628 97.672  147.630 1.00 86.80  ?  2   DT  C P     1 
ATOM   778  O  OP1   . DT  B 2 2   ? -116.719 96.203  147.796 1.00 72.06  -1 2   DT  C OP1   1 
ATOM   779  O  OP2   . DT  B 2 2   ? -115.798 98.240  146.544 1.00 70.95  ?  2   DT  C OP2   1 
ATOM   780  O  "O5'" . DT  B 2 2   ? -118.116 98.243  147.498 1.00 60.14  ?  2   DT  C "O5'" 1 
ATOM   781  C  "C5'" . DT  B 2 2   ? -119.084 97.952  148.500 1.00 58.41  ?  2   DT  C "C5'" 1 
ATOM   782  C  "C4'" . DT  B 2 2   ? -120.441 98.518  148.120 1.00 63.32  ?  2   DT  C "C4'" 1 
ATOM   783  O  "O4'" . DT  B 2 2   ? -120.376 99.969  148.106 1.00 62.31  ?  2   DT  C "O4'" 1 
ATOM   784  C  "C3'" . DT  B 2 2   ? -120.950 98.100  146.742 1.00 57.68  ?  2   DT  C "C3'" 1 
ATOM   785  O  "O3'" . DT  B 2 2   ? -122.346 97.848  146.792 1.00 62.80  ?  2   DT  C "O3'" 1 
ATOM   786  C  "C2'" . DT  B 2 2   ? -120.628 99.308  145.866 1.00 54.62  ?  2   DT  C "C2'" 1 
ATOM   787  C  "C1'" . DT  B 2 2   ? -120.780 100.461 146.846 1.00 52.06  ?  2   DT  C "C1'" 1 
ATOM   788  N  N1    . DT  B 2 2   ? -119.926 101.631 146.510 1.00 52.14  ?  2   DT  C N1    1 
ATOM   789  C  C2    . DT  B 2 2   ? -120.516 102.806 146.107 1.00 56.29  ?  2   DT  C C2    1 
ATOM   790  O  O2    . DT  B 2 2   ? -121.721 102.950 146.009 1.00 61.78  ?  2   DT  C O2    1 
ATOM   791  N  N3    . DT  B 2 2   ? -119.638 103.817 145.821 1.00 57.19  ?  2   DT  C N3    1 
ATOM   792  C  C4    . DT  B 2 2   ? -118.258 103.771 145.895 1.00 55.95  ?  2   DT  C C4    1 
ATOM   793  O  O4    . DT  B 2 2   ? -117.553 104.735 145.617 1.00 56.81  ?  2   DT  C O4    1 
ATOM   794  C  C5    . DT  B 2 2   ? -117.705 102.509 146.323 1.00 55.54  ?  2   DT  C C5    1 
ATOM   795  C  C7    . DT  B 2 2   ? -116.221 102.337 146.443 1.00 61.05  ?  2   DT  C C7    1 
ATOM   796  C  C6    . DT  B 2 2   ? -118.556 101.512 146.606 1.00 57.81  ?  2   DT  C C6    1 
ATOM   797  P  P     . DA  B 2 3   ? -123.044 96.963  145.647 1.00 62.97  ?  3   DA  C P     1 
ATOM   798  O  OP1   . DA  B 2 3   ? -124.034 96.080  146.301 1.00 78.03  -1 3   DA  C OP1   1 
ATOM   799  O  OP2   . DA  B 2 3   ? -121.968 96.377  144.818 1.00 66.16  ?  3   DA  C OP2   1 
ATOM   800  O  "O5'" . DA  B 2 3   ? -123.844 98.035  144.771 1.00 52.57  ?  3   DA  C "O5'" 1 
ATOM   801  C  "C5'" . DA  B 2 3   ? -124.889 98.791  145.362 1.00 51.47  ?  3   DA  C "C5'" 1 
ATOM   802  C  "C4'" . DA  B 2 3   ? -125.329 99.916  144.443 1.00 58.34  ?  3   DA  C "C4'" 1 
ATOM   803  O  "O4'" . DA  B 2 3   ? -124.284 100.919 144.363 1.00 60.19  ?  3   DA  C "O4'" 1 
ATOM   804  C  "C3'" . DA  B 2 3   ? -125.636 99.498  143.002 1.00 50.39  ?  3   DA  C "C3'" 1 
ATOM   805  O  "O3'" . DA  B 2 3   ? -126.867 100.073 142.587 1.00 55.94  ?  3   DA  C "O3'" 1 
ATOM   806  C  "C2'" . DA  B 2 3   ? -124.456 100.059 142.206 1.00 57.03  ?  3   DA  C "C2'" 1 
ATOM   807  C  "C1'" . DA  B 2 3   ? -124.096 101.290 143.019 1.00 53.04  ?  3   DA  C "C1'" 1 
ATOM   808  N  N9    . DA  B 2 3   ? -122.712 101.725 142.850 1.00 56.36  ?  3   DA  C N9    1 
ATOM   809  C  C8    . DA  B 2 3   ? -121.588 100.951 142.929 1.00 58.95  ?  3   DA  C C8    1 
ATOM   810  N  N7    . DA  B 2 3   ? -120.473 101.617 142.738 1.00 55.01  ?  3   DA  C N7    1 
ATOM   811  C  C5    . DA  B 2 3   ? -120.895 102.918 142.522 1.00 57.63  ?  3   DA  C C5    1 
ATOM   812  C  C6    . DA  B 2 3   ? -120.196 104.113 142.260 1.00 57.80  ?  3   DA  C C6    1 
ATOM   813  N  N6    . DA  B 2 3   ? -118.864 104.182 142.167 1.00 59.08  ?  3   DA  C N6    1 
ATOM   814  N  N1    . DA  B 2 3   ? -120.921 105.238 142.095 1.00 58.65  ?  3   DA  C N1    1 
ATOM   815  C  C2    . DA  B 2 3   ? -122.254 105.166 142.187 1.00 62.24  ?  3   DA  C C2    1 
ATOM   816  N  N3    . DA  B 2 3   ? -123.021 104.105 142.430 1.00 64.86  ?  3   DA  C N3    1 
ATOM   817  C  C4    . DA  B 2 3   ? -122.272 103.002 142.589 1.00 61.83  ?  3   DA  C C4    1 
ATOM   818  P  P     . DG  B 2 4   ? -127.687 99.442  141.358 1.00 63.47  ?  4   DG  C P     1 
ATOM   819  O  OP1   . DG  B 2 4   ? -129.080 99.235  141.813 1.00 64.42  -1 4   DG  C OP1   1 
ATOM   820  O  OP2   . DG  B 2 4   ? -126.910 98.299  140.830 1.00 61.25  ?  4   DG  C OP2   1 
ATOM   821  O  "O5'" . DG  B 2 4   ? -127.700 100.616 140.273 1.00 62.86  ?  4   DG  C "O5'" 1 
ATOM   822  C  "C5'" . DG  B 2 4   ? -128.284 101.870 140.601 1.00 57.84  ?  4   DG  C "C5'" 1 
ATOM   823  C  "C4'" . DG  B 2 4   ? -127.671 102.991 139.782 1.00 55.75  ?  4   DG  C "C4'" 1 
ATOM   824  O  "O4'" . DG  B 2 4   ? -126.273 103.119 140.097 1.00 56.79  ?  4   DG  C "O4'" 1 
ATOM   825  C  "C3'" . DG  B 2 4   ? -127.732 102.799 138.265 1.00 52.72  ?  4   DG  C "C3'" 1 
ATOM   826  O  "O3'" . DG  B 2 4   ? -128.744 103.637 137.714 1.00 56.24  ?  4   DG  C "O3'" 1 
ATOM   827  C  "C2'" . DG  B 2 4   ? -126.327 103.195 137.766 1.00 52.94  ?  4   DG  C "C2'" 1 
ATOM   828  C  "C1'" . DG  B 2 4   ? -125.647 103.749 139.016 1.00 53.43  ?  4   DG  C "C1'" 1 
ATOM   829  N  N9    . DG  B 2 4   ? -124.214 103.470 139.076 1.00 62.95  ?  4   DG  C N9    1 
ATOM   830  C  C8    . DG  B 2 4   ? -123.615 102.242 139.220 1.00 60.20  ?  4   DG  C C8    1 
ATOM   831  N  N7    . DG  B 2 4   ? -122.312 102.298 139.240 1.00 60.28  ?  4   DG  C N7    1 
ATOM   832  C  C5    . DG  B 2 4   ? -122.027 103.650 139.100 1.00 60.26  ?  4   DG  C C5    1 
ATOM   833  C  C6    . DG  B 2 4   ? -120.780 104.317 139.052 1.00 57.48  ?  4   DG  C C6    1 
ATOM   834  O  O6    . DG  B 2 4   ? -119.644 103.829 139.129 1.00 52.56  ?  4   DG  C O6    1 
ATOM   835  N  N1    . DG  B 2 4   ? -120.938 105.693 138.902 1.00 60.05  ?  4   DG  C N1    1 
ATOM   836  C  C2    . DG  B 2 4   ? -122.147 106.340 138.809 1.00 59.89  ?  4   DG  C C2    1 
ATOM   837  N  N2    . DG  B 2 4   ? -122.098 107.672 138.666 1.00 60.65  ?  4   DG  C N2    1 
ATOM   838  N  N3    . DG  B 2 4   ? -123.323 105.726 138.850 1.00 61.60  ?  4   DG  C N3    1 
ATOM   839  C  C4    . DG  B 2 4   ? -123.186 104.385 138.997 1.00 63.99  ?  4   DG  C C4    1 
ATOM   840  P  P     . DC  B 2 5   ? -129.090 103.576 136.146 1.00 53.95  ?  5   DC  C P     1 
ATOM   841  O  OP1   . DC  B 2 5   ? -130.461 104.104 135.973 1.00 49.52  ?  5   DC  C OP1   1 
ATOM   842  O  OP2   . DC  B 2 5   ? -128.758 102.219 135.657 1.00 65.13  -1 5   DC  C OP2   1 
ATOM   843  O  "O5'" . DC  B 2 5   ? -128.058 104.604 135.489 1.00 53.49  ?  5   DC  C "O5'" 1 
ATOM   844  C  "C5'" . DC  B 2 5   ? -127.952 105.922 136.005 1.00 52.45  ?  5   DC  C "C5'" 1 
ATOM   845  C  "C4'" . DC  B 2 5   ? -126.725 106.623 135.453 1.00 55.48  ?  5   DC  C "C4'" 1 
ATOM   846  O  "O4'" . DC  B 2 5   ? -125.529 105.980 135.948 1.00 62.99  ?  5   DC  C "O4'" 1 
ATOM   847  C  "C3'" . DC  B 2 5   ? -126.609 106.618 133.923 1.00 54.97  ?  5   DC  C "C3'" 1 
ATOM   848  O  "O3'" . DC  B 2 5   ? -126.613 107.953 133.435 1.00 70.23  ?  5   DC  C "O3'" 1 
ATOM   849  C  "C2'" . DC  B 2 5   ? -125.271 105.916 133.643 1.00 57.02  ?  5   DC  C "C2'" 1 
ATOM   850  C  "C1'" . DC  B 2 5   ? -124.537 106.080 134.963 1.00 63.40  ?  5   DC  C "C1'" 1 
ATOM   851  N  N1    . DC  B 2 5   ? -123.507 105.031 135.210 1.00 63.01  ?  5   DC  C N1    1 
ATOM   852  C  C2    . DC  B 2 5   ? -122.218 105.409 135.603 1.00 62.00  ?  5   DC  C C2    1 
ATOM   853  O  O2    . DC  B 2 5   ? -121.960 106.610 135.743 1.00 60.91  ?  5   DC  C O2    1 
ATOM   854  N  N3    . DC  B 2 5   ? -121.289 104.445 135.821 1.00 61.37  ?  5   DC  C N3    1 
ATOM   855  C  C4    . DC  B 2 5   ? -121.609 103.160 135.658 1.00 61.13  ?  5   DC  C C4    1 
ATOM   856  N  N4    . DC  B 2 5   ? -120.660 102.246 135.885 1.00 53.08  ?  5   DC  C N4    1 
ATOM   857  C  C5    . DC  B 2 5   ? -122.916 102.755 135.256 1.00 61.41  ?  5   DC  C C5    1 
ATOM   858  C  C6    . DC  B 2 5   ? -123.824 103.714 135.044 1.00 62.82  ?  5   DC  C C6    1 
ATOM   859  P  P     . DG  B 2 6   ? -126.438 108.244 131.865 1.00 75.66  ?  6   DG  C P     1 
ATOM   860  O  OP1   . DG  B 2 6   ? -127.331 109.374 131.522 1.00 71.50  ?  6   DG  C OP1   1 
ATOM   861  O  OP2   . DG  B 2 6   ? -126.571 106.958 131.144 1.00 67.00  -1 6   DG  C OP2   1 
ATOM   862  O  "O5'" . DG  B 2 6   ? -124.919 108.726 131.736 1.00 64.72  ?  6   DG  C "O5'" 1 
ATOM   863  C  "C5'" . DG  B 2 6   ? -124.440 109.780 132.561 1.00 65.79  ?  6   DG  C "C5'" 1 
ATOM   864  C  "C4'" . DG  B 2 6   ? -122.924 109.841 132.538 1.00 71.35  ?  6   DG  C "C4'" 1 
ATOM   865  O  "O4'" . DG  B 2 6   ? -122.385 108.602 133.024 1.00 73.85  ?  6   DG  C "O4'" 1 
ATOM   866  C  "C3'" . DG  B 2 6   ? -122.307 110.014 131.157 1.00 75.17  ?  6   DG  C "C3'" 1 
ATOM   867  O  "O3'" . DG  B 2 6   ? -122.083 111.394 130.892 1.00 76.02  ?  6   DG  C "O3'" 1 
ATOM   868  C  "C2'" . DG  B 2 6   ? -120.981 109.235 131.236 1.00 68.02  ?  6   DG  C "C2'" 1 
ATOM   869  C  "C1'" . DG  B 2 6   ? -121.056 108.503 132.580 1.00 70.38  ?  6   DG  C "C1'" 1 
ATOM   870  N  N9    . DG  B 2 6   ? -120.690 107.093 132.494 1.00 69.84  ?  6   DG  C N9    1 
ATOM   871  C  C8    . DG  B 2 6   ? -121.541 106.017 132.405 1.00 63.95  ?  6   DG  C C8    1 
ATOM   872  N  N7    . DG  B 2 6   ? -120.922 104.871 132.339 1.00 59.84  ?  6   DG  C N7    1 
ATOM   873  C  C5    . DG  B 2 6   ? -119.575 105.207 132.385 1.00 58.90  ?  6   DG  C C5    1 
ATOM   874  C  C6    . DG  B 2 6   ? -118.426 104.381 132.349 1.00 61.35  ?  6   DG  C C6    1 
ATOM   875  O  O6    . DG  B 2 6   ? -118.371 103.147 132.268 1.00 62.01  ?  6   DG  C O6    1 
ATOM   876  N  N1    . DG  B 2 6   ? -117.252 105.128 132.420 1.00 61.86  ?  6   DG  C N1    1 
ATOM   877  C  C2    . DG  B 2 6   ? -117.196 106.499 132.512 1.00 63.22  ?  6   DG  C C2    1 
ATOM   878  N  N2    . DG  B 2 6   ? -115.971 107.041 132.570 1.00 64.38  ?  6   DG  C N2    1 
ATOM   879  N  N3    . DG  B 2 6   ? -118.265 107.284 132.547 1.00 60.95  ?  6   DG  C N3    1 
ATOM   880  C  C4    . DG  B 2 6   ? -119.416 106.571 132.479 1.00 63.11  ?  6   DG  C C4    1 
ATOM   881  P  P     . DT  B 2 7   ? -121.691 111.880 129.411 1.00 84.49  ?  7   DT  C P     1 
ATOM   882  O  OP1   . DT  B 2 7   ? -121.951 113.335 129.331 1.00 83.30  ?  7   DT  C OP1   1 
ATOM   883  O  OP2   . DT  B 2 7   ? -122.343 110.962 128.451 1.00 69.34  -1 7   DT  C OP2   1 
ATOM   884  O  "O5'" . DT  B 2 7   ? -120.112 111.634 129.326 1.00 71.20  ?  7   DT  C "O5'" 1 
ATOM   885  C  "C5'" . DT  B 2 7   ? -119.243 112.250 130.271 1.00 73.04  ?  7   DT  C "C5'" 1 
ATOM   886  C  "C4'" . DT  B 2 7   ? -117.792 111.931 129.959 1.00 72.87  ?  7   DT  C "C4'" 1 
ATOM   887  O  "O4'" . DT  B 2 7   ? -117.530 110.529 130.236 1.00 72.19  ?  7   DT  C "O4'" 1 
ATOM   888  C  "C3'" . DT  B 2 7   ? -117.378 112.167 128.506 1.00 75.07  ?  7   DT  C "C3'" 1 
ATOM   889  O  "O3'" . DT  B 2 7   ? -116.114 112.817 128.458 1.00 76.86  ?  7   DT  C "O3'" 1 
ATOM   890  C  "C2'" . DT  B 2 7   ? -117.309 110.757 127.922 1.00 74.55  ?  7   DT  C "C2'" 1 
ATOM   891  C  "C1'" . DT  B 2 7   ? -116.878 109.945 129.132 1.00 71.94  ?  7   DT  C "C1'" 1 
ATOM   892  N  N1    . DT  B 2 7   ? -117.273 108.508 129.057 1.00 63.93  ?  7   DT  C N1    1 
ATOM   893  C  C2    . DT  B 2 7   ? -116.306 107.535 129.163 1.00 63.65  ?  7   DT  C C2    1 
ATOM   894  O  O2    . DT  B 2 7   ? -115.124 107.783 129.320 1.00 71.16  ?  7   DT  C O2    1 
ATOM   895  N  N3    . DT  B 2 7   ? -116.774 106.251 129.082 1.00 60.89  ?  7   DT  C N3    1 
ATOM   896  C  C4    . DT  B 2 7   ? -118.086 105.849 128.907 1.00 62.81  ?  7   DT  C C4    1 
ATOM   897  O  O4    . DT  B 2 7   ? -118.409 104.667 128.845 1.00 62.49  ?  7   DT  C O4    1 
ATOM   898  C  C5    . DT  B 2 7   ? -119.050 106.919 128.801 1.00 59.75  ?  7   DT  C C5    1 
ATOM   899  C  C7    . DT  B 2 7   ? -120.504 106.607 128.609 1.00 58.66  ?  7   DT  C C7    1 
ATOM   900  C  C6    . DT  B 2 7   ? -118.601 108.181 128.879 1.00 65.58  ?  7   DT  C C6    1 
ATOM   901  P  P     . DC  B 2 8   ? -115.583 113.450 127.080 1.00 88.52  ?  8   DC  C P     1 
ATOM   902  O  OP1   . DC  B 2 8   ? -114.760 114.632 127.419 1.00 82.66  ?  8   DC  C OP1   1 
ATOM   903  O  OP2   . DC  B 2 8   ? -116.744 113.594 126.174 1.00 85.06  -1 8   DC  C OP2   1 
ATOM   904  O  "O5'" . DC  B 2 8   ? -114.632 112.312 126.481 1.00 84.69  ?  8   DC  C "O5'" 1 
ATOM   905  C  "C5'" . DC  B 2 8   ? -113.509 111.863 127.229 1.00 80.33  ?  8   DC  C "C5'" 1 
ATOM   906  C  "C4'" . DC  B 2 8   ? -112.969 110.560 126.666 1.00 81.85  ?  8   DC  C "C4'" 1 
ATOM   907  O  "O4'" . DC  B 2 8   ? -113.915 109.502 126.906 1.00 70.80  ?  8   DC  C "O4'" 1 
ATOM   908  C  "C3'" . DC  B 2 8   ? -112.726 110.562 125.156 1.00 82.25  ?  8   DC  C "C3'" 1 
ATOM   909  O  "O3'" . DC  B 2 8   ? -111.330 110.628 124.890 1.00 90.59  ?  8   DC  C "O3'" 1 
ATOM   910  C  "C2'" . DC  B 2 8   ? -113.337 109.238 124.657 1.00 76.69  ?  8   DC  C "C2'" 1 
ATOM   911  C  "C1'" . DC  B 2 8   ? -113.712 108.507 125.943 1.00 67.24  ?  8   DC  C "C1'" 1 
ATOM   912  N  N1    . DC  B 2 8   ? -114.961 107.706 125.825 1.00 68.18  ?  8   DC  C N1    1 
ATOM   913  C  C2    . DC  B 2 8   ? -114.894 106.309 125.853 1.00 64.66  ?  8   DC  C C2    1 
ATOM   914  O  O2    . DC  B 2 8   ? -113.793 105.760 125.980 1.00 62.26  ?  8   DC  C O2    1 
ATOM   915  N  N3    . DC  B 2 8   ? -116.042 105.595 125.743 1.00 62.96  ?  8   DC  C N3    1 
ATOM   916  C  C4    . DC  B 2 8   ? -117.210 106.226 125.608 1.00 60.96  ?  8   DC  C C4    1 
ATOM   917  N  N4    . DC  B 2 8   ? -118.314 105.480 125.502 1.00 63.62  ?  8   DC  C N4    1 
ATOM   918  C  C5    . DC  B 2 8   ? -117.297 107.648 125.575 1.00 60.67  ?  8   DC  C C5    1 
ATOM   919  C  C6    . DC  B 2 8   ? -116.159 108.341 125.684 1.00 63.34  ?  8   DC  C C6    1 
ATOM   920  P  P     . DT  B 2 9   ? -110.799 110.777 123.382 1.00 101.30 ?  9   DT  C P     1 
ATOM   921  O  OP1   . DT  B 2 9   ? -109.458 111.402 123.442 1.00 100.47 ?  9   DT  C OP1   1 
ATOM   922  O  OP2   . DT  B 2 9   ? -111.872 111.412 122.585 1.00 93.59  -1 9   DT  C OP2   1 
ATOM   923  O  "O5'" . DT  B 2 9   ? -110.641 109.267 122.879 1.00 78.74  ?  9   DT  C "O5'" 1 
ATOM   924  C  "C5'" . DT  B 2 9   ? -109.838 108.356 123.618 1.00 76.17  ?  9   DT  C "C5'" 1 
ATOM   925  C  "C4'" . DT  B 2 9   ? -109.987 106.945 123.078 1.00 78.38  ?  9   DT  C "C4'" 1 
ATOM   926  O  "O4'" . DT  B 2 9   ? -111.331 106.477 123.311 1.00 77.95  ?  9   DT  C "O4'" 1 
ATOM   927  C  "C3'" . DT  B 2 9   ? -109.741 106.801 121.573 1.00 78.11  ?  9   DT  C "C3'" 1 
ATOM   928  O  "O3'" . DT  B 2 9   ? -108.564 106.035 121.346 1.00 80.67  ?  9   DT  C "O3'" 1 
ATOM   929  C  "C2'" . DT  B 2 9   ? -110.997 106.091 121.035 1.00 79.11  ?  9   DT  C "C2'" 1 
ATOM   930  C  "C1'" . DT  B 2 9   ? -111.672 105.572 122.298 1.00 74.17  ?  9   DT  C "C1'" 1 
ATOM   931  N  N1    . DT  B 2 9   ? -113.159 105.516 122.199 1.00 70.43  ?  9   DT  C N1    1 
ATOM   932  C  C2    . DT  B 2 9   ? -113.793 104.296 122.236 1.00 67.25  ?  9   DT  C C2    1 
ATOM   933  O  O2    . DT  B 2 9   ? -113.199 103.238 122.348 1.00 67.55  ?  9   DT  C O2    1 
ATOM   934  N  N3    . DT  B 2 9   ? -115.158 104.356 122.139 1.00 65.08  ?  9   DT  C N3    1 
ATOM   935  C  C4    . DT  B 2 9   ? -115.937 105.492 122.010 1.00 62.29  ?  9   DT  C C4    1 
ATOM   936  O  O4    . DT  B 2 9   ? -117.160 105.443 121.929 1.00 63.49  ?  9   DT  C O4    1 
ATOM   937  C  C5    . DT  B 2 9   ? -115.210 106.738 121.977 1.00 62.87  ?  9   DT  C C5    1 
ATOM   938  C  C7    . DT  B 2 9   ? -115.947 108.037 121.840 1.00 57.85  ?  9   DT  C C7    1 
ATOM   939  C  C6    . DT  B 2 9   ? -113.872 106.691 122.072 1.00 66.21  ?  9   DT  C C6    1 
ATOM   940  P  P     . DT  B 2 10  ? -108.004 105.834 119.853 1.00 97.96  ?  10  DT  C P     1 
ATOM   941  O  OP1   . DT  B 2 10  ? -106.535 105.669 119.938 1.00 90.41  ?  10  DT  C OP1   1 
ATOM   942  O  OP2   . DT  B 2 10  ? -108.580 106.902 119.007 1.00 85.62  -1 10  DT  C OP2   1 
ATOM   943  O  "O5'" . DT  B 2 10  ? -108.652 104.450 119.391 1.00 82.19  ?  10  DT  C "O5'" 1 
ATOM   944  C  "C5'" . DT  B 2 10  ? -108.612 103.324 120.256 1.00 77.69  ?  10  DT  C "C5'" 1 
ATOM   945  C  "C4'" . DT  B 2 10  ? -109.493 102.214 119.722 1.00 77.14  ?  10  DT  C "C4'" 1 
ATOM   946  O  "O4'" . DT  B 2 10  ? -110.875 102.517 120.005 1.00 75.61  ?  10  DT  C "O4'" 1 
ATOM   947  C  "C3'" . DT  B 2 10  ? -109.404 102.006 118.208 1.00 80.83  ?  10  DT  C "C3'" 1 
ATOM   948  O  "O3'" . DT  B 2 10  ? -108.830 100.739 117.923 1.00 89.68  ?  10  DT  C "O3'" 1 
ATOM   949  C  "C2'" . DT  B 2 10  ? -110.856 102.100 117.710 1.00 74.19  ?  10  DT  C "C2'" 1 
ATOM   950  C  "C1'" . DT  B 2 10  ? -111.671 101.970 118.989 1.00 75.29  ?  10  DT  C "C1'" 1 
ATOM   951  N  N1    . DT  B 2 10  ? -112.961 102.716 118.948 1.00 75.45  ?  10  DT  C N1    1 
ATOM   952  C  C2    . DT  B 2 10  ? -114.142 102.027 119.095 1.00 69.66  ?  10  DT  C C2    1 
ATOM   953  O  O2    . DT  B 2 10  ? -114.195 100.822 119.262 1.00 67.49  ?  10  DT  C O2    1 
ATOM   954  N  N3    . DT  B 2 10  ? -115.268 102.805 119.041 1.00 65.81  ?  10  DT  C N3    1 
ATOM   955  C  C4    . DT  B 2 10  ? -115.331 104.175 118.856 1.00 68.77  ?  10  DT  C C4    1 
ATOM   956  O  O4    . DT  B 2 10  ? -116.394 104.785 118.822 1.00 70.90  ?  10  DT  C O4    1 
ATOM   957  C  C5    . DT  B 2 10  ? -114.056 104.836 118.707 1.00 68.22  ?  10  DT  C C5    1 
ATOM   958  C  C7    . DT  B 2 10  ? -113.995 106.320 118.501 1.00 67.30  ?  10  DT  C C7    1 
ATOM   959  C  C6    . DT  B 2 10  ? -112.946 104.083 118.759 1.00 75.07  ?  10  DT  C C6    1 
ATOM   960  P  P     . DA  B 2 11  ? -108.238 100.436 116.461 1.00 103.79 ?  11  DA  C P     1 
ATOM   961  O  OP1   . DA  B 2 11  ? -107.023 99.608  116.627 1.00 95.46  ?  11  DA  C OP1   1 
ATOM   962  O  OP2   . DA  B 2 11  ? -108.160 101.724 115.736 1.00 91.64  -1 11  DA  C OP2   1 
ATOM   963  O  "O5'" . DA  B 2 11  ? -109.377 99.555  115.767 1.00 94.40  ?  11  DA  C "O5'" 1 
ATOM   964  C  "C5'" . DA  B 2 11  ? -109.868 98.391  116.419 1.00 85.28  ?  11  DA  C "C5'" 1 
ATOM   965  C  "C4'" . DA  B 2 11  ? -111.236 98.013  115.885 1.00 85.47  ?  11  DA  C "C4'" 1 
ATOM   966  O  "O4'" . DA  B 2 11  ? -112.220 98.936  116.390 1.00 90.18  ?  11  DA  C "O4'" 1 
ATOM   967  C  "C3'" . DA  B 2 11  ? -111.370 98.087  114.377 1.00 84.71  ?  11  DA  C "C3'" 1 
ATOM   968  O  "O3'" . DA  B 2 11  ? -110.963 96.849  113.803 1.00 88.35  ?  11  DA  C "O3'" 1 
ATOM   969  C  "C2'" . DA  B 2 11  ? -112.867 98.336  114.176 1.00 84.02  ?  11  DA  C "C2'" 1 
ATOM   970  C  "C1'" . DA  B 2 11  ? -113.292 99.039  115.473 1.00 85.42  ?  11  DA  C "C1'" 1 
ATOM   971  N  N9    . DA  B 2 11  ? -113.619 100.453 115.304 1.00 79.45  ?  11  DA  C N9    1 
ATOM   972  C  C8    . DA  B 2 11  ? -112.770 101.457 114.932 1.00 81.88  ?  11  DA  C C8    1 
ATOM   973  N  N7    . DA  B 2 11  ? -113.341 102.638 114.872 1.00 82.14  ?  11  DA  C N7    1 
