data_6NE3
# 
_entry.id   6NE3 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6NE3         
WWPDB D_1000231295 
EMDB  EMD-9356     
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
EMDB .                                                      EMD-9352 'other EM volume'      
EMDB .                                                      EMD-9354 'other EM volume'      
EMDB .                                                      EMD-9355 'other EM volume'      
EMDB 'Structure of a translocated SNF2h-nucleosome complex' EMD-9356 'associated EM volume' 
EMDB .                                                      EMD-9351 'other EM volume'      
EMDB .                                                      EMD-9353 'other EM volume'      
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6NE3 
_pdbx_database_status.recvd_initial_deposition_date   2018-12-16 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Armache, J.-P.' 1 ? 
'Gamarra, N.'    2 ? 
'Johnson, S.L.'  3 ? 
'Leonard, J.D.'  4 ? 
'Wu, S.'         5 ? 
'Narlikar, G.N.' 6 ? 
'Cheng, Y.'      7 ? 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Elife 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           2050-084X 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            8 
_citation.language                  ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.title                     
'Cryo-EM structures of remodeler-nucleosome intermediates suggest allosteric control through the nucleosome.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.7554/eLife.46057 
_citation.pdbx_database_id_PubMed   31210637 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Armache, J.P.'  1 0000-0001-9195-2282 
primary 'Gamarra, N.'    2 0000-0002-2430-8662 
primary 'Johnson, S.L.'  3 ?                   
primary 'Leonard, J.D.'  4 ?                   
primary 'Wu, S.'         5 ?                   
primary 'Narlikar, G.J.' 6 0000-0002-1920-0147 
primary 'Cheng, Y.'      7 0000-0001-9535-0369 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6NE3 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1 
_cell.length_a_esd                 ? 
_cell.length_b                     1 
_cell.length_b_esd                 ? 
_cell.length_c                     1 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        1 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6NE3 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Histone H3.2'                                                                                  15435.126 2 ? 
G102A ? ? 
2 polymer     man 'Histone H4'                                                                                    11394.426 2 ? ? 
? ? 
3 polymer     man 'Histone H2A type 1'                                                                            14093.436 2 ? 
G99R  ? ? 
4 polymer     man 'Histone H2B'                                                                                   11179.959 1 ? ? 
? ? 
5 polymer     man 'Histone H2B'                                                                                   10348.852 1 ? ? 
? ? 
6 polymer     man 'DNA (156-MER)'                                                                                 47936.531 1 ? ? 
? ? 
7 polymer     man 'DNA (156-MER)'                                                                                 48372.832 1 ? ? 
? ? 
8 polymer     man 'SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5' 54653.332 1 
3.6.4.- ?     ? ? 
9 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"                                                                      427.201   1 ? ? 
? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Histone H3'                                                                                                                 
8 'SWI/SNF-related matrix-associated actin-dependent regulator of chromatin A5,Sucrose nonfermenting protein 2 homolog,hSNF2H' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEASEAYLVALFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
A,E ? 
2 'polypeptide(L)'        no no 
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
B,F ? 
3 'polypeptide(L)'        no no 
;MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESAKSAKSK
;
;MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAVRNDEELNKLLGRVTIAQGGVLPNIQSVLLPKKTESAKSAKSK
;
C,G ? 
4 'polypeptide(L)'        no no 
;KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGEL
AKHAVSEGTKAVTKYTSAK
;
;KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGEL
AKHAVSEGTKAVTKYTSAK
;
D   ? 
5 'polypeptide(L)'        no no 
;TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAV
SEGTKAVTKYTSA
;
;TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAV
SEGTKAVTKYTSA
;
H   ? 
6 polydeoxyribonucleotide no no 
;(DC)(DT)(DG)(DG)(DA)(DG)(DA)(DA)(DT)(DC)(DC)(DC)(DG)(DG)(DT)(DG)(DC)(DC)(DG)(DA)
(DG)(DG)(DC)(DC)(DG)(DC)(DT)(DC)(DA)(DA)(DT)(DT)(DG)(DG)(DT)(DC)(DG)(DT)(DA)(DG)
(DA)(DC)(DA)(DG)(DC)(DT)(DC)(DT)(DA)(DG)(DC)(DA)(DC)(DC)(DG)(DC)(DT)(DT)(DA)(DA)
(DA)(DC)(DG)(DC)(DA)(DC)(DG)(DT)(DA)(DC)(DG)(DC)(DG)(DC)(DT)(DG)(DT)(DC)(DC)(DC)
(DC)(DC)(DG)(DC)(DG)(DT)(DT)(DT)(DT)(DA)(DA)(DC)(DC)(DG)(DC)(DC)(DA)(DA)(DG)(DG)
(DG)(DG)(DA)(DT)(DT)(DA)(DC)(DT)(DC)(DC)(DC)(DT)(DA)(DG)(DT)(DC)(DT)(DC)(DC)(DA)
(DG)(DG)(DC)(DA)(DC)(DG)(DT)(DG)(DT)(DC)(DA)(DG)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DC)
(DA)(DT)(DC)(DC)(DT)(DG)(DT)(DG)(DC)(DA)(DT)(DG)(DT)(DA)(DT)(DT)
;
;CTGGAGAATCCCGGTGCCGAGGCCGCTCAATTGGTCGTAGACAGCTCTAGCACCGCTTAAACGCACGTACGCGCTGTCCC
CCGCGTTTTAACCGCCAAGGGGATTACTCCCTAGTCTCCAGGCACGTGTCAGATATATACATCCTGTGCATGTATT
;
J   ? 
7 polydeoxyribonucleotide no no 
;(DA)(DA)(DT)(DA)(DC)(DA)(DT)(DG)(DC)(DA)(DC)(DA)(DG)(DG)(DA)(DT)(DG)(DT)(DA)(DT)
(DA)(DT)(DA)(DT)(DC)(DT)(DG)(DA)(DC)(DA)(DC)(DG)(DT)(DG)(DC)(DC)(DT)(DG)(DG)(DA)
(DG)(DA)(DC)(DT)(DA)(DG)(DG)(DG)(DA)(DG)(DT)(DA)(DA)(DT)(DC)(DC)(DC)(DC)(DT)(DT)
(DG)(DG)(DC)(DG)(DG)(DT)(DT)(DA)(DA)(DA)(DA)(DC)(DG)(DC)(DG)(DG)(DG)(DG)(DG)(DA)
(DC)(DA)(DG)(DC)(DG)(DC)(DG)(DT)(DA)(DC)(DG)(DT)(DG)(DC)(DG)(DT)(DT)(DT)(DA)(DA)
(DG)(DC)(DG)(DG)(DT)(DG)(DC)(DT)(DA)(DG)(DA)(DG)(DC)(DT)(DG)(DT)(DC)(DT)(DA)(DC)
(DG)(DA)(DC)(DC)(DA)(DA)(DT)(DT)(DG)(DA)(DG)(DC)(DG)(DG)(DC)(DC)(DT)(DC)(DG)(DG)
(DC)(DA)(DC)(DC)(DG)(DG)(DG)(DA)(DT)(DT)(DC)(DT)(DC)(DC)(DA)(DG)
;
;AATACATGCACAGGATGTATATATCTGACACGTGCCTGGAGACTAGGGAGTAATCCCCTTGGCGGTTAAAACGCGGGGGA
CAGCGCGTACGTGCGTTTAAGCGGTGCTAGAGCTGTCTACGACCAATTGAGCGGCCTCGGCACCGGGATTCTCCAG
;
I   ? 
8 'polypeptide(L)'        no no 
;TRFEDSPSYVKWGKLRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLHNWM
SEFKRWVPTLRSVCLIGDKEQRAAFVRDVLLPGEWDVCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVR
EFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSADDFDSWFDTNCLGQKLVERLHMVLRPFLLRRIKADVEKSLPPK
KEVKIYVGLSKMQREWYTRILMKDIDILNSAGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDMHLVTNSGKMVV
LDKLLPKLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHDERQDSINAYNEPNSTKFVFMLSTRAGGLGIN
LATADVVILYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRFITDNTVEERIVERAEMKLRLDSIVIQQ
;
;TRFEDSPSYVKWGKLRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLHNWM
SEFKRWVPTLRSVCLIGDKEQRAAFVRDVLLPGEWDVCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVR
EFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSADDFDSWFDTNCLGQKLVERLHMVLRPFLLRRIKADVEKSLPPK
KEVKIYVGLSKMQREWYTRILMKDIDILNSAGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDMHLVTNSGKMVV
LDKLLPKLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHDERQDSINAYNEPNSTKFVFMLSTRAGGLGIN
LATADVVILYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRFITDNTVEERIVERAEMKLRLDSIVIQQ
;
W   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ALA n 
1 3   ARG n 
1 4   THR n 
1 5   LYS n 
1 6   GLN n 
1 7   THR n 
1 8   ALA n 
1 9   ARG n 
1 10  LYS n 
1 11  SER n 
1 12  THR n 
1 13  GLY n 
1 14  GLY n 
1 15  LYS n 
1 16  ALA n 
1 17  PRO n 
1 18  ARG n 
1 19  LYS n 
1 20  GLN n 
1 21  LEU n 
1 22  ALA n 
1 23  THR n 
1 24  LYS n 
1 25  ALA n 
1 26  ALA n 
1 27  ARG n 
1 28  LYS n 
1 29  SER n 
1 30  ALA n 
1 31  PRO n 
1 32  ALA n 
1 33  THR n 
1 34  GLY n 
1 35  GLY n 
1 36  VAL n 
1 37  LYS n 
1 38  LYS n 
1 39  PRO n 
1 40  HIS n 
1 41  ARG n 
1 42  TYR n 
1 43  ARG n 
1 44  PRO n 
1 45  GLY n 
1 46  THR n 
1 47  VAL n 
1 48  ALA n 
1 49  LEU n 
1 50  ARG n 
1 51  GLU n 
1 52  ILE n 
1 53  ARG n 
1 54  ARG n 
1 55  TYR n 
1 56  GLN n 
1 57  LYS n 
1 58  SER n 
1 59  THR n 
1 60  GLU n 
1 61  LEU n 
1 62  LEU n 
1 63  ILE n 
1 64  ARG n 
1 65  LYS n 
1 66  LEU n 
1 67  PRO n 
1 68  PHE n 
1 69  GLN n 
1 70  ARG n 
1 71  LEU n 
1 72  VAL n 
1 73  ARG n 
1 74  GLU n 
1 75  ILE n 
1 76  ALA n 
1 77  GLN n 
1 78  ASP n 
1 79  PHE n 
1 80  LYS n 
1 81  THR n 
1 82  ASP n 
1 83  LEU n 
1 84  ARG n 
1 85  PHE n 
1 86  GLN n 
1 87  SER n 
1 88  SER n 
1 89  ALA n 
1 90  VAL n 
1 91  MET n 
1 92  ALA n 
1 93  LEU n 
1 94  GLN n 
1 95  GLU n 
1 96  ALA n 
1 97  SER n 
1 98  GLU n 
1 99  ALA n 
1 100 TYR n 
1 101 LEU n 
1 102 VAL n 
1 103 ALA n 
1 104 LEU n 
1 105 PHE n 
1 106 GLU n 
1 107 ASP n 
1 108 THR n 
1 109 ASN n 
1 110 LEU n 
1 111 CYS n 
1 112 ALA n 
1 113 ILE n 
1 114 HIS n 
1 115 ALA n 
1 116 LYS n 
1 117 ARG n 
1 118 VAL n 
1 119 THR n 
1 120 ILE n 
1 121 MET n 
1 122 PRO n 
1 123 LYS n 
1 124 ASP n 
1 125 ILE n 
1 126 GLN n 
1 127 LEU n 
1 128 ALA n 
1 129 ARG n 
1 130 ARG n 
1 131 ILE n 
1 132 ARG n 
1 133 GLY n 
1 134 GLU n 
1 135 ARG n 
1 136 ALA n 
2 1   MET n 
2 2   SER n 
2 3   GLY n 
2 4   ARG n 
2 5   GLY n 
2 6   LYS n 
2 7   GLY n 
2 8   GLY n 
2 9   LYS n 
2 10  GLY n 
2 11  LEU n 
2 12  GLY n 
2 13  LYS n 
2 14  GLY n 
2 15  GLY n 
2 16  ALA n 
2 17  LYS n 
2 18  ARG n 
2 19  HIS n 
2 20  ARG n 
2 21  LYS n 
2 22  VAL n 
2 23  LEU n 
2 24  ARG n 
2 25  ASP n 
2 26  ASN n 
2 27  ILE n 
2 28  GLN n 
2 29  GLY n 
2 30  ILE n 
2 31  THR n 
2 32  LYS n 
2 33  PRO n 
2 34  ALA n 
2 35  ILE n 
2 36  ARG n 
2 37  ARG n 
2 38  LEU n 
2 39  ALA n 
2 40  ARG n 
2 41  ARG n 
2 42  GLY n 
2 43  GLY n 
2 44  VAL n 
2 45  LYS n 
2 46  ARG n 
2 47  ILE n 
2 48  SER n 
2 49  GLY n 
2 50  LEU n 
2 51  ILE n 
2 52  TYR n 
2 53  GLU n 
2 54  GLU n 
2 55  THR n 
2 56  ARG n 
2 57  GLY n 
2 58  VAL n 
2 59  LEU n 
2 60  LYS n 
2 61  VAL n 
2 62  PHE n 
2 63  LEU n 
2 64  GLU n 
2 65  ASN n 
2 66  VAL n 
2 67  ILE n 
2 68  ARG n 
2 69  ASP n 
2 70  ALA n 
2 71  VAL n 
2 72  THR n 
2 73  TYR n 
2 74  THR n 
2 75  GLU n 
2 76  HIS n 
2 77  ALA n 
2 78  LYS n 
2 79  ARG n 
2 80  LYS n 
2 81  THR n 
2 82  VAL n 
2 83  THR n 
2 84  ALA n 
2 85  MET n 
2 86  ASP n 
2 87  VAL n 
2 88  VAL n 
2 89  TYR n 
2 90  ALA n 
2 91  LEU n 
2 92  LYS n 
2 93  ARG n 
2 94  GLN n 
2 95  GLY n 
2 96  ARG n 
2 97  THR n 
2 98  LEU n 
2 99  TYR n 
2 100 GLY n 
2 101 PHE n 
2 102 GLY n 
2 103 GLY n 
3 1   MET n 
3 2   SER n 
3 3   GLY n 
3 4   ARG n 
3 5   GLY n 
3 6   LYS n 
3 7   GLN n 
3 8   GLY n 
3 9   GLY n 
3 10  LYS n 
3 11  THR n 
3 12  ARG n 
3 13  ALA n 
3 14  LYS n 
3 15  ALA n 
3 16  LYS n 
3 17  THR n 
3 18  ARG n 
3 19  SER n 
3 20  SER n 
3 21  ARG n 
3 22  ALA n 
3 23  GLY n 
3 24  LEU n 
3 25  GLN n 
3 26  PHE n 
3 27  PRO n 
3 28  VAL n 
3 29  GLY n 
3 30  ARG n 
3 31  VAL n 
3 32  HIS n 
3 33  ARG n 
3 34  LEU n 
3 35  LEU n 
3 36  ARG n 
3 37  LYS n 
3 38  GLY n 
3 39  ASN n 
3 40  TYR n 
3 41  ALA n 
3 42  GLU n 
3 43  ARG n 
3 44  VAL n 
3 45  GLY n 
3 46  ALA n 
3 47  GLY n 
3 48  ALA n 
3 49  PRO n 
3 50  VAL n 
3 51  TYR n 
3 52  LEU n 
3 53  ALA n 
3 54  ALA n 
3 55  VAL n 
3 56  LEU n 
3 57  GLU n 
3 58  TYR n 
3 59  LEU n 
3 60  THR n 
3 61  ALA n 
3 62  GLU n 
3 63  ILE n 
3 64  LEU n 
3 65  GLU n 
3 66  LEU n 
3 67  ALA n 
3 68  GLY n 
3 69  ASN n 
3 70  ALA n 
3 71  ALA n 
3 72  ARG n 
3 73  ASP n 
3 74  ASN n 
3 75  LYS n 
3 76  LYS n 
3 77  THR n 
3 78  ARG n 
3 79  ILE n 
3 80  ILE n 
3 81  PRO n 
3 82  ARG n 
3 83  HIS n 
3 84  LEU n 
3 85  GLN n 
3 86  LEU n 
3 87  ALA n 
3 88  VAL n 
3 89  ARG n 
3 90  ASN n 
3 91  ASP n 
3 92  GLU n 
3 93  GLU n 
3 94  LEU n 
3 95  ASN n 
3 96  LYS n 
3 97  LEU n 
3 98  LEU n 
3 99  GLY n 
3 100 ARG n 
3 101 VAL n 
3 102 THR n 
3 103 ILE n 
3 104 ALA n 
3 105 GLN n 
3 106 GLY n 
3 107 GLY n 
3 108 VAL n 
3 109 LEU n 
3 110 PRO n 
3 111 ASN n 
3 112 ILE n 
3 113 GLN n 
3 114 SER n 
3 115 VAL n 
3 116 LEU n 
3 117 LEU n 
3 118 PRO n 
3 119 LYS n 
3 120 LYS n 
3 121 THR n 
3 122 GLU n 
3 123 SER n 
3 124 ALA n 
3 125 LYS n 
3 126 SER n 
3 127 ALA n 
3 128 LYS n 
3 129 SER n 
3 130 LYS n 
4 1   LYS n 
4 2   LYS n 
4 3   ARG n 
4 4   ARG n 
4 5   LYS n 
4 6   THR n 
4 7   ARG n 
4 8   LYS n 
4 9   GLU n 
4 10  SER n 
4 11  TYR n 
4 12  ALA n 
4 13  ILE n 
4 14  TYR n 
4 15  VAL n 
4 16  TYR n 
4 17  LYS n 
4 18  VAL n 
4 19  LEU n 
4 20  LYS n 
4 21  GLN n 
4 22  VAL n 
4 23  HIS n 
4 24  PRO n 
4 25  ASP n 
4 26  THR n 
4 27  GLY n 
4 28  ILE n 
4 29  SER n 
4 30  SER n 
4 31  LYS n 
4 32  ALA n 
4 33  MET n 
4 34  SER n 
4 35  ILE n 
4 36  MET n 
4 37  ASN n 
4 38  SER n 
4 39  PHE n 
4 40  VAL n 
4 41  ASN n 
4 42  ASP n 
4 43  VAL n 
4 44  PHE n 
4 45  GLU n 
4 46  ARG n 
4 47  ILE n 
4 48  ALA n 
4 49  GLY n 
4 50  GLU n 
4 51  ALA n 
4 52  SER n 
4 53  ARG n 
4 54  LEU n 
4 55  ALA n 
4 56  HIS n 
4 57  TYR n 
4 58  ASN n 
4 59  LYS n 
4 60  ARG n 
4 61  SER n 
4 62  THR n 
4 63  ILE n 
4 64  THR n 
4 65  SER n 
4 66  ARG n 
4 67  GLU n 
4 68  ILE n 
4 69  GLN n 
4 70  THR n 
4 71  ALA n 
4 72  VAL n 
4 73  ARG n 
4 74  LEU n 
4 75  LEU n 
4 76  LEU n 
4 77  PRO n 
4 78  GLY n 
4 79  GLU n 
4 80  LEU n 
4 81  ALA n 
4 82  LYS n 
4 83  HIS n 
4 84  ALA n 
4 85  VAL n 
4 86  SER n 
4 87  GLU n 
4 88  GLY n 
4 89  THR n 
4 90  LYS n 
4 91  ALA n 
4 92  VAL n 
4 93  THR n 
4 94  LYS n 
4 95  TYR n 
4 96  THR n 
4 97  SER n 
4 98  ALA n 
4 99  LYS n 
5 1   THR n 
5 2   ARG n 
5 3   LYS n 
5 4   GLU n 
5 5   SER n 
5 6   TYR n 
5 7   ALA n 
5 8   ILE n 
5 9   TYR n 
5 10  VAL n 
5 11  TYR n 
5 12  LYS n 
5 13  VAL n 
5 14  LEU n 
5 15  LYS n 
5 16  GLN n 
5 17  VAL n 
5 18  HIS n 
5 19  PRO n 
5 20  ASP n 
5 21  THR n 
5 22  GLY n 
5 23  ILE n 
5 24  SER n 
5 25  SER n 
5 26  LYS n 
5 27  ALA n 
5 28  MET n 
5 29  SER n 
5 30  ILE n 
5 31  MET n 
5 32  ASN n 
5 33  SER n 
5 34  PHE n 
5 35  VAL n 
5 36  ASN n 
5 37  ASP n 
5 38  VAL n 
5 39  PHE n 
5 40  GLU n 
5 41  ARG n 
5 42  ILE n 
5 43  ALA n 
5 44  GLY n 
5 45  GLU n 
5 46  ALA n 
5 47  SER n 
5 48  ARG n 
5 49  LEU n 
5 50  ALA n 
5 51  HIS n 
5 52  TYR n 
5 53  ASN n 
5 54  LYS n 
5 55  ARG n 
5 56  SER n 
5 57  THR n 
5 58  ILE n 
5 59  THR n 
5 60  SER n 
5 61  ARG n 
5 62  GLU n 
5 63  ILE n 
5 64  GLN n 
5 65  THR n 
5 66  ALA n 
5 67  VAL n 
5 68  ARG n 
5 69  LEU n 
5 70  LEU n 
5 71  LEU n 
5 72  PRO n 
5 73  GLY n 
5 74  GLU n 
5 75  LEU n 
5 76  ALA n 
5 77  LYS n 
5 78  HIS n 
5 79  ALA n 
5 80  VAL n 
5 81  SER n 
5 82  GLU n 
5 83  GLY n 
5 84  THR n 
5 85  LYS n 
5 86  ALA n 
5 87  VAL n 
5 88  THR n 
5 89  LYS n 
5 90  TYR n 
5 91  THR n 
5 92  SER n 
5 93  ALA n 
6 1   DC  n 
6 2   DT  n 
6 3   DG  n 
6 4   DG  n 
6 5   DA  n 
6 6   DG  n 
6 7   DA  n 
6 8   DA  n 
6 9   DT  n 
6 10  DC  n 
6 11  DC  n 
6 12  DC  n 
6 13  DG  n 
6 14  DG  n 
6 15  DT  n 
6 16  DG  n 
6 17  DC  n 
6 18  DC  n 
6 19  DG  n 
6 20  DA  n 
6 21  DG  n 
6 22  DG  n 
6 23  DC  n 
6 24  DC  n 
6 25  DG  n 
6 26  DC  n 
6 27  DT  n 
6 28  DC  n 
6 29  DA  n 
6 30  DA  n 
6 31  DT  n 
6 32  DT  n 
6 33  DG  n 
6 34  DG  n 
6 35  DT  n 
6 36  DC  n 
6 37  DG  n 
6 38  DT  n 
6 39  DA  n 
6 40  DG  n 
6 41  DA  n 
6 42  DC  n 
6 43  DA  n 
6 44  DG  n 
6 45  DC  n 
6 46  DT  n 
6 47  DC  n 
6 48  DT  n 
6 49  DA  n 
6 50  DG  n 
6 51  DC  n 
6 52  DA  n 
6 53  DC  n 
6 54  DC  n 
6 55  DG  n 
6 56  DC  n 
6 57  DT  n 
6 58  DT  n 
6 59  DA  n 
6 60  DA  n 
6 61  DA  n 
6 62  DC  n 
6 63  DG  n 
6 64  DC  n 
6 65  DA  n 
6 66  DC  n 
6 67  DG  n 
6 68  DT  n 
6 69  DA  n 
6 70  DC  n 
6 71  DG  n 
6 72  DC  n 
6 73  DG  n 
6 74  DC  n 
6 75  DT  n 
6 76  DG  n 
6 77  DT  n 
6 78  DC  n 
6 79  DC  n 
6 80  DC  n 
6 81  DC  n 
6 82  DC  n 
6 83  DG  n 
6 84  DC  n 
6 85  DG  n 
6 86  DT  n 
6 87  DT  n 
6 88  DT  n 
6 89  DT  n 
6 90  DA  n 
6 91  DA  n 
6 92  DC  n 
6 93  DC  n 
6 94  DG  n 
6 95  DC  n 
6 96  DC  n 
6 97  DA  n 
6 98  DA  n 
6 99  DG  n 
6 100 DG  n 
6 101 DG  n 
6 102 DG  n 
6 103 DA  n 
6 104 DT  n 
6 105 DT  n 
6 106 DA  n 
6 107 DC  n 
6 108 DT  n 
6 109 DC  n 
6 110 DC  n 
6 111 DC  n 
6 112 DT  n 
6 113 DA  n 
6 114 DG  n 
6 115 DT  n 
6 116 DC  n 
6 117 DT  n 
6 118 DC  n 
6 119 DC  n 
6 120 DA  n 
6 121 DG  n 
6 122 DG  n 
6 123 DC  n 
6 124 DA  n 
6 125 DC  n 
6 126 DG  n 
6 127 DT  n 
6 128 DG  n 
6 129 DT  n 
6 130 DC  n 
6 131 DA  n 
6 132 DG  n 
6 133 DA  n 
6 134 DT  n 
6 135 DA  n 
6 136 DT  n 
6 137 DA  n 
6 138 DT  n 
6 139 DA  n 
6 140 DC  n 
6 141 DA  n 
6 142 DT  n 
6 143 DC  n 
6 144 DC  n 
6 145 DT  n 
6 146 DG  n 
6 147 DT  n 
6 148 DG  n 
6 149 DC  n 
6 150 DA  n 
6 151 DT  n 
6 152 DG  n 
6 153 DT  n 
6 154 DA  n 
6 155 DT  n 
6 156 DT  n 
7 1   DA  n 
7 2   DA  n 
7 3   DT  n 
7 4   DA  n 
7 5   DC  n 
7 6   DA  n 
7 7   DT  n 
7 8   DG  n 
7 9   DC  n 
7 10  DA  n 
7 11  DC  n 
7 12  DA  n 
7 13  DG  n 
7 14  DG  n 
7 15  DA  n 
7 16  DT  n 
7 17  DG  n 
7 18  DT  n 
7 19  DA  n 
7 20  DT  n 
7 21  DA  n 
7 22  DT  n 
7 23  DA  n 
7 24  DT  n 
7 25  DC  n 
7 26  DT  n 
7 27  DG  n 
7 28  DA  n 
7 29  DC  n 
7 30  DA  n 
7 31  DC  n 
7 32  DG  n 
7 33  DT  n 
7 34  DG  n 
7 35  DC  n 
7 36  DC  n 
7 37  DT  n 
7 38  DG  n 
7 39  DG  n 
7 40  DA  n 
7 41  DG  n 
7 42  DA  n 
7 43  DC  n 
7 44  DT  n 
7 45  DA  n 
7 46  DG  n 
7 47  DG  n 
7 48  DG  n 
7 49  DA  n 
7 50  DG  n 
7 51  DT  n 
7 52  DA  n 
7 53  DA  n 
7 54  DT  n 
7 55  DC  n 
7 56  DC  n 
7 57  DC  n 
7 58  DC  n 
7 59  DT  n 
7 60  DT  n 
7 61  DG  n 
7 62  DG  n 
7 63  DC  n 
7 64  DG  n 
7 65  DG  n 
7 66  DT  n 
7 67  DT  n 
7 68  DA  n 
7 69  DA  n 
7 70  DA  n 
7 71  DA  n 
7 72  DC  n 
7 73  DG  n 
7 74  DC  n 
7 75  DG  n 
7 76  DG  n 
7 77  DG  n 
7 78  DG  n 
7 79  DG  n 
7 80  DA  n 
7 81  DC  n 
7 82  DA  n 
7 83  DG  n 
7 84  DC  n 
7 85  DG  n 
7 86  DC  n 
7 87  DG  n 
7 88  DT  n 
7 89  DA  n 
7 90  DC  n 
7 91  DG  n 
7 92  DT  n 
7 93  DG  n 
7 94  DC  n 
7 95  DG  n 
7 96  DT  n 
7 97  DT  n 
7 98  DT  n 
7 99  DA  n 
7 100 DA  n 
7 101 DG  n 
7 102 DC  n 
7 103 DG  n 
7 104 DG  n 
7 105 DT  n 
7 106 DG  n 
7 107 DC  n 
7 108 DT  n 
7 109 DA  n 
7 110 DG  n 
7 111 DA  n 
7 112 DG  n 
7 113 DC  n 
7 114 DT  n 
7 115 DG  n 
7 116 DT  n 
7 117 DC  n 
7 118 DT  n 
7 119 DA  n 
7 120 DC  n 
7 121 DG  n 
7 122 DA  n 
7 123 DC  n 
7 124 DC  n 
7 125 DA  n 
7 126 DA  n 
7 127 DT  n 
7 128 DT  n 
7 129 DG  n 
7 130 DA  n 
7 131 DG  n 
7 132 DC  n 
7 133 DG  n 
7 134 DG  n 
7 135 DC  n 
7 136 DC  n 
7 137 DT  n 
7 138 DC  n 
7 139 DG  n 
7 140 DG  n 
7 141 DC  n 
7 142 DA  n 
7 143 DC  n 
7 144 DC  n 
7 145 DG  n 
7 146 DG  n 
7 147 DG  n 
7 148 DA  n 
7 149 DT  n 
7 150 DT  n 
7 151 DC  n 
7 152 DT  n 
7 153 DC  n 
7 154 DC  n 
7 155 DA  n 
7 156 DG  n 
8 1   THR n 
8 2   ARG n 
8 3   PHE n 
8 4   GLU n 
8 5   ASP n 
8 6   SER n 
8 7   PRO n 
8 8   SER n 
8 9   TYR n 
8 10  VAL n 
8 11  LYS n 
8 12  TRP n 
8 13  GLY n 
8 14  LYS n 
8 15  LEU n 
8 16  ARG n 
8 17  ASP n 
8 18  TYR n 
8 19  GLN n 
8 20  VAL n 
8 21  ARG n 
8 22  GLY n 
8 23  LEU n 
8 24  ASN n 
8 25  TRP n 
8 26  LEU n 
8 27  ILE n 
8 28  SER n 
8 29  LEU n 
8 30  TYR n 
8 31  GLU n 
8 32  ASN n 
8 33  GLY n 
8 34  ILE n 
8 35  ASN n 
8 36  GLY n 
8 37  ILE n 
8 38  LEU n 
8 39  ALA n 
8 40  ASP n 
8 41  GLU n 
8 42  MET n 
8 43  GLY n 
8 44  LEU n 
8 45  GLY n 
8 46  LYS n 
8 47  THR n 
8 48  LEU n 
8 49  GLN n 
8 50  THR n 
8 51  ILE n 
8 52  SER n 
8 53  LEU n 
8 54  LEU n 
8 55  GLY n 
8 56  TYR n 
8 57  MET n 
8 58  LYS n 
8 59  HIS n 
8 60  TYR n 
8 61  ARG n 
8 62  ASN n 
8 63  ILE n 
8 64  PRO n 
8 65  GLY n 
8 66  PRO n 
8 67  HIS n 
8 68  MET n 
8 69  VAL n 
8 70  LEU n 
8 71  VAL n 
8 72  PRO n 
8 73  LYS n 
8 74  SER n 
8 75  THR n 
8 76  LEU n 
8 77  HIS n 
8 78  ASN n 
8 79  TRP n 
8 80  MET n 
8 81  SER n 
8 82  GLU n 
8 83  PHE n 
8 84  LYS n 
8 85  ARG n 
8 86  TRP n 
8 87  VAL n 
8 88  PRO n 
8 89  THR n 
8 90  LEU n 
8 91  ARG n 
8 92  SER n 
8 93  VAL n 
8 94  CYS n 
8 95  LEU n 
8 96  ILE n 
8 97  GLY n 
8 98  ASP n 
8 99  LYS n 
8 100 GLU n 
8 101 GLN n 
8 102 ARG n 
8 103 ALA n 
8 104 ALA n 
8 105 PHE n 
8 106 VAL n 
8 107 ARG n 
8 108 ASP n 
8 109 VAL n 
8 110 LEU n 
8 111 LEU n 
8 112 PRO n 
8 113 GLY n 
8 114 GLU n 
8 115 TRP n 
8 116 ASP n 
8 117 VAL n 
8 118 CYS n 
8 119 VAL n 
8 120 THR n 
8 121 SER n 
8 122 TYR n 
8 123 GLU n 
8 124 MET n 
8 125 LEU n 
8 126 ILE n 
8 127 LYS n 
8 128 GLU n 
8 129 LYS n 
8 130 SER n 
8 131 VAL n 
8 132 PHE n 
8 133 LYS n 
8 134 LYS n 
8 135 PHE n 
8 136 ASN n 
8 137 TRP n 
8 138 ARG n 
8 139 TYR n 
8 140 LEU n 
8 141 VAL n 
8 142 ILE n 
8 143 ASP n 
8 144 GLU n 
8 145 ALA n 
8 146 HIS n 
8 147 ARG n 
8 148 ILE n 
8 149 LYS n 
8 150 ASN n 
8 151 GLU n 
8 152 LYS n 
8 153 SER n 
8 154 LYS n 
8 155 LEU n 
8 156 SER n 
8 157 GLU n 
8 158 ILE n 
8 159 VAL n 
8 160 ARG n 
8 161 GLU n 
8 162 PHE n 
8 163 LYS n 
8 164 THR n 
8 165 THR n 
8 166 ASN n 
8 167 ARG n 
8 168 LEU n 
8 169 LEU n 
8 170 LEU n 
8 171 THR n 
8 172 GLY n 
8 173 THR n 
8 174 PRO n 
8 175 LEU n 
8 176 GLN n 
8 177 ASN n 
8 178 ASN n 
8 179 LEU n 
8 180 HIS n 
8 181 GLU n 
8 182 LEU n 
8 183 TRP n 
8 184 SER n 
8 185 LEU n 
8 186 LEU n 
8 187 ASN n 
8 188 PHE n 
8 189 LEU n 
8 190 LEU n 
8 191 PRO n 
8 192 ASP n 
8 193 VAL n 
8 194 PHE n 
8 195 ASN n 
8 196 SER n 
8 197 ALA n 
8 198 ASP n 
8 199 ASP n 
8 200 PHE n 
8 201 ASP n 
8 202 SER n 
8 203 TRP n 
8 204 PHE n 
8 205 ASP n 
8 206 THR n 
8 207 ASN n 
8 208 CYS n 
8 209 LEU n 
8 210 GLY n 
8 211 GLN n 
8 212 LYS n 
8 213 LEU n 
8 214 VAL n 
8 215 GLU n 
8 216 ARG n 
8 217 LEU n 
8 218 HIS n 
8 219 MET n 
8 220 VAL n 
8 221 LEU n 
8 222 ARG n 
8 223 PRO n 
8 224 PHE n 
8 225 LEU n 
8 226 LEU n 
8 227 ARG n 
8 228 ARG n 
8 229 ILE n 
8 230 LYS n 
8 231 ALA n 
8 232 ASP n 
8 233 VAL n 
8 234 GLU n 
8 235 LYS n 
8 236 SER n 
8 237 LEU n 
8 238 PRO n 
8 239 PRO n 
8 240 LYS n 
8 241 LYS n 
8 242 GLU n 
8 243 VAL n 
8 244 LYS n 
8 245 ILE n 
8 246 TYR n 
8 247 VAL n 
8 248 GLY n 
8 249 LEU n 
8 250 SER n 
8 251 LYS n 
8 252 MET n 
8 253 GLN n 
8 254 ARG n 
8 255 GLU n 
8 256 TRP n 
8 257 TYR n 
8 258 THR n 
8 259 ARG n 
8 260 ILE n 
8 261 LEU n 
8 262 MET n 
8 263 LYS n 
8 264 ASP n 
8 265 ILE n 
8 266 ASP n 
8 267 ILE n 
8 268 LEU n 
8 269 ASN n 
8 270 SER n 
8 271 ALA n 
8 272 GLY n 
8 273 LYS n 
8 274 MET n 
8 275 ASP n 
8 276 LYS n 
8 277 MET n 
8 278 ARG n 
8 279 LEU n 
8 280 LEU n 
8 281 ASN n 
8 282 ILE n 
8 283 LEU n 
8 284 MET n 
8 285 GLN n 
8 286 LEU n 
8 287 ARG n 
8 288 LYS n 
8 289 CYS n 
8 290 CYS n 
8 291 ASN n 
8 292 HIS n 
8 293 PRO n 
8 294 TYR n 
8 295 LEU n 
8 296 PHE n 
8 297 ASP n 
8 298 GLY n 
8 299 ALA n 
8 300 GLU n 
8 301 PRO n 
8 302 GLY n 
8 303 PRO n 
8 304 PRO n 
8 305 TYR n 
8 306 THR n 
8 307 THR n 
8 308 ASP n 
8 309 MET n 
8 310 HIS n 
8 311 LEU n 
8 312 VAL n 
8 313 THR n 
8 314 ASN n 
8 315 SER n 
8 316 GLY n 
8 317 LYS n 
8 318 MET n 
8 319 VAL n 
8 320 VAL n 
8 321 LEU n 
8 322 ASP n 
8 323 LYS n 
8 324 LEU n 
8 325 LEU n 
8 326 PRO n 
8 327 LYS n 
8 328 LEU n 
8 329 LYS n 
8 330 GLU n 
8 331 GLN n 
8 332 GLY n 
8 333 SER n 
8 334 ARG n 
8 335 VAL n 
8 336 LEU n 
8 337 ILE n 
8 338 PHE n 
8 339 SER n 
8 340 GLN n 
8 341 MET n 
8 342 THR n 
8 343 ARG n 
8 344 VAL n 
8 345 LEU n 
8 346 ASP n 
8 347 ILE n 
8 348 LEU n 
8 349 GLU n 
8 350 ASP n 
8 351 TYR n 
8 352 CYS n 
8 353 MET n 
8 354 TRP n 
8 355 ARG n 
8 356 ASN n 
8 357 TYR n 
8 358 GLU n 
8 359 TYR n 
8 360 CYS n 
8 361 ARG n 
8 362 LEU n 
8 363 ASP n 
8 364 GLY n 
8 365 GLN n 
8 366 THR n 
8 367 PRO n 
8 368 HIS n 
8 369 ASP n 
8 370 GLU n 
8 371 ARG n 
8 372 GLN n 
8 373 ASP n 
8 374 SER n 
8 375 ILE n 
8 376 ASN n 
8 377 ALA n 
8 378 TYR n 
8 379 ASN n 
8 380 GLU n 
8 381 PRO n 
8 382 ASN n 
8 383 SER n 
8 384 THR n 
8 385 LYS n 
8 386 PHE n 
8 387 VAL n 
8 388 PHE n 
8 389 MET n 
8 390 LEU n 
8 391 SER n 
8 392 THR n 
8 393 ARG n 
8 394 ALA n 
8 395 GLY n 
8 396 GLY n 
8 397 LEU n 
8 398 GLY n 
8 399 ILE n 
8 400 ASN n 
8 401 LEU n 
8 402 ALA n 
8 403 THR n 
8 404 ALA n 
8 405 ASP n 
8 406 VAL n 
8 407 VAL n 
8 408 ILE n 
8 409 LEU n 
8 410 TYR n 
8 411 ASP n 
8 412 SER n 
8 413 ASP n 
8 414 TRP n 
8 415 ASN n 
8 416 PRO n 
8 417 GLN n 
8 418 VAL n 
8 419 ASP n 
8 420 LEU n 
8 421 GLN n 
8 422 ALA n 
8 423 MET n 
8 424 ASP n 
8 425 ARG n 
8 426 ALA n 
8 427 HIS n 
8 428 ARG n 
8 429 ILE n 
8 430 GLY n 
8 431 GLN n 
8 432 THR n 
8 433 LYS n 
8 434 THR n 
8 435 VAL n 
8 436 ARG n 
8 437 VAL n 
8 438 PHE n 
8 439 ARG n 
8 440 PHE n 
8 441 ILE n 
8 442 THR n 
8 443 ASP n 
8 444 ASN n 
8 445 THR n 
8 446 VAL n 
8 447 GLU n 
8 448 GLU n 
8 449 ARG n 
8 450 ILE n 
8 451 VAL n 
8 452 GLU n 
8 453 ARG n 
8 454 ALA n 
8 455 GLU n 
8 456 MET n 
8 457 LYS n 
8 458 LEU n 
8 459 ARG n 
8 460 LEU n 
8 461 ASP n 
8 462 SER n 
8 463 ILE n 
8 464 VAL n 
8 465 ILE n 
8 466 GLN n 
8 467 GLN n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 136 'African clawed frog' ? ?                         ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? 
? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 103 'African clawed frog' ? ?                         ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? 
? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3 1 sample 'Biological sequence' 1 130 'African clawed frog' ? ?                         ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? 
? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4 1 sample 'Biological sequence' 1 99  'African clawed frog' ? XELAEV_18032686mg         ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? 
? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5 1 sample 'Biological sequence' 1 93  'African clawed frog' ? XELAEV_18032686mg         ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? 
? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6 1 sample 'Biological sequence' 1 156 'African clawed frog' ? ?                         ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? 
? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7 1 sample 'Biological sequence' 1 156 'African clawed frog' ? ?                         ? ? ? ? ? ? 'Xenopus laevis' 8355 ? ? ? ? 
? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8 1 sample 'Biological sequence' 1 469 Human                 ? 'SMARCA5, SNF2H, WCRF135' ? ? ? ? ? ? 'Homo sapiens'   9606 ? ? ? ? 
? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP H32_XENLA        P84233     ? 1 
;MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFK
TDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
;
1   
2 UNP H4_XENLA         P62799     ? 2 
;MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRK
TVTAMDVVYALKRQGRTLYGFGG
;
1   
3 UNP H2A1_XENLA       P06897     ? 3 
;MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTRII
PRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKKTESAKSAKSK
;
1   
4 UNP A0A1L8FQ56_XENLA A0A1L8FQ56 ? 4 
;KKRRKTRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGEL
AKHAVSEGTKAVTKYTSAK
;
28  
5 UNP A0A1L8FQ56_XENLA A0A1L8FQ56 ? 5 
;TRKESYAIYVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAV
SEGTKAVTKYTSA
;
33  
6 PDB 6NE3             6NE3       ? 6 ? 1   
7 PDB 6NE3             6NE3       ? 7 ? 1   
8 UNP SMCA5_HUMAN      O60264     ? 8 
;TRFEDSPSYVKWGKLRDYQVRGLNWLISLYENGINGILADEMGLGKTLQTISLLGYMKHYRNIPGPHMVLVPKSTLHNWM
SEFKRWVPTLRSVCLIGDKEQRAAFVRDVLLPGEWDVCVTSYEMLIKEKSVFKKFNWRYLVIDEAHRIKNEKSKLSEIVR
EFKTTNRLLLTGTPLQNNLHELWSLLNFLLPDVFNSADDFDSWFDTNNCLGDQKLVERLHMVLRPFLLRRIKADVEKSLP
PKKEVKIYVGLSKMQREWYTRILMKDIDILNSAGKMDKMRLLNILMQLRKCCNHPYLFDGAEPGPPYTTDMHLVTNSGKM
VVLDKLLPKLKEQGSRVLIFSQMTRVLDILEDYCMWRNYEYCRLDGQTPHDERQDSINAYNEPNSTKFVFMLSTRAGGLG
INLATADVVILYDSDWNPQVDLQAMDRAHRIGQTKTVRVFRFITDNTVEERIVERAEMKLRLDSIVIQQ
;
166 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6NE3 A 1 ? 136 ? P84233     1   ? 136 ? 0   135 
2  2 6NE3 B 1 ? 103 ? P62799     1   ? 103 ? 0   102 
3  3 6NE3 C 1 ? 130 ? P06897     1   ? 130 ? 0   129 
4  4 6NE3 D 1 ? 99  ? A0A1L8FQ56 28  ? 126 ? 24  122 
5  1 6NE3 E 1 ? 136 ? P84233     1   ? 136 ? 0   135 
6  2 6NE3 F 1 ? 103 ? P62799     1   ? 103 ? 0   102 
7  3 6NE3 G 1 ? 130 ? P06897     1   ? 130 ? 0   129 
8  5 6NE3 H 1 ? 93  ? A0A1L8FQ56 33  ? 125 ? 29  121 
9  6 6NE3 J 1 ? 156 ? 6NE3       0   ? 155 ? 0   155 
10 7 6NE3 I 1 ? 156 ? 6NE3       52  ? 207 ? 52  207 
11 8 6NE3 W 1 ? 294 ? O60264     166 ? 634 ? 166 461 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6NE3 ALA A 103 ? UNP P84233 GLY 103 'engineered mutation' 102 1 
3 6NE3 ARG C 100 ? UNP P06897 GLY 100 'engineered mutation' 99  2 
5 6NE3 ALA E 103 ? UNP P84233 GLY 103 'engineered mutation' 102 3 
7 6NE3 ARG G 100 ? UNP P06897 GLY 100 'engineered mutation' 99  4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE"           ? 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'        89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                             ? 'C3 H7 N O2 S'      121.158 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P'   331.222 
DC  'DNA linking'       y "2'-DEOXYCYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O7 P'    307.197 
DG  'DNA linking'       y "2'-DEOXYGUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'   347.221 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P'   322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                            ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'     149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'       117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6NE3 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6NE3 
_refine.pdbx_refine_id                           'ELECTRON MICROSCOPY' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            . 
_refine.ls_d_res_low                             ? 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     ? 
_refine.ls_number_reflns_R_free                  ? 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          ? 
_refine.ls_R_factor_R_free                       ? 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       ? 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.pdbx_method_to_determine_struct          ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           ? 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'ELECTRON MICROSCOPY' ? 0.005  ? 17123 ? f_bond_d           ? ? 
'ELECTRON MICROSCOPY' ? 0.781  ? 24529 ? f_angle_d          ? ? 
'ELECTRON MICROSCOPY' ? 23.382 ? 9201  ? f_dihedral_angle_d ? ? 
'ELECTRON MICROSCOPY' ? 0.055  ? 2797  ? f_chiral_restr     ? ? 
'ELECTRON MICROSCOPY' ? 0.004  ? 2009  ? f_plane_restr      ? ? 
# 
_struct.entry_id                     6NE3 
_struct.title                        'Cryo-EM structure of singly-bound SNF2h-nucleosome complex with SNF2h bound at SHL-2' 
_struct.pdbx_descriptor              
;Histone H3.2, Histone H4, Histone H2A type 1, Histone H2B, SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5/DNA Complex
;
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6NE3 
_struct_keywords.text            
'ISWI, Chromatin, Nucleosome, DNA, SNF2h, histones, DNA BINDING PROTEIN, DNA BINDING PROTEIN-DNA complex' 
_struct_keywords.pdbx_keywords   'DNA BINDING PROTEIN/DNA' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
E N N 1 ? 
F N N 2 ? 
G N N 3 ? 
H N N 5 ? 
I N N 6 ? 
J N N 7 ? 
K N N 8 ? 
L N N 9 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 THR A 46  ? LYS A 57  ? THR A 45  LYS A 56  1 ? 12 
HELX_P HELX_P2  AA2 ARG A 64  ? LYS A 80  ? ARG A 63  LYS A 79  1 ? 17 
HELX_P HELX_P3  AA3 SER A 88  ? ALA A 115 ? SER A 87  ALA A 114 1 ? 28 
HELX_P HELX_P4  AA4 MET A 121 ? GLY A 133 ? MET A 120 GLY A 132 1 ? 13 
HELX_P HELX_P5  AA5 THR B 31  ? GLY B 43  ? THR B 30  GLY B 42  1 ? 13 
HELX_P HELX_P6  AA6 LEU B 50  ? ALA B 77  ? LEU B 49  ALA B 76  1 ? 28 
HELX_P HELX_P7  AA7 THR B 83  ? GLY B 95  ? THR B 82  GLY B 94  1 ? 13 
HELX_P HELX_P8  AA8 THR C 17  ? ALA C 22  ? THR C 16  ALA C 21  1 ? 6  
HELX_P HELX_P9  AA9 PRO C 27  ? LYS C 37  ? PRO C 26  LYS C 36  1 ? 11 
HELX_P HELX_P10 AB1 GLY C 47  ? ASP C 73  ? GLY C 46  ASP C 72  1 ? 27 
HELX_P HELX_P11 AB2 ILE C 80  ? ASN C 90  ? ILE C 79  ASN C 89  1 ? 11 
HELX_P HELX_P12 AB3 ASP C 91  ? LEU C 98  ? ASP C 90  LEU C 97  1 ? 8  
HELX_P HELX_P13 AB4 TYR D 11  ? HIS D 23  ? TYR D 34  HIS D 46  1 ? 13 
HELX_P HELX_P14 AB5 SER D 29  ? ASN D 58  ? SER D 52  ASN D 81  1 ? 30 
HELX_P HELX_P15 AB6 THR D 64  ? LEU D 76  ? THR D 87  LEU D 99  1 ? 13 
HELX_P HELX_P16 AB7 GLY D 78  ? ALA D 98  ? GLY D 101 ALA D 121 1 ? 21 
HELX_P HELX_P17 AB8 THR E 46  ? SER E 58  ? THR E 45  SER E 57  1 ? 13 
HELX_P HELX_P18 AB9 ARG E 64  ? GLN E 77  ? ARG E 63  GLN E 76  1 ? 14 
HELX_P HELX_P19 AC1 SER E 87  ? ALA E 115 ? SER E 86  ALA E 114 1 ? 29 
HELX_P HELX_P20 AC2 MET E 121 ? GLY E 133 ? MET E 120 GLY E 132 1 ? 13 
HELX_P HELX_P21 AC3 ASN F 26  ? ILE F 30  ? ASN F 25  ILE F 29  5 ? 5  
HELX_P HELX_P22 AC4 THR F 31  ? GLY F 43  ? THR F 30  GLY F 42  1 ? 13 
HELX_P HELX_P23 AC5 ILE F 51  ? ALA F 77  ? ILE F 50  ALA F 76  1 ? 27 
HELX_P HELX_P24 AC6 THR F 83  ? GLN F 94  ? THR F 82  GLN F 93  1 ? 12 
HELX_P HELX_P25 AC7 THR G 17  ? ALA G 22  ? THR G 16  ALA G 21  1 ? 6  
HELX_P HELX_P26 AC8 VAL G 28  ? GLY G 38  ? VAL G 27  GLY G 37  1 ? 11 
HELX_P HELX_P27 AC9 GLY G 47  ? ASN G 74  ? GLY G 46  ASN G 73  1 ? 28 
HELX_P HELX_P28 AD1 ILE G 80  ? ASP G 91  ? ILE G 79  ASP G 90  1 ? 12 
HELX_P HELX_P29 AD2 GLU G 92  ? LEU G 98  ? GLU G 91  LEU G 97  1 ? 7  
HELX_P HELX_P30 AD3 TYR H 6   ? HIS H 18  ? TYR H 34  HIS H 46  1 ? 13 
HELX_P HELX_P31 AD4 SER H 25  ? ASN H 53  ? SER H 53  ASN H 81  1 ? 29 
HELX_P HELX_P32 AD5 THR H 59  ? LEU H 71  ? THR H 87  LEU H 99  1 ? 13 
HELX_P HELX_P33 AD6 PRO H 72  ? ALA H 93  ? PRO H 100 ALA H 121 1 ? 22 
HELX_P HELX_P34 AD7 ARG K 16  ? GLY K 33  ? ARG W 181 GLY W 198 1 ? 18 
HELX_P HELX_P35 AD8 GLY K 45  ? ARG K 61  ? GLY W 210 ARG W 226 1 ? 17 
HELX_P HELX_P36 AD9 PRO K 72  ? SER K 74  ? PRO W 237 SER W 239 5 ? 3  
HELX_P HELX_P37 AE1 THR K 75  ? TRP K 86  ? THR W 240 TRP W 251 1 ? 12 
HELX_P HELX_P38 AE2 ASP K 98  ? LEU K 110 ? ASP W 263 LEU W 275 1 ? 13 
HELX_P HELX_P39 AE3 TYR K 122 ? GLU K 128 ? TYR W 287 GLU W 293 1 ? 7  
HELX_P HELX_P40 AE4 GLU K 128 ? LYS K 133 ? GLU W 293 LYS W 298 1 ? 6  
HELX_P HELX_P41 AE5 SER K 153 ? GLU K 161 ? SER W 318 GLU W 326 1 ? 9  
HELX_P HELX_P42 AE6 LEU K 179 ? LEU K 190 ? LEU W 344 LEU W 355 1 ? 12 
HELX_P HELX_P43 AE7 PRO K 191 ? PHE K 194 ? PRO W 356 PHE W 359 5 ? 4  
HELX_P HELX_P44 AE8 SER K 196 ? PHE K 204 ? SER W 361 PHE W 369 1 ? 9  
HELX_P HELX_P45 AE9 LYS K 212 ? LEU K 225 ? LYS W 379 LEU W 392 1 ? 14 
HELX_P HELX_P46 AF1 ILE K 229 ? GLU K 234 ? ILE W 396 GLU W 401 1 ? 6  
HELX_P HELX_P47 AF2 SER K 250 ? MET K 262 ? SER W 417 MET W 429 1 ? 13 
HELX_P HELX_P48 AF3 ASN K 281 ? HIS K 292 ? ASN W 448 HIS W 459 1 ? 12 
HELX_P HELX_P49 AF4 PRO K 293 ? PHE K 296 ? PRO W 460 PHE W 463 5 ? 4  
HELX_P HELX_P50 AF5 SER K 315 ? GLY K 332 ? SER W 482 GLY W 499 1 ? 18 
HELX_P HELX_P51 AF6 MET K 341 ? ARG K 355 ? MET W 508 ARG W 522 1 ? 15 
HELX_P HELX_P52 AF7 PRO K 367 ? GLU K 370 ? PRO W 534 GLU W 537 5 ? 4  
HELX_P HELX_P53 AF8 ARG K 371 ? ASN K 379 ? ARG W 538 ASN W 546 1 ? 9  
HELX_P HELX_P54 AF9 THR K 392 ? LEU K 397 ? THR W 559 LEU W 564 1 ? 6  
HELX_P HELX_P55 AG1 ASN K 415 ? ARG K 425 ? ASN W 582 ARG W 592 1 ? 11 
HELX_P HELX_P56 AG2 VAL K 446 ? GLN K 466 ? VAL W 613 GLN W 633 1 ? 21 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1   hydrog ? ? I DC 1   N3 ? ? ? 1_555 J DG 156 N1 ? ? J DC 0   I DG 207 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2   hydrog ? ? I DC 1   N4 ? ? ? 1_555 J DG 156 O6 ? ? J DC 0   I DG 207 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3   hydrog ? ? I DC 1   O2 ? ? ? 1_555 J DG 156 N2 ? ? J DC 0   I DG 207 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4   hydrog ? ? I DT 2   N3 ? ? ? 1_555 J DA 155 N1 ? ? J DT 1   I DA 206 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5   hydrog ? ? I DT 2   O4 ? ? ? 1_555 J DA 155 N6 ? ? J DT 1   I DA 206 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6   hydrog ? ? I DG 3   N1 ? ? ? 1_555 J DC 154 N3 ? ? J DG 2   I DC 205 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7   hydrog ? ? I DG 3   N2 ? ? ? 1_555 J DC 154 O2 ? ? J DG 2   I DC 205 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8   hydrog ? ? I DG 3   O6 ? ? ? 1_555 J DC 154 N4 ? ? J DG 2   I DC 205 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9   hydrog ? ? I DG 4   N1 ? ? ? 1_555 J DC 153 N3 ? ? J DG 3   I DC 204 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10  hydrog ? ? I DG 4   N2 ? ? ? 1_555 J DC 153 O2 ? ? J DG 3   I DC 204 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11  hydrog ? ? I DG 4   O6 ? ? ? 1_555 J DC 153 N4 ? ? J DG 3   I DC 204 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12  hydrog ? ? I DA 5   N1 ? ? ? 1_555 J DT 152 N3 ? ? J DA 4   I DT 203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13  hydrog ? ? I DA 5   N6 ? ? ? 1_555 J DT 152 O4 ? ? J DA 4   I DT 203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14  hydrog ? ? I DG 6   N1 ? ? ? 1_555 J DC 151 N3 ? ? J DG 5   I DC 202 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15  hydrog ? ? I DG 6   N2 ? ? ? 1_555 J DC 151 O2 ? ? J DG 5   I DC 202 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16  hydrog ? ? I DG 6   O6 ? ? ? 1_555 J DC 151 N4 ? ? J DG 5   I DC 202 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17  hydrog ? ? I DA 7   N1 ? ? ? 1_555 J DT 150 N3 ? ? J DA 6   I DT 201 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18  hydrog ? ? I DA 7   N6 ? ? ? 1_555 J DT 150 O4 ? ? J DA 6   I DT 201 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19  hydrog ? ? I DA 8   N1 ? ? ? 1_555 J DT 149 N3 ? ? J DA 7   I DT 200 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20  hydrog ? ? I DA 8   N6 ? ? ? 1_555 J DT 149 O4 ? ? J DA 7   I DT 200 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21  hydrog ? ? I DT 9   N3 ? ? ? 1_555 J DA 148 N1 ? ? J DT 8   I DA 199 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22  hydrog ? ? I DT 9   O4 ? ? ? 1_555 J DA 148 N6 ? ? J DT 8   I DA 199 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23  hydrog ? ? I DC 10  N3 ? ? ? 1_555 J DG 147 N1 ? ? J DC 9   I DG 198 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24  hydrog ? ? I DC 10  N4 ? ? ? 1_555 J DG 147 O6 ? ? J DC 9   I DG 198 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25  hydrog ? ? I DC 10  O2 ? ? ? 1_555 J DG 147 N2 ? ? J DC 9   I DG 198 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26  hydrog ? ? I DC 11  N3 ? ? ? 1_555 J DG 146 N1 ? ? J DC 10  I DG 197 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27  hydrog ? ? I DC 11  N4 ? ? ? 1_555 J DG 146 O6 ? ? J DC 10  I DG 197 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28  hydrog ? ? I DC 11  O2 ? ? ? 1_555 J DG 146 N2 ? ? J DC 10  I DG 197 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29  hydrog ? ? I DC 12  N3 ? ? ? 1_555 J DG 145 N1 ? ? J DC 11  I DG 196 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30  hydrog ? ? I DC 12  N4 ? ? ? 1_555 J DG 145 O6 ? ? J DC 11  I DG 196 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31  hydrog ? ? I DC 12  O2 ? ? ? 1_555 J DG 145 N2 ? ? J DC 11  I DG 196 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32  hydrog ? ? I DG 13  N1 ? ? ? 1_555 J DC 144 N3 ? ? J DG 12  I DC 195 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33  hydrog ? ? I DG 13  N2 ? ? ? 1_555 J DC 144 O2 ? ? J DG 12  I DC 195 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34  hydrog ? ? I DG 13  O6 ? ? ? 1_555 J DC 144 N4 ? ? J DG 12  I DC 195 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35  hydrog ? ? I DG 14  N1 ? ? ? 1_555 J DC 143 N3 ? ? J DG 13  I DC 194 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36  hydrog ? ? I DG 14  N2 ? ? ? 1_555 J DC 143 O2 ? ? J DG 13  I DC 194 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37  hydrog ? ? I DG 14  O6 ? ? ? 1_555 J DC 143 N4 ? ? J DG 13  I DC 194 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38  hydrog ? ? I DT 15  N3 ? ? ? 1_555 J DA 142 N1 ? ? J DT 14  I DA 193 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39  hydrog ? ? I DT 15  O4 ? ? ? 1_555 J DA 142 N6 ? ? J DT 14  I DA 193 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40  hydrog ? ? I DG 16  N1 ? ? ? 1_555 J DC 141 N3 ? ? J DG 15  I DC 192 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41  hydrog ? ? I DG 16  N2 ? ? ? 1_555 J DC 141 O2 ? ? J DG 15  I DC 192 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42  hydrog ? ? I DG 16  O6 ? ? ? 1_555 J DC 141 N4 ? ? J DG 15  I DC 192 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43  hydrog ? ? I DC 17  N3 ? ? ? 1_555 J DG 140 N1 ? ? J DC 16  I DG 191 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44  hydrog ? ? I DC 17  N4 ? ? ? 1_555 J DG 140 O6 ? ? J DC 16  I DG 191 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45  hydrog ? ? I DC 17  O2 ? ? ? 1_555 J DG 140 N2 ? ? J DC 16  I DG 191 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46  hydrog ? ? I DC 18  N3 ? ? ? 1_555 J DG 139 N1 ? ? J DC 17  I DG 190 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47  hydrog ? ? I DC 18  N4 ? ? ? 1_555 J DG 139 O6 ? ? J DC 17  I DG 190 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48  hydrog ? ? I DC 18  O2 ? ? ? 1_555 J DG 139 N2 ? ? J DC 17  I DG 190 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49  hydrog ? ? I DG 19  N1 ? ? ? 1_555 J DC 138 N3 ? ? J DG 18  I DC 189 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog50  hydrog ? ? I DG 19  N2 ? ? ? 1_555 J DC 138 O2 ? ? J DG 18  I DC 189 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51  hydrog ? ? I DG 19  O6 ? ? ? 1_555 J DC 138 N4 ? ? J DG 18  I DC 189 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52  hydrog ? ? I DA 20  N1 ? ? ? 1_555 J DT 137 N3 ? ? J DA 19  I DT 188 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53  hydrog ? ? I DA 20  N6 ? ? ? 1_555 J DT 137 O4 ? ? J DA 19  I DT 188 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54  hydrog ? ? I DG 21  N1 ? ? ? 1_555 J DC 136 N3 ? ? J DG 20  I DC 187 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55  hydrog ? ? I DG 21  N2 ? ? ? 1_555 J DC 136 O2 ? ? J DG 20  I DC 187 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56  hydrog ? ? I DG 21  O6 ? ? ? 1_555 J DC 136 N4 ? ? J DG 20  I DC 187 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57  hydrog ? ? I DG 22  N1 ? ? ? 1_555 J DC 135 N3 ? ? J DG 21  I DC 186 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58  hydrog ? ? I DG 22  N2 ? ? ? 1_555 J DC 135 O2 ? ? J DG 21  I DC 186 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59  hydrog ? ? I DG 22  O6 ? ? ? 1_555 J DC 135 N4 ? ? J DG 21  I DC 186 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60  hydrog ? ? I DC 23  N3 ? ? ? 1_555 J DG 134 N1 ? ? J DC 22  I DG 185 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61  hydrog ? ? I DC 23  N4 ? ? ? 1_555 J DG 134 O6 ? ? J DC 22  I DG 185 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog62  hydrog ? ? I DC 23  O2 ? ? ? 1_555 J DG 134 N2 ? ? J DC 22  I DG 185 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63  hydrog ? ? I DC 24  N3 ? ? ? 1_555 J DG 133 N1 ? ? J DC 23  I DG 184 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64  hydrog ? ? I DC 24  N4 ? ? ? 1_555 J DG 133 O6 ? ? J DC 23  I DG 184 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog65  hydrog ? ? I DC 24  O2 ? ? ? 1_555 J DG 133 N2 ? ? J DC 23  I DG 184 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog66  hydrog ? ? I DG 25  N1 ? ? ? 1_555 J DC 132 N3 ? ? J DG 24  I DC 183 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog67  hydrog ? ? I DG 25  N2 ? ? ? 1_555 J DC 132 O2 ? ? J DG 24  I DC 183 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog68  hydrog ? ? I DG 25  O6 ? ? ? 1_555 J DC 132 N4 ? ? J DG 24  I DC 183 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog69  hydrog ? ? I DC 26  N3 ? ? ? 1_555 J DG 131 N1 ? ? J DC 25  I DG 182 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog70  hydrog ? ? I DC 26  N4 ? ? ? 1_555 J DG 131 O6 ? ? J DC 25  I DG 182 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog71  hydrog ? ? I DC 26  O2 ? ? ? 1_555 J DG 131 N2 ? ? J DC 25  I DG 182 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog72  hydrog ? ? I DT 27  N3 ? ? ? 1_555 J DA 130 N1 ? ? J DT 26  I DA 181 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog73  hydrog ? ? I DT 27  O4 ? ? ? 1_555 J DA 130 N6 ? ? J DT 26  I DA 181 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog74  hydrog ? ? I DC 28  N3 ? ? ? 1_555 J DG 129 N1 ? ? J DC 27  I DG 180 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog75  hydrog ? ? I DC 28  N4 ? ? ? 1_555 J DG 129 O6 ? ? J DC 27  I DG 180 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog76  hydrog ? ? I DC 28  O2 ? ? ? 1_555 J DG 129 N2 ? ? J DC 27  I DG 180 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog77  hydrog ? ? I DA 29  N6 ? ? ? 1_555 J DT 128 O4 ? ? J DA 28  I DT 179 1_555 ? ? ? ? ? ? HOOGSTEEN    ? ? 
hydrog78  hydrog ? ? I DA 29  N7 ? ? ? 1_555 J DT 128 N3 ? ? J DA 28  I DT 179 1_555 ? ? ? ? ? ? HOOGSTEEN    ? ? 
hydrog79  hydrog ? ? I DA 30  N1 ? ? ? 1_555 J DT 127 N3 ? ? J DA 29  I DT 178 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog80  hydrog ? ? I DA 30  N6 ? ? ? 1_555 J DT 127 O4 ? ? J DA 29  I DT 178 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog81  hydrog ? ? I DT 31  N3 ? ? ? 1_555 J DA 125 N1 ? ? J DT 30  I DA 176 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog82  hydrog ? ? I DT 31  O4 ? ? ? 1_555 J DA 125 N6 ? ? J DT 30  I DA 176 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog83  hydrog ? ? I DT 31  N3 ? ? ? 1_555 J DA 126 N1 ? ? J DT 30  I DA 177 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog84  hydrog ? ? I DT 31  O4 ? ? ? 1_555 J DA 126 N6 ? ? J DT 30  I DA 177 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog85  hydrog ? ? I DT 32  N3 ? ? ? 1_555 J DA 125 N1 ? ? J DT 31  I DA 176 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog86  hydrog ? ? I DT 32  O4 ? ? ? 1_555 J DA 125 N6 ? ? J DT 31  I DA 176 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog87  hydrog ? ? I DG 33  N1 ? ? ? 1_555 J DC 124 N3 ? ? J DG 32  I DC 175 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog88  hydrog ? ? I DG 33  N2 ? ? ? 1_555 J DC 124 O2 ? ? J DG 32  I DC 175 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog89  hydrog ? ? I DG 33  O6 ? ? ? 1_555 J DC 124 N4 ? ? J DG 32  I DC 175 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog90  hydrog ? ? I DG 34  N1 ? ? ? 1_555 J DA 122 N1 ? ? J DG 33  I DA 173 1_555 ? ? ? ? ? ? TYPE_8_PAIR  ? ? 
hydrog91  hydrog ? ? I DG 34  O6 ? ? ? 1_555 J DA 122 N6 ? ? J DG 33  I DA 173 1_555 ? ? ? ? ? ? TYPE_8_PAIR  ? ? 
hydrog92  hydrog ? ? I DG 34  N1 ? ? ? 1_555 J DC 123 N3 ? ? J DG 33  I DC 174 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog93  hydrog ? ? I DG 34  N2 ? ? ? 1_555 J DC 123 O2 ? ? J DG 33  I DC 174 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog94  hydrog ? ? I DG 34  O6 ? ? ? 1_555 J DC 123 N4 ? ? J DG 33  I DC 174 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog95  hydrog ? ? I DT 35  N3 ? ? ? 1_555 J DA 122 N1 ? ? J DT 34  I DA 173 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog96  hydrog ? ? I DT 35  O4 ? ? ? 1_555 J DA 122 N6 ? ? J DT 34  I DA 173 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog97  hydrog ? ? I DC 36  N3 ? ? ? 1_555 J DG 121 N1 ? ? J DC 35  I DG 172 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog98  hydrog ? ? I DC 36  N4 ? ? ? 1_555 J DG 121 O6 ? ? J DC 35  I DG 172 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog99  hydrog ? ? I DC 36  O2 ? ? ? 1_555 J DG 121 N2 ? ? J DC 35  I DG 172 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog100 hydrog ? ? I DG 37  N1 ? ? ? 1_555 J DC 120 N3 ? ? J DG 36  I DC 171 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog101 hydrog ? ? I DG 37  N2 ? ? ? 1_555 J DC 120 O2 ? ? J DG 36  I DC 171 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog102 hydrog ? ? I DG 37  O6 ? ? ? 1_555 J DC 120 N4 ? ? J DG 36  I DC 171 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog103 hydrog ? ? I DT 38  N3 ? ? ? 1_555 J DA 119 N1 ? ? J DT 37  I DA 170 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog104 hydrog ? ? I DT 38  O4 ? ? ? 1_555 J DA 119 N6 ? ? J DT 37  I DA 170 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog105 hydrog ? ? I DA 39  N1 ? ? ? 1_555 J DT 118 N3 ? ? J DA 38  I DT 169 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog106 hydrog ? ? I DA 39  N6 ? ? ? 1_555 J DT 118 O4 ? ? J DA 38  I DT 169 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog107 hydrog ? ? I DG 40  N1 ? ? ? 1_555 J DC 117 N3 ? ? J DG 39  I DC 168 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog108 hydrog ? ? I DG 40  N2 ? ? ? 1_555 J DC 117 O2 ? ? J DG 39  I DC 168 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog109 hydrog ? ? I DG 40  O6 ? ? ? 1_555 J DC 117 N4 ? ? J DG 39  I DC 168 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog110 hydrog ? ? I DA 41  N1 ? ? ? 1_555 J DT 116 N3 ? ? J DA 40  I DT 167 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog111 hydrog ? ? I DA 41  N6 ? ? ? 1_555 J DT 116 O4 ? ? J DA 40  I DT 167 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog112 hydrog ? ? I DC 42  N3 ? ? ? 1_555 J DG 115 N1 ? ? J DC 41  I DG 166 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog113 hydrog ? ? I DC 42  N4 ? ? ? 1_555 J DG 115 O6 ? ? J DC 41  I DG 166 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog114 hydrog ? ? I DC 42  O2 ? ? ? 1_555 J DG 115 N2 ? ? J DC 41  I DG 166 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog115 hydrog ? ? I DA 43  N1 ? ? ? 1_555 J DT 114 N3 ? ? J DA 42  I DT 165 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog116 hydrog ? ? I DA 43  N6 ? ? ? 1_555 J DT 114 O4 ? ? J DA 42  I DT 165 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog117 hydrog ? ? I DG 44  N1 ? ? ? 1_555 J DC 113 N3 ? ? J DG 43  I DC 164 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog118 hydrog ? ? I DG 44  N2 ? ? ? 1_555 J DC 113 O2 ? ? J DG 43  I DC 164 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog119 hydrog ? ? I DG 44  O6 ? ? ? 1_555 J DC 113 N4 ? ? J DG 43  I DC 164 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog120 hydrog ? ? I DC 45  N3 ? ? ? 1_555 J DG 112 N1 ? ? J DC 44  I DG 163 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog121 hydrog ? ? I DC 45  N4 ? ? ? 1_555 J DG 112 O6 ? ? J DC 44  I DG 163 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog122 hydrog ? ? I DC 45  O2 ? ? ? 1_555 J DG 112 N2 ? ? J DC 44  I DG 163 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog123 hydrog ? ? I DT 46  N3 ? ? ? 1_555 J DA 111 N1 ? ? J DT 45  I DA 162 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog124 hydrog ? ? I DT 46  O4 ? ? ? 1_555 J DA 111 N6 ? ? J DT 45  I DA 162 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog125 hydrog ? ? I DC 47  N3 ? ? ? 1_555 J DG 110 N1 ? ? J DC 46  I DG 161 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog126 hydrog ? ? I DC 47  N4 ? ? ? 1_555 J DG 110 O6 ? ? J DC 46  I DG 161 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog127 hydrog ? ? I DC 47  O2 ? ? ? 1_555 J DG 110 N2 ? ? J DC 46  I DG 161 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog128 hydrog ? ? I DT 48  N3 ? ? ? 1_555 J DA 109 N1 ? ? J DT 47  I DA 160 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog129 hydrog ? ? I DT 48  O4 ? ? ? 1_555 J DA 109 N6 ? ? J DT 47  I DA 160 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog130 hydrog ? ? I DA 49  N1 ? ? ? 1_555 J DT 108 N3 ? ? J DA 48  I DT 159 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog131 hydrog ? ? I DA 49  N6 ? ? ? 1_555 J DT 108 O4 ? ? J DA 48  I DT 159 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog132 hydrog ? ? I DG 50  N1 ? ? ? 1_555 J DC 107 N3 ? ? J DG 49  I DC 158 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog133 hydrog ? ? I DG 50  N2 ? ? ? 1_555 J DC 107 O2 ? ? J DG 49  I DC 158 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog134 hydrog ? ? I DG 50  O6 ? ? ? 1_555 J DC 107 N4 ? ? J DG 49  I DC 158 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog135 hydrog ? ? I DC 51  N3 ? ? ? 1_555 J DG 106 N1 ? ? J DC 50  I DG 157 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog136 hydrog ? ? I DC 51  N4 ? ? ? 1_555 J DG 106 O6 ? ? J DC 50  I DG 157 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog137 hydrog ? ? I DC 51  O2 ? ? ? 1_555 J DG 106 N2 ? ? J DC 50  I DG 157 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog138 hydrog ? ? I DA 52  N1 ? ? ? 1_555 J DT 105 N3 ? ? J DA 51  I DT 156 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog139 hydrog ? ? I DA 52  N6 ? ? ? 1_555 J DT 105 O4 ? ? J DA 51  I DT 156 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog140 hydrog ? ? I DC 53  N3 ? ? ? 1_555 J DG 104 N1 ? ? J DC 52  I DG 155 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog141 hydrog ? ? I DC 53  N4 ? ? ? 1_555 J DG 104 O6 ? ? J DC 52  I DG 155 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog142 hydrog ? ? I DC 53  O2 ? ? ? 1_555 J DG 104 N2 ? ? J DC 52  I DG 155 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog143 hydrog ? ? I DC 54  N3 ? ? ? 1_555 J DG 103 N1 ? ? J DC 53  I DG 154 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog144 hydrog ? ? I DC 54  N4 ? ? ? 1_555 J DG 103 O6 ? ? J DC 53  I DG 154 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog145 hydrog ? ? I DC 54  O2 ? ? ? 1_555 J DG 103 N2 ? ? J DC 53  I DG 154 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog146 hydrog ? ? I DC 54  N3 ? ? ? 1_555 J DG 104 N1 ? ? J DC 53  I DG 155 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog147 hydrog ? ? I DC 54  N4 ? ? ? 1_555 J DG 104 O6 ? ? J DC 53  I DG 155 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog148 hydrog ? ? I DC 54  O2 ? ? ? 1_555 J DG 104 N2 ? ? J DC 53  I DG 155 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog149 hydrog ? ? I DG 55  N1 ? ? ? 1_555 J DC 102 N3 ? ? J DG 54  I DC 153 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog150 hydrog ? ? I DG 55  N2 ? ? ? 1_555 J DC 102 O2 ? ? J DG 54  I DC 153 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog151 hydrog ? ? I DG 55  O6 ? ? ? 1_555 J DC 102 N4 ? ? J DG 54  I DC 153 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog152 hydrog ? ? I DC 56  N3 ? ? ? 1_555 J DG 101 N1 ? ? J DC 55  I DG 152 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog153 hydrog ? ? I DC 56  N4 ? ? ? 1_555 J DG 101 O6 ? ? J DC 55  I DG 152 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog154 hydrog ? ? I DC 56  O2 ? ? ? 1_555 J DG 101 N2 ? ? J DC 55  I DG 152 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog155 hydrog ? ? I DT 57  N3 ? ? ? 1_555 J DA 100 N1 ? ? J DT 56  I DA 151 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog156 hydrog ? ? I DT 57  O4 ? ? ? 1_555 J DA 100 N6 ? ? J DT 56  I DA 151 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog157 hydrog ? ? I DT 58  N3 ? ? ? 1_555 J DA 99  N1 ? ? J DT 57  I DA 150 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog158 hydrog ? ? I DT 58  O4 ? ? ? 1_555 J DA 99  N6 ? ? J DT 57  I DA 150 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog159 hydrog ? ? I DA 59  N1 ? ? ? 1_555 J DT 98  N3 ? ? J DA 58  I DT 149 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog160 hydrog ? ? I DA 59  N6 ? ? ? 1_555 J DT 98  O4 ? ? J DA 58  I DT 149 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog161 hydrog ? ? I DA 60  N1 ? ? ? 1_555 J DT 97  N3 ? ? J DA 59  I DT 148 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog162 hydrog ? ? I DA 60  N6 ? ? ? 1_555 J DT 97  O4 ? ? J DA 59  I DT 148 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog163 hydrog ? ? I DA 61  N1 ? ? ? 1_555 J DT 96  N3 ? ? J DA 60  I DT 147 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog164 hydrog ? ? I DA 61  N6 ? ? ? 1_555 J DT 96  O4 ? ? J DA 60  I DT 147 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog165 hydrog ? ? I DC 62  N3 ? ? ? 1_555 J DG 95  N1 ? ? J DC 61  I DG 146 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog166 hydrog ? ? I DC 62  N4 ? ? ? 1_555 J DG 95  O6 ? ? J DC 61  I DG 146 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog167 hydrog ? ? I DC 62  O2 ? ? ? 1_555 J DG 95  N2 ? ? J DC 61  I DG 146 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog168 hydrog ? ? I DG 63  N1 ? ? ? 1_555 J DC 94  N3 ? ? J DG 62  I DC 145 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog169 hydrog ? ? I DG 63  N2 ? ? ? 1_555 J DC 94  O2 ? ? J DG 62  I DC 145 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog170 hydrog ? ? I DG 63  O6 ? ? ? 1_555 J DC 94  N4 ? ? J DG 62  I DC 145 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog171 hydrog ? ? I DC 64  N3 ? ? ? 1_555 J DG 93  N1 ? ? J DC 63  I DG 144 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog172 hydrog ? ? I DC 64  N4 ? ? ? 1_555 J DG 93  O6 ? ? J DC 63  I DG 144 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog173 hydrog ? ? I DC 64  O2 ? ? ? 1_555 J DG 93  N2 ? ? J DC 63  I DG 144 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog174 hydrog ? ? I DA 65  N1 ? ? ? 1_555 J DG 91  N1 ? ? J DA 64  I DG 142 1_555 ? ? ? ? ? ? TYPE_8_PAIR  ? ? 
hydrog175 hydrog ? ? I DA 65  N6 ? ? ? 1_555 J DG 91  O6 ? ? J DA 64  I DG 142 1_555 ? ? ? ? ? ? TYPE_8_PAIR  ? ? 
hydrog176 hydrog ? ? I DA 65  N1 ? ? ? 1_555 J DT 92  N3 ? ? J DA 64  I DT 143 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog177 hydrog ? ? I DA 65  N6 ? ? ? 1_555 J DT 92  O4 ? ? J DA 64  I DT 143 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog178 hydrog ? ? I DC 66  N3 ? ? ? 1_555 J DG 91  N1 ? ? J DC 65  I DG 142 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog179 hydrog ? ? I DC 66  N4 ? ? ? 1_555 J DG 91  O6 ? ? J DC 65  I DG 142 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog180 hydrog ? ? I DC 66  O2 ? ? ? 1_555 J DG 91  N2 ? ? J DC 65  I DG 142 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog181 hydrog ? ? I DG 67  N1 ? ? ? 1_555 J DA 89  N1 ? ? J DG 66  I DA 140 1_555 ? ? ? ? ? ? TYPE_8_PAIR  ? ? 
hydrog182 hydrog ? ? I DG 67  O6 ? ? ? 1_555 J DA 89  N6 ? ? J DG 66  I DA 140 1_555 ? ? ? ? ? ? TYPE_8_PAIR  ? ? 
hydrog183 hydrog ? ? I DG 67  N1 ? ? ? 1_555 J DC 90  N3 ? ? J DG 66  I DC 141 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog184 hydrog ? ? I DG 67  N2 ? ? ? 1_555 J DC 90  O2 ? ? J DG 66  I DC 141 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog185 hydrog ? ? I DG 67  O6 ? ? ? 1_555 J DC 90  N4 ? ? J DG 66  I DC 141 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog186 hydrog ? ? I DT 68  N3 ? ? ? 1_555 J DA 89  N1 ? ? J DT 67  I DA 140 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog187 hydrog ? ? I DT 68  O4 ? ? ? 1_555 J DA 89  N6 ? ? J DT 67  I DA 140 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog188 hydrog ? ? I DA 69  N1 ? ? ? 1_555 J DT 88  N3 ? ? J DA 68  I DT 139 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog189 hydrog ? ? I DA 69  N6 ? ? ? 1_555 J DT 88  O4 ? ? J DA 68  I DT 139 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog190 hydrog ? ? I DC 70  N3 ? ? ? 1_555 J DG 87  N1 ? ? J DC 69  I DG 138 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog191 hydrog ? ? I DC 70  N4 ? ? ? 1_555 J DG 87  O6 ? ? J DC 69  I DG 138 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog192 hydrog ? ? I DC 70  O2 ? ? ? 1_555 J DG 87  N2 ? ? J DC 69  I DG 138 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog193 hydrog ? ? I DG 71  N1 ? ? ? 1_555 J DC 86  N3 ? ? J DG 70  I DC 137 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog194 hydrog ? ? I DG 71  N2 ? ? ? 1_555 J DC 86  O2 ? ? J DG 70  I DC 137 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog195 hydrog ? ? I DG 71  O6 ? ? ? 1_555 J DC 86  N4 ? ? J DG 70  I DC 137 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog196 hydrog ? ? I DC 72  N3 ? ? ? 1_555 J DG 85  N1 ? ? J DC 71  I DG 136 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog197 hydrog ? ? I DC 72  N4 ? ? ? 1_555 J DG 85  O6 ? ? J DC 71  I DG 136 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog198 hydrog ? ? I DC 72  O2 ? ? ? 1_555 J DG 85  N2 ? ? J DC 71  I DG 136 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog199 hydrog ? ? I DG 73  N1 ? ? ? 1_555 J DG 83  O6 ? ? J DG 72  I DG 134 1_555 ? ? ? ? ? ? TYPE_3_PAIR  ? ? 
hydrog200 hydrog ? ? I DG 73  O6 ? ? ? 1_555 J DG 83  N1 ? ? J DG 72  I DG 134 1_555 ? ? ? ? ? ? TYPE_3_PAIR  ? ? 
hydrog201 hydrog ? ? I DG 73  N1 ? ? ? 1_555 J DC 84  N3 ? ? J DG 72  I DC 135 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog202 hydrog ? ? I DG 73  N2 ? ? ? 1_555 J DC 84  O2 ? ? J DG 72  I DC 135 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog203 hydrog ? ? I DG 73  O6 ? ? ? 1_555 J DC 84  N4 ? ? J DG 72  I DC 135 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog204 hydrog ? ? I DC 74  N3 ? ? ? 1_555 J DG 83  N1 ? ? J DC 73  I DG 134 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog205 hydrog ? ? I DC 74  N4 ? ? ? 1_555 J DG 83  O6 ? ? J DC 73  I DG 134 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog206 hydrog ? ? I DC 74  O2 ? ? ? 1_555 J DG 83  N2 ? ? J DC 73  I DG 134 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog207 hydrog ? ? I DT 75  N3 ? ? ? 1_555 J DA 82  N1 ? ? J DT 74  I DA 133 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog208 hydrog ? ? I DT 75  O4 ? ? ? 1_555 J DA 82  N6 ? ? J DT 74  I DA 133 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog209 hydrog ? ? I DG 76  N1 ? ? ? 1_555 J DA 80  N1 ? ? J DG 75  I DA 131 1_555 ? ? ? ? ? ? TYPE_8_PAIR  ? ? 
hydrog210 hydrog ? ? I DG 76  O6 ? ? ? 1_555 J DA 80  N6 ? ? J DG 75  I DA 131 1_555 ? ? ? ? ? ? TYPE_8_PAIR  ? ? 
hydrog211 hydrog ? ? I DG 76  N1 ? ? ? 1_555 J DC 81  N3 ? ? J DG 75  I DC 132 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog212 hydrog ? ? I DG 76  N2 ? ? ? 1_555 J DC 81  O2 ? ? J DG 75  I DC 132 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog213 hydrog ? ? I DG 76  O6 ? ? ? 1_555 J DC 81  N4 ? ? J DG 75  I DC 132 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog214 hydrog ? ? I DT 77  N3 ? ? ? 1_555 J DA 80  N1 ? ? J DT 76  I DA 131 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog215 hydrog ? ? I DT 77  O4 ? ? ? 1_555 J DA 80  N6 ? ? J DT 76  I DA 131 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog216 hydrog ? ? I DC 78  N3 ? ? ? 1_555 J DG 79  N1 ? ? J DC 77  I DG 130 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog217 hydrog ? ? I DC 78  N4 ? ? ? 1_555 J DG 79  O6 ? ? J DC 77  I DG 130 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog218 hydrog ? ? I DC 78  O2 ? ? ? 1_555 J DG 79  N2 ? ? J DC 77  I DG 130 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog219 hydrog ? ? I DC 79  N3 ? ? ? 1_555 J DG 78  N1 ? ? J DC 78  I DG 129 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog220 hydrog ? ? I DC 79  N4 ? ? ? 1_555 J DG 78  O6 ? ? J DC 78  I DG 129 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog221 hydrog ? ? I DC 79  O2 ? ? ? 1_555 J DG 78  N2 ? ? J DC 78  I DG 129 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog222 hydrog ? ? I DC 80  N3 ? ? ? 1_555 J DG 77  N1 ? ? J DC 79  I DG 128 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog223 hydrog ? ? I DC 80  N4 ? ? ? 1_555 J DG 77  O6 ? ? J DC 79  I DG 128 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog224 hydrog ? ? I DC 80  O2 ? ? ? 1_555 J DG 77  N2 ? ? J DC 79  I DG 128 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog225 hydrog ? ? I DC 81  N3 ? ? ? 1_555 J DG 76  N1 ? ? J DC 80  I DG 127 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog226 hydrog ? ? I DC 81  N4 ? ? ? 1_555 J DG 76  O6 ? ? J DC 80  I DG 127 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog227 hydrog ? ? I DC 81  O2 ? ? ? 1_555 J DG 76  N2 ? ? J DC 80  I DG 127 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog228 hydrog ? ? I DC 82  N3 ? ? ? 1_555 J DG 75  N1 ? ? J DC 81  I DG 126 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog229 hydrog ? ? I DC 82  N4 ? ? ? 1_555 J DG 75  O6 ? ? J DC 81  I DG 126 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog230 hydrog ? ? I DC 82  O2 ? ? ? 1_555 J DG 75  N2 ? ? J DC 81  I DG 126 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog231 hydrog ? ? I DG 83  N1 ? ? ? 1_555 J DC 74  N3 ? ? J DG 82  I DC 125 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog232 hydrog ? ? I DG 83  N2 ? ? ? 1_555 J DC 74  O2 ? ? J DG 82  I DC 125 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog233 hydrog ? ? I DG 83  O6 ? ? ? 1_555 J DC 74  N4 ? ? J DG 82  I DC 125 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog234 hydrog ? ? I DC 84  N3 ? ? ? 1_555 J DG 73  N1 ? ? J DC 83  I DG 124 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog235 hydrog ? ? I DC 84  N4 ? ? ? 1_555 J DG 73  O6 ? ? J DC 83  I DG 124 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog236 hydrog ? ? I DC 84  O2 ? ? ? 1_555 J DG 73  N2 ? ? J DC 83  I DG 124 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog237 hydrog ? ? I DG 85  N1 ? ? ? 1_555 J DA 71  N1 ? ? J DG 84  I DA 122 1_555 ? ? ? ? ? ? TYPE_8_PAIR  ? ? 
hydrog238 hydrog ? ? I DG 85  O6 ? ? ? 1_555 J DA 71  N6 ? ? J DG 84  I DA 122 1_555 ? ? ? ? ? ? TYPE_8_PAIR  ? ? 
hydrog239 hydrog ? ? I DG 85  N1 ? ? ? 1_555 J DC 72  N3 ? ? J DG 84  I DC 123 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog240 hydrog ? ? I DG 85  N2 ? ? ? 1_555 J DC 72  O2 ? ? J DG 84  I DC 123 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog241 hydrog ? ? I DG 85  O6 ? ? ? 1_555 J DC 72  N4 ? ? J DG 84  I DC 123 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog242 hydrog ? ? I DT 86  N3 ? ? ? 1_555 J DA 71  N1 ? ? J DT 85  I DA 122 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog243 hydrog ? ? I DT 86  O4 ? ? ? 1_555 J DA 71  N6 ? ? J DT 85  I DA 122 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog244 hydrog ? ? I DT 87  N3 ? ? ? 1_555 J DA 70  N1 ? ? J DT 86  I DA 121 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog245 hydrog ? ? I DT 87  O4 ? ? ? 1_555 J DA 70  N6 ? ? J DT 86  I DA 121 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog246 hydrog ? ? I DT 88  N3 ? ? ? 1_555 J DA 69  N1 ? ? J DT 87  I DA 120 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog247 hydrog ? ? I DT 88  O4 ? ? ? 1_555 J DA 69  N6 ? ? J DT 87  I DA 120 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog248 hydrog ? ? I DT 89  N3 ? ? ? 1_555 J DA 68  N1 ? ? J DT 88  I DA 119 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog249 hydrog ? ? I DT 89  O4 ? ? ? 1_555 J DA 68  N6 ? ? J DT 88  I DA 119 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog250 hydrog ? ? I DA 90  N1 ? ? ? 1_555 J DT 67  N3 ? ? J DA 89  I DT 118 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog251 hydrog ? ? I DA 90  N6 ? ? ? 1_555 J DT 67  O4 ? ? J DA 89  I DT 118 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog252 hydrog ? ? I DA 91  N1 ? ? ? 1_555 J DT 66  N3 ? ? J DA 90  I DT 117 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog253 hydrog ? ? I DA 91  N6 ? ? ? 1_555 J DT 66  O4 ? ? J DA 90  I DT 117 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog254 hydrog ? ? I DC 92  N3 ? ? ? 1_555 J DG 65  N1 ? ? J DC 91  I DG 116 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog255 hydrog ? ? I DC 92  N4 ? ? ? 1_555 J DG 65  O6 ? ? J DC 91  I DG 116 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog256 hydrog ? ? I DC 92  O2 ? ? ? 1_555 J DG 65  N2 ? ? J DC 91  I DG 116 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog257 hydrog ? ? I DC 93  N3 ? ? ? 1_555 J DG 64  N1 ? ? J DC 92  I DG 115 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog258 hydrog ? ? I DC 93  N4 ? ? ? 1_555 J DG 64  O6 ? ? J DC 92  I DG 115 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog259 hydrog ? ? I DC 93  O2 ? ? ? 1_555 J DG 64  N2 ? ? J DC 92  I DG 115 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog260 hydrog ? ? I DG 94  N1 ? ? ? 1_555 J DC 63  N3 ? ? J DG 93  I DC 114 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog261 hydrog ? ? I DG 94  N2 ? ? ? 1_555 J DC 63  O2 ? ? J DG 93  I DC 114 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog262 hydrog ? ? I DG 94  O6 ? ? ? 1_555 J DC 63  N4 ? ? J DG 93  I DC 114 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog263 hydrog ? ? I DC 95  N3 ? ? ? 1_555 J DG 62  N1 ? ? J DC 94  I DG 113 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog264 hydrog ? ? I DC 95  N4 ? ? ? 1_555 J DG 62  O6 ? ? J DC 94  I DG 113 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog265 hydrog ? ? I DC 95  O2 ? ? ? 1_555 J DG 62  N2 ? ? J DC 94  I DG 113 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog266 hydrog ? ? I DC 96  N3 ? ? ? 1_555 J DG 61  N1 ? ? J DC 95  I DG 112 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog267 hydrog ? ? I DC 96  N4 ? ? ? 1_555 J DG 61  O6 ? ? J DC 95  I DG 112 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog268 hydrog ? ? I DC 96  O2 ? ? ? 1_555 J DG 61  N2 ? ? J DC 95  I DG 112 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog269 hydrog ? ? I DA 97  N1 ? ? ? 1_555 J DT 60  N3 ? ? J DA 96  I DT 111 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog270 hydrog ? ? I DA 97  N6 ? ? ? 1_555 J DT 60  O4 ? ? J DA 96  I DT 111 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog271 hydrog ? ? I DA 98  N1 ? ? ? 1_555 J DT 59  N3 ? ? J DA 97  I DT 110 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog272 hydrog ? ? I DA 98  N6 ? ? ? 1_555 J DT 59  O4 ? ? J DA 97  I DT 110 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog273 hydrog ? ? I DA 98  N1 ? ? ? 1_555 J DT 60  N3 ? ? J DA 97  I DT 111 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog274 hydrog ? ? I DA 98  N6 ? ? ? 1_555 J DT 60  O4 ? ? J DA 97  I DT 111 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog275 hydrog ? ? I DG 99  N1 ? ? ? 1_555 J DC 58  N3 ? ? J DG 98  I DC 109 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog276 hydrog ? ? I DG 99  N2 ? ? ? 1_555 J DC 58  O2 ? ? J DG 98  I DC 109 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog277 hydrog ? ? I DG 99  O6 ? ? ? 1_555 J DC 58  N4 ? ? J DG 98  I DC 109 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog278 hydrog ? ? I DG 100 N1 ? ? ? 1_555 J DC 57  N3 ? ? J DG 99  I DC 108 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog279 hydrog ? ? I DG 100 N2 ? ? ? 1_555 J DC 57  O2 ? ? J DG 99  I DC 108 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog280 hydrog ? ? I DG 100 O6 ? ? ? 1_555 J DC 57  N4 ? ? J DG 99  I DC 108 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog281 hydrog ? ? I DG 101 N1 ? ? ? 1_555 J DC 56  N3 ? ? J DG 100 I DC 107 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog282 hydrog ? ? I DG 101 N2 ? ? ? 1_555 J DC 56  O2 ? ? J DG 100 I DC 107 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog283 hydrog ? ? I DG 101 O6 ? ? ? 1_555 J DC 56  N4 ? ? J DG 100 I DC 107 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog284 hydrog ? ? I DG 102 N1 ? ? ? 1_555 J DC 55  N3 ? ? J DG 101 I DC 106 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog285 hydrog ? ? I DG 102 N2 ? ? ? 1_555 J DC 55  O2 ? ? J DG 101 I DC 106 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog286 hydrog ? ? I DG 102 O6 ? ? ? 1_555 J DC 55  N4 ? ? J DG 101 I DC 106 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog287 hydrog ? ? I DA 103 N1 ? ? ? 1_555 J DT 54  N3 ? ? J DA 102 I DT 105 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog288 hydrog ? ? I DA 103 N6 ? ? ? 1_555 J DT 54  O4 ? ? J DA 102 I DT 105 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog289 hydrog ? ? I DT 104 N3 ? ? ? 1_555 J DA 53  N1 ? ? J DT 103 I DA 104 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog290 hydrog ? ? I DT 104 O4 ? ? ? 1_555 J DA 53  N6 ? ? J DT 103 I DA 104 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog291 hydrog ? ? I DT 105 N3 ? ? ? 1_555 J DA 52  N1 ? ? J DT 104 I DA 103 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog292 hydrog ? ? I DT 105 O4 ? ? ? 1_555 J DA 52  N6 ? ? J DT 104 I DA 103 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog293 hydrog ? ? I DA 106 N1 ? ? ? 1_555 J DT 51  N3 ? ? J DA 105 I DT 102 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog294 hydrog ? ? I DA 106 N6 ? ? ? 1_555 J DT 51  O4 ? ? J DA 105 I DT 102 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog295 hydrog ? ? I DC 107 N3 ? ? ? 1_555 J DG 50  N1 ? ? J DC 106 I DG 101 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog296 hydrog ? ? I DC 107 N4 ? ? ? 1_555 J DG 50  O6 ? ? J DC 106 I DG 101 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog297 hydrog ? ? I DC 107 O2 ? ? ? 1_555 J DG 50  N2 ? ? J DC 106 I DG 101 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog298 hydrog ? ? I DT 108 N3 ? ? ? 1_555 J DA 49  N1 ? ? J DT 107 I DA 100 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog299 hydrog ? ? I DT 108 O4 ? ? ? 1_555 J DA 49  N6 ? ? J DT 107 I DA 100 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog300 hydrog ? ? I DC 109 N3 ? ? ? 1_555 J DG 48  N1 ? ? J DC 108 I DG 99  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog301 hydrog ? ? I DC 109 N4 ? ? ? 1_555 J DG 48  O6 ? ? J DC 108 I DG 99  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog302 hydrog ? ? I DC 109 O2 ? ? ? 1_555 J DG 48  N2 ? ? J DC 108 I DG 99  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog303 hydrog ? ? I DC 110 N3 ? ? ? 1_555 J DG 47  N1 ? ? J DC 109 I DG 98  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog304 hydrog ? ? I DC 110 N4 ? ? ? 1_555 J DG 47  O6 ? ? J DC 109 I DG 98  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog305 hydrog ? ? I DC 110 O2 ? ? ? 1_555 J DG 47  N2 ? ? J DC 109 I DG 98  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog306 hydrog ? ? I DC 111 N3 ? ? ? 1_555 J DG 46  N1 ? ? J DC 110 I DG 97  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog307 hydrog ? ? I DC 111 N4 ? ? ? 1_555 J DG 46  O6 ? ? J DC 110 I DG 97  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog308 hydrog ? ? I DC 111 O2 ? ? ? 1_555 J DG 46  N2 ? ? J DC 110 I DG 97  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog309 hydrog ? ? I DT 112 N3 ? ? ? 1_555 J DA 45  N1 ? ? J DT 111 I DA 96  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog310 hydrog ? ? I DT 112 O4 ? ? ? 1_555 J DA 45  N6 ? ? J DT 111 I DA 96  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog311 hydrog ? ? I DA 113 N1 ? ? ? 1_555 J DT 44  N3 ? ? J DA 112 I DT 95  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog312 hydrog ? ? I DA 113 N6 ? ? ? 1_555 J DT 44  O4 ? ? J DA 112 I DT 95  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog313 hydrog ? ? I DG 114 N1 ? ? ? 1_555 J DC 43  N3 ? ? J DG 113 I DC 94  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog314 hydrog ? ? I DG 114 N2 ? ? ? 1_555 J DC 43  O2 ? ? J DG 113 I DC 94  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog315 hydrog ? ? I DG 114 O6 ? ? ? 1_555 J DC 43  N4 ? ? J DG 113 I DC 94  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog316 hydrog ? ? I DT 115 N3 ? ? ? 1_555 J DA 42  N1 ? ? J DT 114 I DA 93  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog317 hydrog ? ? I DT 115 O4 ? ? ? 1_555 J DA 42  N6 ? ? J DT 114 I DA 93  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog318 hydrog ? ? I DC 116 N3 ? ? ? 1_555 J DG 41  N1 ? ? J DC 115 I DG 92  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog319 hydrog ? ? I DC 116 N4 ? ? ? 1_555 J DG 41  O6 ? ? J DC 115 I DG 92  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog320 hydrog ? ? I DC 116 O2 ? ? ? 1_555 J DG 41  N2 ? ? J DC 115 I DG 92  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog321 hydrog ? ? I DT 117 N3 ? ? ? 1_555 J DA 40  N1 ? ? J DT 116 I DA 91  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog322 hydrog ? ? I DT 117 O4 ? ? ? 1_555 J DA 40  N6 ? ? J DT 116 I DA 91  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog323 hydrog ? ? I DT 117 N3 ? ? ? 1_555 J DG 41  O6 ? ? J DT 116 I DG 92  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog324 hydrog ? ? I DT 117 O2 ? ? ? 1_555 J DG 41  N1 ? ? J DT 116 I DG 92  1_555 ? ? ? ? ? ? TYPE_28_PAIR ? ? 
hydrog325 hydrog ? ? I DC 118 N3 ? ? ? 1_555 J DG 39  N1 ? ? J DC 117 I DG 90  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog326 hydrog ? ? I DC 118 N4 ? ? ? 1_555 J DG 39  O6 ? ? J DC 117 I DG 90  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog327 hydrog ? ? I DC 118 O2 ? ? ? 1_555 J DG 39  N2 ? ? J DC 117 I DG 90  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog328 hydrog ? ? I DC 119 N3 ? ? ? 1_555 J DG 38  N1 ? ? J DC 118 I DG 89  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog329 hydrog ? ? I DC 119 N4 ? ? ? 1_555 J DG 38  O6 ? ? J DC 118 I DG 89  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog330 hydrog ? ? I DC 119 O2 ? ? ? 1_555 J DG 38  N2 ? ? J DC 118 I DG 89  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog331 hydrog ? ? I DG 121 N1 ? ? ? 1_555 J DC 36  N3 ? ? J DG 120 I DC 87  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog332 hydrog ? ? I DG 121 N2 ? ? ? 1_555 J DC 36  O2 ? ? J DG 120 I DC 87  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog333 hydrog ? ? I DG 121 O6 ? ? ? 1_555 J DC 36  N4 ? ? J DG 120 I DC 87  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog334 hydrog ? ? I DG 122 N1 ? ? ? 1_555 J DC 35  N3 ? ? J DG 121 I DC 86  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog335 hydrog ? ? I DG 122 N2 ? ? ? 1_555 J DC 35  O2 ? ? J DG 121 I DC 86  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog336 hydrog ? ? I DG 122 O6 ? ? ? 1_555 J DC 35  N4 ? ? J DG 121 I DC 86  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog337 hydrog ? ? I DC 123 N3 ? ? ? 1_555 J DG 34  N1 ? ? J DC 122 I DG 85  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog338 hydrog ? ? I DC 123 N4 ? ? ? 1_555 J DG 34  O6 ? ? J DC 122 I DG 85  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog339 hydrog ? ? I DC 123 O2 ? ? ? 1_555 J DG 34  N2 ? ? J DC 122 I DG 85  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog340 hydrog ? ? I DA 124 N1 ? ? ? 1_555 J DT 33  N3 ? ? J DA 123 I DT 84  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog341 hydrog ? ? I DA 124 N6 ? ? ? 1_555 J DT 33  O4 ? ? J DA 123 I DT 84  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog342 hydrog ? ? I DC 125 N3 ? ? ? 1_555 J DG 32  N1 ? ? J DC 124 I DG 83  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog343 hydrog ? ? I DC 125 N4 ? ? ? 1_555 J DG 32  O6 ? ? J DC 124 I DG 83  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog344 hydrog ? ? I DC 125 O2 ? ? ? 1_555 J DG 32  N2 ? ? J DC 124 I DG 83  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog345 hydrog ? ? I DG 126 N1 ? ? ? 1_555 J DC 31  N3 ? ? J DG 125 I DC 82  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog346 hydrog ? ? I DG 126 N2 ? ? ? 1_555 J DC 31  O2 ? ? J DG 125 I DC 82  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog347 hydrog ? ? I DG 126 O6 ? ? ? 1_555 J DC 31  N4 ? ? J DG 125 I DC 82  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog348 hydrog ? ? I DT 127 N3 ? ? ? 1_555 J DA 30  N1 ? ? J DT 126 I DA 81  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog349 hydrog ? ? I DT 127 O4 ? ? ? 1_555 J DA 30  N6 ? ? J DT 126 I DA 81  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog350 hydrog ? ? I DG 128 N1 ? ? ? 1_555 J DC 29  N3 ? ? J DG 127 I DC 80  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog351 hydrog ? ? I DG 128 N2 ? ? ? 1_555 J DC 29  O2 ? ? J DG 127 I DC 80  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog352 hydrog ? ? I DG 128 O6 ? ? ? 1_555 J DC 29  N4 ? ? J DG 127 I DC 80  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog353 hydrog ? ? I DT 129 N3 ? ? ? 1_555 J DA 28  N1 ? ? J DT 128 I DA 79  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog354 hydrog ? ? I DT 129 O4 ? ? ? 1_555 J DA 28  N6 ? ? J DT 128 I DA 79  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog355 hydrog ? ? I DC 130 N3 ? ? ? 1_555 J DG 27  N1 ? ? J DC 129 I DG 78  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog356 hydrog ? ? I DC 130 N4 ? ? ? 1_555 J DG 27  O6 ? ? J DC 129 I DG 78  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog357 hydrog ? ? I DC 130 O2 ? ? ? 1_555 J DG 27  N2 ? ? J DC 129 I DG 78  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog358 hydrog ? ? I DA 131 N1 ? ? ? 1_555 J DT 26  N3 ? ? J DA 130 I DT 77  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog359 hydrog ? ? I DA 131 N6 ? ? ? 1_555 J DT 26  O4 ? ? J DA 130 I DT 77  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog360 hydrog ? ? I DG 132 N1 ? ? ? 1_555 J DC 25  N3 ? ? J DG 131 I DC 76  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog361 hydrog ? ? I DG 132 N2 ? ? ? 1_555 J DC 25  O2 ? ? J DG 131 I DC 76  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog362 hydrog ? ? I DG 132 O6 ? ? ? 1_555 J DC 25  N4 ? ? J DG 131 I DC 76  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog363 hydrog ? ? I DA 133 N1 ? ? ? 1_555 J DT 24  N3 ? ? J DA 132 I DT 75  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog364 hydrog ? ? I DA 133 N6 ? ? ? 1_555 J DT 24  O4 ? ? J DA 132 I DT 75  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog365 hydrog ? ? I DT 134 N3 ? ? ? 1_555 J DA 23  N1 ? ? J DT 133 I DA 74  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog366 hydrog ? ? I DT 134 O4 ? ? ? 1_555 J DA 23  N6 ? ? J DT 133 I DA 74  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog367 hydrog ? ? I DA 135 N1 ? ? ? 1_555 J DT 22  N3 ? ? J DA 134 I DT 73  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog368 hydrog ? ? I DA 135 N6 ? ? ? 1_555 J DT 22  O4 ? ? J DA 134 I DT 73  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog369 hydrog ? ? I DT 136 N3 ? ? ? 1_555 J DA 21  N1 ? ? J DT 135 I DA 72  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog370 hydrog ? ? I DT 136 O4 ? ? ? 1_555 J DA 21  N6 ? ? J DT 135 I DA 72  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog371 hydrog ? ? I DA 137 N1 ? ? ? 1_555 J DT 20  N3 ? ? J DA 136 I DT 71  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog372 hydrog ? ? I DA 137 N6 ? ? ? 1_555 J DT 20  O4 ? ? J DA 136 I DT 71  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog373 hydrog ? ? I DT 138 N3 ? ? ? 1_555 J DA 19  N1 ? ? J DT 137 I DA 70  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog374 hydrog ? ? I DT 138 O4 ? ? ? 1_555 J DA 19  N6 ? ? J DT 137 I DA 70  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog375 hydrog ? ? I DA 139 N1 ? ? ? 1_555 J DT 18  N3 ? ? J DA 138 I DT 69  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog376 hydrog ? ? I DA 139 N6 ? ? ? 1_555 J DT 18  O4 ? ? J DA 138 I DT 69  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog377 hydrog ? ? I DC 140 N3 ? ? ? 1_555 J DG 17  N1 ? ? J DC 139 I DG 68  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog378 hydrog ? ? I DC 140 N4 ? ? ? 1_555 J DG 17  O6 ? ? J DC 139 I DG 68  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog379 hydrog ? ? I DC 140 O2 ? ? ? 1_555 J DG 17  N2 ? ? J DC 139 I DG 68  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog380 hydrog ? ? I DA 141 N1 ? ? ? 1_555 J DT 16  N3 ? ? J DA 140 I DT 67  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog381 hydrog ? ? I DA 141 N6 ? ? ? 1_555 J DT 16  O4 ? ? J DA 140 I DT 67  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog382 hydrog ? ? I DT 142 N3 ? ? ? 1_555 J DA 15  N1 ? ? J DT 141 I DA 66  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog383 hydrog ? ? I DT 142 O4 ? ? ? 1_555 J DA 15  N6 ? ? J DT 141 I DA 66  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog384 hydrog ? ? I DC 143 N3 ? ? ? 1_555 J DG 14  N1 ? ? J DC 142 I DG 65  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog385 hydrog ? ? I DC 143 N4 ? ? ? 1_555 J DG 14  O6 ? ? J DC 142 I DG 65  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog386 hydrog ? ? I DC 143 O2 ? ? ? 1_555 J DG 14  N2 ? ? J DC 142 I DG 65  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog387 hydrog ? ? I DC 144 N3 ? ? ? 1_555 J DG 13  N1 ? ? J DC 143 I DG 64  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog388 hydrog ? ? I DC 144 N4 ? ? ? 1_555 J DG 13  O6 ? ? J DC 143 I DG 64  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog389 hydrog ? ? I DC 144 O2 ? ? ? 1_555 J DG 13  N2 ? ? J DC 143 I DG 64  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog390 hydrog ? ? I DT 145 N3 ? ? ? 1_555 J DA 12  N1 ? ? J DT 144 I DA 63  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog391 hydrog ? ? I DT 145 O4 ? ? ? 1_555 J DA 12  N6 ? ? J DT 144 I DA 63  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog392 hydrog ? ? I DG 146 N1 ? ? ? 1_555 J DC 11  N3 ? ? J DG 145 I DC 62  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog393 hydrog ? ? I DG 146 N2 ? ? ? 1_555 J DC 11  O2 ? ? J DG 145 I DC 62  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog394 hydrog ? ? I DG 146 O6 ? ? ? 1_555 J DC 11  N4 ? ? J DG 145 I DC 62  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog395 hydrog ? ? I DT 147 N3 ? ? ? 1_555 J DA 10  N1 ? ? J DT 146 I DA 61  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog396 hydrog ? ? I DT 147 O4 ? ? ? 1_555 J DA 10  N6 ? ? J DT 146 I DA 61  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog397 hydrog ? ? I DG 148 N1 ? ? ? 1_555 J DC 9   N3 ? ? J DG 147 I DC 60  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog398 hydrog ? ? I DG 148 N2 ? ? ? 1_555 J DC 9   O2 ? ? J DG 147 I DC 60  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog399 hydrog ? ? I DG 148 O6 ? ? ? 1_555 J DC 9   N4 ? ? J DG 147 I DC 60  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog400 hydrog ? ? I DC 149 N3 ? ? ? 1_555 J DG 8   N1 ? ? J DC 148 I DG 59  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog401 hydrog ? ? I DC 149 N4 ? ? ? 1_555 J DG 8   O6 ? ? J DC 148 I DG 59  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog402 hydrog ? ? I DC 149 O2 ? ? ? 1_555 J DG 8   N2 ? ? J DC 148 I DG 59  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog403 hydrog ? ? I DA 150 N1 ? ? ? 1_555 J DT 7   N3 ? ? J DA 149 I DT 58  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog404 hydrog ? ? I DA 150 N6 ? ? ? 1_555 J DT 7   O4 ? ? J DA 149 I DT 58  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog405 hydrog ? ? I DT 151 N3 ? ? ? 1_555 J DA 6   N1 ? ? J DT 150 I DA 57  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog406 hydrog ? ? I DT 151 O4 ? ? ? 1_555 J DA 6   N6 ? ? J DT 150 I DA 57  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog407 hydrog ? ? I DG 152 N1 ? ? ? 1_555 J DA 4   N1 ? ? J DG 151 I DA 55  1_555 ? ? ? ? ? ? TYPE_8_PAIR  ? ? 
hydrog408 hydrog ? ? I DG 152 O6 ? ? ? 1_555 J DA 4   N6 ? ? J DG 151 I DA 55  1_555 ? ? ? ? ? ? TYPE_8_PAIR  ? ? 
hydrog409 hydrog ? ? I DG 152 N1 ? ? ? 1_555 J DC 5   N3 ? ? J DG 151 I DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog410 hydrog ? ? I DG 152 N2 ? ? ? 1_555 J DC 5   O2 ? ? J DG 151 I DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog411 hydrog ? ? I DG 152 O6 ? ? ? 1_555 J DC 5   N4 ? ? J DG 151 I DC 56  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog412 hydrog ? ? I DT 153 N3 ? ? ? 1_555 J DA 4   N1 ? ? J DT 152 I DA 55  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog413 hydrog ? ? I DT 153 O4 ? ? ? 1_555 J DA 4   N6 ? ? J DT 152 I DA 55  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog414 hydrog ? ? I DA 154 N1 ? ? ? 1_555 J DT 3   N3 ? ? J DA 153 I DT 54  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog415 hydrog ? ? I DA 154 N6 ? ? ? 1_555 J DT 3   O4 ? ? J DA 153 I DT 54  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog416 hydrog ? ? I DT 155 N3 ? ? ? 1_555 J DA 2   N1 ? ? J DT 154 I DA 53  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog417 hydrog ? ? I DT 155 O4 ? ? ? 1_555 J DA 2   N6 ? ? J DT 154 I DA 53  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog418 hydrog ? ? I DT 156 N3 ? ? ? 1_555 J DA 1   N1 ? ? J DT 155 I DA 52  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog419 hydrog ? ? I DT 156 O4 ? ? ? 1_555 J DA 1   N6 ? ? J DT 155 I DA 52  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          GLY 
_struct_mon_prot_cis.label_seq_id           65 
_struct_mon_prot_cis.label_asym_id          K 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           GLY 
_struct_mon_prot_cis.auth_seq_id            230 
_struct_mon_prot_cis.auth_asym_id           W 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    66 
_struct_mon_prot_cis.pdbx_label_asym_id_2   K 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     231 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    W 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -4.18 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 2 ? 
AA3 ? 2 ? 
AA4 ? 2 ? 
AA5 ? 2 ? 
AA6 ? 2 ? 
AA7 ? 6 ? 
AA8 ? 5 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? parallel 
AA2 1 2 ? parallel 
AA3 1 2 ? parallel 
AA4 1 2 ? parallel 
AA5 1 2 ? parallel 
AA6 1 2 ? parallel 
AA7 1 2 ? parallel 
AA7 2 3 ? parallel 
AA7 3 4 ? parallel 
AA7 4 5 ? parallel 
AA7 5 6 ? parallel 
AA8 1 2 ? parallel 
AA8 2 3 ? parallel 
AA8 3 4 ? parallel 
AA8 4 5 ? parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 ARG A 84  ? PHE A 85  ? ARG A 83  PHE A 84  
AA1 2 THR B 81  ? VAL B 82  ? THR B 80  VAL B 81  
AA2 1 THR B 97  ? LEU B 98  ? THR B 96  LEU B 97  
AA2 2 VAL G 101 ? THR G 102 ? VAL G 100 THR G 101 
AA3 1 ARG C 43  ? VAL C 44  ? ARG C 42  VAL C 43  
AA3 2 THR D 62  ? ILE D 63  ? THR D 85  ILE D 86  
AA4 1 ARG C 78  ? ILE C 79  ? ARG C 77  ILE C 78  
AA4 2 GLY D 27  ? ILE D 28  ? GLY D 50  ILE D 51  
AA5 1 ARG E 84  ? PHE E 85  ? ARG E 83  PHE E 84  
AA5 2 THR F 81  ? VAL F 82  ? THR F 80  VAL F 81  
AA6 1 ARG G 43  ? VAL G 44  ? ARG G 42  VAL G 43  
AA6 2 THR H 57  ? ILE H 58  ? THR H 85  ILE H 86  
AA7 1 GLY K 36  ? LEU K 38  ? GLY W 201 LEU W 203 
AA7 2 LEU K 168 ? LEU K 170 ? LEU W 333 LEU W 335 
AA7 3 TYR K 139 ? ASP K 143 ? TYR W 304 ASP W 308 
AA7 4 HIS K 67  ? VAL K 71  ? HIS W 232 VAL W 236 
AA7 5 VAL K 117 ? SER K 121 ? VAL W 282 SER W 286 
AA7 6 SER K 92  ? LEU K 95  ? SER W 257 LEU W 260 
AA8 1 LYS K 241 ? TYR K 246 ? LYS W 408 TYR W 413 
AA8 2 ARG K 436 ? ILE K 441 ? ARG W 603 ILE W 608 
AA8 3 VAL K 406 ? LEU K 409 ? VAL W 573 LEU W 576 
AA8 4 VAL K 335 ? SER K 339 ? VAL W 502 SER W 506 
AA8 5 MET K 389 ? SER K 391 ? MET W 556 SER W 558 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N ARG A 84  ? N ARG A 83  O VAL B 82  ? O VAL B 81  
AA2 1 2 N THR B 97  ? N THR B 96  O THR G 102 ? O THR G 101 
AA3 1 2 N ARG C 43  ? N ARG C 42  O ILE D 63  ? O ILE D 86  
AA4 1 2 N ILE C 79  ? N ILE C 78  O GLY D 27  ? O GLY D 50  
AA5 1 2 N ARG E 84  ? N ARG E 83  O VAL F 82  ? O VAL F 81  
AA6 1 2 N ARG G 43  ? N ARG G 42  O ILE H 58  ? O ILE H 86  
AA7 1 2 N LEU K 38  ? N LEU W 203 O LEU K 169 ? O LEU W 334 
AA7 2 3 O LEU K 168 ? O LEU W 333 N LEU K 140 ? N LEU W 305 
AA7 3 4 O ASP K 143 ? O ASP W 308 N LEU K 70  ? N LEU W 235 
AA7 4 5 N VAL K 69  ? N VAL W 234 O THR K 120 ? O THR W 285 
AA7 5 6 O VAL K 119 ? O VAL W 284 N VAL K 93  ? N VAL W 258 
AA8 1 2 N VAL K 243 ? N VAL W 410 O VAL K 437 ? O VAL W 604 
AA8 2 3 O PHE K 438 ? O PHE W 605 N VAL K 407 ? N VAL W 574 
AA8 3 4 O ILE K 408 ? O ILE W 575 N LEU K 336 ? N LEU W 503 
AA8 4 5 N SER K 339 ? N SER W 506 O LEU K 390 ? O LEU W 557 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software W ADP 801 ? 16 'binding site for Di-peptide ADP W 801 and LYS W 179' 
AC2 Software W ADP 801 ? 18 'binding site for Di-peptide ADP W 801 and ARG W 595' 
AC3 Software W ADP 801 ? 18 'binding site for Di-peptide ADP W 801 and ARG W 595' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 16 SER K 6   ? SER W 171 . ? 1_555 ? 
2  AC1 16 GLY K 13  ? GLY W 178 . ? 1_555 ? 
3  AC1 16 LEU K 15  ? LEU W 180 . ? 1_555 ? 
4  AC1 16 ARG K 16  ? ARG W 181 . ? 1_555 ? 
5  AC1 16 GLN K 19  ? GLN W 184 . ? 1_555 ? 
6  AC1 16 MET K 42  ? MET W 207 . ? 1_555 ? 
7  AC1 16 GLY K 43  ? GLY W 208 . ? 1_555 ? 
8  AC1 16 LEU K 44  ? LEU W 209 . ? 1_555 ? 
9  AC1 16 GLY K 45  ? GLY W 210 . ? 1_555 ? 
10 AC1 16 LYS K 46  ? LYS W 211 . ? 1_555 ? 
11 AC1 16 THR K 47  ? THR W 212 . ? 1_555 ? 
12 AC1 16 GLU K 82  ? GLU W 247 . ? 1_555 ? 
13 AC1 16 TRP K 86  ? TRP W 251 . ? 1_555 ? 
14 AC1 16 ASP K 143 ? ASP W 308 . ? 1_555 ? 
15 AC1 16 ARG K 428 ? ARG W 595 . ? 1_555 ? 
16 AC1 16 ILE K 429 ? ILE W 596 . ? 1_555 ? 
17 AC2 18 LYS K 14  ? LYS W 179 . ? 1_555 ? 
18 AC2 18 LEU K 15  ? LEU W 180 . ? 1_555 ? 
19 AC2 18 GLN K 19  ? GLN W 184 . ? 1_555 ? 
20 AC2 18 MET K 42  ? MET W 207 . ? 1_555 ? 
21 AC2 18 GLY K 43  ? GLY W 208 . ? 1_555 ? 
22 AC2 18 LEU K 44  ? LEU W 209 . ? 1_555 ? 
23 AC2 18 GLY K 45  ? GLY W 210 . ? 1_555 ? 
24 AC2 18 LYS K 46  ? LYS W 211 . ? 1_555 ? 
25 AC2 18 THR K 47  ? THR W 212 . ? 1_555 ? 
26 AC2 18 GLU K 82  ? GLU W 247 . ? 1_555 ? 
27 AC2 18 TRP K 86  ? TRP W 251 . ? 1_555 ? 
28 AC2 18 ASP K 143 ? ASP W 308 . ? 1_555 ? 
29 AC2 18 ASP K 424 ? ASP W 591 . ? 1_555 ? 
30 AC2 18 ARG K 425 ? ARG W 592 . ? 1_555 ? 
31 AC2 18 ALA K 426 ? ALA W 593 . ? 1_555 ? 
32 AC2 18 HIS K 427 ? HIS W 594 . ? 1_555 ? 
33 AC2 18 ILE K 429 ? ILE W 596 . ? 1_555 ? 
34 AC2 18 GLY K 430 ? GLY W 597 . ? 1_555 ? 
35 AC3 18 LYS K 14  ? LYS W 179 . ? 1_555 ? 
36 AC3 18 LEU K 15  ? LEU W 180 . ? 1_555 ? 
37 AC3 18 GLN K 19  ? GLN W 184 . ? 1_555 ? 
38 AC3 18 MET K 42  ? MET W 207 . ? 1_555 ? 
39 AC3 18 GLY K 43  ? GLY W 208 . ? 1_555 ? 
40 AC3 18 LEU K 44  ? LEU W 209 . ? 1_555 ? 
41 AC3 18 GLY K 45  ? GLY W 210 . ? 1_555 ? 
42 AC3 18 LYS K 46  ? LYS W 211 . ? 1_555 ? 
43 AC3 18 THR K 47  ? THR W 212 . ? 1_555 ? 
44 AC3 18 GLU K 82  ? GLU W 247 . ? 1_555 ? 
45 AC3 18 TRP K 86  ? TRP W 251 . ? 1_555 ? 
46 AC3 18 ASP K 143 ? ASP W 308 . ? 1_555 ? 
47 AC3 18 ASP K 424 ? ASP W 591 . ? 1_555 ? 
48 AC3 18 ARG K 425 ? ARG W 592 . ? 1_555 ? 
49 AC3 18 ALA K 426 ? ALA W 593 . ? 1_555 ? 
50 AC3 18 HIS K 427 ? HIS W 594 . ? 1_555 ? 
51 AC3 18 ILE K 429 ? ILE W 596 . ? 1_555 ? 
52 AC3 18 GLY K 430 ? GLY W 597 . ? 1_555 ? 
# 
_atom_sites.entry_id                    6NE3 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     N N     . LYS A 1 37  ? 152.360 207.072 125.246 1.00 202.57 ? 36  LYS A N     1 
ATOM   2     C CA    . LYS A 1 37  ? 152.221 207.911 126.429 1.00 202.57 ? 36  LYS A CA    1 
ATOM   3     C C     . LYS A 1 37  ? 151.535 207.150 127.555 1.00 202.57 ? 36  LYS A C     1 
ATOM   4     O O     . LYS A 1 37  ? 150.464 206.575 127.348 1.00 202.57 ? 36  LYS A O     1 
ATOM   5     C CB    . LYS A 1 37  ? 151.435 209.181 126.099 1.00 202.57 ? 36  LYS A CB    1 
ATOM   6     N N     . LYS A 1 38  ? 152.165 207.178 128.743 1.00 201.85 ? 37  LYS A N     1 
ATOM   7     C CA    . LYS A 1 38  ? 151.751 206.492 129.966 1.00 201.85 ? 37  LYS A CA    1 
ATOM   8     C C     . LYS A 1 38  ? 151.533 205.005 129.715 1.00 201.85 ? 37  LYS A C     1 
ATOM   9     O O     . LYS A 1 38  ? 150.381 204.568 129.598 1.00 201.85 ? 37  LYS A O     1 
ATOM   10    C CB    . LYS A 1 38  ? 150.484 207.127 130.544 1.00 201.85 ? 37  LYS A CB    1 
ATOM   11    N N     . PRO A 1 39  ? 152.599 204.215 129.578 1.00 198.11 ? 38  PRO A N     1 
ATOM   12    C CA    . PRO A 1 39  ? 152.437 202.791 129.261 1.00 198.11 ? 38  PRO A CA    1 
ATOM   13    C C     . PRO A 1 39  ? 151.789 202.038 130.411 1.00 198.11 ? 38  PRO A C     1 
ATOM   14    O O     . PRO A 1 39  ? 151.887 202.409 131.581 1.00 198.11 ? 38  PRO A O     1 
ATOM   15    C CB    . PRO A 1 39  ? 153.871 202.305 129.015 1.00 198.11 ? 38  PRO A CB    1 
ATOM   16    C CG    . PRO A 1 39  ? 154.713 203.545 128.943 1.00 198.11 ? 38  PRO A CG    1 
ATOM   17    C CD    . PRO A 1 39  ? 154.013 204.565 129.775 1.00 198.11 ? 38  PRO A CD    1 
ATOM   18    N N     . HIS A 1 40  ? 151.106 200.962 130.052 1.00 205.53 ? 39  HIS A N     1 
ATOM   19    C CA    . HIS A 1 40  ? 150.234 200.244 130.972 1.00 205.53 ? 39  HIS A CA    1 
ATOM   20    C C     . HIS A 1 40  ? 151.045 199.163 131.675 1.00 205.53 ? 39  HIS A C     1 
ATOM   21    O O     . HIS A 1 40  ? 151.139 198.030 131.203 1.00 205.53 ? 39  HIS A O     1 
ATOM   22    C CB    . HIS A 1 40  ? 149.052 199.655 130.237 1.00 205.53 ? 39  HIS A CB    1 
ATOM   23    C CG    . HIS A 1 40  ? 148.103 198.921 131.125 1.00 205.53 ? 39  HIS A CG    1 
ATOM   24    N ND1   . HIS A 1 40  ? 148.222 197.574 131.385 1.00 205.53 ? 39  HIS A ND1   1 
ATOM   25    C CD2   . HIS A 1 40  ? 147.023 199.346 131.821 1.00 205.53 ? 39  HIS A CD2   1 
ATOM   26    C CE1   . HIS A 1 40  ? 147.252 197.199 132.199 1.00 205.53 ? 39  HIS A CE1   1 
ATOM   27    N NE2   . HIS A 1 40  ? 146.511 198.255 132.479 1.00 205.53 ? 39  HIS A NE2   1 
ATOM   28    N N     . ARG A 1 41  ? 151.625 199.521 132.813 1.00 190.68 ? 40  ARG A N     1 
ATOM   29    C CA    . ARG A 1 41  ? 152.302 198.558 133.661 1.00 190.68 ? 40  ARG A CA    1 
ATOM   30    C C     . ARG A 1 41  ? 151.300 197.917 134.603 1.00 190.68 ? 40  ARG A C     1 
ATOM   31    O O     . ARG A 1 41  ? 150.494 198.605 135.233 1.00 190.68 ? 40  ARG A O     1 
ATOM   32    C CB    . ARG A 1 41  ? 153.412 199.223 134.467 1.00 190.68 ? 40  ARG A CB    1 
ATOM   33    C CG    . ARG A 1 41  ? 154.598 199.654 133.646 1.00 190.68 ? 40  ARG A CG    1 
ATOM   34    C CD    . ARG A 1 41  ? 155.665 200.230 134.545 1.00 190.68 ? 40  ARG A CD    1 
ATOM   35    N NE    . ARG A 1 41  ? 155.925 199.363 135.687 1.00 190.68 ? 40  ARG A NE    1 
ATOM   36    C CZ    . ARG A 1 41  ? 156.803 198.369 135.677 1.00 190.68 ? 40  ARG A CZ    1 
ATOM   37    N NH1   . ARG A 1 41  ? 157.506 198.121 134.582 1.00 190.68 ? 40  ARG A NH1   1 
ATOM   38    N NH2   . ARG A 1 41  ? 156.981 197.627 136.760 1.00 190.68 ? 40  ARG A NH2   1 
ATOM   39    N N     . TYR A 1 42  ? 151.354 196.596 134.693 1.00 202.26 ? 41  TYR A N     1 
ATOM   40    C CA    . TYR A 1 42  ? 150.476 195.882 135.598 1.00 202.26 ? 41  TYR A CA    1 
ATOM   41    C C     . TYR A 1 42  ? 150.963 196.029 137.026 1.00 202.26 ? 41  TYR A C     1 
ATOM   42    O O     . TYR A 1 42  ? 152.161 196.155 137.286 1.00 202.26 ? 41  TYR A O     1 
ATOM   43    C CB    . TYR A 1 42  ? 150.401 194.407 135.228 1.00 202.26 ? 41  TYR A CB    1 
ATOM   44    C CG    . TYR A 1 42  ? 149.295 194.101 134.258 1.00 202.26 ? 41  TYR A CG    1 
ATOM   45    C CD1   . TYR A 1 42  ? 147.978 194.385 134.578 1.00 202.26 ? 41  TYR A CD1   1 
ATOM   46    C CD2   . TYR A 1 42  ? 149.566 193.537 133.022 1.00 202.26 ? 41  TYR A CD2   1 
ATOM   47    C CE1   . TYR A 1 42  ? 146.962 194.111 133.700 1.00 202.26 ? 41  TYR A CE1   1 
ATOM   48    C CE2   . TYR A 1 42  ? 148.554 193.262 132.138 1.00 202.26 ? 41  TYR A CE2   1 
ATOM   49    C CZ    . TYR A 1 42  ? 147.255 193.551 132.485 1.00 202.26 ? 41  TYR A CZ    1 
ATOM   50    O OH    . TYR A 1 42  ? 146.236 193.280 131.608 1.00 202.26 ? 41  TYR A OH    1 
ATOM   51    N N     . ARG A 1 43  ? 150.014 196.015 137.951 1.00 199.90 ? 42  ARG A N     1 
ATOM   52    C CA    . ARG A 1 43  ? 150.332 196.167 139.356 1.00 199.90 ? 42  ARG A CA    1 
ATOM   53    C C     . ARG A 1 43  ? 151.079 194.938 139.868 1.00 199.90 ? 42  ARG A C     1 
ATOM   54    O O     . ARG A 1 43  ? 150.935 193.844 139.317 1.00 199.90 ? 42  ARG A O     1 
ATOM   55    C CB    . ARG A 1 43  ? 149.058 196.368 140.161 1.00 199.90 ? 42  ARG A CB    1 
ATOM   56    C CG    . ARG A 1 43  ? 148.368 197.677 139.884 1.00 199.90 ? 42  ARG A CG    1 
ATOM   57    C CD    . ARG A 1 43  ? 147.476 198.066 141.032 1.00 199.90 ? 42  ARG A CD    1 
ATOM   58    N NE    . ARG A 1 43  ? 148.245 198.474 142.200 1.00 199.90 ? 42  ARG A NE    1 
ATOM   59    C CZ    . ARG A 1 43  ? 148.396 197.727 143.287 1.00 199.90 ? 42  ARG A CZ    1 
ATOM   60    N NH1   . ARG A 1 43  ? 147.837 196.528 143.347 1.00 199.90 ? 42  ARG A NH1   1 
ATOM   61    N NH2   . ARG A 1 43  ? 149.112 198.172 144.309 1.00 199.90 ? 42  ARG A NH2   1 
ATOM   62    N N     . PRO A 1 44  ? 151.920 195.103 140.886 1.00 187.84 ? 43  PRO A N     1 
ATOM   63    C CA    . PRO A 1 44  ? 152.535 193.938 141.530 1.00 187.84 ? 43  PRO A CA    1 
ATOM   64    C C     . PRO A 1 44  ? 151.477 193.082 142.202 1.00 187.84 ? 43  PRO A C     1 
ATOM   65    O O     . PRO A 1 44  ? 150.739 193.544 143.071 1.00 187.84 ? 43  PRO A O     1 
ATOM   66    C CB    . PRO A 1 44  ? 153.494 194.564 142.546 1.00 187.84 ? 43  PRO A CB    1 
ATOM   67    C CG    . PRO A 1 44  ? 153.782 195.910 142.009 1.00 187.84 ? 43  PRO A CG    1 
ATOM   68    C CD    . PRO A 1 44  ? 152.525 196.363 141.345 1.00 187.84 ? 43  PRO A CD    1 
ATOM   69    N N     . GLY A 1 45  ? 151.393 191.832 141.773 1.00 185.15 ? 44  GLY A N     1 
ATOM   70    C CA    . GLY A 1 45  ? 150.358 190.940 142.234 1.00 185.15 ? 44  GLY A CA    1 
ATOM   71    C C     . GLY A 1 45  ? 149.186 190.771 141.297 1.00 185.15 ? 44  GLY A C     1 
ATOM   72    O O     . GLY A 1 45  ? 148.089 190.448 141.762 1.00 185.15 ? 44  GLY A O     1 
ATOM   73    N N     . THR A 1 46  ? 149.372 190.996 140.002 1.00 184.18 ? 45  THR A N     1 
ATOM   74    C CA    . THR A 1 46  ? 148.362 190.688 139.005 1.00 184.18 ? 45  THR A CA    1 
ATOM   75    C C     . THR A 1 46  ? 148.860 189.665 138.003 1.00 184.18 ? 45  THR A C     1 
ATOM   76    O O     . THR A 1 46  ? 148.173 188.674 137.715 1.00 184.18 ? 45  THR A O     1 
ATOM   77    C CB    . THR A 1 46  ? 147.940 191.960 138.279 1.00 184.18 ? 45  THR A CB    1 
ATOM   78    O OG1   . THR A 1 46  ? 147.544 192.939 139.242 1.00 184.18 ? 45  THR A OG1   1 
ATOM   79    C CG2   . THR A 1 46  ? 146.778 191.670 137.369 1.00 184.18 ? 45  THR A CG2   1 
ATOM   80    N N     . VAL A 1 47  ? 150.070 189.877 137.484 1.00 170.27 ? 46  VAL A N     1 
ATOM   81    C CA    . VAL A 1 47  ? 150.703 188.887 136.634 1.00 170.27 ? 46  VAL A CA    1 
ATOM   82    C C     . VAL A 1 47  ? 151.035 187.639 137.424 1.00 170.27 ? 46  VAL A C     1 
ATOM   83    O O     . VAL A 1 47  ? 151.038 186.541 136.863 1.00 170.27 ? 46  VAL A O     1 
ATOM   84    C CB    . VAL A 1 47  ? 151.961 189.477 135.990 1.00 170.27 ? 46  VAL A CB    1 
ATOM   85    C CG1   . VAL A 1 47  ? 152.375 188.657 134.789 1.00 170.27 ? 46  VAL A CG1   1 
ATOM   86    C CG2   . VAL A 1 47  ? 151.717 190.910 135.610 1.00 170.27 ? 46  VAL A CG2   1 
ATOM   87    N N     . ALA A 1 48  ? 151.280 187.780 138.727 1.00 163.70 ? 47  ALA A N     1 
ATOM   88    C CA    . ALA A 1 48  ? 151.438 186.623 139.598 1.00 163.70 ? 47  ALA A CA    1 
ATOM   89    C C     . ALA A 1 48  ? 150.173 185.778 139.626 1.00 163.70 ? 47  ALA A C     1 
ATOM   90    O O     . ALA A 1 48  ? 150.233 184.551 139.497 1.00 163.70 ? 47  ALA A O     1 
ATOM   91    C CB    . ALA A 1 48  ? 151.805 187.084 141.004 1.00 163.70 ? 47  ALA A CB    1 
ATOM   92    N N     . LEU A 1 49  ? 149.014 186.425 139.753 1.00 163.56 ? 48  LEU A N     1 
ATOM   93    C CA    . LEU A 1 49  ? 147.751 185.696 139.786 1.00 163.56 ? 48  LEU A CA    1 
ATOM   94    C C     . LEU A 1 49  ? 147.454 185.028 138.455 1.00 163.56 ? 48  LEU A C     1 
ATOM   95    O O     . LEU A 1 49  ? 147.049 183.860 138.421 1.00 163.56 ? 48  LEU A O     1 
ATOM   96    C CB    . LEU A 1 49  ? 146.601 186.623 140.164 1.00 163.56 ? 48  LEU A CB    1 
ATOM   97    C CG    . LEU A 1 49  ? 146.211 186.741 141.633 1.00 163.56 ? 48  LEU A CG    1 
ATOM   98    C CD1   . LEU A 1 49  ? 145.766 185.391 142.120 1.00 163.56 ? 48  LEU A CD1   1 
ATOM   99    C CD2   . LEU A 1 49  ? 147.328 187.272 142.498 1.00 163.56 ? 48  LEU A CD2   1 
ATOM   100   N N     . ARG A 1 50  ? 147.658 185.743 137.349 1.00 170.44 ? 49  ARG A N     1 
ATOM   101   C CA    . ARG A 1 50  ? 147.394 185.127 136.056 1.00 170.44 ? 49  ARG A CA    1 
ATOM   102   C C     . ARG A 1 50  ? 148.399 184.030 135.738 1.00 170.44 ? 49  ARG A C     1 
ATOM   103   O O     . ARG A 1 50  ? 148.039 183.042 135.092 1.00 170.44 ? 49  ARG A O     1 
ATOM   104   C CB    . ARG A 1 50  ? 147.383 186.184 134.964 1.00 170.44 ? 49  ARG A CB    1 
ATOM   105   C CG    . ARG A 1 50  ? 146.394 187.284 135.238 1.00 170.44 ? 49  ARG A CG    1 
ATOM   106   C CD    . ARG A 1 50  ? 146.363 188.281 134.110 1.00 170.44 ? 49  ARG A CD    1 
ATOM   107   N NE    . ARG A 1 50  ? 147.656 188.386 133.449 1.00 170.44 ? 49  ARG A NE    1 
ATOM   108   C CZ    . ARG A 1 50  ? 147.973 189.352 132.598 1.00 170.44 ? 49  ARG A CZ    1 
ATOM   109   N NH1   . ARG A 1 50  ? 147.089 190.293 132.310 1.00 170.44 ? 49  ARG A NH1   1 
ATOM   110   N NH2   . ARG A 1 50  ? 149.173 189.378 132.039 1.00 170.44 ? 49  ARG A NH2   1 
ATOM   111   N N     . GLU A 1 51  ? 149.628 184.142 136.240 1.00 159.29 ? 50  GLU A N     1 
ATOM   112   C CA    . GLU A 1 51  ? 150.600 183.074 136.062 1.00 159.29 ? 50  GLU A CA    1 
ATOM   113   C C     . GLU A 1 51  ? 150.216 181.842 136.861 1.00 159.29 ? 50  GLU A C     1 
ATOM   114   O O     . GLU A 1 51  ? 150.367 180.716 136.374 1.00 159.29 ? 50  GLU A O     1 
ATOM   115   C CB    . GLU A 1 51  ? 151.983 183.555 136.474 1.00 159.29 ? 50  GLU A CB    1 
ATOM   116   C CG    . GLU A 1 51  ? 152.813 184.072 135.336 1.00 159.29 ? 50  GLU A CG    1 
ATOM   117   C CD    . GLU A 1 51  ? 154.283 184.134 135.680 1.00 159.29 ? 50  GLU A CD    1 
ATOM   118   O OE1   . GLU A 1 51  ? 154.676 183.552 136.708 1.00 159.29 ? 50  GLU A OE1   1 
ATOM   119   O OE2   . GLU A 1 51  ? 155.049 184.765 134.926 1.00 159.29 ? 50  GLU A OE2   1 
ATOM   120   N N     . ILE A 1 52  ? 149.720 182.040 138.087 1.00 155.73 ? 51  ILE A N     1 
ATOM   121   C CA    . ILE A 1 52  ? 149.272 180.918 138.907 1.00 155.73 ? 51  ILE A CA    1 
ATOM   122   C C     . ILE A 1 52  ? 148.110 180.206 138.240 1.00 155.73 ? 51  ILE A C     1 
ATOM   123   O O     . ILE A 1 52  ? 148.106 178.976 138.127 1.00 155.73 ? 51  ILE A O     1 
ATOM   124   C CB    . ILE A 1 52  ? 148.903 181.389 140.324 1.00 155.73 ? 51  ILE A CB    1 
ATOM   125   C CG1   . ILE A 1 52  ? 150.153 181.701 141.126 1.00 155.73 ? 51  ILE A CG1   1 
ATOM   126   C CG2   . ILE A 1 52  ? 148.095 180.354 141.060 1.00 155.73 ? 51  ILE A CG2   1 
ATOM   127   C CD1   . ILE A 1 52  ? 149.847 182.309 142.465 1.00 155.73 ? 51  ILE A CD1   1 
ATOM   128   N N     . ARG A 1 53  ? 147.137 180.969 137.739 1.00 159.85 ? 52  ARG A N     1 
ATOM   129   C CA    . ARG A 1 53  ? 145.984 180.340 137.103 1.00 159.85 ? 52  ARG A CA    1 
ATOM   130   C C     . ARG A 1 53  ? 146.360 179.646 135.804 1.00 159.85 ? 52  ARG A C     1 
ATOM   131   O O     . ARG A 1 53  ? 145.859 178.548 135.529 1.00 159.85 ? 52  ARG A O     1 
ATOM   132   C CB    . ARG A 1 53  ? 144.893 181.368 136.857 1.00 159.85 ? 52  ARG A CB    1 
ATOM   133   C CG    . ARG A 1 53  ? 144.407 182.005 138.122 1.00 159.85 ? 52  ARG A CG    1 
ATOM   134   C CD    . ARG A 1 53  ? 142.913 182.132 138.136 1.00 159.85 ? 52  ARG A CD    1 
ATOM   135   N NE    . ARG A 1 53  ? 142.477 183.126 139.105 1.00 159.85 ? 52  ARG A NE    1 
ATOM   136   C CZ    . ARG A 1 53  ? 142.290 184.405 138.813 1.00 159.85 ? 52  ARG A CZ    1 
ATOM   137   N NH1   . ARG A 1 53  ? 142.501 184.838 137.580 1.00 159.85 ? 52  ARG A NH1   1 
ATOM   138   N NH2   . ARG A 1 53  ? 141.891 185.249 139.751 1.00 159.85 ? 52  ARG A NH2   1 
ATOM   139   N N     . ARG A 1 54  ? 147.286 180.220 135.035 1.00 156.44 ? 53  ARG A N     1 
ATOM   140   C CA    . ARG A 1 54  ? 147.674 179.597 133.778 1.00 156.44 ? 53  ARG A CA    1 
ATOM   141   C C     . ARG A 1 54  ? 148.490 178.336 134.012 1.00 156.44 ? 53  ARG A C     1 
ATOM   142   O O     . ARG A 1 54  ? 148.297 177.329 133.325 1.00 156.44 ? 53  ARG A O     1 
ATOM   143   C CB    . ARG A 1 54  ? 148.457 180.577 132.916 1.00 156.44 ? 53  ARG A CB    1 
ATOM   144   C CG    . ARG A 1 54  ? 148.701 180.051 131.528 1.00 156.44 ? 53  ARG A CG    1 
ATOM   145   C CD    . ARG A 1 54  ? 149.322 181.093 130.647 1.00 156.44 ? 53  ARG A CD    1 
ATOM   146   N NE    . ARG A 1 54  ? 150.762 180.919 130.560 1.00 156.44 ? 53  ARG A NE    1 
ATOM   147   C CZ    . ARG A 1 54  ? 151.634 181.637 131.252 1.00 156.44 ? 53  ARG A CZ    1 
ATOM   148   N NH1   . ARG A 1 54  ? 151.203 182.577 132.080 1.00 156.44 ? 53  ARG A NH1   1 
ATOM   149   N NH2   . ARG A 1 54  ? 152.931 181.418 131.114 1.00 156.44 ? 53  ARG A NH2   1 
ATOM   150   N N     . TYR A 1 55  ? 149.397 178.358 134.981 1.00 155.54 ? 54  TYR A N     1 
ATOM   151   C CA    . TYR A 1 55  ? 150.199 177.168 135.197 1.00 155.54 ? 54  TYR A CA    1 
ATOM   152   C C     . TYR A 1 55  ? 149.472 176.094 135.985 1.00 155.54 ? 54  TYR A C     1 
ATOM   153   O O     . TYR A 1 55  ? 149.829 174.919 135.863 1.00 155.54 ? 54  TYR A O     1 
ATOM   154   C CB    . TYR A 1 55  ? 151.499 177.527 135.894 1.00 155.54 ? 54  TYR A CB    1 
ATOM   155   C CG    . TYR A 1 55  ? 152.460 178.177 134.955 1.00 155.54 ? 54  TYR A CG    1 
ATOM   156   C CD1   . TYR A 1 55  ? 152.757 177.594 133.740 1.00 155.54 ? 54  TYR A CD1   1 
ATOM   157   C CD2   . TYR A 1 55  ? 153.060 179.379 135.273 1.00 155.54 ? 54  TYR A CD2   1 
ATOM   158   C CE1   . TYR A 1 55  ? 153.632 178.192 132.866 1.00 155.54 ? 54  TYR A CE1   1 
ATOM   159   C CE2   . TYR A 1 55  ? 153.935 179.983 134.411 1.00 155.54 ? 54  TYR A CE2   1 
ATOM   160   C CZ    . TYR A 1 55  ? 154.220 179.385 133.210 1.00 155.54 ? 54  TYR A CZ    1 
ATOM   161   O OH    . TYR A 1 55  ? 155.092 179.993 132.346 1.00 155.54 ? 54  TYR A OH    1 
ATOM   162   N N     . GLN A 1 56  ? 148.462 176.446 136.769 1.00 155.13 ? 55  GLN A N     1 
ATOM   163   C CA    . GLN A 1 56  ? 147.663 175.423 137.418 1.00 155.13 ? 55  GLN A CA    1 
ATOM   164   C C     . GLN A 1 56  ? 146.633 174.835 136.479 1.00 155.13 ? 55  GLN A C     1 
ATOM   165   O O     . GLN A 1 56  ? 146.244 173.677 136.648 1.00 155.13 ? 55  GLN A O     1 
ATOM   166   C CB    . GLN A 1 56  ? 146.968 175.999 138.648 1.00 155.13 ? 55  GLN A CB    1 
ATOM   167   C CG    . GLN A 1 56  ? 147.865 176.131 139.851 1.00 155.13 ? 55  GLN A CG    1 
ATOM   168   C CD    . GLN A 1 56  ? 147.086 176.408 141.104 1.00 155.13 ? 55  GLN A CD    1 
ATOM   169   O OE1   . GLN A 1 56  ? 145.911 176.755 141.049 1.00 155.13 ? 55  GLN A OE1   1 
ATOM   170   N NE2   . GLN A 1 56  ? 147.731 176.259 142.245 1.00 155.13 ? 55  GLN A NE2   1 
ATOM   171   N N     . LYS A 1 57  ? 146.194 175.592 135.479 1.00 160.72 ? 56  LYS A N     1 
ATOM   172   C CA    . LYS A 1 57  ? 145.266 175.041 134.504 1.00 160.72 ? 56  LYS A CA    1 
ATOM   173   C C     . LYS A 1 57  ? 145.949 174.220 133.420 1.00 160.72 ? 56  LYS A C     1 
ATOM   174   O O     . LYS A 1 57  ? 145.267 173.760 132.500 1.00 160.72 ? 56  LYS A O     1 
ATOM   175   C CB    . LYS A 1 57  ? 144.456 176.160 133.858 1.00 160.72 ? 56  LYS A CB    1 
ATOM   176   C CG    . LYS A 1 57  ? 143.115 176.376 134.515 1.00 160.72 ? 56  LYS A CG    1 
ATOM   177   C CD    . LYS A 1 57  ? 142.338 177.483 133.837 1.00 160.72 ? 56  LYS A CD    1 
ATOM   178   C CE    . LYS A 1 57  ? 140.953 177.614 134.439 1.00 160.72 ? 56  LYS A CE    1 
ATOM   179   N NZ    . LYS A 1 57  ? 141.010 177.720 135.923 1.00 160.72 ? 56  LYS A NZ    1 
ATOM   180   N N     . SER A 1 58  ? 147.256 174.026 133.494 1.00 160.65 ? 57  SER A N     1 
ATOM   181   C CA    . SER A 1 58  ? 147.985 173.221 132.529 1.00 160.65 ? 57  SER A CA    1 
ATOM   182   C C     . SER A 1 58  ? 148.579 172.010 133.232 1.00 160.65 ? 57  SER A C     1 
ATOM   183   O O     . SER A 1 58  ? 148.456 171.847 134.445 1.00 160.65 ? 57  SER A O     1 
ATOM   184   C CB    . SER A 1 58  ? 149.083 174.037 131.852 1.00 160.65 ? 57  SER A CB    1 
ATOM   185   O OG    . SER A 1 58  ? 150.289 173.938 132.583 1.00 160.65 ? 57  SER A OG    1 
ATOM   186   N N     . THR A 1 59  ? 149.236 171.159 132.455 1.00 166.44 ? 58  THR A N     1 
ATOM   187   C CA    . THR A 1 59  ? 149.808 169.940 132.999 1.00 166.44 ? 58  THR A CA    1 
ATOM   188   C C     . THR A 1 59  ? 151.163 169.579 132.418 1.00 166.44 ? 58  THR A C     1 
ATOM   189   O O     . THR A 1 59  ? 151.667 168.494 132.717 1.00 166.44 ? 58  THR A O     1 
ATOM   190   C CB    . THR A 1 59  ? 148.860 168.761 132.776 1.00 166.44 ? 58  THR A CB    1 
ATOM   191   O OG1   . THR A 1 59  ? 149.467 167.564 133.280 1.00 166.44 ? 58  THR A OG1   1 
ATOM   192   C CG2   . THR A 1 59  ? 148.582 168.593 131.296 1.00 166.44 ? 58  THR A CG2   1 
ATOM   193   N N     . GLU A 1 60  ? 151.764 170.430 131.598 1.00 169.46 ? 59  GLU A N     1 
ATOM   194   C CA    . GLU A 1 60  ? 153.043 170.110 130.989 1.00 169.46 ? 59  GLU A CA    1 
ATOM   195   C C     . GLU A 1 60  ? 154.167 170.275 132.004 1.00 169.46 ? 59  GLU A C     1 
ATOM   196   O O     . GLU A 1 60  ? 153.953 170.653 133.158 1.00 169.46 ? 59  GLU A O     1 
ATOM   197   C CB    . GLU A 1 60  ? 153.289 170.989 129.768 1.00 169.46 ? 59  GLU A CB    1 
ATOM   198   C CG    . GLU A 1 60  ? 153.540 172.442 130.106 1.00 169.46 ? 59  GLU A CG    1 
ATOM   199   C CD    . GLU A 1 60  ? 152.259 173.233 130.238 1.00 169.46 ? 59  GLU A CD    1 
ATOM   200   O OE1   . GLU A 1 60  ? 151.247 172.820 129.637 1.00 169.46 ? 59  GLU A OE1   1 
ATOM   201   O OE2   . GLU A 1 60  ? 152.259 174.255 130.952 1.00 169.46 ? 59  GLU A OE2   1 
ATOM   202   N N     . LEU A 1 61  ? 155.387 169.998 131.566 1.00 165.77 ? 60  LEU A N     1 
ATOM   203   C CA    . LEU A 1 61  ? 156.529 170.145 132.445 1.00 165.77 ? 60  LEU A CA    1 
ATOM   204   C C     . LEU A 1 61  ? 156.900 171.616 132.596 1.00 165.77 ? 60  LEU A C     1 
ATOM   205   O O     . LEU A 1 61  ? 156.398 172.491 131.889 1.00 165.77 ? 60  LEU A O     1 
ATOM   206   C CB    . LEU A 1 61  ? 157.714 169.350 131.914 1.00 165.77 ? 60  LEU A CB    1 
ATOM   207   C CG    . LEU A 1 61  ? 157.472 167.851 131.781 1.00 165.77 ? 60  LEU A CG    1 
ATOM   208   C CD1   . LEU A 1 61  ? 158.772 167.157 131.447 1.00 165.77 ? 60  LEU A CD1   1 
ATOM   209   C CD2   . LEU A 1 61  ? 156.870 167.283 133.054 1.00 165.77 ? 60  LEU A CD2   1 
ATOM   210   N N     . LEU A 1 62  ? 157.786 171.885 133.542 1.00 160.36 ? 61  LEU A N     1 
ATOM   211   C CA    . LEU A 1 62  ? 158.249 173.242 133.778 1.00 160.36 ? 61  LEU A CA    1 
ATOM   212   C C     . LEU A 1 62  ? 159.757 173.360 133.715 1.00 160.36 ? 61  LEU A C     1 
ATOM   213   O O     . LEU A 1 62  ? 160.273 174.355 133.209 1.00 160.36 ? 61  LEU A O     1 
ATOM   214   C CB    . LEU A 1 62  ? 157.773 173.754 135.137 1.00 160.36 ? 61  LEU A CB    1 
ATOM   215   C CG    . LEU A 1 62  ? 156.321 174.204 135.289 1.00 160.36 ? 61  LEU A CG    1 
ATOM   216   C CD1   . LEU A 1 62  ? 155.951 175.142 134.168 1.00 160.36 ? 61  LEU A CD1   1 
ATOM   217   C CD2   . LEU A 1 62  ? 155.326 173.074 135.423 1.00 160.36 ? 61  LEU A CD2   1 
ATOM   218   N N     . ILE A 1 63  ? 160.477 172.366 134.225 1.00 155.03 ? 62  ILE A N     1 
ATOM   219   C CA    . ILE A 1 63  ? 161.925 172.357 134.104 1.00 155.03 ? 62  ILE A CA    1 
ATOM   220   C C     . ILE A 1 63  ? 162.302 171.954 132.690 1.00 155.03 ? 62  ILE A C     1 
ATOM   221   O O     . ILE A 1 63  ? 161.699 171.049 132.102 1.00 155.03 ? 62  ILE A O     1 
ATOM   222   C CB    . ILE A 1 63  ? 162.532 171.400 135.140 1.00 155.03 ? 62  ILE A CB    1 
ATOM   223   C CG1   . ILE A 1 63  ? 161.860 171.611 136.494 1.00 155.03 ? 62  ILE A CG1   1 
ATOM   224   C CG2   . ILE A 1 63  ? 164.027 171.605 135.250 1.00 155.03 ? 62  ILE A CG2   1 
ATOM   225   C CD1   . ILE A 1 63  ? 162.311 170.643 137.549 1.00 155.03 ? 62  ILE A CD1   1 
ATOM   226   N N     . ARG A 1 64  ? 163.294 172.630 132.130 1.00 169.97 ? 63  ARG A N     1 
ATOM   227   C CA    . ARG A 1 64  ? 163.723 172.325 130.778 1.00 169.97 ? 63  ARG A CA    1 
ATOM   228   C C     . ARG A 1 64  ? 164.552 171.052 130.773 1.00 169.97 ? 63  ARG A C     1 
ATOM   229   O O     . ARG A 1 64  ? 165.353 170.812 131.677 1.00 169.97 ? 63  ARG A O     1 
ATOM   230   C CB    . ARG A 1 64  ? 164.507 173.494 130.197 1.00 169.97 ? 63  ARG A CB    1 
ATOM   231   C CG    . ARG A 1 64  ? 163.643 174.722 130.009 1.00 169.97 ? 63  ARG A CG    1 
ATOM   232   C CD    . ARG A 1 64  ? 164.393 175.803 129.280 1.00 169.97 ? 63  ARG A CD    1 
ATOM   233   N NE    . ARG A 1 64  ? 163.521 176.572 128.401 1.00 169.97 ? 63  ARG A NE    1 
ATOM   234   C CZ    . ARG A 1 64  ? 163.200 176.204 127.167 1.00 169.97 ? 63  ARG A CZ    1 
ATOM   235   N NH1   . ARG A 1 64  ? 163.672 175.072 126.667 1.00 169.97 ? 63  ARG A NH1   1 
ATOM   236   N NH2   . ARG A 1 64  ? 162.405 176.965 126.431 1.00 169.97 ? 63  ARG A NH2   1 
ATOM   237   N N     . LYS A 1 65  ? 164.359 170.244 129.733 1.00 165.48 ? 64  LYS A N     1 
ATOM   238   C CA    . LYS A 1 65  ? 164.692 168.830 129.817 1.00 165.48 ? 64  LYS A CA    1 
ATOM   239   C C     . LYS A 1 65  ? 166.187 168.572 129.721 1.00 165.48 ? 64  LYS A C     1 
ATOM   240   O O     . LYS A 1 65  ? 166.695 167.655 130.371 1.00 165.48 ? 64  LYS A O     1 
ATOM   241   C CB    . LYS A 1 65  ? 163.951 168.067 128.729 1.00 165.48 ? 64  LYS A CB    1 
ATOM   242   C CG    . LYS A 1 65  ? 162.447 168.106 128.891 1.00 165.48 ? 64  LYS A CG    1 
ATOM   243   C CD    . LYS A 1 65  ? 161.742 167.755 127.593 1.00 165.48 ? 64  LYS A CD    1 
ATOM   244   C CE    . LYS A 1 65  ? 160.241 167.660 127.792 1.00 165.48 ? 64  LYS A CE    1 
ATOM   245   N NZ    . LYS A 1 65  ? 159.706 168.817 128.555 1.00 165.48 ? 64  LYS A NZ    1 
ATOM   246   N N     . LEU A 1 66  ? 166.904 169.343 128.929 1.00 160.12 ? 65  LEU A N     1 
ATOM   247   C CA    . LEU A 1 66  ? 168.338 169.100 128.824 1.00 160.12 ? 65  LEU A CA    1 
ATOM   248   C C     . LEU A 1 66  ? 169.160 169.516 130.049 1.00 160.12 ? 65  LEU A C     1 
ATOM   249   O O     . LEU A 1 66  ? 170.084 168.767 130.406 1.00 160.12 ? 65  LEU A O     1 
ATOM   250   C CB    . LEU A 1 66  ? 168.890 169.755 127.559 1.00 160.12 ? 65  LEU A CB    1 
ATOM   251   C CG    . LEU A 1 66  ? 168.822 168.810 126.366 1.00 160.12 ? 65  LEU A CG    1 
ATOM   252   C CD1   . LEU A 1 66  ? 169.070 169.537 125.064 1.00 160.12 ? 65  LEU A CD1   1 
ATOM   253   C CD2   . LEU A 1 66  ? 169.832 167.700 126.558 1.00 160.12 ? 65  LEU A CD2   1 
ATOM   254   N N     . PRO A 1 67  ? 168.899 170.650 130.730 1.00 160.69 ? 66  PRO A N     1 
ATOM   255   C CA    . PRO A 1 67  ? 169.597 170.866 132.008 1.00 160.69 ? 66  PRO A CA    1 
ATOM   256   C C     . PRO A 1 67  ? 169.243 169.849 133.068 1.00 160.69 ? 66  PRO A C     1 
ATOM   257   O O     . PRO A 1 67  ? 170.120 169.451 133.844 1.00 160.69 ? 66  PRO A O     1 
ATOM   258   C CB    . PRO A 1 67  ? 169.149 172.271 132.420 1.00 160.69 ? 66  PRO A CB    1 
ATOM   259   C CG    . PRO A 1 67  ? 168.870 172.930 131.176 1.00 160.69 ? 66  PRO A CG    1 
ATOM   260   C CD    . PRO A 1 67  ? 168.206 171.895 130.342 1.00 160.69 ? 66  PRO A CD    1 
ATOM   261   N N     . PHE A 1 68  ? 167.991 169.392 133.099 1.00 154.47 ? 67  PHE A N     1 
ATOM   262   C CA    . PHE A 1 68  ? 167.615 168.357 134.050 1.00 154.47 ? 67  PHE A CA    1 
ATOM   263   C C     . PHE A 1 68  ? 168.313 167.045 133.742 1.00 154.47 ? 67  PHE A C     1 
ATOM   264   O O     . PHE A 1 68  ? 168.737 166.335 134.658 1.00 154.47 ? 67  PHE A O     1 
ATOM   265   C CB    . PHE A 1 68  ? 166.108 168.156 134.049 1.00 154.47 ? 67  PHE A CB    1 
ATOM   266   C CG    . PHE A 1 68  ? 165.634 167.305 135.169 1.00 154.47 ? 67  PHE A CG    1 
ATOM   267   C CD1   . PHE A 1 68  ? 165.451 167.844 136.423 1.00 154.47 ? 67  PHE A CD1   1 
ATOM   268   C CD2   . PHE A 1 68  ? 165.397 165.962 134.980 1.00 154.47 ? 67  PHE A CD2   1 
ATOM   269   C CE1   . PHE A 1 68  ? 165.031 167.060 137.465 1.00 154.47 ? 67  PHE A CE1   1 
ATOM   270   C CE2   . PHE A 1 68  ? 164.989 165.177 136.017 1.00 154.47 ? 67  PHE A CE2   1 
ATOM   271   C CZ    . PHE A 1 68  ? 164.798 165.725 137.260 1.00 154.47 ? 67  PHE A CZ    1 
ATOM   272   N N     . GLN A 1 69  ? 168.445 166.714 132.462 1.00 160.82 ? 68  GLN A N     1 
ATOM   273   C CA    . GLN A 1 69  ? 169.112 165.481 132.075 1.00 160.82 ? 68  GLN A CA    1 
ATOM   274   C C     . GLN A 1 69  ? 170.589 165.521 132.426 1.00 160.82 ? 68  GLN A C     1 
ATOM   275   O O     . GLN A 1 69  ? 171.140 164.535 132.931 1.00 160.82 ? 68  GLN A O     1 
ATOM   276   C CB    . GLN A 1 69  ? 168.921 165.250 130.583 1.00 160.82 ? 68  GLN A CB    1 
ATOM   277   C CG    . GLN A 1 69  ? 169.681 164.076 130.038 1.00 160.82 ? 68  GLN A CG    1 
ATOM   278   C CD    . GLN A 1 69  ? 168.968 163.439 128.876 1.00 160.82 ? 68  GLN A CD    1 
ATOM   279   O OE1   . GLN A 1 69  ? 168.430 164.127 128.011 1.00 160.82 ? 68  GLN A OE1   1 
ATOM   280   N NE2   . GLN A 1 69  ? 168.945 162.114 128.855 1.00 160.82 ? 68  GLN A NE2   1 
ATOM   281   N N     . ARG A 1 70  ? 171.236 166.663 132.203 1.00 158.25 ? 69  ARG A N     1 
ATOM   282   C CA    . ARG A 1 70  ? 172.643 166.769 132.564 1.00 158.25 ? 69  ARG A CA    1 
ATOM   283   C C     . ARG A 1 70  ? 172.839 166.774 134.075 1.00 158.25 ? 69  ARG A C     1 
ATOM   284   O O     . ARG A 1 70  ? 173.826 166.214 134.570 1.00 158.25 ? 69  ARG A O     1 
ATOM   285   C CB    . ARG A 1 70  ? 173.244 168.015 131.929 1.00 158.25 ? 69  ARG A CB    1 
ATOM   286   C CG    . ARG A 1 70  ? 173.364 167.916 130.426 1.00 158.25 ? 69  ARG A CG    1 
ATOM   287   C CD    . ARG A 1 70  ? 173.736 169.245 129.825 1.00 158.25 ? 69  ARG A CD    1 
ATOM   288   N NE    . ARG A 1 70  ? 172.954 170.321 130.412 1.00 158.25 ? 69  ARG A NE    1 
ATOM   289   C CZ    . ARG A 1 70  ? 173.387 171.568 130.529 1.00 158.25 ? 69  ARG A CZ    1 
ATOM   290   N NH1   . ARG A 1 70  ? 174.595 171.889 130.094 1.00 158.25 ? 69  ARG A NH1   1 
ATOM   291   N NH2   . ARG A 1 70  ? 172.615 172.492 131.080 1.00 158.25 ? 69  ARG A NH2   1 
ATOM   292   N N     . LEU A 1 71  ? 171.892 167.350 134.821 1.00 156.12 ? 70  LEU A N     1 
ATOM   293   C CA    . LEU A 1 71  ? 171.952 167.301 136.280 1.00 156.12 ? 70  LEU A CA    1 
ATOM   294   C C     . LEU A 1 71  ? 171.807 165.875 136.796 1.00 156.12 ? 70  LEU A C     1 
ATOM   295   O O     . LEU A 1 71  ? 172.530 165.459 137.714 1.00 156.12 ? 70  LEU A O     1 
ATOM   296   C CB    . LEU A 1 71  ? 170.862 168.194 136.864 1.00 156.12 ? 70  LEU A CB    1 
ATOM   297   C CG    . LEU A 1 71  ? 170.417 167.941 138.299 1.00 156.12 ? 70  LEU A CG    1 
ATOM   298   C CD1   . LEU A 1 71  ? 171.489 168.399 139.249 1.00 156.12 ? 70  LEU A CD1   1 
ATOM   299   C CD2   . LEU A 1 71  ? 169.129 168.667 138.579 1.00 156.12 ? 70  LEU A CD2   1 
ATOM   300   N N     . VAL A 1 72  ? 170.888 165.111 136.205 1.00 155.74 ? 71  VAL A N     1 
ATOM   301   C CA    . VAL A 1 72  ? 170.682 163.729 136.613 1.00 155.74 ? 71  VAL A CA    1 
ATOM   302   C C     . VAL A 1 72  ? 171.902 162.890 136.277 1.00 155.74 ? 71  VAL A C     1 
ATOM   303   O O     . VAL A 1 72  ? 172.319 162.040 137.068 1.00 155.74 ? 71  VAL A O     1 
ATOM   304   C CB    . VAL A 1 72  ? 169.398 163.188 135.962 1.00 155.74 ? 71  VAL A CB    1 
ATOM   305   C CG1   . VAL A 1 72  ? 169.327 161.688 136.010 1.00 155.74 ? 71  VAL A CG1   1 
ATOM   306   C CG2   . VAL A 1 72  ? 168.210 163.749 136.669 1.00 155.74 ? 71  VAL A CG2   1 
ATOM   307   N N     . ARG A 1 73  ? 172.533 163.159 135.136 1.00 169.35 ? 72  ARG A N     1 
ATOM   308   C CA    . ARG A 1 73  ? 173.741 162.423 134.795 1.00 169.35 ? 72  ARG A CA    1 
ATOM   309   C C     . ARG A 1 73  ? 174.901 162.781 135.705 1.00 169.35 ? 72  ARG A C     1 
ATOM   310   O O     . ARG A 1 73  ? 175.738 161.921 135.994 1.00 169.35 ? 72  ARG A O     1 
ATOM   311   C CB    . ARG A 1 73  ? 174.115 162.667 133.343 1.00 169.35 ? 72  ARG A CB    1 
ATOM   312   C CG    . ARG A 1 73  ? 173.442 161.701 132.416 1.00 169.35 ? 72  ARG A CG    1 
ATOM   313   C CD    . ARG A 1 73  ? 173.192 162.312 131.061 1.00 169.35 ? 72  ARG A CD    1 
ATOM   314   N NE    . ARG A 1 73  ? 172.084 161.649 130.392 1.00 169.35 ? 72  ARG A NE    1 
ATOM   315   C CZ    . ARG A 1 73  ? 172.189 160.510 129.720 1.00 169.35 ? 72  ARG A CZ    1 
ATOM   316   N NH1   . ARG A 1 73  ? 173.359 159.896 129.609 1.00 169.35 ? 72  ARG A NH1   1 
ATOM   317   N NH2   . ARG A 1 73  ? 171.115 159.986 129.155 1.00 169.35 ? 72  ARG A NH2   1 
ATOM   318   N N     . GLU A 1 74  ? 174.957 164.015 136.199 1.00 178.57 ? 73  GLU A N     1 
ATOM   319   C CA    . GLU A 1 74  ? 176.020 164.322 137.145 1.00 178.57 ? 73  GLU A CA    1 
ATOM   320   C C     . GLU A 1 74  ? 175.769 163.757 138.526 1.00 178.57 ? 73  GLU A C     1 
ATOM   321   O O     . GLU A 1 74  ? 176.733 163.448 139.233 1.00 178.57 ? 73  GLU A O     1 
ATOM   322   C CB    . GLU A 1 74  ? 176.246 165.821 137.250 1.00 178.57 ? 73  GLU A CB    1 
ATOM   323   C CG    . GLU A 1 74  ? 176.820 166.403 135.993 1.00 178.57 ? 73  GLU A CG    1 
ATOM   324   C CD    . GLU A 1 74  ? 177.823 165.486 135.324 1.00 178.57 ? 73  GLU A CD    1 
ATOM   325   O OE1   . GLU A 1 74  ? 177.572 165.093 134.166 1.00 178.57 ? 73  GLU A OE1   1 
ATOM   326   O OE2   . GLU A 1 74  ? 178.869 165.176 135.938 1.00 178.57 ? 73  GLU A OE2   1 
ATOM   327   N N     . ILE A 1 75  ? 174.511 163.622 138.930 1.00 161.85 ? 74  ILE A N     1 
ATOM   328   C CA    . ILE A 1 75  ? 174.230 162.956 140.195 1.00 161.85 ? 74  ILE A CA    1 
ATOM   329   C C     . ILE A 1 75  ? 174.546 161.472 140.089 1.00 161.85 ? 74  ILE A C     1 
ATOM   330   O O     . ILE A 1 75  ? 175.248 160.906 140.933 1.00 161.85 ? 74  ILE A O     1 
ATOM   331   C CB    . ILE A 1 75  ? 172.775 163.203 140.611 1.00 161.85 ? 74  ILE A CB    1 
ATOM   332   C CG1   . ILE A 1 75  ? 172.621 164.653 141.025 1.00 161.85 ? 74  ILE A CG1   1 
ATOM   333   C CG2   . ILE A 1 75  ? 172.388 162.309 141.755 1.00 161.85 ? 74  ILE A CG2   1 
ATOM   334   C CD1   . ILE A 1 75  ? 171.221 165.115 141.008 1.00 161.85 ? 74  ILE A CD1   1 
ATOM   335   N N     . ALA A 1 76  ? 174.073 160.831 139.023 1.00 170.95 ? 75  ALA A N     1 
ATOM   336   C CA    . ALA A 1 76  ? 174.299 159.410 138.814 1.00 170.95 ? 75  ALA A CA    1 
ATOM   337   C C     . ALA A 1 76  ? 175.738 159.077 138.485 1.00 170.95 ? 75  ALA A C     1 
ATOM   338   O O     . ALA A 1 76  ? 176.111 157.908 138.578 1.00 170.95 ? 75  ALA A O     1 
ATOM   339   C CB    . ALA A 1 76  ? 173.408 158.893 137.692 1.00 170.95 ? 75  ALA A CB    1 
ATOM   340   N N     . GLN A 1 77  ? 176.544 160.056 138.086 1.00 192.86 ? 76  GLN A N     1 
ATOM   341   C CA    . GLN A 1 77  ? 177.950 159.779 137.861 1.00 192.86 ? 76  GLN A CA    1 
ATOM   342   C C     . GLN A 1 77  ? 178.690 159.529 139.166 1.00 192.86 ? 76  GLN A C     1 
ATOM   343   O O     . GLN A 1 77  ? 179.695 158.812 139.167 1.00 192.86 ? 76  GLN A O     1 
ATOM   344   C CB    . GLN A 1 77  ? 178.576 160.938 137.090 1.00 192.86 ? 76  GLN A CB    1 
ATOM   345   C CG    . GLN A 1 77  ? 179.899 160.611 136.453 1.00 192.86 ? 76  GLN A CG    1 
ATOM   346   C CD    . GLN A 1 77  ? 181.051 160.949 137.358 1.00 192.86 ? 76  GLN A CD    1 
ATOM   347   O OE1   . GLN A 1 77  ? 181.042 161.977 138.033 1.00 192.86 ? 76  GLN A OE1   1 
ATOM   348   N NE2   . GLN A 1 77  ? 182.025 160.057 137.427 1.00 192.86 ? 76  GLN A NE2   1 
ATOM   349   N N     . ASP A 1 78  ? 178.196 160.082 140.274 1.00 177.23 ? 77  ASP A N     1 
ATOM   350   C CA    . ASP A 1 78  ? 178.867 159.934 141.560 1.00 177.23 ? 77  ASP A CA    1 
ATOM   351   C C     . ASP A 1 78  ? 178.812 158.498 142.066 1.00 177.23 ? 77  ASP A C     1 
ATOM   352   O O     . ASP A 1 78  ? 179.773 158.010 142.668 1.00 177.23 ? 77  ASP A O     1 
ATOM   353   C CB    . ASP A 1 78  ? 178.233 160.875 142.580 1.00 177.23 ? 77  ASP A CB    1 
ATOM   354   C CG    . ASP A 1 78  ? 179.105 161.089 143.794 1.00 177.23 ? 77  ASP A CG    1 
ATOM   355   O OD1   . ASP A 1 78  ? 178.612 161.675 144.779 1.00 177.23 ? 77  ASP A OD1   1 
ATOM   356   O OD2   . ASP A 1 78  ? 180.286 160.685 143.763 1.00 177.23 ? 77  ASP A OD2   1 
ATOM   357   N N     . PHE A 1 79  ? 177.703 157.807 141.831 1.00 162.44 ? 78  PHE A N     1 
ATOM   358   C CA    . PHE A 1 79  ? 177.548 156.471 142.387 1.00 162.44 ? 78  PHE A CA    1 
ATOM   359   C C     . PHE A 1 79  ? 178.250 155.430 141.532 1.00 162.44 ? 78  PHE A C     1 
ATOM   360   O O     . PHE A 1 79  ? 178.901 154.522 142.058 1.00 162.44 ? 78  PHE A O     1 
ATOM   361   C CB    . PHE A 1 79  ? 176.069 156.146 142.537 1.00 162.44 ? 78  PHE A CB    1 
ATOM   362   C CG    . PHE A 1 79  ? 175.317 157.167 143.321 1.00 162.44 ? 78  PHE A CG    1 
ATOM   363   C CD1   . PHE A 1 79  ? 175.834 157.665 144.501 1.00 162.44 ? 78  PHE A CD1   1 
ATOM   364   C CD2   . PHE A 1 79  ? 174.106 157.647 142.872 1.00 162.44 ? 78  PHE A CD2   1 
ATOM   365   C CE1   . PHE A 1 79  ? 175.148 158.612 145.223 1.00 162.44 ? 78  PHE A CE1   1 
ATOM   366   C CE2   . PHE A 1 79  ? 173.423 158.599 143.586 1.00 162.44 ? 78  PHE A CE2   1 
ATOM   367   C CZ    . PHE A 1 79  ? 173.941 159.077 144.765 1.00 162.44 ? 78  PHE A CZ    1 
ATOM   368   N N     . LYS A 1 80  ? 178.139 155.550 140.214 1.00 173.83 ? 79  LYS A N     1 
ATOM   369   C CA    . LYS A 1 80  ? 178.782 154.626 139.294 1.00 173.83 ? 79  LYS A CA    1 
ATOM   370   C C     . LYS A 1 80  ? 178.974 155.347 137.969 1.00 173.83 ? 79  LYS A C     1 
ATOM   371   O O     . LYS A 1 80  ? 178.173 156.208 137.607 1.00 173.83 ? 79  LYS A O     1 
ATOM   372   C CB    . LYS A 1 80  ? 177.952 153.353 139.132 1.00 173.83 ? 79  LYS A CB    1 
ATOM   373   C CG    . LYS A 1 80  ? 178.644 152.224 138.406 1.00 173.83 ? 79  LYS A CG    1 
ATOM   374   C CD    . LYS A 1 80  ? 177.694 151.066 138.185 1.00 173.83 ? 79  LYS A CD    1 
ATOM   375   C CE    . LYS A 1 80  ? 178.288 150.048 137.233 1.00 173.83 ? 79  LYS A CE    1 
ATOM   376   N NZ    . LYS A 1 80  ? 177.453 148.823 137.139 1.00 173.83 ? 79  LYS A NZ    1 
ATOM   377   N N     . THR A 1 81  ? 180.040 155.002 137.252 1.00 188.28 ? 80  THR A N     1 
ATOM   378   C CA    . THR A 1 81  ? 180.496 155.845 136.153 1.00 188.28 ? 80  THR A CA    1 
ATOM   379   C C     . THR A 1 81  ? 179.709 155.607 134.868 1.00 188.28 ? 80  THR A C     1 
ATOM   380   O O     . THR A 1 81  ? 179.031 156.506 134.363 1.00 188.28 ? 80  THR A O     1 
ATOM   381   C CB    . THR A 1 81  ? 181.979 155.594 135.910 1.00 188.28 ? 80  THR A CB    1 
ATOM   382   O OG1   . THR A 1 81  ? 182.142 154.307 135.307 1.00 188.28 ? 80  THR A OG1   1 
ATOM   383   C CG2   . THR A 1 81  ? 182.717 155.606 137.230 1.00 188.28 ? 80  THR A CG2   1 
ATOM   384   N N     . ASP A 1 82  ? 179.795 154.396 134.325 1.00 195.02 ? 81  ASP A N     1 
ATOM   385   C CA    . ASP A 1 82  ? 179.295 154.088 132.985 1.00 195.02 ? 81  ASP A CA    1 
ATOM   386   C C     . ASP A 1 82  ? 177.797 153.819 133.095 1.00 195.02 ? 81  ASP A C     1 
ATOM   387   O O     . ASP A 1 82  ? 177.336 152.677 133.145 1.00 195.02 ? 81  ASP A O     1 
ATOM   388   C CB    . ASP A 1 82  ? 180.065 152.897 132.417 1.00 195.02 ? 81  ASP A CB    1 
ATOM   389   C CG    . ASP A 1 82  ? 179.745 152.590 130.950 1.00 195.02 ? 81  ASP A CG    1 
ATOM   390   O OD1   . ASP A 1 82  ? 178.572 152.518 130.526 1.00 195.02 ? 81  ASP A OD1   1 
ATOM   391   O OD2   . ASP A 1 82  ? 180.722 152.408 130.196 1.00 195.02 ? 81  ASP A OD2   1 
ATOM   392   N N     . LEU A 1 83  ? 177.017 154.892 133.130 1.00 178.89 ? 82  LEU A N     1 
ATOM   393   C CA    . LEU A 1 83  ? 175.570 154.776 133.251 1.00 178.89 ? 82  LEU A CA    1 
ATOM   394   C C     . LEU A 1 83  ? 174.882 155.375 132.040 1.00 178.89 ? 82  LEU A C     1 
ATOM   395   O O     . LEU A 1 83  ? 174.955 156.584 131.812 1.00 178.89 ? 82  LEU A O     1 
ATOM   396   C CB    . LEU A 1 83  ? 175.056 155.440 134.524 1.00 178.89 ? 82  LEU A CB    1 
ATOM   397   C CG    . LEU A 1 83  ? 174.796 154.481 135.682 1.00 178.89 ? 82  LEU A CG    1 
ATOM   398   C CD1   . LEU A 1 83  ? 173.727 153.518 135.262 1.00 178.89 ? 82  LEU A CD1   1 
ATOM   399   C CD2   . LEU A 1 83  ? 176.013 153.719 136.090 1.00 178.89 ? 82  LEU A CD2   1 
ATOM   400   N N     . ARG A 1 84  ? 174.193 154.531 131.285 1.00 176.45 ? 83  ARG A N     1 
ATOM   401   C CA    . ARG A 1 84  ? 173.277 154.991 130.257 1.00 176.45 ? 83  ARG A CA    1 
ATOM   402   C C     . ARG A 1 84  ? 171.951 155.331 130.921 1.00 176.45 ? 83  ARG A C     1 
ATOM   403   O O     . ARG A 1 84  ? 171.795 155.216 132.137 1.00 176.45 ? 83  ARG A O     1 
ATOM   404   C CB    . ARG A 1 84  ? 173.112 153.925 129.188 1.00 176.45 ? 83  ARG A CB    1 
ATOM   405   C CG    . ARG A 1 84  ? 174.364 153.145 128.944 1.00 176.45 ? 83  ARG A CG    1 
ATOM   406   C CD    . ARG A 1 84  ? 174.264 152.339 127.678 1.00 176.45 ? 83  ARG A CD    1 
ATOM   407   N NE    . ARG A 1 84  ? 174.274 153.166 126.482 1.00 176.45 ? 83  ARG A NE    1 
ATOM   408   C CZ    . ARG A 1 84  ? 174.067 152.705 125.253 1.00 176.45 ? 83  ARG A CZ    1 
ATOM   409   N NH1   . ARG A 1 84  ? 173.830 151.415 125.059 1.00 176.45 ? 83  ARG A NH1   1 
ATOM   410   N NH2   . ARG A 1 84  ? 174.102 153.531 124.217 1.00 176.45 ? 83  ARG A NH2   1 
ATOM   411   N N     . PHE A 1 85  ? 170.963 155.724 130.129 1.00 165.30 ? 84  PHE A N     1 
ATOM   412   C CA    . PHE A 1 85  ? 169.643 155.984 130.672 1.00 165.30 ? 84  PHE A CA    1 
ATOM   413   C C     . PHE A 1 85  ? 168.610 155.597 129.637 1.00 165.30 ? 84  PHE A C     1 
ATOM   414   O O     . PHE A 1 85  ? 168.931 155.358 128.474 1.00 165.30 ? 84  PHE A O     1 
ATOM   415   C CB    . PHE A 1 85  ? 169.482 157.441 131.085 1.00 165.30 ? 84  PHE A CB    1 
ATOM   416   C CG    . PHE A 1 85  ? 170.092 157.746 132.402 1.00 165.30 ? 84  PHE A CG    1 
ATOM   417   C CD1   . PHE A 1 85  ? 169.448 157.392 133.563 1.00 165.30 ? 84  PHE A CD1   1 
ATOM   418   C CD2   . PHE A 1 85  ? 171.326 158.347 132.481 1.00 165.30 ? 84  PHE A CD2   1 
ATOM   419   C CE1   . PHE A 1 85  ? 170.010 157.652 134.782 1.00 165.30 ? 84  PHE A CE1   1 
ATOM   420   C CE2   . PHE A 1 85  ? 171.892 158.607 133.699 1.00 165.30 ? 84  PHE A CE2   1 
ATOM   421   C CZ    . PHE A 1 85  ? 171.232 158.257 134.850 1.00 165.30 ? 84  PHE A CZ    1 
ATOM   422   N N     . GLN A 1 86  ? 167.360 155.543 130.069 1.00 164.74 ? 85  GLN A N     1 
ATOM   423   C CA    . GLN A 1 86  ? 166.331 154.985 129.212 1.00 164.74 ? 85  GLN A CA    1 
ATOM   424   C C     . GLN A 1 86  ? 165.782 155.993 128.224 1.00 164.74 ? 85  GLN A C     1 
ATOM   425   O O     . GLN A 1 86  ? 165.169 155.586 127.230 1.00 164.74 ? 85  GLN A O     1 
ATOM   426   C CB    . GLN A 1 86  ? 165.193 154.428 130.062 1.00 164.74 ? 85  GLN A CB    1 
ATOM   427   C CG    . GLN A 1 86  ? 164.419 153.306 129.412 1.00 164.74 ? 85  GLN A CG    1 
ATOM   428   C CD    . GLN A 1 86  ? 165.322 152.244 128.844 1.00 164.74 ? 85  GLN A CD    1 
ATOM   429   O OE1   . GLN A 1 86  ? 165.287 151.966 127.650 1.00 164.74 ? 85  GLN A OE1   1 
ATOM   430   N NE2   . GLN A 1 86  ? 166.131 151.633 129.698 1.00 164.74 ? 85  GLN A NE2   1 
ATOM   431   N N     . SER A 1 87  ? 165.972 157.290 128.490 1.00 164.88 ? 86  SER A N     1 
ATOM   432   C CA    . SER A 1 87  ? 165.395 158.483 127.853 1.00 164.88 ? 86  SER A CA    1 
ATOM   433   C C     . SER A 1 87  ? 163.900 158.618 128.116 1.00 164.88 ? 86  SER A C     1 
ATOM   434   O O     . SER A 1 87  ? 163.303 159.619 127.713 1.00 164.88 ? 86  SER A O     1 
ATOM   435   C CB    . SER A 1 87  ? 165.649 158.582 126.338 1.00 164.88 ? 86  SER A CB    1 
ATOM   436   O OG    . SER A 1 87  ? 165.197 157.442 125.627 1.00 164.88 ? 86  SER A OG    1 
ATOM   437   N N     . SER A 1 88  ? 163.277 157.644 128.769 1.00 155.61 ? 87  SER A N     1 
ATOM   438   C CA    . SER A 1 88  ? 162.035 157.843 129.486 1.00 155.61 ? 87  SER A CA    1 
ATOM   439   C C     . SER A 1 88  ? 162.258 157.819 130.984 1.00 155.61 ? 87  SER A C     1 
ATOM   440   O O     . SER A 1 88  ? 161.394 158.281 131.736 1.00 155.61 ? 87  SER A O     1 
ATOM   441   C CB    . SER A 1 88  ? 161.027 156.765 129.106 1.00 155.61 ? 87  SER A CB    1 
ATOM   442   O OG    . SER A 1 88  ? 161.655 155.500 129.100 1.00 155.61 ? 87  SER A OG    1 
ATOM   443   N N     . ALA A 1 89  ? 163.411 157.306 131.419 1.00 152.50 ? 88  ALA A N     1 
ATOM   444   C CA    . ALA A 1 89  ? 163.762 157.326 132.832 1.00 152.50 ? 88  ALA A CA    1 
ATOM   445   C C     . ALA A 1 89  ? 163.908 158.750 133.341 1.00 152.50 ? 88  ALA A C     1 
ATOM   446   O O     . ALA A 1 89  ? 163.414 159.086 134.424 1.00 152.50 ? 88  ALA A O     1 
ATOM   447   C CB    . ALA A 1 89  ? 165.056 156.554 133.062 1.00 152.50 ? 88  ALA A CB    1 
ATOM   448   N N     . VAL A 1 90  ? 164.581 159.602 132.565 1.00 153.64 ? 89  VAL A N     1 
ATOM   449   C CA    . VAL A 1 90  ? 164.782 160.977 132.994 1.00 153.64 ? 89  VAL A CA    1 
ATOM   450   C C     . VAL A 1 90  ? 163.473 161.747 132.984 1.00 153.64 ? 89  VAL A C     1 
ATOM   451   O O     . VAL A 1 90  ? 163.249 162.594 133.850 1.00 153.64 ? 89  VAL A O     1 
ATOM   452   C CB    . VAL A 1 90  ? 165.863 161.659 132.142 1.00 153.64 ? 89  VAL A CB    1 
ATOM   453   C CG1   . VAL A 1 90  ? 167.194 161.027 132.423 1.00 153.64 ? 89  VAL A CG1   1 
ATOM   454   C CG2   . VAL A 1 90  ? 165.553 161.525 130.677 1.00 153.64 ? 89  VAL A CG2   1 
ATOM   455   N N     . MET A 1 91  ? 162.561 161.418 132.069 1.00 157.58 ? 90  MET A N     1 
ATOM   456   C CA    . MET A 1 91  ? 161.235 162.018 132.096 1.00 157.58 ? 90  MET A CA    1 
ATOM   457   C C     . MET A 1 91  ? 160.453 161.547 133.314 1.00 157.58 ? 90  MET A C     1 
ATOM   458   O O     . MET A 1 91  ? 159.714 162.331 133.928 1.00 157.58 ? 90  MET A O     1 
ATOM   459   C CB    . MET A 1 91  ? 160.489 161.675 130.813 1.00 157.58 ? 90  MET A CB    1 
ATOM   460   C CG    . MET A 1 91  ? 159.258 162.510 130.568 1.00 157.58 ? 90  MET A CG    1 
ATOM   461   S SD    . MET A 1 91  ? 159.585 163.976 129.586 1.00 157.58 ? 90  MET A SD    1 
ATOM   462   C CE    . MET A 1 91  ? 157.927 164.390 129.051 1.00 157.58 ? 90  MET A CE    1 
ATOM   463   N N     . ALA A 1 92  ? 160.643 160.281 133.695 1.00 153.06 ? 91  ALA A N     1 
ATOM   464   C CA    . ALA A 1 92  ? 159.968 159.727 134.863 1.00 153.06 ? 91  ALA A CA    1 
ATOM   465   C C     . ALA A 1 92  ? 160.400 160.432 136.138 1.00 153.06 ? 91  ALA A C     1 
ATOM   466   O O     . ALA A 1 92  ? 159.563 160.934 136.902 1.00 153.06 ? 91  ALA A O     1 
ATOM   467   C CB    . ALA A 1 92  ? 160.246 158.231 134.961 1.00 153.06 ? 91  ALA A CB    1 
ATOM   468   N N     . LEU A 1 93  ? 161.700 160.525 136.373 1.00 144.55 ? 92  LEU A N     1 
ATOM   469   C CA    . LEU A 1 93  ? 162.060 161.192 137.610 1.00 144.55 ? 92  LEU A CA    1 
ATOM   470   C C     . LEU A 1 93  ? 162.017 162.706 137.488 1.00 144.55 ? 92  LEU A C     1 
ATOM   471   O O     . LEU A 1 93  ? 162.028 163.385 138.516 1.00 144.55 ? 92  LEU A O     1 
ATOM   472   C CB    . LEU A 1 93  ? 163.414 160.732 138.150 1.00 144.55 ? 92  LEU A CB    1 
ATOM   473   C CG    . LEU A 1 93  ? 164.801 161.201 137.767 1.00 144.55 ? 92  LEU A CG    1 
ATOM   474   C CD1   . LEU A 1 93  ? 165.666 160.888 138.945 1.00 144.55 ? 92  LEU A CD1   1 
ATOM   475   C CD2   . LEU A 1 93  ? 165.331 160.456 136.614 1.00 144.55 ? 92  LEU A CD2   1 
ATOM   476   N N     . GLN A 1 94  ? 161.865 163.248 136.278 1.00 154.80 ? 93  GLN A N     1 
ATOM   477   C CA    . GLN A 1 94  ? 161.502 164.652 136.159 1.00 154.80 ? 93  GLN A CA    1 
ATOM   478   C C     . GLN A 1 94  ? 160.099 164.892 136.674 1.00 154.80 ? 93  GLN A C     1 
ATOM   479   O O     . GLN A 1 94  ? 159.867 165.849 137.421 1.00 154.80 ? 93  GLN A O     1 
ATOM   480   C CB    . GLN A 1 94  ? 161.623 165.112 134.711 1.00 154.80 ? 93  GLN A CB    1 
ATOM   481   C CG    . GLN A 1 94  ? 161.129 166.525 134.477 1.00 154.80 ? 93  GLN A CG    1 
ATOM   482   C CD    . GLN A 1 94  ? 161.852 167.209 133.345 1.00 154.80 ? 93  GLN A CD    1 
ATOM   483   O OE1   . GLN A 1 94  ? 162.719 166.620 132.702 1.00 154.80 ? 93  GLN A OE1   1 
ATOM   484   N NE2   . GLN A 1 94  ? 161.505 168.461 133.095 1.00 154.80 ? 93  GLN A NE2   1 
ATOM   485   N N     . GLU A 1 95  ? 159.158 164.021 136.303 1.00 153.88 ? 94  GLU A N     1 
ATOM   486   C CA    . GLU A 1 95  ? 157.810 164.118 136.850 1.00 153.88 ? 94  GLU A CA    1 
ATOM   487   C C     . GLU A 1 95  ? 157.796 163.900 138.353 1.00 153.88 ? 94  GLU A C     1 
ATOM   488   O O     . GLU A 1 95  ? 157.038 164.568 139.069 1.00 153.88 ? 94  GLU A O     1 
ATOM   489   C CB    . GLU A 1 95  ? 156.894 163.118 136.162 1.00 153.88 ? 94  GLU A CB    1 
ATOM   490   C CG    . GLU A 1 95  ? 156.429 163.581 134.803 1.00 153.88 ? 94  GLU A CG    1 
ATOM   491   C CD    . GLU A 1 95  ? 155.154 164.399 134.877 1.00 153.88 ? 94  GLU A CD    1 
ATOM   492   O OE1   . GLU A 1 95  ? 154.672 164.855 133.819 1.00 153.88 ? 94  GLU A OE1   1 
ATOM   493   O OE2   . GLU A 1 95  ? 154.628 164.585 135.995 1.00 153.88 ? 94  GLU A OE2   1 
ATOM   494   N N     . ALA A 1 96  ? 158.668 163.022 138.846 1.00 149.01 ? 95  ALA A N     1 
ATOM   495   C CA    . ALA A 1 96  ? 158.769 162.792 140.284 1.00 149.01 ? 95  ALA A CA    1 
ATOM   496   C C     . ALA A 1 96  ? 159.261 164.027 141.024 1.00 149.01 ? 95  ALA A C     1 
ATOM   497   O O     . ALA A 1 96  ? 158.648 164.456 142.011 1.00 149.01 ? 95  ALA A O     1 
ATOM   498   C CB    . ALA A 1 96  ? 159.705 161.629 140.556 1.00 149.01 ? 95  ALA A CB    1 
ATOM   499   N N     . SER A 1 97  ? 160.376 164.600 140.566 1.00 148.37 ? 96  SER A N     1 
ATOM   500   C CA    . SER A 1 97  ? 160.947 165.766 141.227 1.00 148.37 ? 96  SER A CA    1 
ATOM   501   C C     . SER A 1 97  ? 160.033 166.972 141.104 1.00 148.37 ? 96  SER A C     1 
ATOM   502   O O     . SER A 1 97  ? 159.960 167.800 142.020 1.00 148.37 ? 96  SER A O     1 
ATOM   503   C CB    . SER A 1 97  ? 162.310 166.073 140.630 1.00 148.37 ? 96  SER A CB    1 
ATOM   504   O OG    . SER A 1 97  ? 162.246 165.968 139.224 1.00 148.37 ? 96  SER A OG    1 
ATOM   505   N N     . GLU A 1 98  ? 159.298 167.063 139.996 1.00 156.29 ? 97  GLU A N     1 
ATOM   506   C CA    . GLU A 1 98  ? 158.338 168.141 139.839 1.00 156.29 ? 97  GLU A CA    1 
ATOM   507   C C     . GLU A 1 98  ? 157.195 168.011 140.828 1.00 156.29 ? 97  GLU A C     1 
ATOM   508   O O     . GLU A 1 98  ? 156.808 169.003 141.451 1.00 156.29 ? 97  GLU A O     1 
ATOM   509   C CB    . GLU A 1 98  ? 157.804 168.160 138.418 1.00 156.29 ? 97  GLU A CB    1 
ATOM   510   C CG    . GLU A 1 98  ? 158.602 169.020 137.491 1.00 156.29 ? 97  GLU A CG    1 
ATOM   511   C CD    . GLU A 1 98  ? 157.760 169.559 136.360 1.00 156.29 ? 97  GLU A CD    1 
ATOM   512   O OE1   . GLU A 1 98  ? 156.634 169.057 136.170 1.00 156.29 ? 97  GLU A OE1   1 
ATOM   513   O OE2   . GLU A 1 98  ? 158.219 170.483 135.659 1.00 156.29 ? 97  GLU A OE2   1 
ATOM   514   N N     . ALA A 1 99  ? 156.656 166.800 141.001 1.00 149.33 ? 98  ALA A N     1 
ATOM   515   C CA    . ALA A 1 99  ? 155.583 166.613 141.972 1.00 149.33 ? 98  ALA A CA    1 
ATOM   516   C C     . ALA A 1 99  ? 156.062 166.865 143.395 1.00 149.33 ? 98  ALA A C     1 
ATOM   517   O O     . ALA A 1 99  ? 155.326 167.455 144.204 1.00 149.33 ? 98  ALA A O     1 
ATOM   518   C CB    . ALA A 1 99  ? 155.005 165.208 141.848 1.00 149.33 ? 98  ALA A CB    1 
ATOM   519   N N     . TYR A 1 100 ? 157.306 166.482 143.689 1.00 142.86 ? 99  TYR A N     1 
ATOM   520   C CA    . TYR A 1 100 ? 157.878 166.729 145.005 1.00 142.86 ? 99  TYR A CA    1 
ATOM   521   C C     . TYR A 1 100 ? 158.009 168.218 145.284 1.00 142.86 ? 99  TYR A C     1 
ATOM   522   O O     . TYR A 1 100 ? 157.590 168.696 146.346 1.00 142.86 ? 99  TYR A O     1 
ATOM   523   C CB    . TYR A 1 100 ? 159.235 166.052 145.115 1.00 142.86 ? 99  TYR A CB    1 
ATOM   524   C CG    . TYR A 1 100 ? 159.900 166.244 146.448 1.00 142.86 ? 99  TYR A CG    1 
ATOM   525   C CD1   . TYR A 1 100 ? 159.182 166.120 147.628 1.00 142.86 ? 99  TYR A CD1   1 
ATOM   526   C CD2   . TYR A 1 100 ? 161.250 166.527 146.530 1.00 142.86 ? 99  TYR A CD2   1 
ATOM   527   C CE1   . TYR A 1 100 ? 159.788 166.291 148.848 1.00 142.86 ? 99  TYR A CE1   1 
ATOM   528   C CE2   . TYR A 1 100 ? 161.866 166.692 147.744 1.00 142.86 ? 99  TYR A CE2   1 
ATOM   529   C CZ    . TYR A 1 100 ? 161.131 166.572 148.899 1.00 142.86 ? 99  TYR A CZ    1 
ATOM   530   O OH    . TYR A 1 100 ? 161.741 166.738 150.117 1.00 142.86 ? 99  TYR A OH    1 
ATOM   531   N N     . LEU A 1 101 ? 158.567 168.973 144.335 1.00 142.10 ? 100 LEU A N     1 
ATOM   532   C CA    . LEU A 1 101 ? 158.743 170.398 144.575 1.00 142.10 ? 100 LEU A CA    1 
ATOM   533   C C     . LEU A 1 101 ? 157.427 171.148 144.557 1.00 142.10 ? 100 LEU A C     1 
ATOM   534   O O     . LEU A 1 101 ? 157.305 172.172 145.229 1.00 142.10 ? 100 LEU A O     1 
ATOM   535   C CB    . LEU A 1 101 ? 159.687 171.018 143.558 1.00 142.10 ? 100 LEU A CB    1 
ATOM   536   C CG    . LEU A 1 101 ? 161.139 170.597 143.663 1.00 142.10 ? 100 LEU A CG    1 
ATOM   537   C CD1   . LEU A 1 101 ? 161.920 171.371 142.642 1.00 142.10 ? 100 LEU A CD1   1 
ATOM   538   C CD2   . LEU A 1 101 ? 161.654 170.862 145.048 1.00 142.10 ? 100 LEU A CD2   1 
ATOM   539   N N     . VAL A 1 102 ? 156.431 170.659 143.822 1.00 142.53 ? 101 VAL A N     1 
ATOM   540   C CA    . VAL A 1 102 ? 155.138 171.328 143.836 1.00 142.53 ? 101 VAL A CA    1 
ATOM   541   C C     . VAL A 1 102 ? 154.461 171.146 145.186 1.00 142.53 ? 101 VAL A C     1 
ATOM   542   O O     . VAL A 1 102 ? 153.912 172.103 145.747 1.00 142.53 ? 101 VAL A O     1 
ATOM   543   C CB    . VAL A 1 102 ? 154.270 170.825 142.672 1.00 142.53 ? 101 VAL A CB    1 
ATOM   544   C CG1   . VAL A 1 102 ? 152.817 171.161 142.883 1.00 142.53 ? 101 VAL A CG1   1 
ATOM   545   C CG2   . VAL A 1 102 ? 154.726 171.469 141.411 1.00 142.53 ? 101 VAL A CG2   1 
ATOM   546   N N     . ALA A 1 103 ? 154.543 169.942 145.762 1.00 147.92 ? 102 ALA A N     1 
ATOM   547   C CA    . ALA A 1 103 ? 153.990 169.740 147.100 1.00 147.92 ? 102 ALA A CA    1 
ATOM   548   C C     . ALA A 1 103 ? 154.750 170.547 148.147 1.00 147.92 ? 102 ALA A C     1 
ATOM   549   O O     . ALA A 1 103 ? 154.143 171.115 149.070 1.00 147.92 ? 102 ALA A O     1 
ATOM   550   C CB    . ALA A 1 103 ? 154.012 168.259 147.456 1.00 147.92 ? 102 ALA A CB    1 
ATOM   551   N N     . LEU A 1 104 ? 156.072 170.632 147.989 1.00 147.22 ? 103 LEU A N     1 
ATOM   552   C CA    . LEU A 1 104 ? 156.895 171.401 148.913 1.00 147.22 ? 103 LEU A CA    1 
ATOM   553   C C     . LEU A 1 104 ? 156.575 172.887 148.844 1.00 147.22 ? 103 LEU A C     1 
ATOM   554   O O     . LEU A 1 104 ? 156.465 173.554 149.877 1.00 147.22 ? 103 LEU A O     1 
ATOM   555   C CB    . LEU A 1 104 ? 158.363 171.161 148.601 1.00 147.22 ? 103 LEU A CB    1 
ATOM   556   C CG    . LEU A 1 104 ? 159.323 171.885 149.520 1.00 147.22 ? 103 LEU A CG    1 
ATOM   557   C CD1   . LEU A 1 104 ? 159.101 171.404 150.929 1.00 147.22 ? 103 LEU A CD1   1 
ATOM   558   C CD2   . LEU A 1 104 ? 160.743 171.632 149.084 1.00 147.22 ? 103 LEU A CD2   1 
ATOM   559   N N     . PHE A 1 105 ? 156.401 173.424 147.640 1.00 150.51 ? 104 PHE A N     1 
ATOM   560   C CA    . PHE A 1 105 ? 156.015 174.821 147.519 1.00 150.51 ? 104 PHE A CA    1 
ATOM   561   C C     . PHE A 1 105 ? 154.594 175.067 147.980 1.00 150.51 ? 104 PHE A C     1 
ATOM   562   O O     . PHE A 1 105 ? 154.304 176.155 148.481 1.00 150.51 ? 104 PHE A O     1 
ATOM   563   C CB    . PHE A 1 105 ? 156.193 175.304 146.089 1.00 150.51 ? 104 PHE A CB    1 
ATOM   564   C CG    . PHE A 1 105 ? 157.596 175.682 145.761 1.00 150.51 ? 104 PHE A CG    1 
ATOM   565   C CD1   . PHE A 1 105 ? 158.511 175.911 146.765 1.00 150.51 ? 104 PHE A CD1   1 
ATOM   566   C CD2   . PHE A 1 105 ? 158.000 175.823 144.452 1.00 150.51 ? 104 PHE A CD2   1 
ATOM   567   C CE1   . PHE A 1 105 ? 159.800 176.269 146.469 1.00 150.51 ? 104 PHE A CE1   1 
ATOM   568   C CE2   . PHE A 1 105 ? 159.287 176.182 144.151 1.00 150.51 ? 104 PHE A CE2   1 
ATOM   569   C CZ    . PHE A 1 105 ? 160.189 176.401 145.161 1.00 150.51 ? 104 PHE A CZ    1 
ATOM   570   N N     . GLU A 1 106 ? 153.721 174.065 147.880 1.00 155.89 ? 105 GLU A N     1 
ATOM   571   C CA    . GLU A 1 106 ? 152.358 174.246 148.354 1.00 155.89 ? 105 GLU A CA    1 
ATOM   572   C C     . GLU A 1 106 ? 152.316 174.395 149.867 1.00 155.89 ? 105 GLU A C     1 
ATOM   573   O O     . GLU A 1 106 ? 151.736 175.359 150.383 1.00 155.89 ? 105 GLU A O     1 
ATOM   574   C CB    . GLU A 1 106 ? 151.488 173.079 147.909 1.00 155.89 ? 105 GLU A CB    1 
ATOM   575   C CG    . GLU A 1 106 ? 150.029 173.446 147.694 1.00 155.89 ? 105 GLU A CG    1 
ATOM   576   C CD    . GLU A 1 106 ? 149.269 173.670 148.983 1.00 155.89 ? 105 GLU A CD    1 
ATOM   577   O OE1   . GLU A 1 106 ? 148.382 174.548 149.010 1.00 155.89 ? 105 GLU A OE1   1 
ATOM   578   O OE2   . GLU A 1 106 ? 149.564 172.970 149.972 1.00 155.89 ? 105 GLU A OE2   1 
ATOM   579   N N     . ASP A 1 107 ? 152.931 173.473 150.604 1.00 159.50 ? 106 ASP A N     1 
ATOM   580   C CA    . ASP A 1 107 ? 152.821 173.627 152.053 1.00 159.50 ? 106 ASP A CA    1 
ATOM   581   C C     . ASP A 1 107 ? 153.791 174.679 152.586 1.00 159.50 ? 106 ASP A C     1 
ATOM   582   O O     . ASP A 1 107 ? 153.570 175.226 153.674 1.00 159.50 ? 106 ASP A O     1 
ATOM   583   C CB    . ASP A 1 107 ? 152.976 172.287 152.767 1.00 159.50 ? 106 ASP A CB    1 
ATOM   584   C CG    . ASP A 1 107 ? 154.072 171.442 152.203 1.00 159.50 ? 106 ASP A CG    1 
ATOM   585   O OD1   . ASP A 1 107 ? 155.020 172.003 151.646 1.00 159.50 ? 106 ASP A OD1   1 
ATOM   586   O OD2   . ASP A 1 107 ? 153.971 170.201 152.296 1.00 159.50 ? 106 ASP A OD2   1 
ATOM   587   N N     . THR A 1 108 ? 154.824 175.021 151.813 1.00 155.50 ? 107 THR A N     1 
ATOM   588   C CA    . THR A 1 108 ? 155.609 176.209 152.112 1.00 155.50 ? 107 THR A CA    1 
ATOM   589   C C     . THR A 1 108 ? 154.757 177.465 152.038 1.00 155.50 ? 107 THR A C     1 
ATOM   590   O O     . THR A 1 108 ? 154.809 178.310 152.940 1.00 155.50 ? 107 THR A O     1 
ATOM   591   C CB    . THR A 1 108 ? 156.781 176.286 151.142 1.00 155.50 ? 107 THR A CB    1 
ATOM   592   O OG1   . THR A 1 108 ? 157.754 175.306 151.508 1.00 155.50 ? 107 THR A OG1   1 
ATOM   593   C CG2   . THR A 1 108 ? 157.416 177.638 151.167 1.00 155.50 ? 107 THR A CG2   1 
ATOM   594   N N     . ASN A 1 109 ? 153.943 177.586 150.988 1.00 152.11 ? 108 ASN A N     1 
ATOM   595   C CA    . ASN A 1 109 ? 153.009 178.697 150.890 1.00 152.11 ? 108 ASN A CA    1 
ATOM   596   C C     . ASN A 1 109 ? 151.988 178.672 152.014 1.00 152.11 ? 108 ASN A C     1 
ATOM   597   O O     . ASN A 1 109 ? 151.602 179.733 152.514 1.00 152.11 ? 108 ASN A O     1 
ATOM   598   C CB    . ASN A 1 109 ? 152.307 178.659 149.540 1.00 152.11 ? 108 ASN A CB    1 
ATOM   599   C CG    . ASN A 1 109 ? 151.064 179.498 149.515 1.00 152.11 ? 108 ASN A CG    1 
ATOM   600   O OD1   . ASN A 1 109 ? 149.952 178.978 149.508 1.00 152.11 ? 108 ASN A OD1   1 
ATOM   601   N ND2   . ASN A 1 109 ? 151.242 180.809 149.518 1.00 152.11 ? 108 ASN A ND2   1 
ATOM   602   N N     . LEU A 1 110 ? 151.587 177.473 152.446 1.00 153.28 ? 109 LEU A N     1 
ATOM   603   C CA    . LEU A 1 110 ? 150.659 177.335 153.567 1.00 153.28 ? 109 LEU A CA    1 
ATOM   604   C C     . LEU A 1 110 ? 151.235 177.914 154.850 1.00 153.28 ? 109 LEU A C     1 
ATOM   605   O O     . LEU A 1 110 ? 150.605 178.753 155.509 1.00 153.28 ? 109 LEU A O     1 
ATOM   606   C CB    . LEU A 1 110 ? 150.319 175.868 153.779 1.00 153.28 ? 109 LEU A CB    1 
ATOM   607   C CG    . LEU A 1 110 ? 149.108 175.364 153.026 1.00 153.28 ? 109 LEU A CG    1 
ATOM   608   C CD1   . LEU A 1 110 ? 149.037 173.868 153.162 1.00 153.28 ? 109 LEU A CD1   1 
ATOM   609   C CD2   . LEU A 1 110 ? 147.877 176.016 153.597 1.00 153.28 ? 109 LEU A CD2   1 
ATOM   610   N N     . CYS A 1 111 ? 152.437 177.485 155.215 1.00 161.17 ? 110 CYS A N     1 
ATOM   611   C CA    . CYS A 1 111 ? 153.038 177.983 156.442 1.00 161.17 ? 110 CYS A CA    1 
ATOM   612   C C     . CYS A 1 111 ? 153.457 179.442 156.347 1.00 161.17 ? 110 CYS A C     1 
ATOM   613   O O     . CYS A 1 111 ? 153.459 180.134 157.369 1.00 161.17 ? 110 CYS A O     1 
ATOM   614   C CB    . CYS A 1 111 ? 154.236 177.128 156.828 1.00 161.17 ? 110 CYS A CB    1 
ATOM   615   S SG    . CYS A 1 111 ? 155.723 177.502 155.917 1.00 161.17 ? 110 CYS A SG    1 
ATOM   616   N N     . ALA A 1 112 ? 153.791 179.933 155.157 1.00 156.12 ? 111 ALA A N     1 
ATOM   617   C CA    . ALA A 1 112 ? 154.071 181.350 155.003 1.00 156.12 ? 111 ALA A CA    1 
ATOM   618   C C     . ALA A 1 112 ? 152.822 182.201 155.117 1.00 156.12 ? 111 ALA A C     1 
ATOM   619   O O     . ALA A 1 112 ? 152.895 183.320 155.629 1.00 156.12 ? 111 ALA A O     1 
ATOM   620   C CB    . ALA A 1 112 ? 154.743 181.612 153.661 1.00 156.12 ? 111 ALA A CB    1 
ATOM   621   N N     . ILE A 1 113 ? 151.685 181.695 154.641 1.00 155.68 ? 112 ILE A N     1 
ATOM   622   C CA    . ILE A 1 113 ? 150.404 182.340 154.897 1.00 155.68 ? 112 ILE A CA    1 
ATOM   623   C C     . ILE A 1 113 ? 150.112 182.340 156.384 1.00 155.68 ? 112 ILE A C     1 
ATOM   624   O O     . ILE A 1 113 ? 149.600 183.329 156.929 1.00 155.68 ? 112 ILE A O     1 
ATOM   625   C CB    . ILE A 1 113 ? 149.306 181.620 154.095 1.00 155.68 ? 112 ILE A CB    1 
ATOM   626   C CG1   . ILE A 1 113 ? 149.308 182.101 152.659 1.00 155.68 ? 112 ILE A CG1   1 
ATOM   627   C CG2   . ILE A 1 113 ? 147.923 181.849 154.660 1.00 155.68 ? 112 ILE A CG2   1 
ATOM   628   C CD1   . ILE A 1 113 ? 148.651 181.128 151.746 1.00 155.68 ? 112 ILE A CD1   1 
ATOM   629   N N     . HIS A 1 114 ? 150.481 181.259 157.071 1.00 154.11 ? 113 HIS A N     1 
ATOM   630   C CA    . HIS A 1 114 ? 150.241 181.166 158.503 1.00 154.11 ? 113 HIS A CA    1 
ATOM   631   C C     . HIS A 1 114 ? 151.041 182.192 159.293 1.00 154.11 ? 113 HIS A C     1 
ATOM   632   O O     . HIS A 1 114 ? 150.564 182.690 160.317 1.00 154.11 ? 113 HIS A O     1 
ATOM   633   C CB    . HIS A 1 114 ? 150.574 179.771 158.999 1.00 154.11 ? 113 HIS A CB    1 
ATOM   634   C CG    . HIS A 1 114 ? 150.568 179.659 160.485 1.00 154.11 ? 113 HIS A CG    1 
ATOM   635   N ND1   . HIS A 1 114 ? 149.432 179.861 161.234 1.00 154.11 ? 113 HIS A ND1   1 
ATOM   636   C CD2   . HIS A 1 114 ? 151.565 179.422 161.365 1.00 154.11 ? 113 HIS A CD2   1 
ATOM   637   C CE1   . HIS A 1 114 ? 149.723 179.724 162.514 1.00 154.11 ? 113 HIS A CE1   1 
ATOM   638   N NE2   . HIS A 1 114 ? 151.012 179.458 162.620 1.00 154.11 ? 113 HIS A NE2   1 
ATOM   639   N N     . ALA A 1 115 ? 152.207 182.588 158.802 1.00 150.41 ? 114 ALA A N     1 
ATOM   640   C CA    . ALA A 1 115 ? 153.053 183.518 159.535 1.00 150.41 ? 114 ALA A CA    1 
ATOM   641   C C     . ALA A 1 115 ? 152.663 184.975 159.336 1.00 150.41 ? 114 ALA A C     1 
ATOM   642   O O     . ALA A 1 115 ? 153.518 185.838 159.562 1.00 150.41 ? 114 ALA A O     1 
ATOM   643   C CB    . ALA A 1 115 ? 154.516 183.320 159.141 1.00 150.41 ? 114 ALA A CB    1 
ATOM   644   N N     . LYS A 1 116 ? 151.416 185.239 158.939 1.00 149.82 ? 115 LYS A N     1 
ATOM   645   C CA    . LYS A 1 116 ? 150.883 186.566 158.634 1.00 149.82 ? 115 LYS A CA    1 
ATOM   646   C C     . LYS A 1 116 ? 151.735 187.253 157.575 1.00 149.82 ? 115 LYS A C     1 
ATOM   647   O O     . LYS A 1 116 ? 152.232 188.363 157.745 1.00 149.82 ? 115 LYS A O     1 
ATOM   648   C CB    . LYS A 1 116 ? 150.752 187.415 159.897 1.00 149.82 ? 115 LYS A CB    1 
ATOM   649   C CG    . LYS A 1 116 ? 149.899 186.747 160.941 1.00 149.82 ? 115 LYS A CG    1 
ATOM   650   C CD    . LYS A 1 116 ? 148.474 186.615 160.449 1.00 149.82 ? 115 LYS A CD    1 
ATOM   651   C CE    . LYS A 1 116 ? 147.929 185.222 160.709 1.00 149.82 ? 115 LYS A CE    1 
ATOM   652   N NZ    . LYS A 1 116 ? 148.563 184.214 159.812 1.00 149.82 ? 115 LYS A NZ    1 
ATOM   653   N N     . ARG A 1 117 ? 151.900 186.549 156.467 1.00 155.74 ? 116 ARG A N     1 
ATOM   654   C CA    . ARG A 1 117 ? 152.849 186.952 155.449 1.00 155.74 ? 116 ARG A CA    1 
ATOM   655   C C     . ARG A 1 117 ? 152.401 186.339 154.134 1.00 155.74 ? 116 ARG A C     1 
ATOM   656   O O     . ARG A 1 117 ? 151.597 185.409 154.107 1.00 155.74 ? 116 ARG A O     1 
ATOM   657   C CB    . ARG A 1 117 ? 154.257 186.507 155.829 1.00 155.74 ? 116 ARG A CB    1 
ATOM   658   C CG    . ARG A 1 117 ? 155.345 187.349 155.249 1.00 155.74 ? 116 ARG A CG    1 
ATOM   659   C CD    . ARG A 1 117 ? 156.670 186.913 155.783 1.00 155.74 ? 116 ARG A CD    1 
ATOM   660   N NE    . ARG A 1 117 ? 156.892 185.500 155.531 1.00 155.74 ? 116 ARG A NE    1 
ATOM   661   C CZ    . ARG A 1 117 ? 158.007 184.863 155.853 1.00 155.74 ? 116 ARG A CZ    1 
ATOM   662   N NH1   . ARG A 1 117 ? 158.996 185.517 156.435 1.00 155.74 ? 116 ARG A NH1   1 
ATOM   663   N NH2   . ARG A 1 117 ? 158.131 183.578 155.597 1.00 155.74 ? 116 ARG A NH2   1 
ATOM   664   N N     . VAL A 1 118 ? 152.913 186.889 153.036 1.00 153.29 ? 117 VAL A N     1 
ATOM   665   C CA    . VAL A 1 118 ? 152.659 186.362 151.707 1.00 153.29 ? 117 VAL A CA    1 
ATOM   666   C C     . VAL A 1 118 ? 153.923 185.789 151.083 1.00 153.29 ? 117 VAL A C     1 
ATOM   667   O O     . VAL A 1 118 ? 153.885 184.727 150.452 1.00 153.29 ? 117 VAL A O     1 
ATOM   668   C CB    . VAL A 1 118 ? 152.043 187.446 150.799 1.00 153.29 ? 117 VAL A CB    1 
ATOM   669   C CG1   . VAL A 1 118 ? 151.688 186.888 149.446 1.00 153.29 ? 117 VAL A CG1   1 
ATOM   670   C CG2   . VAL A 1 118 ? 150.813 188.028 151.452 1.00 153.29 ? 117 VAL A CG2   1 
ATOM   671   N N     . THR A 1 119 ? 155.058 186.448 151.285 1.00 157.08 ? 118 THR A N     1 
ATOM   672   C CA    . THR A 1 119 ? 156.309 185.994 150.701 1.00 157.08 ? 118 THR A CA    1 
ATOM   673   C C     . THR A 1 119 ? 156.812 184.760 151.429 1.00 157.08 ? 118 THR A C     1 
ATOM   674   O O     . THR A 1 119 ? 156.812 184.715 152.660 1.00 157.08 ? 118 THR A O     1 
ATOM   675   C CB    . THR A 1 119 ? 157.356 187.099 150.778 1.00 157.08 ? 118 THR A CB    1 
ATOM   676   O OG1   . THR A 1 119 ? 156.773 188.339 150.372 1.00 157.08 ? 118 THR A OG1   1 
ATOM   677   C CG2   . THR A 1 119 ? 158.521 186.789 149.864 1.00 157.08 ? 118 THR A CG2   1 
ATOM   678   N N     . ILE A 1 120 ? 157.232 183.761 150.677 1.00 151.39 ? 119 ILE A N     1 
ATOM   679   C CA    . ILE A 1 120 ? 157.880 182.605 151.278 1.00 151.39 ? 119 ILE A CA    1 
ATOM   680   C C     . ILE A 1 120 ? 159.349 182.916 151.521 1.00 151.39 ? 119 ILE A C     1 
ATOM   681   O O     . ILE A 1 120 ? 159.923 183.816 150.906 1.00 151.39 ? 119 ILE A O     1 
ATOM   682   C CB    . ILE A 1 120 ? 157.698 181.369 150.389 1.00 151.39 ? 119 ILE A CB    1 
ATOM   683   C CG1   . ILE A 1 120 ? 158.256 181.632 149.003 1.00 151.39 ? 119 ILE A CG1   1 
ATOM   684   C CG2   . ILE A 1 120 ? 156.251 181.057 150.290 1.00 151.39 ? 119 ILE A CG2   1 
ATOM   685   C CD1   . ILE A 1 120 ? 158.067 180.483 148.057 1.00 151.39 ? 119 ILE A CD1   1 
ATOM   686   N N     . MET A 1 121 ? 159.965 182.171 152.426 1.00 158.23 ? 120 MET A N     1 
ATOM   687   C CA    . MET A 1 121 ? 161.297 182.495 152.917 1.00 158.23 ? 120 MET A CA    1 
ATOM   688   C C     . MET A 1 121 ? 162.055 181.193 153.171 1.00 158.23 ? 120 MET A C     1 
ATOM   689   O O     . MET A 1 121 ? 161.458 180.122 153.030 1.00 158.23 ? 120 MET A O     1 
ATOM   690   C CB    . MET A 1 121 ? 161.162 183.353 154.177 1.00 158.23 ? 120 MET A CB    1 
ATOM   691   C CG    . MET A 1 121 ? 161.106 184.839 153.901 1.00 158.23 ? 120 MET A CG    1 
ATOM   692   S SD    . MET A 1 121 ? 162.633 185.466 153.181 1.00 158.23 ? 120 MET A SD    1 
ATOM   693   C CE    . MET A 1 121 ? 162.172 187.144 152.771 1.00 158.23 ? 120 MET A CE    1 
ATOM   694   N N     . PRO A 1 122 ? 163.359 181.220 153.489 1.00 153.32 ? 121 PRO A N     1 
ATOM   695   C CA    . PRO A 1 122 ? 164.042 179.966 153.849 1.00 153.32 ? 121 PRO A CA    1 
ATOM   696   C C     . PRO A 1 122 ? 163.486 179.251 155.062 1.00 153.32 ? 121 PRO A C     1 
ATOM   697   O O     . PRO A 1 122 ? 163.435 178.012 155.058 1.00 153.32 ? 121 PRO A O     1 
ATOM   698   C CB    . PRO A 1 122 ? 165.480 180.424 154.094 1.00 153.32 ? 121 PRO A CB    1 
ATOM   699   C CG    . PRO A 1 122 ? 165.656 181.521 153.166 1.00 153.32 ? 121 PRO A CG    1 
ATOM   700   C CD    . PRO A 1 122 ? 164.346 182.245 153.103 1.00 153.32 ? 121 PRO A CD    1 
ATOM   701   N N     . LYS A 1 123 ? 163.059 179.983 156.091 1.00 152.54 ? 122 LYS A N     1 
ATOM   702   C CA    . LYS A 1 123 ? 162.491 179.333 157.261 1.00 152.54 ? 122 LYS A CA    1 
ATOM   703   C C     . LYS A 1 123 ? 161.171 178.653 156.949 1.00 152.54 ? 122 LYS A C     1 
ATOM   704   O O     . LYS A 1 123 ? 160.816 177.692 157.634 1.00 152.54 ? 122 LYS A O     1 
ATOM   705   C CB    . LYS A 1 123 ? 162.310 180.336 158.394 1.00 152.54 ? 122 LYS A CB    1 
ATOM   706   C CG    . LYS A 1 123 ? 161.516 181.559 158.028 1.00 152.54 ? 122 LYS A CG    1 
ATOM   707   C CD    . LYS A 1 123 ? 161.894 182.708 158.933 1.00 152.54 ? 122 LYS A CD    1 
ATOM   708   C CE    . LYS A 1 123 ? 161.100 183.955 158.622 1.00 152.54 ? 122 LYS A CE    1 
ATOM   709   N NZ    . LYS A 1 123 ? 161.675 185.140 159.306 1.00 152.54 ? 122 LYS A NZ    1 
ATOM   710   N N     . ASP A 1 124 ? 160.480 179.087 155.894 1.00 160.28 ? 123 ASP A N     1 
ATOM   711   C CA    . ASP A 1 124 ? 159.260 178.414 155.472 1.00 160.28 ? 123 ASP A CA    1 
ATOM   712   C C     . ASP A 1 124 ? 159.544 176.999 154.995 1.00 160.28 ? 123 ASP A C     1 
ATOM   713   O O     . ASP A 1 124 ? 158.940 176.041 155.488 1.00 160.28 ? 123 ASP A O     1 
ATOM   714   C CB    . ASP A 1 124 ? 158.578 179.213 154.373 1.00 160.28 ? 123 ASP A CB    1 
ATOM   715   C CG    . ASP A 1 124 ? 157.979 180.487 154.884 1.00 160.28 ? 123 ASP A CG    1 
ATOM   716   O OD1   . ASP A 1 124 ? 157.142 180.421 155.801 1.00 160.28 ? 123 ASP A OD1   1 
ATOM   717   O OD2   . ASP A 1 124 ? 158.353 181.563 154.381 1.00 160.28 ? 123 ASP A OD2   1 
ATOM   718   N N     . ILE A 1 125 ? 160.472 176.838 154.050 1.00 156.63 ? 124 ILE A N     1 
ATOM   719   C CA    . ILE A 1 125 ? 160.750 175.488 153.575 1.00 156.63 ? 124 ILE A CA    1 
ATOM   720   C C     . ILE A 1 125 ? 161.529 174.683 154.601 1.00 156.63 ? 124 ILE A C     1 
ATOM   721   O O     . ILE A 1 125 ? 161.426 173.454 154.600 1.00 156.63 ? 124 ILE A O     1 
ATOM   722   C CB    . ILE A 1 125 ? 161.487 175.450 152.223 1.00 156.63 ? 124 ILE A CB    1 
ATOM   723   C CG1   . ILE A 1 125 ? 162.967 175.771 152.359 1.00 156.63 ? 124 ILE A CG1   1 
ATOM   724   C CG2   . ILE A 1 125 ? 160.880 176.410 151.256 1.00 156.63 ? 124 ILE A CG2   1 
ATOM   725   C CD1   . ILE A 1 125 ? 163.747 175.392 151.136 1.00 156.63 ? 124 ILE A CD1   1 
ATOM   726   N N     . GLN A 1 126 ? 162.241 175.332 155.525 1.00 153.25 ? 125 GLN A N     1 
ATOM   727   C CA    . GLN A 1 126 ? 162.888 174.568 156.581 1.00 153.25 ? 125 GLN A CA    1 
ATOM   728   C C     . GLN A 1 126 ? 161.863 174.001 157.554 1.00 153.25 ? 125 GLN A C     1 
ATOM   729   O O     . GLN A 1 126 ? 161.949 172.829 157.934 1.00 153.25 ? 125 GLN A O     1 
ATOM   730   C CB    . GLN A 1 126 ? 163.911 175.436 157.299 1.00 153.25 ? 125 GLN A CB    1 
ATOM   731   C CG    . GLN A 1 126 ? 165.197 175.593 156.522 1.00 153.25 ? 125 GLN A CG    1 
ATOM   732   C CD    . GLN A 1 126 ? 165.854 176.930 156.752 1.00 153.25 ? 125 GLN A CD    1 
ATOM   733   O OE1   . GLN A 1 126 ? 165.745 177.508 157.830 1.00 153.25 ? 125 GLN A OE1   1 
ATOM   734   N NE2   . GLN A 1 126 ? 166.537 177.435 155.737 1.00 153.25 ? 125 GLN A NE2   1 
ATOM   735   N N     . LEU A 1 127 ? 160.853 174.795 157.916 1.00 153.84 ? 126 LEU A N     1 
ATOM   736   C CA    . LEU A 1 127 ? 159.787 174.293 158.774 1.00 153.84 ? 126 LEU A CA    1 
ATOM   737   C C     . LEU A 1 127 ? 158.945 173.249 158.056 1.00 153.84 ? 126 LEU A C     1 
ATOM   738   O O     . LEU A 1 127 ? 158.526 172.254 158.665 1.00 153.84 ? 126 LEU A O     1 
ATOM   739   C CB    . LEU A 1 127 ? 158.914 175.449 159.242 1.00 153.84 ? 126 LEU A CB    1 
ATOM   740   C CG    . LEU A 1 127 ? 157.661 175.067 160.016 1.00 153.84 ? 126 LEU A CG    1 
ATOM   741   C CD1   . LEU A 1 127 ? 158.023 174.721 161.436 1.00 153.84 ? 126 LEU A CD1   1 
ATOM   742   C CD2   . LEU A 1 127 ? 156.657 176.177 159.982 1.00 153.84 ? 126 LEU A CD2   1 
ATOM   743   N N     . ALA A 1 128 ? 158.705 173.448 156.759 1.00 154.33 ? 127 ALA A N     1 
ATOM   744   C CA    . ALA A 1 128 ? 157.905 172.497 155.999 1.00 154.33 ? 127 ALA A CA    1 
ATOM   745   C C     . ALA A 1 128 ? 158.618 171.164 155.856 1.00 154.33 ? 127 ALA A C     1 
ATOM   746   O O     . ALA A 1 128 ? 158.003 170.109 156.027 1.00 154.33 ? 127 ALA A O     1 
ATOM   747   C CB    . ALA A 1 128 ? 157.570 173.068 154.628 1.00 154.33 ? 127 ALA A CB    1 
ATOM   748   N N     . ARG A 1 129 ? 159.919 171.185 155.588 1.00 154.94 ? 128 ARG A N     1 
ATOM   749   C CA    . ARG A 1 129 ? 160.672 169.946 155.537 1.00 154.94 ? 128 ARG A CA    1 
ATOM   750   C C     . ARG A 1 129 ? 160.874 169.323 156.908 1.00 154.94 ? 128 ARG A C     1 
ATOM   751   O O     . ARG A 1 129 ? 161.070 168.108 156.992 1.00 154.94 ? 128 ARG A O     1 
ATOM   752   C CB    . ARG A 1 129 ? 162.024 170.185 154.883 1.00 154.94 ? 128 ARG A CB    1 
ATOM   753   C CG    . ARG A 1 129 ? 161.967 170.183 153.388 1.00 154.94 ? 128 ARG A CG    1 
ATOM   754   C CD    . ARG A 1 129 ? 163.346 170.030 152.816 1.00 154.94 ? 128 ARG A CD    1 
ATOM   755   N NE    . ARG A 1 129 ? 163.656 168.640 152.519 1.00 154.94 ? 128 ARG A NE    1 
ATOM   756   C CZ    . ARG A 1 129 ? 164.860 168.102 152.665 1.00 154.94 ? 128 ARG A CZ    1 
ATOM   757   N NH1   . ARG A 1 129 ? 165.863 168.839 153.115 1.00 154.94 ? 128 ARG A NH1   1 
ATOM   758   N NH2   . ARG A 1 129 ? 165.061 166.829 152.366 1.00 154.94 ? 128 ARG A NH2   1 
ATOM   759   N N     . ARG A 1 130 ? 160.836 170.113 157.980 1.00 159.20 ? 129 ARG A N     1 
ATOM   760   C CA    . ARG A 1 130 ? 160.964 169.502 159.295 1.00 159.20 ? 129 ARG A CA    1 
ATOM   761   C C     . ARG A 1 130 ? 159.682 168.798 159.703 1.00 159.20 ? 129 ARG A C     1 
ATOM   762   O O     . ARG A 1 130 ? 159.679 167.582 159.913 1.00 159.20 ? 129 ARG A O     1 
ATOM   763   C CB    . ARG A 1 130 ? 161.356 170.540 160.340 1.00 159.20 ? 129 ARG A CB    1 
ATOM   764   C CG    . ARG A 1 130 ? 162.086 169.922 161.511 1.00 159.20 ? 129 ARG A CG    1 
ATOM   765   C CD    . ARG A 1 130 ? 162.684 170.968 162.425 1.00 159.20 ? 129 ARG A CD    1 
ATOM   766   N NE    . ARG A 1 130 ? 163.304 172.062 161.685 1.00 159.20 ? 129 ARG A NE    1 
ATOM   767   C CZ    . ARG A 1 130 ? 163.886 173.111 162.257 1.00 159.20 ? 129 ARG A CZ    1 
ATOM   768   N NH1   . ARG A 1 130 ? 163.943 173.201 163.577 1.00 159.20 ? 129 ARG A NH1   1 
ATOM   769   N NH2   . ARG A 1 130 ? 164.420 174.065 161.510 1.00 159.20 ? 129 ARG A NH2   1 
ATOM   770   N N     . ILE A 1 131 ? 158.567 169.530 159.794 1.00 155.12 ? 130 ILE A N     1 
ATOM   771   C CA    . ILE A 1 131 ? 157.338 168.912 160.275 1.00 155.12 ? 130 ILE A CA    1 
ATOM   772   C C     . ILE A 1 131 ? 156.644 168.099 159.203 1.00 155.12 ? 130 ILE A C     1 
ATOM   773   O O     . ILE A 1 131 ? 155.635 167.444 159.491 1.00 155.12 ? 130 ILE A O     1 
ATOM   774   C CB    . ILE A 1 131 ? 156.326 169.927 160.828 1.00 155.12 ? 130 ILE A CB    1 
ATOM   775   C CG1   . ILE A 1 131 ? 155.705 170.733 159.711 1.00 155.12 ? 130 ILE A CG1   1 
ATOM   776   C CG2   . ILE A 1 131 ? 157.002 170.866 161.789 1.00 155.12 ? 130 ILE A CG2   1 
ATOM   777   C CD1   . ILE A 1 131 ? 154.515 171.504 160.178 1.00 155.12 ? 130 ILE A CD1   1 
ATOM   778   N N     . ARG A 1 132 ? 157.142 168.127 157.971 1.00 160.22 ? 131 ARG A N     1 
ATOM   779   C CA    . ARG A 1 132 ? 156.636 167.235 156.941 1.00 160.22 ? 131 ARG A CA    1 
ATOM   780   C C     . ARG A 1 132 ? 156.987 165.791 157.248 1.00 160.22 ? 131 ARG A C     1 
ATOM   781   O O     . ARG A 1 132 ? 156.230 164.880 156.900 1.00 160.22 ? 131 ARG A O     1 
ATOM   782   C CB    . ARG A 1 132 ? 157.211 167.661 155.596 1.00 160.22 ? 131 ARG A CB    1 
ATOM   783   C CG    . ARG A 1 132 ? 156.707 166.931 154.388 1.00 160.22 ? 131 ARG A CG    1 
ATOM   784   C CD    . ARG A 1 132 ? 157.252 167.614 153.160 1.00 160.22 ? 131 ARG A CD    1 
ATOM   785   N NE    . ARG A 1 132 ? 157.120 166.796 151.965 1.00 160.22 ? 131 ARG A NE    1 
ATOM   786   C CZ    . ARG A 1 132 ? 156.046 166.793 151.189 1.00 160.22 ? 131 ARG A CZ    1 
ATOM   787   N NH1   . ARG A 1 132 ? 155.014 167.568 151.490 1.00 160.22 ? 131 ARG A NH1   1 
ATOM   788   N NH2   . ARG A 1 132 ? 156.002 166.018 150.115 1.00 160.22 ? 131 ARG A NH2   1 
ATOM   789   N N     . GLY A 1 133 ? 158.108 165.567 157.919 1.00 166.85 ? 132 GLY A N     1 
ATOM   790   C CA    . GLY A 1 133 ? 158.539 164.225 158.235 1.00 166.85 ? 132 GLY A CA    1 
ATOM   791   C C     . GLY A 1 133 ? 159.782 163.864 157.456 1.00 166.85 ? 132 GLY A C     1 
ATOM   792   O O     . GLY A 1 133 ? 160.061 162.687 157.214 1.00 166.85 ? 132 GLY A O     1 
ATOM   793   N N     . GLU A 1 134 ? 160.534 164.882 157.050 1.00 160.91 ? 133 GLU A N     1 
ATOM   794   C CA    . GLU A 1 134 ? 161.759 164.658 156.299 1.00 160.91 ? 133 GLU A CA    1 
ATOM   795   C C     . GLU A 1 134 ? 162.956 165.185 157.076 1.00 160.91 ? 133 GLU A C     1 
ATOM   796   O O     . GLU A 1 134 ? 162.820 165.586 158.236 1.00 160.91 ? 133 GLU A O     1 
ATOM   797   C CB    . GLU A 1 134 ? 161.675 165.321 154.926 1.00 160.91 ? 133 GLU A CB    1 
ATOM   798   C CG    . GLU A 1 134 ? 160.379 165.045 154.184 1.00 160.91 ? 133 GLU A CG    1 
ATOM   799   C CD    . GLU A 1 134 ? 160.493 165.325 152.704 1.00 160.91 ? 133 GLU A CD    1 
ATOM   800   O OE1   . GLU A 1 134 ? 161.633 165.407 152.203 1.00 160.91 ? 133 GLU A OE1   1 
ATOM   801   O OE2   . GLU A 1 134 ? 159.449 165.462 152.038 1.00 160.91 ? 133 GLU A OE2   1 
ATOM   802   N N     . ARG A 1 135 ? 164.128 165.179 156.451 1.00 161.59 ? 134 ARG A N     1 
ATOM   803   C CA    . ARG A 1 135 ? 165.350 165.635 157.100 1.00 161.59 ? 134 ARG A CA    1 
ATOM   804   C C     . ARG A 1 135 ? 165.357 167.148 157.270 1.00 161.59 ? 134 ARG A C     1 
ATOM   805   O O     . ARG A 1 135 ? 165.086 167.659 158.355 1.00 161.59 ? 134 ARG A O     1 
ATOM   806   C CB    . ARG A 1 135 ? 166.576 165.194 156.302 1.00 161.59 ? 134 ARG A CB    1 
ATOM   807   N N     . ALA B 2 16  ? 182.643 191.587 127.568 0.00 231.85 ? 15  ALA B N     1 
ATOM   808   C CA    . ALA B 2 16  ? 181.712 190.468 127.627 0.00 231.85 ? 15  ALA B CA    1 
ATOM   809   C C     . ALA B 2 16  ? 182.409 189.225 128.166 0.00 231.85 ? 15  ALA B C     1 
ATOM   810   O O     . ALA B 2 16  ? 182.712 189.145 129.355 0.00 231.85 ? 15  ALA B O     1 
ATOM   811   C CB    . ALA B 2 16  ? 181.118 190.199 126.254 0.00 231.85 ? 15  ALA B CB    1 
ATOM   812   N N     . LYS B 2 17  ? 182.665 188.259 127.287 1.00 231.50 ? 16  LYS B N     1 
ATOM   813   C CA    . LYS B 2 17  ? 183.371 187.042 127.653 1.00 231.50 ? 16  LYS B CA    1 
ATOM   814   C C     . LYS B 2 17  ? 184.412 186.718 126.592 1.00 231.50 ? 16  LYS B C     1 
ATOM   815   O O     . LYS B 2 17  ? 184.346 187.192 125.454 1.00 231.50 ? 16  LYS B O     1 
ATOM   816   C CB    . LYS B 2 17  ? 182.411 185.850 127.823 1.00 231.50 ? 16  LYS B CB    1 
ATOM   817   C CG    . LYS B 2 17  ? 182.853 184.846 128.882 1.00 231.50 ? 16  LYS B CG    1 
ATOM   818   C CD    . LYS B 2 17  ? 182.224 183.479 128.675 1.00 231.50 ? 16  LYS B CD    1 
ATOM   819   C CE    . LYS B 2 17  ? 182.998 182.411 129.435 1.00 231.50 ? 16  LYS B CE    1 
ATOM   820   N NZ    . LYS B 2 17  ? 182.164 181.221 129.755 1.00 231.50 ? 16  LYS B NZ    1 
ATOM   821   N N     . ARG B 2 18  ? 185.384 185.906 126.986 1.00 240.46 ? 17  ARG B N     1 
ATOM   822   C CA    . ARG B 2 18  ? 186.391 185.393 126.078 1.00 240.46 ? 17  ARG B CA    1 
ATOM   823   C C     . ARG B 2 18  ? 185.983 183.977 125.660 1.00 240.46 ? 17  ARG B C     1 
ATOM   824   O O     . ARG B 2 18  ? 185.057 183.383 126.219 1.00 240.46 ? 17  ARG B O     1 
ATOM   825   C CB    . ARG B 2 18  ? 187.772 185.449 126.757 1.00 240.46 ? 17  ARG B CB    1 
ATOM   826   C CG    . ARG B 2 18  ? 189.022 185.323 125.861 1.00 240.46 ? 17  ARG B CG    1 
ATOM   827   C CD    . ARG B 2 18  ? 189.185 186.534 124.944 1.00 240.46 ? 17  ARG B CD    1 
ATOM   828   N NE    . ARG B 2 18  ? 188.487 186.380 123.668 1.00 240.46 ? 17  ARG B NE    1 
ATOM   829   C CZ    . ARG B 2 18  ? 188.270 187.370 122.809 1.00 240.46 ? 17  ARG B CZ    1 
ATOM   830   N NH1   . ARG B 2 18  ? 188.687 188.597 123.088 1.00 240.46 ? 17  ARG B NH1   1 
ATOM   831   N NH2   . ARG B 2 18  ? 187.626 187.136 121.674 1.00 240.46 ? 17  ARG B NH2   1 
ATOM   832   N N     . HIS B 2 19  ? 186.685 183.444 124.662 1.00 243.89 ? 18  HIS B N     1 
ATOM   833   C CA    . HIS B 2 19  ? 186.365 182.185 124.007 1.00 243.89 ? 18  HIS B CA    1 
ATOM   834   C C     . HIS B 2 19  ? 186.508 180.993 124.958 1.00 243.89 ? 18  HIS B C     1 
ATOM   835   O O     . HIS B 2 19  ? 186.936 181.118 126.112 1.00 243.89 ? 18  HIS B O     1 
ATOM   836   C CB    . HIS B 2 19  ? 187.268 182.015 122.795 1.00 243.89 ? 18  HIS B CB    1 
ATOM   837   C CG    . HIS B 2 19  ? 188.710 182.254 123.106 1.00 243.89 ? 18  HIS B CG    1 
ATOM   838   N ND1   . HIS B 2 19  ? 189.527 181.287 123.646 1.00 243.89 ? 18  HIS B ND1   1 
ATOM   839   C CD2   . HIS B 2 19  ? 189.477 183.360 122.962 1.00 243.89 ? 18  HIS B CD2   1 
ATOM   840   C CE1   . HIS B 2 19  ? 190.736 181.788 123.828 1.00 243.89 ? 18  HIS B CE1   1 
ATOM   841   N NE2   . HIS B 2 19  ? 190.734 183.042 123.414 1.00 243.89 ? 18  HIS B NE2   1 
ATOM   842   N N     . ARG B 2 20  ? 186.164 179.818 124.419 1.00 239.48 ? 19  ARG B N     1 
ATOM   843   C CA    . ARG B 2 20  ? 186.002 178.563 125.159 1.00 239.48 ? 19  ARG B CA    1 
ATOM   844   C C     . ARG B 2 20  ? 185.029 178.743 126.326 1.00 239.48 ? 19  ARG B C     1 
ATOM   845   O O     . ARG B 2 20  ? 185.375 178.590 127.498 1.00 239.48 ? 19  ARG B O     1 
ATOM   846   C CB    . ARG B 2 20  ? 187.351 177.999 125.626 1.00 239.48 ? 19  ARG B CB    1 
ATOM   847   C CG    . ARG B 2 20  ? 188.423 178.021 124.559 1.00 239.48 ? 19  ARG B CG    1 
ATOM   848   C CD    . ARG B 2 20  ? 189.797 178.297 125.138 1.00 239.48 ? 19  ARG B CD    1 
ATOM   849   N NE    . ARG B 2 20  ? 190.303 177.174 125.921 1.00 239.48 ? 19  ARG B NE    1 
ATOM   850   C CZ    . ARG B 2 20  ? 191.481 177.168 126.535 1.00 239.48 ? 19  ARG B CZ    1 
ATOM   851   N NH1   . ARG B 2 20  ? 192.275 178.225 126.453 1.00 239.48 ? 19  ARG B NH1   1 
ATOM   852   N NH2   . ARG B 2 20  ? 191.867 176.107 127.229 1.00 239.48 ? 19  ARG B NH2   1 
ATOM   853   N N     . LYS B 2 21  ? 183.791 179.075 125.973 1.00 227.35 ? 20  LYS B N     1 
ATOM   854   C CA    . LYS B 2 21  ? 182.757 179.395 126.952 1.00 227.35 ? 20  LYS B CA    1 
ATOM   855   C C     . LYS B 2 21  ? 182.146 178.106 127.484 1.00 227.35 ? 20  LYS B C     1 
ATOM   856   O O     . LYS B 2 21  ? 181.175 177.588 126.929 1.00 227.35 ? 20  LYS B O     1 
ATOM   857   C CB    . LYS B 2 21  ? 181.693 180.290 126.329 1.00 227.35 ? 20  LYS B CB    1 
ATOM   858   N N     . VAL B 2 22  ? 182.720 177.583 128.566 1.00 219.32 ? 21  VAL B N     1 
ATOM   859   C CA    . VAL B 2 22  ? 182.147 176.478 129.330 1.00 219.32 ? 21  VAL B CA    1 
ATOM   860   C C     . VAL B 2 22  ? 181.888 176.997 130.737 1.00 219.32 ? 21  VAL B C     1 
ATOM   861   O O     . VAL B 2 22  ? 182.833 177.337 131.457 1.00 219.32 ? 21  VAL B O     1 
ATOM   862   C CB    . VAL B 2 22  ? 183.070 175.248 129.373 1.00 219.32 ? 21  VAL B CB    1 
ATOM   863   C CG1   . VAL B 2 22  ? 182.302 174.031 129.859 1.00 219.32 ? 21  VAL B CG1   1 
ATOM   864   C CG2   . VAL B 2 22  ? 183.695 174.985 128.012 1.00 219.32 ? 21  VAL B CG2   1 
ATOM   865   N N     . LEU B 2 23  ? 180.622 177.052 131.131 0.00 206.38 ? 22  LEU B N     1 
ATOM   866   C CA    . LEU B 2 23  ? 180.241 177.737 132.360 0.00 206.38 ? 22  LEU B CA    1 
ATOM   867   C C     . LEU B 2 23  ? 178.938 177.128 132.866 0.00 206.38 ? 22  LEU B C     1 
ATOM   868   O O     . LEU B 2 23  ? 178.498 176.086 132.368 0.00 206.38 ? 22  LEU B O     1 
ATOM   869   C CB    . LEU B 2 23  ? 180.139 179.252 132.125 0.00 206.38 ? 22  LEU B CB    1 
ATOM   870   C CG    . LEU B 2 23  ? 178.992 179.899 131.334 0.00 206.38 ? 22  LEU B CG    1 
ATOM   871   C CD1   . LEU B 2 23  ? 178.937 181.381 131.656 0.00 206.38 ? 22  LEU B CD1   1 
ATOM   872   C CD2   . LEU B 2 23  ? 179.104 179.705 129.826 0.00 206.38 ? 22  LEU B CD2   1 
ATOM   873   N N     . ARG B 2 24  ? 178.335 177.784 133.872 0.00 191.75 ? 23  ARG B N     1 
ATOM   874   C CA    . ARG B 2 24  ? 177.041 177.432 134.458 0.00 191.75 ? 23  ARG B CA    1 
ATOM   875   C C     . ARG B 2 24  ? 177.033 176.017 135.016 0.00 191.75 ? 23  ARG B C     1 
ATOM   876   O O     . ARG B 2 24  ? 176.514 175.109 134.358 0.00 191.75 ? 23  ARG B O     1 
ATOM   877   C CB    . ARG B 2 24  ? 175.896 177.614 133.456 0.00 191.75 ? 23  ARG B CB    1 
ATOM   878   C CG    . ARG B 2 24  ? 175.509 179.062 133.233 0.00 191.75 ? 23  ARG B CG    1 
ATOM   879   C CD    . ARG B 2 24  ? 174.543 179.212 132.070 0.00 191.75 ? 23  ARG B CD    1 
ATOM   880   N NE    . ARG B 2 24  ? 173.165 179.388 132.519 0.00 191.75 ? 23  ARG B NE    1 
ATOM   881   C CZ    . ARG B 2 24  ? 172.167 179.775 131.729 0.00 191.75 ? 23  ARG B CZ    1 
ATOM   882   N NH1   . ARG B 2 24  ? 172.396 180.022 130.448 0.00 191.75 ? 23  ARG B NH1   1 
ATOM   883   N NH2   . ARG B 2 24  ? 170.943 179.918 132.220 0.00 191.75 ? 23  ARG B NH2   1 
ATOM   884   N N     . ASP B 2 25  ? 177.726 175.824 136.146 1.00 180.56 ? 24  ASP B N     1 
ATOM   885   C CA    . ASP B 2 25  ? 177.760 174.569 136.898 1.00 180.56 ? 24  ASP B CA    1 
ATOM   886   C C     . ASP B 2 25  ? 176.376 173.953 137.046 1.00 180.56 ? 24  ASP B C     1 
ATOM   887   O O     . ASP B 2 25  ? 175.388 174.655 137.269 1.00 180.56 ? 24  ASP B O     1 
ATOM   888   C CB    . ASP B 2 25  ? 178.367 174.811 138.280 1.00 180.56 ? 24  ASP B CB    1 
ATOM   889   C CG    . ASP B 2 25  ? 178.611 173.527 139.039 1.00 180.56 ? 24  ASP B CG    1 
ATOM   890   O OD1   . ASP B 2 25  ? 178.787 172.475 138.391 1.00 180.56 ? 24  ASP B OD1   1 
ATOM   891   O OD2   . ASP B 2 25  ? 178.625 173.570 140.286 1.00 180.56 ? 24  ASP B OD2   1 
ATOM   892   N N     . ASN B 2 26  ? 176.328 172.626 136.924 1.00 169.18 ? 25  ASN B N     1 
ATOM   893   C CA    . ASN B 2 26  ? 175.149 171.926 136.431 1.00 169.18 ? 25  ASN B CA    1 
ATOM   894   C C     . ASN B 2 26  ? 173.946 171.997 137.356 1.00 169.18 ? 25  ASN B C     1 
ATOM   895   O O     . ASN B 2 26  ? 172.822 171.838 136.875 1.00 169.18 ? 25  ASN B O     1 
ATOM   896   C CB    . ASN B 2 26  ? 175.504 170.474 136.156 1.00 169.18 ? 25  ASN B CB    1 
ATOM   897   C CG    . ASN B 2 26  ? 174.807 169.947 134.941 1.00 169.18 ? 25  ASN B CG    1 
ATOM   898   O OD1   . ASN B 2 26  ? 173.817 170.512 134.491 1.00 169.18 ? 25  ASN B OD1   1 
ATOM   899   N ND2   . ASN B 2 26  ? 175.341 168.884 134.371 1.00 169.18 ? 25  ASN B ND2   1 
ATOM   900   N N     . ILE B 2 27  ? 174.139 172.240 138.649 1.00 163.21 ? 26  ILE B N     1 
ATOM   901   C CA    . ILE B 2 27  ? 172.977 172.446 139.500 1.00 163.21 ? 26  ILE B CA    1 
ATOM   902   C C     . ILE B 2 27  ? 172.356 173.807 139.214 1.00 163.21 ? 26  ILE B C     1 
ATOM   903   O O     . ILE B 2 27  ? 171.129 173.940 139.186 1.00 163.21 ? 26  ILE B O     1 
ATOM   904   C CB    . ILE B 2 27  ? 173.360 172.262 140.980 1.00 163.21 ? 26  ILE B CB    1 
ATOM   905   C CG1   . ILE B 2 27  ? 172.184 172.578 141.903 1.00 163.21 ? 26  ILE B CG1   1 
ATOM   906   C CG2   . ILE B 2 27  ? 174.596 173.074 141.344 1.00 163.21 ? 26  ILE B CG2   1 
ATOM   907   C CD1   . ILE B 2 27  ? 171.018 171.649 141.719 1.00 163.21 ? 26  ILE B CD1   1 
ATOM   908   N N     . GLN B 2 28  ? 173.177 174.808 138.900 1.00 163.53 ? 27  GLN B N     1 
ATOM   909   C CA    . GLN B 2 28  ? 172.684 176.141 138.592 1.00 163.53 ? 27  GLN B CA    1 
ATOM   910   C C     . GLN B 2 28  ? 172.010 176.196 137.226 1.00 163.53 ? 27  GLN B C     1 
ATOM   911   O O     . GLN B 2 28  ? 171.320 177.175 136.923 1.00 163.53 ? 27  GLN B O     1 
ATOM   912   C CB    . GLN B 2 28  ? 173.855 177.129 138.702 1.00 163.53 ? 27  GLN B CB    1 
ATOM   913   C CG    . GLN B 2 28  ? 173.505 178.600 138.698 1.00 163.53 ? 27  GLN B CG    1 
ATOM   914   C CD    . GLN B 2 28  ? 172.515 178.946 139.783 1.00 163.53 ? 27  GLN B CD    1 
ATOM   915   O OE1   . GLN B 2 28  ? 171.340 179.179 139.509 1.00 163.53 ? 27  GLN B OE1   1 
ATOM   916   N NE2   . GLN B 2 28  ? 172.979 178.969 141.026 1.00 163.53 ? 27  GLN B NE2   1 
ATOM   917   N N     . GLY B 2 29  ? 172.143 175.140 136.419 1.00 167.05 ? 28  GLY B N     1 
ATOM   918   C CA    . GLY B 2 29  ? 171.369 175.016 135.199 1.00 167.05 ? 28  GLY B CA    1 
ATOM   919   C C     . GLY B 2 29  ? 169.873 174.943 135.418 1.00 167.05 ? 28  GLY B C     1 
ATOM   920   O O     . GLY B 2 29  ? 169.110 175.274 134.506 1.00 167.05 ? 28  GLY B O     1 
ATOM   921   N N     . ILE B 2 30  ? 169.434 174.526 136.603 1.00 158.14 ? 29  ILE B N     1 
ATOM   922   C CA    . ILE B 2 30  ? 168.027 174.640 136.958 1.00 158.14 ? 29  ILE B CA    1 
ATOM   923   C C     . ILE B 2 30  ? 167.756 176.106 137.232 1.00 158.14 ? 29  ILE B C     1 
ATOM   924   O O     . ILE B 2 30  ? 168.032 176.610 138.325 1.00 158.14 ? 29  ILE B O     1 
ATOM   925   C CB    . ILE B 2 30  ? 167.674 173.772 138.171 1.00 158.14 ? 29  ILE B CB    1 
ATOM   926   C CG1   . ILE B 2 30  ? 168.138 172.342 137.932 1.00 158.14 ? 29  ILE B CG1   1 
ATOM   927   C CG2   . ILE B 2 30  ? 166.188 173.816 138.424 1.00 158.14 ? 29  ILE B CG2   1 
ATOM   928   C CD1   . ILE B 2 30  ? 167.551 171.718 136.697 1.00 158.14 ? 29  ILE B CD1   1 
ATOM   929   N N     . THR B 2 31  ? 167.214 176.797 136.241 1.00 161.53 ? 30  THR B N     1 
ATOM   930   C CA    . THR B 2 31  ? 167.238 178.243 136.249 1.00 161.53 ? 30  THR B CA    1 
ATOM   931   C C     . THR B 2 31  ? 166.167 178.810 137.170 1.00 161.53 ? 30  THR B C     1 
ATOM   932   O O     . THR B 2 31  ? 165.231 178.126 137.584 1.00 161.53 ? 30  THR B O     1 
ATOM   933   C CB    . THR B 2 31  ? 167.055 178.778 134.840 1.00 161.53 ? 30  THR B CB    1 
ATOM   934   O OG1   . THR B 2 31  ? 167.101 180.204 134.879 1.00 161.53 ? 30  THR B OG1   1 
ATOM   935   C CG2   . THR B 2 31  ? 165.722 178.336 134.281 1.00 161.53 ? 30  THR B CG2   1 
ATOM   936   N N     . LYS B 2 32  ? 166.319 180.085 137.482 1.00 154.73 ? 31  LYS B N     1 
ATOM   937   C CA    . LYS B 2 32  ? 165.463 180.782 138.432 1.00 154.73 ? 31  LYS B CA    1 
ATOM   938   C C     . LYS B 2 32  ? 164.026 180.994 137.943 1.00 154.73 ? 31  LYS B C     1 
ATOM   939   O O     . LYS B 2 32  ? 163.105 180.860 138.759 1.00 154.73 ? 31  LYS B O     1 
ATOM   940   C CB    . LYS B 2 32  ? 166.116 182.109 138.826 1.00 154.73 ? 31  LYS B CB    1 
ATOM   941   C CG    . LYS B 2 32  ? 165.437 182.840 139.951 1.00 154.73 ? 31  LYS B CG    1 
ATOM   942   C CD    . LYS B 2 32  ? 166.062 184.203 140.126 1.00 154.73 ? 31  LYS B CD    1 
ATOM   943   C CE    . LYS B 2 32  ? 165.861 185.059 138.895 1.00 154.73 ? 31  LYS B CE    1 
ATOM   944   N NZ    . LYS B 2 32  ? 166.523 186.382 139.040 1.00 154.73 ? 31  LYS B NZ    1 
ATOM   945   N N     . PRO B 2 33  ? 163.747 181.304 136.667 1.00 158.20 ? 32  PRO B N     1 
ATOM   946   C CA    . PRO B 2 33  ? 162.347 181.256 136.235 1.00 158.20 ? 32  PRO B CA    1 
ATOM   947   C C     . PRO B 2 33  ? 161.756 179.867 136.202 1.00 158.20 ? 32  PRO B C     1 
ATOM   948   O O     . PRO B 2 33  ? 160.534 179.760 136.254 1.00 158.20 ? 32  PRO B O     1 
ATOM   949   C CB    . PRO B 2 33  ? 162.384 181.869 134.832 1.00 158.20 ? 32  PRO B CB    1 
ATOM   950   C CG    . PRO B 2 33  ? 163.766 181.759 134.417 1.00 158.20 ? 32  PRO B CG    1 
ATOM   951   C CD    . PRO B 2 33  ? 164.523 182.036 135.651 1.00 158.20 ? 32  PRO B CD    1 
ATOM   952   N N     . ALA B 2 34  ? 162.555 178.802 136.148 1.00 153.89 ? 33  ALA B N     1 
ATOM   953   C CA    . ALA B 2 34  ? 161.966 177.470 136.265 1.00 153.89 ? 33  ALA B CA    1 
ATOM   954   C C     . ALA B 2 34  ? 161.455 177.224 137.675 1.00 153.89 ? 33  ALA B C     1 
ATOM   955   O O     . ALA B 2 34  ? 160.368 176.667 137.859 1.00 153.89 ? 33  ALA B O     1 
ATOM   956   C CB    . ALA B 2 34  ? 162.976 176.398 135.871 1.00 153.89 ? 33  ALA B CB    1 
ATOM   957   N N     . ILE B 2 35  ? 162.213 177.659 138.678 1.00 146.80 ? 34  ILE B N     1 
ATOM   958   C CA    . ILE B 2 35  ? 161.748 177.581 140.056 1.00 146.80 ? 34  ILE B CA    1 
ATOM   959   C C     . ILE B 2 35  ? 160.573 178.519 140.271 1.00 146.80 ? 34  ILE B C     1 
ATOM   960   O O     . ILE B 2 35  ? 159.651 178.216 141.036 1.00 146.80 ? 34  ILE B O     1 
ATOM   961   C CB    . ILE B 2 35  ? 162.907 177.891 141.009 1.00 146.80 ? 34  ILE B CB    1 
ATOM   962   C CG1   . ILE B 2 35  ? 164.113 177.053 140.621 1.00 146.80 ? 34  ILE B CG1   1 
ATOM   963   C CG2   . ILE B 2 35  ? 162.528 177.585 142.420 1.00 146.80 ? 34  ILE B CG2   1 
ATOM   964   C CD1   . ILE B 2 35  ? 165.399 177.525 141.225 1.00 146.80 ? 34  ILE B CD1   1 
ATOM   965   N N     . ARG B 2 36  ? 160.563 179.649 139.567 1.00 152.23 ? 35  ARG B N     1 
ATOM   966   C CA    . ARG B 2 36  ? 159.414 180.542 139.623 1.00 152.23 ? 35  ARG B CA    1 
ATOM   967   C C     . ARG B 2 36  ? 158.175 179.890 139.025 1.00 152.23 ? 35  ARG B C     1 
ATOM   968   O O     . ARG B 2 36  ? 157.076 180.019 139.569 1.00 152.23 ? 35  ARG B O     1 
ATOM   969   C CB    . ARG B 2 36  ? 159.742 181.839 138.894 1.00 152.23 ? 35  ARG B CB    1 
ATOM   970   C CG    . ARG B 2 36  ? 158.708 182.915 139.064 1.00 152.23 ? 35  ARG B CG    1 
ATOM   971   C CD    . ARG B 2 36  ? 159.288 184.261 138.712 1.00 152.23 ? 35  ARG B CD    1 
ATOM   972   N NE    . ARG B 2 36  ? 160.460 184.564 139.522 1.00 152.23 ? 35  ARG B NE    1 
ATOM   973   C CZ    . ARG B 2 36  ? 160.459 185.410 140.545 1.00 152.23 ? 35  ARG B CZ    1 
ATOM   974   N NH1   . ARG B 2 36  ? 159.347 186.044 140.885 1.00 152.23 ? 35  ARG B NH1   1 
ATOM   975   N NH2   . ARG B 2 36  ? 161.572 185.624 141.226 1.00 152.23 ? 35  ARG B NH2   1 
ATOM   976   N N     . ARG B 2 37  ? 158.343 179.165 137.919 1.00 152.69 ? 36  ARG B N     1 
ATOM   977   C CA    . ARG B 2 37  ? 157.226 178.484 137.279 1.00 152.69 ? 36  ARG B CA    1 
ATOM   978   C C     . ARG B 2 37  ? 156.707 177.353 138.147 1.00 152.69 ? 36  ARG B C     1 
ATOM   979   O O     . ARG B 2 37  ? 155.496 177.126 138.219 1.00 152.69 ? 36  ARG B O     1 
ATOM   980   C CB    . ARG B 2 37  ? 157.657 177.951 135.918 1.00 152.69 ? 36  ARG B CB    1 
ATOM   981   C CG    . ARG B 2 37  ? 157.709 178.996 134.830 1.00 152.69 ? 36  ARG B CG    1 
ATOM   982   C CD    . ARG B 2 37  ? 157.712 178.368 133.455 1.00 152.69 ? 36  ARG B CD    1 
ATOM   983   N NE    . ARG B 2 37  ? 158.870 177.517 133.224 1.00 152.69 ? 36  ARG B NE    1 
ATOM   984   C CZ    . ARG B 2 37  ? 159.921 177.883 132.507 1.00 152.69 ? 36  ARG B CZ    1 
ATOM   985   N NH1   . ARG B 2 37  ? 159.958 179.086 131.963 1.00 152.69 ? 36  ARG B NH1   1 
ATOM   986   N NH2   . ARG B 2 37  ? 160.936 177.053 132.339 1.00 152.69 ? 36  ARG B NH2   1 
ATOM   987   N N     . LEU B 2 38  ? 157.612 176.641 138.818 1.00 150.07 ? 37  LEU B N     1 
ATOM   988   C CA    . LEU B 2 38  ? 157.208 175.639 139.799 1.00 150.07 ? 37  LEU B CA    1 
ATOM   989   C C     . LEU B 2 38  ? 156.475 176.267 140.968 1.00 150.07 ? 37  LEU B C     1 
ATOM   990   O O     . LEU B 2 38  ? 155.564 175.656 141.533 1.00 150.07 ? 37  LEU B O     1 
ATOM   991   C CB    . LEU B 2 38  ? 158.429 174.894 140.311 1.00 150.07 ? 37  LEU B CB    1 
ATOM   992   C CG    . LEU B 2 38  ? 158.837 173.730 139.436 1.00 150.07 ? 37  LEU B CG    1 
ATOM   993   C CD1   . LEU B 2 38  ? 160.223 173.275 139.792 1.00 150.07 ? 37  LEU B CD1   1 
ATOM   994   C CD2   . LEU B 2 38  ? 157.851 172.634 139.655 1.00 150.07 ? 37  LEU B CD2   1 
ATOM   995   N N     . ALA B 2 39  ? 156.865 177.480 141.344 1.00 156.72 ? 38  ALA B N     1 
ATOM   996   C CA    . ALA B 2 39  ? 156.214 178.169 142.445 1.00 156.72 ? 38  ALA B CA    1 
ATOM   997   C C     . ALA B 2 39  ? 154.788 178.556 142.088 1.00 156.72 ? 38  ALA B C     1 
ATOM   998   O O     . ALA B 2 39  ? 153.855 178.292 142.855 1.00 156.72 ? 38  ALA B O     1 
ATOM   999   C CB    . ALA B 2 39  ? 157.033 179.395 142.825 1.00 156.72 ? 38  ALA B CB    1 
ATOM   1000  N N     . ARG B 2 40  ? 154.600 179.179 140.922 1.00 155.48 ? 39  ARG B N     1 
ATOM   1001  C CA    . ARG B 2 40  ? 153.250 179.522 140.487 1.00 155.48 ? 39  ARG B CA    1 
ATOM   1002  C C     . ARG B 2 40  ? 152.423 178.288 140.197 1.00 155.48 ? 39  ARG B C     1 
ATOM   1003  O O     . ARG B 2 40  ? 151.198 178.338 140.325 1.00 155.48 ? 39  ARG B O     1 
ATOM   1004  C CB    . ARG B 2 40  ? 153.256 180.393 139.238 1.00 155.48 ? 39  ARG B CB    1 
ATOM   1005  C CG    . ARG B 2 40  ? 154.271 181.484 139.219 1.00 155.48 ? 39  ARG B CG    1 
ATOM   1006  C CD    . ARG B 2 40  ? 154.101 182.456 140.337 1.00 155.48 ? 39  ARG B CD    1 
ATOM   1007  N NE    . ARG B 2 40  ? 155.171 183.437 140.300 1.00 155.48 ? 39  ARG B NE    1 
ATOM   1008  C CZ    . ARG B 2 40  ? 155.175 184.553 141.010 1.00 155.48 ? 39  ARG B CZ    1 
ATOM   1009  N NH1   . ARG B 2 40  ? 154.163 184.816 141.814 1.00 155.48 ? 39  ARG B NH1   1 
ATOM   1010  N NH2   . ARG B 2 40  ? 156.188 185.398 140.920 1.00 155.48 ? 39  ARG B NH2   1 
ATOM   1011  N N     . ARG B 2 41  ? 153.066 177.196 139.793 1.00 154.22 ? 40  ARG B N     1 
ATOM   1012  C CA    . ARG B 2 41  ? 152.370 175.923 139.704 1.00 154.22 ? 40  ARG B CA    1 
ATOM   1013  C C     . ARG B 2 41  ? 151.949 175.454 141.085 1.00 154.22 ? 40  ARG B C     1 
ATOM   1014  O O     . ARG B 2 41  ? 150.833 174.961 141.268 1.00 154.22 ? 40  ARG B O     1 
ATOM   1015  C CB    . ARG B 2 41  ? 153.269 174.898 139.020 1.00 154.22 ? 40  ARG B CB    1 
ATOM   1016  C CG    . ARG B 2 41  ? 152.761 173.487 139.053 1.00 154.22 ? 40  ARG B CG    1 
ATOM   1017  C CD    . ARG B 2 41  ? 151.508 173.333 138.242 1.00 154.22 ? 40  ARG B CD    1 
ATOM   1018  N NE    . ARG B 2 41  ? 151.762 173.109 136.825 1.00 154.22 ? 40  ARG B NE    1 
ATOM   1019  C CZ    . ARG B 2 41  ? 152.060 171.929 136.299 1.00 154.22 ? 40  ARG B CZ    1 
ATOM   1020  N NH1   . ARG B 2 41  ? 152.161 170.862 137.072 1.00 154.22 ? 40  ARG B NH1   1 
ATOM   1021  N NH2   . ARG B 2 41  ? 152.253 171.811 134.995 1.00 154.22 ? 40  ARG B NH2   1 
ATOM   1022  N N     . GLY B 2 42  ? 152.816 175.646 142.077 1.00 151.31 ? 41  GLY B N     1 
ATOM   1023  C CA    . GLY B 2 42  ? 152.442 175.349 143.443 1.00 151.31 ? 41  GLY B CA    1 
ATOM   1024  C C     . GLY B 2 42  ? 151.446 176.317 144.028 1.00 151.31 ? 41  GLY B C     1 
ATOM   1025  O O     . GLY B 2 42  ? 150.809 176.001 145.035 1.00 151.31 ? 41  GLY B O     1 
ATOM   1026  N N     . GLY B 2 43  ? 151.297 177.487 143.427 1.00 154.67 ? 42  GLY B N     1 
ATOM   1027  C CA    . GLY B 2 43  ? 150.248 178.387 143.844 1.00 154.67 ? 42  GLY B CA    1 
ATOM   1028  C C     . GLY B 2 43  ? 150.672 179.332 144.939 1.00 154.67 ? 42  GLY B C     1 
ATOM   1029  O O     . GLY B 2 43  ? 150.025 179.395 145.985 1.00 154.67 ? 42  GLY B O     1 
ATOM   1030  N N     . VAL B 2 44  ? 151.756 180.068 144.717 1.00 150.69 ? 43  VAL B N     1 
ATOM   1031  C CA    . VAL B 2 44  ? 152.261 181.031 145.685 1.00 150.69 ? 43  VAL B CA    1 
ATOM   1032  C C     . VAL B 2 44  ? 152.496 182.362 144.977 1.00 150.69 ? 43  VAL B C     1 
ATOM   1033  O O     . VAL B 2 44  ? 152.980 182.399 143.842 1.00 150.69 ? 43  VAL B O     1 
ATOM   1034  C CB    . VAL B 2 44  ? 153.518 180.498 146.401 1.00 150.69 ? 43  VAL B CB    1 
ATOM   1035  C CG1   . VAL B 2 44  ? 154.628 180.197 145.451 1.00 150.69 ? 43  VAL B CG1   1 
ATOM   1036  C CG2   . VAL B 2 44  ? 153.976 181.457 147.453 1.00 150.69 ? 43  VAL B CG2   1 
ATOM   1037  N N     . LYS B 2 45  ? 152.090 183.451 145.629 1.00 158.06 ? 44  LYS B N     1 
ATOM   1038  C CA    . LYS B 2 45  ? 152.032 184.742 144.962 1.00 158.06 ? 44  LYS B CA    1 
ATOM   1039  C C     . LYS B 2 45  ? 153.398 185.396 144.841 1.00 158.06 ? 44  LYS B C     1 
ATOM   1040  O O     . LYS B 2 45  ? 153.654 186.095 143.857 1.00 158.06 ? 44  LYS B O     1 
ATOM   1041  C CB    . LYS B 2 45  ? 151.082 185.663 145.718 1.00 158.06 ? 44  LYS B CB    1 
ATOM   1042  C CG    . LYS B 2 45  ? 150.589 186.867 144.958 1.00 158.06 ? 44  LYS B CG    1 
ATOM   1043  C CD    . LYS B 2 45  ? 149.421 187.493 145.707 1.00 158.06 ? 44  LYS B CD    1 
ATOM   1044  C CE    . LYS B 2 45  ? 149.163 188.924 145.284 1.00 158.06 ? 44  LYS B CE    1 
ATOM   1045  N NZ    . LYS B 2 45  ? 148.052 189.534 146.063 1.00 158.06 ? 44  LYS B NZ    1 
ATOM   1046  N N     . ARG B 2 46  ? 154.288 185.191 145.805 1.00 155.10 ? 45  ARG B N     1 
ATOM   1047  C CA    . ARG B 2 46  ? 155.459 186.057 145.893 1.00 155.10 ? 45  ARG B CA    1 
ATOM   1048  C C     . ARG B 2 46  ? 156.611 185.306 146.528 1.00 155.10 ? 45  ARG B C     1 
ATOM   1049  O O     . ARG B 2 46  ? 156.475 184.796 147.640 1.00 155.10 ? 45  ARG B O     1 
ATOM   1050  C CB    . ARG B 2 46  ? 155.120 187.290 146.700 1.00 155.10 ? 45  ARG B CB    1 
ATOM   1051  C CG    . ARG B 2 46  ? 156.301 188.119 147.075 1.00 155.10 ? 45  ARG B CG    1 
ATOM   1052  C CD    . ARG B 2 46  ? 155.856 189.526 147.388 1.00 155.10 ? 45  ARG B CD    1 
ATOM   1053  N NE    . ARG B 2 46  ? 156.983 190.431 147.553 1.00 155.10 ? 45  ARG B NE    1 
ATOM   1054  C CZ    . ARG B 2 46  ? 156.886 191.748 147.463 1.00 155.10 ? 45  ARG B CZ    1 
ATOM   1055  N NH1   . ARG B 2 46  ? 155.711 192.304 147.212 1.00 155.10 ? 45  ARG B NH1   1 
ATOM   1056  N NH2   . ARG B 2 46  ? 157.958 192.507 147.624 1.00 155.10 ? 45  ARG B NH2   1 
ATOM   1057  N N     . ILE B 2 47  ? 157.745 185.267 145.846 1.00 150.02 ? 46  ILE B N     1 
ATOM   1058  C CA    . ILE B 2 47  ? 158.896 184.496 146.280 1.00 150.02 ? 46  ILE B CA    1 
ATOM   1059  C C     . ILE B 2 47  ? 159.947 185.461 146.805 1.00 150.02 ? 46  ILE B C     1 
ATOM   1060  O O     . ILE B 2 47  ? 159.989 186.630 146.426 1.00 150.02 ? 46  ILE B O     1 
ATOM   1061  C CB    . ILE B 2 47  ? 159.452 183.655 145.120 1.00 150.02 ? 46  ILE B CB    1 
ATOM   1062  C CG1   . ILE B 2 47  ? 158.312 183.165 144.251 1.00 150.02 ? 46  ILE B CG1   1 
ATOM   1063  C CG2   . ILE B 2 47  ? 160.169 182.442 145.623 1.00 150.02 ? 46  ILE B CG2   1 
ATOM   1064  C CD1   . ILE B 2 47  ? 158.778 182.670 142.922 1.00 150.02 ? 46  ILE B CD1   1 
ATOM   1065  N N     . SER B 2 48  ? 160.814 184.967 147.682 1.00 150.23 ? 47  SER B N     1 
ATOM   1066  C CA    . SER B 2 48  ? 161.942 185.771 148.128 1.00 150.23 ? 47  SER B CA    1 
ATOM   1067  C C     . SER B 2 48  ? 163.072 185.659 147.116 1.00 150.23 ? 47  SER B C     1 
ATOM   1068  O O     . SER B 2 48  ? 162.905 185.159 146.002 1.00 150.23 ? 47  SER B O     1 
ATOM   1069  C CB    . SER B 2 48  ? 162.433 185.332 149.495 1.00 150.23 ? 47  SER B CB    1 
ATOM   1070  O OG    . SER B 2 48  ? 163.187 184.147 149.371 1.00 150.23 ? 47  SER B OG    1 
ATOM   1071  N N     . GLY B 2 49  ? 164.254 186.112 147.507 1.00 153.54 ? 48  GLY B N     1 
ATOM   1072  C CA    . GLY B 2 49  ? 165.416 185.981 146.657 1.00 153.54 ? 48  GLY B CA    1 
ATOM   1073  C C     . GLY B 2 49  ? 166.344 184.884 147.125 1.00 153.54 ? 48  GLY B C     1 
ATOM   1074  O O     . GLY B 2 49  ? 167.377 184.623 146.504 1.00 153.54 ? 48  GLY B O     1 
ATOM   1075  N N     . LEU B 2 50  ? 165.989 184.233 148.227 1.00 146.85 ? 49  LEU B N     1 
ATOM   1076  C CA    . LEU B 2 50  ? 166.818 183.182 148.786 1.00 146.85 ? 49  LEU B CA    1 
ATOM   1077  C C     . LEU B 2 50  ? 166.243 181.796 148.578 1.00 146.85 ? 49  LEU B C     1 
ATOM   1078  O O     . LEU B 2 50  ? 166.900 180.817 148.942 1.00 146.85 ? 49  LEU B O     1 
ATOM   1079  C CB    . LEU B 2 50  ? 167.035 183.412 150.283 1.00 146.85 ? 49  LEU B CB    1 
ATOM   1080  C CG    . LEU B 2 50  ? 167.373 184.838 150.687 1.00 146.85 ? 49  LEU B CG    1 
ATOM   1081  C CD1   . LEU B 2 50  ? 167.428 184.948 152.192 1.00 146.85 ? 49  LEU B CD1   1 
ATOM   1082  C CD2   . LEU B 2 50  ? 168.692 185.238 150.076 1.00 146.85 ? 49  LEU B CD2   1 
ATOM   1083  N N     . ILE B 2 51  ? 165.041 181.686 148.012 1.00 150.09 ? 50  ILE B N     1 
ATOM   1084  C CA    . ILE B 2 51  ? 164.376 180.396 147.872 1.00 150.09 ? 50  ILE B CA    1 
ATOM   1085  C C     . ILE B 2 51  ? 165.109 179.510 146.876 1.00 150.09 ? 50  ILE B C     1 
ATOM   1086  O O     . ILE B 2 51  ? 165.173 178.287 147.053 1.00 150.09 ? 50  ILE B O     1 
ATOM   1087  C CB    . ILE B 2 51  ? 162.901 180.639 147.492 1.00 150.09 ? 50  ILE B CB    1 
ATOM   1088  C CG1   . ILE B 2 51  ? 162.123 181.129 148.707 1.00 150.09 ? 50  ILE B CG1   1 
ATOM   1089  C CG2   . ILE B 2 51  ? 162.213 179.415 146.931 1.00 150.09 ? 50  ILE B CG2   1 
ATOM   1090  C CD1   . ILE B 2 51  ? 161.927 180.093 149.764 1.00 150.09 ? 50  ILE B CD1   1 
ATOM   1091  N N     . TYR B 2 52  ? 165.751 180.114 145.878 1.00 152.69 ? 51  TYR B N     1 
ATOM   1092  C CA    . TYR B 2 52  ? 166.263 179.356 144.743 1.00 152.69 ? 51  TYR B CA    1 
ATOM   1093  C C     . TYR B 2 52  ? 167.453 178.482 145.119 1.00 152.69 ? 51  TYR B C     1 
ATOM   1094  O O     . TYR B 2 52  ? 167.558 177.341 144.651 1.00 152.69 ? 51  TYR B O     1 
ATOM   1095  C CB    . TYR B 2 52  ? 166.630 180.320 143.622 1.00 152.69 ? 51  TYR B CB    1 
ATOM   1096  C CG    . TYR B 2 52  ? 165.601 181.401 143.433 1.00 152.69 ? 51  TYR B CG    1 
ATOM   1097  C CD1   . TYR B 2 52  ? 164.310 181.090 143.045 1.00 152.69 ? 51  TYR B CD1   1 
ATOM   1098  C CD2   . TYR B 2 52  ? 165.916 182.731 143.656 1.00 152.69 ? 51  TYR B CD2   1 
ATOM   1099  C CE1   . TYR B 2 52  ? 163.363 182.073 142.874 1.00 152.69 ? 51  TYR B CE1   1 
ATOM   1100  C CE2   . TYR B 2 52  ? 164.972 183.720 143.493 1.00 152.69 ? 51  TYR B CE2   1 
ATOM   1101  C CZ    . TYR B 2 52  ? 163.701 183.384 143.099 1.00 152.69 ? 51  TYR B CZ    1 
ATOM   1102  O OH    . TYR B 2 52  ? 162.759 184.365 142.932 1.00 152.69 ? 51  TYR B OH    1 
ATOM   1103  N N     . GLU B 2 53  ? 168.330 178.969 145.994 1.00 157.16 ? 52  GLU B N     1 
ATOM   1104  C CA    . GLU B 2 53  ? 169.545 178.222 146.307 1.00 157.16 ? 52  GLU B CA    1 
ATOM   1105  C C     . GLU B 2 53  ? 169.239 177.002 147.165 1.00 157.16 ? 52  GLU B C     1 
ATOM   1106  O O     . GLU B 2 53  ? 169.687 175.884 146.869 1.00 157.16 ? 52  GLU B O     1 
ATOM   1107  C CB    . GLU B 2 53  ? 170.544 179.135 147.007 1.00 157.16 ? 52  GLU B CB    1 
ATOM   1108  C CG    . GLU B 2 53  ? 170.882 180.366 146.205 1.00 157.16 ? 52  GLU B CG    1 
ATOM   1109  C CD    . GLU B 2 53  ? 171.036 180.065 144.730 1.00 157.16 ? 52  GLU B CD    1 
ATOM   1110  O OE1   . GLU B 2 53  ? 171.985 179.342 144.361 1.00 157.16 ? 52  GLU B OE1   1 
ATOM   1111  O OE2   . GLU B 2 53  ? 170.193 180.539 143.942 1.00 157.16 ? 52  GLU B OE2   1 
ATOM   1112  N N     . GLU B 2 54  ? 168.458 177.193 148.222 1.00 155.94 ? 53  GLU B N     1 
ATOM   1113  C CA    . GLU B 2 54  ? 168.027 176.068 149.034 1.00 155.94 ? 53  GLU B CA    1 
ATOM   1114  C C     . GLU B 2 54  ? 167.082 175.148 148.284 1.00 155.94 ? 53  GLU B C     1 
ATOM   1115  O O     . GLU B 2 54  ? 167.035 173.960 148.597 1.00 155.94 ? 53  GLU B O     1 
ATOM   1116  C CB    . GLU B 2 54  ? 167.351 176.573 150.290 1.00 155.94 ? 53  GLU B CB    1 
ATOM   1117  C CG    . GLU B 2 54  ? 166.488 177.718 149.958 1.00 155.94 ? 53  GLU B CG    1 
ATOM   1118  C CD    . GLU B 2 54  ? 165.780 178.292 151.128 1.00 155.94 ? 53  GLU B CD    1 
ATOM   1119  O OE1   . GLU B 2 54  ? 165.918 177.752 152.241 1.00 155.94 ? 53  GLU B OE1   1 
ATOM   1120  O OE2   . GLU B 2 54  ? 165.069 179.285 150.906 1.00 155.94 ? 53  GLU B OE2   1 
ATOM   1121  N N     . THR B 2 55  ? 166.352 175.656 147.290 1.00 151.14 ? 54  THR B N     1 
ATOM   1122  C CA    . THR B 2 55  ? 165.527 174.781 146.471 1.00 151.14 ? 54  THR B CA    1 
ATOM   1123  C C     . THR B 2 55  ? 166.391 173.873 145.615 1.00 151.14 ? 54  THR B C     1 
ATOM   1124  O O     . THR B 2 55  ? 166.108 172.676 145.488 1.00 151.14 ? 54  THR B O     1 
ATOM   1125  C CB    . THR B 2 55  ? 164.592 175.622 145.614 1.00 151.14 ? 54  THR B CB    1 
ATOM   1126  O OG1   . THR B 2 55  ? 163.703 176.339 146.472 1.00 151.14 ? 54  THR B OG1   1 
ATOM   1127  C CG2   . THR B 2 55  ? 163.775 174.758 144.685 1.00 151.14 ? 54  THR B CG2   1 
ATOM   1128  N N     . ARG B 2 56  ? 167.473 174.419 145.061 1.00 150.53 ? 55  ARG B N     1 
ATOM   1129  C CA    . ARG B 2 56  ? 168.437 173.586 144.358 1.00 150.53 ? 55  ARG B CA    1 
ATOM   1130  C C     . ARG B 2 56  ? 169.081 172.570 145.286 1.00 150.53 ? 55  ARG B C     1 
ATOM   1131  O O     . ARG B 2 56  ? 169.306 171.425 144.879 1.00 150.53 ? 55  ARG B O     1 
ATOM   1132  C CB    . ARG B 2 56  ? 169.504 174.454 143.709 1.00 150.53 ? 55  ARG B CB    1 
ATOM   1133  C CG    . ARG B 2 56  ? 169.182 174.829 142.286 1.00 150.53 ? 55  ARG B CG    1 
ATOM   1134  C CD    . ARG B 2 56  ? 170.192 175.805 141.740 1.00 150.53 ? 55  ARG B CD    1 
ATOM   1135  N NE    . ARG B 2 56  ? 169.583 176.695 140.766 1.00 150.53 ? 55  ARG B NE    1 
ATOM   1136  C CZ    . ARG B 2 56  ? 169.013 177.849 141.079 1.00 150.53 ? 55  ARG B CZ    1 
ATOM   1137  N NH1   . ARG B 2 56  ? 168.991 178.249 142.336 1.00 150.53 ? 55  ARG B NH1   1 
ATOM   1138  N NH2   . ARG B 2 56  ? 168.479 178.605 140.135 1.00 150.53 ? 55  ARG B NH2   1 
ATOM   1139  N N     . GLY B 2 57  ? 169.335 172.952 146.538 1.00 145.48 ? 56  GLY B N     1 
ATOM   1140  C CA    . GLY B 2 57  ? 169.870 171.994 147.500 1.00 145.48 ? 56  GLY B CA    1 
ATOM   1141  C C     . GLY B 2 57  ? 168.903 170.867 147.827 1.00 145.48 ? 56  GLY B C     1 
ATOM   1142  O O     . GLY B 2 57  ? 169.295 169.696 147.887 1.00 145.48 ? 56  GLY B O     1 
ATOM   1143  N N     . VAL B 2 58  ? 167.627 171.211 148.029 1.00 141.76 ? 57  VAL B N     1 
ATOM   1144  C CA    . VAL B 2 58  ? 166.575 170.229 148.280 1.00 141.76 ? 57  VAL B CA    1 
ATOM   1145  C C     . VAL B 2 58  ? 166.446 169.264 147.116 1.00 141.76 ? 57  VAL B C     1 
ATOM   1146  O O     . VAL B 2 58  ? 166.364 168.040 147.305 1.00 141.76 ? 57  VAL B O     1 
ATOM   1147  C CB    . VAL B 2 58  ? 165.249 170.956 148.555 1.00 141.76 ? 57  VAL B CB    1 
ATOM   1148  C CG1   . VAL B 2 58  ? 164.081 170.014 148.453 1.00 141.76 ? 57  VAL B CG1   1 
ATOM   1149  C CG2   . VAL B 2 58  ? 165.278 171.547 149.932 1.00 141.76 ? 57  VAL B CG2   1 
ATOM   1150  N N     . LEU B 2 59  ? 166.465 169.795 145.899 1.00 139.45 ? 58  LEU B N     1 
ATOM   1151  C CA    . LEU B 2 59  ? 166.306 168.952 144.726 1.00 139.45 ? 58  LEU B CA    1 
ATOM   1152  C C     . LEU B 2 59  ? 167.503 168.042 144.525 1.00 139.45 ? 58  LEU B C     1 
ATOM   1153  O O     . LEU B 2 59  ? 167.342 166.883 144.128 1.00 139.45 ? 58  LEU B O     1 
ATOM   1154  C CB    . LEU B 2 59  ? 166.089 169.813 143.497 1.00 139.45 ? 58  LEU B CB    1 
ATOM   1155  C CG    . LEU B 2 59  ? 165.471 169.044 142.350 1.00 139.45 ? 58  LEU B CG    1 
ATOM   1156  C CD1   . LEU B 2 59  ? 164.163 168.457 142.791 1.00 139.45 ? 58  LEU B CD1   1 
ATOM   1157  C CD2   . LEU B 2 59  ? 165.275 169.988 141.196 1.00 139.45 ? 58  LEU B CD2   1 
ATOM   1158  N N     . LYS B 2 60  ? 168.706 168.537 144.820 1.00 143.37 ? 59  LYS B N     1 
ATOM   1159  C CA    . LYS B 2 60  ? 169.881 167.687 144.724 1.00 143.37 ? 59  LYS B CA    1 
ATOM   1160  C C     . LYS B 2 60  ? 169.854 166.573 145.760 1.00 143.37 ? 59  LYS B C     1 
ATOM   1161  O O     . LYS B 2 60  ? 170.233 165.442 145.446 1.00 143.37 ? 59  LYS B O     1 
ATOM   1162  C CB    . LYS B 2 60  ? 171.144 168.515 144.877 1.00 143.37 ? 59  LYS B CB    1 
ATOM   1163  C CG    . LYS B 2 60  ? 172.376 167.757 144.496 1.00 143.37 ? 59  LYS B CG    1 
ATOM   1164  C CD    . LYS B 2 60  ? 173.620 168.482 144.929 1.00 143.37 ? 59  LYS B CD    1 
ATOM   1165  C CE    . LYS B 2 60  ? 174.843 167.609 144.723 1.00 143.37 ? 59  LYS B CE    1 
ATOM   1166  N NZ    . LYS B 2 60  ? 176.098 168.317 145.086 1.00 143.37 ? 59  LYS B NZ    1 
ATOM   1167  N N     . VAL B 2 61  ? 169.357 166.857 146.967 1.00 140.62 ? 60  VAL B N     1 
ATOM   1168  C CA    . VAL B 2 61  ? 169.232 165.825 147.998 1.00 140.62 ? 60  VAL B CA    1 
ATOM   1169  C C     . VAL B 2 61  ? 168.250 164.741 147.565 1.00 140.62 ? 60  VAL B C     1 
ATOM   1170  O O     . VAL B 2 61  ? 168.549 163.536 147.636 1.00 140.62 ? 60  VAL B O     1 
ATOM   1171  C CB    . VAL B 2 61  ? 168.810 166.467 149.331 1.00 140.62 ? 60  VAL B CB    1 
ATOM   1172  C CG1   . VAL B 2 61  ? 168.215 165.442 150.277 1.00 140.62 ? 60  VAL B CG1   1 
ATOM   1173  C CG2   . VAL B 2 61  ? 169.994 167.138 149.979 1.00 140.62 ? 60  VAL B CG2   1 
ATOM   1174  N N     . PHE B 2 62  ? 167.078 165.162 147.088 1.00 138.22 ? 61  PHE B N     1 
ATOM   1175  C CA    . PHE B 2 62  ? 166.026 164.224 146.714 1.00 138.22 ? 61  PHE B CA    1 
ATOM   1176  C C     . PHE B 2 62  ? 166.449 163.356 145.537 1.00 138.22 ? 61  PHE B C     1 
ATOM   1177  O O     . PHE B 2 62  ? 166.278 162.126 145.557 1.00 138.22 ? 61  PHE B O     1 
ATOM   1178  C CB    . PHE B 2 62  ? 164.762 165.013 146.393 1.00 138.22 ? 61  PHE B CB    1 
ATOM   1179  C CG    . PHE B 2 62  ? 163.689 164.212 145.755 1.00 138.22 ? 61  PHE B CG    1 
ATOM   1180  C CD1   . PHE B 2 62  ? 162.916 163.356 146.504 1.00 138.22 ? 61  PHE B CD1   1 
ATOM   1181  C CD2   . PHE B 2 62  ? 163.422 164.344 144.409 1.00 138.22 ? 61  PHE B CD2   1 
ATOM   1182  C CE1   . PHE B 2 62  ? 161.911 162.624 145.916 1.00 138.22 ? 61  PHE B CE1   1 
ATOM   1183  C CE2   . PHE B 2 62  ? 162.424 163.617 143.820 1.00 138.22 ? 61  PHE B CE2   1 
ATOM   1184  C CZ    . PHE B 2 62  ? 161.666 162.757 144.576 1.00 138.22 ? 61  PHE B CZ    1 
ATOM   1185  N N     . LEU B 2 63  ? 167.039 163.978 144.514 1.00 144.34 ? 62  LEU B N     1 
ATOM   1186  C CA    . LEU B 2 63  ? 167.516 163.214 143.374 1.00 144.34 ? 62  LEU B CA    1 
ATOM   1187  C C     . LEU B 2 63  ? 168.685 162.321 143.740 1.00 144.34 ? 62  LEU B C     1 
ATOM   1188  O O     . LEU B 2 63  ? 168.828 161.248 143.153 1.00 144.34 ? 62  LEU B O     1 
ATOM   1189  C CB    . LEU B 2 63  ? 167.926 164.139 142.241 1.00 144.34 ? 62  LEU B CB    1 
ATOM   1190  C CG    . LEU B 2 63  ? 166.845 164.850 141.447 1.00 144.34 ? 62  LEU B CG    1 
ATOM   1191  C CD1   . LEU B 2 63  ? 167.437 165.321 140.145 1.00 144.34 ? 62  LEU B CD1   1 
ATOM   1192  C CD2   . LEU B 2 63  ? 165.669 163.938 141.207 1.00 144.34 ? 62  LEU B CD2   1 
ATOM   1193  N N     . GLU B 2 64  ? 169.507 162.722 144.715 1.00 152.03 ? 63  GLU B N     1 
ATOM   1194  C CA    . GLU B 2 64  ? 170.609 161.867 145.130 1.00 152.03 ? 63  GLU B CA    1 
ATOM   1195  C C     . GLU B 2 64  ? 170.098 160.595 145.781 1.00 152.03 ? 63  GLU B C     1 
ATOM   1196  O O     . GLU B 2 64  ? 170.583 159.502 145.467 1.00 152.03 ? 63  GLU B O     1 
ATOM   1197  C CB    . GLU B 2 64  ? 171.529 162.624 146.077 1.00 152.03 ? 63  GLU B CB    1 
ATOM   1198  C CG    . GLU B 2 64  ? 172.719 163.247 145.385 1.00 152.03 ? 63  GLU B CG    1 
ATOM   1199  C CD    . GLU B 2 64  ? 173.633 163.985 146.339 1.00 152.03 ? 63  GLU B CD    1 
ATOM   1200  O OE1   . GLU B 2 64  ? 174.728 164.405 145.912 1.00 152.03 ? 63  GLU B OE1   1 
ATOM   1201  O OE2   . GLU B 2 64  ? 173.257 164.142 147.518 1.00 152.03 ? 63  GLU B OE2   1 
ATOM   1202  N N     . ASN B 2 65  ? 169.068 160.713 146.623 1.00 145.14 ? 64  ASN B N     1 
ATOM   1203  C CA    . ASN B 2 65  ? 168.492 159.527 147.257 1.00 145.14 ? 64  ASN B CA    1 
ATOM   1204  C C     . ASN B 2 65  ? 167.845 158.598 146.232 1.00 145.14 ? 64  ASN B C     1 
ATOM   1205  O O     . ASN B 2 65  ? 168.117 157.385 146.212 1.00 145.14 ? 64  ASN B O     1 
ATOM   1206  C CB    . ASN B 2 65  ? 167.473 159.944 148.309 1.00 145.14 ? 64  ASN B CB    1 
ATOM   1207  C CG    . ASN B 2 65  ? 168.114 160.566 149.517 1.00 145.14 ? 64  ASN B CG    1 
ATOM   1208  O OD1   . ASN B 2 65  ? 169.306 160.389 149.759 1.00 145.14 ? 64  ASN B OD1   1 
ATOM   1209  N ND2   . ASN B 2 65  ? 167.328 161.303 150.289 1.00 145.14 ? 64  ASN B ND2   1 
ATOM   1210  N N     . VAL B 2 66  ? 167.012 159.161 145.349 1.00 143.43 ? 65  VAL B N     1 
ATOM   1211  C CA    . VAL B 2 66  ? 166.270 158.335 144.397 1.00 143.43 ? 65  VAL B CA    1 
ATOM   1212  C C     . VAL B 2 66  ? 167.208 157.697 143.377 1.00 143.43 ? 65  VAL B C     1 
ATOM   1213  O O     . VAL B 2 66  ? 167.087 156.505 143.058 1.00 143.43 ? 65  VAL B O     1 
ATOM   1214  C CB    . VAL B 2 66  ? 165.172 159.176 143.729 1.00 143.43 ? 65  VAL B CB    1 
ATOM   1215  C CG1   . VAL B 2 66  ? 164.582 158.466 142.539 1.00 143.43 ? 65  VAL B CG1   1 
ATOM   1216  C CG2   . VAL B 2 66  ? 164.093 159.471 144.730 1.00 143.43 ? 65  VAL B CG2   1 
ATOM   1217  N N     . ILE B 2 67  ? 168.195 158.452 142.901 1.00 145.39 ? 66  ILE B N     1 
ATOM   1218  C CA    . ILE B 2 67  ? 169.136 157.922 141.934 1.00 145.39 ? 66  ILE B CA    1 
ATOM   1219  C C     . ILE B 2 67  ? 170.058 156.899 142.579 1.00 145.39 ? 66  ILE B C     1 
ATOM   1220  O O     . ILE B 2 67  ? 170.434 155.916 141.934 1.00 145.39 ? 66  ILE B O     1 
ATOM   1221  C CB    . ILE B 2 67  ? 169.880 159.102 141.285 1.00 145.39 ? 66  ILE B CB    1 
ATOM   1222  C CG1   . ILE B 2 67  ? 168.996 159.731 140.223 1.00 145.39 ? 66  ILE B CG1   1 
ATOM   1223  C CG2   . ILE B 2 67  ? 171.163 158.701 140.635 1.00 145.39 ? 66  ILE B CG2   1 
ATOM   1224  C CD1   . ILE B 2 67  ? 169.518 161.032 139.719 1.00 145.39 ? 66  ILE B CD1   1 
ATOM   1225  N N     . ARG B 2 68  ? 170.368 157.050 143.872 1.00 149.62 ? 67  ARG B N     1 