ATOM   974  C  C5    . DA  B 2 11  ? -114.654 102.390 115.235 1.00 73.40  ?  11  DA  C C5    1 
ATOM   975  C  C6    . DA  B 2 11  ? -115.778 103.231 115.368 1.00 71.57  ?  11  DA  C C6    1 
ATOM   976  N  N6    . DA  B 2 11  ? -115.743 104.548 115.136 1.00 79.63  ?  11  DA  C N6    1 
ATOM   977  N  N1    . DA  B 2 11  ? -116.942 102.664 115.746 1.00 65.68  ?  11  DA  C N1    1 
ATOM   978  C  C2    . DA  B 2 11  ? -116.973 101.346 115.975 1.00 62.59  ?  11  DA  C C2    1 
ATOM   979  N  N3    . DA  B 2 11  ? -115.986 100.456 115.885 1.00 63.66  ?  11  DA  C N3    1 
ATOM   980  C  C4    . DA  B 2 11  ? -114.842 101.049 115.507 1.00 71.02  ?  11  DA  C C4    1 
ATOM   981  P  P     . DG  B 2 12  ? -110.728 96.721  112.219 1.00 96.22  ?  12  DG  C P     1 
ATOM   982  O  OP1   . DG  B 2 12  ? -109.828 95.568  111.994 1.00 93.09  ?  12  DG  C OP1   1 
ATOM   983  O  OP2   . DG  B 2 12  ? -110.358 98.058  111.705 1.00 99.47  -1 12  DG  C OP2   1 
ATOM   984  O  "O5'" . DG  B 2 12  ? -112.177 96.360  111.650 1.00 96.38  ?  12  DG  C "O5'" 1 
ATOM   985  C  "C5'" . DG  B 2 12  ? -112.923 95.300  112.233 1.00 93.95  ?  12  DG  C "C5'" 1 
ATOM   986  C  "C4'" . DG  B 2 12  ? -114.375 95.367  111.802 1.00 104.02 ?  12  DG  C "C4'" 1 
ATOM   987  O  "O4'" . DG  B 2 12  ? -114.974 96.588  112.306 1.00 100.57 ?  12  DG  C "O4'" 1 
ATOM   988  C  "C3'" . DG  B 2 12  ? -114.593 95.367  110.288 1.00 105.29 ?  12  DG  C "C3'" 1 
ATOM   989  O  "O3'" . DG  B 2 12  ? -115.594 94.422  109.941 1.00 118.41 ?  12  DG  C "O3'" 1 
ATOM   990  C  "C2'" . DG  B 2 12  ? -115.029 96.801  109.976 1.00 96.03  ?  12  DG  C "C2'" 1 
ATOM   991  C  "C1'" . DG  B 2 12  ? -115.691 97.228  111.277 1.00 87.75  ?  12  DG  C "C1'" 1 
ATOM   992  N  N9    . DG  B 2 12  ? -115.633 98.670  111.507 1.00 77.63  ?  12  DG  C N9    1 
ATOM   993  C  C8    . DG  B 2 12  ? -114.528 99.480  111.397 1.00 78.84  ?  12  DG  C C8    1 
ATOM   994  N  N7    . DG  B 2 12  ? -114.773 100.733 111.663 1.00 80.25  ?  12  DG  C N7    1 
ATOM   995  C  C5    . DG  B 2 12  ? -116.127 100.758 111.970 1.00 75.51  ?  12  DG  C C5    1 
ATOM   996  C  C6    . DG  B 2 12  ? -116.957 101.843 112.339 1.00 68.84  ?  12  DG  C C6    1 
ATOM   997  O  O6    . DG  B 2 12  ? -116.649 103.035 112.470 1.00 64.38  ?  12  DG  C O6    1 
ATOM   998  N  N1    . DG  B 2 12  ? -118.270 101.434 112.563 1.00 67.01  ?  12  DG  C N1    1 
ATOM   999  C  C2    . DG  B 2 12  ? -118.721 100.140 112.447 1.00 68.71  ?  12  DG  C C2    1 
ATOM   1000 N  N2    . DG  B 2 12  ? -120.022 99.940  112.704 1.00 68.76  ?  12  DG  C N2    1 
ATOM   1001 N  N3    . DG  B 2 12  ? -117.953 99.114  112.102 1.00 70.75  ?  12  DG  C N3    1 
ATOM   1002 C  C4    . DG  B 2 12  ? -116.672 99.496  111.880 1.00 75.21  ?  12  DG  C C4    1 
ATOM   1003 P  P     . DC  B 2 13  ? -115.932 94.134  108.398 1.00 125.53 ?  13  DC  C P     1 
ATOM   1004 O  OP1   . DC  B 2 13  ? -116.314 92.710  108.278 1.00 118.16 ?  13  DC  C OP1   1 
ATOM   1005 O  OP2   . DC  B 2 13  ? -114.818 94.671  107.585 1.00 113.34 -1 13  DC  C OP2   1 
ATOM   1006 O  "O5'" . DC  B 2 13  ? -117.220 95.038  108.124 1.00 103.27 ?  13  DC  C "O5'" 1 
ATOM   1007 C  "C5'" . DC  B 2 13  ? -118.321 94.979  109.018 1.00 102.41 ?  13  DC  C "C5'" 1 
ATOM   1008 C  "C4'" . DC  B 2 13  ? -119.274 96.133  108.775 1.00 100.26 ?  13  DC  C "C4'" 1 
ATOM   1009 O  "O4'" . DC  B 2 13  ? -118.673 97.363  109.230 1.00 93.49  ?  13  DC  C "O4'" 1 
ATOM   1010 C  "C3'" . DC  B 2 13  ? -119.650 96.359  107.308 1.00 92.77  ?  13  DC  C "C3'" 1 
ATOM   1011 O  "O3'" . DC  B 2 13  ? -121.036 96.109  107.125 1.00 95.20  ?  13  DC  C "O3'" 1 
ATOM   1012 C  "C2'" . DC  B 2 13  ? -119.292 97.831  107.034 1.00 83.23  ?  13  DC  C "C2'" 1 
ATOM   1013 C  "C1'" . DC  B 2 13  ? -119.150 98.412  108.435 1.00 83.71  ?  13  DC  C "C1'" 1 
ATOM   1014 N  N1    . DC  B 2 13  ? -118.183 99.544  108.520 1.00 74.72  ?  13  DC  C N1    1 
ATOM   1015 C  C2    . DC  B 2 13  ? -118.591 100.759 109.081 1.00 71.18  ?  13  DC  C C2    1 
ATOM   1016 O  O2    . DC  B 2 13  ? -119.751 100.872 109.494 1.00 69.71  ?  13  DC  C O2    1 
ATOM   1017 N  N3    . DC  B 2 13  ? -117.701 101.780 109.155 1.00 66.08  ?  13  DC  C N3    1 
ATOM   1018 C  C4    . DC  B 2 13  ? -116.459 101.617 108.697 1.00 69.77  ?  13  DC  C C4    1 
ATOM   1019 N  N4    . DC  B 2 13  ? -115.618 102.653 108.791 1.00 69.54  ?  13  DC  C N4    1 
ATOM   1020 C  C5    . DC  B 2 13  ? -116.024 100.386 108.123 1.00 76.33  ?  13  DC  C C5    1 
ATOM   1021 C  C6    . DC  B 2 13  ? -116.911 99.386  108.056 1.00 75.55  ?  13  DC  C C6    1 
ATOM   1022 P  P     . DA  B 2 14  ? -121.682 96.165  105.656 1.00 92.45  ?  14  DA  C P     1 
ATOM   1023 O  OP1   . DA  B 2 14  ? -122.810 95.208  105.622 1.00 91.08  ?  14  DA  C OP1   1 
ATOM   1024 O  OP2   . DA  B 2 14  ? -120.583 96.047  104.672 1.00 83.79  -1 14  DA  C OP2   1 
ATOM   1025 O  "O5'" . DA  B 2 14  ? -122.263 97.649  105.561 1.00 81.90  ?  14  DA  C "O5'" 1 
ATOM   1026 C  "C5'" . DA  B 2 14  ? -122.987 98.196  106.653 1.00 81.53  ?  14  DA  C "C5'" 1 
ATOM   1027 C  "C4'" . DA  B 2 14  ? -123.140 99.693  106.486 1.00 85.87  ?  14  DA  C "C4'" 1 
ATOM   1028 O  "O4'" . DA  B 2 14  ? -121.945 100.353 106.928 1.00 88.74  ?  14  DA  C "O4'" 1 
ATOM   1029 C  "C3'" . DA  B 2 14  ? -123.319 100.147 105.047 1.00 87.88  ?  14  DA  C "C3'" 1 
ATOM   1030 O  "O3'" . DA  B 2 14  ? -124.696 100.244 104.739 1.00 84.89  ?  14  DA  C "O3'" 1 
ATOM   1031 C  "C2'" . DA  B 2 14  ? -122.632 101.522 104.997 1.00 79.09  ?  14  DA  C "C2'" 1 
ATOM   1032 C  "C1'" . DA  B 2 14  ? -121.911 101.630 106.343 1.00 75.41  ?  14  DA  C "C1'" 1 
ATOM   1033 N  N9    . DA  B 2 14  ? -120.521 102.057 106.221 1.00 71.42  ?  14  DA  C N9    1 
ATOM   1034 C  C8    . DA  B 2 14  ? -119.437 101.274 105.939 1.00 71.89  ?  14  DA  C C8    1 
ATOM   1035 N  N7    . DA  B 2 14  ? -118.305 101.936 105.891 1.00 75.37  ?  14  DA  C N7    1 
ATOM   1036 C  C5    . DA  B 2 14  ? -118.674 103.245 106.157 1.00 70.97  ?  14  DA  C C5    1 
ATOM   1037 C  C6    . DA  B 2 14  ? -117.935 104.441 106.252 1.00 69.36  ?  14  DA  C C6    1 
ATOM   1038 N  N6    . DA  B 2 14  ? -116.610 104.505 106.078 1.00 69.84  ?  14  DA  C N6    1 
ATOM   1039 N  N1    . DA  B 2 14  ? -118.613 105.573 106.532 1.00 63.51  ?  14  DA  C N1    1 
ATOM   1040 C  C2    . DA  B 2 14  ? -119.939 105.505 106.705 1.00 65.47  ?  14  DA  C C2    1 
ATOM   1041 N  N3    . DA  B 2 14  ? -120.739 104.444 106.641 1.00 67.61  ?  14  DA  C N3    1 
ATOM   1042 C  C4    . DA  B 2 14  ? -120.037 103.335 106.362 1.00 68.43  ?  14  DA  C C4    1 
ATOM   1043 P  P     . DT  B 2 15  ? -125.160 100.674 103.264 1.00 92.88  ?  15  DT  C P     1 
ATOM   1044 O  OP1   . DT  B 2 15  ? -126.417 99.959  102.967 1.00 76.11  ?  15  DT  C OP1   1 
ATOM   1045 O  OP2   . DT  B 2 15  ? -123.992 100.523 102.366 1.00 92.99  -1 15  DT  C OP2   1 
ATOM   1046 O  "O5'" . DT  B 2 15  ? -125.459 102.237 103.399 1.00 84.78  ?  15  DT  C "O5'" 1 
ATOM   1047 C  "C5'" . DT  B 2 15  ? -125.922 102.770 104.633 1.00 75.61  ?  15  DT  C "C5'" 1 
ATOM   1048 C  "C4'" . DT  B 2 15  ? -125.694 104.267 104.679 1.00 75.20  ?  15  DT  C "C4'" 1 
ATOM   1049 O  "O4'" . DT  B 2 15  ? -124.280 104.541 104.842 1.00 79.49  ?  15  DT  C "O4'" 1 
ATOM   1050 C  "C3'" . DT  B 2 15  ? -126.136 105.015 103.418 1.00 73.48  ?  15  DT  C "C3'" 1 
ATOM   1051 O  "O3'" . DT  B 2 15  ? -127.000 106.084 103.765 1.00 85.54  ?  15  DT  C "O3'" 1 
ATOM   1052 C  "C2'" . DT  B 2 15  ? -124.825 105.518 102.801 1.00 77.21  ?  15  DT  C "C2'" 1 
ATOM   1053 C  "C1'" . DT  B 2 15  ? -123.924 105.624 104.018 1.00 76.93  ?  15  DT  C "C1'" 1 
ATOM   1054 N  N1    . DT  B 2 15  ? -122.471 105.521 103.698 1.00 71.43  ?  15  DT  C N1    1 
ATOM   1055 C  C2    . DT  B 2 15  ? -121.663 106.617 103.885 1.00 70.63  ?  15  DT  C C2    1 
ATOM   1056 O  O2    . DT  B 2 15  ? -122.074 107.684 104.303 1.00 73.24  ?  15  DT  C O2    1 
ATOM   1057 N  N3    . DT  B 2 15  ? -120.347 106.419 103.564 1.00 63.66  ?  15  DT  C N3    1 
ATOM   1058 C  C4    . DT  B 2 15  ? -119.769 105.258 103.084 1.00 63.75  ?  15  DT  C C4    1 
ATOM   1059 O  O4    . DT  B 2 15  ? -118.573 105.179 102.825 1.00 65.26  ?  15  DT  C O4    1 
ATOM   1060 C  C5    . DT  B 2 15  ? -120.673 104.146 102.910 1.00 68.08  ?  15  DT  C C5    1 
ATOM   1061 C  C7    . DT  B 2 15  ? -120.163 102.833 102.396 1.00 71.77  ?  15  DT  C C7    1 
ATOM   1062 C  C6    . DT  B 2 15  ? -121.965 104.331 103.220 1.00 70.71  ?  15  DT  C C6    1 
ATOM   1063 P  P     . DG  B 2 16  ? -127.581 107.051 102.622 1.00 77.54  ?  16  DG  C P     1 
ATOM   1064 O  OP1   . DG  B 2 16  ? -128.925 107.501 103.048 1.00 80.95  ?  16  DG  C OP1   1 
ATOM   1065 O  OP2   . DG  B 2 16  ? -127.415 106.358 101.325 1.00 72.79  -1 16  DG  C OP2   1 
ATOM   1066 O  "O5'" . DG  B 2 16  ? -126.584 108.300 102.640 1.00 74.00  ?  16  DG  C "O5'" 1 
ATOM   1067 C  "C5'" . DG  B 2 16  ? -126.619 109.248 101.586 1.00 81.78  ?  16  DG  C "C5'" 1 
ATOM   1068 C  "C4'" . DG  B 2 16  ? -125.548 110.306 101.771 1.00 71.49  ?  16  DG  C "C4'" 1 
ATOM   1069 O  "O4'" . DG  B 2 16  ? -124.363 109.701 102.330 1.00 74.84  ?  16  DG  C "O4'" 1 
ATOM   1070 C  "C3'" . DG  B 2 16  ? -125.077 110.963 100.488 1.00 83.23  ?  16  DG  C "C3'" 1 
ATOM   1071 O  "O3'" . DG  B 2 16  ? -125.936 112.047 100.152 1.00 86.66  ?  16  DG  C "O3'" 1 
ATOM   1072 C  "C2'" . DG  B 2 16  ? -123.680 111.451 100.867 1.00 77.19  ?  16  DG  C "C2'" 1 
ATOM   1073 C  "C1'" . DG  B 2 16  ? -123.212 110.387 101.866 1.00 78.70  ?  16  DG  C "C1'" 1 
ATOM   1074 N  N9    . DG  B 2 16  ? -122.285 109.411 101.297 1.00 75.23  ?  16  DG  C N9    1 
ATOM   1075 C  C8    . DG  B 2 16  ? -122.586 108.147 100.849 1.00 72.00  ?  16  DG  C C8    1 
ATOM   1076 N  N7    . DG  B 2 16  ? -121.550 107.497 100.394 1.00 63.78  ?  16  DG  C N7    1 
ATOM   1077 C  C5    . DG  B 2 16  ? -120.494 108.386 100.553 1.00 63.11  ?  16  DG  C C5    1 
ATOM   1078 C  C6    . DG  B 2 16  ? -119.122 108.237 100.237 1.00 64.30  ?  16  DG  C C6    1 
ATOM   1079 O  O6    . DG  B 2 16  ? -118.551 107.258 99.738  1.00 65.69  ?  16  DG  C O6    1 
ATOM   1080 N  N1    . DG  B 2 16  ? -118.393 109.380 100.558 1.00 59.43  ?  16  DG  C N1    1 
ATOM   1081 C  C2    . DG  B 2 16  ? -118.922 110.521 101.113 1.00 65.36  ?  16  DG  C C2    1 
ATOM   1082 N  N2    . DG  B 2 16  ? -118.061 111.521 101.353 1.00 64.99  ?  16  DG  C N2    1 
ATOM   1083 N  N3    . DG  B 2 16  ? -120.206 110.673 101.415 1.00 69.84  ?  16  DG  C N3    1 
ATOM   1084 C  C4    . DG  B 2 16  ? -120.930 109.568 101.108 1.00 68.51  ?  16  DG  C C4    1 
ATOM   1085 O  "O5'" . DT  C 3 1   ? -109.114 105.989 98.767  1.00 75.60  ?  1   DT  D "O5'" 1 
ATOM   1086 C  "C5'" . DT  C 3 1   ? -107.897 106.620 98.390  1.00 76.88  ?  1   DT  D "C5'" 1 
ATOM   1087 C  "C4'" . DT  C 3 1   ? -108.104 108.109 98.176  1.00 79.88  ?  1   DT  D "C4'" 1 
ATOM   1088 O  "O4'" . DT  C 3 1   ? -108.981 108.317 97.041  1.00 77.37  ?  1   DT  D "O4'" 1 
ATOM   1089 C  "C3'" . DT  C 3 1   ? -108.778 108.834 99.327  1.00 80.25  ?  1   DT  D "C3'" 1 
ATOM   1090 O  "O3'" . DT  C 3 1   ? -107.810 109.233 100.288 1.00 82.59  ?  1   DT  D "O3'" 1 
ATOM   1091 C  "C2'" . DT  C 3 1   ? -109.394 110.035 98.620  1.00 83.04  ?  1   DT  D "C2'" 1 
ATOM   1092 C  "C1'" . DT  C 3 1   ? -109.837 109.421 97.291  1.00 76.81  ?  1   DT  D "C1'" 1 
ATOM   1093 N  N1    . DT  C 3 1   ? -111.251 108.939 97.299  1.00 77.01  ?  1   DT  D N1    1 
ATOM   1094 C  C2    . DT  C 3 1   ? -112.276 109.856 97.270  1.00 75.21  ?  1   DT  D C2    1 
ATOM   1095 O  O2    . DT  C 3 1   ? -112.096 111.061 97.238  1.00 71.86  ?  1   DT  D O2    1 
ATOM   1096 N  N3    . DT  C 3 1   ? -113.533 109.310 97.281  1.00 68.54  ?  1   DT  D N3    1 
ATOM   1097 C  C4    . DT  C 3 1   ? -113.860 107.967 97.316  1.00 68.25  ?  1   DT  D C4    1 
ATOM   1098 O  O4    . DT  C 3 1   ? -115.023 107.575 97.323  1.00 70.77  ?  1   DT  D O4    1 
ATOM   1099 C  C5    . DT  C 3 1   ? -112.738 107.059 97.345  1.00 68.10  ?  1   DT  D C5    1 
ATOM   1100 C  C7    . DT  C 3 1   ? -112.968 105.577 97.384  1.00 64.72  ?  1   DT  D C7    1 
ATOM   1101 C  C6    . DT  C 3 1   ? -111.503 107.582 97.334  1.00 71.97  ?  1   DT  D C6    1 
ATOM   1102 P  P     . DC  C 3 2   ? -108.114 109.064 101.857 1.00 93.47  ?  2   DC  D P     1 
ATOM   1103 O  OP1   . DC  C 3 2   ? -106.904 109.490 102.594 1.00 99.09  ?  2   DC  D OP1   1 
ATOM   1104 O  OP2   . DC  C 3 2   ? -108.663 107.706 102.065 1.00 78.84  -1 2   DC  D OP2   1 
ATOM   1105 O  "O5'" . DC  C 3 2   ? -109.287 110.115 102.139 1.00 90.53  ?  2   DC  D "O5'" 1 
ATOM   1106 C  "C5'" . DC  C 3 2   ? -109.065 111.502 101.919 1.00 86.80  ?  2   DC  D "C5'" 1 
ATOM   1107 C  "C4'" . DC  C 3 2   ? -110.380 112.255 101.835 1.00 82.16  ?  2   DC  D "C4'" 1 
ATOM   1108 O  "O4'" . DC  C 3 2   ? -111.203 111.680 100.797 1.00 81.25  ?  2   DC  D "O4'" 1 
ATOM   1109 C  "C3'" . DC  C 3 2   ? -111.238 112.184 103.082 1.00 82.51  ?  2   DC  D "C3'" 1 
ATOM   1110 O  "O3'" . DC  C 3 2   ? -110.833 113.190 104.006 1.00 88.76  ?  2   DC  D "O3'" 1 
ATOM   1111 C  "C2'" . DC  C 3 2   ? -112.635 112.464 102.530 1.00 81.11  ?  2   DC  D "C2'" 1 
ATOM   1112 C  "C1'" . DC  C 3 2   ? -112.570 111.885 101.111 1.00 78.82  ?  2   DC  D "C1'" 1 
ATOM   1113 N  N1    . DC  C 3 2   ? -113.299 110.589 100.956 1.00 71.09  ?  2   DC  D N1    1 
ATOM   1114 C  C2    . DC  C 3 2   ? -114.700 110.566 101.018 1.00 68.02  ?  2   DC  D C2    1 
ATOM   1115 O  O2    . DC  C 3 2   ? -115.316 111.623 101.205 1.00 66.60  ?  2   DC  D O2    1 
ATOM   1116 N  N3    . DC  C 3 2   ? -115.343 109.381 100.873 1.00 65.63  ?  2   DC  D N3    1 
ATOM   1117 C  C4    . DC  C 3 2   ? -114.646 108.262 100.672 1.00 68.86  ?  2   DC  D C4    1 
ATOM   1118 N  N4    . DC  C 3 2   ? -115.325 107.119 100.535 1.00 63.39  ?  2   DC  D N4    1 
ATOM   1119 C  C5    . DC  C 3 2   ? -113.221 108.266 100.604 1.00 68.82  ?  2   DC  D C5    1 
ATOM   1120 C  C6    . DC  C 3 2   ? -112.596 109.439 100.748 1.00 72.71  ?  2   DC  D C6    1 
ATOM   1121 P  P     . DA  C 3 3   ? -111.144 113.028 105.575 1.00 98.78  ?  3   DA  D P     1 
ATOM   1122 O  OP1   . DA  C 3 3   ? -110.409 114.094 106.291 1.00 95.56  ?  3   DA  D OP1   1 
ATOM   1123 O  OP2   . DA  C 3 3   ? -110.923 111.610 105.935 1.00 90.14  -1 3   DA  D OP2   1 
ATOM   1124 O  "O5'" . DA  C 3 3   ? -112.711 113.324 105.691 1.00 76.28  ?  3   DA  D "O5'" 1 
ATOM   1125 C  "C5'" . DA  C 3 3   ? -113.235 114.569 105.246 1.00 79.87  ?  3   DA  D "C5'" 1 
ATOM   1126 C  "C4'" . DA  C 3 3   ? -114.751 114.547 105.269 1.00 81.15  ?  3   DA  D "C4'" 1 
ATOM   1127 O  "O4'" . DA  C 3 3   ? -115.230 113.419 104.490 1.00 81.93  ?  3   DA  D "O4'" 1 
ATOM   1128 C  "C3'" . DA  C 3 3   ? -115.362 114.400 106.661 1.00 99.34  ?  3   DA  D "C3'" 1 
ATOM   1129 O  "O3'" . DA  C 3 3   ? -116.450 115.296 106.819 1.00 104.22 ?  3   DA  D "O3'" 1 
ATOM   1130 C  "C2'" . DA  C 3 3   ? -115.815 112.943 106.707 1.00 92.21  ?  3   DA  D "C2'" 1 
ATOM   1131 C  "C1'" . DA  C 3 3   ? -116.143 112.660 105.250 1.00 76.22  ?  3   DA  D "C1'" 1 
ATOM   1132 N  N9    . DA  C 3 3   ? -115.988 111.252 104.888 1.00 71.82  ?  3   DA  D N9    1 
ATOM   1133 C  C8    . DA  C 3 3   ? -114.816 110.561 104.752 1.00 71.99  ?  3   DA  D C8    1 
ATOM   1134 N  N7    . DA  C 3 3   ? -114.979 109.302 104.421 1.00 71.32  ?  3   DA  D N7    1 
ATOM   1135 C  C5    . DA  C 3 3   ? -116.353 109.155 104.333 1.00 66.06  ?  3   DA  D C5    1 
ATOM   1136 C  C6    . DA  C 3 3   ? -117.172 108.052 104.018 1.00 61.30  ?  3   DA  D C6    1 
ATOM   1137 N  N6    . DA  C 3 3   ? -116.693 106.840 103.721 1.00 57.39  ?  3   DA  D N6    1 
ATOM   1138 N  N1    . DA  C 3 3   ? -118.508 108.244 104.021 1.00 60.87  ?  3   DA  D N1    1 
ATOM   1139 C  C2    . DA  C 3 3   ? -118.984 109.459 104.318 1.00 62.94  ?  3   DA  D C2    1 
ATOM   1140 N  N3    . DA  C 3 3   ? -118.316 110.569 104.630 1.00 71.59  ?  3   DA  D N3    1 
ATOM   1141 C  C4    . DA  C 3 3   ? -116.992 110.347 104.620 1.00 70.33  ?  3   DA  D C4    1 
ATOM   1142 P  P     . DT  C 3 4   ? -116.982 115.658 108.291 1.00 108.75 ?  4   DT  D P     1 
ATOM   1143 O  OP1   . DT  C 3 4   ? -117.507 117.041 108.255 1.00 101.00 ?  4   DT  D OP1   1 
ATOM   1144 O  OP2   . DT  C 3 4   ? -115.913 115.299 109.250 1.00 93.97  -1 4   DT  D OP2   1 
ATOM   1145 O  "O5'" . DT  C 3 4   ? -118.198 114.645 108.513 1.00 94.58  ?  4   DT  D "O5'" 1 
ATOM   1146 C  "C5'" . DT  C 3 4   ? -119.283 114.636 107.597 1.00 94.62  ?  4   DT  D "C5'" 1 
ATOM   1147 C  "C4'" . DT  C 3 4   ? -120.179 113.435 107.833 1.00 94.99  ?  4   DT  D "C4'" 1 
ATOM   1148 O  "O4'" . DT  C 3 4   ? -119.541 112.242 107.322 1.00 94.22  ?  4   DT  D "O4'" 1 
ATOM   1149 C  "C3'" . DT  C 3 4   ? -120.508 113.152 109.302 1.00 87.11  ?  4   DT  D "C3'" 1 
ATOM   1150 O  "O3'" . DT  C 3 4   ? -121.911 113.234 109.505 1.00 91.06  ?  4   DT  D "O3'" 1 
ATOM   1151 C  "C2'" . DT  C 3 4   ? -119.975 111.731 109.550 1.00 84.77  ?  4   DT  D "C2'" 1 
ATOM   1152 C  "C1'" . DT  C 3 4   ? -119.889 111.161 108.143 1.00 81.34  ?  4   DT  D "C1'" 1 
ATOM   1153 N  N1    . DT  C 3 4   ? -118.852 110.099 107.986 1.00 76.09  ?  4   DT  D N1    1 
ATOM   1154 C  C2    . DT  C 3 4   ? -119.231 108.848 107.562 1.00 72.06  ?  4   DT  D C2    1 
ATOM   1155 O  O2    . DT  C 3 4   ? -120.384 108.551 107.303 1.00 66.99  ?  4   DT  D O2    1 
ATOM   1156 N  N3    . DT  C 3 4   ? -118.205 107.948 107.447 1.00 64.33  ?  4   DT  D N3    1 
ATOM   1157 C  C4    . DT  C 3 4   ? -116.866 108.167 107.710 1.00 62.46  ?  4   DT  D C4    1 
ATOM   1158 O  O4    . DT  C 3 4   ? -116.018 107.290 107.576 1.00 60.59  ?  4   DT  D O4    1 
ATOM   1159 C  C5    . DT  C 3 4   ? -116.535 109.500 108.152 1.00 63.56  ?  4   DT  D C5    1 
ATOM   1160 C  C7    . DT  C 3 4   ? -115.113 109.858 108.468 1.00 63.36  ?  4   DT  D C7    1 
ATOM   1161 C  C6    . DT  C 3 4   ? -117.533 110.391 108.268 1.00 71.90  ?  4   DT  D C6    1 
ATOM   1162 P  P     . DG  C 3 5   ? -122.543 112.921 110.948 1.00 100.61 ?  5   DG  D P     1 
ATOM   1163 O  OP1   . DG  C 3 5   ? -123.756 113.755 111.100 1.00 87.45  ?  5   DG  D OP1   1 
ATOM   1164 O  OP2   . DG  C 3 5   ? -121.457 113.010 111.949 1.00 97.52  -1 5   DG  D OP2   1 
ATOM   1165 O  "O5'" . DG  C 3 5   ? -122.984 111.390 110.841 1.00 83.12  ?  5   DG  D "O5'" 1 
ATOM   1166 C  "C5'" . DG  C 3 5   ? -123.801 110.963 109.760 1.00 83.98  ?  5   DG  D "C5'" 1 
ATOM   1167 C  "C4'" . DG  C 3 5   ? -124.176 109.503 109.918 1.00 82.89  ?  5   DG  D "C4'" 1 
ATOM   1168 O  "O4'" . DG  C 3 5   ? -123.069 108.669 109.489 1.00 90.30  ?  5   DG  D "O4'" 1 
ATOM   1169 C  "C3'" . DG  C 3 5   ? -124.504 109.081 111.348 1.00 91.75  ?  5   DG  D "C3'" 1 
ATOM   1170 O  "O3'" . DG  C 3 5   ? -125.628 108.219 111.353 1.00 103.21 ?  5   DG  D "O3'" 1 