ATOM   1226  C CA    . ARG B 2 68  ? 171.156 156.034 144.562 1.00 149.62 ? 67  ARG B CA    1 
ATOM   1227  C C     . ARG B 2 68  ? 170.404 154.716 144.651 1.00 149.62 ? 67  ARG B C     1 
ATOM   1228  O O     . ARG B 2 68  ? 170.982 153.645 144.409 1.00 149.62 ? 67  ARG B O     1 
ATOM   1229  C CB    . ARG B 2 68  ? 171.536 156.530 145.953 1.00 149.62 ? 67  ARG B CB    1 
ATOM   1230  C CG    . ARG B 2 68  ? 172.338 155.539 146.764 1.00 149.62 ? 67  ARG B CG    1 
ATOM   1231  C CD    . ARG B 2 68  ? 172.544 156.037 148.181 1.00 149.62 ? 67  ARG B CD    1 
ATOM   1232  N NE    . ARG B 2 68  ? 172.498 154.946 149.149 1.00 149.62 ? 67  ARG B NE    1 
ATOM   1233  C CZ    . ARG B 2 68  ? 171.400 154.571 149.798 1.00 149.62 ? 67  ARG B CZ    1 
ATOM   1234  N NH1   . ARG B 2 68  ? 171.446 153.567 150.661 1.00 149.62 ? 67  ARG B NH1   1 
ATOM   1235  N NH2   . ARG B 2 68  ? 170.255 155.202 149.585 1.00 149.62 ? 67  ARG B NH2   1 
ATOM   1236  N N     . ASP B 2 69  ? 169.097 154.780 144.918 1.00 151.62 ? 68  ASP B N     1 
ATOM   1237  C CA    . ASP B 2 69  ? 168.309 153.550 144.940 1.00 151.62 ? 68  ASP B CA    1 
ATOM   1238  C C     . ASP B 2 69  ? 168.208 152.915 143.556 1.00 151.62 ? 68  ASP B C     1 
ATOM   1239  O O     . ASP B 2 69  ? 168.352 151.693 143.422 1.00 151.62 ? 68  ASP B O     1 
ATOM   1240  C CB    . ASP B 2 69  ? 166.921 153.820 145.504 1.00 151.62 ? 68  ASP B CB    1 
ATOM   1241  C CG    . ASP B 2 69  ? 166.966 154.381 146.897 1.00 151.62 ? 68  ASP B CG    1 
ATOM   1242  O OD1   . ASP B 2 69  ? 168.076 154.682 147.373 1.00 151.62 ? 68  ASP B OD1   1 
ATOM   1243  O OD2   . ASP B 2 69  ? 165.896 154.515 147.522 1.00 151.62 ? 68  ASP B OD2   1 
ATOM   1244  N N     . ALA B 2 70  ? 167.997 153.725 142.513 1.00 145.48 ? 69  ALA B N     1 
ATOM   1245  C CA    . ALA B 2 70  ? 167.849 153.166 141.169 1.00 145.48 ? 69  ALA B CA    1 
ATOM   1246  C C     . ALA B 2 70  ? 169.160 152.590 140.653 1.00 145.48 ? 69  ALA B C     1 
ATOM   1247  O O     . ALA B 2 70  ? 169.166 151.570 139.953 1.00 145.48 ? 69  ALA B O     1 
ATOM   1248  C CB    . ALA B 2 70  ? 167.324 154.225 140.210 1.00 145.48 ? 69  ALA B CB    1 
ATOM   1249  N N     . VAL B 2 71  ? 170.279 153.214 141.011 1.00 143.89 ? 70  VAL B N     1 
ATOM   1250  C CA    . VAL B 2 71  ? 171.585 152.691 140.645 1.00 143.89 ? 70  VAL B CA    1 
ATOM   1251  C C     . VAL B 2 71  ? 171.861 151.395 141.385 1.00 143.89 ? 70  VAL B C     1 
ATOM   1252  O O     . VAL B 2 71  ? 172.440 150.465 140.813 1.00 143.89 ? 70  VAL B O     1 
ATOM   1253  C CB    . VAL B 2 71  ? 172.651 153.773 140.902 1.00 143.89 ? 70  VAL B CB    1 
ATOM   1254  C CG1   . VAL B 2 71  ? 174.049 153.201 141.001 1.00 143.89 ? 70  VAL B CG1   1 
ATOM   1255  C CG2   . VAL B 2 71  ? 172.616 154.774 139.784 1.00 143.89 ? 70  VAL B CG2   1 
ATOM   1256  N N     . THR B 2 72  ? 171.386 151.275 142.628 1.00 145.16 ? 71  THR B N     1 
ATOM   1257  C CA    . THR B 2 72  ? 171.507 150.010 143.349 1.00 145.16 ? 71  THR B CA    1 
ATOM   1258  C C     . THR B 2 72  ? 170.701 148.900 142.687 1.00 145.16 ? 71  THR B C     1 
ATOM   1259  O O     . THR B 2 72  ? 171.189 147.769 142.552 1.00 145.16 ? 71  THR B O     1 
ATOM   1260  C CB    . THR B 2 72  ? 171.050 150.195 144.785 1.00 145.16 ? 71  THR B CB    1 
ATOM   1261  O OG1   . THR B 2 72  ? 171.687 151.353 145.333 1.00 145.16 ? 71  THR B OG1   1 
ATOM   1262  C CG2   . THR B 2 72  ? 171.405 148.987 145.605 1.00 145.16 ? 71  THR B CG2   1 
ATOM   1263  N N     . TYR B 2 73  ? 169.473 149.217 142.264 1.00 146.25 ? 72  TYR B N     1 
ATOM   1264  C CA    . TYR B 2 73  ? 168.636 148.255 141.548 1.00 146.25 ? 72  TYR B CA    1 
ATOM   1265  C C     . TYR B 2 73  ? 169.299 147.776 140.266 1.00 146.25 ? 72  TYR B C     1 
ATOM   1266  O O     . TYR B 2 73  ? 169.397 146.570 140.019 1.00 146.25 ? 72  TYR B O     1 
ATOM   1267  C CB    . TYR B 2 73  ? 167.292 148.879 141.202 1.00 146.25 ? 72  TYR B CB    1 
ATOM   1268  C CG    . TYR B 2 73  ? 166.211 148.695 142.218 1.00 146.25 ? 72  TYR B CG    1 
ATOM   1269  C CD1   . TYR B 2 73  ? 165.367 147.607 142.163 1.00 146.25 ? 72  TYR B CD1   1 
ATOM   1270  C CD2   . TYR B 2 73  ? 166.000 149.636 143.200 1.00 146.25 ? 72  TYR B CD2   1 
ATOM   1271  C CE1   . TYR B 2 73  ? 164.362 147.450 143.085 1.00 146.25 ? 72  TYR B CE1   1 
ATOM   1272  C CE2   . TYR B 2 73  ? 165.001 149.493 144.118 1.00 146.25 ? 72  TYR B CE2   1 
ATOM   1273  C CZ    . TYR B 2 73  ? 164.186 148.398 144.061 1.00 146.25 ? 72  TYR B CZ    1 
ATOM   1274  O OH    . TYR B 2 73  ? 163.185 148.256 144.990 1.00 146.25 ? 72  TYR B OH    1 
ATOM   1275  N N     . THR B 2 74  ? 169.771 148.711 139.446 1.00 148.10 ? 73  THR B N     1 
ATOM   1276  C CA    . THR B 2 74  ? 170.363 148.351 138.166 1.00 148.10 ? 73  THR B CA    1 
ATOM   1277  C C     . THR B 2 74  ? 171.732 147.713 138.331 1.00 148.10 ? 73  THR B C     1 
ATOM   1278  O O     . THR B 2 74  ? 172.175 146.957 137.460 1.00 148.10 ? 73  THR B O     1 
ATOM   1279  C CB    . THR B 2 74  ? 170.439 149.590 137.292 1.00 148.10 ? 73  THR B CB    1 
ATOM   1280  O OG1   . THR B 2 74  ? 169.235 150.339 137.467 1.00 148.10 ? 73  THR B OG1   1 
ATOM   1281  C CG2   . THR B 2 74  ? 170.543 149.213 135.842 1.00 148.10 ? 73  THR B CG2   1 
ATOM   1282  N N     . GLU B 2 75  ? 172.407 147.974 139.444 1.00 156.05 ? 74  GLU B N     1 
ATOM   1283  C CA    . GLU B 2 75  ? 173.613 147.225 139.742 1.00 156.05 ? 74  GLU B CA    1 
ATOM   1284  C C     . GLU B 2 75  ? 173.284 145.797 140.126 1.00 156.05 ? 74  GLU B C     1 
ATOM   1285  O O     . GLU B 2 75  ? 174.062 144.886 139.826 1.00 156.05 ? 74  GLU B O     1 
ATOM   1286  C CB    . GLU B 2 75  ? 174.395 147.907 140.857 1.00 156.05 ? 74  GLU B CB    1 
ATOM   1287  C CG    . GLU B 2 75  ? 175.809 147.391 141.010 1.00 156.05 ? 74  GLU B CG    1 
ATOM   1288  C CD    . GLU B 2 75  ? 176.753 148.438 141.554 1.00 156.05 ? 74  GLU B CD    1 
ATOM   1289  O OE1   . GLU B 2 75  ? 176.272 149.508 141.976 1.00 156.05 ? 74  GLU B OE1   1 
ATOM   1290  O OE2   . GLU B 2 75  ? 177.976 148.192 141.557 1.00 156.05 ? 74  GLU B OE2   1 
ATOM   1291  N N     . HIS B 2 76  ? 172.139 145.575 140.777 1.00 151.38 ? 75  HIS B N     1 
ATOM   1292  C CA    . HIS B 2 76  ? 171.806 144.208 141.152 1.00 151.38 ? 75  HIS B CA    1 
ATOM   1293  C C     . HIS B 2 76  ? 171.418 143.377 139.943 1.00 151.38 ? 75  HIS B C     1 
ATOM   1294  O O     . HIS B 2 76  ? 171.782 142.202 139.853 1.00 151.38 ? 75  HIS B O     1 
ATOM   1295  C CB    . HIS B 2 76  ? 170.683 144.158 142.170 1.00 151.38 ? 75  HIS B CB    1 
ATOM   1296  C CG    . HIS B 2 76  ? 170.249 142.763 142.467 1.00 151.38 ? 75  HIS B CG    1 
ATOM   1297  N ND1   . HIS B 2 76  ? 169.031 142.259 142.073 1.00 151.38 ? 75  HIS B ND1   1 
ATOM   1298  C CD2   . HIS B 2 76  ? 170.911 141.737 143.049 1.00 151.38 ? 75  HIS B CD2   1 
ATOM   1299  C CE1   . HIS B 2 76  ? 168.942 140.994 142.442 1.00 151.38 ? 75  HIS B CE1   1 
ATOM   1300  N NE2   . HIS B 2 76  ? 170.071 140.653 143.035 1.00 151.38 ? 75  HIS B NE2   1 
ATOM   1301  N N     . ALA B 2 77  ? 170.719 143.972 138.984 1.00 145.31 ? 76  ALA B N     1 
ATOM   1302  C CA    . ALA B 2 77  ? 170.350 143.246 137.777 1.00 145.31 ? 76  ALA B CA    1 
ATOM   1303  C C     . ALA B 2 77  ? 171.499 143.104 136.791 1.00 145.31 ? 76  ALA B C     1 
ATOM   1304  O O     . ALA B 2 77  ? 171.268 142.598 135.690 1.00 145.31 ? 76  ALA B O     1 
ATOM   1305  C CB    . ALA B 2 77  ? 169.165 143.924 137.091 1.00 145.31 ? 76  ALA B CB    1 
ATOM   1306  N N     . LYS B 2 78  ? 172.702 143.558 137.165 1.00 152.95 ? 77  LYS B N     1 
ATOM   1307  C CA    . LYS B 2 78  ? 173.937 143.442 136.386 1.00 152.95 ? 77  LYS B CA    1 
ATOM   1308  C C     . LYS B 2 78  ? 173.825 144.124 135.032 1.00 152.95 ? 77  LYS B C     1 
ATOM   1309  O O     . LYS B 2 78  ? 174.474 143.723 134.067 1.00 152.95 ? 77  LYS B O     1 
ATOM   1310  C CB    . LYS B 2 78  ? 174.368 141.982 136.220 1.00 152.95 ? 77  LYS B CB    1 
ATOM   1311  C CG    . LYS B 2 78  ? 175.062 141.412 137.438 1.00 152.95 ? 77  LYS B CG    1 
ATOM   1312  C CD    . LYS B 2 78  ? 175.310 139.922 137.287 1.00 152.95 ? 77  LYS B CD    1 
ATOM   1313  C CE    . LYS B 2 78  ? 174.070 139.113 137.623 1.00 152.95 ? 77  LYS B CE    1 
ATOM   1314  N NZ    . LYS B 2 78  ? 173.792 139.092 139.084 1.00 152.95 ? 77  LYS B NZ    1 
ATOM   1315  N N     . ARG B 2 79  ? 172.999 145.155 134.953 1.00 162.76 ? 78  ARG B N     1 
ATOM   1316  C CA    . ARG B 2 79  ? 172.817 145.891 133.721 1.00 162.76 ? 78  ARG B CA    1 
ATOM   1317  C C     . ARG B 2 79  ? 173.769 147.075 133.686 1.00 162.76 ? 78  ARG B C     1 
ATOM   1318  O O     . ARG B 2 79  ? 174.695 147.189 134.489 1.00 162.76 ? 78  ARG B O     1 
ATOM   1319  C CB    . ARG B 2 79  ? 171.374 146.351 133.588 1.00 162.76 ? 78  ARG B CB    1 
ATOM   1320  C CG    . ARG B 2 79  ? 170.490 145.368 132.885 1.00 162.76 ? 78  ARG B CG    1 
ATOM   1321  C CD    . ARG B 2 79  ? 169.307 146.082 132.302 1.00 162.76 ? 78  ARG B CD    1 
ATOM   1322  N NE    . ARG B 2 79  ? 168.818 147.087 133.229 1.00 162.76 ? 78  ARG B NE    1 
ATOM   1323  C CZ    . ARG B 2 79  ? 167.890 146.851 134.144 1.00 162.76 ? 78  ARG B CZ    1 
ATOM   1324  N NH1   . ARG B 2 79  ? 167.354 145.646 134.249 1.00 162.76 ? 78  ARG B NH1   1 
ATOM   1325  N NH2   . ARG B 2 79  ? 167.503 147.815 134.956 1.00 162.76 ? 78  ARG B NH2   1 
ATOM   1326  N N     . LYS B 2 80  ? 173.545 147.963 132.726 1.00 173.40 ? 79  LYS B N     1 
ATOM   1327  C CA    . LYS B 2 80  ? 174.258 149.223 132.669 1.00 173.40 ? 79  LYS B CA    1 
ATOM   1328  C C     . LYS B 2 80  ? 173.333 150.393 132.407 1.00 173.40 ? 79  LYS B C     1 
ATOM   1329  O O     . LYS B 2 80  ? 173.761 151.540 132.551 1.00 173.40 ? 79  LYS B O     1 
ATOM   1330  C CB    . LYS B 2 80  ? 175.343 149.183 131.588 1.00 173.40 ? 79  LYS B CB    1 
ATOM   1331  C CG    . LYS B 2 80  ? 176.577 148.415 131.988 1.00 173.40 ? 79  LYS B CG    1 
ATOM   1332  C CD    . LYS B 2 80  ? 176.531 147.002 131.445 1.00 173.40 ? 79  LYS B CD    1 
ATOM   1333  C CE    . LYS B 2 80  ? 177.712 146.184 131.924 1.00 173.40 ? 79  LYS B CE    1 
ATOM   1334  N NZ    . LYS B 2 80  ? 177.610 144.768 131.480 1.00 173.40 ? 79  LYS B NZ    1 
ATOM   1335  N N     . THR B 2 81  ? 172.084 150.145 132.032 1.00 173.11 ? 80  THR B N     1 
ATOM   1336  C CA    . THR B 2 81  ? 171.156 151.196 131.647 1.00 173.11 ? 80  THR B CA    1 
ATOM   1337  C C     . THR B 2 81  ? 170.074 151.294 132.701 1.00 173.11 ? 80  THR B C     1 
ATOM   1338  O O     . THR B 2 81  ? 169.353 150.322 132.936 1.00 173.11 ? 80  THR B O     1 
ATOM   1339  C CB    . THR B 2 81  ? 170.505 150.898 130.301 1.00 173.11 ? 80  THR B CB    1 
ATOM   1340  O OG1   . THR B 2 81  ? 169.580 149.820 130.463 1.00 173.11 ? 80  THR B OG1   1 
ATOM   1341  C CG2   . THR B 2 81  ? 171.544 150.472 129.301 1.00 173.11 ? 80  THR B CG2   1 
ATOM   1342  N N     . VAL B 2 82  ? 169.946 152.463 133.317 1.00 156.70 ? 81  VAL B N     1 
ATOM   1343  C CA    . VAL B 2 82  ? 168.814 152.725 134.191 1.00 156.70 ? 81  VAL B CA    1 
ATOM   1344  C C     . VAL B 2 82  ? 167.546 152.740 133.352 1.00 156.70 ? 81  VAL B C     1 
ATOM   1345  O O     . VAL B 2 82  ? 167.446 153.482 132.371 1.00 156.70 ? 81  VAL B O     1 
ATOM   1346  C CB    . VAL B 2 82  ? 168.996 154.049 134.931 1.00 156.70 ? 81  VAL B CB    1 
ATOM   1347  C CG1   . VAL B 2 82  ? 167.723 154.437 135.627 1.00 156.70 ? 81  VAL B CG1   1 
ATOM   1348  C CG2   . VAL B 2 82  ? 170.112 153.927 135.916 1.00 156.70 ? 81  VAL B CG2   1 
ATOM   1349  N N     . THR B 2 83  ? 166.585 151.908 133.716 1.00 154.34 ? 82  THR B N     1 
ATOM   1350  C CA    . THR B 2 83  ? 165.327 151.871 132.995 1.00 154.34 ? 82  THR B CA    1 
ATOM   1351  C C     . THR B 2 83  ? 164.344 152.833 133.638 1.00 154.34 ? 82  THR B C     1 
ATOM   1352  O O     . THR B 2 83  ? 164.665 153.547 134.587 1.00 154.34 ? 82  THR B O     1 
ATOM   1353  C CB    . THR B 2 83  ? 164.747 150.466 132.982 1.00 154.34 ? 82  THR B CB    1 
ATOM   1354  O OG1   . THR B 2 83  ? 164.281 150.141 134.297 1.00 154.34 ? 82  THR B OG1   1 
ATOM   1355  C CG2   . THR B 2 83  ? 165.793 149.465 132.551 1.00 154.34 ? 82  THR B CG2   1 
ATOM   1356  N N     . ALA B 2 84  ? 163.126 152.857 133.120 1.00 153.19 ? 83  ALA B N     1 
ATOM   1357  C CA    . ALA B 2 84  ? 162.059 153.517 133.844 1.00 153.19 ? 83  ALA B CA    1 
ATOM   1358  C C     . ALA B 2 84  ? 161.572 152.658 134.993 1.00 153.19 ? 83  ALA B C     1 
ATOM   1359  O O     . ALA B 2 84  ? 161.122 153.191 136.010 1.00 153.19 ? 83  ALA B O     1 
ATOM   1360  C CB    . ALA B 2 84  ? 160.903 153.841 132.907 1.00 153.19 ? 83  ALA B CB    1 
ATOM   1361  N N     . MET B 2 85  ? 161.674 151.336 134.858 1.00 152.45 ? 84  MET B N     1 
ATOM   1362  C CA    . MET B 2 85  ? 161.201 150.449 135.912 1.00 152.45 ? 84  MET B CA    1 
ATOM   1363  C C     . MET B 2 85  ? 162.045 150.571 137.166 1.00 152.45 ? 84  MET B C     1 
ATOM   1364  O O     . MET B 2 85  ? 161.511 150.475 138.275 1.00 152.45 ? 84  MET B O     1 
ATOM   1365  C CB    . MET B 2 85  ? 161.197 149.004 135.427 1.00 152.45 ? 84  MET B CB    1 
ATOM   1366  C CG    . MET B 2 85  ? 160.025 148.664 134.545 1.00 152.45 ? 84  MET B CG    1 
ATOM   1367  S SD    . MET B 2 85  ? 158.540 149.554 135.026 1.00 152.45 ? 84  MET B SD    1 
ATOM   1368  C CE    . MET B 2 85  ? 157.971 148.571 136.401 1.00 152.45 ? 84  MET B CE    1 
ATOM   1369  N N     . ASP B 2 86  ? 163.346 150.816 137.007 1.00 151.62 ? 85  ASP B N     1 
ATOM   1370  C CA    . ASP B 2 86  ? 164.218 150.953 138.163 1.00 151.62 ? 85  ASP B CA    1 
ATOM   1371  C C     . ASP B 2 86  ? 163.859 152.180 138.979 1.00 151.62 ? 85  ASP B C     1 
ATOM   1372  O O     . ASP B 2 86  ? 163.814 152.123 140.211 1.00 151.62 ? 85  ASP B O     1 
ATOM   1373  C CB    . ASP B 2 86  ? 165.667 151.031 137.712 1.00 151.62 ? 85  ASP B CB    1 
ATOM   1374  C CG    . ASP B 2 86  ? 166.107 149.786 137.019 1.00 151.62 ? 85  ASP B CG    1 
ATOM   1375  O OD1   . ASP B 2 86  ? 165.488 148.737 137.266 1.00 151.62 ? 85  ASP B OD1   1 
ATOM   1376  O OD2   . ASP B 2 86  ? 167.076 149.839 136.238 1.00 151.62 ? 85  ASP B OD2   1 
ATOM   1377  N N     . VAL B 2 87  ? 163.537 153.290 138.314 1.00 144.63 ? 86  VAL B N     1 
ATOM   1378  C CA    . VAL B 2 87  ? 163.170 154.476 139.064 1.00 144.63 ? 86  VAL B CA    1 
ATOM   1379  C C     . VAL B 2 87  ? 161.729 154.435 139.517 1.00 144.63 ? 86  VAL B C     1 
ATOM   1380  O O     . VAL B 2 87  ? 161.371 155.182 140.428 1.00 144.63 ? 86  VAL B O     1 
ATOM   1381  C CB    . VAL B 2 87  ? 163.423 155.776 138.280 1.00 144.63 ? 86  VAL B CB    1 
ATOM   1382  C CG1   . VAL B 2 87  ? 164.848 155.813 137.788 1.00 144.63 ? 86  VAL B CG1   1 
ATOM   1383  C CG2   . VAL B 2 87  ? 162.450 155.932 137.155 1.00 144.63 ? 86  VAL B CG2   1 
ATOM   1384  N N     . VAL B 2 88  ? 160.894 153.568 138.955 1.00 143.03 ? 87  VAL B N     1 
ATOM   1385  C CA    . VAL B 2 88  ? 159.592 153.390 139.588 1.00 143.03 ? 87  VAL B CA    1 
ATOM   1386  C C     . VAL B 2 88  ? 159.715 152.550 140.850 1.00 143.03 ? 87  VAL B C     1 
ATOM   1387  O O     . VAL B 2 88  ? 159.081 152.853 141.862 1.00 143.03 ? 87  VAL B O     1 
ATOM   1388  C CB    . VAL B 2 88  ? 158.566 152.807 138.600 1.00 143.03 ? 87  VAL B CB    1 
ATOM   1389  C CG1   . VAL B 2 88  ? 157.226 152.634 139.262 1.00 143.03 ? 87  VAL B CG1   1 
ATOM   1390  C CG2   . VAL B 2 88  ? 158.354 153.770 137.487 1.00 143.03 ? 87  VAL B CG2   1 
ATOM   1391  N N     . TYR B 2 89  ? 160.582 151.535 140.835 1.00 147.03 ? 88  TYR B N     1 
ATOM   1392  C CA    . TYR B 2 89  ? 160.811 150.745 142.043 1.00 147.03 ? 88  TYR B CA    1 
ATOM   1393  C C     . TYR B 2 89  ? 161.492 151.570 143.122 1.00 147.03 ? 88  TYR B C     1 
ATOM   1394  O O     . TYR B 2 89  ? 161.188 151.418 144.310 1.00 147.03 ? 88  TYR B O     1 
ATOM   1395  C CB    . TYR B 2 89  ? 161.660 149.519 141.737 1.00 147.03 ? 88  TYR B CB    1 
ATOM   1396  C CG    . TYR B 2 89  ? 161.070 148.580 140.731 1.00 147.03 ? 88  TYR B CG    1 
ATOM   1397  C CD1   . TYR B 2 89  ? 159.699 148.438 140.607 1.00 147.03 ? 88  TYR B CD1   1 
ATOM   1398  C CD2   . TYR B 2 89  ? 161.889 147.821 139.912 1.00 147.03 ? 88  TYR B CD2   1 
ATOM   1399  C CE1   . TYR B 2 89  ? 159.162 147.582 139.685 1.00 147.03 ? 88  TYR B CE1   1 
ATOM   1400  C CE2   . TYR B 2 89  ? 161.364 146.964 138.987 1.00 147.03 ? 88  TYR B CE2   1 
ATOM   1401  C CZ    . TYR B 2 89  ? 159.999 146.846 138.879 1.00 147.03 ? 88  TYR B CZ    1 
ATOM   1402  O OH    . TYR B 2 89  ? 159.468 145.982 137.955 1.00 147.03 ? 88  TYR B OH    1 
ATOM   1403  N N     . ALA B 2 90  ? 162.408 152.452 142.722 1.00 143.37 ? 89  ALA B N     1 
ATOM   1404  C CA    . ALA B 2 90  ? 163.103 153.296 143.682 1.00 143.37 ? 89  ALA B CA    1 
ATOM   1405  C C     . ALA B 2 90  ? 162.157 154.294 144.330 1.00 143.37 ? 89  ALA B C     1 
ATOM   1406  O O     . ALA B 2 90  ? 162.204 154.502 145.546 1.00 143.37 ? 89  ALA B O     1 
ATOM   1407  C CB    . ALA B 2 90  ? 164.251 154.020 142.991 1.00 143.37 ? 89  ALA B CB    1 
ATOM   1408  N N     . LEU B 2 91  ? 161.283 154.905 143.538 1.00 140.15 ? 90  LEU B N     1 
ATOM   1409  C CA    . LEU B 2 91  ? 160.330 155.853 144.092 1.00 140.15 ? 90  LEU B CA    1 
ATOM   1410  C C     . LEU B 2 91  ? 159.255 155.160 144.907 1.00 140.15 ? 90  LEU B C     1 
ATOM   1411  O O     . LEU B 2 91  ? 158.757 155.734 145.880 1.00 140.15 ? 90  LEU B O     1 
ATOM   1412  C CB    . LEU B 2 91  ? 159.690 156.655 142.975 1.00 140.15 ? 90  LEU B CB    1 
ATOM   1413  C CG    . LEU B 2 91  ? 160.555 157.694 142.292 1.00 140.15 ? 90  LEU B CG    1 
ATOM   1414  C CD1   . LEU B 2 91  ? 159.902 158.028 140.986 1.00 140.15 ? 90  LEU B CD1   1 
ATOM   1415  C CD2   . LEU B 2 91  ? 160.679 158.911 143.156 1.00 140.15 ? 90  LEU B CD2   1 
ATOM   1416  N N     . LYS B 2 92  ? 158.878 153.941 144.523 1.00 144.36 ? 91  LYS B N     1 
ATOM   1417  C CA    . LYS B 2 92  ? 157.922 153.178 145.309 1.00 144.36 ? 91  LYS B CA    1 
ATOM   1418  C C     . LYS B 2 92  ? 158.513 152.776 146.646 1.00 144.36 ? 91  LYS B C     1 
ATOM   1419  O O     . LYS B 2 92  ? 157.826 152.823 147.670 1.00 144.36 ? 91  LYS B O     1 
ATOM   1420  C CB    . LYS B 2 92  ? 157.480 151.947 144.521 1.00 144.36 ? 91  LYS B CB    1 
ATOM   1421  C CG    . LYS B 2 92  ? 156.630 150.961 145.299 1.00 144.36 ? 91  LYS B CG    1 
ATOM   1422  C CD    . LYS B 2 92  ? 155.986 149.943 144.380 1.00 144.36 ? 91  LYS B CD    1 
ATOM   1423  C CE    . LYS B 2 92  ? 155.039 150.619 143.408 1.00 144.36 ? 91  LYS B CE    1 
ATOM   1424  N NZ    . LYS B 2 92  ? 154.480 149.664 142.415 1.00 144.36 ? 91  LYS B NZ    1 
ATOM   1425  N N     . ARG B 2 93  ? 159.799 152.433 146.660 1.00 145.80 ? 92  ARG B N     1 
ATOM   1426  C CA    . ARG B 2 93  ? 160.457 152.048 147.899 1.00 145.80 ? 92  ARG B CA    1 
ATOM   1427  C C     . ARG B 2 93  ? 160.657 153.239 148.828 1.00 145.80 ? 92  ARG B C     1 
ATOM   1428  O O     . ARG B 2 93  ? 160.883 153.057 150.028 1.00 145.80 ? 92  ARG B O     1 
ATOM   1429  C CB    . ARG B 2 93  ? 161.790 151.387 147.573 1.00 145.80 ? 92  ARG B CB    1 
ATOM   1430  C CG    . ARG B 2 93  ? 162.308 150.457 148.630 1.00 145.80 ? 92  ARG B CG    1 
ATOM   1431  C CD    . ARG B 2 93  ? 163.802 150.392 148.546 1.00 145.80 ? 92  ARG B CD    1 
ATOM   1432  N NE    . ARG B 2 93  ? 164.410 151.509 149.247 1.00 145.80 ? 92  ARG B NE    1 
ATOM   1433  C CZ    . ARG B 2 93  ? 164.977 151.405 150.440 1.00 145.80 ? 92  ARG B CZ    1 
ATOM   1434  N NH1   . ARG B 2 93  ? 165.515 152.466 151.021 1.00 145.80 ? 92  ARG B NH1   1 
ATOM   1435  N NH2   . ARG B 2 93  ? 165.010 150.232 151.046 1.00 145.80 ? 92  ARG B NH2   1 
ATOM   1436  N N     . GLN B 2 94  ? 160.574 154.455 148.301 1.00 150.18 ? 93  GLN B N     1 
ATOM   1437  C CA    . GLN B 2 94  ? 160.660 155.652 149.117 1.00 150.18 ? 93  GLN B CA    1 
ATOM   1438  C C     . GLN B 2 94  ? 159.321 156.098 149.676 1.00 150.18 ? 93  GLN B C     1 
ATOM   1439  O O     . GLN B 2 94  ? 159.297 156.864 150.642 1.00 150.18 ? 93  GLN B O     1 
ATOM   1440  C CB    . GLN B 2 94  ? 161.253 156.791 148.303 1.00 150.18 ? 93  GLN B CB    1 
ATOM   1441  C CG    . GLN B 2 94  ? 162.745 156.808 148.305 1.00 150.18 ? 93  GLN B CG    1 
ATOM   1442  C CD    . GLN B 2 94  ? 163.277 158.203 148.189 1.00 150.18 ? 93  GLN B CD    1 
ATOM   1443  O OE1   . GLN B 2 94  ? 162.531 159.172 148.303 1.00 150.18 ? 93  GLN B OE1   1 
ATOM   1444  N NE2   . GLN B 2 94  ? 164.572 158.322 147.950 1.00 150.18 ? 93  GLN B NE2   1 
ATOM   1445  N N     . GLY B 2 95  ? 158.215 155.649 149.101 1.00 146.12 ? 94  GLY B N     1 
ATOM   1446  C CA    . GLY B 2 95  ? 156.909 156.089 149.529 1.00 146.12 ? 94  GLY B CA    1 
ATOM   1447  C C     . GLY B 2 95  ? 156.198 157.006 148.563 1.00 146.12 ? 94  GLY B C     1 
ATOM   1448  O O     . GLY B 2 95  ? 155.122 157.510 148.897 1.00 146.12 ? 94  GLY B O     1 
ATOM   1449  N N     . ARG B 2 96  ? 156.758 157.242 147.386 1.00 144.76 ? 95  ARG B N     1 
ATOM   1450  C CA    . ARG B 2 96  ? 156.109 158.039 146.353 1.00 144.76 ? 95  ARG B CA    1 
ATOM   1451  C C     . ARG B 2 96  ? 155.922 157.147 145.136 1.00 144.76 ? 95  ARG B C     1 
ATOM   1452  O O     . ARG B 2 96  ? 156.778 157.093 144.259 1.00 144.76 ? 95  ARG B O     1 
ATOM   1453  C CB    . ARG B 2 96  ? 156.930 159.252 146.000 1.00 144.76 ? 95  ARG B CB    1 
ATOM   1454  C CG    . ARG B 2 96  ? 157.065 160.241 147.110 1.00 144.76 ? 95  ARG B CG    1 
ATOM   1455  C CD    . ARG B 2 96  ? 158.433 160.865 147.093 1.00 144.76 ? 95  ARG B CD    1 
ATOM   1456  N NE    . ARG B 2 96  ? 158.599 161.782 148.209 1.00 144.76 ? 95  ARG B NE    1 
ATOM   1457  C CZ    . ARG B 2 96  ? 159.714 161.894 148.914 1.00 144.76 ? 95  ARG B CZ    1 
ATOM   1458  N NH1   . ARG B 2 96  ? 160.763 161.144 148.615 1.00 144.76 ? 95  ARG B NH1   1 
ATOM   1459  N NH2   . ARG B 2 96  ? 159.780 162.753 149.918 1.00 144.76 ? 95  ARG B NH2   1 
ATOM   1460  N N     . THR B 2 97  ? 154.798 156.449 145.081 1.00 147.56 ? 96  THR B N     1 
ATOM   1461  C CA    . THR B 2 97  ? 154.527 155.594 143.937 1.00 147.56 ? 96  THR B CA    1 
ATOM   1462  C C     . THR B 2 97  ? 154.183 156.453 142.734 1.00 147.56 ? 96  THR B C     1 
ATOM   1463  O O     . THR B 2 97  ? 153.254 157.264 142.787 1.00 147.56 ? 96  THR B O     1 
ATOM   1464  C CB    . THR B 2 97  ? 153.384 154.644 144.243 1.00 147.56 ? 96  THR B CB    1 
ATOM   1465  O OG1   . THR B 2 97  ? 152.176 155.398 144.309 1.00 147.56 ? 96  THR B OG1   1 
ATOM   1466  C CG2   . THR B 2 97  ? 153.609 153.962 145.570 1.00 147.56 ? 96  THR B CG2   1 
ATOM   1467  N N     . LEU B 2 98  ? 154.935 156.277 141.657 1.00 146.36 ? 97  LEU B N     1 
ATOM   1468  C CA    . LEU B 2 98  ? 154.739 157.001 140.408 1.00 146.36 ? 97  LEU B CA    1 
ATOM   1469  C C     . LEU B 2 98  ? 153.971 156.114 139.443 1.00 146.36 ? 97  LEU B C     1 
ATOM   1470  O O     . LEU B 2 98  ? 154.463 155.056 139.044 1.00 146.36 ? 97  LEU B O     1 
ATOM   1471  C CB    . LEU B 2 98  ? 156.079 157.400 139.807 1.00 146.36 ? 97  LEU B CB    1 
ATOM   1472  C CG    . LEU B 2 98  ? 155.982 158.022 138.425 1.00 146.36 ? 97  LEU B CG    1 
ATOM   1473  C CD1   . LEU B 2 98  ? 155.237 159.319 138.474 1.00 146.36 ? 97  LEU B CD1   1 
ATOM   1474  C CD2   . LEU B 2 98  ? 157.360 158.219 137.849 1.00 146.36 ? 97  LEU B CD2   1 
ATOM   1475  N N     . TYR B 2 99  ? 152.776 156.546 139.058 1.00 146.93 ? 98  TYR B N     1 
ATOM   1476  C CA    . TYR B 2 99  ? 152.039 155.829 138.035 1.00 146.93 ? 98  TYR B CA    1 
ATOM   1477  C C     . TYR B 2 99  ? 152.512 156.297 136.667 1.00 146.93 ? 98  TYR B C     1 
ATOM   1478  O O     . TYR B 2 99  ? 153.337 157.201 136.545 1.00 146.93 ? 98  TYR B O     1 
ATOM   1479  C CB    . TYR B 2 99  ? 150.543 156.048 138.196 1.00 146.93 ? 98  TYR B CB    1 
ATOM   1480  C CG    . TYR B 2 99  ? 149.916 155.280 139.323 1.00 146.93 ? 98  TYR B CG    1 
ATOM   1481  C CD1   . TYR B 2 99  ? 150.646 154.363 140.059 1.00 146.93 ? 98  TYR B CD1   1 
ATOM   1482  C CD2   . TYR B 2 99  ? 148.583 155.461 139.642 1.00 146.93 ? 98  TYR B CD2   1 
ATOM   1483  C CE1   . TYR B 2 99  ? 150.073 153.663 141.090 1.00 146.93 ? 98  TYR B CE1   1 
ATOM   1484  C CE2   . TYR B 2 99  ? 147.996 154.755 140.665 1.00 146.93 ? 98  TYR B CE2   1 
ATOM   1485  C CZ    . TYR B 2 99  ? 148.750 153.863 141.388 1.00 146.93 ? 98  TYR B CZ    1 
ATOM   1486  O OH    . TYR B 2 99  ? 148.179 153.160 142.418 1.00 146.93 ? 98  TYR B OH    1 
ATOM   1487  N N     . GLY B 2 100 ? 151.987 155.692 135.614 1.00 146.05 ? 99  GLY B N     1 
ATOM   1488  C CA    . GLY B 2 100 ? 152.391 156.148 134.305 1.00 146.05 ? 99  GLY B CA    1 
ATOM   1489  C C     . GLY B 2 100 ? 153.549 155.379 133.725 1.00 146.05 ? 99  GLY B C     1 
ATOM   1490  O O     . GLY B 2 100 ? 153.344 154.362 133.059 1.00 146.05 ? 99  GLY B O     1 
ATOM   1491  N N     . PHE B 2 101 ? 154.758 155.900 133.945 1.00 152.61 ? 100 PHE B N     1 
ATOM   1492  C CA    . PHE B 2 101 ? 155.983 155.380 133.347 1.00 152.61 ? 100 PHE B CA    1 
ATOM   1493  C C     . PHE B 2 101 ? 156.207 153.929 133.714 1.00 152.61 ? 100 PHE B C     1 
ATOM   1494  O O     . PHE B 2 101 ? 156.323 153.591 134.892 1.00 152.61 ? 100 PHE B O     1 
ATOM   1495  C CB    . PHE B 2 101 ? 157.178 156.200 133.812 1.00 152.61 ? 100 PHE B CB    1 
ATOM   1496  C CG    . PHE B 2 101 ? 157.196 157.594 133.293 1.00 152.61 ? 100 PHE B CG    1 
ATOM   1497  C CD1   . PHE B 2 101 ? 157.887 157.901 132.137 1.00 152.61 ? 100 PHE B CD1   1 
ATOM   1498  C CD2   . PHE B 2 101 ? 156.547 158.606 133.975 1.00 152.61 ? 100 PHE B CD2   1 
ATOM   1499  C CE1   . PHE B 2 101 ? 157.915 159.188 131.663 1.00 152.61 ? 100 PHE B CE1   1 
ATOM   1500  C CE2   . PHE B 2 101 ? 156.570 159.894 133.504 1.00 152.61 ? 100 PHE B CE2   1 
ATOM   1501  C CZ    . PHE B 2 101 ? 157.252 160.186 132.350 1.00 152.61 ? 100 PHE B CZ    1 
ATOM   1502  N N     . GLY B 2 102 ? 156.247 153.073 132.702 1.00 165.64 ? 101 GLY B N     1 
ATOM   1503  C CA    . GLY B 2 102 ? 156.469 151.663 132.926 1.00 165.64 ? 101 GLY B CA    1 
ATOM   1504  C C     . GLY B 2 102 ? 155.313 150.955 133.600 1.00 165.64 ? 101 GLY B C     1 
ATOM   1505  O O     . GLY B 2 102 ? 154.280 151.563 133.898 1.00 165.64 ? 101 GLY B O     1 
ATOM   1506  N N     . GLY B 2 103 ? 155.479 149.665 133.857 1.00 177.16 ? 102 GLY B N     1 
ATOM   1507  C CA    . GLY B 2 103 ? 154.393 148.861 134.377 1.00 177.16 ? 102 GLY B CA    1 
ATOM   1508  C C     . GLY B 2 103 ? 153.328 148.658 133.320 1.00 177.16 ? 102 GLY B C     1 
ATOM   1509  O O     . GLY B 2 103 ? 152.363 149.418 133.249 1.00 177.16 ? 102 GLY B O     1 
ATOM   1510  O OXT   . GLY B 2 103 ? 153.404 147.740 132.502 1.00 177.16 ? 102 GLY B OXT   1 
ATOM   1511  N N     . GLY C 3 9   ? 179.094 103.367 158.965 0.00 191.02 ? 8   GLY C N     1 
ATOM   1512  C CA    . GLY C 3 9   ? 179.277 104.738 158.529 0.00 191.02 ? 8   GLY C CA    1 
ATOM   1513  C C     . GLY C 3 9   ? 178.810 105.753 159.552 0.00 191.02 ? 8   GLY C C     1 
ATOM   1514  O O     . GLY C 3 9   ? 177.957 105.456 160.388 0.00 191.02 ? 8   GLY C O     1 
ATOM   1515  N N     . LYS C 3 10  ? 179.372 106.958 159.489 0.00 190.58 ? 9   LYS C N     1 
ATOM   1516  C CA    . LYS C 3 10  ? 179.015 108.030 160.415 0.00 190.58 ? 9   LYS C CA    1 
ATOM   1517  C C     . LYS C 3 10  ? 177.684 108.626 159.978 0.00 190.58 ? 9   LYS C C     1 
ATOM   1518  O O     . LYS C 3 10  ? 177.641 109.661 159.310 0.00 190.58 ? 9   LYS C O     1 
ATOM   1519  C CB    . LYS C 3 10  ? 180.108 109.090 160.460 0.00 190.58 ? 9   LYS C CB    1 
ATOM   1520  N N     . THR C 3 11  ? 176.587 107.974 160.366 1.00 191.56 ? 10  THR C N     1 
ATOM   1521  C CA    . THR C 3 11  ? 175.243 108.467 160.090 1.00 191.56 ? 10  THR C CA    1 
ATOM   1522  C C     . THR C 3 11  ? 174.886 109.694 160.914 1.00 191.56 ? 10  THR C C     1 
ATOM   1523  O O     . THR C 3 11  ? 173.911 110.381 160.592 1.00 191.56 ? 10  THR C O     1 
ATOM   1524  C CB    . THR C 3 11  ? 174.207 107.369 160.350 1.00 191.56 ? 10  THR C CB    1 
ATOM   1525  N N     . ARG C 3 12  ? 175.641 109.968 161.973 1.00 191.19 ? 11  ARG C N     1 
ATOM   1526  C CA    . ARG C 3 12  ? 175.505 111.211 162.719 1.00 191.19 ? 11  ARG C CA    1 
ATOM   1527  C C     . ARG C 3 12  ? 176.888 111.548 163.256 1.00 191.19 ? 11  ARG C C     1 
ATOM   1528  O O     . ARG C 3 12  ? 177.300 111.005 164.285 1.00 191.19 ? 11  ARG C O     1 
ATOM   1529  C CB    . ARG C 3 12  ? 174.486 111.071 163.843 1.00 191.19 ? 11  ARG C CB    1 
ATOM   1530  N N     . ALA C 3 13  ? 177.599 112.428 162.559 1.00 182.55 ? 12  ALA C N     1 
ATOM   1531  C CA    . ALA C 3 13  ? 178.912 112.879 162.988 1.00 182.55 ? 12  ALA C CA    1 
ATOM   1532  C C     . ALA C 3 13  ? 178.750 114.025 163.986 1.00 182.55 ? 12  ALA C C     1 
ATOM   1533  O O     . ALA C 3 13  ? 177.662 114.261 164.521 1.00 182.55 ? 12  ALA C O     1 
ATOM   1534  C CB    . ALA C 3 13  ? 179.756 113.275 161.780 1.00 182.55 ? 12  ALA C CB    1 
ATOM   1535  N N     . LYS C 3 14  ? 179.843 114.736 164.265 0.00 176.17 ? 13  LYS C N     1 
ATOM   1536  C CA    . LYS C 3 14  ? 179.826 115.848 165.213 0.00 176.17 ? 13  LYS C CA    1 
ATOM   1537  C C     . LYS C 3 14  ? 178.991 116.988 164.644 0.00 176.17 ? 13  LYS C C     1 
ATOM   1538  O O     . LYS C 3 14  ? 179.408 117.665 163.699 0.00 176.17 ? 13  LYS C O     1 
ATOM   1539  C CB    . LYS C 3 14  ? 181.247 116.308 165.514 0.00 176.17 ? 13  LYS C CB    1 
ATOM   1540  C CG    . LYS C 3 14  ? 181.330 117.340 166.621 0.00 176.17 ? 13  LYS C CG    1 
ATOM   1541  C CD    . LYS C 3 14  ? 181.731 118.696 166.073 0.00 176.17 ? 13  LYS C CD    1 
ATOM   1542  C CE    . LYS C 3 14  ? 181.575 119.781 167.118 0.00 176.17 ? 13  LYS C CE    1 
ATOM   1543  N NZ    . LYS C 3 14  ? 181.766 121.135 166.530 0.00 176.17 ? 13  LYS C NZ    1 
ATOM   1544  N N     . ALA C 3 15  ? 177.815 117.206 165.232 0.00 172.96 ? 14  ALA C N     1 
ATOM   1545  C CA    . ALA C 3 15  ? 176.816 118.127 164.695 0.00 172.96 ? 14  ALA C CA    1 
ATOM   1546  C C     . ALA C 3 15  ? 177.274 119.560 164.935 0.00 172.96 ? 14  ALA C C     1 
ATOM   1547  O O     . ALA C 3 15  ? 176.856 120.240 165.874 0.00 172.96 ? 14  ALA C O     1 
ATOM   1548  C CB    . ALA C 3 15  ? 175.456 117.869 165.327 0.00 172.96 ? 14  ALA C CB    1 
ATOM   1549  N N     . LYS C 3 16  ? 178.155 120.022 164.056 1.00 168.09 ? 15  LYS C N     1 
ATOM   1550  C CA    . LYS C 3 16  ? 178.663 121.385 164.106 1.00 168.09 ? 15  LYS C CA    1 
ATOM   1551  C C     . LYS C 3 16  ? 177.624 122.309 163.493 1.00 168.09 ? 15  LYS C C     1 
ATOM   1552  O O     . LYS C 3 16  ? 177.398 122.273 162.282 1.00 168.09 ? 15  LYS C O     1 
ATOM   1553  C CB    . LYS C 3 16  ? 179.988 121.474 163.364 1.00 168.09 ? 15  LYS C CB    1 
ATOM   1554  C CG    . LYS C 3 16  ? 180.532 122.873 163.237 1.00 168.09 ? 15  LYS C CG    1 
ATOM   1555  C CD    . LYS C 3 16  ? 181.991 122.851 162.822 1.00 168.09 ? 15  LYS C CD    1 
ATOM   1556  C CE    . LYS C 3 16  ? 182.198 122.045 161.552 1.00 168.09 ? 15  LYS C CE    1 
ATOM   1557  N NZ    . LYS C 3 16  ? 183.612 122.096 161.098 1.00 168.09 ? 15  LYS C NZ    1 
ATOM   1558  N N     . THR C 3 17  ? 176.988 123.124 164.329 1.00 156.90 ? 16  THR C N     1 
ATOM   1559  C CA    . THR C 3 17  ? 175.944 124.019 163.863 1.00 156.90 ? 16  THR C CA    1 
ATOM   1560  C C     . THR C 3 17  ? 176.523 125.099 162.962 1.00 156.90 ? 16  THR C C     1 
ATOM   1561  O O     . THR C 3 17  ? 177.715 125.406 162.999 1.00 156.90 ? 16  THR C O     1 
ATOM   1562  C CB    . THR C 3 17  ? 175.238 124.674 165.039 1.00 156.90 ? 16  THR C CB    1 
ATOM   1563  O OG1   . THR C 3 17  ? 176.218 125.165 165.957 1.00 156.90 ? 16  THR C OG1   1 
ATOM   1564  C CG2   . THR C 3 17  ? 174.363 123.675 165.741 1.00 156.90 ? 16  THR C CG2   1 
ATOM   1565  N N     . ARG C 3 18  ? 175.655 125.681 162.140 1.00 149.08 ? 17  ARG C N     1 
ATOM   1566  C CA    . ARG C 3 18  ? 176.123 126.642 161.156 1.00 149.08 ? 17  ARG C CA    1 
ATOM   1567  C C     . ARG C 3 18  ? 176.469 127.987 161.773 1.00 149.08 ? 17  ARG C C     1 
ATOM   1568  O O     . ARG C 3 18  ? 177.285 128.717 161.204 1.00 149.08 ? 17  ARG C O     1 
ATOM   1569  C CB    . ARG C 3 18  ? 175.078 126.795 160.061 1.00 149.08 ? 17  ARG C CB    1 
ATOM   1570  C CG    . ARG C 3 18  ? 175.018 125.578 159.170 1.00 149.08 ? 17  ARG C CG    1 
ATOM   1571  C CD    . ARG C 3 18  ? 174.077 125.780 158.015 1.00 149.08 ? 17  ARG C CD    1 
ATOM   1572  N NE    . ARG C 3 18  ? 172.736 125.322 158.336 1.00 149.08 ? 17  ARG C NE    1 
ATOM   1573  C CZ    . ARG C 3 18  ? 171.655 125.668 157.653 1.00 149.08 ? 17  ARG C CZ    1 
ATOM   1574  N NH1   . ARG C 3 18  ? 171.761 126.475 156.610 1.00 149.08 ? 17  ARG C NH1   1 
ATOM   1575  N NH2   . ARG C 3 18  ? 170.471 125.207 158.015 1.00 149.08 ? 17  ARG C NH2   1 
ATOM   1576  N N     . SER C 3 19  ? 175.882 128.322 162.923 1.00 152.06 ? 18  SER C N     1 
ATOM   1577  C CA    . SER C 3 19  ? 176.281 129.530 163.633 1.00 152.06 ? 18  SER C CA    1 
ATOM   1578  C C     . SER C 3 19  ? 177.717 129.440 164.124 1.00 152.06 ? 18  SER C C     1 
ATOM   1579  O O     . SER C 3 19  ? 178.439 130.439 164.106 1.00 152.06 ? 18  SER C O     1 
ATOM   1580  C CB    . SER C 3 19  ? 175.342 129.787 164.805 1.00 152.06 ? 18  SER C CB    1 
ATOM   1581  O OG    . SER C 3 19  ? 174.010 129.932 164.357 1.00 152.06 ? 18  SER C OG    1 
ATOM   1582  N N     . SER C 3 20  ? 178.149 128.267 164.558 1.00 155.69 ? 19  SER C N     1 
ATOM   1583  C CA    . SER C 3 20  ? 179.557 128.063 164.840 1.00 155.69 ? 19  SER C CA    1 
ATOM   1584  C C     . SER C 3 20  ? 180.360 127.779 163.590 1.00 155.69 ? 19  SER C C     1 
ATOM   1585  O O     . SER C 3 20  ? 181.589 127.858 163.633 1.00 155.69 ? 19  SER C O     1 
ATOM   1586  C CB    . SER C 3 20  ? 179.754 126.911 165.817 1.00 155.69 ? 19  SER C CB    1 
ATOM   1587  O OG    . SER C 3 20  ? 181.055 126.376 165.680 1.00 155.69 ? 19  SER C OG    1 
ATOM   1588  N N     . ARG C 3 21  ? 179.707 127.443 162.485 1.00 158.06 ? 20  ARG C N     1 
ATOM   1589  C CA    . ARG C 3 21  ? 180.423 127.182 161.251 1.00 158.06 ? 20  ARG C CA    1 
ATOM   1590  C C     . ARG C 3 21  ? 180.550 128.419 160.386 1.00 158.06 ? 20  ARG C C     1 
ATOM   1591  O O     . ARG C 3 21  ? 181.302 128.397 159.409 1.00 158.06 ? 20  ARG C O     1 
ATOM   1592  C CB    . ARG C 3 21  ? 179.732 126.075 160.459 1.00 158.06 ? 20  ARG C CB    1 
ATOM   1593  C CG    . ARG C 3 21  ? 180.684 125.077 159.866 1.00 158.06 ? 20  ARG C CG    1 
ATOM   1594  C CD    . ARG C 3 21  ? 179.922 123.912 159.290 1.00 158.06 ? 20  ARG C CD    1 
ATOM   1595  N NE    . ARG C 3 21  ? 179.219 124.295 158.075 1.00 158.06 ? 20  ARG C NE    1 
ATOM   1596  C CZ    . ARG C 3 21  ? 178.268 123.567 157.507 1.00 158.06 ? 20  ARG C CZ    1 
ATOM   1597  N NH1   . ARG C 3 21  ? 177.902 122.418 158.048 1.00 158.06 ? 20  ARG C NH1   1 
ATOM   1598  N NH2   . ARG C 3 21  ? 177.683 123.991 156.400 1.00 158.06 ? 20  ARG C NH2   1 
ATOM   1599  N N     . ALA C 3 22  ? 179.829 129.486 160.715 1.00 152.41 ? 21  ALA C N     1 
ATOM   1600  C CA    . ALA C 3 22  ? 180.013 130.785 160.088 1.00 152.41 ? 21  ALA C CA    1 
ATOM   1601  C C     . ALA C 3 22  ? 180.770 131.744 160.987 1.00 152.41 ? 21  ALA C C     1 
ATOM   1602  O O     . ALA C 3 22  ? 181.032 132.879 160.583 1.00 152.41 ? 21  ALA C O     1 
ATOM   1603  C CB    . ALA C 3 22  ? 178.664 131.392 159.710 1.00 152.41 ? 21  ALA C CB    1 
ATOM   1604  N N     . GLY C 3 23  ? 181.134 131.314 162.188 1.00 152.35 ? 22  GLY C N     1 
ATOM   1605  C CA    . GLY C 3 23  ? 181.720 132.224 163.154 1.00 152.35 ? 22  GLY C CA    1 
ATOM   1606  C C     . GLY C 3 23  ? 180.735 133.255 163.653 1.00 152.35 ? 22  GLY C C     1 
ATOM   1607  O O     . GLY C 3 23  ? 181.114 134.404 163.909 1.00 152.35 ? 22  GLY C O     1 
ATOM   1608  N N     . LEU C 3 24  ? 179.479 132.867 163.807 1.00 150.80 ? 23  LEU C N     1 
ATOM   1609  C CA    . LEU C 3 24  ? 178.395 133.785 164.101 1.00 150.80 ? 23  LEU C CA    1 
ATOM   1610  C C     . LEU C 3 24  ? 177.800 133.453 165.463 1.00 150.80 ? 23  LEU C C     1 
ATOM   1611  O O     . LEU C 3 24  ? 178.275 132.570 166.174 1.00 150.80 ? 23  LEU C O     1 
ATOM   1612  C CB    . LEU C 3 24  ? 177.332 133.714 163.008 1.00 150.80 ? 23  LEU C CB    1 
ATOM   1613  C CG    . LEU C 3 24  ? 176.698 135.031 162.596 1.00 150.80 ? 23  LEU C CG    1 
ATOM   1614  C CD1   . LEU C 3 24  ? 177.727 135.896 161.920 1.00 150.80 ? 23  LEU C CD1   1 
ATOM   1615  C CD2   . LEU C 3 24  ? 175.565 134.763 161.675 1.00 150.80 ? 23  LEU C CD2   1 
ATOM   1616  N N     . GLN C 3 25  ? 176.749 134.184 165.826 1.00 155.16 ? 24  GLN C N     1 
ATOM   1617  C CA    . GLN C 3 25  ? 176.044 133.968 167.077 1.00 155.16 ? 24  GLN C CA    1 
ATOM   1618  C C     . GLN C 3 25  ? 174.537 133.901 166.923 1.00 155.16 ? 24  GLN C C     1 
ATOM   1619  O O     . GLN C 3 25  ? 173.834 133.926 167.937 1.00 155.16 ? 24  GLN C O     1 
ATOM   1620  C CB    . GLN C 3 25  ? 176.376 135.079 168.082 1.00 155.16 ? 24  GLN C CB    1 
ATOM   1621  C CG    . GLN C 3 25  ? 177.790 135.042 168.605 1.00 155.16 ? 24  GLN C CG    1 
ATOM   1622  C CD    . GLN C 3 25  ? 178.009 133.930 169.603 1.00 155.16 ? 24  GLN C CD    1 
ATOM   1623  O OE1   . GLN C 3 25  ? 177.062 133.417 170.195 1.00 155.16 ? 24  GLN C OE1   1 
ATOM   1624  N NE2   . GLN C 3 25  ? 179.264 133.553 169.800 1.00 155.16 ? 24  GLN C NE2   1 
ATOM   1625  N N     . PHE C 3 26  ? 174.037 133.830 165.743 1.00 156.08 ? 25  PHE C N     1 
ATOM   1626  C CA    . PHE C 3 26  ? 172.616 133.897 165.454 1.00 156.08 ? 25  PHE C CA    1 
ATOM   1627  C C     . PHE C 3 26  ? 172.117 132.611 164.792 1.00 156.08 ? 25  PHE C C     1 
ATOM   1628  O O     . PHE C 3 26  ? 172.875 131.928 164.101 1.00 156.08 ? 25  PHE C O     1 
ATOM   1629  C CB    . PHE C 3 26  ? 172.330 135.104 164.574 1.00 156.08 ? 25  PHE C CB    1 
ATOM   1630  C CG    . PHE C 3 26  ? 171.715 136.228 165.322 1.00 156.08 ? 25  PHE C CG    1 
ATOM   1631  C CD1   . PHE C 3 26  ? 170.350 136.424 165.294 1.00 156.08 ? 25  PHE C CD1   1 
ATOM   1632  C CD2   . PHE C 3 26  ? 172.491 137.050 166.109 1.00 156.08 ? 25  PHE C CD2   1 
ATOM   1633  C CE1   . PHE C 3 26  ? 169.774 137.450 166.000 1.00 156.08 ? 25  PHE C CE1   1 
ATOM   1634  C CE2   . PHE C 3 26  ? 171.923 138.081 166.816 1.00 156.08 ? 25  PHE C CE2   1 
ATOM   1635  C CZ    . PHE C 3 26  ? 170.561 138.279 166.764 1.00 156.08 ? 25  PHE C CZ    1 
ATOM   1636  N N     . PRO C 3 27  ? 170.844 132.248 164.991 1.00 154.54 ? 26  PRO C N     1 
ATOM   1637  C CA    . PRO C 3 27  ? 170.377 130.928 164.554 1.00 154.54 ? 26  PRO C CA    1 
ATOM   1638  C C     . PRO C 3 27  ? 170.197 130.801 163.053 1.00 154.54 ? 26  PRO C C     1 
ATOM   1639  O O     . PRO C 3 27  ? 169.126 131.109 162.521 1.00 154.54 ? 26  PRO C O     1 
ATOM   1640  C CB    . PRO C 3 27  ? 169.044 130.784 165.287 1.00 154.54 ? 26  PRO C CB    1 
ATOM   1641  C CG    . PRO C 3 27  ? 168.592 132.177 165.490 1.00 154.54 ? 26  PRO C CG    1 
ATOM   1642  C CD    . PRO C 3 27  ? 169.820 132.923 165.805 1.00 154.54 ? 26  PRO C CD    1 
ATOM   1643  N N     . VAL C 3 28  ? 171.274 130.392 162.373 1.00 149.56 ? 27  VAL C N     1 
ATOM   1644  C CA    . VAL C 3 28  ? 171.278 130.227 160.920 1.00 149.56 ? 27  VAL C CA    1 
ATOM   1645  C C     . VAL C 3 28  ? 170.182 129.278 160.463 1.00 149.56 ? 27  VAL C C     1 
ATOM   1646  O O     . VAL C 3 28  ? 169.486 129.542 159.476 1.00 149.56 ? 27  VAL C O     1 
ATOM   1647  C CB    . VAL C 3 28  ? 172.655 129.731 160.460 1.00 149.56 ? 27  VAL C CB    1 
ATOM   1648  C CG1   . VAL C 3 28  ? 172.731 129.748 158.967 1.00 149.56 ? 27  VAL C CG1   1 
ATOM   1649  C CG2   . VAL C 3 28  ? 173.733 130.578 161.068 1.00 149.56 ? 27  VAL C CG2   1 
ATOM   1650  N N     . GLY C 3 29  ? 169.992 128.179 161.188 1.00 153.53 ? 28  GLY C N     1 
ATOM   1651  C CA    . GLY C 3 29  ? 168.966 127.226 160.807 1.00 153.53 ? 28  GLY C CA    1 
ATOM   1652  C C     . GLY C 3 29  ? 167.565 127.768 160.996 1.00 153.53 ? 28  GLY C C     1 
ATOM   1653  O O     . GLY C 3 29  ? 166.687 127.542 160.160 1.00 153.53 ? 28  GLY C O     1 
ATOM   1654  N N     . ARG C 3 30  ? 167.342 128.512 162.079 1.00 157.05 ? 29  ARG C N     1 
ATOM   1655  C CA    . ARG C 3 30  ? 166.027 129.091 162.317 1.00 157.05 ? 29  ARG C CA    1 
ATOM   1656  C C     . ARG C 3 30  ? 165.716 130.189 161.312 1.00 157.05 ? 29  ARG C C     1 
ATOM   1657  O O     . ARG C 3 30  ? 164.571 130.315 160.866 1.00 157.05 ? 29  ARG C O     1 
ATOM   1658  C CB    . ARG C 3 30  ? 165.953 129.616 163.745 1.00 157.05 ? 29  ARG C CB    1 
ATOM   1659  C CG    . ARG C 3 30  ? 164.712 130.382 164.082 1.00 157.05 ? 29  ARG C CG    1 
ATOM   1660  C CD    . ARG C 3 30  ? 164.963 131.280 165.259 1.00 157.05 ? 29  ARG C CD    1 
ATOM   1661  N NE    . ARG C 3 30  ? 164.895 130.546 166.514 1.00 157.05 ? 29  ARG C NE    1 
ATOM   1662  C CZ    . ARG C 3 30  ? 163.983 130.769 167.450 1.00 157.05 ? 29  ARG C CZ    1 
ATOM   1663  N NH1   . ARG C 3 30  ? 163.067 131.706 167.269 1.00 157.05 ? 29  ARG C NH1   1 
ATOM   1664  N NH2   . ARG C 3 30  ? 163.985 130.059 168.566 1.00 157.05 ? 29  ARG C NH2   1 
ATOM   1665  N N     . VAL C 3 31  ? 166.729 130.950 160.902 1.00 150.42 ? 30  VAL C N     1 
ATOM   1666  C CA    . VAL C 3 31  ? 166.537 131.959 159.869 1.00 150.42 ? 30  VAL C CA    1 
ATOM   1667  C C     . VAL C 3 31  ? 166.264 131.298 158.525 1.00 150.42 ? 30  VAL C C     1 
ATOM   1668  O O     . VAL C 3 31  ? 165.418 131.762 157.752 1.00 150.42 ? 30  VAL C O     1 
ATOM   1669  C CB    . VAL C 3 31  ? 167.763 132.887 159.830 1.00 150.42 ? 30  VAL C CB    1 
ATOM   1670  C CG1   . VAL C 3 31  ? 167.788 133.738 158.588 1.00 150.42 ? 30  VAL C CG1   1 
ATOM   1671  C CG2   . VAL C 3 31  ? 167.753 133.767 161.041 1.00 150.42 ? 30  VAL C CG2   1 
ATOM   1672  N N     . HIS C 3 32  ? 166.933 130.177 158.253 1.00 145.84 ? 31  HIS C N     1 
ATOM   1673  C CA    . HIS C 3 32  ? 166.668 129.409 157.040 1.00 145.84 ? 31  HIS C CA    1 
ATOM   1674  C C     . HIS C 3 32  ? 165.241 128.883 157.020 1.00 145.84 ? 31  HIS C C     1 
ATOM   1675  O O     . HIS C 3 32  ? 164.561 128.933 155.989 1.00 145.84 ? 31  HIS C O     1 
ATOM   1676  C CB    . HIS C 3 32  ? 167.653 128.251 156.958 1.00 145.84 ? 31  HIS C CB    1 
ATOM   1677  C CG    . HIS C 3 32  ? 167.816 127.685 155.588 1.00 145.84 ? 31  HIS C CG    1 
ATOM   1678  N ND1   . HIS C 3 32  ? 166.787 127.081 154.904 1.00 145.84 ? 31  HIS C ND1   1 
ATOM   1679  C CD2   . HIS C 3 32  ? 168.902 127.599 154.788 1.00 145.84 ? 31  HIS C CD2   1 
ATOM   1680  C CE1   . HIS C 3 32  ? 167.226 126.665 153.732 1.00 145.84 ? 31  HIS C CE1   1 
ATOM   1681  N NE2   . HIS C 3 32  ? 168.508 126.965 153.638 1.00 145.84 ? 31  HIS C NE2   1 
ATOM   1682  N N     . ARG C 3 33  ? 164.765 128.409 158.166 1.00 154.90 ? 32  ARG C N     1 
ATOM   1683  C CA    . ARG C 3 33  ? 163.407 127.897 158.252 1.00 154.90 ? 32  ARG C CA    1 
ATOM   1684  C C     . ARG C 3 33  ? 162.388 129.015 158.111 1.00 154.90 ? 32  ARG C C     1 
ATOM   1685  O O     . ARG C 3 33  ? 161.356 128.839 157.458 1.00 154.90 ? 32  ARG C O     1 
ATOM   1686  C CB    . ARG C 3 33  ? 163.218 127.166 159.574 1.00 154.90 ? 32  ARG C CB    1 
ATOM   1687  C CG    . ARG C 3 33  ? 161.875 126.517 159.731 1.00 154.90 ? 32  ARG C CG    1 
ATOM   1688  C CD    . ARG C 3 33  ? 161.582 126.273 161.184 1.00 154.90 ? 32  ARG C CD    1 
ATOM   1689  N NE    . ARG C 3 33  ? 161.031 127.446 161.843 1.00 154.90 ? 32  ARG C NE    1 
ATOM   1690  C CZ    . ARG C 3 33  ? 161.073 127.638 163.153 1.00 154.90 ? 32  ARG C CZ    1 
ATOM   1691  N NH1   . ARG C 3 33  ? 161.654 126.739 163.931 1.00 154.90 ? 32  ARG C NH1   1 
ATOM   1692  N NH2   . ARG C 3 33  ? 160.542 128.728 163.684 1.00 154.90 ? 32  ARG C NH2   1 
ATOM   1693  N N     . LEU C 3 34  ? 162.663 130.174 158.701 1.00 149.25 ? 33  LEU C N     1 
ATOM   1694  C CA    . LEU C 3 34  ? 161.739 131.288 158.574 1.00 149.25 ? 33  LEU C CA    1 
ATOM   1695  C C     . LEU C 3 34  ? 161.775 131.907 157.194 1.00 149.25 ? 33  LEU C C     1 
ATOM   1696  O O     . LEU C 3 34  ? 160.809 132.559 156.797 1.00 149.25 ? 33  LEU C O     1 
ATOM   1697  C CB    . LEU C 3 34  ? 162.039 132.356 159.620 1.00 149.25 ? 33  LEU C CB    1 
ATOM   1698  C CG    . LEU C 3 34  ? 161.690 131.997 161.061 1.00 149.25 ? 33  LEU C CG    1 
ATOM   1699  C CD1   . LEU C 3 34  ? 161.669 133.241 161.910 1.00 149.25 ? 33  LEU C CD1   1 
ATOM   1700  C CD2   . LEU C 3 34  ? 160.360 131.284 161.152 1.00 149.25 ? 33  LEU C CD2   1 
ATOM   1701  N N     . LEU C 3 35  ? 162.862 131.724 156.458 1.00 151.66 ? 34  LEU C N     1 
ATOM   1702  C CA    . LEU C 3 35  ? 162.858 132.136 155.067 1.00 151.66 ? 34  LEU C CA    1 
ATOM   1703  C C     . LEU C 3 35  ? 162.094 131.152 154.202 1.00 151.66 ? 34  LEU C C     1 
ATOM   1704  O O     . LEU C 3 35  ? 161.429 131.563 153.247 1.00 151.66 ? 34  LEU C O     1 
ATOM   1705  C CB    . LEU C 3 35  ? 164.286 132.283 154.557 1.00 151.66 ? 34  LEU C CB    1 
ATOM   1706  C CG    . LEU C 3 35  ? 164.947 133.613 154.882 1.00 151.66 ? 34  LEU C CG    1 
ATOM   1707  C CD1   . LEU C 3 35  ? 166.314 133.672 154.261 1.00 151.66 ? 34  LEU C CD1   1 
ATOM   1708  C CD2   . LEU C 3 35  ? 164.094 134.734 154.374 1.00 151.66 ? 34  LEU C CD2   1 
ATOM   1709  N N     . ARG C 3 36  ? 162.181 129.858 154.513 1.00 156.74 ? 35  ARG C N     1 
ATOM   1710  C CA    . ARG C 3 36  ? 161.463 128.858 153.732 1.00 156.74 ? 35  ARG C CA    1 
ATOM   1711  C C     . ARG C 3 36  ? 159.963 128.965 153.951 1.00 156.74 ? 35  ARG C C     1 
ATOM   1712  O O     . ARG C 3 36  ? 159.185 129.029 152.996 1.00 156.74 ? 35  ARG C O     1 
ATOM   1713  C CB    . ARG C 3 36  ? 161.955 127.462 154.093 1.00 156.74 ? 35  ARG C CB    1 
ATOM   1714  C CG    . ARG C 3 36  ? 163.109 126.999 153.254 1.00 156.74 ? 35  ARG C CG    1 
ATOM   1715  C CD    . ARG C 3 36  ? 163.526 125.619 153.670 1.00 156.74 ? 35  ARG C CD    1 
ATOM   1716  N NE    . ARG C 3 36  ? 164.566 125.083 152.803 1.00 156.74 ? 35  ARG C NE    1 
ATOM   1717  C CZ    . ARG C 3 36  ? 165.114 123.884 152.962 1.00 156.74 ? 35  ARG C CZ    1 
ATOM   1718  N NH1   . ARG C 3 36  ? 164.713 123.100 153.953 1.00 156.74 ? 35  ARG C NH1   1 
ATOM   1719  N NH2   . ARG C 3 36  ? 166.059 123.467 152.132 1.00 156.74 ? 35  ARG C NH2   1 
ATOM   1720  N N     . LYS C 3 37  ? 159.537 129.005 155.211 1.00 152.01 ? 36  LYS C N     1 
ATOM   1721  C CA    . LYS C 3 37  ? 158.114 129.095 155.501 1.00 152.01 ? 36  LYS C CA    1 
ATOM   1722  C C     . LYS C 3 37  ? 157.575 130.494 155.264 1.00 152.01 ? 36  LYS C C     1 
ATOM   1723  O O     . LYS C 3 37  ? 156.358 130.683 155.220 1.00 152.01 ? 36  LYS C O     1 
ATOM   1724  C CB    . LYS C 3 37  ? 157.846 128.688 156.942 1.00 152.01 ? 36  LYS C CB    1 
ATOM   1725  C CG    . LYS C 3 37  ? 158.316 127.300 157.290 1.00 152.01 ? 36  LYS C CG    1 
ATOM   1726  C CD    . LYS C 3 37  ? 158.342 127.115 158.794 1.00 152.01 ? 36  LYS C CD    1 
ATOM   1727  C CE    . LYS C 3 37  ? 156.982 127.381 159.417 1.00 152.01 ? 36  LYS C CE    1 
ATOM   1728  N NZ    . LYS C 3 37  ? 156.020 126.278 159.145 1.00 152.01 ? 36  LYS C NZ    1 
ATOM   1729  N N     . GLY C 3 38  ? 158.446 131.477 155.107 1.00 153.56 ? 37  GLY C N     1 
ATOM   1730  C CA    . GLY C 3 38  ? 158.005 132.852 155.087 1.00 153.56 ? 37  GLY C CA    1 
ATOM   1731  C C     . GLY C 3 38  ? 157.350 133.325 153.811 1.00 153.56 ? 37  GLY C C     1 
ATOM   1732  O O     . GLY C 3 38  ? 157.017 134.512 153.742 1.00 153.56 ? 37  GLY C O     1 
ATOM   1733  N N     . ASN C 3 39  ? 157.168 132.447 152.817 1.00 155.94 ? 38  ASN C N     1 
ATOM   1734  C CA    . ASN C 3 39  ? 156.508 132.745 151.541 1.00 155.94 ? 38  ASN C CA    1 
ATOM   1735  C C     . ASN C 3 39  ? 157.188 133.902 150.813 1.00 155.94 ? 38  ASN C C     1 
ATOM   1736  O O     . ASN C 3 39  ? 156.547 134.845 150.352 1.00 155.94 ? 38  ASN C O     1 
ATOM   1737  C CB    . ASN C 3 39  ? 155.018 133.031 151.739 1.00 155.94 ? 38  ASN C CB    1 
ATOM   1738  C CG    . ASN C 3 39  ? 154.218 131.780 151.955 1.00 155.94 ? 38  ASN C CG    1 
ATOM   1739  O OD1   . ASN C 3 39  ? 154.664 130.684 151.624 1.00 155.94 ? 38  ASN C OD1   1 
ATOM   1740  N ND2   . ASN C 3 39  ? 153.023 131.931 152.512 1.00 155.94 ? 38  ASN C ND2   1 
ATOM   1741  N N     . TYR C 3 40  ? 158.510 133.822 150.734 1.00 152.99 ? 39  TYR C N     1 
ATOM   1742  C CA    . TYR C 3 40  ? 159.308 134.900 150.176 1.00 152.99 ? 39  TYR C CA    1 
ATOM   1743  C C     . TYR C 3 40  ? 159.759 134.621 148.755 1.00 152.99 ? 39  TYR C C     1 
ATOM   1744  O O     . TYR C 3 40  ? 159.701 135.508 147.903 1.00 152.99 ? 39  TYR C O     1 
ATOM   1745  C CB    . TYR C 3 40  ? 160.512 135.159 151.076 1.00 152.99 ? 39  TYR C CB    1 
ATOM   1746  C CG    . TYR C 3 40  ? 160.103 135.747 152.389 1.00 152.99 ? 39  TYR C CG    1 
ATOM   1747  C CD1   . TYR C 3 40  ? 159.243 136.827 152.438 1.00 152.99 ? 39  TYR C CD1   1 
ATOM   1748  C CD2   . TYR C 3 40  ? 160.548 135.209 153.580 1.00 152.99 ? 39  TYR C CD2   1 
ATOM   1749  C CE1   . TYR C 3 40  ? 158.854 137.371 153.634 1.00 152.99 ? 39  TYR C CE1   1 
ATOM   1750  C CE2   . TYR C 3 40  ? 160.163 135.746 154.784 1.00 152.99 ? 39  TYR C CE2   1 
ATOM   1751  C CZ    . TYR C 3 40  ? 159.314 136.825 154.802 1.00 152.99 ? 39  TYR C CZ    1 
ATOM   1752  O OH    . TYR C 3 40  ? 158.926 137.363 155.999 1.00 152.99 ? 39  TYR C OH    1 
ATOM   1753  N N     . ALA C 3 41  ? 160.214 133.408 148.479 1.00 155.44 ? 40  ALA C N     1 
ATOM   1754  C CA    . ALA C 3 41  ? 160.459 132.973 147.119 1.00 155.44 ? 40  ALA C CA    1 
ATOM   1755  C C     . ALA C 3 41  ? 160.210 131.480 147.057 1.00 155.44 ? 40  ALA C C     1 
ATOM   1756  O O     . ALA C 3 41  ? 159.845 130.852 148.053 1.00 155.44 ? 40  ALA C O     1 
ATOM   1757  C CB    . ALA C 3 41  ? 161.877 133.307 146.656 1.00 155.44 ? 40  ALA C CB    1 
ATOM   1758  N N     . GLU C 3 42  ? 160.397 130.913 145.869 1.00 166.56 ? 41  GLU C N     1 
ATOM   1759  C CA    . GLU C 3 42  ? 160.249 129.474 145.717 1.00 166.56 ? 41  GLU C CA    1 
ATOM   1760  C C     . GLU C 3 42  ? 161.374 128.748 146.429 1.00 166.56 ? 41  GLU C C     1 
ATOM   1761  O O     . GLU C 3 42  ? 161.138 127.949 147.339 1.00 166.56 ? 41  GLU C O     1 
ATOM   1762  C CB    . GLU C 3 42  ? 160.222 129.095 144.242 1.00 166.56 ? 41  GLU C CB    1 
ATOM   1763  C CG    . GLU C 3 42  ? 160.351 127.606 144.015 1.00 166.56 ? 41  GLU C CG    1 
ATOM   1764  C CD    . GLU C 3 42  ? 161.070 127.277 142.731 1.00 166.56 ? 41  GLU C CD    1 
ATOM   1765  O OE1   . GLU C 3 42  ? 161.866 126.314 142.729 1.00 166.56 ? 41  GLU C OE1   1 
ATOM   1766  O OE2   . GLU C 3 42  ? 160.838 127.976 141.723 1.00 166.56 ? 41  GLU C OE2   1 
ATOM   1767  N N     . ARG C 3 43  ? 162.606 129.023 146.041 1.00 166.22 ? 42  ARG C N     1 
ATOM   1768  C CA    . ARG C 3 43  ? 163.749 128.417 146.689 1.00 166.22 ? 42  ARG C CA    1 
ATOM   1769  C C     . ARG C 3 43  ? 164.597 129.496 147.337 1.00 166.22 ? 42  ARG C C     1 
ATOM   1770  O O     . ARG C 3 43  ? 164.598 130.652 146.915 1.00 166.22 ? 42  ARG C O     1 
ATOM   1771  C CB    . ARG C 3 43  ? 164.579 127.601 145.702 1.00 166.22 ? 42  ARG C CB    1 
ATOM   1772  C CG    . ARG C 3 43  ? 164.996 128.371 144.495 1.00 166.22 ? 42  ARG C CG    1 
ATOM   1773  C CD    . ARG C 3 43  ? 165.538 127.449 143.441 1.00 166.22 ? 42  ARG C CD    1 
ATOM   1774  N NE    . ARG C 3 43  ? 164.547 126.450 143.074 1.00 166.22 ? 42  ARG C NE    1 
ATOM   1775  C CZ    . ARG C 3 43  ? 164.762 125.145 143.125 1.00 166.22 ? 42  ARG C CZ    1 
ATOM   1776  N NH1   . ARG C 3 43  ? 165.942 124.688 143.511 1.00 166.22 ? 42  ARG C NH1   1 
ATOM   1777  N NH2   . ARG C 3 43  ? 163.805 124.298 142.782 1.00 166.22 ? 42  ARG C NH2   1 
ATOM   1778  N N     . VAL C 3 44  ? 165.311 129.101 148.383 1.00 149.45 ? 43  VAL C N     1 
ATOM   1779  C CA    . VAL C 3 44  ? 166.123 130.001 149.187 1.00 149.45 ? 43  VAL C CA    1 
ATOM   1780  C C     . VAL C 3 44  ? 167.548 129.493 149.149 1.00 149.45 ? 43  VAL C C     1 
ATOM   1781  O O     . VAL C 3 44  ? 167.803 128.337 149.500 1.00 149.45 ? 43  VAL C O     1 
ATOM   1782  C CB    . VAL C 3 44  ? 165.612 130.070 150.633 1.00 149.45 ? 43  VAL C CB    1 
ATOM   1783  C CG1   . VAL C 3 44  ? 166.614 130.777 151.506 1.00 149.45 ? 43  VAL C CG1   1 
ATOM   1784  C CG2   . VAL C 3 44  ? 164.271 130.762 150.677 1.00 149.45 ? 43  VAL C CG2   1 
ATOM   1785  N N     . GLY C 3 45  ? 168.468 130.346 148.720 1.00 148.06 ? 44  GLY C N     1 
ATOM   1786  C CA    . GLY C 3 45  ? 169.840 129.921 148.548 1.00 148.06 ? 44  GLY C CA    1 
ATOM   1787  C C     . GLY C 3 45  ? 170.517 129.607 149.867 1.00 148.06 ? 44  GLY C C     1 
ATOM   1788  O O     . GLY C 3 45  ? 170.105 130.064 150.930 1.00 148.06 ? 44  GLY C O     1 
ATOM   1789  N N     . ALA C 3 46  ? 171.563 128.789 149.789 1.00 150.46 ? 45  ALA C N     1 
ATOM   1790  C CA    . ALA C 3 46  ? 172.257 128.358 150.992 1.00 150.46 ? 45  ALA C CA    1 
ATOM   1791  C C     . ALA C 3 46  ? 173.105 129.456 151.605 1.00 150.46 ? 45  ALA C C     1 
ATOM   1792  O O     . ALA C 3 46  ? 173.247 129.498 152.830 1.00 150.46 ? 45  ALA C O     1 
ATOM   1793  C CB    . ALA C 3 46  ? 173.134 127.145 150.691 1.00 150.46 ? 45  ALA C CB    1 
ATOM   1794  N N     . GLY C 3 47  ? 173.666 130.343 150.796 1.00 151.11 ? 46  GLY C N     1 
ATOM   1795  C CA    . GLY C 3 47  ? 174.422 131.464 151.302 1.00 151.11 ? 46  GLY C CA    1 
ATOM   1796  C C     . GLY C 3 47  ? 173.583 132.610 151.815 1.00 151.11 ? 46  GLY C C     1 
ATOM   1797  O O     . GLY C 3 47  ? 174.142 133.595 152.308 1.00 151.11 ? 46  GLY C O     1 
ATOM   1798  N N     . ALA C 3 48  ? 172.271 132.522 151.717 1.00 145.93 ? 47  ALA C N     1 
ATOM   1799  C CA    . ALA C 3 48  ? 171.389 133.598 152.145 1.00 145.93 ? 47  ALA C CA    1 
ATOM   1800  C C     . ALA C 3 48  ? 171.215 133.728 153.662 1.00 145.93 ? 47  ALA C C     1 
ATOM   1801  O O     . ALA C 3 48  ? 171.429 134.837 154.171 1.00 145.93 ? 47  ALA C O     1 
ATOM   1802  C CB    . ALA C 3 48  ? 170.028 133.456 151.462 1.00 145.93 ? 47  ALA C CB    1 
ATOM   1803  N N     . PRO C 3 49  ? 170.829 132.691 154.434 1.00 140.49 ? 48  PRO C N     1 
ATOM   1804  C CA    . PRO C 3 49  ? 170.537 132.955 155.846 1.00 140.49 ? 48  PRO C CA    1 
ATOM   1805  C C     . PRO C 3 49  ? 171.772 133.232 156.679 1.00 140.49 ? 48  PRO C C     1 
ATOM   1806  O O     . PRO C 3 49  ? 171.644 133.881 157.721 1.00 140.49 ? 48  PRO C O     1 
ATOM   1807  C CB    . PRO C 3 49  ? 169.831 131.678 156.298 1.00 140.49 ? 48  PRO C CB    1 
ATOM   1808  C CG    . PRO C 3 49  ? 170.484 130.661 155.555 1.00 140.49 ? 48  PRO C CG    1 
ATOM   1809  C CD    . PRO C 3 49  ? 170.714 131.237 154.192 1.00 140.49 ? 48  PRO C CD    1 
ATOM   1810  N N     . VAL C 3 50  ? 172.958 132.816 156.229 1.00 141.12 ? 49  VAL C N     1 
ATOM   1811  C CA    . VAL C 3 50  ? 174.192 133.225 156.886 1.00 141.12 ? 49  VAL C CA    1 
ATOM   1812  C C     . VAL C 3 50  ? 174.375 134.730 156.782 1.00 141.12 ? 49  VAL C C     1 
ATOM   1813  O O     . VAL C 3 50  ? 174.649 135.406 157.781 1.00 141.12 ? 49  VAL C O     1 
ATOM   1814  C CB    . VAL C 3 50  ? 175.384 132.475 156.280 1.00 141.12 ? 49  VAL C CB    1 
ATOM   1815  C CG1   . VAL C 3 50  ? 176.676 133.031 156.811 1.00 141.12 ? 49  VAL C CG1   1 
ATOM   1816  C CG2   . VAL C 3 50  ? 175.288 131.019 156.595 1.00 141.12 ? 49  VAL C CG2   1 
ATOM   1817  N N     . TYR C 3 51  ? 174.184 135.277 155.581 1.00 142.55 ? 50  TYR C N     1 
ATOM   1818  C CA    . TYR C 3 51  ? 174.290 136.715 155.377 1.00 142.55 ? 50  TYR C CA    1 
ATOM   1819  C C     . TYR C 3 51  ? 173.240 137.464 156.175 1.00 142.55 ? 50  TYR C C     1 
ATOM   1820  O O     . TYR C 3 51  ? 173.534 138.501 156.788 1.00 142.55 ? 50  TYR C O     1 
ATOM   1821  C CB    . TYR C 3 51  ? 174.133 137.032 153.898 1.00 142.55 ? 50  TYR C CB    1 
ATOM   1822  C CG    . TYR C 3 51  ? 174.813 138.296 153.448 1.00 142.55 ? 50  TYR C CG    1 
ATOM   1823  C CD1   . TYR C 3 51  ? 176.072 138.256 152.879 1.00 142.55 ? 50  TYR C CD1   1 
ATOM   1824  C CD2   . TYR C 3 51  ? 174.196 139.524 153.586 1.00 142.55 ? 50  TYR C CD2   1 
ATOM   1825  C CE1   . TYR C 3 51  ? 176.693 139.395 152.456 1.00 142.55 ? 50  TYR C CE1   1 
ATOM   1826  C CE2   . TYR C 3 51  ? 174.814 140.670 153.170 1.00 142.55 ? 50  TYR C CE2   1 
ATOM   1827  C CZ    . TYR C 3 51  ? 176.064 140.597 152.607 1.00 142.55 ? 50  TYR C CZ    1 
ATOM   1828  O OH    . TYR C 3 51  ? 176.694 141.738 152.185 1.00 142.55 ? 50  TYR C OH    1 
ATOM   1829  N N     . LEU C 3 52  ? 172.020 136.932 156.212 1.00 134.64 ? 51  LEU C N     1 
ATOM   1830  C CA    . LEU C 3 52  ? 170.946 137.621 156.910 1.00 134.64 ? 51  LEU C CA    1 
ATOM   1831  C C     . LEU C 3 52  ? 171.166 137.620 158.413 1.00 134.64 ? 51  LEU C C     1 
ATOM   1832  O O     . LEU C 3 52  ? 170.980 138.650 159.074 1.00 134.64 ? 51  LEU C O     1 
ATOM   1833  C CB    . LEU C 3 52  ? 169.613 136.979 156.573 1.00 134.64 ? 51  LEU C CB    1 
ATOM   1834  C CG    . LEU C 3 52  ? 168.368 137.743 156.977 1.00 134.64 ? 51  LEU C CG    1 
ATOM   1835  C CD1   . LEU C 3 52  ? 168.520 139.202 156.679 1.00 134.64 ? 51  LEU C CD1   1 
ATOM   1836  C CD2   . LEU C 3 52  ? 167.234 137.188 156.184 1.00 134.64 ? 51  LEU C CD2   1 
ATOM   1837  N N     . ALA C 3 53  ? 171.595 136.488 158.965 1.00 138.97 ? 52  ALA C N     1 
ATOM   1838  C CA    . ALA C 3 53  ? 171.842 136.426 160.395 1.00 138.97 ? 52  ALA C CA    1 
ATOM   1839  C C     . ALA C 3 53  ? 173.057 137.246 160.785 1.00 138.97 ? 52  ALA C C     1 
ATOM   1840  O O     . ALA C 3 53  ? 173.080 137.820 161.876 1.00 138.97 ? 52  ALA C O     1 
ATOM   1841  C CB    . ALA C 3 53  ? 172.002 134.977 160.828 1.00 138.97 ? 52  ALA C CB    1 
ATOM   1842  N N     . ALA C 3 54  ? 174.045 137.362 159.896 1.00 139.33 ? 53  ALA C N     1 
ATOM   1843  C CA    . ALA C 3 54  ? 175.191 138.214 160.186 1.00 139.33 ? 53  ALA C CA    1 
ATOM   1844  C C     . ALA C 3 54  ? 174.797 139.679 160.220 1.00 139.33 ? 53  ALA C C     1 
ATOM   1845  O O     . ALA C 3 54  ? 175.257 140.429 161.090 1.00 139.33 ? 53  ALA C O     1 
ATOM   1846  C CB    . ALA C 3 54  ? 176.282 137.994 159.149 1.00 139.33 ? 53  ALA C CB    1 
ATOM   1847  N N     . VAL C 3 55  ? 173.944 140.099 159.285 1.00 137.14 ? 54  VAL C N     1 
ATOM   1848  C CA    . VAL C 3 55  ? 173.498 141.486 159.258 1.00 137.14 ? 54  VAL C CA    1 
ATOM   1849  C C     . VAL C 3 55  ? 172.669 141.811 160.497 1.00 137.14 ? 54  VAL C C     1 
ATOM   1850  O O     . VAL C 3 55  ? 172.872 142.850 161.144 1.00 137.14 ? 54  VAL C O     1 
ATOM   1851  C CB    . VAL C 3 55  ? 172.729 141.749 157.954 1.00 137.14 ? 54  VAL C CB    1 
ATOM   1852  C CG1   . VAL C 3 55  ? 171.845 142.963 158.075 1.00 137.14 ? 54  VAL C CG1   1 
ATOM   1853  C CG2   . VAL C 3 55  ? 173.705 141.917 156.817 1.00 137.14 ? 54  VAL C CG2   1 
ATOM   1854  N N     . LEU C 3 56  ? 171.774 140.900 160.882 1.00 135.96 ? 55  LEU C N     1 
ATOM   1855  C CA    . LEU C 3 56  ? 170.965 141.105 162.081 1.00 135.96 ? 55  LEU C CA    1 
ATOM   1856  C C     . LEU C 3 56  ? 171.822 141.110 163.340 1.00 135.96 ? 55  LEU C C     1 
ATOM   1857  O O     . LEU C 3 56  ? 171.569 141.890 164.270 1.00 135.96 ? 55  LEU C O     1 
ATOM   1858  C CB    . LEU C 3 56  ? 169.893 140.029 162.158 1.00 135.96 ? 55  LEU C CB    1 
ATOM   1859  C CG    . LEU C 3 56  ? 168.523 140.306 161.554 1.00 135.96 ? 55  LEU C CG    1 
ATOM   1860  C CD1   . LEU C 3 56  ? 168.567 140.686 160.114 1.00 135.96 ? 55  LEU C CD1   1 
ATOM   1861  C CD2   . LEU C 3 56  ? 167.728 139.036 161.675 1.00 135.96 ? 55  LEU C CD2   1 
ATOM   1862  N N     . GLU C 3 57  ? 172.870 140.290 163.356 1.00 143.57 ? 56  GLU C N     1 
ATOM   1863  C CA    . GLU C 3 57  ? 173.800 140.266 164.473 1.00 143.57 ? 56  GLU C CA    1 
ATOM   1864  C C     . GLU C 3 57  ? 174.548 141.581 164.599 1.00 143.57 ? 56  GLU C C     1 
ATOM   1865  O O     . GLU C 3 57  ? 174.711 142.098 165.708 1.00 143.57 ? 56  GLU C O     1 
ATOM   1866  C CB    . GLU C 3 57  ? 174.762 139.099 164.285 1.00 143.57 ? 56  GLU C CB    1 
ATOM   1867  C CG    . GLU C 3 57  ? 175.734 138.846 165.405 1.00 143.57 ? 56  GLU C CG    1 
ATOM   1868  C CD    . GLU C 3 57  ? 177.058 139.530 165.166 1.00 143.57 ? 56  GLU C CD    1 
ATOM   1869  O OE1   . GLU C 3 57  ? 177.382 139.777 163.989 1.00 143.57 ? 56  GLU C OE1   1 
ATOM   1870  O OE2   . GLU C 3 57  ? 177.785 139.798 166.141 1.00 143.57 ? 56  GLU C OE2   1 
ATOM   1871  N N     . TYR C 3 58  ? 174.983 142.149 163.475 1.00 143.51 ? 57  TYR C N     1 
ATOM   1872  C CA    . TYR C 3 58  ? 175.710 143.412 163.540 1.00 143.51 ? 57  TYR C CA    1 
ATOM   1873  C C     . TYR C 3 58  ? 174.804 144.555 163.979 1.00 143.51 ? 57  TYR C C     1 
ATOM   1874  O O     . TYR C 3 58  ? 175.223 145.416 164.765 1.00 143.51 ? 57  TYR C O     1 
ATOM   1875  C CB    . TYR C 3 58  ? 176.348 143.735 162.195 1.00 143.51 ? 57  TYR C CB    1 
ATOM   1876  C CG    . TYR C 3 58  ? 176.800 145.164 162.120 1.00 143.51 ? 57  TYR C CG    1 
ATOM   1877  C CD1   . TYR C 3 58  ? 177.842 145.618 162.912 1.00 143.51 ? 57  TYR C CD1   1 
ATOM   1878  C CD2   . TYR C 3 58  ? 176.168 146.070 161.285 1.00 143.51 ? 57  TYR C CD2   1 
ATOM   1879  C CE1   . TYR C 3 58  ? 178.249 146.934 162.867 1.00 143.51 ? 57  TYR C CE1   1 
ATOM   1880  C CE2   . TYR C 3 58  ? 176.568 147.387 161.231 1.00 143.51 ? 57  TYR C CE2   1 
ATOM   1881  C CZ    . TYR C 3 58  ? 177.609 147.814 162.023 1.00 143.51 ? 57  TYR C CZ    1 
ATOM   1882  O OH    . TYR C 3 58  ? 178.012 149.126 161.969 1.00 143.51 ? 57  TYR C OH    1 
ATOM   1883  N N     . LEU C 3 59  ? 173.563 144.572 163.492 1.00 140.32 ? 58  LEU C N     1 
ATOM   1884  C CA    . LEU C 3 59  ? 172.627 145.622 163.889 1.00 140.32 ? 58  LEU C CA    1 
ATOM   1885  C C     . LEU C 3 59  ? 172.309 145.558 165.377 1.00 140.32 ? 58  LEU C C     1 
ATOM   1886  O O     . LEU C 3 59  ? 172.285 146.593 166.066 1.00 140.32 ? 58  LEU C O     1 
ATOM   1887  C CB    . LEU C 3 59  ? 171.346 145.515 163.075 1.00 140.32 ? 58  LEU C CB    1 
ATOM   1888  C CG    . LEU C 3 59  ? 171.235 146.341 161.803 1.00 140.32 ? 58  LEU C CG    1 
ATOM   1889  C CD1   . LEU C 3 59  ? 171.276 147.792 162.195 1.00 140.32 ? 58  LEU C CD1   1 
ATOM   1890  C CD2   . LEU C 3 59  ? 172.313 146.043 160.789 1.00 140.32 ? 58  LEU C CD2   1 
ATOM   1891  N N     . THR C 3 60  ? 172.081 144.347 165.889 1.00 143.68 ? 59  THR C N     1 
ATOM   1892  C CA    . THR C 3 60  ? 171.831 144.181 167.313 1.00 143.68 ? 59  THR C CA    1 
ATOM   1893  C C     . THR C 3 60  ? 173.056 144.562 168.132 1.00 143.68 ? 59  THR C C     1 
ATOM   1894  O O     . THR C 3 60  ? 172.924 145.177 169.195 1.00 143.68 ? 59  THR C O     1 
ATOM   1895  C CB    . THR C 3 60  ? 171.406 142.742 167.582 1.00 143.68 ? 59  THR C CB    1 
ATOM   1896  O OG1   . THR C 3 60  ? 170.177 142.492 166.897 1.00 143.68 ? 59  THR C OG1   1 
ATOM   1897  C CG2   . THR C 3 60  ? 171.203 142.480 169.057 1.00 143.68 ? 59  THR C CG2   1 
ATOM   1898  N N     . ALA C 3 61  ? 174.257 144.266 167.622 1.00 147.11 ? 60  ALA C N     1 
ATOM   1899  C CA    . ALA C 3 61  ? 175.474 144.652 168.325 1.00 147.11 ? 60  ALA C CA    1 
ATOM   1900  C C     . ALA C 3 61  ? 175.618 146.160 168.411 1.00 147.11 ? 60  ALA C C     1 
ATOM   1901  O O     . ALA C 3 61  ? 176.019 146.684 169.457 1.00 147.11 ? 60  ALA C O     1 
ATOM   1902  C CB    . ALA C 3 61  ? 176.696 144.052 167.639 1.00 147.11 ? 60  ALA C CB    1 
ATOM   1903  N N     . GLU C 3 62  ? 175.231 146.868 167.353 1.00 150.28 ? 61  GLU C N     1 
ATOM   1904  C CA    . GLU C 3 62  ? 175.309 148.324 167.372 1.00 150.28 ? 61  GLU C CA    1 
ATOM   1905  C C     . GLU C 3 62  ? 174.329 148.923 168.371 1.00 150.28 ? 61  GLU C C     1 
ATOM   1906  O O     . GLU C 3 62  ? 174.696 149.803 169.171 1.00 150.28 ? 61  GLU C O     1 
ATOM   1907  C CB    . GLU C 3 62  ? 175.046 148.880 165.980 1.00 150.28 ? 61  GLU C CB    1 
ATOM   1908  C CG    . GLU C 3 62  ? 175.338 150.349 165.882 1.00 150.28 ? 61  GLU C CG    1 
ATOM   1909  C CD    . GLU C 3 62  ? 176.679 150.701 166.490 1.00 150.28 ? 61  GLU C CD    1 
ATOM   1910  O OE1   . GLU C 3 62  ? 177.712 150.212 165.986 1.00 150.28 ? 61  GLU C OE1   1 
ATOM   1911  O OE2   . GLU C 3 62  ? 176.706 151.459 167.479 1.00 150.28 ? 61  GLU C OE2   1 
ATOM   1912  N N     . ILE C 3 63  ? 173.081 148.445 168.345 1.00 137.75 ? 62  ILE C N     1 
ATOM   1913  C CA    . ILE C 3 63  ? 172.064 148.981 169.247 1.00 137.75 ? 62  ILE C CA    1 
ATOM   1914  C C     . ILE C 3 63  ? 172.416 148.678 170.698 1.00 137.75 ? 62  ILE C C     1 
ATOM   1915  O O     . ILE C 3 63  ? 172.271 149.536 171.576 1.00 137.75 ? 62  ILE C O     1 
ATOM   1916  C CB    . ILE C 3 63  ? 170.678 148.438 168.861 1.00 137.75 ? 62  ILE C CB    1 
ATOM   1917  C CG1   . ILE C 3 63  ? 170.185 149.144 167.610 1.00 137.75 ? 62  ILE C CG1   1 
ATOM   1918  C CG2   . ILE C 3 63  ? 169.664 148.647 169.958 1.00 137.75 ? 62  ILE C CG2   1 
ATOM   1919  C CD1   . ILE C 3 63  ? 169.948 150.605 167.821 1.00 137.75 ? 62  ILE C CD1   1 
ATOM   1920  N N     . LEU C 3 64  ? 172.974 147.498 170.958 1.00 142.40 ? 63  LEU C N     1 
ATOM   1921  C CA    . LEU C 3 64  ? 173.325 147.163 172.329 1.00 142.40 ? 63  LEU C CA    1 
ATOM   1922  C C     . LEU C 3 64  ? 174.545 147.927 172.808 1.00 142.40 ? 63  LEU C C     1 
ATOM   1923  O O     . LEU C 3 64  ? 174.617 148.259 173.994 1.00 142.40 ? 63  LEU C O     1 
ATOM   1924  C CB    . LEU C 3 64  ? 173.555 145.667 172.471 1.00 142.40 ? 63  LEU C CB    1 
ATOM   1925  C CG    . LEU C 3 64  ? 172.284 144.836 172.374 1.00 142.40 ? 63  LEU C CG    1 
ATOM   1926  C CD1   . LEU C 3 64  ? 172.614 143.394 172.614 1.00 142.40 ? 63  LEU C CD1   1 
ATOM   1927  C CD2   . LEU C 3 64  ? 171.238 145.317 173.343 1.00 142.40 ? 63  LEU C CD2   1 
ATOM   1928  N N     . GLU C 3 65  ? 175.492 148.233 171.916 1.00 148.23 ? 64  GLU C N     1 
ATOM   1929  C CA    . GLU C 3 65  ? 176.619 149.077 172.301 1.00 148.23 ? 64  GLU C CA    1 
ATOM   1930  C C     . GLU C 3 65  ? 176.151 150.456 172.728 1.00 148.23 ? 64  GLU C C     1 
ATOM   1931  O O     . GLU C 3 65  ? 176.541 150.957 173.793 1.00 148.23 ? 64  GLU C O     1 
ATOM   1932  C CB    . GLU C 3 65  ? 177.603 149.203 171.146 1.00 148.23 ? 64  GLU C CB    1 
ATOM   1933  C CG    . GLU C 3 65  ? 178.833 148.353 171.278 1.00 148.23 ? 64  GLU C CG    1 
ATOM   1934  C CD    . GLU C 3 65  ? 179.824 148.636 170.177 1.00 148.23 ? 64  GLU C CD    1 
ATOM   1935  O OE1   . GLU C 3 65  ? 179.418 149.240 169.164 1.00 148.23 ? 64  GLU C OE1   1 
ATOM   1936  O OE2   . GLU C 3 65  ? 181.005 148.265 170.325 1.00 148.23 ? 64  GLU C OE2   1 
ATOM   1937  N N     . LEU C 3 66  ? 175.275 151.066 171.931 1.00 145.24 ? 65  LEU C N     1 
ATOM   1938  C CA    . LEU C 3 66  ? 174.833 152.411 172.279 1.00 145.24 ? 65  LEU C CA    1 
ATOM   1939  C C     . LEU C 3 66  ? 173.918 152.416 173.497 1.00 145.24 ? 65  LEU C C     1 
ATOM   1940  O O     . LEU C 3 66  ? 173.992 153.339 174.320 1.00 145.24 ? 65  LEU C O     1 
ATOM   1941  C CB    . LEU C 3 66  ? 174.154 153.063 171.086 1.00 145.24 ? 65  LEU C CB    1 
ATOM   1942  C CG    . LEU C 3 66  ? 175.051 153.052 169.856 1.00 145.24 ? 65  LEU C CG    1 
ATOM   1943  C CD1   . LEU C 3 66  ? 174.357 153.701 168.693 1.00 145.24 ? 65  LEU C CD1   1 
ATOM   1944  C CD2   . LEU C 3 66  ? 176.370 153.737 170.138 1.00 145.24 ? 65  LEU C CD2   1 
ATOM   1945  N N     . ALA C 3 67  ? 173.093 151.380 173.662 1.00 146.56 ? 66  ALA C N     1 
ATOM   1946  C CA    . ALA C 3 67  ? 172.218 151.323 174.825 1.00 146.56 ? 66  ALA C CA    1 
ATOM   1947  C C     . ALA C 3 67  ? 173.006 151.070 176.096 1.00 146.56 ? 66  ALA C C     1 
ATOM   1948  O O     . ALA C 3 67  ? 172.699 151.651 177.139 1.00 146.56 ? 66  ALA C O     1 
ATOM   1949  C CB    . ALA C 3 67  ? 171.156 150.249 174.635 1.00 146.56 ? 66  ALA C CB    1 
ATOM   1950  N N     . GLY C 3 68  ? 174.039 150.231 176.024 1.00 150.06 ? 67  GLY C N     1 
ATOM   1951  C CA    . GLY C 3 68  ? 174.886 150.022 177.178 1.00 150.06 ? 67  GLY C CA    1 
ATOM   1952  C C     . GLY C 3 68  ? 175.670 151.256 177.558 1.00 150.06 ? 67  GLY C C     1 
ATOM   1953  O O     . GLY C 3 68  ? 175.847 151.529 178.748 1.00 150.06 ? 67  GLY C O     1 
ATOM   1954  N N     . ASN C 3 69  ? 176.115 152.032 176.562 1.00 156.16 ? 68  ASN C N     1 
ATOM   1955  C CA    . ASN C 3 69  ? 176.793 153.291 176.859 1.00 156.16 ? 68  ASN C CA    1 
ATOM   1956  C C     . ASN C 3 69  ? 175.859 154.276 177.541 1.00 156.16 ? 68  ASN C C     1 
ATOM   1957  O O     . ASN C 3 69  ? 176.213 154.860 178.573 1.00 156.16 ? 68  ASN C O     1 
ATOM   1958  C CB    . ASN C 3 69  ? 177.353 153.904 175.583 1.00 156.16 ? 68  ASN C CB    1 
ATOM   1959  C CG    . ASN C 3 69  ? 178.552 153.162 175.069 1.00 156.16 ? 68  ASN C CG    1 
ATOM   1960  O OD1   . ASN C 3 69  ? 178.833 153.165 173.874 1.00 156.16 ? 68  ASN C OD1   1 
ATOM   1961  N ND2   . ASN C 3 69  ? 179.270 152.510 175.971 1.00 156.16 ? 68  ASN C ND2   1 
ATOM   1962  N N     . ALA C 3 70  ? 174.649 154.446 177.002 1.00 156.81 ? 69  ALA C N     1 
ATOM   1963  C CA    . ALA C 3 70  ? 173.706 155.379 177.603 1.00 156.81 ? 69  ALA C CA    1 
ATOM   1964  C C     . ALA C 3 70  ? 173.189 154.901 178.953 1.00 156.81 ? 69  ALA C C     1 
ATOM   1965  O O     . ALA C 3 70  ? 172.794 155.732 179.776 1.00 156.81 ? 69  ALA C O     1 
ATOM   1966  C CB    . ALA C 3 70  ? 172.534 155.628 176.659 1.00 156.81 ? 69  ALA C CB    1 
ATOM   1967  N N     . ALA C 3 71  ? 173.192 153.592 179.207 1.00 154.83 ? 70  ALA C N     1 
ATOM   1968  C CA    . ALA C 3 71  ? 172.764 153.097 180.507 1.00 154.83 ? 70  ALA C CA    1 
ATOM   1969  C C     . ALA C 3 71  ? 173.865 153.232 181.542 1.00 154.83 ? 70  ALA C C     1 
ATOM   1970  O O     . ALA C 3 71  ? 173.589 153.549 182.703 1.00 154.83 ? 70  ALA C O     1 
ATOM   1971  C CB    . ALA C 3 71  ? 172.326 151.644 180.399 1.00 154.83 ? 70  ALA C CB    1 
ATOM   1972  N N     . ARG C 3 72  ? 175.112 152.981 181.142 1.00 162.60 ? 71  ARG C N     1 
ATOM   1973  C CA    . ARG C 3 72  ? 176.238 153.185 182.042 1.00 162.60 ? 71  ARG C CA    1 
ATOM   1974  C C     . ARG C 3 72  ? 176.403 154.656 182.385 1.00 162.60 ? 71  ARG C C     1 
ATOM   1975  O O     . ARG C 3 72  ? 176.786 154.994 183.510 1.00 162.60 ? 71  ARG C O     1 
ATOM   1976  C CB    . ARG C 3 72  ? 177.511 152.629 181.407 1.00 162.60 ? 71  ARG C CB    1 
ATOM   1977  C CG    . ARG C 3 72  ? 178.753 152.769 182.254 1.00 162.60 ? 71  ARG C CG    1 
ATOM   1978  C CD    . ARG C 3 72  ? 179.887 153.280 181.412 1.00 162.60 ? 71  ARG C CD    1 
ATOM   1979  N NE    . ARG C 3 72  ? 180.299 152.292 180.426 1.00 162.60 ? 71  ARG C NE    1 
ATOM   1980  C CZ    . ARG C 3 72  ? 180.670 152.588 179.187 1.00 162.60 ? 71  ARG C CZ    1 
ATOM   1981  N NH1   . ARG C 3 72  ? 180.663 153.846 178.778 1.00 162.60 ? 71  ARG C NH1   1 
ATOM   1982  N NH2   . ARG C 3 72  ? 181.037 151.625 178.354 1.00 162.60 ? 71  ARG C NH2   1 
ATOM   1983  N N     . ASP C 3 73  ? 176.069 155.546 181.450 1.00 169.84 ? 72  ASP C N     1 
ATOM   1984  C CA    . ASP C 3 73  ? 176.070 156.966 181.770 1.00 169.84 ? 72  ASP C CA    1 
ATOM   1985  C C     . ASP C 3 73  ? 174.965 157.344 182.745 1.00 169.84 ? 72  ASP C C     1 
ATOM   1986  O O     . ASP C 3 73  ? 175.057 158.396 183.384 1.00 169.84 ? 72  ASP C O     1 
ATOM   1987  C CB    . ASP C 3 73  ? 175.948 157.791 180.494 1.00 169.84 ? 72  ASP C CB    1 
ATOM   1988  C CG    . ASP C 3 73  ? 177.163 157.657 179.605 1.00 169.84 ? 72  ASP C CG    1 
ATOM   1989  O OD1   . ASP C 3 73  ? 178.003 156.775 179.880 1.00 169.84 ? 72  ASP C OD1   1 
ATOM   1990  O OD2   . ASP C 3 73  ? 177.283 158.432 178.635 1.00 169.84 ? 72  ASP C OD2   1 
ATOM   1991  N N     . ASN C 3 74  ? 173.930 156.519 182.884 1.00 161.24 ? 73  ASN C N     1 
ATOM   1992  C CA    . ASN C 3 74  ? 172.941 156.700 183.934 1.00 161.24 ? 73  ASN C CA    1 
ATOM   1993  C C     . ASN C 3 74  ? 173.187 155.772 185.112 1.00 161.24 ? 73  ASN C C     1 
ATOM   1994  O O     . ASN C 3 74  ? 172.279 155.550 185.919 1.00 161.24 ? 73  ASN C O     1 
ATOM   1995  C CB    . ASN C 3 74  ? 171.533 156.496 183.387 1.00 161.24 ? 73  ASN C CB    1 
ATOM   1996  C CG    . ASN C 3 74  ? 170.863 157.792 183.043 1.00 161.24 ? 73  ASN C CG    1 
ATOM   1997  O OD1   . ASN C 3 74  ? 171.250 158.845 183.538 1.00 161.24 ? 73  ASN C OD1   1 
ATOM   1998  N ND2   . ASN C 3 74  ? 169.851 157.730 182.191 1.00 161.24 ? 73  ASN C ND2   1 
ATOM   1999  N N     . LYS C 3 75  ? 174.381 155.182 185.188 1.00 164.47 ? 74  LYS C N     1 
ATOM   2000  C CA    . LYS C 3 75  ? 174.920 154.384 186.291 1.00 164.47 ? 74  LYS C CA    1 
ATOM   2001  C C     . LYS C 3 75  ? 174.195 153.065 186.525 1.00 164.47 ? 74  LYS C C     1 
ATOM   2002  O O     . LYS C 3 75  ? 174.584 152.327 187.433 1.00 164.47 ? 74  LYS C O     1 
ATOM   2003  C CB    . LYS C 3 75  ? 174.951 155.149 187.624 1.00 164.47 ? 74  LYS C CB    1 
ATOM   2004  C CG    . LYS C 3 75  ? 176.166 156.037 187.823 1.00 164.47 ? 74  LYS C CG    1 
ATOM   2005  C CD    . LYS C 3 75  ? 175.984 157.388 187.156 1.00 164.47 ? 74  LYS C CD    1 
ATOM   2006  C CE    . LYS C 3 75  ? 174.895 158.193 187.836 1.00 164.47 ? 74  LYS C CE    1 
ATOM   2007  N NZ    . LYS C 3 75  ? 174.742 159.530 187.206 1.00 164.47 ? 74  LYS C NZ    1 
ATOM   2008  N N     . LYS C 3 76  ? 173.176 152.732 185.743 1.00 168.01 ? 75  LYS C N     1 
ATOM   2009  C CA    . LYS C 3 76  ? 172.442 151.500 185.963 1.00 168.01 ? 75  LYS C CA    1 
ATOM   2010  C C     . LYS C 3 76  ? 173.190 150.320 185.349 1.00 168.01 ? 75  LYS C C     1 
ATOM   2011  O O     . LYS C 3 76  ? 174.244 150.468 184.730 1.00 168.01 ? 75  LYS C O     1 
ATOM   2012  C CB    . LYS C 3 76  ? 171.035 151.605 185.385 1.00 168.01 ? 75  LYS C CB    1 
ATOM   2013  C CG    . LYS C 3 76  ? 170.308 152.887 185.740 1.00 168.01 ? 75  LYS C CG    1 
ATOM   2014  C CD    . LYS C 3 76  ? 170.204 153.072 187.235 1.00 168.01 ? 75  LYS C CD    1 
ATOM   2015  C CE    . LYS C 3 76  ? 169.333 154.254 187.571 1.00 168.01 ? 75  LYS C CE    1 
ATOM   2016  N NZ    . LYS C 3 76  ? 167.926 153.974 187.196 1.00 168.01 ? 75  LYS C NZ    1 
ATOM   2017  N N     . THR C 3 77  ? 172.629 149.132 185.525 1.00 166.63 ? 76  THR C N     1 
ATOM   2018  C CA    . THR C 3 77  ? 173.284 147.904 185.106 1.00 166.63 ? 76  THR C CA    1 
ATOM   2019  C C     . THR C 3 77  ? 172.354 147.121 184.187 1.00 166.63 ? 76  THR C C     1 
ATOM   2020  O O     . THR C 3 77  ? 172.715 146.092 183.612 1.00 166.63 ? 76  THR C O     1 
ATOM   2021  C CB    . THR C 3 77  ? 173.697 147.094 186.333 1.00 166.63 ? 76  THR C CB    1 
ATOM   2022  O OG1   . THR C 3 77  ? 174.249 147.991 187.299 1.00 166.63 ? 76  THR C OG1   1 
ATOM   2023  C CG2   . THR C 3 77  ? 174.798 146.086 186.007 1.00 166.63 ? 76  THR C CG2   1 
ATOM   2024  N N     . ARG C 3 78  ? 171.146 147.632 183.988 1.00 159.26 ? 77  ARG C N     1 
ATOM   2025  C CA    . ARG C 3 78  ? 170.197 146.961 183.115 1.00 159.26 ? 77  ARG C CA    1 
ATOM   2026  C C     . ARG C 3 78  ? 169.699 147.953 182.086 1.00 159.26 ? 77  ARG C C     1 
ATOM   2027  O O     . ARG C 3 78  ? 169.293 149.060 182.436 1.00 159.26 ? 77  ARG C O     1 
ATOM   2028  C CB    . ARG C 3 78  ? 169.030 146.389 183.900 1.00 159.26 ? 77  ARG C CB    1 
ATOM   2029  C CG    . ARG C 3 78  ? 169.374 145.168 184.690 1.00 159.26 ? 77  ARG C CG    1 
ATOM   2030  C CD    . ARG C 3 78  ? 168.160 144.707 185.439 1.00 159.26 ? 77  ARG C CD    1 
ATOM   2031  N NE    . ARG C 3 78  ? 168.507 143.821 186.535 1.00 159.26 ? 77  ARG C NE    1 
ATOM   2032  C CZ    . ARG C 3 78  ? 167.632 143.393 187.433 1.00 159.26 ? 77  ARG C CZ    1 
ATOM   2033  N NH1   . ARG C 3 78  ? 166.367 143.772 187.350 1.00 159.26 ? 77  ARG C NH1   1 
ATOM   2034  N NH2   . ARG C 3 78  ? 168.019 142.589 188.409 1.00 159.26 ? 77  ARG C NH2   1 
ATOM   2035  N N     . ILE C 3 79  ? 169.735 147.547 180.824 1.00 142.90 ? 78  ILE C N     1 
ATOM   2036  C CA    . ILE C 3 79  ? 169.178 148.345 179.745 1.00 142.90 ? 78  ILE C CA    1 
ATOM   2037  C C     . ILE C 3 79  ? 167.661 148.338 179.862 1.00 142.90 ? 78  ILE C C     1 
ATOM   2038  O O     . ILE C 3 79  ? 167.030 147.277 179.848 1.00 142.90 ? 78  ILE C O     1 
ATOM   2039  C CB    . ILE C 3 79  ? 169.639 147.794 178.398 1.00 142.90 ? 78  ILE C CB    1 
ATOM   2040  C CG1   . ILE C 3 79  ? 171.134 148.028 178.251 1.00 142.90 ? 78  ILE C CG1   1 
ATOM   2041  C CG2   . ILE C 3 79  ? 168.861 148.407 177.276 1.00 142.90 ? 78  ILE C CG2   1 
ATOM   2042  C CD1   . ILE C 3 79  ? 171.724 147.392 177.049 1.00 142.90 ? 78  ILE C CD1   1 
ATOM   2043  N N     . ILE C 3 80  ? 167.069 149.516 180.003 1.00 141.71 ? 79  ILE C N     1 
ATOM   2044  C CA    . ILE C 3 80  ? 165.618 149.630 180.122 1.00 141.71 ? 79  ILE C CA    1 
ATOM   2045  C C     . ILE C 3 80  ? 165.151 150.248 178.807 1.00 141.71 ? 79  ILE C C     1 
ATOM   2046  O O     . ILE C 3 80  ? 166.013 150.576 177.983 1.00 141.71 ? 79  ILE C O     1 
ATOM   2047  C CB    . ILE C 3 80  ? 165.233 150.444 181.372 1.00 141.71 ? 79  ILE C CB    1 
ATOM   2048  C CG1   . ILE C 3 80  ? 165.327 151.940 181.112 1.00 141.71 ? 79  ILE C CG1   1 
ATOM   2049  C CG2   . ILE C 3 80  ? 166.102 150.063 182.546 1.00 141.71 ? 79  ILE C CG2   1 
ATOM   2050  C CD1   . ILE C 3 80  ? 164.642 152.756 182.184 1.00 141.71 ? 79  ILE C CD1   1 
ATOM   2051  N N     . PRO C 3 81  ? 163.844 150.364 178.522 1.00 139.99 ? 80  PRO C N     1 
ATOM   2052  C CA    . PRO C 3 81  ? 163.418 151.022 177.273 1.00 139.99 ? 80  PRO C CA    1 
ATOM   2053  C C     . PRO C 3 81  ? 163.876 152.456 177.095 1.00 139.99 ? 80  PRO C C     1 
ATOM   2054  O O     . PRO C 3 81  ? 164.039 152.888 175.945 1.00 139.99 ? 80  PRO C O     1 
ATOM   2055  C CB    . PRO C 3 81  ? 161.896 150.955 177.364 1.00 139.99 ? 80  PRO C CB    1 
ATOM   2056  C CG    . PRO C 3 81  ? 161.655 149.697 178.024 1.00 139.99 ? 80  PRO C CG    1 
ATOM   2057  C CD    . PRO C 3 81  ? 162.757 149.501 179.025 1.00 139.99 ? 80  PRO C CD    1 
ATOM   2058  N N     . ARG C 3 82  ? 164.079 153.202 178.180 1.00 136.32 ? 81  ARG C N     1 
ATOM   2059  C CA    . ARG C 3 82  ? 164.554 154.573 178.056 1.00 136.32 ? 81  ARG C CA    1 
ATOM   2060  C C     . ARG C 3 82  ? 165.954 154.612 177.467 1.00 136.32 ? 81  ARG C C     1 
ATOM   2061  O O     . ARG C 3 82  ? 166.252 155.462 176.620 1.00 136.32 ? 81  ARG C O     1 
ATOM   2062  C CB    . ARG C 3 82  ? 164.511 155.260 179.416 1.00 136.32 ? 81  ARG C CB    1 
ATOM   2063  C CG    . ARG C 3 82  ? 165.222 156.593 179.482 1.00 136.32 ? 81  ARG C CG    1 
ATOM   2064  C CD    . ARG C 3 82  ? 164.571 157.615 178.572 1.00 136.32 ? 81  ARG C CD    1 
ATOM   2065  N NE    . ARG C 3 82  ? 164.944 158.980 178.917 1.00 136.32 ? 81  ARG C NE    1 
ATOM   2066  C CZ    . ARG C 3 82  ? 164.388 160.058 178.381 1.00 136.32 ? 81  ARG C CZ    1 
ATOM   2067  N NH1   . ARG C 3 82  ? 163.438 159.931 177.467 1.00 136.32 ? 81  ARG C NH1   1 
ATOM   2068  N NH2   . ARG C 3 82  ? 164.785 161.263 178.756 1.00 136.32 ? 81  ARG C NH2   1 
ATOM   2069  N N     . HIS C 3 83  ? 166.807 153.670 177.860 1.00 140.26 ? 82  HIS C N     1 
ATOM   2070  C CA    . HIS C 3 83  ? 168.148 153.624 177.301 1.00 140.26 ? 82  HIS C CA    1 
ATOM   2071  C C     . HIS C 3 83  ? 168.132 153.233 175.839 1.00 140.26 ? 82  HIS C C     1 
ATOM   2072  O O     . HIS C 3 83  ? 168.950 153.732 175.061 1.00 140.26 ? 82  HIS C O     1 
ATOM   2073  C CB    . HIS C 3 83  ? 169.004 152.661 178.096 1.00 140.26 ? 82  HIS C CB    1 
ATOM   2074  C CG    . HIS C 3 83  ? 169.165 153.061 179.519 1.00 140.26 ? 82  HIS C CG    1 
ATOM   2075  N ND1   . HIS C 3 83  ? 168.978 152.186 180.563 1.00 140.26 ? 82  HIS C ND1   1 
ATOM   2076  C CD2   . HIS C 3 83  ? 169.469 154.255 180.074 1.00 140.26 ? 82  HIS C CD2   1 
ATOM   2077  C CE1   . HIS C 3 83  ? 169.178 152.821 181.703 1.00 140.26 ? 82  HIS C CE1   1 
ATOM   2078  N NE2   . HIS C 3 83  ? 169.478 154.077 181.434 1.00 140.26 ? 82  HIS C NE2   1 
ATOM   2079  N N     . LEU C 3 84  ? 167.177 152.404 175.434 1.00 138.14 ? 83  LEU C N     1 
ATOM   2080  C CA    . LEU C 3 84  ? 167.067 152.063 174.024 1.00 138.14 ? 83  LEU C CA    1 
ATOM   2081  C C     . LEU C 3 84  ? 166.586 153.252 173.211 1.00 138.14 ? 83  LEU C C     1 
ATOM   2082  O O     . LEU C 3 84  ? 167.076 153.482 172.100 1.00 138.14 ? 83  LEU C O     1 
ATOM   2083  C CB    . LEU C 3 84  ? 166.135 150.875 173.846 1.00 138.14 ? 83  LEU C CB    1 
ATOM   2084  C CG    . LEU C 3 84  ? 166.831 149.568 174.189 1.00 138.14 ? 83  LEU C CG    1 
ATOM   2085  C CD1   . LEU C 3 84  ? 165.844 148.436 174.292 1.00 138.14 ? 83  LEU C CD1   1 
ATOM   2086  C CD2   . LEU C 3 84  ? 167.852 149.280 173.134 1.00 138.14 ? 83  LEU C CD2   1 
ATOM   2087  N N     . GLN C 3 85  ? 165.657 154.036 173.765 1.00 138.96 ? 84  GLN C N     1 
ATOM   2088  C CA    . GLN C 3 85  ? 165.175 155.227 173.072 1.00 138.96 ? 84  GLN C CA    1 
ATOM   2089  C C     . GLN C 3 85  ? 166.275 156.263 172.907 1.00 138.96 ? 84  GLN C C     1 
ATOM   2090  O O     . GLN C 3 85  ? 166.448 156.823 171.820 1.00 138.96 ? 84  GLN C O     1 
ATOM   2091  C CB    . GLN C 3 85  ? 164.004 155.833 173.831 1.00 138.96 ? 84  GLN C CB    1 
ATOM   2092  C CG    . GLN C 3 85  ? 163.531 157.128 173.255 1.00 138.96 ? 84  GLN C CG    1 
ATOM   2093  C CD    . GLN C 3 85  ? 162.351 156.943 172.349 1.00 138.96 ? 84  GLN C CD    1 
ATOM   2094  O OE1   . GLN C 3 85  ? 161.321 156.421 172.759 1.00 138.96 ? 84  GLN C OE1   1 
ATOM   2095  N NE2   . GLN C 3 85  ? 162.489 157.372 171.105 1.00 138.96 ? 84  GLN C NE2   1 
ATOM   2096  N N     . LEU C 3 86  ? 167.042 156.516 173.971 1.00 143.58 ? 85  LEU C N     1 
ATOM   2097  C CA    . LEU C 3 86  ? 168.125 157.491 173.877 1.00 143.58 ? 85  LEU C CA    1 
ATOM   2098  C C     . LEU C 3 86  ? 169.247 156.998 172.980 1.00 143.58 ? 85  LEU C C     1 
ATOM   2099  O O     . LEU C 3 86  ? 169.887 157.804 172.296 1.00 143.58 ? 85  LEU C O     1 
ATOM   2100  C CB    . LEU C 3 86  ? 168.686 157.820 175.255 1.00 143.58 ? 85  LEU C CB    1 
ATOM   2101  C CG    . LEU C 3 86  ? 167.753 158.350 176.337 1.00 143.58 ? 85  LEU C CG    1 
ATOM   2102  C CD1   . LEU C 3 86  ? 168.563 159.005 177.432 1.00 143.58 ? 85  LEU C CD1   1 
ATOM   2103  C CD2   . LEU C 3 86  ? 166.727 159.314 175.782 1.00 143.58 ? 85  LEU C CD2   1 
ATOM   2104  N N     . ALA C 3 87  ? 169.474 155.686 172.940 1.00 147.96 ? 86  ALA C N     1 
ATOM   2105  C CA    . ALA C 3 87  ? 170.488 155.139 172.051 1.00 147.96 ? 86  ALA C CA    1 
ATOM   2106  C C     . ALA C 3 87  ? 170.074 155.265 170.595 1.00 147.96 ? 86  ALA C C     1 
ATOM   2107  O O     . ALA C 3 87  ? 170.896 155.595 169.736 1.00 147.96 ? 86  ALA C O     1 
ATOM   2108  C CB    . ALA C 3 87  ? 170.748 153.681 172.401 1.00 147.96 ? 86  ALA C CB    1 
ATOM   2109  N N     . VAL C 3 88  ? 168.802 155.007 170.290 1.00 145.95 ? 87  VAL C N     1 
ATOM   2110  C CA    . VAL C 3 88  ? 168.406 155.053 168.887 1.00 145.95 ? 87  VAL C CA    1 
ATOM   2111  C C     . VAL C 3 88  ? 168.175 156.478 168.409 1.00 145.95 ? 87  VAL C C     1 
ATOM   2112  O O     . VAL C 3 88  ? 168.394 156.768 167.228 1.00 145.95 ? 87  VAL C O     1 
ATOM   2113  C CB    . VAL C 3 88  ? 167.171 154.160 168.648 1.00 145.95 ? 87  VAL C CB    1 
ATOM   2114  C CG1   . VAL C 3 88  ? 165.925 154.709 169.317 1.00 145.95 ? 87  VAL C CG1   1 
ATOM   2115  C CG2   . VAL C 3 88  ? 166.945 153.903 167.166 1.00 145.95 ? 87  VAL C CG2   1 
ATOM   2116  N N     . ARG C 3 89  ? 167.818 157.403 169.296 1.00 144.63 ? 88  ARG C N     1 
ATOM   2117  C CA    . ARG C 3 89  ? 167.608 158.769 168.854 1.00 144.63 ? 88  ARG C CA    1 
ATOM   2118  C C     . ARG C 3 89  ? 168.868 159.608 168.909 1.00 144.63 ? 88  ARG C C     1 
ATOM   2119  O O     . ARG C 3 89  ? 168.954 160.603 168.187 1.00 144.63 ? 88  ARG C O     1 
ATOM   2120  C CB    . ARG C 3 89  ? 166.520 159.440 169.686 1.00 144.63 ? 88  ARG C CB    1 
ATOM   2121  C CG    . ARG C 3 89  ? 165.162 158.804 169.550 1.00 144.63 ? 88  ARG C CG    1 
ATOM   2122  C CD    . ARG C 3 89  ? 164.606 158.942 168.156 1.00 144.63 ? 88  ARG C CD    1 
ATOM   2123  N NE    . ARG C 3 89  ? 163.204 158.545 168.115 1.00 144.63 ? 88  ARG C NE    1 
ATOM   2124  C CZ    . ARG C 3 89  ? 162.782 157.341 167.753 1.00 144.63 ? 88  ARG C CZ    1 
ATOM   2125  N NH1   . ARG C 3 89  ? 163.656 156.417 167.398 1.00 144.63 ? 88  ARG C NH1   1 
ATOM   2126  N NH2   . ARG C 3 89  ? 161.488 157.063 167.752 1.00 144.63 ? 88  ARG C NH2   1 
ATOM   2127  N N     . ASN C 3 90  ? 169.851 159.240 169.722 1.00 153.31 ? 89  ASN C N     1 
ATOM   2128  C CA    . ASN C 3 90  ? 171.125 159.953 169.699 1.00 153.31 ? 89  ASN C CA    1 
ATOM   2129  C C     . ASN C 3 90  ? 172.115 159.291 168.751 1.00 153.31 ? 89  ASN C C     1 
ATOM   2130  O O     . ASN C 3 90  ? 173.274 159.056 169.085 1.00 153.31 ? 89  ASN C O     1 
ATOM   2131  C CB    . ASN C 3 90  ? 171.693 160.042 171.106 1.00 153.31 ? 89  ASN C CB    1 
ATOM   2132  C CG    . ASN C 3 90  ? 170.963 161.046 171.958 1.00 153.31 ? 89  ASN C CG    1 
ATOM   2133  O OD1   . ASN C 3 90  ? 170.502 162.070 171.464 1.00 153.31 ? 89  ASN C OD1   1 
ATOM   2134  N ND2   . ASN C 3 90  ? 170.854 160.761 173.247 1.00 153.31 ? 89  ASN C ND2   1 
ATOM   2135  N N     . ASP C 3 91  ? 171.644 159.004 167.542 1.00 163.19 ? 90  ASP C N     1 
ATOM   2136  C CA    . ASP C 3 91  ? 172.479 158.543 166.442 1.00 163.19 ? 90  ASP C CA    1 
ATOM   2137  C C     . ASP C 3 91  ? 171.693 158.806 165.175 1.00 163.19 ? 90  ASP C C     1 
ATOM   2138  O O     . ASP C 3 91  ? 170.480 158.597 165.156 1.00 163.19 ? 90  ASP C O     1 
ATOM   2139  C CB    . ASP C 3 91  ? 172.824 157.059 166.552 1.00 163.19 ? 90  ASP C CB    1 
ATOM   2140  C CG    . ASP C 3 91  ? 173.582 156.556 165.347 1.00 163.19 ? 90  ASP C CG    1 
ATOM   2141  O OD1   . ASP C 3 91  ? 174.820 156.690 165.328 1.00 163.19 ? 90  ASP C OD1   1 
ATOM   2142  O OD2   . ASP C 3 91  ? 172.940 156.039 164.410 1.00 163.19 ? 90  ASP C OD2   1 
ATOM   2143  N N     . GLU C 3 92  ? 172.374 159.256 164.128 1.00 173.58 ? 91  GLU C N     1 
ATOM   2144  C CA    . GLU C 3 92  ? 171.643 159.758 162.974 1.00 173.58 ? 91  GLU C CA    1 
ATOM   2145  C C     . GLU C 3 92  ? 171.085 158.631 162.117 1.00 173.58 ? 91  GLU C C     1 
ATOM   2146  O O     . GLU C 3 92  ? 169.891 158.625 161.796 1.00 173.58 ? 91  GLU C O     1 
ATOM   2147  C CB    . GLU C 3 92  ? 172.537 160.672 162.143 1.00 173.58 ? 91  GLU C CB    1 
ATOM   2148  C CG    . GLU C 3 92  ? 171.760 161.515 161.158 1.00 173.58 ? 91  GLU C CG    1 
ATOM   2149  C CD    . GLU C 3 92  ? 170.466 162.043 161.744 1.00 173.58 ? 91  GLU C CD    1 
ATOM   2150  O OE1   . GLU C 3 92  ? 170.522 162.840 162.705 1.00 173.58 ? 91  GLU C OE1   1 
ATOM   2151  O OE2   . GLU C 3 92  ? 169.390 161.656 161.248 1.00 173.58 ? 91  GLU C OE2   1 
ATOM   2152  N N     . GLU C 3 93  ? 171.930 157.670 161.738 1.00 170.76 ? 92  GLU C N     1 
ATOM   2153  C CA    . GLU C 3 93  ? 171.498 156.631 160.812 1.00 170.76 ? 92  GLU C CA    1 
ATOM   2154  C C     . GLU C 3 93  ? 170.510 155.675 161.455 1.00 170.76 ? 92  GLU C C     1 
ATOM   2155  O O     . GLU C 3 93  ? 169.619 155.160 160.775 1.00 170.76 ? 92  GLU C O     1 
ATOM   2156  C CB    . GLU C 3 93  ? 172.702 155.865 160.288 1.00 170.76 ? 92  GLU C CB    1 
ATOM   2157  C CG    . GLU C 3 93  ? 173.830 156.758 159.841 1.00 170.76 ? 92  GLU C CG    1 
ATOM   2158  C CD    . GLU C 3 93  ? 174.916 156.863 160.882 1.00 170.76 ? 92  GLU C CD    1 
ATOM   2159  O OE1   . GLU C 3 93  ? 174.577 156.989 162.076 1.00 170.76 ? 92  GLU C OE1   1 
ATOM   2160  O OE2   . GLU C 3 93  ? 176.106 156.812 160.508 1.00 170.76 ? 92  GLU C OE2   1 
ATOM   2161  N N     . LEU C 3 94  ? 170.636 155.439 162.757 1.00 159.07 ? 93  LEU C N     1 
ATOM   2162  C CA    . LEU C 3 94  ? 169.631 154.648 163.445 1.00 159.07 ? 93  LEU C CA    1 
ATOM   2163  C C     . LEU C 3 94  ? 168.331 155.405 163.606 1.00 159.07 ? 93  LEU C C     1 
ATOM   2164  O O     . LEU C 3 94  ? 167.269 154.779 163.652 1.00 159.07 ? 93  LEU C O     1 
ATOM   2165  C CB    . LEU C 3 94  ? 170.151 154.211 164.803 1.00 159.07 ? 93  LEU C CB    1 
ATOM   2166  C CG    . LEU C 3 94  ? 171.191 153.124 164.612 1.00 159.07 ? 93  LEU C CG    1 
ATOM   2167  C CD1   . LEU C 3 94  ? 172.063 153.009 165.828 1.00 159.07 ? 93  LEU C CD1   1 
ATOM   2168  C CD2   . LEU C 3 94  ? 170.485 151.825 164.322 1.00 159.07 ? 93  LEU C CD2   1 
ATOM   2169  N N     . ASN C 3 95  ? 168.390 156.730 163.696 1.00 161.58 ? 94  ASN C N     1 
ATOM   2170  C CA    . ASN C 3 95  ? 167.158 157.501 163.709 1.00 161.58 ? 94  ASN C CA    1 
ATOM   2171  C C     . ASN C 3 95  ? 166.480 157.455 162.353 1.00 161.58 ? 94  ASN C C     1 
ATOM   2172  O O     . ASN C 3 95  ? 165.251 157.402 162.272 1.00 161.58 ? 94  ASN C O     1 
ATOM   2173  C CB    . ASN C 3 95  ? 167.432 158.943 164.107 1.00 161.58 ? 94  ASN C CB    1 
ATOM   2174  C CG    . ASN C 3 95  ? 166.166 159.730 164.310 1.00 161.58 ? 94  ASN C CG    1 
ATOM   2175  O OD1   . ASN C 3 95  ? 165.126 159.172 164.649 1.00 161.58 ? 94  ASN C OD1   1 
ATOM   2176  N ND2   . ASN C 3 95  ? 166.242 161.034 164.104 1.00 161.58 ? 94  ASN C ND2   1 
ATOM   2177  N N     . LYS C 3 96  ? 167.263 157.467 161.277 1.00 161.09 ? 95  LYS C N     1 
ATOM   2178  C CA    . LYS C 3 96  ? 166.667 157.386 159.951 1.00 161.09 ? 95  LYS C CA    1 
ATOM   2179  C C     . LYS C 3 96  ? 166.172 155.986 159.640 1.00 161.09 ? 95  LYS C C     1 
ATOM   2180  O O     . LYS C 3 96  ? 165.220 155.827 158.871 1.00 161.09 ? 95  LYS C O     1 
ATOM   2181  C CB    . LYS C 3 96  ? 167.667 157.839 158.892 1.00 161.09 ? 95  LYS C CB    1 
ATOM   2182  C CG    . LYS C 3 96  ? 167.381 159.223 158.352 1.00 161.09 ? 95  LYS C CG    1 
ATOM   2183  C CD    . LYS C 3 96  ? 168.523 159.723 157.496 1.00 161.09 ? 95  LYS C CD    1 
ATOM   2184  C CE    . LYS C 3 96  ? 169.757 159.986 158.337 1.00 161.09 ? 95  LYS C CE    1 
ATOM   2185  N NZ    . LYS C 3 96  ? 170.881 160.515 157.523 1.00 161.09 ? 95  LYS C NZ    1 
ATOM   2186  N N     . LEU C 3 97  ? 166.797 154.966 160.224 1.00 154.43 ? 96  LEU C N     1 
ATOM   2187  C CA    . LEU C 3 97  ? 166.285 153.612 160.075 1.00 154.43 ? 96  LEU C CA    1 
ATOM   2188  C C     . LEU C 3 97  ? 165.002 153.427 160.867 1.00 154.43 ? 96  LEU C C     1 
ATOM   2189  O O     . LEU C 3 97  ? 164.126 152.655 160.465 1.00 154.43 ? 96  LEU C O     1 
ATOM   2190  C CB    . LEU C 3 97  ? 167.348 152.610 160.515 1.00 154.43 ? 96  LEU C CB    1 
ATOM   2191  C CG    . LEU C 3 97  ? 167.019 151.123 160.471 1.00 154.43 ? 96  LEU C CG    1 
ATOM   2192  C CD1   . LEU C 3 97  ? 166.535 150.743 159.100 1.00 154.43 ? 96  LEU C CD1   1 
ATOM   2193  C CD2   . LEU C 3 97  ? 168.236 150.319 160.841 1.00 154.43 ? 96  LEU C CD2   1 
ATOM   2194  N N     . LEU C 3 98  ? 164.858 154.147 161.969 1.00 152.44 ? 97  LEU C N     1 
ATOM   2195  C CA    . LEU C 3 98  ? 163.683 154.058 162.823 1.00 152.44 ? 97  LEU C CA    1 
ATOM   2196  C C     . LEU C 3 98  ? 162.942 155.387 162.880 1.00 152.44 ? 97  LEU C C     1 
ATOM   2197  O O     . LEU C 3 98  ? 162.547 155.852 163.948 1.00 152.44 ? 97  LEU C O     1 
ATOM   2198  C CB    . LEU C 3 98  ? 164.061 153.594 164.223 1.00 152.44 ? 97  LEU C CB    1 
ATOM   2199  C CG    . LEU C 3 98  ? 164.175 152.087 164.455 1.00 152.44 ? 97  LEU C CG    1 
ATOM   2200  C CD1   . LEU C 3 98  ? 165.429 151.477 163.862 1.00 152.44 ? 97  LEU C CD1   1 
ATOM   2201  C CD2   . LEU C 3 98  ? 164.104 151.803 165.934 1.00 152.44 ? 97  LEU C CD2   1 
ATOM   2202  N N     . GLY C 3 99  ? 162.755 156.015 161.726 1.00 161.60 ? 98  GLY C N     1 
ATOM   2203  C CA    . GLY C 3 99  ? 162.047 157.275 161.665 1.00 161.60 ? 98  GLY C CA    1 
ATOM   2204  C C     . GLY C 3 99  ? 160.563 157.183 161.899 1.00 161.60 ? 98  GLY C C     1 
ATOM   2205  O O     . GLY C 3 99  ? 159.923 158.210 162.139 1.00 161.60 ? 98  GLY C O     1 
ATOM   2206  N N     . ARG C 3 100 ? 159.994 155.986 161.836 1.00 156.21 ? 99  ARG C N     1 
ATOM   2207  C CA    . ARG C 3 100 ? 158.591 155.783 162.135 1.00 156.21 ? 99  ARG C CA    1 
ATOM   2208  C C     . ARG C 3 100 ? 158.360 155.036 163.428 1.00 156.21 ? 99  ARG C C     1 
ATOM   2209  O O     . ARG C 3 100 ? 157.265 155.133 163.987 1.00 156.21 ? 99  ARG C O     1 
ATOM   2210  C CB    . ARG C 3 100 ? 157.911 155.006 161.001 1.00 156.21 ? 99  ARG C CB    1 
ATOM   2211  C CG    . ARG C 3 100 ? 157.907 155.739 159.685 1.00 156.21 ? 99  ARG C CG    1 
ATOM   2212  C CD    . ARG C 3 100 ? 156.985 156.931 159.756 1.00 156.21 ? 99  ARG C CD    1 
ATOM   2213  N NE    . ARG C 3 100 ? 156.586 157.388 158.432 1.00 156.21 ? 99  ARG C NE    1 
ATOM   2214  C CZ    . ARG C 3 100 ? 155.511 158.129 158.200 1.00 156.21 ? 99  ARG C CZ    1 
ATOM   2215  N NH1   . ARG C 3 100 ? 154.727 158.492 159.206 1.00 156.21 ? 99  ARG C NH1   1 
ATOM   2216  N NH2   . ARG C 3 100 ? 155.217 158.506 156.965 1.00 156.21 ? 99  ARG C NH2   1 
ATOM   2217  N N     . VAL C 3 101 ? 159.359 154.314 163.923 1.00 146.78 ? 100 VAL C N     1 
ATOM   2218  C CA    . VAL C 3 101 ? 159.164 153.380 165.021 1.00 146.78 ? 100 VAL C CA    1 
ATOM   2219  C C     . VAL C 3 101 ? 159.032 154.139 166.331 1.00 146.78 ? 100 VAL C C     1 
ATOM   2220  O O     . VAL C 3 101 ? 159.952 154.847 166.753 1.00 146.78 ? 100 VAL C O     1 
ATOM   2221  C CB    . VAL C 3 101 ? 160.326 152.390 165.095 1.00 146.78 ? 100 VAL C CB    1 
ATOM   2222  C CG1   . VAL C 3 101 ? 160.164 151.529 166.300 1.00 146.78 ? 100 VAL C CG1   1 
ATOM   2223  C CG2   . VAL C 3 101 ? 160.391 151.565 163.841 1.00 146.78 ? 100 VAL C CG2   1 
ATOM   2224  N N     . THR C 3 102 ? 157.891 153.993 166.983 1.00 143.07 ? 101 THR C N     1 
ATOM   2225  C CA    . THR C 3 102 ? 157.805 154.305 168.396 1.00 143.07 ? 101 THR C CA    1 
ATOM   2226  C C     . THR C 3 102 ? 158.134 153.055 169.186 1.00 143.07 ? 101 THR C C     1 
ATOM   2227  O O     . THR C 3 102 ? 157.868 151.939 168.741 1.00 143.07 ? 101 THR C O     1 
ATOM   2228  C CB    . THR C 3 102 ? 156.420 154.810 168.788 1.00 143.07 ? 101 THR C CB    1 
ATOM   2229  O OG1   . THR C 3 102 ? 156.317 154.819 170.216 1.00 143.07 ? 101 THR C OG1   1 
ATOM   2230  C CG2   . THR C 3 102 ? 155.334 153.936 168.216 1.00 143.07 ? 101 THR C CG2   1 
ATOM   2231  N N     . ILE C 3 103 ? 158.744 153.239 170.346 1.00 142.01 ? 102 ILE C N     1 
ATOM   2232  C CA    . ILE C 3 103 ? 158.991 152.139 171.261 1.00 142.01 ? 102 ILE C CA    1 
ATOM   2233  C C     . ILE C 3 103 ? 158.200 152.404 172.529 1.00 142.01 ? 102 ILE C C     1 
ATOM   2234  O O     . ILE C 3 103 ? 157.875 153.554 172.841 1.00 142.01 ? 102 ILE C O     1 
ATOM   2235  C CB    . ILE C 3 103 ? 160.490 151.950 171.554 1.00 142.01 ? 102 ILE C CB    1 
ATOM   2236  C CG1   . ILE C 3 103 ? 161.021 153.033 172.471 1.00 142.01 ? 102 ILE C CG1   1 
ATOM   2237  C CG2   . ILE C 3 103 ? 161.295 151.981 170.273 1.00 142.01 ? 102 ILE C CG2   1 
ATOM   2238  C CD1   . ILE C 3 103 ? 162.348 152.669 173.036 1.00 142.01 ? 102 ILE C CD1   1 
ATOM   2239  N N     . ALA C 3 104 ? 157.844 151.341 173.227 1.00 146.90 ? 103 ALA C N     1 
ATOM   2240  C CA    . ALA C 3 104 ? 157.034 151.489 174.420 1.00 146.90 ? 103 ALA C CA    1 
ATOM   2241  C C     . ALA C 3 104 ? 157.902 151.927 175.584 1.00 146.90 ? 103 ALA C C     1 
ATOM   2242  O O     . ALA C 3 104 ? 159.067 151.537 175.684 1.00 146.90 ? 103 ALA C O     1 
ATOM   2243  C CB    . ALA C 3 104 ? 156.335 150.179 174.759 1.00 146.90 ? 103 ALA C CB    1 
ATOM   2244  N N     . GLN C 3 105 ? 157.320 152.765 176.452 1.00 150.84 ? 104 GLN C N     1 
ATOM   2245  C CA    . GLN C 3 105 ? 157.957 153.289 177.667 1.00 150.84 ? 104 GLN C CA    1 
ATOM   2246  C C     . GLN C 3 105 ? 159.261 154.019 177.375 1.00 150.84 ? 104 GLN C C     1 
ATOM   2247  O O     . GLN C 3 105 ? 160.165 154.050 178.208 1.00 150.84 ? 104 GLN C O     1 
ATOM   2248  C CB    . GLN C 3 105 ? 158.198 152.183 178.696 1.00 150.84 ? 104 GLN C CB    1 
ATOM   2249  C CG    . GLN C 3 105 ? 156.940 151.643 179.301 1.00 150.84 ? 104 GLN C CG    1 
ATOM   2250  C CD    . GLN C 3 105 ? 156.317 152.617 180.262 1.00 150.84 ? 104 GLN C CD    1 
ATOM   2251  O OE1   . GLN C 3 105 ? 155.097 152.755 180.323 1.00 150.84 ? 104 GLN C OE1   1 
ATOM   2252  N NE2   . GLN C 3 105 ? 157.153 153.306 181.024 1.00 150.84 ? 104 GLN C NE2   1 
ATOM   2253  N N     . GLY C 3 106 ? 159.374 154.618 176.200 1.00 149.73 ? 105 GLY C N     1 
ATOM   2254  C CA    . GLY C 3 106 ? 160.656 155.107 175.754 1.00 149.73 ? 105 GLY C CA    1 
ATOM   2255  C C     . GLY C 3 106 ? 160.971 156.514 176.195 1.00 149.73 ? 105 GLY C C     1 
ATOM   2256  O O     . GLY C 3 106 ? 162.131 156.840 176.445 1.00 149.73 ? 105 GLY C O     1 
ATOM   2257  N N     . GLY C 3 107 ? 159.963 157.357 176.287 1.00 146.27 ? 106 GLY C N     1 
ATOM   2258  C CA    . GLY C 3 107 ? 160.205 158.753 176.568 1.00 146.27 ? 106 GLY C CA    1 
ATOM   2259  C C     . GLY C 3 107 ? 160.686 159.492 175.340 1.00 146.27 ? 106 GLY C C     1 
ATOM   2260  O O     . GLY C 3 107 ? 160.756 158.958 174.230 1.00 146.27 ? 106 GLY C O     1 
ATOM   2261  N N     . VAL C 3 108 ? 161.019 160.763 175.550 1.00 139.72 ? 107 VAL C N     1 
ATOM   2262  C CA    . VAL C 3 108 ? 161.488 161.633 174.483 1.00 139.72 ? 107 VAL C CA    1 
ATOM   2263  C C     . VAL C 3 108 ? 162.915 162.041 174.821 1.00 139.72 ? 107 VAL C C     1 
ATOM   2264  O O     . VAL C 3 108 ? 163.332 162.010 175.980 1.00 139.72 ? 107 VAL C O     1 
ATOM   2265  C CB    . VAL C 3 108 ? 160.577 162.871 174.313 1.00 139.72 ? 107 VAL C CB    1 
ATOM   2266  C CG1   . VAL C 3 108 ? 160.758 163.534 172.953 1.00 139.72 ? 107 VAL C CG1   1 
ATOM   2267  C CG2   . VAL C 3 108 ? 159.138 162.493 174.504 1.00 139.72 ? 107 VAL C CG2   1 
ATOM   2268  N N     . LEU C 3 109 ? 163.682 162.363 173.786 1.00 145.52 ? 108 LEU C N     1 
ATOM   2269  C CA    . LEU C 3 109 ? 164.941 163.055 173.981 1.00 145.52 ? 108 LEU C CA    1 
ATOM   2270  C C     . LEU C 3 109 ? 164.689 164.408 174.638 1.00 145.52 ? 108 LEU C C     1 
ATOM   2271  O O     . LEU C 3 109 ? 163.733 165.101 174.281 1.00 145.52 ? 108 LEU C O     1 
ATOM   2272  C CB    . LEU C 3 109 ? 165.639 163.267 172.648 1.00 145.52 ? 108 LEU C CB    1 
ATOM   2273  C CG    . LEU C 3 109 ? 166.656 162.242 172.177 1.00 145.52 ? 108 LEU C CG    1 
ATOM   2274  C CD1   . LEU C 3 109 ? 167.340 162.795 170.955 1.00 145.52 ? 108 LEU C CD1   1 
ATOM   2275  C CD2   . LEU C 3 109 ? 167.660 161.955 173.258 1.00 145.52 ? 108 LEU C CD2   1 
ATOM   2276  N N     . PRO C 3 110 ? 165.518 164.811 175.602 1.00 146.73 ? 109 PRO C N     1 
ATOM   2277  C CA    . PRO C 3 110 ? 165.321 166.113 176.253 1.00 146.73 ? 109 PRO C CA    1 
ATOM   2278  C C     . PRO C 3 110 ? 165.758 167.230 175.320 1.00 146.73 ? 109 PRO C C     1 
ATOM   2279  O O     . PRO C 3 110 ? 166.926 167.308 174.936 1.00 146.73 ? 109 PRO C O     1 
ATOM   2280  C CB    . PRO C 3 110 ? 166.219 166.030 177.494 1.00 146.73 ? 109 PRO C CB    1 
ATOM   2281  C CG    . PRO C 3 110 ? 166.699 164.609 177.557 1.00 146.73 ? 109 PRO C CG    1 
ATOM   2282  C CD    . PRO C 3 110 ? 166.661 164.091 176.171 1.00 146.73 ? 109 PRO C CD    1 
ATOM   2283  N N     . ASN C 3 111 ? 164.813 168.095 174.946 1.00 151.62 ? 110 ASN C N     1 
ATOM   2284  C CA    . ASN C 3 111 ? 165.119 169.171 174.007 1.00 151.62 ? 110 ASN C CA    1 
ATOM   2285  C C     . ASN C 3 111 ? 164.123 170.309 174.225 1.00 151.62 ? 110 ASN C C     1 
ATOM   2286  O O     . ASN C 3 111 ? 162.994 170.242 173.736 1.00 151.62 ? 110 ASN C O     1 
ATOM   2287  C CB    . ASN C 3 111 ? 165.072 168.667 172.576 1.00 151.62 ? 110 ASN C CB    1 
ATOM   2288  C CG    . ASN C 3 111 ? 165.468 169.724 171.575 1.00 151.62 ? 110 ASN C CG    1 
ATOM   2289  O OD1   . ASN C 3 111 ? 166.168 170.680 171.906 1.00 151.62 ? 110 ASN C OD1   1 
ATOM   2290  N ND2   . ASN C 3 111 ? 165.022 169.559 170.337 1.00 151.62 ? 110 ASN C ND2   1 
ATOM   2291  N N     . ILE C 3 112 ? 164.554 171.342 174.931 1.00 153.54 ? 111 ILE C N     1 
ATOM   2292  C CA    . ILE C 3 112 ? 163.785 172.576 175.004 1.00 153.54 ? 111 ILE C CA    1 
ATOM   2293  C C     . ILE C 3 112 ? 164.198 173.458 173.839 1.00 153.54 ? 111 ILE C C     1 
ATOM   2294  O O     . ILE C 3 112 ? 165.374 173.495 173.463 1.00 153.54 ? 111 ILE C O     1 
ATOM   2295  C CB    . ILE C 3 112 ? 164.015 173.292 176.345 1.00 153.54 ? 111 ILE C CB    1 
ATOM   2296  C CG1   . ILE C 3 112 ? 164.060 172.290 177.491 1.00 153.54 ? 111 ILE C CG1   1 
ATOM   2297  C CG2   . ILE C 3 112 ? 162.908 174.288 176.609 1.00 153.54 ? 111 ILE C CG2   1 
ATOM   2298  C CD1   . ILE C 3 112 ? 164.480 172.899 178.810 1.00 153.54 ? 111 ILE C CD1   1 
ATOM   2299  N N     . GLN C 3 113 ? 163.235 174.156 173.247 1.00 162.62 ? 112 GLN C N     1 
ATOM   2300  C CA    . GLN C 3 113 ? 163.561 175.087 172.179 1.00 162.62 ? 112 GLN C CA    1 
ATOM   2301  C C     . GLN C 3 113 ? 164.274 176.307 172.743 1.00 162.62 ? 112 GLN C C     1 
ATOM   2302  O O     . GLN C 3 113 ? 164.023 176.733 173.873 1.00 162.62 ? 112 GLN C O     1 
ATOM   2303  C CB    . GLN C 3 113 ? 162.303 175.517 171.435 1.00 162.62 ? 112 GLN C CB    1 
ATOM   2304  C CG    . GLN C 3 113 ? 161.676 174.418 170.620 1.00 162.62 ? 112 GLN C CG    1 
ATOM   2305  C CD    . GLN C 3 113 ? 162.450 174.128 169.362 1.00 162.62 ? 112 GLN C CD    1 
ATOM   2306  O OE1   . GLN C 3 113 ? 163.192 174.973 168.870 1.00 162.62 ? 112 GLN C OE1   1 
ATOM   2307  N NE2   . GLN C 3 113 ? 162.279 172.927 168.828 1.00 162.62 ? 112 GLN C NE2   1 
ATOM   2308  N N     . SER C 3 114 ? 165.182 176.864 171.941 1.00 170.54 ? 113 SER C N     1 
ATOM   2309  C CA    . SER C 3 114 ? 166.012 177.970 172.398 1.00 170.54 ? 113 SER C CA    1 
ATOM   2310  C C     . SER C 3 114 ? 165.219 179.251 172.602 1.00 170.54 ? 113 SER C C     1 
ATOM   2311  O O     . SER C 3 114 ? 165.624 180.091 173.409 1.00 170.54 ? 113 SER C O     1 
ATOM   2312  C CB    . SER C 3 114 ? 167.134 178.224 171.399 1.00 170.54 ? 113 SER C CB    1 
ATOM   2313  O OG    . SER C 3 114 ? 166.606 178.722 170.185 1.00 170.54 ? 113 SER C OG    1 
ATOM   2314  N N     . VAL C 3 115 ? 164.105 179.415 171.894 1.00 161.06 ? 114 VAL C N     1 
ATOM   2315  C CA    . VAL C 3 115 ? 163.302 180.620 172.048 1.00 161.06 ? 114 VAL C CA    1 
ATOM   2316  C C     . VAL C 3 115 ? 162.576 180.605 173.385 1.00 161.06 ? 114 VAL C C     1 
ATOM   2317  O O     . VAL C 3 115 ? 162.484 181.629 174.071 1.00 161.06 ? 114 VAL C O     1 
ATOM   2318  C CB    . VAL C 3 115 ? 162.330 180.745 170.863 1.00 161.06 ? 114 VAL C CB    1 
ATOM   2319  C CG1   . VAL C 3 115 ? 161.405 181.942 171.027 1.00 161.06 ? 114 VAL C CG1   1 
ATOM   2320  C CG2   . VAL C 3 115 ? 163.106 180.833 169.562 1.00 161.06 ? 114 VAL C CG2   1 
ATOM   2321  N N     . LEU C 3 116 ? 162.108 179.434 173.811 1.00 162.03 ? 115 LEU C N     1 
ATOM   2322  C CA    . LEU C 3 116 ? 161.329 179.339 175.037 1.00 162.03 ? 115 LEU C CA    1 
ATOM   2323  C C     . LEU C 3 116 ? 162.171 179.458 176.298 1.00 162.03 ? 115 LEU C C     1 
ATOM   2324  O O     . LEU C 3 116 ? 161.601 179.442 177.394 1.00 162.03 ? 115 LEU C O     1 
ATOM   2325  C CB    . LEU C 3 116 ? 160.558 178.024 175.064 1.00 162.03 ? 115 LEU C CB    1 
ATOM   2326  C CG    . LEU C 3 116 ? 159.689 177.740 173.845 1.00 162.03 ? 115 LEU C CG    1 
ATOM   2327  C CD1   . LEU C 3 116 ? 159.445 176.261 173.716 1.00 162.03 ? 115 LEU C CD1   1 
ATOM   2328  C CD2   . LEU C 3 116 ? 158.383 178.471 173.968 1.00 162.03 ? 115 LEU C CD2   1 
ATOM   2329  N N     . LEU C 3 117 ? 163.493 179.543 176.178 1.00 172.43 ? 116 LEU C N     1 
ATOM   2330  C CA    . LEU C 3 117 ? 164.336 179.866 177.316 1.00 172.43 ? 116 LEU C CA    1 
ATOM   2331  C C     . LEU C 3 117 ? 163.993 181.267 177.820 1.00 172.43 ? 116 LEU C C     1 
ATOM   2332  O O     . LEU C 3 117 ? 163.594 182.128 177.031 1.00 172.43 ? 116 LEU C O     1 
ATOM   2333  C CB    . LEU C 3 117 ? 165.804 179.778 176.910 1.00 172.43 ? 116 LEU C CB    1 
ATOM   2334  C CG    . LEU C 3 117 ? 166.197 178.372 176.474 1.00 172.43 ? 116 LEU C CG    1 
ATOM   2335  C CD1   . LEU C 3 117 ? 167.598 178.354 175.912 1.00 172.43 ? 116 LEU C CD1   1 
ATOM   2336  C CD2   . LEU C 3 117 ? 166.088 177.437 177.653 1.00 172.43 ? 116 LEU C CD2   1 
ATOM   2337  N N     . PRO C 3 118 ? 164.096 181.515 179.127 1.00 186.06 ? 117 PRO C N     1 
ATOM   2338  C CA    . PRO C 3 118 ? 163.581 182.773 179.674 1.00 186.06 ? 117 PRO C CA    1 
ATOM   2339  C C     . PRO C 3 118 ? 164.428 183.967 179.271 1.00 186.06 ? 117 PRO C C     1 
ATOM   2340  O O     . PRO C 3 118 ? 165.651 183.880 179.136 1.00 186.06 ? 117 PRO C O     1 
ATOM   2341  C CB    . PRO C 3 118 ? 163.629 182.547 181.186 1.00 186.06 ? 117 PRO C CB    1 
ATOM   2342  C CG    . PRO C 3 118 ? 164.726 181.584 181.366 1.00 186.06 ? 117 PRO C CG    1 
ATOM   2343  C CD    . PRO C 3 118 ? 164.643 180.657 180.192 1.00 186.06 ? 117 PRO C CD    1 
ATOM   2344  N N     . LYS C 3 119 ? 163.745 185.087 179.061 1.00 197.69 ? 118 LYS C N     1 
ATOM   2345  C CA    . LYS C 3 119 ? 164.383 186.299 178.578 1.00 197.69 ? 118 LYS C CA    1 
ATOM   2346  C C     . LYS C 3 119 ? 165.243 186.917 179.672 1.00 197.69 ? 118 LYS C C     1 
ATOM   2347  O O     . LYS C 3 119 ? 165.025 186.692 180.867 1.00 197.69 ? 118 LYS C O     1 
ATOM   2348  C CB    . LYS C 3 119 ? 163.332 187.297 178.096 1.00 197.69 ? 118 LYS C CB    1 
ATOM   2349  C CG    . LYS C 3 119 ? 162.842 187.036 176.678 1.00 197.69 ? 118 LYS C CG    1 
ATOM   2350  C CD    . LYS C 3 119 ? 161.649 186.087 176.649 1.00 197.69 ? 118 LYS C CD    1 
ATOM   2351  C CE    . LYS C 3 119 ? 161.399 185.557 175.250 1.00 197.69 ? 118 LYS C CE    1 
ATOM   2352  N NZ    . LYS C 3 119 ? 160.329 184.529 175.229 1.00 197.69 ? 118 LYS C NZ    1 
ATOM   2353  N N     . LYS C 3 120 ? 166.202 187.739 179.237 1.00 210.91 ? 119 LYS C N     1 
ATOM   2354  C CA    . LYS C 3 120 ? 167.365 188.158 180.025 1.00 210.91 ? 119 LYS C CA    1 
ATOM   2355  C C     . LYS C 3 120 ? 168.045 186.940 180.650 1.00 210.91 ? 119 LYS C C     1 
ATOM   2356  O O     . LYS C 3 120 ? 168.137 186.795 181.869 1.00 210.91 ? 119 LYS C O     1 
ATOM   2357  C CB    . LYS C 3 120 ? 167.002 189.195 181.096 1.00 210.91 ? 119 LYS C CB    1 
ATOM   2358  C CG    . LYS C 3 120 ? 165.933 190.201 180.703 1.00 210.91 ? 119 LYS C CG    1 
ATOM   2359  C CD    . LYS C 3 120 ? 165.588 191.109 181.876 1.00 210.91 ? 119 LYS C CD    1 
ATOM   2360  C CE    . LYS C 3 120 ? 165.180 190.305 183.105 1.00 210.91 ? 119 LYS C CE    1 
ATOM   2361  N NZ    . LYS C 3 120 ? 165.163 191.137 184.340 1.00 210.91 ? 119 LYS C NZ    1 
ATOM   2362  N N     . THR C 3 121 ? 168.505 186.047 179.773 1.00 207.96 ? 120 THR C N     1 
ATOM   2363  C CA    . THR C 3 121 ? 169.070 184.782 180.230 1.00 207.96 ? 120 THR C CA    1 
ATOM   2364  C C     . THR C 3 121 ? 170.439 184.987 180.867 1.00 207.96 ? 120 THR C C     1 
ATOM   2365  O O     . THR C 3 121 ? 170.746 184.366 181.894 1.00 207.96 ? 120 THR C O     1 
ATOM   2366  C CB    . THR C 3 121 ? 169.149 183.803 179.060 1.00 207.96 ? 120 THR C CB    1 
ATOM   2367  O OG1   . THR C 3 121 ? 167.876 183.747 178.405 1.00 207.96 ? 120 THR C OG1   1 
ATOM   2368  C CG2   . THR C 3 121 ? 169.510 182.408 179.545 1.00 207.96 ? 120 THR C CG2   1 
ATOM   2369  N N     . GLU C 3 122 ? 171.255 185.868 180.282 0.00 208.99 ? 121 GLU C N     1 
ATOM   2370  C CA    . GLU C 3 122 ? 172.583 186.272 180.775 0.00 208.99 ? 121 GLU C CA    1 
ATOM   2371  C C     . GLU C 3 122 ? 173.543 185.105 181.011 0.00 208.99 ? 121 GLU C C     1 
ATOM   2372  O O     . GLU C 3 122 ? 173.685 184.628 182.136 0.00 208.99 ? 121 GLU C O     1 
ATOM   2373  C CB    . GLU C 3 122 ? 172.452 187.097 182.063 0.00 208.99 ? 121 GLU C CB    1 
ATOM   2374  C CG    . GLU C 3 122 ? 171.432 188.221 181.981 0.00 208.99 ? 121 GLU C CG    1 
ATOM   2375  C CD    . GLU C 3 122 ? 171.655 189.128 180.787 0.00 208.99 ? 121 GLU C CD    1 
ATOM   2376  O OE1   . GLU C 3 122 ? 172.768 189.679 180.654 0.00 208.99 ? 121 GLU C OE1   1 
ATOM   2377  O OE2   . GLU C 3 122 ? 170.717 189.289 179.978 0.00 208.99 ? 121 GLU C OE2   1 
ATOM   2378  N N     . LYS D 4 1   ? 151.510 118.270 183.352 1.00 217.30 ? 24  LYS D N     1 
ATOM   2379  C CA    . LYS D 4 1   ? 151.534 119.651 183.817 1.00 217.30 ? 24  LYS D CA    1 
ATOM   2380  C C     . LYS D 4 1   ? 150.340 120.427 183.272 1.00 217.30 ? 24  LYS D C     1 
ATOM   2381  O O     . LYS D 4 1   ? 149.190 120.113 183.576 1.00 217.30 ? 24  LYS D O     1 
ATOM   2382  C CB    . LYS D 4 1   ? 152.843 120.333 183.406 1.00 217.30 ? 24  LYS D CB    1 
ATOM   2383  C CG    . LYS D 4 1   ? 153.857 120.485 184.533 1.00 217.30 ? 24  LYS D CG    1 
ATOM   2384  C CD    . LYS D 4 1   ? 153.438 121.560 185.525 1.00 217.30 ? 24  LYS D CD    1 
ATOM   2385  C CE    . LYS D 4 1   ? 154.579 121.922 186.464 1.00 217.30 ? 24  LYS D CE    1 
ATOM   2386  N NZ    . LYS D 4 1   ? 154.264 123.121 187.290 1.00 217.30 ? 24  LYS D NZ    1 
ATOM   2387  N N     . LYS D 4 2   ? 150.627 121.437 182.454 1.00 218.56 ? 25  LYS D N     1 
ATOM   2388  C CA    . LYS D 4 2   ? 149.595 122.279 181.865 1.00 218.56 ? 25  LYS D CA    1 
ATOM   2389  C C     . LYS D 4 2   ? 149.731 122.234 180.353 1.00 218.56 ? 25  LYS D C     1 
ATOM   2390  O O     . LYS D 4 2   ? 149.796 123.278 179.694 1.00 218.56 ? 25  LYS D O     1 
ATOM   2391  C CB    . LYS D 4 2   ? 149.697 123.717 182.376 1.00 218.56 ? 25  LYS D CB    1 
ATOM   2392  C CG    . LYS D 4 2   ? 149.724 123.847 183.894 1.00 218.56 ? 25  LYS D CG    1 
ATOM   2393  C CD    . LYS D 4 2   ? 149.525 125.285 184.347 1.00 218.56 ? 25  LYS D CD    1 
ATOM   2394  C CE    . LYS D 4 2   ? 150.440 126.250 183.606 1.00 218.56 ? 25  LYS D CE    1 
ATOM   2395  N NZ    . LYS D 4 2   ? 151.879 125.906 183.781 1.00 218.56 ? 25  LYS D NZ    1 
ATOM   2396  N N     . ARG D 4 3   ? 149.840 121.011 179.821 1.00 217.75 ? 26  ARG D N     1 
ATOM   2397  C CA    . ARG D 4 3   ? 150.034 120.686 178.408 1.00 217.75 ? 26  ARG D CA    1 
ATOM   2398  C C     . ARG D 4 3   ? 151.333 121.239 177.833 1.00 217.75 ? 26  ARG D C     1 
ATOM   2399  O O     . ARG D 4 3   ? 151.473 121.287 176.604 1.00 217.75 ? 26  ARG D O     1 
ATOM   2400  C CB    . ARG D 4 3   ? 148.846 121.134 177.542 1.00 217.75 ? 26  ARG D CB    1 
ATOM   2401  C CG    . ARG D 4 3   ? 147.500 120.625 178.027 1.00 217.75 ? 26  ARG D CG    1 
ATOM   2402  C CD    . ARG D 4 3   ? 146.427 120.738 176.948 1.00 217.75 ? 26  ARG D CD    1 
ATOM   2403  N NE    . ARG D 4 3   ? 145.984 122.116 176.737 1.00 217.75 ? 26  ARG D NE    1 
ATOM   2404  C CZ    . ARG D 4 3   ? 144.989 122.467 175.926 1.00 217.75 ? 26  ARG D CZ    1 
ATOM   2405  N NH1   . ARG D 4 3   ? 144.329 121.543 175.243 1.00 217.75 ? 26  ARG D NH1   1 
ATOM   2406  N NH2   . ARG D 4 3   ? 144.657 123.744 175.793 1.00 217.75 ? 26  ARG D NH2   1 
ATOM   2407  N N     . ARG D 4 4   ? 152.286 121.624 178.699 1.00 209.66 ? 27  ARG D N     1 
ATOM   2408  C CA    . ARG D 4 4   ? 153.631 122.089 178.338 1.00 209.66 ? 27  ARG D CA    1 
ATOM   2409  C C     . ARG D 4 4   ? 153.563 123.264 177.359 1.00 209.66 ? 27  ARG D C     1 
ATOM   2410  O O     . ARG D 4 4   ? 153.835 123.110 176.165 1.00 209.66 ? 27  ARG D O     1 
ATOM   2411  C CB    . ARG D 4 4   ? 154.491 120.949 177.777 1.00 209.66 ? 27  ARG D CB    1 
ATOM   2412  C CG    . ARG D 4 4   ? 154.988 119.969 178.824 1.00 209.66 ? 27  ARG D CG    1 
ATOM   2413  C CD    . ARG D 4 4   ? 155.680 120.675 179.977 1.00 209.66 ? 27  ARG D CD    1 
ATOM   2414  N NE    . ARG D 4 4   ? 156.855 121.423 179.548 1.00 209.66 ? 27  ARG D NE    1 
ATOM   2415  C CZ    . ARG D 4 4   ? 157.767 121.914 180.379 1.00 209.66 ? 27  ARG D CZ    1 
ATOM   2416  N NH1   . ARG D 4 4   ? 157.638 121.733 181.685 1.00 209.66 ? 27  ARG D NH1   1 
ATOM   2417  N NH2   . ARG D 4 4   ? 158.809 122.583 179.908 1.00 209.66 ? 27  ARG D NH2   1 
ATOM   2418  N N     . LYS D 4 5   ? 153.103 124.400 177.915 1.00 199.43 ? 28  LYS D N     1 
ATOM   2419  C CA    . LYS D 4 5   ? 152.733 125.642 177.221 1.00 199.43 ? 28  LYS D CA    1 
ATOM   2420  C C     . LYS D 4 5   ? 153.651 125.986 176.054 1.00 199.43 ? 28  LYS D C     1 
ATOM   2421  O O     . LYS D 4 5   ? 154.876 125.983 176.193 1.00 199.43 ? 28  LYS D O     1 
ATOM   2422  C CB    . LYS D 4 5   ? 152.729 126.786 178.235 1.00 199.43 ? 28  LYS D CB    1 
ATOM   2423  C CG    . LYS D 4 5   ? 152.510 128.155 177.639 1.00 199.43 ? 28  LYS D CG    1 
ATOM   2424  C CD    . LYS D 4 5   ? 152.083 129.140 178.703 1.00 199.43 ? 28  LYS D CD    1 
ATOM   2425  C CE    . LYS D 4 5   ? 153.073 129.184 179.850 1.00 199.43 ? 28  LYS D CE    1 
ATOM   2426  N NZ    . LYS D 4 5   ? 152.626 130.124 180.910 1.00 199.43 ? 28  LYS D NZ    1 
ATOM   2427  N N     . THR D 4 6   ? 153.025 126.271 174.908 1.00 187.86 ? 29  THR D N     1 
ATOM   2428  C CA    . THR D 4 6   ? 153.585 126.067 173.577 1.00 187.86 ? 29  THR D CA    1 
ATOM   2429  C C     . THR D 4 6   ? 154.862 126.867 173.342 1.00 187.86 ? 29  THR D C     1 
ATOM   2430  O O     . THR D 4 6   ? 155.093 127.920 173.937 1.00 187.86 ? 29  THR D O     1 
ATOM   2431  C CB    . THR D 4 6   ? 152.556 126.429 172.510 1.00 187.86 ? 29  THR D CB    1 
ATOM   2432  O OG1   . THR D 4 6   ? 153.161 126.339 171.216 1.00 187.86 ? 29  THR D OG1   1 
ATOM   2433  C CG2   . THR D 4 6   ? 152.030 127.837 172.728 1.00 187.86 ? 29  THR D CG2   1 
ATOM   2434  N N     . ARG D 4 7   ? 155.693 126.340 172.444 1.00 189.85 ? 30  ARG D N     1 
ATOM   2435  C CA    . ARG D 4 7   ? 157.052 126.828 172.229 1.00 189.85 ? 30  ARG D CA    1 
ATOM   2436  C C     . ARG D 4 7   ? 156.999 128.165 171.502 1.00 189.85 ? 30  ARG D C     1 
ATOM   2437  O O     . ARG D 4 7   ? 157.113 128.256 170.279 1.00 189.85 ? 30  ARG D O     1 
ATOM   2438  C CB    . ARG D 4 7   ? 157.865 125.816 171.435 1.00 189.85 ? 30  ARG D CB    1 
ATOM   2439  C CG    . ARG D 4 7   ? 158.034 124.483 172.114 1.00 189.85 ? 30  ARG D CG    1 
ATOM   2440  C CD    . ARG D 4 7   ? 159.236 124.489 173.029 1.00 189.85 ? 30  ARG D CD    1 
ATOM   2441  N NE    . ARG D 4 7   ? 159.884 123.183 173.065 1.00 189.85 ? 30  ARG D NE    1 
ATOM   2442  C CZ    . ARG D 4 7   ? 160.628 122.743 174.073 1.00 189.85 ? 30  ARG D CZ    1 
ATOM   2443  N NH1   . ARG D 4 7   ? 160.817 123.504 175.142 1.00 189.85 ? 30  ARG D NH1   1 
ATOM   2444  N NH2   . ARG D 4 7   ? 161.180 121.538 174.015 1.00 189.85 ? 30  ARG D NH2   1 
ATOM   2445  N N     . LYS D 4 8   ? 156.832 129.227 172.283 1.00 185.12 ? 31  LYS D N     1 
ATOM   2446  C CA    . LYS D 4 8   ? 156.874 130.584 171.749 1.00 185.12 ? 31  LYS D CA    1 
ATOM   2447  C C     . LYS D 4 8   ? 158.330 130.913 171.446 1.00 185.12 ? 31  LYS D C     1 
ATOM   2448  O O     . LYS D 4 8   ? 159.080 131.417 172.285 1.00 185.12 ? 31  LYS D O     1 
ATOM   2449  C CB    . LYS D 4 8   ? 156.267 131.568 172.737 1.00 185.12 ? 31  LYS D CB    1 
ATOM   2450  C CG    . LYS D 4 8   ? 156.167 132.979 172.212 1.00 185.12 ? 31  LYS D CG    1 
ATOM   2451  C CD    . LYS D 4 8   ? 155.100 133.091 171.150 1.00 185.12 ? 31  LYS D CD    1 
ATOM   2452  C CE    . LYS D 4 8   ? 155.145 134.456 170.500 1.00 185.12 ? 31  LYS D CE    1 
ATOM   2453  N NZ    . LYS D 4 8   ? 155.394 135.523 171.507 1.00 185.12 ? 31  LYS D NZ    1 
ATOM   2454  N N     . GLU D 4 9   ? 158.744 130.593 170.226 1.00 173.89 ? 32  GLU D N     1 
ATOM   2455  C CA    . GLU D 4 9   ? 160.134 130.787 169.849 1.00 173.89 ? 32  GLU D CA    1 
ATOM   2456  C C     . GLU D 4 9   ? 160.416 132.263 169.616 1.00 173.89 ? 32  GLU D C     1 
ATOM   2457  O O     . GLU D 4 9   ? 159.619 132.974 169.001 1.00 173.89 ? 32  GLU D O     1 
ATOM   2458  C CB    . GLU D 4 9   ? 160.465 129.977 168.600 1.00 173.89 ? 32  GLU D CB    1 
ATOM   2459  C CG    . GLU D 4 9   ? 160.736 128.510 168.884 1.00 173.89 ? 32  GLU D CG    1 
ATOM   2460  C CD    . GLU D 4 9   ? 161.416 127.797 167.734 1.00 173.89 ? 32  GLU D CD    1 
ATOM   2461  O OE1   . GLU D 4 9   ? 161.531 128.393 166.646 1.00 173.89 ? 32  GLU D OE1   1 
ATOM   2462  O OE2   . GLU D 4 9   ? 161.832 126.634 167.918 1.00 173.89 ? 32  GLU D OE2   1 
ATOM   2463  N N     . SER D 4 10  ? 161.554 132.724 170.121 1.00 160.60 ? 33  SER D N     1 
ATOM   2464  C CA    . SER D 4 10  ? 161.914 134.129 170.026 1.00 160.60 ? 33  SER D CA    1 
ATOM   2465  C C     . SER D 4 10  ? 163.428 134.241 170.005 1.00 160.60 ? 33  SER D C     1 
ATOM   2466  O O     . SER D 4 10  ? 164.146 133.240 169.993 1.00 160.60 ? 33  SER D O     1 
ATOM   2467  C CB    . SER D 4 10  ? 161.328 134.931 171.182 1.00 160.60 ? 33  SER D CB    1 
ATOM   2468  O OG    . SER D 4 10  ? 162.229 134.932 172.269 1.00 160.60 ? 33  SER D OG    1 
ATOM   2469  N N     . TYR D 4 11  ? 163.907 135.478 170.016 1.00 147.61 ? 34  TYR D N     1 
ATOM   2470  C CA    . TYR D 4 11  ? 165.322 135.788 169.851 1.00 147.61 ? 34  TYR D CA    1 
ATOM   2471  C C     . TYR D 4 11  ? 165.968 136.205 171.157 1.00 147.61 ? 34  TYR D C     1 
ATOM   2472  O O     . TYR D 4 11  ? 166.801 137.107 171.165 1.00 147.61 ? 34  TYR D O     1 
ATOM   2473  C CB    . TYR D 4 11  ? 165.500 136.889 168.818 1.00 147.61 ? 34  TYR D CB    1 
ATOM   2474  C CG    . TYR D 4 11  ? 165.150 136.516 167.404 1.00 147.61 ? 34  TYR D CG    1 
ATOM   2475  C CD1   . TYR D 4 11  ? 166.138 136.177 166.495 1.00 147.61 ? 34  TYR D CD1   1 
ATOM   2476  C CD2   . TYR D 4 11  ? 163.837 136.540 166.967 1.00 147.61 ? 34  TYR D CD2   1 
ATOM   2477  C CE1   . TYR D 4 11  ? 165.822 135.853 165.197 1.00 147.61 ? 34  TYR D CE1   1 
ATOM   2478  C CE2   . TYR D 4 11  ? 163.513 136.217 165.676 1.00 147.61 ? 34  TYR D CE2   1 
ATOM   2479  C CZ    . TYR D 4 11  ? 164.507 135.877 164.797 1.00 147.61 ? 34  TYR D CZ    1 
ATOM   2480  O OH    . TYR D 4 11  ? 164.177 135.557 163.509 1.00 147.61 ? 34  TYR D OH    1 
ATOM   2481  N N     . ALA D 4 12  ? 165.598 135.586 172.274 1.00 148.75 ? 35  ALA D N     1 
ATOM   2482  C CA    . ALA D 4 12  ? 166.070 136.059 173.570 1.00 148.75 ? 35  ALA D CA    1 
ATOM   2483  C C     . ALA D 4 12  ? 167.548 135.755 173.772 1.00 148.75 ? 35  ALA D C     1 
ATOM   2484  O O     . ALA D 4 12  ? 168.344 136.654 174.074 1.00 148.75 ? 35  ALA D O     1 
ATOM   2485  C CB    . ALA D 4 12  ? 165.238 135.431 174.686 1.00 148.75 ? 35  ALA D CB    1 
ATOM   2486  N N     . ILE D 4 13  ? 167.936 134.492 173.591 1.00 150.84 ? 36  ILE D N     1 
ATOM   2487  C CA    . ILE D 4 13  ? 169.275 134.073 173.970 1.00 150.84 ? 36  ILE D CA    1 
ATOM   2488  C C     . ILE D 4 13  ? 170.334 134.613 173.030 1.00 150.84 ? 36  ILE D C     1 
ATOM   2489  O O     . ILE D 4 13  ? 171.479 134.795 173.443 1.00 150.84 ? 36  ILE D O     1 
ATOM   2490  C CB    . ILE D 4 13  ? 169.351 132.544 174.048 1.00 150.84 ? 36  ILE D CB    1 
ATOM   2491  C CG1   . ILE D 4 13  ? 168.892 131.926 172.735 1.00 150.84 ? 36  ILE D CG1   1 
ATOM   2492  C CG2   . ILE D 4 13  ? 168.492 132.044 175.180 1.00 150.84 ? 36  ILE D CG2   1 
ATOM   2493  C CD1   . ILE D 4 13  ? 168.968 130.424 172.722 1.00 150.84 ? 36  ILE D CD1   1 
ATOM   2494  N N     . TYR D 4 14  ? 169.975 134.941 171.797 1.00 155.34 ? 37  TYR D N     1 
ATOM   2495  C CA    . TYR D 4 14  ? 170.966 135.482 170.880 1.00 155.34 ? 37  TYR D CA    1 
ATOM   2496  C C     . TYR D 4 14  ? 171.256 136.943 171.181 1.00 155.34 ? 37  TYR D C     1 
ATOM   2497  O O     . TYR D 4 14  ? 172.420 137.366 171.154 1.00 155.34 ? 37  TYR D O     1 
ATOM   2498  C CB    . TYR D 4 14  ? 170.478 135.283 169.455 1.00 155.34 ? 37  TYR D CB    1 
ATOM   2499  C CG    . TYR D 4 14  ? 169.989 133.875 169.264 1.00 155.34 ? 37  TYR D CG    1 
ATOM   2500  C CD1   . TYR D 4 14  ? 170.881 132.819 169.237 1.00 155.34 ? 37  TYR D CD1   1 
ATOM   2501  C CD2   . TYR D 4 14  ? 168.637 133.595 169.158 1.00 155.34 ? 37  TYR D CD2   1 
ATOM   2502  C CE1   . TYR D 4 14  ? 170.447 131.531 169.081 1.00 155.34 ? 37  TYR D CE1   1 
ATOM   2503  C CE2   . TYR D 4 14  ? 168.195 132.308 169.009 1.00 155.34 ? 37  TYR D CE2   1 
ATOM   2504  C CZ    . TYR D 4 14  ? 169.107 131.282 168.968 1.00 155.34 ? 37  TYR D CZ    1 
ATOM   2505  O OH    . TYR D 4 14  ? 168.682 129.989 168.816 1.00 155.34 ? 37  TYR D OH    1 
ATOM   2506  N N     . VAL D 4 15  ? 170.205 137.710 171.486 1.00 151.02 ? 38  VAL D N     1 
ATOM   2507  C CA    . VAL D 4 15  ? 170.356 139.057 172.029 1.00 151.02 ? 38  VAL D CA    1 
ATOM   2508  C C     . VAL D 4 15  ? 171.196 139.034 173.293 1.00 151.02 ? 38  VAL D C     1 
ATOM   2509  O O     . VAL D 4 15  ? 172.104 139.853 173.467 1.00 151.02 ? 38  VAL D O     1 
ATOM   2510  C CB    . VAL D 4 15  ? 168.970 139.673 172.280 1.00 151.02 ? 38  VAL D CB    1 
ATOM   2511  C CG1   . VAL D 4 15  ? 169.064 140.905 173.134 1.00 151.02 ? 38  VAL D CG1   1 
ATOM   2512  C CG2   . VAL D 4 15  ? 168.345 140.034 170.967 1.00 151.02 ? 38  VAL D CG2   1 
ATOM   2513  N N     . TYR D 4 16  ? 170.953 138.058 174.159 1.00 154.18 ? 39  TYR D N     1 
ATOM   2514  C CA    . TYR D 4 16  ? 171.679 138.007 175.416 1.00 154.18 ? 39  TYR D CA    1 
ATOM   2515  C C     . TYR D 4 16  ? 173.141 137.616 175.212 1.00 154.18 ? 39  TYR D C     1 
ATOM   2516  O O     . TYR D 4 16  ? 174.021 138.150 175.898 1.00 154.18 ? 39  TYR D O     1 
ATOM   2517  C CB    . TYR D 4 16  ? 170.966 137.046 176.352 1.00 154.18 ? 39  TYR D CB    1 
ATOM   2518  C CG    . TYR D 4 16  ? 171.456 137.079 177.761 1.00 154.18 ? 39  TYR D CG    1 
ATOM   2519  C CD1   . TYR D 4 16  ? 171.096 138.110 178.611 1.00 154.18 ? 39  TYR D CD1   1 
ATOM   2520  C CD2   . TYR D 4 16  ? 172.270 136.071 178.249 1.00 154.18 ? 39  TYR D CD2   1 
ATOM   2521  C CE1   . TYR D 4 16  ? 171.538 138.141 179.911 1.00 154.18 ? 39  TYR D CE1   1 
ATOM   2522  C CE2   . TYR D 4 16  ? 172.720 136.090 179.546 1.00 154.18 ? 39  TYR D CE2   1 
ATOM   2523  C CZ    . TYR D 4 16  ? 172.350 137.128 180.373 1.00 154.18 ? 39  TYR D CZ    1 
ATOM   2524  O OH    . TYR D 4 16  ? 172.796 137.145 181.673 1.00 154.18 ? 39  TYR D OH    1 
ATOM   2525  N N     . LYS D 4 17  ? 173.425 136.738 174.246 1.00 148.67 ? 40  LYS D N     1 
ATOM   2526  C CA    . LYS D 4 17  ? 174.808 136.391 173.933 1.00 148.67 ? 40  LYS D CA    1 
ATOM   2527  C C     . LYS D 4 17  ? 175.561 137.576 173.354 1.00 148.67 ? 40  LYS D C     1 
ATOM   2528  O O     . LYS D 4 17  ? 176.720 137.819 173.714 1.00 148.67 ? 40  LYS D O     1 
ATOM   2529  C CB    . LYS D 4 17  ? 174.857 135.235 172.947 1.00 148.67 ? 40  LYS D CB    1 
ATOM   2530  C CG    . LYS D 4 17  ? 174.642 133.877 173.554 1.00 148.67 ? 40  LYS D CG    1 
ATOM   2531  C CD    . LYS D 4 17  ? 174.565 132.834 172.460 1.00 148.67 ? 40  LYS D CD    1 
ATOM   2532  C CE    . LYS D 4 17  ? 174.081 131.508 172.991 1.00 148.67 ? 40  LYS D CE    1 
ATOM   2533  N NZ    . LYS D 4 17  ? 173.837 130.563 171.876 1.00 148.67 ? 40  LYS D NZ    1 
ATOM   2534  N N     . VAL D 4 18  ? 174.917 138.328 172.462 1.00 146.61 ? 41  VAL D N     1 
ATOM   2535  C CA    . VAL D 4 18  ? 175.565 139.500 171.883 1.00 146.61 ? 41  VAL D CA    1 
ATOM   2536  C C     . VAL D 4 18  ? 175.783 140.573 172.943 1.00 146.61 ? 41  VAL D C     1 
ATOM   2537  O O     . VAL D 4 18  ? 176.840 141.224 172.972 1.00 146.61 ? 41  VAL D O     1 
ATOM   2538  C CB    . VAL D 4 18  ? 174.730 139.990 170.690 1.00 146.61 ? 41  VAL D CB    1 
ATOM   2539  C CG1   . VAL D 4 18  ? 175.004 141.434 170.357 1.00 146.61 ? 41  VAL D CG1   1 
ATOM   2540  C CG2   . VAL D 4 18  ? 175.025 139.126 169.498 1.00 146.61 ? 41  VAL D CG2   1 
ATOM   2541  N N     . LEU D 4 19  ? 174.829 140.721 173.865 1.00 147.52 ? 42  LEU D N     1 
ATOM   2542  C CA    . LEU D 4 19  ? 174.974 141.665 174.965 1.00 147.52 ? 42  LEU D CA    1 
ATOM   2543  C C     . LEU D 4 19  ? 176.127 141.284 175.875 1.00 147.52 ? 42  LEU D C     1 
ATOM   2544  O O     . LEU D 4 19  ? 176.861 142.153 176.351 1.00 147.52 ? 42  LEU D O     1 
ATOM   2545  C CB    . LEU D 4 19  ? 173.682 141.732 175.764 1.00 147.52 ? 42  LEU D CB    1 
ATOM   2546  C CG    . LEU D 4 19  ? 173.655 142.835 176.805 1.00 147.52 ? 42  LEU D CG    1 
ATOM   2547  C CD1   . LEU D 4 19  ? 173.839 144.161 176.128 1.00 147.52 ? 42  LEU D CD1   1 
ATOM   2548  C CD2   . LEU D 4 19  ? 172.347 142.796 177.533 1.00 147.52 ? 42  LEU D CD2   1 
ATOM   2549  N N     . LYS D 4 20  ? 176.322 139.990 176.102 1.00 151.47 ? 43  LYS D N     1 
ATOM   2550  C CA    . LYS D 4 20  ? 177.504 139.578 176.839 1.00 151.47 ? 43  LYS D CA    1 
ATOM   2551  C C     . LYS D 4 20  ? 178.775 139.733 176.020 1.00 151.47 ? 43  LYS D C     1 
ATOM   2552  O O     . LYS D 4 20  ? 179.863 139.791 176.599 1.00 151.47 ? 43  LYS D O     1 
ATOM   2553  C CB    . LYS D 4 20  ? 177.354 138.138 177.315 1.00 151.47 ? 43  LYS D CB    1 
ATOM   2554  C CG    . LYS D 4 20  ? 176.278 137.957 178.372 1.00 151.47 ? 43  LYS D CG    1 
ATOM   2555  C CD    . LYS D 4 20  ? 176.403 138.996 179.467 1.00 151.47 ? 43  LYS D CD    1 
ATOM   2556  C CE    . LYS D 4 20  ? 175.571 138.629 180.670 1.00 151.47 ? 43  LYS D CE    1 
ATOM   2557  N NZ    . LYS D 4 20  ? 175.596 139.712 181.684 1.00 151.47 ? 43  LYS D NZ    1 
ATOM   2558  N N     . GLN D 4 21  ? 178.672 139.794 174.695 1.00 154.40 ? 44  GLN D N     1 
ATOM   2559  C CA    . GLN D 4 21  ? 179.874 140.059 173.912 1.00 154.40 ? 44  GLN D CA    1 
ATOM   2560  C C     . GLN D 4 21  ? 180.314 141.514 174.011 1.00 154.40 ? 44  GLN D C     1 
ATOM   2561  O O     . GLN D 4 21  ? 181.496 141.788 174.240 1.00 154.40 ? 44  GLN D O     1 
ATOM   2562  C CB    . GLN D 4 21  ? 179.677 139.680 172.448 1.00 154.40 ? 44  GLN D CB    1 
ATOM   2563  C CG    . GLN D 4 21  ? 179.880 138.219 172.162 1.00 154.40 ? 44  GLN D CG    1 
ATOM   2564  C CD    . GLN D 4 21  ? 179.972 137.945 170.682 1.00 154.40 ? 44  GLN D CD    1 
ATOM   2565  O OE1   . GLN D 4 21  ? 179.859 138.857 169.867 1.00 154.40 ? 44  GLN D OE1   1 
ATOM   2566  N NE2   . GLN D 4 21  ? 180.186 136.687 170.324 1.00 154.40 ? 44  GLN D NE2   1 
ATOM   2567  N N     . VAL D 4 22  ? 179.398 142.467 173.833 1.00 152.41 ? 45  VAL D N     1 
ATOM   2568  C CA    . VAL D 4 22  ? 179.830 143.866 173.761 1.00 152.41 ? 45  VAL D CA    1 
ATOM   2569  C C     . VAL D 4 22  ? 180.046 144.457 175.156 1.00 152.41 ? 45  VAL D C     1 
ATOM   2570  O O     . VAL D 4 22  ? 181.154 144.894 175.486 1.00 152.41 ? 45  VAL D O     1 
ATOM   2571  C CB    . VAL D 4 22  ? 178.873 144.707 172.889 1.00 152.41 ? 45  VAL D CB    1 
ATOM   2572  C CG1   . VAL D 4 22  ? 179.101 144.372 171.444 1.00 152.41 ? 45  VAL D CG1   1 
ATOM   2573  C CG2   . VAL D 4 22  ? 177.412 144.450 173.191 1.00 152.41 ? 45  VAL D CG2   1 
ATOM   2574  N N     . HIS D 4 23  ? 179.015 144.470 176.000 1.00 153.13 ? 46  HIS D N     1 
ATOM   2575  C CA    . HIS D 4 23  ? 179.108 144.979 177.364 1.00 153.13 ? 46  HIS D CA    1 
ATOM   2576  C C     . HIS D 4 23  ? 179.011 143.794 178.306 1.00 153.13 ? 46  HIS D C     1 
ATOM   2577  O O     . HIS D 4 23  ? 177.911 143.441 178.751 1.00 153.13 ? 46  HIS D O     1 
ATOM   2578  C CB    . HIS D 4 23  ? 177.997 145.987 177.651 1.00 153.13 ? 46  HIS D CB    1 
ATOM   2579  C CG    . HIS D 4 23  ? 178.245 147.341 177.071 1.00 153.13 ? 46  HIS D CG    1 
ATOM   2580  N ND1   . HIS D 4 23  ? 179.288 148.143 177.476 1.00 153.13 ? 46  HIS D ND1   1 
ATOM   2581  C CD2   . HIS D 4 23  ? 177.582 148.037 176.120 1.00 153.13 ? 46  HIS D CD2   1 
ATOM   2582  C CE1   . HIS D 4 23  ? 179.258 149.275 176.798 1.00 153.13 ? 46  HIS D CE1   1 
ATOM   2583  N NE2   . HIS D 4 23  ? 178.231 149.237 175.969 1.00 153.13 ? 46  HIS D NE2   1 
ATOM   2584  N N     . PRO D 4 24  ? 180.130 143.167 178.676 1.00 154.27 ? 47  PRO D N     1 
ATOM   2585  C CA    . PRO D 4 24  ? 180.068 141.849 179.324 1.00 154.27 ? 47  PRO D CA    1 
ATOM   2586  C C     . PRO D 4 24  ? 179.594 141.868 180.765 1.00 154.27 ? 47  PRO D C     1 
ATOM   2587  O O     . PRO D 4 24  ? 179.580 140.811 181.402 1.00 154.27 ? 47  PRO D O     1 
ATOM   2588  C CB    . PRO D 4 24  ? 181.522 141.353 179.241 1.00 154.27 ? 47  PRO D CB    1 
ATOM   2589  C CG    . PRO D 4 24  ? 182.242 142.337 178.359 1.00 154.27 ? 47  PRO D CG    1 
ATOM   2590  C CD    . PRO D 4 24  ? 181.513 143.618 178.501 1.00 154.27 ? 47  PRO D CD    1 
ATOM   2591  N N     . ASP D 4 25  ? 179.198 143.016 181.300 1.00 162.59 ? 48  ASP D N     1 
ATOM   2592  C CA    . ASP D 4 25  ? 178.762 143.140 182.680 1.00 162.59 ? 48  ASP D CA    1 
ATOM   2593  C C     . ASP D 4 25  ? 177.502 143.980 182.760 1.00 162.59 ? 48  ASP D C     1 
ATOM   2594  O O     . ASP D 4 25  ? 177.387 144.899 183.570 1.00 162.59 ? 48  ASP D O     1 
ATOM   2595  C CB    . ASP D 4 25  ? 179.873 143.741 183.527 1.00 162.59 ? 48  ASP D CB    1 
ATOM   2596  C CG    . ASP D 4 25  ? 179.749 143.381 184.984 1.00 162.59 ? 48  ASP D CG    1 
ATOM   2597  O OD1   . ASP D 4 25  ? 179.901 142.188 185.319 1.00 162.59 ? 48  ASP D OD1   1 
ATOM   2598  O OD2   . ASP D 4 25  ? 179.497 144.293 185.795 1.00 162.59 ? 48  ASP D OD2   1 
ATOM   2599  N N     . THR D 4 26  ? 176.530 143.682 181.905 1.00 159.22 ? 49  THR D N     1 
ATOM   2600  C CA    . THR D 4 26  ? 175.324 144.497 181.839 1.00 159.22 ? 49  THR D CA    1 
ATOM   2601  C C     . THR D 4 26  ? 174.138 143.615 181.504 1.00 159.22 ? 49  THR D C     1 
ATOM   2602  O O     . THR D 4 26  ? 174.100 143.008 180.433 1.00 159.22 ? 49  THR D O     1 
ATOM   2603  C CB    . THR D 4 26  ? 175.474 145.602 180.800 1.00 159.22 ? 49  THR D CB    1 
ATOM   2604  O OG1   . THR D 4 26  ? 176.469 146.531 181.237 1.00 159.22 ? 49  THR D OG1   1 
ATOM   2605  C CG2   . THR D 4 26  ? 174.171 146.334 180.614 1.00 159.22 ? 49  THR D CG2   1 
ATOM   2606  N N     . GLY D 4 27  ? 173.171 143.561 182.406 1.00 160.29 ? 50  GLY D N     1 
ATOM   2607  C CA    . GLY D 4 27  ? 171.946 142.828 182.175 1.00 160.29 ? 50  GLY D CA    1 
ATOM   2608  C C     . GLY D 4 27  ? 170.982 143.625 181.325 1.00 160.29 ? 50  GLY D C     1 
ATOM   2609  O O     . GLY D 4 27  ? 171.336 144.633 180.712 1.00 160.29 ? 50  GLY D O     1 
ATOM   2610  N N     . ILE D 4 28  ? 169.735 143.173 181.306 1.00 148.48 ? 51  ILE D N     1 
ATOM   2611  C CA    . ILE D 4 28  ? 168.724 143.775 180.452 1.00 148.48 ? 51  ILE D CA    1 
ATOM   2612  C C     . ILE D 4 28  ? 167.358 143.444 181.026 1.00 148.48 ? 51  ILE D C     1 
ATOM   2613  O O     . ILE D 4 28  ? 167.098 142.310 181.427 1.00 148.48 ? 51  ILE D O     1 
ATOM   2614  C CB    . ILE D 4 28  ? 168.897 143.298 178.989 1.00 148.48 ? 51  ILE D CB    1 
ATOM   2615  C CG1   . ILE D 4 28  ? 167.816 143.859 178.077 1.00 148.48 ? 51  ILE D CG1   1 
ATOM   2616  C CG2   . ILE D 4 28  ? 169.009 141.801 178.905 1.00 148.48 ? 51  ILE D CG2   1 
ATOM   2617  C CD1   . ILE D 4 28  ? 168.098 143.613 176.622 1.00 148.48 ? 51  ILE D CD1   1 
ATOM   2618  N N     . SER D 4 29  ? 166.500 144.454 181.107 1.00 145.06 ? 52  SER D N     1 
ATOM   2619  C CA    . SER D 4 29  ? 165.146 144.220 181.571 1.00 145.06 ? 52  SER D CA    1 
ATOM   2620  C C     . SER D 4 29  ? 164.371 143.432 180.528 1.00 145.06 ? 52  SER D C     1 
ATOM   2621  O O     . SER D 4 29  ? 164.726 143.403 179.351 1.00 145.06 ? 52  SER D O     1 
ATOM   2622  C CB    . SER D 4 29  ? 164.434 145.534 181.849 1.00 145.06 ? 52  SER D CB    1 
ATOM   2623  O OG    . SER D 4 29  ? 163.773 145.974 180.681 1.00 145.06 ? 52  SER D OG    1 
ATOM   2624  N N     . SER D 4 30  ? 163.296 142.784 180.973 1.00 145.47 ? 53  SER D N     1 
ATOM   2625  C CA    . SER D 4 30  ? 162.547 141.919 180.070 1.00 145.47 ? 53  SER D CA    1 
ATOM   2626  C C     . SER D 4 30  ? 161.763 142.699 179.032 1.00 145.47 ? 53  SER D C     1 
ATOM   2627  O O     . SER D 4 30  ? 161.609 142.223 177.902 1.00 145.47 ? 53  SER D O     1 
ATOM   2628  C CB    . SER D 4 30  ? 161.588 141.027 180.845 1.00 145.47 ? 53  SER D CB    1 
ATOM   2629  O OG    . SER D 4 30  ? 160.815 140.253 179.949 1.00 145.47 ? 53  SER D OG    1 
ATOM   2630  N N     . LYS D 4 31  ? 161.261 143.882 179.387 1.00 145.18 ? 54  LYS D N     1 
ATOM   2631  C CA    . LYS D 4 31  ? 160.582 144.699 178.394 1.00 145.18 ? 54  LYS D CA    1 
ATOM   2632  C C     . LYS D 4 31  ? 161.550 145.196 177.333 1.00 145.18 ? 54  LYS D C     1 
ATOM   2633  O O     . LYS D 4 31  ? 161.189 145.278 176.155 1.00 145.18 ? 54  LYS D O     1 
ATOM   2634  C CB    . LYS D 4 31  ? 159.878 145.871 179.059 1.00 145.18 ? 54  LYS D CB    1 
ATOM   2635  C CG    . LYS D 4 31  ? 158.872 146.527 178.152 1.00 145.18 ? 54  LYS D CG    1 
ATOM   2636  C CD    . LYS D 4 31  ? 158.086 147.600 178.865 1.00 145.18 ? 54  LYS D CD    1 
ATOM   2637  C CE    . LYS D 4 31  ? 157.008 148.159 177.958 1.00 145.18 ? 54  LYS D CE    1 
ATOM   2638  N NZ    . LYS D 4 31  ? 156.090 147.093 177.483 1.00 145.18 ? 54  LYS D NZ    1 
ATOM   2639  N N     . ALA D 4 32  ? 162.794 145.478 177.715 1.00 146.86 ? 55  ALA D N     1 
ATOM   2640  C CA    . ALA D 4 32  ? 163.797 145.822 176.718 1.00 146.86 ? 55  ALA D CA    1 
ATOM   2641  C C     . ALA D 4 32  ? 164.146 144.629 175.849 1.00 146.86 ? 55  ALA D C     1 
ATOM   2642  O O     . ALA D 4 32  ? 164.456 144.798 174.665 1.00 146.86 ? 55  ALA D O     1 
ATOM   2643  C CB    . ALA D 4 32  ? 165.051 146.361 177.392 1.00 146.86 ? 55  ALA D CB    1 
ATOM   2644  N N     . MET D 4 33  ? 164.085 143.422 176.406 1.00 146.55 ? 56  MET D N     1 
ATOM   2645  C CA    . MET D 4 33  ? 164.311 142.237 175.594 1.00 146.55 ? 56  MET D CA    1 
ATOM   2646  C C     . MET D 4 33  ? 163.186 142.044 174.596 1.00 146.55 ? 56  MET D C     1 
ATOM   2647  O O     . MET D 4 33  ? 163.430 141.656 173.449 1.00 146.55 ? 56  MET D O     1 
ATOM   2648  C CB    . MET D 4 33  ? 164.449 141.007 176.474 1.00 146.55 ? 56  MET D CB    1 
ATOM   2649  C CG    . MET D 4 33  ? 164.945 139.812 175.713 1.00 146.55 ? 56  MET D CG    1 
ATOM   2650  S SD    . MET D 4 33  ? 166.732 139.678 175.754 1.00 146.55 ? 56  MET D SD    1 
ATOM   2651  C CE    . MET D 4 33  ? 166.966 139.027 177.404 1.00 146.55 ? 56  MET D CE    1 
ATOM   2652  N N     . SER D 4 34  ? 161.953 142.333 175.007 1.00 145.29 ? 57  SER D N     1 
ATOM   2653  C CA    . SER D 4 34  ? 160.837 142.295 174.071 1.00 145.29 ? 57  SER D CA    1 
ATOM   2654  C C     . SER D 4 34  ? 160.969 143.366 172.999 1.00 145.29 ? 57  SER D C     1 
ATOM   2655  O O     . SER D 4 34  ? 160.586 143.133 171.846 1.00 145.29 ? 57  SER D O     1 
ATOM   2656  C CB    . SER D 4 34  ? 159.519 142.460 174.817 1.00 145.29 ? 57  SER D CB    1 
ATOM   2657  O OG    . SER D 4 34  ? 158.516 142.936 173.942 1.00 145.29 ? 57  SER D OG    1 
ATOM   2658  N N     . ILE D 4 35  ? 161.534 144.521 173.355 1.00 144.79 ? 58  ILE D N     1 
ATOM   2659  C CA    . ILE D 4 35  ? 161.788 145.568 172.372 1.00 144.79 ? 58  ILE D CA    1 
ATOM   2660  C C     . ILE D 4 35  ? 162.801 145.100 171.341 1.00 144.79 ? 58  ILE D C     1 
ATOM   2661  O O     . ILE D 4 35  ? 162.576 145.231 170.134 1.00 144.79 ? 58  ILE D O     1 
ATOM   2662  C CB    . ILE D 4 35  ? 162.258 146.854 173.069 1.00 144.79 ? 58  ILE D CB    1 
ATOM   2663  C CG1   . ILE D 4 35  ? 161.088 147.534 173.762 1.00 144.79 ? 58  ILE D CG1   1 
ATOM   2664  C CG2   . ILE D 4 35  ? 162.887 147.806 172.072 1.00 144.79 ? 58  ILE D CG2   1 
ATOM   2665  C CD1   . ILE D 4 35  ? 161.418 148.868 174.356 1.00 144.79 ? 58  ILE D CD1   1 
ATOM   2666  N N     . MET D 4 36  ? 163.912 144.521 171.795 1.00 144.88 ? 59  MET D N     1 
ATOM   2667  C CA    . MET D 4 36  ? 164.936 144.056 170.865 1.00 144.88 ? 59  MET D CA    1 
ATOM   2668  C C     . MET D 4 36  ? 164.440 142.897 170.013 1.00 144.88 ? 59  MET D C     1 
ATOM   2669  O O     . MET D 4 36  ? 164.801 142.788 168.837 1.00 144.88 ? 59  MET D O     1 
ATOM   2670  C CB    . MET D 4 36  ? 166.188 143.639 171.622 1.00 144.88 ? 59  MET D CB    1 
ATOM   2671  C CG    . MET D 4 36  ? 166.959 144.792 172.168 1.00 144.88 ? 59  MET D CG    1 
ATOM   2672  S SD    . MET D 4 36  ? 167.390 145.906 170.844 1.00 144.88 ? 59  MET D SD    1 
ATOM   2673  C CE    . MET D 4 36  ? 168.416 144.837 169.853 1.00 144.88 ? 59  MET D CE    1 
ATOM   2674  N N     . ASN D 4 37  ? 163.587 142.043 170.576 1.00 145.55 ? 60  ASN D N     1 
ATOM   2675  C CA    . ASN D 4 37  ? 163.052 140.928 169.811 1.00 145.55 ? 60  ASN D CA    1 
ATOM   2676  C C     . ASN D 4 37  ? 162.087 141.405 168.736 1.00 145.55 ? 60  ASN D C     1 
ATOM   2677  O O     . ASN D 4 37  ? 162.152 140.940 167.590 1.00 145.55 ? 60  ASN D O     1 
ATOM   2678  C CB    . ASN D 4 37  ? 162.366 139.945 170.746 1.00 145.55 ? 60  ASN D CB    1 
ATOM   2679  C CG    . ASN D 4 37  ? 161.666 138.849 170.007 1.00 145.55 ? 60  ASN D CG    1 
ATOM   2680  O OD1   . ASN D 4 37  ? 162.195 138.301 169.048 1.00 145.55 ? 60  ASN D OD1   1 
ATOM   2681  N ND2   . ASN D 4 37  ? 160.462 138.521 170.444 1.00 145.55 ? 60  ASN D ND2   1 
ATOM   2682  N N     . SER D 4 38  ? 161.200 142.346 169.079 1.00 144.96 ? 61  SER D N     1 
ATOM   2683  C CA    . SER D 4 38  ? 160.320 142.932 168.076 1.00 144.96 ? 61  SER D CA    1 
ATOM   2684  C C     . SER D 4 38  ? 161.110 143.691 167.030 1.00 144.96 ? 61  SER D C     1 
ATOM   2685  O O     . SER D 4 38  ? 160.754 143.669 165.848 1.00 144.96 ? 61  SER D O     1 
ATOM   2686  C CB    . SER D 4 38  ? 159.314 143.861 168.741 1.00 144.96 ? 61  SER D CB    1 
ATOM   2687  O OG    . SER D 4 38  ? 158.543 143.165 169.700 1.00 144.96 ? 61  SER D OG    1 
ATOM   2688  N N     . PHE D 4 39  ? 162.215 144.304 167.445 1.00 144.30 ? 62  PHE D N     1 
ATOM   2689  C CA    . PHE D 4 39  ? 163.076 145.028 166.527 1.00 144.30 ? 62  PHE D CA    1 
ATOM   2690  C C     . PHE D 4 39  ? 163.722 144.099 165.517 1.00 144.30 ? 62  PHE D C     1 
ATOM   2691  O O     . PHE D 4 39  ? 163.745 144.397 164.317 1.00 144.30 ? 62  PHE D O     1 
ATOM   2692  C CB    . PHE D 4 39  ? 164.145 145.767 167.317 1.00 144.30 ? 62  PHE D CB    1 
ATOM   2693  C CG    . PHE D 4 39  ? 165.329 146.157 166.508 1.00 144.30 ? 62  PHE D CG    1 
ATOM   2694  C CD1   . PHE D 4 39  ? 165.242 147.190 165.602 1.00 144.30 ? 62  PHE D CD1   1 
ATOM   2695  C CD2   . PHE D 4 39  ? 166.538 145.506 166.665 1.00 144.30 ? 62  PHE D CD2   1 
ATOM   2696  C CE1   . PHE D 4 39  ? 166.336 147.563 164.862 1.00 144.30 ? 62  PHE D CE1   1 
ATOM   2697  C CE2   . PHE D 4 39  ? 167.632 145.870 165.923 1.00 144.30 ? 62  PHE D CE2   1 
ATOM   2698  C CZ    . PHE D 4 39  ? 167.532 146.899 165.019 1.00 144.30 ? 62  PHE D CZ    1 
ATOM   2699  N N     . VAL D 4 40  ? 164.265 142.978 165.983 1.00 139.85 ? 63  VAL D N     1 
ATOM   2700  C CA    . VAL D 4 40  ? 164.985 142.107 165.072 1.00 139.85 ? 63  VAL D CA    1 
ATOM   2701  C C     . VAL D 4 40  ? 164.005 141.353 164.184 1.00 139.85 ? 63  VAL D C     1 
ATOM   2702  O O     . VAL D 4 40  ? 164.303 141.073 163.017 1.00 139.85 ? 63  VAL D O     1 
ATOM   2703  C CB    . VAL D 4 40  ? 165.934 141.183 165.857 1.00 139.85 ? 63  VAL D CB    1 
ATOM   2704  C CG1   . VAL D 4 40  ? 165.200 140.172 166.701 1.00 139.85 ? 63  VAL D CG1   1 
ATOM   2705  C CG2   . VAL D 4 40  ? 166.893 140.517 164.946 1.00 139.85 ? 63  VAL D CG2   1 
ATOM   2706  N N     . ASN D 4 41  ? 162.783 141.116 164.677 1.00 139.51 ? 64  ASN D N     1 
ATOM   2707  C CA    . ASN D 4 41  ? 161.749 140.549 163.820 1.00 139.51 ? 64  ASN D CA    1 
ATOM   2708  C C     . ASN D 4 41  ? 161.339 141.525 162.730 1.00 139.51 ? 64  ASN D C     1 
ATOM   2709  O O     . ASN D 4 41  ? 161.174 141.131 161.571 1.00 139.51 ? 64  ASN D O     1 
ATOM   2710  C CB    . ASN D 4 41  ? 160.537 140.146 164.649 1.00 139.51 ? 64  ASN D CB    1 
ATOM   2711  C CG    . ASN D 4 41  ? 160.573 138.694 165.044 1.00 139.51 ? 64  ASN D CG    1 
ATOM   2712  O OD1   . ASN D 4 41  ? 161.099 137.859 164.315 1.00 139.51 ? 64  ASN D OD1   1 
ATOM   2713  N ND2   . ASN D 4 41  ? 160.018 138.380 166.206 1.00 139.51 ? 64  ASN D ND2   1 
ATOM   2714  N N     . ASP D 4 42  ? 161.218 142.808 163.075 1.00 141.67 ? 65  ASP D N     1 
ATOM   2715  C CA    . ASP D 4 42  ? 160.860 143.814 162.082 1.00 141.67 ? 65  ASP D CA    1 
ATOM   2716  C C     . ASP D 4 42  ? 161.947 143.999 161.036 1.00 141.67 ? 65  ASP D C     1 
ATOM   2717  O O     . ASP D 4 42  ? 161.649 144.116 159.842 1.00 141.67 ? 65  ASP D O     1 
ATOM   2718  C CB    . ASP D 4 42  ? 160.580 145.138 162.765 1.00 141.67 ? 65  ASP D CB    1 
ATOM   2719  C CG    . ASP D 4 42  ? 160.758 146.296 161.836 1.00 141.67 ? 65  ASP D CG    1 
ATOM   2720  O OD1   . ASP D 4 42  ? 159.948 146.439 160.901 1.00 141.67 ? 65  ASP D OD1   1 
ATOM   2721  O OD2   . ASP D 4 42  ? 161.725 147.056 162.033 1.00 141.67 ? 65  ASP D OD2   1 
ATOM   2722  N N     . VAL D 4 43  ? 163.208 144.031 161.460 1.00 138.45 ? 66  VAL D N     1 
ATOM   2723  C CA    . VAL D 4 43  ? 164.300 144.245 160.517 1.00 138.45 ? 66  VAL D CA    1 
ATOM   2724  C C     . VAL D 4 43  ? 164.464 143.039 159.602 1.00 138.45 ? 66  VAL D C     1 
ATOM   2725  O O     . VAL D 4 43  ? 164.689 143.189 158.390 1.00 138.45 ? 66  VAL D O     1 
ATOM   2726  C CB    . VAL D 4 43  ? 165.586 144.579 161.289 1.00 138.45 ? 66  VAL D CB    1 
ATOM   2727  C CG1   . VAL D 4 43  ? 166.822 144.363 160.452 1.00 138.45 ? 66  VAL D CG1   1 
ATOM   2728  C CG2   . VAL D 4 43  ? 165.529 146.002 161.733 1.00 138.45 ? 66  VAL D CG2   1 
ATOM   2729  N N     . PHE D 4 44  ? 164.296 141.831 160.148 1.00 139.68 ? 67  PHE D N     1 
ATOM   2730  C CA    . PHE D 4 44  ? 164.321 140.638 159.314 1.00 139.68 ? 67  PHE D CA    1 
ATOM   2731  C C     . PHE D 4 44  ? 163.164 140.630 158.331 1.00 139.68 ? 67  PHE D C     1 
ATOM   2732  O O     . PHE D 4 44  ? 163.333 140.225 157.177 1.00 139.68 ? 67  PHE D O     1 
ATOM   2733  C CB    . PHE D 4 44  ? 164.287 139.394 160.191 1.00 139.68 ? 67  PHE D CB    1 
ATOM   2734  C CG    . PHE D 4 44  ? 163.794 138.175 159.489 1.00 139.68 ? 67  PHE D CG    1 
ATOM   2735  C CD1   . PHE D 4 44  ? 164.564 137.560 158.528 1.00 139.68 ? 67  PHE D CD1   1 
ATOM   2736  C CD2   . PHE D 4 44  ? 162.562 137.634 159.801 1.00 139.68 ? 67  PHE D CD2   1 
ATOM   2737  C CE1   . PHE D 4 44  ? 164.115 136.441 157.882 1.00 139.68 ? 67  PHE D CE1   1 
ATOM   2738  C CE2   . PHE D 4 44  ? 162.109 136.511 159.157 1.00 139.68 ? 67  PHE D CE2   1 
ATOM   2739  C CZ    . PHE D 4 44  ? 162.889 135.914 158.196 1.00 139.68 ? 67  PHE D CZ    1 
ATOM   2740  N N     . GLU D 4 45  ? 161.997 141.113 158.758 1.00 145.84 ? 68  GLU D N     1 
ATOM   2741  C CA    . GLU D 4 45  ? 160.863 141.215 157.851 1.00 145.84 ? 68  GLU D CA    1 
ATOM   2742  C C     . GLU D 4 45  ? 161.130 142.210 156.731 1.00 145.84 ? 68  GLU D C     1 
ATOM   2743  O O     . GLU D 4 45  ? 160.765 141.960 155.577 1.00 145.84 ? 68  GLU D O     1 
ATOM   2744  C CB    . GLU D 4 45  ? 159.616 141.611 158.632 1.00 145.84 ? 68  GLU D CB    1 
ATOM   2745  C CG    . GLU D 4 45  ? 158.320 141.238 157.958 1.00 145.84 ? 68  GLU D CG    1 
ATOM   2746  C CD    . GLU D 4 45  ? 157.830 142.319 157.022 1.00 145.84 ? 68  GLU D CD    1 
ATOM   2747  O OE1   . GLU D 4 45  ? 156.986 142.020 156.154 1.00 145.84 ? 68  GLU D OE1   1 
ATOM   2748  O OE2   . GLU D 4 45  ? 158.299 143.468 157.151 1.00 145.84 ? 68  GLU D OE2   1 
ATOM   2749  N N     . ARG D 4 46  ? 161.783 143.328 157.049 1.00 139.90 ? 69  ARG D N     1 
ATOM   2750  C CA    . ARG D 4 46  ? 162.072 144.341 156.040 1.00 139.90 ? 69  ARG D CA    1 
ATOM   2751  C C     . ARG D 4 46  ? 163.053 143.825 155.002 1.00 139.90 ? 69  ARG D C     1 
ATOM   2752  O O     . ARG D 4 46  ? 162.826 143.975 153.795 1.00 139.90 ? 69  ARG D O     1 
ATOM   2753  C CB    . ARG D 4 46  ? 162.632 145.594 156.696 1.00 139.90 ? 69  ARG D CB    1 
ATOM   2754  C CG    . ARG D 4 46  ? 161.603 146.507 157.298 1.00 139.90 ? 69  ARG D CG    1 
ATOM   2755  C CD    . ARG D 4 46  ? 162.276 147.778 157.762 1.00 139.90 ? 69  ARG D CD    1 
ATOM   2756  N NE    . ARG D 4 46  ? 161.450 148.538 158.687 1.00 139.90 ? 69  ARG D NE    1 
ATOM   2757  C CZ    . ARG D 4 46  ? 161.891 149.579 159.381 1.00 139.90 ? 69  ARG D CZ    1 
ATOM   2758  N NH1   . ARG D 4 46  ? 163.147 149.974 159.248 1.00 139.90 ? 69  ARG D NH1   1 
ATOM   2759  N NH2   . ARG D 4 46  ? 161.081 150.224 160.206 1.00 139.90 ? 69  ARG D NH2   1 
ATOM   2760  N N     . ILE D 4 47  ? 164.140 143.198 155.454 1.00 138.00 ? 70  ILE D N     1 
ATOM   2761  C CA    . ILE D 4 47  ? 165.137 142.691 154.516 1.00 138.00 ? 70  ILE D CA    1 
ATOM   2762  C C     . ILE D 4 47  ? 164.577 141.525 153.712 1.00 138.00 ? 70  ILE D C     1 
ATOM   2763  O O     . ILE D 4 47  ? 164.873 141.383 152.518 1.00 138.00 ? 70  ILE D O     1 
ATOM   2764  C CB    . ILE D 4 47  ? 166.425 142.307 155.260 1.00 138.00 ? 70  ILE D CB    1 
ATOM   2765  C CG1   . ILE D 4 47  ? 166.954 143.500 156.031 1.00 138.00 ? 70  ILE D CG1   1 
ATOM   2766  C CG2   . ILE D 4 47  ? 167.502 141.905 154.302 1.00 138.00 ? 70  ILE D CG2   1 
ATOM   2767  C CD1   . ILE D 4 47  ? 168.099 143.158 156.934 1.00 138.00 ? 70  ILE D CD1   1 
ATOM   2768  N N     . ALA D 4 48  ? 163.708 140.715 154.323 1.00 143.71 ? 71  ALA D N     1 
ATOM   2769  C CA    . ALA D 4 48  ? 163.111 139.604 153.595 1.00 143.71 ? 71  ALA D CA    1 
ATOM   2770  C C     . ALA D 4 48  ? 162.156 140.091 152.519 1.00 143.71 ? 71  ALA D C     1 
ATOM   2771  O O     . ALA D 4 48  ? 162.199 139.599 151.387 1.00 143.71 ? 71  ALA D O     1 
ATOM   2772  C CB    . ALA D 4 48  ? 162.390 138.671 154.558 1.00 143.71 ? 71  ALA D CB    1 
ATOM   2773  N N     . GLY D 4 49  ? 161.309 141.071 152.843 1.00 146.38 ? 72  GLY D N     1 
ATOM   2774  C CA    . GLY D 4 49  ? 160.407 141.617 151.843 1.00 146.38 ? 72  GLY D CA    1 
ATOM   2775  C C     . GLY D 4 49  ? 161.142 142.318 150.719 1.00 146.38 ? 72  GLY D C     1 
ATOM   2776  O O     . GLY D 4 49  ? 160.760 142.203 149.549 1.00 146.38 ? 72  GLY D O     1 
ATOM   2777  N N     . GLU D 4 50  ? 162.246 142.991 151.046 1.00 151.96 ? 73  GLU D N     1 
ATOM   2778  C CA    . GLU D 4 50  ? 163.025 143.666 150.017 1.00 151.96 ? 73  GLU D CA    1 
ATOM   2779  C C     . GLU D 4 50  ? 163.712 142.676 149.087 1.00 151.96 ? 73  GLU D C     1 
ATOM   2780  O O     . GLU D 4 50  ? 163.683 142.851 147.862 1.00 151.96 ? 73  GLU D O     1 
ATOM   2781  C CB    . GLU D 4 50  ? 164.055 144.583 150.660 1.00 151.96 ? 73  GLU D CB    1 
ATOM   2782  C CG    . GLU D 4 50  ? 164.622 145.572 149.695 1.00 151.96 ? 73  GLU D CG    1 
ATOM   2783  C CD    . GLU D 4 50  ? 163.541 146.399 149.053 1.00 151.96 ? 73  GLU D CD    1 
ATOM   2784  O OE1   . GLU D 4 50  ? 162.722 146.977 149.795 1.00 151.96 ? 73  GLU D OE1   1 
ATOM   2785  O OE2   . GLU D 4 50  ? 163.502 146.466 147.808 1.00 151.96 ? 73  GLU D OE2   1 
ATOM   2786  N N     . ALA D 4 51  ? 164.321 141.626 149.640 1.00 147.30 ? 74  ALA D N     1 
ATOM   2787  C CA    . ALA D 4 51  ? 164.992 140.646 148.794 1.00 147.30 ? 74  ALA D CA    1 
ATOM   2788  C C     . ALA D 4 51  ? 163.990 139.847 147.974 1.00 147.30 ? 74  ALA D C     1 
ATOM   2789  O O     . ALA D 4 51  ? 164.276 139.471 146.829 1.00 147.30 ? 74  ALA D O     1 
ATOM   2790  C CB    . ALA D 4 51  ? 165.848 139.721 149.647 1.00 147.30 ? 74  ALA D CB    1 
ATOM   2791  N N     . SER D 4 52  ? 162.796 139.620 148.527 1.00 147.02 ? 75  SER D N     1 
ATOM   2792  C CA    . SER D 4 52  ? 161.739 138.959 147.776 1.00 147.02 ? 75  SER D CA    1 
ATOM   2793  C C     . SER D 4 52  ? 161.288 139.801 146.597 1.00 147.02 ? 75  SER D C     1 
ATOM   2794  O O     . SER D 4 52  ? 161.103 139.276 145.494 1.00 147.02 ? 75  SER D O     1 
ATOM   2795  C CB    . SER D 4 52  ? 160.555 138.661 148.685 1.00 147.02 ? 75  SER D CB    1 
ATOM   2796  O OG    . SER D 4 52  ? 159.369 138.553 147.926 1.00 147.02 ? 75  SER D OG    1 
ATOM   2797  N N     . ARG D 4 53  ? 161.133 141.109 146.797 1.00 151.16 ? 76  ARG D N     1 
ATOM   2798  C CA    . ARG D 4 53  ? 160.705 141.947 145.684 1.00 151.16 ? 76  ARG D CA    1 
ATOM   2799  C C     . ARG D 4 53  ? 161.804 142.103 144.646 1.00 151.16 ? 76  ARG D C     1 
ATOM   2800  O O     . ARG D 4 53  ? 161.511 142.198 143.451 1.00 151.16 ? 76  ARG D O     1 
ATOM   2801  C CB    . ARG D 4 53  ? 160.238 143.301 146.189 1.00 151.16 ? 76  ARG D CB    1 
ATOM   2802  C CG    . ARG D 4 53  ? 158.760 143.310 146.474 1.00 151.16 ? 76  ARG D CG    1 
ATOM   2803  C CD    . ARG D 4 53  ? 158.482 143.922 147.816 1.00 151.16 ? 76  ARG D CD    1 
ATOM   2804  N NE    . ARG D 4 53  ? 158.862 145.325 147.842 1.00 151.16 ? 76  ARG D NE    1 
ATOM   2805  C CZ    . ARG D 4 53  ? 159.193 145.980 148.945 1.00 151.16 ? 76  ARG D CZ    1 
ATOM   2806  N NH1   . ARG D 4 53  ? 159.206 145.348 150.109 1.00 151.16 ? 76  ARG D NH1   1 
ATOM   2807  N NH2   . ARG D 4 53  ? 159.519 147.262 148.882 1.00 151.16 ? 76  ARG D NH2   1 
ATOM   2808  N N     . LEU D 4 54  ? 163.069 142.086 145.072 1.00 155.45 ? 77  LEU D N     1 
ATOM   2809  C CA    . LEU D 4 54  ? 164.176 142.095 144.113 1.00 155.45 ? 77  LEU D CA    1 
ATOM   2810  C C     . LEU D 4 54  ? 164.172 140.848 143.239 1.00 155.45 ? 77  LEU D C     1 
ATOM   2811  O O     . LEU D 4 54  ? 164.236 140.939 142.002 1.00 155.45 ? 77  LEU D O     1 
ATOM   2812  C CB    . LEU D 4 54  ? 165.510 142.213 144.841 1.00 155.45 ? 77  LEU D CB    1 
ATOM   2813  C CG    . LEU D 4 54  ? 166.169 143.581 144.939 1.00 155.45 ? 77  LEU D CG    1 
ATOM   2814  C CD1   . LEU D 4 54  ? 166.539 144.007 143.550 1.00 155.45 ? 77  LEU D CD1   1 
ATOM   2815  C CD2   . LEU D 4 54  ? 165.274 144.609 145.575 1.00 155.45 ? 77  LEU D CD2   1 
ATOM   2816  N N     . ALA D 4 55  ? 164.094 139.675 143.867 1.00 150.12 ? 78  ALA D N     1 
ATOM   2817  C CA    . ALA D 4 55  ? 164.079 138.432 143.112 1.00 150.12 ? 78  ALA D CA    1 
ATOM   2818  C C     . ALA D 4 55  ? 162.826 138.287 142.264 1.00 150.12 ? 78  ALA D C     1 
ATOM   2819  O O     . ALA D 4 55  ? 162.864 137.610 141.235 1.00 150.12 ? 78  ALA D O     1 
ATOM   2820  C CB    . ALA D 4 55  ? 164.205 137.249 144.060 1.00 150.12 ? 78  ALA D CB    1 
ATOM   2821  N N     . HIS D 4 56  ? 161.730 138.922 142.664 1.00 154.96 ? 79  HIS D N     1 
ATOM   2822  C CA    . HIS D 4 56  ? 160.554 138.980 141.813 1.00 154.96 ? 79  HIS D CA    1 
ATOM   2823  C C     . HIS D 4 56  ? 160.783 139.869 140.601 1.00 154.96 ? 79  HIS D C     1 
ATOM   2824  O O     . HIS D 4 56  ? 160.349 139.535 139.495 1.00 154.96 ? 79  HIS D O     1 
ATOM   2825  C CB    . HIS D 4 56  ? 159.370 139.490 142.621 1.00 154.96 ? 79  HIS D CB    1 
ATOM   2826  C CG    . HIS D 4 56  ? 158.049 139.238 141.978 1.00 154.96 ? 79  HIS D CG    1 
ATOM   2827  N ND1   . HIS D 4 56  ? 156.895 139.876 142.378 1.00 154.96 ? 79  HIS D ND1   1 
ATOM   2828  C CD2   . HIS D 4 56  ? 157.693 138.412 140.969 1.00 154.96 ? 79  HIS D CD2   1 
ATOM   2829  C CE1   . HIS D 4 56  ? 155.885 139.456 141.639 1.00 154.96 ? 79  HIS D CE1   1 
ATOM   2830  N NE2   . HIS D 4 56  ? 156.342 138.566 140.777 1.00 154.96 ? 79  HIS D NE2   1 
ATOM   2831  N N     . TYR D 4 57  ? 161.455 141.006 140.792 1.00 151.46 ? 80  TYR D N     1 
ATOM   2832  C CA    . TYR D 4 57  ? 161.623 141.958 139.702 1.00 151.46 ? 80  TYR D CA    1 
ATOM   2833  C C     . TYR D 4 57  ? 162.593 141.456 138.653 1.00 151.46 ? 80  TYR D C     1 
ATOM   2834  O O     . TYR D 4 57  ? 162.418 141.747 137.468 1.00 151.46 ? 80  TYR D O     1 
ATOM   2835  C CB    . TYR D 4 57  ? 162.099 143.303 140.235 1.00 151.46 ? 80  TYR D CB    1 
ATOM   2836  C CG    . TYR D 4 57  ? 161.036 144.056 140.979 1.00 151.46 ? 80  TYR D CG    1 
ATOM   2837  C CD1   . TYR D 4 57  ? 159.693 143.833 140.718 1.00 151.46 ? 80  TYR D CD1   1 
ATOM   2838  C CD2   . TYR D 4 57  ? 161.371 144.984 141.951 1.00 151.46 ? 80  TYR D CD2   1 
ATOM   2839  C CE1   . TYR D 4 57  ? 158.712 144.517 141.403 1.00 151.46 ? 80  TYR D CE1   1 
ATOM   2840  C CE2   . TYR D 4 57  ? 160.398 145.670 142.644 1.00 151.46 ? 80  TYR D CE2   1 
ATOM   2841  C CZ    . TYR D 4 57  ? 159.071 145.433 142.363 1.00 151.46 ? 80  TYR D CZ    1 
ATOM   2842  O OH    . TYR D 4 57  ? 158.095 146.116 143.046 1.00 151.46 ? 80  TYR D OH    1 
ATOM   2843  N N     . ASN D 4 58  ? 163.608 140.700 139.048 1.00 153.23 ? 81  ASN D N     1 
ATOM   2844  C CA    . ASN D 4 58  ? 164.519 140.145 138.057 1.00 153.23 ? 81  ASN D CA    1 
ATOM   2845  C C     . ASN D 4 58  ? 164.022 138.840 137.456 1.00 153.23 ? 81  ASN D C     1 
ATOM   2846  O O     . ASN D 4 58  ? 164.784 138.190 136.733 1.00 153.23 ? 81  ASN D O     1 
ATOM   2847  C CB    . ASN D 4 58  ? 165.896 139.939 138.663 1.00 153.23 ? 81  ASN D CB    1 
ATOM   2848  C CG    . ASN D 4 58  ? 166.355 141.137 139.429 1.00 153.23 ? 81  ASN D CG    1 
ATOM   2849  O OD1   . ASN D 4 58  ? 166.771 142.134 138.847 1.00 153.23 ? 81  ASN D OD1   1 
ATOM   2850  N ND2   . ASN D 4 58  ? 166.263 141.066 140.744 1.00 153.23 ? 81  ASN D ND2   1 
ATOM   2851  N N     . LYS D 4 59  ? 162.770 138.461 137.742 1.00 152.62 ? 82  LYS D N     1 
ATOM   2852  C CA    . LYS D 4 59  ? 162.121 137.245 137.241 1.00 152.62 ? 82  LYS D CA    1 
ATOM   2853  C C     . LYS D 4 59  ? 162.913 135.997 137.608 1.00 152.62 ? 82  LYS D C     1 
ATOM   2854  O O     . LYS D 4 59  ? 163.090 135.086 136.802 1.00 152.62 ? 82  LYS D O     1 
ATOM   2855  C CB    . LYS D 4 59  ? 161.874 137.306 135.731 1.00 152.62 ? 82  LYS D CB    1 
ATOM   2856  C CG    . LYS D 4 59  ? 160.564 137.962 135.317 1.00 152.62 ? 82  LYS D CG    1 
ATOM   2857  C CD    . LYS D 4 59  ? 160.633 139.475 135.394 1.00 152.62 ? 82  LYS D CD    1 
ATOM   2858  C CE    . LYS D 4 59  ? 161.564 140.035 134.331 1.00 152.62 ? 82  LYS D CE    1 
ATOM   2859  N NZ    . LYS D 4 59  ? 161.617 141.524 134.365 1.00 152.62 ? 82  LYS D NZ    1 
ATOM   2860  N N     . ARG D 4 60  ? 163.405 135.969 138.837 1.00 166.36 ? 83  ARG D N     1 
ATOM   2861  C CA    . ARG D 4 60  ? 164.075 134.798 139.364 1.00 166.36 ? 83  ARG D CA    1 
ATOM   2862  C C     . ARG D 4 60  ? 163.258 134.254 140.521 1.00 166.36 ? 83  ARG D C     1 
ATOM   2863  O O     . ARG D 4 60  ? 162.215 134.799 140.886 1.00 166.36 ? 83  ARG D O     1 
ATOM   2864  C CB    . ARG D 4 60  ? 165.506 135.120 139.793 1.00 166.36 ? 83  ARG D CB    1 
ATOM   2865  C CG    . ARG D 4 60  ? 166.474 135.115 138.638 1.00 166.36 ? 83  ARG D CG    1 
ATOM   2866  C CD    . ARG D 4 60  ? 167.615 136.076 138.872 1.00 166.36 ? 83  ARG D CD    1 
ATOM   2867  N NE    . ARG D 4 60  ? 168.721 135.443 139.580 1.00 166.36 ? 83  ARG D NE    1 
ATOM   2868  C CZ    . ARG D 4 60  ? 168.925 135.538 140.890 1.00 166.36 ? 83  ARG D CZ    1 
ATOM   2869  N NH1   . ARG D 4 60  ? 168.094 136.240 141.645 1.00 166.36 ? 83  ARG D NH1   1 
ATOM   2870  N NH2   . ARG D 4 60  ? 169.963 134.931 141.448 1.00 166.36 ? 83  ARG D NH2   1 
ATOM   2871  N N     . SER D 4 61  ? 163.730 133.159 141.097 1.00 171.21 ? 84  SER D N     1 
ATOM   2872  C CA    . SER D 4 61  ? 162.984 132.510 142.162 1.00 171.21 ? 84  SER D CA    1 
ATOM   2873  C C     . SER D 4 61  ? 163.873 132.081 143.320 1.00 171.21 ? 84  SER D C     1 
ATOM   2874  O O     . SER D 4 61  ? 163.383 131.425 144.247 1.00 171.21 ? 84  SER D O     1 
ATOM   2875  C CB    . SER D 4 61  ? 162.227 131.312 141.597 1.00 171.21 ? 84  SER D CB    1 
ATOM   2876  O OG    . SER D 4 61  ? 163.131 130.381 141.033 1.00 171.21 ? 84  SER D OG    1 
ATOM   2877  N N     . THR D 4 62  ? 165.147 132.443 143.309 1.00 171.99 ? 85  THR D N     1 
ATOM   2878  C CA    . THR D 4 62  ? 166.112 131.987 144.298 1.00 171.99 ? 85  THR D CA    1 
ATOM   2879  C C     . THR D 4 62  ? 166.612 133.186 145.086 1.00 171.99 ? 85  THR D C     1 
ATOM   2880  O O     . THR D 4 62  ? 167.440 133.954 144.589 1.00 171.99 ? 85  THR D O     1 
ATOM   2881  C CB    . THR D 4 62  ? 167.278 131.278 143.621 1.00 171.99 ? 85  THR D CB    1 
ATOM   2882  O OG1   . THR D 4 62  ? 166.781 130.432 142.580 1.00 171.99 ? 85  THR D OG1   1 
ATOM   2883  C CG2   . THR D 4 62  ? 168.055 130.452 144.622 1.00 171.99 ? 85  THR D CG2   1 
ATOM   2884  N N     . ILE D 4 63  ? 166.121 133.349 146.309 1.00 153.54 ? 86  ILE D N     1 
ATOM   2885  C CA    . ILE D 4 63  ? 166.723 134.329 147.204 1.00 153.54 ? 86  ILE D CA    1 
ATOM   2886  C C     . ILE D 4 63  ? 168.084 133.790 147.627 1.00 153.54 ? 86  ILE D C     1 
ATOM   2887  O O     . ILE D 4 63  ? 168.169 132.813 148.373 1.00 153.54 ? 86  ILE D O     1 
ATOM   2888  C CB    . ILE D 4 63  ? 165.832 134.611 148.413 1.00 153.54 ? 86  ILE D CB    1 
ATOM   2889  C CG1   . ILE D 4 63  ? 164.601 135.377 147.975 1.00 153.54 ? 86  ILE D CG1   1 
ATOM   2890  C CG2   . ILE D 4 63  ? 166.571 135.427 149.440 1.00 153.54 ? 86  ILE D CG2   1 
ATOM   2891  C CD1   . ILE D 4 63  ? 163.633 135.610 149.080 1.00 153.54 ? 86  ILE D CD1   1 
ATOM   2892  N N     . THR D 4 64  ? 169.149 134.386 147.118 1.00 155.30 ? 87  THR D N     1 
ATOM   2893  C CA    . THR D 4 64  ? 170.493 134.030 147.541 1.00 155.30 ? 87  THR D CA    1 
ATOM   2894  C C     . THR D 4 64  ? 171.149 135.259 148.152 1.00 155.30 ? 87  THR D C     1 
ATOM   2895  O O     . THR D 4 64  ? 170.493 136.270 148.409 1.00 155.30 ? 87  THR D O     1 
ATOM   2896  C CB    . THR D 4 64  ? 171.317 133.461 146.387 1.00 155.30 ? 87  THR D CB    1 
ATOM   2897  O OG1   . THR D 4 64  ? 172.650 133.205 146.844 1.00 155.30 ? 87  THR D OG1   1 
ATOM   2898  C CG2   . THR D 4 64  ? 171.375 134.428 145.232 1.00 155.30 ? 87  THR D CG2   1 
ATOM   2899  N N     . SER D 4 65  ? 172.456 135.154 148.392 1.00 154.81 ? 88  SER D N     1 
ATOM   2900  C CA    . SER D 4 65  ? 173.187 136.173 149.132 1.00 154.81 ? 88  SER D CA    1 
ATOM   2901  C C     . SER D 4 65  ? 173.237 137.510 148.417 1.00 154.81 ? 88  SER D C     1 
ATOM   2902  O O     . SER D 4 65  ? 173.306 138.546 149.084 1.00 154.81 ? 88  SER D O     1 
ATOM   2903  C CB    . SER D 4 65  ? 174.606 135.696 149.395 1.00 154.81 ? 88  SER D CB    1 
ATOM   2904  O OG    . SER D 4 65  ? 175.129 135.084 148.232 1.00 154.81 ? 88  SER D OG    1 
ATOM   2905  N N     . ARG D 4 66  ? 173.188 137.513 147.087 1.00 155.73 ? 89  ARG D N     1 
ATOM   2906  C CA    . ARG D 4 66  ? 173.290 138.765 146.352 1.00 155.73 ? 89  ARG D CA    1 
ATOM   2907  C C     . ARG D 4 66  ? 172.051 139.629 146.553 1.00 155.73 ? 89  ARG D C     1 
ATOM   2908  O O     . ARG D 4 66  ? 172.152 140.861 146.640 1.00 155.73 ? 89  ARG D O     1 
ATOM   2909  C CB    . ARG D 4 66  ? 173.518 138.478 144.874 1.00 155.73 ? 89  ARG D CB    1 
ATOM   2910  C CG    . ARG D 4 66  ? 173.845 139.700 144.063 1.00 155.73 ? 89  ARG D CG    1 
ATOM   2911  C CD    . ARG D 4 66  ? 173.868 139.386 142.582 1.00 155.73 ? 89  ARG D CD    1 
ATOM   2912  N NE    . ARG D 4 66  ? 173.791 140.598 141.772 1.00 155.73 ? 89  ARG D NE    1 
ATOM   2913  C CZ    . ARG D 4 66  ? 174.843 141.327 141.415 1.00 155.73 ? 89  ARG D CZ    1 
ATOM   2914  N NH1   . ARG D 4 66  ? 176.062 140.971 141.794 1.00 155.73 ? 89  ARG D NH1   1 
ATOM   2915  N NH2   . ARG D 4 66  ? 174.677 142.415 140.678 1.00 155.73 ? 89  ARG D NH2   1 
ATOM   2916  N N     . GLU D 4 67  ? 170.880 139.005 146.679 1.00 155.32 ? 90  GLU D N     1 
ATOM   2917  C CA    . GLU D 4 67  ? 169.676 139.794 146.890 1.00 155.32 ? 90  GLU D CA    1 
ATOM   2918  C C     . GLU D 4 67  ? 169.607 140.344 148.299 1.00 155.32 ? 90  GLU D C     1 
ATOM   2919  O O     . GLU D 4 67  ? 169.089 141.441 148.502 1.00 155.32 ? 90  GLU D O     1 
ATOM   2920  C CB    . GLU D 4 67  ? 168.432 138.977 146.592 1.00 155.32 ? 90  GLU D CB    1 
ATOM   2921  C CG    . GLU D 4 67  ? 168.326 138.578 145.154 1.00 155.32 ? 90  GLU D CG    1 
ATOM   2922  C CD    . GLU D 4 67  ? 168.828 137.183 144.937 1.00 155.32 ? 90  GLU D CD    1 
ATOM   2923  O OE1   . GLU D 4 67  ? 168.918 136.452 145.937 1.00 155.32 ? 90  GLU D OE1   1 
ATOM   2924  O OE2   . GLU D 4 67  ? 169.133 136.814 143.784 1.00 155.32 ? 90  GLU D OE2   1 
ATOM   2925  N N     . ILE D 4 68  ? 170.148 139.628 149.278 1.00 145.45 ? 91  ILE D N     1 
ATOM   2926  C CA    . ILE D 4 68  ? 170.197 140.197 150.616 1.00 145.45 ? 91  ILE D CA    1 
ATOM   2927  C C     . ILE D 4 68  ? 171.236 141.306 150.678 1.00 145.45 ? 91  ILE D C     1 
ATOM   2928  O O     . ILE D 4 68  ? 171.039 142.309 151.378 1.00 145.45 ? 91  ILE D O     1 
ATOM   2929  C CB    . ILE D 4 68  ? 170.451 139.083 151.636 1.00 145.45 ? 91  ILE D CB    1 
ATOM   2930  C CG1   . ILE D 4 68  ? 169.276 138.122 151.602 1.00 145.45 ? 91  ILE D CG1   1 
ATOM   2931  C CG2   . ILE D 4 68  ? 170.589 139.623 153.034 1.00 145.45 ? 91  ILE D CG2   1 
ATOM   2932  C CD1   . ILE D 4 68  ? 169.434 136.953 152.499 1.00 145.45 ? 91  ILE D CD1   1 
ATOM   2933  N N     . GLN D 4 69  ? 172.306 141.178 149.891 1.00 143.40 ? 92  GLN D N     1 
ATOM   2934  C CA    . GLN D 4 69  ? 173.301 142.237 149.786 1.00 143.40 ? 92  GLN D CA    1 
ATOM   2935  C C     . GLN D 4 69  ? 172.686 143.516 149.243 1.00 143.40 ? 92  GLN D C     1 
ATOM   2936  O O     . GLN D 4 69  ? 172.828 144.590 149.839 1.00 143.40 ? 92  GLN D O     1 
ATOM   2937  C CB    . GLN D 4 69  ? 174.444 141.782 148.894 1.00 143.40 ? 92  GLN D CB    1 
ATOM   2938  C CG    . GLN D 4 69  ? 175.621 142.692 148.928 1.00 143.40 ? 92  GLN D CG    1 
ATOM   2939  C CD    . GLN D 4 69  ? 176.871 141.995 148.485 1.00 143.40 ? 92  GLN D CD    1 
ATOM   2940  O OE1   . GLN D 4 69  ? 176.882 140.783 148.304 1.00 143.40 ? 92  GLN D OE1   1 
ATOM   2941  N NE2   . GLN D 4 69  ? 177.939 142.753 148.303 1.00 143.40 ? 92  GLN D NE2   1 
ATOM   2942  N N     . THR D 4 70  ? 171.943 143.414 148.149 1.00 145.30 ? 93  THR D N     1 
ATOM   2943  C CA    . THR D 4 70  ? 171.328 144.627 147.636 1.00 145.30 ? 93  THR D CA    1 
ATOM   2944  C C     . THR D 4 70  ? 170.131 145.078 148.466 1.00 145.30 ? 93  THR D C     1 
ATOM   2945  O O     . THR D 4 70  ? 169.829 146.275 148.480 1.00 145.30 ? 93  THR D O     1 
ATOM   2946  C CB    . THR D 4 70  ? 170.933 144.468 146.170 1.00 145.30 ? 93  THR D CB    1 
ATOM   2947  O OG1   . THR D 4 70  ? 170.441 145.717 145.683 1.00 145.30 ? 93  THR D OG1   1 
ATOM   2948  C CG2   . THR D 4 70  ? 169.863 143.440 146.000 1.00 145.30 ? 93  THR D CG2   1 
ATOM   2949  N N     . ALA D 4 71  ? 169.500 144.185 149.230 1.00 143.78 ? 94  ALA D N     1 
ATOM   2950  C CA    . ALA D 4 71  ? 168.397 144.619 150.077 1.00 143.78 ? 94  ALA D CA    1 
ATOM   2951  C C     . ALA D 4 71  ? 168.900 145.417 151.266 1.00 143.78 ? 94  ALA D C     1 
ATOM   2952  O O     . ALA D 4 71  ? 168.274 146.402 151.671 1.00 143.78 ? 94  ALA D O     1 
ATOM   2953  C CB    . ALA D 4 71  ? 167.588 143.417 150.546 1.00 143.78 ? 94  ALA D CB    1 
ATOM   2954  N N     . VAL D 4 72  ? 170.038 145.024 151.831 1.00 139.78 ? 95  VAL D N     1 
ATOM   2955  C CA    . VAL D 4 72  ? 170.586 145.833 152.904 1.00 139.78 ? 95  VAL D CA    1 
ATOM   2956  C C     . VAL D 4 72  ? 171.340 147.032 152.367 1.00 139.78 ? 95  VAL D C     1 
ATOM   2957  O O     . VAL D 4 72  ? 171.580 147.979 153.121 1.00 139.78 ? 95  VAL D O     1 
ATOM   2958  C CB    . VAL D 4 72  ? 171.484 145.016 153.839 1.00 139.78 ? 95  VAL D CB    1 
ATOM   2959  C CG1   . VAL D 4 72  ? 170.738 143.813 154.339 1.00 139.78 ? 95  VAL D CG1   1 
ATOM   2960  C CG2   . VAL D 4 72  ? 172.727 144.596 153.137 1.00 139.78 ? 95  VAL D CG2   1 
ATOM   2961  N N     . ARG D 4 73  ? 171.717 147.038 151.088 1.00 143.67 ? 96  ARG D N     1 
ATOM   2962  C CA    . ARG D 4 73  ? 172.187 148.291 150.515 1.00 143.67 ? 96  ARG D CA    1 
ATOM   2963  C C     . ARG D 4 73  ? 171.046 149.271 150.324 1.00 143.67 ? 96  ARG D C     1 
ATOM   2964  O O     . ARG D 4 73  ? 171.252 150.483 150.421 1.00 143.67 ? 96  ARG D O     1 
ATOM   2965  C CB    . ARG D 4 73  ? 172.881 148.054 149.183 1.00 143.67 ? 96  ARG D CB    1 
ATOM   2966  C CG    . ARG D 4 73  ? 174.286 147.576 149.327 1.00 143.67 ? 96  ARG D CG    1 
ATOM   2967  C CD    . ARG D 4 73  ? 175.080 147.876 148.084 1.00 143.67 ? 96  ARG D CD    1 
ATOM   2968  N NE    . ARG D 4 73  ? 176.297 147.079 148.035 1.00 143.67 ? 96  ARG D NE    1 
ATOM   2969  C CZ    . ARG D 4 73  ? 177.424 147.397 148.662 1.00 143.67 ? 96  ARG D CZ    1 
ATOM   2970  N NH1   . ARG D 4 73  ? 177.497 148.503 149.385 1.00 143.67 ? 96  ARG D NH1   1 
ATOM   2971  N NH2   . ARG D 4 73  ? 178.483 146.609 148.562 1.00 143.67 ? 96  ARG D NH2   1 
ATOM   2972  N N     . LEU D 4 74  ? 169.848 148.770 150.053 1.00 146.13 ? 97  LEU D N     1 
ATOM   2973  C CA    . LEU D 4 74  ? 168.711 149.668 149.928 1.00 146.13 ? 97  LEU D CA    1 
ATOM   2974  C C     . LEU D 4 74  ? 168.214 150.152 151.282 1.00 146.13 ? 97  LEU D C     1 
ATOM   2975  O O     . LEU D 4 74  ? 167.948 151.344 151.453 1.00 146.13 ? 97  LEU D O     1 
ATOM   2976  C CB    . LEU D 4 74  ? 167.580 148.979 149.181 1.00 146.13 ? 97  LEU D CB    1 
ATOM   2977  C CG    . LEU D 4 74  ? 167.797 148.810 147.690 1.00 146.13 ? 97  LEU D CG    1 
ATOM   2978  C CD1   . LEU D 4 74  ? 166.567 148.199 147.094 1.00 146.13 ? 97  LEU D CD1   1 
ATOM   2979  C CD2   . LEU D 4 74  ? 168.075 150.146 147.067 1.00 146.13 ? 97  LEU D CD2   1 
ATOM   2980  N N     . LEU D 4 75  ? 168.077 149.249 152.250 1.00 150.76 ? 98  LEU D N     1 
ATOM   2981  C CA    . LEU D 4 75  ? 167.389 149.596 153.489 1.00 150.76 ? 98  LEU D CA    1 
ATOM   2982  C C     . LEU D 4 75  ? 168.257 150.428 154.419 1.00 150.76 ? 98  LEU D C     1 
ATOM   2983  O O     . LEU D 4 75  ? 167.829 151.481 154.897 1.00 150.76 ? 98  LEU D O     1 
ATOM   2984  C CB    . LEU D 4 75  ? 166.927 148.330 154.197 1.00 150.76 ? 98  LEU D CB    1 
ATOM   2985  C CG    . LEU D 4 75  ? 165.604 147.814 153.658 1.00 150.76 ? 98  LEU D CG    1 
ATOM   2986  C CD1   . LEU D 4 75  ? 165.308 146.459 154.233 1.00 150.76 ? 98  LEU D CD1   1 
ATOM   2987  C CD2   . LEU D 4 75  ? 164.510 148.777 154.032 1.00 150.76 ? 98  LEU D CD2   1 
ATOM   2988  N N     . LEU D 4 76  ? 169.469 149.973 154.693 1.00 145.93 ? 99  LEU D N     1 
ATOM   2989  C CA    . LEU D 4 76  ? 170.288 150.641 155.687 1.00 145.93 ? 99  LEU D CA    1 
ATOM   2990  C C     . LEU D 4 76  ? 170.936 151.888 155.093 1.00 145.93 ? 99  LEU D C     1 
ATOM   2991  O O     . LEU D 4 76  ? 171.414 151.860 153.958 1.00 145.93 ? 99  LEU D O     1 
ATOM   2992  C CB    . LEU D 4 76  ? 171.358 149.701 156.215 1.00 145.93 ? 99  LEU D CB    1 
ATOM   2993  C CG    . LEU D 4 76  ? 170.891 148.307 156.608 1.00 145.93 ? 99  LEU D CG    1 
ATOM   2994  C CD1   . LEU D 4 76  ? 172.065 147.541 157.149 1.00 145.93 ? 99  LEU D CD1   1 
ATOM   2995  C CD2   . LEU D 4 76  ? 169.782 148.372 157.633 1.00 145.93 ? 99  LEU D CD2   1 
ATOM   2996  N N     . PRO D 4 77  ? 170.941 152.998 155.817 1.00 148.56 ? 100 PRO D N     1 
ATOM   2997  C CA    . PRO D 4 77  ? 171.533 154.227 155.279 1.00 148.56 ? 100 PRO D CA    1 
ATOM   2998  C C     . PRO D 4 77  ? 173.028 154.351 155.526 1.00 148.56 ? 100 PRO D C     1 
ATOM   2999  O O     . PRO D 4 77  ? 173.476 154.384 156.674 1.00 148.56 ? 100 PRO D O     1 
ATOM   3000  C CB    . PRO D 4 77  ? 170.764 155.334 156.014 1.00 148.56 ? 100 PRO D CB    1 
ATOM   3001  C CG    . PRO D 4 77  ? 169.692 154.634 156.813 1.00 148.56 ? 100 PRO D CG    1 
ATOM   3002  C CD    . PRO D 4 77  ? 170.183 153.260 157.045 1.00 148.56 ? 100 PRO D CD    1 
ATOM   3003  N N     . GLY D 4 78  ? 173.802 154.414 154.447 1.00 152.69 ? 101 GLY D N     1 
ATOM   3004  C CA    . GLY D 4 78  ? 175.183 154.853 154.500 1.00 152.69 ? 101 GLY D CA    1 
ATOM   3005  C C     . GLY D 4 78  ? 176.182 153.969 155.215 1.00 152.69 ? 101 GLY D C     1 
ATOM   3006  O O     . GLY D 4 78  ? 176.462 152.842 154.787 1.00 152.69 ? 101 GLY D O     1 
ATOM   3007  N N     . GLU D 4 79  ? 176.739 154.503 156.306 1.00 161.30 ? 102 GLU D N     1 
ATOM   3008  C CA    . GLU D 4 79  ? 177.843 153.848 156.998 1.00 161.30 ? 102 GLU D CA    1 
ATOM   3009  C C     . GLU D 4 79  ? 177.397 152.546 157.641 1.00 161.30 ? 102 GLU D C     1 
ATOM   3010  O O     . GLU D 4 79  ? 178.150 151.560 157.659 1.00 161.30 ? 102 GLU D O     1 
ATOM   3011  C CB    . GLU D 4 79  ? 178.419 154.792 158.051 1.00 161.30 ? 102 GLU D CB    1 
ATOM   3012  C CG    . GLU D 4 79  ? 179.667 154.272 158.714 1.00 161.30 ? 102 GLU D CG    1 
ATOM   3013  C CD    . GLU D 4 79  ? 180.648 153.717 157.709 1.00 161.30 ? 102 GLU D CD    1 
ATOM   3014  O OE1   . GLU D 4 79  ? 181.125 154.493 156.856 1.00 161.30 ? 102 GLU D OE1   1 
ATOM   3015  O OE2   . GLU D 4 79  ? 180.934 152.503 157.761 1.00 161.30 ? 102 GLU D OE2   1 
ATOM   3016  N N     . LEU D 4 80  ? 176.169 152.538 158.160 1.00 154.69 ? 103 LEU D N     1 
ATOM   3017  C CA    . LEU D 4 80  ? 175.558 151.322 158.673 1.00 154.69 ? 103 LEU D CA    1 
ATOM   3018  C C     . LEU D 4 80  ? 175.482 150.253 157.597 1.00 154.69 ? 103 LEU D C     1 
ATOM   3019  O O     . LEU D 4 80  ? 175.824 149.089 157.842 1.00 154.69 ? 103 LEU D O     1 
ATOM   3020  C CB    . LEU D 4 80  ? 174.167 151.649 159.199 1.00 154.69 ? 103 LEU D CB    1 
ATOM   3021  C CG    . LEU D 4 80  ? 173.621 150.801 160.332 1.00 154.69 ? 103 LEU D CG    1 
ATOM   3022  C CD1   . LEU D 4 80  ? 174.639 150.715 161.442 1.00 154.69 ? 103 LEU D CD1   1 
ATOM   3023  C CD2   . LEU D 4 80  ? 172.341 151.426 160.823 1.00 154.69 ? 103 LEU D CD2   1 
ATOM   3024  N N     . ALA D 4 81  ? 175.089 150.651 156.385 1.00 153.82 ? 104 ALA D N     1 
ATOM   3025  C CA    . ALA D 4 81  ? 174.980 149.713 155.278 1.00 153.82 ? 104 ALA D CA    1 
ATOM   3026  C C     . ALA D 4 81  ? 176.335 149.155 154.888 1.00 153.82 ? 104 ALA D C     1 
ATOM   3027  O O     . ALA D 4 81  ? 176.466 147.948 154.666 1.00 153.82 ? 104 ALA D O     1 
ATOM   3028  C CB    . ALA D 4 81  ? 174.331 150.389 154.076 1.00 153.82 ? 104 ALA D CB    1 
ATOM   3029  N N     . LYS D 4 82  ? 177.354 150.008 154.827 1.00 156.44 ? 105 LYS D N     1 
ATOM   3030  C CA    . LYS D 4 82  ? 178.667 149.540 154.398 1.00 156.44 ? 105 LYS D CA    1 
ATOM   3031  C C     . LYS D 4 82  ? 179.290 148.606 155.427 1.00 156.44 ? 105 LYS D C     1 
ATOM   3032  O O     . LYS D 4 82  ? 179.872 147.573 155.064 1.00 156.44 ? 105 LYS D O     1 
ATOM   3033  C CB    . LYS D 4 82  ? 179.577 150.729 154.134 1.00 156.44 ? 105 LYS D CB    1 
ATOM   3034  C CG    . LYS D 4 82  ? 180.904 150.356 153.512 1.00 156.44 ? 105 LYS D CG    1 
ATOM   3035  C CD    . LYS D 4 82  ? 181.694 151.586 153.087 1.00 156.44 ? 105 LYS D CD    1 
ATOM   3036  C CE    . LYS D 4 82  ? 181.672 152.680 154.144 1.00 156.44 ? 105 LYS D CE    1 
ATOM   3037  N NZ    . LYS D 4 82  ? 182.356 152.248 155.392 1.00 156.44 ? 105 LYS D NZ    1 
ATOM   3038  N N     . HIS D 4 83  ? 179.132 148.923 156.714 1.00 165.26 ? 106 HIS D N     1 
ATOM   3039  C CA    . HIS D 4 83  ? 179.680 148.057 157.751 1.00 165.26 ? 106 HIS D CA    1 
ATOM   3040  C C     . HIS D 4 83  ? 178.940 146.729 157.817 1.00 165.26 ? 106 HIS D C     1 
ATOM   3041  O O     . HIS D 4 83  ? 179.566 145.672 157.978 1.00 165.26 ? 106 HIS D O     1 
ATOM   3042  C CB    . HIS D 4 83  ? 179.633 148.766 159.095 1.00 165.26 ? 106 HIS D CB    1 
ATOM   3043  C CG    . HIS D 4 83  ? 180.839 149.601 159.368 1.00 165.26 ? 106 HIS D CG    1 
ATOM   3044  N ND1   . HIS D 4 83  ? 180.897 150.515 160.397 1.00 165.26 ? 106 HIS D ND1   1 
ATOM   3045  C CD2   . HIS D 4 83  ? 182.038 149.662 158.742 1.00 165.26 ? 106 HIS D CD2   1 
ATOM   3046  C CE1   . HIS D 4 83  ? 182.080 151.102 160.395 1.00 165.26 ? 106 HIS D CE1   1 
ATOM   3047  N NE2   . HIS D 4 83  ? 182.791 150.602 159.400 1.00 165.26 ? 106 HIS D NE2   1 
ATOM   3048  N N     . ALA D 4 84  ? 177.615 146.759 157.652 1.00 157.20 ? 107 ALA D N     1 
ATOM   3049  C CA    . ALA D 4 84  ? 176.844 145.525 157.653 1.00 157.20 ? 107 ALA D CA    1 
ATOM   3050  C C     . ALA D 4 84  ? 177.163 144.652 156.447 1.00 157.20 ? 107 ALA D C     1 
ATOM   3051  O O     . ALA D 4 84  ? 177.231 143.428 156.583 1.00 157.20 ? 107 ALA D O     1 
ATOM   3052  C CB    . ALA D 4 84  ? 175.355 145.846 157.698 1.00 157.20 ? 107 ALA D CB    1 
ATOM   3053  N N     . VAL D 4 85  ? 177.381 145.256 155.276 1.00 151.50 ? 108 VAL D N     1 
ATOM   3054  C CA    . VAL D 4 85  ? 177.726 144.483 154.087 1.00 151.50 ? 108 VAL D CA    1 
ATOM   3055  C C     . VAL D 4 85  ? 179.098 143.846 154.242 1.00 151.50 ? 108 VAL D C     1 
ATOM   3056  O O     . VAL D 4 85  ? 179.289 142.672 153.895 1.00 151.50 ? 108 VAL D O     1 
ATOM   3057  C CB    . VAL D 4 85  ? 177.641 145.375 152.838 1.00 151.50 ? 108 VAL D CB    1 
ATOM   3058  C CG1   . VAL D 4 85  ? 178.380 144.770 151.662 1.00 151.50 ? 108 VAL D CG1   1 
ATOM   3059  C CG2   . VAL D 4 85  ? 176.209 145.563 152.454 1.00 151.50 ? 108 VAL D CG2   1 
ATOM   3060  N N     . SER D 4 86  ? 180.057 144.591 154.804 1.00 159.52 ? 109 SER D N     1 
ATOM   3061  C CA    . SER D 4 86  ? 181.382 144.032 155.053 1.00 159.52 ? 109 SER D CA    1 
ATOM   3062  C C     . SER D 4 86  ? 181.319 142.861 156.022 1.00 159.52 ? 109 SER D C     1 
ATOM   3063  O O     . SER D 4 86  ? 181.926 141.807 155.776 1.00 159.52 ? 109 SER D O     1 
ATOM   3064  C CB    . SER D 4 86  ? 182.309 145.110 155.597 1.00 159.52 ? 109 SER D CB    1 
ATOM   3065  O OG    . SER D 4 86  ? 181.771 145.662 156.782 1.00 159.52 ? 109 SER D OG    1 
ATOM   3066  N N     . GLU D 4 87  ? 180.528 143.000 157.089 1.00 164.07 ? 110 GLU D N     1 
ATOM   3067  C CA    . GLU D 4 87  ? 180.426 141.925 158.069 1.00 164.07 ? 110 GLU D CA    1 
ATOM   3068  C C     . GLU D 4 87  ? 179.717 140.701 157.511 1.00 164.07 ? 110 GLU D C     1 
ATOM   3069  O O     . GLU D 4 87  ? 180.159 139.569 157.752 1.00 164.07 ? 110 GLU D O     1 
ATOM   3070  C CB    . GLU D 4 87  ? 179.700 142.412 159.315 1.00 164.07 ? 110 GLU D CB    1 
ATOM   3071  C CG    . GLU D 4 87  ? 179.899 141.493 160.491 1.00 164.07 ? 110 GLU D CG    1 
ATOM   3072  C CD    . GLU D 4 87  ? 181.331 141.008 160.601 1.00 164.07 ? 110 GLU D CD    1 
ATOM   3073  O OE1   . GLU D 4 87  ? 182.217 141.834 160.902 1.00 164.07 ? 110 GLU D OE1   1 
ATOM   3074  O OE2   . GLU D 4 87  ? 181.576 139.803 160.384 1.00 164.07 ? 110 GLU D OE2   1 
ATOM   3075  N N     . GLY D 4 88  ? 178.638 140.905 156.757 1.00 159.14 ? 111 GLY D N     1 
ATOM   3076  C CA    . GLY D 4 88  ? 177.923 139.780 156.182 1.00 159.14 ? 111 GLY D CA    1 
ATOM   3077  C C     . GLY D 4 88  ? 178.737 139.036 155.144 1.00 159.14 ? 111 GLY D C     1 
ATOM   3078  O O     . GLY D 4 88  ? 178.709 137.803 155.095 1.00 159.14 ? 111 GLY D O     1 
ATOM   3079  N N     . THR D 4 89  ? 179.479 139.770 154.307 1.00 158.15 ? 112 THR D N     1 
ATOM   3080  C CA    . THR D 4 89  ? 180.349 139.123 153.334 1.00 158.15 ? 112 THR D CA    1 
ATOM   3081  C C     . THR D 4 89  ? 181.466 138.353 154.009 1.00 158.15 ? 112 THR D C     1 
ATOM   3082  O O     . THR D 4 89  ? 181.832 137.271 153.537 1.00 158.15 ? 112 THR D O     1 
ATOM   3083  C CB    . THR D 4 89  ? 180.943 140.153 152.385 1.00 158.15 ? 112 THR D CB    1 
ATOM   3084  O OG1   . THR D 4 89  ? 181.366 141.297 153.134 1.00 158.15 ? 112 THR D OG1   1 
ATOM   3085  C CG2   . THR D 4 89  ? 179.920 140.575 151.360 1.00 158.15 ? 112 THR D CG2   1 
ATOM   3086  N N     . LYS D 4 90  ? 181.992 138.873 155.122 1.00 159.43 ? 113 LYS D N     1 
ATOM   3087  C CA    . LYS D 4 90  ? 183.005 138.135 155.868 1.00 159.43 ? 113 LYS D CA    1 
ATOM   3088  C C     . LYS D 4 90  ? 182.440 136.848 156.453 1.00 159.43 ? 113 LYS D C     1 
ATOM   3089  O O     . LYS D 4 90  ? 183.093 135.798 156.404 1.00 159.43 ? 113 LYS D O     1 
ATOM   3090  C CB    . LYS D 4 90  ? 183.575 139.007 156.976 1.00 159.43 ? 113 LYS D CB    1 
ATOM   3091  C CG    . LYS D 4 90  ? 184.739 138.380 157.703 1.00 159.43 ? 113 LYS D CG    1 
ATOM   3092  C CD    . LYS D 4 90  ? 185.172 139.237 158.872 1.00 159.43 ? 113 LYS D CD    1 
ATOM   3093  C CE    . LYS D 4 90  ? 185.505 140.654 158.429 1.00 159.43 ? 113 LYS D CE    1 
ATOM   3094  N NZ    . LYS D 4 90  ? 186.525 140.676 157.347 1.00 159.43 ? 113 LYS D NZ    1 
ATOM   3095  N N     . ALA D 4 91  ? 181.214 136.906 156.979 1.00 156.17 ? 114 ALA D N     1 
ATOM   3096  C CA    . ALA D 4 91  ? 180.601 135.709 157.546 1.00 156.17 ? 114 ALA D CA    1 
ATOM   3097  C C     . ALA D 4 91  ? 180.315 134.668 156.475 1.00 156.17 ? 114 ALA D C     1 
ATOM   3098  O O     . ALA D 4 91  ? 180.555 133.473 156.686 1.00 156.17 ? 114 ALA D O     1 
ATOM   3099  C CB    . ALA D 4 91  ? 179.319 136.074 158.280 1.00 156.17 ? 114 ALA D CB    1 
ATOM   3100  N N     . VAL D 4 92  ? 179.843 135.109 155.310 1.00 158.01 ? 115 VAL D N     1 
ATOM   3101  C CA    . VAL D 4 92  ? 179.518 134.177 154.236 1.00 158.01 ? 115 VAL D CA    1 
ATOM   3102  C C     . VAL D 4 92  ? 180.780 133.547 153.663 1.00 158.01 ? 115 VAL D C     1 
ATOM   3103  O O     . VAL D 4 92  ? 180.815 132.338 153.408 1.00 158.01 ? 115 VAL D O     1 
ATOM   3104  C CB    . VAL D 4 92  ? 178.672 134.888 153.165 1.00 158.01 ? 115 VAL D CB    1 
ATOM   3105  C CG1   . VAL D 4 92  ? 178.739 134.185 151.831 1.00 158.01 ? 115 VAL D CG1   1 
ATOM   3106  C CG2   . VAL D 4 92  ? 177.237 134.931 153.617 1.00 158.01 ? 115 VAL D CG2   1 
ATOM   3107  N N     . THR D 4 93  ? 181.855 134.326 153.507 1.00 163.13 ? 116 THR D N     1 
ATOM   3108  C CA    . THR D 4 93  ? 183.072 133.716 152.983 1.00 163.13 ? 116 THR D CA    1 
ATOM   3109  C C     . THR D 4 93  ? 183.752 132.831 154.019 1.00 163.13 ? 116 THR D C     1 
ATOM   3110  O O     . THR D 4 93  ? 184.436 131.872 153.644 1.00 163.13 ? 116 THR D O     1 
ATOM   3111  C CB    . THR D 4 93  ? 184.041 134.771 152.441 1.00 163.13 ? 116 THR D CB    1 
ATOM   3112  O OG1   . THR D 4 93  ? 185.086 134.109 151.723 1.00 163.13 ? 116 THR D OG1   1 
ATOM   3113  C CG2   . THR D 4 93  ? 184.672 135.599 153.538 1.00 163.13 ? 116 THR D CG2   1 
ATOM   3114  N N     . LYS D 4 94  ? 183.532 133.080 155.313 1.00 162.09 ? 117 LYS D N     1 
ATOM   3115  C CA    . LYS D 4 94  ? 184.059 132.154 156.302 1.00 162.09 ? 117 LYS D CA    1 
ATOM   3116  C C     . LYS D 4 94  ? 183.281 130.851 156.311 1.00 162.09 ? 117 LYS D C     1 
ATOM   3117  O O     . LYS D 4 94  ? 183.879 129.774 156.407 1.00 162.09 ? 117 LYS D O     1 
ATOM   3118  C CB    . LYS D 4 94  ? 184.034 132.779 157.691 1.00 162.09 ? 117 LYS D CB    1 
ATOM   3119  C CG    . LYS D 4 94  ? 184.697 131.911 158.739 1.00 162.09 ? 117 LYS D CG    1 
ATOM   3120  C CD    . LYS D 4 94  ? 184.464 132.432 160.137 1.00 162.09 ? 117 LYS D CD    1 
ATOM   3121  C CE    . LYS D 4 94  ? 184.883 131.396 161.160 1.00 162.09 ? 117 LYS D CE    1 
ATOM   3122  N NZ    . LYS D 4 94  ? 185.034 131.984 162.514 1.00 162.09 ? 117 LYS D NZ    1 
ATOM   3123  N N     . TYR D 4 95  ? 181.960 130.931 156.186 1.00 163.28 ? 118 TYR D N     1 
ATOM   3124  C CA    . TYR D 4 95  ? 181.127 129.736 156.188 1.00 163.28 ? 118 TYR D CA    1 
ATOM   3125  C C     . TYR D 4 95  ? 181.308 128.920 154.915 1.00 163.28 ? 118 TYR D C     1 
ATOM   3126  O O     . TYR D 4 95  ? 181.211 127.691 154.943 1.00 163.28 ? 118 TYR D O     1 
ATOM   3127  C CB    . TYR D 4 95  ? 179.674 130.151 156.376 1.00 163.28 ? 118 TYR D CB    1 
ATOM   3128  C CG    . TYR D 4 95  ? 178.653 129.253 155.755 1.00 163.28 ? 118 TYR D CG    1 
ATOM   3129  C CD1   . TYR D 4 95  ? 178.329 128.043 156.335 1.00 163.28 ? 118 TYR D CD1   1 
ATOM   3130  C CD2   . TYR D 4 95  ? 177.985 129.633 154.608 1.00 163.28 ? 118 TYR D CD2   1 
ATOM   3131  C CE1   . TYR D 4 95  ? 177.387 127.228 155.780 1.00 163.28 ? 118 TYR D CE1   1 
ATOM   3132  C CE2   . TYR D 4 95  ? 177.039 128.829 154.048 1.00 163.28 ? 118 TYR D CE2   1 
ATOM   3133  C CZ    . TYR D 4 95  ? 176.743 127.626 154.637 1.00 163.28 ? 118 TYR D CZ    1 
ATOM   3134  O OH    . TYR D 4 95  ? 175.794 126.810 154.075 1.00 163.28 ? 118 TYR D OH    1 
ATOM   3135  N N     . THR D 4 96  ? 181.570 129.583 153.792 1.00 169.83 ? 119 THR D N     1 
ATOM   3136  C CA    . THR D 4 96  ? 181.833 128.854 152.558 1.00 169.83 ? 119 THR D CA    1 
ATOM   3137  C C     . THR D 4 96  ? 183.226 128.246 152.574 1.00 169.83 ? 119 THR D C     1 
ATOM   3138  O O     . THR D 4 96  ? 183.413 127.099 152.152 1.00 169.83 ? 119 THR D O     1 
ATOM   3139  C CB    . THR D 4 96  ? 181.660 129.782 151.359 1.00 169.83 ? 119 THR D CB    1 
ATOM   3140  O OG1   . THR D 4 96  ? 180.374 130.408 151.428 1.00 169.83 ? 119 THR D OG1   1 
ATOM   3141  C CG2   . THR D 4 96  ? 181.759 129.007 150.061 1.00 169.83 ? 119 THR D CG2   1 
ATOM   3142  N N     . SER D 4 97  ? 184.215 128.993 153.073 1.00 174.84 ? 120 SER D N     1 
ATOM   3143  C CA    . SER D 4 97  ? 185.562 128.448 153.184 1.00 174.84 ? 120 SER D CA    1 
ATOM   3144  C C     . SER D 4 97  ? 185.643 127.361 154.244 1.00 174.84 ? 120 SER D C     1 
ATOM   3145  O O     . SER D 4 97  ? 186.486 126.464 154.145 1.00 174.84 ? 120 SER D O     1 
ATOM   3146  C CB    . SER D 4 97  ? 186.554 129.559 153.508 1.00 174.84 ? 120 SER D CB    1 
ATOM   3147  O OG    . SER D 4 97  ? 186.205 130.188 154.726 1.00 174.84 ? 120 SER D OG    1 
ATOM   3148  N N     . ALA D 4 98  ? 184.788 127.422 155.258 1.00 179.22 ? 121 ALA D N     1 
ATOM   3149  C CA    . ALA D 4 98  ? 184.741 126.410 156.308 1.00 179.22 ? 121 ALA D CA    1 
ATOM   3150  C C     . ALA D 4 98  ? 183.304 125.918 156.408 1.00 179.22 ? 121 ALA D C     1 
ATOM   3151  O O     . ALA D 4 98  ? 182.519 126.423 157.213 1.00 179.22 ? 121 ALA D O     1 
ATOM   3152  C CB    . ALA D 4 98  ? 185.237 126.966 157.634 1.00 179.22 ? 121 ALA D CB    1 
ATOM   3153  N N     . LYS D 4 99  ? 182.965 124.928 155.589 1.00 180.59 ? 122 LYS D N     1 
ATOM   3154  C CA    . LYS D 4 99  ? 181.627 124.348 155.593 1.00 180.59 ? 122 LYS D CA    1 
ATOM   3155  C C     . LYS D 4 99  ? 181.670 122.896 156.053 1.00 180.59 ? 122 LYS D C     1 
ATOM   3156  O O     . LYS D 4 99  ? 182.713 122.246 155.986 1.00 180.59 ? 122 LYS D O     1 
ATOM   3157  C CB    . LYS D 4 99  ? 180.993 124.438 154.204 1.00 180.59 ? 122 LYS D CB    1 
ATOM   3158  N N     . LYS E 1 38  ? 154.801 188.857 200.388 1.00 188.00 ? 37  LYS E N     1 
ATOM   3159  C CA    . LYS E 1 38  ? 155.181 187.856 201.385 1.00 188.00 ? 37  LYS E CA    1 
ATOM   3160  C C     . LYS E 1 38  ? 155.028 186.373 200.945 1.00 188.00 ? 37  LYS E C     1 
ATOM   3161  O O     . LYS E 1 38  ? 155.952 185.597 201.182 1.00 188.00 ? 37  LYS E O     1 
ATOM   3162  C CB    . LYS E 1 38  ? 154.416 188.105 202.697 1.00 188.00 ? 37  LYS E CB    1 
ATOM   3163  N N     . PRO E 1 39  ? 153.890 185.941 200.307 1.00 188.58 ? 38  PRO E N     1 
ATOM   3164  C CA    . PRO E 1 39  ? 153.872 184.564 199.793 1.00 188.58 ? 38  PRO E CA    1 
ATOM   3165  C C     . PRO E 1 39  ? 154.680 184.448 198.516 1.00 188.58 ? 38  PRO E C     1 
ATOM   3166  O O     . PRO E 1 39  ? 154.118 184.629 197.433 1.00 188.58 ? 38  PRO E O     1 
ATOM   3167  C CB    . PRO E 1 39  ? 152.383 184.288 199.542 1.00 188.58 ? 38  PRO E CB    1 
ATOM   3168  C CG    . PRO E 1 39  ? 151.654 185.404 200.185 1.00 188.58 ? 38  PRO E CG    1 
ATOM   3169  C CD    . PRO E 1 39  ? 152.569 186.558 200.071 1.00 188.58 ? 38  PRO E CD    1 
ATOM   3170  N N     . HIS E 1 40  ? 155.986 184.192 198.653 1.00 184.37 ? 39  HIS E N     1 
ATOM   3171  C CA    . HIS E 1 40  ? 156.987 184.253 197.590 1.00 184.37 ? 39  HIS E CA    1 
ATOM   3172  C C     . HIS E 1 40  ? 156.599 183.439 196.366 1.00 184.37 ? 39  HIS E C     1 
ATOM   3173  O O     . HIS E 1 40  ? 156.472 182.214 196.430 1.00 184.37 ? 39  HIS E O     1 
ATOM   3174  C CB    . HIS E 1 40  ? 158.327 183.759 198.130 1.00 184.37 ? 39  HIS E CB    1 
ATOM   3175  C CG    . HIS E 1 40  ? 159.468 183.967 197.186 1.00 184.37 ? 39  HIS E CG    1 
ATOM   3176  N ND1   . HIS E 1 40  ? 159.770 183.080 196.175 1.00 184.37 ? 39  HIS E ND1   1 
ATOM   3177  C CD2   . HIS E 1 40  ? 160.388 184.958 197.105 1.00 184.37 ? 39  HIS E CD2   1 
ATOM   3178  C CE1   . HIS E 1 40  ? 160.820 183.521 195.505 1.00 184.37 ? 39  HIS E CE1   1 
ATOM   3179  N NE2   . HIS E 1 40  ? 161.216 184.657 196.051 1.00 184.37 ? 39  HIS E NE2   1 
ATOM   3180  N N     . ARG E 1 41  ? 156.421 184.132 195.249 1.00 176.17 ? 40  ARG E N     1 
ATOM   3181  C CA    . ARG E 1 41  ? 155.871 183.556 194.035 1.00 176.17 ? 40  ARG E CA    1 
ATOM   3182  C C     . ARG E 1 41  ? 156.968 183.288 193.019 1.00 176.17 ? 40  ARG E C     1 
ATOM   3183  O O     . ARG E 1 41  ? 158.132 183.646 193.203 1.00 176.17 ? 40  ARG E O     1 
ATOM   3184  C CB    . ARG E 1 41  ? 154.823 184.489 193.433 1.00 176.17 ? 40  ARG E CB    1 
ATOM   3185  C CG    . ARG E 1 41  ? 153.598 183.778 192.930 1.00 176.17 ? 40  ARG E CG    1 
ATOM   3186  C CD    . ARG E 1 41  ? 152.596 184.759 192.374 1.00 176.17 ? 40  ARG E CD    1 
ATOM   3187  N NE    . ARG E 1 41  ? 151.563 184.099 191.583 1.00 176.17 ? 40  ARG E NE    1 
ATOM   3188  C CZ    . ARG E 1 41  ? 150.477 183.533 192.098 1.00 176.17 ? 40  ARG E CZ    1 
ATOM   3189  N NH1   . ARG E 1 41  ? 150.279 183.539 193.409 1.00 176.17 ? 40  ARG E NH1   1 
ATOM   3190  N NH2   . ARG E 1 41  ? 149.589 182.961 191.300 1.00 176.17 ? 40  ARG E NH2   1 
ATOM   3191  N N     . TYR E 1 42  ? 156.575 182.639 191.933 1.00 175.49 ? 41  TYR E N     1 
ATOM   3192  C CA    . TYR E 1 42  ? 157.443 182.412 190.794 1.00 175.49 ? 41  TYR E CA    1 
ATOM   3193  C C     . TYR E 1 42  ? 156.936 183.243 189.633 1.00 175.49 ? 41  TYR E C     1 
ATOM   3194  O O     . TYR E 1 42  ? 155.746 183.557 189.560 1.00 175.49 ? 41  TYR E O     1 
ATOM   3195  C CB    . TYR E 1 42  ? 157.483 180.937 190.414 1.00 175.49 ? 41  TYR E CB    1 
ATOM   3196  C CG    . TYR E 1 42  ? 158.485 180.144 191.212 1.00 175.49 ? 41  TYR E CG    1 
ATOM   3197  C CD1   . TYR E 1 42  ? 159.581 179.560 190.598 1.00 175.49 ? 41  TYR E CD1   1 
ATOM   3198  C CD2   . TYR E 1 42  ? 158.339 179.982 192.580 1.00 175.49 ? 41  TYR E CD2   1 
ATOM   3199  C CE1   . TYR E 1 42  ? 160.496 178.838 191.320 1.00 175.49 ? 41  TYR E CE1   1 
ATOM   3200  C CE2   . TYR E 1 42  ? 159.253 179.263 193.309 1.00 175.49 ? 41  TYR E CE2   1 
ATOM   3201  C CZ    . TYR E 1 42  ? 160.327 178.694 192.672 1.00 175.49 ? 41  TYR E CZ    1 
ATOM   3202  O OH    . TYR E 1 42  ? 161.240 177.975 193.396 1.00 175.49 ? 41  TYR E OH    1 
ATOM   3203  N N     . ARG E 1 43  ? 157.825 183.608 188.761 1.00 174.12 ? 42  ARG E N     1 
ATOM   3204  C CA    . ARG E 1 43  ? 157.428 184.443 187.644 1.00 174.12 ? 42  ARG E CA    1 
ATOM   3205  C C     . ARG E 1 43  ? 156.712 183.590 186.604 1.00 174.12 ? 42  ARG E C     1 
ATOM   3206  O O     . ARG E 1 43  ? 157.107 182.447 186.381 1.00 174.12 ? 42  ARG E O     1 
ATOM   3207  C CB    . ARG E 1 43  ? 158.650 185.111 187.035 1.00 174.12 ? 42  ARG E CB    1 
ATOM   3208  C CG    . ARG E 1 43  ? 158.361 186.084 185.925 1.00 174.12 ? 42  ARG E CG    1 
ATOM   3209  C CD    . ARG E 1 43  ? 159.306 187.257 185.995 1.00 174.12 ? 42  ARG E CD    1 
ATOM   3210  N NE    . ARG E 1 43  ? 159.020 188.091 187.156 1.00 174.12 ? 42  ARG E NE    1 
ATOM   3211  C CZ    . ARG E 1 43  ? 159.766 189.120 187.533 1.00 174.12 ? 42  ARG E CZ    1 
ATOM   3212  N NH1   . ARG E 1 43  ? 160.849 189.440 186.840 1.00 174.12 ? 42  ARG E NH1   1 
ATOM   3213  N NH2   . ARG E 1 43  ? 159.431 189.830 188.601 1.00 174.12 ? 42  ARG E NH2   1 
ATOM   3214  N N     . PRO E 1 44  ? 155.615 184.095 186.008 1.00 163.58 ? 43  PRO E N     1 
ATOM   3215  C CA    . PRO E 1 44  ? 154.893 183.316 184.995 1.00 163.58 ? 43  PRO E CA    1 
ATOM   3216  C C     . PRO E 1 44  ? 155.740 182.954 183.793 1.00 163.58 ? 43  PRO E C     1 
ATOM   3217  O O     . PRO E 1 44  ? 156.157 183.818 183.023 1.00 163.58 ? 43  PRO E O     1 
ATOM   3218  C CB    . PRO E 1 44  ? 153.746 184.248 184.603 1.00 163.58 ? 43  PRO E CB    1 
ATOM   3219  C CG    . PRO E 1 44  ? 153.474 184.998 185.829 1.00 163.58 ? 43  PRO E CG    1 
ATOM   3220  C CD    . PRO E 1 44  ? 154.817 185.243 186.464 1.00 163.58 ? 43  PRO E CD    1 
ATOM   3221  N N     . GLY E 1 45  ? 156.007 181.666 183.644 1.00 164.48 ? 44  GLY E N     1 
ATOM   3222  C CA    . GLY E 1 45  ? 156.845 181.206 182.566 1.00 164.48 ? 44  GLY E CA    1 
ATOM   3223  C C     . GLY E 1 45  ? 158.001 180.336 183.007 1.00 164.48 ? 44  GLY E C     1 
ATOM   3224  O O     . GLY E 1 45  ? 158.706 179.797 182.153 1.00 164.48 ? 44  GLY E O     1 
ATOM   3225  N N     . THR E 1 46  ? 158.225 180.174 184.313 1.00 166.08 ? 45  THR E N     1 
ATOM   3226  C CA    . THR E 1 46  ? 159.325 179.329 184.761 1.00 166.08 ? 45  THR E CA    1 
ATOM   3227  C C     . THR E 1 46  ? 158.888 177.995 185.339 1.00 166.08 ? 45  THR E C     1 
ATOM   3228  O O     . THR E 1 46  ? 159.655 177.029 185.274 1.00 166.08 ? 45  THR E O     1 
ATOM   3229  C CB    . THR E 1 46  ? 160.204 180.056 185.787 1.00 166.08 ? 45  THR E CB    1 
ATOM   3230  O OG1   . THR E 1 46  ? 161.343 179.245 186.083 1.00 166.08 ? 45  THR E OG1   1 
ATOM   3231  C CG2   . THR E 1 46  ? 159.467 180.341 187.074 1.00 166.08 ? 45  THR E CG2   1 
ATOM   3232  N N     . VAL E 1 47  ? 157.666 177.896 185.865 1.00 161.64 ? 46  VAL E N     1 
ATOM   3233  C CA    . VAL E 1 47  ? 157.183 176.607 186.317 1.00 161.64 ? 46  VAL E CA    1 
ATOM   3234  C C     . VAL E 1 47  ? 156.886 175.730 185.114 1.00 161.64 ? 46  VAL E C     1 
ATOM   3235  O O     . VAL E 1 47  ? 157.049 174.507 185.180 1.00 161.64 ? 46  VAL E O     1 
ATOM   3236  C CB    . VAL E 1 47  ? 155.980 176.833 187.253 1.00 161.64 ? 46  VAL E CB    1 
ATOM   3237  C CG1   . VAL E 1 47  ? 155.233 175.553 187.560 1.00 161.64 ? 46  VAL E CG1   1 
ATOM   3238  C CG2   . VAL E 1 47  ? 156.451 177.471 188.539 1.00 161.64 ? 46  VAL E CG2   1 
ATOM   3239  N N     . ALA E 1 48  ? 156.547 176.341 183.981 1.00 156.78 ? 47  ALA E N     1 
ATOM   3240  C CA    . ALA E 1 48  ? 156.400 175.587 182.744 1.00 156.78 ? 47  ALA E CA    1 
ATOM   3241  C C     . ALA E 1 48  ? 157.727 175.004 182.282 1.00 156.78 ? 47  ALA E C     1 
ATOM   3242  O O     . ALA E 1 48  ? 157.771 173.874 181.791 1.00 156.78 ? 47  ALA E O     1 
ATOM   3243  C CB    . ALA E 1 48  ? 155.802 176.475 181.662 1.00 156.78 ? 47  ALA E CB    1 
ATOM   3244  N N     . LEU E 1 49  ? 158.822 175.735 182.455 1.00 157.84 ? 48  LEU E N     1 
ATOM   3245  C CA    . LEU E 1 49  ? 160.118 175.173 182.101 1.00 157.84 ? 48  LEU E CA    1 
ATOM   3246  C C     . LEU E 1 49  ? 160.537 174.082 183.072 1.00 157.84 ? 48  LEU E C     1 
ATOM   3247  O O     . LEU E 1 49  ? 161.158 173.087 182.663 1.00 157.84 ? 48  LEU E O     1 
ATOM   3248  C CB    . LEU E 1 49  ? 161.162 176.275 182.059 1.00 157.84 ? 48  LEU E CB    1 
ATOM   3249  C CG    . LEU E 1 49  ? 160.829 177.344 181.031 1.00 157.84 ? 48  LEU E CG    1 
ATOM   3250  C CD1   . LEU E 1 49  ? 161.697 178.558 181.234 1.00 157.84 ? 48  LEU E CD1   1 
ATOM   3251  C CD2   . LEU E 1 49  ? 161.025 176.783 179.646 1.00 157.84 ? 48  LEU E CD2   1 
ATOM   3252  N N     . ARG E 1 50  ? 160.195 174.253 184.348 1.00 161.94 ? 49  ARG E N     1 
ATOM   3253  C CA    . ARG E 1 50  ? 160.383 173.200 185.338 1.00 161.94 ? 49  ARG E CA    1 
ATOM   3254  C C     . ARG E 1 50  ? 159.644 171.930 184.938 1.00 161.94 ? 49  ARG E C     1 
ATOM   3255  O O     . ARG E 1 50  ? 160.210 170.831 184.960 1.00 161.94 ? 49  ARG E O     1 
ATOM   3256  C CB    . ARG E 1 50  ? 159.897 173.711 186.687 1.00 161.94 ? 49  ARG E CB    1 
ATOM   3257  C CG    . ARG E 1 50  ? 159.547 172.664 187.709 1.00 161.94 ? 49  ARG E CG    1 
ATOM   3258  C CD    . ARG E 1 50  ? 159.559 173.316 189.074 1.00 161.94 ? 49  ARG E CD    1 
ATOM   3259  N NE    . ARG E 1 50  ? 160.671 174.254 189.159 1.00 161.94 ? 49  ARG E NE    1 
ATOM   3260  C CZ    . ARG E 1 50  ? 160.619 175.429 189.770 1.00 161.94 ? 49  ARG E CZ    1 
ATOM   3261  N NH1   . ARG E 1 50  ? 159.504 175.822 190.368 1.00 161.94 ? 49  ARG E NH1   1 
ATOM   3262  N NH2   . ARG E 1 50  ? 161.687 176.211 189.780 1.00 161.94 ? 49  ARG E NH2   1 
ATOM   3263  N N     . GLU E 1 51  ? 158.396 172.078 184.510 1.00 157.11 ? 50  GLU E N     1 
ATOM   3264  C CA    . GLU E 1 51  ? 157.603 170.931 184.099 1.00 157.11 ? 50  GLU E CA    1 
ATOM   3265  C C     . GLU E 1 51  ? 158.119 170.317 182.810 1.00 157.11 ? 50  GLU E C     1 
ATOM   3266  O O     . GLU E 1 51  ? 158.024 169.101 182.636 1.00 157.11 ? 50  GLU E O     1 
ATOM   3267  C CB    . GLU E 1 51  ? 156.146 171.339 183.935 1.00 157.11 ? 50  GLU E CB    1 
ATOM   3268  C CG    . GLU E 1 51  ? 155.419 171.519 185.241 1.00 157.11 ? 50  GLU E CG    1 
ATOM   3269  C CD    . GLU E 1 51  ? 153.960 171.868 185.053 1.00 157.11 ? 50  GLU E CD    1 
ATOM   3270  O OE1   . GLU E 1 51  ? 153.636 172.614 184.110 1.00 157.11 ? 50  GLU E OE1   1 
ATOM   3271  O OE2   . GLU E 1 51  ? 153.130 171.399 185.856 1.00 157.11 ? 50  GLU E OE2   1 
ATOM   3272  N N     . ILE E 1 52  ? 158.667 171.130 181.907 1.00 148.85 ? 51  ILE E N     1 
ATOM   3273  C CA    . ILE E 1 52  ? 159.195 170.600 180.655 1.00 148.85 ? 51  ILE E CA    1 
ATOM   3274  C C     . ILE E 1 52  ? 160.401 169.719 180.925 1.00 148.85 ? 51  ILE E C     1 
ATOM   3275  O O     . ILE E 1 52  ? 160.486 168.594 180.417 1.00 148.85 ? 51  ILE E O     1 
ATOM   3276  C CB    . ILE E 1 52  ? 159.532 171.743 179.684 1.00 148.85 ? 51  ILE E CB    1 
ATOM   3277  C CG1   . ILE E 1 52  ? 158.270 172.239 178.990 1.00 148.85 ? 51  ILE E CG1   1 
ATOM   3278  C CG2   . ILE E 1 52  ? 160.530 171.297 178.637 1.00 148.85 ? 51  ILE E CG2   1 
ATOM   3279  C CD1   . ILE E 1 52  ? 158.520 173.309 177.952 1.00 148.85 ? 51  ILE E CD1   1 
ATOM   3280  N N     . ARG E 1 53  ? 161.321 170.191 181.774 1.00 153.55 ? 52  ARG E N     1 
ATOM   3281  C CA    . ARG E 1 53  ? 162.470 169.364 182.131 1.00 153.55 ? 52  ARG E CA    1 
ATOM   3282  C C     . ARG E 1 53  ? 162.052 168.119 182.900 1.00 153.55 ? 52  ARG E C     1 
ATOM   3283  O O     . ARG E 1 53  ? 162.595 167.032 182.662 1.00 153.55 ? 52  ARG E O     1 
ATOM   3284  C CB    . ARG E 1 53  ? 163.471 170.164 182.953 1.00 153.55 ? 52  ARG E CB    1 
ATOM   3285  C CG    . ARG E 1 53  ? 163.965 171.412 182.278 1.00 153.55 ? 52  ARG E CG    1 
ATOM   3286  C CD    . ARG E 1 53  ? 164.327 172.460 183.306 1.00 153.55 ? 52  ARG E CD    1 
ATOM   3287  N NE    . ARG E 1 53  ? 164.085 173.812 182.816 1.00 153.55 ? 52  ARG E NE    1 
ATOM   3288  C CZ    . ARG E 1 53  ? 164.938 174.497 182.062 1.00 153.55 ? 52  ARG E CZ    1 
ATOM   3289  N NH1   . ARG E 1 53  ? 166.096 173.961 181.705 1.00 153.55 ? 52  ARG E NH1   1 
ATOM   3290  N NH2   . ARG E 1 53  ? 164.635 175.724 181.665 1.00 153.55 ? 52  ARG E NH2   1 
ATOM   3291  N N     . ARG E 1 54  ? 161.048 168.245 183.769 1.00 152.48 ? 53  ARG E N     1 
ATOM   3292  C CA    . ARG E 1 54  ? 160.616 167.114 184.576 1.00 152.48 ? 53  ARG E CA    1 
ATOM   3293  C C     . ARG E 1 54  ? 159.931 166.040 183.742 1.00 152.48 ? 53  ARG E C     1 
ATOM   3294  O O     . ARG E 1 54  ? 160.194 164.850 183.933 1.00 152.48 ? 53  ARG E O     1 
ATOM   3295  C CB    . ARG E 1 54  ? 159.690 167.603 185.680 1.00 152.48 ? 53  ARG E CB    1 
ATOM   3296  C CG    . ARG E 1 54  ? 159.164 166.519 186.566 1.00 152.48 ? 53  ARG E CG    1 
ATOM   3297  C CD    . ARG E 1 54  ? 158.088 167.065 187.460 1.00 152.48 ? 53  ARG E CD    1 
ATOM   3298  N NE    . ARG E 1 54  ? 156.950 166.161 187.542 1.00 152.48 ? 53  ARG E NE    1 
ATOM   3299  C CZ    . ARG E 1 54  ? 155.756 166.513 188.000 1.00 152.48 ? 53  ARG E CZ    1 
ATOM   3300  N NH1   . ARG E 1 54  ? 155.551 167.753 188.419 1.00 152.48 ? 53  ARG E NH1   1 
ATOM   3301  N NH2   . ARG E 1 54  ? 154.770 165.629 188.041 1.00 152.48 ? 53  ARG E NH2   1 
ATOM   3302  N N     . TYR E 1 55  ? 159.078 166.425 182.800 1.00 146.31 ? 54  TYR E N     1 
ATOM   3303  C CA    . TYR E 1 55  ? 158.387 165.418 182.009 1.00 146.31 ? 54  TYR E CA    1 
ATOM   3304  C C     . TYR E 1 55  ? 159.253 164.852 180.898 1.00 146.31 ? 54  TYR E C     1 
ATOM   3305  O O     . TYR E 1 55  ? 159.083 163.686 180.537 1.00 146.31 ? 54  TYR E O     1 
ATOM   3306  C CB    . TYR E 1 55  ? 157.104 165.989 181.426 1.00 146.31 ? 54  TYR E CB    1 
ATOM   3307  C CG    . TYR E 1 55  ? 156.059 166.179 182.471 1.00 146.31 ? 54  TYR E CG    1 
ATOM   3308  C CD1   . TYR E 1 55  ? 155.773 165.173 183.366 1.00 146.31 ? 54  TYR E CD1   1 
ATOM   3309  C CD2   . TYR E 1 55  ? 155.374 167.370 182.583 1.00 146.31 ? 54  TYR E CD2   1 
ATOM   3310  C CE1   . TYR E 1 55  ? 154.822 165.342 184.340 1.00 146.31 ? 54  TYR E CE1   1 
ATOM   3311  C CE2   . TYR E 1 55  ? 154.421 167.553 183.554 1.00 146.31 ? 54  TYR E CE2   1 
ATOM   3312  C CZ    . TYR E 1 55  ? 154.149 166.537 184.427 1.00 146.31 ? 54  TYR E CZ    1 
ATOM   3313  O OH    . TYR E 1 55  ? 153.197 166.717 185.397 1.00 146.31 ? 54  TYR E OH    1 
ATOM   3314  N N     . GLN E 1 56  ? 160.173 165.632 180.333 1.00 145.53 ? 55  GLN E N     1 
ATOM   3315  C CA    . GLN E 1 56  ? 161.085 165.037 179.371 1.00 145.53 ? 55  GLN E CA    1 
ATOM   3316  C C     . GLN E 1 56  ? 162.104 164.140 180.040 1.00 145.53 ? 55  GLN E C     1 
ATOM   3317  O O     . GLN E 1 56  ? 162.628 163.231 179.394 1.00 145.53 ? 55  GLN E O     1 
ATOM   3318  C CB    . GLN E 1 56  ? 161.799 166.117 178.568 1.00 145.53 ? 55  GLN E CB    1 
ATOM   3319  C CG    . GLN E 1 56  ? 160.882 166.890 177.664 1.00 145.53 ? 55  GLN E CG    1 
ATOM   3320  C CD    . GLN E 1 56  ? 161.616 167.641 176.594 1.00 145.53 ? 55  GLN E CD    1 
ATOM   3321  O OE1   . GLN E 1 56  ? 162.726 168.114 176.800 1.00 145.53 ? 55  GLN E OE1   1 
ATOM   3322  N NE2   . GLN E 1 56  ? 160.999 167.753 175.434 1.00 145.53 ? 55  GLN E NE2   1 
ATOM   3323  N N     . LYS E 1 57  ? 162.398 164.374 181.318 1.00 149.73 ? 56  LYS E N     1 
ATOM   3324  C CA    . LYS E 1 57  ? 163.222 163.426 182.051 1.00 149.73 ? 56  LYS E CA    1 
ATOM   3325  C C     . LYS E 1 57  ? 162.471 162.130 182.324 1.00 149.73 ? 56  LYS E C     1 
ATOM   3326  O O     . LYS E 1 57  ? 163.065 161.050 182.277 1.00 149.73 ? 56  LYS E O     1 
ATOM   3327  C CB    . LYS E 1 57  ? 163.690 164.056 183.356 1.00 149.73 ? 56  LYS E CB    1 
ATOM   3328  C CG    . LYS E 1 57  ? 164.765 163.283 184.073 1.00 149.73 ? 56  LYS E CG    1 
ATOM   3329  C CD    . LYS E 1 57  ? 165.352 164.108 185.205 1.00 149.73 ? 56  LYS E CD    1 
ATOM   3330  C CE    . LYS E 1 57  ? 164.279 164.564 186.185 1.00 149.73 ? 56  LYS E CE    1 
ATOM   3331  N NZ    . LYS E 1 57  ? 164.851 165.402 187.276 1.00 149.73 ? 56  LYS E NZ    1 
ATOM   3332  N N     . SER E 1 58  ? 161.174 162.216 182.592 1.00 148.34 ? 57  SER E N     1 
ATOM   3333  C CA    . SER E 1 58  ? 160.377 161.046 182.915 1.00 148.34 ? 57  SER E CA    1 
ATOM   3334  C C     . SER E 1 58  ? 159.993 160.282 181.654 1.00 148.34 ? 57  SER E C     1 
ATOM   3335  O O     . SER E 1 58  ? 160.178 160.747 180.529 1.00 148.34 ? 57  SER E O     1 
ATOM   3336  C CB    . SER E 1 58  ? 159.120 161.450 183.673 1.00 148.34 ? 57  SER E CB    1 
ATOM   3337  O OG    . SER E 1 58  ? 158.102 160.489 183.477 1.00 148.34 ? 57  SER E OG    1 
ATOM   3338  N N     . THR E 1 59  ? 159.460 159.079 181.856 1.00 152.18 ? 58  THR E N     1 
ATOM   3339  C CA    . THR E 1 59  ? 159.006 158.255 180.746 1.00 152.18 ? 58  THR E CA    1 
ATOM   3340  C C     . THR E 1 59  ? 157.723 157.502 181.076 1.00 152.18 ? 58  THR E C     1 
ATOM   3341  O O     . THR E 1 59  ? 157.472 156.428 180.523 1.00 152.18 ? 58  THR E O     1 
ATOM   3342  C CB    . THR E 1 59  ? 160.089 157.274 180.325 1.00 152.18 ? 58  THR E CB    1 
ATOM   3343  O OG1   . THR E 1 59  ? 159.555 156.379 179.347 1.00 152.18 ? 58  THR E OG1   1 
ATOM   3344  C CG2   . THR E 1 59  ? 160.595 156.493 181.524 1.00 152.18 ? 58  THR E CG2   1 
ATOM   3345  N N     . GLU E 1 60  ? 156.893 158.050 181.947 1.00 154.90 ? 59  GLU E N     1 
ATOM   3346  C CA    . GLU E 1 60  ? 155.711 157.349 182.416 1.00 154.90 ? 59  GLU E CA    1 
ATOM   3347  C C     . GLU E 1 60  ? 154.552 157.559 181.449 1.00 154.90 ? 59  GLU E C     1 
ATOM   3348  O O     . GLU E 1 60  ? 154.725 158.029 180.325 1.00 154.90 ? 59  GLU E O     1 
ATOM   3349  C CB    . GLU E 1 60  ? 155.357 157.815 183.822 1.00 154.90 ? 59  GLU E CB    1 
ATOM   3350  C CG    . GLU E 1 60  ? 156.558 157.876 184.736 1.00 154.90 ? 59  GLU E CG    1 
ATOM   3351  C CD    . GLU E 1 60  ? 156.206 157.615 186.178 1.00 154.90 ? 59  GLU E CD    1 
ATOM   3352  O OE1   . GLU E 1 60  ? 155.099 158.008 186.599 1.00 154.90 ? 59  GLU E OE1   1 
ATOM   3353  O OE2   . GLU E 1 60  ? 157.034 157.013 186.891 1.00 154.90 ? 59  GLU E OE2   1 
ATOM   3354  N N     . LEU E 1 61  ? 153.356 157.185 181.876 1.00 154.27 ? 60  LEU E N     1 
ATOM   3355  C CA    . LEU E 1 61  ? 152.136 157.474 181.140 1.00 154.27 ? 60  LEU E CA    1 
ATOM   3356  C C     . LEU E 1 61  ? 151.513 158.730 181.726 1.00 154.27 ? 60  LEU E C     1 
ATOM   3357  O O     . LEU E 1 61  ? 151.110 158.741 182.892 1.00 154.27 ? 60  LEU E O     1 
ATOM   3358  C CB    . LEU E 1 61  ? 151.153 156.311 181.217 1.00 154.27 ? 60  LEU E CB    1 
ATOM   3359  C CG    . LEU E 1 61  ? 151.500 155.045 180.445 1.00 154.27 ? 60  LEU E CG    1 
ATOM   3360  C CD1   . LEU E 1 61  ? 150.280 154.156 180.374 1.00 154.27 ? 60  LEU E CD1   1 
ATOM   3361  C CD2   . LEU E 1 61  ? 152.004 155.374 179.058 1.00 154.27 ? 60  LEU E CD2   1 
ATOM   3362  N N     . LEU E 1 62  ? 151.427 159.778 180.918 1.00 155.89 ? 61  LEU E N     1 
ATOM   3363  C CA    . LEU E 1 62  ? 150.968 161.062 181.417 1.00 155.89 ? 61  LEU E CA    1 
ATOM   3364  C C     . LEU E 1 62  ? 149.462 161.126 181.550 1.00 155.89 ? 61  LEU E C     1 
ATOM   3365  O O     . LEU E 1 62  ? 148.954 161.889 182.378 1.00 155.89 ? 61  LEU E O     1 
ATOM   3366  C CB    . LEU E 1 62  ? 151.457 162.177 180.504 1.00 155.89 ? 61  LEU E CB    1 
ATOM   3367  C CG    . LEU E 1 62  ? 152.905 161.984 180.078 1.00 155.89 ? 61  LEU E CG    1 
ATOM   3368  C CD1   . LEU E 1 62  ? 153.260 163.002 179.036 1.00 155.89 ? 61  LEU E CD1   1 
ATOM   3369  C CD2   . LEU E 1 62  ? 153.828 162.111 181.268 1.00 155.89 ? 61  LEU E CD2   1 
ATOM   3370  N N     . ILE E 1 63  ? 148.739 160.355 180.758 1.00 154.57 ? 62  ILE E N     1 
ATOM   3371  C CA    . ILE E 1 63  ? 147.300 160.222 180.913 1.00 154.57 ? 62  ILE E CA    1 
ATOM   3372  C C     . ILE E 1 63  ? 147.039 158.982 181.756 1.00 154.57 ? 62  ILE E C     1 
ATOM   3373  O O     . ILE E 1 63  ? 147.705 157.956 181.586 1.00 154.57 ? 62  ILE E O     1 
ATOM   3374  C CB    . ILE E 1 63  ? 146.606 160.153 179.540 1.00 154.57 ? 62  ILE E CB    1 
ATOM   3375  C CG1   . ILE E 1 63  ? 145.125 159.822 179.670 1.00 154.57 ? 62  ILE E CG1   1 
ATOM   3376  C CG2   . ILE E 1 63  ? 147.300 159.185 178.609 1.00 154.57 ? 62  ILE E CG2   1 
ATOM   3377  C CD1   . ILE E 1 63  ? 144.347 160.859 180.415 1.00 154.57 ? 62  ILE E CD1   1 
ATOM   3378  N N     . ARG E 1 64  ? 146.124 159.094 182.714 1.00 170.30 ? 63  ARG E N     1 
ATOM   3379  C CA    . ARG E 1 64  ? 145.798 157.956 183.555 1.00 170.30 ? 63  ARG E CA    1 
ATOM   3380  C C     . ARG E 1 64  ? 145.069 156.888 182.751 1.00 170.30 ? 63  ARG E C     1 
ATOM   3381  O O     . ARG E 1 64  ? 144.451 157.164 181.723 1.00 170.30 ? 63  ARG E O     1 
ATOM   3382  C CB    . ARG E 1 64  ? 144.951 158.394 184.739 1.00 170.30 ? 63  ARG E CB    1 
ATOM   3383  C CG    . ARG E 1 64  ? 145.708 159.244 185.736 1.00 170.30 ? 63  ARG E CG    1 
ATOM   3384  C CD    . ARG E 1 64  ? 144.767 159.823 186.764 1.00 170.30 ? 63  ARG E CD    1 
ATOM   3385  N NE    . ARG E 1 64  ? 143.456 160.095 186.188 1.00 170.30 ? 63  ARG E NE    1 
ATOM   3386  C CZ    . ARG E 1 64  ? 143.121 161.239 185.601 1.00 170.30 ? 63  ARG E CZ    1 
ATOM   3387  N NH1   . ARG E 1 64  ? 144.004 162.224 185.512 1.00 170.30 ? 63  ARG E NH1   1 
ATOM   3388  N NH2   . ARG E 1 64  ? 141.905 161.396 185.101 1.00 170.30 ? 63  ARG E NH2   1 
ATOM   3389  N N     . LYS E 1 65  ? 145.140 155.654 183.242 1.00 166.05 ? 64  LYS E N     1 
ATOM   3390  C CA    . LYS E 1 65  ? 144.861 154.508 182.390 1.00 166.05 ? 64  LYS E CA    1 
ATOM   3391  C C     . LYS E 1 65  ? 143.388 154.141 182.351 1.00 166.05 ? 64  LYS E C     1 
ATOM   3392  O O     . LYS E 1 65  ? 142.896 153.710 181.304 1.00 166.05 ? 64  LYS E O     1 
ATOM   3393  C CB    . LYS E 1 65  ? 145.689 153.321 182.862 1.00 166.05 ? 64  LYS E CB    1 
ATOM   3394  C CG    . LYS E 1 65  ? 147.163 153.643 182.927 1.00 166.05 ? 64  LYS E CG    1 
ATOM   3395  C CD    . LYS E 1 65  ? 147.924 152.609 183.719 1.00 166.05 ? 64  LYS E CD    1 
ATOM   3396  C CE    . LYS E 1 65  ? 147.436 152.595 185.153 1.00 166.05 ? 64  LYS E CE    1 
ATOM   3397  N NZ    . LYS E 1 65  ? 147.542 153.936 185.793 1.00 166.05 ? 64  LYS E NZ    1 
ATOM   3398  N N     . LEU E 1 66  ? 142.678 154.289 183.454 1.00 160.76 ? 65  LEU E N     1 
ATOM   3399  C CA    . LEU E 1 66  ? 141.286 153.856 183.487 1.00 160.76 ? 65  LEU E CA    1 
ATOM   3400  C C     . LEU E 1 66  ? 140.336 154.738 182.668 1.00 160.76 ? 65  LEU E C     1 
ATOM   3401  O O     . LEU E 1 66  ? 139.458 154.173 181.997 1.00 160.76 ? 65  LEU E O     1 
ATOM   3402  C CB    . LEU E 1 66  ? 140.816 153.727 184.937 1.00 160.76 ? 65  LEU E CB    1 
ATOM   3403  C CG    . LEU E 1 66  ? 139.526 152.966 185.218 1.00 160.76 ? 65  LEU E CG    1 
ATOM   3404  C CD1   . LEU E 1 66  ? 139.702 152.225 186.520 1.00 160.76 ? 65  LEU E CD1   1 
ATOM   3405  C CD2   . LEU E 1 66  ? 138.322 153.878 185.327 1.00 160.76 ? 65  LEU E CD2   1 
ATOM   3406  N N     . PRO E 1 67  ? 140.426 156.082 182.671 1.00 162.75 ? 66  PRO E N     1 
ATOM   3407  C CA    . PRO E 1 67  ? 139.572 156.827 181.734 1.00 162.75 ? 66  PRO E CA    1 
ATOM   3408  C C     . PRO E 1 67  ? 139.950 156.609 180.288 1.00 162.75 ? 66  PRO E C     1 
ATOM   3409  O O     . PRO E 1 67  ? 139.071 156.656 179.420 1.00 162.75 ? 66  PRO E O     1 
ATOM   3410  C CB    . PRO E 1 67  ? 139.773 158.286 182.152 1.00 162.75 ? 66  PRO E CB    1 
ATOM   3411  C CG    . PRO E 1 67  ? 140.156 158.206 183.545 1.00 162.75 ? 66  PRO E CG    1 
ATOM   3412  C CD    . PRO E 1 67  ? 141.062 157.035 183.601 1.00 162.75 ? 66  PRO E CD    1 
ATOM   3413  N N     . PHE E 1 68  ? 141.218 156.324 180.009 1.00 150.03 ? 67  PHE E N     1 
ATOM   3414  C CA    . PHE E 1 68  ? 141.600 155.965 178.653 1.00 150.03 ? 67  PHE E CA    1 
ATOM   3415  C C     . PHE E 1 68  ? 140.987 154.635 178.241 1.00 150.03 ? 67  PHE E C     1 
ATOM   3416  O O     . PHE E 1 68  ? 140.551 154.473 177.094 1.00 150.03 ? 67  PHE E O     1 
ATOM   3417  C CB    . PHE E 1 68  ? 143.111 155.901 178.536 1.00 150.03 ? 67  PHE E CB    1 
ATOM   3418  C CG    . PHE E 1 68  ? 143.582 155.741 177.143 1.00 150.03 ? 67  PHE E CG    1 
ATOM   3419  C CD1   . PHE E 1 68  ? 143.597 156.817 176.291 1.00 150.03 ? 67  PHE E CD1   1 
ATOM   3420  C CD2   . PHE E 1 68  ? 143.990 154.513 176.673 1.00 150.03 ? 67  PHE E CD2   1 
ATOM   3421  C CE1   . PHE E 1 68  ? 144.024 156.676 175.002 1.00 150.03 ? 67  PHE E CE1   1 
ATOM   3422  C CE2   . PHE E 1 68  ? 144.410 154.366 175.378 1.00 150.03 ? 67  PHE E CE2   1 
ATOM   3423  C CZ    . PHE E 1 68  ? 144.435 155.448 174.547 1.00 150.03 ? 67  PHE E CZ    1 
ATOM   3424  N N     . GLN E 1 69  ? 140.942 153.678 179.165 1.00 153.53 ? 68  GLN E N     1 
ATOM   3425  C CA    . GLN E 1 69  ? 140.322 152.392 178.879 1.00 153.53 ? 68  GLN E CA    1 
ATOM   3426  C C     . GLN E 1 69  ? 138.829 152.545 178.638 1.00 153.53 ? 68  GLN E C     1 
ATOM   3427  O O     . GLN E 1 69  ? 138.273 151.933 177.713 1.00 153.53 ? 68  GLN E O     1 
ATOM   3428  C CB    . GLN E 1 69  ? 140.594 151.434 180.033 1.00 153.53 ? 68  GLN E CB    1 
ATOM   3429  C CG    . GLN E 1 69  ? 139.586 150.324 180.187 1.00 153.53 ? 68  GLN E CG    1 
ATOM   3430  C CD    . GLN E 1 69  ? 139.901 149.434 181.358 1.00 153.53 ? 68  GLN E CD    1 
ATOM   3431  O OE1   . GLN E 1 69  ? 141.014 149.448 181.877 1.00 153.53 ? 68  GLN E OE1   1 
ATOM   3432  N NE2   . GLN E 1 69  ? 138.917 148.661 181.794 1.00 153.53 ? 68  GLN E NE2   1 
ATOM   3433  N N     . ARG E 1 70  ? 138.172 153.388 179.435 1.00 155.69 ? 69  ARG E N     1 
ATOM   3434  C CA    . ARG E 1 70  ? 136.759 153.654 179.203 1.00 155.69 ? 69  ARG E CA    1 
ATOM   3435  C C     . ARG E 1 70  ? 136.527 154.371 177.882 1.00 155.69 ? 69  ARG E C     1 
ATOM   3436  O O     . ARG E 1 70  ? 135.510 154.132 177.229 1.00 155.69 ? 69  ARG E O     1 
ATOM   3437  C CB    . ARG E 1 70  ? 136.180 154.462 180.353 1.00 155.69 ? 69  ARG E CB    1 
ATOM   3438  C CG    . ARG E 1 70  ? 136.148 153.701 181.650 1.00 155.69 ? 69  ARG E CG    1 
ATOM   3439  C CD    . ARG E 1 70  ? 135.707 154.595 182.771 1.00 155.69 ? 69  ARG E CD    1 
ATOM   3440  N NE    . ARG E 1 70  ? 136.358 155.890 182.679 1.00 155.69 ? 69  ARG E NE    1 
ATOM   3441  C CZ    . ARG E 1 70  ? 135.794 157.029 183.051 1.00 155.69 ? 69  ARG E CZ    1 
ATOM   3442  N NH1   . ARG E 1 70  ? 134.566 157.031 183.544 1.00 155.69 ? 69  ARG E NH1   1 
ATOM   3443  N NH2   . ARG E 1 70  ? 136.461 158.165 182.931 1.00 155.69 ? 69  ARG E NH2   1 
ATOM   3444  N N     . LEU E 1 71  ? 137.475 155.203 177.449 1.00 152.25 ? 70  LEU E N     1 
ATOM   3445  C CA    . LEU E 1 71  ? 137.363 155.848 176.144 1.00 152.25 ? 70  LEU E CA    1 
ATOM   3446  C C     . LEU E 1 71  ? 137.450 154.835 175.015 1.00 152.25 ? 70  LEU E C     1 
ATOM   3447  O O     . LEU E 1 71  ? 136.686 154.908 174.041 1.00 152.25 ? 70  LEU E O     1 
ATOM   3448  C CB    . LEU E 1 71  ? 138.460 156.894 175.984 1.00 152.25 ? 70  LEU E CB    1 
ATOM   3449  C CG    . LEU E 1 71  ? 138.442 157.795 174.752 1.00 152.25 ? 70  LEU E CG    1 
ATOM   3450  C CD1   . LEU E 1 71  ? 138.813 159.172 175.178 1.00 152.25 ? 70  LEU E CD1   1 
ATOM   3451  C CD2   . LEU E 1 71  ? 139.412 157.347 173.701 1.00 152.25 ? 70  LEU E CD2   1 
ATOM   3452  N N     . VAL E 1 72  ? 138.409 153.913 175.107 1.00 143.88 ? 71  VAL E N     1 
ATOM   3453  C CA    . VAL E 1 72  ? 138.598 152.937 174.041 1.00 143.88 ? 71  VAL E CA    1 
ATOM   3454  C C     . VAL E 1 72  ? 137.393 152.013 173.949 1.00 143.88 ? 71  VAL E C     1 
ATOM   3455  O O     . VAL E 1 72  ? 136.911 151.716 172.851 1.00 143.88 ? 71  VAL E O     1 
ATOM   3456  C CB    . VAL E 1 72  ? 139.904 152.157 174.254 1.00 143.88 ? 71  VAL E CB    1 
ATOM   3457  C CG1   . VAL E 1 72  ? 140.042 151.088 173.235 1.00 143.88 ? 71  VAL E CG1   1 
ATOM   3458  C CG2   . VAL E 1 72  ? 141.078 153.079 174.141 1.00 143.88 ? 71  VAL E CG2   1 
ATOM   3459  N N     . ARG E 1 73  ? 136.842 151.608 175.095 1.00 155.07 ? 72  ARG E N     1 
ATOM   3460  C CA    . ARG E 1 73  ? 135.615 150.815 175.071 1.00 155.07 ? 72  ARG E CA    1 
ATOM   3461  C C     . ARG E 1 73  ? 134.429 151.618 174.558 1.00 155.07 ? 72  ARG E C     1 
ATOM   3462  O O     . ARG E 1 73  ? 133.559 151.065 173.873 1.00 155.07 ? 72  ARG E O     1 
ATOM   3463  C CB    . ARG E 1 73  ? 135.305 150.273 176.459 1.00 155.07 ? 72  ARG E CB    1 
ATOM   3464  C CG    . ARG E 1 73  ? 136.052 149.010 176.794 1.00 155.07 ? 72  ARG E CG    1 
ATOM   3465  C CD    . ARG E 1 73  ? 136.080 148.776 178.284 1.00 155.07 ? 72  ARG E CD    1 
ATOM   3466  N NE    . ARG E 1 73  ? 137.292 148.077 178.682 1.00 155.07 ? 72  ARG E NE    1 
ATOM   3467  C CZ    . ARG E 1 73  ? 137.396 146.757 178.754 1.00 155.07 ? 72  ARG E CZ    1 
ATOM   3468  N NH1   . ARG E 1 73  ? 136.354 145.995 178.461 1.00 155.07 ? 72  ARG E NH1   1 
ATOM   3469  N NH2   . ARG E 1 73  ? 138.539 146.201 179.123 1.00 155.07 ? 72  ARG E NH2   1 
ATOM   3470  N N     . GLU E 1 74  ? 134.399 152.919 174.849 1.00 166.90 ? 73  GLU E N     1 
ATOM   3471  C CA    . GLU E 1 74  ? 133.307 153.767 174.394 1.00 166.90 ? 73  GLU E CA    1 
ATOM   3472  C C     . GLU E 1 74  ? 133.295 153.901 172.881 1.00 166.90 ? 73  GLU E C     1 
ATOM   3473  O O     . GLU E 1 74  ? 132.226 153.875 172.264 1.00 166.90 ? 73  GLU E O     1 
ATOM   3474  C CB    . GLU E 1 74  ? 133.426 155.135 175.050 1.00 166.90 ? 73  GLU E CB    1 
ATOM   3475  C CG    . GLU E 1 74  ? 132.346 156.117 174.683 1.00 166.90 ? 73  GLU E CG    1 
ATOM   3476  C CD    . GLU E 1 74  ? 132.611 157.490 175.269 1.00 166.90 ? 73  GLU E CD    1 
ATOM   3477  O OE1   . GLU E 1 74  ? 133.514 158.193 174.768 1.00 166.90 ? 73  GLU E OE1   1 
ATOM   3478  O OE2   . GLU E 1 74  ? 131.935 157.862 176.247 1.00 166.90 ? 73  GLU E OE2   1 
ATOM   3479  N N     . ILE E 1 75  ? 134.468 154.025 172.255 1.00 153.81 ? 74  ILE E N     1 
ATOM   3480  C CA    . ILE E 1 75  ? 134.465 154.151 170.798 1.00 153.81 ? 74  ILE E CA    1 
ATOM   3481  C C     . ILE E 1 75  ? 134.612 152.821 170.077 1.00 153.81 ? 74  ILE E C     1 
ATOM   3482  O O     . ILE E 1 75  ? 134.512 152.786 168.843 1.00 153.81 ? 74  ILE E O     1 
ATOM   3483  C CB    . ILE E 1 75  ? 135.560 155.062 170.220 1.00 153.81 ? 74  ILE E CB    1 
ATOM   3484  C CG1   . ILE E 1 75  ? 136.915 154.387 170.286 1.00 153.81 ? 74  ILE E CG1   1 
ATOM   3485  C CG2   . ILE E 1 75  ? 135.598 156.373 170.971 1.00 153.81 ? 74  ILE E CG2   1 
ATOM   3486  C CD1   . ILE E 1 75  ? 137.829 154.960 169.312 1.00 153.81 ? 74  ILE E CD1   1 
ATOM   3487  N N     . ALA E 1 76  ? 134.885 151.736 170.784 1.00 159.22 ? 75  ALA E N     1 
ATOM   3488  C CA    . ALA E 1 76  ? 134.749 150.428 170.172 1.00 159.22 ? 75  ALA E CA    1 
ATOM   3489  C C     . ALA E 1 76  ? 133.367 149.848 170.396 1.00 159.22 ? 75  ALA E C     1 
ATOM   3490  O O     . ALA E 1 76  ? 133.076 148.760 169.894 1.00 159.22 ? 75  ALA E O     1 
ATOM   3491  C CB    . ALA E 1 76  ? 135.810 149.470 170.709 1.00 159.22 ? 75  ALA E CB    1 
ATOM   3492  N N     . GLN E 1 77  ? 132.515 150.555 171.143 1.00 166.79 ? 76  GLN E N     1 
ATOM   3493  C CA    . GLN E 1 77  ? 131.160 150.081 171.389 1.00 166.79 ? 76  GLN E CA    1 
ATOM   3494  C C     . GLN E 1 77  ? 130.309 150.072 170.128 1.00 166.79 ? 76  GLN E C     1 
ATOM   3495  O O     . GLN E 1 77  ? 129.330 149.325 170.056 1.00 166.79 ? 76  GLN E O     1 
ATOM   3496  C CB    . GLN E 1 77  ? 130.496 150.948 172.455 1.00 166.79 ? 76  GLN E CB    1 
ATOM   3497  C CG    . GLN E 1 77  ? 129.463 150.218 173.279 1.00 166.79 ? 76  GLN E CG    1 
ATOM   3498  C CD    . GLN E 1 77  ? 130.037 149.010 173.990 1.00 166.79 ? 76  GLN E CD    1 
ATOM   3499  O OE1   . GLN E 1 77  ? 131.093 149.086 174.615 1.00 166.79 ? 76  GLN E OE1   1 
ATOM   3500  N NE2   . GLN E 1 77  ? 129.343 147.882 173.895 1.00 166.79 ? 76  GLN E NE2   1 
ATOM   3501  N N     . ASP E 1 78  ? 130.653 150.878 169.128 1.00 162.50 ? 77  ASP E N     1 
ATOM   3502  C CA    . ASP E 1 78  ? 129.830 151.000 167.934 1.00 162.50 ? 77  ASP E CA    1 
ATOM   3503  C C     . ASP E 1 78  ? 130.465 150.377 166.700 1.00 162.50 ? 77  ASP E C     1 
ATOM   3504  O O     . ASP E 1 78  ? 129.942 150.551 165.595 1.00 162.50 ? 77  ASP E O     1 
ATOM   3505  C CB    . ASP E 1 78  ? 129.507 152.467 167.666 1.00 162.50 ? 77  ASP E CB    1 
ATOM   3506  C CG    . ASP E 1 78  ? 130.738 153.330 167.663 1.00 162.50 ? 77  ASP E CG    1 
ATOM   3507  O OD1   . ASP E 1 78  ? 131.797 152.825 168.068 1.00 162.50 ? 77  ASP E OD1   1 
ATOM   3508  O OD2   . ASP E 1 78  ? 130.654 154.503 167.253 1.00 162.50 ? 77  ASP E OD2   1 
ATOM   3509  N N     . PHE E 1 79  ? 131.581 149.669 166.846 1.00 153.22 ? 78  PHE E N     1 
ATOM   3510  C CA    . PHE E 1 79  ? 132.135 148.904 165.737 1.00 153.22 ? 78  PHE E CA    1 
ATOM   3511  C C     . PHE E 1 79  ? 131.706 147.447 165.822 1.00 153.22 ? 78  PHE E C     1 
ATOM   3512  O O     . PHE E 1 79  ? 131.108 146.909 164.888 1.00 153.22 ? 78  PHE E O     1 
ATOM   3513  C CB    . PHE E 1 79  ? 133.661 149.006 165.714 1.00 153.22 ? 78  PHE E CB    1 
ATOM   3514  C CG    . PHE E 1 79  ? 134.171 150.347 165.300 1.00 153.22 ? 78  PHE E CG    1 
ATOM   3515  C CD1   . PHE E 1 79  ? 133.350 151.251 164.654 1.00 153.22 ? 78  PHE E CD1   1 
ATOM   3516  C CD2   . PHE E 1 79  ? 135.483 150.697 165.544 1.00 153.22 ? 78  PHE E CD2   1 
ATOM   3517  C CE1   . PHE E 1 79  ? 133.828 152.479 164.278 1.00 153.22 ? 78  PHE E CE1   1 
ATOM   3518  C CE2   . PHE E 1 79  ? 135.965 151.922 165.173 1.00 153.22 ? 78  PHE E CE2   1 
ATOM   3519  C CZ    . PHE E 1 79  ? 135.139 152.813 164.535 1.00 153.22 ? 78  PHE E CZ    1 
ATOM   3520  N N     . LYS E 1 80  ? 132.004 146.800 166.939 1.00 160.70 ? 79  LYS E N     1 
ATOM   3521  C CA    . LYS E 1 80  ? 131.467 145.488 167.249 1.00 160.70 ? 79  LYS E CA    1 
ATOM   3522  C C     . LYS E 1 80  ? 131.093 145.488 168.718 1.00 160.70 ? 79  LYS E C     1 
ATOM   3523  O O     . LYS E 1 80  ? 131.921 145.824 169.567 1.00 160.70 ? 79  LYS E O     1 
ATOM   3524  C CB    . LYS E 1 80  ? 132.477 144.381 166.956 1.00 160.70 ? 79  LYS E CB    1 
ATOM   3525  C CG    . LYS E 1 80  ? 132.117 143.058 167.588 1.00 160.70 ? 79  LYS E CG    1 
ATOM   3526  C CD    . LYS E 1 80  ? 130.915 142.440 166.904 1.00 160.70 ? 79  LYS E CD    1 
ATOM   3527  C CE    . LYS E 1 80  ? 130.553 141.108 167.529 1.00 160.70 ? 79  LYS E CE    1 
ATOM   3528  N NZ    . LYS E 1 80  ? 130.064 141.272 168.921 1.00 160.70 ? 79  LYS E NZ    1 
ATOM   3529  N N     . THR E 1 81  ? 129.856 145.126 169.013 1.00 168.60 ? 80  THR E N     1 
ATOM   3530  C CA    . THR E 1 81  ? 129.378 145.177 170.381 1.00 168.60 ? 80  THR E CA    1 
ATOM   3531  C C     . THR E 1 81  ? 129.938 144.007 171.179 1.00 168.60 ? 80  THR E C     1 
ATOM   3532  O O     . THR E 1 81  ? 130.169 142.922 170.640 1.00 168.60 ? 80  THR E O     1 
ATOM   3533  C CB    . THR E 1 81  ? 127.851 145.155 170.404 1.00 168.60 ? 80  THR E CB    1 
ATOM   3534  O OG1   . THR E 1 81  ? 127.357 145.917 169.298 1.00 168.60 ? 80  THR E OG1   1 
ATOM   3535  C CG2   . THR E 1 81  ? 127.319 145.781 171.684 1.00 168.60 ? 80  THR E CG2   1 
ATOM   3536  N N     . ASP E 1 82  ? 130.173 144.260 172.472 1.00 168.63 ? 81  ASP E N     1 
ATOM   3537  C CA    . ASP E 1 82  ? 130.605 143.273 173.467 1.00 168.63 ? 81  ASP E CA    1 
ATOM   3538  C C     . ASP E 1 82  ? 131.941 142.631 173.091 1.00 168.63 ? 81  ASP E C     1 
ATOM   3539  O O     . ASP E 1 82  ? 132.042 141.430 172.843 1.00 168.63 ? 81  ASP E O     1 
ATOM   3540  C CB    . ASP E 1 82  ? 129.527 142.211 173.697 1.00 168.63 ? 81  ASP E CB    1 
ATOM   3541  C CG    . ASP E 1 82  ? 128.139 142.803 173.762 1.00 168.63 ? 81  ASP E CG    1 
ATOM   3542  O OD1   . ASP E 1 82  ? 127.835 143.502 174.752 1.00 168.63 ? 81  ASP E OD1   1 
ATOM   3543  O OD2   . ASP E 1 82  ? 127.355 142.578 172.817 1.00 168.63 ? 81  ASP E OD2   1 
ATOM   3544  N N     . LEU E 1 83  ? 132.968 143.468 173.044 1.00 156.71 ? 82  LEU E N     1 
ATOM   3545  C CA    . LEU E 1 83  ? 134.329 143.014 172.840 1.00 156.71 ? 82  LEU E CA    1 
ATOM   3546  C C     . LEU E 1 83  ? 135.042 142.913 174.179 1.00 156.71 ? 82  LEU E C     1 
ATOM   3547  O O     . LEU E 1 83  ? 134.546 143.342 175.219 1.00 156.71 ? 82  LEU E O     1 
ATOM   3548  C CB    . LEU E 1 83  ? 135.075 143.955 171.897 1.00 156.71 ? 82  LEU E CB    1 
ATOM   3549  C CG    . LEU E 1 83  ? 134.814 143.765 170.408 1.00 156.71 ? 82  LEU E CG    1 
ATOM   3550  C CD1   . LEU E 1 83  ? 135.786 144.584 169.614 1.00 156.71 ? 82  LEU E CD1   1 
ATOM   3551  C CD2   . LEU E 1 83  ? 134.930 142.314 170.021 1.00 156.71 ? 82  LEU E CD2   1 
ATOM   3552  N N     . ARG E 1 84  ? 136.223 142.327 174.148 1.00 155.49 ? 83  ARG E N     1 
ATOM   3553  C CA    . ARG E 1 84  ? 137.065 142.217 175.321 1.00 155.49 ? 83  ARG E CA    1 
ATOM   3554  C C     . ARG E 1 84  ? 138.450 142.712 174.970 1.00 155.49 ? 83  ARG E C     1 
ATOM   3555  O O     . ARG E 1 84  ? 138.946 142.461 173.871 1.00 155.49 ? 83  ARG E O     1 
ATOM   3556  C CB    . ARG E 1 84  ? 137.142 140.787 175.807 1.00 155.49 ? 83  ARG E CB    1 
ATOM   3557  C CG    . ARG E 1 84  ? 135.843 140.255 176.325 1.00 155.49 ? 83  ARG E CG    1 
ATOM   3558  C CD    . ARG E 1 84  ? 135.926 138.774 176.583 1.00 155.49 ? 83  ARG E CD    1 
ATOM   3559  N NE    . ARG E 1 84  ? 134.699 138.305 177.202 1.00 155.49 ? 83  ARG E NE    1 
ATOM   3560  C CZ    . ARG E 1 84  ? 134.505 138.275 178.513 1.00 155.49 ? 83  ARG E CZ    1 
ATOM   3561  N NH1   . ARG E 1 84  ? 135.466 138.674 179.332 1.00 155.49 ? 83  ARG E NH1   1 
ATOM   3562  N NH2   . ARG E 1 84  ? 133.355 137.839 179.007 1.00 155.49 ? 83  ARG E NH2   1 
ATOM   3563  N N     . PHE E 1 85  ? 139.077 143.415 175.895 1.00 152.25 ? 84  PHE E N     1 
ATOM   3564  C CA    . PHE E 1 85  ? 140.409 143.935 175.666 1.00 152.25 ? 84  PHE E CA    1 
ATOM   3565  C C     . PHE E 1 85  ? 141.395 143.198 176.548 1.00 152.25 ? 84  PHE E C     1 
ATOM   3566  O O     . PHE E 1 85  ? 141.128 142.962 177.727 1.00 152.25 ? 84  PHE E O     1 
ATOM   3567  C CB    . PHE E 1 85  ? 140.453 145.431 175.934 1.00 152.25 ? 84  PHE E CB    1 
ATOM   3568  C CG    . PHE E 1 85  ? 139.818 146.238 174.857 1.00 152.25 ? 84  PHE E CG    1 
ATOM   3569  C CD1   . PHE E 1 85  ? 140.428 146.357 173.624 1.00 152.25 ? 84  PHE E CD1   1 
ATOM   3570  C CD2   . PHE E 1 85  ? 138.606 146.860 175.066 1.00 152.25 ? 84  PHE E CD2   1 
ATOM   3571  C CE1   . PHE E 1 85  ? 139.847 147.088 172.623 1.00 152.25 ? 84  PHE E CE1   1 
ATOM   3572  C CE2   . PHE E 1 85  ? 138.021 147.595 174.066 1.00 152.25 ? 84  PHE E CE2   1 
ATOM   3573  C CZ    . PHE E 1 85  ? 138.643 147.706 172.843 1.00 152.25 ? 84  PHE E CZ    1 
ATOM   3574  N N     . GLN E 1 86  ? 142.536 142.840 175.980 1.00 147.89 ? 85  GLN E N     1 
ATOM   3575  C CA    . GLN E 1 86  ? 143.485 142.013 176.703 1.00 147.89 ? 85  GLN E CA    1 
ATOM   3576  C C     . GLN E 1 86  ? 144.309 142.825 177.698 1.00 147.89 ? 85  GLN E C     1 
ATOM   3577  O O     . GLN E 1 86  ? 145.098 142.253 178.457 1.00 147.89 ? 85  GLN E O     1 
ATOM   3578  C CB    . GLN E 1 86  ? 144.384 141.285 175.699 1.00 147.89 ? 85  GLN E CB    1 
ATOM   3579  C CG    . GLN E 1 86  ? 145.008 140.011 176.225 1.00 147.89 ? 85  GLN E CG    1 
ATOM   3580  C CD    . GLN E 1 86  ? 145.840 139.283 175.209 1.00 147.89 ? 85  GLN E CD    1 
ATOM   3581  O OE1   . GLN E 1 86  ? 146.096 139.788 174.128 1.00 147.89 ? 85  GLN E OE1   1 
ATOM   3582  N NE2   . GLN E 1 86  ? 146.251 138.071 175.545 1.00 147.89 ? 85  GLN E NE2   1 
ATOM   3583  N N     . SER E 1 87  ? 144.156 144.153 177.682 1.00 149.83 ? 86  SER E N     1 
ATOM   3584  C CA    . SER E 1 87  ? 144.715 145.202 178.545 1.00 149.83 ? 86  SER E CA    1 
ATOM   3585  C C     . SER E 1 87  ? 146.203 145.426 178.306 1.00 149.83 ? 86  SER E C     1 
ATOM   3586  O O     . SER E 1 87  ? 146.718 146.514 178.585 1.00 149.83 ? 86  SER E O     1 
ATOM   3587  C CB    . SER E 1 87  ? 144.484 144.939 180.040 1.00 149.83 ? 86  SER E CB    1 
ATOM   3588  O OG    . SER E 1 87  ? 145.009 143.698 180.475 1.00 149.83 ? 86  SER E OG    1 
ATOM   3589  N N     . SER E 1 88  ? 146.871 144.477 177.663 1.00 146.73 ? 87  SER E N     1 
ATOM   3590  C CA    . SER E 1 88  ? 148.079 144.818 176.949 1.00 146.73 ? 87  SER E CA    1 
ATOM   3591  C C     . SER E 1 88  ? 147.734 145.556 175.675 1.00 146.73 ? 87  SER E C     1 
ATOM   3592  O O     . SER E 1 88  ? 148.515 146.396 175.226 1.00 146.73 ? 87  SER E O     1 
ATOM   3593  C CB    . SER E 1 88  ? 148.891 143.565 176.648 1.00 146.73 ? 87  SER E CB    1 
ATOM   3594  O OG    . SER E 1 88  ? 148.037 142.510 176.264 1.00 146.73 ? 87  SER E OG    1 
ATOM   3595  N N     . ALA E 1 89  ? 146.547 145.297 175.126 1.00 144.88 ? 88  ALA E N     1 
ATOM   3596  C CA    . ALA E 1 89  ? 146.032 146.117 174.043 1.00 144.88 ? 88  ALA E CA    1 
ATOM   3597  C C     . ALA E 1 89  ? 145.795 147.547 174.501 1.00 144.88 ? 88  ALA E C     1 
ATOM   3598  O O     . ALA E 1 89  ? 146.127 148.491 173.779 1.00 144.88 ? 88  ALA E O     1 
ATOM   3599  C CB    . ALA E 1 89  ? 144.745 145.514 173.499 1.00 144.88 ? 88  ALA E CB    1 
ATOM   3600  N N     . VAL E 1 90  ? 145.243 147.732 175.701 1.00 142.80 ? 89  VAL E N     1 
ATOM   3601  C CA    . VAL E 1 90  ? 145.003 149.087 176.186 1.00 142.80 ? 89  VAL E CA    1 
ATOM   3602  C C     . VAL E 1 90  ? 146.312 149.772 176.538 1.00 142.80 ? 89  VAL E C     1 
ATOM   3603  O O     . VAL E 1 90  ? 146.459 150.981 176.320 1.00 142.80 ? 89  VAL E O     1 
ATOM   3604  C CB    . VAL E 1 90  ? 144.034 149.070 177.376 1.00 142.80 ? 89  VAL E CB    1 
ATOM   3605  C CG1   . VAL E 1 90  ? 143.533 150.457 177.671 1.00 142.80 ? 89  VAL E CG1   1 
ATOM   3606  C CG2   . VAL E 1 90  ? 142.875 148.181 177.064 1.00 142.80 ? 89  VAL E CG2   1 
ATOM   3607  N N     . MET E 1 91  ? 147.294 149.020 177.047 1.00 145.89 ? 90  MET E N     1 
ATOM   3608  C CA    . MET E 1 91  ? 148.616 149.602 177.263 1.00 145.89 ? 90  MET E CA    1 
ATOM   3609  C C     . MET E 1 91  ? 149.261 150.016 175.950 1.00 145.89 ? 90  MET E C     1 
ATOM   3610  O O     . MET E 1 91  ? 149.870 151.090 175.862 1.00 145.89 ? 90  MET E O     1 
ATOM   3611  C CB    . MET E 1 91  ? 149.519 148.620 177.996 1.00 145.89 ? 90  MET E CB    1 
ATOM   3612  C CG    . MET E 1 91  ? 149.204 148.492 179.457 1.00 145.89 ? 90  MET E CG    1 
ATOM   3613  S SD    . MET E 1 91  ? 148.669 150.051 180.167 1.00 145.89 ? 90  MET E SD    1 
ATOM   3614  C CE    . MET E 1 91  ? 147.812 149.454 181.619 1.00 145.89 ? 90  MET E CE    1 
ATOM   3615  N N     . ALA E 1 92  ? 149.105 149.197 174.912 1.00 144.37 ? 91  ALA E N     1 
ATOM   3616  C CA    . ALA E 1 92  ? 149.680 149.523 173.616 1.00 144.37 ? 91  ALA E CA    1 
ATOM   3617  C C     . ALA E 1 92  ? 148.990 150.723 172.995 1.00 144.37 ? 91  ALA E C     1 
ATOM   3618  O O     . ALA E 1 92  ? 149.641 151.563 172.365 1.00 144.37 ? 91  ALA E O     1 
ATOM   3619  C CB    . ALA E 1 92  ? 149.594 148.317 172.689 1.00 144.37 ? 91  ALA E CB    1 
ATOM   3620  N N     . LEU E 1 93  ? 147.684 150.844 173.201 1.00 142.48 ? 92  LEU E N     1 
ATOM   3621  C CA    . LEU E 1 93  ? 146.969 151.993 172.672 1.00 142.48 ? 92  LEU E CA    1 
ATOM   3622  C C     . LEU E 1 93  ? 147.352 153.264 173.403 1.00 142.48 ? 92  LEU E C     1 
ATOM   3623  O O     . LEU E 1 93  ? 147.470 154.325 172.781 1.00 142.48 ? 92  LEU E O     1 
ATOM   3624  C CB    . LEU E 1 93  ? 145.471 151.768 172.767 1.00 142.48 ? 92  LEU E CB    1 
ATOM   3625  C CG    . LEU E 1 93  ? 144.934 150.871 171.669 1.00 142.48 ? 92  LEU E CG    1 
ATOM   3626  C CD1   . LEU E 1 93  ? 143.460 150.818 171.803 1.00 142.48 ? 92  LEU E CD1   1 
ATOM   3627  C CD2   . LEU E 1 93  ? 145.321 151.407 170.324 1.00 142.48 ? 92  LEU E CD2   1 
ATOM   3628  N N     . GLN E 1 94  ? 147.563 153.174 174.715 1.00 151.64 ? 93  GLN E N     1 
ATOM   3629  C CA    . GLN E 1 94  ? 147.976 154.351 175.462 1.00 151.64 ? 93  GLN E CA    1 
ATOM   3630  C C     . GLN E 1 94  ? 149.368 154.791 175.054 1.00 151.64 ? 93  GLN E C     1 
ATOM   3631  O O     . GLN E 1 94  ? 149.608 155.990 174.879 1.00 151.64 ? 93  GLN E O     1 
ATOM   3632  C CB    . GLN E 1 94  ? 147.911 154.073 176.956 1.00 151.64 ? 93  GLN E CB    1 
ATOM   3633  C CG    . GLN E 1 94  ? 147.762 155.310 177.799 1.00 151.64 ? 93  GLN E CG    1 
ATOM   3634  C CD    . GLN E 1 94  ? 147.021 155.032 179.084 1.00 151.64 ? 93  GLN E CD    1 
ATOM   3635  O OE1   . GLN E 1 94  ? 146.533 153.927 179.302 1.00 151.64 ? 93  GLN E OE1   1 
ATOM   3636  N NE2   . GLN E 1 94  ? 146.932 156.033 179.945 1.00 151.64 ? 93  GLN E NE2   1 
ATOM   3637  N N     . GLU E 1 95  ? 150.270 153.838 174.821 1.00 144.48 ? 94  GLU E N     1 
ATOM   3638  C CA    . GLU E 1 95  ? 151.602 154.197 174.351 1.00 144.48 ? 94  GLU E CA    1 
ATOM   3639  C C     . GLU E 1 95  ? 151.572 154.792 172.951 1.00 144.48 ? 94  GLU E C     1 
ATOM   3640  O O     . GLU E 1 95  ? 152.264 155.784 172.691 1.00 144.48 ? 94  GLU E O     1 
ATOM   3641  C CB    . GLU E 1 95  ? 152.515 152.982 174.378 1.00 144.48 ? 94  GLU E CB    1 
ATOM   3642  C CG    . GLU E 1 95  ? 152.911 152.555 175.766 1.00 144.48 ? 94  GLU E CG    1 
ATOM   3643  C CD    . GLU E 1 95  ? 154.062 153.362 176.308 1.00 144.48 ? 94  GLU E CD    1 
ATOM   3644  O OE1   . GLU E 1 95  ? 154.755 154.022 175.508 1.00 144.48 ? 94  GLU E OE1   1 
ATOM   3645  O OE2   . GLU E 1 95  ? 154.281 153.332 177.535 1.00 144.48 ? 94  GLU E OE2   1 
ATOM   3646  N N     . ALA E 1 96  ? 150.736 154.249 172.066 1.00 143.46 ? 95  ALA E N     1 
ATOM   3647  C CA    . ALA E 1 96  ? 150.688 154.740 170.694 1.00 143.46 ? 95  ALA E CA    1 
ATOM   3648  C C     . ALA E 1 96  ? 150.086 156.132 170.622 1.00 143.46 ? 95  ALA E C     1 
ATOM   3649  O O     . ALA E 1 96  ? 150.642 157.023 169.970 1.00 143.46 ? 95  ALA E O     1 
ATOM   3650  C CB    . ALA E 1 96  ? 149.892 153.780 169.822 1.00 143.46 ? 95  ALA E CB    1 
ATOM   3651  N N     . SER E 1 97  ? 148.955 156.342 171.298 1.00 144.94 ? 96  SER E N     1 
ATOM   3652  C CA    . SER E 1 97  ? 148.322 157.652 171.271 1.00 144.94 ? 96  SER E CA    1 
ATOM   3653  C C     . SER E 1 97  ? 149.146 158.689 172.015 1.00 144.94 ? 96  SER E C     1 
ATOM   3654  O O     . SER E 1 97  ? 149.163 159.856 171.614 1.00 144.94 ? 96  SER E O     1 
ATOM   3655  C CB    . SER E 1 97  ? 146.929 157.583 171.873 1.00 144.94 ? 96  SER E CB    1 
ATOM   3656  O OG    . SER E 1 97  ? 146.989 157.893 173.248 1.00 144.94 ? 96  SER E OG    1 
ATOM   3657  N N     . GLU E 1 98  ? 149.871 158.283 173.060 1.00 155.61 ? 97  GLU E N     1 
ATOM   3658  C CA    . GLU E 1 98  ? 150.726 159.229 173.757 1.00 155.61 ? 97  GLU E CA    1 
ATOM   3659  C C     . GLU E 1 98  ? 151.903 159.647 172.896 1.00 155.61 ? 97  GLU E C     1 
ATOM   3660  O O     . GLU E 1 98  ? 152.228 160.836 172.833 1.00 155.61 ? 97  GLU E O     1 
ATOM   3661  C CB    . GLU E 1 98  ? 151.214 158.628 175.067 1.00 155.61 ? 97  GLU E CB    1 
ATOM   3662  C CG    . GLU E 1 98  ? 150.379 159.001 176.265 1.00 155.61 ? 97  GLU E CG    1 
ATOM   3663  C CD    . GLU E 1 98  ? 151.130 158.784 177.559 1.00 155.61 ? 97  GLU E CD    1 
ATOM   3664  O OE1   . GLU E 1 98  ? 152.266 158.271 177.500 1.00 155.61 ? 97  GLU E OE1   1 
ATOM   3665  O OE2   . GLU E 1 98  ? 150.597 159.133 178.634 1.00 155.61 ? 97  GLU E OE2   1 
ATOM   3666  N N     . ALA E 1 99  ? 152.536 158.698 172.203 1.00 148.57 ? 98  ALA E N     1 
ATOM   3667  C CA    . ALA E 1 99  ? 153.644 159.069 171.328 1.00 148.57 ? 98  ALA E CA    1 
ATOM   3668  C C     . ALA E 1 99  ? 153.174 159.905 170.148 1.00 148.57 ? 98  ALA E C     1 
ATOM   3669  O O     . ALA E 1 99  ? 153.863 160.854 169.746 1.00 148.57 ? 98  ALA E O     1 
ATOM   3670  C CB    . ALA E 1 99  ? 154.364 157.821 170.834 1.00 148.57 ? 98  ALA E CB    1 
ATOM   3671  N N     . TYR E 1 100 ? 151.982 159.610 169.633 1.00 139.95 ? 99  TYR E N     1 
ATOM   3672  C CA    . TYR E 1 100 ? 151.435 160.374 168.522 1.00 139.95 ? 99  TYR E CA    1 
ATOM   3673  C C     . TYR E 1 100 ? 151.108 161.800 168.938 1.00 139.95 ? 99  TYR E C     1 
ATOM   3674  O O     . TYR E 1 100 ? 151.466 162.755 168.241 1.00 139.95 ? 99  TYR E O     1 
ATOM   3675  C CB    . TYR E 1 100 ? 150.199 159.670 167.993 1.00 139.95 ? 99  TYR E CB    1 
ATOM   3676  C CG    . TYR E 1 100 ? 149.399 160.484 167.036 1.00 139.95 ? 99  TYR E CG    1 
ATOM   3677  C CD1   . TYR E 1 100 ? 149.918 160.847 165.811 1.00 139.95 ? 99  TYR E CD1   1 
ATOM   3678  C CD2   . TYR E 1 100 ? 148.114 160.877 167.350 1.00 139.95 ? 99  TYR E CD2   1 
ATOM   3679  C CE1   . TYR E 1 100 ? 149.181 161.588 164.928 1.00 139.95 ? 99  TYR E CE1   1 
ATOM   3680  C CE2   . TYR E 1 100 ? 147.369 161.618 166.473 1.00 139.95 ? 99  TYR E CE2   1 
ATOM   3681  C CZ    . TYR E 1 100 ? 147.906 161.967 165.264 1.00 139.95 ? 99  TYR E CZ    1 
ATOM   3682  O OH    . TYR E 1 100 ? 147.161 162.709 164.384 1.00 139.95 ? 99  TYR E OH    1 
ATOM   3683  N N     . LEU E 1 101 ? 150.466 161.966 170.095 1.00 138.98 ? 100 LEU E N     1 
ATOM   3684  C CA    . LEU E 1 101 ? 150.131 163.303 170.559 1.00 138.98 ? 100 LEU E CA    1 
ATOM   3685  C C     . LEU E 1 101 ? 151.362 164.091 170.970 1.00 138.98 ? 100 LEU E C     1 
ATOM   3686  O O     . LEU E 1 101 ? 151.382 165.315 170.820 1.00 138.98 ? 100 LEU E O     1 
ATOM   3687  C CB    . LEU E 1 101 ? 149.162 163.222 171.724 1.00 138.98 ? 100 LEU E CB    1 
ATOM   3688  C CG    . LEU E 1 101 ? 147.690 163.139 171.368 1.00 138.98 ? 100 LEU E CG    1 
ATOM   3689  C CD1   . LEU E 1 101 ? 146.871 163.436 172.593 1.00 138.98 ? 100 LEU E CD1   1 
ATOM   3690  C CD2   . LEU E 1 101 ? 147.353 164.107 170.270 1.00 138.98 ? 100 LEU E CD2   1 
ATOM   3691  N N     . VAL E 1 102 ? 152.398 163.418 171.467 1.00 141.14 ? 101 VAL E N     1 
ATOM   3692  C CA    . VAL E 1 102 ? 153.614 164.127 171.838 1.00 141.14 ? 101 VAL E CA    1 
ATOM   3693  C C     . VAL E 1 102 ? 154.340 164.630 170.599 1.00 141.14 ? 101 VAL E C     1 
ATOM   3694  O O     . VAL E 1 102 ? 154.796 165.781 170.563 1.00 141.14 ? 101 VAL E O     1 
ATOM   3695  C CB    . VAL E 1 102 ? 154.494 163.226 172.718 1.00 141.14 ? 101 VAL E CB    1 
ATOM   3696  C CG1   . VAL E 1 102 ? 155.940 163.657 172.690 1.00 141.14 ? 101 VAL E CG1   1 
ATOM   3697  C CG2   . VAL E 1 102 ? 153.992 163.287 174.134 1.00 141.14 ? 101 VAL E CG2   1 
ATOM   3698  N N     . ALA E 1 103 ? 154.410 163.807 169.546 1.00 145.24 ? 102 ALA E N     1 
ATOM   3699  C CA    . ALA E 1 103 ? 154.998 164.281 168.295 1.00 145.24 ? 102 ALA E CA    1 
ATOM   3700  C C     . ALA E 1 103 ? 154.174 165.401 167.675 1.00 145.24 ? 102 ALA E C     1 
ATOM   3701  O O     . ALA E 1 103 ? 154.741 166.359 167.124 1.00 145.24 ? 102 ALA E O     1 
ATOM   3702  C CB    . ALA E 1 103 ? 155.142 163.129 167.308 1.00 145.24 ? 102 ALA E CB    1 
ATOM   3703  N N     . LEU E 1 104 ? 152.849 165.323 167.805 1.00 143.59 ? 103 LEU E N     1 
ATOM   3704  C CA    . LEU E 1 104 ? 151.990 166.384 167.301 1.00 143.59 ? 103 LEU E CA    1 
ATOM   3705  C C     . LEU E 1 104 ? 152.210 167.690 168.043 1.00 143.59 ? 103 LEU E C     1 
ATOM   3706  O O     . LEU E 1 104 ? 152.272 168.754 167.421 1.00 143.59 ? 103 LEU E O     1 
ATOM   3707  C CB    . LEU E 1 104 ? 150.536 165.976 167.412 1.00 143.59 ? 103 LEU E CB    1 
ATOM   3708  C CG    . LEU E 1 104 ? 149.667 166.848 166.536 1.00 143.59 ? 103 LEU E CG    1 
ATOM   3709  C CD1   . LEU E 1 104 ? 149.978 166.538 165.101 1.00 143.59 ? 103 LEU E CD1   1 
ATOM   3710  C CD2   . LEU E 1 104 ? 148.236 166.572 166.825 1.00 143.59 ? 103 LEU E CD2   1 
ATOM   3711  N N     . PHE E 1 105 ? 152.344 167.635 169.366 1.00 148.83 ? 104 PHE E N     1 
ATOM   3712  C CA    . PHE E 1 105 ? 152.549 168.865 170.117 1.00 148.83 ? 104 PHE E CA    1 
ATOM   3713  C C     . PHE E 1 105 ? 153.940 169.424 169.909 1.00 148.83 ? 104 PHE E C     1 
ATOM   3714  O O     . PHE E 1 105 ? 154.118 170.643 169.957 1.00 148.83 ? 104 PHE E O     1 
ATOM   3715  C CB    . PHE E 1 105 ? 152.293 168.633 171.590 1.00 148.83 ? 104 PHE E CB    1 
ATOM   3716  C CG    . PHE E 1 105 ? 150.867 168.755 171.957 1.00 148.83 ? 104 PHE E CG    1 
ATOM   3717  C CD1   . PHE E 1 105 ? 150.091 169.744 171.399 1.00 148.83 ? 104 PHE E CD1   1 
ATOM   3718  C CD2   . PHE E 1 105 ? 150.288 167.866 172.837 1.00 148.83 ? 104 PHE E CD2   1 
ATOM   3719  C CE1   . PHE E 1 105 ? 148.764 169.861 171.728 1.00 148.83 ? 104 PHE E CE1   1 
ATOM   3720  C CE2   . PHE E 1 105 ? 148.961 167.976 173.172 1.00 148.83 ? 104 PHE E CE2   1 
ATOM   3721  C CZ    . PHE E 1 105 ? 148.198 168.974 172.615 1.00 148.83 ? 104 PHE E CZ    1 
ATOM   3722  N N     . GLU E 1 106 ? 154.920 168.563 169.643 1.00 158.74 ? 105 GLU E N     1 
ATOM   3723  C CA    . GLU E 1 106 ? 156.252 169.044 169.296 1.00 158.74 ? 105 GLU E CA    1 
ATOM   3724  C C     . GLU E 1 106 ? 156.230 169.825 167.990 1.00 158.74 ? 105 GLU E C     1 
ATOM   3725  O O     . GLU E 1 106 ? 156.766 170.939 167.908 1.00 158.74 ? 105 GLU E O     1 
ATOM   3726  C CB    . GLU E 1 106 ? 157.218 167.869 169.201 1.00 158.74 ? 105 GLU E CB    1 
ATOM   3727  C CG    . GLU E 1 106 ? 158.472 168.156 168.410 1.00 158.74 ? 105 GLU E CG    1 