ATOM   1171 C  "C2'" . DG  C 3 5   ? -123.238 108.359 111.804 1.00 84.50  ?  5   DG  D "C2'" 1 
ATOM   1172 C  "C1'" . DG  C 3 5   ? -122.744 107.745 110.504 1.00 82.68  ?  5   DG  D "C1'" 1 
ATOM   1173 N  N9    . DG  C 3 5   ? -121.302 107.523 110.478 1.00 72.23  ?  5   DG  D N9    1 
ATOM   1174 C  C8    . DG  C 3 5   ? -120.316 108.460 110.674 1.00 72.44  ?  5   DG  D C8    1 
ATOM   1175 N  N7    . DG  C 3 5   ? -119.110 107.971 110.592 1.00 69.54  ?  5   DG  D N7    1 
ATOM   1176 C  C5    . DG  C 3 5   ? -119.308 106.623 110.323 1.00 65.18  ?  5   DG  D C5    1 
ATOM   1177 C  C6    . DG  C 3 5   ? -118.366 105.584 110.129 1.00 68.99  ?  5   DG  D C6    1 
ATOM   1178 O  O6    . DG  C 3 5   ? -117.129 105.654 110.158 1.00 66.41  ?  5   DG  D O6    1 
ATOM   1179 N  N1    . DG  C 3 5   ? -118.991 104.364 109.882 1.00 64.66  ?  5   DG  D N1    1 
ATOM   1180 C  C2    . DG  C 3 5   ? -120.352 104.174 109.828 1.00 66.72  ?  5   DG  D C2    1 
ATOM   1181 N  N2    . DG  C 3 5   ? -120.769 102.926 109.578 1.00 66.77  ?  5   DG  D N2    1 
ATOM   1182 N  N3    . DG  C 3 5   ? -121.243 105.139 110.008 1.00 67.05  ?  5   DG  D N3    1 
ATOM   1183 C  C4    . DG  C 3 5   ? -120.652 106.332 110.249 1.00 67.04  ?  5   DG  D C4    1 
ATOM   1184 P  P     . DC  C 3 6   ? -126.424 107.940 112.720 1.00 114.11 ?  6   DC  D P     1 
ATOM   1185 O  OP1   . DC  C 3 6   ? -127.781 108.515 112.585 1.00 93.61  ?  6   DC  D OP1   1 
ATOM   1186 O  OP2   . DC  C 3 6   ? -125.552 108.360 113.839 1.00 88.95  -1 6   DC  D OP2   1 
ATOM   1187 O  "O5'" . DC  C 3 6   ? -126.534 106.348 112.768 1.00 103.13 ?  6   DC  D "O5'" 1 
ATOM   1188 C  "C5'" . DC  C 3 6   ? -126.377 105.591 111.575 1.00 87.79  ?  6   DC  D "C5'" 1 
ATOM   1189 C  "C4'" . DC  C 3 6   ? -125.819 104.219 111.892 1.00 88.97  ?  6   DC  D "C4'" 1 
ATOM   1190 O  "O4'" . DC  C 3 6   ? -124.380 104.227 111.720 1.00 96.37  ?  6   DC  D "O4'" 1 
ATOM   1191 C  "C3'" . DC  C 3 6   ? -126.082 103.744 113.323 1.00 98.46  ?  6   DC  D "C3'" 1 
ATOM   1192 O  "O3'" . DC  C 3 6   ? -126.694 102.465 113.307 1.00 115.98 ?  6   DC  D "O3'" 1 
ATOM   1193 C  "C2'" . DC  C 3 6   ? -124.692 103.702 113.967 1.00 90.96  ?  6   DC  D "C2'" 1 
ATOM   1194 C  "C1'" . DC  C 3 6   ? -123.787 103.497 112.764 1.00 91.30  ?  6   DC  D "C1'" 1 
ATOM   1195 N  N1    . DC  C 3 6   ? -122.398 104.007 112.969 1.00 76.65  ?  6   DC  D N1    1 
ATOM   1196 C  C2    . DC  C 3 6   ? -121.312 103.138 112.817 1.00 73.78  ?  6   DC  D C2    1 
ATOM   1197 O  O2    . DC  C 3 6   ? -121.522 101.958 112.511 1.00 74.71  ?  6   DC  D O2    1 
ATOM   1198 N  N3    . DC  C 3 6   ? -120.057 103.617 113.005 1.00 65.70  ?  6   DC  D N3    1 
ATOM   1199 C  C4    . DC  C 3 6   ? -119.872 104.897 113.333 1.00 68.04  ?  6   DC  D C4    1 
ATOM   1200 N  N4    . DC  C 3 6   ? -118.617 105.323 113.509 1.00 64.53  ?  6   DC  D N4    1 
ATOM   1201 C  C5    . DC  C 3 6   ? -120.967 105.796 113.496 1.00 67.84  ?  6   DC  D C5    1 
ATOM   1202 C  C6    . DC  C 3 6   ? -122.200 105.313 113.306 1.00 71.69  ?  6   DC  D C6    1 
ATOM   1203 P  P     . DT  C 3 7   ? -127.697 102.040 114.487 1.00 125.08 ?  7   DT  D P     1 
ATOM   1204 O  OP1   . DT  C 3 7   ? -128.900 101.441 113.868 1.00 118.20 ?  7   DT  D OP1   1 
ATOM   1205 O  OP2   . DT  C 3 7   ? -127.834 103.200 115.396 1.00 109.13 -1 7   DT  D OP2   1 
ATOM   1206 O  "O5'" . DT  C 3 7   ? -126.895 100.902 115.269 1.00 111.62 ?  7   DT  D "O5'" 1 
ATOM   1207 C  "C5'" . DT  C 3 7   ? -126.308 99.829  114.548 1.00 102.88 ?  7   DT  D "C5'" 1 
ATOM   1208 C  "C4'" . DT  C 3 7   ? -125.104 99.284  115.290 1.00 102.65 ?  7   DT  D "C4'" 1 
ATOM   1209 O  "O4'" . DT  C 3 7   ? -123.992 100.176 115.119 1.00 97.94  ?  7   DT  D "O4'" 1 
ATOM   1210 C  "C3'" . DT  C 3 7   ? -125.288 99.162  116.797 1.00 98.97  ?  7   DT  D "C3'" 1 
ATOM   1211 O  "O3'" . DT  C 3 7   ? -125.655 97.829  117.128 1.00 100.97 ?  7   DT  D "O3'" 1 
ATOM   1212 C  "C2'" . DT  C 3 7   ? -123.915 99.542  117.387 1.00 87.23  ?  7   DT  D "C2'" 1 
ATOM   1213 C  "C1'" . DT  C 3 7   ? -123.085 99.957  116.167 1.00 86.89  ?  7   DT  D "C1'" 1 
ATOM   1214 N  N1    . DT  C 3 7   ? -122.291 101.208 116.371 1.00 77.83  ?  7   DT  D N1    1 
ATOM   1215 C  C2    . DT  C 3 7   ? -120.921 101.161 116.253 1.00 71.58  ?  7   DT  D C2    1 
ATOM   1216 O  O2    . DT  C 3 7   ? -120.308 100.142 115.994 1.00 71.77  ?  7   DT  D O2    1 
ATOM   1217 N  N3    . DT  C 3 7   ? -120.288 102.360 116.452 1.00 65.63  ?  7   DT  D N3    1 
ATOM   1218 C  C4    . DT  C 3 7   ? -120.875 103.576 116.750 1.00 67.73  ?  7   DT  D C4    1 
ATOM   1219 O  O4    . DT  C 3 7   ? -120.218 104.601 116.911 1.00 63.81  ?  7   DT  D O4    1 
ATOM   1220 C  C5    . DT  C 3 7   ? -122.315 103.556 116.857 1.00 69.60  ?  7   DT  D C5    1 
ATOM   1221 C  C7    . DT  C 3 7   ? -123.064 104.816 117.176 1.00 74.59  ?  7   DT  D C7    1 
ATOM   1222 C  C6    . DT  C 3 7   ? -122.946 102.387 116.665 1.00 74.47  ?  7   DT  D C6    1 
ATOM   1223 P  P     . DA  C 3 8   ? -126.094 97.452  118.626 1.00 114.14 ?  8   DA  D P     1 
ATOM   1224 O  OP1   . DA  C 3 8   ? -127.151 96.420  118.539 1.00 109.32 ?  8   DA  D OP1   1 
ATOM   1225 O  OP2   . DA  C 3 8   ? -126.353 98.714  119.355 1.00 103.78 -1 8   DA  D OP2   1 
ATOM   1226 O  "O5'" . DA  C 3 8   ? -124.779 96.788  119.244 1.00 104.93 ?  8   DA  D "O5'" 1 
ATOM   1227 C  "C5'" . DA  C 3 8   ? -124.049 95.833  118.485 1.00 94.39  ?  8   DA  D "C5'" 1 
ATOM   1228 C  "C4'" . DA  C 3 8   ? -122.603 95.780  118.939 1.00 84.66  ?  8   DA  D "C4'" 1 
ATOM   1229 O  "O4'" . DA  C 3 8   ? -121.965 97.044  118.658 1.00 84.72  ?  8   DA  D "O4'" 1 
ATOM   1230 C  "C3'" . DA  C 3 8   ? -122.413 95.524  120.435 1.00 77.83  ?  8   DA  D "C3'" 1 
ATOM   1231 O  "O3'" . DA  C 3 8   ? -121.756 94.281  120.631 1.00 78.39  ?  8   DA  D "O3'" 1 
ATOM   1232 C  "C2'" . DA  C 3 8   ? -121.565 96.707  120.935 1.00 72.32  ?  8   DA  D "C2'" 1 
ATOM   1233 C  "C1'" . DA  C 3 8   ? -121.009 97.306  119.649 1.00 69.83  ?  8   DA  D "C1'" 1 
ATOM   1234 N  N9    . DA  C 3 8   ? -120.813 98.752  119.718 1.00 63.95  ?  8   DA  D N9    1 
ATOM   1235 C  C8    . DA  C 3 8   ? -121.759 99.697  120.001 1.00 67.29  ?  8   DA  D C8    1 
ATOM   1236 N  N7    . DA  C 3 8   ? -121.300 100.927 119.989 1.00 62.79  ?  8   DA  D N7    1 
ATOM   1237 C  C5    . DA  C 3 8   ? -119.960 100.778 119.675 1.00 59.70  ?  8   DA  D C5    1 
ATOM   1238 C  C6    . DA  C 3 8   ? -118.915 101.709 119.509 1.00 57.57  ?  8   DA  D C6    1 
ATOM   1239 N  N6    . DA  C 3 8   ? -119.077 103.029 119.645 1.00 60.05  ?  8   DA  D N6    1 
ATOM   1240 N  N1    . DA  C 3 8   ? -117.694 101.228 119.198 1.00 54.42  ?  8   DA  D N1    1 
ATOM   1241 C  C2    . DA  C 3 8   ? -117.535 99.906  119.064 1.00 56.79  ?  8   DA  D C2    1 
ATOM   1242 N  N3    . DA  C 3 8   ? -118.439 98.935  119.194 1.00 56.64  ?  8   DA  D N3    1 
ATOM   1243 C  C4    . DA  C 3 8   ? -119.642 99.444  119.504 1.00 62.00  ?  8   DA  D C4    1 
ATOM   1244 P  P     . DA  C 3 9   ? -121.695 93.620  122.093 1.00 82.95  ?  9   DA  D P     1 
ATOM   1245 O  OP1   . DA  C 3 9   ? -121.659 92.151  121.923 1.00 74.60  ?  9   DA  D OP1   1 
ATOM   1246 O  OP2   . DA  C 3 9   ? -122.759 94.242  122.913 1.00 84.95  -1 9   DA  D OP2   1 
ATOM   1247 O  "O5'" . DA  C 3 9   ? -120.285 94.108  122.663 1.00 76.53  ?  9   DA  D "O5'" 1 
ATOM   1248 C  "C5'" . DA  C 3 9   ? -119.116 93.948  121.875 1.00 66.70  ?  9   DA  D "C5'" 1 
ATOM   1249 C  "C4'" . DA  C 3 9   ? -117.996 94.836  122.383 1.00 67.36  ?  9   DA  D "C4'" 1 
ATOM   1250 O  "O4'" . DA  C 3 9   ? -118.210 96.187  121.949 1.00 64.63  ?  9   DA  D "O4'" 1 
ATOM   1251 C  "C3'" . DA  C 3 9   ? -117.894 94.938  123.895 1.00 66.94  ?  9   DA  D "C3'" 1 
ATOM   1252 O  "O3'" . DA  C 3 9   ? -117.031 93.921  124.387 1.00 62.59  ?  9   DA  D "O3'" 1 
ATOM   1253 C  "C2'" . DA  C 3 9   ? -117.309 96.345  124.127 1.00 66.10  ?  9   DA  D "C2'" 1 
ATOM   1254 C  "C1'" . DA  C 3 9   ? -117.423 97.027  122.756 1.00 58.62  ?  9   DA  D "C1'" 1 
ATOM   1255 N  N9    . DA  C 3 9   ? -118.040 98.350  122.807 1.00 54.75  ?  9   DA  D N9    1 
ATOM   1256 C  C8    . DA  C 3 9   ? -119.360 98.639  123.013 1.00 57.98  ?  9   DA  D C8    1 
ATOM   1257 N  N7    . DA  C 3 9   ? -119.627 99.925  123.011 1.00 57.25  ?  9   DA  D N7    1 
ATOM   1258 C  C5    . DA  C 3 9   ? -118.396 100.519 122.788 1.00 53.08  ?  9   DA  D C5    1 
ATOM   1259 C  C6    . DA  C 3 9   ? -117.997 101.866 122.675 1.00 57.98  ?  9   DA  D C6    1 
ATOM   1260 N  N6    . DA  C 3 9   ? -118.843 102.896 122.776 1.00 52.84  ?  9   DA  D N6    1 
ATOM   1261 N  N1    . DA  C 3 9   ? -116.689 102.115 122.452 1.00 56.87  ?  9   DA  D N1    1 
ATOM   1262 C  C2    . DA  C 3 9   ? -115.845 101.082 122.351 1.00 55.39  ?  9   DA  D C2    1 
ATOM   1263 N  N3    . DA  C 3 9   ? -116.101 99.778  122.440 1.00 54.59  ?  9   DA  D N3    1 
ATOM   1264 C  C4    . DA  C 3 9   ? -117.407 99.562  122.661 1.00 53.03  ?  9   DA  D C4    1 
ATOM   1265 P  P     . DG  C 3 10  ? -116.924 93.640  125.965 1.00 70.05  ?  10  DG  D P     1 
ATOM   1266 O  OP1   . DG  C 3 10  ? -116.366 92.281  126.139 1.00 71.18  ?  10  DG  D OP1   1 
ATOM   1267 O  OP2   . DG  C 3 10  ? -118.222 93.993  126.582 1.00 77.21  -1 10  DG  D OP2   1 
ATOM   1268 O  "O5'" . DG  C 3 10  ? -115.835 94.697  126.464 1.00 67.12  ?  10  DG  D "O5'" 1 
ATOM   1269 C  "C5'" . DG  C 3 10  ? -114.585 94.786  125.795 1.00 67.71  ?  10  DG  D "C5'" 1 
ATOM   1270 C  "C4'" . DG  C 3 10  ? -113.841 96.040  126.208 1.00 71.08  ?  10  DG  D "C4'" 1 
ATOM   1271 O  "O4'" . DG  C 3 10  ? -114.565 97.216  125.756 1.00 67.74  ?  10  DG  D "O4'" 1 
ATOM   1272 C  "C3'" . DG  C 3 10  ? -113.653 96.213  127.719 1.00 66.90  ?  10  DG  D "C3'" 1 
ATOM   1273 O  "O3'" . DG  C 3 10  ? -112.315 96.583  127.990 1.00 71.52  ?  10  DG  D "O3'" 1 
ATOM   1274 C  "C2'" . DG  C 3 10  ? -114.620 97.346  128.064 1.00 59.19  ?  10  DG  D "C2'" 1 
ATOM   1275 C  "C1'" . DG  C 3 10  ? -114.553 98.166  126.790 1.00 66.09  ?  10  DG  D "C1'" 1 
ATOM   1276 N  N9    . DG  C 3 10  ? -115.674 99.085  126.615 1.00 63.42  ?  10  DG  D N9    1 
ATOM   1277 C  C8    . DG  C 3 10  ? -117.014 98.791  126.694 1.00 59.70  ?  10  DG  D C8    1 
ATOM   1278 N  N7    . DG  C 3 10  ? -117.785 99.825  126.495 1.00 56.34  ?  10  DG  D N7    1 
ATOM   1279 C  C5    . DG  C 3 10  ? -116.898 100.872 126.271 1.00 60.08  ?  10  DG  D C5    1 
ATOM   1280 C  C6    . DG  C 3 10  ? -117.149 102.238 125.997 1.00 60.92  ?  10  DG  D C6    1 
ATOM   1281 O  O6    . DG  C 3 10  ? -118.241 102.813 125.895 1.00 64.79  ?  10  DG  D O6    1 
ATOM   1282 N  N1    . DG  C 3 10  ? -115.966 102.956 125.835 1.00 61.04  ?  10  DG  D N1    1 
ATOM   1283 C  C2    . DG  C 3 10  ? -114.703 102.422 125.927 1.00 63.16  ?  10  DG  D C2    1 
ATOM   1284 N  N2    . DG  C 3 10  ? -113.682 103.271 125.741 1.00 64.54  ?  10  DG  D N2    1 
ATOM   1285 N  N3    . DG  C 3 10  ? -114.455 101.144 126.182 1.00 60.24  ?  10  DG  D N3    1 
ATOM   1286 C  C4    . DG  C 3 10  ? -115.596 100.432 126.342 1.00 60.21  ?  10  DG  D C4    1 
ATOM   1287 P  P     . DA  C 3 11  ? -111.540 95.965  129.254 1.00 73.17  ?  11  DA  D P     1 
ATOM   1288 O  OP1   . DA  C 3 11  ? -110.826 94.754  128.794 1.00 86.38  ?  11  DA  D OP1   1 
ATOM   1289 O  OP2   . DA  C 3 11  ? -112.503 95.873  130.374 1.00 62.27  -1 11  DA  D OP2   1 
ATOM   1290 O  "O5'" . DA  C 3 11  ? -110.466 97.091  129.618 1.00 71.25  ?  11  DA  D "O5'" 1 
ATOM   1291 C  "C5'" . DA  C 3 11  ? -109.683 97.680  128.588 1.00 64.53  ?  11  DA  D "C5'" 1 
ATOM   1292 C  "C4'" . DA  C 3 11  ? -109.399 99.138  128.896 1.00 68.61  ?  11  DA  D "C4'" 1 
ATOM   1293 O  "O4'" . DA  C 3 11  ? -110.558 99.945  128.556 1.00 65.58  ?  11  DA  D "O4'" 1 
ATOM   1294 C  "C3'" . DA  C 3 11  ? -109.084 99.437  130.361 1.00 64.06  ?  11  DA  D "C3'" 1 
ATOM   1295 O  "O3'" . DA  C 3 11  ? -108.005 100.355 130.447 1.00 59.57  ?  11  DA  D "O3'" 1 
ATOM   1296 C  "C2'" . DA  C 3 11  ? -110.384 100.045 130.884 1.00 59.52  ?  11  DA  D "C2'" 1 
ATOM   1297 C  "C1'" . DA  C 3 11  ? -110.904 100.764 129.650 1.00 62.67  ?  11  DA  D "C1'" 1 
ATOM   1298 N  N9    . DA  C 3 11  ? -112.353 100.945 129.650 1.00 64.84  ?  11  DA  D N9    1 
ATOM   1299 C  C8    . DA  C 3 11  ? -113.303 99.977  129.818 1.00 61.60  ?  11  DA  D C8    1 
ATOM   1300 N  N7    . DA  C 3 11  ? -114.534 100.429 129.768 1.00 59.67  ?  11  DA  D N7    1 
ATOM   1301 C  C5    . DA  C 3 11  ? -114.381 101.788 129.551 1.00 61.13  ?  11  DA  D C5    1 
ATOM   1302 C  C6    . DA  C 3 11  ? -115.311 102.835 129.401 1.00 63.09  ?  11  DA  D C6    1 
ATOM   1303 N  N6    . DA  C 3 11  ? -116.635 102.657 129.453 1.00 63.46  ?  11  DA  D N6    1 
ATOM   1304 N  N1    . DA  C 3 11  ? -114.826 104.077 129.197 1.00 61.40  ?  11  DA  D N1    1 
ATOM   1305 C  C2    . DA  C 3 11  ? -113.500 104.252 129.146 1.00 62.17  ?  11  DA  D C2    1 
ATOM   1306 N  N3    . DA  C 3 11  ? -112.530 103.347 129.272 1.00 64.86  ?  11  DA  D N3    1 
ATOM   1307 C  C4    . DA  C 3 11  ? -113.043 102.123 129.474 1.00 62.54  ?  11  DA  D C4    1 
ATOM   1308 P  P     . DC  C 3 12  ? -107.409 100.771 131.879 1.00 66.55  ?  12  DC  D P     1 
ATOM   1309 O  OP1   . DC  C 3 12  ? -106.010 101.205 131.671 1.00 70.19  ?  12  DC  D OP1   1 
ATOM   1310 O  OP2   . DC  C 3 12  ? -107.708 99.672  132.825 1.00 75.30  -1 12  DC  D OP2   1 
ATOM   1311 O  "O5'" . DC  C 3 12  ? -108.288 102.038 132.303 1.00 64.45  ?  12  DC  D "O5'" 1 
ATOM   1312 C  "C5'" . DC  C 3 12  ? -108.423 103.133 131.407 1.00 59.16  ?  12  DC  D "C5'" 1 
ATOM   1313 C  "C4'" . DC  C 3 12  ? -109.358 104.186 131.973 1.00 62.37  ?  12  DC  D "C4'" 1 
ATOM   1314 O  "O4'" . DC  C 3 12  ? -110.734 103.810 131.724 1.00 68.95  ?  12  DC  D "O4'" 1 
ATOM   1315 C  "C3'" . DC  C 3 12  ? -109.245 104.416 133.487 1.00 67.19  ?  12  DC  D "C3'" 1 
ATOM   1316 O  "O3'" . DC  C 3 12  ? -108.917 105.775 133.744 1.00 70.50  ?  12  DC  D "O3'" 1 
ATOM   1317 C  "C2'" . DC  C 3 12  ? -110.636 104.056 134.026 1.00 63.84  ?  12  DC  D "C2'" 1 
ATOM   1318 C  "C1'" . DC  C 3 12  ? -111.511 104.257 132.803 1.00 69.05  ?  12  DC  D "C1'" 1 
ATOM   1319 N  N1    . DC  C 3 12  ? -112.777 103.475 132.843 1.00 62.89  ?  12  DC  D N1    1 
ATOM   1320 C  C2    . DC  C 3 12  ? -113.989 104.109 132.550 1.00 63.34  ?  12  DC  D C2    1 
ATOM   1321 O  O2    . DC  C 3 12  ? -113.986 105.310 132.253 1.00 64.42  ?  12  DC  D O2    1 
ATOM   1322 N  N3    . DC  C 3 12  ? -115.135 103.385 132.595 1.00 60.30  ?  12  DC  D N3    1 
ATOM   1323 C  C4    . DC  C 3 12  ? -115.096 102.092 132.919 1.00 57.05  ?  12  DC  D C4    1 
ATOM   1324 N  N4    . DC  C 3 12  ? -116.251 101.421 132.951 1.00 58.74  ?  12  DC  D N4    1 
ATOM   1325 C  C5    . DC  C 3 12  ? -113.870 101.431 133.226 1.00 61.34  ?  12  DC  D C5    1 
ATOM   1326 C  C6    . DC  C 3 12  ? -112.747 102.154 133.178 1.00 63.33  ?  12  DC  D C6    1 
ATOM   1327 P  P     . DG  C 3 13  ? -109.063 106.387 135.223 1.00 64.60  ?  13  DG  D P     1 
ATOM   1328 O  OP1   . DG  C 3 13  ? -107.970 107.368 135.390 1.00 68.25  ?  13  DG  D OP1   1 
ATOM   1329 O  OP2   . DG  C 3 13  ? -109.194 105.273 136.189 1.00 63.01  -1 13  DG  D OP2   1 
ATOM   1330 O  "O5'" . DG  C 3 13  ? -110.454 107.176 135.174 1.00 57.11  ?  13  DG  D "O5'" 1 
ATOM   1331 C  "C5'" . DG  C 3 13  ? -110.663 108.178 134.186 1.00 51.15  ?  13  DG  D "C5'" 1 
ATOM   1332 C  "C4'" . DG  C 3 13  ? -111.946 108.948 134.450 1.00 52.33  ?  13  DG  D "C4'" 1 
ATOM   1333 O  "O4'" . DG  C 3 13  ? -113.086 108.059 134.325 1.00 53.35  ?  13  DG  D "O4'" 1 
ATOM   1334 C  "C3'" . DG  C 3 13  ? -112.047 109.585 135.838 1.00 56.25  ?  13  DG  D "C3'" 1 
ATOM   1335 O  "O3'" . DG  C 3 13  ? -112.567 110.903 135.726 1.00 54.46  ?  13  DG  D "O3'" 1 
ATOM   1336 C  "C2'" . DG  C 3 13  ? -113.010 108.661 136.582 1.00 50.65  ?  13  DG  D "C2'" 1 
ATOM   1337 C  "C1'" . DG  C 3 13  ? -113.917 108.191 135.456 1.00 57.23  ?  13  DG  D "C1'" 1 
ATOM   1338 N  N9    . DG  C 3 13  ? -114.547 106.900 135.715 1.00 57.98  ?  13  DG  D N9    1 
ATOM   1339 C  C8    . DG  C 3 13  ? -113.913 105.703 135.947 1.00 58.64  ?  13  DG  D C8    1 
ATOM   1340 N  N7    . DG  C 3 13  ? -114.734 104.710 136.144 1.00 54.52  ?  13  DG  D N7    1 
ATOM   1341 C  C5    . DG  C 3 13  ? -115.994 105.283 136.033 1.00 55.18  ?  13  DG  D C5    1 
ATOM   1342 C  C6    . DG  C 3 13  ? -117.275 104.694 136.150 1.00 60.28  ?  13  DG  D C6    1 
ATOM   1343 O  O6    . DG  C 3 13  ? -117.558 103.511 136.384 1.00 57.10  ?  13  DG  D O6    1 
ATOM   1344 N  N1    . DG  C 3 13  ? -118.291 105.630 135.968 1.00 59.49  ?  13  DG  D N1    1 
ATOM   1345 C  C2    . DG  C 3 13  ? -118.092 106.964 135.705 1.00 58.67  ?  13  DG  D C2    1 
ATOM   1346 N  N2    . DG  C 3 13  ? -119.196 107.711 135.559 1.00 63.68  ?  13  DG  D N2    1 
ATOM   1347 N  N3    . DG  C 3 13  ? -116.896 107.529 135.593 1.00 60.24  ?  13  DG  D N3    1 
ATOM   1348 C  C4    . DG  C 3 13  ? -115.897 106.631 135.768 1.00 56.13  ?  13  DG  D C4    1 
ATOM   1349 P  P     . DC  C 3 14  ? -112.547 111.893 136.992 1.00 61.71  ?  14  DC  D P     1 
ATOM   1350 O  OP1   . DC  C 3 14  ? -112.046 113.202 136.517 1.00 70.10  ?  14  DC  D OP1   1 
ATOM   1351 O  OP2   . DC  C 3 14  ? -111.863 111.199 138.105 1.00 52.30  -1 14  DC  D OP2   1 
ATOM   1352 O  "O5'" . DC  C 3 14  ? -114.091 112.053 137.376 1.00 56.53  ?  14  DC  D "O5'" 1 
ATOM   1353 C  "C5'" . DC  C 3 14  ? -114.985 112.655 136.452 1.00 61.20  ?  14  DC  D "C5'" 1 
ATOM   1354 C  "C4'" . DC  C 3 14  ? -116.430 112.422 136.856 1.00 60.01  ?  14  DC  D "C4'" 1 
ATOM   1355 O  "O4'" . DC  C 3 14  ? -116.686 111.002 136.961 1.00 59.43  ?  14  DC  D "O4'" 1 
ATOM   1356 C  "C3'" . DC  C 3 14  ? -116.840 113.033 138.201 1.00 56.40  ?  14  DC  D "C3'" 1 
ATOM   1357 O  "O3'" . DC  C 3 14  ? -117.929 113.925 138.008 1.00 63.06  ?  14  DC  D "O3'" 1 
ATOM   1358 C  "C2'" . DC  C 3 14  ? -117.242 111.824 139.058 1.00 53.36  ?  14  DC  D "C2'" 1 
ATOM   1359 C  "C1'" . DC  C 3 14  ? -117.599 110.790 138.003 1.00 57.74  ?  14  DC  D "C1'" 1 
ATOM   1360 N  N1    . DC  C 3 14  ? -117.467 109.379 138.470 1.00 58.07  ?  14  DC  D N1    1 
ATOM   1361 C  C2    . DC  C 3 14  ? -118.617 108.613 138.689 1.00 60.19  ?  14  DC  D C2    1 
ATOM   1362 O  O2    . DC  C 3 14  ? -119.727 109.122 138.495 1.00 64.05  ?  14  DC  D O2    1 
ATOM   1363 N  N3    . DC  C 3 14  ? -118.481 107.331 139.110 1.00 58.90  ?  14  DC  D N3    1 
ATOM   1364 C  C4    . DC  C 3 14  ? -117.266 106.819 139.308 1.00 58.82  ?  14  DC  D C4    1 
ATOM   1365 N  N4    . DC  C 3 14  ? -117.182 105.551 139.723 1.00 58.44  ?  14  DC  D N4    1 
ATOM   1366 C  C5    . DC  C 3 14  ? -116.083 107.584 139.089 1.00 56.35  ?  14  DC  D C5    1 