ATOM   3728  C CD    . GLU E 1 106 ? 159.436 166.989 168.416 1.00 158.74 ? 105 GLU E CD    1 
ATOM   3729  O OE1   . GLU E 1 106 ? 159.262 166.078 169.251 1.00 158.74 ? 105 GLU E OE1   1 
ATOM   3730  O OE2   . GLU E 1 106 ? 160.369 166.980 167.588 1.00 158.74 ? 105 GLU E OE2   1 
ATOM   3731  N N     . ASP E 1 107 ? 155.572 169.277 166.967 1.00 158.63 ? 106 ASP E N     1 
ATOM   3732  C CA    . ASP E 1 107 ? 155.529 169.982 165.690 1.00 158.63 ? 106 ASP E CA    1 
ATOM   3733  C C     . ASP E 1 107 ? 154.623 171.207 165.742 1.00 158.63 ? 106 ASP E C     1 
ATOM   3734  O O     . ASP E 1 107 ? 154.894 172.205 165.066 1.00 158.63 ? 106 ASP E O     1 
ATOM   3735  C CB    . ASP E 1 107 ? 155.101 169.019 164.596 1.00 158.63 ? 106 ASP E CB    1 
ATOM   3736  C CG    . ASP E 1 107 ? 155.994 167.800 164.533 1.00 158.63 ? 106 ASP E CG    1 
ATOM   3737  O OD1   . ASP E 1 107 ? 157.083 167.840 165.141 1.00 158.63 ? 106 ASP E OD1   1 
ATOM   3738  O OD2   . ASP E 1 107 ? 155.614 166.803 163.885 1.00 158.63 ? 106 ASP E OD2   1 
ATOM   3739  N N     . THR E 1 108 ? 153.585 171.174 166.573 1.00 154.07 ? 107 THR E N     1 
ATOM   3740  C CA    . THR E 1 108 ? 152.758 172.355 166.781 1.00 154.07 ? 107 THR E CA    1 
ATOM   3741  C C     . THR E 1 108 ? 153.541 173.458 167.476 1.00 154.07 ? 107 THR E C     1 
ATOM   3742  O O     . THR E 1 108 ? 153.384 174.642 167.150 1.00 154.07 ? 107 THR E O     1 
ATOM   3743  C CB    . THR E 1 108 ? 151.534 171.964 167.594 1.00 154.07 ? 107 THR E CB    1 
ATOM   3744  O OG1   . THR E 1 108 ? 150.837 170.932 166.897 1.00 154.07 ? 107 THR E OG1   1 
ATOM   3745  C CG2   . THR E 1 108 ? 150.602 173.122 167.776 1.00 154.07 ? 107 THR E CG2   1 
ATOM   3746  N N     . ASN E 1 109 ? 154.402 173.084 168.420 1.00 149.49 ? 108 ASN E N     1 
ATOM   3747  C CA    . ASN E 1 109 ? 155.250 174.064 169.079 1.00 149.49 ? 108 ASN E CA    1 
ATOM   3748  C C     . ASN E 1 109 ? 156.243 174.669 168.105 1.00 149.49 ? 108 ASN E C     1 
ATOM   3749  O O     . ASN E 1 109 ? 156.511 175.875 168.152 1.00 149.49 ? 108 ASN E O     1 
ATOM   3750  C CB    . ASN E 1 109 ? 155.986 173.413 170.235 1.00 149.49 ? 108 ASN E CB    1 
ATOM   3751  C CG    . ASN E 1 109 ? 157.122 174.244 170.714 1.00 149.49 ? 108 ASN E CG    1 
ATOM   3752  O OD1   . ASN E 1 109 ? 156.927 175.372 171.148 1.00 149.49 ? 108 ASN E OD1   1 
ATOM   3753  N ND2   . ASN E 1 109 ? 158.328 173.714 170.613 1.00 149.49 ? 108 ASN E ND2   1 
ATOM   3754  N N     . LEU E 1 110 ? 156.783 173.840 167.207 1.00 148.19 ? 109 LEU E N     1 
ATOM   3755  C CA    . LEU E 1 110 ? 157.620 174.338 166.118 1.00 148.19 ? 109 LEU E CA    1 
ATOM   3756  C C     . LEU E 1 110 ? 156.882 175.353 165.261 1.00 148.19 ? 109 LEU E C     1 
ATOM   3757  O O     . LEU E 1 110 ? 157.443 176.395 164.893 1.00 148.19 ? 109 LEU E O     1 
ATOM   3758  C CB    . LEU E 1 110 ? 158.075 173.180 165.249 1.00 148.19 ? 109 LEU E CB    1 
ATOM   3759  C CG    . LEU E 1 110 ? 159.492 172.713 165.485 1.00 148.19 ? 109 LEU E CG    1 
ATOM   3760  C CD1   . LEU E 1 110 ? 159.764 171.561 164.567 1.00 148.19 ? 109 LEU E CD1   1 
ATOM   3761  C CD2   . LEU E 1 110 ? 160.428 173.853 165.209 1.00 148.19 ? 109 LEU E CD2   1 
ATOM   3762  N N     . CYS E 1 111 ? 155.615 175.071 164.961 1.00 153.51 ? 110 CYS E N     1 
ATOM   3763  C CA    . CYS E 1 111 ? 154.801 175.979 164.161 1.00 153.51 ? 110 CYS E CA    1 
ATOM   3764  C C     . CYS E 1 111 ? 154.594 177.316 164.853 1.00 153.51 ? 110 CYS E C     1 
ATOM   3765  O O     . CYS E 1 111 ? 154.858 178.376 164.273 1.00 153.51 ? 110 CYS E O     1 
ATOM   3766  C CB    . CYS E 1 111 ? 153.453 175.338 163.869 1.00 153.51 ? 110 CYS E CB    1 
ATOM   3767  S SG    . CYS E 1 111 ? 152.319 176.459 163.065 1.00 153.51 ? 110 CYS E SG    1 
ATOM   3768  N N     . ALA E 1 112 ? 154.138 177.288 166.094 1.00 150.39 ? 111 ALA E N     1 
ATOM   3769  C CA    . ALA E 1 112 ? 153.845 178.538 166.773 1.00 150.39 ? 111 ALA E CA    1 
ATOM   3770  C C     . ALA E 1 112 ? 155.091 179.275 167.234 1.00 150.39 ? 111 ALA E C     1 
ATOM   3771  O O     . ALA E 1 112 ? 154.983 180.430 167.647 1.00 150.39 ? 111 ALA E O     1 
ATOM   3772  C CB    . ALA E 1 112 ? 152.926 178.292 167.960 1.00 150.39 ? 111 ALA E CB    1 
ATOM   3773  N N     . ILE E 1 113 ? 156.262 178.651 167.185 1.00 149.01 ? 112 ILE E N     1 
ATOM   3774  C CA    . ILE E 1 113 ? 157.489 179.418 167.323 1.00 149.01 ? 112 ILE E CA    1 
ATOM   3775  C C     . ILE E 1 113 ? 157.884 180.070 166.008 1.00 149.01 ? 112 ILE E C     1 
ATOM   3776  O O     . ILE E 1 113 ? 158.284 181.241 166.002 1.00 149.01 ? 112 ILE E O     1 
ATOM   3777  C CB    . ILE E 1 113 ? 158.608 178.527 167.879 1.00 149.01 ? 112 ILE E CB    1 
ATOM   3778  C CG1   . ILE E 1 113 ? 158.371 178.276 169.360 1.00 149.01 ? 112 ILE E CG1   1 
ATOM   3779  C CG2   . ILE E 1 113 ? 159.979 179.125 167.682 1.00 149.01 ? 112 ILE E CG2   1 
ATOM   3780  C CD1   . ILE E 1 113 ? 159.323 177.284 169.949 1.00 149.01 ? 112 ILE E CD1   1 
ATOM   3781  N N     . HIS E 1 114 ? 157.731 179.356 164.886 1.00 150.57 ? 113 HIS E N     1 
ATOM   3782  C CA    . HIS E 1 114 ? 158.010 179.945 163.577 1.00 150.57 ? 113 HIS E CA    1 
ATOM   3783  C C     . HIS E 1 114 ? 157.097 181.124 163.278 1.00 150.57 ? 113 HIS E C     1 
ATOM   3784  O O     . HIS E 1 114 ? 157.523 182.093 162.644 1.00 150.57 ? 113 HIS E O     1 
ATOM   3785  C CB    . HIS E 1 114 ? 157.871 178.887 162.485 1.00 150.57 ? 113 HIS E CB    1 
ATOM   3786  C CG    . HIS E 1 114 ? 157.615 179.453 161.125 1.00 150.57 ? 113 HIS E CG    1 
ATOM   3787  N ND1   . HIS E 1 114 ? 158.628 179.909 160.311 1.00 150.57 ? 113 HIS E ND1   1 
ATOM   3788  C CD2   . HIS E 1 114 ? 156.465 179.643 160.438 1.00 150.57 ? 113 HIS E CD2   1 
ATOM   3789  C CE1   . HIS E 1 114 ? 158.113 180.351 159.179 1.00 150.57 ? 113 HIS E CE1   1 
ATOM   3790  N NE2   . HIS E 1 114 ? 156.803 180.201 159.231 1.00 150.57 ? 113 HIS E NE2   1 
ATOM   3791  N N     . ALA E 1 115 ? 155.868 181.096 163.778 1.00 149.82 ? 114 ALA E N     1 
ATOM   3792  C CA    . ALA E 1 115 ? 154.945 182.203 163.576 1.00 149.82 ? 114 ALA E CA    1 
ATOM   3793  C C     . ALA E 1 115 ? 155.131 183.334 164.581 1.00 149.82 ? 114 ALA E C     1 
ATOM   3794  O O     . ALA E 1 115 ? 154.176 184.092 164.787 1.00 149.82 ? 114 ALA E O     1 
ATOM   3795  C CB    . ALA E 1 115 ? 153.503 181.702 163.625 1.00 149.82 ? 114 ALA E CB    1 
ATOM   3796  N N     . LYS E 1 116 ? 156.310 183.428 165.204 1.00 152.79 ? 115 LYS E N     1 
ATOM   3797  C CA    . LYS E 1 116 ? 156.704 184.507 166.114 1.00 152.79 ? 115 LYS E CA    1 
ATOM   3798  C C     . LYS E 1 116 ? 155.772 184.591 167.319 1.00 152.79 ? 115 LYS E C     1 
ATOM   3799  O O     . LYS E 1 116 ? 155.207 185.634 167.637 1.00 152.79 ? 115 LYS E O     1 
ATOM   3800  C CB    . LYS E 1 116 ? 156.788 185.851 165.387 1.00 152.79 ? 115 LYS E CB    1 
ATOM   3801  C CG    . LYS E 1 116 ? 157.933 185.944 164.405 1.00 152.79 ? 115 LYS E CG    1 
ATOM   3802  C CD    . LYS E 1 116 ? 159.266 185.976 165.123 1.00 152.79 ? 115 LYS E CD    1 
ATOM   3803  C CE    . LYS E 1 116 ? 160.358 186.498 164.211 1.00 152.79 ? 115 LYS E CE    1 
ATOM   3804  N NZ    . LYS E 1 116 ? 159.992 187.820 163.637 1.00 152.79 ? 115 LYS E NZ    1 
ATOM   3805  N N     . ARG E 1 117 ? 155.617 183.456 167.984 1.00 155.78 ? 116 ARG E N     1 
ATOM   3806  C CA    . ARG E 1 117 ? 154.854 183.393 169.213 1.00 155.78 ? 116 ARG E CA    1 
ATOM   3807  C C     . ARG E 1 117 ? 155.509 182.396 170.149 1.00 155.78 ? 116 ARG E C     1 
ATOM   3808  O O     . ARG E 1 117 ? 156.491 181.735 169.807 1.00 155.78 ? 116 ARG E O     1 
ATOM   3809  C CB    . ARG E 1 117 ? 153.410 182.984 168.968 1.00 155.78 ? 116 ARG E CB    1 
ATOM   3810  C CG    . ARG E 1 117 ? 152.468 184.114 168.745 1.00 155.78 ? 116 ARG E CG    1 
ATOM   3811  C CD    . ARG E 1 117 ? 151.084 183.552 168.693 1.00 155.78 ? 116 ARG E CD    1 
ATOM   3812  N NE    . ARG E 1 117 ? 150.980 182.584 167.614 1.00 155.78 ? 116 ARG E NE    1 
ATOM   3813  C CZ    . ARG E 1 117 ? 150.064 181.630 167.562 1.00 155.78 ? 116 ARG E CZ    1 
ATOM   3814  N NH1   . ARG E 1 117 ? 149.181 181.512 168.534 1.00 155.78 ? 116 ARG E NH1   1 
ATOM   3815  N NH2   . ARG E 1 117 ? 150.039 180.793 166.542 1.00 155.78 ? 116 ARG E NH2   1 
ATOM   3816  N N     . VAL E 1 118 ? 154.934 182.289 171.341 1.00 153.44 ? 117 VAL E N     1 
ATOM   3817  C CA    . VAL E 1 118 ? 155.312 181.291 172.324 1.00 153.44 ? 117 VAL E CA    1 
ATOM   3818  C C     . VAL E 1 118 ? 154.158 180.344 172.618 1.00 153.44 ? 117 VAL E C     1 
ATOM   3819  O O     . VAL E 1 118 ? 154.329 179.121 172.618 1.00 153.44 ? 117 VAL E O     1 
ATOM   3820  C CB    . VAL E 1 118 ? 155.806 181.978 173.615 1.00 153.44 ? 117 VAL E CB    1 
ATOM   3821  C CG1   . VAL E 1 118 ? 155.809 181.037 174.781 1.00 153.44 ? 117 VAL E CG1   1 
ATOM   3822  C CG2   . VAL E 1 118 ? 157.182 182.550 173.398 1.00 153.44 ? 117 VAL E CG2   1 
ATOM   3823  N N     . THR E 1 119 ? 152.968 180.896 172.808 1.00 153.96 ? 118 THR E N     1 
ATOM   3824  C CA    . THR E 1 119 ? 151.762 180.121 173.024 1.00 153.96 ? 118 THR E CA    1 
ATOM   3825  C C     . THR E 1 119 ? 151.399 179.354 171.762 1.00 153.96 ? 118 THR E C     1 
ATOM   3826  O O     . THR E 1 119 ? 151.710 179.779 170.651 1.00 153.96 ? 118 THR E O     1 
ATOM   3827  C CB    . THR E 1 119 ? 150.633 181.070 173.391 1.00 153.96 ? 118 THR E CB    1 
ATOM   3828  O OG1   . THR E 1 119 ? 151.172 182.148 174.155 1.00 153.96 ? 118 THR E OG1   1 
ATOM   3829  C CG2   . THR E 1 119 ? 149.646 180.380 174.238 1.00 153.96 ? 118 THR E CG2   1 
ATOM   3830  N N     . ILE E 1 120 ? 150.741 178.210 171.929 1.00 149.55 ? 119 ILE E N     1 
ATOM   3831  C CA    . ILE E 1 120 ? 150.217 177.445 170.806 1.00 149.55 ? 119 ILE E CA    1 
ATOM   3832  C C     . ILE E 1 120 ? 148.703 177.582 170.791 1.00 149.55 ? 119 ILE E C     1 
ATOM   3833  O O     . ILE E 1 120 ? 148.072 177.753 171.838 1.00 149.55 ? 119 ILE E O     1 
ATOM   3834  C CB    . ILE E 1 120 ? 150.641 175.967 170.857 1.00 149.55 ? 119 ILE E CB    1 
ATOM   3835  C CG1   . ILE E 1 120 ? 150.219 175.327 172.169 1.00 149.55 ? 119 ILE E CG1   1 
ATOM   3836  C CG2   . ILE E 1 120 ? 152.128 175.845 170.670 1.00 149.55 ? 119 ILE E CG2   1 
ATOM   3837  C CD1   . ILE E 1 120 ? 150.408 173.845 172.178 1.00 149.55 ? 119 ILE E CD1   1 
ATOM   3838  N N     . MET E 1 121 ? 148.126 177.515 169.600 1.00 158.22 ? 120 MET E N     1 
ATOM   3839  C CA    . MET E 1 121 ? 146.734 177.869 169.363 1.00 158.22 ? 120 MET E CA    1 
ATOM   3840  C C     . MET E 1 121 ? 146.188 176.922 168.298 1.00 158.22 ? 120 MET E C     1 
ATOM   3841  O O     . MET E 1 121 ? 146.993 176.252 167.641 1.00 158.22 ? 120 MET E O     1 
ATOM   3842  C CB    . MET E 1 121 ? 146.668 179.344 168.959 1.00 158.22 ? 120 MET E CB    1 
ATOM   3843  C CG    . MET E 1 121 ? 146.454 180.262 170.140 1.00 158.22 ? 120 MET E CG    1 
ATOM   3844  S SD    . MET E 1 121 ? 146.805 181.985 169.784 1.00 158.22 ? 120 MET E SD    1 
ATOM   3845  C CE    . MET E 1 121 ? 145.819 182.212 168.316 1.00 158.22 ? 120 MET E CE    1 
ATOM   3846  N N     . PRO E 1 122 ? 144.860 176.795 168.117 1.00 153.94 ? 121 PRO E N     1 
ATOM   3847  C CA    . PRO E 1 122 ? 144.337 175.764 167.198 1.00 153.94 ? 121 PRO E CA    1 
ATOM   3848  C C     . PRO E 1 122 ? 144.736 175.921 165.742 1.00 153.94 ? 121 PRO E C     1 
ATOM   3849  O O     . PRO E 1 122 ? 144.750 174.915 165.016 1.00 153.94 ? 121 PRO E O     1 
ATOM   3850  C CB    . PRO E 1 122 ? 142.822 175.894 167.358 1.00 153.94 ? 121 PRO E CB    1 
ATOM   3851  C CG    . PRO E 1 122 ? 142.650 176.393 168.716 1.00 153.94 ? 121 PRO E CG    1 
ATOM   3852  C CD    . PRO E 1 122 ? 143.774 177.335 168.957 1.00 153.94 ? 121 PRO E CD    1 
ATOM   3853  N N     . LYS E 1 123 ? 145.083 177.127 165.294 1.00 154.92 ? 122 LYS E N     1 
ATOM   3854  C CA    . LYS E 1 123 ? 145.559 177.272 163.927 1.00 154.92 ? 122 LYS E CA    1 
ATOM   3855  C C     . LYS E 1 123 ? 146.910 176.597 163.735 1.00 154.92 ? 122 LYS E C     1 
ATOM   3856  O O     . LYS E 1 123 ? 147.184 176.075 162.651 1.00 154.92 ? 122 LYS E O     1 
ATOM   3857  C CB    . LYS E 1 123 ? 145.618 178.747 163.539 1.00 154.92 ? 122 LYS E CB    1 
ATOM   3858  C CG    . LYS E 1 123 ? 146.578 179.583 164.347 1.00 154.92 ? 122 LYS E CG    1 
ATOM   3859  C CD    . LYS E 1 123 ? 146.315 181.052 164.141 1.00 154.92 ? 122 LYS E CD    1 
ATOM   3860  C CE    . LYS E 1 123 ? 144.997 181.439 164.766 1.00 154.92 ? 122 LYS E CE    1 
ATOM   3861  N NZ    . LYS E 1 123 ? 144.941 182.895 165.043 1.00 154.92 ? 122 LYS E NZ    1 
ATOM   3862  N N     . ASP E 1 124 ? 147.719 176.516 164.793 1.00 161.24 ? 123 ASP E N     1 
ATOM   3863  C CA    . ASP E 1 124 ? 149.025 175.882 164.683 1.00 161.24 ? 123 ASP E CA    1 
ATOM   3864  C C     . ASP E 1 124 ? 148.892 174.378 164.527 1.00 161.24 ? 123 ASP E C     1 
ATOM   3865  O O     . ASP E 1 124 ? 149.562 173.771 163.686 1.00 161.24 ? 123 ASP E O     1 
ATOM   3866  C CB    . ASP E 1 124 ? 149.870 176.205 165.905 1.00 161.24 ? 123 ASP E CB    1 
ATOM   3867  C CG    . ASP E 1 124 ? 149.721 177.626 166.349 1.00 161.24 ? 123 ASP E CG    1 
ATOM   3868  O OD1   . ASP E 1 124 ? 149.849 178.525 165.498 1.00 161.24 ? 123 ASP E OD1   1 
ATOM   3869  O OD2   . ASP E 1 124 ? 149.491 177.854 167.551 1.00 161.24 ? 123 ASP E OD2   1 
ATOM   3870  N N     . ILE E 1 125 ? 148.027 173.756 165.325 1.00 153.30 ? 124 ILE E N     1 
ATOM   3871  C CA    . ILE E 1 125 ? 147.877 172.311 165.236 1.00 153.30 ? 124 ILE E CA    1 
ATOM   3872  C C     . ILE E 1 125 ? 147.125 171.935 163.965 1.00 153.30 ? 124 ILE E C     1 
ATOM   3873  O O     . ILE E 1 125 ? 147.401 170.887 163.359 1.00 153.30 ? 124 ILE E O     1 
ATOM   3874  C CB    . ILE E 1 125 ? 147.216 171.778 166.526 1.00 153.30 ? 124 ILE E CB    1 
ATOM   3875  C CG1   . ILE E 1 125 ? 147.087 170.263 166.521 1.00 153.30 ? 124 ILE E CG1   1 
ATOM   3876  C CG2   . ILE E 1 125 ? 145.874 172.391 166.754 1.00 153.30 ? 124 ILE E CG2   1 
ATOM   3877  C CD1   . ILE E 1 125 ? 146.569 169.726 167.821 1.00 153.30 ? 124 ILE E CD1   1 
ATOM   3878  N N     . GLN E 1 126 ? 146.228 172.808 163.492 1.00 153.52 ? 125 GLN E N     1 
ATOM   3879  C CA    . GLN E 1 126 ? 145.589 172.558 162.208 1.00 153.52 ? 125 GLN E CA    1 
ATOM   3880  C C     . GLN E 1 126 ? 146.589 172.657 161.067 1.00 153.52 ? 125 GLN E C     1 
ATOM   3881  O O     . GLN E 1 126 ? 146.548 171.852 160.130 1.00 153.52 ? 125 GLN E O     1 
ATOM   3882  C CB    . GLN E 1 126 ? 144.436 173.526 162.002 1.00 153.52 ? 125 GLN E CB    1 
ATOM   3883  C CG    . GLN E 1 126 ? 143.194 173.124 162.741 1.00 153.52 ? 125 GLN E CG    1 
ATOM   3884  C CD    . GLN E 1 126 ? 142.064 174.086 162.505 1.00 153.52 ? 125 GLN E CD    1 
ATOM   3885  O OE1   . GLN E 1 126 ? 141.967 174.691 161.441 1.00 153.52 ? 125 GLN E OE1   1 
ATOM   3886  N NE2   . GLN E 1 126 ? 141.202 174.243 163.500 1.00 153.52 ? 125 GLN E NE2   1 
ATOM   3887  N N     . LEU E 1 127 ? 147.528 173.601 161.156 1.00 153.51 ? 126 LEU E N     1 
ATOM   3888  C CA    . LEU E 1 127 ? 148.591 173.676 160.164 1.00 153.51 ? 126 LEU E CA    1 
ATOM   3889  C C     . LEU E 1 127 ? 149.513 172.470 160.252 1.00 153.51 ? 126 LEU E C     1 
ATOM   3890  O O     . LEU E 1 127 ? 149.979 171.968 159.225 1.00 153.51 ? 126 LEU E O     1 
ATOM   3891  C CB    . LEU E 1 127 ? 149.389 174.964 160.337 1.00 153.51 ? 126 LEU E CB    1 
ATOM   3892  C CG    . LEU E 1 127 ? 150.476 175.120 159.275 1.00 153.51 ? 126 LEU E CG    1 
ATOM   3893  C CD1   . LEU E 1 127 ? 149.836 175.262 157.915 1.00 153.51 ? 126 LEU E CD1   1 
ATOM   3894  C CD2   . LEU E 1 127 ? 151.415 176.253 159.548 1.00 153.51 ? 126 LEU E CD2   1 
ATOM   3895  N N     . ALA E 1 128 ? 149.765 171.976 161.465 1.00 157.84 ? 127 ALA E N     1 
ATOM   3896  C CA    . ALA E 1 128 ? 150.656 170.833 161.634 1.00 157.84 ? 127 ALA E CA    1 
ATOM   3897  C C     . ALA E 1 128 ? 150.071 169.576 161.009 1.00 157.84 ? 127 ALA E C     1 
ATOM   3898  O O     . ALA E 1 128 ? 150.768 168.847 160.294 1.00 157.84 ? 127 ALA E O     1 
ATOM   3899  C CB    . ALA E 1 128 ? 150.941 170.608 163.113 1.00 157.84 ? 127 ALA E CB    1 
ATOM   3900  N N     . ARG E 1 129 ? 148.782 169.335 161.219 1.00 163.39 ? 128 ARG E N     1 
ATOM   3901  C CA    . ARG E 1 129 ? 148.162 168.194 160.565 1.00 163.39 ? 128 ARG E CA    1 
ATOM   3902  C C     . ARG E 1 129 ? 147.931 168.414 159.077 1.00 163.39 ? 128 ARG E C     1 
ATOM   3903  O O     . ARG E 1 129 ? 147.905 167.436 158.324 1.00 163.39 ? 128 ARG E O     1 
ATOM   3904  C CB    . ARG E 1 129 ? 146.847 167.847 161.245 1.00 163.39 ? 128 ARG E CB    1 
ATOM   3905  C CG    . ARG E 1 129 ? 147.047 167.260 162.603 1.00 163.39 ? 128 ARG E CG    1 
ATOM   3906  C CD    . ARG E 1 129 ? 145.744 167.146 163.322 1.00 163.39 ? 128 ARG E CD    1 
ATOM   3907  N NE    . ARG E 1 129 ? 144.917 166.090 162.765 1.00 163.39 ? 128 ARG E NE    1 
ATOM   3908  C CZ    . ARG E 1 129 ? 143.761 166.305 162.154 1.00 163.39 ? 128 ARG E CZ    1 
ATOM   3909  N NH1   . ARG E 1 129 ? 143.304 167.542 162.029 1.00 163.39 ? 128 ARG E NH1   1 
ATOM   3910  N NH2   . ARG E 1 129 ? 143.062 165.288 161.673 1.00 163.39 ? 128 ARG E NH2   1 
ATOM   3911  N N     . ARG E 1 130 ? 147.772 169.660 158.631 1.00 163.57 ? 129 ARG E N     1 
ATOM   3912  C CA    . ARG E 1 130 ? 147.624 169.904 157.203 1.00 163.57 ? 129 ARG E CA    1 
ATOM   3913  C C     . ARG E 1 130 ? 148.937 169.696 156.460 1.00 163.57 ? 129 ARG E C     1 
ATOM   3914  O O     . ARG E 1 130 ? 148.953 169.096 155.382 1.00 163.57 ? 129 ARG E O     1 
ATOM   3915  C CB    . ARG E 1 130 ? 147.094 171.315 156.975 1.00 163.57 ? 129 ARG E CB    1 
ATOM   3916  C CG    . ARG E 1 130 ? 147.044 171.732 155.525 1.00 163.57 ? 129 ARG E CG    1 
ATOM   3917  C CD    . ARG E 1 130 ? 146.113 170.844 154.721 1.00 163.57 ? 129 ARG E CD    1 
ATOM   3918  N NE    . ARG E 1 130 ? 145.708 171.473 153.468 1.00 163.57 ? 129 ARG E NE    1 
ATOM   3919  C CZ    . ARG E 1 130 ? 144.681 172.310 153.351 1.00 163.57 ? 129 ARG E CZ    1 
ATOM   3920  N NH1   . ARG E 1 130 ? 143.950 172.620 154.414 1.00 163.57 ? 129 ARG E NH1   1 
ATOM   3921  N NH2   . ARG E 1 130 ? 144.384 172.836 152.172 1.00 163.57 ? 129 ARG E NH2   1 
ATOM   3922  N N     . ILE E 1 131 ? 150.042 170.177 157.023 1.00 152.87 ? 130 ILE E N     1 
ATOM   3923  C CA    . ILE E 1 131 ? 151.341 170.001 156.391 1.00 152.87 ? 130 ILE E CA    1 
ATOM   3924  C C     . ILE E 1 131 ? 151.776 168.551 156.473 1.00 152.87 ? 130 ILE E C     1 
ATOM   3925  O O     . ILE E 1 131 ? 152.260 167.980 155.488 1.00 152.87 ? 130 ILE E O     1 
ATOM   3926  C CB    . ILE E 1 131 ? 152.377 170.937 157.033 1.00 152.87 ? 130 ILE E CB    1 
ATOM   3927  C CG1   . ILE E 1 131 ? 152.042 172.388 156.717 1.00 152.87 ? 130 ILE E CG1   1 
ATOM   3928  C CG2   . ILE E 1 131 ? 153.770 170.622 156.540 1.00 152.87 ? 130 ILE E CG2   1 
ATOM   3929  C CD1   . ILE E 1 131 ? 153.065 173.374 157.224 1.00 152.87 ? 130 ILE E CD1   1 
ATOM   3930  N N     . ARG E 1 132 ? 151.583 167.918 157.632 1.00 159.88 ? 131 ARG E N     1 
ATOM   3931  C CA    . ARG E 1 132 ? 152.020 166.538 157.779 1.00 159.88 ? 131 ARG E CA    1 
ATOM   3932  C C     . ARG E 1 132 ? 151.163 165.572 156.974 1.00 159.88 ? 131 ARG E C     1 
ATOM   3933  O O     . ARG E 1 132 ? 151.644 164.498 156.601 1.00 159.88 ? 131 ARG E O     1 
ATOM   3934  C CB    . ARG E 1 132 ? 152.024 166.134 159.250 1.00 159.88 ? 131 ARG E CB    1 
ATOM   3935  C CG    . ARG E 1 132 ? 153.008 165.019 159.535 1.00 159.88 ? 131 ARG E CG    1 
ATOM   3936  C CD    . ARG E 1 132 ? 152.815 164.415 160.898 1.00 159.88 ? 131 ARG E CD    1 
ATOM   3937  N NE    . ARG E 1 132 ? 153.193 165.322 161.965 1.00 159.88 ? 131 ARG E NE    1 
ATOM   3938  C CZ    . ARG E 1 132 ? 152.883 165.123 163.238 1.00 159.88 ? 131 ARG E CZ    1 
ATOM   3939  N NH1   . ARG E 1 132 ? 152.182 164.055 163.585 1.00 159.88 ? 131 ARG E NH1   1 
ATOM   3940  N NH2   . ARG E 1 132 ? 153.268 165.989 164.160 1.00 159.88 ? 131 ARG E NH2   1 
ATOM   3941  N N     . GLY E 1 133 ? 149.925 165.936 156.673 1.00 168.87 ? 132 GLY E N     1 
ATOM   3942  C CA    . GLY E 1 133 ? 149.109 165.151 155.780 1.00 168.87 ? 132 GLY E CA    1 
ATOM   3943  C C     . GLY E 1 133 ? 148.056 164.295 156.436 1.00 168.87 ? 132 GLY E C     1 
ATOM   3944  O O     . GLY E 1 133 ? 147.358 163.563 155.729 1.00 168.87 ? 132 GLY E O     1 
ATOM   3945  N N     . GLU E 1 134 ? 147.926 164.347 157.763 1.00 173.98 ? 133 GLU E N     1 
ATOM   3946  C CA    . GLU E 1 134 ? 146.807 163.675 158.412 1.00 173.98 ? 133 GLU E CA    1 
ATOM   3947  C C     . GLU E 1 134 ? 145.491 164.350 158.071 1.00 173.98 ? 133 GLU E C     1 
ATOM   3948  O O     . GLU E 1 134 ? 144.453 163.685 157.994 1.00 173.98 ? 133 GLU E O     1 
ATOM   3949  C CB    . GLU E 1 134 ? 147.006 163.640 159.926 1.00 173.98 ? 133 GLU E CB    1 
ATOM   3950  C CG    . GLU E 1 134 ? 147.854 162.482 160.408 1.00 173.98 ? 133 GLU E CG    1 
ATOM   3951  C CD    . GLU E 1 134 ? 149.326 162.794 160.352 1.00 173.98 ? 133 GLU E CD    1 
ATOM   3952  O OE1   . GLU E 1 134 ? 149.664 163.976 160.161 1.00 173.98 ? 133 GLU E OE1   1 
ATOM   3953  O OE2   . GLU E 1 134 ? 150.144 161.862 160.481 1.00 173.98 ? 133 GLU E OE2   1 
ATOM   3954  N N     . ARG E 1 135 ? 145.512 165.659 157.866 1.00 185.32 ? 134 ARG E N     1 
ATOM   3955  C CA    . ARG E 1 135 ? 144.359 166.388 157.371 1.00 185.32 ? 134 ARG E CA    1 
ATOM   3956  C C     . ARG E 1 135 ? 144.577 166.713 155.902 1.00 185.32 ? 134 ARG E C     1 
ATOM   3957  O O     . ARG E 1 135 ? 145.689 167.063 155.494 1.00 185.32 ? 134 ARG E O     1 
ATOM   3958  C CB    . ARG E 1 135 ? 144.120 167.670 158.176 1.00 185.32 ? 134 ARG E CB    1 
ATOM   3959  C CG    . ARG E 1 135 ? 142.796 168.372 157.882 1.00 185.32 ? 134 ARG E CG    1 
ATOM   3960  C CD    . ARG E 1 135 ? 141.602 167.537 158.339 1.00 185.32 ? 134 ARG E CD    1 
ATOM   3961  N NE    . ARG E 1 135 ? 141.044 166.720 157.261 1.00 185.32 ? 134 ARG E NE    1 
ATOM   3962  C CZ    . ARG E 1 135 ? 140.254 165.667 157.448 1.00 185.32 ? 134 ARG E CZ    1 
ATOM   3963  N NH1   . ARG E 1 135 ? 139.922 165.292 158.674 1.00 185.32 ? 134 ARG E NH1   1 
ATOM   3964  N NH2   . ARG E 1 135 ? 139.799 164.985 156.407 1.00 185.32 ? 134 ARG E NH2   1 
ATOM   3965  N N     . ALA E 1 136 ? 143.521 166.572 155.109 1.00 193.67 ? 135 ALA E N     1 
ATOM   3966  C CA    . ALA E 1 136 ? 143.596 166.845 153.680 1.00 193.67 ? 135 ALA E CA    1 
ATOM   3967  C C     . ALA E 1 136 ? 143.668 168.345 153.426 1.00 193.67 ? 135 ALA E C     1 
ATOM   3968  O O     . ALA E 1 136 ? 144.440 168.810 152.590 1.00 193.67 ? 135 ALA E O     1 
ATOM   3969  C CB    . ALA E 1 136 ? 142.404 166.237 152.959 1.00 193.67 ? 135 ALA E CB    1 
ATOM   3970  O OXT   . ALA E 1 136 ? 142.960 169.127 154.061 1.00 193.67 ? 135 ALA E OXT   1 
ATOM   3971  N N     . LYS F 2 21  ? 125.996 147.619 177.775 1.00 183.75 ? 20  LYS F N     1 
ATOM   3972  C CA    . LYS F 2 21  ? 126.247 148.837 178.537 1.00 183.75 ? 20  LYS F CA    1 
ATOM   3973  C C     . LYS F 2 21  ? 127.152 149.791 177.767 1.00 183.75 ? 20  LYS F C     1 
ATOM   3974  O O     . LYS F 2 21  ? 128.375 149.740 177.890 1.00 183.75 ? 20  LYS F O     1 
ATOM   3975  C CB    . LYS F 2 21  ? 126.869 148.503 179.893 1.00 183.75 ? 20  LYS F CB    1 
ATOM   3976  N N     . VAL F 2 22  ? 126.542 150.661 176.972 1.00 190.92 ? 21  VAL F N     1 
ATOM   3977  C CA    . VAL F 2 22  ? 127.288 151.635 176.186 1.00 190.92 ? 21  VAL F CA    1 
ATOM   3978  C C     . VAL F 2 22  ? 127.710 152.785 177.096 1.00 190.92 ? 21  VAL F C     1 
ATOM   3979  O O     . VAL F 2 22  ? 126.967 153.198 177.996 1.00 190.92 ? 21  VAL F O     1 
ATOM   3980  C CB    . VAL F 2 22  ? 126.442 152.103 174.980 1.00 190.92 ? 21  VAL F CB    1 
ATOM   3981  C CG1   . VAL F 2 22  ? 125.080 152.639 175.416 1.00 190.92 ? 21  VAL F CG1   1 
ATOM   3982  C CG2   . VAL F 2 22  ? 127.185 153.117 174.111 1.00 190.92 ? 21  VAL F CG2   1 
ATOM   3983  N N     . LEU F 2 23  ? 128.930 153.273 176.898 1.00 189.42 ? 22  LEU F N     1 
ATOM   3984  C CA    . LEU F 2 23  ? 129.475 154.351 177.705 1.00 189.42 ? 22  LEU F CA    1 
ATOM   3985  C C     . LEU F 2 23  ? 129.216 155.692 177.028 1.00 189.42 ? 22  LEU F C     1 
ATOM   3986  O O     . LEU F 2 23  ? 129.186 155.792 175.799 1.00 189.42 ? 22  LEU F O     1 
ATOM   3987  C CB    . LEU F 2 23  ? 130.975 154.151 177.925 1.00 189.42 ? 22  LEU F CB    1 
ATOM   3988  C CG    . LEU F 2 23  ? 131.452 152.817 178.511 1.00 189.42 ? 22  LEU F CG    1 
ATOM   3989  C CD1   . LEU F 2 23  ? 131.996 151.903 177.422 1.00 189.42 ? 22  LEU F CD1   1 
ATOM   3990  C CD2   . LEU F 2 23  ? 132.494 153.029 179.595 1.00 189.42 ? 22  LEU F CD2   1 
ATOM   3991  N N     . ARG F 2 24  ? 129.026 156.728 177.844 1.00 185.80 ? 23  ARG F N     1 
ATOM   3992  C CA    . ARG F 2 24  ? 128.644 158.047 177.352 1.00 185.80 ? 23  ARG F CA    1 
ATOM   3993  C C     . ARG F 2 24  ? 129.615 159.094 177.875 1.00 185.80 ? 23  ARG F C     1 
ATOM   3994  O O     . ARG F 2 24  ? 129.809 159.208 179.091 1.00 185.80 ? 23  ARG F O     1 
ATOM   3995  C CB    . ARG F 2 24  ? 127.212 158.395 177.769 1.00 185.80 ? 23  ARG F CB    1 
ATOM   3996  N N     . ASP F 2 25  ? 130.217 159.848 176.946 1.00 177.98 ? 24  ASP F N     1 
ATOM   3997  C CA    . ASP F 2 25  ? 131.078 161.007 177.205 1.00 177.98 ? 24  ASP F CA    1 
ATOM   3998  C C     . ASP F 2 25  ? 132.291 160.635 178.063 1.00 177.98 ? 24  ASP F C     1 
ATOM   3999  O O     . ASP F 2 25  ? 132.445 161.058 179.211 1.00 177.98 ? 24  ASP F O     1 
ATOM   4000  C CB    . ASP F 2 25  ? 130.290 162.160 177.838 1.00 177.98 ? 24  ASP F CB    1 
ATOM   4001  C CG    . ASP F 2 25  ? 131.074 163.456 177.850 1.00 177.98 ? 24  ASP F CG    1 
ATOM   4002  O OD1   . ASP F 2 25  ? 131.285 164.034 176.764 1.00 177.98 ? 24  ASP F OD1   1 
ATOM   4003  O OD2   . ASP F 2 25  ? 131.489 163.886 178.946 1.00 177.98 ? 24  ASP F OD2   1 
ATOM   4004  N N     . ASN F 2 26  ? 133.146 159.806 177.479 1.00 169.22 ? 25  ASN F N     1 
ATOM   4005  C CA    . ASN F 2 26  ? 134.445 159.547 178.072 1.00 169.22 ? 25  ASN F CA    1 
ATOM   4006  C C     . ASN F 2 26  ? 135.550 160.365 177.436 1.00 169.22 ? 25  ASN F C     1 
ATOM   4007  O O     . ASN F 2 26  ? 136.664 160.383 177.965 1.00 169.22 ? 25  ASN F O     1 
ATOM   4008  C CB    . ASN F 2 26  ? 134.797 158.070 177.975 1.00 169.22 ? 25  ASN F CB    1 
ATOM   4009  C CG    . ASN F 2 26  ? 133.840 157.208 178.737 1.00 169.22 ? 25  ASN F CG    1 
ATOM   4010  O OD1   . ASN F 2 26  ? 133.201 157.659 179.686 1.00 169.22 ? 25  ASN F OD1   1 
ATOM   4011  N ND2   . ASN F 2 26  ? 133.758 155.947 178.354 1.00 169.22 ? 25  ASN F ND2   1 
ATOM   4012  N N     . ILE F 2 27  ? 135.276 161.032 176.314 1.00 154.32 ? 26  ILE F N     1 
ATOM   4013  C CA    . ILE F 2 27  ? 136.307 161.834 175.669 1.00 154.32 ? 26  ILE F CA    1 
ATOM   4014  C C     . ILE F 2 27  ? 136.603 163.073 176.499 1.00 154.32 ? 26  ILE F C     1 
ATOM   4015  O O     . ILE F 2 27  ? 137.761 163.478 176.643 1.00 154.32 ? 26  ILE F O     1 
ATOM   4016  C CB    . ILE F 2 27  ? 135.895 162.167 174.223 1.00 154.32 ? 26  ILE F CB    1 
ATOM   4017  C CG1   . ILE F 2 27  ? 136.903 163.104 173.566 1.00 154.32 ? 26  ILE F CG1   1 
ATOM   4018  C CG2   . ILE F 2 27  ? 134.480 162.716 174.159 1.00 154.32 ? 26  ILE F CG2   1 
ATOM   4019  C CD1   . ILE F 2 27  ? 138.270 162.505 173.435 1.00 154.32 ? 26  ILE F CD1   1 
ATOM   4020  N N     . GLN F 2 28  ? 135.587 163.629 177.147 1.00 160.13 ? 27  GLN F N     1 
ATOM   4021  C CA    . GLN F 2 28  ? 135.787 164.722 178.082 1.00 160.13 ? 27  GLN F CA    1 
ATOM   4022  C C     . GLN F 2 28  ? 136.332 164.253 179.418 1.00 160.13 ? 27  GLN F C     1 
ATOM   4023  O O     . GLN F 2 28  ? 136.540 165.079 180.308 1.00 160.13 ? 27  GLN F O     1 
ATOM   4024  C CB    . GLN F 2 28  ? 134.479 165.485 178.287 1.00 160.13 ? 27  GLN F CB    1 
ATOM   4025  C CG    . GLN F 2 28  ? 133.912 166.089 177.009 1.00 160.13 ? 27  GLN F CG    1 
ATOM   4026  C CD    . GLN F 2 28  ? 134.550 167.422 176.654 1.00 160.13 ? 27  GLN F CD    1 
ATOM   4027  O OE1   . GLN F 2 28  ? 134.933 168.191 177.533 1.00 160.13 ? 27  GLN F OE1   1 
ATOM   4028  N NE2   . GLN F 2 28  ? 134.672 167.698 175.361 1.00 160.13 ? 27  GLN F NE2   1 
ATOM   4029  N N     . GLY F 2 29  ? 136.552 162.957 179.581 1.00 161.21 ? 28  GLY F N     1 
ATOM   4030  C CA    . GLY F 2 29  ? 137.297 162.441 180.698 1.00 161.21 ? 28  GLY F CA    1 
ATOM   4031  C C     . GLY F 2 29  ? 138.789 162.597 180.564 1.00 161.21 ? 28  GLY F C     1 
ATOM   4032  O O     . GLY F 2 29  ? 139.509 162.428 181.551 1.00 161.21 ? 28  GLY F O     1 
ATOM   4033  N N     . ILE F 2 30  ? 139.289 162.918 179.375 1.00 151.97 ? 29  ILE F N     1 
ATOM   4034  C CA    . ILE F 2 30  ? 140.700 163.246 179.225 1.00 151.97 ? 29  ILE F CA    1 
ATOM   4035  C C     . ILE F 2 30  ? 140.889 164.669 179.724 1.00 151.97 ? 29  ILE F C     1 
ATOM   4036  O O     . ILE F 2 30  ? 140.668 165.632 178.983 1.00 151.97 ? 29  ILE F O     1 
ATOM   4037  C CB    . ILE F 2 30  ? 141.160 163.095 177.769 1.00 151.97 ? 29  ILE F CB    1 
ATOM   4038  C CG1   . ILE F 2 30  ? 140.813 161.707 177.256 1.00 151.97 ? 29  ILE F CG1   1 
ATOM   4039  C CG2   . ILE F 2 30  ? 142.643 163.313 177.661 1.00 151.97 ? 29  ILE F CG2   1 
ATOM   4040  C CD1   . ILE F 2 30  ? 141.476 160.612 178.020 1.00 151.97 ? 29  ILE F CD1   1 
ATOM   4041  N N     . THR F 2 31  ? 141.294 164.805 180.981 1.00 159.78 ? 30  THR F N     1 
ATOM   4042  C CA    . THR F 2 31  ? 141.214 166.074 181.685 1.00 159.78 ? 30  THR F CA    1 
ATOM   4043  C C     . THR F 2 31  ? 142.239 167.075 181.165 1.00 159.78 ? 30  THR F C     1 
ATOM   4044  O O     . THR F 2 31  ? 143.218 166.716 180.510 1.00 159.78 ? 30  THR F O     1 
ATOM   4045  C CB    . THR F 2 31  ? 141.427 165.862 183.176 1.00 159.78 ? 30  THR F CB    1 
ATOM   4046  O OG1   . THR F 2 31  ? 142.588 165.049 183.372 1.00 159.78 ? 30  THR F OG1   1 
ATOM   4047  C CG2   . THR F 2 31  ? 140.240 165.156 183.763 1.00 159.78 ? 30  THR F CG2   1 
ATOM   4048  N N     . LYS F 2 32  ? 141.984 168.348 181.474 1.00 149.10 ? 31  LYS F N     1 
ATOM   4049  C CA    . LYS F 2 32  ? 142.874 169.431 181.060 1.00 149.10 ? 31  LYS F CA    1 
ATOM   4050  C C     . LYS F 2 32  ? 144.311 169.306 181.561 1.00 149.10 ? 31  LYS F C     1 
ATOM   4051  O O     . LYS F 2 32  ? 145.219 169.495 180.734 1.00 149.10 ? 31  LYS F O     1 
ATOM   4052  C CB    . LYS F 2 32  ? 142.259 170.777 181.470 1.00 149.10 ? 31  LYS F CB    1 
ATOM   4053  C CG    . LYS F 2 32  ? 143.132 171.977 181.232 1.00 149.10 ? 31  LYS F CG    1 
ATOM   4054  C CD    . LYS F 2 32  ? 142.405 173.251 181.621 1.00 149.10 ? 31  LYS F CD    1 
ATOM   4055  C CE    . LYS F 2 32  ? 142.305 173.402 183.115 1.00 149.10 ? 31  LYS F CE    1 
ATOM   4056  N NZ    . LYS F 2 32  ? 141.699 174.708 183.469 1.00 149.10 ? 31  LYS F NZ    1 
ATOM   4057  N N     . PRO F 2 33  ? 144.612 168.976 182.831 1.00 153.15 ? 32  PRO F N     1 
ATOM   4058  C CA    . PRO F 2 33  ? 146.026 168.791 183.182 1.00 153.15 ? 32  PRO F CA    1 
ATOM   4059  C C     . PRO F 2 33  ? 146.665 167.574 182.550 1.00 153.15 ? 32  PRO F C     1 
ATOM   4060  O O     . PRO F 2 33  ? 147.890 167.557 182.417 1.00 153.15 ? 32  PRO F O     1 
ATOM   4061  C CB    . PRO F 2 33  ? 146.006 168.675 184.709 1.00 153.15 ? 32  PRO F CB    1 
ATOM   4062  C CG    . PRO F 2 33  ? 144.669 168.257 185.021 1.00 153.15 ? 32  PRO F CG    1 
ATOM   4063  C CD    . PRO F 2 33  ? 143.804 168.964 184.067 1.00 153.15 ? 32  PRO F CD    1 
ATOM   4064  N N     . ALA F 2 34  ? 145.895 166.577 182.118 1.00 149.67 ? 33  ALA F N     1 
ATOM   4065  C CA    . ALA F 2 34  ? 146.502 165.476 181.383 1.00 149.67 ? 33  ALA F CA    1 
ATOM   4066  C C     . ALA F 2 34  ? 146.957 165.916 180.007 1.00 149.67 ? 33  ALA F C     1 
ATOM   4067  O O     . ALA F 2 34  ? 148.031 165.513 179.549 1.00 149.67 ? 33  ALA F O     1 
ATOM   4068  C CB    . ALA F 2 34  ? 145.525 164.317 181.255 1.00 149.67 ? 33  ALA F CB    1 
ATOM   4069  N N     . ILE F 2 35  ? 146.173 166.770 179.357 1.00 145.37 ? 34  ILE F N     1 
ATOM   4070  C CA    . ILE F 2 35  ? 146.597 167.348 178.092 1.00 145.37 ? 34  ILE F CA    1 
ATOM   4071  C C     . ILE F 2 35  ? 147.765 168.293 178.307 1.00 145.37 ? 34  ILE F C     1 
ATOM   4072  O O     . ILE F 2 35  ? 148.660 168.384 177.461 1.00 145.37 ? 34  ILE F O     1 
ATOM   4073  C CB    . ILE F 2 35  ? 145.405 168.046 177.428 1.00 145.37 ? 34  ILE F CB    1 
ATOM   4074  C CG1   . ILE F 2 35  ? 144.222 167.092 177.398 1.00 145.37 ? 34  ILE F CG1   1 
ATOM   4075  C CG2   . ILE F 2 35  ? 145.743 168.456 176.027 1.00 145.37 ? 34  ILE F CG2   1 
ATOM   4076  C CD1   . ILE F 2 35  ? 142.901 167.777 177.390 1.00 145.37 ? 34  ILE F CD1   1 
ATOM   4077  N N     . ARG F 2 36  ? 147.807 168.974 179.454 1.00 148.57 ? 35  ARG F N     1 
ATOM   4078  C CA    . ARG F 2 36  ? 148.942 169.844 179.736 1.00 148.57 ? 35  ARG F CA    1 
ATOM   4079  C C     . ARG F 2 36  ? 150.209 169.043 179.974 1.00 148.57 ? 35  ARG F C     1 
ATOM   4080  O O     . ARG F 2 36  ? 151.284 169.455 179.545 1.00 148.57 ? 35  ARG F O     1 
ATOM   4081  C CB    . ARG F 2 36  ? 148.640 170.743 180.925 1.00 148.57 ? 35  ARG F CB    1 
ATOM   4082  C CG    . ARG F 2 36  ? 147.608 171.769 180.591 1.00 148.57 ? 35  ARG F CG    1 
ATOM   4083  C CD    . ARG F 2 36  ? 147.268 172.614 181.770 1.00 148.57 ? 35  ARG F CD    1 
ATOM   4084  N NE    . ARG F 2 36  ? 148.342 173.529 182.097 1.00 148.57 ? 35  ARG F NE    1 
ATOM   4085  C CZ    . ARG F 2 36  ? 148.306 174.357 183.128 1.00 148.57 ? 35  ARG F CZ    1 
ATOM   4086  N NH1   . ARG F 2 36  ? 147.248 174.376 183.922 1.00 148.57 ? 35  ARG F NH1   1 
ATOM   4087  N NH2   . ARG F 2 36  ? 149.322 175.168 183.363 1.00 148.57 ? 35  ARG F NH2   1 
ATOM   4088  N N     . ARG F 2 37  ? 150.101 167.892 180.633 1.00 148.58 ? 36  ARG F N     1 
ATOM   4089  C CA    . ARG F 2 37  ? 151.258 167.019 180.781 1.00 148.58 ? 36  ARG F CA    1 
ATOM   4090  C C     . ARG F 2 37  ? 151.710 166.479 179.435 1.00 148.58 ? 36  ARG F C     1 
ATOM   4091  O O     . ARG F 2 37  ? 152.912 166.444 179.146 1.00 148.58 ? 36  ARG F O     1 
ATOM   4092  C CB    . ARG F 2 37  ? 150.930 165.868 181.720 1.00 148.58 ? 36  ARG F CB    1 
ATOM   4093  C CG    . ARG F 2 37  ? 150.796 166.259 183.160 1.00 148.58 ? 36  ARG F CG    1 
ATOM   4094  C CD    . ARG F 2 37  ? 150.574 165.030 184.015 1.00 148.58 ? 36  ARG F CD    1 
ATOM   4095  N NE    . ARG F 2 37  ? 149.325 164.355 183.687 1.00 148.58 ? 36  ARG F NE    1 
ATOM   4096  C CZ    . ARG F 2 37  ? 148.350 164.133 184.558 1.00 148.58 ? 36  ARG F CZ    1 
ATOM   4097  N NH1   . ARG F 2 37  ? 148.478 164.526 185.812 1.00 148.58 ? 36  ARG F NH1   1 
ATOM   4098  N NH2   . ARG F 2 37  ? 147.246 163.518 184.176 1.00 148.58 ? 36  ARG F NH2   1 
ATOM   4099  N N     . LEU F 2 38  ? 150.755 166.085 178.590 1.00 147.76 ? 37  LEU F N     1 
ATOM   4100  C CA    . LEU F 2 38  ? 151.084 165.567 177.268 1.00 147.76 ? 37  LEU F CA    1 
ATOM   4101  C C     . LEU F 2 38  ? 151.717 166.625 176.389 1.00 147.76 ? 37  LEU F C     1 
ATOM   4102  O O     . LEU F 2 38  ? 152.527 166.304 175.517 1.00 147.76 ? 37  LEU F O     1 
ATOM   4103  C CB    . LEU F 2 38  ? 149.832 165.035 176.591 1.00 147.76 ? 37  LEU F CB    1 
ATOM   4104  C CG    . LEU F 2 38  ? 149.608 163.552 176.807 1.00 147.76 ? 37  LEU F CG    1 
ATOM   4105  C CD1   . LEU F 2 38  ? 148.270 163.145 176.239 1.00 147.76 ? 37  LEU F CD1   1 
ATOM   4106  C CD2   . LEU F 2 38  ? 150.733 162.789 176.156 1.00 147.76 ? 37  LEU F CD2   1 
ATOM   4107  N N     . ALA F 2 39  ? 151.355 167.880 176.600 1.00 148.83 ? 38  ALA F N     1 
ATOM   4108  C CA    . ALA F 2 39  ? 151.950 168.954 175.832 1.00 148.83 ? 38  ALA F CA    1 
ATOM   4109  C C     . ALA F 2 39  ? 153.319 169.322 176.378 1.00 148.83 ? 38  ALA F C     1 
ATOM   4110  O O     . ALA F 2 39  ? 154.278 169.466 175.618 1.00 148.83 ? 38  ALA F O     1 
ATOM   4111  C CB    . ALA F 2 39  ? 151.014 170.154 175.837 1.00 148.83 ? 38  ALA F CB    1 
ATOM   4112  N N     . ARG F 2 40  ? 153.438 169.451 177.699 1.00 145.57 ? 39  ARG F N     1 
ATOM   4113  C CA    . ARG F 2 40  ? 154.692 169.852 178.315 1.00 145.57 ? 39  ARG F CA    1 
ATOM   4114  C C     . ARG F 2 40  ? 155.745 168.769 178.260 1.00 145.57 ? 39  ARG F C     1 
ATOM   4115  O O     . ARG F 2 40  ? 156.909 169.056 178.542 1.00 145.57 ? 39  ARG F O     1 
ATOM   4116  C CB    . ARG F 2 40  ? 154.457 170.265 179.755 1.00 145.57 ? 39  ARG F CB    1 
ATOM   4117  C CG    . ARG F 2 40  ? 153.714 171.546 179.839 1.00 145.57 ? 39  ARG F CG    1 
ATOM   4118  C CD    . ARG F 2 40  ? 154.247 172.439 180.898 1.00 145.57 ? 39  ARG F CD    1 
ATOM   4119  N NE    . ARG F 2 40  ? 153.165 173.240 181.440 1.00 145.57 ? 39  ARG F NE    1 
ATOM   4120  C CZ    . ARG F 2 40  ? 152.755 174.380 180.906 1.00 145.57 ? 39  ARG F CZ    1 
ATOM   4121  N NH1   . ARG F 2 40  ? 153.351 174.854 179.827 1.00 145.57 ? 39  ARG F NH1   1 
ATOM   4122  N NH2   . ARG F 2 40  ? 151.753 175.049 181.452 1.00 145.57 ? 39  ARG F NH2   1 
ATOM   4123  N N     . ARG F 2 41  ? 155.376 167.538 177.932 1.00 145.98 ? 40  ARG F N     1 
ATOM   4124  C CA    . ARG F 2 41  ? 156.408 166.621 177.488 1.00 145.98 ? 40  ARG F CA    1 
ATOM   4125  C C     . ARG F 2 41  ? 156.945 167.049 176.133 1.00 145.98 ? 40  ARG F C     1 
ATOM   4126  O O     . ARG F 2 41  ? 158.155 167.002 175.896 1.00 145.98 ? 40  ARG F O     1 
ATOM   4127  C CB    . ARG F 2 41  ? 155.865 165.197 177.435 1.00 145.98 ? 40  ARG F CB    1 
ATOM   4128  C CG    . ARG F 2 41  ? 156.812 164.218 176.786 1.00 145.98 ? 40  ARG F CG    1 
ATOM   4129  C CD    . ARG F 2 41  ? 156.439 162.787 177.056 1.00 145.98 ? 40  ARG F CD    1 
ATOM   4130  N NE    . ARG F 2 41  ? 156.891 162.340 178.361 1.00 145.98 ? 40  ARG F NE    1 
ATOM   4131  C CZ    . ARG F 2 41  ? 156.436 161.250 178.957 1.00 145.98 ? 40  ARG F CZ    1 
ATOM   4132  N NH1   . ARG F 2 41  ? 155.524 160.508 178.355 1.00 145.98 ? 40  ARG F NH1   1 
ATOM   4133  N NH2   . ARG F 2 41  ? 156.891 160.900 180.149 1.00 145.98 ? 40  ARG F NH2   1 
ATOM   4134  N N     . GLY F 2 42  ? 156.071 167.527 175.249 1.00 141.76 ? 41  GLY F N     1 
ATOM   4135  C CA    . GLY F 2 42  ? 156.504 167.869 173.908 1.00 141.76 ? 41  GLY F CA    1 
ATOM   4136  C C     . GLY F 2 42  ? 157.347 169.119 173.831 1.00 141.76 ? 41  GLY F C     1 
ATOM   4137  O O     . GLY F 2 42  ? 158.027 169.332 172.824 1.00 141.76 ? 41  GLY F O     1 
ATOM   4138  N N     . GLY F 2 43  ? 157.335 169.940 174.871 1.00 144.29 ? 42  GLY F N     1 
ATOM   4139  C CA    . GLY F 2 43  ? 158.221 171.082 174.899 1.00 144.29 ? 42  GLY F CA    1 
ATOM   4140  C C     . GLY F 2 43  ? 157.563 172.383 174.514 1.00 144.29 ? 42  GLY F C     1 
ATOM   4141  O O     . GLY F 2 43  ? 158.081 173.112 173.669 1.00 144.29 ? 42  GLY F O     1 
ATOM   4142  N N     . VAL F 2 44  ? 156.417 172.680 175.111 1.00 143.22 ? 43  VAL F N     1 
ATOM   4143  C CA    . VAL F 2 44  ? 155.697 173.918 174.855 1.00 143.22 ? 43  VAL F CA    1 
ATOM   4144  C C     . VAL F 2 44  ? 155.493 174.647 176.178 1.00 143.22 ? 43  VAL F C     1 
ATOM   4145  O O     . VAL F 2 44  ? 155.134 174.033 177.187 1.00 143.22 ? 43  VAL F O     1 
ATOM   4146  C CB    . VAL F 2 44  ? 154.377 173.645 174.109 1.00 143.22 ? 43  VAL F CB    1 
ATOM   4147  C CG1   . VAL F 2 44  ? 153.554 172.613 174.806 1.00 143.22 ? 43  VAL F CG1   1 
ATOM   4148  C CG2   . VAL F 2 44  ? 153.581 174.900 173.963 1.00 143.22 ? 43  VAL F CG2   1 
ATOM   4149  N N     . LYS F 2 45  ? 155.787 175.948 176.189 1.00 152.63 ? 44  LYS F N     1 
ATOM   4150  C CA    . LYS F 2 45  ? 155.796 176.709 177.430 1.00 152.63 ? 44  LYS F CA    1 
ATOM   4151  C C     . LYS F 2 45  ? 154.425 177.266 177.777 1.00 152.63 ? 44  LYS F C     1 
ATOM   4152  O O     . LYS F 2 45  ? 153.888 176.968 178.844 1.00 152.63 ? 44  LYS F O     1 
ATOM   4153  C CB    . LYS F 2 45  ? 156.813 177.842 177.346 1.00 152.63 ? 44  LYS F CB    1 
ATOM   4154  C CG    . LYS F 2 45  ? 156.789 178.758 178.546 1.00 152.63 ? 44  LYS F CG    1 
ATOM   4155  C CD    . LYS F 2 45  ? 158.101 179.494 178.699 1.00 152.63 ? 44  LYS F CD    1 
ATOM   4156  C CE    . LYS F 2 45  ? 158.404 180.336 177.479 1.00 152.63 ? 44  LYS F CE    1 
ATOM   4157  N NZ    . LYS F 2 45  ? 159.690 181.069 177.613 1.00 152.63 ? 44  LYS F NZ    1 
ATOM   4158  N N     . ARG F 2 46  ? 153.853 178.083 176.910 1.00 154.98 ? 45  ARG F N     1 
ATOM   4159  C CA    . ARG F 2 46  ? 152.511 178.598 177.111 1.00 154.98 ? 45  ARG F CA    1 
ATOM   4160  C C     . ARG F 2 46  ? 151.551 177.819 176.234 1.00 154.98 ? 45  ARG F C     1 
ATOM   4161  O O     . ARG F 2 46  ? 151.876 177.478 175.099 1.00 154.98 ? 45  ARG F O     1 
ATOM   4162  C CB    . ARG F 2 46  ? 152.427 180.087 176.788 1.00 154.98 ? 45  ARG F CB    1 
ATOM   4163  C CG    . ARG F 2 46  ? 153.119 180.961 177.802 1.00 154.98 ? 45  ARG F CG    1 
ATOM   4164  C CD    . ARG F 2 46  ? 152.745 182.402 177.608 1.00 154.98 ? 45  ARG F CD    1 
ATOM   4165  N NE    . ARG F 2 46  ? 151.449 182.715 178.190 1.00 154.98 ? 45  ARG F NE    1 
ATOM   4166  C CZ    . ARG F 2 46  ? 150.375 183.041 177.482 1.00 154.98 ? 45  ARG F CZ    1 
ATOM   4167  N NH1   . ARG F 2 46  ? 150.443 183.101 176.166 1.00 154.98 ? 45  ARG F NH1   1 
ATOM   4168  N NH2   . ARG F 2 46  ? 149.234 183.313 178.092 1.00 154.98 ? 45  ARG F NH2   1 
ATOM   4169  N N     . ILE F 2 47  ? 150.373 177.530 176.764 1.00 152.26 ? 46  ILE F N     1 
ATOM   4170  C CA    . ILE F 2 47  ? 149.375 176.738 176.065 1.00 152.26 ? 46  ILE F CA    1 
ATOM   4171  C C     . ILE F 2 47  ? 148.059 177.478 176.170 1.00 152.26 ? 46  ILE F C     1 
ATOM   4172  O O     . ILE F 2 47  ? 147.545 177.669 177.275 1.00 152.26 ? 46  ILE F O     1 
ATOM   4173  C CB    . ILE F 2 47  ? 149.251 175.334 176.664 1.00 152.26 ? 46  ILE F CB    1 
ATOM   4174  C CG1   . ILE F 2 47  ? 150.496 174.511 176.378 1.00 152.26 ? 46  ILE F CG1   1 
ATOM   4175  C CG2   . ILE F 2 47  ? 148.062 174.624 176.117 1.00 152.26 ? 46  ILE F CG2   1 
ATOM   4176  C CD1   . ILE F 2 47  ? 150.737 173.470 177.416 1.00 152.26 ? 46  ILE F CD1   1 
ATOM   4177  N N     . SER F 2 48  ? 147.508 177.889 175.035 1.00 149.50 ? 47  SER F N     1 
ATOM   4178  C CA    . SER F 2 48  ? 146.328 178.735 175.079 1.00 149.50 ? 47  SER F CA    1 
ATOM   4179  C C     . SER F 2 48  ? 145.090 177.907 175.357 1.00 149.50 ? 47  SER F C     1 
ATOM   4180  O O     . SER F 2 48  ? 145.100 176.680 175.285 1.00 149.50 ? 47  SER F O     1 
ATOM   4181  C CB    . SER F 2 48  ? 146.138 179.489 173.773 1.00 149.50 ? 47  SER F CB    1 
ATOM   4182  O OG    . SER F 2 48  ? 145.434 178.684 172.853 1.00 149.50 ? 47  SER F OG    1 
ATOM   4183  N N     . GLY F 2 49  ? 144.002 178.596 175.654 1.00 145.59 ? 48  GLY F N     1 
ATOM   4184  C CA    . GLY F 2 49  ? 142.718 177.945 175.733 1.00 145.59 ? 48  GLY F CA    1 
ATOM   4185  C C     . GLY F 2 49  ? 142.263 177.466 174.374 1.00 145.59 ? 48  GLY F C     1 
ATOM   4186  O O     . GLY F 2 49  ? 142.816 177.824 173.334 1.00 145.59 ? 48  GLY F O     1 
ATOM   4187  N N     . LEU F 2 50  ? 141.267 176.580 174.406 1.00 144.01 ? 49  LEU F N     1 
ATOM   4188  C CA    . LEU F 2 50  ? 140.608 175.991 173.242 1.00 144.01 ? 49  LEU F CA    1 
ATOM   4189  C C     . LEU F 2 50  ? 141.543 175.189 172.344 1.00 144.01 ? 49  LEU F C     1 
ATOM   4190  O O     . LEU F 2 50  ? 141.172 174.839 171.222 1.00 144.01 ? 49  LEU F O     1 
ATOM   4191  C CB    . LEU F 2 50  ? 139.890 177.061 172.417 1.00 144.01 ? 49  LEU F CB    1 
ATOM   4192  C CG    . LEU F 2 50  ? 138.942 177.932 173.235 1.00 144.01 ? 49  LEU F CG    1 
ATOM   4193  C CD1   . LEU F 2 50  ? 138.378 179.045 172.382 1.00 144.01 ? 49  LEU F CD1   1 
ATOM   4194  C CD2   . LEU F 2 50  ? 137.835 177.087 173.830 1.00 144.01 ? 49  LEU F CD2   1 
ATOM   4195  N N     . ILE F 2 51  ? 142.751 174.891 172.819 1.00 146.47 ? 50  ILE F N     1 
ATOM   4196  C CA    . ILE F 2 51  ? 143.539 173.837 172.207 1.00 146.47 ? 50  ILE F CA    1 
ATOM   4197  C C     . ILE F 2 51  ? 143.057 172.483 172.699 1.00 146.47 ? 50  ILE F C     1 
ATOM   4198  O O     . ILE F 2 51  ? 143.332 171.454 172.064 1.00 146.47 ? 50  ILE F O     1 
ATOM   4199  C CB    . ILE F 2 51  ? 145.029 174.061 172.506 1.00 146.47 ? 50  ILE F CB    1 
ATOM   4200  C CG1   . ILE F 2 51  ? 145.902 173.373 171.473 1.00 146.47 ? 50  ILE F CG1   1 
ATOM   4201  C CG2   . ILE F 2 51  ? 145.394 173.537 173.854 1.00 146.47 ? 50  ILE F CG2   1 
ATOM   4202  C CD1   . ILE F 2 51  ? 145.768 173.953 170.132 1.00 146.47 ? 50  ILE F CD1   1 
ATOM   4203  N N     . TYR F 2 52  ? 142.284 172.477 173.785 1.00 148.47 ? 51  TYR F N     1 
ATOM   4204  C CA    . TYR F 2 52  ? 141.934 171.238 174.451 1.00 148.47 ? 51  TYR F CA    1 
ATOM   4205  C C     . TYR F 2 52  ? 140.952 170.437 173.623 1.00 148.47 ? 51  TYR F C     1 
ATOM   4206  O O     . TYR F 2 52  ? 141.216 169.276 173.312 1.00 148.47 ? 51  TYR F O     1 
ATOM   4207  C CB    . TYR F 2 52  ? 141.373 171.547 175.829 1.00 148.47 ? 51  TYR F CB    1 
ATOM   4208  C CG    . TYR F 2 52  ? 142.382 172.254 176.685 1.00 148.47 ? 51  TYR F CG    1 
ATOM   4209  C CD1   . TYR F 2 52  ? 143.712 171.868 176.675 1.00 148.47 ? 51  TYR F CD1   1 
ATOM   4210  C CD2   . TYR F 2 52  ? 142.021 173.335 177.467 1.00 148.47 ? 51  TYR F CD2   1 
ATOM   4211  C CE1   . TYR F 2 52  ? 144.648 172.517 177.445 1.00 148.47 ? 51  TYR F CE1   1 
ATOM   4212  C CE2   . TYR F 2 52  ? 142.955 174.000 178.230 1.00 148.47 ? 51  TYR F CE2   1 
ATOM   4213  C CZ    . TYR F 2 52  ? 144.265 173.580 178.221 1.00 148.47 ? 51  TYR F CZ    1 
ATOM   4214  O OH    . TYR F 2 52  ? 145.198 174.229 178.985 1.00 148.47 ? 51  TYR F OH    1 
ATOM   4215  N N     . GLU F 2 53  ? 139.843 171.059 173.214 1.00 150.85 ? 52  GLU F N     1 
ATOM   4216  C CA    . GLU F 2 53  ? 138.818 170.357 172.447 1.00 150.85 ? 52  GLU F CA    1 
ATOM   4217  C C     . GLU F 2 53  ? 139.335 169.910 171.090 1.00 150.85 ? 52  GLU F C     1 
ATOM   4218  O O     . GLU F 2 53  ? 138.937 168.849 170.589 1.00 150.85 ? 52  GLU F O     1 
ATOM   4219  C CB    . GLU F 2 53  ? 137.600 171.255 172.273 1.00 150.85 ? 52  GLU F CB    1 
ATOM   4220  C CG    . GLU F 2 53  ? 136.847 171.526 173.552 1.00 150.85 ? 52  GLU F CG    1 
ATOM   4221  C CD    . GLU F 2 53  ? 137.368 172.736 174.289 1.00 150.85 ? 52  GLU F CD    1 
ATOM   4222  O OE1   . GLU F 2 53  ? 138.363 173.328 173.830 1.00 150.85 ? 52  GLU F OE1   1 
ATOM   4223  O OE2   . GLU F 2 53  ? 136.785 173.100 175.329 1.00 150.85 ? 52  GLU F OE2   1 
ATOM   4224  N N     . GLU F 2 54  ? 140.258 170.676 170.510 1.00 153.19 ? 53  GLU F N     1 
ATOM   4225  C CA    . GLU F 2 54  ? 140.921 170.235 169.294 1.00 153.19 ? 53  GLU F CA    1 
ATOM   4226  C C     . GLU F 2 54  ? 141.795 169.016 169.548 1.00 153.19 ? 53  GLU F C     1 
ATOM   4227  O O     . GLU F 2 54  ? 141.837 168.103 168.714 1.00 153.19 ? 53  GLU F O     1 
ATOM   4228  C CB    . GLU F 2 54  ? 141.739 171.381 168.712 1.00 153.19 ? 53  GLU F CB    1 
ATOM   4229  C CG    . GLU F 2 54  ? 142.525 171.022 167.475 1.00 153.19 ? 53  GLU F CG    1 
ATOM   4230  C CD    . GLU F 2 54  ? 141.659 170.495 166.352 1.00 153.19 ? 53  GLU F CD    1 
ATOM   4231  O OE1   . GLU F 2 54  ? 140.578 171.067 166.110 1.00 153.19 ? 53  GLU F OE1   1 
ATOM   4232  O OE2   . GLU F 2 54  ? 142.062 169.515 165.696 1.00 153.19 ? 53  GLU F OE2   1 
ATOM   4233  N N     . THR F 2 55  ? 142.455 168.957 170.709 1.00 145.42 ? 54  THR F N     1 
ATOM   4234  C CA    . THR F 2 55  ? 143.245 167.774 171.040 1.00 145.42 ? 54  THR F CA    1 
ATOM   4235  C C     . THR F 2 55  ? 142.358 166.554 171.277 1.00 145.42 ? 54  THR F C     1 
ATOM   4236  O O     . THR F 2 55  ? 142.720 165.440 170.876 1.00 145.42 ? 54  THR F O     1 
ATOM   4237  C CB    . THR F 2 55  ? 144.119 168.075 172.255 1.00 145.42 ? 54  THR F CB    1 
ATOM   4238  O OG1   . THR F 2 55  ? 144.971 169.177 171.943 1.00 145.42 ? 54  THR F OG1   1 
ATOM   4239  C CG2   . THR F 2 55  ? 144.998 166.898 172.610 1.00 145.42 ? 54  THR F CG2   1 
ATOM   4240  N N     . ARG F 2 56  ? 141.184 166.757 171.884 1.00 145.10 ? 55  ARG F N     1 
ATOM   4241  C CA    . ARG F 2 56  ? 140.211 165.676 172.023 1.00 145.10 ? 55  ARG F CA    1 
ATOM   4242  C C     . ARG F 2 56  ? 139.767 165.156 170.667 1.00 145.10 ? 55  ARG F C     1 
ATOM   4243  O O     . ARG F 2 56  ? 139.700 163.939 170.463 1.00 145.10 ? 55  ARG F O     1 
ATOM   4244  C CB    . ARG F 2 56  ? 138.981 166.128 172.799 1.00 145.10 ? 55  ARG F CB    1 
ATOM   4245  C CG    . ARG F 2 56  ? 139.253 166.925 174.016 1.00 145.10 ? 55  ARG F CG    1 
ATOM   4246  C CD    . ARG F 2 56  ? 139.364 166.092 175.247 1.00 145.10 ? 55  ARG F CD    1 
ATOM   4247  N NE    . ARG F 2 56  ? 139.798 166.900 176.374 1.00 145.10 ? 55  ARG F NE    1 
ATOM   4248  C CZ    . ARG F 2 56  ? 139.000 167.679 177.094 1.00 145.10 ? 55  ARG F CZ    1 
ATOM   4249  N NH1   . ARG F 2 56  ? 137.708 167.755 176.819 1.00 145.10 ? 55  ARG F NH1   1 
ATOM   4250  N NH2   . ARG F 2 56  ? 139.497 168.375 178.104 1.00 145.10 ? 55  ARG F NH2   1 
ATOM   4251  N N     . GLY F 2 57  ? 139.474 166.062 169.731 1.00 145.13 ? 56  GLY F N     1 
ATOM   4252  C CA    . GLY F 2 57  ? 139.069 165.636 168.401 1.00 145.13 ? 56  GLY F CA    1 
ATOM   4253  C C     . GLY F 2 57  ? 140.161 164.886 167.662 1.00 145.13 ? 56  GLY F C     1 
ATOM   4254  O O     . GLY F 2 57  ? 139.892 163.884 166.989 1.00 145.13 ? 56  GLY F O     1 
ATOM   4255  N N     . VAL F 2 58  ? 141.411 165.323 167.828 1.00 143.64 ? 57  VAL F N     1 
ATOM   4256  C CA    . VAL F 2 58  ? 142.534 164.669 167.161 1.00 143.64 ? 57  VAL F CA    1 
ATOM   4257  C C     . VAL F 2 58  ? 142.743 163.268 167.712 1.00 143.64 ? 57  VAL F C     1 
ATOM   4258  O O     . VAL F 2 58  ? 142.858 162.295 166.952 1.00 143.64 ? 57  VAL F O     1 
ATOM   4259  C CB    . VAL F 2 58  ? 143.805 165.518 167.311 1.00 143.64 ? 57  VAL F CB    1 
ATOM   4260  C CG1   . VAL F 2 58  ? 145.038 164.698 166.999 1.00 143.64 ? 57  VAL F CG1   1 
ATOM   4261  C CG2   . VAL F 2 58  ? 143.729 166.706 166.405 1.00 143.64 ? 57  VAL F CG2   1 
ATOM   4262  N N     . LEU F 2 59  ? 142.783 163.152 169.041 1.00 138.44 ? 58  LEU F N     1 
ATOM   4263  C CA    . LEU F 2 59  ? 142.973 161.863 169.693 1.00 138.44 ? 58  LEU F CA    1 
ATOM   4264  C C     . LEU F 2 59  ? 141.839 160.909 169.366 1.00 138.44 ? 58  LEU F C     1 
ATOM   4265  O O     . LEU F 2 59  ? 142.074 159.722 169.095 1.00 138.44 ? 58  LEU F O     1 
ATOM   4266  C CB    . LEU F 2 59  ? 143.068 162.073 171.198 1.00 138.44 ? 58  LEU F CB    1 
ATOM   4267  C CG    . LEU F 2 59  ? 142.971 160.849 172.086 1.00 138.44 ? 58  LEU F CG    1 
ATOM   4268  C CD1   . LEU F 2 59  ? 144.338 160.244 172.197 1.00 138.44 ? 58  LEU F CD1   1 
ATOM   4269  C CD2   . LEU F 2 59  ? 142.432 161.223 173.446 1.00 138.44 ? 58  LEU F CD2   1 
ATOM   4270  N N     . LYS F 2 60  ? 140.611 161.428 169.331 1.00 137.26 ? 59  LYS F N     1 
ATOM   4271  C CA    . LYS F 2 60  ? 139.461 160.591 169.048 1.00 137.26 ? 59  LYS F CA    1 
ATOM   4272  C C     . LYS F 2 60  ? 139.494 160.069 167.628 1.00 137.26 ? 59  LYS F C     1 
ATOM   4273  O O     . LYS F 2 60  ? 139.255 158.882 167.410 1.00 137.26 ? 59  LYS F O     1 
ATOM   4274  C CB    . LYS F 2 60  ? 138.177 161.361 169.294 1.00 137.26 ? 59  LYS F CB    1 
ATOM   4275  C CG    . LYS F 2 60  ? 137.055 160.478 169.731 1.00 137.26 ? 59  LYS F CG    1 
ATOM   4276  C CD    . LYS F 2 60  ? 135.754 161.223 169.679 1.00 137.26 ? 59  LYS F CD    1 
ATOM   4277  C CE    . LYS F 2 60  ? 135.385 161.538 168.248 1.00 137.26 ? 59  LYS F CE    1 
ATOM   4278  N NZ    . LYS F 2 60  ? 134.056 162.197 168.165 1.00 137.26 ? 59  LYS F NZ    1 
ATOM   4279  N N     . VAL F 2 61  ? 139.841 160.912 166.655 1.00 138.50 ? 60  VAL F N     1 
ATOM   4280  C CA    . VAL F 2 61  ? 139.823 160.402 165.289 1.00 138.50 ? 60  VAL F CA    1 
ATOM   4281  C C     . VAL F 2 61  ? 141.011 159.478 165.027 1.00 138.50 ? 60  VAL F C     1 
ATOM   4282  O O     . VAL F 2 61  ? 140.874 158.492 164.283 1.00 138.50 ? 60  VAL F O     1 
ATOM   4283  C CB    . VAL F 2 61  ? 139.731 161.551 164.267 1.00 138.50 ? 60  VAL F CB    1 
ATOM   4284  C CG1   . VAL F 2 61  ? 141.039 162.300 164.106 1.00 138.50 ? 60  VAL F CG1   1 
ATOM   4285  C CG2   . VAL F 2 61  ? 139.259 161.016 162.934 1.00 138.50 ? 60  VAL F CG2   1 
ATOM   4286  N N     . PHE F 2 62  ? 142.143 159.693 165.707 1.00 136.86 ? 61  PHE F N     1 
ATOM   4287  C CA    . PHE F 2 62  ? 143.285 158.810 165.511 1.00 136.86 ? 61  PHE F CA    1 
ATOM   4288  C C     . PHE F 2 62  ? 143.004 157.431 166.074 1.00 136.86 ? 61  PHE F C     1 
ATOM   4289  O O     . PHE F 2 62  ? 143.222 156.408 165.403 1.00 136.86 ? 61  PHE F O     1 
ATOM   4290  C CB    . PHE F 2 62  ? 144.525 159.388 166.172 1.00 136.86 ? 61  PHE F CB    1 
ATOM   4291  C CG    . PHE F 2 62  ? 145.605 158.382 166.379 1.00 136.86 ? 61  PHE F CG    1 
ATOM   4292  C CD1   . PHE F 2 62  ? 146.266 157.834 165.298 1.00 136.86 ? 61  PHE F CD1   1 
ATOM   4293  C CD2   . PHE F 2 62  ? 145.957 157.980 167.647 1.00 136.86 ? 61  PHE F CD2   1 
ATOM   4294  C CE1   . PHE F 2 62  ? 147.259 156.904 165.477 1.00 136.86 ? 61  PHE F CE1   1 
ATOM   4295  C CE2   . PHE F 2 62  ? 146.950 157.050 167.834 1.00 136.86 ? 61  PHE F CE2   1 
ATOM   4296  C CZ    . PHE F 2 62  ? 147.602 156.514 166.747 1.00 136.86 ? 61  PHE F CZ    1 
ATOM   4297  N N     . LEU F 2 63  ? 142.495 157.374 167.295 1.00 139.09 ? 62  LEU F N     1 
ATOM   4298  C CA    . LEU F 2 63  ? 142.285 156.035 167.793 1.00 139.09 ? 62  LEU F CA    1 
ATOM   4299  C C     . LEU F 2 63  ? 140.966 155.446 167.320 1.00 139.09 ? 62  LEU F C     1 
ATOM   4300  O O     . LEU F 2 63  ? 140.805 154.236 167.419 1.00 139.09 ? 62  LEU F O     1 
ATOM   4301  C CB    . LEU F 2 63  ? 142.459 156.000 169.310 1.00 139.09 ? 62  LEU F CB    1 
ATOM   4302  C CG    . LEU F 2 63  ? 141.522 156.470 170.394 1.00 139.09 ? 62  LEU F CG    1 
ATOM   4303  C CD1   . LEU F 2 63  ? 140.975 155.261 171.024 1.00 139.09 ? 62  LEU F CD1   1 
ATOM   4304  C CD2   . LEU F 2 63  ? 142.333 157.203 171.396 1.00 139.09 ? 62  LEU F CD2   1 
ATOM   4305  N N     . GLU F 2 64  ? 140.083 156.227 166.691 1.00 145.55 ? 63  GLU F N     1 
ATOM   4306  C CA    . GLU F 2 64  ? 139.021 155.617 165.898 1.00 145.55 ? 63  GLU F CA    1 
ATOM   4307  C C     . GLU F 2 64  ? 139.589 154.873 164.708 1.00 145.55 ? 63  GLU F C     1 
ATOM   4308  O O     . GLU F 2 64  ? 139.134 153.764 164.397 1.00 145.55 ? 63  GLU F O     1 
ATOM   4309  C CB    . GLU F 2 64  ? 138.027 156.666 165.414 1.00 145.55 ? 63  GLU F CB    1 
ATOM   4310  C CG    . GLU F 2 64  ? 136.886 156.931 166.361 1.00 145.55 ? 63  GLU F CG    1 
ATOM   4311  C CD    . GLU F 2 64  ? 135.918 157.954 165.822 1.00 145.55 ? 63  GLU F CD    1 
ATOM   4312  O OE1   . GLU F 2 64  ? 136.170 158.481 164.719 1.00 145.55 ? 63  GLU F OE1   1 
ATOM   4313  O OE2   . GLU F 2 64  ? 134.912 158.239 166.503 1.00 145.55 ? 63  GLU F OE2   1 
ATOM   4314  N N     . ASN F 2 65  ? 140.583 155.467 164.040 1.00 141.95 ? 64  ASN F N     1 
ATOM   4315  C CA    . ASN F 2 65  ? 141.242 154.784 162.931 1.00 141.95 ? 64  ASN F CA    1 
ATOM   4316  C C     . ASN F 2 65  ? 141.904 153.492 163.389 1.00 141.95 ? 64  ASN F C     1 
ATOM   4317  O O     . ASN F 2 65  ? 141.710 152.431 162.778 1.00 141.95 ? 64  ASN F O     1 
ATOM   4318  C CB    . ASN F 2 65  ? 142.274 155.702 162.287 1.00 141.95 ? 64  ASN F CB    1 
ATOM   4319  C CG    . ASN F 2 65  ? 141.644 156.757 161.420 1.00 141.95 ? 64  ASN F CG    1 
ATOM   4320  O OD1   . ASN F 2 65  ? 140.489 156.635 161.020 1.00 141.95 ? 64  ASN F OD1   1 
ATOM   4321  N ND2   . ASN F 2 65  ? 142.398 157.805 161.121 1.00 141.95 ? 64  ASN F ND2   1 
ATOM   4322  N N     . VAL F 2 66  ? 142.643 153.547 164.496 1.00 137.33 ? 65  VAL F N     1 
ATOM   4323  C CA    . VAL F 2 66  ? 143.355 152.328 164.871 1.00 137.33 ? 65  VAL F CA    1 
ATOM   4324  C C     . VAL F 2 66  ? 142.420 151.304 165.533 1.00 137.33 ? 65  VAL F C     1 
ATOM   4325  O O     . VAL F 2 66  ? 142.648 150.096 165.414 1.00 137.33 ? 65  VAL F O     1 
ATOM   4326  C CB    . VAL F 2 66  ? 144.586 152.645 165.736 1.00 137.33 ? 65  VAL F CB    1 
ATOM   4327  C CG1   . VAL F 2 66  ? 144.209 152.941 167.144 1.00 137.33 ? 65  VAL F CG1   1 
ATOM   4328  C CG2   . VAL F 2 66  ? 145.577 151.505 165.684 1.00 137.33 ? 65  VAL F CG2   1 
ATOM   4329  N N     . ILE F 2 67  ? 141.312 151.732 166.144 1.00 136.19 ? 66  ILE F N     1 
ATOM   4330  C CA    . ILE F 2 67  ? 140.367 150.763 166.684 1.00 136.19 ? 66  ILE F CA    1 
ATOM   4331  C C     . ILE F 2 67  ? 139.588 150.077 165.577 1.00 136.19 ? 66  ILE F C     1 
ATOM   4332  O O     . ILE F 2 67  ? 139.362 148.869 165.657 1.00 136.19 ? 66  ILE F O     1 
ATOM   4333  C CB    . ILE F 2 67  ? 139.459 151.436 167.732 1.00 136.19 ? 66  ILE F CB    1 
ATOM   4334  C CG1   . ILE F 2 67  ? 140.208 151.554 169.045 1.00 136.19 ? 66  ILE F CG1   1 
ATOM   4335  C CG2   . ILE F 2 67  ? 138.170 150.686 167.983 1.00 136.19 ? 66  ILE F CG2   1 
ATOM   4336  C CD1   . ILE F 2 67  ? 140.601 150.234 169.578 1.00 136.19 ? 66  ILE F CD1   1 
ATOM   4337  N N     . ARG F 2 68  ? 139.212 150.794 164.516 1.00 143.09 ? 67  ARG F N     1 
ATOM   4338  C CA    . ARG F 2 68  ? 138.586 150.126 163.379 1.00 143.09 ? 67  ARG F CA    1 
ATOM   4339  C C     . ARG F 2 68  ? 139.547 149.145 162.724 1.00 143.09 ? 67  ARG F C     1 
ATOM   4340  O O     . ARG F 2 68  ? 139.181 147.993 162.442 1.00 143.09 ? 67  ARG F O     1 
ATOM   4341  C CB    . ARG F 2 68  ? 138.100 151.154 162.366 1.00 143.09 ? 67  ARG F CB    1 
ATOM   4342  C CG    . ARG F 2 68  ? 137.820 150.575 160.996 1.00 143.09 ? 67  ARG F CG    1 
ATOM   4343  C CD    . ARG F 2 68  ? 137.839 151.650 159.938 1.00 143.09 ? 67  ARG F CD    1 
ATOM   4344  N NE    . ARG F 2 68  ? 137.064 152.808 160.355 1.00 143.09 ? 67  ARG F NE    1 
ATOM   4345  C CZ    . ARG F 2 68  ? 137.362 154.057 160.028 1.00 143.09 ? 67  ARG F CZ    1 
ATOM   4346  N NH1   . ARG F 2 68  ? 138.422 154.310 159.276 1.00 143.09 ? 67  ARG F NH1   1 
ATOM   4347  N NH2   . ARG F 2 68  ? 136.599 155.050 160.454 1.00 143.09 ? 67  ARG F NH2   1 
ATOM   4348  N N     . ASP F 2 69  ? 140.806 149.552 162.551 1.00 145.08 ? 68  ASP F N     1 
ATOM   4349  C CA    . ASP F 2 69  ? 141.765 148.641 161.944 1.00 145.08 ? 68  ASP F CA    1 
ATOM   4350  C C     . ASP F 2 69  ? 142.185 147.502 162.865 1.00 145.08 ? 68  ASP F C     1 
ATOM   4351  O O     . ASP F 2 69  ? 142.788 146.547 162.381 1.00 145.08 ? 68  ASP F O     1 
ATOM   4352  C CB    . ASP F 2 69  ? 143.000 149.407 161.482 1.00 145.08 ? 68  ASP F CB    1 
ATOM   4353  C CG    . ASP F 2 69  ? 142.666 150.512 160.503 1.00 145.08 ? 68  ASP F CG    1 
ATOM   4354  O OD1   . ASP F 2 69  ? 141.589 150.442 159.881 1.00 145.08 ? 68  ASP F OD1   1 
ATOM   4355  O OD2   . ASP F 2 69  ? 143.474 151.453 160.361 1.00 145.08 ? 68  ASP F OD2   1 
ATOM   4356  N N     . ALA F 2 70  ? 141.896 147.571 164.164 1.00 139.23 ? 69  ALA F N     1 
ATOM   4357  C CA    . ALA F 2 70  ? 142.148 146.426 165.032 1.00 139.23 ? 69  ALA F CA    1 
ATOM   4358  C C     . ALA F 2 70  ? 140.950 145.493 165.133 1.00 139.23 ? 69  ALA F C     1 
ATOM   4359  O O     . ALA F 2 70  ? 141.114 144.265 165.153 1.00 139.23 ? 69  ALA F O     1 
ATOM   4360  C CB    . ALA F 2 70  ? 142.537 146.904 166.427 1.00 139.23 ? 69  ALA F CB    1 
ATOM   4361  N N     . VAL F 2 71  ? 139.749 146.065 165.214 1.00 136.56 ? 70  VAL F N     1 
ATOM   4362  C CA    . VAL F 2 71  ? 138.514 145.294 165.246 1.00 136.56 ? 70  VAL F CA    1 
ATOM   4363  C C     . VAL F 2 71  ? 138.344 144.483 163.972 1.00 136.56 ? 70  VAL F C     1 
ATOM   4364  O O     . VAL F 2 71  ? 137.864 143.344 164.020 1.00 136.56 ? 70  VAL F O     1 
ATOM   4365  C CB    . VAL F 2 71  ? 137.338 146.254 165.512 1.00 136.56 ? 70  VAL F CB    1 
ATOM   4366  C CG1   . VAL F 2 71  ? 136.001 145.623 165.234 1.00 136.56 ? 70  VAL F CG1   1 
ATOM   4367  C CG2   . VAL F 2 71  ? 137.361 146.669 166.952 1.00 136.56 ? 70  VAL F CG2   1 
ATOM   4368  N N     . THR F 2 72  ? 138.792 145.010 162.828 1.00 140.04 ? 71  THR F N     1 
ATOM   4369  C CA    . THR F 2 72  ? 138.721 144.223 161.598 1.00 140.04 ? 71  THR F CA    1 
ATOM   4370  C C     . THR F 2 72  ? 139.649 143.015 161.644 1.00 140.04 ? 71  THR F C     1 
ATOM   4371  O O     . THR F 2 72  ? 139.275 141.926 161.192 1.00 140.04 ? 71  THR F O     1 
ATOM   4372  C CB    . THR F 2 72  ? 139.052 145.092 160.399 1.00 140.04 ? 71  THR F CB    1 
ATOM   4373  O OG1   . THR F 2 72  ? 138.349 146.333 160.507 1.00 140.04 ? 71  THR F OG1   1 
ATOM   4374  C CG2   . THR F 2 72  ? 138.630 144.404 159.131 1.00 140.04 ? 71  THR F CG2   1 
ATOM   4375  N N     . TYR F 2 73  ? 140.836 143.176 162.231 1.00 142.27 ? 72  TYR F N     1 
ATOM   4376  C CA    . TYR F 2 73  ? 141.745 142.049 162.416 1.00 142.27 ? 72  TYR F CA    1 
ATOM   4377  C C     . TYR F 2 73  ? 141.144 140.989 163.331 1.00 142.27 ? 72  TYR F C     1 
ATOM   4378  O O     . TYR F 2 73  ? 141.218 139.787 163.036 1.00 142.27 ? 72  TYR F O     1 
ATOM   4379  C CB    . TYR F 2 73  ? 143.056 142.538 163.007 1.00 142.27 ? 72  TYR F CB    1 
ATOM   4380  C CG    . TYR F 2 73  ? 144.146 142.813 162.020 1.00 142.27 ? 72  TYR F CG    1 
ATOM   4381  C CD1   . TYR F 2 73  ? 144.710 141.797 161.288 1.00 142.27 ? 72  TYR F CD1   1 
ATOM   4382  C CD2   . TYR F 2 73  ? 144.641 144.089 161.860 1.00 142.27 ? 72  TYR F CD2   1 
ATOM   4383  C CE1   . TYR F 2 73  ? 145.724 142.054 160.400 1.00 142.27 ? 72  TYR F CE1   1 
ATOM   4384  C CE2   . TYR F 2 73  ? 145.644 144.358 160.979 1.00 142.27 ? 72  TYR F CE2   1 
ATOM   4385  C CZ    . TYR F 2 73  ? 146.185 143.340 160.249 1.00 142.27 ? 72  TYR F CZ    1 
ATOM   4386  O OH    . TYR F 2 73  ? 147.197 143.611 159.361 1.00 142.27 ? 72  TYR F OH    1 
ATOM   4387  N N     . THR F 2 74  ? 140.543 141.426 164.440 1.00 141.84 ? 73  THR F N     1 
ATOM   4388  C CA    . THR F 2 74  ? 139.952 140.491 165.394 1.00 141.84 ? 73  THR F CA    1 
ATOM   4389  C C     . THR F 2 74  ? 138.779 139.742 164.778 1.00 141.84 ? 73  THR F C     1 
ATOM   4390  O O     . THR F 2 74  ? 138.690 138.513 164.881 1.00 141.84 ? 73  THR F O     1 
ATOM   4391  C CB    . THR F 2 74  ? 139.525 141.241 166.652 1.00 141.84 ? 73  THR F CB    1 
ATOM   4392  O OG1   . THR F 2 74  ? 140.677 141.481 167.461 1.00 141.84 ? 73  THR F OG1   1 
ATOM   4393  C CG2   . THR F 2 74  ? 138.527 140.455 167.464 1.00 141.84 ? 73  THR F CG2   1 
ATOM   4394  N N     . GLU F 2 75  ? 137.903 140.457 164.078 1.00 141.08 ? 74  GLU F N     1 
ATOM   4395  C CA    . GLU F 2 75  ? 136.773 139.809 163.434 1.00 141.08 ? 74  GLU F CA    1 
ATOM   4396  C C     . GLU F 2 75  ? 137.190 138.930 162.271 1.00 141.08 ? 74  GLU F C     1 
ATOM   4397  O O     . GLU F 2 75  ? 136.446 138.014 161.914 1.00 141.08 ? 74  GLU F O     1 
ATOM   4398  C CB    . GLU F 2 75  ? 135.770 140.849 162.948 1.00 141.08 ? 74  GLU F CB    1 
ATOM   4399  C CG    . GLU F 2 75  ? 135.041 141.562 164.060 1.00 141.08 ? 74  GLU F CG    1 
ATOM   4400  C CD    . GLU F 2 75  ? 134.157 140.639 164.864 1.00 141.08 ? 74  GLU F CD    1 
ATOM   4401  O OE1   . GLU F 2 75  ? 133.587 139.692 164.286 1.00 141.08 ? 74  GLU F OE1   1 
ATOM   4402  O OE2   . GLU F 2 75  ? 134.030 140.861 166.082 1.00 141.08 ? 74  GLU F OE2   1 
ATOM   4403  N N     . HIS F 2 76  ? 138.348 139.175 161.667 1.00 143.00 ? 75  HIS F N     1 
ATOM   4404  C CA    . HIS F 2 76  ? 138.808 138.192 160.703 1.00 143.00 ? 75  HIS F CA    1 
ATOM   4405  C C     . HIS F 2 76  ? 139.326 136.952 161.399 1.00 143.00 ? 75  HIS F C     1 
ATOM   4406  O O     . HIS F 2 76  ? 139.122 135.836 160.915 1.00 143.00 ? 75  HIS F O     1 
ATOM   4407  C CB    . HIS F 2 76  ? 139.899 138.745 159.808 1.00 143.00 ? 75  HIS F CB    1 
ATOM   4408  C CG    . HIS F 2 76  ? 140.438 137.726 158.860 1.00 143.00 ? 75  HIS F CG    1 
ATOM   4409  N ND1   . HIS F 2 76  ? 141.604 137.033 159.096 1.00 143.00 ? 75  HIS F ND1   1 
ATOM   4410  C CD2   . HIS F 2 76  ? 139.938 137.237 157.703 1.00 143.00 ? 75  HIS F CD2   1 
ATOM   4411  C CE1   . HIS F 2 76  ? 141.816 136.185 158.107 1.00 143.00 ? 75  HIS F CE1   1 
ATOM   4412  N NE2   . HIS F 2 76  ? 140.819 136.288 157.249 1.00 143.00 ? 75  HIS F NE2   1 
ATOM   4413  N N     . ALA F 2 77  ? 139.974 137.119 162.544 1.00 143.16 ? 76  ALA F N     1 
ATOM   4414  C CA    . ALA F 2 77  ? 140.515 135.962 163.242 1.00 143.16 ? 76  ALA F CA    1 
ATOM   4415  C C     . ALA F 2 77  ? 139.458 135.149 163.976 1.00 143.16 ? 76  ALA F C     1 
ATOM   4416  O O     . ALA F 2 77  ? 139.815 134.136 164.586 1.00 143.16 ? 76  ALA F O     1 
ATOM   4417  C CB    . ALA F 2 77  ? 141.593 136.401 164.229 1.00 143.16 ? 76  ALA F CB    1 
ATOM   4418  N N     . LYS F 2 78  ? 138.190 135.572 163.918 1.00 142.46 ? 77  LYS F N     1 
ATOM   4419  C CA    . LYS F 2 78  ? 137.058 134.941 164.600 1.00 142.46 ? 77  LYS F CA    1 
ATOM   4420  C C     . LYS F 2 78  ? 137.294 134.862 166.102 1.00 142.46 ? 77  LYS F C     1 
ATOM   4421  O O     . LYS F 2 78  ? 137.363 133.785 166.689 1.00 142.46 ? 77  LYS F O     1 
ATOM   4422  C CB    . LYS F 2 78  ? 136.737 133.563 164.021 1.00 142.46 ? 77  LYS F CB    1 
ATOM   4423  C CG    . LYS F 2 78  ? 135.482 133.536 163.184 1.00 142.46 ? 77  LYS F CG    1 
ATOM   4424  C CD    . LYS F 2 78  ? 135.515 132.376 162.212 1.00 142.46 ? 77  LYS F CD    1 
ATOM   4425  C CE    . LYS F 2 78  ? 134.413 132.484 161.179 1.00 142.46 ? 77  LYS F CE    1 
ATOM   4426  N NZ    . LYS F 2 78  ? 134.544 131.425 160.143 1.00 142.46 ? 77  LYS F NZ    1 
ATOM   4427  N N     . ARG F 2 79  ? 137.435 136.017 166.718 1.00 150.53 ? 78  ARG F N     1 
ATOM   4428  C CA    . ARG F 2 79  ? 137.560 136.111 168.156 1.00 150.53 ? 78  ARG F CA    1 
ATOM   4429  C C     . ARG F 2 79  ? 136.488 137.040 168.694 1.00 150.53 ? 78  ARG F C     1 
ATOM   4430  O O     . ARG F 2 79  ? 135.673 137.587 167.952 1.00 150.53 ? 78  ARG F O     1 
ATOM   4431  C CB    . ARG F 2 79  ? 138.951 136.599 168.543 1.00 150.53 ? 78  ARG F CB    1 
ATOM   4432  C CG    . ARG F 2 79  ? 139.960 135.497 168.639 1.00 150.53 ? 78  ARG F CG    1 
ATOM   4433  C CD    . ARG F 2 79  ? 141.309 136.043 169.008 1.00 150.53 ? 78  ARG F CD    1 
ATOM   4434  N NE    . ARG F 2 79  ? 141.777 136.999 168.020 1.00 150.53 ? 78  ARG F NE    1 
ATOM   4435  C CZ    . ARG F 2 79  ? 143.053 137.299 167.832 1.00 150.53 ? 78  ARG F CZ    1 
ATOM   4436  N NH1   . ARG F 2 79  ? 143.979 136.705 168.563 1.00 150.53 ? 78  ARG F NH1   1 
ATOM   4437  N NH2   . ARG F 2 79  ? 143.404 138.183 166.910 1.00 150.53 ? 78  ARG F NH2   1 
ATOM   4438  N N     . LYS F 2 80  ? 136.471 137.183 170.009 1.00 153.71 ? 79  LYS F N     1 
ATOM   4439  C CA    . LYS F 2 80  ? 135.691 138.212 170.663 1.00 153.71 ? 79  LYS F CA    1 
ATOM   4440  C C     . LYS F 2 80  ? 136.574 139.119 171.488 1.00 153.71 ? 79  LYS F C     1 
ATOM   4441  O O     . LYS F 2 80  ? 136.066 140.030 172.147 1.00 153.71 ? 79  LYS F O     1 
ATOM   4442  C CB    . LYS F 2 80  ? 134.618 137.594 171.562 1.00 153.71 ? 79  LYS F CB    1 
ATOM   4443  C CG    . LYS F 2 80  ? 133.706 136.629 170.858 1.00 153.71 ? 79  LYS F CG    1 
ATOM   4444  C CD    . LYS F 2 80  ? 132.874 137.344 169.827 1.00 153.71 ? 79  LYS F CD    1 
ATOM   4445  C CE    . LYS F 2 80  ? 132.469 136.398 168.716 1.00 153.71 ? 79  LYS F CE    1 
ATOM   4446  N NZ    . LYS F 2 80  ? 133.643 135.753 168.073 1.00 153.71 ? 79  LYS F NZ    1 
ATOM   4447  N N     . THR F 2 81  ? 137.879 138.892 171.473 1.00 154.09 ? 80  THR F N     1 
ATOM   4448  C CA    . THR F 2 81  ? 138.811 139.570 172.357 1.00 154.09 ? 80  THR F CA    1 
ATOM   4449  C C     . THR F 2 81  ? 139.864 140.257 171.508 1.00 154.09 ? 80  THR F C     1 
ATOM   4450  O O     . THR F 2 81  ? 140.556 139.602 170.725 1.00 154.09 ? 80  THR F O     1 
ATOM   4451  C CB    . THR F 2 81  ? 139.459 138.579 173.323 1.00 154.09 ? 80  THR F CB    1 
ATOM   4452  O OG1   . THR F 2 81  ? 138.501 138.172 174.305 1.00 154.09 ? 80  THR F OG1   1 
ATOM   4453  C CG2   . THR F 2 81  ? 140.641 139.204 174.021 1.00 154.09 ? 80  THR F CG2   1 
ATOM   4454  N N     . VAL F 2 82  ? 139.979 141.571 171.653 1.00 143.39 ? 81  VAL F N     1 
ATOM   4455  C CA    . VAL F 2 82  ? 141.026 142.297 170.949 1.00 143.39 ? 81  VAL F CA    1 
ATOM   4456  C C     . VAL F 2 82  ? 142.341 142.024 171.661 1.00 143.39 ? 81  VAL F C     1 
ATOM   4457  O O     . VAL F 2 82  ? 142.503 142.367 172.833 1.00 143.39 ? 81  VAL F O     1 
ATOM   4458  C CB    . VAL F 2 82  ? 140.733 143.794 170.895 1.00 143.39 ? 81  VAL F CB    1 
ATOM   4459  C CG1   . VAL F 2 82  ? 141.847 144.499 170.183 1.00 143.39 ? 81  VAL F CG1   1 
ATOM   4460  C CG2   . VAL F 2 82  ? 139.435 144.027 170.188 1.00 143.39 ? 81  VAL F CG2   1 
ATOM   4461  N N     . THR F 2 83  ? 143.275 141.398 170.969 1.00 145.14 ? 82  THR F N     1 
ATOM   4462  C CA    . THR F 2 83  ? 144.568 141.116 171.560 1.00 145.14 ? 82  THR F CA    1 
ATOM   4463  C C     . THR F 2 83  ? 145.492 142.302 171.341 1.00 145.14 ? 82  THR F C     1 
ATOM   4464  O O     . THR F 2 83  ? 145.138 143.278 170.681 1.00 145.14 ? 82  THR F O     1 
ATOM   4465  C CB    . THR F 2 83  ? 145.163 139.848 170.971 1.00 145.14 ? 82  THR F CB    1 
ATOM   4466  O OG1   . THR F 2 83  ? 145.257 139.992 169.552 1.00 145.14 ? 82  THR F OG1   1 
ATOM   4467  C CG2   . THR F 2 83  ? 144.290 138.667 171.303 1.00 145.14 ? 82  THR F CG2   1 
ATOM   4468  N N     . ALA F 2 84  ? 146.694 142.228 171.890 1.00 143.98 ? 83  ALA F N     1 
ATOM   4469  C CA    . ALA F 2 84  ? 147.677 143.263 171.637 1.00 143.98 ? 83  ALA F CA    1 
ATOM   4470  C C     . ALA F 2 84  ? 148.303 143.129 170.266 1.00 143.98 ? 83  ALA F C     1 
ATOM   4471  O O     . ALA F 2 84  ? 148.766 144.129 169.707 1.00 143.98 ? 83  ALA F O     1 
ATOM   4472  C CB    . ALA F 2 84  ? 148.773 143.230 172.700 1.00 143.98 ? 83  ALA F CB    1 
ATOM   4473  N N     . MET F 2 85  ? 148.304 141.928 169.704 1.00 142.25 ? 84  MET F N     1 
ATOM   4474  C CA    . MET F 2 85  ? 148.880 141.752 168.384 1.00 142.25 ? 84  MET F CA    1 
ATOM   4475  C C     . MET F 2 85  ? 148.026 142.382 167.299 1.00 142.25 ? 84  MET F C     1 
ATOM   4476  O O     . MET F 2 85  ? 148.570 142.854 166.299 1.00 142.25 ? 84  MET F O     1 
ATOM   4477  C CB    . MET F 2 85  ? 149.091 140.273 168.100 1.00 142.25 ? 84  MET F CB    1 
ATOM   4478  C CG    . MET F 2 85  ? 150.186 139.683 168.938 1.00 142.25 ? 84  MET F CG    1 
ATOM   4479  S SD    . MET F 2 85  ? 151.606 140.776 168.970 1.00 142.25 ? 84  MET F SD    1 
ATOM   4480  C CE    . MET F 2 85  ? 152.235 140.555 167.309 1.00 142.25 ? 84  MET F CE    1 
ATOM   4481  N N     . ASP F 2 86  ? 146.709 142.437 167.489 1.00 144.31 ? 85  ASP F N     1 
ATOM   4482  C CA    . ASP F 2 86  ? 145.868 143.136 166.527 1.00 144.31 ? 85  ASP F CA    1 
ATOM   4483  C C     . ASP F 2 86  ? 146.146 144.627 166.539 1.00 144.31 ? 85  ASP F C     1 
ATOM   4484  O O     . ASP F 2 86  ? 146.179 145.265 165.481 1.00 144.31 ? 85  ASP F O     1 
ATOM   4485  C CB    . ASP F 2 86  ? 144.400 142.866 166.817 1.00 144.31 ? 85  ASP F CB    1 
ATOM   4486  C CG    . ASP F 2 86  ? 144.073 141.397 166.792 1.00 144.31 ? 85  ASP F CG    1 
ATOM   4487  O OD1   . ASP F 2 86  ? 144.995 140.598 166.536 1.00 144.31 ? 85  ASP F OD1   1 
ATOM   4488  O OD2   . ASP F 2 86  ? 142.897 141.037 166.997 1.00 144.31 ? 85  ASP F OD2   1 
ATOM   4489  N N     . VAL F 2 87  ? 146.383 145.188 167.723 1.00 137.72 ? 86  VAL F N     1 
ATOM   4490  C CA    . VAL F 2 87  ? 146.740 146.594 167.830 1.00 137.72 ? 86  VAL F CA    1 
ATOM   4491  C C     . VAL F 2 87  ? 148.096 146.845 167.191 1.00 137.72 ? 86  VAL F C     1 
ATOM   4492  O O     . VAL F 2 87  ? 148.280 147.836 166.474 1.00 137.72 ? 86  VAL F O     1 
ATOM   4493  C CB    . VAL F 2 87  ? 146.705 147.019 169.305 1.00 137.72 ? 86  VAL F CB    1 
ATOM   4494  C CG1   . VAL F 2 87  ? 147.376 148.345 169.512 1.00 137.72 ? 86  VAL F CG1   1 
ATOM   4495  C CG2   . VAL F 2 87  ? 145.283 147.084 169.779 1.00 137.72 ? 86  VAL F CG2   1 
ATOM   4496  N N     . VAL F 2 88  ? 149.039 145.921 167.382 1.00 136.10 ? 87  VAL F N     1 
ATOM   4497  C CA    . VAL F 2 88  ? 150.367 146.077 166.799 1.00 136.10 ? 87  VAL F CA    1 
ATOM   4498  C C     . VAL F 2 88  ? 150.302 146.008 165.278 1.00 136.10 ? 87  VAL F C     1 
ATOM   4499  O O     . VAL F 2 88  ? 150.933 146.812 164.583 1.00 136.10 ? 87  VAL F O     1 
ATOM   4500  C CB    . VAL F 2 88  ? 151.323 145.029 167.389 1.00 136.10 ? 87  VAL F CB    1 
ATOM   4501  C CG1   . VAL F 2 88  ? 152.582 144.890 166.560 1.00 136.10 ? 87  VAL F CG1   1 
ATOM   4502  C CG2   . VAL F 2 88  ? 151.687 145.421 168.789 1.00 136.10 ? 87  VAL F CG2   1 
ATOM   4503  N N     . TYR F 2 89  ? 149.470 145.122 164.738 1.00 145.37 ? 88  TYR F N     1 
ATOM   4504  C CA    . TYR F 2 89  ? 149.359 145.031 163.287 1.00 145.37 ? 88  TYR F CA    1 
ATOM   4505  C C     . TYR F 2 89  ? 148.619 146.228 162.709 1.00 145.37 ? 88  TYR F C     1 
ATOM   4506  O O     . TYR F 2 89  ? 148.977 146.719 161.630 1.00 145.37 ? 88  TYR F O     1 
ATOM   4507  C CB    . TYR F 2 89  ? 148.669 143.732 162.892 1.00 145.37 ? 88  TYR F CB    1 
ATOM   4508  C CG    . TYR F 2 89  ? 149.455 142.511 163.275 1.00 145.37 ? 88  TYR F CG    1 
ATOM   4509  C CD1   . TYR F 2 89  ? 150.839 142.542 163.303 1.00 145.37 ? 88  TYR F CD1   1 
ATOM   4510  C CD2   . TYR F 2 89  ? 148.816 141.329 163.607 1.00 145.37 ? 88  TYR F CD2   1 
ATOM   4511  C CE1   . TYR F 2 89  ? 151.564 141.437 163.660 1.00 145.37 ? 88  TYR F CE1   1 
ATOM   4512  C CE2   . TYR F 2 89  ? 149.531 140.217 163.967 1.00 145.37 ? 88  TYR F CE2   1 
ATOM   4513  C CZ    . TYR F 2 89  ? 150.907 140.277 163.990 1.00 145.37 ? 88  TYR F CZ    1 
ATOM   4514  O OH    . TYR F 2 89  ? 151.636 139.168 164.340 1.00 145.37 ? 88  TYR F OH    1 
ATOM   4515  N N     . ALA F 2 90  ? 147.599 146.722 163.416 1.00 142.14 ? 89  ALA F N     1 
ATOM   4516  C CA    . ALA F 2 90  ? 146.865 147.888 162.944 1.00 142.14 ? 89  ALA F CA    1 
ATOM   4517  C C     . ALA F 2 90  ? 147.728 149.137 162.965 1.00 142.14 ? 89  ALA F C     1 
ATOM   4518  O O     . ALA F 2 90  ? 147.599 149.993 162.087 1.00 142.14 ? 89  ALA F O     1 
ATOM   4519  C CB    . ALA F 2 90  ? 145.615 148.096 163.790 1.00 142.14 ? 89  ALA F CB    1 
ATOM   4520  N N     . LEU F 2 91  ? 148.619 149.254 163.944 1.00 136.55 ? 90  LEU F N     1 
ATOM   4521  C CA    . LEU F 2 91  ? 149.572 150.349 163.920 1.00 136.55 ? 90  LEU F CA    1 
ATOM   4522  C C     . LEU F 2 91  ? 150.655 150.121 162.888 1.00 136.55 ? 90  LEU F C     1 
ATOM   4523  O O     . LEU F 2 91  ? 151.220 151.087 162.372 1.00 136.55 ? 90  LEU F O     1 
ATOM   4524  C CB    . LEU F 2 91  ? 150.202 150.533 165.291 1.00 136.55 ? 90  LEU F CB    1 
ATOM   4525  C CG    . LEU F 2 91  ? 149.279 151.206 166.289 1.00 136.55 ? 90  LEU F CG    1 
ATOM   4526  C CD1   . LEU F 2 91  ? 149.589 150.739 167.677 1.00 136.55 ? 90  LEU F CD1   1 
ATOM   4527  C CD2   . LEU F 2 91  ? 149.457 152.687 166.189 1.00 136.55 ? 90  LEU F CD2   1 
ATOM   4528  N N     . LYS F 2 92  ? 150.958 148.865 162.579 1.00 140.61 ? 91  LYS F N     1 
ATOM   4529  C CA    . LYS F 2 92  ? 151.983 148.581 161.589 1.00 140.61 ? 91  LYS F CA    1 
ATOM   4530  C C     . LYS F 2 92  ? 151.535 148.950 160.190 1.00 140.61 ? 91  LYS F C     1 
ATOM   4531  O O     . LYS F 2 92  ? 152.303 149.557 159.439 1.00 140.61 ? 91  LYS F O     1 
ATOM   4532  C CB    . LYS F 2 92  ? 152.368 147.107 161.639 1.00 140.61 ? 91  LYS F CB    1 
ATOM   4533  C CG    . LYS F 2 92  ? 153.378 146.707 160.581 1.00 140.61 ? 91  LYS F CG    1 
ATOM   4534  C CD    . LYS F 2 92  ? 153.703 145.232 160.650 1.00 140.61 ? 91  LYS F CD    1 
ATOM   4535  C CE    . LYS F 2 92  ? 154.473 144.920 161.908 1.00 140.61 ? 91  LYS F CE    1 
ATOM   4536  N NZ    . LYS F 2 92  ? 155.588 145.885 162.086 1.00 140.61 ? 91  LYS F NZ    1 
ATOM   4537  N N     . ARG F 2 93  ? 150.300 148.629 159.830 1.00 139.87 ? 92  ARG F N     1 
ATOM   4538  C CA    . ARG F 2 93  ? 149.845 148.966 158.491 1.00 139.87 ? 92  ARG F CA    1 
ATOM   4539  C C     . ARG F 2 93  ? 149.520 150.442 158.331 1.00 139.87 ? 92  ARG F C     1 
ATOM   4540  O O     . ARG F 2 93  ? 149.324 150.894 157.201 1.00 139.87 ? 92  ARG F O     1 
ATOM   4541  C CB    . ARG F 2 93  ? 148.628 148.129 158.113 1.00 139.87 ? 92  ARG F CB    1 
ATOM   4542  C CG    . ARG F 2 93  ? 147.386 148.458 158.888 1.00 139.87 ? 92  ARG F CG    1 
ATOM   4543  C CD    . ARG F 2 93  ? 146.180 148.110 158.068 1.00 139.87 ? 92  ARG F CD    1 
ATOM   4544  N NE    . ARG F 2 93  ? 146.297 148.670 156.732 1.00 139.87 ? 92  ARG F NE    1 
ATOM   4545  C CZ    . ARG F 2 93  ? 145.849 149.873 156.401 1.00 139.87 ? 92  ARG F CZ    1 
ATOM   4546  N NH1   . ARG F 2 93  ? 145.252 150.627 157.311 1.00 139.87 ? 92  ARG F NH1   1 
ATOM   4547  N NH2   . ARG F 2 93  ? 145.991 150.322 155.163 1.00 139.87 ? 92  ARG F NH2   1 
ATOM   4548  N N     . GLN F 2 94  ? 149.467 151.202 159.417 1.00 141.71 ? 93  GLN F N     1 
ATOM   4549  C CA    . GLN F 2 94  ? 149.325 152.645 159.343 1.00 141.71 ? 93  GLN F CA    1 
ATOM   4550  C C     . GLN F 2 94  ? 150.659 153.358 159.215 1.00 141.71 ? 93  GLN F C     1 
ATOM   4551  O O     . GLN F 2 94  ? 150.690 154.590 159.244 1.00 141.71 ? 93  GLN F O     1 
ATOM   4552  C CB    . GLN F 2 94  ? 148.597 153.165 160.573 1.00 141.71 ? 93  GLN F CB    1 
ATOM   4553  C CG    . GLN F 2 94  ? 147.107 153.129 160.462 1.00 141.71 ? 93  GLN F CG    1 
ATOM   4554  C CD    . GLN F 2 94  ? 146.455 154.017 161.485 1.00 141.71 ? 93  GLN F CD    1 
ATOM   4555  O OE1   . GLN F 2 94  ? 147.116 154.836 162.117 1.00 141.71 ? 93  GLN F OE1   1 
ATOM   4556  N NE2   . GLN F 2 94  ? 145.151 153.859 161.663 1.00 141.71 ? 93  GLN F NE2   1 
ATOM   4557  N N     . GLY F 2 95  ? 151.756 152.620 159.081 1.00 139.17 ? 94  GLY F N     1 
ATOM   4558  C CA    . GLY F 2 95  ? 153.065 153.238 159.037 1.00 139.17 ? 94  GLY F CA    1 
ATOM   4559  C C     . GLY F 2 95  ? 153.514 153.823 160.351 1.00 139.17 ? 94  GLY F C     1 
ATOM   4560  O O     . GLY F 2 95  ? 154.394 154.683 160.373 1.00 139.17 ? 94  GLY F O     1 
ATOM   4561  N N     . ARG F 2 96  ? 152.933 153.373 161.450 1.00 139.66 ? 95  ARG F N     1 
ATOM   4562  C CA    . ARG F 2 96  ? 153.165 153.912 162.778 1.00 139.66 ? 95  ARG F CA    1 
ATOM   4563  C C     . ARG F 2 96  ? 153.464 152.777 163.732 1.00 139.66 ? 95  ARG F C     1 
ATOM   4564  O O     . ARG F 2 96  ? 152.803 152.602 164.756 1.00 139.66 ? 95  ARG F O     1 
ATOM   4565  C CB    . ARG F 2 96  ? 151.964 154.724 163.244 1.00 139.66 ? 95  ARG F CB    1 
ATOM   4566  C CG    . ARG F 2 96  ? 152.288 155.781 164.280 1.00 139.66 ? 95  ARG F CG    1 
ATOM   4567  C CD    . ARG F 2 96  ? 151.082 156.650 164.553 1.00 139.66 ? 95  ARG F CD    1 
ATOM   4568  N NE    . ARG F 2 96  ? 150.405 157.014 163.317 1.00 139.66 ? 95  ARG F NE    1 
ATOM   4569  C CZ    . ARG F 2 96  ? 150.766 158.029 162.541 1.00 139.66 ? 95  ARG F CZ    1 
ATOM   4570  N NH1   . ARG F 2 96  ? 151.796 158.791 162.875 1.00 139.66 ? 95  ARG F NH1   1 
ATOM   4571  N NH2   . ARG F 2 96  ? 150.094 158.283 161.431 1.00 139.66 ? 95  ARG F NH2   1 
ATOM   4572  N N     . THR F 2 97  ? 154.420 151.937 163.346 1.00 144.73 ? 96  THR F N     1 
ATOM   4573  C CA    . THR F 2 97  ? 154.674 150.692 164.057 1.00 144.73 ? 96  THR F CA    1 
ATOM   4574  C C     . THR F 2 97  ? 155.177 150.924 165.473 1.00 144.73 ? 96  THR F C     1 
ATOM   4575  O O     . THR F 2 97  ? 155.948 151.846 165.743 1.00 144.73 ? 96  THR F O     1 
ATOM   4576  C CB    . THR F 2 97  ? 155.668 149.836 163.281 1.00 144.73 ? 96  THR F CB    1 
ATOM   4577  O OG1   . THR F 2 97  ? 156.017 148.688 164.062 1.00 144.73 ? 96  THR F OG1   1 
ATOM   4578  C CG2   . THR F 2 97  ? 156.908 150.619 162.908 1.00 144.73 ? 96  THR F CG2   1 
ATOM   4579  N N     . LEU F 2 98  ? 154.691 150.093 166.383 1.00 139.26 ? 97  LEU F N     1 
ATOM   4580  C CA    . LEU F 2 98  ? 154.964 150.206 167.806 1.00 139.26 ? 97  LEU F CA    1 
ATOM   4581  C C     . LEU F 2 98  ? 155.748 148.982 168.231 1.00 139.26 ? 97  LEU F C     1 
ATOM   4582  O O     . LEU F 2 98  ? 155.310 147.856 167.994 1.00 139.26 ? 97  LEU F O     1 
ATOM   4583  C CB    . LEU F 2 98  ? 153.666 150.306 168.599 1.00 139.26 ? 97  LEU F CB    1 
ATOM   4584  C CG    . LEU F 2 98  ? 153.772 150.055 170.094 1.00 139.26 ? 97  LEU F CG    1 
ATOM   4585  C CD1   . LEU F 2 98  ? 154.582 151.143 170.750 1.00 139.26 ? 97  LEU F CD1   1 
ATOM   4586  C CD2   . LEU F 2 98  ? 152.400 149.972 170.707 1.00 139.26 ? 97  LEU F CD2   1 
ATOM   4587  N N     . TYR F 2 99  ? 156.894 149.195 168.853 1.00 139.73 ? 98  TYR F N     1 
ATOM   4588  C CA    . TYR F 2 99  ? 157.680 148.065 169.298 1.00 139.73 ? 98  TYR F CA    1 
ATOM   4589  C C     . TYR F 2 99  ? 157.239 147.676 170.698 1.00 139.73 ? 98  TYR F C     1 
ATOM   4590  O O     . TYR F 2 99  ? 156.244 148.171 171.223 1.00 139.73 ? 98  TYR F O     1 
ATOM   4591  C CB    . TYR F 2 99  ? 159.164 148.390 169.271 1.00 139.73 ? 98  TYR F CB    1 
ATOM   4592  C CG    . TYR F 2 99  ? 159.806 148.297 167.920 1.00 139.73 ? 98  TYR F CG    1 
ATOM   4593  C CD1   . TYR F 2 99  ? 159.056 148.092 166.775 1.00 139.73 ? 98  TYR F CD1   1 
ATOM   4594  C CD2   . TYR F 2 99  ? 161.173 148.411 167.790 1.00 139.73 ? 98  TYR F CD2   1 
ATOM   4595  C CE1   . TYR F 2 99  ? 159.654 148.012 165.540 1.00 139.73 ? 98  TYR F CE1   1 
ATOM   4596  C CE2   . TYR F 2 99  ? 161.776 148.338 166.565 1.00 139.73 ? 98  TYR F CE2   1 
ATOM   4597  C CZ    . TYR F 2 99  ? 161.016 148.134 165.446 1.00 139.73 ? 98  TYR F CZ    1 
ATOM   4598  O OH    . TYR F 2 99  ? 161.636 148.056 164.228 1.00 139.73 ? 98  TYR F OH    1 
ATOM   4599  N N     . GLY F 2 100 ? 157.982 146.773 171.316 1.00 147.51 ? 99  GLY F N     1 
ATOM   4600  C CA    . GLY F 2 100 ? 157.794 146.462 172.719 1.00 147.51 ? 99  GLY F CA    1 
ATOM   4601  C C     . GLY F 2 100 ? 156.730 145.463 173.089 1.00 147.51 ? 99  GLY F C     1 
ATOM   4602  O O     . GLY F 2 100 ? 156.936 144.655 173.996 1.00 147.51 ? 99  GLY F O     1 
ATOM   4603  N N     . PHE F 2 101 ? 155.588 145.497 172.419 1.00 147.08 ? 100 PHE F N     1 
ATOM   4604  C CA    . PHE F 2 101 ? 154.489 144.606 172.778 1.00 147.08 ? 100 PHE F CA    1 
ATOM   4605  C C     . PHE F 2 101 ? 154.522 143.320 171.971 1.00 147.08 ? 100 PHE F C     1 
ATOM   4606  O O     . PHE F 2 101 ? 153.521 142.901 171.400 1.00 147.08 ? 100 PHE F O     1 
ATOM   4607  C CB    . PHE F 2 101 ? 153.166 145.324 172.610 1.00 147.08 ? 100 PHE F CB    1 
ATOM   4608  C CG    . PHE F 2 101 ? 152.927 146.363 173.644 1.00 147.08 ? 100 PHE F CG    1 
ATOM   4609  C CD1   . PHE F 2 101 ? 152.336 146.033 174.844 1.00 147.08 ? 100 PHE F CD1   1 
ATOM   4610  C CD2   . PHE F 2 101 ? 153.309 147.668 173.427 1.00 147.08 ? 100 PHE F CD2   1 
ATOM   4611  C CE1   . PHE F 2 101 ? 152.120 146.993 175.806 1.00 147.08 ? 100 PHE F CE1   1 
ATOM   4612  C CE2   . PHE F 2 101 ? 153.097 148.629 174.383 1.00 147.08 ? 100 PHE F CE2   1 
ATOM   4613  C CZ    . PHE F 2 101 ? 152.501 148.291 175.574 1.00 147.08 ? 100 PHE F CZ    1 
ATOM   4614  N N     . GLY F 2 102 ? 155.685 142.676 171.949 1.00 162.39 ? 101 GLY F N     1 
ATOM   4615  C CA    . GLY F 2 102 ? 155.857 141.369 171.348 1.00 162.39 ? 101 GLY F CA    1 
ATOM   4616  C C     . GLY F 2 102 ? 155.633 141.329 169.854 1.00 162.39 ? 101 GLY F C     1 
ATOM   4617  O O     . GLY F 2 102 ? 154.842 140.515 169.372 1.00 162.39 ? 101 GLY F O     1 
ATOM   4618  N N     . GLY F 2 103 ? 156.321 142.190 169.113 1.00 166.49 ? 102 GLY F N     1 
ATOM   4619  C CA    . GLY F 2 103 ? 156.124 142.288 167.677 1.00 166.49 ? 102 GLY F CA    1 
ATOM   4620  C C     . GLY F 2 103 ? 156.595 141.087 166.878 1.00 166.49 ? 102 GLY F C     1 
ATOM   4621  O O     . GLY F 2 103 ? 156.386 141.009 165.668 1.00 166.49 ? 102 GLY F O     1 
ATOM   4622  O OXT   . GLY F 2 103 ? 157.195 140.156 167.414 1.00 166.49 ? 102 GLY F OXT   1 
ATOM   4623  N N     . ARG G 3 12  ? 136.026 118.352 127.828 0.00 178.30 ? 11  ARG G N     1 
ATOM   4624  C CA    . ARG G 3 12  ? 135.804 118.021 126.428 0.00 178.30 ? 11  ARG G CA    1 
ATOM   4625  C C     . ARG G 3 12  ? 134.771 118.959 125.815 0.00 178.30 ? 11  ARG G C     1 
ATOM   4626  O O     . ARG G 3 12  ? 134.729 119.148 124.601 0.00 178.30 ? 11  ARG G O     1 
ATOM   4627  C CB    . ARG G 3 12  ? 135.349 116.569 126.285 0.00 178.30 ? 11  ARG G CB    1 
ATOM   4628  C CG    . ARG G 3 12  ? 135.517 115.999 124.884 0.00 178.30 ? 11  ARG G CG    1 
ATOM   4629  C CD    . ARG G 3 12  ? 135.035 114.563 124.794 0.00 178.30 ? 11  ARG G CD    1 
ATOM   4630  N NE    . ARG G 3 12  ? 133.580 114.472 124.836 0.00 178.30 ? 11  ARG G NE    1 
ATOM   4631  C CZ    . ARG G 3 12  ? 132.893 114.023 125.879 0.00 178.30 ? 11  ARG G CZ    1 
ATOM   4632  N NH1   . ARG G 3 12  ? 133.530 113.625 126.971 0.00 178.30 ? 11  ARG G NH1   1 
ATOM   4633  N NH2   . ARG G 3 12  ? 131.570 113.974 125.834 0.00 178.30 ? 11  ARG G NH2   1 
ATOM   4634  N N     . ALA G 3 13  ? 133.951 119.566 126.666 0.00 174.10 ? 12  ALA G N     1 
ATOM   4635  C CA    . ALA G 3 13  ? 132.866 120.430 126.216 0.00 174.10 ? 12  ALA G CA    1 
ATOM   4636  C C     . ALA G 3 13  ? 133.397 121.824 125.880 0.00 174.10 ? 12  ALA G C     1 
ATOM   4637  O O     . ALA G 3 13  ? 134.603 122.049 125.754 0.00 174.10 ? 12  ALA G O     1 
ATOM   4638  C CB    . ALA G 3 13  ? 131.766 120.485 127.271 0.00 174.10 ? 12  ALA G CB    1 
ATOM   4639  N N     . LYS G 3 14  ? 132.482 122.774 125.706 1.00 167.45 ? 13  LYS G N     1 
ATOM   4640  C CA    . LYS G 3 14  ? 132.863 124.151 125.435 1.00 167.45 ? 13  LYS G CA    1 
ATOM   4641  C C     . LYS G 3 14  ? 133.519 124.775 126.659 1.00 167.45 ? 13  LYS G C     1 
ATOM   4642  O O     . LYS G 3 14  ? 133.107 124.546 127.798 1.00 167.45 ? 13  LYS G O     1 
ATOM   4643  C CB    . LYS G 3 14  ? 131.644 124.974 125.024 1.00 167.45 ? 13  LYS G CB    1 
ATOM   4644  N N     . ALA G 3 15  ? 134.553 125.572 126.413 1.00 166.48 ? 14  ALA G N     1 
ATOM   4645  C CA    . ALA G 3 15  ? 135.357 126.168 127.471 1.00 166.48 ? 14  ALA G CA    1 
ATOM   4646  C C     . ALA G 3 15  ? 134.703 127.470 127.913 1.00 166.48 ? 14  ALA G C     1 
ATOM   4647  O O     . ALA G 3 15  ? 134.780 128.479 127.208 1.00 166.48 ? 14  ALA G O     1 
ATOM   4648  C CB    . ALA G 3 15  ? 136.784 126.408 126.991 1.00 166.48 ? 14  ALA G CB    1 
ATOM   4649  N N     . LYS G 3 16  ? 134.058 127.444 129.077 1.00 161.92 ? 15  LYS G N     1 
ATOM   4650  C CA    . LYS G 3 16  ? 133.489 128.643 129.681 1.00 161.92 ? 15  LYS G CA    1 
ATOM   4651  C C     . LYS G 3 16  ? 134.559 129.295 130.541 1.00 161.92 ? 15  LYS G C     1 
ATOM   4652  O O     . LYS G 3 16  ? 135.051 128.685 131.493 1.00 161.92 ? 15  LYS G O     1 
ATOM   4653  C CB    . LYS G 3 16  ? 132.264 128.308 130.523 1.00 161.92 ? 15  LYS G CB    1 
ATOM   4654  C CG    . LYS G 3 16  ? 131.179 127.599 129.779 1.00 161.92 ? 15  LYS G CG    1 
ATOM   4655  C CD    . LYS G 3 16  ? 129.892 127.656 130.558 1.00 161.92 ? 15  LYS G CD    1 
ATOM   4656  C CE    . LYS G 3 16  ? 128.705 127.403 129.659 1.00 161.92 ? 15  LYS G CE    1 
ATOM   4657  N NZ    . LYS G 3 16  ? 127.448 127.906 130.264 1.00 161.92 ? 15  LYS G NZ    1 
ATOM   4658  N N     . THR G 3 17  ? 134.935 130.519 130.194 1.00 158.42 ? 16  THR G N     1 
ATOM   4659  C CA    . THR G 3 17  ? 135.833 131.274 131.046 1.00 158.42 ? 16  THR G CA    1 
ATOM   4660  C C     . THR G 3 17  ? 135.127 131.614 132.345 1.00 158.42 ? 16  THR G C     1 
ATOM   4661  O O     . THR G 3 17  ? 133.921 131.865 132.369 1.00 158.42 ? 16  THR G O     1 
ATOM   4662  C CB    . THR G 3 17  ? 136.285 132.552 130.356 1.00 158.42 ? 16  THR G CB    1 
ATOM   4663  O OG1   . THR G 3 17  ? 135.156 133.171 129.732 1.00 158.42 ? 16  THR G OG1   1 
ATOM   4664  C CG2   . THR G 3 17  ? 137.329 132.241 129.305 1.00 158.42 ? 16  THR G CG2   1 
ATOM   4665  N N     . ARG G 3 18  ? 135.888 131.598 133.437 1.00 153.60 ? 17  ARG G N     1 
ATOM   4666  C CA    . ARG G 3 18  ? 135.279 131.816 134.741 1.00 153.60 ? 17  ARG G CA    1 
ATOM   4667  C C     . ARG G 3 18  ? 134.857 133.266 134.919 1.00 153.60 ? 17  ARG G C     1 
ATOM   4668  O O     . ARG G 3 18  ? 133.949 133.557 135.704 1.00 153.60 ? 17  ARG G O     1 
ATOM   4669  C CB    . ARG G 3 18  ? 136.245 131.387 135.835 1.00 153.60 ? 17  ARG G CB    1 
ATOM   4670  C CG    . ARG G 3 18  ? 136.731 129.979 135.694 1.00 153.60 ? 17  ARG G CG    1 
ATOM   4671  C CD    . ARG G 3 18  ? 137.607 129.610 136.858 1.00 153.60 ? 17  ARG G CD    1 
ATOM   4672  N NE    . ARG G 3 18  ? 138.987 130.029 136.660 1.00 153.60 ? 17  ARG G NE    1 
ATOM   4673  C CZ    . ARG G 3 18  ? 139.889 130.090 137.631 1.00 153.60 ? 17  ARG G CZ    1 
ATOM   4674  N NH1   . ARG G 3 18  ? 139.553 129.773 138.872 1.00 153.60 ? 17  ARG G NH1   1 
ATOM   4675  N NH2   . ARG G 3 18  ? 141.126 130.473 137.364 1.00 153.60 ? 17  ARG G NH2   1 
ATOM   4676  N N     . SER G 3 19  ? 135.478 134.176 134.175 1.00 157.26 ? 18  SER G N     1 
ATOM   4677  C CA    . SER G 3 19  ? 135.000 135.544 134.116 1.00 157.26 ? 18  SER G CA    1 
ATOM   4678  C C     . SER G 3 19  ? 133.651 135.657 133.430 1.00 157.26 ? 18  SER G C     1 
ATOM   4679  O O     . SER G 3 19  ? 132.902 136.590 133.729 1.00 157.26 ? 18  SER G O     1 
ATOM   4680  C CB    . SER G 3 19  ? 136.015 136.417 133.391 1.00 157.26 ? 18  SER G CB    1 
ATOM   4681  O OG    . SER G 3 19  ? 135.535 137.741 133.269 1.00 157.26 ? 18  SER G OG    1 
ATOM   4682  N N     . SER G 3 20  ? 133.327 134.743 132.521 1.00 157.01 ? 19  SER G N     1 
ATOM   4683  C CA    . SER G 3 20  ? 132.005 134.687 131.923 1.00 157.01 ? 19  SER G CA    1 
ATOM   4684  C C     . SER G 3 20  ? 131.011 133.956 132.800 1.00 157.01 ? 19  SER G C     1 
ATOM   4685  O O     . SER G 3 20  ? 129.810 134.007 132.532 1.00 157.01 ? 19  SER G O     1 
ATOM   4686  C CB    . SER G 3 20  ? 132.066 134.016 130.551 1.00 157.01 ? 19  SER G CB    1 
ATOM   4687  O OG    . SER G 3 20  ? 132.876 132.857 130.582 1.00 157.01 ? 19  SER G OG    1 
ATOM   4688  N N     . ARG G 3 21  ? 131.484 133.269 133.836 1.00 150.66 ? 20  ARG G N     1 
ATOM   4689  C CA    . ARG G 3 21  ? 130.603 132.659 134.811 1.00 150.66 ? 20  ARG G CA    1 
ATOM   4690  C C     . ARG G 3 21  ? 130.505 133.452 136.098 1.00 150.66 ? 20  ARG G C     1 
ATOM   4691  O O     . ARG G 3 21  ? 129.665 133.133 136.941 1.00 150.66 ? 20  ARG G O     1 
ATOM   4692  C CB    . ARG G 3 21  ? 131.068 131.236 135.133 1.00 150.66 ? 20  ARG G CB    1 
ATOM   4693  C CG    . ARG G 3 21  ? 130.275 130.180 134.418 1.00 150.66 ? 20  ARG G CG    1 
ATOM   4694  C CD    . ARG G 3 21  ? 130.645 128.820 134.932 1.00 150.66 ? 20  ARG G CD    1 
ATOM   4695  N NE    . ARG G 3 21  ? 132.086 128.689 135.066 1.00 150.66 ? 20  ARG G NE    1 
ATOM   4696  C CZ    . ARG G 3 21  ? 132.679 128.111 136.099 1.00 150.66 ? 20  ARG G CZ    1 
ATOM   4697  N NH1   . ARG G 3 21  ? 131.951 127.615 137.086 1.00 150.66 ? 20  ARG G NH1   1 
ATOM   4698  N NH2   . ARG G 3 21  ? 133.998 128.030 136.147 1.00 150.66 ? 20  ARG G NH2   1 
ATOM   4699  N N     . ALA G 3 22  ? 131.336 134.469 136.270 1.00 150.85 ? 21  ALA G N     1 
ATOM   4700  C CA    . ALA G 3 22  ? 131.243 135.350 137.418 1.00 150.85 ? 21  ALA G CA    1 
ATOM   4701  C C     . ALA G 3 22  ? 130.538 136.653 137.092 1.00 150.85 ? 21  ALA G C     1 
ATOM   4702  O O     . ALA G 3 22  ? 130.337 137.477 137.986 1.00 150.85 ? 21  ALA G O     1 
ATOM   4703  C CB    . ALA G 3 22  ? 132.634 135.637 137.969 1.00 150.85 ? 21  ALA G CB    1 
ATOM   4704  N N     . GLY G 3 23  ? 130.153 136.856 135.837 1.00 151.09 ? 22  GLY G N     1 
ATOM   4705  C CA    . GLY G 3 23  ? 129.611 138.131 135.426 1.00 151.09 ? 22  GLY G CA    1 
ATOM   4706  C C     . GLY G 3 23  ? 130.614 139.255 135.389 1.00 151.09 ? 22  GLY G C     1 
ATOM   4707  O O     . GLY G 3 23  ? 130.215 140.420 135.413 1.00 151.09 ? 22  GLY G O     1 
ATOM   4708  N N     . LEU G 3 24  ? 131.903 138.947 135.327 1.00 151.15 ? 23  LEU G N     1 
ATOM   4709  C CA    . LEU G 3 24  ? 132.912 139.984 135.408 1.00 151.15 ? 23  LEU G CA    1 
ATOM   4710  C C     . LEU G 3 24  ? 133.407 140.381 134.026 1.00 151.15 ? 23  LEU G C     1 
ATOM   4711  O O     . LEU G 3 24  ? 133.101 139.749 133.013 1.00 151.15 ? 23  LEU G O     1 
ATOM   4712  C CB    . LEU G 3 24  ? 134.094 139.522 136.245 1.00 151.15 ? 23  LEU G CB    1 
ATOM   4713  C CG    . LEU G 3 24  ? 133.794 139.277 137.710 1.00 151.15 ? 23  LEU G CG    1 
ATOM   4714  C CD1   . LEU G 3 24  ? 135.041 138.788 138.389 1.00 151.15 ? 23  LEU G CD1   1 
ATOM   4715  C CD2   . LEU G 3 24  ? 133.303 140.543 138.356 1.00 151.15 ? 23  LEU G CD2   1 
ATOM   4716  N N     . GLN G 3 25  ? 134.195 141.452 134.003 1.00 154.72 ? 24  GLN G N     1 
ATOM   4717  C CA    . GLN G 3 25  ? 134.914 141.869 132.817 1.00 154.72 ? 24  GLN G CA    1 
ATOM   4718  C C     . GLN G 3 25  ? 136.417 141.779 132.978 1.00 154.72 ? 24  GLN G C     1 
ATOM   4719  O O     . GLN G 3 25  ? 137.130 141.809 131.971 1.00 154.72 ? 24  GLN G O     1 
ATOM   4720  C CB    . GLN G 3 25  ? 134.540 143.304 132.443 1.00 154.72 ? 24  GLN G CB    1 
ATOM   4721  C CG    . GLN G 3 25  ? 133.060 143.518 132.369 1.00 154.72 ? 24  GLN G CG    1 
ATOM   4722  C CD    . GLN G 3 25  ? 132.456 142.822 131.184 1.00 154.72 ? 24  GLN G CD    1 
ATOM   4723  O OE1   . GLN G 3 25  ? 131.870 141.753 131.312 1.00 154.72 ? 24  GLN G OE1   1 
ATOM   4724  N NE2   . GLN G 3 25  ? 132.601 143.422 130.013 1.00 154.72 ? 24  GLN G NE2   1 
ATOM   4725  N N     . PHE G 3 26  ? 136.892 141.682 134.140 1.00 154.14 ? 25  PHE G N     1 
ATOM   4726  C CA    . PHE G 3 26  ? 138.299 141.405 134.348 1.00 154.14 ? 25  PHE G CA    1 
ATOM   4727  C C     . PHE G 3 26  ? 138.569 139.915 134.191 1.00 154.14 ? 25  PHE G C     1 
ATOM   4728  O O     . PHE G 3 26  ? 137.672 139.097 134.401 1.00 154.14 ? 25  PHE G O     1 
ATOM   4729  C CB    . PHE G 3 26  ? 138.723 141.865 135.730 1.00 154.14 ? 25  PHE G CB    1 
ATOM   4730  C CG    . PHE G 3 26  ? 139.357 143.199 135.725 1.00 154.14 ? 25  PHE G CG    1 
ATOM   4731  C CD1   . PHE G 3 26  ? 140.666 143.349 135.319 1.00 154.14 ? 25  PHE G CD1   1 
ATOM   4732  C CD2   . PHE G 3 26  ? 138.641 144.309 136.088 1.00 154.14 ? 25  PHE G CD2   1 
ATOM   4733  C CE1   . PHE G 3 26  ? 141.252 144.588 135.294 1.00 154.14 ? 25  PHE G CE1   1 
ATOM   4734  C CE2   . PHE G 3 26  ? 139.216 145.548 136.076 1.00 154.14 ? 25  PHE G CE2   1 
ATOM   4735  C CZ    . PHE G 3 26  ? 140.524 145.690 135.674 1.00 154.14 ? 25  PHE G CZ    1 
ATOM   4736  N N     . PRO G 3 27  ? 139.774 139.503 133.806 1.00 155.34 ? 26  PRO G N     1 
ATOM   4737  C CA    . PRO G 3 27  ? 140.058 138.074 133.753 1.00 155.34 ? 26  PRO G CA    1 
ATOM   4738  C C     . PRO G 3 27  ? 140.310 137.538 135.147 1.00 155.34 ? 26  PRO G C     1 
ATOM   4739  O O     . PRO G 3 27  ? 140.709 138.262 136.060 1.00 155.34 ? 26  PRO G O     1 
ATOM   4740  C CB    . PRO G 3 27  ? 141.322 138.003 132.897 1.00 155.34 ? 26  PRO G CB    1 
ATOM   4741  C CG    . PRO G 3 27  ? 142.028 139.238 133.242 1.00 155.34 ? 26  PRO G CG    1 
ATOM   4742  C CD    . PRO G 3 27  ? 140.967 140.283 133.437 1.00 155.34 ? 26  PRO G CD    1 
ATOM   4743  N N     . VAL G 3 28  ? 140.053 136.248 135.310 1.00 147.95 ? 27  VAL G N     1 
ATOM   4744  C CA    . VAL G 3 28  ? 140.293 135.590 136.576 1.00 147.95 ? 27  VAL G CA    1 
ATOM   4745  C C     . VAL G 3 28  ? 141.321 134.478 136.467 1.00 147.95 ? 27  VAL G C     1 
ATOM   4746  O O     . VAL G 3 28  ? 141.932 134.122 137.479 1.00 147.95 ? 27  VAL G O     1 
ATOM   4747  C CB    . VAL G 3 28  ? 138.977 135.060 137.161 1.00 147.95 ? 27  VAL G CB    1 
ATOM   4748  C CG1   . VAL G 3 28  ? 138.135 136.194 137.630 1.00 147.95 ? 27  VAL G CG1   1 
ATOM   4749  C CG2   . VAL G 3 28  ? 138.250 134.376 136.089 1.00 147.95 ? 27  VAL G CG2   1 
ATOM   4750  N N     . GLY G 3 29  ? 141.531 133.915 135.279 1.00 155.62 ? 28  GLY G N     1 
ATOM   4751  C CA    . GLY G 3 29  ? 142.624 132.978 135.109 1.00 155.62 ? 28  GLY G CA    1 
ATOM   4752  C C     . GLY G 3 29  ? 143.970 133.649 135.277 1.00 155.62 ? 28  GLY G C     1 
ATOM   4753  O O     . GLY G 3 29  ? 144.871 133.105 135.921 1.00 155.62 ? 28  GLY G O     1 
ATOM   4754  N N     . ARG G 3 30  ? 144.107 134.860 134.739 1.00 159.32 ? 29  ARG G N     1 
ATOM   4755  C CA    . ARG G 3 30  ? 145.335 135.617 134.916 1.00 159.32 ? 29  ARG G CA    1 
ATOM   4756  C C     . ARG G 3 30  ? 145.516 136.056 136.359 1.00 159.32 ? 29  ARG G C     1 
ATOM   4757  O O     . ARG G 3 30  ? 146.640 136.045 136.867 1.00 159.32 ? 29  ARG G O     1 
ATOM   4758  C CB    . ARG G 3 30  ? 145.337 136.826 133.993 1.00 159.32 ? 29  ARG G CB    1 
ATOM   4759  C CG    . ARG G 3 30  ? 146.636 137.571 133.989 1.00 159.32 ? 29  ARG G CG    1 
ATOM   4760  C CD    . ARG G 3 30  ? 146.455 138.924 133.383 1.00 159.32 ? 29  ARG G CD    1 
ATOM   4761  N NE    . ARG G 3 30  ? 145.818 138.826 132.080 1.00 159.32 ? 29  ARG G NE    1 
ATOM   4762  C CZ    . ARG G 3 30  ? 146.093 139.629 131.062 1.00 159.32 ? 29  ARG G CZ    1 
ATOM   4763  N NH1   . ARG G 3 30  ? 147.001 140.581 131.201 1.00 159.32 ? 29  ARG G NH1   1 
ATOM   4764  N NH2   . ARG G 3 30  ? 145.471 139.473 129.905 1.00 159.32 ? 29  ARG G NH2   1 
ATOM   4765  N N     . VAL G 3 31  ? 144.424 136.402 137.042 1.00 150.70 ? 30  VAL G N     1 
ATOM   4766  C CA    . VAL G 3 31  ? 144.508 136.779 138.447 1.00 150.70 ? 30  VAL G CA    1 
ATOM   4767  C C     . VAL G 3 31  ? 144.901 135.585 139.307 1.00 150.70 ? 30  VAL G C     1 
ATOM   4768  O O     . VAL G 3 31  ? 145.734 135.712 140.211 1.00 150.70 ? 30  VAL G O     1 
ATOM   4769  C CB    . VAL G 3 31  ? 143.174 137.404 138.886 1.00 150.70 ? 30  VAL G CB    1 
ATOM   4770  C CG1   . VAL G 3 31  ? 143.013 137.393 140.388 1.00 150.70 ? 30  VAL G CG1   1 
ATOM   4771  C CG2   . VAL G 3 31  ? 143.095 138.807 138.386 1.00 150.70 ? 30  VAL G CG2   1 
ATOM   4772  N N     . HIS G 3 32  ? 144.361 134.403 139.011 1.00 147.88 ? 31  HIS G N     1 
ATOM   4773  C CA    . HIS G 3 32  ? 144.723 133.211 139.769 1.00 147.88 ? 31  HIS G CA    1 
ATOM   4774  C C     . HIS G 3 32  ? 146.166 132.808 139.511 1.00 147.88 ? 31  HIS G C     1 
ATOM   4775  O O     . HIS G 3 32  ? 146.879 132.415 140.442 1.00 147.88 ? 31  HIS G O     1 
ATOM   4776  C CB    . HIS G 3 32  ? 143.787 132.066 139.414 1.00 147.88 ? 31  HIS G CB    1 
ATOM   4777  C CG    . HIS G 3 32  ? 144.059 130.809 140.173 1.00 147.88 ? 31  HIS G CG    1 
ATOM   4778  N ND1   . HIS G 3 32  ? 143.442 130.517 141.367 1.00 147.88 ? 31  HIS G ND1   1 
ATOM   4779  C CD2   . HIS G 3 32  ? 144.873 129.763 139.905 1.00 147.88 ? 31  HIS G CD2   1 
ATOM   4780  C CE1   . HIS G 3 32  ? 143.868 129.347 141.806 1.00 147.88 ? 31  HIS G CE1   1 
ATOM   4781  N NE2   . HIS G 3 32  ? 144.739 128.870 140.938 1.00 147.88 ? 31  HIS G NE2   1 
ATOM   4782  N N     . ARG G 3 33  ? 146.611 132.901 138.257 1.00 151.08 ? 32  ARG G N     1 
ATOM   4783  C CA    . ARG G 3 33  ? 148.003 132.609 137.947 1.00 151.08 ? 32  ARG G CA    1 
ATOM   4784  C C     . ARG G 3 33  ? 148.932 133.624 138.585 1.00 151.08 ? 32  ARG G C     1 
ATOM   4785  O O     . ARG G 3 33  ? 150.044 133.277 138.992 1.00 151.08 ? 32  ARG G O     1 
ATOM   4786  C CB    . ARG G 3 33  ? 148.206 132.579 136.437 1.00 151.08 ? 32  ARG G CB    1 
ATOM   4787  C CG    . ARG G 3 33  ? 149.588 132.141 136.009 1.00 151.08 ? 32  ARG G CG    1 
ATOM   4788  C CD    . ARG G 3 33  ? 149.798 132.337 134.526 1.00 151.08 ? 32  ARG G CD    1 
ATOM   4789  N NE    . ARG G 3 33  ? 149.330 133.641 134.074 1.00 151.08 ? 32  ARG G NE    1 
ATOM   4790  C CZ    . ARG G 3 33  ? 150.063 134.746 134.115 1.00 151.08 ? 32  ARG G CZ    1 
ATOM   4791  N NH1   . ARG G 3 33  ? 151.299 134.704 134.590 1.00 151.08 ? 32  ARG G NH1   1 
ATOM   4792  N NH2   . ARG G 3 33  ? 149.563 135.892 133.683 1.00 151.08 ? 32  ARG G NH2   1 
ATOM   4793  N N     . LEU G 3 34  ? 148.483 134.864 138.723 1.00 145.54 ? 33  LEU G N     1 
ATOM   4794  C CA    . LEU G 3 34  ? 149.289 135.853 139.414 1.00 145.54 ? 33  LEU G CA    1 
ATOM   4795  C C     . LEU G 3 34  ? 149.323 135.612 140.911 1.00 145.54 ? 33  LEU G C     1 
ATOM   4796  O O     . LEU G 3 34  ? 150.346 135.868 141.550 1.00 145.54 ? 33  LEU G O     1 
ATOM   4797  C CB    . LEU G 3 34  ? 148.756 137.247 139.122 1.00 145.54 ? 33  LEU G CB    1 
ATOM   4798  C CG    . LEU G 3 34  ? 149.596 137.974 138.089 1.00 145.54 ? 33  LEU G CG    1 
ATOM   4799  C CD1   . LEU G 3 34  ? 149.033 139.346 137.840 1.00 145.54 ? 33  LEU G CD1   1 
ATOM   4800  C CD2   . LEU G 3 34  ? 151.026 138.065 138.570 1.00 145.54 ? 33  LEU G CD2   1 
ATOM   4801  N N     . LEU G 3 35  ? 148.225 135.126 141.482 1.00 145.82 ? 34  LEU G N     1 
ATOM   4802  C CA    . LEU G 3 35  ? 148.207 134.853 142.910 1.00 145.82 ? 34  LEU G CA    1 
ATOM   4803  C C     . LEU G 3 35  ? 149.069 133.653 143.252 1.00 145.82 ? 34  LEU G C     1 
ATOM   4804  O O     . LEU G 3 35  ? 149.717 133.640 144.301 1.00 145.82 ? 34  LEU G O     1 
ATOM   4805  C CB    . LEU G 3 35  ? 146.780 134.620 143.388 1.00 145.82 ? 34  LEU G CB    1 
ATOM   4806  C CG    . LEU G 3 35  ? 145.892 135.838 143.609 1.00 145.82 ? 34  LEU G CG    1 
ATOM   4807  C CD1   . LEU G 3 35  ? 144.687 135.441 144.426 1.00 145.82 ? 34  LEU G CD1   1 
ATOM   4808  C CD2   . LEU G 3 35  ? 146.650 136.935 144.302 1.00 145.82 ? 34  LEU G CD2   1 
ATOM   4809  N N     . ARG G 3 36  ? 149.092 132.641 142.386 1.00 152.28 ? 35  ARG G N     1 
ATOM   4810  C CA    . ARG G 3 36  ? 149.927 131.479 142.654 1.00 152.28 ? 35  ARG G CA    1 
ATOM   4811  C C     . ARG G 3 36  ? 151.397 131.804 142.451 1.00 152.28 ? 35  ARG G C     1 
ATOM   4812  O O     . ARG G 3 36  ? 152.237 131.476 143.293 1.00 152.28 ? 35  ARG G O     1 
ATOM   4813  C CB    . ARG G 3 36  ? 149.519 130.316 141.763 1.00 152.28 ? 35  ARG G CB    1 
ATOM   4814  C CG    . ARG G 3 36  ? 148.326 129.538 142.261 1.00 152.28 ? 35  ARG G CG    1 
ATOM   4815  C CD    . ARG G 3 36  ? 148.133 128.277 141.446 1.00 152.28 ? 35  ARG G CD    1 
ATOM   4816  N NE    . ARG G 3 36  ? 147.842 128.574 140.050 1.00 152.28 ? 35  ARG G NE    1 
ATOM   4817  C CZ    . ARG G 3 36  ? 148.666 128.312 139.042 1.00 152.28 ? 35  ARG G CZ    1 
ATOM   4818  N NH1   . ARG G 3 36  ? 149.840 127.748 139.277 1.00 152.28 ? 35  ARG G NH1   1 
ATOM   4819  N NH2   . ARG G 3 36  ? 148.317 128.622 137.803 1.00 152.28 ? 35  ARG G NH2   1 
ATOM   4820  N N     . LYS G 3 37  ? 151.728 132.453 141.342 1.00 150.45 ? 36  LYS G N     1 
ATOM   4821  C CA    . LYS G 3 37  ? 153.123 132.736 141.048 1.00 150.45 ? 36  LYS G CA    1 
ATOM   4822  C C     . LYS G 3 37  ? 153.663 133.930 141.813 1.00 150.45 ? 36  LYS G C     1 
ATOM   4823  O O     . LYS G 3 37  ? 154.881 134.120 141.844 1.00 150.45 ? 36  LYS G O     1 
ATOM   4824  C CB    . LYS G 3 37  ? 153.308 132.970 139.552 1.00 150.45 ? 36  LYS G CB    1 
ATOM   4825  C CG    . LYS G 3 37  ? 152.986 131.764 138.708 1.00 150.45 ? 36  LYS G CG    1 
ATOM   4826  C CD    . LYS G 3 37  ? 153.799 130.568 139.137 1.00 150.45 ? 36  LYS G CD    1 
ATOM   4827  C CE    . LYS G 3 37  ? 153.158 129.290 138.648 1.00 150.45 ? 36  LYS G CE    1 
ATOM   4828  N NZ    . LYS G 3 37  ? 152.748 129.408 137.225 1.00 150.45 ? 36  LYS G NZ    1 
ATOM   4829  N N     . GLY G 3 38  ? 152.809 134.730 142.430 1.00 149.91 ? 37  GLY G N     1 
ATOM   4830  C CA    . GLY G 3 38  ? 153.303 135.896 143.125 1.00 149.91 ? 37  GLY G CA    1 
ATOM   4831  C C     . GLY G 3 38  ? 153.855 135.658 144.508 1.00 149.91 ? 37  GLY G C     1 
ATOM   4832  O O     . GLY G 3 38  ? 154.299 136.621 145.139 1.00 149.91 ? 37  GLY G O     1 
ATOM   4833  N N     . ASN G 3 39  ? 153.829 134.407 144.981 1.00 153.82 ? 38  ASN G N     1 
ATOM   4834  C CA    . ASN G 3 39  ? 154.342 133.986 146.288 1.00 153.82 ? 38  ASN G CA    1 
ATOM   4835  C C     . ASN G 3 39  ? 153.671 134.750 147.427 1.00 153.82 ? 38  ASN G C     1 
ATOM   4836  O O     . ASN G 3 39  ? 154.305 135.485 148.180 1.00 153.82 ? 38  ASN G O     1 
ATOM   4837  C CB    . ASN G 3 39  ? 155.862 134.120 146.355 1.00 153.82 ? 38  ASN G CB    1 
ATOM   4838  C CG    . ASN G 3 39  ? 156.529 133.669 145.087 1.00 153.82 ? 38  ASN G CG    1 
ATOM   4839  O OD1   . ASN G 3 39  ? 156.117 132.687 144.475 1.00 153.82 ? 38  ASN G OD1   1 
ATOM   4840  N ND2   . ASN G 3 39  ? 157.560 134.390 144.672 1.00 153.82 ? 38  ASN G ND2   1 
ATOM   4841  N N     . TYR G 3 40  ? 152.358 134.568 147.528 1.00 144.78 ? 39  TYR G N     1 
ATOM   4842  C CA    . TYR G 3 40  ? 151.580 135.126 148.623 1.00 144.78 ? 39  TYR G CA    1 
ATOM   4843  C C     . TYR G 3 40  ? 151.220 134.073 149.656 1.00 144.78 ? 39  TYR G C     1 
ATOM   4844  O O     . TYR G 3 40  ? 151.385 134.294 150.857 1.00 144.78 ? 39  TYR G O     1 
ATOM   4845  C CB    . TYR G 3 40  ? 150.320 135.787 148.077 1.00 144.78 ? 39  TYR G CB    1 
ATOM   4846  C CG    . TYR G 3 40  ? 150.644 136.861 147.087 1.00 144.78 ? 39  TYR G CG    1 
ATOM   4847  C CD1   . TYR G 3 40  ? 151.186 138.063 147.505 1.00 144.78 ? 39  TYR G CD1   1 
ATOM   4848  C CD2   . TYR G 3 40  ? 150.433 136.669 145.736 1.00 144.78 ? 39  TYR G CD2   1 
ATOM   4849  C CE1   . TYR G 3 40  ? 151.497 139.050 146.605 1.00 144.78 ? 39  TYR G CE1   1 
ATOM   4850  C CE2   . TYR G 3 40  ? 150.733 137.653 144.830 1.00 144.78 ? 39  TYR G CE2   1 
ATOM   4851  C CZ    . TYR G 3 40  ? 151.269 138.837 145.269 1.00 144.78 ? 39  TYR G CZ    1 
ATOM   4852  O OH    . TYR G 3 40  ? 151.577 139.820 144.363 1.00 144.78 ? 39  TYR G OH    1 
ATOM   4853  N N     . ALA G 3 41  ? 150.734 132.924 149.207 1.00 150.14 ? 40  ALA G N     1 
ATOM   4854  C CA    . ALA G 3 41  ? 150.589 131.771 150.074 1.00 150.14 ? 40  ALA G CA    1 
ATOM   4855  C C     . ALA G 3 41  ? 150.756 130.529 149.222 1.00 150.14 ? 40  ALA G C     1 
ATOM   4856  O O     . ALA G 3 41  ? 150.677 130.585 147.993 1.00 150.14 ? 40  ALA G O     1 
ATOM   4857  C CB    . ALA G 3 41  ? 149.242 131.759 150.797 1.00 150.14 ? 40  ALA G CB    1 
ATOM   4858  N N     . GLU G 3 42  ? 150.999 129.403 149.886 1.00 163.86 ? 41  GLU G N     1 
ATOM   4859  C CA    . GLU G 3 42  ? 151.197 128.161 149.160 1.00 163.86 ? 41  GLU G CA    1 
ATOM   4860  C C     . GLU G 3 42  ? 149.915 127.636 148.542 1.00 163.86 ? 41  GLU G C     1 
ATOM   4861  O O     . GLU G 3 42  ? 149.981 126.826 147.615 1.00 163.86 ? 41  GLU G O     1 
ATOM   4862  C CB    . GLU G 3 42  ? 151.796 127.105 150.086 1.00 163.86 ? 41  GLU G CB    1 
ATOM   4863  C CG    . GLU G 3 42  ? 150.894 126.697 151.234 1.00 163.86 ? 41  GLU G CG    1 
ATOM   4864  C CD    . GLU G 3 42  ? 151.638 125.936 152.309 1.00 163.86 ? 41  GLU G CD    1 
ATOM   4865  O OE1   . GLU G 3 42  ? 152.868 126.115 152.412 1.00 163.86 ? 41  GLU G OE1   1 
ATOM   4866  O OE2   . GLU G 3 42  ? 151.000 125.151 153.042 1.00 163.86 ? 41  GLU G OE2   1 
ATOM   4867  N N     . ARG G 3 43  ? 148.761 128.073 149.023 1.00 159.64 ? 42  ARG G N     1 
ATOM   4868  C CA    . ARG G 3 43  ? 147.486 127.638 148.492 1.00 159.64 ? 42  ARG G CA    1 
ATOM   4869  C C     . ARG G 3 43  ? 146.613 128.860 148.262 1.00 159.64 ? 42  ARG G C     1 
ATOM   4870  O O     . ARG G 3 43  ? 146.750 129.874 148.945 1.00 159.64 ? 42  ARG G O     1 
ATOM   4871  C CB    . ARG G 3 43  ? 146.816 126.640 149.432 1.00 159.64 ? 42  ARG G CB    1 
ATOM   4872  C CG    . ARG G 3 43  ? 147.495 125.284 149.444 1.00 159.64 ? 42  ARG G CG    1 
ATOM   4873  C CD    . ARG G 3 43  ? 147.260 124.549 150.734 1.00 159.64 ? 42  ARG G CD    1 
ATOM   4874  N NE    . ARG G 3 43  ? 145.872 124.143 150.877 1.00 159.64 ? 42  ARG G NE    1 
ATOM   4875  C CZ    . ARG G 3 43  ? 145.393 122.989 150.438 1.00 159.64 ? 42  ARG G CZ    1 
ATOM   4876  N NH1   . ARG G 3 43  ? 146.191 122.135 149.819 1.00 159.64 ? 42  ARG G NH1   1 
ATOM   4877  N NH2   . ARG G 3 43  ? 144.117 122.693 150.610 1.00 159.64 ? 42  ARG G NH2   1 
ATOM   4878  N N     . VAL G 3 44  ? 145.747 128.778 147.257 1.00 147.49 ? 43  VAL G N     1 
ATOM   4879  C CA    . VAL G 3 44  ? 144.920 129.901 146.832 1.00 147.49 ? 43  VAL G CA    1 
ATOM   4880  C C     . VAL G 3 44  ? 143.510 129.386 146.611 1.00 147.49 ? 43  VAL G C     1 
ATOM   4881  O O     . VAL G 3 44  ? 143.308 128.461 145.822 1.00 147.49 ? 43  VAL G O     1 
ATOM   4882  C CB    . VAL G 3 44  ? 145.459 130.550 145.543 1.00 147.49 ? 43  VAL G CB    1 
ATOM   4883  C CG1   . VAL G 3 44  ? 144.417 131.441 144.916 1.00 147.49 ? 43  VAL G CG1   1 
ATOM   4884  C CG2   . VAL G 3 44  ? 146.710 131.343 145.823 1.00 147.49 ? 43  VAL G CG2   1 
ATOM   4885  N N     . GLY G 3 45  ? 142.538 129.987 147.284 1.00 141.66 ? 44  GLY G N     1 
ATOM   4886  C CA    . GLY G 3 45  ? 141.169 129.530 147.198 1.00 141.66 ? 44  GLY G CA    1 
ATOM   4887  C C     . GLY G 3 45  ? 140.560 129.754 145.829 1.00 141.66 ? 44  GLY G C     1 
ATOM   4888  O O     . GLY G 3 45  ? 141.120 130.407 144.950 1.00 141.66 ? 44  GLY G O     1 
ATOM   4889  N N     . ALA G 3 46  ? 139.380 129.178 145.644 1.00 142.04 ? 45  ALA G N     1 
ATOM   4890  C CA    . ALA G 3 46  ? 138.666 129.306 144.387 1.00 142.04 ? 45  ALA G CA    1 
ATOM   4891  C C     . ALA G 3 46  ? 137.615 130.402 144.414 1.00 142.04 ? 45  ALA G C     1 
ATOM   4892  O O     . ALA G 3 46  ? 137.005 130.679 143.379 1.00 142.04 ? 45  ALA G O     1 
ATOM   4893  C CB    . ALA G 3 46  ? 138.017 127.974 144.011 1.00 142.04 ? 45  ALA G CB    1 
ATOM   4894  N N     . GLY G 3 47  ? 137.380 131.025 145.562 1.00 142.72 ? 46  GLY G N     1 
ATOM   4895  C CA    . GLY G 3 47  ? 136.557 132.214 145.609 1.00 142.72 ? 46  GLY G CA    1 
ATOM   4896  C C     . GLY G 3 47  ? 137.449 133.432 145.568 1.00 142.72 ? 46  GLY G C     1 
ATOM   4897  O O     . GLY G 3 47  ? 136.996 134.561 145.345 1.00 142.72 ? 46  GLY G O     1 
ATOM   4898  N N     . ALA G 3 48  ? 138.747 133.183 145.756 1.00 139.97 ? 47  ALA G N     1 
ATOM   4899  C CA    . ALA G 3 48  ? 139.707 134.280 145.861 1.00 139.97 ? 47  ALA G CA    1 
ATOM   4900  C C     . ALA G 3 48  ? 139.908 135.061 144.565 1.00 139.97 ? 47  ALA G C     1 
ATOM   4901  O O     . ALA G 3 48  ? 139.793 136.297 144.611 1.00 139.97 ? 47  ALA G O     1 
ATOM   4902  C CB    . ALA G 3 48  ? 141.030 133.763 146.432 1.00 139.97 ? 47  ALA G CB    1 
ATOM   4903  N N     . PRO G 3 49  ? 140.213 134.458 143.402 1.00 138.07 ? 48  PRO G N     1 
ATOM   4904  C CA    . PRO G 3 49  ? 140.419 135.314 142.228 1.00 138.07 ? 48  PRO G CA    1 
ATOM   4905  C C     . PRO G 3 49  ? 139.138 135.939 141.730 1.00 138.07 ? 48  PRO G C     1 
ATOM   4906  O O     . PRO G 3 49  ? 139.186 137.052 141.197 1.00 138.07 ? 48  PRO G O     1 
ATOM   4907  C CB    . PRO G 3 49  ? 141.021 134.361 141.188 1.00 138.07 ? 48  PRO G CB    1 
ATOM   4908  C CG    . PRO G 3 49  ? 141.350 133.146 141.920 1.00 138.07 ? 48  PRO G CG    1 
ATOM   4909  C CD    . PRO G 3 49  ? 140.354 133.053 142.988 1.00 138.07 ? 48  PRO G CD    1 
ATOM   4910  N N     . VAL G 3 50  ? 138.000 135.277 141.945 1.00 138.47 ? 49  VAL G N     1 
ATOM   4911  C CA    . VAL G 3 50  ? 136.704 135.855 141.604 1.00 138.47 ? 49  VAL G CA    1 
ATOM   4912  C C     . VAL G 3 50  ? 136.455 137.112 142.419 1.00 138.47 ? 49  VAL G C     1 
ATOM   4913  O O     . VAL G 3 50  ? 136.115 138.169 141.872 1.00 138.47 ? 49  VAL G O     1 
ATOM   4914  C CB    . VAL G 3 50  ? 135.593 134.817 141.819 1.00 138.47 ? 49  VAL G CB    1 
ATOM   4915  C CG1   . VAL G 3 50  ? 134.234 135.484 141.970 1.00 138.47 ? 49  VAL G CG1   1 
ATOM   4916  C CG2   . VAL G 3 50  ? 135.587 133.840 140.678 1.00 138.47 ? 49  VAL G CG2   1 
ATOM   4917  N N     . TYR G 3 51  ? 136.672 137.029 143.732 1.00 138.90 ? 50  TYR G N     1 
ATOM   4918  C CA    . TYR G 3 51  ? 136.450 138.186 144.587 1.00 138.90 ? 50  TYR G CA    1 
ATOM   4919  C C     . TYR G 3 51  ? 137.442 139.299 144.282 1.00 138.90 ? 50  TYR G C     1 
ATOM   4920  O O     . TYR G 3 51  ? 137.065 140.478 144.255 1.00 138.90 ? 50  TYR G O     1 
ATOM   4921  C CB    . TYR G 3 51  ? 136.543 137.764 146.043 1.00 138.90 ? 50  TYR G CB    1 
ATOM   4922  C CG    . TYR G 3 51  ? 135.913 138.710 147.024 1.00 138.90 ? 50  TYR G CG    1 
ATOM   4923  C CD1   . TYR G 3 51  ? 136.551 139.876 147.408 1.00 138.90 ? 50  TYR G CD1   1 
ATOM   4924  C CD2   . TYR G 3 51  ? 134.695 138.415 147.598 1.00 138.90 ? 50  TYR G CD2   1 
ATOM   4925  C CE1   . TYR G 3 51  ? 135.985 140.729 148.304 1.00 138.90 ? 50  TYR G CE1   1 
ATOM   4926  C CE2   . TYR G 3 51  ? 134.127 139.258 148.516 1.00 138.90 ? 50  TYR G CE2   1 
ATOM   4927  C CZ    . TYR G 3 51  ? 134.771 140.416 148.855 1.00 138.90 ? 50  TYR G CZ    1 
ATOM   4928  O OH    . TYR G 3 51  ? 134.195 141.267 149.764 1.00 138.90 ? 50  TYR G OH    1 
ATOM   4929  N N     . LEU G 3 52  ? 138.697 138.948 144.014 1.00 136.75 ? 51  LEU G N     1 
ATOM   4930  C CA    . LEU G 3 52  ? 139.699 139.977 143.769 1.00 136.75 ? 51  LEU G CA    1 
ATOM   4931  C C     . LEU G 3 52  ? 139.456 140.694 142.449 1.00 136.75 ? 51  LEU G C     1 
ATOM   4932  O O     . LEU G 3 52  ? 139.585 141.924 142.372 1.00 136.75 ? 51  LEU G O     1 
ATOM   4933  C CB    . LEU G 3 52  ? 141.087 139.365 143.795 1.00 136.75 ? 51  LEU G CB    1 
ATOM   4934  C CG    . LEU G 3 52  ? 142.237 140.355 143.718 1.00 136.75 ? 51  LEU G CG    1 
ATOM   4935  C CD1   . LEU G 3 52  ? 142.049 141.462 144.720 1.00 136.75 ? 51  LEU G CD1   1 
ATOM   4936  C CD2   . LEU G 3 52  ? 143.521 139.623 143.988 1.00 136.75 ? 51  LEU G CD2   1 
ATOM   4937  N N     . ALA G 3 53  ? 139.072 139.955 141.408 1.00 137.93 ? 52  ALA G N     1 
ATOM   4938  C CA    . ALA G 3 53  ? 138.754 140.605 140.149 1.00 137.93 ? 52  ALA G CA    1 
ATOM   4939  C C     . ALA G 3 53  ? 137.472 141.408 140.247 1.00 137.93 ? 52  ALA G C     1 
ATOM   4940  O O     . ALA G 3 53  ? 137.337 142.421 139.557 1.00 137.93 ? 52  ALA G O     1 
ATOM   4941  C CB    . ALA G 3 53  ? 138.650 139.576 139.037 1.00 137.93 ? 52  ALA G CB    1 
ATOM   4942  N N     . ALA G 3 54  ? 136.548 141.010 141.122 1.00 138.94 ? 53  ALA G N     1 
ATOM   4943  C CA    . ALA G 3 54  ? 135.362 141.828 141.348 1.00 138.94 ? 53  ALA G CA    1 
ATOM   4944  C C     . ALA G 3 54  ? 135.714 143.167 141.978 1.00 138.94 ? 53  ALA G C     1 
ATOM   4945  O O     . ALA G 3 54  ? 135.172 144.205 141.578 1.00 138.94 ? 53  ALA G O     1 
ATOM   4946  C CB    . ALA G 3 54  ? 134.374 141.089 142.235 1.00 138.94 ? 53  ALA G CB    1 
ATOM   4947  N N     . VAL G 3 55  ? 136.622 143.166 142.953 1.00 135.63 ? 54  VAL G N     1 
ATOM   4948  C CA    . VAL G 3 55  ? 137.016 144.430 143.574 1.00 135.63 ? 54  VAL G CA    1 
ATOM   4949  C C     . VAL G 3 55  ? 137.787 145.307 142.592 1.00 135.63 ? 54  VAL G C     1 
ATOM   4950  O O     . VAL G 3 55  ? 137.583 146.529 142.546 1.00 135.63 ? 54  VAL G O     1 
ATOM   4951  C CB    . VAL G 3 55  ? 137.812 144.175 144.860 1.00 135.63 ? 54  VAL G CB    1 
ATOM   4952  C CG1   . VAL G 3 55  ? 138.098 145.469 145.562 1.00 135.63 ? 54  VAL G CG1   1 
ATOM   4953  C CG2   . VAL G 3 55  ? 137.000 143.327 145.781 1.00 135.63 ? 54  VAL G CG2   1 
ATOM   4954  N N     . LEU G 3 56  ? 138.652 144.703 141.770 1.00 137.05 ? 55  LEU G N     1 
ATOM   4955  C CA    . LEU G 3 56  ? 139.378 145.484 140.769 1.00 137.05 ? 55  LEU G CA    1 
ATOM   4956  C C     . LEU G 3 56  ? 138.438 146.069 139.724 1.00 137.05 ? 55  LEU G C     1 
ATOM   4957  O O     . LEU G 3 56  ? 138.621 147.211 139.285 1.00 137.05 ? 55  LEU G O     1 
ATOM   4958  C CB    . LEU G 3 56  ? 140.436 144.623 140.097 1.00 137.05 ? 55  LEU G CB    1 
ATOM   4959  C CG    . LEU G 3 56  ? 141.624 144.283 140.979 1.00 137.05 ? 55  LEU G CG    1 
ATOM   4960  C CD1   . LEU G 3 56  ? 142.610 143.440 140.214 1.00 137.05 ? 55  LEU G CD1   1 
ATOM   4961  C CD2   . LEU G 3 56  ? 142.274 145.549 141.441 1.00 137.05 ? 55  LEU G CD2   1 
ATOM   4962  N N     . GLU G 3 57  ? 137.402 145.322 139.354 1.00 141.42 ? 56  GLU G N     1 
ATOM   4963  C CA    . GLU G 3 57  ? 136.434 145.817 138.390 1.00 141.42 ? 56  GLU G CA    1 
ATOM   4964  C C     . GLU G 3 57  ? 135.604 146.946 138.967 1.00 141.42 ? 56  GLU G C     1 
ATOM   4965  O O     . GLU G 3 57  ? 135.328 147.928 138.269 1.00 141.42 ? 56  GLU G O     1 
ATOM   4966  C CB    . GLU G 3 57  ? 135.564 144.657 137.925 1.00 141.42 ? 56  GLU G CB    1 
ATOM   4967  C CG    . GLU G 3 57  ? 134.606 144.954 136.815 1.00 141.42 ? 56  GLU G CG    1 
ATOM   4968  C CD    . GLU G 3 57  ? 133.230 145.271 137.328 1.00 141.42 ? 56  GLU G CD    1 
ATOM   4969  O OE1   . GLU G 3 57  ? 132.885 144.773 138.414 1.00 141.42 ? 56  GLU G OE1   1 
ATOM   4970  O OE2   . GLU G 3 57  ? 132.483 145.996 136.645 1.00 141.42 ? 56  GLU G OE2   1 
ATOM   4971  N N     . TYR G 3 58  ? 135.242 146.857 140.248 1.00 139.89 ? 57  TYR G N     1 
ATOM   4972  C CA    . TYR G 3 58  ? 134.494 147.956 140.845 1.00 139.89 ? 57  TYR G CA    1 
ATOM   4973  C C     . TYR G 3 58  ? 135.355 149.199 140.993 1.00 139.89 ? 57  TYR G C     1 
ATOM   4974  O O     . TYR G 3 58  ? 134.876 150.316 140.769 1.00 139.89 ? 57  TYR G O     1 
ATOM   4975  C CB    . TYR G 3 58  ? 133.927 147.573 142.197 1.00 139.89 ? 57  TYR G CB    1 
ATOM   4976  C CG    . TYR G 3 58  ? 133.263 148.753 142.833 1.00 139.89 ? 57  TYR G CG    1 
ATOM   4977  C CD1   . TYR G 3 58  ? 132.156 149.335 142.244 1.00 139.89 ? 57  TYR G CD1   1 
ATOM   4978  C CD2   . TYR G 3 58  ? 133.765 149.319 143.991 1.00 139.89 ? 57  TYR G CD2   1 
ATOM   4979  C CE1   . TYR G 3 58  ? 131.547 150.430 142.805 1.00 139.89 ? 57  TYR G CE1   1 
ATOM   4980  C CE2   . TYR G 3 58  ? 133.164 150.413 144.560 1.00 139.89 ? 57  TYR G CE2   1 
ATOM   4981  C CZ    . TYR G 3 58  ? 132.056 150.964 143.963 1.00 139.89 ? 57  TYR G CZ    1 
ATOM   4982  O OH    . TYR G 3 58  ? 131.450 152.058 144.529 1.00 139.89 ? 57  TYR G OH    1 
ATOM   4983  N N     . LEU G 3 59  ? 136.634 149.029 141.324 1.00 141.16 ? 58  LEU G N     1 
ATOM   4984  C CA    . LEU G 3 59  ? 137.507 150.189 141.464 1.00 141.16 ? 58  LEU G CA    1 
ATOM   4985  C C     . LEU G 3 59  ? 137.767 150.867 140.124 1.00 141.16 ? 58  LEU G C     1 
ATOM   4986  O O     . LEU G 3 59  ? 137.775 152.103 140.036 1.00 141.16 ? 58  LEU G O     1 
ATOM   4987  C CB    . LEU G 3 59  ? 138.817 149.774 142.111 1.00 141.16 ? 58  LEU G CB    1 
ATOM   4988  C CG    . LEU G 3 59  ? 138.737 149.594 143.618 1.00 141.16 ? 58  LEU G CG    1 
ATOM   4989  C CD1   . LEU G 3 59  ? 140.129 149.518 144.164 1.00 141.16 ? 58  LEU G CD1   1 
ATOM   4990  C CD2   . LEU G 3 59  ? 137.981 150.735 144.270 1.00 141.16 ? 58  LEU G CD2   1 
ATOM   4991  N N     . THR G 3 60  ? 137.954 150.078 139.069 1.00 136.05 ? 59  THR G N     1 
ATOM   4992  C CA    . THR G 3 60  ? 138.196 150.666 137.762 1.00 136.05 ? 59  THR G CA    1 
ATOM   4993  C C     . THR G 3 60  ? 136.949 151.344 137.219 1.00 136.05 ? 59  THR G C     1 
ATOM   4994  O O     . THR G 3 60  ? 137.046 152.420 136.620 1.00 136.05 ? 59  THR G O     1 
ATOM   4995  C CB    . THR G 3 60  ? 138.694 149.599 136.806 1.00 136.05 ? 59  THR G CB    1 
ATOM   4996  O OG1   . THR G 3 60  ? 139.753 148.878 137.437 1.00 136.05 ? 59  THR G OG1   1 
ATOM   4997  C CG2   . THR G 3 60  ? 139.230 150.234 135.556 1.00 136.05 ? 59  THR G CG2   1 
ATOM   4998  N N     . ALA G 3 61  ? 135.768 150.758 137.446 1.00 138.91 ? 60  ALA G N     1 
ATOM   4999  C CA    . ALA G 3 61  ? 134.533 151.437 137.061 1.00 138.91 ? 60  ALA G CA    1 
ATOM   5000  C C     . ALA G 3 61  ? 134.345 152.727 137.845 1.00 138.91 ? 60  ALA G C     1 
ATOM   5001  O O     . ALA G 3 61  ? 133.914 153.749 137.287 1.00 138.91 ? 60  ALA G O     1 
ATOM   5002  C CB    . ALA G 3 61  ? 133.339 150.513 137.271 1.00 138.91 ? 60  ALA G CB    1 
ATOM   5003  N N     . GLU G 3 62  ? 134.729 152.711 139.124 1.00 147.88 ? 61  GLU G N     1 
ATOM   5004  C CA    . GLU G 3 62  ? 134.590 153.879 139.980 1.00 147.88 ? 61  GLU G CA    1 
ATOM   5005  C C     . GLU G 3 62  ? 135.478 155.024 139.519 1.00 147.88 ? 61  GLU G C     1 
ATOM   5006  O O     . GLU G 3 62  ? 135.059 156.186 139.541 1.00 147.88 ? 61  GLU G O     1 
ATOM   5007  C CB    . GLU G 3 62  ? 134.926 153.491 141.414 1.00 147.88 ? 61  GLU G CB    1 
ATOM   5008  C CG    . GLU G 3 62  ? 134.775 154.609 142.405 1.00 147.88 ? 61  GLU G CG    1 
ATOM   5009  C CD    . GLU G 3 62  ? 133.379 154.677 142.969 1.00 147.88 ? 61  GLU G CD    1 
ATOM   5010  O OE1   . GLU G 3 62  ? 132.560 153.801 142.620 1.00 147.88 ? 61  GLU G OE1   1 
ATOM   5011  O OE2   . GLU G 3 62  ? 133.099 155.597 143.767 1.00 147.88 ? 61  GLU G OE2   1 
ATOM   5012  N N     . ILE G 3 63  ? 136.703 154.720 139.090 1.00 135.72 ? 62  ILE G N     1 
ATOM   5013  C CA    . ILE G 3 63  ? 137.567 155.781 138.578 1.00 135.72 ? 62  ILE G CA    1 
ATOM   5014  C C     . ILE G 3 63  ? 137.077 156.269 137.223 1.00 135.72 ? 62  ILE G C     1 
ATOM   5015  O O     . ILE G 3 63  ? 136.933 157.479 137.004 1.00 135.72 ? 62  ILE G O     1 
ATOM   5016  C CB    . ILE G 3 63  ? 139.032 155.320 138.522 1.00 135.72 ? 62  ILE G CB    1 
ATOM   5017  C CG1   . ILE G 3 63  ? 139.669 155.507 139.885 1.00 135.72 ? 62  ILE G CG1   1 
ATOM   5018  C CG2   . ILE G 3 63  ? 139.830 156.099 137.491 1.00 135.72 ? 62  ILE G CG2   1 
ATOM   5019  C CD1   . ILE G 3 63  ? 141.115 155.152 139.914 1.00 135.72 ? 62  ILE G CD1   1 
ATOM   5020  N N     . LEU G 3 64  ? 136.780 155.342 136.309 1.00 137.82 ? 63  LEU G N     1 
ATOM   5021  C CA    . LEU G 3 64  ? 136.532 155.734 134.932 1.00 137.82 ? 63  LEU G CA    1 
ATOM   5022  C C     . LEU G 3 64  ? 135.214 156.461 134.750 1.00 137.82 ? 63  LEU G C     1 
ATOM   5023  O O     . LEU G 3 64  ? 135.101 157.243 133.806 1.00 137.82 ? 63  LEU G O     1 
ATOM   5024  C CB    . LEU G 3 64  ? 136.588 154.521 134.010 1.00 137.82 ? 63  LEU G CB    1 
ATOM   5025  C CG    . LEU G 3 64  ? 137.967 153.890 133.828 1.00 137.82 ? 63  LEU G CG    1 
ATOM   5026  C CD1   . LEU G 3 64  ? 137.974 152.991 132.625 1.00 137.82 ? 63  LEU G CD1   1 
ATOM   5027  C CD2   . LEU G 3 64  ? 139.058 154.926 133.716 1.00 137.82 ? 63  LEU G CD2   1 
ATOM   5028  N N     . GLU G 3 65  ? 134.246 156.286 135.650 1.00 150.85 ? 64  GLU G N     1 
ATOM   5029  C CA    . GLU G 3 65  ? 133.034 157.092 135.545 1.00 150.85 ? 64  GLU G CA    1 
ATOM   5030  C C     . GLU G 3 65  ? 133.320 158.563 135.827 1.00 150.85 ? 64  GLU G C     1 
ATOM   5031  O O     . GLU G 3 65  ? 132.890 159.452 135.076 1.00 150.85 ? 64  GLU G O     1 
ATOM   5032  C CB    . GLU G 3 65  ? 131.969 156.563 136.492 1.00 150.85 ? 64  GLU G CB    1 
ATOM   5033  C CG    . GLU G 3 65  ? 130.654 157.289 136.363 1.00 150.85 ? 64  GLU G CG    1 
ATOM   5034  C CD    . GLU G 3 65  ? 129.567 156.672 137.211 1.00 150.85 ? 64  GLU G CD    1 
ATOM   5035  O OE1   . GLU G 3 65  ? 129.852 155.677 137.911 1.00 150.85 ? 64  GLU G OE1   1 
ATOM   5036  O OE2   . GLU G 3 65  ? 128.426 157.179 137.175 1.00 150.85 ? 64  GLU G OE2   1 
ATOM   5037  N N     . LEU G 3 66  ? 134.087 158.837 136.881 1.00 145.09 ? 65  LEU G N     1 
ATOM   5038  C CA    . LEU G 3 66  ? 134.419 160.218 137.207 1.00 145.09 ? 65  LEU G CA    1 
ATOM   5039  C C     . LEU G 3 66  ? 135.367 160.820 136.181 1.00 145.09 ? 65  LEU G C     1 
ATOM   5040  O O     . LEU G 3 66  ? 135.240 162.000 135.833 1.00 145.09 ? 65  LEU G O     1 
ATOM   5041  C CB    . LEU G 3 66  ? 135.024 160.291 138.602 1.00 145.09 ? 65  LEU G CB    1 
ATOM   5042  C CG    . LEU G 3 66  ? 134.175 159.569 139.636 1.00 145.09 ? 65  LEU G CG    1 
ATOM   5043  C CD1   . LEU G 3 66  ? 134.912 159.489 140.939 1.00 145.09 ? 65  LEU G CD1   1 
ATOM   5044  C CD2   . LEU G 3 66  ? 132.867 160.299 139.807 1.00 145.09 ? 65  LEU G CD2   1 
ATOM   5045  N N     . ALA G 3 67  ? 136.313 160.024 135.679 1.00 146.63 ? 66  ALA G N     1 
ATOM   5046  C CA    . ALA G 3 67  ? 137.216 160.530 134.654 1.00 146.63 ? 66  ALA G CA    1 
ATOM   5047  C C     . ALA G 3 67  ? 136.481 160.806 133.352 1.00 146.63 ? 66  ALA G C     1 
ATOM   5048  O O     . ALA G 3 67  ? 136.825 161.755 132.644 1.00 146.63 ? 66  ALA G O     1 
ATOM   5049  C CB    . ALA G 3 67  ? 138.363 159.553 134.422 1.00 146.63 ? 66  ALA G CB    1 
ATOM   5050  N N     . GLY G 3 68  ? 135.445 160.025 133.046 1.00 154.77 ? 67  GLY G N     1 
ATOM   5051  C CA    . GLY G 3 68  ? 134.625 160.326 131.888 1.00 154.77 ? 67  GLY G CA    1 
ATOM   5052  C C     . GLY G 3 68  ? 133.817 161.593 132.066 1.00 154.77 ? 67  GLY G C     1 
ATOM   5053  O O     . GLY G 3 68  ? 133.642 162.362 131.116 1.00 154.77 ? 67  GLY G O     1 
ATOM   5054  N N     . ASN G 3 69  ? 133.334 161.841 133.287 1.00 156.88 ? 68  ASN G N     1 
ATOM   5055  C CA    . ASN G 3 69  ? 132.651 163.105 133.550 1.00 156.88 ? 68  ASN G CA    1 
ATOM   5056  C C     . ASN G 3 69  ? 133.599 164.290 133.404 1.00 156.88 ? 68  ASN G C     1 
ATOM   5057  O O     . ASN G 3 69  ? 133.237 165.319 132.815 1.00 156.88 ? 68  ASN G O     1 
ATOM   5058  C CB    . ASN G 3 69  ? 132.029 163.085 134.939 1.00 156.88 ? 68  ASN G CB    1 
ATOM   5059  C CG    . ASN G 3 69  ? 130.892 162.107 135.039 1.00 156.88 ? 68  ASN G CG    1 
ATOM   5060  O OD1   . ASN G 3 69  ? 130.358 161.661 134.027 1.00 156.88 ? 68  ASN G OD1   1 
ATOM   5061  N ND2   . ASN G 3 69  ? 130.510 161.764 136.259 1.00 156.88 ? 68  ASN G ND2   1 
ATOM   5062  N N     . ALA G 3 70  ? 134.833 164.140 133.887 1.00 160.72 ? 69  ALA G N     1 
ATOM   5063  C CA    . ALA G 3 70  ? 135.808 165.222 133.787 1.00 160.72 ? 69  ALA G CA    1 
ATOM   5064  C C     . ALA G 3 70  ? 136.247 165.465 132.350 1.00 160.72 ? 69  ALA G C     1 
ATOM   5065  O O     . ALA G 3 70  ? 136.472 166.616 131.964 1.00 160.72 ? 69  ALA G O     1 
ATOM   5066  C CB    . ALA G 3 70  ? 137.021 164.924 134.662 1.00 160.72 ? 69  ALA G CB    1 
ATOM   5067  N N     . ALA G 3 71  ? 136.370 164.410 131.545 1.00 158.68 ? 70  ALA G N     1 
ATOM   5068  C CA    . ALA G 3 71  ? 136.646 164.612 130.129 1.00 158.68 ? 70  ALA G CA    1 
ATOM   5069  C C     . ALA G 3 71  ? 135.449 165.207 129.411 1.00 158.68 ? 70  ALA G C     1 
ATOM   5070  O O     . ALA G 3 71  ? 135.613 165.878 128.388 1.00 158.68 ? 70  ALA G O     1 
ATOM   5071  C CB    . ALA G 3 71  ? 137.047 163.298 129.470 1.00 158.68 ? 70  ALA G CB    1 
ATOM   5072  N N     . ARG G 3 72  ? 134.244 164.970 129.919 1.00 162.07 ? 71  ARG G N     1 
ATOM   5073  C CA    . ARG G 3 72  ? 133.087 165.631 129.346 1.00 162.07 ? 71  ARG G CA    1 
ATOM   5074  C C     . ARG G 3 72  ? 133.045 167.108 129.694 1.00 162.07 ? 71  ARG G C     1 
ATOM   5075  O O     . ARG G 3 72  ? 132.478 167.892 128.928 1.00 162.07 ? 71  ARG G O     1 
ATOM   5076  C CB    . ARG G 3 72  ? 131.808 164.956 129.815 1.00 162.07 ? 71  ARG G CB    1 
ATOM   5077  C CG    . ARG G 3 72  ? 130.669 165.135 128.854 1.00 162.07 ? 71  ARG G CG    1 
ATOM   5078  C CD    . ARG G 3 72  ? 129.351 164.977 129.552 1.00 162.07 ? 71  ARG G CD    1 
ATOM   5079  N NE    . ARG G 3 72  ? 128.255 165.399 128.692 1.00 162.07 ? 71  ARG G NE    1 
ATOM   5080  C CZ    . ARG G 3 72  ? 126.974 165.242 128.996 1.00 162.07 ? 71  ARG G CZ    1 
ATOM   5081  N NH1   . ARG G 3 72  ? 126.634 164.667 130.141 1.00 162.07 ? 71  ARG G NH1   1 
ATOM   5082  N NH2   . ARG G 3 72  ? 126.035 165.655 128.157 1.00 162.07 ? 71  ARG G NH2   1 
ATOM   5083  N N     . ASP G 3 73  ? 133.622 167.507 130.826 1.00 166.12 ? 72  ASP G N     1 
ATOM   5084  C CA    . ASP G 3 73  ? 133.633 168.928 131.166 1.00 166.12 ? 72  ASP G CA    1 
ATOM   5085  C C     . ASP G 3 73  ? 134.569 169.718 130.260 1.00 166.12 ? 72  ASP G C     1 
ATOM   5086  O O     . ASP G 3 73  ? 134.269 170.855 129.885 1.00 166.12 ? 72  ASP G O     1 
ATOM   5087  C CB    . ASP G 3 73  ? 134.015 169.124 132.628 1.00 166.12 ? 72  ASP G CB    1 
ATOM   5088  C CG    . ASP G 3 73  ? 133.096 168.390 133.565 1.00 166.12 ? 72  ASP G CG    1 
ATOM   5089  O OD1   . ASP G 3 73  ? 131.867 168.557 133.432 1.00 166.12 ? 72  ASP G OD1   1 
ATOM   5090  O OD2   . ASP G 3 73  ? 133.598 167.664 134.447 1.00 166.12 ? 72  ASP G OD2   1 
ATOM   5091  N N     . ASN G 3 74  ? 135.701 169.131 129.881 1.00 161.94 ? 73  ASN G N     1 
ATOM   5092  C CA    . ASN G 3 74  ? 136.662 169.808 129.024 1.00 161.94 ? 73  ASN G CA    1 
ATOM   5093  C C     . ASN G 3 74  ? 136.405 169.574 127.545 1.00 161.94 ? 73  ASN G C     1 
ATOM   5094  O O     . ASN G 3 74  ? 137.326 169.760 126.741 1.00 161.94 ? 73  ASN G O     1 
ATOM   5095  C CB    . ASN G 3 74  ? 138.081 169.377 129.379 1.00 161.94 ? 73  ASN G CB    1 
ATOM   5096  C CG    . ASN G 3 74  ? 138.451 169.735 130.791 1.00 161.94 ? 73  ASN G CG    1 
ATOM   5097  O OD1   . ASN G 3 74  ? 137.609 170.184 131.564 1.00 161.94 ? 73  ASN G OD1   1 
ATOM   5098  N ND2   . ASN G 3 74  ? 139.713 169.535 131.142 1.00 161.94 ? 73  ASN G ND2   1 
ATOM   5099  N N     . LYS G 3 75  ? 135.189 169.143 127.187 1.00 166.28 ? 74  LYS G N     1 
ATOM   5100  C CA    . LYS G 3 75  ? 134.701 169.065 125.804 1.00 166.28 ? 74  LYS G CA    1 
ATOM   5101  C C     . LYS G 3 75  ? 135.541 168.125 124.944 1.00 166.28 ? 74  LYS G C     1 
ATOM   5102  O O     . LYS G 3 75  ? 135.833 168.412 123.784 1.00 166.28 ? 74  LYS G O     1 
ATOM   5103  C CB    . LYS G 3 75  ? 134.622 170.454 125.165 1.00 166.28 ? 74  LYS G CB    1 
ATOM   5104  C CG    . LYS G 3 75  ? 133.808 171.447 125.961 1.00 166.28 ? 74  LYS G CG    1 
ATOM   5105  C CD    . LYS G 3 75  ? 132.343 171.077 125.941 1.00 166.28 ? 74  LYS G CD    1 
ATOM   5106  C CE    . LYS G 3 75  ? 131.718 171.267 127.306 1.00 166.28 ? 74  LYS G CE    1 
ATOM   5107  N NZ    . LYS G 3 75  ? 132.147 170.201 128.247 1.00 166.28 ? 74  LYS G NZ    1 
ATOM   5108  N N     . LYS G 3 76  ? 135.943 166.997 125.515 1.00 177.87 ? 75  LYS G N     1 
ATOM   5109  C CA    . LYS G 3 76  ? 136.764 166.033 124.803 1.00 177.87 ? 75  LYS G CA    1 
ATOM   5110  C C     . LYS G 3 76  ? 136.152 164.646 124.913 1.00 177.87 ? 75  LYS G C     1 
ATOM   5111  O O     . LYS G 3 76  ? 135.568 164.285 125.937 1.00 177.87 ? 75  LYS G O     1 
ATOM   5112  C CB    . LYS G 3 76  ? 138.191 166.005 125.346 1.00 177.87 ? 75  LYS G CB    1 
ATOM   5113  C CG    . LYS G 3 76  ? 138.929 167.309 125.214 1.00 177.87 ? 75  LYS G CG    1 
ATOM   5114  C CD    . LYS G 3 76  ? 140.421 167.083 125.179 1.00 177.87 ? 75  LYS G CD    1 
ATOM   5115  C CE    . LYS G 3 76  ? 141.137 168.278 124.579 1.00 177.87 ? 75  LYS G CE    1 
ATOM   5116  N NZ    . LYS G 3 76  ? 142.548 167.960 124.243 1.00 177.87 ? 75  LYS G NZ    1 
ATOM   5117  N N     . THR G 3 77  ? 136.289 163.868 123.840 1.00 170.37 ? 76  THR G N     1 
ATOM   5118  C CA    . THR G 3 77  ? 135.872 162.473 123.885 1.00 170.37 ? 76  THR G CA    1 
ATOM   5119  C C     . THR G 3 77  ? 136.871 161.638 124.668 1.00 170.37 ? 76  THR G C     1 
ATOM   5120  O O     . THR G 3 77  ? 136.493 160.908 125.588 1.00 170.37 ? 76  THR G O     1 
ATOM   5121  C CB    . THR G 3 77  ? 135.705 161.925 122.466 1.00 170.37 ? 76  THR G CB    1 
ATOM   5122  O OG1   . THR G 3 77  ? 134.524 162.477 121.878 1.00 170.37 ? 76  THR G OG1   1 
ATOM   5123  C CG2   . THR G 3 77  ? 135.585 160.416 122.472 1.00 170.37 ? 76  THR G CG2   1 
ATOM   5124  N N     . ARG G 3 78  ? 138.151 161.757 124.327 1.00 165.57 ? 77  ARG G N     1 
ATOM   5125  C CA    . ARG G 3 78  ? 139.196 160.953 124.937 1.00 165.57 ? 77  ARG G CA    1 
ATOM   5126  C C     . ARG G 3 78  ? 139.386 161.325 126.405 1.00 165.57 ? 77  ARG G C     1 
ATOM   5127  O O     . ARG G 3 78  ? 138.947 162.375 126.872 1.00 165.57 ? 77  ARG G O     1 
ATOM   5128  C CB    . ARG G 3 78  ? 140.505 161.137 124.172 1.00 165.57 ? 77  ARG G CB    1 
ATOM   5129  C CG    . ARG G 3 78  ? 141.329 159.880 124.049 1.00 165.57 ? 77  ARG G CG    1 
ATOM   5130  C CD    . ARG G 3 78  ? 142.210 159.881 122.805 1.00 165.57 ? 77  ARG G CD    1 
ATOM   5131  N NE    . ARG G 3 78  ? 141.458 160.001 121.559 1.00 165.57 ? 77  ARG G NE    1 
ATOM   5132  C CZ    . ARG G 3 78  ? 140.761 159.022 120.988 1.00 165.57 ? 77  ARG G CZ    1 
ATOM   5133  N NH1   . ARG G 3 78  ? 140.687 157.820 121.541 1.00 165.57 ? 77  ARG G NH1   1 
ATOM   5134  N NH2   . ARG G 3 78  ? 140.121 159.248 119.852 1.00 165.57 ? 77  ARG G NH2   1 
ATOM   5135  N N     . ILE G 3 79  ? 140.031 160.429 127.142 1.00 150.41 ? 78  ILE G N     1 
ATOM   5136  C CA    . ILE G 3 79  ? 140.359 160.647 128.543 1.00 150.41 ? 78  ILE G CA    1 
ATOM   5137  C C     . ILE G 3 79  ? 141.871 160.726 128.652 1.00 150.41 ? 78  ILE G C     1 
ATOM   5138  O O     . ILE G 3 79  ? 142.580 159.779 128.295 1.00 150.41 ? 78  ILE G O     1 
ATOM   5139  C CB    . ILE G 3 79  ? 139.791 159.554 129.450 1.00 150.41 ? 78  ILE G CB    1 
ATOM   5140  C CG1   . ILE G 3 79  ? 138.278 159.685 129.524 1.00 150.41 ? 78  ILE G CG1   1 
ATOM   5141  C CG2   . ILE G 3 79  ? 140.388 159.642 130.823 1.00 150.41 ? 78  ILE G CG2   1 
ATOM   5142  C CD1   . ILE G 3 79  ? 137.621 158.586 130.295 1.00 150.41 ? 78  ILE G CD1   1 
ATOM   5143  N N     . ILE G 3 80  ? 142.362 161.858 129.134 1.00 147.48 ? 79  ILE G N     1 
ATOM   5144  C CA    . ILE G 3 80  ? 143.789 162.135 129.227 1.00 147.48 ? 79  ILE G CA    1 
ATOM   5145  C C     . ILE G 3 80  ? 144.165 162.002 130.699 1.00 147.48 ? 79  ILE G C     1 
ATOM   5146  O O     . ILE G 3 80  ? 143.257 161.937 131.539 1.00 147.48 ? 79  ILE G O     1 
ATOM   5147  C CB    . ILE G 3 80  ? 144.095 163.524 128.645 1.00 147.48 ? 79  ILE G CB    1 
ATOM   5148  C CG1   . ILE G 3 80  ? 143.612 164.617 129.597 1.00 147.48 ? 79  ILE G CG1   1 
ATOM   5149  C CG2   . ILE G 3 80  ? 143.451 163.659 127.280 1.00 147.48 ? 79  ILE G CG2   1 
ATOM   5150  C CD1   . ILE G 3 80  ? 143.627 166.011 129.005 1.00 147.48 ? 79  ILE G CD1   1 
ATOM   5151  N N     . PRO G 3 81  ? 145.455 161.906 131.056 1.00 145.23 ? 80  PRO G N     1 
ATOM   5152  C CA    . PRO G 3 81  ? 145.821 161.814 132.480 1.00 145.23 ? 80  PRO G CA    1 
ATOM   5153  C C     . PRO G 3 81  ? 145.376 162.979 133.339 1.00 145.23 ? 80  PRO G C     1 
ATOM   5154  O O     . PRO G 3 81  ? 145.167 162.793 134.545 1.00 145.23 ? 80  PRO G O     1 
ATOM   5155  C CB    . PRO G 3 81  ? 147.346 161.734 132.423 1.00 145.23 ? 80  PRO G CB    1 
ATOM   5156  C CG    . PRO G 3 81  ? 147.609 161.024 131.186 1.00 145.23 ? 80  PRO G CG    1 
ATOM   5157  C CD    . PRO G 3 81  ? 146.584 161.490 130.205 1.00 145.23 ? 80  PRO G CD    1 
ATOM   5158  N N     . ARG G 3 82  ? 145.225 164.169 132.757 1.00 148.18 ? 81  ARG G N     1 
ATOM   5159  C CA    . ARG G 3 82  ? 144.698 165.306 133.498 1.00 148.18 ? 81  ARG G CA    1 
ATOM   5160  C C     . ARG G 3 82  ? 143.277 165.048 133.975 1.00 148.18 ? 81  ARG G C     1 
ATOM   5161  O O     . ARG G 3 82  ? 142.930 165.421 135.101 1.00 148.18 ? 81  ARG G O     1 
ATOM   5162  C CB    . ARG G 3 82  ? 144.758 166.560 132.624 1.00 148.18 ? 81  ARG G CB    1 
ATOM   5163  C CG    . ARG G 3 82  ? 144.059 167.779 133.187 1.00 148.18 ? 81  ARG G CG    1 
ATOM   5164  C CD    . ARG G 3 82  ? 144.702 168.222 134.474 1.00 148.18 ? 81  ARG G CD    1 
ATOM   5165  N NE    . ARG G 3 82  ? 143.915 169.228 135.167 1.00 148.18 ? 81  ARG G NE    1 
ATOM   5166  C CZ    . ARG G 3 82  ? 144.361 169.931 136.199 1.00 148.18 ? 81  ARG G CZ    1 
ATOM   5167  N NH1   . ARG G 3 82  ? 145.586 169.733 136.659 1.00 148.18 ? 81  ARG G NH1   1 
ATOM   5168  N NH2   . ARG G 3 82  ? 143.581 170.832 136.774 1.00 148.18 ? 81  ARG G NH2   1 
ATOM   5169  N N     . HIS G 3 83  ? 142.477 164.350 133.168 1.00 148.23 ? 82  HIS G N     1 
ATOM   5170  C CA    . HIS G 3 83  ? 141.093 164.091 133.536 1.00 148.23 ? 82  HIS G CA    1 
ATOM   5171  C C     . HIS G 3 83  ? 140.997 163.168 134.734 1.00 148.23 ? 82  HIS G C     1 
ATOM   5172  O O     . HIS G 3 83  ? 140.321 163.494 135.713 1.00 148.23 ? 82  HIS G O     1 
ATOM   5173  C CB    . HIS G 3 83  ? 140.343 163.492 132.363 1.00 148.23 ? 82  HIS G CB    1 
ATOM   5174  C CG    . HIS G 3 83  ? 140.129 164.454 131.251 1.00 148.23 ? 82  HIS G CG    1 
ATOM   5175  N ND1   . HIS G 3 83  ? 140.320 164.119 129.931 1.00 148.23 ? 82  HIS G ND1   1 
ATOM   5176  C CD2   . HIS G 3 83  ? 139.760 165.753 131.264 1.00 148.23 ? 82  HIS G CD2   1 
ATOM   5177  C CE1   . HIS G 3 83  ? 140.070 165.171 129.175 1.00 148.23 ? 82  HIS G CE1   1 
ATOM   5178  N NE2   . HIS G 3 83  ? 139.724 166.174 129.959 1.00 148.23 ? 82  HIS G NE2   1 
ATOM   5179  N N     . LEU G 3 84  ? 141.681 162.027 134.695 1.00 147.98 ? 83  LEU G N     1 
ATOM   5180  C CA    . LEU G 3 84  ? 141.595 161.114 135.823 1.00 147.98 ? 83  LEU G CA    1 
ATOM   5181  C C     . LEU G 3 84  ? 142.353 161.620 137.039 1.00 147.98 ? 83  LEU G C     1 
ATOM   5182  O O     . LEU G 3 84  ? 141.972 161.279 138.157 1.00 147.98 ? 83  LEU G O     1 
ATOM   5183  C CB    . LEU G 3 84  ? 142.073 159.714 135.426 1.00 147.98 ? 83  LEU G CB    1 
ATOM   5184  C CG    . LEU G 3 84  ? 143.410 159.482 134.734 1.00 147.98 ? 83  LEU G CG    1 
ATOM   5185  C CD1   . LEU G 3 84  ? 144.523 159.285 135.725 1.00 147.98 ? 83  LEU G CD1   1 
ATOM   5186  C CD2   . LEU G 3 84  ? 143.305 158.271 133.831 1.00 147.98 ? 83  LEU G CD2   1 
ATOM   5187  N N     . GLN G 3 85  ? 143.386 162.445 136.852 1.00 150.96 ? 84  GLN G N     1 
ATOM   5188  C CA    . GLN G 3 85  ? 144.052 163.054 137.998 1.00 150.96 ? 84  GLN G CA    1 
ATOM   5189  C C     . GLN G 3 85  ? 143.138 164.047 138.702 1.00 150.96 ? 84  GLN G C     1 
ATOM   5190  O O     . GLN G 3 85  ? 143.051 164.054 139.937 1.00 150.96 ? 84  GLN G O     1 
ATOM   5191  C CB    . GLN G 3 85  ? 145.343 163.730 137.549 1.00 150.96 ? 84  GLN G CB    1 
ATOM   5192  C CG    . GLN G 3 85  ? 145.770 164.919 138.378 1.00 150.96 ? 84  GLN G CG    1 
ATOM   5193  C CD    . GLN G 3 85  ? 146.422 164.522 139.675 1.00 150.96 ? 84  GLN G CD    1 
ATOM   5194  O OE1   . GLN G 3 85  ? 146.768 163.363 139.880 1.00 150.96 ? 84  GLN G OE1   1 
ATOM   5195  N NE2   . GLN G 3 85  ? 146.624 165.491 140.552 1.00 150.96 ? 84  GLN G NE2   1 
ATOM   5196  N N     . LEU G 3 86  ? 142.426 164.867 137.931 1.00 150.86 ? 85  LEU G N     1 
ATOM   5197  C CA    . LEU G 3 86  ? 141.432 165.751 138.516 1.00 150.86 ? 85  LEU G CA    1 
ATOM   5198  C C     . LEU G 3 86  ? 140.276 164.969 139.116 1.00 150.86 ? 85  LEU G C     1 
ATOM   5199  O O     . LEU G 3 86  ? 139.704 165.392 140.123 1.00 150.86 ? 85  LEU G O     1 
ATOM   5200  C CB    . LEU G 3 86  ? 140.931 166.726 137.456 1.00 150.86 ? 85  LEU G CB    1 
ATOM   5201  C CG    . LEU G 3 86  ? 140.001 167.852 137.895 1.00 150.86 ? 85  LEU G CG    1 
ATOM   5202  C CD1   . LEU G 3 86  ? 140.534 168.547 139.131 1.00 150.86 ? 85  LEU G CD1   1 
ATOM   5203  C CD2   . LEU G 3 86  ? 139.828 168.840 136.766 1.00 150.86 ? 85  LEU G CD2   1 
ATOM   5204  N N     . ALA G 3 87  ? 139.950 163.813 138.544 1.00 151.99 ? 86  ALA G N     1 
ATOM   5205  C CA    . ALA G 3 87  ? 138.884 162.990 139.093 1.00 151.99 ? 86  ALA G CA    1 
ATOM   5206  C C     . ALA G 3 87  ? 139.270 162.354 140.417 1.00 151.99 ? 86  ALA G C     1 
ATOM   5207  O O     . ALA G 3 87  ? 138.433 162.265 141.319 1.00 151.99 ? 86  ALA G O     1 
ATOM   5208  C CB    . ALA G 3 87  ? 138.492 161.903 138.098 1.00 151.99 ? 86  ALA G CB    1 
ATOM   5209  N N     . VAL G 3 88  ? 140.515 161.908 140.564 1.00 154.18 ? 87  VAL G N     1 
ATOM   5210  C CA    . VAL G 3 88  ? 140.895 161.268 141.816 1.00 154.18 ? 87  VAL G CA    1 
ATOM   5211  C C     . VAL G 3 88  ? 141.141 162.312 142.898 1.00 154.18 ? 87  VAL G C     1 
ATOM   5212  O O     . VAL G 3 88  ? 140.677 162.162 144.032 1.00 154.18 ? 87  VAL G O     1 
ATOM   5213  C CB    . VAL G 3 88  ? 142.088 160.310 141.619 1.00 154.18 ? 87  VAL G CB    1 
ATOM   5214  C CG1   . VAL G 3 88  ? 143.323 160.978 141.084 1.00 154.18 ? 87  VAL G CG1   1 
ATOM   5215  C CG2   . VAL G 3 88  ? 142.431 159.658 142.918 1.00 154.18 ? 87  VAL G CG2   1 
ATOM   5216  N N     . ARG G 3 89  ? 141.812 163.412 142.567 1.00 155.78 ? 88  ARG G N     1 
ATOM   5217  C CA    . ARG G 3 89  ? 142.079 164.398 143.598 1.00 155.78 ? 88  ARG G CA    1 
ATOM   5218  C C     . ARG G 3 89  ? 140.871 165.261 143.895 1.00 155.78 ? 88  ARG G C     1 
ATOM   5219  O O     . ARG G 3 89  ? 140.832 165.906 144.944 1.00 155.78 ? 88  ARG G O     1 
ATOM   5220  C CB    . ARG G 3 89  ? 143.261 165.263 143.193 1.00 155.78 ? 88  ARG G CB    1 
ATOM   5221  C CG    . ARG G 3 89  ? 144.502 164.454 142.915 1.00 155.78 ? 88  ARG G CG    1 
ATOM   5222  C CD    . ARG G 3 89  ? 145.166 163.989 144.191 1.00 155.78 ? 88  ARG G CD    1 
ATOM   5223  N NE    . ARG G 3 89  ? 146.584 163.725 143.979 1.00 155.78 ? 88  ARG G NE    1 
ATOM   5224  C CZ    . ARG G 3 89  ? 147.072 162.547 143.618 1.00 155.78 ? 88  ARG G CZ    1 
ATOM   5225  N NH1   . ARG G 3 89  ? 146.256 161.524 143.441 1.00 155.78 ? 88  ARG G NH1   1 
ATOM   5226  N NH2   . ARG G 3 89  ? 148.374 162.393 143.441 1.00 155.78 ? 88  ARG G NH2   1 
ATOM   5227  N N     . ASN G 3 90  ? 139.883 165.276 143.011 1.00 158.03 ? 89  ASN G N     1 
ATOM   5228  C CA    . ASN G 3 90  ? 138.648 165.984 143.282 1.00 158.03 ? 89  ASN G CA    1 
ATOM   5229  C C     . ASN G 3 90  ? 137.711 165.178 144.159 1.00 158.03 ? 89  ASN G C     1 
ATOM   5230  O O     . ASN G 3 90  ? 136.988 165.759 144.973 1.00 158.03 ? 89  ASN G O     1 
ATOM   5231  C CB    . ASN G 3 90  ? 137.955 166.334 141.970 1.00 158.03 ? 89  ASN G CB    1 
ATOM   5232  C CG    . ASN G 3 90  ? 137.144 167.587 142.073 1.00 158.03 ? 89  ASN G CG    1 
ATOM   5233  O OD1   . ASN G 3 90  ? 137.094 168.214 143.126 1.00 158.03 ? 89  ASN G OD1   1 
ATOM   5234  N ND2   . ASN G 3 90  ? 136.502 167.969 140.982 1.00 158.03 ? 89  ASN G ND2   1 
ATOM   5235  N N     . ASP G 3 91  ? 137.705 163.858 144.012 1.00 166.16 ? 90  ASP G N     1 
ATOM   5236  C CA    . ASP G 3 91  ? 136.962 162.998 144.915 1.00 166.16 ? 90  ASP G CA    1 
ATOM   5237  C C     . ASP G 3 91  ? 137.697 162.890 146.250 1.00 166.16 ? 90  ASP G C     1 
ATOM   5238  O O     . ASP G 3 91  ? 138.888 163.181 146.355 1.00 166.16 ? 90  ASP G O     1 
ATOM   5239  C CB    . ASP G 3 91  ? 136.764 161.618 144.291 1.00 166.16 ? 90  ASP G CB    1 
ATOM   5240  C CG    . ASP G 3 91  ? 135.712 160.796 145.009 1.00 166.16 ? 90  ASP G CG    1 
ATOM   5241  O OD1   . ASP G 3 91  ? 134.522 161.163 144.947 1.00 166.16 ? 90  ASP G OD1   1 
ATOM   5242  O OD2   . ASP G 3 91  ? 136.085 159.796 145.659 1.00 166.16 ? 90  ASP G OD2   1 
ATOM   5243  N N     . GLU G 3 92  ? 136.968 162.478 147.286 1.00 167.96 ? 91  GLU G N     1 
ATOM   5244  C CA    . GLU G 3 92  ? 137.532 162.316 148.618 1.00 167.96 ? 91  GLU G CA    1 
ATOM   5245  C C     . GLU G 3 92  ? 138.152 160.938 148.821 1.00 167.96 ? 91  GLU G C     1 
ATOM   5246  O O     . GLU G 3 92  ? 139.333 160.837 149.169 1.00 167.96 ? 91  GLU G O     1 
ATOM   5247  C CB    . GLU G 3 92  ? 136.450 162.570 149.673 1.00 167.96 ? 91  GLU G CB    1 
ATOM   5248  C CG    . GLU G 3 92  ? 136.987 163.051 151.013 1.00 167.96 ? 91  GLU G CG    1 
ATOM   5249  C CD    . GLU G 3 92  ? 137.527 161.925 151.879 1.00 167.96 ? 91  GLU G CD    1 
ATOM   5250  O OE1   . GLU G 3 92  ? 137.015 160.793 151.769 1.00 167.96 ? 91  GLU G OE1   1 
ATOM   5251  O OE2   . GLU G 3 92  ? 138.471 162.167 152.657 1.00 167.96 ? 91  GLU G OE2   1 
ATOM   5252  N N     . GLU G 3 93  ? 137.361 159.873 148.640 1.00 165.36 ? 92  GLU G N     1 
ATOM   5253  C CA    . GLU G 3 93  ? 137.802 158.534 149.022 1.00 165.36 ? 92  GLU G CA    1 
ATOM   5254  C C     . GLU G 3 93  ? 138.924 158.039 148.129 1.00 165.36 ? 92  GLU G C     1 
ATOM   5255  O O     . GLU G 3 93  ? 139.856 157.381 148.601 1.00 165.36 ? 92  GLU G O     1 
ATOM   5256  C CB    . GLU G 3 93  ? 136.634 157.556 148.976 1.00 165.36 ? 92  GLU G CB    1 
ATOM   5257  C CG    . GLU G 3 93  ? 135.716 157.629 150.170 1.00 165.36 ? 92  GLU G CG    1 
ATOM   5258  C CD    . GLU G 3 93  ? 134.536 158.531 149.930 1.00 165.36 ? 92  GLU G CD    1 
ATOM   5259  O OE1   . GLU G 3 93  ? 134.404 159.041 148.800 1.00 165.36 ? 92  GLU G OE1   1 
ATOM   5260  O OE2   . GLU G 3 93  ? 133.738 158.728 150.867 1.00 165.36 ? 92  GLU G OE2   1 
ATOM   5261  N N     . LEU G 3 94  ? 138.856 158.355 146.841 1.00 158.15 ? 93  LEU G N     1 
ATOM   5262  C CA    . LEU G 3 94  ? 139.934 157.976 145.944 1.00 158.15 ? 93  LEU G CA    1 
ATOM   5263  C C     . LEU G 3 94  ? 141.191 158.782 146.214 1.00 158.15 ? 93  LEU G C     1 
ATOM   5264  O O     . LEU G 3 94  ? 142.301 158.291 145.983 1.00 158.15 ? 93  LEU G O     1 
ATOM   5265  C CB    . LEU G 3 94  ? 139.481 158.148 144.507 1.00 158.15 ? 93  LEU G CB    1 
ATOM   5266  C CG    . LEU G 3 94  ? 138.333 157.217 144.158 1.00 158.15 ? 93  LEU G CG    1 
ATOM   5267  C CD1   . LEU G 3 94  ? 137.377 157.905 143.221 1.00 158.15 ? 93  LEU G CD1   1 
ATOM   5268  C CD2   . LEU G 3 94  ? 138.881 155.954 143.533 1.00 158.15 ? 93  LEU G CD2   1 
ATOM   5269  N N     . ASN G 3 95  ? 141.036 160.015 146.697 1.00 160.18 ? 94  ASN G N     1 
ATOM   5270  C CA    . ASN G 3 95  ? 142.191 160.776 147.146 1.00 160.18 ? 94  ASN G CA    1 
ATOM   5271  C C     . ASN G 3 95  ? 142.829 160.135 148.362 1.00 160.18 ? 94  ASN G C     1 
ATOM   5272  O O     . ASN G 3 95  ? 144.058 160.049 148.441 1.00 160.18 ? 94  ASN G O     1 
ATOM   5273  C CB    . ASN G 3 95  ? 141.786 162.206 147.478 1.00 160.18 ? 94  ASN G CB    1 
ATOM   5274  C CG    . ASN G 3 95  ? 142.971 163.116 147.652 1.00 160.18 ? 94  ASN G CG    1 
ATOM   5275  O OD1   . ASN G 3 95  ? 144.096 162.767 147.303 1.00 160.18 ? 94  ASN G OD1   1 
ATOM   5276  N ND2   . ASN G 3 95  ? 142.730 164.294 148.209 1.00 160.18 ? 94  ASN G ND2   1 
ATOM   5277  N N     . LYS G 3 96  ? 142.011 159.677 149.309 1.00 154.43 ? 95  LYS G N     1 
ATOM   5278  C CA    . LYS G 3 96  ? 142.552 159.051 150.506 1.00 154.43 ? 95  LYS G CA    1 
ATOM   5279  C C     . LYS G 3 96  ? 143.167 157.698 150.195 1.00 154.43 ? 95  LYS G C     1 
ATOM   5280  O O     . LYS G 3 96  ? 144.098 157.268 150.882 1.00 154.43 ? 95  LYS G O     1 
ATOM   5281  C CB    . LYS G 3 96  ? 141.463 158.908 151.559 1.00 154.43 ? 95  LYS G CB    1 
ATOM   5282  C CG    . LYS G 3 96  ? 142.004 158.815 152.957 1.00 154.43 ? 95  LYS G CG    1 
ATOM   5283  C CD    . LYS G 3 96  ? 141.027 159.396 153.952 1.00 154.43 ? 95  LYS G CD    1 
ATOM   5284  C CE    . LYS G 3 96  ? 141.719 159.711 155.266 1.00 154.43 ? 95  LYS G CE    1 
ATOM   5285  N NZ    . LYS G 3 96  ? 142.844 160.672 155.089 1.00 154.43 ? 95  LYS G NZ    1 
ATOM   5286  N N     . LEU G 3 97  ? 142.668 157.022 149.163 1.00 152.35 ? 96  LEU G N     1 
ATOM   5287  C CA    . LEU G 3 97  ? 143.300 155.791 148.714 1.00 152.35 ? 96  LEU G CA    1 
ATOM   5288  C C     . LEU G 3 97  ? 144.628 156.076 148.037 1.00 152.35 ? 96  LEU G C     1 
ATOM   5289  O O     . LEU G 3 97  ? 145.553 155.263 148.122 1.00 152.35 ? 96  LEU G O     1 
ATOM   5290  C CB    . LEU G 3 97  ? 142.372 155.057 147.753 1.00 152.35 ? 96  LEU G CB    1 
ATOM   5291  C CG    . LEU G 3 97  ? 142.493 153.551 147.531 1.00 152.35 ? 96  LEU G CG    1 
ATOM   5292  C CD1   . LEU G 3 97  ? 141.144 153.055 147.097 1.00 152.35 ? 96  LEU G CD1   1 
ATOM   5293  C CD2   . LEU G 3 97  ? 143.524 153.169 146.495 1.00 152.35 ? 96  LEU G CD2   1 
ATOM   5294  N N     . LEU G 3 98  ? 144.741 157.216 147.365 1.00 150.84 ? 97  LEU G N     1 
ATOM   5295  C CA    . LEU G 3 98  ? 145.911 157.494 146.549 1.00 150.84 ? 97  LEU G CA    1 
ATOM   5296  C C     . LEU G 3 98  ? 146.627 158.745 147.027 1.00 150.84 ? 97  LEU G C     1 
ATOM   5297  O O     . LEU G 3 98  ? 146.965 159.618 146.223 1.00 150.84 ? 97  LEU G O     1 
ATOM   5298  C CB    . LEU G 3 98  ? 145.512 157.635 145.084 1.00 150.84 ? 97  LEU G CB    1 
ATOM   5299  C CG    . LEU G 3 98  ? 144.921 156.364 144.483 1.00 150.84 ? 97  LEU G CG    1 
ATOM   5300  C CD1   . LEU G 3 98  ? 144.460 156.597 143.078 1.00 150.84 ? 97  LEU G CD1   1 
ATOM   5301  C CD2   . LEU G 3 98  ? 145.932 155.253 144.502 1.00 150.84 ? 97  LEU G CD2   1 
ATOM   5302  N N     . GLY G 3 99  ? 146.850 158.844 148.332 1.00 157.15 ? 98  GLY G N     1 
ATOM   5303  C CA    . GLY G 3 99  ? 147.466 160.019 148.913 1.00 157.15 ? 98  GLY G CA    1 
ATOM   5304  C C     . GLY G 3 99  ? 148.920 160.206 148.541 1.00 157.15 ? 98  GLY G C     1 
ATOM   5305  O O     . GLY G 3 99  ? 149.320 161.289 148.111 1.00 157.15 ? 98  GLY G O     1 
ATOM   5306  N N     . ARG G 3 100 ? 149.725 159.158 148.695 1.00 154.52 ? 99  ARG G N     1 
ATOM   5307  C CA    . ARG G 3 100 ? 151.146 159.217 148.385 1.00 154.52 ? 99  ARG G CA    1 
ATOM   5308  C C     . ARG G 3 100 ? 151.437 158.741 146.972 1.00 154.52 ? 99  ARG G C     1 
ATOM   5309  O O     . ARG G 3 100 ? 152.507 158.183 146.709 1.00 154.52 ? 99  ARG G O     1 
ATOM   5310  C CB    . ARG G 3 100 ? 151.943 158.393 149.393 1.00 154.52 ? 99  ARG G CB    1 
ATOM   5311  C CG    . ARG G 3 100 ? 152.473 159.189 150.572 1.00 154.52 ? 99  ARG G CG    1 
ATOM   5312  C CD    . ARG G 3 100 ? 153.561 160.166 150.155 1.00 154.52 ? 99  ARG G CD    1 
ATOM   5313  N NE    . ARG G 3 100 ? 154.396 160.565 151.286 1.00 154.52 ? 99  ARG G NE    1 
ATOM   5314  C CZ    . ARG G 3 100 ? 155.476 161.334 151.189 1.00 154.52 ? 99  ARG G CZ    1 
ATOM   5315  N NH1   . ARG G 3 100 ? 155.863 161.794 150.007 1.00 154.52 ? 99  ARG G NH1   1 
ATOM   5316  N NH2   . ARG G 3 100 ? 156.173 161.643 152.273 1.00 154.52 ? 99  ARG G NH2   1 
ATOM   5317  N N     . VAL G 3 101 ? 150.497 158.944 146.057 1.00 149.54 ? 100 VAL G N     1 
ATOM   5318  C CA    . VAL G 3 101 ? 150.566 158.407 144.707 1.00 149.54 ? 100 VAL G CA    1 
ATOM   5319  C C     . VAL G 3 101 ? 150.595 159.559 143.722 1.00 149.54 ? 100 VAL G C     1 
ATOM   5320  O O     . VAL G 3 101 ? 149.667 160.373 143.685 1.00 149.54 ? 100 VAL G O     1 
ATOM   5321  C CB    . VAL G 3 101 ? 149.373 157.490 144.416 1.00 149.54 ? 100 VAL G CB    1 
ATOM   5322  C CG1   . VAL G 3 101 ? 149.520 156.911 143.052 1.00 149.54 ? 100 VAL G CG1   1 
ATOM   5323  C CG2   . VAL G 3 101 ? 149.294 156.405 145.459 1.00 149.54 ? 100 VAL G CG2   1 
ATOM   5324  N N     . THR G 3 102 ? 151.637 159.615 142.914 1.00 151.52 ? 101 THR G N     1 
ATOM   5325  C CA    . THR G 3 102 ? 151.865 160.728 142.004 1.00 151.52 ? 101 THR G CA    1 
ATOM   5326  C C     . THR G 3 102 ? 151.531 160.291 140.587 1.00 151.52 ? 101 THR G C     1 
ATOM   5327  O O     . THR G 3 102 ? 152.263 159.498 139.990 1.00 151.52 ? 101 THR G O     1 
ATOM   5328  C CB    . THR G 3 102 ? 153.307 161.204 142.092 1.00 151.52 ? 101 THR G CB    1 
ATOM   5329  O OG1   . THR G 3 102 ? 154.145 160.259 141.429 1.00 151.52 ? 101 THR G OG1   1 
ATOM   5330  C CG2   . THR G 3 102 ? 153.735 161.317 143.539 1.00 151.52 ? 101 THR G CG2   1 
ATOM   5331  N N     . ILE G 3 103 ? 150.433 160.813 140.052 1.00 150.95 ? 102 ILE G N     1 
ATOM   5332  C CA    . ILE G 3 103 ? 150.057 160.530 138.675 1.00 150.95 ? 102 ILE G CA    1 
ATOM   5333  C C     . ILE G 3 103 ? 150.955 161.333 137.748 1.00 150.95 ? 102 ILE G C     1 
ATOM   5334  O O     . ILE G 3 103 ? 150.995 162.565 137.819 1.00 150.95 ? 102 ILE G O     1 
ATOM   5335  C CB    . ILE G 3 103 ? 148.585 160.866 138.432 1.00 150.95 ? 102 ILE G CB    1 
ATOM   5336  C CG1   . ILE G 3 103 ? 147.693 159.906 139.205 1.00 150.95 ? 102 ILE G CG1   1 
ATOM   5337  C CG2   . ILE G 3 103 ? 148.275 160.814 136.960 1.00 150.95 ? 102 ILE G CG2   1 
ATOM   5338  C CD1   . ILE G 3 103 ? 146.237 160.122 138.964 1.00 150.95 ? 102 ILE G CD1   1 
ATOM   5339  N N     . ALA G 3 104 ? 151.684 160.641 136.883 1.00 155.72 ? 103 ALA G N     1 
ATOM   5340  C CA    . ALA G 3 104 ? 152.484 161.325 135.883 1.00 155.72 ? 103 ALA G CA    1 
ATOM   5341  C C     . ALA G 3 104 ? 151.580 161.976 134.851 1.00 155.72 ? 103 ALA G C     1 
ATOM   5342  O O     . ALA G 3 104 ? 150.489 161.477 134.563 1.00 155.72 ? 103 ALA G O     1 
ATOM   5343  C CB    . ALA G 3 104 ? 153.437 160.351 135.201 1.00 155.72 ? 103 ALA G CB    1 
ATOM   5344  N N     . GLN G 3 105 ? 152.044 163.113 134.314 1.00 157.51 ? 104 GLN G N     1 
ATOM   5345  C CA    . GLN G 3 105 ? 151.311 163.944 133.351 1.00 157.51 ? 104 GLN G CA    1 
ATOM   5346  C C     . GLN G 3 105 ? 149.957 164.386 133.895 1.00 157.51 ? 104 GLN G C     1 
ATOM   5347  O O     . GLN G 3 105 ? 148.987 164.529 133.150 1.00 157.51 ? 104 GLN G O     1 
ATOM   5348  C CB    . GLN G 3 105 ? 151.142 163.230 132.006 1.00 157.51 ? 104 GLN G CB    1 
ATOM   5349  C CG    . GLN G 3 105 ? 151.215 164.133 130.808 1.00 157.51 ? 104 GLN G CG    1 
ATOM   5350  C CD    . GLN G 3 105 ? 152.588 164.705 130.621 1.00 157.51 ? 104 GLN G CD    1 
ATOM   5351  O OE1   . GLN G 3 105 ? 153.588 164.055 130.923 1.00 157.51 ? 104 GLN G OE1   1 
ATOM   5352  N NE2   . GLN G 3 105 ? 152.654 165.933 130.122 1.00 157.51 ? 104 GLN G NE2   1 
ATOM   5353  N N     . GLY G 3 106 ? 149.873 164.602 135.199 1.00 154.25 ? 105 GLY G N     1 
ATOM   5354  C CA    . GLY G 3 106 ? 148.587 164.821 135.819 1.00 154.25 ? 105 GLY G CA    1 
ATOM   5355  C C     . GLY G 3 106 ? 148.303 166.272 136.102 1.00 154.25 ? 105 GLY G C     1 
ATOM   5356  O O     . GLY G 3 106 ? 147.161 166.714 135.991 1.00 154.25 ? 105 GLY G O     1 
ATOM   5357  N N     . GLY G 3 107 ? 149.318 167.024 136.463 1.00 154.59 ? 106 GLY G N     1 
ATOM   5358  C CA    . GLY G 3 107 ? 149.089 168.394 136.842 1.00 154.59 ? 106 GLY G CA    1 
ATOM   5359  C C     . GLY G 3 107 ? 148.517 168.494 138.241 1.00 154.59 ? 106 GLY G C     1 
ATOM   5360  O O     . GLY G 3 107 ? 148.412 167.515 138.981 1.00 154.59 ? 106 GLY G O     1 
ATOM   5361  N N     . VAL G 3 108 ? 148.140 169.714 138.604 1.00 140.42 ? 107 VAL G N     1 
ATOM   5362  C CA    . VAL G 3 108 ? 147.682 170.032 139.948 1.00 140.42 ? 107 VAL G CA    1 
ATOM   5363  C C     . VAL G 3 108 ? 146.225 170.447 139.866 1.00 140.42 ? 107 VAL G C     1 
ATOM   5364  O O     . VAL G 3 108 ? 145.823 171.124 138.914 1.00 140.42 ? 107 VAL G O     1 
ATOM   5365  C CB    . VAL G 3 108 ? 148.541 171.139 140.580 1.00 140.42 ? 107 VAL G CB    1 
ATOM   5366  C CG1   . VAL G 3 108 ? 148.170 171.375 142.030 1.00 140.42 ? 107 VAL G CG1   1 
ATOM   5367  C CG2   . VAL G 3 108 ? 149.993 170.766 140.483 1.00 140.42 ? 107 VAL G CG2   1 
ATOM   5368  N N     . LEU G 3 109 ? 145.434 169.997 140.832 1.00 150.85 ? 108 LEU G N     1 
ATOM   5369  C CA    . LEU G 3 109 ? 144.087 170.509 141.002 1.00 150.85 ? 108 LEU G CA    1 
ATOM   5370  C C     . LEU G 3 109 ? 144.147 172.003 141.306 1.00 150.85 ? 108 LEU G C     1 
ATOM   5371  O O     . LEU G 3 109 ? 145.012 172.443 142.070 1.00 150.85 ? 108 LEU G O     1 
ATOM   5372  C CB    . LEU G 3 109 ? 143.386 169.749 142.129 1.00 150.85 ? 108 LEU G CB    1 
ATOM   5373  C CG    . LEU G 3 109 ? 141.904 169.957 142.427 1.00 150.85 ? 108 LEU G CG    1 
ATOM   5374  C CD1   . LEU G 3 109 ? 141.310 168.637 142.839 1.00 150.85 ? 108 LEU G CD1   1 
ATOM   5375  C CD2   . LEU G 3 109 ? 141.694 170.967 143.544 1.00 150.85 ? 108 LEU G CD2   1 
ATOM   5376  N N     . PRO G 3 110 ? 143.272 172.809 140.709 1.00 154.61 ? 109 PRO G N     1 
ATOM   5377  C CA    . PRO G 3 110 ? 143.359 174.261 140.898 1.00 154.61 ? 109 PRO G CA    1 
ATOM   5378  C C     . PRO G 3 110 ? 142.929 174.670 142.296 1.00 154.61 ? 109 PRO G C     1 
ATOM   5379  O O     . PRO G 3 110 ? 141.824 174.359 142.741 1.00 154.61 ? 109 PRO G O     1 
ATOM   5380  C CB    . PRO G 3 110 ? 142.407 174.814 139.834 1.00 154.61 ? 109 PRO G CB    1 
ATOM   5381  C CG    . PRO G 3 110 ? 141.473 173.708 139.559 1.00 154.61 ? 109 PRO G CG    1 
ATOM   5382  C CD    . PRO G 3 110 ? 142.265 172.452 139.701 1.00 154.61 ? 109 PRO G CD    1 
ATOM   5383  N N     . ASN G 3 111 ? 143.820 175.377 142.985 1.00 166.14 ? 110 ASN G N     1 
ATOM   5384  C CA    . ASN G 3 111 ? 143.532 175.865 144.328 1.00 166.14 ? 110 ASN G CA    1 
ATOM   5385  C C     . ASN G 3 111 ? 144.419 177.071 144.591 1.00 166.14 ? 110 ASN G C     1 
ATOM   5386  O O     . ASN G 3 111 ? 145.645 176.936 144.640 1.00 166.14 ? 110 ASN G O     1 
ATOM   5387  C CB    . ASN G 3 111 ? 143.772 174.782 145.365 1.00 166.14 ? 110 ASN G CB    1 
ATOM   5388  C CG    . ASN G 3 111 ? 143.015 175.034 146.644 1.00 166.14 ? 110 ASN G CG    1 
ATOM   5389  O OD1   . ASN G 3 111 ? 142.412 176.092 146.822 1.00 166.14 ? 110 ASN G OD1   1 
ATOM   5390  N ND2   . ASN G 3 111 ? 143.041 174.065 147.547 1.00 166.14 ? 110 ASN G ND2   1 
ATOM   5391  N N     . ILE G 3 112 ? 143.804 178.236 144.750 1.00 165.92 ? 111 ILE G N     1 
ATOM   5392  C CA    . ILE G 3 112 ? 144.491 179.443 145.185 1.00 165.92 ? 111 ILE G CA    1 
ATOM   5393  C C     . ILE G 3 112 ? 143.959 179.789 146.563 1.00 165.92 ? 111 ILE G C     1 
ATOM   5394  O O     . ILE G 3 112 ? 142.741 179.799 146.774 1.00 165.92 ? 111 ILE G O     1 
ATOM   5395  C CB    . ILE G 3 112 ? 144.266 180.605 144.208 1.00 165.92 ? 111 ILE G CB    1 
ATOM   5396  C CG1   . ILE G 3 112 ? 144.673 180.195 142.802 1.00 165.92 ? 111 ILE G CG1   1 
ATOM   5397  C CG2   . ILE G 3 112 ? 145.082 181.802 144.623 1.00 165.92 ? 111 ILE G CG2   1 
ATOM   5398  C CD1   . ILE G 3 112 ? 144.217 181.167 141.750 1.00 165.92 ? 111 ILE G CD1   1 
ATOM   5399  N N     . GLN G 3 113 ? 144.861 180.051 147.501 1.00 175.14 ? 112 GLN G N     1 
ATOM   5400  C CA    . GLN G 3 113 ? 144.439 180.396 148.848 1.00 175.14 ? 112 GLN G CA    1 
ATOM   5401  C C     . GLN G 3 113 ? 143.808 181.778 148.856 1.00 175.14 ? 112 GLN G C     1 
ATOM   5402  O O     . GLN G 3 113 ? 144.250 182.682 148.145 1.00 175.14 ? 112 GLN G O     1 
ATOM   5403  C CB    . GLN G 3 113 ? 145.623 180.345 149.800 1.00 175.14 ? 112 GLN G CB    1 
ATOM   5404  C CG    . GLN G 3 113 ? 145.859 178.978 150.402 1.00 175.14 ? 112 GLN G CG    1 
ATOM   5405  C CD    . GLN G 3 113 ? 145.081 178.771 151.681 1.00 175.14 ? 112 GLN G CD    1 
ATOM   5406  O OE1   . GLN G 3 113 ? 144.837 179.714 152.430 1.00 175.14 ? 112 GLN G OE1   1 
ATOM   5407  N NE2   . GLN G 3 113 ? 144.686 177.532 151.939 1.00 175.14 ? 112 GLN G NE2   1 
ATOM   5408  N N     . SER G 3 114 ? 142.763 181.933 149.665 1.00 184.22 ? 113 SER G N     1 
ATOM   5409  C CA    . SER G 3 114 ? 141.882 183.088 149.585 1.00 184.22 ? 113 SER G CA    1 
ATOM   5410  C C     . SER G 3 114 ? 142.528 184.385 150.043 1.00 184.22 ? 113 SER G C     1 
ATOM   5411  O O     . SER G 3 114 ? 142.053 185.457 149.660 1.00 184.22 ? 113 SER G O     1 
ATOM   5412  C CB    . SER G 3 114 ? 140.626 182.848 150.415 1.00 184.22 ? 113 SER G CB    1 
ATOM   5413  O OG    . SER G 3 114 ? 140.817 183.302 151.741 1.00 184.22 ? 113 SER G OG    1 
ATOM   5414  N N     . VAL G 3 115 ? 143.594 184.324 150.845 1.00 179.20 ? 114 VAL G N     1 
ATOM   5415  C CA    . VAL G 3 115 ? 144.282 185.539 151.264 1.00 179.20 ? 114 VAL G CA    1 
ATOM   5416  C C     . VAL G 3 115 ? 145.260 186.035 150.213 1.00 179.20 ? 114 VAL G C     1 
ATOM   5417  O O     . VAL G 3 115 ? 145.927 187.054 150.432 1.00 179.20 ? 114 VAL G O     1 
ATOM   5418  C CB    . VAL G 3 115 ? 144.997 185.323 152.612 1.00 179.20 ? 114 VAL G CB    1 
ATOM   5419  C CG1   . VAL G 3 115 ? 144.025 184.776 153.636 1.00 179.20 ? 114 VAL G CG1   1 
ATOM   5420  C CG2   . VAL G 3 115 ? 146.162 184.378 152.452 1.00 179.20 ? 114 VAL G CG2   1 
ATOM   5421  N N     . LEU G 3 116 ? 145.362 185.350 149.075 1.00 180.01 ? 115 LEU G N     1 
ATOM   5422  C CA    . LEU G 3 116 ? 146.209 185.768 147.971 1.00 180.01 ? 115 LEU G CA    1 
ATOM   5423  C C     . LEU G 3 116 ? 145.444 186.383 146.813 1.00 180.01 ? 115 LEU G C     1 
ATOM   5424  O O     . LEU G 3 116 ? 146.065 187.025 145.962 1.00 180.01 ? 115 LEU G O     1 
ATOM   5425  C CB    . LEU G 3 116 ? 147.028 184.582 147.451 1.00 180.01 ? 115 LEU G CB    1 
ATOM   5426  C CG    . LEU G 3 116 ? 148.416 184.346 148.037 1.00 180.01 ? 115 LEU G CG    1 
ATOM   5427  C CD1   . LEU G 3 116 ? 148.398 184.096 149.511 1.00 180.01 ? 115 LEU G CD1   1 
ATOM   5428  C CD2   . LEU G 3 116 ? 148.999 183.139 147.353 1.00 180.01 ? 115 LEU G CD2   1 
ATOM   5429  N N     . LEU G 3 117 ? 144.133 186.190 146.746 1.00 188.75 ? 116 LEU G N     1 
ATOM   5430  C CA    . LEU G 3 117 ? 143.322 186.986 145.846 1.00 188.75 ? 116 LEU G CA    1 
ATOM   5431  C C     . LEU G 3 117 ? 143.309 188.434 146.328 1.00 188.75 ? 116 LEU G C     1 
ATOM   5432  O O     . LEU G 3 117 ? 143.353 188.687 147.534 1.00 188.75 ? 116 LEU G O     1 
ATOM   5433  C CB    . LEU G 3 117 ? 141.896 186.452 145.776 1.00 188.75 ? 116 LEU G CB    1 
ATOM   5434  C CG    . LEU G 3 117 ? 141.558 185.319 144.804 1.00 188.75 ? 116 LEU G CG    1 
ATOM   5435  C CD1   . LEU G 3 117 ? 142.087 183.979 145.266 1.00 188.75 ? 116 LEU G CD1   1 
ATOM   5436  C CD2   . LEU G 3 117 ? 140.057 185.252 144.600 1.00 188.75 ? 116 LEU G CD2   1 
ATOM   5437  N N     . PRO G 3 118 ? 143.297 189.403 145.405 1.00 197.08 ? 117 PRO G N     1 
ATOM   5438  C CA    . PRO G 3 118 ? 143.279 190.814 145.815 1.00 197.08 ? 117 PRO G CA    1 
ATOM   5439  C C     . PRO G 3 118 ? 142.015 191.214 146.561 1.00 197.08 ? 117 PRO G C     1 
ATOM   5440  O O     . PRO G 3 118 ? 142.105 191.672 147.705 1.00 197.08 ? 117 PRO G O     1 
ATOM   5441  C CB    . PRO G 3 118 ? 143.407 191.570 144.485 1.00 197.08 ? 117 PRO G CB    1 
ATOM   5442  C CG    . PRO G 3 118 ? 143.052 190.586 143.429 1.00 197.08 ? 117 PRO G CG    1 
ATOM   5443  C CD    . PRO G 3 118 ? 143.443 189.250 143.949 1.00 197.08 ? 117 PRO G CD    1 
ATOM   5444  N N     . LYS G 3 119 ? 140.852 191.018 145.925 1.00 204.53 ? 118 LYS G N     1 
ATOM   5445  C CA    . LYS G 3 119 ? 139.520 191.269 146.499 1.00 204.53 ? 118 LYS G CA    1 
ATOM   5446  C C     . LYS G 3 119 ? 139.354 192.695 147.023 1.00 204.53 ? 118 LYS G C     1 
ATOM   5447  O O     . LYS G 3 119 ? 138.627 192.931 147.990 1.00 204.53 ? 118 LYS G O     1 
ATOM   5448  C CB    . LYS G 3 119 ? 139.192 190.258 147.603 1.00 204.53 ? 118 LYS G CB    1 
ATOM   5449  N N     . LYS G 3 120 ? 140.020 193.656 146.394 1.00 205.74 ? 119 LYS G N     1 
ATOM   5450  C CA    . LYS G 3 120 ? 139.990 195.034 146.864 1.00 205.74 ? 119 LYS G CA    1 
ATOM   5451  C C     . LYS G 3 120 ? 139.408 195.962 145.805 1.00 205.74 ? 119 LYS G C     1 
ATOM   5452  O O     . LYS G 3 120 ? 138.377 195.663 145.203 1.00 205.74 ? 119 LYS G O     1 
ATOM   5453  C CB    . LYS G 3 120 ? 141.395 195.494 147.255 1.00 205.74 ? 119 LYS G CB    1 
ATOM   5454  N N     . THR H 5 1   ? 158.150 141.095 122.390 1.00 194.10 ? 29  THR H N     1 
ATOM   5455  C CA    . THR H 5 1   ? 157.701 139.758 122.748 1.00 194.10 ? 29  THR H CA    1 
ATOM   5456  C C     . THR H 5 1   ? 156.406 139.817 123.543 1.00 194.10 ? 29  THR H C     1 
ATOM   5457  O O     . THR H 5 1   ? 155.756 140.857 123.607 1.00 194.10 ? 29  THR H O     1 
ATOM   5458  C CB    . THR H 5 1   ? 158.764 139.003 123.566 1.00 194.10 ? 29  THR H CB    1 
ATOM   5459  O OG1   . THR H 5 1   ? 158.234 137.746 124.000 1.00 194.10 ? 29  THR H OG1   1 
ATOM   5460  C CG2   . THR H 5 1   ? 159.185 139.819 124.776 1.00 194.10 ? 29  THR H CG2   1 
ATOM   5461  N N     . ARG H 5 2   ? 156.036 138.691 124.140 1.00 194.89 ? 30  ARG H N     1 
ATOM   5462  C CA    . ARG H 5 2   ? 154.814 138.625 124.925 1.00 194.89 ? 30  ARG H CA    1 
ATOM   5463  C C     . ARG H 5 2   ? 154.972 139.398 126.225 1.00 194.89 ? 30  ARG H C     1 
ATOM   5464  O O     . ARG H 5 2   ? 155.944 139.213 126.961 1.00 194.89 ? 30  ARG H O     1 
ATOM   5465  C CB    . ARG H 5 2   ? 154.448 137.168 125.204 1.00 194.89 ? 30  ARG H CB    1 
ATOM   5466  C CG    . ARG H 5 2   ? 153.254 136.976 126.124 1.00 194.89 ? 30  ARG H CG    1 
ATOM   5467  C CD    . ARG H 5 2   ? 152.033 137.672 125.585 1.00 194.89 ? 30  ARG H CD    1 
ATOM   5468  N NE    . ARG H 5 2   ? 151.710 137.258 124.228 1.00 194.89 ? 30  ARG H NE    1 
ATOM   5469  C CZ    . ARG H 5 2   ? 150.891 136.262 123.928 1.00 194.89 ? 30  ARG H CZ    1 
ATOM   5470  N NH1   . ARG H 5 2   ? 150.297 135.580 124.898 1.00 194.89 ? 30  ARG H NH1   1 
ATOM   5471  N NH2   . ARG H 5 2   ? 150.655 135.960 122.657 1.00 194.89 ? 30  ARG H NH2   1 
ATOM   5472  N N     . LYS H 5 3   ? 154.014 140.279 126.494 1.00 185.60 ? 31  LYS H N     1 
ATOM   5473  C CA    . LYS H 5 3   ? 153.937 141.014 127.750 1.00 185.60 ? 31  LYS H CA    1 
ATOM   5474  C C     . LYS H 5 3   ? 152.468 141.246 128.063 1.00 185.60 ? 31  LYS H C     1 
ATOM   5475  O O     . LYS H 5 3   ? 151.798 142.016 127.369 1.00 185.60 ? 31  LYS H O     1 
ATOM   5476  C CB    . LYS H 5 3   ? 154.697 142.334 127.661 1.00 185.60 ? 31  LYS H CB    1 
ATOM   5477  C CG    . LYS H 5 3   ? 154.850 143.044 128.989 1.00 185.60 ? 31  LYS H CG    1 
ATOM   5478  C CD    . LYS H 5 3   ? 155.887 144.151 128.894 1.00 185.60 ? 31  LYS H CD    1 
ATOM   5479  C CE    . LYS H 5 3   ? 155.950 144.977 130.171 1.00 185.60 ? 31  LYS H CE    1 
ATOM   5480  N NZ    . LYS H 5 3   ? 154.788 145.897 130.312 1.00 185.60 ? 31  LYS H NZ    1 
ATOM   5481  N N     . GLU H 5 4   ? 151.969 140.581 129.098 1.00 182.15 ? 32  GLU H N     1 
ATOM   5482  C CA    . GLU H 5 4   ? 150.566 140.705 129.463 1.00 182.15 ? 32  GLU H CA    1 
ATOM   5483  C C     . GLU H 5 4   ? 150.293 142.065 130.086 1.00 182.15 ? 32  GLU H C     1 
ATOM   5484  O O     . GLU H 5 4   ? 151.176 142.676 130.689 1.00 182.15 ? 32  GLU H O     1 
ATOM   5485  C CB    . GLU H 5 4   ? 150.175 139.603 130.446 1.00 182.15 ? 32  GLU H CB    1 
ATOM   5486  C CG    . GLU H 5 4   ? 150.361 138.184 129.926 1.00 182.15 ? 32  GLU H CG    1 
ATOM   5487  C CD    . GLU H 5 4   ? 149.242 137.731 129.008 1.00 182.15 ? 32  GLU H CD    1 
ATOM   5488  O OE1   . GLU H 5 4   ? 148.098 138.197 129.183 1.00 182.15 ? 32  GLU H OE1   1 
ATOM   5489  O OE2   . GLU H 5 4   ? 149.507 136.902 128.113 1.00 182.15 ? 32  GLU H OE2   1 
ATOM   5490  N N     . SER H 5 5   ? 149.058 142.534 129.940 1.00 162.32 ? 33  SER H N     1 
ATOM   5491  C CA    . SER H 5 5   ? 148.635 143.776 130.565 1.00 162.32 ? 33  SER H CA    1 
ATOM   5492  C C     . SER H 5 5   ? 147.123 143.786 130.668 1.00 162.32 ? 33  SER H C     1 
ATOM   5493  O O     . SER H 5 5   ? 146.432 143.014 130.005 1.00 162.32 ? 33  SER H O     1 
ATOM   5494  C CB    . SER H 5 5   ? 149.103 144.999 129.785 1.00 162.32 ? 33  SER H CB    1 
ATOM   5495  O OG    . SER H 5 5   ? 148.597 146.172 130.389 1.00 162.32 ? 33  SER H OG    1 
ATOM   5496  N N     . TYR H 5 6   ? 146.621 144.678 131.510 1.00 152.16 ? 34  TYR H N     1 
ATOM   5497  C CA    . TYR H 5 6   ? 145.183 144.857 131.680 1.00 152.16 ? 34  TYR H CA    1 
ATOM   5498  C C     . TYR H 5 6   ? 144.657 145.952 130.767 1.00 152.16 ? 34  TYR H C     1 
ATOM   5499  O O     . TYR H 5 6   ? 143.983 146.870 131.210 1.00 152.16 ? 34  TYR H O     1 
ATOM   5500  C CB    . TYR H 5 6   ? 144.858 145.181 133.132 1.00 152.16 ? 34  TYR H CB    1 
ATOM   5501  C CG    . TYR H 5 6   ? 145.318 144.164 134.141 1.00 152.16 ? 34  TYR H CG    1 
ATOM   5502  C CD1   . TYR H 5 6   ? 144.464 143.173 134.583 1.00 152.16 ? 34  TYR H CD1   1 
ATOM   5503  C CD2   . TYR H 5 6   ? 146.595 144.216 134.677 1.00 152.16 ? 34  TYR H CD2   1 
ATOM   5504  C CE1   . TYR H 5 6   ? 144.875 142.250 135.509 1.00 152.16 ? 34  TYR H CE1   1 
ATOM   5505  C CE2   . TYR H 5 6   ? 147.015 143.296 135.597 1.00 152.16 ? 34  TYR H CE2   1 
ATOM   5506  C CZ    . TYR H 5 6   ? 146.151 142.318 136.011 1.00 152.16 ? 34  TYR H CZ    1 
ATOM   5507  O OH    . TYR H 5 6   ? 146.572 141.402 136.938 1.00 152.16 ? 34  TYR H OH    1 
ATOM   5508  N N     . ALA H 5 7   ? 144.953 145.873 129.480 1.00 149.13 ? 35  ALA H N     1 
ATOM   5509  C CA    . ALA H 5 7   ? 144.497 146.937 128.602 1.00 149.13 ? 35  ALA H CA    1 
ATOM   5510  C C     . ALA H 5 7   ? 143.053 146.730 128.172 1.00 149.13 ? 35  ALA H C     1 
ATOM   5511  O O     . ALA H 5 7   ? 142.211 147.620 128.345 1.00 149.13 ? 35  ALA H O     1 
ATOM   5512  C CB    . ALA H 5 7   ? 145.405 147.029 127.377 1.00 149.13 ? 35  ALA H CB    1 
ATOM   5513  N N     . ILE H 5 8   ? 142.759 145.547 127.635 1.00 153.65 ? 36  ILE H N     1 
ATOM   5514  C CA    . ILE H 5 8   ? 141.479 145.315 126.984 1.00 153.65 ? 36  ILE H CA    1 
ATOM   5515  C C     . ILE H 5 8   ? 140.351 145.252 127.992 1.00 153.65 ? 36  ILE H C     1 
ATOM   5516  O O     . ILE H 5 8   ? 139.214 145.605 127.676 1.00 153.65 ? 36  ILE H O     1 
ATOM   5517  C CB    . ILE H 5 8   ? 141.548 144.034 126.146 1.00 153.65 ? 36  ILE H CB    1 
ATOM   5518  C CG1   . ILE H 5 8   ? 142.222 142.930 126.940 1.00 153.65 ? 36  ILE H CG1   1 
ATOM   5519  C CG2   . ILE H 5 8   ? 142.334 144.276 124.890 1.00 153.65 ? 36  ILE H CG2   1 
ATOM   5520  C CD1   . ILE H 5 8   ? 142.144 141.614 126.260 1.00 153.65 ? 36  ILE H CD1   1 
ATOM   5521  N N     . TYR H 5 9   ? 140.637 144.840 129.221 1.00 160.34 ? 37  TYR H N     1 
ATOM   5522  C CA    . TYR H 5 9   ? 139.588 144.795 130.227 1.00 160.34 ? 37  TYR H CA    1 
ATOM   5523  C C     . TYR H 5 9   ? 139.224 146.190 130.701 1.00 160.34 ? 37  TYR H C     1 
ATOM   5524  O O     . TYR H 5 9   ? 138.047 146.480 130.951 1.00 160.34 ? 37  TYR H O     1 
ATOM   5525  C CB    . TYR H 5 9   ? 140.038 143.927 131.386 1.00 160.34 ? 37  TYR H CB    1 
ATOM   5526  C CG    . TYR H 5 9   ? 140.838 142.752 130.916 1.00 160.34 ? 37  TYR H CG    1 
ATOM   5527  C CD1   . TYR H 5 9   ? 140.228 141.706 130.251 1.00 160.34 ? 37  TYR H CD1   1 
ATOM   5528  C CD2   . TYR H 5 9   ? 142.206 142.697 131.115 1.00 160.34 ? 37  TYR H CD2   1 
ATOM   5529  C CE1   . TYR H 5 9   ? 140.952 140.632 129.819 1.00 160.34 ? 37  TYR H CE1   1 
ATOM   5530  C CE2   . TYR H 5 9   ? 142.938 141.626 130.682 1.00 160.34 ? 37  TYR H CE2   1 
ATOM   5531  C CZ    . TYR H 5 9   ? 142.305 140.601 130.034 1.00 160.34 ? 37  TYR H CZ    1 
ATOM   5532  O OH    . TYR H 5 9   ? 143.037 139.528 129.599 1.00 160.34 ? 37  TYR H OH    1 
ATOM   5533  N N     . VAL H 5 10  ? 140.223 147.065 130.823 1.00 153.40 ? 38  VAL H N     1 
ATOM   5534  C CA    . VAL H 5 10  ? 139.963 148.471 131.108 1.00 153.40 ? 38  VAL H CA    1 
ATOM   5535  C C     . VAL H 5 10  ? 139.158 149.094 129.983 1.00 153.40 ? 38  VAL H C     1 
ATOM   5536  O O     . VAL H 5 10  ? 138.206 149.845 130.225 1.00 153.40 ? 38  VAL H O     1 
ATOM   5537  C CB    . VAL H 5 10  ? 141.288 149.212 131.354 1.00 153.40 ? 38  VAL H CB    1 
ATOM   5538  C CG1   . VAL H 5 10  ? 141.090 150.700 131.358 1.00 153.40 ? 38  VAL H CG1   1 
ATOM   5539  C CG2   . VAL H 5 10  ? 141.836 148.807 132.689 1.00 153.40 ? 38  VAL H CG2   1 
ATOM   5540  N N     . TYR H 5 11  ? 139.479 148.739 128.740 1.00 158.54 ? 39  TYR H N     1 
ATOM   5541  C CA    . TYR H 5 11  ? 138.696 149.253 127.626 1.00 158.54 ? 39  TYR H CA    1 
ATOM   5542  C C     . TYR H 5 11  ? 137.276 148.704 127.630 1.00 158.54 ? 39  TYR H C     1 
ATOM   5543  O O     . TYR H 5 11  ? 136.337 149.419 127.264 1.00 158.54 ? 39  TYR H O     1 
ATOM   5544  C CB    . TYR H 5 11  ? 139.379 148.919 126.311 1.00 158.54 ? 39  TYR H CB    1 
ATOM   5545  C CG    . TYR H 5 11  ? 139.041 149.904 125.239 1.00 158.54 ? 39  TYR H CG    1 
ATOM   5546  C CD1   . TYR H 5 11  ? 139.800 151.047 125.066 1.00 158.54 ? 39  TYR H CD1   1 
ATOM   5547  C CD2   . TYR H 5 11  ? 137.940 149.716 124.426 1.00 158.54 ? 39  TYR H CD2   1 
ATOM   5548  C CE1   . TYR H 5 11  ? 139.490 151.961 124.088 1.00 158.54 ? 39  TYR H CE1   1 
ATOM   5549  C CE2   . TYR H 5 11  ? 137.618 150.624 123.451 1.00 158.54 ? 39  TYR H CE2   1 
ATOM   5550  C CZ    . TYR H 5 11  ? 138.393 151.747 123.287 1.00 158.54 ? 39  TYR H CZ    1 
ATOM   5551  O OH    . TYR H 5 11  ? 138.072 152.655 122.308 1.00 158.54 ? 39  TYR H OH    1 
ATOM   5552  N N     . LYS H 5 12  ? 137.100 147.464 128.084 1.00 151.86 ? 40  LYS H N     1 
ATOM   5553  C CA    . LYS H 5 12  ? 135.771 146.874 128.158 1.00 151.86 ? 40  LYS H CA    1 
ATOM   5554  C C     . LYS H 5 12  ? 134.914 147.564 129.202 1.00 151.86 ? 40  LYS H C     1 
ATOM   5555  O O     . LYS H 5 12  ? 133.751 147.884 128.938 1.00 151.86 ? 40  LYS H O     1 
ATOM   5556  C CB    . LYS H 5 12  ? 135.874 145.388 128.471 1.00 151.86 ? 40  LYS H CB    1 
ATOM   5557  C CG    . LYS H 5 12  ? 136.145 144.519 127.277 1.00 151.86 ? 40  LYS H CG    1 
ATOM   5558  C CD    . LYS H 5 12  ? 136.286 143.078 127.705 1.00 151.86 ? 40  LYS H CD    1 
ATOM   5559  C CE    . LYS H 5 12  ? 136.145 142.135 126.534 1.00 151.86 ? 40  LYS H CE    1 
ATOM   5560  N NZ    . LYS H 5 12  ? 136.153 140.721 126.991 1.00 151.86 ? 40  LYS H NZ    1 
ATOM   5561  N N     . VAL H 5 13  ? 135.468 147.820 130.388 1.00 149.33 ? 41  VAL H N     1 
ATOM   5562  C CA    . VAL H 5 13  ? 134.662 148.475 131.415 1.00 149.33 ? 41  VAL H CA    1 
ATOM   5563  C C     . VAL H 5 13  ? 134.472 149.946 131.083 1.00 149.33 ? 41  VAL H C     1 
ATOM   5564  O O     . VAL H 5 13  ? 133.490 150.564 131.504 1.00 149.33 ? 41  VAL H O     1 
ATOM   5565  C CB    . VAL H 5 13  ? 135.264 148.294 132.818 1.00 149.33 ? 41  VAL H CB    1 
ATOM   5566  C CG1   . VAL H 5 13  ? 135.159 146.866 133.249 1.00 149.33 ? 41  VAL H CG1   1 
ATOM   5567  C CG2   . VAL H 5 13  ? 136.682 148.760 132.874 1.00 149.33 ? 41  VAL H CG2   1 
ATOM   5568  N N     . LEU H 5 14  ? 135.389 150.524 130.308 1.00 156.98 ? 42  LEU H N     1 
ATOM   5569  C CA    . LEU H 5 14  ? 135.203 151.895 129.854 1.00 156.98 ? 42  LEU H CA    1 
ATOM   5570  C C     . LEU H 5 14  ? 134.049 151.992 128.871 1.00 156.98 ? 42  LEU H C     1 
ATOM   5571  O O     . LEU H 5 14  ? 133.200 152.881 128.992 1.00 156.98 ? 42  LEU H O     1 
ATOM   5572  C CB    . LEU H 5 14  ? 136.489 152.407 129.223 1.00 156.98 ? 42  LEU H CB    1 
ATOM   5573  C CG    . LEU H 5 14  ? 136.358 153.602 128.296 1.00 156.98 ? 42  LEU H CG    1 
ATOM   5574  C CD1   . LEU H 5 14  ? 136.102 154.851 129.096 1.00 156.98 ? 42  LEU H CD1   1 
ATOM   5575  C CD2   . LEU H 5 14  ? 137.620 153.739 127.496 1.00 156.98 ? 42  LEU H CD2   1 
ATOM   5576  N N     . LYS H 5 15  ? 133.990 151.076 127.904 1.00 160.44 ? 43  LYS H N     1 
ATOM   5577  C CA    . LYS H 5 15  ? 132.861 151.053 126.986 1.00 160.44 ? 43  LYS H CA    1 
ATOM   5578  C C     . LYS H 5 15  ? 131.570 150.646 127.676 1.00 160.44 ? 43  LYS H C     1 
ATOM   5579  O O     . LYS H 5 15  ? 130.494 151.051 127.231 1.00 160.44 ? 43  LYS H O     1 
ATOM   5580  C CB    . LYS H 5 15  ? 133.150 150.114 125.819 1.00 160.44 ? 43  LYS H CB    1 
ATOM   5581  C CG    . LYS H 5 15  ? 134.084 150.698 124.774 1.00 160.44 ? 43  LYS H CG    1 
ATOM   5582  C CD    . LYS H 5 15  ? 133.650 152.095 124.366 1.00 160.44 ? 43  LYS H CD    1 
ATOM   5583  C CE    . LYS H 5 15  ? 134.671 152.751 123.463 1.00 160.44 ? 43  LYS H CE    1 
ATOM   5584  N NZ    . LYS H 5 15  ? 134.897 151.944 122.243 1.00 160.44 ? 43  LYS H NZ    1 
ATOM   5585  N N     . GLN H 5 16  ? 131.653 149.866 128.754 1.00 157.30 ? 44  GLN H N     1 
ATOM   5586  C CA    . GLN H 5 16  ? 130.454 149.522 129.507 1.00 157.30 ? 44  GLN H CA    1 
ATOM   5587  C C     . GLN H 5 16  ? 129.921 150.724 130.271 1.00 157.30 ? 44  GLN H C     1 
ATOM   5588  O O     . GLN H 5 16  ? 128.710 150.968 130.287 1.00 157.30 ? 44  GLN H O     1 
ATOM   5589  C CB    . GLN H 5 16  ? 130.753 148.368 130.458 1.00 157.30 ? 44  GLN H CB    1 
ATOM   5590  C CG    . GLN H 5 16  ? 129.654 148.084 131.455 1.00 157.30 ? 44  GLN H CG    1 
ATOM   5591  C CD    . GLN H 5 16  ? 129.950 146.881 132.318 1.00 157.30 ? 44  GLN H CD    1 
ATOM   5592  O OE1   . GLN H 5 16  ? 130.069 145.762 131.822 1.00 157.30 ? 44  GLN H OE1   1 
ATOM   5593  N NE2   . GLN H 5 16  ? 130.069 147.102 133.619 1.00 157.30 ? 44  GLN H NE2   1 
ATOM   5594  N N     . VAL H 5 17  ? 130.809 151.495 130.899 1.00 155.99 ? 45  VAL H N     1 
ATOM   5595  C CA    . VAL H 5 17  ? 130.375 152.678 131.636 1.00 155.99 ? 45  VAL H CA    1 
ATOM   5596  C C     . VAL H 5 17  ? 129.945 153.774 130.671 1.00 155.99 ? 45  VAL H C     1 
ATOM   5597  O O     . VAL H 5 17  ? 128.806 154.252 130.714 1.00 155.99 ? 45  VAL H O     1 
ATOM   5598  C CB    . VAL H 5 17  ? 131.485 153.166 132.580 1.00 155.99 ? 45  VAL H CB    1 
ATOM   5599  C CG1   . VAL H 5 17  ? 131.145 154.533 133.129 1.00 155.99 ? 45  VAL H CG1   1 
ATOM   5600  C CG2   . VAL H 5 17  ? 131.653 152.194 133.715 1.00 155.99 ? 45  VAL H CG2   1 
ATOM   5601  N N     . HIS H 5 18  ? 130.841 154.182 129.785 1.00 161.26 ? 46  HIS H N     1 
ATOM   5602  C CA    . HIS H 5 18  ? 130.532 155.216 128.803 1.00 161.26 ? 46  HIS H CA    1 
ATOM   5603  C C     . HIS H 5 18  ? 130.650 154.630 127.409 1.00 161.26 ? 46  HIS H C     1 
ATOM   5604  O O     . HIS H 5 18  ? 131.770 154.314 126.965 1.00 161.26 ? 46  HIS H O     1 
ATOM   5605  C CB    . HIS H 5 18  ? 131.461 156.413 128.968 1.00 161.26 ? 46  HIS H CB    1 
ATOM   5606  C CG    . HIS H 5 18  ? 131.029 157.362 130.038 1.00 161.26 ? 46  HIS H CG    1 
ATOM   5607  N ND1   . HIS H 5 18  ? 131.765 157.581 131.181 1.00 161.26 ? 46  HIS H ND1   1 
ATOM   5608  C CD2   . HIS H 5 18  ? 129.930 158.145 130.142 1.00 161.26 ? 46  HIS H CD2   1 
ATOM   5609  C CE1   . HIS H 5 18  ? 131.143 158.464 131.940 1.00 161.26 ? 46  HIS H CE1   1 
ATOM   5610  N NE2   . HIS H 5 18  ? 130.026 158.821 131.333 1.00 161.26 ? 46  HIS H NE2   1 
ATOM   5611  N N     . PRO H 5 19  ? 129.545 154.473 126.680 1.00 164.23 ? 47  PRO H N     1 
ATOM   5612  C CA    . PRO H 5 19  ? 129.595 153.756 125.402 1.00 164.23 ? 47  PRO H CA    1 
ATOM   5613  C C     . PRO H 5 19  ? 130.271 154.517 124.278 1.00 164.23 ? 47  PRO H C     1 
ATOM   5614  O O     . PRO H 5 19  ? 130.653 153.893 123.281 1.00 164.23 ? 47  PRO H O     1 
ATOM   5615  C CB    . PRO H 5 19  ? 128.118 153.519 125.086 1.00 164.23 ? 47  PRO H CB    1 
ATOM   5616  C CG    . PRO H 5 19  ? 127.420 154.642 125.759 1.00 164.23 ? 47  PRO H CG    1 
ATOM   5617  C CD    . PRO H 5 19  ? 128.194 154.957 126.999 1.00 164.23 ? 47  PRO H CD    1 
ATOM   5618  N N     . ASP H 5 20  ? 130.430 155.834 124.394 1.00 162.00 ? 48  ASP H N     1 
ATOM   5619  C CA    . ASP H 5 20  ? 131.148 156.631 123.398 1.00 162.00 ? 48  ASP H CA    1 
ATOM   5620  C C     . ASP H 5 20  ? 132.165 157.490 124.137 1.00 162.00 ? 48  ASP H C     1 
ATOM   5621  O O     . ASP H 5 20  ? 131.926 158.663 124.424 1.00 162.00 ? 48  ASP H O     1 
ATOM   5622  C CB    . ASP H 5 20  ? 130.176 157.461 122.579 1.00 162.00 ? 48  ASP H CB    1 
ATOM   5623  C CG    . ASP H 5 20  ? 129.091 158.092 123.431 1.00 162.00 ? 48  ASP H CG    1 
ATOM   5624  O OD1   . ASP H 5 20  ? 129.093 157.865 124.660 1.00 162.00 ? 48  ASP H OD1   1 
ATOM   5625  O OD2   . ASP H 5 20  ? 128.235 158.807 122.876 1.00 162.00 ? 48  ASP H OD2   1 
ATOM   5626  N N     . THR H 5 21  ? 133.322 156.901 124.420 1.00 156.86 ? 49  THR H N     1 
ATOM   5627  C CA    . THR H 5 21  ? 134.381 157.593 125.145 1.00 156.86 ? 49  THR H CA    1 
ATOM   5628  C C     . THR H 5 21  ? 135.673 156.846 124.886 1.00 156.86 ? 49  THR H C     1 
ATOM   5629  O O     . THR H 5 21  ? 135.777 155.662 125.209 1.00 156.86 ? 49  THR H O     1 
ATOM   5630  C CB    . THR H 5 21  ? 134.092 157.656 126.644 1.00 156.86 ? 49  THR H CB    1 
ATOM   5631  O OG1   . THR H 5 21  ? 133.010 158.560 126.889 1.00 156.86 ? 49  THR H OG1   1 
ATOM   5632  C CG2   . THR H 5 21  ? 135.300 158.149 127.391 1.00 156.86 ? 49  THR H CG2   1 
ATOM   5633  N N     . GLY H 5 22  ? 136.646 157.522 124.296 1.00 155.37 ? 50  GLY H N     1 
ATOM   5634  C CA    . GLY H 5 22  ? 137.950 156.947 124.079 1.00 155.37 ? 50  GLY H CA    1 
ATOM   5635  C C     . GLY H 5 22  ? 138.839 157.123 125.288 1.00 155.37 ? 50  GLY H C     1 
ATOM   5636  O O     . GLY H 5 22  ? 138.423 157.596 126.345 1.00 155.37 ? 50  GLY H O     1 
ATOM   5637  N N     . ILE H 5 23  ? 140.103 156.750 125.109 1.00 155.07 ? 51  ILE H N     1 
ATOM   5638  C CA    . ILE H 5 23  ? 141.089 156.798 126.176 1.00 155.07 ? 51  ILE H CA    1 
ATOM   5639  C C     . ILE H 5 23  ? 142.451 156.820 125.503 1.00 155.07 ? 51  ILE H C     1 
ATOM   5640  O O     . ILE H 5 23  ? 142.611 156.325 124.387 1.00 155.07 ? 51  ILE H O     1 
ATOM   5641  C CB    . ILE H 5 23  ? 140.903 155.600 127.143 1.00 155.07 ? 51  ILE H CB    1 
ATOM   5642  C CG1   . ILE H 5 23  ? 141.699 155.777 128.431 1.00 155.07 ? 51  ILE H CG1   1 
ATOM   5643  C CG2   . ILE H 5 23  ? 141.220 154.289 126.464 1.00 155.07 ? 51  ILE H CG2   1 
ATOM   5644  C CD1   . ILE H 5 23  ? 141.458 154.688 129.431 1.00 155.07 ? 51  ILE H CD1   1 
ATOM   5645  N N     . SER H 5 24  ? 143.425 157.434 126.159 1.00 147.30 ? 52  SER H N     1 
ATOM   5646  C CA    . SER H 5 24  ? 144.703 157.689 125.512 1.00 147.30 ? 52  SER H CA    1 
ATOM   5647  C C     . SER H 5 24  ? 145.557 156.432 125.524 1.00 147.30 ? 52  SER H C     1 
ATOM   5648  O O     . SER H 5 24  ? 145.108 155.340 125.871 1.00 147.30 ? 52  SER H O     1 
ATOM   5649  C CB    . SER H 5 24  ? 145.449 158.812 126.210 1.00 147.30 ? 52  SER H CB    1 
ATOM   5650  O OG    . SER H 5 24  ? 146.287 158.264 127.211 1.00 147.30 ? 52  SER H OG    1 
ATOM   5651  N N     . SER H 5 25  ? 146.821 156.581 125.145 1.00 141.77 ? 53  SER H N     1 
ATOM   5652  C CA    . SER H 5 25  ? 147.789 155.528 125.411 1.00 141.77 ? 53  SER H CA    1 
ATOM   5653  C C     . SER H 5 25  ? 148.323 155.641 126.828 1.00 141.77 ? 53  SER H C     1 
ATOM   5654  O O     . SER H 5 25  ? 148.398 154.647 127.559 1.00 141.77 ? 53  SER H O     1 
ATOM   5655  C CB    . SER H 5 25  ? 148.939 155.595 124.415 1.00 141.77 ? 53  SER H CB    1 
ATOM   5656  O OG    . SER H 5 25  ? 150.094 154.990 124.966 1.00 141.77 ? 53  SER H OG    1 
ATOM   5657  N N     . LYS H 5 26  ? 148.694 156.851 127.232 1.00 144.20 ? 54  LYS H N     1 
ATOM   5658  C CA    . LYS H 5 26  ? 149.247 157.022 128.561 1.00 144.20 ? 54  LYS H CA    1 
ATOM   5659  C C     . LYS H 5 26  ? 148.197 156.890 129.647 1.00 144.20 ? 54  LYS H C     1 
ATOM   5660  O O     . LYS H 5 26  ? 148.533 156.460 130.750 1.00 144.20 ? 54  LYS H O     1 
ATOM   5661  C CB    . LYS H 5 26  ? 149.955 158.366 128.685 1.00 144.20 ? 54  LYS H CB    1 
ATOM   5662  C CG    . LYS H 5 26  ? 151.042 158.344 129.742 1.00 144.20 ? 54  LYS H CG    1 
ATOM   5663  C CD    . LYS H 5 26  ? 151.932 159.559 129.676 1.00 144.20 ? 54  LYS H CD    1 
ATOM   5664  C CE    . LYS H 5 26  ? 153.160 159.288 128.836 1.00 144.20 ? 54  LYS H CE    1 
ATOM   5665  N NZ    . LYS H 5 26  ? 154.054 160.473 128.808 1.00 144.20 ? 54  LYS H NZ    1 
ATOM   5666  N N     . ALA H 5 27  ? 146.934 157.201 129.360 1.00 146.71 ? 55  ALA H N     1 
ATOM   5667  C CA    . ALA H 5 27  ? 145.896 156.912 130.342 1.00 146.71 ? 55  ALA H CA    1 
ATOM   5668  C C     . ALA H 5 27  ? 145.695 155.418 130.498 1.00 146.71 ? 55  ALA H C     1 
ATOM   5669  O O     . ALA H 5 27  ? 145.382 154.947 131.596 1.00 146.71 ? 55  ALA H O     1 
ATOM   5670  C CB    . ALA H 5 27  ? 144.584 157.578 129.955 1.00 146.71 ? 55  ALA H CB    1 
ATOM   5671  N N     . MET H 5 28  ? 145.916 154.659 129.430 1.00 146.21 ? 56  MET H N     1 
ATOM   5672  C CA    . MET H 5 28  ? 145.871 153.211 129.541 1.00 146.21 ? 56  MET H CA    1 
ATOM   5673  C C     . MET H 5 28  ? 147.035 152.692 130.363 1.00 146.21 ? 56  MET H C     1 
ATOM   5674  O O     . MET H 5 28  ? 146.860 151.784 131.181 1.00 146.21 ? 56  MET H O     1 
ATOM   5675  C CB    . MET H 5 28  ? 145.869 152.576 128.158 1.00 146.21 ? 56  MET H CB    1 
ATOM   5676  C CG    . MET H 5 28  ? 145.652 151.090 128.185 1.00 146.21 ? 56  MET H CG    1 
ATOM   5677  S SD    . MET H 5 28  ? 144.183 150.653 129.128 1.00 146.21 ? 56  MET H SD    1 
ATOM   5678  C CE    . MET H 5 28  ? 142.910 151.422 128.141 1.00 146.21 ? 56  MET H CE    1 
ATOM   5679  N N     . SER H 5 29  ? 148.223 153.270 130.179 1.00 141.09 ? 57  SER H N     1 
ATOM   5680  C CA    . SER H 5 29  ? 149.356 152.881 131.014 1.00 141.09 ? 57  SER H CA    1 
ATOM   5681  C C     . SER H 5 29  ? 149.146 153.257 132.474 1.00 141.09 ? 57  SER H C     1 
ATOM   5682  O O     . SER H 5 29  ? 149.552 152.510 133.371 1.00 141.09 ? 57  SER H O     1 
ATOM   5683  C CB    . SER H 5 29  ? 150.637 153.519 130.506 1.00 141.09 ? 57  SER H CB    1 
ATOM   5684  O OG    . SER H 5 29  ? 151.580 153.594 131.556 1.00 141.09 ? 57  SER H OG    1 
ATOM   5685  N N     . ILE H 5 30  ? 148.479 154.381 132.727 1.00 141.71 ? 58  ILE H N     1 
ATOM   5686  C CA    . ILE H 5 30  ? 148.210 154.800 134.096 1.00 141.71 ? 58  ILE H CA    1 
ATOM   5687  C C     . ILE H 5 30  ? 147.201 153.872 134.753 1.00 141.71 ? 58  ILE H C     1 
ATOM   5688  O O     . ILE H 5 30  ? 147.394 153.443 135.895 1.00 141.71 ? 58  ILE H O     1 
ATOM   5689  C CB    . ILE H 5 30  ? 147.741 156.262 134.117 1.00 141.71 ? 58  ILE H CB    1 
ATOM   5690  C CG1   . ILE H 5 30  ? 148.935 157.178 133.926 1.00 141.71 ? 58  ILE H CG1   1 
ATOM   5691  C CG2   . ILE H 5 30  ? 147.071 156.602 135.418 1.00 141.71 ? 58  ILE H CG2   1 
ATOM   5692  C CD1   . ILE H 5 30  ? 148.597 158.622 133.923 1.00 141.71 ? 58  ILE H CD1   1 
ATOM   5693  N N     . MET H 5 31  ? 146.128 153.524 134.040 1.00 145.30 ? 59  MET H N     1 
ATOM   5694  C CA    . MET H 5 31  ? 145.146 152.607 134.605 1.00 145.30 ? 59  MET H CA    1 
ATOM   5695  C C     . MET H 5 31  ? 145.723 151.217 134.803 1.00 145.30 ? 59  MET H C     1 
ATOM   5696  O O     . MET H 5 31  ? 145.406 150.559 135.798 1.00 145.30 ? 59  MET H O     1 
ATOM   5697  C CB    . MET H 5 31  ? 143.914 152.530 133.717 1.00 145.30 ? 59  MET H CB    1 
ATOM   5698  C CG    . MET H 5 31  ? 143.011 153.724 133.846 1.00 145.30 ? 59  MET H CG    1 
ATOM   5699  S SD    . MET H 5 31  ? 142.955 154.344 135.529 1.00 145.30 ? 59  MET H SD    1 
ATOM   5700  C CE    . MET H 5 31  ? 141.842 153.171 136.277 1.00 145.30 ? 59  MET H CE    1 
ATOM   5701  N N     . ASN H 5 32  ? 146.598 150.779 133.899 1.00 149.71 ? 60  ASN H N     1 
ATOM   5702  C CA    . ASN H 5 32  ? 147.246 149.487 134.065 1.00 149.71 ? 60  ASN H CA    1 
ATOM   5703  C C     . ASN H 5 32  ? 148.163 149.475 135.280 1.00 149.71 ? 60  ASN H C     1 
ATOM   5704  O O     . ASN H 5 32  ? 148.152 148.514 136.061 1.00 149.71 ? 60  ASN H O     1 
ATOM   5705  C CB    . ASN H 5 32  ? 148.021 149.138 132.805 1.00 149.71 ? 60  ASN H CB    1 
ATOM   5706  C CG    . ASN H 5 32  ? 148.961 147.991 133.010 1.00 149.71 ? 60  ASN H CG    1 
ATOM   5707  O OD1   . ASN H 5 32  ? 148.579 146.943 133.524 1.00 149.71 ? 60  ASN H OD1   1 
ATOM   5708  N ND2   . ASN H 5 32  ? 150.206 148.176 132.609 1.00 149.71 ? 60  ASN H ND2   1 
ATOM   5709  N N     . SER H 5 33  ? 148.939 150.543 135.479 1.00 142.92 ? 61  SER H N     1 
ATOM   5710  C CA    . SER H 5 33  ? 149.802 150.600 136.653 1.00 142.92 ? 61  SER H CA    1 
ATOM   5711  C C     . SER H 5 33  ? 148.997 150.746 137.933 1.00 142.92 ? 61  SER H C     1 
ATOM   5712  O O     . SER H 5 33  ? 149.396 150.220 138.977 1.00 142.92 ? 61  SER H O     1 
ATOM   5713  C CB    . SER H 5 33  ? 150.797 151.744 136.515 1.00 142.92 ? 61  SER H CB    1 
ATOM   5714  O OG    . SER H 5 33  ? 151.351 151.766 135.213 1.00 142.92 ? 61  SER H OG    1 
ATOM   5715  N N     . PHE H 5 34  ? 147.849 151.413 137.859 1.00 138.65 ? 62  PHE H N     1 
ATOM   5716  C CA    . PHE H 5 34  ? 146.985 151.545 139.022 1.00 138.65 ? 62  PHE H CA    1 
ATOM   5717  C C     . PHE H 5 34  ? 146.414 150.201 139.439 1.00 138.65 ? 62  PHE H C     1 
ATOM   5718  O O     . PHE H 5 34  ? 146.388 149.875 140.631 1.00 138.65 ? 62  PHE H O     1 
ATOM   5719  C CB    . PHE H 5 34  ? 145.858 152.520 138.711 1.00 138.65 ? 62  PHE H CB    1 
ATOM   5720  C CG    . PHE H 5 34  ? 144.713 152.437 139.663 1.00 138.65 ? 62  PHE H CG    1 
ATOM   5721  C CD1   . PHE H 5 34  ? 144.818 152.988 140.919 1.00 138.65 ? 62  PHE H CD1   1 
ATOM   5722  C CD2   . PHE H 5 34  ? 143.526 151.830 139.297 1.00 138.65 ? 62  PHE H CD2   1 
ATOM   5723  C CE1   . PHE H 5 34  ? 143.770 152.930 141.798 1.00 138.65 ? 62  PHE H CE1   1 
ATOM   5724  C CE2   . PHE H 5 34  ? 142.481 151.756 140.176 1.00 138.65 ? 62  PHE H CE2   1 
ATOM   5725  C CZ    . PHE H 5 34  ? 142.606 152.302 141.432 1.00 138.65 ? 62  PHE H CZ    1 
ATOM   5726  N N     . VAL H 5 35  ? 145.934 149.424 138.468 1.00 136.15 ? 63  VAL H N     1 
ATOM   5727  C CA    . VAL H 5 35  ? 145.387 148.103 138.754 1.00 136.15 ? 63  VAL H CA    1 
ATOM   5728  C C     . VAL H 5 35  ? 146.469 147.178 139.291 1.00 136.15 ? 63  VAL H C     1 
ATOM   5729  O O     . VAL H 5 35  ? 146.231 146.418 140.239 1.00 136.15 ? 63  VAL H O     1 
ATOM   5730  C CB    . VAL H 5 35  ? 144.708 147.542 137.494 1.00 136.15 ? 63  VAL H CB    1 
ATOM   5731  C CG1   . VAL H 5 35  ? 144.378 146.089 137.646 1.00 136.15 ? 63  VAL H CG1   1 
ATOM   5732  C CG2   . VAL H 5 35  ? 143.440 148.303 137.228 1.00 136.15 ? 63  VAL H CG2   1 
ATOM   5733  N N     . ASN H 5 36  ? 147.682 147.267 138.731 1.00 138.56 ? 64  ASN H N     1 
ATOM   5734  C CA    . ASN H 5 36  ? 148.809 146.490 139.243 1.00 138.56 ? 64  ASN H CA    1 
ATOM   5735  C C     . ASN H 5 36  ? 149.112 146.827 140.693 1.00 138.56 ? 64  ASN H C     1 
ATOM   5736  O O     . ASN H 5 36  ? 149.289 145.925 141.519 1.00 138.56 ? 64  ASN H O     1 
ATOM   5737  C CB    . ASN H 5 36  ? 150.045 146.739 138.392 1.00 138.56 ? 64  ASN H CB    1 
ATOM   5738  C CG    . ASN H 5 36  ? 150.250 145.677 137.358 1.00 138.56 ? 64  ASN H CG    1 
ATOM   5739  O OD1   . ASN H 5 36  ? 149.428 144.779 137.208 1.00 138.56 ? 64  ASN H OD1   1 
ATOM   5740  N ND2   . ASN H 5 36  ? 151.352 145.766 136.632 1.00 138.56 ? 64  ASN H ND2   1 
ATOM   5741  N N     . ASP H 5 37  ? 149.117 148.118 141.028 1.00 145.16 ? 65  ASP H N     1 
ATOM   5742  C CA    . ASP H 5 37  ? 149.395 148.531 142.398 1.00 145.16 ? 65  ASP H CA    1 
ATOM   5743  C C     . ASP H 5 37  ? 148.313 148.086 143.367 1.00 145.16 ? 65  ASP H C     1 
ATOM   5744  O O     . ASP H 5 37  ? 148.623 147.614 144.467 1.00 145.16 ? 65  ASP H O     1 
ATOM   5745  C CB    . ASP H 5 37  ? 149.549 150.040 142.475 1.00 145.16 ? 65  ASP H CB    1 
ATOM   5746  C CG    . ASP H 5 37  ? 149.714 150.519 143.891 1.00 145.16 ? 65  ASP H CG    1 
ATOM   5747  O OD1   . ASP H 5 37  ? 150.792 150.291 144.475 1.00 145.16 ? 65  ASP H OD1   1 
ATOM   5748  O OD2   . ASP H 5 37  ? 148.755 151.110 144.426 1.00 145.16 ? 65  ASP H OD2   1 
ATOM   5749  N N     . VAL H 5 38  ? 147.046 148.228 142.982 1.00 136.55 ? 66  VAL H N     1 
ATOM   5750  C CA    . VAL H 5 38  ? 145.963 147.884 143.894 1.00 136.55 ? 66  VAL H CA    1 
ATOM   5751  C C     . VAL H 5 38  ? 145.908 146.383 144.127 1.00 136.55 ? 66  VAL H C     1 
ATOM   5752  O O     . VAL H 5 38  ? 145.772 145.925 145.270 1.00 136.55 ? 66  VAL H O     1 
ATOM   5753  C CB    . VAL H 5 38  ? 144.633 148.426 143.359 1.00 136.55 ? 66  VAL H CB    1 
ATOM   5754  C CG1   . VAL H 5 38  ? 143.475 147.873 144.140 1.00 136.55 ? 66  VAL H CG1   1 
ATOM   5755  C CG2   . VAL H 5 38  ? 144.636 149.907 143.468 1.00 136.55 ? 66  VAL H CG2   1 
ATOM   5756  N N     . PHE H 5 39  ? 146.048 145.597 143.056 1.00 139.83 ? 67  PHE H N     1 
ATOM   5757  C CA    . PHE H 5 39  ? 146.074 144.148 143.190 1.00 139.83 ? 67  PHE H CA    1 
ATOM   5758  C C     . PHE H 5 39  ? 147.261 143.692 144.022 1.00 139.83 ? 67  PHE H C     1 
ATOM   5759  O O     . PHE H 5 39  ? 147.127 142.781 144.846 1.00 139.83 ? 67  PHE H O     1 
ATOM   5760  C CB    . PHE H 5 39  ? 146.096 143.507 141.805 1.00 139.83 ? 67  PHE H CB    1 
ATOM   5761  C CG    . PHE H 5 39  ? 146.846 142.220 141.742 1.00 139.83 ? 67  PHE H CG    1 
ATOM   5762  C CD1   . PHE H 5 39  ? 146.287 141.056 142.226 1.00 139.83 ? 67  PHE H CD1   1 
ATOM   5763  C CD2   . PHE H 5 39  ? 148.107 142.168 141.175 1.00 139.83 ? 67  PHE H CD2   1 
ATOM   5764  C CE1   . PHE H 5 39  ? 146.974 139.874 142.172 1.00 139.83 ? 67  PHE H CE1   1 
ATOM   5765  C CE2   . PHE H 5 39  ? 148.799 140.987 141.119 1.00 139.83 ? 67  PHE H CE2   1 
ATOM   5766  C CZ    . PHE H 5 39  ? 148.231 139.838 141.614 1.00 139.83 ? 67  PHE H CZ    1 
ATOM   5767  N N     . GLU H 5 40  ? 148.421 144.329 143.839 1.00 144.10 ? 68  GLU H N     1 
ATOM   5768  C CA    . GLU H 5 40  ? 149.594 143.976 144.627 1.00 144.10 ? 68  GLU H CA    1 
ATOM   5769  C C     . GLU H 5 40  ? 149.390 144.292 146.101 1.00 144.10 ? 68  GLU H C     1 
ATOM   5770  O O     . GLU H 5 40  ? 149.754 143.488 146.967 1.00 144.10 ? 68  GLU H O     1 
ATOM   5771  C CB    . GLU H 5 40  ? 150.814 144.708 144.077 1.00 144.10 ? 68  GLU H CB    1 
ATOM   5772  C CG    . GLU H 5 40  ? 152.043 144.657 144.957 1.00 144.10 ? 68  GLU H CG    1 
ATOM   5773  C CD    . GLU H 5 40  ? 152.446 143.244 145.315 1.00 144.10 ? 68  GLU H CD    1 
ATOM   5774  O OE1   . GLU H 5 40  ? 152.653 142.974 146.515 1.00 144.10 ? 68  GLU H OE1   1 
ATOM   5775  O OE2   . GLU H 5 40  ? 152.550 142.403 144.400 1.00 144.10 ? 68  GLU H OE2   1 
ATOM   5776  N N     . ARG H 5 41  ? 148.759 145.426 146.399 1.00 140.27 ? 69  ARG H N     1 
ATOM   5777  C CA    . ARG H 5 41  ? 148.541 145.800 147.788 1.00 140.27 ? 69  ARG H CA    1 
ATOM   5778  C C     . ARG H 5 41  ? 147.547 144.865 148.462 1.00 140.27 ? 69  ARG H C     1 
ATOM   5779  O O     . ARG H 5 41  ? 147.777 144.426 149.597 1.00 140.27 ? 69  ARG H O     1 
ATOM   5780  C CB    . ARG H 5 41  ? 148.064 147.244 147.863 1.00 140.27 ? 69  ARG H CB    1 
ATOM   5781  C CG    . ARG H 5 41  ? 148.587 147.996 149.059 1.00 140.27 ? 69  ARG H CG    1 
ATOM   5782  C CD    . ARG H 5 41  ? 148.022 149.404 149.118 1.00 140.27 ? 69  ARG H CD    1 
ATOM   5783  N NE    . ARG H 5 41  ? 148.350 150.200 147.942 1.00 140.27 ? 69  ARG H NE    1 
ATOM   5784  C CZ    . ARG H 5 41  ? 147.736 151.334 147.619 1.00 140.27 ? 69  ARG H CZ    1 
ATOM   5785  N NH1   . ARG H 5 41  ? 146.759 151.799 148.381 1.00 140.27 ? 69  ARG H NH1   1 
ATOM   5786  N NH2   . ARG H 5 41  ? 148.095 152.002 146.534 1.00 140.27 ? 69  ARG H NH2   1 
ATOM   5787  N N     . ILE H 5 42  ? 146.478 144.490 147.754 1.00 131.07 ? 70  ILE H N     1 
ATOM   5788  C CA    . ILE H 5 42  ? 145.480 143.606 148.352 1.00 131.07 ? 70  ILE H CA    1 
ATOM   5789  C C     . ILE H 5 42  ? 146.034 142.197 148.519 1.00 131.07 ? 70  ILE H C     1 
ATOM   5790  O O     . ILE H 5 42  ? 145.794 141.543 149.543 1.00 131.07 ? 70  ILE H O     1 
ATOM   5791  C CB    . ILE H 5 42  ? 144.184 143.614 147.527 1.00 131.07 ? 70  ILE H CB    1 
ATOM   5792  C CG1   . ILE H 5 42  ? 143.605 145.016 147.482 1.00 131.07 ? 70  ILE H CG1   1 
ATOM   5793  C CG2   . ILE H 5 42  ? 143.142 142.732 148.157 1.00 131.07 ? 70  ILE H CG2   1 
ATOM   5794  C CD1   . ILE H 5 42  ? 142.401 145.138 146.600 1.00 131.07 ? 70  ILE H CD1   1 
ATOM   5795  N N     . ALA H 5 43  ? 146.815 141.720 147.549 1.00 137.03 ? 71  ALA H N     1 
ATOM   5796  C CA    . ALA H 5 43  ? 147.378 140.384 147.671 1.00 137.03 ? 71  ALA H CA    1 
ATOM   5797  C C     . ALA H 5 43  ? 148.422 140.311 148.772 1.00 137.03 ? 71  ALA H C     1 
ATOM   5798  O O     . ALA H 5 43  ? 148.464 139.320 149.511 1.00 137.03 ? 71  ALA H O     1 
ATOM   5799  C CB    . ALA H 5 43  ? 147.980 139.939 146.345 1.00 137.03 ? 71  ALA H CB    1 
ATOM   5800  N N     . GLY H 5 44  ? 149.242 141.353 148.924 1.00 139.46 ? 72  GLY H N     1 
ATOM   5801  C CA    . GLY H 5 44  ? 150.188 141.376 150.025 1.00 139.46 ? 72  GLY H CA    1 
ATOM   5802  C C     . GLY H 5 44  ? 149.503 141.436 151.375 1.00 139.46 ? 72  GLY H C     1 
ATOM   5803  O O     . GLY H 5 44  ? 149.940 140.786 152.333 1.00 139.46 ? 72  GLY H O     1 
ATOM   5804  N N     . GLU H 5 45  ? 148.395 142.175 151.460 1.00 142.38 ? 73  GLU H N     1 
ATOM   5805  C CA    . GLU H 5 45  ? 147.668 142.227 152.718 1.00 142.38 ? 73  GLU H CA    1 
ATOM   5806  C C     . GLU H 5 45  ? 147.011 140.901 153.054 1.00 142.38 ? 73  GLU H C     1 
ATOM   5807  O O     . GLU H 5 45  ? 146.998 140.500 154.221 1.00 142.38 ? 73  GLU H O     1 
ATOM   5808  C CB    . GLU H 5 45  ? 146.621 143.324 152.678 1.00 142.38 ? 73  GLU H CB    1 
ATOM   5809  C CG    . GLU H 5 45  ? 146.392 143.911 154.025 1.00 142.38 ? 73  GLU H CG    1 
ATOM   5810  C CD    . GLU H 5 45  ? 147.694 144.238 154.701 1.00 142.38 ? 73  GLU H CD    1 
ATOM   5811  O OE1   . GLU H 5 45  ? 148.430 145.098 154.175 1.00 142.38 ? 73  GLU H OE1   1 
ATOM   5812  O OE2   . GLU H 5 45  ? 147.991 143.630 155.748 1.00 142.38 ? 73  GLU H OE2   1 
ATOM   5813  N N     . ALA H 5 46  ? 146.487 140.195 152.054 1.00 138.81 ? 74  ALA H N     1 
ATOM   5814  C CA    . ALA H 5 46  ? 145.902 138.891 152.336 1.00 138.81 ? 74  ALA H CA    1 
ATOM   5815  C C     . ALA H 5 46  ? 146.967 137.873 152.704 1.00 138.81 ? 74  ALA H C     1 
ATOM   5816  O O     . ALA H 5 46  ? 146.712 136.989 153.529 1.00 138.81 ? 74  ALA H O     1 
ATOM   5817  C CB    . ALA H 5 46  ? 145.099 138.399 151.143 1.00 138.81 ? 74  ALA H CB    1 
ATOM   5818  N N     . SER H 5 47  ? 148.164 138.000 152.131 1.00 141.75 ? 75  SER H N     1 
ATOM   5819  C CA    . SER H 5 47  ? 149.262 137.133 152.533 1.00 141.75 ? 75  SER H CA    1 
ATOM   5820  C C     . SER H 5 47  ? 149.649 137.373 153.982 1.00 141.75 ? 75  SER H C     1 
ATOM   5821  O O     . SER H 5 47  ? 149.889 136.423 154.737 1.00 141.75 ? 75  SER H O     1 
ATOM   5822  C CB    . SER H 5 47  ? 150.465 137.364 151.633 1.00 141.75 ? 75  SER H CB    1 
ATOM   5823  O OG    . SER H 5 47  ? 151.263 138.403 152.160 1.00 141.75 ? 75  SER H OG    1 
ATOM   5824  N N     . ARG H 5 48  ? 149.691 138.638 154.397 1.00 147.97 ? 76  ARG H N     1 
ATOM   5825  C CA    . ARG H 5 48  ? 150.034 138.917 155.786 1.00 147.97 ? 76  ARG H CA    1 
ATOM   5826  C C     . ARG H 5 48  ? 148.927 138.492 156.739 1.00 147.97 ? 76  ARG H C     1 
ATOM   5827  O O     . ARG H 5 48  ? 149.218 138.066 157.859 1.00 147.97 ? 76  ARG H O     1 
ATOM   5828  C CB    . ARG H 5 48  ? 150.364 140.391 155.967 1.00 147.97 ? 76  ARG H CB    1 
ATOM   5829  C CG    . ARG H 5 48  ? 151.853 140.657 155.955 1.00 147.97 ? 76  ARG H CG    1 
ATOM   5830  C CD    . ARG H 5 48  ? 152.162 142.136 156.035 1.00 147.97 ? 76  ARG H CD    1 
ATOM   5831  N NE    . ARG H 5 48  ? 151.295 142.917 155.166 1.00 147.97 ? 76  ARG H NE    1 
ATOM   5832  C CZ    . ARG H 5 48  ? 151.512 143.108 153.871 1.00 147.97 ? 76  ARG H CZ    1 
ATOM   5833  N NH1   . ARG H 5 48  ? 152.575 142.574 153.287 1.00 147.97 ? 76  ARG H NH1   1 
ATOM   5834  N NH2   . ARG H 5 48  ? 150.665 143.837 153.161 1.00 147.97 ? 76  ARG H NH2   1 
ATOM   5835  N N     . LEU H 5 49  ? 147.668 138.553 156.303 1.00 146.06 ? 77  LEU H N     1 
ATOM   5836  C CA    . LEU H 5 49  ? 146.577 138.008 157.108 1.00 146.06 ? 77  LEU H CA    1 
ATOM   5837  C C     . LEU H 5 49  ? 146.704 136.500 157.277 1.00 146.06 ? 77  LEU H C     1 
ATOM   5838  O O     . LEU H 5 49  ? 146.493 135.964 158.374 1.00 146.06 ? 77  LEU H O     1 
ATOM   5839  C CB    . LEU H 5 49  ? 145.232 138.350 156.484 1.00 146.06 ? 77  LEU H CB    1 
ATOM   5840  C CG    . LEU H 5 49  ? 144.485 139.542 157.053 1.00 146.06 ? 77  LEU H CG    1 
ATOM   5841  C CD1   . LEU H 5 49  ? 144.145 139.209 158.474 1.00 146.06 ? 77  LEU H CD1   1 
ATOM   5842  C CD2   . LEU H 5 49  ? 145.293 140.802 156.999 1.00 146.06 ? 77  LEU H CD2   1 
ATOM   5843  N N     . ALA H 5 50  ? 147.048 135.797 156.196 1.00 148.89 ? 78  ALA H N     1 
ATOM   5844  C CA    . ALA H 5 50  ? 147.230 134.356 156.280 1.00 148.89 ? 78  ALA H CA    1 
ATOM   5845  C C     . ALA H 5 50  ? 148.417 133.978 157.145 1.00 148.89 ? 78  ALA H C     1 
ATOM   5846  O O     . ALA H 5 50  ? 148.385 132.929 157.793 1.00 148.89 ? 78  ALA H O     1 
ATOM   5847  C CB    . ALA H 5 50  ? 147.405 133.763 154.889 1.00 148.89 ? 78  ALA H CB    1 
ATOM   5848  N N     . HIS H 5 51  ? 149.453 134.810 157.182 1.00 154.54 ? 79  HIS H N     1 
ATOM   5849  C CA    . HIS H 5 51  ? 150.549 134.537 158.100 1.00 154.54 ? 79  HIS H CA    1 
ATOM   5850  C C     . HIS H 5 51  ? 150.162 134.836 159.539 1.00 154.54 ? 79  HIS H C     1 
ATOM   5851  O O     . HIS H 5 51  ? 150.632 134.162 160.458 1.00 154.54 ? 79  HIS H O     1 
ATOM   5852  C CB    . HIS H 5 51  ? 151.781 135.342 157.715 1.00 154.54 ? 79  HIS H CB    1 
ATOM   5853  C CG    . HIS H 5 51  ? 152.626 134.677 156.680 1.00 154.54 ? 79  HIS H CG    1 
ATOM   5854  N ND1   . HIS H 5 51  ? 153.624 135.336 155.995 1.00 154.54 ? 79  HIS H ND1   1 
ATOM   5855  C CD2   . HIS H 5 51  ? 152.618 133.409 156.206 1.00 154.54 ? 79  HIS H CD2   1 
ATOM   5856  C CE1   . HIS H 5 51  ? 154.195 134.502 155.145 1.00 154.54 ? 79  HIS H CE1   1 
ATOM   5857  N NE2   . HIS H 5 51  ? 153.603 133.327 155.253 1.00 154.54 ? 79  HIS H NE2   1 
ATOM   5858  N N     . TYR H 5 52  ? 149.316 135.840 159.756 1.00 152.53 ? 80  TYR H N     1 
ATOM   5859  C CA    . TYR H 5 52  ? 148.963 136.188 161.124 1.00 152.53 ? 80  TYR H CA    1 
ATOM   5860  C C     . TYR H 5 52  ? 148.018 135.175 161.736 1.00 152.53 ? 80  TYR H C     1 
ATOM   5861  O O     . TYR H 5 52  ? 148.110 134.897 162.933 1.00 152.53 ? 80  TYR H O     1 
ATOM   5862  C CB    . TYR H 5 52  ? 148.335 137.574 161.186 1.00 152.53 ? 80  TYR H CB    1 
ATOM   5863  C CG    . TYR H 5 52  ? 149.295 138.687 160.877 1.00 152.53 ? 80  TYR H CG    1 
ATOM   5864  C CD1   . TYR H 5 52  ? 150.662 138.508 161.013 1.00 152.53 ? 80  TYR H CD1   1 
ATOM   5865  C CD2   . TYR H 5 52  ? 148.834 139.914 160.437 1.00 152.53 ? 80  TYR H CD2   1 
ATOM   5866  C CE1   . TYR H 5 52  ? 151.543 139.522 160.721 1.00 152.53 ? 80  TYR H CE1   1 
ATOM   5867  C CE2   . TYR H 5 52  ? 149.706 140.936 160.148 1.00 152.53 ? 80  TYR H CE2   1 
ATOM   5868  C CZ    . TYR H 5 52  ? 151.059 140.735 160.294 1.00 152.53 ? 80  TYR H CZ    1 
ATOM   5869  O OH    . TYR H 5 52  ? 151.937 141.751 160.007 1.00 152.53 ? 80  TYR H OH    1 
ATOM   5870  N N     . ASN H 5 53  ? 147.113 134.608 160.949 1.00 151.06 ? 81  ASN H N     1 
ATOM   5871  C CA    . ASN H 5 53  ? 146.171 133.646 161.496 1.00 151.06 ? 81  ASN H CA    1 
ATOM   5872  C C     . ASN H 5 53  ? 146.680 132.219 161.425 1.00 151.06 ? 81  ASN H C     1 
ATOM   5873  O O     . ASN H 5 53  ? 145.869 131.289 161.495 1.00 151.06 ? 81  ASN H O     1 
ATOM   5874  C CB    . ASN H 5 53  ? 144.831 133.751 160.778 1.00 151.06 ? 81  ASN H CB    1 
ATOM   5875  C CG    . ASN H 5 53  ? 144.274 135.146 160.804 1.00 151.06 ? 81  ASN H CG    1 
ATOM   5876  O OD1   . ASN H 5 53  ? 143.600 135.535 161.753 1.00 151.06 ? 81  ASN H OD1   1 
ATOM   5877  N ND2   . ASN H 5 53  ? 144.555 135.916 159.762 1.00 151.06 ? 81  ASN H ND2   1 
ATOM   5878  N N     . LYS H 5 54  ? 147.988 132.031 161.237 1.00 150.45 ? 82  LYS H N     1 
ATOM   5879  C CA    . LYS H 5 54  ? 148.684 130.748 161.129 1.00 150.45 ? 82  LYS H CA    1 
ATOM   5880  C C     . LYS H 5 54  ? 148.209 129.892 159.962 1.00 150.45 ? 82  LYS H C     1 
ATOM   5881  O O     . LYS H 5 54  ? 148.525 128.702 159.910 1.00 150.45 ? 82  LYS H O     1 
ATOM   5882  C CB    . LYS H 5 54  ? 148.592 129.932 162.425 1.00 150.45 ? 82  LYS H CB    1 
ATOM   5883  C CG    . LYS H 5 54  ? 149.639 130.284 163.443 1.00 150.45 ? 82  LYS H CG    1 
ATOM   5884  C CD    . LYS H 5 54  ? 151.020 130.073 162.874 1.00 150.45 ? 82  LYS H CD    1 
ATOM   5885  C CE    . LYS H 5 54  ? 152.028 130.904 163.626 1.00 150.45 ? 82  LYS H CE    1 
ATOM   5886  N NZ    . LYS H 5 54  ? 151.542 132.299 163.793 1.00 150.45 ? 82  LYS H NZ    1 
ATOM   5887  N N     . ARG H 5 55  ? 147.473 130.460 159.017 1.00 161.68 ? 83  ARG H N     1 
ATOM   5888  C CA    . ARG H 5 55  ? 146.939 129.687 157.915 1.00 161.68 ? 83  ARG H CA    1 
ATOM   5889  C C     . ARG H 5 55  ? 147.992 129.531 156.829 1.00 161.68 ? 83  ARG H C     1 
ATOM   5890  O O     . ARG H 5 55  ? 149.140 129.953 156.971 1.00 161.68 ? 83  ARG H O     1 
ATOM   5891  C CB    . ARG H 5 55  ? 145.686 130.350 157.365 1.00 161.68 ? 83  ARG H CB    1 
ATOM   5892  C CG    . ARG H 5 55  ? 144.546 130.322 158.336 1.00 161.68 ? 83  ARG H CG    1 
ATOM   5893  C CD    . ARG H 5 55  ? 144.045 128.917 158.505 1.00 161.68 ? 83  ARG H CD    1 
ATOM   5894  N NE    . ARG H 5 55  ? 143.095 128.829 159.601 1.00 161.68 ? 83  ARG H NE    1 
ATOM   5895  C CZ    . ARG H 5 55  ? 143.438 128.531 160.846 1.00 161.68 ? 83  ARG H CZ    1 
ATOM   5896  N NH1   . ARG H 5 55  ? 144.706 128.289 161.140 1.00 161.68 ? 83  ARG H NH1   1 
ATOM   5897  N NH2   . ARG H 5 55  ? 142.517 128.471 161.795 1.00 161.68 ? 83  ARG H NH2   1 
ATOM   5898  N N     . SER H 5 56  ? 147.595 128.908 155.730 1.00 163.81 ? 84  SER H N     1 
ATOM   5899  C CA    . SER H 5 56  ? 148.483 128.767 154.592 1.00 163.81 ? 84  SER H CA    1 
ATOM   5900  C C     . SER H 5 56  ? 147.788 128.991 153.263 1.00 163.81 ? 84  SER H C     1 
ATOM   5901  O O     . SER H 5 56  ? 148.432 128.843 152.222 1.00 163.81 ? 84  SER H O     1 
ATOM   5902  C CB    . SER H 5 56  ? 149.126 127.383 154.593 1.00 163.81 ? 84  SER H CB    1 
ATOM   5903  O OG    . SER H 5 56  ? 148.140 126.391 154.402 1.00 163.81 ? 84  SER H OG    1 
ATOM   5904  N N     . THR H 5 57  ? 146.509 129.344 153.257 1.00 159.42 ? 85  THR H N     1 
ATOM   5905  C CA    . THR H 5 57  ? 145.775 129.543 152.024 1.00 159.42 ? 85  THR H CA    1 
ATOM   5906  C C     . THR H 5 57  ? 145.133 130.919 152.025 1.00 159.42 ? 85  THR H C     1 
ATOM   5907  O O     . THR H 5 57  ? 145.078 131.605 153.045 1.00 159.42 ? 85  THR H O     1 
ATOM   5908  C CB    . THR H 5 57  ? 144.710 128.465 151.824 1.00 159.42 ? 85  THR H CB    1 
ATOM   5909  O OG1   . THR H 5 57  ? 144.256 128.507 150.469 1.00 159.42 ? 85  THR H OG1   1 
ATOM   5910  C CG2   . THR H 5 57  ? 143.536 128.684 152.752 1.00 159.42 ? 85  THR H CG2   1 
ATOM   5911  N N     . ILE H 5 58  ? 144.651 131.324 150.862 1.00 145.16 ? 86  ILE H N     1 
ATOM   5912  C CA    . ILE H 5 58  ? 143.981 132.603 150.689 1.00 145.16 ? 86  ILE H CA    1 
ATOM   5913  C C     . ILE H 5 58  ? 142.588 132.308 150.154 1.00 145.16 ? 86  ILE H C     1 
ATOM   5914  O O     . ILE H 5 58  ? 142.419 132.031 148.965 1.00 145.16 ? 86  ILE H O     1 
ATOM   5915  C CB    . ILE H 5 58  ? 144.747 133.532 149.744 1.00 145.16 ? 86  ILE H CB    1 
ATOM   5916  C CG1   . ILE H 5 58  ? 146.164 133.757 150.245 1.00 145.16 ? 86  ILE H CG1   1 
ATOM   5917  C CG2   . ILE H 5 58  ? 144.042 134.851 149.627 1.00 145.16 ? 86  ILE H CG2   1 
ATOM   5918  C CD1   . ILE H 5 58  ? 146.970 134.663 149.369 1.00 145.16 ? 86  ILE H CD1   1 
ATOM   5919  N N     . THR H 5 59  ? 141.583 132.348 151.014 1.00 143.53 ? 87  THR H N     1 
ATOM   5920  C CA    . THR H 5 59  ? 140.228 132.249 150.510 1.00 143.53 ? 87  THR H CA    1 
ATOM   5921  C C     . THR H 5 59  ? 139.635 133.645 150.412 1.00 143.53 ? 87  THR H C     1 
ATOM   5922  O O     . THR H 5 59  ? 140.321 134.647 150.610 1.00 143.53 ? 87  THR H O     1 
ATOM   5923  C CB    . THR H 5 59  ? 139.368 131.338 151.380 1.00 143.53 ? 87  THR H CB    1 
ATOM   5924  O OG1   . THR H 5 59  ? 138.069 131.220 150.789 1.00 143.53 ? 87  THR H OG1   1 
ATOM   5925  C CG2   . THR H 5 59  ? 139.219 131.893 152.784 1.00 143.53 ? 87  THR H CG2   1 
ATOM   5926  N N     . SER H 5 60  ? 138.340 133.711 150.099 1.00 140.93 ? 88  SER H N     1 
ATOM   5927  C CA    . SER H 5 60  ? 137.674 134.989 149.898 1.00 140.93 ? 88  SER H CA    1 
ATOM   5928  C C     . SER H 5 60  ? 137.576 135.804 151.174 1.00 140.93 ? 88  SER H C     1 
ATOM   5929  O O     . SER H 5 60  ? 137.449 137.028 151.101 1.00 140.93 ? 88  SER H O     1 
ATOM   5930  C CB    . SER H 5 60  ? 136.272 134.777 149.347 1.00 140.93 ? 88  SER H CB    1 
ATOM   5931  O OG    . SER H 5 60  ? 135.346 134.672 150.410 1.00 140.93 ? 88  SER H OG    1 
ATOM   5932  N N     . ARG H 5 61  ? 137.647 135.156 152.332 1.00 144.11 ? 89  ARG H N     1 
ATOM   5933  C CA    . ARG H 5 61  ? 137.532 135.878 153.588 1.00 144.11 ? 89  ARG H CA    1 
ATOM   5934  C C     . ARG H 5 61  ? 138.740 136.765 153.844 1.00 144.11 ? 89  ARG H C     1 
ATOM   5935  O O     . ARG H 5 61  ? 138.584 137.898 154.322 1.00 144.11 ? 89  ARG H O     1 
ATOM   5936  C CB    . ARG H 5 61  ? 137.350 134.885 154.721 1.00 144.11 ? 89  ARG H CB    1 
ATOM   5937  C CG    . ARG H 5 61  ? 136.534 135.418 155.847 1.00 144.11 ? 89  ARG H CG    1 
ATOM   5938  C CD    . ARG H 5 61  ? 136.734 134.580 157.080 1.00 144.11 ? 89  ARG H CD    1 
ATOM   5939  N NE    . ARG H 5 61  ? 136.147 135.220 158.248 1.00 144.11 ? 89  ARG H NE    1 
ATOM   5940  C CZ    . ARG H 5 61  ? 136.454 134.904 159.497 1.00 144.11 ? 89  ARG H CZ    1 
ATOM   5941  N NH1   . ARG H 5 61  ? 137.343 133.951 159.736 1.00 144.11 ? 89  ARG H NH1   1 
ATOM   5942  N NH2   . ARG H 5 61  ? 135.874 135.542 160.502 1.00 144.11 ? 89  ARG H NH2   1 
ATOM   5943  N N     . GLU H 5 62  ? 139.940 136.291 153.498 1.00 146.10 ? 90  GLU H N     1 
ATOM   5944  C CA    . GLU H 5 62  ? 141.141 137.080 153.739 1.00 146.10 ? 90  GLU H CA    1 
ATOM   5945  C C     . GLU H 5 62  ? 141.189 138.307 152.851 1.00 146.10 ? 90  GLU H C     1 
ATOM   5946  O O     . GLU H 5 62  ? 141.504 139.403 153.322 1.00 146.10 ? 90  GLU H O     1 
ATOM   5947  C CB    . GLU H 5 62  ? 142.385 136.239 153.521 1.00 146.10 ? 90  GLU H CB    1 
ATOM   5948  C CG    . GLU H 5 62  ? 142.615 135.233 154.604 1.00 146.10 ? 90  GLU H CG    1 
ATOM   5949  C CD    . GLU H 5 62  ? 142.224 133.856 154.164 1.00 146.10 ? 90  GLU H CD    1 
ATOM   5950  O OE1   . GLU H 5 62  ? 141.912 133.708 152.968 1.00 146.10 ? 90  GLU H OE1   1 
ATOM   5951  O OE2   . GLU H 5 62  ? 142.226 132.927 155.000 1.00 146.10 ? 90  GLU H OE2   1 
ATOM   5952  N N     . ILE H 5 63  ? 140.857 138.161 151.571 1.00 138.45 ? 91  ILE H N     1 
ATOM   5953  C CA    . ILE H 5 63  ? 140.855 139.340 150.722 1.00 138.45 ? 91  ILE H CA    1 
ATOM   5954  C C     . ILE H 5 63  ? 139.665 140.236 150.998 1.00 138.45 ? 91  ILE H C     1 
ATOM   5955  O O     . ILE H 5 63  ? 139.755 141.444 150.761 1.00 138.45 ? 91  ILE H O     1 
ATOM   5956  C CB    . ILE H 5 63  ? 140.869 138.981 149.237 1.00 138.45 ? 91  ILE H CB    1 
ATOM   5957  C CG1   . ILE H 5 63  ? 139.901 137.856 148.998 1.00 138.45 ? 91  ILE H CG1   1 
ATOM   5958  C CG2   . ILE H 5 63  ? 142.250 138.580 148.798 1.00 138.45 ? 91  ILE H CG2   1 
ATOM   5959  C CD1   . ILE H 5 63  ? 139.834 137.509 147.605 1.00 138.45 ? 91  ILE H CD1   1 
ATOM   5960  N N     . GLN H 5 64  ? 138.561 139.695 151.516 1.00 137.22 ? 92  GLN H N     1 
ATOM   5961  C CA    . GLN H 5 64  ? 137.466 140.564 151.921 1.00 137.22 ? 92  GLN H CA    1 
ATOM   5962  C C     . GLN H 5 64  ? 137.873 141.434 153.098 1.00 137.22 ? 92  GLN H C     1 
ATOM   5963  O O     . GLN H 5 64  ? 137.595 142.638 153.112 1.00 137.22 ? 92  GLN H O     1 
ATOM   5964  C CB    . GLN H 5 64  ? 136.236 139.743 152.263 1.00 137.22 ? 92  GLN H CB    1 
ATOM   5965  C CG    . GLN H 5 64  ? 135.126 140.568 152.835 1.00 137.22 ? 92  GLN H CG    1 
ATOM   5966  C CD    . GLN H 5 64  ? 133.960 139.735 153.264 1.00 137.22 ? 92  GLN H CD    1 
ATOM   5967  O OE1   . GLN H 5 64  ? 133.301 139.102 152.443 1.00 137.22 ? 92  GLN H OE1   1 
ATOM   5968  N NE2   . GLN H 5 64  ? 133.689 139.725 154.560 1.00 137.22 ? 92  GLN H NE2   1 
ATOM   5969  N N     . THR H 5 65  ? 138.596 140.872 154.057 1.00 138.70 ? 93  THR H N     1 
ATOM   5970  C CA    . THR H 5 65  ? 139.075 141.735 155.124 1.00 138.70 ? 93  THR H CA    1 
ATOM   5971  C C     . THR H 5 65  ? 140.232 142.618 154.685 1.00 138.70 ? 93  THR H C     1 
ATOM   5972  O O     . THR H 5 65  ? 140.412 143.696 155.256 1.00 138.70 ? 93  THR H O     1 
ATOM   5973  C CB    . THR H 5 65  ? 139.468 140.919 156.344 1.00 138.70 ? 93  THR H CB    1 
ATOM   5974  O OG1   . THR H 5 65  ? 140.471 139.971 155.983 1.00 138.70 ? 93  THR H OG1   1 
ATOM   5975  C CG2   . THR H 5 65  ? 138.256 140.194 156.854 1.00 138.70 ? 93  THR H CG2   1 
ATOM   5976  N N     . ALA H 5 66  ? 140.985 142.225 153.658 1.00 134.29 ? 94  ALA H N     1 
ATOM   5977  C CA    . ALA H 5 66  ? 141.999 143.130 153.130 1.00 134.29 ? 94  ALA H CA    1 
ATOM   5978  C C     . ALA H 5 66  ? 141.367 144.322 152.429 1.00 134.29 ? 94  ALA H C     1 
ATOM   5979  O O     . ALA H 5 66  ? 141.906 145.432 152.481 1.00 134.29 ? 94  ALA H O     1 
ATOM   5980  C CB    . ALA H 5 66  ? 142.925 142.384 152.179 1.00 134.29 ? 94  ALA H CB    1 
ATOM   5981  N N     . VAL H 5 67  ? 140.218 144.113 151.790 1.00 132.43 ? 95  VAL H N     1 
ATOM   5982  C CA    . VAL H 5 67  ? 139.464 145.218 151.211 1.00 132.43 ? 95  VAL H CA    1 
ATOM   5983  C C     . VAL H 5 67  ? 138.846 146.071 152.311 1.00 132.43 ? 95  VAL H C     1 
ATOM   5984  O O     . VAL H 5 67  ? 138.782 147.302 152.199 1.00 132.43 ? 95  VAL H O     1 
ATOM   5985  C CB    . VAL H 5 67  ? 138.416 144.656 150.234 1.00 132.43 ? 95  VAL H CB    1 
ATOM   5986  C CG1   . VAL H 5 67  ? 137.355 145.672 149.875 1.00 132.43 ? 95  VAL H CG1   1 
ATOM   5987  C CG2   . VAL H 5 67  ? 139.105 144.172 148.985 1.00 132.43 ? 95  VAL H CG2   1 
ATOM   5988  N N     . ARG H 5 68  ? 138.422 145.435 153.406 1.00 133.44 ? 96  ARG H N     1 
ATOM   5989  C CA    . ARG H 5 68  ? 137.951 146.174 154.574 1.00 133.44 ? 96  ARG H CA    1 
ATOM   5990  C C     . ARG H 5 68  ? 139.044 147.060 155.154 1.00 133.44 ? 96  ARG H C     1 
ATOM   5991  O O     . ARG H 5 68  ? 138.775 148.172 155.616 1.00 133.44 ? 96  ARG H O     1 
ATOM   5992  C CB    . ARG H 5 68  ? 137.462 145.203 155.640 1.00 133.44 ? 96  ARG H CB    1 
ATOM   5993  C CG    . ARG H 5 68  ? 136.137 144.584 155.352 1.00 133.44 ? 96  ARG H CG    1 
ATOM   5994  C CD    . ARG H 5 68  ? 135.024 145.530 155.690 1.00 133.44 ? 96  ARG H CD    1 
ATOM   5995  N NE    . ARG H 5 68  ? 133.733 144.989 155.291 1.00 133.44 ? 96  ARG H NE    1 
ATOM   5996  C CZ    . ARG H 5 68  ? 133.011 144.164 156.037 1.00 133.44 ? 96  ARG H CZ    1 
ATOM   5997  N NH1   . ARG H 5 68  ? 133.455 143.785 157.224 1.00 133.44 ? 96  ARG H NH1   1 
ATOM   5998  N NH2   . ARG H 5 68  ? 131.844 143.720 155.596 1.00 133.44 ? 96  ARG H NH2   1 
ATOM   5999  N N     . LEU H 5 69  ? 140.284 146.583 155.128 1.00 133.43 ? 97  LEU H N     1 
ATOM   6000  C CA    . LEU H 5 69  ? 141.388 147.372 155.656 1.00 133.43 ? 97  LEU H CA    1 
ATOM   6001  C C     . LEU H 5 69  ? 141.762 148.506 154.714 1.00 133.43 ? 97  LEU H C     1 
ATOM   6002  O O     . LEU H 5 69  ? 141.837 149.667 155.128 1.00 133.43 ? 97  LEU H O     1 
ATOM   6003  C CB    . LEU H 5 69  ? 142.598 146.481 155.902 1.00 133.43 ? 97  LEU H CB    1 
ATOM   6004  C CG    . LEU H 5 69  ? 142.547 145.502 157.065 1.00 133.43 ? 97  LEU H CG    1 
ATOM   6005  C CD1   . LEU H 5 69  ? 143.948 145.058 157.399 1.00 133.43 ? 97  LEU H CD1   1 
ATOM   6006  C CD2   . LEU H 5 69  ? 141.904 146.133 158.264 1.00 133.43 ? 97  LEU H CD2   1 
ATOM   6007  N N     . LEU H 5 70  ? 141.996 148.185 153.441 1.00 139.86 ? 98  LEU H N     1 
ATOM   6008  C CA    . LEU H 5 70  ? 142.668 149.117 152.543 1.00 139.86 ? 98  LEU H CA    1 
ATOM   6009  C C     . LEU H 5 70  ? 141.780 150.276 152.120 1.00 139.86 ? 98  LEU H C     1 
ATOM   6010  O O     . LEU H 5 70  ? 142.287 151.371 151.857 1.00 139.86 ? 98  LEU H O     1 
ATOM   6011  C CB    . LEU H 5 70  ? 143.161 148.380 151.308 1.00 139.86 ? 98  LEU H CB    1 
ATOM   6012  C CG    . LEU H 5 70  ? 144.651 148.079 151.267 1.00 139.86 ? 98  LEU H CG    1 
ATOM   6013  C CD1   . LEU H 5 70  ? 145.042 147.161 152.397 1.00 139.86 ? 98  LEU H CD1   1 
ATOM   6014  C CD2   . LEU H 5 70  ? 144.981 147.446 149.945 1.00 139.86 ? 98  LEU H CD2   1 
ATOM   6015  N N     . LEU H 5 71  ? 140.517 150.075 152.056 1.00 140.96 ? 99  LEU H N     1 
ATOM   6016  C CA    . LEU H 5 71  ? 139.752 151.153 151.459 1.00 140.96 ? 99  LEU H CA    1 
ATOM   6017  C C     . LEU H 5 71  ? 139.079 152.001 152.527 1.00 140.96 ? 99  LEU H C     1 
ATOM   6018  O O     . LEU H 5 71  ? 138.790 151.517 153.622 1.00 140.96 ? 99  LEU H O     1 
ATOM   6019  C CB    . LEU H 5 71  ? 138.678 150.604 150.519 1.00 140.96 ? 99  LEU H CB    1 
ATOM   6020  C CG    . LEU H 5 71  ? 139.021 149.519 149.504 1.00 140.96 ? 99  LEU H CG    1 
ATOM   6021  C CD1   . LEU H 5 71  ? 137.872 149.413 148.538 1.00 140.96 ? 99  LEU H CD1   1 
ATOM   6022  C CD2   . LEU H 5 71  ? 140.301 149.802 148.749 1.00 140.96 ? 99  LEU H CD2   1 
ATOM   6023  N N     . PRO H 5 72  ? 138.811 153.270 152.235 1.00 146.56 ? 100 PRO H N     1 
ATOM   6024  C CA    . PRO H 5 72  ? 137.927 154.057 153.103 1.00 146.56 ? 100 PRO H CA    1 
ATOM   6025  C C     . PRO H 5 72  ? 136.480 153.600 153.020 1.00 146.56 ? 100 PRO H C     1 
ATOM   6026  O O     . PRO H 5 72  ? 136.148 152.758 152.183 1.00 146.56 ? 100 PRO H O     1 
ATOM   6027  C CB    . PRO H 5 72  ? 138.094 155.482 152.570 1.00 146.56 ? 100 PRO H CB    1 
ATOM   6028  C CG    . PRO H 5 72  ? 138.615 155.310 151.191 1.00 146.56 ? 100 PRO H CG    1 
ATOM   6029  C CD    . PRO H 5 72  ? 139.496 154.118 151.250 1.00 146.56 ? 100 PRO H CD    1 
ATOM   6030  N N     . GLY H 5 73  ? 135.613 154.202 153.835 1.00 149.46 ? 101 GLY H N     1 
ATOM   6031  C CA    . GLY H 5 73  ? 134.313 153.659 154.197 1.00 149.46 ? 101 GLY H CA    1 
ATOM   6032  C C     . GLY H 5 73  ? 133.345 153.191 153.127 1.00 149.46 ? 101 GLY H C     1 
ATOM   6033  O O     . GLY H 5 73  ? 133.119 151.982 152.993 1.00 149.46 ? 101 GLY H O     1 
ATOM   6034  N N     . GLU H 5 74  ? 132.783 154.113 152.344 1.00 156.28 ? 102 GLU H N     1 
ATOM   6035  C CA    . GLU H 5 74  ? 131.760 153.703 151.391 1.00 156.28 ? 102 GLU H CA    1 
ATOM   6036  C C     . GLU H 5 74  ? 132.360 152.951 150.217 1.00 156.28 ? 102 GLU H C     1 
ATOM   6037  O O     . GLU H 5 74  ? 131.700 152.078 149.637 1.00 156.28 ? 102 GLU H O     1 
ATOM   6038  C CB    . GLU H 5 74  ? 130.974 154.908 150.895 1.00 156.28 ? 102 GLU H CB    1 
ATOM   6039  C CG    . GLU H 5 74  ? 129.596 154.539 150.395 1.00 156.28 ? 102 GLU H CG    1 
ATOM   6040  C CD    . GLU H 5 74  ? 128.834 155.723 149.847 1.00 156.28 ? 102 GLU H CD    1 
ATOM   6041  O OE1   . GLU H 5 74  ? 129.233 156.872 150.126 1.00 156.28 ? 102 GLU H OE1   1 
ATOM   6042  O OE2   . GLU H 5 74  ? 127.833 155.504 149.136 1.00 156.28 ? 102 GLU H OE2   1 
ATOM   6043  N N     . LEU H 5 75  ? 133.614 153.248 149.886 1.00 150.31 ? 103 LEU H N     1 
ATOM   6044  C CA    . LEU H 5 75  ? 134.309 152.489 148.858 1.00 150.31 ? 103 LEU H CA    1 
ATOM   6045  C C     . LEU H 5 75  ? 134.524 151.049 149.292 1.00 150.31 ? 103 LEU H C     1 
ATOM   6046  O O     . LEU H 5 75  ? 134.323 150.121 148.498 1.00 150.31 ? 103 LEU H O     1 
ATOM   6047  C CB    . LEU H 5 75  ? 135.639 153.158 148.538 1.00 150.31 ? 103 LEU H CB    1 
ATOM   6048  C CG    . LEU H 5 75  ? 136.197 152.879 147.151 1.00 150.31 ? 103 LEU H CG    1 
ATOM   6049  C CD1   . LEU H 5 75  ? 135.149 153.168 146.104 1.00 150.31 ? 103 LEU H CD1   1 
ATOM   6050  C CD2   . LEU H 5 75  ? 137.417 153.733 146.927 1.00 150.31 ? 103 LEU H CD2   1 
ATOM   6051  N N     . ALA H 5 76  ? 134.891 150.844 150.558 1.00 149.39 ? 104 ALA H N     1 
ATOM   6052  C CA    . ALA H 5 76  ? 135.038 149.491 151.079 1.00 149.39 ? 104 ALA H CA    1 
ATOM   6053  C C     . ALA H 5 76  ? 133.705 148.765 151.116 1.00 149.39 ? 104 ALA H C     1 
ATOM   6054  O O     . ALA H 5 76  ? 133.638 147.580 150.779 1.00 149.39 ? 104 ALA H O     1 
ATOM   6055  C CB    . ALA H 5 76  ? 135.656 149.519 152.473 1.00 149.39 ? 104 ALA H CB    1 
ATOM   6056  N N     . LYS H 5 77  ? 132.636 149.470 151.493 1.00 148.10 ? 105 LYS H N     1 
ATOM   6057  C CA    . LYS H 5 77  ? 131.315 148.851 151.555 1.00 148.10 ? 105 LYS H CA    1 
ATOM   6058  C C     . LYS H 5 77  ? 130.843 148.391 150.184 1.00 148.10 ? 105 LYS H C     1 
ATOM   6059  O O     . LYS H 5 77  ? 130.361 147.260 150.027 1.00 148.10 ? 105 LYS H O     1 
ATOM   6060  C CB    . LYS H 5 77  ? 130.319 149.837 152.141 1.00 148.10 ? 105 LYS H CB    1 
ATOM   6061  C CG    . LYS H 5 77  ? 128.927 149.296 152.290 1.00 148.10 ? 105 LYS H CG    1 
ATOM   6062  C CD    . LYS H 5 77  ? 128.018 150.388 152.807 1.00 148.10 ? 105 LYS H CD    1 
ATOM   6063  C CE    . LYS H 5 77  ? 128.420 150.795 154.211 1.00 148.10 ? 105 LYS H CE    1 
ATOM   6064  N NZ    . LYS H 5 77  ? 127.537 151.856 154.749 1.00 148.10 ? 105 LYS H NZ    1 
ATOM   6065  N N     . HIS H 5 78  ? 131.018 149.232 149.170 1.00 154.19 ? 106 HIS H N     1 
ATOM   6066  C CA    . HIS H 5 78  ? 130.561 148.852 147.843 1.00 154.19 ? 106 HIS H CA    1 
ATOM   6067  C C     . HIS H 5 78  ? 131.460 147.811 147.192 1.00 154.19 ? 106 HIS H C     1 
ATOM   6068  O O     . HIS H 5 78  ? 130.962 146.959 146.446 1.00 154.19 ? 106 HIS H O     1 
ATOM   6069  C CB    . HIS H 5 78  ? 130.442 150.087 146.969 1.00 154.19 ? 106 HIS H CB    1 
ATOM   6070  C CG    . HIS H 5 78  ? 129.242 150.912 147.285 1.00 154.19 ? 106 HIS H CG    1 
ATOM   6071  N ND1   . HIS H 5 78  ? 128.878 152.015 146.546 1.00 154.19 ? 106 HIS H ND1   1 
ATOM   6072  C CD2   . HIS H 5 78  ? 128.317 150.791 148.264 1.00 154.19 ? 106 HIS H CD2   1 
ATOM   6073  C CE1   . HIS H 5 78  ? 127.778 152.539 147.057 1.00 154.19 ? 106 HIS H CE1   1 
ATOM   6074  N NE2   . HIS H 5 78  ? 127.418 151.815 148.101 1.00 154.19 ? 106 HIS H NE2   1 
ATOM   6075  N N     . ALA H 5 79  ? 132.764 147.833 147.480 1.00 146.94 ? 107 ALA H N     1 
ATOM   6076  C CA    . ALA H 5 79  ? 133.630 146.777 146.973 1.00 146.94 ? 107 ALA H CA    1 
ATOM   6077  C C     . ALA H 5 79  ? 133.310 145.432 147.610 1.00 146.94 ? 107 ALA H C     1 
ATOM   6078  O O     . ALA H 5 79  ? 133.341 144.407 146.921 1.00 146.94 ? 107 ALA H O     1 
ATOM   6079  C CB    . ALA H 5 79  ? 135.092 147.138 147.202 1.00 146.94 ? 107 ALA H CB    1 
ATOM   6080  N N     . VAL H 5 80  ? 132.976 145.419 148.904 1.00 145.00 ? 108 VAL H N     1 
ATOM   6081  C CA    . VAL H 5 80  ? 132.567 144.182 149.562 1.00 145.00 ? 108 VAL H CA    1 
ATOM   6082  C C     . VAL H 5 80  ? 131.257 143.666 148.981 1.00 145.00 ? 108 VAL H C     1 
ATOM   6083  O O     . VAL H 5 80  ? 131.107 142.459 148.742 1.00 145.00 ? 108 VAL H O     1 
ATOM   6084  C CB    . VAL H 5 80  ? 132.487 144.401 151.083 1.00 145.00 ? 108 VAL H CB    1 
ATOM   6085  C CG1   . VAL H 5 80  ? 131.751 143.281 151.770 1.00 145.00 ? 108 VAL H CG1   1 
ATOM   6086  C CG2   . VAL H 5 80  ? 133.875 144.454 151.646 1.00 145.00 ? 108 VAL H CG2   1 
ATOM   6087  N N     . SER H 5 81  ? 130.310 144.571 148.701 1.00 150.11 ? 109 SER H N     1 
ATOM   6088  C CA    . SER H 5 81  ? 129.050 144.153 148.085 1.00 150.11 ? 109 SER H CA    1 
ATOM   6089  C C     . SER H 5 81  ? 129.267 143.570 146.694 1.00 150.11 ? 109 SER H C     1 
ATOM   6090  O O     . SER H 5 81  ? 128.677 142.536 146.348 1.00 150.11 ? 109 SER H O     1 
ATOM   6091  C CB    . SER H 5 81  ? 128.081 145.325 148.009 1.00 150.11 ? 109 SER H CB    1 
ATOM   6092  O OG    . SER H 5 81  ? 127.128 145.094 146.989 1.00 150.11 ? 109 SER H OG    1 
ATOM   6093  N N     . GLU H 5 82  ? 130.144 144.193 145.906 1.00 148.32 ? 110 GLU H N     1 
ATOM   6094  C CA    . GLU H 5 82  ? 130.443 143.687 144.572 1.00 148.32 ? 110 GLU H CA    1 
ATOM   6095  C C     . GLU H 5 82  ? 131.131 142.330 144.626 1.00 148.32 ? 110 GLU H C     1 
ATOM   6096  O O     . GLU H 5 82  ? 130.790 141.424 143.853 1.00 148.32 ? 110 GLU H O     1 
ATOM   6097  C CB    . GLU H 5 82  ? 131.308 144.692 143.822 1.00 148.32 ? 110 GLU H CB    1 
ATOM   6098  C CG    . GLU H 5 82  ? 131.776 144.214 142.467 1.00 148.32 ? 110 GLU H CG    1 
ATOM   6099  C CD    . GLU H 5 82  ? 130.642 144.102 141.472 1.00 148.32 ? 110 GLU H CD    1 
ATOM   6100  O OE1   . GLU H 5 82  ? 129.696 144.911 141.555 1.00 148.32 ? 110 GLU H OE1   1 
ATOM   6101  O OE2   . GLU H 5 82  ? 130.694 143.209 140.602 1.00 148.32 ? 110 GLU H OE2   1 
ATOM   6102  N N     . GLY H 5 83  ? 132.068 142.156 145.557 1.00 143.32 ? 111 GLY H N     1 
ATOM   6103  C CA    . GLY H 5 83  ? 132.772 140.889 145.650 1.00 143.32 ? 111 GLY H CA    1 
ATOM   6104  C C     . GLY H 5 83  ? 131.877 139.749 146.098 1.00 143.32 ? 111 GLY H C     1 
ATOM   6105  O O     . GLY H 5 83  ? 131.956 138.639 145.563 1.00 143.32 ? 111 GLY H O     1 
ATOM   6106  N N     . THR H 5 84  ? 131.020 140.004 147.088 1.00 142.97 ? 112 THR H N     1 
ATOM   6107  C CA    . THR H 5 84  ? 130.110 138.961 147.545 1.00 142.97 ? 112 THR H CA    1 
ATOM   6108  C C     . THR H 5 84  ? 129.085 138.606 146.483 1.00 142.97 ? 112 THR H C     1 
ATOM   6109  O O     . THR H 5 84  ? 128.754 137.424 146.323 1.00 142.97 ? 112 THR H O     1 
ATOM   6110  C CB    . THR H 5 84  ? 129.400 139.392 148.820 1.00 142.97 ? 112 THR H CB    1 
ATOM   6111  O OG1   . THR H 5 84  ? 128.798 140.674 148.618 1.00 142.97 ? 112 THR H OG1   1 
ATOM   6112  C CG2   . THR H 5 84  ? 130.382 139.472 149.966 1.00 142.97 ? 112 THR H CG2   1 
ATOM   6113  N N     . LYS H 5 85  ? 128.602 139.601 145.731 1.00 148.10 ? 113 LYS H N     1 
ATOM   6114  C CA    . LYS H 5 85  ? 127.685 139.316 144.634 1.00 148.10 ? 113 LYS H CA    1 
ATOM   6115  C C     . LYS H 5 85  ? 128.355 138.471 143.558 1.00 148.10 ? 113 LYS H C     1 
ATOM   6116  O O     . LYS H 5 85  ? 127.759 137.508 143.054 1.00 148.10 ? 113 LYS H O     1 
ATOM   6117  C CB    . LYS H 5 85  ? 127.162 140.624 144.051 1.00 148.10 ? 113 LYS H CB    1 
ATOM   6118  C CG    . LYS H 5 85  ? 126.273 140.456 142.845 1.00 148.10 ? 113 LYS H CG    1 
ATOM   6119  C CD    . LYS H 5 85  ? 126.481 141.588 141.860 1.00 148.10 ? 113 LYS H CD    1 
ATOM   6120  C CE    . LYS H 5 85  ? 127.866 141.529 141.248 1.00 148.10 ? 113 LYS H CE    1 
ATOM   6121  N NZ    . LYS H 5 85  ? 128.071 142.583 140.223 1.00 148.10 ? 113 LYS H NZ    1 
ATOM   6122  N N     . ALA H 5 86  ? 129.619 138.767 143.248 1.00 145.12 ? 114 ALA H N     1 
ATOM   6123  C CA    . ALA H 5 86  ? 130.310 138.017 142.205 1.00 145.12 ? 114 ALA H CA    1 
ATOM   6124  C C     . ALA H 5 86  ? 130.621 136.593 142.640 1.00 145.12 ? 114 ALA H C     1 
ATOM   6125  O O     . ALA H 5 86  ? 130.508 135.661 141.839 1.00 145.12 ? 114 ALA H O     1 
ATOM   6126  C CB    . ALA H 5 86  ? 131.589 138.730 141.804 1.00 145.12 ? 114 ALA H CB    1 
ATOM   6127  N N     . VAL H 5 87  ? 130.998 136.391 143.904 1.00 142.00 ? 115 VAL H N     1 
ATOM   6128  C CA    . VAL H 5 87  ? 131.295 135.028 144.332 1.00 142.00 ? 115 VAL H CA    1 
ATOM   6129  C C     . VAL H 5 87  ? 130.020 134.211 144.514 1.00 142.00 ? 115 VAL H C     1 
ATOM   6130  O O     . VAL H 5 87  ? 130.046 132.994 144.299 1.00 142.00 ? 115 VAL H O     1 
ATOM   6131  C CB    . VAL H 5 87  ? 132.173 135.026 145.598 1.00 142.00 ? 115 VAL H CB    1 
ATOM   6132  C CG1   . VAL H 5 87  ? 131.410 135.478 146.829 1.00 142.00 ? 115 VAL H CG1   1 
ATOM   6133  C CG2   . VAL H 5 87  ? 132.816 133.678 145.818 1.00 142.00 ? 115 VAL H CG2   1 
ATOM   6134  N N     . THR H 5 88  ? 128.883 134.844 144.824 1.00 149.45 ? 116 THR H N     1 
ATOM   6135  C CA    . THR H 5 88  ? 127.634 134.093 144.823 1.00 149.45 ? 116 THR H CA    1 
ATOM   6136  C C     . THR H 5 88  ? 127.220 133.721 143.412 1.00 149.45 ? 116 THR H C     1 
ATOM   6137  O O     . THR H 5 88  ? 126.680 132.630 143.198 1.00 149.45 ? 116 THR H O     1 
ATOM   6138  C CB    . THR H 5 88  ? 126.522 134.891 145.488 1.00 149.45 ? 116 THR H CB    1 
ATOM   6139  O OG1   . THR H 5 88  ? 126.541 136.231 144.991 1.00 149.45 ? 116 THR H OG1   1 
ATOM   6140  C CG2   . THR H 5 88  ? 126.705 134.902 146.991 1.00 149.45 ? 116 THR H CG2   1 
ATOM   6141  N N     . LYS H 5 89  ? 127.469 134.608 142.448 1.00 150.24 ? 117 LYS H N     1 
ATOM   6142  C CA    . LYS H 5 89  ? 127.253 134.266 141.048 1.00 150.24 ? 117 LYS H CA    1 
ATOM   6143  C C     . LYS H 5 89  ? 128.145 133.111 140.603 1.00 150.24 ? 117 LYS H C     1 
ATOM   6144  O O     . LYS H 5 89  ? 127.690 132.221 139.876 1.00 150.24 ? 117 LYS H O     1 
ATOM   6145  C CB    . LYS H 5 89  ? 127.494 135.503 140.186 1.00 150.24 ? 117 LYS H CB    1 
ATOM   6146  C CG    . LYS H 5 89  ? 127.736 135.237 138.712 1.00 150.24 ? 117 LYS H CG    1 
ATOM   6147  C CD    . LYS H 5 89  ? 126.482 134.761 138.012 1.00 150.24 ? 117 LYS H CD    1 
ATOM   6148  C CE    . LYS H 5 89  ? 126.723 134.598 136.530 1.00 150.24 ? 117 LYS H CE    1 
ATOM   6149  N NZ    . LYS H 5 89  ? 127.109 135.892 135.916 1.00 150.24 ? 117 LYS H NZ    1 
ATOM   6150  N N     . TYR H 5 90  ? 129.398 133.092 141.053 1.00 148.66 ? 118 TYR H N     1 
ATOM   6151  C CA    . TYR H 5 90  ? 130.329 132.045 140.644 1.00 148.66 ? 118 TYR H CA    1 
ATOM   6152  C C     . TYR H 5 90  ? 129.993 130.708 141.279 1.00 148.66 ? 118 TYR H C     1 
ATOM   6153  O O     . TYR H 5 90  ? 130.080 129.670 140.619 1.00 148.66 ? 118 TYR H O     1 
ATOM   6154  C CB    . TYR H 5 90  ? 131.751 132.447 141.010 1.00 148.66 ? 118 TYR H CB    1 
ATOM   6155  C CG    . TYR H 5 90  ? 132.806 131.456 140.609 1.00 148.66 ? 118 TYR H CG    1 
ATOM   6156  C CD1   . TYR H 5 90  ? 133.249 131.386 139.305 1.00 148.66 ? 118 TYR H CD1   1 
ATOM   6157  C CD2   . TYR H 5 90  ? 133.384 130.612 141.542 1.00 148.66 ? 118 TYR H CD2   1 
ATOM   6158  C CE1   . TYR H 5 90  ? 134.229 130.491 138.931 1.00 148.66 ? 118 TYR H CE1   1 
ATOM   6159  C CE2   . TYR H 5 90  ? 134.364 129.715 141.179 1.00 148.66 ? 118 TYR H CE2   1 
ATOM   6160  C CZ    . TYR H 5 90  ? 134.781 129.659 139.871 1.00 148.66 ? 118 TYR H CZ    1 
ATOM   6161  O OH    . TYR H 5 90  ? 135.753 128.766 139.499 1.00 148.66 ? 118 TYR H OH    1 
ATOM   6162  N N     . THR H 5 91  ? 129.620 130.716 142.558 1.00 153.95 ? 119 THR H N     1 
ATOM   6163  C CA    . THR H 5 91  ? 129.306 129.472 143.251 1.00 153.95 ? 119 THR H CA    1 
ATOM   6164  C C     . THR H 5 91  ? 127.974 128.904 142.787 1.00 153.95 ? 119 THR H C     1 
ATOM   6165  O O     . THR H 5 91  ? 127.875 127.708 142.489 1.00 153.95 ? 119 THR H O     1 
ATOM   6166  C CB    . THR H 5 91  ? 129.298 129.711 144.759 1.00 153.95 ? 119 THR H CB    1 
ATOM   6167  O OG1   . THR H 5 91  ? 130.631 129.986 145.199 1.00 153.95 ? 119 THR H OG1   1 
ATOM   6168  C CG2   . THR H 5 91  ? 128.778 128.501 145.503 1.00 153.95 ? 119 THR H CG2   1 
ATOM   6169  N N     . SER H 5 92  ? 126.945 129.750 142.690 1.00 161.98 ? 120 SER H N     1 
ATOM   6170  C CA    . SER H 5 92  ? 125.633 129.288 142.255 1.00 161.98 ? 120 SER H CA    1 
ATOM   6171  C C     . SER H 5 92  ? 125.617 128.853 140.797 1.00 161.98 ? 120 SER H C     1 
ATOM   6172  O O     . SER H 5 92  ? 124.730 128.091 140.401 1.00 161.98 ? 120 SER H O     1 
ATOM   6173  C CB    . SER H 5 92  ? 124.599 130.389 142.471 1.00 161.98 ? 120 SER H CB    1 
ATOM   6174  O OG    . SER H 5 92  ? 125.038 131.607 141.894 1.00 161.98 ? 120 SER H OG    1 
ATOM   6175  N N     . ALA H 5 93  ? 126.569 129.311 139.997 1.00 161.16 ? 121 ALA H N     1 
ATOM   6176  C CA    . ALA H 5 93  ? 126.682 128.861 138.622 1.00 161.16 ? 121 ALA H CA    1 
ATOM   6177  C C     . ALA H 5 93  ? 128.053 128.239 138.395 1.00 161.16 ? 121 ALA H C     1 
ATOM   6178  O O     . ALA H 5 93  ? 128.590 127.572 139.277 1.00 161.16 ? 121 ALA H O     1 
ATOM   6179  C CB    . ALA H 5 93  ? 126.446 130.012 137.662 1.00 161.16 ? 121 ALA H CB    1 
ATOM   6180  O "O5'" . DC  I 6 1   ? 165.518 201.527 185.104 1.00 305.56 ? 0   DC  J "O5'" 1 
ATOM   6181  C "C5'" . DC  I 6 1   ? 166.302 201.372 183.923 1.00 305.56 ? 0   DC  J "C5'" 1 
ATOM   6182  C "C4'" . DC  I 6 1   ? 167.787 201.397 184.244 1.00 305.56 ? 0   DC  J "C4'" 1 
ATOM   6183  O "O4'" . DC  I 6 1   ? 168.022 202.242 185.407 1.00 305.56 ? 0   DC  J "O4'" 1 
ATOM   6184  C "C3'" . DC  I 6 1   ? 168.398 200.045 184.602 1.00 305.56 ? 0   DC  J "C3'" 1 
ATOM   6185  O "O3'" . DC  I 6 1   ? 169.774 200.027 184.207 1.00 305.56 ? 0   DC  J "O3'" 1 
ATOM   6186  C "C2'" . DC  I 6 1   ? 168.252 200.042 186.112 1.00 305.56 ? 0   DC  J "C2'" 1 
ATOM   6187  C "C1'" . DC  I 6 1   ? 168.639 201.473 186.417 1.00 305.56 ? 0   DC  J "C1'" 1 
ATOM   6188  N N1    . DC  I 6 1   ? 168.176 201.955 187.739 1.00 305.56 ? 0   DC  J N1    1 
ATOM   6189  C C2    . DC  I 6 1   ? 168.996 201.788 188.858 1.00 305.56 ? 0   DC  J C2    1 
ATOM   6190  O O2    . DC  I 6 1   ? 170.084 201.223 188.723 1.00 305.56 ? 0   DC  J O2    1 
ATOM   6191  N N3    . DC  I 6 1   ? 168.564 202.240 190.058 1.00 305.56 ? 0   DC  J N3    1 
ATOM   6192  C C4    . DC  I 6 1   ? 167.380 202.842 190.156 1.00 305.56 ? 0   DC  J C4    1 
ATOM   6193  N N4    . DC  I 6 1   ? 166.995 203.275 191.358 1.00 305.56 ? 0   DC  J N4    1 
ATOM   6194  C C5    . DC  I 6 1   ? 166.533 203.026 189.025 1.00 305.56 ? 0   DC  J C5    1 
ATOM   6195  C C6    . DC  I 6 1   ? 166.968 202.572 187.848 1.00 305.56 ? 0   DC  J C6    1 
ATOM   6196  P P     . DT  I 6 2   ? 170.756 198.825 184.634 1.00 302.74 ? 1   DT  J P     1 
ATOM   6197  O OP1   . DT  I 6 2   ? 171.864 198.811 183.655 1.00 302.74 ? 1   DT  J OP1   1 
ATOM   6198  O OP2   . DT  I 6 2   ? 169.956 197.594 184.827 1.00 302.74 ? 1   DT  J OP2   1 
ATOM   6199  O "O5'" . DT  I 6 2   ? 171.353 199.295 186.047 1.00 302.74 ? 1   DT  J "O5'" 1 
ATOM   6200  C "C5'" . DT  I 6 2   ? 172.670 198.947 186.417 1.00 302.74 ? 1   DT  J "C5'" 1 
ATOM   6201  C "C4'" . DT  I 6 2   ? 172.671 197.967 187.575 1.00 302.74 ? 1   DT  J "C4'" 1 
ATOM   6202  O "O4'" . DT  I 6 2   ? 171.903 198.499 188.686 1.00 302.74 ? 1   DT  J "O4'" 1 
ATOM   6203  C "C3'" . DT  I 6 2   ? 172.066 196.595 187.274 1.00 302.74 ? 1   DT  J "C3'" 1 
ATOM   6204  O "O3'" . DT  I 6 2   ? 172.858 195.610 187.888 1.00 302.74 ? 1   DT  J "O3'" 1 
ATOM   6205  C "C2'" . DT  I 6 2   ? 170.693 196.682 187.939 1.00 302.74 ? 1   DT  J "C2'" 1 
ATOM   6206  C "C1'" . DT  I 6 2   ? 171.060 197.482 189.168 1.00 302.74 ? 1   DT  J "C1'" 1 
ATOM   6207  N N1    . DT  I 6 2   ? 169.920 198.108 189.877 1.00 302.74 ? 1   DT  J N1    1 
ATOM   6208  C C2    . DT  I 6 2   ? 170.095 198.477 191.178 1.00 302.74 ? 1   DT  J C2    1 
ATOM   6209  O O2    . DT  I 6 2   ? 171.134 198.296 191.785 1.00 302.74 ? 1   DT  J O2    1 
ATOM   6210  N N3    . DT  I 6 2   ? 169.009 199.054 191.760 1.00 302.74 ? 1   DT  J N3    1 
ATOM   6211  C C4    . DT  I 6 2   ? 167.786 199.304 191.186 1.00 302.74 ? 1   DT  J C4    1 
ATOM   6212  O O4    . DT  I 6 2   ? 166.871 199.835 191.803 1.00 302.74 ? 1   DT  J O4    1 
ATOM   6213  C C5    . DT  I 6 2   ? 167.659 198.900 189.814 1.00 302.74 ? 1   DT  J C5    1 
ATOM   6214  C C7    . DT  I 6 2   ? 166.366 199.125 189.091 1.00 302.74 ? 1   DT  J C7    1 
ATOM   6215  C C6    . DT  I 6 2   ? 168.724 198.325 189.224 1.00 302.74 ? 1   DT  J C6    1 
ATOM   6216  P P     . DG  I 6 3   ? 173.704 194.569 187.010 1.00 292.42 ? 2   DG  J P     1 
ATOM   6217  O OP1   . DG  I 6 3   ? 174.436 195.334 185.976 1.00 292.42 ? 2   DG  J OP1   1 
ATOM   6218  O OP2   . DG  I 6 3   ? 172.777 193.487 186.617 1.00 292.42 ? 2   DG  J OP2   1 
ATOM   6219  O "O5'" . DG  I 6 3   ? 174.750 193.957 188.054 1.00 292.42 ? 2   DG  J "O5'" 1 
ATOM   6220  C "C5'" . DG  I 6 3   ? 175.430 194.816 188.966 1.00 292.42 ? 2   DG  J "C5'" 1 
ATOM   6221  C "C4'" . DG  I 6 3   ? 175.973 194.045 190.165 1.00 292.42 ? 2   DG  J "C4'" 1 
ATOM   6222  O "O4'" . DG  I 6 3   ? 175.169 194.321 191.327 1.00 292.42 ? 2   DG  J "O4'" 1 
ATOM   6223  C "C3'" . DG  I 6 3   ? 175.984 192.528 190.029 1.00 292.42 ? 2   DG  J "C3'" 1 
ATOM   6224  O "O3'" . DG  I 6 3   ? 177.205 191.887 190.607 1.00 292.42 ? 2   DG  J "O3'" 1 
ATOM   6225  C "C2'" . DG  I 6 3   ? 174.680 192.072 190.685 1.00 292.42 ? 2   DG  J "C2'" 1 
ATOM   6226  C "C1'" . DG  I 6 3   ? 174.268 193.259 191.563 1.00 292.42 ? 2   DG  J "C1'" 1 
ATOM   6227  N N9    . DG  I 6 3   ? 172.925 193.732 191.282 1.00 292.42 ? 2   DG  J N9    1 
ATOM   6228  C C8    . DG  I 6 3   ? 172.252 193.622 190.097 1.00 292.42 ? 2   DG  J C8    1 