ATOM   1367 C  C6    . DC  C 3 14  ? -116.229 108.846 138.673 1.00 58.02  ?  14  DC  D C6    1 
ATOM   1368 P  P     . DT  C 3 15  ? -118.323 114.987 139.148 1.00 68.41  ?  15  DT  D P     1 
ATOM   1369 O  OP1   . DT  C 3 15  ? -118.758 116.227 138.468 1.00 70.74  ?  15  DT  D OP1   1 
ATOM   1370 O  OP2   . DT  C 3 15  ? -117.218 115.033 140.130 1.00 69.22  -1 15  DT  D OP2   1 
ATOM   1371 O  "O5'" . DT  C 3 15  ? -119.591 114.324 139.859 1.00 65.65  ?  15  DT  D "O5'" 1 
ATOM   1372 C  "C5'" . DT  C 3 15  ? -120.748 114.022 139.093 1.00 64.74  ?  15  DT  D "C5'" 1 
ATOM   1373 C  "C4'" . DT  C 3 15  ? -121.739 113.210 139.905 1.00 62.41  ?  15  DT  D "C4'" 1 
ATOM   1374 O  "O4'" . DT  C 3 15  ? -121.260 111.849 140.042 1.00 65.53  ?  15  DT  D "O4'" 1 
ATOM   1375 C  "C3'" . DT  C 3 15  ? -121.988 113.725 141.327 1.00 58.59  ?  15  DT  D "C3'" 1 
ATOM   1376 O  "O3'" . DT  C 3 15  ? -123.382 113.866 141.548 1.00 66.36  ?  15  DT  D "O3'" 1 
ATOM   1377 C  "C2'" . DT  C 3 15  ? -121.381 112.640 142.222 1.00 63.53  ?  15  DT  D "C2'" 1 
ATOM   1378 C  "C1'" . DT  C 3 15  ? -121.519 111.406 141.348 1.00 63.50  ?  15  DT  D "C1'" 1 
ATOM   1379 N  N1    . DT  C 3 15  ? -120.553 110.319 141.681 1.00 63.47  ?  15  DT  D N1    1 
ATOM   1380 C  C2    . DT  C 3 15  ? -121.013 109.029 141.806 1.00 63.91  ?  15  DT  D C2    1 
ATOM   1381 O  O2    . DT  C 3 15  ? -122.181 108.719 141.657 1.00 62.65  ?  15  DT  D O2    1 
ATOM   1382 N  N3    . DT  C 3 15  ? -120.049 108.106 142.113 1.00 65.84  ?  15  DT  D N3    1 
ATOM   1383 C  C4    . DT  C 3 15  ? -118.699 108.338 142.303 1.00 62.07  ?  15  DT  D C4    1 
ATOM   1384 O  O4    . DT  C 3 15  ? -117.910 107.439 142.577 1.00 58.01  ?  15  DT  D O4    1 
ATOM   1385 C  C5    . DT  C 3 15  ? -118.283 109.713 142.159 1.00 58.47  ?  15  DT  D C5    1 
ATOM   1386 C  C7    . DT  C 3 15  ? -116.843 110.087 142.343 1.00 59.37  ?  15  DT  D C7    1 
ATOM   1387 C  C6    . DT  C 3 15  ? -119.220 110.627 141.858 1.00 61.58  ?  15  DT  D C6    1 
ATOM   1388 P  P     . DA  C 3 16  ? -123.930 114.889 142.658 1.00 82.05  ?  16  DA  D P     1 
ATOM   1389 O  OP1   . DA  C 3 16  ? -124.864 115.820 141.985 1.00 78.17  ?  16  DA  D OP1   1 
ATOM   1390 O  OP2   . DA  C 3 16  ? -122.766 115.423 143.399 1.00 71.03  -1 16  DA  D OP2   1 
ATOM   1391 O  "O5'" . DA  C 3 16  ? -124.761 113.952 143.652 1.00 76.39  ?  16  DA  D "O5'" 1 
ATOM   1392 C  "C5'" . DA  C 3 16  ? -125.762 113.087 143.132 1.00 68.81  ?  16  DA  D "C5'" 1 
ATOM   1393 C  "C4'" . DA  C 3 16  ? -125.913 111.849 143.999 1.00 73.80  ?  16  DA  D "C4'" 1 
ATOM   1394 O  "O4'" . DA  C 3 16  ? -124.716 111.038 143.904 1.00 74.89  ?  16  DA  D "O4'" 1 
ATOM   1395 C  "C3'" . DA  C 3 16  ? -126.128 112.125 145.493 1.00 76.12  ?  16  DA  D "C3'" 1 
ATOM   1396 O  "O3'" . DA  C 3 16  ? -127.300 111.459 145.946 1.00 76.89  ?  16  DA  D "O3'" 1 
ATOM   1397 C  "C2'" . DA  C 3 16  ? -124.868 111.563 146.160 1.00 69.57  ?  16  DA  D "C2'" 1 
ATOM   1398 C  "C1'" . DA  C 3 16  ? -124.440 110.495 145.168 1.00 72.36  ?  16  DA  D "C1'" 1 
ATOM   1399 N  N9    . DA  C 3 16  ? -123.018 110.167 145.240 1.00 73.77  ?  16  DA  D N9    1 
ATOM   1400 C  C8    . DA  C 3 16  ? -121.971 111.043 145.308 1.00 71.31  ?  16  DA  D C8    1 
ATOM   1401 N  N7    . DA  C 3 16  ? -120.796 110.460 145.365 1.00 68.12  ?  16  DA  D N7    1 
ATOM   1402 C  C5    . DA  C 3 16  ? -121.094 109.108 145.333 1.00 67.24  ?  16  DA  D C5    1 
ATOM   1403 C  C6    . DA  C 3 16  ? -120.283 107.955 145.364 1.00 63.89  ?  16  DA  D C6    1 
ATOM   1404 N  N6    . DA  C 3 16  ? -118.949 107.995 145.438 1.00 67.01  ?  16  DA  D N6    1 
ATOM   1405 N  N1    . DA  C 3 16  ? -120.899 106.756 145.317 1.00 64.61  ?  16  DA  D N1    1 
ATOM   1406 C  C2    . DA  C 3 16  ? -122.235 106.719 145.243 1.00 65.74  ?  16  DA  D C2    1 
ATOM   1407 N  N3    . DA  C 3 16  ? -123.101 107.731 145.208 1.00 66.05  ?  16  DA  D N3    1 
ATOM   1408 C  C4    . DA  C 3 16  ? -122.459 108.909 145.256 1.00 69.61  ?  16  DA  D C4    1 
ATOM   1409 N  N     . ASN D 1 2   ? -109.359 131.027 133.874 1.00 108.50 ?  112 ASN B N     1 
ATOM   1410 C  CA    . ASN D 1 2   ? -110.388 130.081 134.292 1.00 106.22 ?  112 ASN B CA    1 
ATOM   1411 C  C     . ASN D 1 2   ? -110.830 129.194 133.131 1.00 106.96 ?  112 ASN B C     1 
ATOM   1412 O  O     . ASN D 1 2   ? -112.005 129.175 132.764 1.00 108.03 ?  112 ASN B O     1 
ATOM   1413 C  CB    . ASN D 1 2   ? -111.594 130.821 134.876 1.00 99.86  ?  112 ASN B CB    1 
ATOM   1414 C  CG    . ASN D 1 2   ? -111.257 131.573 136.150 1.00 107.33 ?  112 ASN B CG    1 
ATOM   1415 O  OD1   . ASN D 1 2   ? -110.095 131.881 136.414 1.00 108.94 ?  112 ASN B OD1   1 
ATOM   1416 N  ND2   . ASN D 1 2   ? -112.276 131.870 136.949 1.00 107.63 ?  112 ASN B ND2   1 
ATOM   1417 N  N     . CYS D 1 3   ? -109.880 128.461 132.557 1.00 109.35 ?  113 CYS B N     1 
ATOM   1418 C  CA    . CYS D 1 3   ? -110.190 127.529 131.487 1.00 107.22 ?  113 CYS B CA    1 
ATOM   1419 C  C     . CYS D 1 3   ? -110.853 126.275 132.053 1.00 109.95 ?  113 CYS B C     1 
ATOM   1420 O  O     . CYS D 1 3   ? -110.931 126.071 133.267 1.00 109.81 ?  113 CYS B O     1 
ATOM   1421 C  CB    . CYS D 1 3   ? -108.924 127.143 130.723 1.00 111.04 ?  113 CYS B CB    1 
ATOM   1422 S  SG    . CYS D 1 3   ? -107.741 128.482 130.464 1.00 128.64 ?  113 CYS B SG    1 
ATOM   1423 N  N     . LYS D 1 4   ? -111.334 125.421 131.151 1.00 102.03 ?  114 LYS B N     1 
ATOM   1424 C  CA    . LYS D 1 4   ? -111.818 124.107 131.540 1.00 97.78  ?  114 LYS B CA    1 
ATOM   1425 C  C     . LYS D 1 4   ? -110.713 123.091 131.320 1.00 99.91  ?  114 LYS B C     1 
ATOM   1426 O  O     . LYS D 1 4   ? -110.231 122.955 130.185 1.00 99.57  ?  114 LYS B O     1 
ATOM   1427 C  CB    . LYS D 1 4   ? -113.057 123.717 130.743 1.00 96.08  ?  114 LYS B CB    1 
ATOM   1428 C  CG    . LYS D 1 4   ? -113.560 122.317 131.069 1.00 94.43  ?  114 LYS B CG    1 
ATOM   1429 C  CD    . LYS D 1 4   ? -114.776 121.937 130.240 1.00 106.43 ?  114 LYS B CD    1 
ATOM   1430 C  CE    . LYS D 1 4   ? -115.258 120.538 130.598 1.00 103.75 ?  114 LYS B CE    1 
ATOM   1431 N  NZ    . LYS D 1 4   ? -116.467 120.141 129.826 1.00 92.39  ?  114 LYS B NZ    1 
ATOM   1432 N  N     . PRO D 1 5   ? -110.277 122.372 132.348 1.00 95.71  ?  115 PRO B N     1 
ATOM   1433 C  CA    . PRO D 1 5   ? -109.199 121.396 132.170 1.00 92.45  ?  115 PRO B CA    1 
ATOM   1434 C  C     . PRO D 1 5   ? -109.688 120.176 131.412 1.00 90.67  ?  115 PRO B C     1 
ATOM   1435 O  O     . PRO D 1 5   ? -110.607 119.476 131.866 1.00 87.53  ?  115 PRO B O     1 
ATOM   1436 C  CB    . PRO D 1 5   ? -108.804 121.041 133.611 1.00 87.37  ?  115 PRO B CB    1 
ATOM   1437 C  CG    . PRO D 1 5   ? -110.037 121.302 134.409 1.00 89.55  ?  115 PRO B CG    1 
ATOM   1438 C  CD    . PRO D 1 5   ? -110.721 122.466 133.750 1.00 89.80  ?  115 PRO B CD    1 
ATOM   1439 N  N     . PRO D 1 6   ? -109.105 119.888 130.244 1.00 99.21  ?  116 PRO B N     1 
ATOM   1440 C  CA    . PRO D 1 6   ? -109.488 118.677 129.504 1.00 98.45  ?  116 PRO B CA    1 
ATOM   1441 C  C     . PRO D 1 6   ? -109.032 117.387 130.163 1.00 95.30  ?  116 PRO B C     1 
ATOM   1442 O  O     . PRO D 1 6   ? -109.378 116.306 129.673 1.00 103.29 ?  116 PRO B O     1 
ATOM   1443 C  CB    . PRO D 1 6   ? -108.799 118.865 128.139 1.00 91.21  ?  116 PRO B CB    1 
ATOM   1444 C  CG    . PRO D 1 6   ? -108.387 120.311 128.090 1.00 98.44  ?  116 PRO B CG    1 
ATOM   1445 C  CD    . PRO D 1 6   ? -108.117 120.691 129.508 1.00 96.02  ?  116 PRO B CD    1 
ATOM   1446 N  N     . TYR D 1 7   ? -108.273 117.464 131.251 1.00 89.88  ?  117 TYR B N     1 
ATOM   1447 C  CA    . TYR D 1 7   ? -107.742 116.285 131.913 1.00 80.46  ?  117 TYR B CA    1 
ATOM   1448 C  C     . TYR D 1 7   ? -108.736 115.749 132.934 1.00 76.33  ?  117 TYR B C     1 
ATOM   1449 O  O     . TYR D 1 7   ? -109.525 116.497 133.517 1.00 81.79  ?  117 TYR B O     1 
ATOM   1450 C  CB    . TYR D 1 7   ? -106.419 116.606 132.609 1.00 79.72  ?  117 TYR B CB    1 
ATOM   1451 C  CG    . TYR D 1 7   ? -105.653 117.751 131.986 1.00 77.24  ?  117 TYR B CG    1 
ATOM   1452 C  CD1   . TYR D 1 7   ? -105.026 117.604 130.756 1.00 89.52  ?  117 TYR B CD1   1 
ATOM   1453 C  CD2   . TYR D 1 7   ? -105.551 118.976 132.632 1.00 76.78  ?  117 TYR B CD2   1 
ATOM   1454 C  CE1   . TYR D 1 7   ? -104.322 118.647 130.184 1.00 91.74  ?  117 TYR B CE1   1 
ATOM   1455 C  CE2   . TYR D 1 7   ? -104.849 120.025 132.068 1.00 86.61  ?  117 TYR B CE2   1 
ATOM   1456 C  CZ    . TYR D 1 7   ? -104.237 119.854 130.844 1.00 93.17  ?  117 TYR B CZ    1 
ATOM   1457 O  OH    . TYR D 1 7   ? -103.537 120.894 130.277 1.00 90.96  ?  117 TYR B OH    1 
ATOM   1458 N  N     . SER D 1 8   ? -108.688 114.437 133.144 1.00 69.64  ?  118 SER B N     1 
ATOM   1459 C  CA    . SER D 1 8   ? -109.460 113.832 134.214 1.00 63.21  ?  118 SER B CA    1 
ATOM   1460 C  C     . SER D 1 8   ? -108.836 114.179 135.564 1.00 66.00  ?  118 SER B C     1 
ATOM   1461 O  O     . SER D 1 8   ? -107.745 114.750 135.650 1.00 67.57  ?  118 SER B O     1 
ATOM   1462 C  CB    . SER D 1 8   ? -109.530 112.316 134.034 1.00 66.84  ?  118 SER B CB    1 
ATOM   1463 O  OG    . SER D 1 8   ? -108.244 111.731 134.146 1.00 66.05  ?  118 SER B OG    1 
ATOM   1464 N  N     . PHE D 1 9   ? -109.548 113.827 136.636 1.00 65.20  ?  119 PHE B N     1 
ATOM   1465 C  CA    . PHE D 1 9   ? -108.987 113.999 137.970 1.00 59.78  ?  119 PHE B CA    1 
ATOM   1466 C  C     . PHE D 1 9   ? -107.784 113.097 138.202 1.00 56.35  ?  119 PHE B C     1 
ATOM   1467 O  O     . PHE D 1 9   ? -106.995 113.360 139.115 1.00 61.39  ?  119 PHE B O     1 
ATOM   1468 C  CB    . PHE D 1 9   ? -110.056 113.740 139.033 1.00 60.00  ?  119 PHE B CB    1 
ATOM   1469 C  CG    . PHE D 1 9   ? -110.941 114.923 139.299 1.00 57.61  ?  119 PHE B CG    1 
ATOM   1470 C  CD1   . PHE D 1 9   ? -110.420 116.206 139.293 1.00 60.20  ?  119 PHE B CD1   1 
ATOM   1471 C  CD2   . PHE D 1 9   ? -112.292 114.756 139.549 1.00 62.48  ?  119 PHE B CD2   1 
ATOM   1472 C  CE1   . PHE D 1 9   ? -111.228 117.299 139.538 1.00 60.10  ?  119 PHE B CE1   1 
ATOM   1473 C  CE2   . PHE D 1 9   ? -113.106 115.847 139.793 1.00 59.79  ?  119 PHE B CE2   1 
ATOM   1474 C  CZ    . PHE D 1 9   ? -112.573 117.119 139.788 1.00 54.05  ?  119 PHE B CZ    1 
ATOM   1475 N  N     . SER D 1 10  ? -107.624 112.046 137.396 1.00 56.88  ?  120 SER B N     1 
ATOM   1476 C  CA    . SER D 1 10  ? -106.436 111.207 137.504 1.00 58.53  ?  120 SER B CA    1 
ATOM   1477 C  C     . SER D 1 10  ? -105.189 111.959 137.059 1.00 62.73  ?  120 SER B C     1 
ATOM   1478 O  O     . SER D 1 10  ? -104.111 111.776 137.635 1.00 61.42  ?  120 SER B O     1 
ATOM   1479 C  CB    . SER D 1 10  ? -106.615 109.937 136.675 1.00 61.18  ?  120 SER B CB    1 
ATOM   1480 O  OG    . SER D 1 10  ? -107.787 109.241 137.063 1.00 65.86  ?  120 SER B OG    1 
ATOM   1481 N  N     . CYS D 1 11  ? -105.312 112.807 136.033 1.00 62.46  ?  121 CYS B N     1 
ATOM   1482 C  CA    . CYS D 1 11  ? -104.169 113.581 135.562 1.00 57.14  ?  121 CYS B CA    1 
ATOM   1483 C  C     . CYS D 1 11  ? -103.910 114.809 136.427 1.00 61.54  ?  121 CYS B C     1 
ATOM   1484 O  O     . CYS D 1 11  ? -102.759 115.244 136.542 1.00 64.58  ?  121 CYS B O     1 
ATOM   1485 C  CB    . CYS D 1 11  ? -104.377 113.999 134.106 1.00 62.00  ?  121 CYS B CB    1 
ATOM   1486 S  SG    . CYS D 1 11  ? -104.257 112.643 132.915 1.00 75.50  ?  121 CYS B SG    1 
ATOM   1487 N  N     . LEU D 1 12  ? -104.953 115.380 137.034 1.00 63.82  ?  122 LEU B N     1 
ATOM   1488 C  CA    . LEU D 1 12  ? -104.751 116.517 137.926 1.00 62.94  ?  122 LEU B CA    1 
ATOM   1489 C  C     . LEU D 1 12  ? -104.010 116.098 139.190 1.00 60.72  ?  122 LEU B C     1 
ATOM   1490 O  O     . LEU D 1 12  ? -103.103 116.803 139.648 1.00 56.84  ?  122 LEU B O     1 
ATOM   1491 C  CB    . LEU D 1 12  ? -106.094 117.160 138.275 1.00 62.45  ?  122 LEU B CB    1 
ATOM   1492 C  CG    . LEU D 1 12  ? -106.896 117.753 137.114 1.00 65.59  ?  122 LEU B CG    1 
ATOM   1493 C  CD1   . LEU D 1 12  ? -108.138 118.463 137.629 1.00 68.64  ?  122 LEU B CD1   1 
ATOM   1494 C  CD2   . LEU D 1 12  ? -106.037 118.701 136.293 1.00 68.91  ?  122 LEU B CD2   1 
ATOM   1495 N  N     . ILE D 1 13  ? -104.383 114.953 139.766 1.00 58.73  ?  123 ILE B N     1 
ATOM   1496 C  CA    . ILE D 1 13  ? -103.655 114.426 140.915 1.00 53.44  ?  123 ILE B CA    1 
ATOM   1497 C  C     . ILE D 1 13  ? -102.238 114.038 140.513 1.00 57.29  ?  123 ILE B C     1 
ATOM   1498 O  O     . ILE D 1 13  ? -101.284 114.233 141.276 1.00 55.06  ?  123 ILE B O     1 
ATOM   1499 C  CB    . ILE D 1 13  ? -104.418 113.236 141.526 1.00 55.38  ?  123 ILE B CB    1 
ATOM   1500 C  CG1   . ILE D 1 13  ? -105.793 113.681 142.027 1.00 63.29  ?  123 ILE B CG1   1 
ATOM   1501 C  CG2   . ILE D 1 13  ? -103.620 112.603 142.657 1.00 53.15  ?  123 ILE B CG2   1 
ATOM   1502 C  CD1   . ILE D 1 13  ? -106.677 112.536 142.480 1.00 57.87  ?  123 ILE B CD1   1 
ATOM   1503 N  N     . PHE D 1 14  ? -102.078 113.497 139.303 1.00 59.29  ?  124 PHE B N     1 
ATOM   1504 C  CA    . PHE D 1 14  ? -100.761 113.066 138.845 1.00 60.40  ?  124 PHE B CA    1 
ATOM   1505 C  C     . PHE D 1 14  ? -99.804  114.244 138.711 1.00 61.27  ?  124 PHE B C     1 
ATOM   1506 O  O     . PHE D 1 14  ? -98.631  114.146 139.092 1.00 63.90  ?  124 PHE B O     1 
ATOM   1507 C  CB    . PHE D 1 14  ? -100.892 112.323 137.514 1.00 64.27  ?  124 PHE B CB    1 
ATOM   1508 C  CG    . PHE D 1 14  ? -99.586  112.116 136.802 1.00 68.62  ?  124 PHE B CG    1 
ATOM   1509 C  CD1   . PHE D 1 14  ? -98.648  111.222 137.290 1.00 71.21  ?  124 PHE B CD1   1 
ATOM   1510 C  CD2   . PHE D 1 14  ? -99.302  112.809 135.637 1.00 64.72  ?  124 PHE B CD2   1 
ATOM   1511 C  CE1   . PHE D 1 14  ? -97.447  111.028 136.633 1.00 74.52  ?  124 PHE B CE1   1 
ATOM   1512 C  CE2   . PHE D 1 14  ? -98.103  112.619 134.975 1.00 64.84  ?  124 PHE B CE2   1 
ATOM   1513 C  CZ    . PHE D 1 14  ? -97.175  111.728 135.474 1.00 74.21  ?  124 PHE B CZ    1 
ATOM   1514 N  N     . MET D 1 15  ? -100.284 115.368 138.176 1.00 58.03  ?  125 MET B N     1 
ATOM   1515 C  CA    . MET D 1 15  ? -99.415  116.528 138.009 1.00 58.97  ?  125 MET B CA    1 
ATOM   1516 C  C     . MET D 1 15  ? -99.113  117.204 139.339 1.00 64.46  ?  125 MET B C     1 
ATOM   1517 O  O     . MET D 1 15  ? -98.025  117.764 139.513 1.00 67.82  ?  125 MET B O     1 
ATOM   1518 C  CB    . MET D 1 15  ? -100.048 117.524 137.039 1.00 63.68  ?  125 MET B CB    1 
ATOM   1519 C  CG    . MET D 1 15  ? -100.181 117.002 135.621 1.00 56.01  ?  125 MET B CG    1 
ATOM   1520 S  SD    . MET D 1 15  ? -100.960 118.193 134.517 1.00 66.15  ?  125 MET B SD    1 
ATOM   1521 C  CE    . MET D 1 15  ? -102.545 118.415 135.316 1.00 60.95  ?  125 MET B CE    1 
ATOM   1522 N  N     . ALA D 1 16  ? -100.056 117.165 140.284 1.00 63.24  ?  126 ALA B N     1 
ATOM   1523 C  CA    . ALA D 1 16  ? -99.815  117.771 141.589 1.00 57.35  ?  126 ALA B CA    1 
ATOM   1524 C  C     . ALA D 1 16  ? -98.729  117.024 142.353 1.00 63.25  ?  126 ALA B C     1 
ATOM   1525 O  O     . ALA D 1 16  ? -97.859  117.646 142.973 1.00 71.49  ?  126 ALA B O     1 
ATOM   1526 C  CB    . ALA D 1 16  ? -101.111 117.810 142.398 1.00 59.78  ?  126 ALA B CB    1 
ATOM   1527 N  N     . ILE D 1 17  ? -98.759  115.691 142.313 1.00 62.07  ?  127 ILE B N     1 
ATOM   1528 C  CA    . ILE D 1 17  ? -97.764  114.904 143.035 1.00 63.57  ?  127 ILE B CA    1 
ATOM   1529 C  C     . ILE D 1 17  ? -96.403  115.006 142.356 1.00 63.50  ?  127 ILE B C     1 
ATOM   1530 O  O     . ILE D 1 17  ? -95.364  115.071 143.025 1.00 76.08  ?  127 ILE B O     1 
ATOM   1531 C  CB    . ILE D 1 17  ? -98.234  113.443 143.162 1.00 67.71  ?  127 ILE B CB    1 
ATOM   1532 C  CG1   . ILE D 1 17  ? -99.552  113.376 143.936 1.00 59.53  ?  127 ILE B CG1   1 
ATOM   1533 C  CG2   . ILE D 1 17  ? -97.175  112.592 143.844 1.00 63.63  ?  127 ILE B CG2   1 
ATOM   1534 C  CD1   . ILE D 1 17  ? -100.082 111.972 144.123 1.00 54.91  ?  127 ILE B CD1   1 
ATOM   1535 N  N     . GLU D 1 18  ? -96.383  115.032 141.021 1.00 66.59  ?  128 GLU B N     1 
ATOM   1536 C  CA    . GLU D 1 18  ? -95.123  115.161 140.297 1.00 69.38  ?  128 GLU B CA    1 
ATOM   1537 C  C     . GLU D 1 18  ? -94.471  116.524 140.498 1.00 69.74  ?  128 GLU B C     1 
ATOM   1538 O  O     . GLU D 1 18  ? -93.255  116.646 140.317 1.00 71.50  ?  128 GLU B O     1 
ATOM   1539 C  CB    . GLU D 1 18  ? -95.341  114.907 138.804 1.00 66.70  ?  128 GLU B CB    1 
ATOM   1540 C  CG    . GLU D 1 18  ? -95.453  113.439 138.421 1.00 68.76  ?  128 GLU B CG    1 
ATOM   1541 C  CD    . GLU D 1 18  ? -94.155  112.679 138.626 1.00 77.61  ?  128 GLU B CD    1 
ATOM   1542 O  OE1   . GLU D 1 18  ? -94.129  111.757 139.468 1.00 80.49  ?  128 GLU B OE1   1 
ATOM   1543 O  OE2   . GLU D 1 18  ? -93.158  113.010 137.950 1.00 87.98  -1 128 GLU B OE2   1 
ATOM   1544 N  N     . ASP D 1 19  ? -95.244  117.545 140.864 1.00 69.11  ?  129 ASP B N     1 
ATOM   1545 C  CA    . ASP D 1 19  ? -94.706  118.873 141.127 1.00 69.15  ?  129 ASP B CA    1 
ATOM   1546 C  C     . ASP D 1 19  ? -94.238  119.052 142.565 1.00 71.03  ?  129 ASP B C     1 
ATOM   1547 O  O     . ASP D 1 19  ? -93.677  120.103 142.891 1.00 73.71  ?  129 ASP B O     1 
ATOM   1548 C  CB    . ASP D 1 19  ? -95.751  119.945 140.794 1.00 72.58  ?  129 ASP B CB    1 
ATOM   1549 C  CG    . ASP D 1 19  ? -95.869  120.204 139.306 1.00 65.48  ?  129 ASP B CG    1 
ATOM   1550 O  OD1   . ASP D 1 19  ? -95.205  119.496 138.521 1.00 61.94  ?  129 ASP B OD1   1 
ATOM   1551 O  OD2   . ASP D 1 19  ? -96.622  121.122 138.920 1.00 71.70  -1 129 ASP B OD2   1 
ATOM   1552 N  N     . SER D 1 20  ? -94.455  118.063 143.427 1.00 72.34  ?  130 SER B N     1 
ATOM   1553 C  CA    . SER D 1 20  ? -94.040  118.150 144.817 1.00 69.61  ?  130 SER B CA    1 
ATOM   1554 C  C     . SER D 1 20  ? -92.546  117.852 144.951 1.00 77.80  ?  130 SER B C     1 
ATOM   1555 O  O     . SER D 1 20  ? -91.967  117.159 144.110 1.00 82.50  ?  130 SER B O     1 
ATOM   1556 C  CB    . SER D 1 20  ? -94.842  117.172 145.668 1.00 70.23  ?  130 SER B CB    1 
ATOM   1557 O  OG    . SER D 1 20  ? -94.716  115.850 145.178 1.00 69.59  ?  130 SER B OG    1 
ATOM   1558 N  N     . PRO D 1 21  ? -91.897  118.371 145.999 1.00 80.19  ?  131 PRO B N     1 
ATOM   1559 C  CA    . PRO D 1 21  ? -90.462  118.080 146.163 1.00 78.70  ?  131 PRO B CA    1 
ATOM   1560 C  C     . PRO D 1 21  ? -90.191  116.619 146.461 1.00 82.14  ?  131 PRO B C     1 
ATOM   1561 O  O     . PRO D 1 21  ? -89.202  116.061 145.969 1.00 80.32  ?  131 PRO B O     1 
ATOM   1562 C  CB    . PRO D 1 21  ? -90.044  118.979 147.338 1.00 73.22  ?  131 PRO B CB    1 
ATOM   1563 C  CG    . PRO D 1 21  ? -91.204  119.892 147.601 1.00 76.73  ?  131 PRO B CG    1 
ATOM   1564 C  CD    . PRO D 1 21  ? -92.422  119.204 147.093 1.00 80.16  ?  131 PRO B CD    1 
ATOM   1565 N  N     . THR D 1 22  ? -91.047  115.983 147.256 1.00 80.55  ?  132 THR B N     1 
ATOM   1566 C  CA    . THR D 1 22  ? -90.848  114.616 147.710 1.00 75.90  ?  132 THR B CA    1 
ATOM   1567 C  C     . THR D 1 22  ? -91.587  113.594 146.855 1.00 75.79  ?  132 THR B C     1 
ATOM   1568 O  O     . THR D 1 22  ? -91.622  112.413 147.218 1.00 81.75  ?  132 THR B O     1 
ATOM   1569 C  CB    . THR D 1 22  ? -91.286  114.486 149.169 1.00 76.82  ?  132 THR B CB    1 
ATOM   1570 O  OG1   . THR D 1 22  ? -92.601  115.036 149.321 1.00 78.31  ?  132 THR B OG1   1 
ATOM   1571 C  CG2   . THR D 1 22  ? -90.327  115.232 150.081 1.00 75.92  ?  132 THR B CG2   1 
ATOM   1572 N  N     . LYS D 1 23  ? -92.173  114.019 145.733 1.00 74.08  ?  133 LYS B N     1 
ATOM   1573 C  CA    . LYS D 1 23  ? -92.979  113.147 144.875 1.00 73.77  ?  133 LYS B CA    1 
ATOM   1574 C  C     . LYS D 1 23  ? -94.116  112.488 145.653 1.00 74.92  ?  133 LYS B C     1 
ATOM   1575 O  O     . LYS D 1 23  ? -94.499  111.349 145.373 1.00 73.05  ?  133 LYS B O     1 
ATOM   1576 C  CB    . LYS D 1 23  ? -92.115  112.087 144.183 1.00 78.86  ?  133 LYS B CB    1 
ATOM   1577 C  CG    . LYS D 1 23  ? -91.094  112.650 143.208 1.00 72.81  ?  133 LYS B CG    1 
ATOM   1578 C  CD    . LYS D 1 23  ? -91.773  113.297 142.013 1.00 71.00  ?  133 LYS B CD    1 
ATOM   1579 C  CE    . LYS D 1 23  ? -90.752  113.860 141.038 1.00 76.20  ?  133 LYS B CE    1 
ATOM   1580 N  NZ    . LYS D 1 23  ? -91.396  114.403 139.810 1.00 83.79  ?  133 LYS B NZ    1 
ATOM   1581 N  N     . ARG D 1 24  ? -94.659  113.203 146.636 1.00 68.66  ?  134 ARG B N     1 
ATOM   1582 C  CA    . ARG D 1 24  ? -95.745  112.695 147.461 1.00 65.62  ?  134 ARG B CA    1 
ATOM   1583 C  C     . ARG D 1 24  ? -96.443  113.872 148.126 1.00 67.25  ?  134 ARG B C     1 
ATOM   1584 O  O     . ARG D 1 24  ? -95.806  114.871 148.472 1.00 67.85  ?  134 ARG B O     1 
ATOM   1585 C  CB    . ARG D 1 24  ? -95.239  111.703 148.514 1.00 72.48  ?  134 ARG B CB    1 
ATOM   1586 C  CG    . ARG D 1 24  ? -94.124  112.249 149.388 1.00 75.83  ?  134 ARG B CG    1 
ATOM   1587 C  CD    . ARG D 1 24  ? -93.745  111.284 150.499 1.00 80.46  ?  134 ARG B CD    1 
ATOM   1588 N  NE    . ARG D 1 24  ? -93.338  109.980 149.987 1.00 93.45  ?  134 ARG B NE    1 
ATOM   1589 C  CZ    . ARG D 1 24  ? -92.107  109.685 149.583 1.00 90.73  ?  134 ARG B CZ    1 
ATOM   1590 N  NH1   . ARG D 1 24  ? -91.154  110.606 149.625 1.00 88.60  ?  134 ARG B NH1   1 
ATOM   1591 N  NH2   . ARG D 1 24  ? -91.830  108.469 149.133 1.00 95.31  ?  134 ARG B NH2   1 
ATOM   1592 N  N     . LEU D 1 25  ? -97.757  113.744 148.303 1.00 66.22  ?  135 LEU B N     1 
ATOM   1593 C  CA    . LEU D 1 25  ? -98.571  114.816 148.858 1.00 61.45  ?  135 LEU B CA    1 
ATOM   1594 C  C     . LEU D 1 25  ? -99.746  114.224 149.617 1.00 64.10  ?  135 LEU B C     1 
ATOM   1595 O  O     . LEU D 1 25  ? -100.265 113.171 149.228 1.00 63.77  ?  135 LEU B O     1 
ATOM   1596 C  CB    . LEU D 1 25  ? -99.094  115.757 147.762 1.00 66.96  ?  135 LEU B CB    1 
ATOM   1597 C  CG    . LEU D 1 25  ? -98.146  116.793 147.163 1.00 64.60  ?  135 LEU B CG    1 
ATOM   1598 C  CD1   . LEU D 1 25  ? -98.853  117.576 146.070 1.00 71.54  ?  135 LEU B CD1   1 
ATOM   1599 C  CD2   . LEU D 1 25  ? -97.628  117.727 148.244 1.00 66.18  ?  135 LEU B CD2   1 
ATOM   1600 N  N     . PRO D 1 26  ? -100.181 114.865 150.696 1.00 69.14  ?  136 PRO B N     1 
ATOM   1601 C  CA    . PRO D 1 26  ? -101.466 114.514 151.304 1.00 70.67  ?  136 PRO B CA    1 
ATOM   1602 C  C     . PRO D 1 26  ? -102.614 115.152 150.530 1.00 69.56  ?  136 PRO B C     1 
ATOM   1603 O  O     . PRO D 1 26  ? -102.420 115.999 149.658 1.00 70.97  ?  136 PRO B O     1 
ATOM   1604 C  CB    . PRO D 1 26  ? -101.358 115.088 152.719 1.00 67.17  ?  136 PRO B CB    1 
ATOM   1605 C  CG    . PRO D 1 26  ? -100.434 116.246 152.569 1.00 62.09  ?  136 PRO B CG    1 
ATOM   1606 C  CD    . PRO D 1 26  ? -99.444  115.857 151.497 1.00 68.32  ?  136 PRO B CD    1 
ATOM   1607 N  N     . VAL D 1 27  ? -103.832 114.730 150.878 1.00 63.20  ?  137 VAL B N     1 
ATOM   1608 C  CA    . VAL D 1 27  ? -105.015 115.161 150.143 1.00 60.27  ?  137 VAL B CA    1 
ATOM   1609 C  C     . VAL D 1 27  ? -105.247 116.664 150.259 1.00 71.63  ?  137 VAL B C     1 
ATOM   1610 O  O     . VAL D 1 27  ? -105.907 117.254 149.396 1.00 76.62  ?  137 VAL B O     1 
ATOM   1611 C  CB    . VAL D 1 27  ? -106.248 114.360 150.620 1.00 64.00  ?  137 VAL B CB    1 
ATOM   1612 C  CG1   . VAL D 1 27  ? -106.644 114.770 152.028 1.00 76.87  ?  137 VAL B CG1   1 
ATOM   1613 C  CG2   . VAL D 1 27  ? -107.412 114.521 149.650 1.00 64.79  ?  137 VAL B CG2   1 
ATOM   1614 N  N     . LYS D 1 28  ? -104.707 117.307 151.298 1.00 67.55  ?  138 LYS B N     1 
ATOM   1615 C  CA    . LYS D 1 28  ? -104.873 118.751 151.442 1.00 69.17  ?  138 LYS B CA    1 
ATOM   1616 C  C     . LYS D 1 28  ? -104.160 119.502 150.325 1.00 79.25  ?  138 LYS B C     1 
ATOM   1617 O  O     . LYS D 1 28  ? -104.766 120.319 149.621 1.00 81.57  ?  138 LYS B O     1 
ATOM   1618 C  CB    . LYS D 1 28  ? -104.357 119.212 152.805 1.00 83.76  ?  138 LYS B CB    1 
ATOM   1619 C  CG    . LYS D 1 28  ? -105.383 119.156 153.919 1.00 92.48  ?  138 LYS B CG    1 
ATOM   1620 C  CD    . LYS D 1 28  ? -104.847 119.783 155.195 1.00 98.65  ?  138 LYS B CD    1 
ATOM   1621 C  CE    . LYS D 1 28  ? -105.884 119.741 156.305 1.00 102.26 ?  138 LYS B CE    1 
ATOM   1622 N  NZ    . LYS D 1 28  ? -105.386 120.379 157.553 1.00 110.78 ?  138 LYS B NZ    1 
ATOM   1623 N  N     . ASP D 1 29  ? -102.862 119.242 150.150 1.00 76.28  ?  139 ASP B N     1 
ATOM   1624 C  CA    . ASP D 1 29  ? -102.090 119.969 149.151 1.00 70.50  ?  139 ASP B CA    1 
ATOM   1625 C  C     . ASP D 1 29  ? -102.467 119.577 147.730 1.00 70.84  ?  139 ASP B C     1 
ATOM   1626 O  O     . ASP D 1 29  ? -102.145 120.315 146.792 1.00 69.78  ?  139 ASP B O     1 
ATOM   1627 C  CB    . ASP D 1 29  ? -100.594 119.752 149.381 1.00 70.36  ?  139 ASP B CB    1 
ATOM   1628 C  CG    . ASP D 1 29  ? -100.195 119.950 150.831 1.00 79.69  ?  139 ASP B CG    1 
ATOM   1629 O  OD1   . ASP D 1 29  ? -99.517  119.065 151.392 1.00 77.23  ?  139 ASP B OD1   1 
ATOM   1630 O  OD2   . ASP D 1 29  ? -100.578 120.985 151.417 1.00 78.03  -1 139 ASP B OD2   1 
ATOM   1631 N  N     . ILE D 1 30  ? -103.135 118.436 147.546 1.00 71.26  ?  140 ILE B N     1 
ATOM   1632 C  CA    . ILE D 1 30  ? -103.667 118.110 146.229 1.00 69.29  ?  140 ILE B CA    1 
ATOM   1633 C  C     . ILE D 1 30  ? -104.831 119.033 145.891 1.00 68.23  ?  140 ILE B C     1 
ATOM   1634 O  O     . ILE D 1 30  ? -105.030 119.393 144.724 1.00 66.85  ?  140 ILE B O     1 
ATOM   1635 C  CB    . ILE D 1 30  ? -104.070 116.625 146.167 1.00 71.46  ?  140 ILE B CB    1 
ATOM   1636 C  CG1   . ILE D 1 30  ? -102.872 115.742 146.521 1.00 65.65  ?  140 ILE B CG1   1 
ATOM   1637 C  CG2   . ILE D 1 30  ? -104.595 116.262 144.787 1.00 57.78  ?  140 ILE B CG2   1 
ATOM   1638 C  CD1   . ILE D 1 30  ? -103.159 114.260 146.462 1.00 69.58  ?  140 ILE B CD1   1 
ATOM   1639 N  N     . TYR D 1 31  ? -105.608 119.441 146.898 1.00 72.42  ?  141 TYR B N     1 
ATOM   1640 C  CA    . TYR D 1 31  ? -106.639 120.451 146.681 1.00 74.14  ?  141 TYR B CA    1 
ATOM   1641 C  C     . TYR D 1 31  ? -106.018 121.788 146.296 1.00 72.42  ?  141 TYR B C     1 
ATOM   1642 O  O     . TYR D 1 31  ? -106.425 122.417 145.312 1.00 75.82  ?  141 TYR B O     1 
ATOM   1643 C  CB    . TYR D 1 31  ? -107.491 120.619 147.940 1.00 78.35  ?  141 TYR B CB    1 
ATOM   1644 C  CG    . TYR D 1 31  ? -108.278 119.399 148.353 1.00 79.18  ?  141 TYR B CG    1 
ATOM   1645 C  CD1   . TYR D 1 31  ? -108.844 118.557 147.408 1.00 75.94  ?  141 TYR B CD1   1 
ATOM   1646 C  CD2   . TYR D 1 31  ? -108.461 119.095 149.696 1.00 76.18  ?  141 TYR B CD2   1 
ATOM   1647 C  CE1   . TYR D 1 31  ? -109.567 117.445 147.789 1.00 61.00  ?  141 TYR B CE1   1 
ATOM   1648 C  CE2   . TYR D 1 31  ? -109.180 117.985 150.085 1.00 67.64  ?  141 TYR B CE2   1 
ATOM   1649 C  CZ    . TYR D 1 31  ? -109.731 117.163 149.128 1.00 67.11  ?  141 TYR B CZ    1 
ATOM   1650 O  OH    . TYR D 1 31  ? -110.450 116.057 149.511 1.00 73.07  ?  141 TYR B OH    1 
ATOM   1651 N  N     . ASN D 1 32  ? -105.026 122.237 147.070 1.00 70.04  ?  142 ASN B N     1 
ATOM   1652 C  CA    . ASN D 1 32  ? -104.461 123.568 146.872 1.00 73.39  ?  142 ASN B CA    1 
ATOM   1653 C  C     . ASN D 1 32  ? -103.737 123.687 145.538 1.00 73.62  ?  142 ASN B C     1 
ATOM   1654 O  O     . ASN D 1 32  ? -103.759 124.757 144.918 1.00 75.97  ?  142 ASN B O     1 
ATOM   1655 C  CB    . ASN D 1 32  ? -103.515 123.907 148.024 1.00 87.78  ?  142 ASN B CB    1 
ATOM   1656 C  CG    . ASN D 1 32  ? -104.147 123.674 149.384 1.00 89.16  ?  142 ASN B CG    1 
ATOM   1657 O  OD1   . ASN D 1 32  ? -105.370 123.608 149.509 1.00 82.70  ?  142 ASN B OD1   1 
ATOM   1658 N  ND2   . ASN D 1 32  ? -103.314 123.552 150.411 1.00 83.83  ?  142 ASN B ND2   1 
ATOM   1659 N  N     . TRP D 1 33  ? -103.089 122.613 145.081 1.00 75.62  ?  143 TRP B N     1 
ATOM   1660 C  CA    . TRP D 1 33  ? -102.437 122.653 143.776 1.00 68.30  ?  143 TRP B CA    1 
ATOM   1661 C  C     . TRP D 1 33  ? -103.463 122.746 142.655 1.00 70.00  ?  143 TRP B C     1 
ATOM   1662 O  O     . TRP D 1 33  ? -103.220 123.402 141.635 1.00 77.51  ?  143 TRP B O     1 
ATOM   1663 C  CB    . TRP D 1 33  ? -101.550 121.422 143.591 1.00 63.16  ?  143 TRP B CB    1 
ATOM   1664 C  CG    . TRP D 1 33  ? -100.689 121.478 142.362 1.00 70.96  ?  143 TRP B CG    1 
ATOM   1665 C  CD1   . TRP D 1 33  ? -99.387  121.880 142.292 1.00 70.64  ?  143 TRP B CD1   1 
ATOM   1666 C  CD2   . TRP D 1 33  ? -101.070 121.122 141.026 1.00 70.33  ?  143 TRP B CD2   1 
ATOM   1667 N  NE1   . TRP D 1 33  ? -98.934  121.796 140.998 1.00 66.66  ?  143 TRP B NE1   1 
ATOM   1668 C  CE2   . TRP D 1 33  ? -99.948  121.334 140.201 1.00 67.55  ?  143 TRP B CE2   1 
ATOM   1669 C  CE3   . TRP D 1 33  ? -102.251 120.644 140.447 1.00 68.24  ?  143 TRP B CE3   1 
ATOM   1670 C  CZ2   . TRP D 1 33  ? -99.971  121.085 138.830 1.00 71.47  ?  143 TRP B CZ2   1 
ATOM   1671 C  CZ3   . TRP D 1 33  ? -102.272 120.399 139.087 1.00 68.15  ?  143 TRP B CZ3   1 
ATOM   1672 C  CH2   . TRP D 1 33  ? -101.140 120.620 138.293 1.00 64.80  ?  143 TRP B CH2   1 
ATOM   1673 N  N     . ILE D 1 34  ? -104.616 122.097 142.827 1.00 72.22  ?  144 ILE B N     1 
ATOM   1674 C  CA    . ILE D 1 34  ? -105.647 122.120 141.796 1.00 71.28  ?  144 ILE B CA    1 
ATOM   1675 C  C     . ILE D 1 34  ? -106.294 123.498 141.713 1.00 73.13  ?  144 ILE B C     1 
ATOM   1676 O  O     . ILE D 1 34  ? -106.564 124.006 140.618 1.00 78.93  ?  144 ILE B O     1 
ATOM   1677 C  CB    . ILE D 1 34  ? -106.683 121.012 142.062 1.00 70.24  ?  144 ILE B CB    1 
ATOM   1678 C  CG1   . ILE D 1 34  ? -106.088 119.639 141.737 1.00 64.65  ?  144 ILE B CG1   1 
ATOM   1679 C  CG2   . ILE D 1 34  ? -107.953 121.249 141.262 1.00 74.63  ?  144 ILE B CG2   1 
ATOM   1680 C  CD1   . ILE D 1 34  ? -107.024 118.483 142.018 1.00 61.18  ?  144 ILE B CD1   1 
ATOM   1681 N  N     . LEU D 1 35  ? -106.541 124.131 142.862 1.00 74.38  ?  145 LEU B N     1 
ATOM   1682 C  CA    . LEU D 1 35  ? -107.176 125.446 142.857 1.00 81.48  ?  145 LEU B CA    1 
ATOM   1683 C  C     . LEU D 1 35  ? -106.255 126.513 142.278 1.00 82.19  ?  145 LEU B C     1 
ATOM   1684 O  O     . LEU D 1 35  ? -106.718 127.431 141.590 1.00 83.66  ?  145 LEU B O     1 
ATOM   1685 C  CB    . LEU D 1 35  ? -107.612 125.827 144.272 1.00 79.77  ?  145 LEU B CB    1 
ATOM   1686 C  CG    . LEU D 1 35  ? -108.964 125.284 144.738 1.00 78.18  ?  145 LEU B CG    1 
ATOM   1687 C  CD1   . LEU D 1 35  ? -109.284 125.781 146.139 1.00 80.00  ?  145 LEU B CD1   1 
ATOM   1688 C  CD2   . LEU D 1 35  ? -110.061 125.684 143.763 1.00 80.74  ?  145 LEU B CD2   1 
ATOM   1689 N  N     . GLU D 1 36  ? -104.951 126.415 142.545 1.00 81.53  ?  146 GLU B N     1 
ATOM   1690 C  CA    . GLU D 1 36  ? -104.014 127.422 142.053 1.00 84.83  ?  146 GLU B CA    1 
ATOM   1691 C  C     . GLU D 1 36  ? -103.906 127.380 140.534 1.00 85.14  ?  146 GLU B C     1 
ATOM   1692 O  O     . GLU D 1 36  ? -104.250 128.348 139.846 1.00 90.67  ?  146 GLU B O     1 
ATOM   1693 C  CB    . GLU D 1 36  ? -102.639 127.224 142.693 1.00 76.41  ?  146 GLU B CB    1 
ATOM   1694 C  CG    . GLU D 1 36  ? -102.543 127.683 144.136 1.00 92.44  ?  146 GLU B CG    1 
ATOM   1695 C  CD    . GLU D 1 36  ? -101.108 127.781 144.615 1.00 104.35 ?  146 GLU B CD    1 
ATOM   1696 O  OE1   . GLU D 1 36  ? -100.190 127.663 143.775 1.00 90.87  ?  146 GLU B OE1   1 
ATOM   1697 O  OE2   . GLU D 1 36  ? -100.897 127.976 145.830 1.00 103.17 ?  146 GLU B OE2   1 
ATOM   1698 N  N     . HIS D 1 37  ? -103.423 126.262 139.990 1.00 76.03  ?  147 HIS B N     1 
ATOM   1699 C  CA    . HIS D 1 37  ? -103.224 126.143 138.551 1.00 80.55  ?  147 HIS B CA    1 
ATOM   1700 C  C     . HIS D 1 37  ? -104.532 126.062 137.779 1.00 82.03  ?  147 HIS B C     1 
ATOM   1701 O  O     . HIS D 1 37  ? -104.510 126.156 136.547 1.00 72.99  ?  147 HIS B O     1 
ATOM   1702 C  CB    . HIS D 1 37  ? -102.362 124.919 138.246 1.00 75.31  ?  147 HIS B CB    1 
ATOM   1703 C  CG    . HIS D 1 37  ? -101.027 124.947 138.919 1.00 70.55  ?  147 HIS B CG    1 
ATOM   1704 N  ND1   . HIS D 1 37  ? -100.875 124.759 140.276 1.00 75.77  ?  147 HIS B ND1   1 
ATOM   1705 C  CD2   . HIS D 1 37  ? -99.784  125.157 138.427 1.00 78.07  ?  147 HIS B CD2   1 
ATOM   1706 C  CE1   . HIS D 1 37  ? -99.594  124.845 140.589 1.00 76.70  ?  147 HIS B CE1   1 
ATOM   1707 N  NE2   . HIS D 1 37  ? -98.911  125.085 139.485 1.00 71.93  ?  147 HIS B NE2   1 
ATOM   1708 N  N     . PHE D 1 38  ? -105.661 125.886 138.465 1.00 86.64  ?  148 PHE B N     1 
ATOM   1709 C  CA    . PHE D 1 38  ? -106.974 125.870 137.825 1.00 85.31  ?  148 PHE B CA    1 
ATOM   1710 C  C     . PHE D 1 38  ? -107.970 126.572 138.734 1.00 85.72  ?  148 PHE B C     1 
ATOM   1711 O  O     . PHE D 1 38  ? -108.644 125.933 139.552 1.00 88.86  ?  148 PHE B O     1 
ATOM   1712 C  CB    . PHE D 1 38  ? -107.431 124.443 137.516 1.00 78.74  ?  148 PHE B CB    1 
ATOM   1713 C  CG    . PHE D 1 38  ? -106.533 123.707 136.564 1.00 79.96  ?  148 PHE B CG    1 
ATOM   1714 C  CD1   . PHE D 1 38  ? -106.686 123.851 135.194 1.00 81.02  ?  148 PHE B CD1   1 
ATOM   1715 C  CD2   . PHE D 1 38  ? -105.544 122.862 137.038 1.00 76.21  ?  148 PHE B CD2   1 
ATOM   1716 C  CE1   . PHE D 1 38  ? -105.863 123.170 134.315 1.00 82.32  ?  148 PHE B CE1   1 
ATOM   1717 C  CE2   . PHE D 1 38  ? -104.718 122.178 136.163 1.00 82.09  ?  148 PHE B CE2   1 
ATOM   1718 C  CZ    . PHE D 1 38  ? -104.879 122.333 134.800 1.00 82.42  ?  148 PHE B CZ    1 
ATOM   1719 N  N     . PRO D 1 39  ? -108.090 127.900 138.619 1.00 92.91  ?  149 PRO B N     1 
ATOM   1720 C  CA    . PRO D 1 39  ? -109.144 128.619 139.356 1.00 90.36  ?  149 PRO B CA    1 
ATOM   1721 C  C     . PRO D 1 39  ? -110.549 128.243 138.919 1.00 91.77  ?  149 PRO B C     1 
ATOM   1722 O  O     . PRO D 1 39  ? -111.520 128.772 139.469 1.00 95.83  ?  149 PRO B O     1 
ATOM   1723 C  CB    . PRO D 1 39  ? -108.845 130.095 139.047 1.00 97.76  ?  149 PRO B CB    1 
ATOM   1724 C  CG    . PRO D 1 39  ? -107.443 130.119 138.521 1.00 91.94  ?  149 PRO B CG    1 
ATOM   1725 C  CD    . PRO D 1 39  ? -107.236 128.809 137.838 1.00 90.80  ?  149 PRO B CD    1 
ATOM   1726 N  N     . TYR D 1 40  ? -110.667 127.339 137.947 1.00 94.07  ?  150 TYR B N     1 
ATOM   1727 C  CA    . TYR D 1 40  ? -111.969 126.880 137.477 1.00 90.64  ?  150 TYR B CA    1 
ATOM   1728 C  C     . TYR D 1 40  ? -112.782 126.253 138.603 1.00 87.17  ?  150 TYR B C     1 
ATOM   1729 O  O     . TYR D 1 40  ? -114.011 126.390 138.643 1.00 91.50  ?  150 TYR B O     1 
ATOM   1730 C  CB    . TYR D 1 40  ? -111.758 125.882 136.338 1.00 92.57  ?  150 TYR B CB    1 
ATOM   1731 C  CG    . TYR D 1 40  ? -112.983 125.131 135.874 1.00 96.80  ?  150 TYR B CG    1 
ATOM   1732 C  CD1   . TYR D 1 40  ? -113.774 125.627 134.847 1.00 98.23  ?  150 TYR B CD1   1 
ATOM   1733 C  CD2   . TYR D 1 40  ? -113.329 123.908 136.439 1.00 94.63  ?  150 TYR B CD2   1 
ATOM   1734 C  CE1   . TYR D 1 40  ? -114.887 124.938 134.409 1.00 97.23  ?  150 TYR B CE1   1 
ATOM   1735 C  CE2   . TYR D 1 40  ? -114.443 123.214 136.007 1.00 98.85  ?  150 TYR B CE2   1 
ATOM   1736 C  CZ    . TYR D 1 40  ? -115.215 123.735 134.992 1.00 98.00  ?  150 TYR B CZ    1 
ATOM   1737 O  OH    . TYR D 1 40  ? -116.322 123.051 134.555 1.00 94.80  ?  150 TYR B OH    1 
ATOM   1738 N  N     . PHE D 1 41  ? -112.117 125.560 139.525 1.00 85.82  ?  151 PHE B N     1 
ATOM   1739 C  CA    . PHE D 1 41  ? -112.802 124.803 140.565 1.00 88.00  ?  151 PHE B CA    1 
ATOM   1740 C  C     . PHE D 1 41  ? -113.237 125.660 141.749 1.00 91.05  ?  151 PHE B C     1 
ATOM   1741 O  O     . PHE D 1 41  ? -113.680 125.108 142.762 1.00 93.20  ?  151 PHE B O     1 
ATOM   1742 C  CB    . PHE D 1 41  ? -111.914 123.654 141.046 1.00 79.90  ?  151 PHE B CB    1 
ATOM   1743 C  CG    . PHE D 1 41  ? -111.705 122.584 140.014 1.00 76.86  ?  151 PHE B CG    1 
ATOM   1744 C  CD1   . PHE D 1 41  ? -112.670 121.615 139.797 1.00 75.66  ?  151 PHE B CD1   1 
ATOM   1745 C  CD2   . PHE D 1 41  ? -110.547 122.551 139.256 1.00 83.04  ?  151 PHE B CD2   1 
ATOM   1746 C  CE1   . PHE D 1 41  ? -112.482 120.629 138.845 1.00 72.17  ?  151 PHE B CE1   1 
ATOM   1747 C  CE2   . PHE D 1 41  ? -110.352 121.567 138.304 1.00 76.66  ?  151 PHE B CE2   1 
ATOM   1748 C  CZ    . PHE D 1 41  ? -111.321 120.605 138.098 1.00 73.00  ?  151 PHE B CZ    1 
ATOM   1749 N  N     . ALA D 1 42  ? -113.117 126.985 141.653 1.00 87.48  ?  152 ALA B N     1 
ATOM   1750 C  CA    . ALA D 1 42  ? -113.705 127.848 142.669 1.00 89.88  ?  152 ALA B CA    1 
ATOM   1751 C  C     . ALA D 1 42  ? -115.187 128.082 142.412 1.00 93.21  ?  152 ALA B C     1 
ATOM   1752 O  O     . ALA D 1 42  ? -115.955 128.280 143.360 1.00 83.78  ?  152 ALA B O     1 
ATOM   1753 C  CB    . ALA D 1 42  ? -112.961 129.183 142.728 1.00 88.84  ?  152 ALA B CB    1 
ATOM   1754 N  N     . ASN D 1 43  ? -115.602 128.055 141.146 1.00 96.27  ?  153 ASN B N     1 
ATOM   1755 C  CA    . ASN D 1 43  ? -117.000 128.206 140.769 1.00 97.16  ?  153 ASN B CA    1 
ATOM   1756 C  C     . ASN D 1 43  ? -117.715 126.873 140.605 1.00 94.73  ?  153 ASN B C     1 
ATOM   1757 O  O     . ASN D 1 43  ? -118.943 126.858 140.464 1.00 95.89  ?  153 ASN B O     1 
ATOM   1758 C  CB    . ASN D 1 43  ? -117.107 129.003 139.465 1.00 94.74  ?  153 ASN B CB    1 
ATOM   1759 C  CG    . ASN D 1 43  ? -116.053 130.088 139.356 1.00 100.02 ?  153 ASN B CG    1 