ATOM   6229  N N7    . DG  I 6 3   ? 171.065 194.152 190.123 1.00 292.42 ? 2   DG  J N7    1 
ATOM   6230  C C5    . DG  I 6 3   ? 170.940 194.638 191.414 1.00 292.42 ? 2   DG  J C5    1 
ATOM   6231  C C6    . DG  I 6 3   ? 169.863 195.306 192.029 1.00 292.42 ? 2   DG  J C6    1 
ATOM   6232  O O6    . DG  I 6 3   ? 168.773 195.618 191.534 1.00 292.42 ? 2   DG  J O6    1 
ATOM   6233  N N1    . DG  I 6 3   ? 170.144 195.627 193.349 1.00 292.42 ? 2   DG  J N1    1 
ATOM   6234  C C2    . DG  I 6 3   ? 171.318 195.330 193.996 1.00 292.42 ? 2   DG  J C2    1 
ATOM   6235  N N2    . DG  I 6 3   ? 171.409 195.717 195.273 1.00 292.42 ? 2   DG  J N2    1 
ATOM   6236  N N3    . DG  I 6 3   ? 172.336 194.701 193.430 1.00 292.42 ? 2   DG  J N3    1 
ATOM   6237  C C4    . DG  I 6 3   ? 172.077 194.387 192.141 1.00 292.42 ? 2   DG  J C4    1 
ATOM   6238  P P     . DG  I 6 4   ? 177.795 192.132 192.100 1.00 277.64 ? 3   DG  J P     1 
ATOM   6239  O OP1   . DG  I 6 4   ? 178.180 193.528 192.397 1.00 277.64 ? 3   DG  J OP1   1 
ATOM   6240  O OP2   . DG  I 6 4   ? 178.856 191.112 192.195 1.00 277.64 ? 3   DG  J OP2   1 
ATOM   6241  O "O5'" . DG  I 6 4   ? 176.656 191.664 193.120 1.00 277.64 ? 3   DG  J "O5'" 1 
ATOM   6242  C "C5'" . DG  I 6 4   ? 176.558 192.267 194.409 1.00 277.64 ? 3   DG  J "C5'" 1 
ATOM   6243  C "C4'" . DG  I 6 4   ? 175.473 191.611 195.252 1.00 277.64 ? 3   DG  J "C4'" 1 
ATOM   6244  O "O4'" . DG  I 6 4   ? 174.161 192.015 194.783 1.00 277.64 ? 3   DG  J "O4'" 1 
ATOM   6245  C "C3'" . DG  I 6 4   ? 175.460 190.071 195.244 1.00 277.64 ? 3   DG  J "C3'" 1 
ATOM   6246  O "O3'" . DG  I 6 4   ? 175.143 189.574 196.547 1.00 277.64 ? 3   DG  J "O3'" 1 
ATOM   6247  C "C2'" . DG  I 6 4   ? 174.306 189.773 194.289 1.00 277.64 ? 3   DG  J "C2'" 1 
ATOM   6248  C "C1'" . DG  I 6 4   ? 173.361 190.866 194.735 1.00 277.64 ? 3   DG  J "C1'" 1 
ATOM   6249  N N9    . DG  I 6 4   ? 172.218 191.105 193.869 1.00 277.64 ? 3   DG  J N9    1 
ATOM   6250  C C8    . DG  I 6 4   ? 172.080 190.790 192.544 1.00 277.64 ? 3   DG  J C8    1 
ATOM   6251  N N7    . DG  I 6 4   ? 170.938 191.161 192.041 1.00 277.64 ? 3   DG  J N7    1 
ATOM   6252  C C5    . DG  I 6 4   ? 170.269 191.729 193.113 1.00 277.64 ? 3   DG  J C5    1 
ATOM   6253  C C6    . DG  I 6 4   ? 168.980 192.295 193.189 1.00 277.64 ? 3   DG  J C6    1 
ATOM   6254  O O6    . DG  I 6 4   ? 168.137 192.415 192.293 1.00 277.64 ? 3   DG  J O6    1 
ATOM   6255  N N1    . DG  I 6 4   ? 168.701 192.757 194.465 1.00 277.64 ? 3   DG  J N1    1 
ATOM   6256  C C2    . DG  I 6 4   ? 169.556 192.677 195.533 1.00 277.64 ? 3   DG  J C2    1 
ATOM   6257  N N2    . DG  I 6 4   ? 169.113 193.175 196.689 1.00 277.64 ? 3   DG  J N2    1 
ATOM   6258  N N3    . DG  I 6 4   ? 170.761 192.149 195.475 1.00 277.64 ? 3   DG  J N3    1 
ATOM   6259  C C4    . DG  I 6 4   ? 171.049 191.700 194.239 1.00 277.64 ? 3   DG  J C4    1 
ATOM   6260  P P     . DA  I 6 5   ? 176.157 189.690 197.791 1.00 256.09 ? 4   DA  J P     1 
ATOM   6261  O OP1   . DA  I 6 5   ? 177.477 190.205 197.370 1.00 256.09 ? 4   DA  J OP1   1 
ATOM   6262  O OP2   . DA  I 6 5   ? 176.099 188.392 198.491 1.00 256.09 ? 4   DA  J OP2   1 
ATOM   6263  O "O5'" . DA  I 6 5   ? 175.438 190.747 198.747 1.00 256.09 ? 4   DA  J "O5'" 1 
ATOM   6264  C "C5'" . DA  I 6 5   ? 174.036 190.959 198.624 1.00 256.09 ? 4   DA  J "C5'" 1 
ATOM   6265  C "C4'" . DA  I 6 5   ? 173.315 190.680 199.930 1.00 256.09 ? 4   DA  J "C4'" 1 
ATOM   6266  O "O4'" . DA  I 6 5   ? 171.929 190.385 199.667 1.00 256.09 ? 4   DA  J "O4'" 1 
ATOM   6267  C "C3'" . DA  I 6 5   ? 173.793 189.469 200.690 1.00 256.09 ? 4   DA  J "C3'" 1 
ATOM   6268  O "O3'" . DA  I 6 5   ? 173.363 189.594 202.040 1.00 256.09 ? 4   DA  J "O3'" 1 
ATOM   6269  C "C2'" . DA  I 6 5   ? 173.074 188.331 199.955 1.00 256.09 ? 4   DA  J "C2'" 1 
ATOM   6270  C "C1'" . DA  I 6 5   ? 171.774 188.989 199.488 1.00 256.09 ? 4   DA  J "C1'" 1 
ATOM   6271  N N9    . DA  I 6 5   ? 171.488 188.771 198.083 1.00 256.09 ? 4   DA  J N9    1 
ATOM   6272  C C8    . DA  I 6 5   ? 172.344 188.307 197.131 1.00 256.09 ? 4   DA  J C8    1 
ATOM   6273  N N7    . DA  I 6 5   ? 171.817 188.244 195.938 1.00 256.09 ? 4   DA  J N7    1 
ATOM   6274  C C5    . DA  I 6 5   ? 170.548 188.744 196.112 1.00 256.09 ? 4   DA  J C5    1 
ATOM   6275  C C6    . DA  I 6 5   ? 169.483 188.936 195.224 1.00 256.09 ? 4   DA  J C6    1 
ATOM   6276  N N6    . DA  I 6 5   ? 169.560 188.662 193.922 1.00 256.09 ? 4   DA  J N6    1 
ATOM   6277  N N1    . DA  I 6 5   ? 168.331 189.425 195.727 1.00 256.09 ? 4   DA  J N1    1 
ATOM   6278  C C2    . DA  I 6 5   ? 168.261 189.697 197.034 1.00 256.09 ? 4   DA  J C2    1 
ATOM   6279  N N3    . DA  I 6 5   ? 169.197 189.549 197.965 1.00 256.09 ? 4   DA  J N3    1 
ATOM   6280  C C4    . DA  I 6 5   ? 170.323 189.062 197.432 1.00 256.09 ? 4   DA  J C4    1 
ATOM   6281  P P     . DG  I 6 6   ? 173.565 188.409 203.106 1.00 241.15 ? 5   DG  J P     1 
ATOM   6282  O OP1   . DG  I 6 6   ? 173.681 189.053 204.432 1.00 241.15 ? 5   DG  J OP1   1 
ATOM   6283  O OP2   . DG  I 6 6   ? 174.633 187.492 202.651 1.00 241.15 ? 5   DG  J OP2   1 
ATOM   6284  O "O5'" . DG  I 6 6   ? 172.167 187.645 203.067 1.00 241.15 ? 5   DG  J "O5'" 1 
ATOM   6285  C "C5'" . DG  I 6 6   ? 170.958 188.393 203.100 1.00 241.15 ? 5   DG  J "C5'" 1 
ATOM   6286  C "C4'" . DG  I 6 6   ? 169.758 187.521 202.778 1.00 241.15 ? 5   DG  J "C4'" 1 
ATOM   6287  O "O4'" . DG  I 6 6   ? 169.558 187.454 201.341 1.00 241.15 ? 5   DG  J "O4'" 1 
ATOM   6288  C "C3'" . DG  I 6 6   ? 169.853 186.071 203.250 1.00 241.15 ? 5   DG  J "C3'" 1 
ATOM   6289  O "O3'" . DG  I 6 6   ? 168.592 185.659 203.707 1.00 241.15 ? 5   DG  J "O3'" 1 
ATOM   6290  C "C2'" . DG  I 6 6   ? 170.225 185.337 201.969 1.00 241.15 ? 5   DG  J "C2'" 1 
ATOM   6291  C "C1'" . DG  I 6 6   ? 169.382 186.109 200.985 1.00 241.15 ? 5   DG  J "C1'" 1 
ATOM   6292  N N9    . DG  I 6 6   ? 169.767 185.917 199.598 1.00 241.15 ? 5   DG  J N9    1 
ATOM   6293  C C8    . DG  I 6 6   ? 171.004 185.585 199.113 1.00 241.15 ? 5   DG  J C8    1 
ATOM   6294  N N7    . DG  I 6 6   ? 171.039 185.483 197.815 1.00 241.15 ? 5   DG  J N7    1 
ATOM   6295  C C5    . DG  I 6 6   ? 169.742 185.756 197.423 1.00 241.15 ? 5   DG  J C5    1 
ATOM   6296  C C6    . DG  I 6 6   ? 169.169 185.782 196.140 1.00 241.15 ? 5   DG  J C6    1 
ATOM   6297  O O6    . DG  I 6 6   ? 169.718 185.587 195.053 1.00 241.15 ? 5   DG  J O6    1 
ATOM   6298  N N1    . DG  I 6 6   ? 167.823 186.110 196.187 1.00 241.15 ? 5   DG  J N1    1 
ATOM   6299  C C2    . DG  I 6 6   ? 167.116 186.357 197.336 1.00 241.15 ? 5   DG  J C2    1 
ATOM   6300  N N2    . DG  I 6 6   ? 165.820 186.645 197.191 1.00 241.15 ? 5   DG  J N2    1 
ATOM   6301  N N3    . DG  I 6 6   ? 167.638 186.322 198.545 1.00 241.15 ? 5   DG  J N3    1 
ATOM   6302  C C4    . DG  I 6 6   ? 168.950 186.020 198.511 1.00 241.15 ? 5   DG  J C4    1 
ATOM   6303  P P     . DA  I 6 7   ? 168.464 184.506 204.812 1.00 229.96 ? 6   DA  J P     1 
ATOM   6304  O OP1   . DA  I 6 7   ? 168.498 185.172 206.130 1.00 229.96 ? 6   DA  J OP1   1 
ATOM   6305  O OP2   . DA  I 6 7   ? 169.432 183.434 204.498 1.00 229.96 ? 6   DA  J OP2   1 
ATOM   6306  O "O5'" . DA  I 6 7   ? 167.004 183.917 204.563 1.00 229.96 ? 6   DA  J "O5'" 1 
ATOM   6307  C "C5'" . DA  I 6 7   ? 165.868 184.728 204.808 1.00 229.96 ? 6   DA  J "C5'" 1 
ATOM   6308  C "C4'" . DA  I 6 7   ? 164.866 184.656 203.665 1.00 229.96 ? 6   DA  J "C4'" 1 
ATOM   6309  O "O4'" . DA  I 6 7   ? 165.545 184.716 202.386 1.00 229.96 ? 6   DA  J "O4'" 1 
ATOM   6310  C "C3'" . DA  I 6 7   ? 164.014 183.401 203.600 1.00 229.96 ? 6   DA  J "C3'" 1 
ATOM   6311  O "O3'" . DA  I 6 7   ? 162.786 183.759 203.027 1.00 229.96 ? 6   DA  J "O3'" 1 
ATOM   6312  C "C2'" . DA  I 6 7   ? 164.820 182.519 202.648 1.00 229.96 ? 6   DA  J "C2'" 1 
ATOM   6313  C "C1'" . DA  I 6 7   ? 165.223 183.563 201.629 1.00 229.96 ? 6   DA  J "C1'" 1 
ATOM   6314  N N9    . DA  I 6 7   ? 166.388 183.252 200.828 1.00 229.96 ? 6   DA  J N9    1 
ATOM   6315  C C8    . DA  I 6 7   ? 167.664 183.111 201.268 1.00 229.96 ? 6   DA  J C8    1 
ATOM   6316  N N7    . DA  I 6 7   ? 168.534 182.913 200.310 1.00 229.96 ? 6   DA  J N7    1 
ATOM   6317  C C5    . DA  I 6 7   ? 167.771 182.942 199.164 1.00 229.96 ? 6   DA  J C5    1 
ATOM   6318  C C6    . DA  I 6 7   ? 168.096 182.801 197.808 1.00 229.96 ? 6   DA  J C6    1 
ATOM   6319  N N6    . DA  I 6 7   ? 169.335 182.573 197.372 1.00 229.96 ? 6   DA  J N6    1 
ATOM   6320  N N1    . DA  I 6 7   ? 167.092 182.871 196.915 1.00 229.96 ? 6   DA  J N1    1 
ATOM   6321  C C2    . DA  I 6 7   ? 165.852 183.090 197.357 1.00 229.96 ? 6   DA  J C2    1 
ATOM   6322  N N3    . DA  I 6 7   ? 165.429 183.250 198.605 1.00 229.96 ? 6   DA  J N3    1 
ATOM   6323  C C4    . DA  I 6 7   ? 166.448 183.164 199.466 1.00 229.96 ? 6   DA  J C4    1 
ATOM   6324  P P     . DA  I 6 8   ? 161.454 182.940 203.358 1.00 221.46 ? 7   DA  J P     1 
ATOM   6325  O OP1   . DA  I 6 8   ? 160.552 183.849 204.096 1.00 221.46 ? 7   DA  J OP1   1 
ATOM   6326  O OP2   . DA  I 6 8   ? 161.868 181.655 203.962 1.00 221.46 ? 7   DA  J OP2   1 
ATOM   6327  O "O5'" . DA  I 6 8   ? 160.835 182.649 201.909 1.00 221.46 ? 7   DA  J "O5'" 1 
ATOM   6328  C "C5'" . DA  I 6 8   ? 161.673 182.711 200.746 1.00 221.46 ? 7   DA  J "C5'" 1 
ATOM   6329  C "C4'" . DA  I 6 8   ? 161.712 181.368 200.052 1.00 221.46 ? 7   DA  J "C4'" 1 
ATOM   6330  O "O4'" . DA  I 6 8   ? 162.997 181.171 199.396 1.00 221.46 ? 7   DA  J "O4'" 1 
ATOM   6331  C "C3'" . DA  I 6 8   ? 161.544 180.180 200.992 1.00 221.46 ? 7   DA  J "C3'" 1 
ATOM   6332  O "O3'" . DA  I 6 8   ? 160.688 179.245 200.418 1.00 221.46 ? 7   DA  J "O3'" 1 
ATOM   6333  C "C2'" . DA  I 6 8   ? 162.957 179.647 201.102 1.00 221.46 ? 7   DA  J "C2'" 1 
ATOM   6334  C "C1'" . DA  I 6 8   ? 163.437 179.874 199.693 1.00 221.46 ? 7   DA  J "C1'" 1 
ATOM   6335  N N9    . DA  I 6 8   ? 164.878 179.820 199.558 1.00 221.46 ? 7   DA  J N9    1 
ATOM   6336  C C8    . DA  I 6 8   ? 165.794 179.884 200.561 1.00 221.46 ? 7   DA  J C8    1 
ATOM   6337  N N7    . DA  I 6 8   ? 167.031 179.821 200.149 1.00 221.46 ? 7   DA  J N7    1 
ATOM   6338  C C5    . DA  I 6 8   ? 166.915 179.700 198.782 1.00 221.46 ? 7   DA  J C5    1 
ATOM   6339  C C6    . DA  I 6 8   ? 167.867 179.575 197.765 1.00 221.46 ? 7   DA  J C6    1 
ATOM   6340  N N6    . DA  I 6 8   ? 169.177 179.575 197.995 1.00 221.46 ? 7   DA  J N6    1 
ATOM   6341  N N1    . DA  I 6 8   ? 167.424 179.484 196.497 1.00 221.46 ? 7   DA  J N1    1 
ATOM   6342  C C2    . DA  I 6 8   ? 166.107 179.493 196.274 1.00 221.46 ? 7   DA  J C2    1 
ATOM   6343  N N3    . DA  I 6 8   ? 165.115 179.594 197.155 1.00 221.46 ? 7   DA  J N3    1 
ATOM   6344  C C4    . DA  I 6 8   ? 165.594 179.696 198.400 1.00 221.46 ? 7   DA  J C4    1 
ATOM   6345  P P     . DT  I 6 9   ? 159.146 179.214 200.850 1.00 214.76 ? 8   DT  J P     1 
ATOM   6346  O OP1   . DT  I 6 9   ? 158.641 180.597 200.949 1.00 214.76 ? 8   DT  J OP1   1 
ATOM   6347  O OP2   . DT  I 6 9   ? 159.039 178.317 202.018 1.00 214.76 ? 8   DT  J OP2   1 
ATOM   6348  O "O5'" . DT  I 6 9   ? 158.446 178.490 199.626 1.00 214.76 ? 8   DT  J "O5'" 1 
ATOM   6349  C "C5'" . DT  I 6 9   ? 158.750 177.150 199.371 1.00 214.76 ? 8   DT  J "C5'" 1 
ATOM   6350  C "C4'" . DT  I 6 9   ? 159.414 176.985 198.024 1.00 214.76 ? 8   DT  J "C4'" 1 
ATOM   6351  O "O4'" . DT  I 6 9   ? 160.825 177.344 198.111 1.00 214.76 ? 8   DT  J "O4'" 1 
ATOM   6352  C "C3'" . DT  I 6 9   ? 159.389 175.555 197.511 1.00 214.76 ? 8   DT  J "C3'" 1 
ATOM   6353  O "O3'" . DT  I 6 9   ? 159.232 175.553 196.117 1.00 214.76 ? 8   DT  J "O3'" 1 
ATOM   6354  C "C2'" . DT  I 6 9   ? 160.760 175.045 197.918 1.00 214.76 ? 8   DT  J "C2'" 1 
ATOM   6355  C "C1'" . DT  I 6 9   ? 161.599 176.266 197.625 1.00 214.76 ? 8   DT  J "C1'" 1 
ATOM   6356  N N1    . DT  I 6 9   ? 162.929 176.275 198.310 1.00 214.76 ? 8   DT  J N1    1 
ATOM   6357  C C2    . DT  I 6 9   ? 164.085 176.264 197.558 1.00 214.76 ? 8   DT  J C2    1 
ATOM   6358  O O2    . DT  I 6 9   ? 164.092 176.226 196.346 1.00 214.76 ? 8   DT  J O2    1 
ATOM   6359  N N3    . DT  I 6 9   ? 165.238 176.283 198.289 1.00 214.76 ? 8   DT  J N3    1 
ATOM   6360  C C4    . DT  I 6 9   ? 165.354 176.318 199.656 1.00 214.76 ? 8   DT  J C4    1 
ATOM   6361  O O4    . DT  I 6 9   ? 166.436 176.334 200.224 1.00 214.76 ? 8   DT  J O4    1 
ATOM   6362  C C5    . DT  I 6 9   ? 164.118 176.330 200.382 1.00 214.76 ? 8   DT  J C5    1 
ATOM   6363  C C7    . DT  I 6 9   ? 164.136 176.353 201.883 1.00 214.76 ? 8   DT  J C7    1 
ATOM   6364  C C6    . DT  I 6 9   ? 162.975 176.306 199.683 1.00 214.76 ? 8   DT  J C6    1 
ATOM   6365  P P     . DC  I 6 10  ? 158.585 174.280 195.390 1.00 215.32 ? 9   DC  J P     1 
ATOM   6366  O OP1   . DC  I 6 10  ? 157.404 174.733 194.630 1.00 215.32 ? 9   DC  J OP1   1 
ATOM   6367  O OP2   . DC  I 6 10  ? 158.448 173.208 196.393 1.00 215.32 ? 9   DC  J OP2   1 
ATOM   6368  O "O5'" . DC  I 6 10  ? 159.713 173.831 194.370 1.00 215.32 ? 9   DC  J "O5'" 1 
ATOM   6369  C "C5'" . DC  I 6 10  ? 160.915 174.559 194.294 1.00 215.32 ? 9   DC  J "C5'" 1 
ATOM   6370  C "C4'" . DC  I 6 10  ? 161.817 173.954 193.257 1.00 215.32 ? 9   DC  J "C4'" 1 
ATOM   6371  O "O4'" . DC  I 6 10  ? 163.181 173.972 193.737 1.00 215.32 ? 9   DC  J "O4'" 1 
ATOM   6372  C "C3'" . DC  I 6 10  ? 161.518 172.507 192.955 1.00 215.32 ? 9   DC  J "C3'" 1 
ATOM   6373  O "O3'" . DC  I 6 10  ? 161.952 172.196 191.646 1.00 215.32 ? 9   DC  J "O3'" 1 
ATOM   6374  C "C2'" . DC  I 6 10  ? 162.332 171.793 194.022 1.00 215.32 ? 9   DC  J "C2'" 1 
ATOM   6375  C "C1'" . DC  I 6 10  ? 163.569 172.679 194.148 1.00 215.32 ? 9   DC  J "C1'" 1 
ATOM   6376  N N1    . DC  I 6 10  ? 164.076 172.783 195.541 1.00 215.32 ? 9   DC  J N1    1 
ATOM   6377  C C2    . DC  I 6 10  ? 165.449 172.818 195.791 1.00 215.32 ? 9   DC  J C2    1 
ATOM   6378  O O2    . DC  I 6 10  ? 166.237 172.744 194.851 1.00 215.32 ? 9   DC  J O2    1 
ATOM   6379  N N3    . DC  I 6 10  ? 165.876 172.931 197.069 1.00 215.32 ? 9   DC  J N3    1 
ATOM   6380  C C4    . DC  I 6 10  ? 164.998 173.004 198.060 1.00 215.32 ? 9   DC  J C4    1 
ATOM   6381  N N4    . DC  I 6 10  ? 165.458 173.113 199.305 1.00 215.32 ? 9   DC  J N4    1 
ATOM   6382  C C5    . DC  I 6 10  ? 163.604 172.961 197.824 1.00 215.32 ? 9   DC  J C5    1 
ATOM   6383  C C6    . DC  I 6 10  ? 163.193 172.862 196.562 1.00 215.32 ? 9   DC  J C6    1 
ATOM   6384  P P     . DC  I 6 11  ? 161.818 170.707 191.062 1.00 221.22 ? 10  DC  J P     1 
ATOM   6385  O OP1   . DC  I 6 11  ? 161.623 170.814 189.605 1.00 221.22 ? 10  DC  J OP1   1 
ATOM   6386  O OP2   . DC  I 6 11  ? 160.845 169.928 191.855 1.00 221.22 ? 10  DC  J OP2   1 
ATOM   6387  O "O5'" . DC  I 6 11  ? 163.272 170.118 191.283 1.00 221.22 ? 10  DC  J "O5'" 1 
ATOM   6388  C "C5'" . DC  I 6 11  ? 164.394 170.902 190.923 1.00 221.22 ? 10  DC  J "C5'" 1 
ATOM   6389  C "C4'" . DC  I 6 11  ? 165.689 170.245 191.358 1.00 221.22 ? 10  DC  J "C4'" 1 
ATOM   6390  O "O4'" . DC  I 6 11  ? 165.938 170.516 192.763 1.00 221.22 ? 10  DC  J "O4'" 1 
ATOM   6391  C "C3'" . DC  I 6 11  ? 165.730 168.726 191.211 1.00 221.22 ? 10  DC  J "C3'" 1 
ATOM   6392  O "O3'" . DC  I 6 11  ? 167.010 168.337 190.762 1.00 221.22 ? 10  DC  J "O3'" 1 
ATOM   6393  C "C2'" . DC  I 6 11  ? 165.489 168.256 192.637 1.00 221.22 ? 10  DC  J "C2'" 1 
ATOM   6394  C "C1'" . DC  I 6 11  ? 166.260 169.307 193.403 1.00 221.22 ? 10  DC  J "C1'" 1 
ATOM   6395  N N1    . DC  I 6 11  ? 165.879 169.415 194.820 1.00 221.22 ? 10  DC  J N1    1 
ATOM   6396  C C2    . DC  I 6 11  ? 166.867 169.560 195.784 1.00 221.22 ? 10  DC  J C2    1 
ATOM   6397  O O2    . DC  I 6 11  ? 168.048 169.592 195.430 1.00 221.22 ? 10  DC  J O2    1 
ATOM   6398  N N3    . DC  I 6 11  ? 166.505 169.667 197.081 1.00 221.22 ? 10  DC  J N3    1 
ATOM   6399  C C4    . DC  I 6 11  ? 165.218 169.626 197.416 1.00 221.22 ? 10  DC  J C4    1 
ATOM   6400  N N4    . DC  I 6 11  ? 164.905 169.729 198.707 1.00 221.22 ? 10  DC  J N4    1 
ATOM   6401  C C5    . DC  I 6 11  ? 164.196 169.476 196.444 1.00 221.22 ? 10  DC  J C5    1 
ATOM   6402  C C6    . DC  I 6 11  ? 164.572 169.366 195.172 1.00 221.22 ? 10  DC  J C6    1 
ATOM   6403  P P     . DC  I 6 12  ? 167.211 166.992 189.909 1.00 227.67 ? 11  DC  J P     1 
ATOM   6404  O OP1   . DC  I 6 12  ? 167.169 167.359 188.478 1.00 227.67 ? 11  DC  J OP1   1 
ATOM   6405  O OP2   . DC  I 6 12  ? 166.292 165.957 190.424 1.00 227.67 ? 11  DC  J OP2   1 
ATOM   6406  O "O5'" . DC  I 6 12  ? 168.694 166.548 190.285 1.00 227.67 ? 11  DC  J "O5'" 1 
ATOM   6407  C "C5'" . DC  I 6 12  ? 169.688 167.537 190.465 1.00 227.67 ? 11  DC  J "C5'" 1 
ATOM   6408  C "C4'" . DC  I 6 12  ? 170.707 167.097 191.496 1.00 227.67 ? 11  DC  J "C4'" 1 
ATOM   6409  O "O4'" . DC  I 6 12  ? 170.188 167.316 192.832 1.00 227.67 ? 11  DC  J "O4'" 1 
ATOM   6410  C "C3'" . DC  I 6 12  ? 171.116 165.633 191.413 1.00 227.67 ? 11  DC  J "C3'" 1 
ATOM   6411  O "O3'" . DC  I 6 12  ? 172.574 165.557 191.333 1.00 227.67 ? 11  DC  J "O3'" 1 
ATOM   6412  C "C2'" . DC  I 6 12  ? 170.487 165.003 192.668 1.00 227.67 ? 11  DC  J "C2'" 1 
ATOM   6413  C "C1'" . DC  I 6 12  ? 170.385 166.172 193.630 1.00 227.67 ? 11  DC  J "C1'" 1 
ATOM   6414  N N1    . DC  I 6 12  ? 169.223 166.084 194.545 1.00 227.67 ? 11  DC  J N1    1 
ATOM   6415  C C2    . DC  I 6 12  ? 169.402 166.142 195.932 1.00 227.67 ? 11  DC  J C2    1 
ATOM   6416  O O2    . DC  I 6 12  ? 170.539 166.227 196.395 1.00 227.67 ? 11  DC  J O2    1 
ATOM   6417  N N3    . DC  I 6 12  ? 168.309 166.091 196.732 1.00 227.67 ? 11  DC  J N3    1 
ATOM   6418  C C4    . DC  I 6 12  ? 167.098 166.000 196.200 1.00 227.67 ? 11  DC  J C4    1 
ATOM   6419  N N4    . DC  I 6 12  ? 166.045 165.952 197.018 1.00 227.67 ? 11  DC  J N4    1 
ATOM   6420  C C5    . DC  I 6 12  ? 166.905 165.940 194.801 1.00 227.67 ? 11  DC  J C5    1 
ATOM   6421  C C6    . DC  I 6 12  ? 167.979 165.999 194.018 1.00 227.67 ? 11  DC  J C6    1 
ATOM   6422  P P     . DG  I 6 13  ? 173.482 164.466 192.097 1.00 233.74 ? 12  DG  J P     1 
ATOM   6423  O OP1   . DG  I 6 13  ? 174.831 164.644 191.528 1.00 233.74 ? 12  DG  J OP1   1 
ATOM   6424  O OP2   . DG  I 6 13  ? 172.928 163.092 192.064 1.00 233.74 ? 12  DG  J OP2   1 
ATOM   6425  O "O5'" . DG  I 6 13  ? 173.567 165.026 193.587 1.00 233.74 ? 12  DG  J "O5'" 1 
ATOM   6426  C "C5'" . DG  I 6 13  ? 174.743 164.851 194.342 1.00 233.74 ? 12  DG  J "C5'" 1 
ATOM   6427  C "C4'" . DG  I 6 13  ? 174.514 163.813 195.410 1.00 233.74 ? 12  DG  J "C4'" 1 
ATOM   6428  O "O4'" . DG  I 6 13  ? 173.196 164.003 195.949 1.00 233.74 ? 12  DG  J "O4'" 1 
ATOM   6429  C "C3'" . DG  I 6 13  ? 174.549 162.375 194.901 1.00 233.74 ? 12  DG  J "C3'" 1 
ATOM   6430  O "O3'" . DG  I 6 13  ? 175.805 161.718 195.298 1.00 233.74 ? 12  DG  J "O3'" 1 
ATOM   6431  C "C2'" . DG  I 6 13  ? 173.254 161.727 195.428 1.00 233.74 ? 12  DG  J "C2'" 1 
ATOM   6432  C "C1'" . DG  I 6 13  ? 172.716 162.773 196.395 1.00 233.74 ? 12  DG  J "C1'" 1 
ATOM   6433  N N9    . DG  I 6 13  ? 171.271 162.838 196.443 1.00 233.74 ? 12  DG  J N9    1 
ATOM   6434  C C8    . DG  I 6 13  ? 170.407 162.844 195.383 1.00 233.74 ? 12  DG  J C8    1 
ATOM   6435  N N7    . DG  I 6 13  ? 169.157 162.913 195.737 1.00 233.74 ? 12  DG  J N7    1 
ATOM   6436  C C5    . DG  I 6 13  ? 169.203 162.952 197.121 1.00 233.74 ? 12  DG  J C5    1 
ATOM   6437  C C6    . DG  I 6 13  ? 168.161 163.028 198.062 1.00 233.74 ? 12  DG  J C6    1 
ATOM   6438  O O6    . DG  I 6 13  ? 166.947 163.075 197.853 1.00 233.74 ? 12  DG  J O6    1 
ATOM   6439  N N1    . DG  I 6 13  ? 168.645 163.046 199.364 1.00 233.74 ? 12  DG  J N1    1 
ATOM   6440  C C2    . DG  I 6 13  ? 169.970 162.996 199.709 1.00 233.74 ? 12  DG  J C2    1 
ATOM   6441  N N2    . DG  I 6 13  ? 170.254 163.025 201.015 1.00 233.74 ? 12  DG  J N2    1 
ATOM   6442  N N3    . DG  I 6 13  ? 170.956 162.926 198.835 1.00 233.74 ? 12  DG  J N3    1 
ATOM   6443  C C4    . DG  I 6 13  ? 170.499 162.915 197.565 1.00 233.74 ? 12  DG  J C4    1 
ATOM   6444  P P     . DG  I 6 14  ? 175.980 160.754 196.581 1.00 236.36 ? 13  DG  J P     1 
ATOM   6445  O OP1   . DG  I 6 14  ? 177.436 160.717 196.816 1.00 236.36 ? 13  DG  J OP1   1 
ATOM   6446  O OP2   . DG  I 6 14  ? 175.294 159.464 196.352 1.00 236.36 ? 13  DG  J OP2   1 
ATOM   6447  O "O5'" . DG  I 6 14  ? 175.363 161.557 197.819 1.00 236.36 ? 13  DG  J "O5'" 1 
ATOM   6448  C "C5'" . DG  I 6 14  ? 176.090 161.666 199.030 1.00 236.36 ? 13  DG  J "C5'" 1 
ATOM   6449  C "C4'" . DG  I 6 14  ? 175.449 160.841 200.134 1.00 236.36 ? 13  DG  J "C4'" 1 
ATOM   6450  O "O4'" . DG  I 6 14  ? 174.001 160.964 200.071 1.00 236.36 ? 13  DG  J "O4'" 1 
ATOM   6451  C "C3'" . DG  I 6 14  ? 175.733 159.338 200.078 1.00 236.36 ? 13  DG  J "C3'" 1 
ATOM   6452  O "O3'" . DG  I 6 14  ? 175.840 158.837 201.393 1.00 236.36 ? 13  DG  J "O3'" 1 
ATOM   6453  C "C2'" . DG  I 6 14  ? 174.479 158.813 199.415 1.00 236.36 ? 13  DG  J "C2'" 1 
ATOM   6454  C "C1'" . DG  I 6 14  ? 173.448 159.672 200.095 1.00 236.36 ? 13  DG  J "C1'" 1 
ATOM   6455  N N9    . DG  I 6 14  ? 172.166 159.697 199.419 1.00 236.36 ? 13  DG  J N9    1 
ATOM   6456  C C8    . DG  I 6 14  ? 171.937 159.763 198.072 1.00 236.36 ? 13  DG  J C8    1 
ATOM   6457  N N7    . DG  I 6 14  ? 170.673 159.773 197.762 1.00 236.36 ? 13  DG  J N7    1 
ATOM   6458  C C5    . DG  I 6 14  ? 170.028 159.725 198.987 1.00 236.36 ? 13  DG  J C5    1 
ATOM   6459  C C6    . DG  I 6 14  ? 168.654 159.712 199.291 1.00 236.36 ? 13  DG  J C6    1 
ATOM   6460  O O6    . DG  I 6 14  ? 167.700 159.751 198.512 1.00 236.36 ? 13  DG  J O6    1 
ATOM   6461  N N1    . DG  I 6 14  ? 168.430 159.648 200.661 1.00 236.36 ? 13  DG  J N1    1 
ATOM   6462  C C2    . DG  I 6 14  ? 169.413 159.604 201.613 1.00 236.36 ? 13  DG  J C2    1 
ATOM   6463  N N2    . DG  I 6 14  ? 169.011 159.542 202.889 1.00 236.36 ? 13  DG  J N2    1 
ATOM   6464  N N3    . DG  I 6 14  ? 170.705 159.610 201.339 1.00 236.36 ? 13  DG  J N3    1 
ATOM   6465  C C4    . DG  I 6 14  ? 170.936 159.671 200.012 1.00 236.36 ? 13  DG  J C4    1 
ATOM   6466  P P     . DT  I 6 15  ? 176.519 157.411 201.689 1.00 230.00 ? 14  DT  J P     1 
ATOM   6467  O OP1   . DT  I 6 15  ? 177.976 157.605 201.554 1.00 230.00 ? 14  DT  J OP1   1 
ATOM   6468  O OP2   . DT  I 6 15  ? 175.848 156.332 200.931 1.00 230.00 ? 14  DT  J OP2   1 
ATOM   6469  O "O5'" . DT  I 6 15  ? 176.165 157.166 203.222 1.00 230.00 ? 14  DT  J "O5'" 1 
ATOM   6470  C "C5'" . DT  I 6 15  ? 175.100 157.897 203.816 1.00 230.00 ? 14  DT  J "C5'" 1 
ATOM   6471  C "C4'" . DT  I 6 15  ? 173.932 156.986 204.135 1.00 230.00 ? 14  DT  J "C4'" 1 
ATOM   6472  O "O4'" . DT  I 6 15  ? 172.828 157.258 203.233 1.00 230.00 ? 14  DT  J "O4'" 1 
ATOM   6473  C "C3'" . DT  I 6 15  ? 174.229 155.490 204.001 1.00 230.00 ? 14  DT  J "C3'" 1 
ATOM   6474  O "O3'" . DT  I 6 15  ? 173.812 154.815 205.168 1.00 230.00 ? 14  DT  J "O3'" 1 
ATOM   6475  C "C2'" . DT  I 6 15  ? 173.398 155.073 202.793 1.00 230.00 ? 14  DT  J "C2'" 1 
ATOM   6476  C "C1'" . DT  I 6 15  ? 172.237 156.037 202.896 1.00 230.00 ? 14  DT  J "C1'" 1 
ATOM   6477  N N1    . DT  I 6 15  ? 171.487 156.190 201.632 1.00 230.00 ? 14  DT  J N1    1 
ATOM   6478  C C2    . DT  I 6 15  ? 170.121 156.310 201.673 1.00 230.00 ? 14  DT  J C2    1 
ATOM   6479  O O2    . DT  I 6 15  ? 169.480 156.304 202.704 1.00 230.00 ? 14  DT  J O2    1 
ATOM   6480  N N3    . DT  I 6 15  ? 169.529 156.436 200.453 1.00 230.00 ? 14  DT  J N3    1 
ATOM   6481  C C4    . DT  I 6 15  ? 170.147 156.438 199.226 1.00 230.00 ? 14  DT  J C4    1 
ATOM   6482  O O4    . DT  I 6 15  ? 169.532 156.560 198.181 1.00 230.00 ? 14  DT  J O4    1 
ATOM   6483  C C5    . DT  I 6 15  ? 171.572 156.312 199.251 1.00 230.00 ? 14  DT  J C5    1 
ATOM   6484  C C7    . DT  I 6 15  ? 172.337 156.300 197.964 1.00 230.00 ? 14  DT  J C7    1 
ATOM   6485  C C6    . DT  I 6 15  ? 172.171 156.190 200.438 1.00 230.00 ? 14  DT  J C6    1 
ATOM   6486  P P     . DG  I 6 16  ? 174.331 153.326 205.460 1.00 222.13 ? 15  DG  J P     1 
ATOM   6487  O OP1   . DG  I 6 16  ? 174.204 153.087 206.913 1.00 222.13 ? 15  DG  J OP1   1 
ATOM   6488  O OP2   . DG  I 6 16  ? 175.646 153.177 204.802 1.00 222.13 ? 15  DG  J OP2   1 
ATOM   6489  O "O5'" . DG  I 6 16  ? 173.289 152.399 204.683 1.00 222.13 ? 15  DG  J "O5'" 1 
ATOM   6490  C "C5'" . DG  I 6 16  ? 172.422 151.548 205.408 1.00 222.13 ? 15  DG  J "C5'" 1 
ATOM   6491  C "C4'" . DG  I 6 16  ? 171.120 152.248 205.742 1.00 222.13 ? 15  DG  J "C4'" 1 
ATOM   6492  O "O4'" . DG  I 6 16  ? 170.751 153.136 204.652 1.00 222.13 ? 15  DG  J "O4'" 1 
ATOM   6493  C "C3'" . DG  I 6 16  ? 169.929 151.317 205.889 1.00 222.13 ? 15  DG  J "C3'" 1 
ATOM   6494  O "O3'" . DG  I 6 16  ? 168.928 151.957 206.659 1.00 222.13 ? 15  DG  J "O3'" 1 
ATOM   6495  C "C2'" . DG  I 6 16  ? 169.498 151.194 204.440 1.00 222.13 ? 15  DG  J "C2'" 1 
ATOM   6496  C "C1'" . DG  I 6 16  ? 169.557 152.655 204.063 1.00 222.13 ? 15  DG  J "C1'" 1 
ATOM   6497  N N9    . DG  I 6 16  ? 169.602 152.912 202.639 1.00 222.13 ? 15  DG  J N9    1 
ATOM   6498  C C8    . DG  I 6 16  ? 170.719 153.042 201.865 1.00 222.13 ? 15  DG  J C8    1 
ATOM   6499  N N7    . DG  I 6 16  ? 170.458 153.309 200.624 1.00 222.13 ? 15  DG  J N7    1 
ATOM   6500  C C5    . DG  I 6 16  ? 169.079 153.343 200.571 1.00 222.13 ? 15  DG  J C5    1 
ATOM   6501  C C6    . DG  I 6 16  ? 168.231 153.594 199.485 1.00 222.13 ? 15  DG  J C6    1 
ATOM   6502  O O6    . DG  I 6 16  ? 168.546 153.823 198.315 1.00 222.13 ? 15  DG  J O6    1 
ATOM   6503  N N1    . DG  I 6 16  ? 166.898 153.552 199.856 1.00 222.13 ? 15  DG  J N1    1 
ATOM   6504  C C2    . DG  I 6 16  ? 166.443 153.304 201.125 1.00 222.13 ? 15  DG  J C2    1 
ATOM   6505  N N2    . DG  I 6 16  ? 165.116 153.302 201.292 1.00 222.13 ? 15  DG  J N2    1 
ATOM   6506  N N3    . DG  I 6 16  ? 167.234 153.075 202.158 1.00 222.13 ? 15  DG  J N3    1 
ATOM   6507  C C4    . DG  I 6 16  ? 168.536 153.117 201.806 1.00 222.13 ? 15  DG  J C4    1 
ATOM   6508  P P     . DC  I 6 17  ? 167.665 151.127 207.195 1.00 212.79 ? 16  DC  J P     1 
ATOM   6509  O OP1   . DC  I 6 17  ? 167.029 151.918 208.269 1.00 212.79 ? 16  DC  J OP1   1 
ATOM   6510  O OP2   . DC  I 6 17  ? 168.164 149.767 207.484 1.00 212.79 ? 16  DC  J OP2   1 
ATOM   6511  O "O5'" . DC  I 6 17  ? 166.668 151.077 205.940 1.00 212.79 ? 16  DC  J "O5'" 1 
ATOM   6512  C "C5'" . DC  I 6 17  ? 165.389 150.483 206.059 1.00 212.79 ? 16  DC  J "C5'" 1 
ATOM   6513  C "C4'" . DC  I 6 17  ? 165.261 149.283 205.139 1.00 212.79 ? 16  DC  J "C4'" 1 
ATOM   6514  O "O4'" . DC  I 6 17  ? 165.659 149.640 203.808 1.00 212.79 ? 16  DC  J "O4'" 1 
ATOM   6515  C "C3'" . DC  I 6 17  ? 166.151 148.096 205.500 1.00 212.79 ? 16  DC  J "C3'" 1 
ATOM   6516  O "O3'" . DC  I 6 17  ? 165.462 147.089 206.324 1.00 212.79 ? 16  DC  J "O3'" 1 
ATOM   6517  C "C2'" . DC  I 6 17  ? 166.643 147.537 204.152 1.00 212.79 ? 16  DC  J "C2'" 1 
ATOM   6518  C "C1'" . DC  I 6 17  ? 165.979 148.456 203.128 1.00 212.79 ? 16  DC  J "C1'" 1 
ATOM   6519  N N1    . DC  I 6 17  ? 166.846 148.788 201.972 1.00 212.79 ? 16  DC  J N1    1 
ATOM   6520  C C2    . DC  I 6 17  ? 166.258 149.103 200.752 1.00 212.79 ? 16  DC  J C2    1 
ATOM   6521  O O2    . DC  I 6 17  ? 165.028 149.100 200.667 1.00 212.79 ? 16  DC  J O2    1 
ATOM   6522  N N3    . DC  I 6 17  ? 167.051 149.405 199.703 1.00 212.79 ? 16  DC  J N3    1 
ATOM   6523  C C4    . DC  I 6 17  ? 168.372 149.395 199.847 1.00 212.79 ? 16  DC  J C4    1 
ATOM   6524  N N4    . DC  I 6 17  ? 169.116 149.699 198.785 1.00 212.79 ? 16  DC  J N4    1 
ATOM   6525  C C5    . DC  I 6 17  ? 168.992 149.072 201.085 1.00 212.79 ? 16  DC  J C5    1 
ATOM   6526  C C6    . DC  I 6 17  ? 168.198 148.775 202.110 1.00 212.79 ? 16  DC  J C6    1 
ATOM   6527  P P     . DC  I 6 18  ? 163.900 146.692 206.182 1.00 209.20 ? 17  DC  J P     1 
ATOM   6528  O OP1   . DC  I 6 18  ? 163.009 147.705 206.792 1.00 209.20 ? 17  DC  J OP1   1 
ATOM   6529  O OP2   . DC  I 6 18  ? 163.824 145.316 206.710 1.00 209.20 ? 17  DC  J OP2   1 
ATOM   6530  O "O5'" . DC  I 6 18  ? 163.622 146.541 204.619 1.00 209.20 ? 17  DC  J "O5'" 1 
ATOM   6531  C "C5'" . DC  I 6 18  ? 162.906 145.425 204.151 1.00 209.20 ? 17  DC  J "C5'" 1 
ATOM   6532  C "C4'" . DC  I 6 18  ? 161.966 145.823 203.039 1.00 209.20 ? 17  DC  J "C4'" 1 
ATOM   6533  O "O4'" . DC  I 6 18  ? 162.724 146.465 201.986 1.00 209.20 ? 17  DC  J "O4'" 1 
ATOM   6534  C "C3'" . DC  I 6 18  ? 161.299 144.662 202.346 1.00 209.20 ? 17  DC  J "C3'" 1 
ATOM   6535  O "O3'" . DC  I 6 18  ? 160.225 145.148 201.573 1.00 209.20 ? 17  DC  J "O3'" 1 
ATOM   6536  C "C2'" . DC  I 6 18  ? 162.437 144.203 201.461 1.00 209.20 ? 17  DC  J "C2'" 1 
ATOM   6537  C "C1'" . DC  I 6 18  ? 162.901 145.546 200.922 1.00 209.20 ? 17  DC  J "C1'" 1 
ATOM   6538  N N1    . DC  I 6 18  ? 164.315 145.587 200.517 1.00 209.20 ? 17  DC  J N1    1 
ATOM   6539  C C2    . DC  I 6 18  ? 164.642 145.899 199.202 1.00 209.20 ? 17  DC  J C2    1 
ATOM   6540  O O2    . DC  I 6 18  ? 163.738 146.108 198.391 1.00 209.20 ? 17  DC  J O2    1 
ATOM   6541  N N3    . DC  I 6 18  ? 165.941 145.961 198.849 1.00 209.20 ? 17  DC  J N3    1 
ATOM   6542  C C4    . DC  I 6 18  ? 166.885 145.731 199.753 1.00 209.20 ? 17  DC  J C4    1 
ATOM   6543  N N4    . DC  I 6 18  ? 168.154 145.802 199.358 1.00 209.20 ? 17  DC  J N4    1 
ATOM   6544  C C5    . DC  I 6 18  ? 166.573 145.418 201.101 1.00 209.20 ? 17  DC  J C5    1 
ATOM   6545  C C6    . DC  I 6 18  ? 165.286 145.357 201.435 1.00 209.20 ? 17  DC  J C6    1 
ATOM   6546  P P     . DG  I 6 19  ? 159.019 144.182 201.145 1.00 200.46 ? 18  DG  J P     1 
ATOM   6547  O OP1   . DG  I 6 19  ? 157.840 144.602 201.926 1.00 200.46 ? 18  DG  J OP1   1 
ATOM   6548  O OP2   . DG  I 6 19  ? 159.482 142.780 201.209 1.00 200.46 ? 18  DG  J OP2   1 
ATOM   6549  O "O5'" . DG  I 6 19  ? 158.775 144.550 199.611 1.00 200.46 ? 18  DG  J "O5'" 1 
ATOM   6550  C "C5'" . DG  I 6 19  ? 159.865 144.968 198.808 1.00 200.46 ? 18  DG  J "C5'" 1 
ATOM   6551  C "C4'" . DG  I 6 19  ? 159.900 144.190 197.516 1.00 200.46 ? 18  DG  J "C4'" 1 
ATOM   6552  O "O4'" . DG  I 6 19  ? 161.261 144.143 197.026 1.00 200.46 ? 18  DG  J "O4'" 1 
ATOM   6553  C "C3'" . DG  I 6 19  ? 159.493 142.733 197.654 1.00 200.46 ? 18  DG  J "C3'" 1 
ATOM   6554  O "O3'" . DG  I 6 19  ? 159.142 142.221 196.385 1.00 200.46 ? 18  DG  J "O3'" 1 
ATOM   6555  C "C2'" . DG  I 6 19  ? 160.805 142.133 198.105 1.00 200.46 ? 18  DG  J "C2'" 1 
ATOM   6556  C "C1'" . DG  I 6 19  ? 161.724 142.815 197.110 1.00 200.46 ? 18  DG  J "C1'" 1 
ATOM   6557  N N9    . DG  I 6 19  ? 163.116 142.835 197.499 1.00 200.46 ? 18  DG  J N9    1 
ATOM   6558  C C8    . DG  I 6 19  ? 163.639 142.542 198.726 1.00 200.46 ? 18  DG  J C8    1 
ATOM   6559  N N7    . DG  I 6 19  ? 164.931 142.657 198.780 1.00 200.46 ? 18  DG  J N7    1 
ATOM   6560  C C5    . DG  I 6 19  ? 165.284 143.037 197.498 1.00 200.46 ? 18  DG  J C5    1 
ATOM   6561  C C6    . DG  I 6 19  ? 166.549 143.302 196.949 1.00 200.46 ? 18  DG  J C6    1 
ATOM   6562  O O6    . DG  I 6 19  ? 167.645 143.265 197.507 1.00 200.46 ? 18  DG  J O6    1 
ATOM   6563  N N1    . DG  I 6 19  ? 166.466 143.659 195.610 1.00 200.46 ? 18  DG  J N1    1 
ATOM   6564  C C2    . DG  I 6 19  ? 165.302 143.753 194.897 1.00 200.46 ? 18  DG  J C2    1 
ATOM   6565  N N2    . DG  I 6 19  ? 165.416 144.110 193.612 1.00 200.46 ? 18  DG  J N2    1 
ATOM   6566  N N3    . DG  I 6 19  ? 164.107 143.499 195.400 1.00 200.46 ? 18  DG  J N3    1 
ATOM   6567  C C4    . DG  I 6 19  ? 164.176 143.151 196.701 1.00 200.46 ? 18  DG  J C4    1 
ATOM   6568  P P     . DA  I 6 20  ? 157.663 142.395 195.782 1.00 196.21 ? 19  DA  J P     1 
ATOM   6569  O OP1   . DA  I 6 20  ? 156.901 143.414 196.536 1.00 196.21 ? 19  DA  J OP1   1 
ATOM   6570  O OP2   . DA  I 6 20  ? 157.109 141.033 195.645 1.00 196.21 ? 19  DA  J OP2   1 
ATOM   6571  O "O5'" . DA  I 6 20  ? 157.943 142.935 194.308 1.00 196.21 ? 19  DA  J "O5'" 1 
ATOM   6572  C "C5'" . DA  I 6 20  ? 159.283 143.204 193.913 1.00 196.21 ? 19  DA  J "C5'" 1 
ATOM   6573  C "C4'" . DA  I 6 20  ? 159.668 142.414 192.678 1.00 196.21 ? 19  DA  J "C4'" 1 
ATOM   6574  O "O4'" . DA  I 6 20  ? 160.984 141.847 192.862 1.00 196.21 ? 19  DA  J "O4'" 1 
ATOM   6575  C "C3'" . DA  I 6 20  ? 158.795 141.221 192.369 1.00 196.21 ? 19  DA  J "C3'" 1 
ATOM   6576  O "O3'" . DA  I 6 20  ? 159.026 140.836 191.044 1.00 196.21 ? 19  DA  J "O3'" 1 
ATOM   6577  C "C2'" . DA  I 6 20  ? 159.383 140.190 193.313 1.00 196.21 ? 19  DA  J "C2'" 1 
ATOM   6578  C "C1'" . DA  I 6 20  ? 160.866 140.460 193.111 1.00 196.21 ? 19  DA  J "C1'" 1 
ATOM   6579  N N9    . DA  I 6 20  ? 161.673 140.154 194.268 1.00 196.21 ? 19  DA  J N9    1 
ATOM   6580  C C8    . DA  I 6 20  ? 161.237 139.757 195.492 1.00 196.21 ? 19  DA  J C8    1 
ATOM   6581  N N7    . DA  I 6 20  ? 162.201 139.573 196.357 1.00 196.21 ? 19  DA  J N7    1 
ATOM   6582  C C5    . DA  I 6 20  ? 163.343 139.878 195.644 1.00 196.21 ? 19  DA  J C5    1 
ATOM   6583  C C6    . DA  I 6 20  ? 164.701 139.878 195.988 1.00 196.21 ? 19  DA  J C6    1 
ATOM   6584  N N6    . DA  I 6 20  ? 165.145 139.556 197.199 1.00 196.21 ? 19  DA  J N6    1 
ATOM   6585  N N1    . DA  I 6 20  ? 165.589 140.228 195.040 1.00 196.21 ? 19  DA  J N1    1 
ATOM   6586  C C2    . DA  I 6 20  ? 165.140 140.552 193.830 1.00 196.21 ? 19  DA  J C2    1 
ATOM   6587  N N3    . DA  I 6 20  ? 163.886 140.588 193.389 1.00 196.21 ? 19  DA  J N3    1 
ATOM   6588  C C4    . DA  I 6 20  ? 163.032 140.236 194.356 1.00 196.21 ? 19  DA  J C4    1 
ATOM   6589  P P     . DG  I 6 21  ? 158.060 141.311 189.856 1.00 192.81 ? 20  DG  J P     1 
ATOM   6590  O OP1   . DG  I 6 21  ? 157.782 142.754 189.998 1.00 192.81 ? 20  DG  J OP1   1 
ATOM   6591  O OP2   . DG  I 6 21  ? 156.935 140.356 189.793 1.00 192.81 ? 20  DG  J OP2   1 
ATOM   6592  O "O5'" . DG  I 6 21  ? 158.961 141.100 188.556 1.00 192.81 ? 20  DG  J "O5'" 1 
ATOM   6593  C "C5'" . DG  I 6 21  ? 159.578 142.218 187.924 1.00 192.81 ? 20  DG  J "C5'" 1 
ATOM   6594  C "C4'" . DG  I 6 21  ? 161.079 142.022 187.722 1.00 192.81 ? 20  DG  J "C4'" 1 
ATOM   6595  O "O4'" . DG  I 6 21  ? 161.662 141.298 188.828 1.00 192.81 ? 20  DG  J "O4'" 1 
ATOM   6596  C "C3'" . DG  I 6 21  ? 161.499 141.227 186.508 1.00 192.81 ? 20  DG  J "C3'" 1 
ATOM   6597  O "O3'" . DG  I 6 21  ? 162.817 141.583 186.230 1.00 192.81 ? 20  DG  J "O3'" 1 
ATOM   6598  C "C2'" . DG  I 6 21  ? 161.453 139.813 187.058 1.00 192.81 ? 20  DG  J "C2'" 1 
ATOM   6599  C "C1'" . DG  I 6 21  ? 162.184 140.065 188.356 1.00 192.81 ? 20  DG  J "C1'" 1 
ATOM   6600  N N9    . DG  I 6 21  ? 161.956 139.117 189.415 1.00 192.81 ? 20  DG  J N9    1 
ATOM   6601  C C8    . DG  I 6 21  ? 160.757 138.618 189.831 1.00 192.81 ? 20  DG  J C8    1 
ATOM   6602  N N7    . DG  I 6 21  ? 160.851 137.868 190.885 1.00 192.81 ? 20  DG  J N7    1 
ATOM   6603  C C5    . DG  I 6 21  ? 162.197 137.893 191.195 1.00 192.81 ? 20  DG  J C5    1 
ATOM   6604  C C6    . DG  I 6 21  ? 162.891 137.273 192.242 1.00 192.81 ? 20  DG  J C6    1 
ATOM   6605  O O6    . DG  I 6 21  ? 162.448 136.540 193.130 1.00 192.81 ? 20  DG  J O6    1 
ATOM   6606  N N1    . DG  I 6 21  ? 164.239 137.566 192.200 1.00 192.81 ? 20  DG  J N1    1 
ATOM   6607  C C2    . DG  I 6 21  ? 164.845 138.364 191.268 1.00 192.81 ? 20  DG  J C2    1 
ATOM   6608  N N2    . DG  I 6 21  ? 166.165 138.524 191.400 1.00 192.81 ? 20  DG  J N2    1 
ATOM   6609  N N3    . DG  I 6 21  ? 164.205 138.956 190.283 1.00 192.81 ? 20  DG  J N3    1 
ATOM   6610  C C4    . DG  I 6 21  ? 162.884 138.680 190.315 1.00 192.81 ? 20  DG  J C4    1 
ATOM   6611  P P     . DG  I 6 22  ? 163.280 141.873 184.733 1.00 183.56 ? 21  DG  J P     1 
ATOM   6612  O OP1   . DG  I 6 22  ? 164.196 143.027 184.771 1.00 183.56 ? 21  DG  J OP1   1 
ATOM   6613  O OP2   . DG  I 6 22  ? 162.051 141.954 183.927 1.00 183.56 ? 21  DG  J OP2   1 
ATOM   6614  O "O5'" . DG  I 6 22  ? 164.079 140.551 184.338 1.00 183.56 ? 21  DG  J "O5'" 1 
ATOM   6615  C "C5'" . DG  I 6 22  ? 165.241 140.632 183.561 1.00 183.56 ? 21  DG  J "C5'" 1 
ATOM   6616  C "C4'" . DG  I 6 22  ? 166.477 140.668 184.433 1.00 183.56 ? 21  DG  J "C4'" 1 
ATOM   6617  O "O4'" . DG  I 6 22  ? 166.169 140.127 185.735 1.00 183.56 ? 21  DG  J "O4'" 1 
ATOM   6618  C "C3'" . DG  I 6 22  ? 167.589 139.788 183.957 1.00 183.56 ? 21  DG  J "C3'" 1 
ATOM   6619  O "O3'" . DG  I 6 22  ? 168.735 140.093 184.708 1.00 183.56 ? 21  DG  J "O3'" 1 
ATOM   6620  C "C2'" . DG  I 6 22  ? 167.023 138.452 184.371 1.00 183.56 ? 21  DG  J "C2'" 1 
ATOM   6621  C "C1'" . DG  I 6 22  ? 166.643 138.792 185.799 1.00 183.56 ? 21  DG  J "C1'" 1 
ATOM   6622  N N9    . DG  I 6 22  ? 165.582 137.998 186.400 1.00 183.56 ? 21  DG  J N9    1 
ATOM   6623  C C8    . DG  I 6 22  ? 164.271 137.985 186.032 1.00 183.56 ? 21  DG  J C8    1 
ATOM   6624  N N7    . DG  I 6 22  ? 163.520 137.257 186.801 1.00 183.56 ? 21  DG  J N7    1 
ATOM   6625  C C5    . DG  I 6 22  ? 164.376 136.792 187.769 1.00 183.56 ? 21  DG  J C5    1 
ATOM   6626  C C6    . DG  I 6 22  ? 164.119 135.945 188.857 1.00 183.56 ? 21  DG  J C6    1 
ATOM   6627  O O6    . DG  I 6 22  ? 163.041 135.451 189.200 1.00 183.56 ? 21  DG  J O6    1 
ATOM   6628  N N1    . DG  I 6 22  ? 165.264 135.690 189.590 1.00 183.56 ? 21  DG  J N1    1 
ATOM   6629  C C2    . DG  I 6 22  ? 166.509 136.190 189.294 1.00 183.56 ? 21  DG  J C2    1 
ATOM   6630  N N2    . DG  I 6 22  ? 167.507 135.839 190.121 1.00 183.56 ? 21  DG  J N2    1 
ATOM   6631  N N3    . DG  I 6 22  ? 166.761 136.987 188.265 1.00 183.56 ? 21  DG  J N3    1 
ATOM   6632  C C4    . DG  I 6 22  ? 165.651 137.241 187.546 1.00 183.56 ? 21  DG  J C4    1 
ATOM   6633  P P     . DC  I 6 23  ? 170.198 139.892 184.091 1.00 188.62 ? 22  DC  J P     1 
ATOM   6634  O OP1   . DC  I 6 23  ? 171.100 140.859 184.743 1.00 188.62 ? 22  DC  J OP1   1 
ATOM   6635  O OP2   . DC  I 6 23  ? 170.069 139.867 182.623 1.00 188.62 ? 22  DC  J OP2   1 
ATOM   6636  O "O5'" . DC  I 6 23  ? 170.607 138.438 184.581 1.00 188.62 ? 22  DC  J "O5'" 1 
ATOM   6637  C "C5'" . DC  I 6 23  ? 170.363 138.069 185.917 1.00 188.62 ? 22  DC  J "C5'" 1 
ATOM   6638  C "C4'" . DC  I 6 23  ? 170.785 136.642 186.159 1.00 188.62 ? 22  DC  J "C4'" 1 
ATOM   6639  O "O4'" . DC  I 6 23  ? 169.680 135.901 186.740 1.00 188.62 ? 22  DC  J "O4'" 1 
ATOM   6640  C "C3'" . DC  I 6 23  ? 171.184 135.874 184.912 1.00 188.62 ? 22  DC  J "C3'" 1 
ATOM   6641  O "O3'" . DC  I 6 23  ? 172.157 134.932 185.267 1.00 188.62 ? 22  DC  J "O3'" 1 
ATOM   6642  C "C2'" . DC  I 6 23  ? 169.880 135.194 184.538 1.00 188.62 ? 22  DC  J "C2'" 1 
ATOM   6643  C "C1'" . DC  I 6 23  ? 169.377 134.805 185.916 1.00 188.62 ? 22  DC  J "C1'" 1 
ATOM   6644  N N1    . DC  I 6 23  ? 167.915 134.559 185.978 1.00 188.62 ? 22  DC  J N1    1 
ATOM   6645  C C2    . DC  I 6 23  ? 167.381 133.812 187.019 1.00 188.62 ? 22  DC  J C2    1 
ATOM   6646  O O2    . DC  I 6 23  ? 168.132 133.336 187.865 1.00 188.62 ? 22  DC  J O2    1 
ATOM   6647  N N3    . DC  I 6 23  ? 166.045 133.614 187.065 1.00 188.62 ? 22  DC  J N3    1 
ATOM   6648  C C4    . DC  I 6 23  ? 165.264 134.130 186.125 1.00 188.62 ? 22  DC  J C4    1 
ATOM   6649  N N4    . DC  I 6 23  ? 163.950 133.917 186.211 1.00 188.62 ? 22  DC  J N4    1 
ATOM   6650  C C5    . DC  I 6 23  ? 165.790 134.898 185.061 1.00 188.62 ? 22  DC  J C5    1 
ATOM   6651  C C6    . DC  I 6 23  ? 167.108 135.071 185.023 1.00 188.62 ? 22  DC  J C6    1 
ATOM   6652  P P     . DC  I 6 24  ? 173.248 134.419 184.208 1.00 200.96 ? 23  DC  J P     1 
ATOM   6653  O OP1   . DC  I 6 24  ? 174.467 135.231 184.395 1.00 200.96 ? 23  DC  J OP1   1 
ATOM   6654  O OP2   . DC  I 6 24  ? 172.617 134.361 182.875 1.00 200.96 ? 23  DC  J OP2   1 
ATOM   6655  O "O5'" . DC  I 6 24  ? 173.543 132.930 184.708 1.00 200.96 ? 23  DC  J "O5'" 1 
ATOM   6656  C "C5'" . DC  I 6 24  ? 173.672 132.678 186.109 1.00 200.96 ? 23  DC  J "C5'" 1 
ATOM   6657  C "C4'" . DC  I 6 24  ? 173.008 131.371 186.514 1.00 200.96 ? 23  DC  J "C4'" 1 
ATOM   6658  O "O4'" . DC  I 6 24  ? 171.563 131.535 186.594 1.00 200.96 ? 23  DC  J "O4'" 1 
ATOM   6659  C "C3'" . DC  I 6 24  ? 173.241 130.194 185.567 1.00 200.96 ? 23  DC  J "C3'" 1 
ATOM   6660  O "O3'" . DC  I 6 24  ? 173.458 129.030 186.332 1.00 200.96 ? 23  DC  J "O3'" 1 
ATOM   6661  C "C2'" . DC  I 6 24  ? 171.917 130.111 184.829 1.00 200.96 ? 23  DC  J "C2'" 1 
ATOM   6662  C "C1'" . DC  I 6 24  ? 170.969 130.432 185.961 1.00 200.96 ? 23  DC  J "C1'" 1 
ATOM   6663  N N1    . DC  I 6 24  ? 169.614 130.789 185.499 1.00 200.96 ? 23  DC  J N1    1 
ATOM   6664  C C2    . DC  I 6 24  ? 168.496 130.219 186.105 1.00 200.96 ? 23  DC  J C2    1 
ATOM   6665  O O2    . DC  I 6 24  ? 168.652 129.441 187.045 1.00 200.96 ? 23  DC  J O2    1 
ATOM   6666  N N3    . DC  I 6 24  ? 167.270 130.544 185.648 1.00 200.96 ? 23  DC  J N3    1 
ATOM   6667  C C4    . DC  I 6 24  ? 167.144 131.384 184.631 1.00 200.96 ? 23  DC  J C4    1 
ATOM   6668  N N4    . DC  I 6 24  ? 165.916 131.677 184.208 1.00 200.96 ? 23  DC  J N4    1 
ATOM   6669  C C5    . DC  I 6 24  ? 168.270 131.959 183.991 1.00 200.96 ? 23  DC  J C5    1 
ATOM   6670  C C6    . DC  I 6 24  ? 169.474 131.623 184.445 1.00 200.96 ? 23  DC  J C6    1 
ATOM   6671  P P     . DG  I 6 25  ? 174.154 127.730 185.695 1.00 211.69 ? 24  DG  J P     1 
ATOM   6672  O OP1   . DG  I 6 25  ? 175.587 128.039 185.515 1.00 211.69 ? 24  DG  J OP1   1 
ATOM   6673  O OP2   . DG  I 6 25  ? 173.355 127.233 184.555 1.00 211.69 ? 24  DG  J OP2   1 
ATOM   6674  O "O5'" . DG  I 6 25  ? 173.999 126.647 186.852 1.00 211.69 ? 24  DG  J "O5'" 1 
ATOM   6675  C "C5'" . DG  I 6 25  ? 173.043 126.860 187.879 1.00 211.69 ? 24  DG  J "C5'" 1 
ATOM   6676  C "C4'" . DG  I 6 25  ? 172.021 125.744 187.906 1.00 211.69 ? 24  DG  J "C4'" 1 
ATOM   6677  O "O4'" . DG  I 6 25  ? 170.733 126.251 187.481 1.00 211.69 ? 24  DG  J "O4'" 1 
ATOM   6678  C "C3'" . DG  I 6 25  ? 172.332 124.564 186.995 1.00 211.69 ? 24  DG  J "C3'" 1 
ATOM   6679  O "O3'" . DG  I 6 25  ? 171.998 123.366 187.653 1.00 211.69 ? 24  DG  J "O3'" 1 
ATOM   6680  C "C2'" . DG  I 6 25  ? 171.430 124.812 185.793 1.00 211.69 ? 24  DG  J "C2'" 1 
ATOM   6681  C "C1'" . DG  I 6 25  ? 170.222 125.436 186.456 1.00 211.69 ? 24  DG  J "C1'" 1 
ATOM   6682  N N9    . DG  I 6 25  ? 169.460 126.280 185.562 1.00 211.69 ? 24  DG  J N9    1 
ATOM   6683  C C8    . DG  I 6 25  ? 169.950 127.267 184.760 1.00 211.69 ? 24  DG  J C8    1 
ATOM   6684  N N7    . DG  I 6 25  ? 169.036 127.874 184.069 1.00 211.69 ? 24  DG  J N7    1 
ATOM   6685  C C5    . DG  I 6 25  ? 167.865 127.249 184.444 1.00 211.69 ? 24  DG  J C5    1 
ATOM   6686  C C6    . DG  I 6 25  ? 166.552 127.475 184.016 1.00 211.69 ? 24  DG  J C6    1 
ATOM   6687  O O6    . DG  I 6 25  ? 166.151 128.314 183.208 1.00 211.69 ? 24  DG  J O6    1 
ATOM   6688  N N1    . DG  I 6 25  ? 165.657 126.613 184.632 1.00 211.69 ? 24  DG  J N1    1 
ATOM   6689  C C2    . DG  I 6 25  ? 165.993 125.657 185.550 1.00 211.69 ? 24  DG  J C2    1 
ATOM   6690  N N2    . DG  I 6 25  ? 164.992 124.920 186.043 1.00 211.69 ? 24  DG  J N2    1 
ATOM   6691  N N3    . DG  I 6 25  ? 167.229 125.432 185.956 1.00 211.69 ? 24  DG  J N3    1 
ATOM   6692  C C4    . DG  I 6 25  ? 168.108 126.267 185.364 1.00 211.69 ? 24  DG  J C4    1 
ATOM   6693  P P     . DC  I 6 26  ? 172.335 121.951 186.981 1.00 212.01 ? 25  DC  J P     1 
ATOM   6694  O OP1   . DC  I 6 26  ? 172.562 120.988 188.078 1.00 212.01 ? 25  DC  J OP1   1 
ATOM   6695  O OP2   . DC  I 6 26  ? 173.386 122.155 185.962 1.00 212.01 ? 25  DC  J OP2   1 
ATOM   6696  O "O5'" . DC  I 6 26  ? 170.980 121.560 186.236 1.00 212.01 ? 25  DC  J "O5'" 1 
ATOM   6697  C "C5'" . DC  I 6 26  ? 170.586 120.209 186.169 1.00 212.01 ? 25  DC  J "C5'" 1 
ATOM   6698  C "C4'" . DC  I 6 26  ? 169.102 120.075 186.416 1.00 212.01 ? 25  DC  J "C4'" 1 
ATOM   6699  O "O4'" . DC  I 6 26  ? 168.454 121.331 186.085 1.00 212.01 ? 25  DC  J "O4'" 1 
ATOM   6700  C "C3'" . DC  I 6 26  ? 168.418 119.042 185.539 1.00 212.01 ? 25  DC  J "C3'" 1 
ATOM   6701  O "O3'" . DC  I 6 26  ? 167.200 118.620 186.140 1.00 212.01 ? 25  DC  J "O3'" 1 
ATOM   6702  C "C2'" . DC  I 6 26  ? 168.155 119.869 184.304 1.00 212.01 ? 25  DC  J "C2'" 1 
ATOM   6703  C "C1'" . DC  I 6 26  ? 167.642 121.139 184.950 1.00 212.01 ? 25  DC  J "C1'" 1 
ATOM   6704  N N1    . DC  I 6 26  ? 167.747 122.317 184.092 1.00 212.01 ? 25  DC  J N1    1 
ATOM   6705  C C2    . DC  I 6 26  ? 166.592 122.856 183.536 1.00 212.01 ? 25  DC  J C2    1 
ATOM   6706  O O2    . DC  I 6 26  ? 165.508 122.317 183.779 1.00 212.01 ? 25  DC  J O2    1 
ATOM   6707  N N3    . DC  I 6 26  ? 166.692 123.949 182.753 1.00 212.01 ? 25  DC  J N3    1 
ATOM   6708  C C4    . DC  I 6 26  ? 167.884 124.490 182.520 1.00 212.01 ? 25  DC  J C4    1 
ATOM   6709  N N4    . DC  I 6 26  ? 167.936 125.569 181.740 1.00 212.01 ? 25  DC  J N4    1 
ATOM   6710  C C5    . DC  I 6 26  ? 169.077 123.951 183.077 1.00 212.01 ? 25  DC  J C5    1 
ATOM   6711  C C6    . DC  I 6 26  ? 168.961 122.877 183.857 1.00 212.01 ? 25  DC  J C6    1 
ATOM   6712  P P     . DT  I 6 27  ? 166.522 117.225 185.718 1.00 207.68 ? 26  DT  J P     1 
ATOM   6713  O OP1   . DT  I 6 27  ? 166.549 116.352 186.908 1.00 207.68 ? 26  DT  J OP1   1 
ATOM   6714  O OP2   . DT  I 6 27  ? 167.121 116.758 184.450 1.00 207.68 ? 26  DT  J OP2   1 
ATOM   6715  O "O5'" . DT  I 6 27  ? 165.005 117.610 185.412 1.00 207.68 ? 26  DT  J "O5'" 1 
ATOM   6716  C "C5'" . DT  I 6 27  ? 164.716 118.727 184.598 1.00 207.68 ? 26  DT  J "C5'" 1 
ATOM   6717  C "C4'" . DT  I 6 27  ? 163.838 118.327 183.437 1.00 207.68 ? 26  DT  J "C4'" 1 
ATOM   6718  O "O4'" . DT  I 6 27  ? 163.840 119.385 182.443 1.00 207.68 ? 26  DT  J "O4'" 1 
ATOM   6719  C "C3'" . DT  I 6 27  ? 164.298 117.100 182.682 1.00 207.68 ? 26  DT  J "C3'" 1 
ATOM   6720  O "O3'" . DT  I 6 27  ? 163.208 116.607 181.957 1.00 207.68 ? 26  DT  J "O3'" 1 
ATOM   6721  C "C2'" . DT  I 6 27  ? 165.323 117.713 181.748 1.00 207.68 ? 26  DT  J "C2'" 1 
ATOM   6722  C "C1'" . DT  I 6 27  ? 164.554 118.950 181.299 1.00 207.68 ? 26  DT  J "C1'" 1 
ATOM   6723  N N1    . DT  I 6 27  ? 165.404 120.067 180.843 1.00 207.68 ? 26  DT  J N1    1 
ATOM   6724  C C2    . DT  I 6 27  ? 164.813 121.148 180.255 1.00 207.68 ? 26  DT  J C2    1 
ATOM   6725  O O2    . DT  I 6 27  ? 163.617 121.235 180.067 1.00 207.68 ? 26  DT  J O2    1 
ATOM   6726  N N3    . DT  I 6 27  ? 165.671 122.132 179.889 1.00 207.68 ? 26  DT  J N3    1 
ATOM   6727  C C4    . DT  I 6 27  ? 167.034 122.148 180.048 1.00 207.68 ? 26  DT  J C4    1 
ATOM   6728  O O4    . DT  I 6 27  ? 167.723 123.084 179.685 1.00 207.68 ? 26  DT  J O4    1 
ATOM   6729  C C5    . DT  I 6 27  ? 167.592 120.990 180.676 1.00 207.68 ? 26  DT  J C5    1 
ATOM   6730  C C7    . DT  I 6 27  ? 169.069 120.897 180.892 1.00 207.68 ? 26  DT  J C7    1 
ATOM   6731  C C6    . DT  I 6 27  ? 166.761 120.015 181.043 1.00 207.68 ? 26  DT  J C6    1 
ATOM   6732  P P     . DC  I 6 28  ? 163.131 115.074 181.500 1.00 205.01 ? 27  DC  J P     1 
ATOM   6733  O OP1   . DC  I 6 28  ? 162.969 114.254 182.718 1.00 205.01 ? 27  DC  J OP1   1 
ATOM   6734  O OP2   . DC  I 6 28  ? 164.247 114.801 180.569 1.00 205.01 ? 27  DC  J OP2   1 
ATOM   6735  O "O5'" . DC  I 6 28  ? 161.775 115.036 180.663 1.00 205.01 ? 27  DC  J "O5'" 1 
ATOM   6736  C "C5'" . DC  I 6 28  ? 161.068 116.253 180.423 1.00 205.01 ? 27  DC  J "C5'" 1 
ATOM   6737  C "C4'" . DC  I 6 28  ? 161.157 116.659 178.964 1.00 205.01 ? 27  DC  J "C4'" 1 
ATOM   6738  O "O4'" . DC  I 6 28  ? 162.238 117.610 178.774 1.00 205.01 ? 27  DC  J "O4'" 1 
ATOM   6739  C "C3'" . DC  I 6 28  ? 161.437 115.514 177.993 1.00 205.01 ? 27  DC  J "C3'" 1 
ATOM   6740  O "O3'" . DC  I 6 28  ? 160.655 115.683 176.838 1.00 205.01 ? 27  DC  J "O3'" 1 
ATOM   6741  C "C2'" . DC  I 6 28  ? 162.914 115.701 177.679 1.00 205.01 ? 27  DC  J "C2'" 1 
ATOM   6742  C "C1'" . DC  I 6 28  ? 162.985 117.208 177.656 1.00 205.01 ? 27  DC  J "C1'" 1 
ATOM   6743  N N1    . DC  I 6 28  ? 164.355 117.758 177.762 1.00 205.01 ? 27  DC  J N1    1 
ATOM   6744  C C2    . DC  I 6 28  ? 164.581 119.079 177.396 1.00 205.01 ? 27  DC  J C2    1 
ATOM   6745  O O2    . DC  I 6 28  ? 163.637 119.757 176.995 1.00 205.01 ? 27  DC  J O2    1 
ATOM   6746  N N3    . DC  I 6 28  ? 165.825 119.582 177.484 1.00 205.01 ? 27  DC  J N3    1 
ATOM   6747  C C4    . DC  I 6 28  ? 166.818 118.814 177.916 1.00 205.01 ? 27  DC  J C4    1 
ATOM   6748  N N4    . DC  I 6 28  ? 168.029 119.356 177.990 1.00 205.01 ? 27  DC  J N4    1 
ATOM   6749  C C5    . DC  I 6 28  ? 166.613 117.461 178.300 1.00 205.01 ? 27  DC  J C5    1 
ATOM   6750  C C6    . DC  I 6 28  ? 165.376 116.976 178.203 1.00 205.01 ? 27  DC  J C6    1 
ATOM   6751  P P     . DA  I 6 29  ? 159.776 114.468 176.271 1.00 201.10 ? 28  DA  J P     1 
ATOM   6752  O OP1   . DA  I 6 29  ? 158.762 114.146 177.297 1.00 201.10 ? 28  DA  J OP1   1 
ATOM   6753  O OP2   . DA  I 6 29  ? 160.701 113.424 175.781 1.00 201.10 ? 28  DA  J OP2   1 
ATOM   6754  O "O5'" . DA  I 6 29  ? 159.044 115.102 175.005 1.00 201.10 ? 28  DA  J "O5'" 1 
ATOM   6755  C "C5'" . DA  I 6 29  ? 158.429 116.370 175.120 1.00 201.10 ? 28  DA  J "C5'" 1 
ATOM   6756  C "C4'" . DA  I 6 29  ? 159.080 117.368 174.186 1.00 201.10 ? 28  DA  J "C4'" 1 
ATOM   6757  O "O4'" . DA  I 6 29  ? 160.435 117.613 174.599 1.00 201.10 ? 28  DA  J "O4'" 1 
ATOM   6758  C "C3'" . DA  I 6 29  ? 159.171 116.919 172.726 1.00 201.10 ? 28  DA  J "C3'" 1 
ATOM   6759  O "O3'" . DA  I 6 29  ? 158.348 117.730 171.932 1.00 201.10 ? 28  DA  J "O3'" 1 
ATOM   6760  C "C2'" . DA  I 6 29  ? 160.650 117.095 172.357 1.00 201.10 ? 28  DA  J "C2'" 1 
ATOM   6761  C "C1'" . DA  I 6 29  ? 161.151 117.997 173.466 1.00 201.10 ? 28  DA  J "C1'" 1 
ATOM   6762  N N9    . DA  I 6 29  ? 162.577 117.893 173.750 1.00 201.10 ? 28  DA  J N9    1 
ATOM   6763  C C8    . DA  I 6 29  ? 163.462 118.927 173.793 1.00 201.10 ? 28  DA  J C8    1 
ATOM   6764  N N7    . DA  I 6 29  ? 164.683 118.572 174.088 1.00 201.10 ? 28  DA  J N7    1 
ATOM   6765  C C5    . DA  I 6 29  ? 164.597 117.207 174.257 1.00 201.10 ? 28  DA  J C5    1 
ATOM   6766  C C6    . DA  I 6 29  ? 165.558 116.239 174.585 1.00 201.10 ? 28  DA  J C6    1 
ATOM   6767  N N6    . DA  I 6 29  ? 166.843 116.528 174.804 1.00 201.10 ? 28  DA  J N6    1 
ATOM   6768  N N1    . DA  I 6 29  ? 165.151 114.958 174.675 1.00 201.10 ? 28  DA  J N1    1 
ATOM   6769  C C2    . DA  I 6 29  ? 163.865 114.671 174.450 1.00 201.10 ? 28  DA  J C2    1 
ATOM   6770  N N3    . DA  I 6 29  ? 162.870 115.497 174.143 1.00 201.10 ? 28  DA  J N3    1 
ATOM   6771  C C4    . DA  I 6 29  ? 163.306 116.764 174.055 1.00 201.10 ? 28  DA  J C4    1 
ATOM   6772  P P     . DA  I 6 30  ? 157.404 117.056 170.827 1.00 195.64 ? 29  DA  J P     1 
ATOM   6773  O OP1   . DA  I 6 30  ? 156.017 117.119 171.334 1.00 195.64 ? 29  DA  J OP1   1 
ATOM   6774  O OP2   . DA  I 6 30  ? 158.011 115.756 170.470 1.00 195.64 ? 29  DA  J OP2   1 
ATOM   6775  O "O5'" . DA  I 6 30  ? 157.533 118.027 169.571 1.00 195.64 ? 29  DA  J "O5'" 1 
ATOM   6776  C "C5'" . DA  I 6 30  ? 157.162 119.383 169.698 1.00 195.64 ? 29  DA  J "C5'" 1 
ATOM   6777  C "C4'" . DA  I 6 30  ? 158.244 120.295 169.156 1.00 195.64 ? 29  DA  J "C4'" 1 
ATOM   6778  O "O4'" . DA  I 6 30  ? 159.538 119.837 169.611 1.00 195.64 ? 29  DA  J "O4'" 1 
ATOM   6779  C "C3'" . DA  I 6 30  ? 158.329 120.374 167.640 1.00 195.64 ? 29  DA  J "C3'" 1 
ATOM   6780  O "O3'" . DA  I 6 30  ? 158.641 121.702 167.258 1.00 195.64 ? 29  DA  J "O3'" 1 
ATOM   6781  C "C2'" . DA  I 6 30  ? 159.452 119.398 167.299 1.00 195.64 ? 29  DA  J "C2'" 1 
ATOM   6782  C "C1'" . DA  I 6 30  ? 160.352 119.488 168.516 1.00 195.64 ? 29  DA  J "C1'" 1 
ATOM   6783  N N9    . DA  I 6 30  ? 160.989 118.228 168.834 1.00 195.64 ? 29  DA  J N9    1 
ATOM   6784  C C8    . DA  I 6 30  ? 160.412 116.997 168.851 1.00 195.64 ? 29  DA  J C8    1 
ATOM   6785  N N7    . DA  I 6 30  ? 161.233 116.036 169.186 1.00 195.64 ? 29  DA  J N7    1 
ATOM   6786  C C5    . DA  I 6 30  ? 162.425 116.689 169.399 1.00 195.64 ? 29  DA  J C5    1 
ATOM   6787  C C6    . DA  I 6 30  ? 163.691 116.240 169.786 1.00 195.64 ? 29  DA  J C6    1 
ATOM   6788  N N6    . DA  I 6 30  ? 163.973 114.959 170.023 1.00 195.64 ? 29  DA  J N6    1 
ATOM   6789  N N1    . DA  I 6 30  ? 164.667 117.163 169.922 1.00 195.64 ? 29  DA  J N1    1 
ATOM   6790  C C2    . DA  I 6 30  ? 164.382 118.440 169.674 1.00 195.64 ? 29  DA  J C2    1 
ATOM   6791  N N3    . DA  I 6 30  ? 163.227 118.977 169.309 1.00 195.64 ? 29  DA  J N3    1 
ATOM   6792  C C4    . DA  I 6 30  ? 162.286 118.041 169.191 1.00 195.64 ? 29  DA  J C4    1 
ATOM   6793  P P     . DT  I 6 31  ? 158.794 122.110 165.713 1.00 185.63 ? 30  DT  J P     1 
ATOM   6794  O OP1   . DT  I 6 31  ? 158.330 123.507 165.599 1.00 185.63 ? 30  DT  J OP1   1 
ATOM   6795  O OP2   . DT  I 6 31  ? 158.191 121.075 164.845 1.00 185.63 ? 30  DT  J OP2   1 
ATOM   6796  O "O5'" . DT  I 6 31  ? 160.369 122.102 165.502 1.00 185.63 ? 30  DT  J "O5'" 1 
ATOM   6797  C "C5'" . DT  I 6 31  ? 161.189 122.625 166.519 1.00 185.63 ? 30  DT  J "C5'" 1 
ATOM   6798  C "C4'" . DT  I 6 31  ? 162.639 122.555 166.123 1.00 185.63 ? 30  DT  J "C4'" 1 
ATOM   6799  O "O4'" . DT  I 6 31  ? 163.159 121.232 166.403 1.00 185.63 ? 30  DT  J "O4'" 1 
ATOM   6800  C "C3'" . DT  I 6 31  ? 162.906 122.829 164.651 1.00 185.63 ? 30  DT  J "C3'" 1 
ATOM   6801  O "O3'" . DT  I 6 31  ? 163.951 123.769 164.544 1.00 185.63 ? 30  DT  J "O3'" 1 
ATOM   6802  C "C2'" . DT  I 6 31  ? 163.305 121.461 164.110 1.00 185.63 ? 30  DT  J "C2'" 1 
ATOM   6803  C "C1'" . DT  I 6 31  ? 163.923 120.789 165.318 1.00 185.63 ? 30  DT  J "C1'" 1 
ATOM   6804  N N1    . DT  I 6 31  ? 163.809 119.325 165.267 1.00 185.63 ? 30  DT  J N1    1 
ATOM   6805  C C2    . DT  I 6 31  ? 164.885 118.532 165.585 1.00 185.63 ? 30  DT  J C2    1 
ATOM   6806  O O2    . DT  I 6 31  ? 165.956 118.968 165.935 1.00 185.63 ? 30  DT  J O2    1 
ATOM   6807  N N3    . DT  I 6 31  ? 164.634 117.194 165.523 1.00 185.63 ? 30  DT  J N3    1 
ATOM   6808  C C4    . DT  I 6 31  ? 163.466 116.586 165.143 1.00 185.63 ? 30  DT  J C4    1 
ATOM   6809  O O4    . DT  I 6 31  ? 163.349 115.371 165.090 1.00 185.63 ? 30  DT  J O4    1 
ATOM   6810  C C5    . DT  I 6 31  ? 162.391 117.473 164.811 1.00 185.63 ? 30  DT  J C5    1 
ATOM   6811  C C7    . DT  I 6 31  ? 161.065 116.923 164.390 1.00 185.63 ? 30  DT  J C7    1 
ATOM   6812  C C6    . DT  I 6 31  ? 162.612 118.783 164.893 1.00 185.63 ? 30  DT  J C6    1 
ATOM   6813  P P     . DT  I 6 32  ? 164.345 124.445 163.143 1.00 177.28 ? 31  DT  J P     1 
ATOM   6814  O OP1   . DT  I 6 32  ? 164.305 125.901 163.360 1.00 177.28 ? 31  DT  J OP1   1 
ATOM   6815  O OP2   . DT  I 6 32  ? 163.585 123.867 162.023 1.00 177.28 ? 31  DT  J OP2   1 
ATOM   6816  O "O5'" . DT  I 6 32  ? 165.857 124.006 162.981 1.00 177.28 ? 31  DT  J "O5'" 1 
ATOM   6817  C "C5'" . DT  I 6 32  ? 166.634 123.870 164.139 1.00 177.28 ? 31  DT  J "C5'" 1 
ATOM   6818  C "C4'" . DT  I 6 32  ? 167.721 122.840 163.954 1.00 177.28 ? 31  DT  J "C4'" 1 
ATOM   6819  O "O4'" . DT  I 6 32  ? 167.169 121.497 164.003 1.00 177.28 ? 31  DT  J "O4'" 1 
ATOM   6820  C "C3'" . DT  I 6 32  ? 168.471 122.932 162.635 1.00 177.28 ? 31  DT  J "C3'" 1 
ATOM   6821  O "O3'" . DT  I 6 32  ? 169.835 122.787 162.890 1.00 177.28 ? 31  DT  J "O3'" 1 
ATOM   6822  C "C2'" . DT  I 6 32  ? 167.933 121.736 161.866 1.00 177.28 ? 31  DT  J "C2'" 1 
ATOM   6823  C "C1'" . DT  I 6 32  ? 167.794 120.747 162.997 1.00 177.28 ? 31  DT  J "C1'" 1 
ATOM   6824  N N1    . DT  I 6 32  ? 166.961 119.571 162.676 1.00 177.28 ? 31  DT  J N1    1 
ATOM   6825  C C2    . DT  I 6 32  ? 167.465 118.308 162.864 1.00 177.28 ? 31  DT  J C2    1 
ATOM   6826  O O2    . DT  I 6 32  ? 168.589 118.088 163.262 1.00 177.28 ? 31  DT  J O2    1 
ATOM   6827  N N3    . DT  I 6 32  ? 166.614 117.303 162.524 1.00 177.28 ? 31  DT  J N3    1 
ATOM   6828  C C4    . DT  I 6 32  ? 165.332 117.427 162.056 1.00 177.28 ? 31  DT  J C4    1 
ATOM   6829  O O4    . DT  I 6 32  ? 164.637 116.458 161.786 1.00 177.28 ? 31  DT  J O4    1 
ATOM   6830  C C5    . DT  I 6 32  ? 164.865 118.772 161.894 1.00 177.28 ? 31  DT  J C5    1 
ATOM   6831  C C7    . DT  I 6 32  ? 163.485 119.027 161.378 1.00 177.28 ? 31  DT  J C7    1 
ATOM   6832  C C6    . DT  I 6 32  ? 165.696 119.766 162.202 1.00 177.28 ? 31  DT  J C6    1 
ATOM   6833  P P     . DG  I 6 33  ? 170.914 123.454 161.915 1.00 179.73 ? 32  DG  J P     1 
ATOM   6834  O OP1   . DG  I 6 33  ? 171.641 124.462 162.718 1.00 179.73 ? 32  DG  J OP1   1 
ATOM   6835  O OP2   . DG  I 6 33  ? 170.224 123.869 160.678 1.00 179.73 ? 32  DG  J OP2   1 
ATOM   6836  O "O5'" . DG  I 6 33  ? 171.889 122.241 161.564 1.00 179.73 ? 32  DG  J "O5'" 1 
ATOM   6837  C "C5'" . DG  I 6 33  ? 172.752 121.742 162.558 1.00 179.73 ? 32  DG  J "C5'" 1 
ATOM   6838  C "C4'" . DG  I 6 33  ? 173.201 120.334 162.245 1.00 179.73 ? 32  DG  J "C4'" 1 
ATOM   6839  O "O4'" . DG  I 6 33  ? 172.053 119.458 162.201 1.00 179.73 ? 32  DG  J "O4'" 1 
ATOM   6840  C "C3'" . DG  I 6 33  ? 173.924 120.159 160.918 1.00 179.73 ? 32  DG  J "C3'" 1 
ATOM   6841  O "O3'" . DG  I 6 33  ? 175.027 119.307 161.102 1.00 179.73 ? 32  DG  J "O3'" 1 
ATOM   6842  C "C2'" . DG  I 6 33  ? 172.870 119.510 160.039 1.00 179.73 ? 32  DG  J "C2'" 1 
ATOM   6843  C "C1'" . DG  I 6 33  ? 172.110 118.673 161.045 1.00 179.73 ? 32  DG  J "C1'" 1 
ATOM   6844  N N9    . DG  I 6 33  ? 170.747 118.389 160.631 1.00 179.73 ? 32  DG  J N9    1 
ATOM   6845  C C8    . DG  I 6 33  ? 169.780 119.303 160.350 1.00 179.73 ? 32  DG  J C8    1 
ATOM   6846  N N7    . DG  I 6 33  ? 168.649 118.777 159.999 1.00 179.73 ? 32  DG  J N7    1 
ATOM   6847  C C5    . DG  I 6 33  ? 168.886 117.420 160.043 1.00 179.73 ? 32  DG  J C5    1 
ATOM   6848  C C6    . DG  I 6 33  ? 168.026 116.348 159.765 1.00 179.73 ? 32  DG  J C6    1 
ATOM   6849  O O6    . DG  I 6 33  ? 166.847 116.388 159.415 1.00 179.73 ? 32  DG  J O6    1 
ATOM   6850  N N1    . DG  I 6 33  ? 168.653 115.126 159.933 1.00 179.73 ? 32  DG  J N1    1 
ATOM   6851  C C2    . DG  I 6 33  ? 169.952 114.963 160.327 1.00 179.73 ? 32  DG  J C2    1 
ATOM   6852  N N2    . DG  I 6 33  ? 170.379 113.698 160.431 1.00 179.73 ? 32  DG  J N2    1 
ATOM   6853  N N3    . DG  I 6 33  ? 170.776 115.965 160.592 1.00 179.73 ? 32  DG  J N3    1 
ATOM   6854  C C4    . DG  I 6 33  ? 170.169 117.161 160.445 1.00 179.73 ? 32  DG  J C4    1 
ATOM   6855  P P     . DG  I 6 34  ? 176.139 119.157 159.957 1.00 185.34 ? 33  DG  J P     1 
ATOM   6856  O OP1   . DG  I 6 34  ? 177.462 119.153 160.608 1.00 185.34 ? 33  DG  J OP1   1 
ATOM   6857  O OP2   . DG  I 6 34  ? 175.852 120.130 158.886 1.00 185.34 ? 33  DG  J OP2   1 
ATOM   6858  O "O5'" . DG  I 6 34  ? 175.898 117.691 159.397 1.00 185.34 ? 33  DG  J "O5'" 1 
ATOM   6859  C "C5'" . DG  I 6 34  ? 176.283 116.583 160.180 1.00 185.34 ? 33  DG  J "C5'" 1 
ATOM   6860  C "C4'" . DG  I 6 34  ? 175.728 115.290 159.620 1.00 185.34 ? 33  DG  J "C4'" 1 
ATOM   6861  O "O4'" . DG  I 6 34  ? 174.290 115.386 159.482 1.00 185.34 ? 33  DG  J "O4'" 1 
ATOM   6862  C "C3'" . DG  I 6 34  ? 176.244 114.901 158.239 1.00 185.34 ? 33  DG  J "C3'" 1 
ATOM   6863  O "O3'" . DG  I 6 34  ? 176.402 113.508 158.191 1.00 185.34 ? 33  DG  J "O3'" 1 
ATOM   6864  C "C2'" . DG  I 6 34  ? 175.102 115.341 157.339 1.00 185.34 ? 33  DG  J "C2'" 1 
ATOM   6865  C "C1'" . DG  I 6 34  ? 173.944 114.930 158.205 1.00 185.34 ? 33  DG  J "C1'" 1 
ATOM   6866  N N9    . DG  I 6 34  ? 172.682 115.520 157.836 1.00 185.34 ? 33  DG  J N9    1 
ATOM   6867  C C8    . DG  I 6 34  ? 172.344 116.840 157.871 1.00 185.34 ? 33  DG  J C8    1 
ATOM   6868  N N7    . DG  I 6 34  ? 171.123 117.070 157.491 1.00 185.34 ? 33  DG  J N7    1 
ATOM   6869  C C5    . DG  I 6 34  ? 170.621 115.816 157.213 1.00 185.34 ? 33  DG  J C5    1 
ATOM   6870  C C6    . DG  I 6 34  ? 169.347 115.429 156.767 1.00 185.34 ? 33  DG  J C6    1 
ATOM   6871  O O6    . DG  I 6 34  ? 168.368 116.140 156.532 1.00 185.34 ? 33  DG  J O6    1 
ATOM   6872  N N1    . DG  I 6 34  ? 169.255 114.055 156.606 1.00 185.34 ? 33  DG  J N1    1 
ATOM   6873  C C2    . DG  I 6 34  ? 170.274 113.172 156.836 1.00 185.34 ? 33  DG  J C2    1 
ATOM   6874  N N2    . DG  I 6 34  ? 169.992 111.882 156.631 1.00 185.34 ? 33  DG  J N2    1 
ATOM   6875  N N3    . DG  I 6 34  ? 171.471 113.523 157.259 1.00 185.34 ? 33  DG  J N3    1 
ATOM   6876  C C4    . DG  I 6 34  ? 171.571 114.855 157.421 1.00 185.34 ? 33  DG  J C4    1 
ATOM   6877  P P     . DT  I 6 35  ? 177.460 112.850 157.186 1.00 188.66 ? 34  DT  J P     1 
ATOM   6878  O OP1   . DT  I 6 35  ? 178.494 112.205 158.017 1.00 188.66 ? 34  DT  J OP1   1 
ATOM   6879  O OP2   . DT  I 6 35  ? 177.836 113.862 156.181 1.00 188.66 ? 34  DT  J OP2   1 
ATOM   6880  O "O5'" . DT  I 6 35  ? 176.619 111.723 156.440 1.00 188.66 ? 34  DT  J "O5'" 1 
ATOM   6881  C "C5'" . DT  I 6 35  ? 175.242 111.918 156.222 1.00 188.66 ? 34  DT  J "C5'" 1 
ATOM   6882  C "C4'" . DT  I 6 35  ? 174.714 110.941 155.207 1.00 188.66 ? 34  DT  J "C4'" 1 
ATOM   6883  O "O4'" . DT  I 6 35  ? 173.329 111.251 154.921 1.00 188.66 ? 34  DT  J "O4'" 1 
ATOM   6884  C "C3'" . DT  I 6 35  ? 175.431 110.965 153.876 1.00 188.66 ? 34  DT  J "C3'" 1 
ATOM   6885  O "O3'" . DT  I 6 35  ? 175.405 109.671 153.313 1.00 188.66 ? 34  DT  J "O3'" 1 
ATOM   6886  C "C2'" . DT  I 6 35  ? 174.606 111.961 153.070 1.00 188.66 ? 34  DT  J "C2'" 1 
ATOM   6887  C "C1'" . DT  I 6 35  ? 173.198 111.740 153.607 1.00 188.66 ? 34  DT  J "C1'" 1 
ATOM   6888  N N1    . DT  I 6 35  ? 172.412 112.978 153.660 1.00 188.66 ? 34  DT  J N1    1 
ATOM   6889  C C2    . DT  I 6 35  ? 171.083 112.949 153.336 1.00 188.66 ? 34  DT  J C2    1 
ATOM   6890  O O2    . DT  I 6 35  ? 170.499 111.939 153.004 1.00 188.66 ? 34  DT  J O2    1 
ATOM   6891  N N3    . DT  I 6 35  ? 170.456 114.156 153.407 1.00 188.66 ? 34  DT  J N3    1 
ATOM   6892  C C4    . DT  I 6 35  ? 171.011 115.357 153.775 1.00 188.66 ? 34  DT  J C4    1 
ATOM   6893  O O4    . DT  I 6 35  ? 170.368 116.392 153.808 1.00 188.66 ? 34  DT  J O4    1 
ATOM   6894  C C5    . DT  I 6 35  ? 172.406 115.317 154.096 1.00 188.66 ? 34  DT  J C5    1 
ATOM   6895  C C7    . DT  I 6 35  ? 173.115 116.569 154.492 1.00 188.66 ? 34  DT  J C7    1 
ATOM   6896  C C6    . DT  I 6 35  ? 173.033 114.144 154.029 1.00 188.66 ? 34  DT  J C6    1 
ATOM   6897  P P     . DC  I 6 36  ? 176.124 109.362 151.912 1.00 193.54 ? 35  DC  J P     1 
ATOM   6898  O OP1   . DC  I 6 36  ? 176.615 107.971 151.978 1.00 193.54 ? 35  DC  J OP1   1 
ATOM   6899  O OP2   . DC  I 6 36  ? 177.077 110.446 151.588 1.00 193.54 ? 35  DC  J OP2   1 
ATOM   6900  O "O5'" . DC  I 6 36  ? 174.915 109.412 150.879 1.00 193.54 ? 35  DC  J "O5'" 1 
ATOM   6901  C "C5'" . DC  I 6 36  ? 173.661 108.867 151.255 1.00 193.54 ? 35  DC  J "C5'" 1 
ATOM   6902  C "C4'" . DC  I 6 36  ? 172.588 109.276 150.276 1.00 193.54 ? 35  DC  J "C4'" 1 
ATOM   6903  O "O4'" . DC  I 6 36  ? 171.958 110.512 150.712 1.00 193.54 ? 35  DC  J "O4'" 1 
ATOM   6904  C "C3'" . DC  I 6 36  ? 173.094 109.547 148.855 1.00 193.54 ? 35  DC  J "C3'" 1 
ATOM   6905  O "O3'" . DC  I 6 36  ? 172.217 108.967 147.928 1.00 193.54 ? 35  DC  J "O3'" 1 
ATOM   6906  C "C2'" . DC  I 6 36  ? 173.031 111.058 148.769 1.00 193.54 ? 35  DC  J "C2'" 1 
ATOM   6907  C "C1'" . DC  I 6 36  ? 171.778 111.297 149.571 1.00 193.54 ? 35  DC  J "C1'" 1 
ATOM   6908  N N1    . DC  I 6 36  ? 171.587 112.701 149.931 1.00 193.54 ? 35  DC  J N1    1 
ATOM   6909  C C2    . DC  I 6 36  ? 170.332 113.279 149.772 1.00 193.54 ? 35  DC  J C2    1 
ATOM   6910  O O2    . DC  I 6 36  ? 169.396 112.584 149.373 1.00 193.54 ? 35  DC  J O2    1 
ATOM   6911  N N3    . DC  I 6 36  ? 170.173 114.582 150.065 1.00 193.54 ? 35  DC  J N3    1 
ATOM   6912  C C4    . DC  I 6 36  ? 171.208 115.298 150.484 1.00 193.54 ? 35  DC  J C4    1 
ATOM   6913  N N4    . DC  I 6 36  ? 171.002 116.581 150.770 1.00 193.54 ? 35  DC  J N4    1 
ATOM   6914  C C5    . DC  I 6 36  ? 172.500 114.729 150.642 1.00 193.54 ? 35  DC  J C5    1 
ATOM   6915  C C6    . DC  I 6 36  ? 172.645 113.441 150.344 1.00 193.54 ? 35  DC  J C6    1 
ATOM   6916  P P     . DG  I 6 37  ? 172.684 108.696 146.416 1.00 194.63 ? 36  DG  J P     1 
ATOM   6917  O OP1   . DG  I 6 37  ? 173.837 107.772 146.464 1.00 194.63 ? 36  DG  J OP1   1 
ATOM   6918  O OP2   . DG  I 6 37  ? 172.813 109.981 145.700 1.00 194.63 ? 36  DG  J OP2   1 
ATOM   6919  O "O5'" . DG  I 6 37  ? 171.428 107.943 145.795 1.00 194.63 ? 36  DG  J "O5'" 1 
ATOM   6920  C "C5'" . DG  I 6 37  ? 170.214 107.899 146.530 1.00 194.63 ? 36  DG  J "C5'" 1 
ATOM   6921  C "C4'" . DG  I 6 37  ? 169.141 108.728 145.856 1.00 194.63 ? 36  DG  J "C4'" 1 
ATOM   6922  O "O4'" . DG  I 6 37  ? 169.095 110.054 146.442 1.00 194.63 ? 36  DG  J "O4'" 1 
ATOM   6923  C "C3'" . DG  I 6 37  ? 169.335 108.937 144.358 1.00 194.63 ? 36  DG  J "C3'" 1 
ATOM   6924  O "O3'" . DG  I 6 37  ? 168.097 108.795 143.702 1.00 194.63 ? 36  DG  J "O3'" 1 
ATOM   6925  C "C2'" . DG  I 6 37  ? 169.840 110.370 144.280 1.00 194.63 ? 36  DG  J "C2'" 1 
ATOM   6926  C "C1'" . DG  I 6 37  ? 169.064 111.004 145.410 1.00 194.63 ? 36  DG  J "C1'" 1 
ATOM   6927  N N9    . DG  I 6 37  ? 169.654 112.229 145.911 1.00 194.63 ? 36  DG  J N9    1 
ATOM   6928  C C8    . DG  I 6 37  ? 170.941 112.408 146.332 1.00 194.63 ? 36  DG  J C8    1 
ATOM   6929  N N7    . DG  I 6 37  ? 171.189 113.613 146.747 1.00 194.63 ? 36  DG  J N7    1 
ATOM   6930  C C5    . DG  I 6 37  ? 169.984 114.271 146.600 1.00 194.63 ? 36  DG  J C5    1 
ATOM   6931  C C6    . DG  I 6 37  ? 169.643 115.603 146.891 1.00 194.63 ? 36  DG  J C6    1 
ATOM   6932  O O6    . DG  I 6 37  ? 170.362 116.489 147.353 1.00 194.63 ? 36  DG  J O6    1 
ATOM   6933  N N1    . DG  I 6 37  ? 168.312 115.872 146.593 1.00 194.63 ? 36  DG  J N1    1 
ATOM   6934  C C2    . DG  I 6 37  ? 167.423 114.960 146.080 1.00 194.63 ? 36  DG  J C2    1 
ATOM   6935  N N2    . DG  I 6 37  ? 166.175 115.403 145.856 1.00 194.63 ? 36  DG  J N2    1 
ATOM   6936  N N3    . DG  I 6 37  ? 167.735 113.703 145.802 1.00 194.63 ? 36  DG  J N3    1 
ATOM   6937  C C4    . DG  I 6 37  ? 169.027 113.432 146.088 1.00 194.63 ? 36  DG  J C4    1 
ATOM   6938  P P     . DT  I 6 38  ? 168.044 108.275 142.187 1.00 190.69 ? 37  DT  J P     1 
ATOM   6939  O OP1   . DT  I 6 38  ? 167.361 106.967 142.183 1.00 190.69 ? 37  DT  J OP1   1 
ATOM   6940  O OP2   . DT  I 6 38  ? 169.403 108.397 141.619 1.00 190.69 ? 37  DT  J OP2   1 
ATOM   6941  O "O5'" . DT  I 6 38  ? 167.119 109.350 141.464 1.00 190.69 ? 37  DT  J "O5'" 1 
ATOM   6942  C "C5'" . DT  I 6 38  ? 167.469 110.707 141.535 1.00 190.69 ? 37  DT  J "C5'" 1 
ATOM   6943  C "C4'" . DT  I 6 38  ? 166.243 111.586 141.522 1.00 190.69 ? 37  DT  J "C4'" 1 
ATOM   6944  O "O4'" . DT  I 6 38  ? 166.452 112.711 142.415 1.00 190.69 ? 37  DT  J "O4'" 1 
ATOM   6945  C "C3'" . DT  I 6 38  ? 165.969 112.232 140.193 1.00 190.69 ? 37  DT  J "C3'" 1 
ATOM   6946  O "O3'" . DT  I 6 38  ? 164.647 112.727 140.200 1.00 190.69 ? 37  DT  J "O3'" 1 
ATOM   6947  C "C2'" . DT  I 6 38  ? 166.992 113.352 140.233 1.00 190.69 ? 37  DT  J "C2'" 1 
ATOM   6948  C "C1'" . DT  I 6 38  ? 166.800 113.855 141.652 1.00 190.69 ? 37  DT  J "C1'" 1 
ATOM   6949  N N1    . DT  I 6 38  ? 168.020 114.466 142.260 1.00 190.69 ? 37  DT  J N1    1 
ATOM   6950  C C2    . DT  I 6 38  ? 167.964 115.751 142.740 1.00 190.69 ? 37  DT  J C2    1 
ATOM   6951  O O2    . DT  I 6 38  ? 166.971 116.445 142.673 1.00 190.69 ? 37  DT  J O2    1 
ATOM   6952  N N3    . DT  I 6 38  ? 169.127 116.200 143.299 1.00 190.69 ? 37  DT  J N3    1 
ATOM   6953  C C4    . DT  I 6 38  ? 170.303 115.499 143.437 1.00 190.69 ? 37  DT  J C4    1 
ATOM   6954  O O4    . DT  I 6 38  ? 171.299 115.980 143.944 1.00 190.69 ? 37  DT  J O4    1 
ATOM   6955  C C5    . DT  I 6 38  ? 170.293 114.171 142.915 1.00 190.69 ? 37  DT  J C5    1 
ATOM   6956  C C7    . DT  I 6 38  ? 171.527 113.335 142.998 1.00 190.69 ? 37  DT  J C7    1 
ATOM   6957  C C6    . DT  I 6 38  ? 169.167 113.718 142.364 1.00 190.69 ? 37  DT  J C6    1 
ATOM   6958  P P     . DA  I 6 39  ? 164.086 113.627 138.996 1.00 184.75 ? 38  DA  J P     1 
ATOM   6959  O OP1   . DA  I 6 39  ? 162.633 113.370 138.924 1.00 184.75 ? 38  DA  J OP1   1 
ATOM   6960  O OP2   . DA  I 6 39  ? 164.907 113.421 137.782 1.00 184.75 ? 38  DA  J OP2   1 
ATOM   6961  O "O5'" . DA  I 6 39  ? 164.293 115.117 139.525 1.00 184.75 ? 38  DA  J "O5'" 1 
ATOM   6962  C "C5'" . DA  I 6 39  ? 163.231 116.052 139.425 1.00 184.75 ? 38  DA  J "C5'" 1 
ATOM   6963  C "C4'" . DA  I 6 39  ? 163.692 117.361 138.807 1.00 184.75 ? 38  DA  J "C4'" 1 
ATOM   6964  O "O4'" . DA  I 6 39  ? 164.986 117.734 139.333 1.00 184.75 ? 38  DA  J "O4'" 1 
ATOM   6965  C "C3'" . DA  I 6 39  ? 163.856 117.354 137.289 1.00 184.75 ? 38  DA  J "C3'" 1 
ATOM   6966  O "O3'" . DA  I 6 39  ? 163.642 118.672 136.764 1.00 184.75 ? 38  DA  J "O3'" 1 
ATOM   6967  C "C2'" . DA  I 6 39  ? 165.327 116.986 137.156 1.00 184.75 ? 38  DA  J "C2'" 1 
ATOM   6968  C "C1'" . DA  I 6 39  ? 165.900 117.852 138.268 1.00 184.75 ? 38  DA  J "C1'" 1 
ATOM   6969  N N9    . DA  I 6 39  ? 167.190 117.431 138.763 1.00 184.75 ? 38  DA  J N9    1 
ATOM   6970  C C8    . DA  I 6 39  ? 167.777 116.223 138.599 1.00 184.75 ? 38  DA  J C8    1 
ATOM   6971  N N7    . DA  I 6 39  ? 168.924 116.103 139.219 1.00 184.75 ? 38  DA  J N7    1 
ATOM   6972  C C5    . DA  I 6 39  ? 169.096 117.328 139.823 1.00 184.75 ? 38  DA  J C5    1 
ATOM   6973  C C6    . DA  I 6 39  ? 170.118 117.851 140.623 1.00 184.75 ? 38  DA  J C6    1 
ATOM   6974  N N6    . DA  I 6 39  ? 171.209 117.168 140.957 1.00 184.75 ? 38  DA  J N6    1 
ATOM   6975  N N1    . DA  I 6 39  ? 169.978 119.113 141.066 1.00 184.75 ? 38  DA  J N1    1 
ATOM   6976  C C2    . DA  I 6 39  ? 168.885 119.799 140.728 1.00 184.75 ? 38  DA  J C2    1 
ATOM   6977  N N3    . DA  I 6 39  ? 167.862 119.413 139.979 1.00 184.75 ? 38  DA  J N3    1 
ATOM   6978  C C4    . DA  I 6 39  ? 168.030 118.154 139.561 1.00 184.75 ? 38  DA  J C4    1 
ATOM   6979  P P     . DG  I 6 40  ? 162.215 119.421 136.815 1.00 184.62 ? 39  DG  J P     1 
ATOM   6980  O OP1   . DG  I 6 40  ? 161.124 118.592 137.373 1.00 184.62 ? 39  DG  J OP1   1 
ATOM   6981  O OP2   . DG  I 6 40  ? 162.020 119.965 135.460 1.00 184.62 ? 39  DG  J OP2   1 
ATOM   6982  O "O5'" . DG  I 6 40  ? 162.497 120.678 137.763 1.00 184.62 ? 39  DG  J "O5'" 1 
ATOM   6983  C "C5'" . DG  I 6 40  ? 163.837 120.981 138.159 1.00 184.62 ? 39  DG  J "C5'" 1 
ATOM   6984  C "C4'" . DG  I 6 40  ? 164.209 122.400 137.805 1.00 184.62 ? 39  DG  J "C4'" 1 
ATOM   6985  O "O4'" . DG  I 6 40  ? 165.625 122.469 137.571 1.00 184.62 ? 39  DG  J "O4'" 1 
ATOM   6986  C "C3'" . DG  I 6 40  ? 163.637 122.892 136.509 1.00 184.62 ? 39  DG  J "C3'" 1 
ATOM   6987  O "O3'" . DG  I 6 40  ? 163.891 124.288 136.405 1.00 184.62 ? 39  DG  J "O3'" 1 
ATOM   6988  C "C2'" . DG  I 6 40  ? 164.505 122.107 135.529 1.00 184.62 ? 39  DG  J "C2'" 1 
ATOM   6989  C "C1'" . DG  I 6 40  ? 165.874 122.251 136.193 1.00 184.62 ? 39  DG  J "C1'" 1 
ATOM   6990  N N9    . DG  I 6 40  ? 166.730 121.095 136.105 1.00 184.62 ? 39  DG  J N9    1 
ATOM   6991  C C8    . DG  I 6 40  ? 166.481 119.910 135.474 1.00 184.62 ? 39  DG  J C8    1 
ATOM   6992  N N7    . DG  I 6 40  ? 167.448 119.046 135.611 1.00 184.62 ? 39  DG  J N7    1 
ATOM   6993  C C5    . DG  I 6 40  ? 168.372 119.699 136.409 1.00 184.62 ? 39  DG  J C5    1 
ATOM   6994  C C6    . DG  I 6 40  ? 169.623 119.270 136.897 1.00 184.62 ? 39  DG  J C6    1 
ATOM   6995  O O6    . DG  I 6 40  ? 170.181 118.181 136.738 1.00 184.62 ? 39  DG  J O6    1 
ATOM   6996  N N1    . DG  I 6 40  ? 170.245 120.256 137.648 1.00 184.62 ? 39  DG  J N1    1 
ATOM   6997  C C2    . DG  I 6 40  ? 169.727 121.500 137.891 1.00 184.62 ? 39  DG  J C2    1 
ATOM   6998  N N2    . DG  I 6 40  ? 170.474 122.321 138.641 1.00 184.62 ? 39  DG  J N2    1 
ATOM   6999  N N3    . DG  I 6 40  ? 168.560 121.911 137.438 1.00 184.62 ? 39  DG  J N3    1 
ATOM   7000  C C4    . DG  I 6 40  ? 167.944 120.962 136.708 1.00 184.62 ? 39  DG  J C4    1 
ATOM   7001  P P     . DA  I 6 41  ? 162.848 125.379 136.966 1.00 183.71 ? 40  DA  J P     1 
ATOM   7002  O OP1   . DA  I 6 41  ? 162.043 124.815 138.068 1.00 183.71 ? 40  DA  J OP1   1 
ATOM   7003  O OP2   . DA  I 6 41  ? 162.163 125.946 135.792 1.00 183.71 ? 40  DA  J OP2   1 
ATOM   7004  O "O5'" . DA  I 6 41  ? 163.779 126.534 137.560 1.00 183.71 ? 40  DA  J "O5'" 1 
ATOM   7005  C "C5'" . DA  I 6 41  ? 164.162 126.507 138.926 1.00 183.71 ? 40  DA  J "C5'" 1 
ATOM   7006  C "C4'" . DA  I 6 41  ? 165.328 127.450 139.251 1.00 183.71 ? 40  DA  J "C4'" 1 
ATOM   7007  O "O4'" . DA  I 6 41  ? 166.583 126.881 138.833 1.00 183.71 ? 40  DA  J "O4'" 1 
ATOM   7008  C "C3'" . DA  I 6 41  ? 165.299 128.843 138.655 1.00 183.71 ? 40  DA  J "C3'" 1 
ATOM   7009  O "O3'" . DA  I 6 41  ? 165.933 129.731 139.570 1.00 183.71 ? 40  DA  J "O3'" 1 
ATOM   7010  C "C2'" . DA  I 6 41  ? 166.108 128.680 137.370 1.00 183.71 ? 40  DA  J "C2'" 1 
ATOM   7011  C "C1'" . DA  I 6 41  ? 167.088 127.562 137.705 1.00 183.71 ? 40  DA  J "C1'" 1 
ATOM   7012  N N9    . DA  I 6 41  ? 167.205 126.571 136.662 1.00 183.71 ? 40  DA  J N9    1 
ATOM   7013  C C8    . DA  I 6 41  ? 166.238 126.196 135.791 1.00 183.71 ? 40  DA  J C8    1 
ATOM   7014  N N7    . DA  I 6 41  ? 166.596 125.234 134.992 1.00 183.71 ? 40  DA  J N7    1 
ATOM   7015  C C5    . DA  I 6 41  ? 167.881 124.943 135.384 1.00 183.71 ? 40  DA  J C5    1 
ATOM   7016  C C6    . DA  I 6 41  ? 168.807 124.007 134.931 1.00 183.71 ? 40  DA  J C6    1 
ATOM   7017  N N6    . DA  I 6 41  ? 168.557 123.157 133.940 1.00 183.71 ? 40  DA  J N6    1 
ATOM   7018  N N1    . DA  I 6 41  ? 170.005 123.975 135.530 1.00 183.71 ? 40  DA  J N1    1 
ATOM   7019  C C2    . DA  I 6 41  ? 170.254 124.827 136.522 1.00 183.71 ? 40  DA  J C2    1 
ATOM   7020  N N3    . DA  I 6 41  ? 169.454 125.752 137.038 1.00 183.71 ? 40  DA  J N3    1 
ATOM   7021  C C4    . DA  I 6 41  ? 168.271 125.753 136.417 1.00 183.71 ? 40  DA  J C4    1 
ATOM   7022  P P     . DC  I 6 42  ? 166.314 131.241 139.175 1.00 192.53 ? 41  DC  J P     1 
ATOM   7023  O OP1   . DC  I 6 42  ? 166.333 131.978 140.449 1.00 192.53 ? 41  DC  J OP1   1 
ATOM   7024  O OP2   . DC  I 6 42  ? 165.447 131.741 138.091 1.00 192.53 ? 41  DC  J OP2   1 
ATOM   7025  O "O5'" . DC  I 6 42  ? 167.818 131.131 138.648 1.00 192.53 ? 41  DC  J "O5'" 1 
ATOM   7026  C "C5'" . DC  I 6 42  ? 168.776 130.438 139.428 1.00 192.53 ? 41  DC  J "C5'" 1 
ATOM   7027  C "C4'" . DC  I 6 42  ? 170.101 130.264 138.696 1.00 192.53 ? 41  DC  J "C4'" 1 
ATOM   7028  O "O4'" . DC  I 6 42  ? 170.016 129.202 137.708 1.00 192.53 ? 41  DC  J "O4'" 1 
ATOM   7029  C "C3'" . DC  I 6 42  ? 170.623 131.481 137.945 1.00 192.53 ? 41  DC  J "C3'" 1 
ATOM   7030  O "O3'" . DC  I 6 42  ? 172.010 131.513 138.106 1.00 192.53 ? 41  DC  J "O3'" 1 
ATOM   7031  C "C2'" . DC  I 6 42  ? 170.260 131.147 136.501 1.00 192.53 ? 41  DC  J "C2'" 1 
ATOM   7032  C "C1'" . DC  I 6 42  ? 170.563 129.665 136.494 1.00 192.53 ? 41  DC  J "C1'" 1 
ATOM   7033  N N1    . DC  I 6 42  ? 169.927 128.906 135.390 1.00 192.53 ? 41  DC  J N1    1 
ATOM   7034  C C2    . DC  I 6 42  ? 170.603 127.840 134.796 1.00 192.53 ? 41  DC  J C2    1 
ATOM   7035  O O2    . DC  I 6 42  ? 171.743 127.570 135.165 1.00 192.53 ? 41  DC  J O2    1 
ATOM   7036  N N3    . DC  I 6 42  ? 169.992 127.144 133.817 1.00 192.53 ? 41  DC  J N3    1 
ATOM   7037  C C4    . DC  I 6 42  ? 168.761 127.462 133.447 1.00 192.53 ? 41  DC  J C4    1 
ATOM   7038  N N4    . DC  I 6 42  ? 168.196 126.748 132.475 1.00 192.53 ? 41  DC  J N4    1 
ATOM   7039  C C5    . DC  I 6 42  ? 168.055 128.538 134.042 1.00 192.53 ? 41  DC  J C5    1 
ATOM   7040  C C6    . DC  I 6 42  ? 168.674 129.227 134.996 1.00 192.53 ? 41  DC  J C6    1 
ATOM   7041  P P     . DA  I 6 43  ? 172.837 132.880 138.009 1.00 205.11 ? 42  DA  J P     1 
ATOM   7042  O OP1   . DA  I 6 43  ? 172.779 133.513 139.342 1.00 205.11 ? 42  DA  J OP1   1 
ATOM   7043  O OP2   . DA  I 6 43  ? 172.395 133.629 136.814 1.00 205.11 ? 42  DA  J OP2   1 
ATOM   7044  O "O5'" . DA  I 6 43  ? 174.318 132.354 137.739 1.00 205.11 ? 42  DA  J "O5'" 1 
ATOM   7045  C "C5'" . DA  I 6 43  ? 174.540 130.948 137.670 1.00 205.11 ? 42  DA  J "C5'" 1 
ATOM   7046  C "C4'" . DA  I 6 43  ? 175.839 130.600 136.963 1.00 205.11 ? 42  DA  J "C4'" 1 
ATOM   7047  O "O4'" . DA  I 6 43  ? 175.565 129.739 135.840 1.00 205.11 ? 42  DA  J "O4'" 1 
ATOM   7048  C "C3'" . DA  I 6 43  ? 176.616 131.757 136.381 1.00 205.11 ? 42  DA  J "C3'" 1 
ATOM   7049  O "O3'" . DA  I 6 43  ? 177.978 131.394 136.298 1.00 205.11 ? 42  DA  J "O3'" 1 
ATOM   7050  C "C2'" . DA  I 6 43  ? 175.992 131.912 134.997 1.00 205.11 ? 42  DA  J "C2'" 1 
ATOM   7051  C "C1'" . DA  I 6 43  ? 175.572 130.489 134.645 1.00 205.11 ? 42  DA  J "C1'" 1 
ATOM   7052  N N9    . DA  I 6 43  ? 174.240 130.428 134.081 1.00 205.11 ? 42  DA  J N9    1 
ATOM   7053  C C8    . DA  I 6 43  ? 173.172 131.190 134.437 1.00 205.11 ? 42  DA  J C8    1 
ATOM   7054  N N7    . DA  I 6 43  ? 172.087 130.920 133.766 1.00 205.11 ? 42  DA  J N7    1 
ATOM   7055  C C5    . DA  I 6 43  ? 172.463 129.903 132.926 1.00 205.11 ? 42  DA  J C5    1 
ATOM   7056  C C6    . DA  I 6 43  ? 171.757 129.170 131.970 1.00 205.11 ? 42  DA  J C6    1 
ATOM   7057  N N6    . DA  I 6 43  ? 170.475 129.385 131.688 1.00 205.11 ? 42  DA  J N6    1 
ATOM   7058  N N1    . DA  I 6 43  ? 172.428 128.231 131.285 1.00 205.11 ? 42  DA  J N1    1 
ATOM   7059  C C2    . DA  I 6 43  ? 173.723 128.040 131.547 1.00 205.11 ? 42  DA  J C2    1 
ATOM   7060  N N3    . DA  I 6 43  ? 174.489 128.655 132.443 1.00 205.11 ? 42  DA  J N3    1 
ATOM   7061  C C4    . DA  I 6 43  ? 173.790 129.585 133.102 1.00 205.11 ? 42  DA  J C4    1 
ATOM   7062  P P     . DG  I 6 44  ? 179.068 132.411 135.703 1.00 215.61 ? 43  DG  J P     1 
ATOM   7063  O OP1   . DG  I 6 44  ? 180.354 132.079 136.352 1.00 215.61 ? 43  DG  J OP1   1 
ATOM   7064  O OP2   . DG  I 6 44  ? 178.543 133.791 135.776 1.00 215.61 ? 43  DG  J OP2   1 
ATOM   7065  O "O5'" . DG  I 6 44  ? 179.166 131.988 134.170 1.00 215.61 ? 43  DG  J "O5'" 1 
ATOM   7066  C "C5'" . DG  I 6 44  ? 179.279 130.618 133.834 1.00 215.61 ? 43  DG  J "C5'" 1 
ATOM   7067  C "C4'" . DG  I 6 44  ? 179.076 130.411 132.351 1.00 215.61 ? 43  DG  J "C4'" 1 
ATOM   7068  O "O4'" . DG  I 6 44  ? 177.664 130.271 132.056 1.00 215.61 ? 43  DG  J "O4'" 1 
ATOM   7069  C "C3'" . DG  I 6 44  ? 179.578 131.550 131.460 1.00 215.61 ? 43  DG  J "C3'" 1 
ATOM   7070  O "O3'" . DG  I 6 44  ? 180.287 131.000 130.379 1.00 215.61 ? 43  DG  J "O3'" 1 
ATOM   7071  C "C2'" . DG  I 6 44  ? 178.283 132.208 130.991 1.00 215.61 ? 43  DG  J "C2'" 1 
ATOM   7072  C "C1'" . DG  I 6 44  ? 177.401 130.993 130.888 1.00 215.61 ? 43  DG  J "C1'" 1 
ATOM   7073  N N9    . DG  I 6 44  ? 175.985 131.289 130.813 1.00 215.61 ? 43  DG  J N9    1 
ATOM   7074  C C8    . DG  I 6 44  ? 175.271 132.172 131.576 1.00 215.61 ? 43  DG  J C8    1 
ATOM   7075  N N7    . DG  I 6 44  ? 174.007 132.216 131.267 1.00 215.61 ? 43  DG  J N7    1 
ATOM   7076  C C5    . DG  I 6 44  ? 173.890 131.311 130.227 1.00 215.61 ? 43  DG  J C5    1 
ATOM   7077  C C6    . DG  I 6 44  ? 172.769 130.945 129.464 1.00 215.61 ? 43  DG  J C6    1 
ATOM   7078  O O6    . DG  I 6 44  ? 171.606 131.337 129.580 1.00 215.61 ? 43  DG  J O6    1 
ATOM   7079  N N1    . DG  I 6 44  ? 173.088 129.991 128.505 1.00 215.61 ? 43  DG  J N1    1 
ATOM   7080  C C2    . DG  I 6 44  ? 174.342 129.482 128.295 1.00 215.61 ? 43  DG  J C2    1 
ATOM   7081  N N2    . DG  I 6 44  ? 174.469 128.573 127.323 1.00 215.61 ? 43  DG  J N2    1 
ATOM   7082  N N3    . DG  I 6 44  ? 175.401 129.827 128.997 1.00 215.61 ? 43  DG  J N3    1 
ATOM   7083  C C4    . DG  I 6 44  ? 175.099 130.736 129.944 1.00 215.61 ? 43  DG  J C4    1 
ATOM   7084  P P     . DC  I 6 45  ? 181.309 131.890 129.522 1.00 220.49 ? 44  DC  J P     1 
ATOM   7085  O OP1   . DC  I 6 45  ? 182.648 131.288 129.691 1.00 220.49 ? 44  DC  J OP1   1 
ATOM   7086  O OP2   . DC  I 6 45  ? 181.105 133.320 129.835 1.00 220.49 ? 44  DC  J OP2   1 
ATOM   7087  O "O5'" . DC  I 6 45  ? 180.838 131.635 128.022 1.00 220.49 ? 44  DC  J "O5'" 1 
ATOM   7088  C "C5'" . DC  I 6 45  ? 180.756 130.309 127.536 1.00 220.49 ? 44  DC  J "C5'" 1 
ATOM   7089  C "C4'" . DC  I 6 45  ? 179.795 130.218 126.370 1.00 220.49 ? 44  DC  J "C4'" 1 
ATOM   7090  O "O4'" . DC  I 6 45  ? 178.442 130.456 126.834 1.00 220.49 ? 44  DC  J "O4'" 1 
ATOM   7091  C "C3'" . DC  I 6 45  ? 180.041 131.232 125.250 1.00 220.49 ? 44  DC  J "C3'" 1 
ATOM   7092  O "O3'" . DC  I 6 45  ? 179.968 130.582 123.995 1.00 220.49 ? 44  DC  J "O3'" 1 
ATOM   7093  C "C2'" . DC  I 6 45  ? 178.896 132.217 125.424 1.00 220.49 ? 44  DC  J "C2'" 1 
ATOM   7094  C "C1'" . DC  I 6 45  ? 177.806 131.293 125.911 1.00 220.49 ? 44  DC  J "C1'" 1 
ATOM   7095  N N1    . DC  I 6 45  ? 176.717 131.998 126.577 1.00 220.49 ? 44  DC  J N1    1 
ATOM   7096  C C2    . DC  I 6 45  ? 175.429 131.879 126.077 1.00 220.49 ? 44  DC  J C2    1 
ATOM   7097  O O2    . DC  I 6 45  ? 175.239 131.162 125.096 1.00 220.49 ? 44  DC  J O2    1 
ATOM   7098  N N3    . DC  I 6 45  ? 174.428 132.540 126.689 1.00 220.49 ? 44  DC  J N3    1 
ATOM   7099  C C4    . DC  I 6 45  ? 174.688 133.305 127.744 1.00 220.49 ? 44  DC  J C4    1 
ATOM   7100  N N4    . DC  I 6 45  ? 173.668 133.936 128.321 1.00 220.49 ? 44  DC  J N4    1 
ATOM   7101  C C5    . DC  I 6 45  ? 176.004 133.448 128.265 1.00 220.49 ? 44  DC  J C5    1 
ATOM   7102  C C6    . DC  I 6 45  ? 176.977 132.766 127.665 1.00 220.49 ? 44  DC  J C6    1 
ATOM   7103  P P     . DT  I 6 46  ? 180.754 131.179 122.728 1.00 221.05 ? 45  DT  J P     1 
ATOM   7104  O OP1   . DT  I 6 46  ? 180.590 130.227 121.608 1.00 221.05 ? 45  DT  J OP1   1 
ATOM   7105  O OP2   . DT  I 6 46  ? 182.109 131.550 123.189 1.00 221.05 ? 45  DT  J OP2   1 
ATOM   7106  O "O5'" . DT  I 6 46  ? 179.974 132.534 122.390 1.00 221.05 ? 45  DT  J "O5'" 1 
ATOM   7107  C "C5'" . DT  I 6 46  ? 179.647 132.853 121.057 1.00 221.05 ? 45  DT  J "C5'" 1 
ATOM   7108  C "C4'" . DT  I 6 46  ? 178.225 132.436 120.738 1.00 221.05 ? 45  DT  J "C4'" 1 
ATOM   7109  O "O4'" . DT  I 6 46  ? 177.452 132.371 121.948 1.00 221.05 ? 45  DT  J "O4'" 1 
ATOM   7110  C "C3'" . DT  I 6 46  ? 177.474 133.406 119.860 1.00 221.05 ? 45  DT  J "C3'" 1 
ATOM   7111  O "O3'" . DT  I 6 46  ? 177.748 133.119 118.514 1.00 221.05 ? 45  DT  J "O3'" 1 
ATOM   7112  C "C2'" . DT  I 6 46  ? 176.017 133.116 120.205 1.00 221.05 ? 45  DT  J "C2'" 1 
ATOM   7113  C "C1'" . DT  I 6 46  ? 176.091 132.627 121.651 1.00 221.05 ? 45  DT  J "C1'" 1 
ATOM   7114  N N1    . DT  I 6 46  ? 175.562 133.566 122.688 1.00 221.05 ? 45  DT  J N1    1 
ATOM   7115  C C2    . DT  I 6 46  ? 174.207 133.815 122.786 1.00 221.05 ? 45  DT  J C2    1 
ATOM   7116  O O2    . DT  I 6 46  ? 173.376 133.354 122.030 1.00 221.05 ? 45  DT  J O2    1 
ATOM   7117  N N3    . DT  I 6 46  ? 173.859 134.639 123.815 1.00 221.05 ? 45  DT  J N3    1 
ATOM   7118  C C4    . DT  I 6 46  ? 174.696 135.216 124.736 1.00 221.05 ? 45  DT  J C4    1 
ATOM   7119  O O4    . DT  I 6 46  ? 174.290 135.948 125.623 1.00 221.05 ? 45  DT  J O4    1 
ATOM   7120  C C5    . DT  I 6 46  ? 176.085 134.905 124.585 1.00 221.05 ? 45  DT  J C5    1 
ATOM   7121  C C7    . DT  I 6 46  ? 177.089 135.498 125.519 1.00 221.05 ? 45  DT  J C7    1 
ATOM   7122  C C6    . DT  I 6 46  ? 176.445 134.100 123.589 1.00 221.05 ? 45  DT  J C6    1 
ATOM   7123  P P     . DC  I 6 47  ? 178.399 134.247 117.582 1.00 214.19 ? 46  DC  J P     1 
ATOM   7124  O OP1   . DC  I 6 47  ? 179.202 133.562 116.548 1.00 214.19 ? 46  DC  J OP1   1 
ATOM   7125  O OP2   . DC  I 6 47  ? 179.023 135.246 118.474 1.00 214.19 ? 46  DC  J OP2   1 
ATOM   7126  O "O5'" . DC  I 6 47  ? 177.135 134.928 116.896 1.00 214.19 ? 46  DC  J "O5'" 1 
ATOM   7127  C "C5'" . DC  I 6 47  ? 176.160 134.114 116.289 1.00 214.19 ? 46  DC  J "C5'" 1 
ATOM   7128  C "C4'" . DC  I 6 47  ? 174.773 134.673 116.512 1.00 214.19 ? 46  DC  J "C4'" 1 
ATOM   7129  O "O4'" . DC  I 6 47  ? 174.554 134.893 117.927 1.00 214.19 ? 46  DC  J "O4'" 1 
ATOM   7130  C "C3'" . DC  I 6 47  ? 174.498 136.012 115.832 1.00 214.19 ? 46  DC  J "C3'" 1 
ATOM   7131  O "O3'" . DC  I 6 47  ? 173.199 135.995 115.289 1.00 214.19 ? 46  DC  J "O3'" 1 
ATOM   7132  C "C2'" . DC  I 6 47  ? 174.597 137.002 116.984 1.00 214.19 ? 46  DC  J "C2'" 1 
ATOM   7133  C "C1'" . DC  I 6 47  ? 174.018 136.175 118.110 1.00 214.19 ? 46  DC  J "C1'" 1 
ATOM   7134  N N1    . DC  I 6 47  ? 174.383 136.655 119.462 1.00 214.19 ? 46  DC  J N1    1 
ATOM   7135  C C2    . DC  I 6 47  ? 173.395 137.180 120.288 1.00 214.19 ? 46  DC  J C2    1 
ATOM   7136  O O2    . DC  I 6 47  ? 172.238 137.233 119.869 1.00 214.19 ? 46  DC  J O2    1 
ATOM   7137  N N3    . DC  I 6 47  ? 173.733 137.611 121.520 1.00 214.19 ? 46  DC  J N3    1 
ATOM   7138  C C4    . DC  I 6 47  ? 174.994 137.533 121.927 1.00 214.19 ? 46  DC  J C4    1 
ATOM   7139  N N4    . DC  I 6 47  ? 175.281 137.975 123.150 1.00 214.19 ? 46  DC  J N4    1 
ATOM   7140  C C5    . DC  I 6 47  ? 176.019 136.999 121.099 1.00 214.19 ? 46  DC  J C5    1 
ATOM   7141  C C6    . DC  I 6 47  ? 175.672 136.584 119.882 1.00 214.19 ? 46  DC  J C6    1 
ATOM   7142  P P     . DT  I 6 48  ? 172.857 136.851 113.977 1.00 211.86 ? 47  DT  J P     1 
ATOM   7143  O OP1   . DT  I 6 48  ? 172.806 135.921 112.831 1.00 211.86 ? 47  DT  J OP1   1 
ATOM   7144  O OP2   . DT  I 6 48  ? 173.772 138.007 113.937 1.00 211.86 ? 47  DT  J OP2   1 
ATOM   7145  O "O5'" . DT  I 6 48  ? 171.381 137.378 114.264 1.00 211.86 ? 47  DT  J "O5'" 1 
ATOM   7146  C "C5'" . DT  I 6 48  ? 170.958 137.573 115.600 1.00 211.86 ? 47  DT  J "C5'" 1 
ATOM   7147  C "C4'" . DT  I 6 48  ? 170.419 138.971 115.777 1.00 211.86 ? 47  DT  J "C4'" 1 
ATOM   7148  O "O4'" . DT  I 6 48  ? 170.788 139.470 117.092 1.00 211.86 ? 47  DT  J "O4'" 1 
ATOM   7149  C "C3'" . DT  I 6 48  ? 170.995 139.988 114.800 1.00 211.86 ? 47  DT  J "C3'" 1 
ATOM   7150  O "O3'" . DT  I 6 48  ? 170.100 141.061 114.671 1.00 211.86 ? 47  DT  J "O3'" 1 
ATOM   7151  C "C2'" . DT  I 6 48  ? 172.225 140.434 115.558 1.00 211.86 ? 47  DT  J "C2'" 1 
ATOM   7152  C "C1'" . DT  I 6 48  ? 171.585 140.619 116.917 1.00 211.86 ? 47  DT  J "C1'" 1 
ATOM   7153  N N1    . DT  I 6 48  ? 172.531 140.736 118.036 1.00 211.86 ? 47  DT  J N1    1 
ATOM   7154  C C2    . DT  I 6 48  ? 172.083 141.247 119.218 1.00 211.86 ? 47  DT  J C2    1 
ATOM   7155  O O2    . DT  I 6 48  ? 170.937 141.606 119.394 1.00 211.86 ? 47  DT  J O2    1 
ATOM   7156  N N3    . DT  I 6 48  ? 173.022 141.326 120.198 1.00 211.86 ? 47  DT  J N3    1 
ATOM   7157  C C4    . DT  I 6 48  ? 174.344 140.951 120.113 1.00 211.86 ? 47  DT  J C4    1 
ATOM   7158  O O4    . DT  I 6 48  ? 175.115 141.060 121.054 1.00 211.86 ? 47  DT  J O4    1 
ATOM   7159  C C5    . DT  I 6 48  ? 174.752 140.425 118.840 1.00 211.86 ? 47  DT  J C5    1 
ATOM   7160  C C7    . DT  I 6 48  ? 176.166 139.986 118.626 1.00 211.86 ? 47  DT  J C7    1 
ATOM   7161  C C6    . DT  I 6 48  ? 173.837 140.349 117.872 1.00 211.86 ? 47  DT  J C6    1 
ATOM   7162  P P     . DA  I 6 49  ? 169.078 141.139 113.439 1.00 209.15 ? 48  DA  J P     1 
ATOM   7163  O OP1   . DA  I 6 49  ? 168.546 139.787 113.173 1.00 209.15 ? 48  DA  J OP1   1 
ATOM   7164  O OP2   . DA  I 6 49  ? 169.755 141.892 112.364 1.00 209.15 ? 48  DA  J OP2   1 
ATOM   7165  O "O5'" . DA  I 6 49  ? 167.904 142.048 114.016 1.00 209.15 ? 48  DA  J "O5'" 1 
ATOM   7166  C "C5'" . DA  I 6 49  ? 167.659 142.059 115.414 1.00 209.15 ? 48  DA  J "C5'" 1 
ATOM   7167  C "C4'" . DA  I 6 49  ? 167.789 143.459 115.990 1.00 209.15 ? 48  DA  J "C4'" 1 
ATOM   7168  O "O4'" . DA  I 6 49  ? 168.984 143.557 116.802 1.00 209.15 ? 48  DA  J "O4'" 1 
ATOM   7169  C "C3'" . DA  I 6 49  ? 167.891 144.599 114.974 1.00 209.15 ? 48  DA  J "C3'" 1 
ATOM   7170  O "O3'" . DA  I 6 49  ? 167.267 145.761 115.502 1.00 209.15 ? 48  DA  J "O3'" 1 
ATOM   7171  C "C2'" . DA  I 6 49  ? 169.396 144.815 114.907 1.00 209.15 ? 48  DA  J "C2'" 1 
ATOM   7172  C "C1'" . DA  I 6 49  ? 169.733 144.669 116.375 1.00 209.15 ? 48  DA  J "C1'" 1 
ATOM   7173  N N9    . DA  I 6 49  ? 171.127 144.391 116.642 1.00 209.15 ? 48  DA  J N9    1 
ATOM   7174  C C8    . DA  I 6 49  ? 172.044 143.884 115.778 1.00 209.15 ? 48  DA  J C8    1 
ATOM   7175  N N7    . DA  I 6 49  ? 173.225 143.705 116.310 1.00 209.15 ? 48  DA  J N7    1 
ATOM   7176  C C5    . DA  I 6 49  ? 173.068 144.137 117.610 1.00 209.15 ? 48  DA  J C5    1 
ATOM   7177  C C6    . DA  I 6 49  ? 173.953 144.215 118.695 1.00 209.15 ? 48  DA  J C6    1 
ATOM   7178  N N6    . DA  I 6 49  ? 175.230 143.841 118.622 1.00 209.15 ? 48  DA  J N6    1 
ATOM   7179  N N1    . DA  I 6 49  ? 173.477 144.700 119.865 1.00 209.15 ? 48  DA  J N1    1 
ATOM   7180  C C2    . DA  I 6 49  ? 172.196 145.068 119.933 1.00 209.15 ? 48  DA  J C2    1 
ATOM   7181  N N3    . DA  I 6 49  ? 171.271 145.041 118.975 1.00 209.15 ? 48  DA  J N3    1 
ATOM   7182  C C4    . DA  I 6 49  ? 171.779 144.560 117.831 1.00 209.15 ? 48  DA  J C4    1 
ATOM   7183  P P     . DG  I 6 50  ? 165.674 145.971 115.454 1.00 205.47 ? 49  DG  J P     1 
ATOM   7184  O OP1   . DG  I 6 50  ? 164.988 144.745 114.996 1.00 205.47 ? 49  DG  J OP1   1 
ATOM   7185  O OP2   . DG  I 6 50  ? 165.449 147.235 114.726 1.00 205.47 ? 49  DG  J OP2   1 
ATOM   7186  O "O5'" . DG  I 6 50  ? 165.300 146.242 116.982 1.00 205.47 ? 49  DG  J "O5'" 1 
ATOM   7187  C "C5'" . DG  I 6 50  ? 166.315 146.143 117.970 1.00 205.47 ? 49  DG  J "C5'" 1 
ATOM   7188  C "C4'" . DG  I 6 50  ? 166.018 147.011 119.167 1.00 205.47 ? 49  DG  J "C4'" 1 
ATOM   7189  O "O4'" . DG  I 6 50  ? 167.263 147.457 119.737 1.00 205.47 ? 49  DG  J "O4'" 1 
ATOM   7190  C "C3'" . DG  I 6 50  ? 165.336 148.304 118.861 1.00 205.47 ? 49  DG  J "C3'" 1 
ATOM   7191  O "O3'" . DG  I 6 50  ? 165.025 148.899 120.093 1.00 205.47 ? 49  DG  J "O3'" 1 
ATOM   7192  C "C2'" . DG  I 6 50  ? 166.482 149.038 118.183 1.00 205.47 ? 49  DG  J "C2'" 1 
ATOM   7193  C "C1'" . DG  I 6 50  ? 167.628 148.686 119.129 1.00 205.47 ? 49  DG  J "C1'" 1 
ATOM   7194  N N9    . DG  I 6 50  ? 168.903 148.465 118.478 1.00 205.47 ? 49  DG  J N9    1 
ATOM   7195  C C8    . DG  I 6 50  ? 169.123 148.121 117.171 1.00 205.47 ? 49  DG  J C8    1 
ATOM   7196  N N7    . DG  I 6 50  ? 170.381 147.932 116.893 1.00 205.47 ? 49  DG  J N7    1 
ATOM   7197  C C5    . DG  I 6 50  ? 171.028 148.146 118.099 1.00 205.47 ? 49  DG  J C5    1 
ATOM   7198  C C6    . DG  I 6 50  ? 172.400 148.086 118.418 1.00 205.47 ? 49  DG  J C6    1 
ATOM   7199  O O6    . DG  I 6 50  ? 173.349 147.806 117.683 1.00 205.47 ? 49  DG  J O6    1 
ATOM   7200  N N1    . DG  I 6 50  ? 172.634 148.368 119.760 1.00 205.47 ? 49  DG  J N1    1 
ATOM   7201  C C2    . DG  I 6 50  ? 171.667 148.678 120.679 1.00 205.47 ? 49  DG  J C2    1 
ATOM   7202  N N2    . DG  I 6 50  ? 172.094 148.932 121.928 1.00 205.47 ? 49  DG  J N2    1 
ATOM   7203  N N3    . DG  I 6 50  ? 170.373 148.744 120.392 1.00 205.47 ? 49  DG  J N3    1 
ATOM   7204  C C4    . DG  I 6 50  ? 170.131 148.464 119.085 1.00 205.47 ? 49  DG  J C4    1 
ATOM   7205  P P     . DC  I 6 51  ? 163.940 150.068 120.209 1.00 200.64 ? 50  DC  J P     1 
ATOM   7206  O OP1   . DC  I 6 51  ? 162.830 149.534 121.027 1.00 200.64 ? 50  DC  J OP1   1 
ATOM   7207  O OP2   . DC  I 6 51  ? 163.678 150.608 118.859 1.00 200.64 ? 50  DC  J OP2   1 
ATOM   7208  O "O5'" . DC  I 6 51  ? 164.705 151.182 121.056 1.00 200.64 ? 50  DC  J "O5'" 1 
ATOM   7209  C "C5'" . DC  I 6 51  ? 165.395 150.809 122.240 1.00 200.64 ? 50  DC  J "C5'" 1 
ATOM   7210  C "C4'" . DC  I 6 51  ? 166.695 151.579 122.391 1.00 200.64 ? 50  DC  J "C4'" 1 
ATOM   7211  O "O4'" . DC  I 6 51  ? 167.638 151.179 121.360 1.00 200.64 ? 50  DC  J "O4'" 1 
ATOM   7212  C "C3'" . DC  I 6 51  ? 166.573 153.101 122.275 1.00 200.64 ? 50  DC  J "C3'" 1 
ATOM   7213  O "O3'" . DC  I 6 51  ? 167.391 153.706 123.247 1.00 200.64 ? 50  DC  J "O3'" 1 
ATOM   7214  C "C2'" . DC  I 6 51  ? 167.127 153.366 120.883 1.00 200.64 ? 50  DC  J "C2'" 1 
ATOM   7215  C "C1'" . DC  I 6 51  ? 168.235 152.340 120.859 1.00 200.64 ? 50  DC  J "C1'" 1 
ATOM   7216  N N1    . DC  I 6 51  ? 168.791 152.083 119.518 1.00 200.64 ? 50  DC  J N1    1 
ATOM   7217  C C2    . DC  I 6 51  ? 170.142 151.784 119.381 1.00 200.64 ? 50  DC  J C2    1 
ATOM   7218  O O2    . DC  I 6 51  ? 170.838 151.717 120.386 1.00 200.64 ? 50  DC  J O2    1 
ATOM   7219  N N3    . DC  I 6 51  ? 170.642 151.548 118.151 1.00 200.64 ? 50  DC  J N3    1 
ATOM   7220  C C4    . DC  I 6 51  ? 169.851 151.627 117.091 1.00 200.64 ? 50  DC  J C4    1 
ATOM   7221  N N4    . DC  I 6 51  ? 170.385 151.394 115.891 1.00 200.64 ? 50  DC  J N4    1 
ATOM   7222  C C5    . DC  I 6 51  ? 168.472 151.948 117.208 1.00 200.64 ? 50  DC  J C5    1 
ATOM   7223  C C6    . DC  I 6 51  ? 167.994 152.185 118.429 1.00 200.64 ? 50  DC  J C6    1 
ATOM   7224  P P     . DA  I 6 52  ? 166.755 154.439 124.522 1.00 190.09 ? 51  DA  J P     1 
ATOM   7225  O OP1   . DA  I 6 52  ? 165.893 153.459 125.208 1.00 190.09 ? 51  DA  J OP1   1 
ATOM   7226  O OP2   . DA  I 6 52  ? 166.198 155.737 124.093 1.00 190.09 ? 51  DA  J OP2   1 
ATOM   7227  O "O5'" . DA  I 6 52  ? 168.031 154.739 125.427 1.00 190.09 ? 51  DA  J "O5'" 1 
ATOM   7228  C "C5'" . DA  I 6 52  ? 169.088 153.804 125.449 1.00 190.09 ? 51  DA  J "C5'" 1 
ATOM   7229  C "C4'" . DA  I 6 52  ? 170.445 154.480 125.393 1.00 190.09 ? 51  DA  J "C4'" 1 
ATOM   7230  O "O4'" . DA  I 6 52  ? 171.086 154.201 124.124 1.00 190.09 ? 51  DA  J "O4'" 1 
ATOM   7231  C "C3'" . DA  I 6 52  ? 170.444 155.991 125.517 1.00 190.09 ? 51  DA  J "C3'" 1 
ATOM   7232  O "O3'" . DA  I 6 52  ? 171.646 156.378 126.133 1.00 190.09 ? 51  DA  J "O3'" 1 
ATOM   7233  C "C2'" . DA  I 6 52  ? 170.427 156.418 124.064 1.00 190.09 ? 51  DA  J "C2'" 1 
ATOM   7234  C "C1'" . DA  I 6 52  ? 171.390 155.412 123.481 1.00 190.09 ? 51  DA  J "C1'" 1 
ATOM   7235  N N9    . DA  I 6 52  ? 171.214 155.215 122.061 1.00 190.09 ? 51  DA  J N9    1 
ATOM   7236  C C8    . DA  I 6 52  ? 170.041 155.211 121.392 1.00 190.09 ? 51  DA  J C8    1 
ATOM   7237  N N7    . DA  I 6 52  ? 170.161 154.995 120.112 1.00 190.09 ? 51  DA  J N7    1 
ATOM   7238  C C5    . DA  I 6 52  ? 171.515 154.862 119.931 1.00 190.09 ? 51  DA  J C5    1 
ATOM   7239  C C6    . DA  I 6 52  ? 172.285 154.626 118.794 1.00 190.09 ? 51  DA  J C6    1 
ATOM   7240  N N6    . DA  I 6 52  ? 171.754 154.474 117.588 1.00 190.09 ? 51  DA  J N6    1 
ATOM   7241  N N1    . DA  I 6 52  ? 173.624 154.552 118.940 1.00 190.09 ? 51  DA  J N1    1 
ATOM   7242  C C2    . DA  I 6 52  ? 174.141 154.705 120.163 1.00 190.09 ? 51  DA  J C2    1 
ATOM   7243  N N3    . DA  I 6 52  ? 173.507 154.924 121.312 1.00 190.09 ? 51  DA  J N3    1 
ATOM   7244  C C4    . DA  I 6 52  ? 172.185 154.994 121.120 1.00 190.09 ? 51  DA  J C4    1 
ATOM   7245  P P     . DC  I 6 53  ? 171.818 157.832 126.781 1.00 195.12 ? 52  DC  J P     1 
ATOM   7246  O OP1   . DC  I 6 53  ? 172.100 157.638 128.212 1.00 195.12 ? 52  DC  J OP1   1 
ATOM   7247  O OP2   . DC  I 6 53  ? 170.711 158.710 126.368 1.00 195.12 ? 52  DC  J OP2   1 
ATOM   7248  O "O5'" . DC  I 6 53  ? 173.159 158.362 126.132 1.00 195.12 ? 52  DC  J "O5'" 1 
ATOM   7249  C "C5'" . DC  I 6 53  ? 174.329 157.622 126.306 1.00 195.12 ? 52  DC  J "C5'" 1 
ATOM   7250  C "C4'" . DC  I 6 53  ? 175.373 158.028 125.296 1.00 195.12 ? 52  DC  J "C4'" 1 
ATOM   7251  O "O4'" . DC  I 6 53  ? 174.968 157.600 123.974 1.00 195.12 ? 52  DC  J "O4'" 1 
ATOM   7252  C "C3'" . DC  I 6 53  ? 175.623 159.526 125.207 1.00 195.12 ? 52  DC  J "C3'" 1 
ATOM   7253  O "O3'" . DC  I 6 53  ? 177.005 159.767 125.183 1.00 195.12 ? 52  DC  J "O3'" 1 
ATOM   7254  C "C2'" . DC  I 6 53  ? 174.969 159.909 123.888 1.00 195.12 ? 52  DC  J "C2'" 1 
ATOM   7255  C "C1'" . DC  I 6 53  ? 175.139 158.653 123.069 1.00 195.12 ? 52  DC  J "C1'" 1 
ATOM   7256  N N1    . DC  I 6 53  ? 174.122 158.526 122.015 1.00 195.12 ? 52  DC  J N1    1 
ATOM   7257  C C2    . DC  I 6 53  ? 174.511 158.427 120.690 1.00 195.12 ? 52  DC  J C2    1 
ATOM   7258  O O2    . DC  I 6 53  ? 175.708 158.451 120.413 1.00 195.12 ? 52  DC  J O2    1 
ATOM   7259  N N3    . DC  I 6 53  ? 173.561 158.330 119.738 1.00 195.12 ? 52  DC  J N3    1 
ATOM   7260  C C4    . DC  I 6 53  ? 172.278 158.315 120.078 1.00 195.12 ? 52  DC  J C4    1 
ATOM   7261  N N4    . DC  I 6 53  ? 171.376 158.213 119.102 1.00 195.12 ? 52  DC  J N4    1 
ATOM   7262  C C5    . DC  I 6 53  ? 171.862 158.419 121.426 1.00 195.12 ? 52  DC  J C5    1 
ATOM   7263  C C6    . DC  I 6 53  ? 172.811 158.525 122.352 1.00 195.12 ? 52  DC  J C6    1 
ATOM   7264  P P     . DC  I 6 54  ? 177.598 161.203 125.582 1.00 208.18 ? 53  DC  J P     1 
ATOM   7265  O OP1   . DC  I 6 54  ? 178.255 161.059 126.893 1.00 208.18 ? 53  DC  J OP1   1 
ATOM   7266  O OP2   . DC  I 6 54  ? 176.574 162.252 125.406 1.00 208.18 ? 53  DC  J OP2   1 
ATOM   7267  O "O5'" . DC  I 6 54  ? 178.723 161.433 124.488 1.00 208.18 ? 53  DC  J "O5'" 1 
ATOM   7268  C "C5'" . DC  I 6 54  ? 178.660 160.716 123.273 1.00 208.18 ? 53  DC  J "C5'" 1 
ATOM   7269  C "C4'" . DC  I 6 54  ? 178.727 161.664 122.103 1.00 208.18 ? 53  DC  J "C4'" 1 
ATOM   7270  O "O4'" . DC  I 6 54  ? 177.750 161.276 121.100 1.00 208.18 ? 53  DC  J "O4'" 1 
ATOM   7271  C "C3'" . DC  I 6 54  ? 178.416 163.113 122.462 1.00 208.18 ? 53  DC  J "C3'" 1 
ATOM   7272  O "O3'" . DC  I 6 54  ? 179.353 163.968 121.849 1.00 208.18 ? 53  DC  J "O3'" 1 
ATOM   7273  C "C2'" . DC  I 6 54  ? 177.027 163.310 121.885 1.00 208.18 ? 53  DC  J "C2'" 1 
ATOM   7274  C "C1'" . DC  I 6 54  ? 177.108 162.431 120.655 1.00 208.18 ? 53  DC  J "C1'" 1 
ATOM   7275  N N1    . DC  I 6 54  ? 175.782 162.094 120.103 1.00 208.18 ? 53  DC  J N1    1 
ATOM   7276  C C2    . DC  I 6 54  ? 175.583 162.064 118.725 1.00 208.18 ? 53  DC  J C2    1 
ATOM   7277  O O2    . DC  I 6 54  ? 176.529 162.280 117.970 1.00 208.18 ? 53  DC  J O2    1 
ATOM   7278  N N3    . DC  I 6 54  ? 174.350 161.790 118.254 1.00 208.18 ? 53  DC  J N3    1 
ATOM   7279  C C4    . DC  I 6 54  ? 173.349 161.565 119.093 1.00 208.18 ? 53  DC  J C4    1 
ATOM   7280  N N4    . DC  I 6 54  ? 172.150 161.300 118.577 1.00 208.18 ? 53  DC  J N4    1 
ATOM   7281  C C5    . DC  I 6 54  ? 173.528 161.611 120.495 1.00 208.18 ? 53  DC  J C5    1 
ATOM   7282  C C6    . DC  I 6 54  ? 174.748 161.882 120.949 1.00 208.18 ? 53  DC  J C6    1 
ATOM   7283  P P     . DG  I 6 55  ? 179.697 165.396 122.497 1.00 213.22 ? 54  DG  J P     1 
ATOM   7284  O OP1   . DG  I 6 55  ? 181.077 165.322 123.013 1.00 213.22 ? 54  DG  J OP1   1 
ATOM   7285  O OP2   . DG  I 6 55  ? 178.600 165.805 123.394 1.00 213.22 ? 54  DG  J OP2   1 
ATOM   7286  O "O5'" . DG  I 6 55  ? 179.691 166.381 121.249 1.00 213.22 ? 54  DG  J "O5'" 1 
ATOM   7287  C "C5'" . DG  I 6 55  ? 180.665 166.225 120.253 1.00 213.22 ? 54  DG  J "C5'" 1 
ATOM   7288  C "C4'" . DG  I 6 55  ? 180.096 166.535 118.897 1.00 213.22 ? 54  DG  J "C4'" 1 
ATOM   7289  O "O4'" . DG  I 6 55  ? 178.947 165.688 118.649 1.00 213.22 ? 54  DG  J "O4'" 1 
ATOM   7290  C "C3'" . DG  I 6 55  ? 179.614 167.974 118.745 1.00 213.22 ? 54  DG  J "C3'" 1 
ATOM   7291  O "O3'" . DG  I 6 55  ? 180.301 168.614 117.683 1.00 213.22 ? 54  DG  J "O3'" 1 
ATOM   7292  C "C2'" . DG  I 6 55  ? 178.128 167.834 118.456 1.00 213.22 ? 54  DG  J "C2'" 1 
ATOM   7293  C "C1'" . DG  I 6 55  ? 178.010 166.421 117.920 1.00 213.22 ? 54  DG  J "C1'" 1 
ATOM   7294  N N9    . DG  I 6 55  ? 176.688 165.876 118.161 1.00 213.22 ? 54  DG  J N9    1 
ATOM   7295  C C8    . DG  I 6 55  ? 176.170 165.519 119.367 1.00 213.22 ? 54  DG  J C8    1 
ATOM   7296  N N7    . DG  I 6 55  ? 174.944 165.098 119.306 1.00 213.22 ? 54  DG  J N7    1 
ATOM   7297  C C5    . DG  I 6 55  ? 174.614 165.220 117.970 1.00 213.22 ? 54  DG  J C5    1 
ATOM   7298  C C6    . DG  I 6 55  ? 173.409 164.919 117.308 1.00 213.22 ? 54  DG  J C6    1 
ATOM   7299  O O6    . DG  I 6 55  ? 172.365 164.475 117.792 1.00 213.22 ? 54  DG  J O6    1 
ATOM   7300  N N1    . DG  I 6 55  ? 173.486 165.191 115.952 1.00 213.22 ? 54  DG  J N1    1 
ATOM   7301  C C2    . DG  I 6 55  ? 174.594 165.675 115.314 1.00 213.22 ? 54  DG  J C2    1 
ATOM   7302  N N2    . DG  I 6 55  ? 174.478 165.868 113.995 1.00 213.22 ? 54  DG  J N2    1 
ATOM   7303  N N3    . DG  I 6 55  ? 175.736 165.960 115.925 1.00 213.22 ? 54  DG  J N3    1 
ATOM   7304  C C4    . DG  I 6 55  ? 175.679 165.686 117.246 1.00 213.22 ? 54  DG  J C4    1 
ATOM   7305  P P     . DC  I 6 56  ? 180.082 170.178 117.391 1.00 211.57 ? 55  DC  J P     1 
ATOM   7306  O OP1   . DC  I 6 56  ? 181.380 170.718 116.940 1.00 211.57 ? 55  DC  J OP1   1 
ATOM   7307  O OP2   . DC  I 6 56  ? 179.405 170.810 118.542 1.00 211.57 ? 55  DC  J OP2   1 
ATOM   7308  O "O5'" . DC  I 6 56  ? 179.089 170.181 116.147 1.00 211.57 ? 55  DC  J "O5'" 1 
ATOM   7309  C "C5'" . DC  I 6 56  ? 179.458 169.500 114.963 1.00 211.57 ? 55  DC  J "C5'" 1 
ATOM   7310  C "C4'" . DC  I 6 56  ? 178.403 169.651 113.883 1.00 211.57 ? 55  DC  J "C4'" 1 
ATOM   7311  O "O4'" . DC  I 6 56  ? 177.220 168.901 114.242 1.00 211.57 ? 55  DC  J "O4'" 1 
ATOM   7312  C "C3'" . DC  I 6 56  ? 177.935 171.076 113.622 1.00 211.57 ? 55  DC  J "C3'" 1 
ATOM   7313  O "O3'" . DC  I 6 56  ? 177.783 171.278 112.243 1.00 211.57 ? 55  DC  J "O3'" 1 
ATOM   7314  C "C2'" . DC  I 6 56  ? 176.589 171.135 114.326 1.00 211.57 ? 55  DC  J "C2'" 1 
ATOM   7315  C "C1'" . DC  I 6 56  ? 176.084 169.723 114.137 1.00 211.57 ? 55  DC  J "C1'" 1 
ATOM   7316  N N1    . DC  I 6 56  ? 175.167 169.313 115.178 1.00 211.57 ? 55  DC  J N1    1 
ATOM   7317  C C2    . DC  I 6 56  ? 173.845 169.030 114.874 1.00 211.57 ? 55  DC  J C2    1 
ATOM   7318  O O2    . DC  I 6 56  ? 173.459 169.145 113.713 1.00 211.57 ? 55  DC  J O2    1 
ATOM   7319  N N3    . DC  I 6 56  ? 173.021 168.636 115.866 1.00 211.57 ? 55  DC  J N3    1 
ATOM   7320  C C4    . DC  I 6 56  ? 173.483 168.523 117.104 1.00 211.57 ? 55  DC  J C4    1 
ATOM   7321  N N4    . DC  I 6 56  ? 172.641 168.132 118.059 1.00 211.57 ? 55  DC  J N4    1 
ATOM   7322  C C5    . DC  I 6 56  ? 174.824 168.828 117.426 1.00 211.57 ? 55  DC  J C5    1 
ATOM   7323  C C6    . DC  I 6 56  ? 175.625 169.190 116.435 1.00 211.57 ? 55  DC  J C6    1 
ATOM   7324  P P     . DT  I 6 57  ? 177.502 172.754 111.691 1.00 209.09 ? 56  DT  J P     1 
ATOM   7325  O OP1   . DT  I 6 57  ? 178.093 172.840 110.341 1.00 209.09 ? 56  DT  J OP1   1 
ATOM   7326  O OP2   . DT  I 6 57  ? 177.902 173.676 112.768 1.00 209.09 ? 56  DT  J OP2   1 
ATOM   7327  O "O5'" . DT  I 6 57  ? 175.913 172.842 111.583 1.00 209.09 ? 56  DT  J "O5'" 1 
ATOM   7328  C "C5'" . DT  I 6 57  ? 175.202 171.845 110.885 1.00 209.09 ? 56  DT  J "C5'" 1 
ATOM   7329  C "C4'" . DT  I 6 57  ? 173.765 172.262 110.618 1.00 209.09 ? 56  DT  J "C4'" 1 
ATOM   7330  O "O4'" . DT  I 6 57  ? 172.891 171.773 111.666 1.00 209.09 ? 56  DT  J "O4'" 1 
ATOM   7331  C "C3'" . DT  I 6 57  ? 173.507 173.753 110.529 1.00 209.09 ? 56  DT  J "C3'" 1 
ATOM   7332  O "O3'" . DT  I 6 57  ? 172.529 173.965 109.547 1.00 209.09 ? 56  DT  J "O3'" 1 
ATOM   7333  C "C2'" . DT  I 6 57  ? 172.968 174.076 111.919 1.00 209.09 ? 56  DT  J "C2'" 1 
ATOM   7334  C "C1'" . DT  I 6 57  ? 172.139 172.841 112.198 1.00 209.09 ? 56  DT  J "C1'" 1 
ATOM   7335  N N1    . DT  I 6 57  ? 171.926 172.542 113.633 1.00 209.09 ? 56  DT  J N1    1 
ATOM   7336  C C2    . DT  I 6 57  ? 170.683 172.155 114.069 1.00 209.09 ? 56  DT  J C2    1 
ATOM   7337  O O2    . DT  I 6 57  ? 169.710 172.098 113.351 1.00 209.09 ? 56  DT  J O2    1 
ATOM   7338  N N3    . DT  I 6 57  ? 170.618 171.845 115.391 1.00 209.09 ? 56  DT  J N3    1 
ATOM   7339  C C4    . DT  I 6 57  ? 171.636 171.861 116.296 1.00 209.09 ? 56  DT  J C4    1 
ATOM   7340  O O4    . DT  I 6 57  ? 171.474 171.570 117.471 1.00 209.09 ? 56  DT  J O4    1 
ATOM   7341  C C5    . DT  I 6 57  ? 172.908 172.259 115.779 1.00 209.09 ? 56  DT  J C5    1 
ATOM   7342  C C7    . DT  I 6 57  ? 174.084 172.332 116.693 1.00 209.09 ? 56  DT  J C7    1 
ATOM   7343  C C6    . DT  I 6 57  ? 172.998 172.558 114.482 1.00 209.09 ? 56  DT  J C6    1 
ATOM   7344  P P     . DT  I 6 58  ? 172.426 175.363 108.776 1.00 204.95 ? 57  DT  J P     1 
ATOM   7345  O OP1   . DT  I 6 58  ? 172.119 175.047 107.368 1.00 204.95 ? 57  DT  J OP1   1 
ATOM   7346  O OP2   . DT  I 6 58  ? 173.619 176.166 109.098 1.00 204.95 ? 57  DT  J OP2   1 
ATOM   7347  O "O5'" . DT  I 6 58  ? 171.134 176.038 109.417 1.00 204.95 ? 57  DT  J "O5'" 1 
ATOM   7348  C "C5'" . DT  I 6 58  ? 169.892 175.393 109.270 1.00 204.95 ? 57  DT  J "C5'" 1 
ATOM   7349  C "C4'" . DT  I 6 58  ? 168.866 175.943 110.233 1.00 204.95 ? 57  DT  J "C4'" 1 
ATOM   7350  O "O4'" . DT  I 6 58  ? 169.045 175.355 111.542 1.00 204.95 ? 57  DT  J "O4'" 1 
ATOM   7351  C "C3'" . DT  I 6 58  ? 168.908 177.455 110.446 1.00 204.95 ? 57  DT  J "C3'" 1 
ATOM   7352  O "O3'" . DT  I 6 58  ? 167.596 177.942 110.439 1.00 204.95 ? 57  DT  J "O3'" 1 
ATOM   7353  C "C2'" . DT  I 6 58  ? 169.516 177.574 111.832 1.00 204.95 ? 57  DT  J "C2'" 1 
ATOM   7354  C "C1'" . DT  I 6 58  ? 168.896 176.371 112.489 1.00 204.95 ? 57  DT  J "C1'" 1 
ATOM   7355  N N1    . DT  I 6 58  ? 169.564 175.969 113.719 1.00 204.95 ? 57  DT  J N1    1 
ATOM   7356  C C2    . DT  I 6 58  ? 168.828 175.411 114.717 1.00 204.95 ? 57  DT  J C2    1 
ATOM   7357  O O2    . DT  I 6 58  ? 167.629 175.249 114.645 1.00 204.95 ? 57  DT  J O2    1 
ATOM   7358  N N3    . DT  I 6 58  ? 169.535 175.074 115.825 1.00 204.95 ? 57  DT  J N3    1 
ATOM   7359  C C4    . DT  I 6 58  ? 170.889 175.218 116.020 1.00 204.95 ? 57  DT  J C4    1 
ATOM   7360  O O4    . DT  I 6 58  ? 171.441 174.881 117.053 1.00 204.95 ? 57  DT  J O4    1 
ATOM   7361  C C5    . DT  I 6 58  ? 171.605 175.808 114.930 1.00 204.95 ? 57  DT  J C5    1 
ATOM   7362  C C7    . DT  I 6 58  ? 173.082 176.030 115.034 1.00 204.95 ? 57  DT  J C7    1 
ATOM   7363  C C6    . DT  I 6 58  ? 170.913 176.158 113.846 1.00 204.95 ? 57  DT  J C6    1 
ATOM   7364  P P     . DA  I 6 59  ? 167.285 179.496 110.194 1.00 197.43 ? 58  DA  J P     1 
ATOM   7365  O OP1   . DA  I 6 59  ? 166.804 179.601 108.807 1.00 197.43 ? 58  DA  J OP1   1 
ATOM   7366  O OP2   . DA  I 6 59  ? 168.406 180.356 110.622 1.00 197.43 ? 58  DA  J OP2   1 
ATOM   7367  O "O5'" . DA  I 6 59  ? 166.051 179.749 111.162 1.00 197.43 ? 58  DA  J "O5'" 1 
ATOM   7368  C "C5'" . DA  I 6 59  ? 164.910 178.938 111.024 1.00 197.43 ? 58  DA  J "C5'" 1 
ATOM   7369  C "C4'" . DA  I 6 59  ? 164.257 178.641 112.360 1.00 197.43 ? 58  DA  J "C4'" 1 
ATOM   7370  O "O4'" . DA  I 6 59  ? 165.206 178.043 113.272 1.00 197.43 ? 58  DA  J "O4'" 1 
ATOM   7371  C "C3'" . DA  I 6 59  ? 163.683 179.839 113.100 1.00 197.43 ? 58  DA  J "C3'" 1 
ATOM   7372  O "O3'" . DA  I 6 59  ? 162.512 179.424 113.719 1.00 197.43 ? 58  DA  J "O3'" 1 
ATOM   7373  C "C2'" . DA  I 6 59  ? 164.765 180.131 114.136 1.00 197.43 ? 58  DA  J "C2'" 1 
ATOM   7374  C "C1'" . DA  I 6 59  ? 165.131 178.718 114.503 1.00 197.43 ? 58  DA  J "C1'" 1 
ATOM   7375  N N9    . DA  I 6 59  ? 166.405 178.548 115.165 1.00 197.43 ? 58  DA  J N9    1 
ATOM   7376  C C8    . DA  I 6 59  ? 167.639 178.813 114.660 1.00 197.43 ? 58  DA  J C8    1 
ATOM   7377  N N7    . DA  I 6 59  ? 168.617 178.484 115.462 1.00 197.43 ? 58  DA  J N7    1 
ATOM   7378  C C5    . DA  I 6 59  ? 167.971 177.957 116.559 1.00 197.43 ? 58  DA  J C5    1 
ATOM   7379  C C6    . DA  I 6 59  ? 168.443 177.414 117.761 1.00 197.43 ? 58  DA  J C6    1 
ATOM   7380  N N6    . DA  I 6 59  ? 169.735 177.334 118.063 1.00 197.43 ? 58  DA  J N6    1 
ATOM   7381  N N1    . DA  I 6 59  ? 167.530 176.964 118.654 1.00 197.43 ? 58  DA  J N1    1 
ATOM   7382  C C2    . DA  I 6 59  ? 166.234 177.047 118.341 1.00 197.43 ? 58  DA  J C2    1 
ATOM   7383  N N3    . DA  I 6 59  ? 165.677 177.541 117.238 1.00 197.43 ? 58  DA  J N3    1 
ATOM   7384  C C4    . DA  I 6 59  ? 166.611 177.975 116.381 1.00 197.43 ? 58  DA  J C4    1 
ATOM   7385  P P     . DA  I 6 60  ? 161.314 180.451 113.957 1.00 195.19 ? 59  DA  J P     1 
ATOM   7386  O OP1   . DA  I 6 60  ? 160.280 180.171 112.942 1.00 195.19 ? 59  DA  J OP1   1 
ATOM   7387  O OP2   . DA  I 6 60  ? 161.894 181.802 114.072 1.00 195.19 ? 59  DA  J OP2   1 
ATOM   7388  O "O5'" . DA  I 6 60  ? 160.766 180.024 115.384 1.00 195.19 ? 59  DA  J "O5'" 1 
ATOM   7389  C "C5'" . DA  I 6 60  ? 161.674 179.617 116.381 1.00 195.19 ? 59  DA  J "C5'" 1 
ATOM   7390  C "C4'" . DA  I 6 60  ? 161.315 180.252 117.698 1.00 195.19 ? 59  DA  J "C4'" 1 
ATOM   7391  O "O4'" . DA  I 6 60  ? 162.514 180.434 118.473 1.00 195.19 ? 59  DA  J "O4'" 1 
ATOM   7392  C "C3'" . DA  I 6 60  ? 160.749 181.645 117.572 1.00 195.19 ? 59  DA  J "C3'" 1 
ATOM   7393  O "O3'" . DA  I 6 60  ? 160.129 182.010 118.784 1.00 195.19 ? 59  DA  J "O3'" 1 
ATOM   7394  C "C2'" . DA  I 6 60  ? 162.021 182.442 117.352 1.00 195.19 ? 59  DA  J "C2'" 1 
ATOM   7395  C "C1'" . DA  I 6 60  ? 162.940 181.776 118.365 1.00 195.19 ? 59  DA  J "C1'" 1 
ATOM   7396  N N9    . DA  I 6 60  ? 164.329 181.760 117.981 1.00 195.19 ? 59  DA  J N9    1 
ATOM   7397  C C8    . DA  I 6 60  ? 164.898 182.335 116.888 1.00 195.19 ? 59  DA  J C8    1 
ATOM   7398  N N7    . DA  I 6 60  ? 166.189 182.134 116.804 1.00 195.19 ? 59  DA  J N7    1 
ATOM   7399  C C5    . DA  I 6 60  ? 166.471 181.375 117.919 1.00 195.19 ? 59  DA  J C5    1 
ATOM   7400  C C6    . DA  I 6 60  ? 167.661 180.832 118.414 1.00 195.19 ? 59  DA  J C6    1 
ATOM   7401  N N6    . DA  I 6 60  ? 168.836 180.983 117.808 1.00 195.19 ? 59  DA  J N6    1 
ATOM   7402  N N1    . DA  I 6 60  ? 167.598 180.128 119.571 1.00 195.19 ? 59  DA  J N1    1 
ATOM   7403  C C2    . DA  I 6 60  ? 166.411 179.979 120.160 1.00 195.19 ? 59  DA  J C2    1 
ATOM   7404  N N3    . DA  I 6 60  ? 165.231 180.449 119.785 1.00 195.19 ? 59  DA  J N3    1 
ATOM   7405  C C4    . DA  I 6 60  ? 165.334 181.139 118.649 1.00 195.19 ? 59  DA  J C4    1 
ATOM   7406  P P     . DA  I 6 61  ? 158.553 181.792 118.990 1.00 190.61 ? 60  DA  J P     1 
ATOM   7407  O OP1   . DA  I 6 61  ? 158.088 180.775 118.026 1.00 190.61 ? 60  DA  J OP1   1 
ATOM   7408  O OP2   . DA  I 6 61  ? 157.917 183.124 119.004 1.00 190.61 ? 60  DA  J OP2   1 
ATOM   7409  O "O5'" . DA  I 6 61  ? 158.450 181.190 120.464 1.00 190.61 ? 60  DA  J "O5'" 1 
ATOM   7410  C "C5'" . DA  I 6 61  ? 159.189 180.029 120.799 1.00 190.61 ? 60  DA  J "C5'" 1 
ATOM   7411  C "C4'" . DA  I 6 61  ? 159.876 180.165 122.149 1.00 190.61 ? 60  DA  J "C4'" 1 
ATOM   7412  O "O4'" . DA  I 6 61  ? 161.232 180.651 121.978 1.00 190.61 ? 60  DA  J "O4'" 1 
ATOM   7413  C "C3'" . DA  I 6 61  ? 159.222 181.112 123.142 1.00 190.61 ? 60  DA  J "C3'" 1 
ATOM   7414  O "O3'" . DA  I 6 61  ? 159.382 180.568 124.427 1.00 190.61 ? 60  DA  J "O3'" 1 
ATOM   7415  C "C2'" . DA  I 6 61  ? 160.058 182.376 122.978 1.00 190.61 ? 60  DA  J "C2'" 1 
ATOM   7416  C "C1'" . DA  I 6 61  ? 161.433 181.774 122.803 1.00 190.61 ? 60  DA  J "C1'" 1 
ATOM   7417  N N9    . DA  I 6 61  ? 162.366 182.648 122.127 1.00 190.61 ? 60  DA  J N9    1 
ATOM   7418  C C8    . DA  I 6 61  ? 162.062 183.619 121.227 1.00 190.61 ? 60  DA  J C8    1 
ATOM   7419  N N7    . DA  I 6 61  ? 163.110 184.232 120.744 1.00 190.61 ? 60  DA  J N7    1 
ATOM   7420  C C5    . DA  I 6 61  ? 164.171 183.616 121.371 1.00 190.61 ? 60  DA  J C5    1 
ATOM   7421  C C6    . DA  I 6 61  ? 165.552 183.813 121.290 1.00 190.61 ? 60  DA  J C6    1 
ATOM   7422  N N6    . DA  I 6 61  ? 166.109 184.731 120.504 1.00 190.61 ? 60  DA  J N6    1 
ATOM   7423  N N1    . DA  I 6 61  ? 166.344 183.034 122.047 1.00 190.61 ? 60  DA  J N1    1 
ATOM   7424  C C2    . DA  I 6 61  ? 165.779 182.120 122.837 1.00 190.61 ? 60  DA  J C2    1 
ATOM   7425  N N3    . DA  I 6 61  ? 164.487 181.842 122.993 1.00 190.61 ? 60  DA  J N3    1 
ATOM   7426  C C4    . DA  I 6 61  ? 163.732 182.635 122.225 1.00 190.61 ? 60  DA  J C4    1 
ATOM   7427  P P     . DC  I 6 62  ? 158.430 180.991 125.647 1.00 186.29 ? 61  DC  J P     1 
ATOM   7428  O OP1   . DC  I 6 62  ? 157.428 179.917 125.799 1.00 186.29 ? 61  DC  J OP1   1 
ATOM   7429  O OP2   . DC  I 6 62  ? 157.991 182.393 125.494 1.00 186.29 ? 61  DC  J OP2   1 
ATOM   7430  O "O5'" . DC  I 6 62  ? 159.416 180.903 126.890 1.00 186.29 ? 61  DC  J "O5'" 1 
ATOM   7431  C "C5'" . DC  I 6 62  ? 160.222 179.758 127.028 1.00 186.29 ? 61  DC  J "C5'" 1 
ATOM   7432  C "C4'" . DC  I 6 62  ? 161.645 180.121 127.396 1.00 186.29 ? 61  DC  J "C4'" 1 
ATOM   7433  O "O4'" . DC  I 6 62  ? 162.207 181.038 126.422 1.00 186.29 ? 61  DC  J "O4'" 1 
ATOM   7434  C "C3'" . DC  I 6 62  ? 161.810 180.791 128.748 1.00 186.29 ? 61  DC  J "C3'" 1 
ATOM   7435  O "O3'" . DC  I 6 62  ? 162.919 180.234 129.380 1.00 186.29 ? 61  DC  J "O3'" 1 
ATOM   7436  C "C2'" . DC  I 6 62  ? 162.063 182.245 128.371 1.00 186.29 ? 61  DC  J "C2'" 1 
ATOM   7437  C "C1'" . DC  I 6 62  ? 162.878 182.059 127.113 1.00 186.29 ? 61  DC  J "C1'" 1 
ATOM   7438  N N1    . DC  I 6 62  ? 162.923 183.247 126.241 1.00 186.29 ? 61  DC  J N1    1 
ATOM   7439  C C2    . DC  I 6 62  ? 164.151 183.806 125.882 1.00 186.29 ? 61  DC  J C2    1 
ATOM   7440  O O2    . DC  I 6 62  ? 165.188 183.315 126.316 1.00 186.29 ? 61  DC  J O2    1 
ATOM   7441  N N3    . DC  I 6 62  ? 164.163 184.880 125.066 1.00 186.29 ? 61  DC  J N3    1 
ATOM   7442  C C4    . DC  I 6 62  ? 163.025 185.386 124.618 1.00 186.29 ? 61  DC  J C4    1 
ATOM   7443  N N4    . DC  I 6 62  ? 163.082 186.450 123.816 1.00 186.29 ? 61  DC  J N4    1 
ATOM   7444  C C5    . DC  I 6 62  ? 161.769 184.829 124.971 1.00 186.29 ? 61  DC  J C5    1 
ATOM   7445  C C6    . DC  I 6 62  ? 161.767 183.772 125.779 1.00 186.29 ? 61  DC  J C6    1 
ATOM   7446  P P     . DG  I 6 63  ? 162.996 180.182 130.973 1.00 184.54 ? 62  DG  J P     1 
ATOM   7447  O OP1   . DG  I 6 63  ? 163.017 178.762 131.370 1.00 184.54 ? 62  DG  J OP1   1 
ATOM   7448  O OP2   . DG  I 6 63  ? 161.949 181.082 131.487 1.00 184.54 ? 62  DG  J OP2   1 
ATOM   7449  O "O5'" . DG  I 6 63  ? 164.414 180.828 131.288 1.00 184.54 ? 62  DG  J "O5'" 1 
ATOM   7450  C "C5'" . DG  I 6 63  ? 165.559 180.317 130.656 1.00 184.54 ? 62  DG  J "C5'" 1 
ATOM   7451  C "C4'" . DG  I 6 63  ? 166.679 181.336 130.649 1.00 184.54 ? 62  DG  J "C4'" 1 
ATOM   7452  O "O4'" . DG  I 6 63  ? 166.419 182.356 129.659 1.00 184.54 ? 62  DG  J "O4'" 1 
ATOM   7453  C "C3'" . DG  I 6 63  ? 166.906 182.071 131.964 1.00 184.54 ? 62  DG  J "C3'" 1 
ATOM   7454  O "O3'" . DG  I 6 63  ? 168.289 182.126 132.206 1.00 184.54 ? 62  DG  J "O3'" 1 
ATOM   7455  C "C2'" . DG  I 6 63  ? 166.326 183.459 131.691 1.00 184.54 ? 62  DG  J "C2'" 1 
ATOM   7456  C "C1'" . DG  I 6 63  ? 166.647 183.621 130.224 1.00 184.54 ? 62  DG  J "C1'" 1 
ATOM   7457  N N9    . DG  I 6 63  ? 165.797 184.569 129.529 1.00 184.54 ? 62  DG  J N9    1 
ATOM   7458  C C8    . DG  I 6 63  ? 164.441 184.513 129.403 1.00 184.54 ? 62  DG  J C8    1 
ATOM   7459  N N7    . DG  I 6 63  ? 163.943 185.478 128.692 1.00 184.54 ? 62  DG  J N7    1 
ATOM   7460  C C5    . DG  I 6 63  ? 165.045 186.220 128.320 1.00 184.54 ? 62  DG  J C5    1 
ATOM   7461  C C6    . DG  I 6 63  ? 165.125 187.390 127.546 1.00 184.54 ? 62  DG  J C6    1 
ATOM   7462  O O6    . DG  I 6 63  ? 164.207 188.019 127.012 1.00 184.54 ? 62  DG  J O6    1 
ATOM   7463  N N1    . DG  I 6 63  ? 166.434 187.823 127.407 1.00 184.54 ? 62  DG  J N1    1 
ATOM   7464  C C2    . DG  I 6 63  ? 167.525 187.200 127.952 1.00 184.54 ? 62  DG  J C2    1 
ATOM   7465  N N2    . DG  I 6 63  ? 168.712 187.762 127.710 1.00 184.54 ? 62  DG  J N2    1 
ATOM   7466  N N3    . DG  I 6 63  ? 167.461 186.100 128.682 1.00 184.54 ? 62  DG  J N3    1 
ATOM   7467  C C4    . DG  I 6 63  ? 166.195 185.667 128.820 1.00 184.54 ? 62  DG  J C4    1 
ATOM   7468  P P     . DC  I 6 64  ? 168.863 182.561 133.636 1.00 184.14 ? 63  DC  J P     1 
ATOM   7469  O OP1   . DC  I 6 64  ? 169.880 181.556 134.001 1.00 184.14 ? 63  DC  J OP1   1 
ATOM   7470  O OP2   . DC  I 6 64  ? 167.738 182.822 134.557 1.00 184.14 ? 63  DC  J OP2   1 
ATOM   7471  O "O5'" . DC  I 6 64  ? 169.582 183.943 133.326 1.00 184.14 ? 63  DC  J "O5'" 1 
ATOM   7472  C "C5'" . DC  I 6 64  ? 170.289 184.094 132.111 1.00 184.14 ? 63  DC  J "C5'" 1 
ATOM   7473  C "C4'" . DC  I 6 64  ? 170.759 185.521 131.933 1.00 184.14 ? 63  DC  J "C4'" 1 
ATOM   7474  O "O4'" . DC  I 6 64  ? 169.786 186.269 131.171 1.00 184.14 ? 63  DC  J "O4'" 1 
ATOM   7475  C "C3'" . DC  I 6 64  ? 170.980 186.292 133.224 1.00 184.14 ? 63  DC  J "C3'" 1 
ATOM   7476  O "O3'" . DC  I 6 64  ? 172.188 187.004 133.121 1.00 184.14 ? 63  DC  J "O3'" 1 
ATOM   7477  C "C2'" . DC  I 6 64  ? 169.765 187.220 133.299 1.00 184.14 ? 63  DC  J "C2'" 1 
ATOM   7478  C "C1'" . DC  I 6 64  ? 169.479 187.470 131.835 1.00 184.14 ? 63  DC  J "C1'" 1 
ATOM   7479  N N1    . DC  I 6 64  ? 168.072 187.776 131.543 1.00 184.14 ? 63  DC  J N1    1 