ATOM   1760 O  OD1   . ASN D 1 43  ? -115.226 130.076 138.444 1.00 95.64  ?  153 ASN B OD1   1 
ATOM   1761 N  ND2   . ASN D 1 43  ? -116.074 131.031 140.291 1.00 100.63 ?  153 ASN B ND2   1 
ATOM   1762 N  N     . ALA D 1 44  ? -116.981 125.763 140.617 1.00 92.67  ?  154 ALA B N     1 
ATOM   1763 C  CA    . ALA D 1 44  ? -117.577 124.451 140.452 1.00 94.59  ?  154 ALA B CA    1 
ATOM   1764 C  C     . ALA D 1 44  ? -118.371 124.063 141.699 1.00 97.46  ?  154 ALA B C     1 
ATOM   1765 O  O     . ALA D 1 44  ? -118.189 124.651 142.768 1.00 97.30  ?  154 ALA B O     1 
ATOM   1766 C  CB    . ALA D 1 44  ? -116.491 123.414 140.170 1.00 97.59  ?  154 ALA B CB    1 
ATOM   1767 N  N     . PRO D 1 45  ? -119.273 123.086 141.581 1.00 97.79  ?  155 PRO B N     1 
ATOM   1768 C  CA    . PRO D 1 45  ? -119.993 122.603 142.764 1.00 95.88  ?  155 PRO B CA    1 
ATOM   1769 C  C     . PRO D 1 45  ? -119.043 122.094 143.840 1.00 92.52  ?  155 PRO B C     1 
ATOM   1770 O  O     . PRO D 1 45  ? -117.878 121.777 143.588 1.00 89.74  ?  155 PRO B O     1 
ATOM   1771 C  CB    . PRO D 1 45  ? -120.866 121.472 142.209 1.00 95.55  ?  155 PRO B CB    1 
ATOM   1772 C  CG    . PRO D 1 45  ? -121.094 121.856 140.790 1.00 84.82  ?  155 PRO B CG    1 
ATOM   1773 C  CD    . PRO D 1 45  ? -119.823 122.519 140.336 1.00 87.35  ?  155 PRO B CD    1 
ATOM   1774 N  N     . THR D 1 46  ? -119.571 122.013 145.064 1.00 94.73  ?  156 THR B N     1 
ATOM   1775 C  CA    . THR D 1 46  ? -118.750 121.687 146.225 1.00 100.57 ?  156 THR B CA    1 
ATOM   1776 C  C     . THR D 1 46  ? -118.233 120.253 146.206 1.00 93.22  ?  156 THR B C     1 
ATOM   1777 O  O     . THR D 1 46  ? -117.279 119.946 146.929 1.00 92.56  ?  156 THR B O     1 
ATOM   1778 C  CB    . THR D 1 46  ? -119.543 121.928 147.510 1.00 97.69  ?  156 THR B CB    1 
ATOM   1779 O  OG1   . THR D 1 46  ? -120.822 121.287 147.413 1.00 98.87  ?  156 THR B OG1   1 
ATOM   1780 C  CG2   . THR D 1 46  ? -119.743 123.419 147.742 1.00 91.77  ?  156 THR B CG2   1 
ATOM   1781 N  N     . GLY D 1 47  ? -118.830 119.375 145.405 1.00 85.70  ?  157 GLY B N     1 
ATOM   1782 C  CA    . GLY D 1 47  ? -118.444 117.981 145.377 1.00 82.84  ?  157 GLY B CA    1 
ATOM   1783 C  C     . GLY D 1 47  ? -117.170 117.656 144.634 1.00 75.72  ?  157 GLY B C     1 
ATOM   1784 O  O     . GLY D 1 47  ? -116.840 116.475 144.492 1.00 76.99  ?  157 GLY B O     1 
ATOM   1785 N  N     . TRP D 1 48  ? -116.432 118.661 144.155 1.00 81.14  ?  158 TRP B N     1 
ATOM   1786 C  CA    . TRP D 1 48  ? -115.225 118.381 143.384 1.00 73.49  ?  158 TRP B CA    1 
ATOM   1787 C  C     . TRP D 1 48  ? -114.120 117.797 144.256 1.00 70.07  ?  158 TRP B C     1 
ATOM   1788 O  O     . TRP D 1 48  ? -113.321 116.986 143.776 1.00 70.20  ?  158 TRP B O     1 
ATOM   1789 C  CB    . TRP D 1 48  ? -114.738 119.649 142.680 1.00 73.88  ?  158 TRP B CB    1 
ATOM   1790 C  CG    . TRP D 1 48  ? -114.149 120.671 143.602 1.00 75.43  ?  158 TRP B CG    1 
ATOM   1791 C  CD1   . TRP D 1 48  ? -114.824 121.621 144.311 1.00 82.36  ?  158 TRP B CD1   1 
ATOM   1792 C  CD2   . TRP D 1 48  ? -112.762 120.849 143.910 1.00 75.13  ?  158 TRP B CD2   1 
ATOM   1793 N  NE1   . TRP D 1 48  ? -113.943 122.379 145.044 1.00 89.51  ?  158 TRP B NE1   1 
ATOM   1794 C  CE2   . TRP D 1 48  ? -112.670 121.925 144.815 1.00 82.08  ?  158 TRP B CE2   1 
ATOM   1795 C  CE3   . TRP D 1 48  ? -111.588 120.203 143.510 1.00 73.16  ?  158 TRP B CE3   1 
ATOM   1796 C  CZ2   . TRP D 1 48  ? -111.452 122.369 145.327 1.00 80.77  ?  158 TRP B CZ2   1 
ATOM   1797 C  CZ3   . TRP D 1 48  ? -110.380 120.645 144.019 1.00 76.74  ?  158 TRP B CZ3   1 
ATOM   1798 C  CH2   . TRP D 1 48  ? -110.322 121.718 144.918 1.00 75.60  ?  158 TRP B CH2   1 
ATOM   1799 N  N     . LYS D 1 49  ? -114.056 118.193 145.530 1.00 69.03  ?  159 LYS B N     1 
ATOM   1800 C  CA    . LYS D 1 49  ? -113.076 117.596 146.431 1.00 69.78  ?  159 LYS B CA    1 
ATOM   1801 C  C     . LYS D 1 49  ? -113.387 116.131 146.707 1.00 69.15  ?  159 LYS B C     1 
ATOM   1802 O  O     . LYS D 1 49  ? -112.473 115.344 146.975 1.00 66.95  ?  159 LYS B O     1 
ATOM   1803 C  CB    . LYS D 1 49  ? -113.015 118.376 147.745 1.00 76.81  ?  159 LYS B CB    1 
ATOM   1804 C  CG    . LYS D 1 49  ? -112.353 119.740 147.644 1.00 76.32  ?  159 LYS B CG    1 
ATOM   1805 C  CD    . LYS D 1 49  ? -112.186 120.360 149.024 1.00 78.25  ?  159 LYS B CD    1 
ATOM   1806 C  CE    . LYS D 1 49  ? -111.455 121.689 148.953 1.00 81.76  ?  159 LYS B CE    1 
ATOM   1807 N  NZ    . LYS D 1 49  ? -111.238 122.269 150.307 1.00 75.10  ?  159 LYS B NZ    1 
ATOM   1808 N  N     . ASN D 1 50  ? -114.665 115.750 146.651 1.00 72.52  ?  160 ASN B N     1 
ATOM   1809 C  CA    . ASN D 1 50  ? -115.035 114.358 146.877 1.00 68.50  ?  160 ASN B CA    1 
ATOM   1810 C  C     . ASN D 1 50  ? -114.633 113.471 145.708 1.00 64.46  ?  160 ASN B C     1 
ATOM   1811 O  O     . ASN D 1 50  ? -114.262 112.309 145.912 1.00 62.35  ?  160 ASN B O     1 
ATOM   1812 C  CB    . ASN D 1 50  ? -116.539 114.249 147.130 1.00 71.10  ?  160 ASN B CB    1 
ATOM   1813 C  CG    . ASN D 1 50  ? -116.930 114.677 148.532 1.00 69.00  ?  160 ASN B CG    1 
ATOM   1814 O  OD1   . ASN D 1 50  ? -117.428 113.872 149.319 1.00 73.18  ?  160 ASN B OD1   1 
ATOM   1815 N  ND2   . ASN D 1 50  ? -116.699 115.944 148.854 1.00 66.66  ?  160 ASN B ND2   1 
ATOM   1816 N  N     . SER D 1 51  ? -114.691 113.997 144.484 1.00 65.60  ?  161 SER B N     1 
ATOM   1817 C  CA    . SER D 1 51  ? -114.389 113.175 143.318 1.00 61.61  ?  161 SER B CA    1 
ATOM   1818 C  C     . SER D 1 51  ? -112.899 112.881 143.200 1.00 59.10  ?  161 SER B C     1 
ATOM   1819 O  O     . SER D 1 51  ? -112.518 111.869 142.601 1.00 62.79  ?  161 SER B O     1 
ATOM   1820 C  CB    . SER D 1 51  ? -114.897 113.855 142.047 1.00 58.84  ?  161 SER B CB    1 
ATOM   1821 O  OG    . SER D 1 51  ? -116.304 114.020 142.083 1.00 63.04  ?  161 SER B OG    1 
ATOM   1822 N  N     . VAL D 1 52  ? -112.043 113.741 143.755 1.00 63.18  ?  162 VAL B N     1 
ATOM   1823 C  CA    . VAL D 1 52  ? -110.611 113.472 143.682 1.00 60.81  ?  162 VAL B CA    1 
ATOM   1824 C  C     . VAL D 1 52  ? -110.184 112.495 144.773 1.00 64.23  ?  162 VAL B C     1 
ATOM   1825 O  O     . VAL D 1 52  ? -109.177 111.794 144.620 1.00 71.82  ?  162 VAL B O     1 
ATOM   1826 C  CB    . VAL D 1 52  ? -109.802 114.780 143.748 1.00 57.56  ?  162 VAL B CB    1 
ATOM   1827 C  CG1   . VAL D 1 52  ? -110.415 115.832 142.836 1.00 66.01  ?  162 VAL B CG1   1 
ATOM   1828 C  CG2   . VAL D 1 52  ? -109.712 115.286 145.171 1.00 68.63  ?  162 VAL B CG2   1 
ATOM   1829 N  N     . ARG D 1 53  ? -110.929 112.422 145.881 1.00 63.83  ?  163 ARG B N     1 
ATOM   1830 C  CA    . ARG D 1 53  ? -110.645 111.401 146.884 1.00 67.04  ?  163 ARG B CA    1 
ATOM   1831 C  C     . ARG D 1 53  ? -111.065 110.025 146.391 1.00 62.76  ?  163 ARG B C     1 
ATOM   1832 O  O     . ARG D 1 53  ? -110.382 109.028 146.655 1.00 64.62  ?  163 ARG B O     1 
ATOM   1833 C  CB    . ARG D 1 53  ? -111.353 111.725 148.199 1.00 72.10  ?  163 ARG B CB    1 
ATOM   1834 C  CG    . ARG D 1 53  ? -110.868 112.980 148.893 1.00 71.17  ?  163 ARG B CG    1 
ATOM   1835 C  CD    . ARG D 1 53  ? -111.314 112.995 150.345 1.00 69.51  ?  163 ARG B CD    1 
ATOM   1836 N  NE    . ARG D 1 53  ? -112.645 112.417 150.510 1.00 68.57  ?  163 ARG B NE    1 
ATOM   1837 C  CZ    . ARG D 1 53  ? -113.778 113.099 150.382 1.00 71.44  ?  163 ARG B CZ    1 
ATOM   1838 N  NH1   . ARG D 1 53  ? -113.748 114.390 150.084 1.00 70.14  ?  163 ARG B NH1   1 
ATOM   1839 N  NH2   . ARG D 1 53  ? -114.943 112.488 150.552 1.00 76.72  ?  163 ARG B NH2   1 
ATOM   1840 N  N     . HIS D 1 54  ? -112.194 109.953 145.683 1.00 59.29  ?  164 HIS B N     1 
ATOM   1841 C  CA    . HIS D 1 54  ? -112.624 108.688 145.100 1.00 62.62  ?  164 HIS B CA    1 
ATOM   1842 C  C     . HIS D 1 54  ? -111.612 108.189 144.078 1.00 62.27  ?  164 HIS B C     1 
ATOM   1843 O  O     . HIS D 1 54  ? -111.331 106.987 144.004 1.00 63.47  ?  164 HIS B O     1 
ATOM   1844 C  CB    . HIS D 1 54  ? -114.003 108.852 144.461 1.00 52.35  ?  164 HIS B CB    1 
ATOM   1845 C  CG    . HIS D 1 54  ? -114.631 107.562 144.038 1.00 61.00  ?  164 HIS B CG    1 
ATOM   1846 N  ND1   . HIS D 1 54  ? -114.419 107.002 142.797 1.00 61.75  ?  164 HIS B ND1   1 
ATOM   1847 C  CD2   . HIS D 1 54  ? -115.466 106.722 144.693 1.00 57.19  ?  164 HIS B CD2   1 
ATOM   1848 C  CE1   . HIS D 1 54  ? -115.097 105.872 142.705 1.00 63.35  ?  164 HIS B CE1   1 
ATOM   1849 N  NE2   . HIS D 1 54  ? -115.741 105.679 143.842 1.00 70.13  ?  164 HIS B NE2   1 
ATOM   1850 N  N     . ASN D 1 55  ? -111.048 109.102 143.285 1.00 59.21  ?  165 ASN B N     1 
ATOM   1851 C  CA    . ASN D 1 55  ? -110.004 108.718 142.343 1.00 61.94  ?  165 ASN B CA    1 
ATOM   1852 C  C     . ASN D 1 55  ? -108.721 108.343 143.075 1.00 59.90  ?  165 ASN B C     1 
ATOM   1853 O  O     . ASN D 1 55  ? -108.045 107.380 142.699 1.00 64.70  ?  165 ASN B O     1 
ATOM   1854 C  CB    . ASN D 1 55  ? -109.753 109.856 141.352 1.00 61.02  ?  165 ASN B CB    1 
ATOM   1855 C  CG    . ASN D 1 55  ? -109.071 109.386 140.079 1.00 52.98  ?  165 ASN B CG    1 
ATOM   1856 O  OD1   . ASN D 1 55  ? -108.188 108.531 140.110 1.00 62.69  ?  165 ASN B OD1   1 
ATOM   1857 N  ND2   . ASN D 1 55  ? -109.485 109.947 138.949 1.00 55.38  ?  165 ASN B ND2   1 
ATOM   1858 N  N     . LEU D 1 56  ? -108.376 109.085 144.129 1.00 63.30  ?  166 LEU B N     1 
ATOM   1859 C  CA    . LEU D 1 56  ? -107.171 108.773 144.891 1.00 60.98  ?  166 LEU B CA    1 
ATOM   1860 C  C     . LEU D 1 56  ? -107.241 107.390 145.523 1.00 69.03  ?  166 LEU B C     1 
ATOM   1861 O  O     . LEU D 1 56  ? -106.210 106.726 145.681 1.00 68.07  ?  166 LEU B O     1 
ATOM   1862 C  CB    . LEU D 1 56  ? -106.945 109.827 145.975 1.00 61.58  ?  166 LEU B CB    1 
ATOM   1863 C  CG    . LEU D 1 56  ? -105.731 110.745 145.837 1.00 68.12  ?  166 LEU B CG    1 
ATOM   1864 C  CD1   . LEU D 1 56  ? -105.577 111.598 147.086 1.00 64.98  ?  166 LEU B CD1   1 
ATOM   1865 C  CD2   . LEU D 1 56  ? -104.470 109.939 145.577 1.00 71.21  ?  166 LEU B CD2   1 
ATOM   1866 N  N     . SER D 1 57  ? -108.441 106.936 145.883 1.00 73.88  ?  167 SER B N     1 
ATOM   1867 C  CA    . SER D 1 57  ? -108.598 105.707 146.651 1.00 71.79  ?  167 SER B CA    1 
ATOM   1868 C  C     . SER D 1 57  ? -108.712 104.463 145.776 1.00 73.51  ?  167 SER B C     1 
ATOM   1869 O  O     . SER D 1 57  ? -108.120 103.428 146.100 1.00 85.66  ?  167 SER B O     1 
ATOM   1870 C  CB    . SER D 1 57  ? -109.828 105.812 147.556 1.00 76.98  ?  167 SER B CB    1 
ATOM   1871 O  OG    . SER D 1 57  ? -110.084 104.584 148.214 1.00 94.97  ?  167 SER B OG    1 
ATOM   1872 N  N     . LEU D 1 58  ? -109.460 104.536 144.676 1.00 70.34  ?  168 LEU B N     1 
ATOM   1873 C  CA    . LEU D 1 58  ? -109.785 103.353 143.890 1.00 71.54  ?  168 LEU B CA    1 
ATOM   1874 C  C     . LEU D 1 58  ? -108.982 103.229 142.601 1.00 77.91  ?  168 LEU B C     1 
ATOM   1875 O  O     . LEU D 1 58  ? -109.112 102.215 141.909 1.00 78.11  ?  168 LEU B O     1 
ATOM   1876 C  CB    . LEU D 1 58  ? -111.281 103.332 143.560 1.00 76.48  ?  168 LEU B CB    1 
ATOM   1877 C  CG    . LEU D 1 58  ? -112.226 103.069 144.734 1.00 83.36  ?  168 LEU B CG    1 
ATOM   1878 C  CD1   . LEU D 1 58  ? -112.875 104.358 145.220 1.00 70.54  ?  168 LEU B CD1   1 
ATOM   1879 C  CD2   . LEU D 1 58  ? -113.273 102.038 144.350 1.00 82.34  ?  168 LEU B CD2   1 
ATOM   1880 N  N     . ASN D 1 59  ? -108.165 104.220 142.256 1.00 77.43  ?  169 ASN B N     1 
ATOM   1881 C  CA    . ASN D 1 59  ? -107.358 104.124 141.048 1.00 77.34  ?  169 ASN B CA    1 
ATOM   1882 C  C     . ASN D 1 59  ? -106.106 103.301 141.317 1.00 75.59  ?  169 ASN B C     1 
ATOM   1883 O  O     . ASN D 1 59  ? -105.485 103.413 142.378 1.00 77.24  ?  169 ASN B O     1 
ATOM   1884 C  CB    . ASN D 1 59  ? -106.971 105.512 140.538 1.00 66.78  ?  169 ASN B CB    1 
ATOM   1885 C  CG    . ASN D 1 59  ? -106.640 105.515 139.059 1.00 70.81  ?  169 ASN B CG    1 
ATOM   1886 O  OD1   . ASN D 1 59  ? -107.245 104.786 138.274 1.00 87.53  ?  169 ASN B OD1   1 
ATOM   1887 N  ND2   . ASN D 1 59  ? -105.672 106.337 138.671 1.00 69.52  ?  169 ASN B ND2   1 
ATOM   1888 N  N     . LYS D 1 60  ? -105.741 102.466 140.343 1.00 80.40  ?  170 LYS B N     1 
ATOM   1889 C  CA    . LYS D 1 60  ? -104.565 101.616 140.477 1.00 80.35  ?  170 LYS B CA    1 
ATOM   1890 C  C     . LYS D 1 60  ? -103.268 102.413 140.508 1.00 81.97  ?  170 LYS B C     1 
ATOM   1891 O  O     . LYS D 1 60  ? -102.233 101.870 140.909 1.00 82.27  ?  170 LYS B O     1 
ATOM   1892 C  CB    . LYS D 1 60  ? -104.521 100.610 139.327 1.00 84.30  ?  170 LYS B CB    1 
ATOM   1893 C  CG    . LYS D 1 60  ? -104.501 101.263 137.952 1.00 92.58  ?  170 LYS B CG    1 
ATOM   1894 C  CD    . LYS D 1 60  ? -104.444 100.235 136.834 1.00 87.52  ?  170 LYS B CD    1 
ATOM   1895 C  CE    . LYS D 1 60  ? -104.353 100.912 135.475 1.00 95.64  ?  170 LYS B CE    1 
ATOM   1896 N  NZ    . LYS D 1 60  ? -104.207 99.929  134.367 1.00 109.63 ?  170 LYS B NZ    1 
ATOM   1897 N  N     . CYS D 1 61  ? -103.299 103.681 140.103 1.00 79.44  ?  171 CYS B N     1 
ATOM   1898 C  CA    . CYS D 1 61  ? -102.086 104.466 139.921 1.00 78.28  ?  171 CYS B CA    1 
ATOM   1899 C  C     . CYS D 1 61  ? -101.671 105.248 141.160 1.00 77.01  ?  171 CYS B C     1 
ATOM   1900 O  O     . CYS D 1 61  ? -100.608 105.878 141.144 1.00 77.73  ?  171 CYS B O     1 
ATOM   1901 C  CB    . CYS D 1 61  ? -102.268 105.439 138.751 1.00 75.42  ?  171 CYS B CB    1 
ATOM   1902 S  SG    . CYS D 1 61  ? -102.857 104.672 137.225 1.00 95.55  ?  171 CYS B SG    1 
ATOM   1903 N  N     . PHE D 1 62  ? -102.466 105.229 142.227 1.00 70.50  ?  172 PHE B N     1 
ATOM   1904 C  CA    . PHE D 1 62  ? -102.176 106.012 143.420 1.00 67.99  ?  172 PHE B CA    1 
ATOM   1905 C  C     . PHE D 1 62  ? -102.193 105.110 144.643 1.00 75.81  ?  172 PHE B C     1 
ATOM   1906 O  O     . PHE D 1 62  ? -103.148 104.354 144.849 1.00 80.43  ?  172 PHE B O     1 
ATOM   1907 C  CB    . PHE D 1 62  ? -103.180 107.157 143.589 1.00 65.63  ?  172 PHE B CB    1 
ATOM   1908 C  CG    . PHE D 1 62  ? -103.263 108.068 142.398 1.00 67.98  ?  172 PHE B CG    1 
ATOM   1909 C  CD1   . PHE D 1 62  ? -104.393 108.083 141.598 1.00 65.41  ?  172 PHE B CD1   1 
ATOM   1910 C  CD2   . PHE D 1 62  ? -102.206 108.899 142.071 1.00 63.96  ?  172 PHE B CD2   1 
ATOM   1911 C  CE1   . PHE D 1 62  ? -104.470 108.917 140.499 1.00 60.91  ?  172 PHE B CE1   1 
ATOM   1912 C  CE2   . PHE D 1 62  ? -102.276 109.734 140.973 1.00 57.16  ?  172 PHE B CE2   1 
ATOM   1913 C  CZ    . PHE D 1 62  ? -103.410 109.743 140.187 1.00 55.86  ?  172 PHE B CZ    1 
ATOM   1914 N  N     . LYS D 1 63  ? -101.138 105.195 145.451 1.00 74.64  ?  173 LYS B N     1 
ATOM   1915 C  CA    . LYS D 1 63  ? -101.013 104.412 146.670 1.00 76.02  ?  173 LYS B CA    1 
ATOM   1916 C  C     . LYS D 1 63  ? -100.499 105.312 147.785 1.00 74.26  ?  173 LYS B C     1 
ATOM   1917 O  O     . LYS D 1 63  ? -100.007 106.418 147.546 1.00 71.84  ?  173 LYS B O     1 
ATOM   1918 C  CB    . LYS D 1 63  ? -100.077 103.212 146.477 1.00 82.31  ?  173 LYS B CB    1 
ATOM   1919 C  CG    . LYS D 1 63  ? -100.578 102.185 145.476 1.00 78.73  ?  173 LYS B CG    1 
ATOM   1920 C  CD    . LYS D 1 63  ? -101.748 101.394 146.035 1.00 80.44  ?  173 LYS B CD    1 
ATOM   1921 C  CE    . LYS D 1 63  ? -102.467 100.628 144.937 1.00 80.92  ?  173 LYS B CE    1 
ATOM   1922 N  NZ    . LYS D 1 63  ? -101.526 99.829  144.104 1.00 84.54  ?  173 LYS B NZ    1 
ATOM   1923 N  N     . LYS D 1 64  ? -100.620 104.825 149.016 1.00 69.79  ?  174 LYS B N     1 
ATOM   1924 C  CA    . LYS D 1 64  ? -100.091 105.527 150.174 1.00 73.72  ?  174 LYS B CA    1 
ATOM   1925 C  C     . LYS D 1 64  ? -98.681  105.041 150.483 1.00 73.74  ?  174 LYS B C     1 
ATOM   1926 O  O     . LYS D 1 64  ? -98.334  103.883 150.238 1.00 73.96  ?  174 LYS B O     1 
ATOM   1927 C  CB    . LYS D 1 64  ? -100.991 105.322 151.395 1.00 83.28  ?  174 LYS B CB    1 
ATOM   1928 C  CG    . LYS D 1 64  ? -102.402 105.864 151.230 1.00 72.51  ?  174 LYS B CG    1 
ATOM   1929 C  CD    . LYS D 1 64  ? -103.184 105.781 152.533 1.00 65.98  ?  174 LYS B CD    1 
ATOM   1930 C  CE    . LYS D 1 64  ? -103.360 104.341 152.988 1.00 74.51  ?  174 LYS B CE    1 
ATOM   1931 N  NZ    . LYS D 1 64  ? -104.190 103.552 152.037 1.00 83.79  ?  174 LYS B NZ    1 
ATOM   1932 N  N     . VAL D 1 65  ? -97.867  105.942 151.022 1.00 82.14  ?  175 VAL B N     1 
ATOM   1933 C  CA    . VAL D 1 65  ? -96.500  105.601 151.394 1.00 88.22  ?  175 VAL B CA    1 
ATOM   1934 C  C     . VAL D 1 65  ? -96.508  104.846 152.717 1.00 89.11  ?  175 VAL B C     1 
ATOM   1935 O  O     . VAL D 1 65  ? -97.417  104.996 153.541 1.00 90.77  ?  175 VAL B O     1 
ATOM   1936 C  CB    . VAL D 1 65  ? -95.620  106.863 151.469 1.00 85.24  ?  175 VAL B CB    1 
ATOM   1937 C  CG1   . VAL D 1 65  ? -95.404  107.436 150.080 1.00 81.65  ?  175 VAL B CG1   1 
ATOM   1938 C  CG2   . VAL D 1 65  ? -96.254  107.898 152.383 1.00 75.98  ?  175 VAL B CG2   1 
ATOM   1939 N  N     . ASP D 1 66  ? -95.483  104.025 152.919 1.00 93.28  ?  176 ASP B N     1 
ATOM   1940 C  CA    . ASP D 1 66  ? -95.384  103.193 154.112 1.00 102.49 ?  176 ASP B CA    1 
ATOM   1941 C  C     . ASP D 1 66  ? -95.213  104.040 155.370 1.00 96.66  ?  176 ASP B C     1 
ATOM   1942 O  O     . ASP D 1 66  ? -96.126  104.143 156.189 1.00 94.66  ?  176 ASP B O     1 
ATOM   1943 C  CB    . ASP D 1 66  ? -94.219  102.211 153.979 1.00 107.35 ?  176 ASP B CB    1 
ATOM   1944 C  CG    . ASP D 1 66  ? -94.207  101.499 152.640 1.00 106.18 ?  176 ASP B CG    1 
ATOM   1945 O  OD1   . ASP D 1 66  ? -95.281  101.400 152.009 1.00 104.59 ?  176 ASP B OD1   1 
ATOM   1946 O  OD2   . ASP D 1 66  ? -93.125  101.041 152.218 1.00 103.39 ?  176 ASP B OD2   1 
ATOM   1947 N  N     . GLY D 1 76  ? -104.402 111.879 158.163 1.00 94.80  ?  186 GLY B N     1 
ATOM   1948 C  CA    . GLY D 1 76  ? -103.805 112.662 157.097 1.00 87.73  ?  186 GLY B CA    1 
ATOM   1949 C  C     . GLY D 1 76  ? -102.513 112.068 156.569 1.00 86.23  ?  186 GLY B C     1 
ATOM   1950 O  O     . GLY D 1 76  ? -101.436 112.633 156.759 1.00 86.78  ?  186 GLY B O     1 
ATOM   1951 N  N     . SER D 1 77  ? -102.624 110.921 155.903 1.00 79.46  ?  187 SER B N     1 
ATOM   1952 C  CA    . SER D 1 77  ? -101.461 110.242 155.354 1.00 76.83  ?  187 SER B CA    1 
ATOM   1953 C  C     . SER D 1 77  ? -101.066 110.866 154.016 1.00 80.91  ?  187 SER B C     1 
ATOM   1954 O  O     . SER D 1 77  ? -101.711 111.790 153.510 1.00 77.80  ?  187 SER B O     1 
ATOM   1955 C  CB    . SER D 1 77  ? -101.740 108.748 155.212 1.00 73.02  ?  187 SER B CB    1 
ATOM   1956 O  OG    . SER D 1 77  ? -102.942 108.518 154.500 1.00 89.46  ?  187 SER B OG    1 
ATOM   1957 N  N     . LEU D 1 78  ? -99.989  110.350 153.431 1.00 79.96  ?  188 LEU B N     1 
ATOM   1958 C  CA    . LEU D 1 78  ? -99.407  110.899 152.216 1.00 68.73  ?  188 LEU B CA    1 
ATOM   1959 C  C     . LEU D 1 78  ? -99.642  109.951 151.047 1.00 68.48  ?  188 LEU B C     1 
ATOM   1960 O  O     . LEU D 1 78  ? -99.573  108.728 151.202 1.00 67.90  ?  188 LEU B O     1 
ATOM   1961 C  CB    . LEU D 1 78  ? -97.904  111.151 152.388 1.00 66.50  ?  188 LEU B CB    1 
ATOM   1962 C  CG    . LEU D 1 78  ? -97.435  112.290 153.305 1.00 68.74  ?  188 LEU B CG    1 
ATOM   1963 C  CD1   . LEU D 1 78  ? -97.659  111.980 154.781 1.00 79.04  ?  188 LEU B CD1   1 
ATOM   1964 C  CD2   . LEU D 1 78  ? -95.970  112.607 153.048 1.00 63.67  ?  188 LEU B CD2   1 
ATOM   1965 N  N     . TRP D 1 79  ? -99.916  110.524 149.878 1.00 68.66  ?  189 TRP B N     1 
ATOM   1966 C  CA    . TRP D 1 79  ? -100.164 109.769 148.660 1.00 67.26  ?  189 TRP B CA    1 
ATOM   1967 C  C     . TRP D 1 79  ? -99.000  109.933 147.693 1.00 61.17  ?  189 TRP B C     1 
ATOM   1968 O  O     . TRP D 1 79  ? -98.313  110.956 147.692 1.00 60.29  ?  189 TRP B O     1 
ATOM   1969 C  CB    . TRP D 1 79  ? -101.460 110.224 147.984 1.00 61.46  ?  189 TRP B CB    1 
ATOM   1970 C  CG    . TRP D 1 79  ? -102.677 110.004 148.819 1.00 66.23  ?  189 TRP B CG    1 
ATOM   1971 C  CD1   . TRP D 1 79  ? -103.226 110.875 149.713 1.00 68.00  ?  189 TRP B CD1   1 
ATOM   1972 C  CD2   . TRP D 1 79  ? -103.500 108.834 148.840 1.00 63.12  ?  189 TRP B CD2   1 
ATOM   1973 N  NE1   . TRP D 1 79  ? -104.342 110.319 150.290 1.00 72.99  ?  189 TRP B NE1   1 
ATOM   1974 C  CE2   . TRP D 1 79  ? -104.532 109.066 149.771 1.00 70.13  ?  189 TRP B CE2   1 
ATOM   1975 C  CE3   . TRP D 1 79  ? -103.466 107.611 148.162 1.00 61.92  ?  189 TRP B CE3   1 
ATOM   1976 C  CZ2   . TRP D 1 79  ? -105.519 108.122 150.040 1.00 68.55  ?  189 TRP B CZ2   1 
ATOM   1977 C  CZ3   . TRP D 1 79  ? -104.447 106.676 148.431 1.00 64.40  ?  189 TRP B CZ3   1 
ATOM   1978 C  CH2   . TRP D 1 79  ? -105.459 106.936 149.362 1.00 64.38  ?  189 TRP B CH2   1 
ATOM   1979 N  N     . CYS D 1 80  ? -98.790  108.915 146.859 1.00 63.06  ?  190 CYS B N     1 
ATOM   1980 C  CA    . CYS D 1 80  ? -97.713  108.922 145.880 1.00 68.94  ?  190 CYS B CA    1 
ATOM   1981 C  C     . CYS D 1 80  ? -98.190  108.224 144.613 1.00 65.28  ?  190 CYS B C     1 
ATOM   1982 O  O     . CYS D 1 80  ? -99.333  107.766 144.522 1.00 66.37  ?  190 CYS B O     1 
ATOM   1983 C  CB    . CYS D 1 80  ? -96.452  108.251 146.437 1.00 72.20  ?  190 CYS B CB    1 
ATOM   1984 S  SG    . CYS D 1 80  ? -96.655  106.496 146.819 1.00 74.92  ?  190 CYS B SG    1 
ATOM   1985 N  N     . ILE D 1 81  ? -97.301  108.145 143.629 1.00 64.84  ?  191 ILE B N     1 
ATOM   1986 C  CA    . ILE D 1 81  ? -97.586  107.480 142.363 1.00 69.35  ?  191 ILE B CA    1 
ATOM   1987 C  C     . ILE D 1 81  ? -97.091  106.044 142.442 1.00 72.56  ?  191 ILE B C     1 
ATOM   1988 O  O     . ILE D 1 81  ? -96.018  105.769 142.991 1.00 83.21  ?  191 ILE B O     1 
ATOM   1989 C  CB    . ILE D 1 81  ? -96.930  108.231 141.188 1.00 69.28  ?  191 ILE B CB    1 
ATOM   1990 C  CG1   . ILE D 1 81  ? -97.247  109.726 141.263 1.00 69.50  ?  191 ILE B CG1   1 
ATOM   1991 C  CG2   . ILE D 1 81  ? -97.398  107.659 139.858 1.00 69.56  ?  191 ILE B CG2   1 
ATOM   1992 C  CD1   . ILE D 1 81  ? -98.716  110.049 141.113 1.00 62.77  ?  191 ILE B CD1   1 
ATOM   1993 N  N     . ASP D 1 82  ? -97.873  105.124 141.895 1.00 68.81  ?  192 ASP B N     1 
ATOM   1994 C  CA    . ASP D 1 82  ? -97.492  103.717 141.906 1.00 69.31  ?  192 ASP B CA    1 
ATOM   1995 C  C     . ASP D 1 82  ? -96.479  103.448 140.797 1.00 76.88  ?  192 ASP B C     1 
ATOM   1996 O  O     . ASP D 1 82  ? -96.714  103.830 139.646 1.00 81.08  ?  192 ASP B O     1 
ATOM   1997 C  CB    . ASP D 1 82  ? -98.724  102.831 141.737 1.00 73.99  ?  192 ASP B CB    1 
ATOM   1998 C  CG    . ASP D 1 82  ? -98.401  101.355 141.828 1.00 78.84  ?  192 ASP B CG    1 
ATOM   1999 O  OD1   . ASP D 1 82  ? -97.786  100.822 140.883 1.00 86.10  ?  192 ASP B OD1   1 
ATOM   2000 O  OD2   . ASP D 1 82  ? -98.753  100.727 142.848 1.00 76.92  -1 192 ASP B OD2   1 
ATOM   2001 N  N     . PRO D 1 83  ? -95.349  102.802 141.102 1.00 78.99  ?  193 PRO B N     1 
ATOM   2002 C  CA    . PRO D 1 83  ? -94.317  102.601 140.070 1.00 72.46  ?  193 PRO B CA    1 
ATOM   2003 C  C     . PRO D 1 83  ? -94.764  101.726 138.911 1.00 79.15  ?  193 PRO B C     1 
ATOM   2004 O  O     . PRO D 1 83  ? -94.284  101.919 137.787 1.00 82.86  ?  193 PRO B O     1 
ATOM   2005 C  CB    . PRO D 1 83  ? -93.164  101.954 140.852 1.00 80.08  ?  193 PRO B CB    1 
ATOM   2006 C  CG    . PRO D 1 83  ? -93.405  102.339 142.280 1.00 68.94  ?  193 PRO B CG    1 
ATOM   2007 C  CD    . PRO D 1 83  ? -94.894  102.369 142.433 1.00 75.08  ?  193 PRO B CD    1 
ATOM   2008 N  N     . GLU D 1 84  ? -95.659  100.764 139.147 1.00 77.25  ?  194 GLU B N     1 
ATOM   2009 C  CA    . GLU D 1 84  ? -96.148  99.920  138.061 1.00 79.40  ?  194 GLU B CA    1 
ATOM   2010 C  C     . GLU D 1 84  ? -96.869  100.748 137.008 1.00 78.71  ?  194 GLU B C     1 
ATOM   2011 O  O     . GLU D 1 84  ? -96.447  100.816 135.847 1.00 91.51  ?  194 GLU B O     1 
ATOM   2012 C  CB    . GLU D 1 84  ? -97.083  98.839  138.606 1.00 85.12  ?  194 GLU B CB    1 
ATOM   2013 C  CG    . GLU D 1 84  ? -96.395  97.578  139.067 1.00 89.04  ?  194 GLU B CG    1 
ATOM   2014 C  CD    . GLU D 1 84  ? -97.368  96.433  139.276 1.00 88.97  ?  194 GLU B CD    1 
ATOM   2015 O  OE1   . GLU D 1 84  ? -97.698  96.134  140.443 1.00 91.80  ?  194 GLU B OE1   1 
ATOM   2016 O  OE2   . GLU D 1 84  ? -97.811  95.840  138.270 1.00 85.11  -1 194 GLU B OE2   1 
ATOM   2017 N  N     . TYR D 1 85  ? -97.970  101.389 137.402 1.00 77.85  ?  195 TYR B N     1 
ATOM   2018 C  CA    . TYR D 1 85  ? -98.835  102.112 136.481 1.00 86.92  ?  195 TYR B CA    1 
ATOM   2019 C  C     . TYR D 1 85  ? -98.468  103.585 136.360 1.00 86.50  ?  195 TYR B C     1 
ATOM   2020 O  O     . TYR D 1 85  ? -99.331  104.405 136.021 1.00 94.46  ?  195 TYR B O     1 
ATOM   2021 C  CB    . TYR D 1 85  ? -100.294 101.954 136.913 1.00 86.34  ?  195 TYR B CB    1 
ATOM   2022 C  CG    . TYR D 1 85  ? -100.660 100.532 137.276 1.00 85.23  ?  195 TYR B CG    1 
ATOM   2023 C  CD1   . TYR D 1 85  ? -100.651 100.108 138.599 1.00 83.69  ?  195 TYR B CD1   1 
ATOM   2024 C  CD2   . TYR D 1 85  ? -100.998 99.608  136.295 1.00 89.38  ?  195 TYR B CD2   1 
ATOM   2025 C  CE1   . TYR D 1 85  ? -100.977 98.806  138.936 1.00 85.94  ?  195 TYR B CE1   1 
ATOM   2026 C  CE2   . TYR D 1 85  ? -101.326 98.304  136.623 1.00 92.62  ?  195 TYR B CE2   1 
ATOM   2027 C  CZ    . TYR D 1 85  ? -101.314 97.909  137.944 1.00 96.94  ?  195 TYR B CZ    1 
ATOM   2028 O  OH    . TYR D 1 85  ? -101.640 96.613  138.274 1.00 102.85 ?  195 TYR B OH    1 
ATOM   2029 N  N     . ARG D 1 86  ? -97.211  103.945 136.634 1.00 74.61  ?  196 ARG B N     1 
ATOM   2030 C  CA    . ARG D 1 86  ? -96.791  105.331 136.463 1.00 76.83  ?  196 ARG B CA    1 
ATOM   2031 C  C     . ARG D 1 86  ? -96.829  105.733 134.994 1.00 80.59  ?  196 ARG B C     1 
ATOM   2032 O  O     . ARG D 1 86  ? -97.478  106.719 134.626 1.00 76.56  ?  196 ARG B O     1 
ATOM   2033 C  CB    . ARG D 1 86  ? -95.392  105.541 137.043 1.00 74.28  ?  196 ARG B CB    1 
ATOM   2034 C  CG    . ARG D 1 86  ? -94.924  106.986 136.978 1.00 75.93  ?  196 ARG B CG    1 
ATOM   2035 C  CD    . ARG D 1 86  ? -93.492  107.145 137.454 1.00 75.87  ?  196 ARG B CD    1 
ATOM   2036 N  NE    . ARG D 1 86  ? -93.084  108.547 137.474 1.00 83.38  ?  196 ARG B NE    1 
ATOM   2037 C  CZ    . ARG D 1 86  ? -92.540  109.184 136.442 1.00 86.26  ?  196 ARG B CZ    1 
ATOM   2038 N  NH1   . ARG D 1 86  ? -92.199  110.461 136.553 1.00 78.09  ?  196 ARG B NH1   1 
ATOM   2039 N  NH2   . ARG D 1 86  ? -92.337  108.545 135.297 1.00 75.97  ?  196 ARG B NH2   1 
ATOM   2040 N  N     . GLN D 1 87  ? -96.150  104.966 134.136 1.00 91.04  ?  197 GLN B N     1 
ATOM   2041 C  CA    . GLN D 1 87  ? -96.137  105.267 132.709 1.00 91.09  ?  197 GLN B CA    1 
ATOM   2042 C  C     . GLN D 1 87  ? -97.529  105.219 132.094 1.00 82.52  ?  197 GLN B C     1 
ATOM   2043 O  O     . GLN D 1 87  ? -97.739  105.791 131.018 1.00 83.45  ?  197 GLN B O     1 
ATOM   2044 C  CB    . GLN D 1 87  ? -95.206  104.300 131.975 1.00 85.71  ?  197 GLN B CB    1 
ATOM   2045 C  CG    . GLN D 1 87  ? -93.745  104.428 132.378 1.00 98.76  ?  197 GLN B CG    1 
ATOM   2046 C  CD    . GLN D 1 87  ? -93.173  105.800 132.068 1.00 95.36  ?  197 GLN B CD    1 
ATOM   2047 O  OE1   . GLN D 1 87  ? -93.516  106.415 131.058 1.00 88.54  ?  197 GLN B OE1   1 
ATOM   2048 N  NE2   . GLN D 1 87  ? -92.300  106.288 132.942 1.00 98.01  ?  197 GLN B NE2   1 
ATOM   2049 N  N     . ASN D 1 88  ? -98.483  104.549 132.746 1.00 86.70  ?  198 ASN B N     1 
ATOM   2050 C  CA    . ASN D 1 88  ? -99.870  104.628 132.303 1.00 89.51  ?  198 ASN B CA    1 
ATOM   2051 C  C     . ASN D 1 88  ? -100.415 106.043 132.435 1.00 83.88  ?  198 ASN B C     1 
ATOM   2052 O  O     . ASN D 1 88  ? -101.285 106.448 131.656 1.00 78.28  ?  198 ASN B O     1 
ATOM   2053 C  CB    . ASN D 1 88  ? -100.738 103.651 133.098 1.00 89.01  ?  198 ASN B CB    1 
ATOM   2054 C  CG    . ASN D 1 88  ? -100.920 102.322 132.393 1.00 94.52  ?  198 ASN B CG    1 
ATOM   2055 O  OD1   . ASN D 1 88  ? -100.892 102.248 131.164 1.00 98.20  ?  198 ASN B OD1   1 
ATOM   2056 N  ND2   . ASN D 1 88  ? -101.117 101.263 133.169 1.00 88.38  ?  198 ASN B ND2   1 
ATOM   2057 N  N     . LEU D 1 89  ? -99.916  106.809 133.409 1.00 86.47  ?  199 LEU B N     1 
ATOM   2058 C  CA    . LEU D 1 89  ? -100.406 108.168 133.617 1.00 84.60  ?  199 LEU B CA    1 
ATOM   2059 C  C     . LEU D 1 89  ? -99.707  109.169 132.706 1.00 80.73  ?  199 LEU B C     1 
ATOM   2060 O  O     . LEU D 1 89  ? -100.335 110.129 132.244 1.00 82.94  ?  199 LEU B O     1 
ATOM   2061 C  CB    . LEU D 1 89  ? -100.232 108.574 135.080 1.00 74.74  ?  199 LEU B CB    1 
ATOM   2062 C  CG    . LEU D 1 89  ? -101.233 107.989 136.077 1.00 68.03  ?  199 LEU B CG    1 
ATOM   2063 C  CD1   . LEU D 1 89  ? -100.969 108.532 137.471 1.00 78.09  ?  199 LEU B CD1   1 
ATOM   2064 C  CD2   . LEU D 1 89  ? -102.657 108.293 135.642 1.00 68.14  ?  199 LEU B CD2   1 
ATOM   2065 N  N     . ILE D 1 90  ? -98.411  108.974 132.447 1.00 78.46  ?  200 ILE B N     1 
ATOM   2066 C  CA    . ILE D 1 90  ? -97.701  109.859 131.527 1.00 82.31  ?  200 ILE B CA    1 
ATOM   2067 C  C     . ILE D 1 90  ? -98.330  109.795 130.140 1.00 92.57  ?  200 ILE B C     1 
ATOM   2068 O  O     . ILE D 1 90  ? -98.495  110.821 129.468 1.00 90.73  ?  200 ILE B O     1 
ATOM   2069 C  CB    . ILE D 1 90  ? -96.199  109.514 131.490 1.00 82.69  ?  200 ILE B CB    1 
ATOM   2070 C  CG1   . ILE D 1 90  ? -95.504  109.974 132.774 1.00 85.88  ?  200 ILE B CG1   1 
ATOM   2071 C  CG2   . ILE D 1 90  ? -95.527  110.149 130.281 1.00 89.27  ?  200 ILE B CG2   1 
ATOM   2072 C  CD1   . ILE D 1 90  ? -95.369  108.899 133.822 1.00 83.94  ?  200 ILE B CD1   1 
ATOM   2073 N  N     . GLN D 1 91  ? -98.708  108.594 129.696 1.00 85.32  ?  201 GLN B N     1 
ATOM   2074 C  CA    . GLN D 1 91  ? -99.377  108.463 128.407 1.00 94.72  ?  201 GLN B CA    1 
ATOM   2075 C  C     . GLN D 1 91  ? -100.836 108.898 128.476 1.00 93.94  ?  201 GLN B C     1 
ATOM   2076 O  O     . GLN D 1 91  ? -101.376 109.396 127.482 1.00 95.70  ?  201 GLN B O     1 
ATOM   2077 C  CB    . GLN D 1 91  ? -99.275  107.022 127.904 1.00 95.55  ?  201 GLN B CB    1 
ATOM   2078 C  CG    . GLN D 1 91  ? -99.712  106.836 126.462 1.00 104.64 ?  201 GLN B CG    1 
ATOM   2079 C  CD    . GLN D 1 91  ? -99.391  105.453 125.933 1.00 118.59 ?  201 GLN B CD    1 
ATOM   2080 O  OE1   . GLN D 1 91  ? -98.943  104.581 126.678 1.00 126.37 ?  201 GLN B OE1   1 
ATOM   2081 N  NE2   . GLN D 1 91  ? -99.612  105.247 124.642 1.00 118.08 ?  201 GLN B NE2   1 
ATOM   2082 N  N     . ALA D 1 92  ? -101.486 108.724 129.630 1.00 90.52  ?  202 ALA B N     1 
ATOM   2083 C  CA    . ALA D 1 92  ? -102.854 109.209 129.781 1.00 92.65  ?  202 ALA B CA    1 
ATOM   2084 C  C     . ALA D 1 92  ? -102.922 110.725 129.670 1.00 93.05  ?  202 ALA B C     1 
ATOM   2085 O  O     . ALA D 1 92  ? -103.965 111.275 129.301 1.00 87.87  ?  202 ALA B O     1 
ATOM   2086 C  CB    . ALA D 1 92  ? -103.436 108.749 131.118 1.00 87.74  ?  202 ALA B CB    1 
ATOM   2087 N  N     . LEU D 1 93  ? -101.826 111.415 129.985 1.00 93.28  ?  203 LEU B N     1 
ATOM   2088 C  CA    . LEU D 1 93  ? -101.755 112.859 129.825 1.00 95.23  ?  203 LEU B CA    1 
ATOM   2089 C  C     . LEU D 1 93  ? -101.316 113.273 128.426 1.00 90.96  ?  203 LEU B C     1 
ATOM   2090 O  O     . LEU D 1 93  ? -101.478 114.443 128.059 1.00 92.00  ?  203 LEU B O     1 
ATOM   2091 C  CB    . LEU D 1 93  ? -100.805 113.455 130.869 1.00 88.25  ?  203 LEU B CB    1 
ATOM   2092 C  CG    . LEU D 1 93  ? -100.886 114.964 131.109 1.00 83.96  ?  203 LEU B CG    1 
ATOM   2093 C  CD1   . LEU D 1 93  ? -102.334 115.406 131.218 1.00 88.33  ?  203 LEU B CD1   1 
ATOM   2094 C  CD2   . LEU D 1 93  ? -100.119 115.340 132.363 1.00 74.89  ?  203 LEU B CD2   1 
ATOM   2095 N  N     . LYS D 1 94  ? -100.764 112.348 127.641 1.00 89.51  ?  204 LYS B N     1 
ATOM   2096 C  CA    . LYS D 1 94  ? -100.478 112.609 126.237 1.00 94.80  ?  204 LYS B CA    1 
ATOM   2097 C  C     . LYS D 1 94  ? -101.655 112.282 125.331 1.00 99.60  ?  204 LYS B C     1 
ATOM   2098 O  O     . LYS D 1 94  ? -101.702 112.771 124.196 1.00 102.70 ?  204 LYS B O     1 
ATOM   2099 C  CB    . LYS D 1 94  ? -99.252  111.809 125.782 1.00 92.80  ?  204 LYS B CB    1 
ATOM   2100 C  CG    . LYS D 1 94  ? -97.940  112.211 126.447 1.00 108.58 ?  204 LYS B CG    1 
ATOM   2101 C  CD    . LYS D 1 94  ? -96.802  111.311 125.979 1.00 96.40  ?  204 LYS B CD    1 
ATOM   2102 C  CE    . LYS D 1 94  ? -95.508  111.576 126.737 1.00 89.95  ?  204 LYS B CE    1 
ATOM   2103 N  NZ    . LYS D 1 94  ? -94.782  112.775 126.231 1.00 91.39  ?  204 LYS B NZ    1 
ATOM   2104 N  N     . LYS D 1 95  ? -102.603 111.474 125.803 1.00 100.37 ?  205 LYS B N     1 
ATOM   2105 C  CA    . LYS D 1 95  ? -103.786 111.113 125.035 1.00 95.21  ?  205 LYS B CA    1 
ATOM   2106 C  C     . LYS D 1 95  ? -105.017 111.918 125.419 1.00 96.63  ?  205 LYS B C     1 
ATOM   2107 O  O     . LYS D 1 95  ? -106.100 111.648 124.892 1.00 96.28  ?  205 LYS B O     1 
ATOM   2108 C  CB    . LYS D 1 95  ? -104.095 109.622 125.202 1.00 96.20  ?  205 LYS B CB    1 
ATOM   2109 C  CG    . LYS D 1 95  ? -103.130 108.698 124.487 1.00 102.61 ?  205 LYS B CG    1 
ATOM   2110 C  CD    . LYS D 1 95  ? -103.447 107.234 124.770 1.00 115.67 ?  205 LYS B CD    1 
ATOM   2111 C  CE    . LYS D 1 95  ? -102.618 106.297 123.898 1.00 117.94 ?  205 LYS B CE    1 
ATOM   2112 N  NZ    . LYS D 1 95  ? -102.873 104.865 124.230 1.00 118.28 ?  205 LYS B NZ    1 
ATOM   2113 N  N     . THR D 1 96  ? -104.886 112.880 126.330 1.00 107.90 ?  206 THR B N     1 
ATOM   2114 C  CA    . THR D 1 96  ? -106.041 113.653 126.765 1.00 106.51 ?  206 THR B CA    1 
ATOM   2115 C  C     . THR D 1 96  ? -106.543 114.537 125.624 1.00 109.60 ?  206 THR B C     1 
ATOM   2116 O  O     . THR D 1 96  ? -105.741 115.077 124.855 1.00 103.94 ?  206 THR B O     1 
ATOM   2117 C  CB    . THR D 1 96  ? -105.692 114.514 127.984 1.00 95.76  ?  206 THR B CB    1 
ATOM   2118 O  OG1   . THR D 1 96  ? -106.811 115.339 128.330 1.00 96.08  ?  206 THR B OG1   1 
ATOM   2119 C  CG2   . THR D 1 96  ? -104.486 115.400 127.698 1.00 95.50  ?  206 THR B CG2   1 
ATOM   2120 N  N     . PRO D 1 97  ? -107.868 114.692 125.477 1.00 108.91 ?  207 PRO B N     1 
ATOM   2121 C  CA    . PRO D 1 97  ? -108.448 115.530 124.422 1.00 103.38 ?  207 PRO B CA    1 
ATOM   2122 C  C     . PRO D 1 97  ? -108.258 117.021 124.683 1.00 108.03 ?  207 PRO B C     1 
ATOM   2123 O  O     . PRO D 1 97  ? -108.877 117.831 123.992 1.00 110.62 ?  207 PRO B O     1 
ATOM   2124 C  CB    . PRO D 1 97  ? -109.932 115.157 124.458 1.00 106.40 ?  207 PRO B CB    1 
ATOM   2125 C  CG    . PRO D 1 97  ? -110.168 114.719 125.860 1.00 107.27 ?  207 PRO B CG    1 
ATOM   2126 C  CD    . PRO D 1 97  ? -108.906 114.021 126.280 1.00 106.43 ?  207 PRO B CD    1 
HETATM 2127 MG MG    . MG  E 4 .   ? -130.315 98.139  131.075 1.00 70.31  ?  301 MG  A MG    1 
HETATM 2128 MG MG    . MG  F 4 .   ? -105.636 103.938 145.143 1.00 75.80  ?  301 MG  B MG    1 
HETATM 2129 O  O     . HOH G 5 .   ? -134.225 87.563  133.864 1.00 63.50  ?  401 HOH A O     1 
HETATM 2130 O  O     . HOH G 5 .   ? -115.985 99.389  140.982 1.00 56.46  ?  402 HOH A O     1 
HETATM 2131 O  O     . HOH G 5 .   ? -110.136 97.458  134.106 1.00 65.33  ?  403 HOH A O     1 
HETATM 2132 O  O     . HOH G 5 .   ? -131.310 100.060 132.440 1.00 69.26  ?  404 HOH A O     1 
HETATM 2133 O  O     . HOH H 5 .   ? -127.557 96.043  141.825 1.00 64.26  ?  101 HOH C O     1 
HETATM 2134 O  O     . HOH H 5 .   ? -124.110 104.727 107.984 1.00 70.60  ?  102 HOH C O     1 
HETATM 2135 O  O     . HOH H 5 .   ? -125.348 107.875 140.148 1.00 60.49  ?  103 HOH C O     1 
HETATM 2136 O  O     . HOH H 5 .   ? -111.099 100.527 123.943 1.00 62.45  ?  104 HOH C O     1 
HETATM 2137 O  O     . HOH I 5 .   ? -123.267 96.407  124.437 1.00 59.78  ?  101 HOH D O     1 
HETATM 2138 O  O     . HOH I 5 .   ? -114.469 104.023 140.234 1.00 45.70  ?  102 HOH D O     1 
HETATM 2139 O  O     . HOH J 5 .   ? -117.883 123.492 133.000 1.00 90.83  ?  401 HOH B O     1 
HETATM 2140 O  O     . HOH J 5 .   ? -116.044 119.051 148.732 1.00 80.86  ?  402 HOH B O     1 
HETATM 2141 O  O     . HOH J 5 .   ? -105.779 101.389 145.831 1.00 74.99  ?  403 HOH B O     1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   111 ?   ?   ?   A . n 
A 1 2   ASN 2   112 ?   ?   ?   A . n 
A 1 3   CYS 3   113 113 CYS CYS A . n 
A 1 4   LYS 4   114 114 LYS LYS A . n 
A 1 5   PRO 5   115 115 PRO PRO A . n 
A 1 6   PRO 6   116 116 PRO PRO A . n 
A 1 7   TYR 7   117 117 TYR TYR A . n 
A 1 8   SER 8   118 118 SER SER A . n 
A 1 9   PHE 9   119 119 PHE PHE A . n 
A 1 10  SER 10  120 120 SER SER A . n 
A 1 11  CYS 11  121 121 CYS CYS A . n 
A 1 12  LEU 12  122 122 LEU LEU A . n 
A 1 13  ILE 13  123 123 ILE ILE A . n 
A 1 14  PHE 14  124 124 PHE PHE A . n 
A 1 15  MET 15  125 125 MET MET A . n 
A 1 16  ALA 16  126 126 ALA ALA A . n 
A 1 17  ILE 17  127 127 ILE ILE A . n 
A 1 18  GLU 18  128 128 GLU GLU A . n 
A 1 19  ASP 19  129 129 ASP ASP A . n 
A 1 20  SER 20  130 130 SER SER A . n 
A 1 21  PRO 21  131 131 PRO PRO A . n 
A 1 22  THR 22  132 132 THR THR A . n 
A 1 23  LYS 23  133 133 LYS LYS A . n 
A 1 24  ARG 24  134 134 ARG ARG A . n 
A 1 25  LEU 25  135 135 LEU LEU A . n 
A 1 26  PRO 26  136 136 PRO PRO A . n 
A 1 27  VAL 27  137 137 VAL VAL A . n 
A 1 28  LYS 28  138 138 LYS LYS A . n 
A 1 29  ASP 29  139 139 ASP ASP A . n 
A 1 30  ILE 30  140 140 ILE ILE A . n 
A 1 31  TYR 31  141 141 TYR TYR A . n 
A 1 32  ASN 32  142 142 ASN ASN A . n 
A 1 33  TRP 33  143 143 TRP TRP A . n 
A 1 34  ILE 34  144 144 ILE ILE A . n 
A 1 35  LEU 35  145 145 LEU LEU A . n 
A 1 36  GLU 36  146 146 GLU GLU A . n 
A 1 37  HIS 37  147 147 HIS HIS A . n 
A 1 38  PHE 38  148 148 PHE PHE A . n 
A 1 39  PRO 39  149 149 PRO PRO A . n 
A 1 40  TYR 40  150 150 TYR TYR A . n 
A 1 41  PHE 41  151 151 PHE PHE A . n 
A 1 42  ALA 42  152 152 ALA ALA A . n 
A 1 43  ASN 43  153 153 ASN ASN A . n 
A 1 44  ALA 44  154 154 ALA ALA A . n 
A 1 45  PRO 45  155 155 PRO PRO A . n 
A 1 46  THR 46  156 156 THR THR A . n 
A 1 47  GLY 47  157 157 GLY GLY A . n 
A 1 48  TRP 48  158 158 TRP TRP A . n 
A 1 49  LYS 49  159 159 LYS LYS A . n 
A 1 50  ASN 50  160 160 ASN ASN A . n 
A 1 51  SER 51  161 161 SER SER A . n 
A 1 52  VAL 52  162 162 VAL VAL A . n 
A 1 53  ARG 53  163 163 ARG ARG A . n 
A 1 54  HIS 54  164 164 HIS HIS A . n 
A 1 55  ASN 55  165 165 ASN ASN A . n 
A 1 56  LEU 56  166 166 LEU LEU A . n 
A 1 57  SER 57  167 167 SER SER A . n 
A 1 58  LEU 58  168 168 LEU LEU A . n 
A 1 59  ASN 59  169 169 ASN ASN A . n 
A 1 60  LYS 60  170 170 LYS LYS A . n 
A 1 61  CYS 61  171 171 CYS CYS A . n 
A 1 62  PHE 62  172 172 PHE PHE A . n 
A 1 63  LYS 63  173 173 LYS LYS A . n 
A 1 64  LYS 64  174 174 LYS LYS A . n 
A 1 65  VAL 65  175 175 VAL VAL A . n 
A 1 66  ASP 66  176 176 ASP ASP A . n 
A 1 67  LYS 67  177 177 LYS LYS A . n 
A 1 68  GLU 68  178 ?   ?   ?   A . n 
A 1 69  ARG 69  179 ?   ?   ?   A . n 
A 1 70  SER 70  180 ?   ?   ?   A . n 
A 1 71  GLN 71  181 ?   ?   ?   A . n 
A 1 72  SER 72  182 ?   ?   ?   A . n 
A 1 73  ILE 73  183 ?   ?   ?   A . n 
A 1 74  GLY 74  184 ?   ?   ?   A . n 
A 1 75  LYS 75  185 185 LYS LYS A . n 
A 1 76  GLY 76  186 186 GLY GLY A . n 
A 1 77  SER 77  187 187 SER SER A . n 
A 1 78  LEU 78  188 188 LEU LEU A . n 
A 1 79  TRP 79  189 189 TRP TRP A . n 
A 1 80  CYS 80  190 190 CYS CYS A . n 
A 1 81  ILE 81  191 191 ILE ILE A . n 
A 1 82  ASP 82  192 192 ASP ASP A . n 
A 1 83  PRO 83  193 193 PRO PRO A . n 
A 1 84  GLU 84  194 194 GLU GLU A . n 
A 1 85  TYR 85  195 195 TYR TYR A . n 
A 1 86  ARG 86  196 196 ARG ARG A . n 
A 1 87  GLN 87  197 197 GLN GLN A . n 
A 1 88  ASN 88  198 198 ASN ASN A . n 
A 1 89  LEU 89  199 199 LEU LEU A . n 
A 1 90  ILE 90  200 200 ILE ILE A . n 
A 1 91  GLN 91  201 201 GLN GLN A . n 
A 1 92  ALA 92  202 202 ALA ALA A . n 
A 1 93  LEU 93  203 203 LEU LEU A . n 
A 1 94  LYS 94  204 204 LYS LYS A . n 
A 1 95  LYS 95  205 205 LYS LYS A . n 
A 1 96  THR 96  206 206 THR THR A . n 
A 1 97  PRO 97  207 207 PRO PRO A . n 
A 1 98  TYR 98  208 208 TYR TYR A . n 
A 1 99  HIS 99  209 209 HIS HIS A . n 
A 1 100 PRO 100 210 210 PRO PRO A . n 
B 2 1   DA  1   1   1   DA  DA  C . n 
B 2 2   DT  2   2   2   DT  DT  C . n 
B 2 3   DA  3   3   3   DA  DA  C . n 
B 2 4   DG  4   4   4   DG  DG  C . n 
B 2 5   DC  5   5   5   DC  DC  C . n 
B 2 6   DG  6   6   6   DG  DG  C . n 
B 2 7   DT  7   7   7   DT  DT  C . n 
B 2 8   DC  8   8   8   DC  DC  C . n 
B 2 9   DT  9   9   9   DT  DT  C . n 
B 2 10  DT  10  10  10  DT  DT  C . n 
B 2 11  DA  11  11  11  DA  DA  C . n 
B 2 12  DG  12  12  12  DG  DG  C . n 
B 2 13  DC  13  13  13  DC  DC  C . n 
B 2 14  DA  14  14  14  DA  DA  C . n 
B 2 15  DT  15  15  15  DT  DT  C . n 
B 2 16  DG  16  16  16  DG  DG  C . n 
C 3 1   DT  1   1   1   DT  DT  D . n 
C 3 2   DC  2   2   2   DC  DC  D . n 
C 3 3   DA  3   3   3   DA  DA  D . n 
C 3 4   DT  4   4   4   DT  DT  D . n 
C 3 5   DG  5   5   5   DG  DG  D . n 
C 3 6   DC  6   6   6   DC  DC  D . n 
C 3 7   DT  7   7   7   DT  DT  D . n 
C 3 8   DA  8   8   8   DA  DA  D . n 
C 3 9   DA  9   9   9   DA  DA  D . n 
C 3 10  DG  10  10  10  DG  DG  D . n 
C 3 11  DA  11  11  11  DA  DA  D . n 
C 3 12  DC  12  12  12  DC  DC  D . n 
C 3 13  DG  13  13  13  DG  DG  D . n 
C 3 14  DC  14  14  14  DC  DC  D . n 
C 3 15  DT  15  15  15  DT  DT  D . n 
C 3 16  DA  16  16  16  DA  DA  D . n 
D 1 1   GLY 1   111 ?   ?   ?   B . n 
D 1 2   ASN 2   112 112 ASN ASN B . n 
D 1 3   CYS 3   113 113 CYS CYS B . n 
D 1 4   LYS 4   114 114 LYS LYS B . n 
D 1 5   PRO 5   115 115 PRO PRO B . n 
D 1 6   PRO 6   116 116 PRO PRO B . n 
D 1 7   TYR 7   117 117 TYR TYR B . n 
D 1 8   SER 8   118 118 SER SER B . n 
D 1 9   PHE 9   119 119 PHE PHE B . n 
D 1 10  SER 10  120 120 SER SER B . n 
D 1 11  CYS 11  121 121 CYS CYS B . n 
D 1 12  LEU 12  122 122 LEU LEU B . n 
D 1 13  ILE 13  123 123 ILE ILE B . n 
D 1 14  PHE 14  124 124 PHE PHE B . n 
D 1 15  MET 15  125 125 MET MET B . n 
D 1 16  ALA 16  126 126 ALA ALA B . n 
D 1 17  ILE 17  127 127 ILE ILE B . n 
D 1 18  GLU 18  128 128 GLU GLU B . n 
D 1 19  ASP 19  129 129 ASP ASP B . n 
D 1 20  SER 20  130 130 SER SER B . n 
D 1 21  PRO 21  131 131 PRO PRO B . n 
D 1 22  THR 22  132 132 THR THR B . n 
D 1 23  LYS 23  133 133 LYS LYS B . n 
D 1 24  ARG 24  134 134 ARG ARG B . n 
D 1 25  LEU 25  135 135 LEU LEU B . n 
D 1 26  PRO 26  136 136 PRO PRO B . n 
D 1 27  VAL 27  137 137 VAL VAL B . n 
D 1 28  LYS 28  138 138 LYS LYS B . n 
D 1 29  ASP 29  139 139 ASP ASP B . n 
D 1 30  ILE 30  140 140 ILE ILE B . n 
D 1 31  TYR 31  141 141 TYR TYR B . n 
D 1 32  ASN 32  142 142 ASN ASN B . n 
D 1 33  TRP 33  143 143 TRP TRP B . n 
D 1 34  ILE 34  144 144 ILE ILE B . n 
D 1 35  LEU 35  145 145 LEU LEU B . n 
D 1 36  GLU 36  146 146 GLU GLU B . n 
D 1 37  HIS 37  147 147 HIS HIS B . n 
D 1 38  PHE 38  148 148 PHE PHE B . n 
D 1 39  PRO 39  149 149 PRO PRO B . n 
D 1 40  TYR 40  150 150 TYR TYR B . n 
D 1 41  PHE 41  151 151 PHE PHE B . n 
D 1 42  ALA 42  152 152 ALA ALA B . n 
D 1 43  ASN 43  153 153 ASN ASN B . n 
D 1 44  ALA 44  154 154 ALA ALA B . n 
D 1 45  PRO 45  155 155 PRO PRO B . n 
D 1 46  THR 46  156 156 THR THR B . n 
D 1 47  GLY 47  157 157 GLY GLY B . n 
D 1 48  TRP 48  158 158 TRP TRP B . n 
D 1 49  LYS 49  159 159 LYS LYS B . n 
D 1 50  ASN 50  160 160 ASN ASN B . n 
D 1 51  SER 51  161 161 SER SER B . n 
D 1 52  VAL 52  162 162 VAL VAL B . n 
D 1 53  ARG 53  163 163 ARG ARG B . n 
D 1 54  HIS 54  164 164 HIS HIS B . n 
D 1 55  ASN 55  165 165 ASN ASN B . n 
D 1 56  LEU 56  166 166 LEU LEU B . n 
D 1 57  SER 57  167 167 SER SER B . n 
D 1 58  LEU 58  168 168 LEU LEU B . n 
D 1 59  ASN 59  169 169 ASN ASN B . n 
D 1 60  LYS 60  170 170 LYS LYS B . n 
D 1 61  CYS 61  171 171 CYS CYS B . n 
D 1 62  PHE 62  172 172 PHE PHE B . n 
D 1 63  LYS 63  173 173 LYS LYS B . n 
D 1 64  LYS 64  174 174 LYS LYS B . n 
D 1 65  VAL 65  175 175 VAL VAL B . n 
D 1 66  ASP 66  176 176 ASP ASP B . n 
D 1 67  LYS 67  177 ?   ?   ?   B . n 
D 1 68  GLU 68  178 ?   ?   ?   B . n 
D 1 69  ARG 69  179 ?   ?   ?   B . n 
D 1 70  SER 70  180 ?   ?   ?   B . n 
D 1 71  GLN 71  181 ?   ?   ?   B . n 
D 1 72  SER 72  182 ?   ?   ?   B . n 
D 1 73  ILE 73  183 ?   ?   ?   B . n 
D 1 74  GLY 74  184 ?   ?   ?   B . n 
D 1 75  LYS 75  185 ?   ?   ?   B . n 
D 1 76  GLY 76  186 186 GLY GLY B . n 
D 1 77  SER 77  187 187 SER SER B . n 
D 1 78  LEU 78  188 188 LEU LEU B . n 
D 1 79  TRP 79  189 189 TRP TRP B . n 
D 1 80  CYS 80  190 190 CYS CYS B . n 
D 1 81  ILE 81  191 191 ILE ILE B . n 
D 1 82  ASP 82  192 192 ASP ASP B . n 
D 1 83  PRO 83  193 193 PRO PRO B . n 
D 1 84  GLU 84  194 194 GLU GLU B . n 
D 1 85  TYR 85  195 195 TYR TYR B . n 
D 1 86  ARG 86  196 196 ARG ARG B . n 
D 1 87  GLN 87  197 197 GLN GLN B . n 
D 1 88  ASN 88  198 198 ASN ASN B . n 
D 1 89  LEU 89  199 199 LEU LEU B . n 
D 1 90  ILE 90  200 200 ILE ILE B . n 
D 1 91  GLN 91  201 201 GLN GLN B . n 
D 1 92  ALA 92  202 202 ALA ALA B . n 
D 1 93  LEU 93  203 203 LEU LEU B . n 
D 1 94  LYS 94  204 204 LYS LYS B . n 
D 1 95  LYS 95  205 205 LYS LYS B . n 
D 1 96  THR 96  206 206 THR THR B . n 
D 1 97  PRO 97  207 207 PRO PRO B . n 
D 1 98  TYR 98  208 ?   ?   ?   B . n 
D 1 99  HIS 99  209 ?   ?   ?   B . n 
D 1 100 PRO 100 210 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 4 MG  1 301 3  MG  MG  A . 
F 4 MG  1 301 2  MG  MG  B . 
G 5 HOH 1 401 24 HOH HOH A . 
G 5 HOH 2 402 20 HOH HOH A . 
G 5 HOH 3 403 12 HOH HOH A . 
G 5 HOH 4 404 8  HOH HOH A . 
H 5 HOH 1 101 32 HOH HOH C . 
H 5 HOH 2 102 25 HOH HOH C . 
H 5 HOH 3 103 27 HOH HOH C . 
H 5 HOH 4 104 26 HOH HOH C . 
I 5 HOH 1 101 30 HOH HOH D . 
I 5 HOH 2 102 5  HOH HOH D . 
J 5 HOH 1 401 22 HOH HOH B . 
J 5 HOH 2 402 23 HOH HOH B . 
J 5 HOH 3 403 19 HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   tetrameric 
_pdbx_struct_assembly.oligomeric_count     4 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I,J 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 4350  ? 
1 MORE         -49   ? 
1 'SSA (A^2)'  15040 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O ? A LEU 56 ? A LEU 166 ? 1_555 MG ? E MG . ? A MG 301 ? 1_555 O ? A ASN 59 ? A ASN 169 ? 1_555 105.0 ? 
2  O ? A LEU 56 ? A LEU 166 ? 1_555 MG ? E MG . ? A MG 301 ? 1_555 O ? A PHE 62 ? A PHE 172 ? 1_555 104.4 ? 
3  O ? A ASN 59 ? A ASN 169 ? 1_555 MG ? E MG . ? A MG 301 ? 1_555 O ? A PHE 62 ? A PHE 172 ? 1_555 101.7 ? 
4  O ? A LEU 56 ? A LEU 166 ? 1_555 MG ? E MG . ? A MG 301 ? 1_555 O ? G HOH .  ? A HOH 404 ? 1_555 99.3  ? 
5  O ? A ASN 59 ? A ASN 169 ? 1_555 MG ? E MG . ? A MG 301 ? 1_555 O ? G HOH .  ? A HOH 404 ? 1_555 143.2 ? 
6  O ? A PHE 62 ? A PHE 172 ? 1_555 MG ? E MG . ? A MG 301 ? 1_555 O ? G HOH .  ? A HOH 404 ? 1_555 98.4  ? 
7  O ? D LEU 56 ? B LEU 166 ? 1_555 MG ? F MG . ? B MG 301 ? 1_555 O ? D SER 57 ? B SER 167 ? 1_555 86.2  ? 
8  O ? D LEU 56 ? B LEU 166 ? 1_555 MG ? F MG . ? B MG 301 ? 1_555 O ? D ASN 59 ? B ASN 169 ? 1_555 111.8 ? 
9  O ? D SER 57 ? B SER 167 ? 1_555 MG ? F MG . ? B MG 301 ? 1_555 O ? D ASN 59 ? B ASN 169 ? 1_555 111.1 ? 
10 O ? D LEU 56 ? B LEU 166 ? 1_555 MG ? F MG . ? B MG 301 ? 1_555 O ? D PHE 62 ? B PHE 172 ? 1_555 93.3  ? 
11 O ? D SER 57 ? B SER 167 ? 1_555 MG ? F MG . ? B MG 301 ? 1_555 O ? D PHE 62 ? B PHE 172 ? 1_555 165.8 ? 
12 O ? D ASN 59 ? B ASN 169 ? 1_555 MG ? F MG . ? B MG 301 ? 1_555 O ? D PHE 62 ? B PHE 172 ? 1_555 82.2  ? 
13 O ? D LEU 56 ? B LEU 166 ? 1_555 MG ? F MG . ? B MG 301 ? 1_555 O ? J HOH .  ? B HOH 403 ? 1_555 150.3 ? 
14 O ? D SER 57 ? B SER 167 ? 1_555 MG ? F MG . ? B MG 301 ? 1_555 O ? J HOH .  ? B HOH 403 ? 1_555 71.2  ? 
15 O ? D ASN 59 ? B ASN 169 ? 1_555 MG ? F MG . ? B MG 301 ? 1_555 O ? J HOH .  ? B HOH 403 ? 1_555 94.5  ? 
16 O ? D PHE 62 ? B PHE 172 ? 1_555 MG ? F MG . ? B MG 301 ? 1_555 O ? J HOH .  ? B HOH 403 ? 1_555 103.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2019-02-27 
2 'Structure model' 1 1 2019-03-13 
3 'Structure model' 1 2 2019-05-01 
4 'Structure model' 1 3 2019-12-04 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Data collection'            
2 2 'Structure model' 'Database references'        
3 3 'Structure model' 'Data collection'            
4 3 'Structure model' 'Database references'        
5 4 'Structure model' 'Author supporting evidence' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1 2 'Structure model' citation                    
2 2 'Structure model' citation_author             
3 2 'Structure model' pdbx_database_proc          
4 2 'Structure model' pdbx_seq_map_depositor_info 
5 3 'Structure model' citation                    
6 4 'Structure model' pdbx_audit_support          
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_citation.country'                                
2  2 'Structure model' '_citation.journal_abbrev'                         
3  2 'Structure model' '_citation.journal_id_ASTM'                        
4  2 'Structure model' '_citation.journal_id_CSD'                         
5  2 'Structure model' '_citation.journal_id_ISSN'                        
6  2 'Structure model' '_citation.pdbx_database_id_DOI'                   
7  2 'Structure model' '_citation.pdbx_database_id_PubMed'                
8  2 'Structure model' '_citation.title'                                  
9  2 'Structure model' '_citation_author.identifier_ORCID'                
10 2 'Structure model' '_citation_author.name'                            
11 2 'Structure model' '_pdbx_seq_map_depositor_info.one_letter_code_mod' 
12 3 'Structure model' '_citation.journal_volume'                         
13 3 'Structure model' '_citation.page_first'                             
14 4 'Structure model' '_pdbx_audit_support.funding_organization'         
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.14_3260)' 1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .             2 
? phasing           ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? .             3 
? 'data processing' ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .             4 
? 'data reduction'  ? ? ? ? ? ? ? ? ? ? ? XDS    ? ? ? .             5 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 SG A CYS 113 ? ? 1_555 SG B CYS 113 ? ? 3_047 2.03 
2 1 SG A CYS 113 ? ? 1_555 CB B CYS 113 ? ? 3_047 2.15 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 111 ? A GLY 1   
2  1 Y 1 A ASN 112 ? A ASN 2   
3  1 Y 1 A GLU 178 ? A GLU 68  
4  1 Y 1 A ARG 179 ? A ARG 69  
5  1 Y 1 A SER 180 ? A SER 70  
6  1 Y 1 A GLN 181 ? A GLN 71  
7  1 Y 1 A SER 182 ? A SER 72  
8  1 Y 1 A ILE 183 ? A ILE 73  
9  1 Y 1 A GLY 184 ? A GLY 74  
10 1 Y 1 B GLY 111 ? D GLY 1   
11 1 Y 1 B LYS 177 ? D LYS 67  
12 1 Y 1 B GLU 178 ? D GLU 68  
13 1 Y 1 B ARG 179 ? D ARG 69  
14 1 Y 1 B SER 180 ? D SER 70  
15 1 Y 1 B GLN 181 ? D GLN 71  
16 1 Y 1 B SER 182 ? D SER 72  
17 1 Y 1 B ILE 183 ? D ILE 73  
18 1 Y 1 B GLY 184 ? D GLY 74  
19 1 Y 1 B LYS 185 ? D LYS 75  
20 1 Y 1 B TYR 208 ? D TYR 98  
21 1 Y 1 B HIS 209 ? D HIS 99  
22 1 Y 1 B PRO 210 ? D PRO 100 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
6NCM 'double helix'        
6NCM 'b-form double helix' 
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 B DT 2  1_555 C DA 16 1_555 -0.175 0.361  0.345  -16.973 -7.191  4.097  1  C_DT2:DA16_D C 2  ? D 16 ? 20 1 
1 B DA 3  1_555 C DT 15 1_555 0.145  0.069  0.488  -4.859  -11.938 5.132  2  C_DA3:DT15_D C 3  ? D 15 ? 20 1 
1 B DG 4  1_555 C DC 14 1_555 -0.216 -0.106 0.694  7.885   -8.915  0.072  3  C_DG4:DC14_D C 4  ? D 14 ? 19 1 
1 B DC 5  1_555 C DG 13 1_555 0.459  0.243  -0.349 18.279  -11.268 3.873  4  C_DC5:DG13_D C 5  ? D 13 ? 19 1 
1 B DG 6  1_555 C DC 12 1_555 -0.601 -0.355 -0.144 -11.458 -14.588 0.922  5  C_DG6:DC12_D C 6  ? D 12 ? 19 1 
1 B DT 7  1_555 C DA 11 1_555 -0.071 -0.115 -0.005 -3.734  -12.381 -8.097 6  C_DT7:DA11_D C 7  ? D 11 ? 20 1 
1 B DC 8  1_555 C DG 10 1_555 -0.003 -0.339 0.025  -11.034 -5.964  1.341  7  C_DC8:DG10_D C 8  ? D 10 ? 19 1 
1 B DT 9  1_555 C DA 9  1_555 -0.395 -0.154 0.336  -5.466  -12.131 6.127  8  C_DT9:DA9_D  C 9  ? D 9  ? 20 1 
1 B DT 10 1_555 C DA 8  1_555 0.092  -0.011 -0.006 -3.825  -15.151 6.618  9  C_DT10:DA8_D C 10 ? D 8  ? 20 1 
1 B DA 11 1_555 C DT 7  1_555 0.732  0.744  0.593  5.602   -22.136 30.565 10 C_DA11:DT7_D C 11 ? D 7  ? ?  1 
1 B DG 12 1_555 C DC 6  1_555 -0.604 -0.157 0.135  10.297  -12.486 7.772  11 C_DG12:DC6_D C 12 ? D 6  ? 19 1 
1 B DC 13 1_555 C DG 5  1_555 0.301  0.171  -0.178 13.351  -14.012 16.095 12 C_DC13:DG5_D C 13 ? D 5  ? 19 1 
1 B DA 14 1_555 C DT 4  1_555 0.410  -0.282 0.330  -10.833 -13.605 10.946 13 C_DA14:DT4_D C 14 ? D 4  ? 20 1 
1 B DT 15 1_555 C DA 3  1_555 -0.370 -0.338 0.268  -6.911  -10.922 -3.866 14 C_DT15:DA3_D C 15 ? D 3  ? 20 1 
1 B DG 16 1_555 C DC 2  1_555 -0.003 0.037  0.696  -5.579  -13.949 2.803  15 C_DG16:DC2_D C 16 ? D 2  ? 19 1 
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 B DT 2  1_555 C DA 16 1_555 B DA 3  1_555 C DT 15 1_555 -0.275 0.185  3.057 -1.142 0.232  35.528 0.272  0.294  3.065 0.380  
1.872   35.546 1  CC_DT2DA3:DT15DA16_DD C 2  ? D 16 ? C 3  ? D 15 ? 
1 B DA 3  1_555 C DT 15 1_555 B DG 4  1_555 C DC 14 1_555 -0.161 -0.500 2.891 -2.974 -0.296 32.093 -0.854 -0.179 2.898 -0.533 
5.366   32.228 2  CC_DA3DG4:DC14DT15_DD C 3  ? D 15 ? C 4  ? D 14 ? 
1 B DG 4  1_555 C DC 14 1_555 B DC 5  1_555 C DG 13 1_555 0.835  -0.497 3.176 9.618  -4.145 34.328 -0.203 0.044  3.319 -6.828 
-15.844 35.844 3  CC_DG4DC5:DG13DC14_DD C 4  ? D 14 ? C 5  ? D 13 ? 
1 B DC 5  1_555 C DG 13 1_555 B DG 6  1_555 C DC 12 1_555 0.127  -1.318 4.196 -4.259 1.316  30.028 -2.854 -1.331 4.079 2.522  
8.164   30.350 4  CC_DC5DG6:DC12DG13_DD C 5  ? D 13 ? C 6  ? D 12 ? 
1 B DG 6  1_555 C DC 12 1_555 B DT 7  1_555 C DA 11 1_555 -1.185 -0.817 3.165 -1.043 -0.407 35.718 -1.275 1.785  3.206 -0.663 
1.701   35.735 5  CC_DG6DT7:DA11DC12_DD C 6  ? D 12 ? C 7  ? D 11 ? 
1 B DT 7  1_555 C DA 11 1_555 B DC 8  1_555 C DG 10 1_555 1.263  -0.105 3.479 1.991  1.030  38.097 -0.300 -1.662 3.534 1.577  
-3.047  38.160 6  CC_DT7DC8:DG10DA11_DD C 7  ? D 11 ? C 8  ? D 10 ? 
1 B DC 8  1_555 C DG 10 1_555 B DT 9  1_555 C DA 9  1_555 0.108  -0.526 3.448 -1.436 6.117  26.838 -2.655 -0.591 3.240 12.955 
3.042   27.551 7  CC_DC8DT9:DA9DG10_DD  C 8  ? D 10 ? C 9  ? D 9  ? 
1 B DT 9  1_555 C DA 9  1_555 B DT 10 1_555 C DA 8  1_555 -0.100 -0.620 3.152 2.979  4.157  32.001 -1.807 0.678  3.028 7.480  
-5.360  32.397 8  CC_DT9DT10:DA8DA9_DD  C 9  ? D 9  ? C 10 ? D 8  ? 
1 B DT 10 1_555 C DA 8  1_555 B DA 11 1_555 C DT 7  1_555 1.005  0.647  3.169 0.974  3.198  35.289 0.602  -1.510 3.239 5.261  
-1.602  35.442 9  CC_DT10DA11:DT7DA8_DD C 10 ? D 8  ? C 11 ? D 7  ? 
1 B DA 11 1_555 C DT 7  1_555 B DG 12 1_555 C DC 6  1_555 -0.978 0.215  3.147 -0.127 11.382 24.017 -2.474 2.097  2.948 25.593 
0.286   26.542 10 CC_DA11DG12:DC6DT7_DD C 11 ? D 7  ? C 12 ? D 6  ? 
1 B DG 12 1_555 C DC 6  1_555 B DC 13 1_555 C DG 5  1_555 0.917  -0.301 3.158 4.810  -0.715 35.924 -0.385 -0.809 3.255 -1.153 
-7.754  36.240 11 CC_DG12DC13:DG5DC6_DD C 12 ? D 6  ? C 13 ? D 5  ? 
1 B DC 13 1_555 C DG 5  1_555 B DA 14 1_555 C DT 4  1_555 0.135  -0.824 3.597 -2.624 8.160  33.525 -2.735 -0.661 3.293 13.867 
4.459   34.573 12 CC_DC13DA14:DT4DG5_DD C 13 ? D 5  ? C 14 ? D 4  ? 
1 B DA 14 1_555 C DT 4  1_555 B DT 15 1_555 C DA 3  1_555 -0.856 -0.865 3.269 0.477  -5.408 31.154 -0.566 1.662  3.355 -9.975 
-0.880  31.612 13 CC_DA14DT15:DA3DT4_DD C 14 ? D 4  ? C 15 ? D 3  ? 
1 B DT 15 1_555 C DA 3  1_555 B DG 16 1_555 C DC 2  1_555 0.357  -1.072 3.281 -2.211 -0.051 37.710 -1.649 -0.837 3.257 -0.079 
3.418   37.773 14 CC_DT15DG16:DC2DA3_DD C 15 ? D 3  ? C 16 ? D 2  ? 
# 
loop_
_pdbx_audit_support.funding_organization 
_pdbx_audit_support.country 
_pdbx_audit_support.grant_number 
_pdbx_audit_support.ordinal 
'National Institutes of Health/National Human Genome Research Institute (NIH/NHGRI)' 'United States' HG003985 1 
'National Institutes of Health/National Cancer Institute (NIH/NCI)'                  'United States' CA220340 2 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
4 'MAGNESIUM ION' MG  
5 water           HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                'protein binding microarray' 
#