ATOM   7480  C C2    . DC  I 6 64  ? 167.766 188.865 130.744 1.00 184.14 ? 63  DC  J C2    1 
ATOM   7481  O O2    . DC  I 6 64  ? 168.684 189.563 130.322 1.00 184.14 ? 63  DC  J O2    1 
ATOM   7482  N N3    . DC  I 6 64  ? 166.479 189.120 130.448 1.00 184.14 ? 63  DC  J N3    1 
ATOM   7483  C C4    . DC  I 6 64  ? 165.524 188.333 130.924 1.00 184.14 ? 63  DC  J C4    1 
ATOM   7484  N N4    . DC  I 6 64  ? 164.263 188.626 130.612 1.00 184.14 ? 63  DC  J N4    1 
ATOM   7485  C C5    . DC  I 6 64  ? 165.816 187.215 131.748 1.00 184.14 ? 63  DC  J C5    1 
ATOM   7486  C C6    . DC  I 6 64  ? 167.095 186.970 132.019 1.00 184.14 ? 63  DC  J C6    1 
ATOM   7487  P P     . DA  I 6 65  ? 172.744 187.865 134.353 1.00 187.16 ? 64  DA  J P     1 
ATOM   7488  O OP1   . DA  I 6 65  ? 174.218 187.818 134.278 1.00 187.16 ? 64  DA  J OP1   1 
ATOM   7489  O OP2   . DA  I 6 65  ? 172.060 187.455 135.597 1.00 187.16 ? 64  DA  J OP2   1 
ATOM   7490  O "O5'" . DA  I 6 65  ? 172.289 189.335 133.976 1.00 187.16 ? 64  DA  J "O5'" 1 
ATOM   7491  C "C5'" . DA  I 6 65  ? 172.411 189.765 132.641 1.00 187.16 ? 64  DA  J "C5'" 1 
ATOM   7492  C "C4'" . DA  I 6 65  ? 172.114 191.237 132.534 1.00 187.16 ? 64  DA  J "C4'" 1 
ATOM   7493  O "O4'" . DA  I 6 65  ? 170.745 191.426 132.114 1.00 187.16 ? 64  DA  J "O4'" 1 
ATOM   7494  C "C3'" . DA  I 6 65  ? 172.286 192.009 133.832 1.00 187.16 ? 64  DA  J "C3'" 1 
ATOM   7495  O "O3'" . DA  I 6 65  ? 172.988 193.207 133.567 1.00 187.16 ? 64  DA  J "O3'" 1 
ATOM   7496  C "C2'" . DA  I 6 65  ? 170.851 192.258 134.303 1.00 187.16 ? 64  DA  J "C2'" 1 
ATOM   7497  C "C1'" . DA  I 6 65  ? 170.068 192.275 133.006 1.00 187.16 ? 64  DA  J "C1'" 1 
ATOM   7498  N N9    . DA  I 6 65  ? 168.729 191.755 133.159 1.00 187.16 ? 64  DA  J N9    1 
ATOM   7499  C C8    . DA  I 6 65  ? 168.360 190.646 133.854 1.00 187.16 ? 64  DA  J C8    1 
ATOM   7500  N N7    . DA  I 6 65  ? 167.080 190.401 133.809 1.00 187.16 ? 64  DA  J N7    1 
ATOM   7501  C C5    . DA  I 6 65  ? 166.582 191.417 133.027 1.00 187.16 ? 64  DA  J C5    1 
ATOM   7502  C C6    . DA  I 6 65  ? 165.290 191.724 132.601 1.00 187.16 ? 64  DA  J C6    1 
ATOM   7503  N N6    . DA  I 6 65  ? 164.227 190.994 132.926 1.00 187.16 ? 64  DA  J N6    1 
ATOM   7504  N N1    . DA  I 6 65  ? 165.128 192.812 131.828 1.00 187.16 ? 64  DA  J N1    1 
ATOM   7505  C C2    . DA  I 6 65  ? 166.198 193.538 131.504 1.00 187.16 ? 64  DA  J C2    1 
ATOM   7506  N N3    . DA  I 6 65  ? 167.464 193.345 131.848 1.00 187.16 ? 64  DA  J N3    1 
ATOM   7507  C C4    . DA  I 6 65  ? 167.586 192.257 132.614 1.00 187.16 ? 64  DA  J C4    1 
ATOM   7508  P P     . DC  I 6 66  ? 173.273 194.280 134.726 1.00 190.69 ? 65  DC  J P     1 
ATOM   7509  O OP1   . DC  I 6 66  ? 174.539 194.948 134.364 1.00 190.69 ? 65  DC  J OP1   1 
ATOM   7510  O OP2   . DC  I 6 66  ? 173.146 193.661 136.064 1.00 190.69 ? 65  DC  J OP2   1 
ATOM   7511  O "O5'" . DC  I 6 66  ? 172.097 195.327 134.519 1.00 190.69 ? 65  DC  J "O5'" 1 
ATOM   7512  C "C5'" . DC  I 6 66  ? 171.732 195.680 133.205 1.00 190.69 ? 65  DC  J "C5'" 1 
ATOM   7513  C "C4'" . DC  I 6 66  ? 170.551 196.606 133.222 1.00 190.69 ? 65  DC  J "C4'" 1 
ATOM   7514  O "O4'" . DC  I 6 66  ? 169.329 195.837 133.282 1.00 190.69 ? 65  DC  J "O4'" 1 
ATOM   7515  C "C3'" . DC  I 6 66  ? 170.519 197.559 134.412 1.00 190.69 ? 65  DC  J "C3'" 1 
ATOM   7516  O "O3'" . DC  I 6 66  ? 170.356 198.875 133.938 1.00 190.69 ? 65  DC  J "O3'" 1 
ATOM   7517  C "C2'" . DC  I 6 66  ? 169.310 197.084 135.218 1.00 190.69 ? 65  DC  J "C2'" 1 
ATOM   7518  C "C1'" . DC  I 6 66  ? 168.439 196.486 134.140 1.00 190.69 ? 65  DC  J "C1'" 1 
ATOM   7519  N N1    . DC  I 6 66  ? 167.501 195.496 134.649 1.00 190.69 ? 65  DC  J N1    1 
ATOM   7520  C C2    . DC  I 6 66  ? 166.157 195.602 134.331 1.00 190.69 ? 65  DC  J C2    1 
ATOM   7521  O O2    . DC  I 6 66  ? 165.780 196.527 133.617 1.00 190.69 ? 65  DC  J O2    1 
ATOM   7522  N N3    . DC  I 6 66  ? 165.298 194.680 134.804 1.00 190.69 ? 65  DC  J N3    1 
ATOM   7523  C C4    . DC  I 6 66  ? 165.742 193.692 135.569 1.00 190.69 ? 65  DC  J C4    1 
ATOM   7524  N N4    . DC  I 6 66  ? 164.856 192.805 136.014 1.00 190.69 ? 65  DC  J N4    1 
ATOM   7525  C C5    . DC  I 6 66  ? 167.116 193.567 135.909 1.00 190.69 ? 65  DC  J C5    1 
ATOM   7526  C C6    . DC  I 6 66  ? 167.953 194.485 135.431 1.00 190.69 ? 65  DC  J C6    1 
ATOM   7527  P P     . DG  I 6 67  ? 170.405 200.134 134.932 1.00 190.13 ? 66  DG  J P     1 
ATOM   7528  O OP1   . DG  I 6 67  ? 171.185 201.174 134.235 1.00 190.13 ? 66  DG  J OP1   1 
ATOM   7529  O OP2   . DG  I 6 67  ? 170.802 199.724 136.297 1.00 190.13 ? 66  DG  J OP2   1 
ATOM   7530  O "O5'" . DG  I 6 67  ? 168.889 200.601 134.972 1.00 190.13 ? 66  DG  J "O5'" 1 
ATOM   7531  C "C5'" . DG  I 6 67  ? 168.046 200.299 133.875 1.00 190.13 ? 66  DG  J "C5'" 1 
ATOM   7532  C "C4'" . DG  I 6 67  ? 166.716 201.012 133.987 1.00 190.13 ? 66  DG  J "C4'" 1 
ATOM   7533  O "O4'" . DG  I 6 67  ? 165.669 200.054 134.239 1.00 190.13 ? 66  DG  J "O4'" 1 
ATOM   7534  C "C3'" . DG  I 6 67  ? 166.618 202.039 135.098 1.00 190.13 ? 66  DG  J "C3'" 1 
ATOM   7535  O "O3'" . DG  I 6 67  ? 165.771 203.084 134.684 1.00 190.13 ? 66  DG  J "O3'" 1 
ATOM   7536  C "C2'" . DG  I 6 67  ? 166.017 201.246 136.259 1.00 190.13 ? 66  DG  J "C2'" 1 
ATOM   7537  C "C1'" . DG  I 6 67  ? 165.170 200.200 135.551 1.00 190.13 ? 66  DG  J "C1'" 1 
ATOM   7538  N N9    . DG  I 6 67  ? 165.221 198.901 136.189 1.00 190.13 ? 66  DG  J N9    1 
ATOM   7539  C C8    . DG  I 6 67  ? 166.332 198.227 136.619 1.00 190.13 ? 66  DG  J C8    1 
ATOM   7540  N N7    . DG  I 6 67  ? 166.061 197.072 137.153 1.00 190.13 ? 66  DG  J N7    1 
ATOM   7541  C C5    . DG  I 6 67  ? 164.686 196.982 137.062 1.00 190.13 ? 66  DG  J C5    1 
ATOM   7542  C C6    . DG  I 6 67  ? 163.814 195.962 137.475 1.00 190.13 ? 66  DG  J C6    1 
ATOM   7543  O O6    . DG  I 6 67  ? 164.085 194.887 138.012 1.00 190.13 ? 66  DG  J O6    1 
ATOM   7544  N N1    . DG  I 6 67  ? 162.495 196.276 137.192 1.00 190.13 ? 66  DG  J N1    1 
ATOM   7545  C C2    . DG  I 6 67  ? 162.077 197.435 136.598 1.00 190.13 ? 66  DG  J C2    1 
ATOM   7546  N N2    . DG  I 6 67  ? 160.762 197.555 136.399 1.00 190.13 ? 66  DG  J N2    1 
ATOM   7547  N N3    . DG  I 6 67  ? 162.882 198.393 136.206 1.00 190.13 ? 66  DG  J N3    1 
ATOM   7548  C C4    . DG  I 6 67  ? 164.163 198.101 136.471 1.00 190.13 ? 66  DG  J C4    1 
ATOM   7549  P P     . DT  I 6 68  ? 165.541 204.361 135.623 1.00 190.54 ? 67  DT  J P     1 
ATOM   7550  O OP1   . DT  I 6 68  ? 165.299 205.507 134.724 1.00 190.54 ? 67  DT  J OP1   1 
ATOM   7551  O OP2   . DT  I 6 68  ? 166.629 204.425 136.624 1.00 190.54 ? 67  DT  J OP2   1 
ATOM   7552  O "O5'" . DT  I 6 68  ? 164.183 204.014 136.378 1.00 190.54 ? 67  DT  J "O5'" 1 
ATOM   7553  C "C5'" . DT  I 6 68  ? 163.115 203.433 135.652 1.00 190.54 ? 67  DT  J "C5'" 1 
ATOM   7554  C "C4'" . DT  I 6 68  ? 161.944 203.114 136.556 1.00 190.54 ? 67  DT  J "C4'" 1 
ATOM   7555  O "O4'" . DT  I 6 68  ? 162.042 201.750 137.045 1.00 190.54 ? 67  DT  J "O4'" 1 
ATOM   7556  C "C3'" . DT  I 6 68  ? 161.817 203.989 137.801 1.00 190.54 ? 67  DT  J "C3'" 1 
ATOM   7557  O "O3'" . DT  I 6 68  ? 160.456 204.231 138.026 1.00 190.54 ? 67  DT  J "O3'" 1 
ATOM   7558  C "C2'" . DT  I 6 68  ? 162.385 203.081 138.882 1.00 190.54 ? 67  DT  J "C2'" 1 
ATOM   7559  C "C1'" . DT  I 6 68  ? 161.803 201.765 138.429 1.00 190.54 ? 67  DT  J "C1'" 1 
ATOM   7560  N N1    . DT  I 6 68  ? 162.436 200.580 139.038 1.00 190.54 ? 67  DT  J N1    1 
ATOM   7561  C C2    . DT  I 6 68  ? 161.647 199.524 139.413 1.00 190.54 ? 67  DT  J C2    1 
ATOM   7562  O O2    . DT  I 6 68  ? 160.441 199.515 139.277 1.00 190.54 ? 67  DT  J O2    1 
ATOM   7563  N N3    . DT  I 6 68  ? 162.321 198.472 139.954 1.00 190.54 ? 67  DT  J N3    1 
ATOM   7564  C C4    . DT  I 6 68  ? 163.679 198.378 140.155 1.00 190.54 ? 67  DT  J C4    1 
ATOM   7565  O O4    . DT  I 6 68  ? 164.199 197.395 140.653 1.00 190.54 ? 67  DT  J O4    1 
ATOM   7566  C C5    . DT  I 6 68  ? 164.445 199.519 139.742 1.00 190.54 ? 67  DT  J C5    1 
ATOM   7567  C C7    . DT  I 6 68  ? 165.929 199.524 139.916 1.00 190.54 ? 67  DT  J C7    1 
ATOM   7568  C C6    . DT  I 6 68  ? 163.796 200.554 139.208 1.00 190.54 ? 67  DT  J C6    1 
ATOM   7569  P P     . DA  I 6 69  ? 159.955 205.476 138.906 1.00 188.06 ? 68  DA  J P     1 
ATOM   7570  O OP1   . DA  I 6 69  ? 159.960 206.663 138.030 1.00 188.06 ? 68  DA  J OP1   1 
ATOM   7571  O OP2   . DA  I 6 69  ? 160.684 205.517 140.190 1.00 188.06 ? 68  DA  J OP2   1 
ATOM   7572  O "O5'" . DA  I 6 69  ? 158.442 205.082 139.219 1.00 188.06 ? 68  DA  J "O5'" 1 
ATOM   7573  C "C5'" . DA  I 6 69  ? 157.972 203.780 138.860 1.00 188.06 ? 68  DA  J "C5'" 1 
ATOM   7574  C "C4'" . DA  I 6 69  ? 157.557 202.985 140.082 1.00 188.06 ? 68  DA  J "C4'" 1 
ATOM   7575  O "O4'" . DA  I 6 69  ? 158.560 201.971 140.388 1.00 188.06 ? 68  DA  J "O4'" 1 
ATOM   7576  C "C3'" . DA  I 6 69  ? 157.408 203.799 141.367 1.00 188.06 ? 68  DA  J "C3'" 1 
ATOM   7577  O "O3'" . DA  I 6 69  ? 156.388 203.242 142.137 1.00 188.06 ? 68  DA  J "O3'" 1 
ATOM   7578  C "C2'" . DA  I 6 69  ? 158.738 203.540 142.035 1.00 188.06 ? 68  DA  J "C2'" 1 
ATOM   7579  C "C1'" . DA  I 6 69  ? 158.826 202.061 141.762 1.00 188.06 ? 68  DA  J "C1'" 1 
ATOM   7580  N N9    . DA  I 6 69  ? 160.115 201.475 142.068 1.00 188.06 ? 68  DA  J N9    1 
ATOM   7581  C C8    . DA  I 6 69  ? 161.326 202.079 141.988 1.00 188.06 ? 68  DA  J C8    1 
ATOM   7582  N N7    . DA  I 6 69  ? 162.321 201.315 142.343 1.00 188.06 ? 68  DA  J N7    1 
ATOM   7583  C C5    . DA  I 6 69  ? 161.713 200.137 142.707 1.00 188.06 ? 68  DA  J C5    1 
ATOM   7584  C C6    . DA  I 6 69  ? 162.224 198.929 143.174 1.00 188.06 ? 68  DA  J C6    1 
ATOM   7585  N N6    . DA  I 6 69  ? 163.522 198.726 143.373 1.00 188.06 ? 68  DA  J N6    1 
ATOM   7586  N N1    . DA  I 6 69  ? 161.354 197.939 143.450 1.00 188.06 ? 68  DA  J N1    1 
ATOM   7587  C C2    . DA  I 6 69  ? 160.051 198.154 143.252 1.00 188.06 ? 68  DA  J C2    1 
ATOM   7588  N N3    . DA  I 6 69  ? 159.452 199.255 142.807 1.00 188.06 ? 68  DA  J N3    1 
ATOM   7589  C C4    . DA  I 6 69  ? 160.352 200.216 142.551 1.00 188.06 ? 68  DA  J C4    1 
ATOM   7590  P P     . DC  I 6 70  ? 154.976 203.976 142.274 1.00 184.52 ? 69  DC  J P     1 
ATOM   7591  O OP1   . DC  I 6 70  ? 154.587 204.429 140.924 1.00 184.52 ? 69  DC  J OP1   1 
ATOM   7592  O OP2   . DC  I 6 70  ? 155.085 204.941 143.386 1.00 184.52 ? 69  DC  J OP2   1 
ATOM   7593  O "O5'" . DC  I 6 70  ? 154.007 202.800 142.738 1.00 184.52 ? 69  DC  J "O5'" 1 
ATOM   7594  C "C5'" . DC  I 6 70  ? 154.381 201.454 142.486 1.00 184.52 ? 69  DC  J "C5'" 1 
ATOM   7595  C "C4'" . DC  I 6 70  ? 154.371 200.630 143.758 1.00 184.52 ? 69  DC  J "C4'" 1 
ATOM   7596  O "O4'" . DC  I 6 70  ? 155.729 200.289 144.140 1.00 184.52 ? 69  DC  J "O4'" 1 
ATOM   7597  C "C3'" . DC  I 6 70  ? 153.764 201.315 144.975 1.00 184.52 ? 69  DC  J "C3'" 1 
ATOM   7598  O "O3'" . DC  I 6 70  ? 153.142 200.344 145.789 1.00 184.52 ? 69  DC  J "O3'" 1 
ATOM   7599  C "C2'" . DC  I 6 70  ? 155.003 201.872 145.665 1.00 184.52 ? 69  DC  J "C2'" 1 
ATOM   7600  C "C1'" . DC  I 6 70  ? 155.950 200.709 145.465 1.00 184.52 ? 69  DC  J "C1'" 1 
ATOM   7601  N N1    . DC  I 6 70  ? 157.377 201.046 145.605 1.00 184.52 ? 69  DC  J N1    1 
ATOM   7602  C C2    . DC  I 6 70  ? 158.259 200.076 146.059 1.00 184.52 ? 69  DC  J C2    1 
ATOM   7603  O O2    . DC  I 6 70  ? 157.820 198.970 146.359 1.00 184.52 ? 69  DC  J O2    1 
ATOM   7604  N N3    . DC  I 6 70  ? 159.567 200.381 146.175 1.00 184.52 ? 69  DC  J N3    1 
ATOM   7605  C C4    . DC  I 6 70  ? 159.996 201.592 145.844 1.00 184.52 ? 69  DC  J C4    1 
ATOM   7606  N N4    . DC  I 6 70  ? 161.300 201.850 145.969 1.00 184.52 ? 69  DC  J N4    1 
ATOM   7607  C C5    . DC  I 6 70  ? 159.111 202.596 145.380 1.00 184.52 ? 69  DC  J C5    1 
ATOM   7608  C C6    . DC  I 6 70  ? 157.821 202.280 145.267 1.00 184.52 ? 69  DC  J C6    1 
ATOM   7609  P P     . DG  I 6 71  ? 151.598 199.954 145.592 1.00 185.71 ? 70  DG  J P     1 
ATOM   7610  O OP1   . DG  I 6 71  ? 151.151 200.344 144.241 1.00 185.71 ? 70  DG  J OP1   1 
ATOM   7611  O OP2   . DG  I 6 71  ? 150.877 200.459 146.775 1.00 185.71 ? 70  DG  J OP2   1 
ATOM   7612  O "O5'" . DG  I 6 71  ? 151.605 198.363 145.696 1.00 185.71 ? 70  DG  J "O5'" 1 
ATOM   7613  C "C5'" . DG  I 6 71  ? 152.827 197.667 145.507 1.00 185.71 ? 70  DG  J "C5'" 1 
ATOM   7614  C "C4'" . DG  I 6 71  ? 153.085 196.622 146.589 1.00 185.71 ? 70  DG  J "C4'" 1 
ATOM   7615  O "O4'" . DG  I 6 71  ? 154.321 196.927 147.275 1.00 185.71 ? 70  DG  J "O4'" 1 
ATOM   7616  C "C3'" . DG  I 6 71  ? 152.063 196.508 147.699 1.00 185.71 ? 70  DG  J "C3'" 1 
ATOM   7617  O "O3'" . DG  I 6 71  ? 152.232 195.240 148.303 1.00 185.71 ? 70  DG  J "O3'" 1 
ATOM   7618  C "C2'" . DG  I 6 71  ? 152.530 197.607 148.639 1.00 185.71 ? 70  DG  J "C2'" 1 
ATOM   7619  C "C1'" . DG  I 6 71  ? 154.037 197.416 148.576 1.00 185.71 ? 70  DG  J "C1'" 1 
ATOM   7620  N N9    . DG  I 6 71  ? 154.789 198.641 148.752 1.00 185.71 ? 70  DG  J N9    1 
ATOM   7621  C C8    . DG  I 6 71  ? 154.319 199.920 148.651 1.00 185.71 ? 70  DG  J C8    1 
ATOM   7622  N N7    . DG  I 6 71  ? 155.241 200.822 148.820 1.00 185.71 ? 70  DG  J N7    1 
ATOM   7623  C C5    . DG  I 6 71  ? 156.395 200.089 149.030 1.00 185.71 ? 70  DG  J C5    1 
ATOM   7624  C C6    . DG  I 6 71  ? 157.711 200.519 149.274 1.00 185.71 ? 70  DG  J C6    1 
ATOM   7625  O O6    . DG  I 6 71  ? 158.146 201.670 149.344 1.00 185.71 ? 70  DG  J O6    1 
ATOM   7626  N N1    . DG  I 6 71  ? 158.570 199.453 149.437 1.00 185.71 ? 70  DG  J N1    1 
ATOM   7627  C C2    . DG  I 6 71  ? 158.209 198.136 149.379 1.00 185.71 ? 70  DG  J C2    1 
ATOM   7628  N N2    . DG  I 6 71  ? 159.186 197.245 149.569 1.00 185.71 ? 70  DG  J N2    1 
ATOM   7629  N N3    . DG  I 6 71  ? 156.979 197.719 149.154 1.00 185.71 ? 70  DG  J N3    1 
ATOM   7630  C C4    . DG  I 6 71  ? 156.129 198.746 148.991 1.00 185.71 ? 70  DG  J C4    1 
ATOM   7631  P P     . DC  I 6 72  ? 151.057 194.526 149.131 1.00 176.22 ? 71  DC  J P     1 
ATOM   7632  O OP1   . DC  I 6 72  ? 150.177 193.838 148.170 1.00 176.22 ? 71  DC  J OP1   1 
ATOM   7633  O OP2   . DC  I 6 72  ? 150.496 195.482 150.104 1.00 176.22 ? 71  DC  J OP2   1 
ATOM   7634  O "O5'" . DC  I 6 72  ? 151.841 193.416 149.957 1.00 176.22 ? 71  DC  J "O5'" 1 
ATOM   7635  C "C5'" . DC  I 6 72  ? 152.966 192.793 149.376 1.00 176.22 ? 71  DC  J "C5'" 1 
ATOM   7636  C "C4'" . DC  I 6 72  ? 154.159 192.816 150.315 1.00 176.22 ? 71  DC  J "C4'" 1 
ATOM   7637  O "O4'" . DC  I 6 72  ? 154.683 194.162 150.437 1.00 176.22 ? 71  DC  J "O4'" 1 
ATOM   7638  C "C3'" . DC  I 6 72  ? 153.881 192.347 151.733 1.00 176.22 ? 71  DC  J "C3'" 1 
ATOM   7639  O "O3'" . DC  I 6 72  ? 154.940 191.551 152.149 1.00 176.22 ? 71  DC  J "O3'" 1 
ATOM   7640  C "C2'" . DC  I 6 72  ? 153.834 193.652 152.521 1.00 176.22 ? 71  DC  J "C2'" 1 
ATOM   7641  C "C1'" . DC  I 6 72  ? 154.881 194.462 151.794 1.00 176.22 ? 71  DC  J "C1'" 1 
ATOM   7642  N N1    . DC  I 6 72  ? 154.716 195.912 151.956 1.00 176.22 ? 71  DC  J N1    1 
ATOM   7643  C C2    . DC  I 6 72  ? 155.839 196.731 152.082 1.00 176.22 ? 71  DC  J C2    1 
ATOM   7644  O O2    . DC  I 6 72  ? 156.961 196.228 152.086 1.00 176.22 ? 71  DC  J O2    1 
ATOM   7645  N N3    . DC  I 6 72  ? 155.663 198.060 152.211 1.00 176.22 ? 71  DC  J N3    1 
ATOM   7646  C C4    . DC  I 6 72  ? 154.441 198.573 152.210 1.00 176.22 ? 71  DC  J C4    1 
ATOM   7647  N N4    . DC  I 6 72  ? 154.320 199.896 152.339 1.00 176.22 ? 71  DC  J N4    1 
ATOM   7648  C C5    . DC  I 6 72  ? 153.285 197.758 152.087 1.00 176.22 ? 71  DC  J C5    1 
ATOM   7649  C C6    . DC  I 6 72  ? 153.467 196.445 151.958 1.00 176.22 ? 71  DC  J C6    1 
ATOM   7650  P P     . DG  I 6 73  ? 154.707 190.399 153.228 1.00 173.93 ? 72  DG  J P     1 
ATOM   7651  O OP1   . DG  I 6 73  ? 154.604 189.123 152.501 1.00 173.93 ? 72  DG  J OP1   1 
ATOM   7652  O OP2   . DG  I 6 73  ? 153.623 190.814 154.136 1.00 173.93 ? 72  DG  J OP2   1 
ATOM   7653  O "O5'" . DG  I 6 73  ? 156.068 190.405 154.041 1.00 173.93 ? 72  DG  J "O5'" 1 
ATOM   7654  C "C5'" . DG  I 6 73  ? 157.296 190.439 153.339 1.00 173.93 ? 72  DG  J "C5'" 1 
ATOM   7655  C "C4'" . DG  I 6 73  ? 158.403 191.044 154.186 1.00 173.93 ? 72  DG  J "C4'" 1 
ATOM   7656  O "O4'" . DG  I 6 73  ? 158.231 192.474 154.266 1.00 173.93 ? 72  DG  J "O4'" 1 
ATOM   7657  C "C3'" . DG  I 6 73  ? 158.481 190.539 155.616 1.00 173.93 ? 72  DG  J "C3'" 1 
ATOM   7658  O "O3'" . DG  I 6 73  ? 159.826 190.356 155.980 1.00 173.93 ? 72  DG  J "O3'" 1 
ATOM   7659  C "C2'" . DG  I 6 73  ? 157.825 191.652 156.427 1.00 173.93 ? 72  DG  J "C2'" 1 
ATOM   7660  C "C1'" . DG  I 6 73  ? 158.130 192.888 155.605 1.00 173.93 ? 72  DG  J "C1'" 1 
ATOM   7661  N N9    . DG  I 6 73  ? 157.077 193.881 155.669 1.00 173.93 ? 72  DG  J N9    1 
ATOM   7662  C C8    . DG  I 6 73  ? 155.742 193.667 155.491 1.00 173.93 ? 72  DG  J C8    1 
ATOM   7663  N N7    . DG  I 6 73  ? 155.028 194.747 155.592 1.00 173.93 ? 72  DG  J N7    1 
ATOM   7664  C C5    . DG  I 6 73  ? 155.953 195.738 155.853 1.00 173.93 ? 72  DG  J C5    1 
ATOM   7665  C C6    . DG  I 6 73  ? 155.766 197.113 156.059 1.00 173.93 ? 72  DG  J C6    1 
ATOM   7666  O O6    . DG  I 6 73  ? 154.713 197.753 156.045 1.00 173.93 ? 72  DG  J O6    1 
ATOM   7667  N N1    . DG  I 6 73  ? 156.964 197.763 156.293 1.00 173.93 ? 72  DG  J N1    1 
ATOM   7668  C C2    . DG  I 6 73  ? 158.188 197.154 156.324 1.00 173.93 ? 72  DG  J C2    1 
ATOM   7669  N N2    . DG  I 6 73  ? 159.235 197.946 156.565 1.00 173.93 ? 72  DG  J N2    1 
ATOM   7670  N N3    . DG  I 6 73  ? 158.376 195.863 156.129 1.00 173.93 ? 72  DG  J N3    1 
ATOM   7671  C C4    . DG  I 6 73  ? 157.218 195.221 155.900 1.00 173.93 ? 72  DG  J C4    1 
ATOM   7672  P P     . DC  I 6 74  ? 160.192 189.629 157.361 1.00 181.68 ? 73  DC  J P     1 
ATOM   7673  O OP1   . DC  I 6 74  ? 161.423 188.851 157.130 1.00 181.68 ? 73  DC  J OP1   1 
ATOM   7674  O OP2   . DC  I 6 74  ? 158.983 188.959 157.878 1.00 181.68 ? 73  DC  J OP2   1 
ATOM   7675  O "O5'" . DC  I 6 74  ? 160.546 190.838 158.331 1.00 181.68 ? 73  DC  J "O5'" 1 
ATOM   7676  C "C5'" . DC  I 6 74  ? 161.599 191.710 157.985 1.00 181.68 ? 73  DC  J "C5'" 1 
ATOM   7677  C "C4'" . DC  I 6 74  ? 161.603 192.923 158.882 1.00 181.68 ? 73  DC  J "C4'" 1 
ATOM   7678  O "O4'" . DC  I 6 74  ? 160.473 193.753 158.567 1.00 181.68 ? 73  DC  J "O4'" 1 
ATOM   7679  C "C3'" . DC  I 6 74  ? 161.496 192.611 160.369 1.00 181.68 ? 73  DC  J "C3'" 1 
ATOM   7680  O "O3'" . DC  I 6 74  ? 162.706 192.971 161.016 1.00 181.68 ? 73  DC  J "O3'" 1 
ATOM   7681  C "C2'" . DC  I 6 74  ? 160.314 193.455 160.853 1.00 181.68 ? 73  DC  J "C2'" 1 
ATOM   7682  C "C1'" . DC  I 6 74  ? 160.083 194.429 159.719 1.00 181.68 ? 73  DC  J "C1'" 1 
ATOM   7683  N N1    . DC  I 6 74  ? 158.675 194.799 159.564 1.00 181.68 ? 73  DC  J N1    1 
ATOM   7684  C C2    . DC  I 6 74  ? 158.284 196.119 159.741 1.00 181.68 ? 73  DC  J C2    1 
ATOM   7685  O O2    . DC  I 6 74  ? 159.132 196.966 160.021 1.00 181.68 ? 73  DC  J O2    1 
ATOM   7686  N N3    . DC  I 6 74  ? 156.981 196.443 159.587 1.00 181.68 ? 73  DC  J N3    1 
ATOM   7687  C C4    . DC  I 6 74  ? 156.097 195.501 159.277 1.00 181.68 ? 73  DC  J C4    1 
ATOM   7688  N N4    . DC  I 6 74  ? 154.825 195.863 159.135 1.00 181.68 ? 73  DC  J N4    1 
ATOM   7689  C C5    . DC  I 6 74  ? 156.479 194.148 159.094 1.00 181.68 ? 73  DC  J C5    1 
ATOM   7690  C C6    . DC  I 6 74  ? 157.766 193.847 159.245 1.00 181.68 ? 73  DC  J C6    1 
ATOM   7691  P P     . DT  I 6 75  ? 162.909 192.722 162.590 1.00 185.67 ? 74  DT  J P     1 
ATOM   7692  O OP1   . DT  I 6 75  ? 164.356 192.513 162.801 1.00 185.67 ? 74  DT  J OP1   1 
ATOM   7693  O OP2   . DT  I 6 75  ? 161.952 191.696 163.057 1.00 185.67 ? 74  DT  J OP2   1 
ATOM   7694  O "O5'" . DT  I 6 75  ? 162.511 194.123 163.240 1.00 185.67 ? 74  DT  J "O5'" 1 
ATOM   7695  C "C5'" . DT  I 6 75  ? 162.992 195.314 162.651 1.00 185.67 ? 74  DT  J "C5'" 1 
ATOM   7696  C "C4'" . DT  I 6 75  ? 162.396 196.526 163.323 1.00 185.67 ? 74  DT  J "C4'" 1 
ATOM   7697  O "O4'" . DT  I 6 75  ? 161.042 196.736 162.855 1.00 185.67 ? 74  DT  J "O4'" 1 
ATOM   7698  C "C3'" . DT  I 6 75  ? 162.319 196.439 164.840 1.00 185.67 ? 74  DT  J "C3'" 1 
ATOM   7699  O "O3'" . DT  I 6 75  ? 162.891 197.598 165.394 1.00 185.67 ? 74  DT  J "O3'" 1 
ATOM   7700  C "C2'" . DT  I 6 75  ? 160.819 196.354 165.121 1.00 185.67 ? 74  DT  J "C2'" 1 
ATOM   7701  C "C1'" . DT  I 6 75  ? 160.232 197.096 163.938 1.00 185.67 ? 74  DT  J "C1'" 1 
ATOM   7702  N N1    . DT  I 6 75  ? 158.861 196.683 163.622 1.00 185.67 ? 74  DT  J N1    1 
ATOM   7703  C C2    . DT  I 6 75  ? 157.854 197.614 163.573 1.00 185.67 ? 74  DT  J C2    1 
ATOM   7704  O O2    . DT  I 6 75  ? 158.015 198.789 163.823 1.00 185.67 ? 74  DT  J O2    1 
ATOM   7705  N N3    . DT  I 6 75  ? 156.627 197.097 163.278 1.00 185.67 ? 74  DT  J N3    1 
ATOM   7706  C C4    . DT  I 6 75  ? 156.323 195.794 162.989 1.00 185.67 ? 74  DT  J C4    1 
ATOM   7707  O O4    . DT  I 6 75  ? 155.192 195.425 162.722 1.00 185.67 ? 74  DT  J O4    1 
ATOM   7708  C C5    . DT  I 6 75  ? 157.422 194.882 163.039 1.00 185.67 ? 74  DT  J C5    1 
ATOM   7709  C C7    . DT  I 6 75  ? 157.196 193.430 162.756 1.00 185.67 ? 74  DT  J C7    1 
ATOM   7710  C C6    . DT  I 6 75  ? 158.625 195.364 163.349 1.00 185.67 ? 74  DT  J C6    1 
ATOM   7711  P P     . DG  I 6 76  ? 163.184 197.694 166.966 1.00 188.47 ? 75  DG  J P     1 
ATOM   7712  O OP1   . DG  I 6 76  ? 164.491 198.360 167.122 1.00 188.47 ? 75  DG  J OP1   1 
ATOM   7713  O OP2   . DG  I 6 76  ? 162.960 196.369 167.578 1.00 188.47 ? 75  DG  J OP2   1 
ATOM   7714  O "O5'" . DG  I 6 76  ? 162.052 198.684 167.481 1.00 188.47 ? 75  DG  J "O5'" 1 
ATOM   7715  C "C5'" . DG  I 6 76  ? 161.652 199.762 166.660 1.00 188.47 ? 75  DG  J "C5'" 1 
ATOM   7716  C "C4'" . DG  I 6 76  ? 160.388 200.409 167.186 1.00 188.47 ? 75  DG  J "C4'" 1 
ATOM   7717  O "O4'" . DG  I 6 76  ? 159.228 199.819 166.551 1.00 188.47 ? 75  DG  J "O4'" 1 
ATOM   7718  C "C3'" . DG  I 6 76  ? 160.160 200.269 168.688 1.00 188.47 ? 75  DG  J "C3'" 1 
ATOM   7719  O "O3'" . DG  I 6 76  ? 159.652 201.484 169.186 1.00 188.47 ? 75  DG  J "O3'" 1 
ATOM   7720  C "C2'" . DG  I 6 76  ? 159.113 199.165 168.764 1.00 188.47 ? 75  DG  J "C2'" 1 
ATOM   7721  C "C1'" . DG  I 6 76  ? 158.290 199.492 167.542 1.00 188.47 ? 75  DG  J "C1'" 1 
ATOM   7722  N N9    . DG  I 6 76  ? 157.483 198.392 167.059 1.00 188.47 ? 75  DG  J N9    1 
ATOM   7723  C C8    . DG  I 6 76  ? 157.896 197.120 166.778 1.00 188.47 ? 75  DG  J C8    1 
ATOM   7724  N N7    . DG  I 6 76  ? 156.942 196.354 166.335 1.00 188.47 ? 75  DG  J N7    1 
ATOM   7725  C C5    . DG  I 6 76  ? 155.829 197.176 166.335 1.00 188.47 ? 75  DG  J C5    1 
ATOM   7726  C C6    . DG  I 6 76  ? 154.500 196.906 165.962 1.00 188.47 ? 75  DG  J C6    1 
ATOM   7727  O O6    . DG  I 6 76  ? 154.020 195.851 165.543 1.00 188.47 ? 75  DG  J O6    1 
ATOM   7728  N N1    . DG  I 6 76  ? 153.688 198.018 166.112 1.00 188.47 ? 75  DG  J N1    1 
ATOM   7729  C C2    . DG  I 6 76  ? 154.108 199.237 166.565 1.00 188.47 ? 75  DG  J C2    1 
ATOM   7730  N N2    . DG  I 6 76  ? 153.178 200.193 166.642 1.00 188.47 ? 75  DG  J N2    1 
ATOM   7731  N N3    . DG  I 6 76  ? 155.350 199.505 166.916 1.00 188.47 ? 75  DG  J N3    1 
ATOM   7732  C C4    . DG  I 6 76  ? 156.152 198.432 166.772 1.00 188.47 ? 75  DG  J C4    1 
ATOM   7733  P P     . DT  I 6 77  ? 159.623 201.777 170.762 1.00 190.16 ? 76  DT  J P     1 
ATOM   7734  O OP1   . DT  I 6 77  ? 160.156 203.141 170.949 1.00 190.16 ? 76  DT  J OP1   1 
ATOM   7735  O OP2   . DT  I 6 77  ? 160.244 200.638 171.469 1.00 190.16 ? 76  DT  J OP2   1 
ATOM   7736  O "O5'" . DT  I 6 77  ? 158.067 201.790 171.105 1.00 190.16 ? 76  DT  J "O5'" 1 
ATOM   7737  C "C5'" . DT  I 6 77  ? 157.134 201.975 170.062 1.00 190.16 ? 76  DT  J "C5'" 1 
ATOM   7738  C "C4'" . DT  I 6 77  ? 155.855 202.588 170.576 1.00 190.16 ? 76  DT  J "C4'" 1 
ATOM   7739  O "O4'" . DT  I 6 77  ? 154.732 201.872 170.013 1.00 190.16 ? 76  DT  J "O4'" 1 
ATOM   7740  C "C3'" . DT  I 6 77  ? 155.663 202.509 172.076 1.00 190.16 ? 76  DT  J "C3'" 1 
ATOM   7741  O "O3'" . DT  I 6 77  ? 154.799 203.552 172.492 1.00 190.16 ? 76  DT  J "O3'" 1 
ATOM   7742  C "C2'" . DT  I 6 77  ? 155.022 201.141 172.236 1.00 190.16 ? 76  DT  J "C2'" 1 
ATOM   7743  C "C1'" . DT  I 6 77  ? 154.150 201.042 170.992 1.00 190.16 ? 76  DT  J "C1'" 1 
ATOM   7744  N N1    . DT  I 6 77  ? 154.085 199.674 170.460 1.00 190.16 ? 76  DT  J N1    1 
ATOM   7745  C C2    . DT  I 6 77  ? 152.894 199.185 170.004 1.00 190.16 ? 76  DT  J C2    1 
ATOM   7746  O O2    . DT  I 6 77  ? 151.866 199.829 170.008 1.00 190.16 ? 76  DT  J O2    1 
ATOM   7747  N N3    . DT  I 6 77  ? 152.947 197.898 169.548 1.00 190.16 ? 76  DT  J N3    1 
ATOM   7748  C C4    . DT  I 6 77  ? 154.053 197.083 169.500 1.00 190.16 ? 76  DT  J C4    1 
ATOM   7749  O O4    . DT  I 6 77  ? 154.012 195.943 169.072 1.00 190.16 ? 76  DT  J O4    1 
ATOM   7750  C C5    . DT  I 6 77  ? 155.263 197.660 169.996 1.00 190.16 ? 76  DT  J C5    1 
ATOM   7751  C C7    . DT  I 6 77  ? 156.522 196.856 170.000 1.00 190.16 ? 76  DT  J C7    1 
ATOM   7752  C C6    . DT  I 6 77  ? 155.224 198.911 170.449 1.00 190.16 ? 76  DT  J C6    1 
ATOM   7753  P P     . DC  I 6 78  ? 154.286 203.654 174.011 1.00 187.95 ? 77  DC  J P     1 
ATOM   7754  O OP1   . DC  I 6 78  ? 154.055 205.092 174.259 1.00 187.95 ? 77  DC  J OP1   1 
ATOM   7755  O OP2   . DC  I 6 78  ? 155.197 202.917 174.914 1.00 187.95 ? 77  DC  J OP2   1 
ATOM   7756  O "O5'" . DC  I 6 78  ? 152.860 202.935 173.965 1.00 187.95 ? 77  DC  J "O5'" 1 
ATOM   7757  C "C5'" . DC  I 6 78  ? 151.935 203.332 172.970 1.00 187.95 ? 77  DC  J "C5'" 1 
ATOM   7758  C "C4'" . DC  I 6 78  ? 150.615 202.590 173.076 1.00 187.95 ? 77  DC  J "C4'" 1 
ATOM   7759  O "O4'" . DC  I 6 78  ? 150.716 201.283 172.463 1.00 187.95 ? 77  DC  J "O4'" 1 
ATOM   7760  C "C3'" . DC  I 6 78  ? 150.077 202.367 174.480 1.00 187.95 ? 77  DC  J "C3'" 1 
ATOM   7761  O "O3'" . DC  I 6 78  ? 148.685 202.585 174.440 1.00 187.95 ? 77  DC  J "O3'" 1 
ATOM   7762  C "C2'" . DC  I 6 78  ? 150.408 200.896 174.733 1.00 187.95 ? 77  DC  J "C2'" 1 
ATOM   7763  C "C1'" . DC  I 6 78  ? 150.229 200.303 173.348 1.00 187.95 ? 77  DC  J "C1'" 1 
ATOM   7764  N N1    . DC  I 6 78  ? 151.026 199.101 173.115 1.00 187.95 ? 77  DC  J N1    1 
ATOM   7765  C C2    . DC  I 6 78  ? 150.449 197.975 172.538 1.00 187.95 ? 77  DC  J C2    1 
ATOM   7766  O O2    . DC  I 6 78  ? 149.259 197.985 172.246 1.00 187.95 ? 77  DC  J O2    1 
ATOM   7767  N N3    . DC  I 6 78  ? 151.221 196.896 172.305 1.00 187.95 ? 77  DC  J N3    1 
ATOM   7768  C C4    . DC  I 6 78  ? 152.509 196.924 172.615 1.00 187.95 ? 77  DC  J C4    1 
ATOM   7769  N N4    . DC  I 6 78  ? 153.235 195.833 172.377 1.00 187.95 ? 77  DC  J N4    1 
ATOM   7770  C C5    . DC  I 6 78  ? 153.111 198.062 173.202 1.00 187.95 ? 77  DC  J C5    1 
ATOM   7771  C C6    . DC  I 6 78  ? 152.339 199.118 173.427 1.00 187.95 ? 77  DC  J C6    1 
ATOM   7772  P P     . DC  I 6 79  ? 147.824 202.819 175.772 1.00 185.59 ? 78  DC  J P     1 
ATOM   7773  O OP1   . DC  I 6 79  ? 147.257 204.179 175.684 1.00 185.59 ? 78  DC  J OP1   1 
ATOM   7774  O OP2   . DC  I 6 79  ? 148.621 202.440 176.954 1.00 185.59 ? 78  DC  J OP2   1 
ATOM   7775  O "O5'" . DC  I 6 79  ? 146.635 201.771 175.599 1.00 185.59 ? 78  DC  J "O5'" 1 
ATOM   7776  C "C5'" . DC  I 6 79  ? 146.654 200.887 174.483 1.00 185.59 ? 78  DC  J "C5'" 1 
ATOM   7777  C "C4'" . DC  I 6 79  ? 145.815 199.651 174.728 1.00 185.59 ? 78  DC  J "C4'" 1 
ATOM   7778  O "O4'" . DC  I 6 79  ? 146.593 198.473 174.389 1.00 185.59 ? 78  DC  J "O4'" 1 
ATOM   7779  C "C3'" . DC  I 6 79  ? 145.405 199.424 176.169 1.00 185.59 ? 78  DC  J "C3'" 1 
ATOM   7780  O "O3'" . DC  I 6 79  ? 144.338 198.500 176.195 1.00 185.59 ? 78  DC  J "O3'" 1 
ATOM   7781  C "C2'" . DC  I 6 79  ? 146.656 198.755 176.685 1.00 185.59 ? 78  DC  J "C2'" 1 
ATOM   7782  C "C1'" . DC  I 6 79  ? 146.829 197.743 175.571 1.00 185.59 ? 78  DC  J "C1'" 1 
ATOM   7783  N N1    . DC  I 6 79  ? 148.162 197.124 175.498 1.00 185.59 ? 78  DC  J N1    1 
ATOM   7784  C C2    . DC  I 6 79  ? 148.289 195.867 174.922 1.00 185.59 ? 78  DC  J C2    1 
ATOM   7785  O O2    . DC  I 6 79  ? 147.278 195.307 174.486 1.00 185.59 ? 78  DC  J O2    1 
ATOM   7786  N N3    . DC  I 6 79  ? 149.509 195.299 174.852 1.00 185.59 ? 78  DC  J N3    1 
ATOM   7787  C C4    . DC  I 6 79  ? 150.566 195.942 175.338 1.00 185.59 ? 78  DC  J C4    1 
ATOM   7788  N N4    . DC  I 6 79  ? 151.750 195.342 175.255 1.00 185.59 ? 78  DC  J N4    1 
ATOM   7789  C C5    . DC  I 6 79  ? 150.456 197.226 175.934 1.00 185.59 ? 78  DC  J C5    1 
ATOM   7790  C C6    . DC  I 6 79  ? 149.245 197.773 175.995 1.00 185.59 ? 78  DC  J C6    1 
ATOM   7791  P P     . DC  I 6 80  ? 142.807 198.978 176.211 1.00 186.11 ? 79  DC  J P     1 
ATOM   7792  O OP1   . DC  I 6 80  ? 142.574 199.932 175.109 1.00 186.11 ? 79  DC  J OP1   1 
ATOM   7793  O OP2   . DC  I 6 80  ? 142.488 199.358 177.603 1.00 186.11 ? 79  DC  J OP2   1 
ATOM   7794  O "O5'" . DC  I 6 80  ? 142.013 197.634 175.870 1.00 186.11 ? 79  DC  J "O5'" 1 
ATOM   7795  C "C5'" . DC  I 6 80  ? 142.626 196.649 175.032 1.00 186.11 ? 79  DC  J "C5'" 1 
ATOM   7796  C "C4'" . DC  I 6 80  ? 142.637 195.280 175.695 1.00 186.11 ? 79  DC  J "C4'" 1 
ATOM   7797  O "O4'" . DC  I 6 80  ? 144.010 194.854 175.929 1.00 186.11 ? 79  DC  J "O4'" 1 
ATOM   7798  C "C3'" . DC  I 6 80  ? 141.961 195.208 177.066 1.00 186.11 ? 79  DC  J "C3'" 1 
ATOM   7799  O "O3'" . DC  I 6 80  ? 141.457 193.902 177.272 1.00 186.11 ? 79  DC  J "O3'" 1 
ATOM   7800  C "C2'" . DC  I 6 80  ? 143.142 195.450 177.981 1.00 186.11 ? 79  DC  J "C2'" 1 
ATOM   7801  C "C1'" . DC  I 6 80  ? 144.142 194.544 177.295 1.00 186.11 ? 79  DC  J "C1'" 1 
ATOM   7802  N N1    . DC  I 6 80  ? 145.542 194.739 177.711 1.00 186.11 ? 79  DC  J N1    1 
ATOM   7803  C C2    . DC  I 6 80  ? 146.499 193.812 177.319 1.00 186.11 ? 79  DC  J C2    1 
ATOM   7804  O O2    . DC  I 6 80  ? 146.151 192.850 176.633 1.00 186.11 ? 79  DC  J O2    1 
ATOM   7805  N N3    . DC  I 6 80  ? 147.780 193.998 177.693 1.00 186.11 ? 79  DC  J N3    1 
ATOM   7806  C C4    . DC  I 6 80  ? 148.109 195.051 178.431 1.00 186.11 ? 79  DC  J C4    1 
ATOM   7807  N N4    . DC  I 6 80  ? 149.386 195.193 178.780 1.00 186.11 ? 79  DC  J N4    1 
ATOM   7808  C C5    . DC  I 6 80  ? 147.144 196.001 178.854 1.00 186.11 ? 79  DC  J C5    1 
ATOM   7809  C C6    . DC  I 6 80  ? 145.882 195.804 178.478 1.00 186.11 ? 79  DC  J C6    1 
ATOM   7810  P P     . DC  I 6 81  ? 139.945 193.528 176.888 1.00 186.98 ? 80  DC  J P     1 
ATOM   7811  O OP1   . DC  I 6 81  ? 139.419 194.575 175.991 1.00 186.98 ? 80  DC  J OP1   1 
ATOM   7812  O OP2   . DC  I 6 81  ? 139.242 193.216 178.149 1.00 186.98 ? 80  DC  J OP2   1 
ATOM   7813  O "O5'" . DC  I 6 81  ? 140.099 192.160 176.079 1.00 186.98 ? 80  DC  J "O5'" 1 
ATOM   7814  C "C5'" . DC  I 6 81  ? 141.388 191.745 175.636 1.00 186.98 ? 80  DC  J "C5'" 1 
ATOM   7815  C "C4'" . DC  I 6 81  ? 141.847 190.486 176.353 1.00 186.98 ? 80  DC  J "C4'" 1 
ATOM   7816  O "O4'" . DC  I 6 81  ? 143.068 190.758 177.090 1.00 186.98 ? 80  DC  J "O4'" 1 
ATOM   7817  C "C3'" . DC  I 6 81  ? 140.873 189.926 177.388 1.00 186.98 ? 80  DC  J "C3'" 1 
ATOM   7818  O "O3'" . DC  I 6 81  ? 141.079 188.526 177.529 1.00 186.98 ? 80  DC  J "O3'" 1 
ATOM   7819  C "C2'" . DC  I 6 81  ? 141.348 190.635 178.640 1.00 186.98 ? 80  DC  J "C2'" 1 
ATOM   7820  C "C1'" . DC  I 6 81  ? 142.844 190.471 178.451 1.00 186.98 ? 80  DC  J "C1'" 1 
ATOM   7821  N N1    . DC  I 6 81  ? 143.670 191.381 179.260 1.00 186.98 ? 80  DC  J N1    1 
ATOM   7822  C C2    . DC  I 6 81  ? 145.037 191.157 179.341 1.00 186.98 ? 80  DC  J C2    1 
ATOM   7823  O O2    . DC  I 6 81  ? 145.521 190.197 178.742 1.00 186.98 ? 80  DC  J O2    1 
ATOM   7824  N N3    . DC  I 6 81  ? 145.795 191.997 180.070 1.00 186.98 ? 80  DC  J N3    1 
ATOM   7825  C C4    . DC  I 6 81  ? 145.234 193.023 180.696 1.00 186.98 ? 80  DC  J C4    1 
ATOM   7826  N N4    . DC  I 6 81  ? 146.026 193.823 181.410 1.00 186.98 ? 80  DC  J N4    1 
ATOM   7827  C C5    . DC  I 6 81  ? 143.836 193.262 180.641 1.00 186.98 ? 80  DC  J C5    1 
ATOM   7828  C C6    . DC  I 6 81  ? 143.097 192.424 179.915 1.00 186.98 ? 80  DC  J C6    1 
ATOM   7829  P P     . DC  I 6 82  ? 140.431 187.463 176.513 1.00 183.55 ? 81  DC  J P     1 
ATOM   7830  O OP1   . DC  I 6 82  ? 139.822 188.149 175.356 1.00 183.55 ? 81  DC  J OP1   1 
ATOM   7831  O OP2   . DC  I 6 82  ? 139.606 186.546 177.324 1.00 183.55 ? 81  DC  J OP2   1 
ATOM   7832  O "O5'" . DC  I 6 82  ? 141.696 186.628 176.018 1.00 183.55 ? 81  DC  J "O5'" 1 
ATOM   7833  C "C5'" . DC  I 6 82  ? 142.978 186.931 176.546 1.00 183.55 ? 81  DC  J "C5'" 1 
ATOM   7834  C "C4'" . DC  I 6 82  ? 143.587 185.720 177.213 1.00 183.55 ? 81  DC  J "C4'" 1 
ATOM   7835  O "O4'" . DC  I 6 82  ? 144.287 186.124 178.407 1.00 183.55 ? 81  DC  J "O4'" 1 
ATOM   7836  C "C3'" . DC  I 6 82  ? 142.587 184.689 177.689 1.00 183.55 ? 81  DC  J "C3'" 1 
ATOM   7837  O "O3'" . DC  I 6 82  ? 143.244 183.459 177.884 1.00 183.55 ? 81  DC  J "O3'" 1 
ATOM   7838  C "C2'" . DC  I 6 82  ? 142.177 185.290 179.025 1.00 183.55 ? 81  DC  J "C2'" 1 
ATOM   7839  C "C1'" . DC  I 6 82  ? 143.530 185.763 179.546 1.00 183.55 ? 81  DC  J "C1'" 1 
ATOM   7840  N N1    . DC  I 6 82  ? 143.469 186.939 180.428 1.00 183.55 ? 81  DC  J N1    1 
ATOM   7841  C C2    . DC  I 6 82  ? 144.642 187.410 181.007 1.00 183.55 ? 81  DC  J C2    1 
ATOM   7842  O O2    . DC  I 6 82  ? 145.695 186.811 180.790 1.00 183.55 ? 81  DC  J O2    1 
ATOM   7843  N N3    . DC  I 6 82  ? 144.592 188.501 181.793 1.00 183.55 ? 81  DC  J N3    1 
ATOM   7844  C C4    . DC  I 6 82  ? 143.438 189.117 182.002 1.00 183.55 ? 81  DC  J C4    1 
ATOM   7845  N N4    . DC  I 6 82  ? 143.442 190.195 182.787 1.00 183.55 ? 81  DC  J N4    1 
ATOM   7846  C C5    . DC  I 6 82  ? 142.224 188.649 181.429 1.00 183.55 ? 81  DC  J C5    1 
ATOM   7847  C C6    . DC  I 6 82  ? 142.288 187.576 180.641 1.00 183.55 ? 81  DC  J C6    1 
ATOM   7848  P P     . DG  I 6 83  ? 143.556 182.467 176.659 1.00 176.14 ? 82  DG  J P     1 
ATOM   7849  O OP1   . DG  I 6 83  ? 143.458 183.122 175.341 1.00 176.14 ? 82  DG  J OP1   1 
ATOM   7850  O OP2   . DG  I 6 83  ? 142.748 181.261 176.919 1.00 176.14 ? 82  DG  J OP2   1 
ATOM   7851  O "O5'" . DG  I 6 83  ? 145.064 182.046 176.927 1.00 176.14 ? 82  DG  J "O5'" 1 
ATOM   7852  C "C5'" . DG  I 6 83  ? 145.310 181.010 177.835 1.00 176.14 ? 82  DG  J "C5'" 1 
ATOM   7853  C "C4'" . DG  I 6 83  ? 146.641 181.162 178.532 1.00 176.14 ? 82  DG  J "C4'" 1 
ATOM   7854  O "O4'" . DG  I 6 83  ? 146.591 182.312 179.410 1.00 176.14 ? 82  DG  J "O4'" 1 
ATOM   7855  C "C3'" . DG  I 6 83  ? 146.941 180.016 179.458 1.00 176.14 ? 82  DG  J "C3'" 1 
ATOM   7856  O "O3'" . DG  I 6 83  ? 148.287 180.012 179.809 1.00 176.14 ? 82  DG  J "O3'" 1 
ATOM   7857  C "C2'" . DG  I 6 83  ? 146.082 180.395 180.628 1.00 176.14 ? 82  DG  J "C2'" 1 
ATOM   7858  C "C1'" . DG  I 6 83  ? 146.443 181.861 180.741 1.00 176.14 ? 82  DG  J "C1'" 1 
ATOM   7859  N N9    . DG  I 6 83  ? 145.420 182.660 181.385 1.00 176.14 ? 82  DG  J N9    1 
ATOM   7860  C C8    . DG  I 6 83  ? 144.069 182.585 181.187 1.00 176.14 ? 82  DG  J C8    1 
ATOM   7861  N N7    . DG  I 6 83  ? 143.394 183.438 181.900 1.00 176.14 ? 82  DG  J N7    1 
ATOM   7862  C C5    . DG  I 6 83  ? 144.362 184.130 182.603 1.00 176.14 ? 82  DG  J C5    1 
ATOM   7863  C C6    . DG  I 6 83  ? 144.230 185.181 183.531 1.00 176.14 ? 82  DG  J C6    1 
ATOM   7864  O O6    . DG  I 6 83  ? 143.200 185.731 183.921 1.00 176.14 ? 82  DG  J O6    1 
ATOM   7865  N N1    . DG  I 6 83  ? 145.461 185.595 184.021 1.00 176.14 ? 82  DG  J N1    1 
ATOM   7866  C C2    . DG  I 6 83  ? 146.668 185.059 183.658 1.00 176.14 ? 82  DG  J C2    1 
ATOM   7867  N N2    . DG  I 6 83  ? 147.755 185.583 184.241 1.00 176.14 ? 82  DG  J N2    1 
ATOM   7868  N N3    . DG  I 6 83  ? 146.805 184.069 182.785 1.00 176.14 ? 82  DG  J N3    1 
ATOM   7869  C C4    . DG  I 6 83  ? 145.613 183.660 182.299 1.00 176.14 ? 82  DG  J C4    1 
ATOM   7870  P P     . DC  I 6 84  ? 148.993 178.620 180.159 1.00 166.96 ? 83  DC  J P     1 
ATOM   7871  O OP1   . DC  I 6 84  ? 149.843 178.261 179.014 1.00 166.96 ? 83  DC  J OP1   1 
ATOM   7872  O OP2   . DC  I 6 84  ? 147.953 177.685 180.625 1.00 166.96 ? 83  DC  J OP2   1 
ATOM   7873  O "O5'" . DC  I 6 84  ? 149.920 178.965 181.399 1.00 166.96 ? 83  DC  J "O5'" 1 
ATOM   7874  C "C5'" . DC  I 6 84  ? 150.937 179.909 181.251 1.00 166.96 ? 83  DC  J "C5'" 1 
ATOM   7875  C "C4'" . DC  I 6 84  ? 151.286 180.523 182.581 1.00 166.96 ? 83  DC  J "C4'" 1 
ATOM   7876  O "O4'" . DC  I 6 84  ? 150.178 181.323 183.052 1.00 166.96 ? 83  DC  J "O4'" 1 
ATOM   7877  C "C3'" . DC  I 6 84  ? 151.590 179.522 183.676 1.00 166.96 ? 83  DC  J "C3'" 1 
ATOM   7878  O "O3'" . DC  I 6 84  ? 152.754 179.909 184.348 1.00 166.96 ? 83  DC  J "O3'" 1 
ATOM   7879  C "C2'" . DC  I 6 84  ? 150.369 179.602 184.582 1.00 166.96 ? 83  DC  J "C2'" 1 
ATOM   7880  C "C1'" . DC  I 6 84  ? 149.922 181.035 184.398 1.00 166.96 ? 83  DC  J "C1'" 1 
ATOM   7881  N N1    . DC  I 6 84  ? 148.485 181.223 184.604 1.00 166.96 ? 83  DC  J N1    1 
ATOM   7882  C C2    . DC  I 6 84  ? 148.011 182.227 185.445 1.00 166.96 ? 83  DC  J C2    1 
ATOM   7883  O O2    . DC  I 6 84  ? 148.807 182.936 186.044 1.00 166.96 ? 83  DC  J O2    1 
ATOM   7884  N N3    . DC  I 6 84  ? 146.676 182.381 185.585 1.00 166.96 ? 83  DC  J N3    1 
ATOM   7885  C C4    . DC  I 6 84  ? 145.845 181.596 184.921 1.00 166.96 ? 83  DC  J C4    1 
ATOM   7886  N N4    . DC  I 6 84  ? 144.533 181.774 185.078 1.00 166.96 ? 83  DC  J N4    1 
ATOM   7887  C C5    . DC  I 6 84  ? 146.315 180.575 184.076 1.00 166.96 ? 83  DC  J C5    1 
ATOM   7888  C C6    . DC  I 6 84  ? 147.627 180.439 183.929 1.00 166.96 ? 83  DC  J C6    1 
ATOM   7889  P P     . DG  I 6 85  ? 153.543 178.855 185.257 1.00 171.20 ? 84  DG  J P     1 
ATOM   7890  O OP1   . DG  I 6 85  ? 154.985 179.083 185.048 1.00 171.20 ? 84  DG  J OP1   1 
ATOM   7891  O OP2   . DG  I 6 85  ? 152.969 177.522 185.009 1.00 171.20 ? 84  DG  J OP2   1 
ATOM   7892  O "O5'" . DG  I 6 85  ? 153.166 179.291 186.736 1.00 171.20 ? 84  DG  J "O5'" 1 
ATOM   7893  C "C5'" . DG  I 6 85  ? 153.336 180.620 187.115 1.00 171.20 ? 84  DG  J "C5'" 1 
ATOM   7894  C "C4'" . DG  I 6 85  ? 152.797 180.848 188.499 1.00 171.20 ? 84  DG  J "C4'" 1 
ATOM   7895  O "O4'" . DG  I 6 85  ? 151.389 181.134 188.421 1.00 171.20 ? 84  DG  J "O4'" 1 
ATOM   7896  C "C3'" . DG  I 6 85  ? 152.951 179.663 189.435 1.00 171.20 ? 84  DG  J "C3'" 1 
ATOM   7897  O "O3'" . DG  I 6 85  ? 153.500 180.091 190.667 1.00 171.20 ? 84  DG  J "O3'" 1 
ATOM   7898  C "C2'" . DG  I 6 85  ? 151.529 179.141 189.603 1.00 171.20 ? 84  DG  J "C2'" 1 
ATOM   7899  C "C1'" . DG  I 6 85  ? 150.695 180.379 189.369 1.00 171.20 ? 84  DG  J "C1'" 1 
ATOM   7900  N N9    . DG  I 6 85  ? 149.397 180.071 188.808 1.00 171.20 ? 84  DG  J N9    1 
ATOM   7901  C C8    . DG  I 6 85  ? 149.142 179.236 187.763 1.00 171.20 ? 84  DG  J C8    1 
ATOM   7902  N N7    . DG  I 6 85  ? 147.885 179.146 187.464 1.00 171.20 ? 84  DG  J N7    1 
ATOM   7903  C C5    . DG  I 6 85  ? 147.268 179.975 188.372 1.00 171.20 ? 84  DG  J C5    1 
ATOM   7904  C C6    . DG  I 6 85  ? 145.912 180.275 188.534 1.00 171.20 ? 84  DG  J C6    1 
ATOM   7905  O O6    . DG  I 6 85  ? 144.955 179.858 187.880 1.00 171.20 ? 84  DG  J O6    1 
ATOM   7906  N N1    . DG  I 6 85  ? 145.705 181.159 189.574 1.00 171.20 ? 84  DG  J N1    1 
ATOM   7907  C C2    . DG  I 6 85  ? 146.691 181.685 190.359 1.00 171.20 ? 84  DG  J C2    1 
ATOM   7908  N N2    . DG  I 6 85  ? 146.295 182.528 191.309 1.00 171.20 ? 84  DG  J N2    1 
ATOM   7909  N N3    . DG  I 6 85  ? 147.973 181.416 190.216 1.00 171.20 ? 84  DG  J N3    1 
ATOM   7910  C C4    . DG  I 6 85  ? 148.185 180.552 189.210 1.00 171.20 ? 84  DG  J C4    1 
ATOM   7911  P P     . DT  I 6 86  ? 153.893 179.025 191.800 1.00 178.41 ? 85  DT  J P     1 
ATOM   7912  O OP1   . DT  I 6 86  ? 155.062 179.566 192.516 1.00 178.41 ? 85  DT  J OP1   1 
ATOM   7913  O OP2   . DT  I 6 86  ? 153.993 177.693 191.181 1.00 178.41 ? 85  DT  J OP2   1 
ATOM   7914  O "O5'" . DT  I 6 86  ? 152.642 179.046 192.788 1.00 178.41 ? 85  DT  J "O5'" 1 
ATOM   7915  C "C5'" . DT  I 6 86  ? 152.392 180.205 193.546 1.00 178.41 ? 85  DT  J "C5'" 1 
ATOM   7916  C "C4'" . DT  I 6 86  ? 151.022 180.165 194.185 1.00 178.41 ? 85  DT  J "C4'" 1 
ATOM   7917  O "O4'" . DT  I 6 86  ? 150.028 179.934 193.179 1.00 178.41 ? 85  DT  J "O4'" 1 
ATOM   7918  C "C3'" . DT  I 6 86  ? 150.816 179.062 195.225 1.00 178.41 ? 85  DT  J "C3'" 1 
ATOM   7919  O "O3'" . DT  I 6 86  ? 150.726 179.631 196.526 1.00 178.41 ? 85  DT  J "O3'" 1 
ATOM   7920  C "C2'" . DT  I 6 86  ? 149.497 178.400 194.817 1.00 178.41 ? 85  DT  J "C2'" 1 
ATOM   7921  C "C1'" . DT  I 6 86  ? 148.921 179.370 193.809 1.00 178.41 ? 85  DT  J "C1'" 1 
ATOM   7922  N N1    . DT  I 6 86  ? 148.104 178.712 192.802 1.00 178.41 ? 85  DT  J N1    1 
ATOM   7923  C C2    . DT  I 6 86  ? 146.750 178.864 192.838 1.00 178.41 ? 85  DT  J C2    1 
ATOM   7924  O O2    . DT  I 6 86  ? 146.181 179.534 193.671 1.00 178.41 ? 85  DT  J O2    1 
ATOM   7925  N N3    . DT  I 6 86  ? 146.077 178.212 191.857 1.00 178.41 ? 85  DT  J N3    1 
ATOM   7926  C C4    . DT  I 6 86  ? 146.617 177.432 190.868 1.00 178.41 ? 85  DT  J C4    1 
ATOM   7927  O O4    . DT  I 6 86  ? 145.933 176.879 190.027 1.00 178.41 ? 85  DT  J O4    1 
ATOM   7928  C C5    . DT  I 6 86  ? 148.044 177.310 190.892 1.00 178.41 ? 85  DT  J C5    1 
ATOM   7929  C C7    . DT  I 6 86  ? 148.738 176.480 189.864 1.00 178.41 ? 85  DT  J C7    1 
ATOM   7930  C C6    . DT  I 6 86  ? 148.714 177.954 191.844 1.00 178.41 ? 85  DT  J C6    1 
ATOM   7931  P P     . DT  I 6 87  ? 150.554 178.694 197.821 1.00 192.94 ? 86  DT  J P     1 
ATOM   7932  O OP1   . DT  I 6 87  ? 151.143 179.421 198.963 1.00 192.94 ? 86  DT  J OP1   1 
ATOM   7933  O OP2   . DT  I 6 87  ? 151.037 177.337 197.491 1.00 192.94 ? 86  DT  J OP2   1 
ATOM   7934  O "O5'" . DT  I 6 87  ? 148.973 178.622 198.043 1.00 192.94 ? 86  DT  J "O5'" 1 
ATOM   7935  C "C5'" . DT  I 6 87  ? 148.216 179.819 198.072 1.00 192.94 ? 86  DT  J "C5'" 1 
ATOM   7936  C "C4'" . DT  I 6 87  ? 146.743 179.525 198.275 1.00 192.94 ? 86  DT  J "C4'" 1 
ATOM   7937  O "O4'" . DT  I 6 87  ? 146.147 179.099 197.026 1.00 192.94 ? 86  DT  J "O4'" 1 
ATOM   7938  C "C3'" . DT  I 6 87  ? 146.440 178.429 199.292 1.00 192.94 ? 86  DT  J "C3'" 1 
ATOM   7939  O "O3'" . DT  I 6 87  ? 145.496 178.902 200.236 1.00 192.94 ? 86  DT  J "O3'" 1 
ATOM   7940  C "C2'" . DT  I 6 87  ? 145.872 177.292 198.443 1.00 192.94 ? 86  DT  J "C2'" 1 
ATOM   7941  C "C1'" . DT  I 6 87  ? 145.267 178.036 197.273 1.00 192.94 ? 86  DT  J "C1'" 1 
ATOM   7942  N N1    . DT  I 6 87  ? 145.194 177.220 196.054 1.00 192.94 ? 86  DT  J N1    1 
ATOM   7943  C C2    . DT  I 6 87  ? 143.987 177.032 195.425 1.00 192.94 ? 86  DT  J C2    1 
ATOM   7944  O O2    . DT  I 6 87  ? 142.942 177.500 195.826 1.00 192.94 ? 86  DT  J O2    1 
ATOM   7945  N N3    . DT  I 6 87  ? 144.051 176.262 194.303 1.00 192.94 ? 86  DT  J N3    1 
ATOM   7946  C C4    . DT  I 6 87  ? 145.171 175.689 193.755 1.00 192.94 ? 86  DT  J C4    1 
ATOM   7947  O O4    . DT  I 6 87  ? 145.133 175.012 192.741 1.00 192.94 ? 86  DT  J O4    1 
ATOM   7948  C C5    . DT  I 6 87  ? 146.392 175.925 194.462 1.00 192.94 ? 86  DT  J C5    1 
ATOM   7949  C C7    . DT  I 6 87  ? 147.666 175.331 193.962 1.00 192.94 ? 86  DT  J C7    1 
ATOM   7950  C C6    . DT  I 6 87  ? 146.349 176.680 195.557 1.00 192.94 ? 86  DT  J C6    1 
ATOM   7951  P P     . DT  I 6 88  ? 145.025 177.974 201.461 1.00 199.76 ? 87  DT  J P     1 
ATOM   7952  O OP1   . DT  I 6 88  ? 144.691 178.882 202.576 1.00 199.76 ? 87  DT  J OP1   1 
ATOM   7953  O OP2   . DT  I 6 88  ? 146.011 176.893 201.677 1.00 199.76 ? 87  DT  J OP2   1 
ATOM   7954  O "O5'" . DT  I 6 88  ? 143.666 177.327 200.935 1.00 199.76 ? 87  DT  J "O5'" 1 
ATOM   7955  C "C5'" . DT  I 6 88  ? 142.617 178.176 200.515 1.00 199.76 ? 87  DT  J "C5'" 1 
ATOM   7956  C "C4'" . DT  I 6 88  ? 141.455 177.376 199.967 1.00 199.76 ? 87  DT  J "C4'" 1 
ATOM   7957  O "O4'" . DT  I 6 88  ? 141.807 176.823 198.676 1.00 199.76 ? 87  DT  J "O4'" 1 
ATOM   7958  C "C3'" . DT  I 6 88  ? 141.012 176.196 200.831 1.00 199.76 ? 87  DT  J "C3'" 1 
ATOM   7959  O "O3'" . DT  I 6 88  ? 139.603 176.213 200.950 1.00 199.76 ? 87  DT  J "O3'" 1 
ATOM   7960  C "C2'" . DT  I 6 88  ? 141.497 174.989 200.037 1.00 199.76 ? 87  DT  J "C2'" 1 
ATOM   7961  C "C1'" . DT  I 6 88  ? 141.367 175.496 198.624 1.00 199.76 ? 87  DT  J "C1'" 1 
ATOM   7962  N N1    . DT  I 6 88  ? 142.202 174.770 197.662 1.00 199.76 ? 87  DT  J N1    1 
ATOM   7963  C C2    . DT  I 6 88  ? 141.629 174.297 196.520 1.00 199.76 ? 87  DT  J C2    1 
ATOM   7964  O O2    . DT  I 6 88  ? 140.454 174.443 196.258 1.00 199.76 ? 87  DT  J O2    1 
ATOM   7965  N N3    . DT  I 6 88  ? 142.478 173.648 195.683 1.00 199.76 ? 87  DT  J N3    1 
ATOM   7966  C C4    . DT  I 6 88  ? 143.819 173.423 195.873 1.00 199.76 ? 87  DT  J C4    1 
ATOM   7967  O O4    . DT  I 6 88  ? 144.500 172.826 195.056 1.00 199.76 ? 87  DT  J O4    1 
ATOM   7968  C C5    . DT  I 6 88  ? 144.363 173.946 197.093 1.00 199.76 ? 87  DT  J C5    1 
ATOM   7969  C C7    . DT  I 6 88  ? 145.811 173.749 197.411 1.00 199.76 ? 87  DT  J C7    1 
ATOM   7970  C C6    . DT  I 6 88  ? 143.539 174.594 197.920 1.00 199.76 ? 87  DT  J C6    1 
ATOM   7971  P P     . DT  I 6 89  ? 138.822 175.131 201.847 1.00 201.79 ? 88  DT  J P     1 
ATOM   7972  O OP1   . DT  I 6 89  ? 137.770 175.887 202.555 1.00 201.79 ? 88  DT  J OP1   1 
ATOM   7973  O OP2   . DT  I 6 89  ? 139.759 174.310 202.644 1.00 201.79 ? 88  DT  J OP2   1 
ATOM   7974  O "O5'" . DT  I 6 89  ? 138.110 174.207 200.760 1.00 201.79 ? 88  DT  J "O5'" 1 
ATOM   7975  C "C5'" . DT  I 6 89  ? 137.202 174.797 199.847 1.00 201.79 ? 88  DT  J "C5'" 1 
ATOM   7976  C "C4'" . DT  I 6 89  ? 136.851 173.853 198.715 1.00 201.79 ? 88  DT  J "C4'" 1 
ATOM   7977  O "O4'" . DT  I 6 89  ? 138.047 173.465 197.998 1.00 201.79 ? 88  DT  J "O4'" 1 
ATOM   7978  C "C3'" . DT  I 6 89  ? 136.180 172.546 199.130 1.00 201.79 ? 88  DT  J "C3'" 1 
ATOM   7979  O "O3'" . DT  I 6 89  ? 135.160 172.248 198.204 1.00 201.79 ? 88  DT  J "O3'" 1 
ATOM   7980  C "C2'" . DT  I 6 89  ? 137.321 171.537 199.030 1.00 201.79 ? 88  DT  J "C2'" 1 
ATOM   7981  C "C1'" . DT  I 6 89  ? 138.011 172.074 197.801 1.00 201.79 ? 88  DT  J "C1'" 1 
ATOM   7982  N N1    . DT  I 6 89  ? 139.388 171.601 197.584 1.00 201.79 ? 88  DT  J N1    1 
ATOM   7983  C C2    . DT  I 6 89  ? 139.699 171.055 196.375 1.00 201.79 ? 88  DT  J C2    1 
ATOM   7984  O O2    . DT  I 6 89  ? 138.888 170.906 195.487 1.00 201.79 ? 88  DT  J O2    1 
ATOM   7985  N N3    . DT  I 6 89  ? 140.988 170.681 196.230 1.00 201.79 ? 88  DT  J N3    1 
ATOM   7986  C C4    . DT  I 6 89  ? 141.993 170.800 197.154 1.00 201.79 ? 88  DT  J C4    1 
ATOM   7987  O O4    . DT  I 6 89  ? 143.131 170.430 196.922 1.00 201.79 ? 88  DT  J O4    1 
ATOM   7988  C C5    . DT  I 6 89  ? 141.614 171.393 198.404 1.00 201.79 ? 88  DT  J C5    1 
ATOM   7989  C C7    . DT  I 6 89  ? 142.629 171.558 199.489 1.00 201.79 ? 88  DT  J C7    1 
ATOM   7990  C C6    . DT  I 6 89  ? 140.340 171.769 198.560 1.00 201.79 ? 88  DT  J C6    1 
ATOM   7991  P P     . DA  I 6 90  ? 133.781 171.622 198.719 1.00 197.41 ? 89  DA  J P     1 
ATOM   7992  O OP1   . DA  I 6 90  ? 132.780 171.735 197.638 1.00 197.41 ? 89  DA  J OP1   1 
ATOM   7993  O OP2   . DA  I 6 90  ? 133.494 172.270 200.013 1.00 197.41 ? 89  DA  J OP2   1 
ATOM   7994  O "O5'" . DA  I 6 90  ? 134.166 170.099 199.016 1.00 197.41 ? 89  DA  J "O5'" 1 
ATOM   7995  C "C5'" . DA  I 6 90  ? 133.547 169.048 198.305 1.00 197.41 ? 89  DA  J "C5'" 1 
ATOM   7996  C "C4'" . DA  I 6 90  ? 134.161 168.879 196.930 1.00 197.41 ? 89  DA  J "C4'" 1 
ATOM   7997  O "O4'" . DA  I 6 90  ? 135.595 169.081 196.994 1.00 197.41 ? 89  DA  J "O4'" 1 
ATOM   7998  C "C3'" . DA  I 6 90  ? 133.959 167.507 196.308 1.00 197.41 ? 89  DA  J "C3'" 1 
ATOM   7999  O "O3'" . DA  I 6 90  ? 133.661 167.668 194.947 1.00 197.41 ? 89  DA  J "O3'" 1 
ATOM   8000  C "C2'" . DA  I 6 90  ? 135.316 166.837 196.521 1.00 197.41 ? 89  DA  J "C2'" 1 
ATOM   8001  C "C1'" . DA  I 6 90  ? 136.235 168.014 196.336 1.00 197.41 ? 89  DA  J "C1'" 1 
ATOM   8002  N N9    . DA  I 6 90  ? 137.568 167.860 196.907 1.00 197.41 ? 89  DA  J N9    1 
ATOM   8003  C C8    . DA  I 6 90  ? 137.970 168.232 198.153 1.00 197.41 ? 89  DA  J C8    1 
ATOM   8004  N N7    . DA  I 6 90  ? 139.242 168.031 198.382 1.00 197.41 ? 89  DA  J N7    1 
ATOM   8005  C C5    . DA  I 6 90  ? 139.709 167.499 197.199 1.00 197.41 ? 89  DA  J C5    1 
ATOM   8006  C C6    . DA  I 6 90  ? 140.982 167.065 196.795 1.00 197.41 ? 89  DA  J C6    1 
ATOM   8007  N N6    . DA  I 6 90  ? 142.049 167.105 197.587 1.00 197.41 ? 89  DA  J N6    1 
ATOM   8008  N N1    . DA  I 6 90  ? 141.117 166.583 195.543 1.00 197.41 ? 89  DA  J N1    1 
ATOM   8009  C C2    . DA  I 6 90  ? 140.041 166.537 194.757 1.00 197.41 ? 89  DA  J C2    1 
ATOM   8010  N N3    . DA  I 6 90  ? 138.792 166.921 195.025 1.00 197.41 ? 89  DA  J N3    1 
ATOM   8011  C C4    . DA  I 6 90  ? 138.694 167.393 196.276 1.00 197.41 ? 89  DA  J C4    1 
ATOM   8012  P P     . DA  I 6 91  ? 133.252 166.407 194.050 1.00 202.04 ? 90  DA  J P     1 
ATOM   8013  O OP1   . DA  I 6 91  ? 132.253 166.868 193.066 1.00 202.04 ? 90  DA  J OP1   1 
ATOM   8014  O OP2   . DA  I 6 91  ? 132.900 165.287 194.945 1.00 202.04 ? 90  DA  J OP2   1 
ATOM   8015  O "O5'" . DA  I 6 91  ? 134.605 166.055 193.286 1.00 202.04 ? 90  DA  J "O5'" 1 
ATOM   8016  C "C5'" . DA  I 6 91  ? 134.561 165.627 191.939 1.00 202.04 ? 90  DA  J "C5'" 1 
ATOM   8017  C "C4'" . DA  I 6 91  ? 135.223 164.275 191.772 1.00 202.04 ? 90  DA  J "C4'" 1 
ATOM   8018  O "O4'" . DA  I 6 91  ? 136.363 164.174 192.664 1.00 202.04 ? 90  DA  J "O4'" 1 
ATOM   8019  C "C3'" . DA  I 6 91  ? 134.344 163.071 192.111 1.00 202.04 ? 90  DA  J "C3'" 1 
ATOM   8020  O "O3'" . DA  I 6 91  ? 134.771 161.955 191.355 1.00 202.04 ? 90  DA  J "O3'" 1 
ATOM   8021  C "C2'" . DA  I 6 91  ? 134.692 162.857 193.571 1.00 202.04 ? 90  DA  J "C2'" 1 
ATOM   8022  C "C1'" . DA  I 6 91  ? 136.192 163.032 193.465 1.00 202.04 ? 90  DA  J "C1'" 1 
ATOM   8023  N N9    . DA  I 6 91  ? 136.875 163.236 194.723 1.00 202.04 ? 90  DA  J N9    1 
ATOM   8024  C C8    . DA  I 6 91  ? 136.336 163.605 195.914 1.00 202.04 ? 90  DA  J C8    1 
ATOM   8025  N N7    . DA  I 6 91  ? 137.218 163.735 196.872 1.00 202.04 ? 90  DA  J N7    1 
ATOM   8026  C C5    . DA  I 6 91  ? 138.409 163.417 196.259 1.00 202.04 ? 90  DA  J C5    1 
ATOM   8027  C C6    . DA  I 6 91  ? 139.725 163.356 196.724 1.00 202.04 ? 90  DA  J C6    1 
ATOM   8028  N N6    . DA  I 6 91  ? 140.070 163.631 197.982 1.00 202.04 ? 90  DA  J N6    1 
ATOM   8029  N N1    . DA  I 6 91  ? 140.686 163.003 195.842 1.00 202.04 ? 90  DA  J N1    1 
ATOM   8030  C C2    . DA  I 6 91  ? 140.336 162.730 194.585 1.00 202.04 ? 90  DA  J C2    1 
ATOM   8031  N N3    . DA  I 6 91  ? 139.132 162.754 194.038 1.00 202.04 ? 90  DA  J N3    1 
ATOM   8032  C C4    . DA  I 6 91  ? 138.209 163.107 194.936 1.00 202.04 ? 90  DA  J C4    1 
ATOM   8033  P P     . DC  I 6 92  ? 134.168 161.651 189.901 1.00 199.87 ? 91  DC  J P     1 
ATOM   8034  O OP1   . DC  I 6 92  ? 133.467 162.851 189.398 1.00 199.87 ? 91  DC  J OP1   1 
ATOM   8035  O OP2   . DC  I 6 92  ? 133.438 160.373 190.003 1.00 199.87 ? 91  DC  J OP2   1 
ATOM   8036  O "O5'" . DC  I 6 92  ? 135.470 161.369 189.024 1.00 199.87 ? 91  DC  J "O5'" 1 
ATOM   8037  C "C5'" . DC  I 6 92  ? 136.750 161.697 189.545 1.00 199.87 ? 91  DC  J "C5'" 1 
ATOM   8038  C "C4'" . DC  I 6 92  ? 137.606 160.456 189.735 1.00 199.87 ? 91  DC  J "C4'" 1 
ATOM   8039  O "O4'" . DC  I 6 92  ? 138.046 160.378 191.116 1.00 199.87 ? 91  DC  J "O4'" 1 
ATOM   8040  C "C3'" . DC  I 6 92  ? 136.911 159.126 189.464 1.00 199.87 ? 91  DC  J "C3'" 1 
ATOM   8041  O "O3'" . DC  I 6 92  ? 137.882 158.161 189.078 1.00 199.87 ? 91  DC  J "O3'" 1 
ATOM   8042  C "C2'" . DC  I 6 92  ? 136.367 158.799 190.846 1.00 199.87 ? 91  DC  J "C2'" 1 
ATOM   8043  C "C1'" . DC  I 6 92  ? 137.581 159.172 191.674 1.00 199.87 ? 91  DC  J "C1'" 1 
ATOM   8044  N N1    . DC  I 6 92  ? 137.325 159.387 193.105 1.00 199.87 ? 91  DC  J N1    1 
ATOM   8045  C C2    . DC  I 6 92  ? 138.406 159.496 193.977 1.00 199.87 ? 91  DC  J C2    1 
ATOM   8046  O O2    . DC  I 6 92  ? 139.549 159.368 193.541 1.00 199.87 ? 91  DC  J O2    1 
ATOM   8047  N N3    . DC  I 6 92  ? 138.172 159.726 195.283 1.00 199.87 ? 91  DC  J N3    1 
ATOM   8048  C C4    . DC  I 6 92  ? 136.928 159.848 195.723 1.00 199.87 ? 91  DC  J C4    1 
ATOM   8049  N N4    . DC  I 6 92  ? 136.748 160.075 197.025 1.00 199.87 ? 91  DC  J N4    1 
ATOM   8050  C C5    . DC  I 6 92  ? 135.808 159.734 194.852 1.00 199.87 ? 91  DC  J C5    1 
ATOM   8051  C C6    . DC  I 6 92  ? 136.052 159.503 193.561 1.00 199.87 ? 91  DC  J C6    1 
ATOM   8052  P P     . DC  I 6 93  ? 138.240 157.902 187.535 1.00 193.54 ? 92  DC  J P     1 
ATOM   8053  O OP1   . DC  I 6 93  ? 137.898 159.096 186.743 1.00 193.54 ? 92  DC  J OP1   1 
ATOM   8054  O OP2   . DC  I 6 93  ? 137.644 156.606 187.173 1.00 193.54 ? 92  DC  J OP2   1 
ATOM   8055  O "O5'" . DC  I 6 93  ? 139.827 157.735 187.557 1.00 193.54 ? 92  DC  J "O5'" 1 
ATOM   8056  C "C5'" . DC  I 6 93  ? 140.577 158.530 188.453 1.00 193.54 ? 92  DC  J "C5'" 1 
ATOM   8057  C "C4'" . DC  I 6 93  ? 142.003 158.035 188.630 1.00 193.54 ? 92  DC  J "C4'" 1 
ATOM   8058  O "O4'" . DC  I 6 93  ? 142.266 157.824 190.035 1.00 193.54 ? 92  DC  J "O4'" 1 
ATOM   8059  C "C3'" . DC  I 6 93  ? 142.352 156.722 187.976 1.00 193.54 ? 92  DC  J "C3'" 1 
ATOM   8060  O "O3'" . DC  I 6 93  ? 143.760 156.674 187.791 1.00 193.54 ? 92  DC  J "O3'" 1 
ATOM   8061  C "C2'" . DC  I 6 93  ? 141.890 155.727 189.026 1.00 193.54 ? 92  DC  J "C2'" 1 
ATOM   8062  C "C1'" . DC  I 6 93  ? 142.200 156.447 190.339 1.00 193.54 ? 92  DC  J "C1'" 1 
ATOM   8063  N N1    . DC  I 6 93  ? 141.133 156.265 191.375 1.00 193.54 ? 92  DC  J N1    1 
ATOM   8064  C C2    . DC  I 6 93  ? 141.440 156.276 192.749 1.00 193.54 ? 92  DC  J C2    1 
ATOM   8065  O O2    . DC  I 6 93  ? 142.608 156.387 193.123 1.00 193.54 ? 92  DC  J O2    1 
ATOM   8066  N N3    . DC  I 6 93  ? 140.428 156.138 193.639 1.00 193.54 ? 92  DC  J N3    1 
ATOM   8067  C C4    . DC  I 6 93  ? 139.182 156.010 193.214 1.00 193.54 ? 92  DC  J C4    1 
ATOM   8068  N N4    . DC  I 6 93  ? 138.215 155.874 194.118 1.00 193.54 ? 92  DC  J N4    1 
ATOM   8069  C C5    . DC  I 6 93  ? 138.864 155.975 191.839 1.00 193.54 ? 92  DC  J C5    1 
ATOM   8070  C C6    . DC  I 6 93  ? 139.849 156.133 190.968 1.00 193.54 ? 92  DC  J C6    1 
ATOM   8071  P P     . DG  I 6 94  ? 144.502 155.340 187.289 1.00 207.23 ? 93  DG  J P     1 
ATOM   8072  O OP1   . DG  I 6 94  ? 145.759 155.749 186.641 1.00 207.23 ? 93  DG  J OP1   1 
ATOM   8073  O OP2   . DG  I 6 94  ? 143.559 154.495 186.541 1.00 207.23 ? 93  DG  J OP2   1 
ATOM   8074  O "O5'" . DG  I 6 94  ? 144.917 154.608 188.640 1.00 207.23 ? 93  DG  J "O5'" 1 
ATOM   8075  C "C5'" . DG  I 6 94  ? 145.735 155.288 189.577 1.00 207.23 ? 93  DG  J "C5'" 1 
ATOM   8076  C "C4'" . DG  I 6 94  ? 146.031 154.428 190.797 1.00 207.23 ? 93  DG  J "C4'" 1 
ATOM   8077  O "O4'" . DG  I 6 94  ? 144.895 154.420 191.694 1.00 207.23 ? 93  DG  J "O4'" 1 
ATOM   8078  C "C3'" . DG  I 6 94  ? 146.357 152.971 190.512 1.00 207.23 ? 93  DG  J "C3'" 1 
ATOM   8079  O "O3'" . DG  I 6 94  ? 147.396 152.570 191.355 1.00 207.23 ? 93  DG  J "O3'" 1 
ATOM   8080  C "C2'" . DG  I 6 94  ? 145.056 152.256 190.859 1.00 207.23 ? 93  DG  J "C2'" 1 
ATOM   8081  C "C1'" . DG  I 6 94  ? 144.553 153.094 192.013 1.00 207.23 ? 93  DG  J "C1'" 1 
ATOM   8082  N N9    . DG  I 6 94  ? 143.114 153.051 192.177 1.00 207.23 ? 93  DG  J N9    1 
ATOM   8083  C C8    . DG  I 6 94  ? 142.175 153.107 191.193 1.00 207.23 ? 93  DG  J C8    1 
ATOM   8084  N N7    . DG  I 6 94  ? 140.954 153.093 191.634 1.00 207.23 ? 93  DG  J N7    1 
ATOM   8085  C C5    . DG  I 6 94  ? 141.099 152.996 193.000 1.00 207.23 ? 93  DG  J C5    1 
ATOM   8086  C C6    . DG  I 6 94  ? 140.124 152.920 194.010 1.00 207.23 ? 93  DG  J C6    1 
ATOM   8087  O O6    . DG  I 6 94  ? 138.895 152.928 193.892 1.00 207.23 ? 93  DG  J O6    1 
ATOM   8088  N N1    . DG  I 6 94  ? 140.700 152.832 195.265 1.00 207.23 ? 93  DG  J N1    1 
ATOM   8089  C C2    . DG  I 6 94  ? 142.045 152.807 195.508 1.00 207.23 ? 93  DG  J C2    1 
ATOM   8090  N N2    . DG  I 6 94  ? 142.425 152.722 196.783 1.00 207.23 ? 93  DG  J N2    1 
ATOM   8091  N N3    . DG  I 6 94  ? 142.967 152.884 194.570 1.00 207.23 ? 93  DG  J N3    1 
ATOM   8092  C C4    . DG  I 6 94  ? 142.424 152.988 193.349 1.00 207.23 ? 93  DG  J C4    1 
ATOM   8093  P P     . DC  I 6 95  ? 148.329 151.322 190.979 1.00 220.91 ? 94  DC  J P     1 
ATOM   8094  O OP1   . DC  I 6 95  ? 149.677 151.852 190.700 1.00 220.91 ? 94  DC  J OP1   1 
ATOM   8095  O OP2   . DC  I 6 95  ? 147.653 150.483 189.968 1.00 220.91 ? 94  DC  J OP2   1 
ATOM   8096  O "O5'" . DC  I 6 95  ? 148.384 150.506 192.344 1.00 220.91 ? 94  DC  J "O5'" 1 
ATOM   8097  C "C5'" . DC  I 6 95  ? 148.329 151.211 193.574 1.00 220.91 ? 94  DC  J "C5'" 1 
ATOM   8098  C "C4'" . DC  I 6 95  ? 147.753 150.335 194.664 1.00 220.91 ? 94  DC  J "C4'" 1 
ATOM   8099  O "O4'" . DC  I 6 95  ? 146.330 150.564 194.776 1.00 220.91 ? 94  DC  J "O4'" 1 
ATOM   8100  C "C3'" . DC  I 6 95  ? 147.937 148.842 194.427 1.00 220.91 ? 94  DC  J "C3'" 1 
ATOM   8101  O "O3'" . DC  I 6 95  ? 148.601 148.268 195.527 1.00 220.91 ? 94  DC  J "O3'" 1 
ATOM   8102  C "C2'" . DC  I 6 95  ? 146.513 148.301 194.267 1.00 220.91 ? 94  DC  J "C2'" 1 
ATOM   8103  C "C1'" . DC  I 6 95  ? 145.674 149.342 194.984 1.00 220.91 ? 94  DC  J "C1'" 1 
ATOM   8104  N N1    . DC  I 6 95  ? 144.317 149.471 194.432 1.00 220.91 ? 94  DC  J N1    1 
ATOM   8105  C C2    . DC  I 6 95  ? 143.210 149.416 195.276 1.00 220.91 ? 94  DC  J C2    1 
ATOM   8106  O O2    . DC  I 6 95  ? 143.382 149.245 196.480 1.00 220.91 ? 94  DC  J O2    1 
ATOM   8107  N N3    . DC  I 6 95  ? 141.976 149.548 194.749 1.00 220.91 ? 94  DC  J N3    1 
ATOM   8108  C C4    . DC  I 6 95  ? 141.833 149.734 193.443 1.00 220.91 ? 94  DC  J C4    1 
ATOM   8109  N N4    . DC  I 6 95  ? 140.598 149.854 192.961 1.00 220.91 ? 94  DC  J N4    1 
ATOM   8110  C C5    . DC  I 6 95  ? 142.950 149.782 192.566 1.00 220.91 ? 94  DC  J C5    1 
ATOM   8111  C C6    . DC  I 6 95  ? 144.160 149.655 193.103 1.00 220.91 ? 94  DC  J C6    1 
ATOM   8112  P P     . DC  I 6 96  ? 149.149 146.764 195.437 1.00 224.89 ? 95  DC  J P     1 
ATOM   8113  O OP1   . DC  I 6 96  ? 150.369 146.688 196.268 1.00 224.89 ? 95  DC  J OP1   1 
ATOM   8114  O OP2   . DC  I 6 96  ? 149.210 146.380 194.011 1.00 224.89 ? 95  DC  J OP2   1 
ATOM   8115  O "O5'" . DC  I 6 96  ? 147.991 145.916 196.129 1.00 224.89 ? 95  DC  J "O5'" 1 
ATOM   8116  C "C5'" . DC  I 6 96  ? 147.411 146.384 197.337 1.00 224.89 ? 95  DC  J "C5'" 1 
ATOM   8117  C "C4'" . DC  I 6 96  ? 146.233 145.523 197.722 1.00 224.89 ? 95  DC  J "C4'" 1 
ATOM   8118  O "O4'" . DC  I 6 96  ? 145.032 146.079 197.162 1.00 224.89 ? 95  DC  J "O4'" 1 
ATOM   8119  C "C3'" . DC  I 6 96  ? 146.323 144.089 197.216 1.00 224.89 ? 95  DC  J "C3'" 1 
ATOM   8120  O "O3'" . DC  I 6 96  ? 146.435 143.202 198.313 1.00 224.89 ? 95  DC  J "O3'" 1 
ATOM   8121  C "C2'" . DC  I 6 96  ? 145.027 143.868 196.426 1.00 224.89 ? 95  DC  J "C2'" 1 
ATOM   8122  C "C1'" . DC  I 6 96  ? 144.155 145.044 196.827 1.00 224.89 ? 95  DC  J "C1'" 1 
ATOM   8123  N N1    . DC  I 6 96  ? 143.324 145.516 195.724 1.00 224.89 ? 95  DC  J N1    1 
ATOM   8124  C C2    . DC  I 6 96  ? 141.943 145.597 195.874 1.00 224.89 ? 95  DC  J C2    1 
ATOM   8125  O O2    . DC  I 6 96  ? 141.427 145.259 196.936 1.00 224.89 ? 95  DC  J O2    1 
ATOM   8126  N N3    . DC  I 6 96  ? 141.204 146.028 194.835 1.00 224.89 ? 95  DC  J N3    1 
ATOM   8127  C C4    . DC  I 6 96  ? 141.792 146.377 193.698 1.00 224.89 ? 95  DC  J C4    1 
ATOM   8128  N N4    . DC  I 6 96  ? 141.018 146.804 192.704 1.00 224.89 ? 95  DC  J N4    1 
ATOM   8129  C C5    . DC  I 6 96  ? 143.199 146.307 193.529 1.00 224.89 ? 95  DC  J C5    1 
ATOM   8130  C C6    . DC  I 6 96  ? 143.917 145.872 194.558 1.00 224.89 ? 95  DC  J C6    1 
ATOM   8131  P P     . DA  I 6 97  ? 146.704 141.638 198.068 1.00 227.11 ? 96  DA  J P     1 
ATOM   8132  O OP1   . DA  I 6 97  ? 147.469 141.125 199.224 1.00 227.11 ? 96  DA  J OP1   1 
ATOM   8133  O OP2   . DA  I 6 97  ? 147.249 141.464 196.705 1.00 227.11 ? 96  DA  J OP2   1 
ATOM   8134  O "O5'" . DA  I 6 97  ? 145.242 141.009 198.108 1.00 227.11 ? 96  DA  J "O5'" 1 
ATOM   8135  C "C5'" . DA  I 6 97  ? 144.328 141.438 199.101 1.00 227.11 ? 96  DA  J "C5'" 1 
ATOM   8136  C "C4'" . DA  I 6 97  ? 142.963 140.850 198.847 1.00 227.11 ? 96  DA  J "C4'" 1 
ATOM   8137  O "O4'" . DA  I 6 97  ? 142.202 141.729 198.000 1.00 227.11 ? 96  DA  J "O4'" 1 
ATOM   8138  C "C3'" . DA  I 6 97  ? 142.985 139.492 198.157 1.00 227.11 ? 96  DA  J "C3'" 1 
ATOM   8139  O "O3'" . DA  I 6 97  ? 142.351 138.545 198.990 1.00 227.11 ? 96  DA  J "O3'" 1 
ATOM   8140  C "C2'" . DA  I 6 97  ? 142.225 139.714 196.838 1.00 227.11 ? 96  DA  J "C2'" 1 
ATOM   8141  C "C1'" . DA  I 6 97  ? 141.421 140.968 197.119 1.00 227.11 ? 96  DA  J "C1'" 1 
ATOM   8142  N N9    . DA  I 6 97  ? 141.187 141.785 195.941 1.00 227.11 ? 96  DA  J N9    1 
ATOM   8143  C C8    . DA  I 6 97  ? 142.135 142.314 195.115 1.00 227.11 ? 96  DA  J C8    1 
ATOM   8144  N N7    . DA  I 6 97  ? 141.644 143.036 194.142 1.00 227.11 ? 96  DA  J N7    1 
ATOM   8145  C C5    . DA  I 6 97  ? 140.280 142.996 194.358 1.00 227.11 ? 96  DA  J C5    1 
ATOM   8146  C C6    . DA  I 6 97  ? 139.205 143.568 193.671 1.00 227.11 ? 96  DA  J C6    1 
ATOM   8147  N N6    . DA  I 6 97  ? 139.363 144.321 192.591 1.00 227.11 ? 96  DA  J N6    1 
ATOM   8148  N N1    . DA  I 6 97  ? 137.956 143.326 194.127 1.00 227.11 ? 96  DA  J N1    1 
ATOM   8149  C C2    . DA  I 6 97  ? 137.808 142.570 195.220 1.00 227.11 ? 96  DA  J C2    1 
ATOM   8150  N N3    . DA  I 6 97  ? 138.751 141.972 195.952 1.00 227.11 ? 96  DA  J N3    1 
ATOM   8151  C C4    . DA  I 6 97  ? 139.977 142.236 195.465 1.00 227.11 ? 96  DA  J C4    1 
ATOM   8152  P P     . DA  I 6 98  ? 142.332 136.990 198.601 1.00 223.67 ? 97  DA  J P     1 
ATOM   8153  O OP1   . DA  I 6 98  ? 142.394 136.228 199.865 1.00 223.67 ? 97  DA  J OP1   1 
ATOM   8154  O OP2   . DA  I 6 98  ? 143.339 136.736 197.549 1.00 223.67 ? 97  DA  J OP2   1 
ATOM   8155  O "O5'" . DA  I 6 98  ? 140.881 136.804 197.977 1.00 223.67 ? 97  DA  J "O5'" 1 
ATOM   8156  C "C5'" . DA  I 6 98  ? 139.783 137.466 198.576 1.00 223.67 ? 97  DA  J "C5'" 1 
ATOM   8157  C "C4'" . DA  I 6 98  ? 138.544 137.306 197.731 1.00 223.67 ? 97  DA  J "C4'" 1 
ATOM   8158  O "O4'" . DA  I 6 98  ? 138.465 138.388 196.773 1.00 223.67 ? 97  DA  J "O4'" 1 
ATOM   8159  C "C3'" . DA  I 6 98  ? 138.499 136.012 196.921 1.00 223.67 ? 97  DA  J "C3'" 1 
ATOM   8160  O "O3'" . DA  I 6 98  ? 137.236 135.402 197.070 1.00 223.67 ? 97  DA  J "O3'" 1 
ATOM   8161  C "C2'" . DA  I 6 98  ? 138.734 136.483 195.487 1.00 223.67 ? 97  DA  J "C2'" 1 
ATOM   8162  C "C1'" . DA  I 6 98  ? 138.110 137.861 195.524 1.00 223.67 ? 97  DA  J "C1'" 1 
ATOM   8163  N N9    . DA  I 6 98  ? 138.606 138.751 194.491 1.00 223.67 ? 97  DA  J N9    1 
ATOM   8164  C C8    . DA  I 6 98  ? 139.908 139.046 194.210 1.00 223.67 ? 97  DA  J C8    1 
ATOM   8165  N N7    . DA  I 6 98  ? 140.055 139.890 193.220 1.00 223.67 ? 97  DA  J N7    1 
ATOM   8166  C C5    . DA  I 6 98  ? 138.759 140.166 192.829 1.00 223.67 ? 97  DA  J C5    1 
ATOM   8167  C C6    . DA  I 6 98  ? 138.227 140.990 191.824 1.00 223.67 ? 97  DA  J C6    1 
ATOM   8168  N N6    . DA  I 6 98  ? 138.982 141.719 191.004 1.00 223.67 ? 97  DA  J N6    1 
ATOM   8169  N N1    . DA  I 6 98  ? 136.884 141.041 191.700 1.00 223.67 ? 97  DA  J N1    1 
ATOM   8170  C C2    . DA  I 6 98  ? 136.135 140.303 192.526 1.00 223.67 ? 97  DA  J C2    1 
ATOM   8171  N N3    . DA  I 6 98  ? 136.522 139.497 193.507 1.00 223.67 ? 97  DA  J N3    1 
ATOM   8172  C C4    . DA  I 6 98  ? 137.857 139.472 193.604 1.00 223.67 ? 97  DA  J C4    1 
ATOM   8173  P P     . DG  I 6 99  ? 137.058 133.831 196.793 1.00 211.80 ? 98  DG  J P     1 
ATOM   8174  O OP1   . DG  I 6 99  ? 136.469 133.234 198.010 1.00 211.80 ? 98  DG  J OP1   1 
ATOM   8175  O OP2   . DG  I 6 99  ? 138.330 133.303 196.258 1.00 211.80 ? 98  DG  J OP2   1 
ATOM   8176  O "O5'" . DG  I 6 99  ? 135.970 133.789 195.632 1.00 211.80 ? 98  DG  J "O5'" 1 
ATOM   8177  C "C5'" . DG  I 6 99  ? 134.709 134.374 195.857 1.00 211.80 ? 98  DG  J "C5'" 1 
ATOM   8178  C "C4'" . DG  I 6 99  ? 134.077 134.823 194.560 1.00 211.80 ? 98  DG  J "C4'" 1 
ATOM   8179  O "O4'" . DG  I 6 99  ? 134.930 135.790 193.903 1.00 211.80 ? 98  DG  J "O4'" 1 
ATOM   8180  C "C3'" . DG  I 6 99  ? 133.832 133.717 193.530 1.00 211.80 ? 98  DG  J "C3'" 1 
ATOM   8181  O "O3'" . DG  I 6 99  ? 132.553 133.901 192.977 1.00 211.80 ? 98  DG  J "O3'" 1 
ATOM   8182  C "C2'" . DG  I 6 99  ? 134.919 133.981 192.491 1.00 211.80 ? 98  DG  J "C2'" 1 
ATOM   8183  C "C1'" . DG  I 6 99  ? 134.948 135.487 192.537 1.00 211.80 ? 98  DG  J "C1'" 1 
ATOM   8184  N N9    . DG  I 6 99  ? 136.123 136.090 191.941 1.00 211.80 ? 98  DG  J N9    1 
ATOM   8185  C C8    . DG  I 6 99  ? 137.427 135.917 192.313 1.00 211.80 ? 98  DG  J C8    1 
ATOM   8186  N N7    . DG  I 6 99  ? 138.263 136.612 191.598 1.00 211.80 ? 98  DG  J N7    1 
ATOM   8187  C C5    . DG  I 6 99  ? 137.454 137.286 190.700 1.00 211.80 ? 98  DG  J C5    1 
ATOM   8188  C C6    . DG  I 6 99  ? 137.792 138.187 189.677 1.00 211.80 ? 98  DG  J C6    1 
ATOM   8189  O O6    . DG  I 6 99  ? 138.912 138.584 189.346 1.00 211.80 ? 98  DG  J O6    1 
ATOM   8190  N N1    . DG  I 6 99  ? 136.669 138.641 189.002 1.00 211.80 ? 98  DG  J N1    1 
ATOM   8191  C C2    . DG  I 6 99  ? 135.382 138.266 189.284 1.00 211.80 ? 98  DG  J C2    1 
ATOM   8192  N N2    . DG  I 6 99  ? 134.425 138.805 188.527 1.00 211.80 ? 98  DG  J N2    1 
ATOM   8193  N N3    . DG  I 6 99  ? 135.054 137.422 190.241 1.00 211.80 ? 98  DG  J N3    1 
ATOM   8194  C C4    . DG  I 6 99  ? 136.137 136.975 190.904 1.00 211.80 ? 98  DG  J C4    1 
ATOM   8195  P P     . DG  I 6 100 ? 131.714 132.661 192.406 1.00 200.86 ? 99  DG  J P     1 
ATOM   8196  O OP1   . DG  I 6 100 ? 130.864 132.160 193.504 1.00 200.86 ? 99  DG  J OP1   1 
ATOM   8197  O OP2   . DG  I 6 100 ? 132.650 131.745 191.720 1.00 200.86 ? 99  DG  J OP2   1 
ATOM   8198  O "O5'" . DG  I 6 100 ? 130.779 133.340 191.305 1.00 200.86 ? 99  DG  J "O5'" 1 
ATOM   8199  C "C5'" . DG  I 6 100 ? 131.236 134.504 190.625 1.00 200.86 ? 99  DG  J "C5'" 1 
ATOM   8200  C "C4'" . DG  I 6 100 ? 131.013 134.381 189.133 1.00 200.86 ? 99  DG  J "C4'" 1 
ATOM   8201  O "O4'" . DG  I 6 100 ? 132.186 134.870 188.434 1.00 200.86 ? 99  DG  J "O4'" 1 
ATOM   8202  C "C3'" . DG  I 6 100 ? 130.848 132.963 188.640 1.00 200.86 ? 99  DG  J "C3'" 1 
ATOM   8203  O "O3'" . DG  I 6 100 ? 130.220 132.984 187.388 1.00 200.86 ? 99  DG  J "O3'" 1 
ATOM   8204  C "C2'" . DG  I 6 100 ? 132.294 132.544 188.505 1.00 200.86 ? 99  DG  J "C2'" 1 
ATOM   8205  C "C1'" . DG  I 6 100 ? 132.854 133.781 187.835 1.00 200.86 ? 99  DG  J "C1'" 1 
ATOM   8206  N N9    . DG  I 6 100 ? 134.274 133.955 188.032 1.00 200.86 ? 99  DG  J N9    1 
ATOM   8207  C C8    . DG  I 6 100 ? 135.063 133.340 188.962 1.00 200.86 ? 99  DG  J C8    1 
ATOM   8208  N N7    . DG  I 6 100 ? 136.310 133.701 188.898 1.00 200.86 ? 99  DG  J N7    1 
ATOM   8209  C C5    . DG  I 6 100 ? 136.341 134.615 187.859 1.00 200.86 ? 99  DG  J C5    1 
ATOM   8210  C C6    . DG  I 6 100 ? 137.417 135.345 187.323 1.00 200.86 ? 99  DG  J C6    1 
ATOM   8211  O O6    . DG  I 6 100 ? 138.599 135.331 187.672 1.00 200.86 ? 99  DG  J O6    1 
ATOM   8212  N N1    . DG  I 6 100 ? 137.015 136.158 186.274 1.00 200.86 ? 99  DG  J N1    1 
ATOM   8213  C C2    . DG  I 6 100 ? 135.733 136.250 185.805 1.00 200.86 ? 99  DG  J C2    1 
ATOM   8214  N N2    . DG  I 6 100 ? 135.527 137.091 184.786 1.00 200.86 ? 99  DG  J N2    1 
ATOM   8215  N N3    . DG  I 6 100 ? 134.716 135.571 186.301 1.00 200.86 ? 99  DG  J N3    1 
ATOM   8216  C C4    . DG  I 6 100 ? 135.094 134.777 187.320 1.00 200.86 ? 99  DG  J C4    1 
ATOM   8217  P P     . DG  I 6 101 ? 129.385 131.710 186.897 1.00 195.49 ? 100 DG  J P     1 
ATOM   8218  O OP1   . DG  I 6 101 ? 128.273 131.539 187.853 1.00 195.49 ? 100 DG  J OP1   1 
ATOM   8219  O OP2   . DG  I 6 101 ? 130.343 130.608 186.669 1.00 195.49 ? 100 DG  J OP2   1 
ATOM   8220  O "O5'" . DG  I 6 101 ? 128.793 132.161 185.483 1.00 195.49 ? 100 DG  J "O5'" 1 
ATOM   8221  C "C5'" . DG  I 6 101 ? 129.107 133.444 184.955 1.00 195.49 ? 100 DG  J "C5'" 1 
ATOM   8222  C "C4'" . DG  I 6 101 ? 130.173 133.362 183.871 1.00 195.49 ? 100 DG  J "C4'" 1 
ATOM   8223  O "O4'" . DG  I 6 101 ? 131.492 133.315 184.471 1.00 195.49 ? 100 DG  J "O4'" 1 
ATOM   8224  C "C3'" . DG  I 6 101 ? 130.107 132.136 182.948 1.00 195.49 ? 100 DG  J "C3'" 1 
ATOM   8225  O "O3'" . DG  I 6 101 ? 130.472 132.525 181.646 1.00 195.49 ? 100 DG  J "O3'" 1 
ATOM   8226  C "C2'" . DG  I 6 101 ? 131.199 131.256 183.528 1.00 195.49 ? 100 DG  J "C2'" 1 
ATOM   8227  C "C1'" . DG  I 6 101 ? 132.216 132.331 183.794 1.00 195.49 ? 100 DG  J "C1'" 1 
ATOM   8228  N N9    . DG  I 6 101 ? 133.341 131.915 184.593 1.00 195.49 ? 100 DG  J N9    1 
ATOM   8229  C C8    . DG  I 6 101 ? 133.350 131.010 185.612 1.00 195.49 ? 100 DG  J C8    1 
ATOM   8230  N N7    . DG  I 6 101 ? 134.525 130.853 186.149 1.00 195.49 ? 100 DG  J N7    1 
ATOM   8231  C C5    . DG  I 6 101 ? 135.340 131.697 185.421 1.00 195.49 ? 100 DG  J C5    1 
ATOM   8232  C C6    . DG  I 6 101 ? 136.717 131.950 185.535 1.00 195.49 ? 100 DG  J C6    1 
ATOM   8233  O O6    . DG  I 6 101 ? 137.522 131.460 186.329 1.00 195.49 ? 100 DG  J O6    1 
ATOM   8234  N N1    . DG  I 6 101 ? 137.143 132.879 184.600 1.00 195.49 ? 100 DG  J N1    1 
ATOM   8235  C C2    . DG  I 6 101 ? 136.336 133.485 183.673 1.00 195.49 ? 100 DG  J C2    1 
ATOM   8236  N N2    . DG  I 6 101 ? 136.920 134.364 182.853 1.00 195.49 ? 100 DG  J N2    1 
ATOM   8237  N N3    . DG  I 6 101 ? 135.045 133.253 183.560 1.00 195.49 ? 100 DG  J N3    1 
ATOM   8238  C C4    . DG  I 6 101 ? 134.620 132.355 184.463 1.00 195.49 ? 100 DG  J C4    1 
ATOM   8239  P P     . DG  I 6 102 ? 129.365 132.811 180.523 1.00 188.21 ? 101 DG  J P     1 
ATOM   8240  O OP1   . DG  I 6 102 ? 128.146 133.302 181.195 1.00 188.21 ? 101 DG  J OP1   1 
ATOM   8241  O OP2   . DG  I 6 102 ? 129.303 131.619 179.653 1.00 188.21 ? 101 DG  J OP2   1 
ATOM   8242  O "O5'" . DG  I 6 102 ? 130.014 133.998 179.670 1.00 188.21 ? 101 DG  J "O5'" 1 
ATOM   8243  C "C5'" . DG  I 6 102 ? 131.248 134.573 180.097 1.00 188.21 ? 101 DG  J "C5'" 1 
ATOM   8244  C "C4'" . DG  I 6 102 ? 132.340 134.376 179.058 1.00 188.21 ? 101 DG  J "C4'" 1 
ATOM   8245  O "O4'" . DG  I 6 102 ? 133.528 133.829 179.698 1.00 188.21 ? 101 DG  J "O4'" 1 
ATOM   8246  C "C3'" . DG  I 6 102 ? 132.017 133.381 177.960 1.00 188.21 ? 101 DG  J "C3'" 1 
ATOM   8247  O "O3'" . DG  I 6 102 ? 132.863 133.628 176.864 1.00 188.21 ? 101 DG  J "O3'" 1 
ATOM   8248  C "C2'" . DG  I 6 102 ? 132.419 132.093 178.637 1.00 188.21 ? 101 DG  J "C2'" 1 
ATOM   8249  C "C1'" . DG  I 6 102 ? 133.760 132.533 179.186 1.00 188.21 ? 101 DG  J "C1'" 1 
ATOM   8250  N N9    . DG  I 6 102 ? 134.255 131.692 180.252 1.00 188.21 ? 101 DG  J N9    1 
ATOM   8251  C C8    . DG  I 6 102 ? 133.530 130.815 180.999 1.00 188.21 ? 101 DG  J C8    1 
ATOM   8252  N N7    . DG  I 6 102 ? 134.228 130.210 181.912 1.00 188.21 ? 101 DG  J N7    1 
ATOM   8253  C C5    . DG  I 6 102 ? 135.507 130.697 181.733 1.00 188.21 ? 101 DG  J C5    1 
ATOM   8254  C C6    . DG  I 6 102 ? 136.692 130.401 182.426 1.00 188.21 ? 101 DG  J C6    1 
ATOM   8255  O O6    . DG  I 6 102 ? 136.858 129.614 183.363 1.00 188.21 ? 101 DG  J O6    1 
ATOM   8256  N N1    . DG  I 6 102 ? 137.765 131.123 181.935 1.00 188.21 ? 101 DG  J N1    1 
ATOM   8257  C C2    . DG  I 6 102 ? 137.700 132.026 180.912 1.00 188.21 ? 101 DG  J C2    1 
ATOM   8258  N N2    . DG  I 6 102 ? 138.848 132.620 180.576 1.00 188.21 ? 101 DG  J N2    1 
ATOM   8259  N N3    . DG  I 6 102 ? 136.593 132.313 180.248 1.00 188.21 ? 101 DG  J N3    1 
ATOM   8260  C C4    . DG  I 6 102 ? 135.539 131.617 180.717 1.00 188.21 ? 101 DG  J C4    1 
ATOM   8261  P P     . DA  I 6 103 ? 132.343 134.469 175.605 1.00 179.90 ? 102 DA  J P     1 
ATOM   8262  O OP1   . DA  I 6 103 ? 132.131 135.865 176.038 1.00 179.90 ? 102 DA  J OP1   1 
ATOM   8263  O OP2   . DA  I 6 103 ? 131.231 133.713 174.995 1.00 179.90 ? 102 DA  J OP2   1 
ATOM   8264  O "O5'" . DA  I 6 103 ? 133.586 134.443 174.608 1.00 179.90 ? 102 DA  J "O5'" 1 
ATOM   8265  C "C5'" . DA  I 6 103 ? 134.618 135.388 174.757 1.00 179.90 ? 102 DA  J "C5'" 1 
ATOM   8266  C "C4'" . DA  I 6 103 ? 135.978 134.724 174.867 1.00 179.90 ? 102 DA  J "C4'" 1 
ATOM   8267  O "O4'" . DA  I 6 103 ? 135.972 133.716 175.903 1.00 179.90 ? 102 DA  J "O4'" 1 
ATOM   8268  C "C3'" . DA  I 6 103 ? 136.485 134.009 173.626 1.00 179.90 ? 102 DA  J "C3'" 1 
ATOM   8269  O "O3'" . DA  I 6 103 ? 137.855 134.157 173.605 1.00 179.90 ? 102 DA  J "O3'" 1 
ATOM   8270  C "C2'" . DA  I 6 103 ? 136.127 132.561 173.926 1.00 179.90 ? 102 DA  J "C2'" 1 
ATOM   8271  C "C1'" . DA  I 6 103 ? 136.513 132.523 175.379 1.00 179.90 ? 102 DA  J "C1'" 1 
ATOM   8272  N N9    . DA  I 6 103 ? 135.955 131.438 176.158 1.00 179.90 ? 102 DA  J N9    1 
ATOM   8273  C C8    . DA  I 6 103 ? 134.661 131.030 176.184 1.00 179.90 ? 102 DA  J C8    1 
ATOM   8274  N N7    . DA  I 6 103 ? 134.431 130.066 177.039 1.00 179.90 ? 102 DA  J N7    1 
ATOM   8275  C C5    . DA  I 6 103 ? 135.644 129.874 177.656 1.00 179.90 ? 102 DA  J C5    1 
ATOM   8276  C C6    . DA  I 6 103 ? 136.060 128.995 178.661 1.00 179.90 ? 102 DA  J C6    1 
ATOM   8277  N N6    . DA  I 6 103 ? 135.242 128.131 179.256 1.00 179.90 ? 102 DA  J N6    1 
ATOM   8278  N N1    . DA  I 6 103 ? 137.351 129.038 179.037 1.00 179.90 ? 102 DA  J N1    1 
ATOM   8279  C C2    . DA  I 6 103 ? 138.169 129.900 178.431 1.00 179.90 ? 102 DA  J C2    1 
ATOM   8280  N N3    . DA  I 6 103 ? 137.890 130.777 177.474 1.00 179.90 ? 102 DA  J N3    1 
ATOM   8281  C C4    . DA  I 6 103 ? 136.598 130.709 177.128 1.00 179.90 ? 102 DA  J C4    1 
ATOM   8282  P P     . DT  I 6 104 ? 138.667 134.146 172.233 1.00 184.66 ? 103 DT  J P     1 
ATOM   8283  O OP1   . DT  I 6 104 ? 138.542 135.492 171.649 1.00 184.66 ? 103 DT  J OP1   1 
ATOM   8284  O OP2   . DT  I 6 104 ? 138.255 132.967 171.451 1.00 184.66 ? 103 DT  J OP2   1 
ATOM   8285  O "O5'" . DT  I 6 104 ? 140.160 133.918 172.728 1.00 184.66 ? 103 DT  J "O5'" 1 
ATOM   8286  C "C5'" . DT  I 6 104 ? 140.381 133.490 174.066 1.00 184.66 ? 103 DT  J "C5'" 1 
ATOM   8287  C "C4'" . DT  I 6 104 ? 141.257 132.257 174.102 1.00 184.66 ? 103 DT  J "C4'" 1 
ATOM   8288  O "O4'" . DT  I 6 104 ? 140.620 131.217 174.908 1.00 184.66 ? 103 DT  J "O4'" 1 
ATOM   8289  C "C3'" . DT  I 6 104 ? 141.486 131.608 172.745 1.00 184.66 ? 103 DT  J "C3'" 1 
ATOM   8290  O "O3'" . DT  I 6 104 ? 142.672 130.862 172.785 1.00 184.66 ? 103 DT  J "O3'" 1 
ATOM   8291  C "C2'" . DT  I 6 104 ? 140.309 130.664 172.703 1.00 184.66 ? 103 DT  J "C2'" 1 
ATOM   8292  C "C1'" . DT  I 6 104 ? 140.448 130.081 174.092 1.00 184.66 ? 103 DT  J "C1'" 1 
ATOM   8293  N N1    . DT  I 6 104 ? 139.279 129.289 174.570 1.00 184.66 ? 103 DT  J N1    1 
ATOM   8294  C C2    . DT  I 6 104 ? 139.444 128.430 175.623 1.00 184.66 ? 103 DT  J C2    1 
ATOM   8295  O O2    . DT  I 6 104 ? 140.500 128.270 176.189 1.00 184.66 ? 103 DT  J O2    1 
ATOM   8296  N N3    . DT  I 6 104 ? 138.320 127.762 175.999 1.00 184.66 ? 103 DT  J N3    1 
ATOM   8297  C C4    . DT  I 6 104 ? 137.074 127.859 175.439 1.00 184.66 ? 103 DT  J C4    1 
ATOM   8298  O O4    . DT  I 6 104 ? 136.118 127.220 175.853 1.00 184.66 ? 103 DT  J O4    1 
ATOM   8299  C C5    . DT  I 6 104 ? 136.964 128.773 174.338 1.00 184.66 ? 103 DT  J C5    1 
ATOM   8300  C C7    . DT  I 6 104 ? 135.651 128.946 173.640 1.00 184.66 ? 103 DT  J C7    1 
ATOM   8301  C C6    . DT  I 6 104 ? 138.060 129.441 173.964 1.00 184.66 ? 103 DT  J C6    1 
ATOM   8302  P P     . DT  I 6 105 ? 144.088 131.487 172.366 1.00 197.67 ? 104 DT  J P     1 
ATOM   8303  O OP1   . DT  I 6 105 ? 144.263 132.828 172.962 1.00 197.67 ? 104 DT  J OP1   1 
ATOM   8304  O OP2   . DT  I 6 105 ? 144.213 131.331 170.905 1.00 197.67 ? 104 DT  J OP2   1 
ATOM   8305  O "O5'" . DT  I 6 105 ? 145.107 130.470 173.054 1.00 197.67 ? 104 DT  J "O5'" 1 
ATOM   8306  C "C5'" . DT  I 6 105 ? 144.656 129.674 174.158 1.00 197.67 ? 104 DT  J "C5'" 1 
ATOM   8307  C "C4'" . DT  I 6 105 ? 144.728 128.196 173.829 1.00 197.67 ? 104 DT  J "C4'" 1 
ATOM   8308  O "O4'" . DT  I 6 105 ? 143.437 127.560 174.065 1.00 197.67 ? 104 DT  J "O4'" 1 
ATOM   8309  C "C3'" . DT  I 6 105 ? 145.073 127.885 172.378 1.00 197.67 ? 104 DT  J "C3'" 1 
ATOM   8310  O "O3'" . DT  I 6 105 ? 145.891 126.746 172.335 1.00 197.67 ? 104 DT  J "O3'" 1 
ATOM   8311  C "C2'" . DT  I 6 105 ? 143.704 127.585 171.789 1.00 197.67 ? 104 DT  J "C2'" 1 
ATOM   8312  C "C1'" . DT  I 6 105 ? 143.120 126.789 172.934 1.00 197.67 ? 104 DT  J "C1'" 1 
ATOM   8313  N N1    . DT  I 6 105 ? 141.648 126.586 172.866 1.00 197.67 ? 104 DT  J N1    1 
ATOM   8314  C C2    . DT  I 6 105 ? 141.061 125.679 173.705 1.00 197.67 ? 104 DT  J C2    1 
ATOM   8315  O O2    . DT  I 6 105 ? 141.684 125.027 174.510 1.00 197.67 ? 104 DT  J O2    1 
ATOM   8316  N N3    . DT  I 6 105 ? 139.705 125.577 173.577 1.00 197.67 ? 104 DT  J N3    1 
ATOM   8317  C C4    . DT  I 6 105 ? 138.903 126.259 172.697 1.00 197.67 ? 104 DT  J C4    1 
ATOM   8318  O O4    . DT  I 6 105 ? 137.692 126.099 172.646 1.00 197.67 ? 104 DT  J O4    1 
ATOM   8319  C C5    . DT  I 6 105 ? 139.582 127.184 171.840 1.00 197.67 ? 104 DT  J C5    1 
ATOM   8320  C C7    . DT  I 6 105 ? 138.803 127.973 170.830 1.00 197.67 ? 104 DT  J C7    1 
ATOM   8321  C C6    . DT  I 6 105 ? 140.910 127.289 171.952 1.00 197.67 ? 104 DT  J C6    1 
ATOM   8322  P P     . DA  I 6 106 ? 147.476 126.892 172.157 1.00 206.63 ? 105 DA  J P     1 
ATOM   8323  O OP1   . DA  I 6 106 ? 147.992 127.584 173.355 1.00 206.63 ? 105 DA  J OP1   1 
ATOM   8324  O OP2   . DA  I 6 106 ? 147.742 127.456 170.821 1.00 206.63 ? 105 DA  J OP2   1 
ATOM   8325  O "O5'" . DA  I 6 106 ? 147.991 125.383 172.181 1.00 206.63 ? 105 DA  J "O5'" 1 
ATOM   8326  C "C5'" . DA  I 6 106 ? 148.062 124.692 173.412 1.00 206.63 ? 105 DA  J "C5'" 1 
ATOM   8327  C "C4'" . DA  I 6 106 ? 147.338 123.359 173.341 1.00 206.63 ? 105 DA  J "C4'" 1 
ATOM   8328  O "O4'" . DA  I 6 106 ? 145.920 123.572 173.150 1.00 206.63 ? 105 DA  J "O4'" 1 
ATOM   8329  C "C3'" . DA  I 6 106 ? 147.776 122.423 172.215 1.00 206.63 ? 105 DA  J "C3'" 1 
ATOM   8330  O "O3'" . DA  I 6 106 ? 147.898 121.118 172.732 1.00 206.63 ? 105 DA  J "O3'" 1 
ATOM   8331  C "C2'" . DA  I 6 106 ? 146.618 122.514 171.229 1.00 206.63 ? 105 DA  J "C2'" 1 
ATOM   8332  C "C1'" . DA  I 6 106 ? 145.461 122.669 172.182 1.00 206.63 ? 105 DA  J "C1'" 1 
ATOM   8333  N N9    . DA  I 6 106 ? 144.276 123.231 171.575 1.00 206.63 ? 105 DA  J N9    1 
ATOM   8334  C C8    . DA  I 6 106 ? 144.210 124.309 170.751 1.00 206.63 ? 105 DA  J C8    1 
ATOM   8335  N N7    . DA  I 6 106 ? 142.995 124.605 170.368 1.00 206.63 ? 105 DA  J N7    1 
ATOM   8336  C C5    . DA  I 6 106 ? 142.218 123.651 170.985 1.00 206.63 ? 105 DA  J C5    1 
ATOM   8337  C C6    . DA  I 6 106 ? 140.841 123.407 170.976 1.00 206.63 ? 105 DA  J C6    1 
ATOM   8338  N N6    . DA  I 6 106 ? 139.976 124.153 170.296 1.00 206.63 ? 105 DA  J N6    1 
ATOM   8339  N N1    . DA  I 6 106 ? 140.384 122.362 171.696 1.00 206.63 ? 105 DA  J N1    1 
ATOM   8340  C C2    . DA  I 6 106 ? 141.260 121.618 172.376 1.00 206.63 ? 105 DA  J C2    1 
ATOM   8341  N N3    . DA  I 6 106 ? 142.578 121.752 172.456 1.00 206.63 ? 105 DA  J N3    1 
ATOM   8342  C C4    . DA  I 6 106 ? 142.994 122.798 171.735 1.00 206.63 ? 105 DA  J C4    1 
ATOM   8343  P P     . DC  I 6 107 ? 148.670 119.976 171.912 1.00 206.19 ? 106 DC  J P     1 
ATOM   8344  O OP1   . DC  I 6 107 ? 149.664 119.397 172.839 1.00 206.19 ? 106 DC  J OP1   1 
ATOM   8345  O OP2   . DC  I 6 107 ? 149.112 120.513 170.608 1.00 206.19 ? 106 DC  J OP2   1 
ATOM   8346  O "O5'" . DC  I 6 107 ? 147.539 118.881 171.656 1.00 206.19 ? 106 DC  J "O5'" 1 
ATOM   8347  C "C5'" . DC  I 6 107 ? 147.006 118.168 172.756 1.00 206.19 ? 106 DC  J "C5'" 1 
ATOM   8348  C "C4'" . DC  I 6 107 ? 145.709 117.470 172.392 1.00 206.19 ? 106 DC  J "C4'" 1 
ATOM   8349  O "O4'" . DC  I 6 107 ? 144.727 118.439 171.950 1.00 206.19 ? 106 DC  J "O4'" 1 
ATOM   8350  C "C3'" . DC  I 6 107 ? 145.806 116.435 171.268 1.00 206.19 ? 106 DC  J "C3'" 1 
ATOM   8351  O "O3'" . DC  I 6 107 ? 145.008 115.322 171.610 1.00 206.19 ? 106 DC  J "O3'" 1 
ATOM   8352  C "C2'" . DC  I 6 107 ? 145.212 117.186 170.084 1.00 206.19 ? 106 DC  J "C2'" 1 
ATOM   8353  C "C1'" . DC  I 6 107 ? 144.117 117.941 170.791 1.00 206.19 ? 106 DC  J "C1'" 1 
ATOM   8354  N N1    . DC  I 6 107 ? 143.574 119.059 170.025 1.00 206.19 ? 106 DC  J N1    1 
ATOM   8355  C C2    . DC  I 6 107 ? 142.230 119.055 169.707 1.00 206.19 ? 106 DC  J C2    1 
ATOM   8356  O O2    . DC  I 6 107 ? 141.544 118.105 170.074 1.00 206.19 ? 106 DC  J O2    1 
ATOM   8357  N N3    . DC  I 6 107 ? 141.719 120.082 169.005 1.00 206.19 ? 106 DC  J N3    1 
ATOM   8358  C C4    . DC  I 6 107 ? 142.506 121.083 168.631 1.00 206.19 ? 106 DC  J C4    1 
ATOM   8359  N N4    . DC  I 6 107 ? 141.957 122.081 167.939 1.00 206.19 ? 106 DC  J N4    1 
ATOM   8360  C C5    . DC  I 6 107 ? 143.892 121.104 168.944 1.00 206.19 ? 106 DC  J C5    1 
ATOM   8361  C C6    . DC  I 6 107 ? 144.379 120.079 169.642 1.00 206.19 ? 106 DC  J C6    1 
ATOM   8362  P P     . DT  I 6 108 ? 145.234 113.893 170.915 1.00 205.97 ? 107 DT  J P     1 
ATOM   8363  O OP1   . DT  I 6 108 ? 145.789 112.995 171.949 1.00 205.97 ? 107 DT  J OP1   1 
ATOM   8364  O OP2   . DT  I 6 108 ? 145.956 114.066 169.638 1.00 205.97 ? 107 DT  J OP2   1 
ATOM   8365  O "O5'" . DT  I 6 108 ? 143.751 113.420 170.572 1.00 205.97 ? 107 DT  J "O5'" 1 
ATOM   8366  C "C5'" . DT  I 6 108 ? 142.794 114.375 170.154 1.00 205.97 ? 107 DT  J "C5'" 1 
ATOM   8367  C "C4'" . DT  I 6 108 ? 141.711 113.717 169.334 1.00 205.97 ? 107 DT  J "C4'" 1 
ATOM   8368  O "O4'" . DT  I 6 108 ? 140.984 114.731 168.590 1.00 205.97 ? 107 DT  J "O4'" 1 
ATOM   8369  C "C3'" . DT  I 6 108 ? 142.221 112.751 168.286 1.00 205.97 ? 107 DT  J "C3'" 1 
ATOM   8370  O "O3'" . DT  I 6 108 ? 141.217 111.804 168.003 1.00 205.97 ? 107 DT  J "O3'" 1 
ATOM   8371  C "C2'" . DT  I 6 108 ? 142.459 113.682 167.109 1.00 205.97 ? 107 DT  J "C2'" 1 
ATOM   8372  C "C1'" . DT  I 6 108 ? 141.240 114.584 167.208 1.00 205.97 ? 107 DT  J "C1'" 1 
ATOM   8373  N N1    . DT  I 6 108 ? 141.453 115.926 166.632 1.00 205.97 ? 107 DT  J N1    1 
ATOM   8374  C C2    . DT  I 6 108 ? 140.401 116.593 166.061 1.00 205.97 ? 107 DT  J C2    1 
ATOM   8375  O O2    . DT  I 6 108 ? 139.281 116.132 165.985 1.00 205.97 ? 107 DT  J O2    1 
ATOM   8376  N N3    . DT  I 6 108 ? 140.708 117.826 165.573 1.00 205.97 ? 107 DT  J N3    1 
ATOM   8377  C C4    . DT  I 6 108 ? 141.931 118.449 165.605 1.00 205.97 ? 107 DT  J C4    1 
ATOM   8378  O O4    . DT  I 6 108 ? 142.111 119.563 165.139 1.00 205.97 ? 107 DT  J O4    1 
ATOM   8379  C C5    . DT  I 6 108 ? 142.988 117.697 166.216 1.00 205.97 ? 107 DT  J C5    1 
ATOM   8380  C C7    . DT  I 6 108 ? 144.364 118.275 166.304 1.00 205.97 ? 107 DT  J C7    1 
ATOM   8381  C C6    . DT  I 6 108 ? 142.702 116.487 166.695 1.00 205.97 ? 107 DT  J C6    1 
ATOM   8382  P P     . DC  I 6 109 ? 141.560 110.457 167.202 1.00 203.00 ? 108 DC  J P     1 
ATOM   8383  O OP1   . DC  I 6 109 ? 141.101 109.334 168.044 1.00 203.00 ? 108 DC  J OP1   1 
ATOM   8384  O OP2   . DC  I 6 109 ? 142.964 110.490 166.741 1.00 203.00 ? 108 DC  J OP2   1 
ATOM   8385  O "O5'" . DC  I 6 109 ? 140.604 110.539 165.931 1.00 203.00 ? 108 DC  J "O5'" 1 
ATOM   8386  C "C5'" . DC  I 6 109 ? 139.206 110.601 166.126 1.00 203.00 ? 108 DC  J "C5'" 1 
ATOM   8387  C "C4'" . DC  I 6 109 ? 138.509 111.281 164.964 1.00 203.00 ? 108 DC  J "C4'" 1 
ATOM   8388  O "O4'" . DC  I 6 109 ? 138.990 112.644 164.811 1.00 203.00 ? 108 DC  J "O4'" 1 
ATOM   8389  C "C3'" . DC  I 6 109 ? 138.699 110.623 163.596 1.00 203.00 ? 108 DC  J "C3'" 1 
ATOM   8390  O "O3'" . DC  I 6 109 ? 137.480 110.704 162.900 1.00 203.00 ? 108 DC  J "O3'" 1 
ATOM   8391  C "C2'" . DC  I 6 109 ? 139.741 111.525 162.954 1.00 203.00 ? 108 DC  J "C2'" 1 
ATOM   8392  C "C1'" . DC  I 6 109 ? 139.236 112.860 163.446 1.00 203.00 ? 108 DC  J "C1'" 1 
ATOM   8393  N N1    . DC  I 6 109 ? 140.192 113.968 163.294 1.00 203.00 ? 108 DC  J N1    1 
ATOM   8394  C C2    . DC  I 6 109 ? 139.759 115.168 162.741 1.00 203.00 ? 108 DC  J C2    1 
ATOM   8395  O O2    . DC  I 6 109 ? 138.584 115.274 162.388 1.00 203.00 ? 108 DC  J O2    1 
ATOM   8396  N N3    . DC  I 6 109 ? 140.639 116.180 162.603 1.00 203.00 ? 108 DC  J N3    1 
ATOM   8397  C C4    . DC  I 6 109 ? 141.898 116.022 162.997 1.00 203.00 ? 108 DC  J C4    1 
ATOM   8398  N N4    . DC  I 6 109 ? 142.735 117.049 162.841 1.00 203.00 ? 108 DC  J N4    1 
ATOM   8399  C C5    . DC  I 6 109 ? 142.359 114.804 163.564 1.00 203.00 ? 108 DC  J C5    1 
ATOM   8400  C C6    . DC  I 6 109 ? 141.479 113.810 163.685 1.00 203.00 ? 108 DC  J C6    1 
ATOM   8401  P P     . DC  I 6 110 ? 137.123 109.688 161.711 1.00 199.97 ? 109 DC  J P     1 
ATOM   8402  O OP1   . DC  I 6 110 ? 136.591 108.460 162.334 1.00 199.97 ? 109 DC  J OP1   1 
ATOM   8403  O OP2   . DC  I 6 110 ? 138.263 109.609 160.773 1.00 199.97 ? 109 DC  J OP2   1 
ATOM   8404  O "O5'" . DC  I 6 110 ? 135.932 110.434 160.959 1.00 199.97 ? 109 DC  J "O5'" 1 
ATOM   8405  C "C5'" . DC  I 6 110 ? 135.644 111.791 161.284 1.00 199.97 ? 109 DC  J "C5'" 1 
ATOM   8406  C "C4'" . DC  I 6 110 ? 135.726 112.679 160.058 1.00 199.97 ? 109 DC  J "C4'" 1 
ATOM   8407  O "O4'" . DC  I 6 110 ? 136.840 113.608 160.190 1.00 199.97 ? 109 DC  J "O4'" 1 
ATOM   8408  C "C3'" . DC  I 6 110 ? 135.970 111.946 158.735 1.00 199.97 ? 109 DC  J "C3'" 1 
ATOM   8409  O "O3'" . DC  I 6 110 ? 135.349 112.664 157.689 1.00 199.97 ? 109 DC  J "O3'" 1 
ATOM   8410  C "C2'" . DC  I 6 110 ? 137.476 112.072 158.609 1.00 199.97 ? 109 DC  J "C2'" 1 
ATOM   8411  C "C1'" . DC  I 6 110 ? 137.599 113.522 159.013 1.00 199.97 ? 109 DC  J "C1'" 1 
ATOM   8412  N N1    . DC  I 6 110 ? 138.974 113.986 159.263 1.00 199.97 ? 109 DC  J N1    1 
ATOM   8413  C C2    . DC  I 6 110 ? 139.326 115.277 158.897 1.00 199.97 ? 109 DC  J C2    1 
ATOM   8414  O O2    . DC  I 6 110 ? 138.475 116.001 158.375 1.00 199.97 ? 109 DC  J O2    1 
ATOM   8415  N N3    . DC  I 6 110 ? 140.584 115.701 159.120 1.00 199.97 ? 109 DC  J N3    1 
ATOM   8416  C C4    . DC  I 6 110 ? 141.466 114.883 159.682 1.00 199.97 ? 109 DC  J C4    1 
ATOM   8417  N N4    . DC  I 6 110 ? 142.697 115.341 159.886 1.00 199.97 ? 109 DC  J N4    1 
ATOM   8418  C C5    . DC  I 6 110 ? 141.126 113.557 160.057 1.00 199.97 ? 109 DC  J C5    1 
ATOM   8419  C C6    . DC  I 6 110 ? 139.880 113.154 159.824 1.00 199.97 ? 109 DC  J C6    1 
ATOM   8420  P P     . DC  I 6 111 ? 133.869 112.307 157.181 1.00 192.27 ? 110 DC  J P     1 
ATOM   8421  O OP1   . DC  I 6 111 ? 132.946 112.277 158.335 1.00 192.27 ? 110 DC  J OP1   1 
ATOM   8422  O OP2   . DC  I 6 111 ? 133.982 111.137 156.287 1.00 192.27 ? 110 DC  J OP2   1 
ATOM   8423  O "O5'" . DC  I 6 111 ? 133.491 113.570 156.284 1.00 192.27 ? 110 DC  J "O5'" 1 
ATOM   8424  C "C5'" . DC  I 6 111 ? 134.058 114.840 156.593 1.00 192.27 ? 110 DC  J "C5'" 1 
ATOM   8425  C "C4'" . DC  I 6 111 ? 134.638 115.492 155.353 1.00 192.27 ? 110 DC  J "C4'" 1 
ATOM   8426  O "O4'" . DC  I 6 111 ? 136.050 115.783 155.557 1.00 192.27 ? 110 DC  J "O4'" 1 
ATOM   8427  C "C3'" . DC  I 6 111 ? 134.589 114.637 154.096 1.00 192.27 ? 110 DC  J "C3'" 1 
ATOM   8428  O "O3'" . DC  I 6 111 ? 134.488 115.481 152.990 1.00 192.27 ? 110 DC  J "O3'" 1 
ATOM   8429  C "C2'" . DC  I 6 111 ? 135.953 113.975 154.128 1.00 192.27 ? 110 DC  J "C2'" 1 
ATOM   8430  C "C1'" . DC  I 6 111 ? 136.787 115.173 154.521 1.00 192.27 ? 110 DC  J "C1'" 1 
ATOM   8431  N N1    . DC  I 6 111 ? 138.128 114.838 155.026 1.00 192.27 ? 110 DC  J N1    1 
ATOM   8432  C C2    . DC  I 6 111 ? 139.131 115.798 154.986 1.00 192.27 ? 110 DC  J C2    1 
ATOM   8433  O O2    . DC  I 6 111 ? 138.878 116.913 154.525 1.00 192.27 ? 110 DC  J O2    1 
ATOM   8434  N N3    . DC  I 6 111 ? 140.355 115.483 155.458 1.00 192.27 ? 110 DC  J N3    1 
ATOM   8435  C C4    . DC  I 6 111 ? 140.582 114.272 155.955 1.00 192.27 ? 110 DC  J C4    1 
ATOM   8436  N N4    . DC  I 6 111 ? 141.809 114.002 156.400 1.00 192.27 ? 110 DC  J N4    1 
ATOM   8437  C C5    . DC  I 6 111 ? 139.576 113.276 155.988 1.00 192.27 ? 110 DC  J C5    1 
ATOM   8438  C C6    . DC  I 6 111 ? 138.374 113.601 155.518 1.00 192.27 ? 110 DC  J C6    1 
ATOM   8439  P P     . DT  I 6 112 ? 133.217 115.406 152.023 1.00 187.80 ? 111 DT  J P     1 
ATOM   8440  O OP1   . DT  I 6 112 ? 132.013 115.471 152.880 1.00 187.80 ? 111 DT  J OP1   1 
ATOM   8441  O OP2   . DT  I 6 112 ? 133.425 114.269 151.102 1.00 187.80 ? 111 DT  J OP2   1 
ATOM   8442  O "O5'" . DT  I 6 112 ? 133.319 116.753 151.176 1.00 187.80 ? 111 DT  J "O5'" 1 
ATOM   8443  C "C5'" . DT  I 6 112 ? 133.115 118.006 151.815 1.00 187.80 ? 111 DT  J "C5'" 1 
ATOM   8444  C "C4'" . DT  I 6 112 ? 134.305 118.942 151.637 1.00 187.80 ? 111 DT  J "C4'" 1 
ATOM   8445  O "O4'" . DT  I 6 112 ? 135.542 118.276 151.994 1.00 187.80 ? 111 DT  J "O4'" 1 
ATOM   8446  C "C3'" . DT  I 6 112 ? 134.535 119.479 150.235 1.00 187.80 ? 111 DT  J "C3'" 1 
ATOM   8447  O "O3'" . DT  I 6 112 ? 135.103 120.760 150.369 1.00 187.80 ? 111 DT  J "O3'" 1 
ATOM   8448  C "C2'" . DT  I 6 112 ? 135.556 118.483 149.687 1.00 187.80 ? 111 DT  J "C2'" 1 
ATOM   8449  C "C1'" . DT  I 6 112 ? 136.441 118.336 150.903 1.00 187.80 ? 111 DT  J "C1'" 1 
ATOM   8450  N N1    . DT  I 6 112 ? 137.258 117.114 150.966 1.00 187.80 ? 111 DT  J N1    1 
ATOM   8451  C C2    . DT  I 6 112 ? 138.565 117.213 151.358 1.00 187.80 ? 111 DT  J C2    1 
ATOM   8452  O O2    . DT  I 6 112 ? 139.114 118.268 151.576 1.00 187.80 ? 111 DT  J O2    1 
ATOM   8453  N N3    . DT  I 6 112 ? 139.220 116.029 151.466 1.00 187.80 ? 111 DT  J N3    1 
ATOM   8454  C C4    . DT  I 6 112 ? 138.710 114.778 151.248 1.00 187.80 ? 111 DT  J C4    1 
ATOM   8455  O O4    . DT  I 6 112 ? 139.388 113.772 151.374 1.00 187.80 ? 111 DT  J O4    1 
ATOM   8456  C C5    . DT  I 6 112 ? 137.324 114.737 150.863 1.00 187.80 ? 111 DT  J C5    1 
ATOM   8457  C C7    . DT  I 6 112 ? 136.657 113.423 150.590 1.00 187.80 ? 111 DT  J C7    1 
ATOM   8458  C C6    . DT  I 6 112 ? 136.670 115.897 150.750 1.00 187.80 ? 111 DT  J C6    1 
ATOM   8459  P P     . DA  I 6 113 ? 134.946 121.883 149.237 1.00 184.37 ? 112 DA  J P     1 
ATOM   8460  O OP1   . DA  I 6 113 ? 133.714 122.650 149.517 1.00 184.37 ? 112 DA  J OP1   1 
ATOM   8461  O OP2   . DA  I 6 113 ? 135.163 121.255 147.918 1.00 184.37 ? 112 DA  J OP2   1 
ATOM   8462  O "O5'" . DA  I 6 113 ? 136.197 122.819 149.525 1.00 184.37 ? 112 DA  J "O5'" 1 
ATOM   8463  C "C5'" . DA  I 6 113 ? 137.309 122.263 150.200 1.00 184.37 ? 112 DA  J "C5'" 1 
ATOM   8464  C "C4'" . DA  I 6 113 ? 138.615 122.780 149.644 1.00 184.37 ? 112 DA  J "C4'" 1 
ATOM   8465  O "O4'" . DA  I 6 113 ? 139.515 121.672 149.426 1.00 184.37 ? 112 DA  J "O4'" 1 
ATOM   8466  C "C3'" . DA  I 6 113 ? 138.524 123.443 148.297 1.00 184.37 ? 112 DA  J "C3'" 1 
ATOM   8467  O "O3'" . DA  I 6 113 ? 139.684 124.196 148.100 1.00 184.37 ? 112 DA  J "O3'" 1 
ATOM   8468  C "C2'" . DA  I 6 113 ? 138.508 122.235 147.379 1.00 184.37 ? 112 DA  J "C2'" 1 
ATOM   8469  C "C1'" . DA  I 6 113 ? 139.546 121.349 148.048 1.00 184.37 ? 112 DA  J "C1'" 1 
ATOM   8470  N N9    . DA  I 6 113 ? 139.249 119.946 147.933 1.00 184.37 ? 112 DA  J N9    1 
ATOM   8471  C C8    . DA  I 6 113 ? 138.083 119.391 147.519 1.00 184.37 ? 112 DA  J C8    1 
ATOM   8472  N N7    . DA  I 6 113 ? 138.080 118.083 147.555 1.00 184.37 ? 112 DA  J N7    1 
ATOM   8473  C C5    . DA  I 6 113 ? 139.332 117.768 148.033 1.00 184.37 ? 112 DA  J C5    1 
ATOM   8474  C C6    . DA  I 6 113 ? 139.961 116.544 148.303 1.00 184.37 ? 112 DA  J C6    1 
ATOM   8475  N N6    . DA  I 6 113 ? 139.374 115.362 148.118 1.00 184.37 ? 112 DA  J N6    1 
ATOM   8476  N N1    . DA  I 6 113 ? 141.223 116.583 148.771 1.00 184.37 ? 112 DA  J N1    1 
ATOM   8477  C C2    . DA  I 6 113 ? 141.810 117.766 148.951 1.00 184.37 ? 112 DA  J C2    1 
ATOM   8478  N N3    . DA  I 6 113 ? 141.316 118.980 148.734 1.00 184.37 ? 112 DA  J N3    1 
ATOM   8479  C C4    . DA  I 6 113 ? 140.062 118.908 148.275 1.00 184.37 ? 112 DA  J C4    1 
ATOM   8480  P P     . DG  I 6 114 ? 139.653 125.508 147.188 1.00 176.97 ? 113 DG  J P     1 
ATOM   8481  O OP1   . DG  I 6 114 ? 139.377 126.651 148.078 1.00 176.97 ? 113 DG  J OP1   1 
ATOM   8482  O OP2   . DG  I 6 114 ? 138.757 125.242 146.045 1.00 176.97 ? 113 DG  J OP2   1 
ATOM   8483  O "O5'" . DG  I 6 114 ? 141.150 125.614 146.657 1.00 176.97 ? 113 DG  J "O5'" 1 
ATOM   8484  C "C5'" . DG  I 6 114 ? 142.218 125.802 147.573 1.00 176.97 ? 113 DG  J "C5'" 1 
ATOM   8485  C "C4'" . DG  I 6 114 ? 143.441 124.985 147.189 1.00 176.97 ? 113 DG  J "C4'" 1 
ATOM   8486  O "O4'" . DG  I 6 114 ? 143.085 123.589 147.133 1.00 176.97 ? 113 DG  J "O4'" 1 
ATOM   8487  C "C3'" . DG  I 6 114 ? 144.062 125.308 145.833 1.00 176.97 ? 113 DG  J "C3'" 1 
ATOM   8488  O "O3'" . DG  I 6 114 ? 145.459 125.166 145.902 1.00 176.97 ? 113 DG  J "O3'" 1 
ATOM   8489  C "C2'" . DG  I 6 114 ? 143.457 124.251 144.942 1.00 176.97 ? 113 DG  J "C2'" 1 
ATOM   8490  C "C1'" . DG  I 6 114 ? 143.413 123.070 145.871 1.00 176.97 ? 113 DG  J "C1'" 1 
ATOM   8491  N N9    . DG  I 6 114 ? 142.394 122.116 145.512 1.00 176.97 ? 113 DG  J N9    1 
ATOM   8492  C C8    . DG  I 6 114 ? 141.134 122.384 145.053 1.00 176.97 ? 113 DG  J C8    1 
ATOM   8493  N N7    . DG  I 6 114 ? 140.438 121.313 144.807 1.00 176.97 ? 113 DG  J N7    1 
ATOM   8494  C C5    . DG  I 6 114 ? 141.282 120.281 145.155 1.00 176.97 ? 113 DG  J C5    1 
ATOM   8495  C C6    . DG  I 6 114 ? 141.074 118.897 145.122 1.00 176.97 ? 113 DG  J C6    1 
ATOM   8496  O O6    . DG  I 6 114 ? 140.067 118.281 144.768 1.00 176.97 ? 113 DG  J O6    1 
ATOM   8497  N N1    . DG  I 6 114 ? 142.195 118.202 145.551 1.00 176.97 ? 113 DG  J N1    1 
ATOM   8498  C C2    . DG  I 6 114 ? 143.368 118.783 145.967 1.00 176.97 ? 113 DG  J C2    1 
ATOM   8499  N N2    . DG  I 6 114 ? 144.347 117.951 146.345 1.00 176.97 ? 113 DG  J N2    1 
ATOM   8500  N N3    . DG  I 6 114 ? 143.572 120.083 145.999 1.00 176.97 ? 113 DG  J N3    1 
ATOM   8501  C C4    . DG  I 6 114 ? 142.491 120.764 145.586 1.00 176.97 ? 113 DG  J C4    1 
ATOM   8502  P P     . DT  I 6 115 ? 146.425 125.772 144.768 1.00 181.34 ? 114 DT  J P     1 
ATOM   8503  O OP1   . DT  I 6 115 ? 147.049 126.984 145.315 1.00 181.34 ? 114 DT  J OP1   1 
ATOM   8504  O OP2   . DT  I 6 115 ? 145.762 125.865 143.457 1.00 181.34 ? 114 DT  J OP2   1 
ATOM   8505  O "O5'" . DT  I 6 115 ? 147.552 124.668 144.657 1.00 181.34 ? 114 DT  J "O5'" 1 
ATOM   8506  C "C5'" . DT  I 6 115 ? 147.737 123.775 145.725 1.00 181.34 ? 114 DT  J "C5'" 1 
ATOM   8507  C "C4'" . DT  I 6 115 ? 148.304 122.462 145.241 1.00 181.34 ? 114 DT  J "C4'" 1 
ATOM   8508  O "O4'" . DT  I 6 115 ? 147.236 121.508 145.008 1.00 181.34 ? 114 DT  J "O4'" 1 
ATOM   8509  C "C3'" . DT  I 6 115 ? 149.082 122.535 143.939 1.00 181.34 ? 114 DT  J "C3'" 1 
ATOM   8510  O "O3'" . DT  I 6 115 ? 150.201 121.701 144.051 1.00 181.34 ? 114 DT  J "O3'" 1 
ATOM   8511  C "C2'" . DT  I 6 115 ? 148.082 121.986 142.923 1.00 181.34 ? 114 DT  J "C2'" 1 
ATOM   8512  C "C1'" . DT  I 6 115 ? 147.424 120.909 143.750 1.00 181.34 ? 114 DT  J "C1'" 1 
ATOM   8513  N N1    . DT  I 6 115 ? 146.095 120.454 143.262 1.00 181.34 ? 114 DT  J N1    1 
ATOM   8514  C C2    . DT  I 6 115 ? 145.831 119.110 143.189 1.00 181.34 ? 114 DT  J C2    1 
ATOM   8515  O O2    . DT  I 6 115 ? 146.640 118.258 143.479 1.00 181.34 ? 114 DT  J O2    1 
ATOM   8516  N N3    . DT  I 6 115 ? 144.571 118.799 142.776 1.00 181.34 ? 114 DT  J N3    1 
ATOM   8517  C C4    . DT  I 6 115 ? 143.575 119.667 142.435 1.00 181.34 ? 114 DT  J C4    1 
ATOM   8518  O O4    . DT  I 6 115 ? 142.476 119.297 142.061 1.00 181.34 ? 114 DT  J O4    1 
ATOM   8519  C C5    . DT  I 6 115 ? 143.908 121.049 142.526 1.00 181.34 ? 114 DT  J C5    1 
ATOM   8520  C C7    . DT  I 6 115 ? 142.889 122.068 142.142 1.00 181.34 ? 114 DT  J C7    1 
ATOM   8521  C C6    . DT  I 6 115 ? 145.136 121.382 142.945 1.00 181.34 ? 114 DT  J C6    1 
ATOM   8522  P P     . DC  I 6 116 ? 151.484 121.931 143.121 1.00 191.04 ? 115 DC  J P     1 
ATOM   8523  O OP1   . DC  I 6 116 ? 152.667 122.012 144.003 1.00 191.04 ? 115 DC  J OP1   1 
ATOM   8524  O OP2   . DC  I 6 116 ? 151.172 123.049 142.210 1.00 191.04 ? 115 DC  J OP2   1 
ATOM   8525  O "O5'" . DC  I 6 116 ? 151.552 120.589 142.263 1.00 191.04 ? 115 DC  J "O5'" 1 
ATOM   8526  C "C5'" . DC  I 6 116 ? 150.772 119.475 142.660 1.00 191.04 ? 115 DC  J "C5'" 1 
ATOM   8527  C "C4'" . DC  I 6 116 ? 151.015 118.292 141.755 1.00 191.04 ? 115 DC  J "C4'" 1 
ATOM   8528  O "O4'" . DC  I 6 116 ? 149.744 117.707 141.386 1.00 191.04 ? 115 DC  J "O4'" 1 
ATOM   8529  C "C3'" . DC  I 6 116 ? 151.715 118.620 140.453 1.00 191.04 ? 115 DC  J "C3'" 1 
ATOM   8530  O "O3'" . DC  I 6 116 ? 152.489 117.517 140.041 1.00 191.04 ? 115 DC  J "O3'" 1 
ATOM   8531  C "C2'" . DC  I 6 116 ? 150.554 118.880 139.508 1.00 191.04 ? 115 DC  J "C2'" 1 
ATOM   8532  C "C1'" . DC  I 6 116 ? 149.481 117.929 140.022 1.00 191.04 ? 115 DC  J "C1'" 1 
ATOM   8533  N N1    . DC  I 6 116 ? 148.136 118.503 139.900 1.00 191.04 ? 115 DC  J N1    1 
ATOM   8534  C C2    . DC  I 6 116 ? 147.070 117.708 139.508 1.00 191.04 ? 115 DC  J C2    1 
ATOM   8535  O O2    . DC  I 6 116 ? 147.259 116.513 139.282 1.00 191.04 ? 115 DC  J O2    1 
ATOM   8536  N N3    . DC  I 6 116 ? 145.850 118.270 139.394 1.00 191.04 ? 115 DC  J N3    1 
ATOM   8537  C C4    . DC  I 6 116 ? 145.685 119.558 139.646 1.00 191.04 ? 115 DC  J C4    1 
ATOM   8538  N N4    . DC  I 6 116 ? 144.467 120.071 139.503 1.00 191.04 ? 115 DC  J N4    1 
ATOM   8539  C C5    . DC  I 6 116 ? 146.761 120.383 140.035 1.00 191.04 ? 115 DC  J C5    1 
ATOM   8540  C C6    . DC  I 6 116 ? 147.956 119.816 140.156 1.00 191.04 ? 115 DC  J C6    1 
ATOM   8541  P P     . DT  I 6 117 ? 153.364 117.589 138.697 1.00 198.17 ? 116 DT  J P     1 
ATOM   8542  O OP1   . DT  I 6 117 ? 154.532 116.706 138.894 1.00 198.17 ? 116 DT  J OP1   1 
ATOM   8543  O OP2   . DT  I 6 117 ? 153.584 119.004 138.331 1.00 198.17 ? 116 DT  J OP2   1 
ATOM   8544  O "O5'" . DT  I 6 117 ? 152.412 116.920 137.609 1.00 198.17 ? 116 DT  J "O5'" 1 
ATOM   8545  C "C5'" . DT  I 6 117 ? 151.718 115.735 137.941 1.00 198.17 ? 116 DT  J "C5'" 1 
ATOM   8546  C "C4'" . DT  I 6 117 ? 150.779 115.328 136.830 1.00 198.17 ? 116 DT  J "C4'" 1 
ATOM   8547  O "O4'" . DT  I 6 117 ? 149.508 116.006 136.973 1.00 198.17 ? 116 DT  J "O4'" 1 
ATOM   8548  C "C3'" . DT  I 6 117 ? 151.271 115.651 135.422 1.00 198.17 ? 116 DT  J "C3'" 1 
ATOM   8549  O "O3'" . DT  I 6 117 ? 151.076 114.528 134.607 1.00 198.17 ? 116 DT  J "O3'" 1 
ATOM   8550  C "C2'" . DT  I 6 117 ? 150.372 116.808 134.996 1.00 198.17 ? 116 DT  J "C2'" 1 
ATOM   8551  C "C1'" . DT  I 6 117 ? 149.093 116.430 135.704 1.00 198.17 ? 116 DT  J "C1'" 1 
ATOM   8552  N N1    . DT  I 6 117 ? 148.154 117.539 135.873 1.00 198.17 ? 116 DT  J N1    1 
ATOM   8553  C C2    . DT  I 6 117 ? 146.831 117.326 135.614 1.00 198.17 ? 116 DT  J C2    1 
ATOM   8554  O O2    . DT  I 6 117 ? 146.391 116.261 135.237 1.00 198.17 ? 116 DT  J O2    1 
ATOM   8555  N N3    . DT  I 6 117 ? 146.032 118.406 135.804 1.00 198.17 ? 116 DT  J N3    1 
ATOM   8556  C C4    . DT  I 6 117 ? 146.418 119.654 136.234 1.00 198.17 ? 116 DT  J C4    1 
ATOM   8557  O O4    . DT  I 6 117 ? 145.625 120.566 136.373 1.00 198.17 ? 116 DT  J O4    1 
ATOM   8558  C C5    . DT  I 6 117 ? 147.823 119.814 136.488 1.00 198.17 ? 116 DT  J C5    1 
ATOM   8559  C C7    . DT  I 6 117 ? 148.362 121.138 136.937 1.00 198.17 ? 116 DT  J C7    1 
ATOM   8560  C C6    . DT  I 6 117 ? 148.616 118.757 136.300 1.00 198.17 ? 116 DT  J C6    1 
ATOM   8561  P P     . DC  I 6 118 ? 151.984 114.319 133.307 1.00 200.33 ? 117 DC  J P     1 
ATOM   8562  O OP1   . DC  I 6 118 ? 151.821 112.917 132.865 1.00 200.33 ? 117 DC  J OP1   1 
ATOM   8563  O OP2   . DC  I 6 118 ? 153.330 114.841 133.620 1.00 200.33 ? 117 DC  J OP2   1 
ATOM   8564  O "O5'" . DC  I 6 118 ? 151.332 115.306 132.241 1.00 200.33 ? 117 DC  J "O5'" 1 
ATOM   8565  C "C5'" . DC  I 6 118 ? 151.212 114.906 130.908 1.00 200.33 ? 117 DC  J "C5'" 1 
ATOM   8566  C "C4'" . DC  I 6 118 ? 149.829 114.362 130.640 1.00 200.33 ? 117 DC  J "C4'" 1 
ATOM   8567  O "O4'" . DC  I 6 118 ? 148.871 115.037 131.503 1.00 200.33 ? 117 DC  J "O4'" 1 
ATOM   8568  C "C3'" . DC  I 6 118 ? 149.342 114.597 129.223 1.00 200.33 ? 117 DC  J "C3'" 1 
ATOM   8569  O "O3'" . DC  I 6 118 ? 148.480 113.547 128.822 1.00 200.33 ? 117 DC  J "O3'" 1 
ATOM   8570  C "C2'" . DC  I 6 118 ? 148.597 115.908 129.373 1.00 200.33 ? 117 DC  J "C2'" 1 
ATOM   8571  C "C1'" . DC  I 6 118 ? 147.918 115.701 130.705 1.00 200.33 ? 117 DC  J "C1'" 1 
ATOM   8572  N N1    . DC  I 6 118 ? 147.529 116.969 131.369 1.00 200.33 ? 117 DC  J N1    1 
ATOM   8573  C C2    . DC  I 6 118 ? 146.204 117.401 131.310 1.00 200.33 ? 117 DC  J C2    1 
ATOM   8574  O O2    . DC  I 6 118 ? 145.377 116.718 130.707 1.00 200.33 ? 117 DC  J O2    1 
ATOM   8575  N N3    . DC  I 6 118 ? 145.865 118.552 131.926 1.00 200.33 ? 117 DC  J N3    1 
ATOM   8576  C C4    . DC  I 6 118 ? 146.786 119.257 132.567 1.00 200.33 ? 117 DC  J C4    1 
ATOM   8577  N N4    . DC  I 6 118 ? 146.404 120.388 133.154 1.00 200.33 ? 117 DC  J N4    1 
ATOM   8578  C C5    . DC  I 6 118 ? 148.142 118.839 132.635 1.00 200.33 ? 117 DC  J C5    1 
ATOM   8579  C C6    . DC  I 6 118 ? 148.466 117.699 132.025 1.00 200.33 ? 117 DC  J C6    1 
ATOM   8580  P P     . DC  I 6 119 ? 147.807 113.558 127.362 1.00 202.07 ? 118 DC  J P     1 
ATOM   8581  O OP1   . DC  I 6 119 ? 147.570 112.152 126.980 1.00 202.07 ? 118 DC  J OP1   1 
ATOM   8582  O OP2   . DC  I 6 119 ? 148.607 114.427 126.471 1.00 202.07 ? 118 DC  J OP2   1 
ATOM   8583  O "O5'" . DC  I 6 119 ? 146.395 114.264 127.604 1.00 202.07 ? 118 DC  J "O5'" 1 
ATOM   8584  C "C5'" . DC  I 6 119 ? 145.287 113.934 126.791 1.00 202.07 ? 118 DC  J "C5'" 1 
ATOM   8585  C "C4'" . DC  I 6 119 ? 144.867 115.123 125.957 1.00 202.07 ? 118 DC  J "C4'" 1 
ATOM   8586  O "O4'" . DC  I 6 119 ? 144.876 116.309 126.779 1.00 202.07 ? 118 DC  J "O4'" 1 
ATOM   8587  C "C3'" . DC  I 6 119 ? 145.772 115.414 124.760 1.00 202.07 ? 118 DC  J "C3'" 1 
ATOM   8588  O "O3'" . DC  I 6 119 ? 145.011 115.239 123.501 1.00 202.07 ? 118 DC  J "O3'" 1 
ATOM   8589  C "C2'" . DC  I 6 119 ? 146.323 116.824 125.025 1.00 202.07 ? 118 DC  J "C2'" 1 
ATOM   8590  C "C1'" . DC  I 6 119 ? 145.324 117.396 126.021 1.00 202.07 ? 118 DC  J "C1'" 1 
ATOM   8591  N N1    . DC  I 6 119 ? 145.907 118.383 126.946 1.00 202.07 ? 118 DC  J N1    1 
ATOM   8592  C C2    . DC  I 6 119 ? 145.096 119.368 127.500 1.00 202.07 ? 118 DC  J C2    1 
ATOM   8593  O O2    . DC  I 6 119 ? 143.903 119.400 127.195 1.00 202.07 ? 118 DC  J O2    1 
ATOM   8594  N N3    . DC  I 6 119 ? 145.644 120.256 128.356 1.00 202.07 ? 118 DC  J N3    1 
ATOM   8595  C C4    . DC  I 6 119 ? 146.937 120.177 128.657 1.00 202.07 ? 118 DC  J C4    1 
ATOM   8596  N N4    . DC  I 6 119 ? 147.440 121.073 129.504 1.00 202.07 ? 118 DC  J N4    1 
ATOM   8597  C C5    . DC  I 6 119 ? 147.776 119.178 128.101 1.00 202.07 ? 118 DC  J C5    1 
ATOM   8598  C C6    . DC  I 6 119 ? 147.223 118.317 127.253 1.00 202.07 ? 118 DC  J C6    1 
ATOM   8599  P P     . DA  I 6 120 ? 144.714 116.401 122.417 1.00 200.93 ? 119 DA  J P     1 
ATOM   8600  O OP1   . DA  I 6 120 ? 143.846 115.740 121.426 1.00 200.93 ? 119 DA  J OP1   1 
ATOM   8601  O OP2   . DA  I 6 120 ? 145.937 117.052 121.898 1.00 200.93 ? 119 DA  J OP2   1 
ATOM   8602  O "O5'" . DA  I 6 120 ? 143.775 117.445 123.173 1.00 200.93 ? 119 DA  J "O5'" 1 
ATOM   8603  C "C5'" . DA  I 6 120 ? 142.383 117.469 122.928 1.00 200.93 ? 119 DA  J "C5'" 1 
ATOM   8604  C "C4'" . DA  I 6 120 ? 141.841 118.887 123.024 1.00 200.93 ? 119 DA  J "C4'" 1 
ATOM   8605  O "O4'" . DA  I 6 120 ? 142.629 119.655 123.967 1.00 200.93 ? 119 DA  J "O4'" 1 
ATOM   8606  C "C3'" . DA  I 6 120 ? 141.881 119.684 121.731 1.00 200.93 ? 119 DA  J "C3'" 1 
ATOM   8607  O "O3'" . DA  I 6 120 ? 140.842 120.628 121.733 1.00 200.93 ? 119 DA  J "O3'" 1 
ATOM   8608  C "C2'" . DA  I 6 120 ? 143.234 120.368 121.811 1.00 200.93 ? 119 DA  J "C2'" 1 
ATOM   8609  C "C1'" . DA  I 6 120 ? 143.318 120.692 123.292 1.00 200.93 ? 119 DA  J "C1'" 1 
ATOM   8610  N N9    . DA  I 6 120 ? 144.677 120.701 123.787 1.00 200.93 ? 119 DA  J N9    1 
ATOM   8611  C C8    . DA  I 6 120 ? 145.682 119.860 123.422 1.00 200.93 ? 119 DA  J C8    1 
ATOM   8612  N N7    . DA  I 6 120 ? 146.809 120.082 124.044 1.00 200.93 ? 119 DA  J N7    1 
ATOM   8613  C C5    . DA  I 6 120 ? 146.521 121.146 124.872 1.00 200.93 ? 119 DA  J C5    1 
ATOM   8614  C C6    . DA  I 6 120 ? 147.296 121.862 125.789 1.00 200.93 ? 119 DA  J C6    1 
ATOM   8615  N N6    . DA  I 6 120 ? 148.579 121.595 126.032 1.00 200.93 ? 119 DA  J N6    1 
ATOM   8616  N N1    . DA  I 6 120 ? 146.704 122.865 126.453 1.00 200.93 ? 119 DA  J N1    1 
ATOM   8617  C C2    . DA  I 6 120 ? 145.421 123.139 126.213 1.00 200.93 ? 119 DA  J C2    1 
ATOM   8618  N N3    . DA  I 6 120 ? 144.589 122.535 125.373 1.00 200.93 ? 119 DA  J N3    1 
ATOM   8619  C C4    . DA  I 6 120 ? 145.209 121.538 124.728 1.00 200.93 ? 119 DA  J C4    1 
ATOM   8620  P P     . DG  I 6 121 ? 140.168 121.088 120.354 1.00 197.12 ? 120 DG  J P     1 
ATOM   8621  O OP1   . DG  I 6 121 ? 139.323 119.976 119.876 1.00 197.12 ? 120 DG  J OP1   1 
ATOM   8622  O OP2   . DG  I 6 121 ? 141.236 121.628 119.487 1.00 197.12 ? 120 DG  J OP2   1 
ATOM   8623  O "O5'" . DG  I 6 121 ? 139.216 122.285 120.798 1.00 197.12 ? 120 DG  J "O5'" 1 
ATOM   8624  C "C5'" . DG  I 6 121 ? 139.366 122.848 122.089 1.00 197.12 ? 120 DG  J "C5'" 1 
ATOM   8625  C "C4'" . DG  I 6 121 ? 139.648 124.334 122.008 1.00 197.12 ? 120 DG  J "C4'" 1 
ATOM   8626  O "O4'" . DG  I 6 121 ? 140.950 124.610 122.574 1.00 197.12 ? 120 DG  J "O4'" 1 
ATOM   8627  C "C3'" . DG  I 6 121 ? 139.682 124.911 120.598 1.00 197.12 ? 120 DG  J "C3'" 1 
ATOM   8628  O "O3'" . DG  I 6 121 ? 139.242 126.262 120.629 1.00 197.12 ? 120 DG  J "O3'" 1 
ATOM   8629  C "C2'" . DG  I 6 121 ? 141.168 124.827 120.272 1.00 197.12 ? 120 DG  J "C2'" 1 
ATOM   8630  C "C1'" . DG  I 6 121 ? 141.747 125.241 121.606 1.00 197.12 ? 120 DG  J "C1'" 1 
ATOM   8631  N N9    . DG  I 6 121 ? 143.125 124.844 121.830 1.00 197.12 ? 120 DG  J N9    1 
ATOM   8632  C C8    . DG  I 6 121 ? 143.808 123.803 121.261 1.00 197.12 ? 120 DG  J C8    1 
ATOM   8633  N N7    . DG  I 6 121 ? 145.035 123.698 121.691 1.00 197.12 ? 120 DG  J N7    1 
ATOM   8634  C C5    . DG  I 6 121 ? 145.158 124.733 122.604 1.00 197.12 ? 120 DG  J C5    1 
ATOM   8635  C C6    . DG  I 6 121 ? 146.256 125.130 123.398 1.00 197.12 ? 120 DG  J C6    1 
ATOM   8636  O O6    . DG  I 6 121 ? 147.381 124.632 123.458 1.00 197.12 ? 120 DG  J O6    1 
ATOM   8637  N N1    . DG  I 6 121 ? 145.948 126.235 124.188 1.00 197.12 ? 120 DG  J N1    1 
ATOM   8638  C C2    . DG  I 6 121 ? 144.735 126.868 124.204 1.00 197.12 ? 120 DG  J C2    1 
ATOM   8639  N N2    . DG  I 6 121 ? 144.607 127.916 125.025 1.00 197.12 ? 120 DG  J N2    1 
ATOM   8640  N N3    . DG  I 6 121 ? 143.707 126.504 123.463 1.00 197.12 ? 120 DG  J N3    1 
ATOM   8641  C C4    . DG  I 6 121 ? 143.989 125.436 122.696 1.00 197.12 ? 120 DG  J C4    1 
ATOM   8642  P P     . DG  I 6 122 ? 137.679 126.639 120.527 1.00 201.24 ? 121 DG  J P     1 
ATOM   8643  O OP1   . DG  I 6 122 ? 136.837 125.453 120.784 1.00 201.24 ? 121 DG  J OP1   1 
ATOM   8644  O OP2   . DG  I 6 122 ? 137.506 127.385 119.266 1.00 201.24 ? 121 DG  J OP2   1 
ATOM   8645  O "O5'" . DG  I 6 122 ? 137.471 127.675 121.724 1.00 201.24 ? 121 DG  J "O5'" 1 
ATOM   8646  C "C5'" . DG  I 6 122 ? 138.551 127.919 122.619 1.00 201.24 ? 121 DG  J "C5'" 1 
ATOM   8647  C "C4'" . DG  I 6 122 ? 138.818 129.403 122.818 1.00 201.24 ? 121 DG  J "C4'" 1 
ATOM   8648  O "O4'" . DG  I 6 122 ? 140.233 129.642 122.717 1.00 201.24 ? 121 DG  J "O4'" 1 
ATOM   8649  C "C3'" . DG  I 6 122 ? 138.239 130.334 121.782 1.00 201.24 ? 121 DG  J "C3'" 1 
ATOM   8650  O "O3'" . DG  I 6 122 ? 138.368 131.650 122.257 1.00 201.24 ? 121 DG  J "O3'" 1 
ATOM   8651  C "C2'" . DG  I 6 122 ? 139.219 130.116 120.647 1.00 201.24 ? 121 DG  J "C2'" 1 
ATOM   8652  C "C1'" . DG  I 6 122 ? 140.525 130.140 121.426 1.00 201.24 ? 121 DG  J "C1'" 1 
ATOM   8653  N N9    . DG  I 6 122 ? 141.552 129.309 120.862 1.00 201.24 ? 121 DG  J N9    1 
ATOM   8654  C C8    . DG  I 6 122 ? 141.423 128.390 119.862 1.00 201.24 ? 121 DG  J C8    1 
ATOM   8655  N N7    . DG  I 6 122 ? 142.535 127.780 119.583 1.00 201.24 ? 121 DG  J N7    1 
ATOM   8656  C C5    . DG  I 6 122 ? 143.443 128.320 120.472 1.00 201.24 ? 121 DG  J C5    1 
ATOM   8657  C C6    . DG  I 6 122 ? 144.809 128.048 120.649 1.00 201.24 ? 121 DG  J C6    1 
ATOM   8658  O O6    . DG  I 6 122 ? 145.518 127.240 120.043 1.00 201.24 ? 121 DG  J O6    1 
ATOM   8659  N N1    . DG  I 6 122 ? 145.355 128.832 121.650 1.00 201.24 ? 121 DG  J N1    1 
ATOM   8660  C C2    . DG  I 6 122 ? 144.664 129.753 122.390 1.00 201.24 ? 121 DG  J C2    1 
ATOM   8661  N N2    . DG  I 6 122 ? 145.359 130.414 123.318 1.00 201.24 ? 121 DG  J N2    1 
ATOM   8662  N N3    . DG  I 6 122 ? 143.388 130.018 122.228 1.00 201.24 ? 121 DG  J N3    1 
ATOM   8663  C C4    . DG  I 6 122 ? 142.846 129.264 121.259 1.00 201.24 ? 121 DG  J C4    1 
ATOM   8664  P P     . DC  I 6 123 ? 137.170 132.392 123.021 1.00 198.92 ? 122 DC  J P     1 
ATOM   8665  O OP1   . DC  I 6 123 ? 136.577 131.467 124.010 1.00 198.92 ? 122 DC  J OP1   1 
ATOM   8666  O OP2   . DC  I 6 123 ? 136.315 133.015 121.992 1.00 198.92 ? 122 DC  J OP2   1 
ATOM   8667  O "O5'" . DC  I 6 123 ? 137.912 133.569 123.808 1.00 198.92 ? 122 DC  J "O5'" 1 
ATOM   8668  C "C5'" . DC  I 6 123 ? 138.422 133.338 125.116 1.00 198.92 ? 122 DC  J "C5'" 1 
ATOM   8669  C "C4'" . DC  I 6 123 ? 139.783 133.995 125.336 1.00 198.92 ? 122 DC  J "C4'" 1 
ATOM   8670  O "O4'" . DC  I 6 123 ? 140.748 133.503 124.383 1.00 198.92 ? 122 DC  J "O4'" 1 
ATOM   8671  C "C3'" . DC  I 6 123 ? 139.838 135.507 125.221 1.00 198.92 ? 122 DC  J "C3'" 1 
ATOM   8672  O "O3'" . DC  I 6 123 ? 140.820 135.975 126.115 1.00 198.92 ? 122 DC  J "O3'" 1 
ATOM   8673  C "C2'" . DC  I 6 123 ? 140.280 135.706 123.775 1.00 198.92 ? 122 DC  J "C2'" 1 
ATOM   8674  C "C1'" . DC  I 6 123 ? 141.276 134.575 123.631 1.00 198.92 ? 122 DC  J "C1'" 1 
ATOM   8675  N N1    . DC  I 6 123 ? 141.429 134.071 122.278 1.00 198.92 ? 122 DC  J N1    1 
ATOM   8676  C C2    . DC  I 6 123 ? 142.662 133.583 121.877 1.00 198.92 ? 122 DC  J C2    1 
ATOM   8677  O O2    . DC  I 6 123 ? 143.612 133.659 122.649 1.00 198.92 ? 122 DC  J O2    1 
ATOM   8678  N N3    . DC  I 6 123 ? 142.790 133.063 120.645 1.00 198.92 ? 122 DC  J N3    1 
ATOM   8679  C C4    . DC  I 6 123 ? 141.740 132.997 119.838 1.00 198.92 ? 122 DC  J C4    1 
ATOM   8680  N N4    . DC  I 6 123 ? 141.925 132.467 118.627 1.00 198.92 ? 122 DC  J N4    1 
ATOM   8681  C C5    . DC  I 6 123 ? 140.461 133.482 120.232 1.00 198.92 ? 122 DC  J C5    1 
ATOM   8682  C C6    . DC  I 6 123 ? 140.351 133.990 121.461 1.00 198.92 ? 122 DC  J C6    1 
ATOM   8683  P P     . DA  I 6 124 ? 140.784 137.477 126.671 1.00 192.89 ? 123 DA  J P     1 
ATOM   8684  O OP1   . DA  I 6 124 ? 140.568 137.398 128.128 1.00 192.89 ? 123 DA  J OP1   1 
ATOM   8685  O OP2   . DA  I 6 124 ? 139.867 138.269 125.830 1.00 192.89 ? 123 DA  J OP2   1 
ATOM   8686  O "O5'" . DA  I 6 124 ? 142.267 137.994 126.414 1.00 192.89 ? 123 DA  J "O5'" 1 
ATOM   8687  C "C5'" . DA  I 6 124 ? 143.341 137.347 127.056 1.00 192.89 ? 123 DA  J "C5'" 1 
ATOM   8688  C "C4'" . DA  I 6 124 ? 144.670 137.688 126.408 1.00 192.89 ? 123 DA  J "C4'" 1 
ATOM   8689  O "O4'" . DA  I 6 124 ? 144.800 136.999 125.144 1.00 192.89 ? 123 DA  J "O4'" 1 
ATOM   8690  C "C3'" . DA  I 6 124 ? 144.911 139.162 126.120 1.00 192.89 ? 123 DA  J "C3'" 1 
ATOM   8691  O "O3'" . DA  I 6 124 ? 146.259 139.468 126.437 1.00 192.89 ? 123 DA  J "O3'" 1 
ATOM   8692  C "C2'" . DA  I 6 124 ? 144.641 139.266 124.619 1.00 192.89 ? 123 DA  J "C2'" 1 
ATOM   8693  C "C1'" . DA  I 6 124 ? 145.103 137.914 124.119 1.00 192.89 ? 123 DA  J "C1'" 1 
ATOM   8694  N N9    . DA  I 6 124 ? 144.386 137.472 122.948 1.00 192.89 ? 123 DA  J N9    1 
ATOM   8695  C C8    . DA  I 6 124 ? 143.045 137.537 122.754 1.00 192.89 ? 123 DA  J C8    1 
ATOM   8696  N N7    . DA  I 6 124 ? 142.649 137.022 121.623 1.00 192.89 ? 123 DA  J N7    1 
ATOM   8697  C C5    . DA  I 6 124 ? 143.814 136.584 121.037 1.00 192.89 ? 123 DA  J C5    1 
ATOM   8698  C C6    . DA  I 6 124 ? 144.070 135.949 119.819 1.00 192.89 ? 123 DA  J C6    1 
ATOM   8699  N N6    . DA  I 6 124 ? 143.116 135.646 118.946 1.00 192.89 ? 123 DA  J N6    1 
ATOM   8700  N N1    . DA  I 6 124 ? 145.345 135.644 119.527 1.00 192.89 ? 123 DA  J N1    1 
ATOM   8701  C C2    . DA  I 6 124 ? 146.303 135.968 120.400 1.00 192.89 ? 123 DA  J C2    1 
ATOM   8702  N N3    . DA  I 6 124 ? 146.181 136.562 121.585 1.00 192.89 ? 123 DA  J N3    1 
ATOM   8703  C C4    . DA  I 6 124 ? 144.897 136.840 121.846 1.00 192.89 ? 123 DA  J C4    1 
ATOM   8704  P P     . DC  I 6 125 ? 146.810 140.977 126.484 1.00 196.61 ? 124 DC  J P     1 
ATOM   8705  O OP1   . DC  I 6 125 ? 147.365 141.165 127.836 1.00 196.61 ? 124 DC  J OP1   1 
ATOM   8706  O OP2   . DC  I 6 125 ? 145.808 141.934 125.976 1.00 196.61 ? 124 DC  J OP2   1 
ATOM   8707  O "O5'" . DC  I 6 125 ? 148.029 140.918 125.466 1.00 196.61 ? 124 DC  J "O5'" 1 
ATOM   8708  C "C5'" . DC  I 6 125 ? 148.324 139.676 124.868 1.00 196.61 ? 124 DC  J "C5'" 1 
ATOM   8709  C "C4'" . DC  I 6 125 ? 149.498 139.745 123.927 1.00 196.61 ? 124 DC  J "C4'" 1 
ATOM   8710  O "O4'" . DC  I 6 125 ? 149.133 139.122 122.676 1.00 196.61 ? 124 DC  J "O4'" 1 
ATOM   8711  C "C3'" . DC  I 6 125 ? 149.968 141.124 123.551 1.00 196.61 ? 124 DC  J "C3'" 1 
ATOM   8712  O "O3'" . DC  I 6 125 ? 151.286 141.021 123.076 1.00 196.61 ? 124 DC  J "O3'" 1 
ATOM   8713  C "C2'" . DC  I 6 125 ? 149.007 141.451 122.428 1.00 196.61 ? 124 DC  J "C2'" 1 
ATOM   8714  C "C1'" . DC  I 6 125 ? 148.921 140.116 121.702 1.00 196.61 ? 124 DC  J "C1'" 1 
ATOM   8715  N N1    . DC  I 6 125 ? 147.608 139.887 121.083 1.00 196.61 ? 124 DC  J N1    1 
ATOM   8716  C C2    . DC  I 6 125 ? 147.530 139.260 119.849 1.00 196.61 ? 124 DC  J C2    1 
ATOM   8717  O O2    . DC  I 6 125 ? 148.570 138.893 119.302 1.00 196.61 ? 124 DC  J O2    1 
ATOM   8718  N N3    . DC  I 6 125 ? 146.318 139.064 119.289 1.00 196.61 ? 124 DC  J N3    1 
ATOM   8719  C C4    . DC  I 6 125 ? 145.224 139.479 119.915 1.00 196.61 ? 124 DC  J C4    1 
ATOM   8720  N N4    . DC  I 6 125 ? 144.048 139.264 119.327 1.00 196.61 ? 124 DC  J N4    1 
ATOM   8721  C C5    . DC  I 6 125 ? 145.285 140.129 121.174 1.00 196.61 ? 124 DC  J C5    1 
ATOM   8722  C C6    . DC  I 6 125 ? 146.487 140.309 121.715 1.00 196.61 ? 124 DC  J C6    1 
ATOM   8723  P P     . DG  I 6 126 ? 152.241 142.305 122.957 1.00 208.64 ? 125 DG  J P     1 
ATOM   8724  O OP1   . DG  I 6 126 ? 153.213 142.226 124.066 1.00 208.64 ? 125 DG  J OP1   1 
ATOM   8725  O OP2   . DG  I 6 126 ? 151.440 143.532 122.782 1.00 208.64 ? 125 DG  J OP2   1 
ATOM   8726  O "O5'" . DG  I 6 126 ? 152.997 142.035 121.586 1.00 208.64 ? 125 DG  J "O5'" 1 
ATOM   8727  C "C5'" . DG  I 6 126 ? 152.541 140.981 120.764 1.00 208.64 ? 125 DG  J "C5'" 1 
ATOM   8728  C "C4'" . DG  I 6 126 ? 153.195 141.011 119.403 1.00 208.64 ? 125 DG  J "C4'" 1 
ATOM   8729  O "O4'" . DG  I 6 126 ? 152.191 140.767 118.400 1.00 208.64 ? 125 DG  J "O4'" 1 
ATOM   8730  C "C3'" . DG  I 6 126 ? 153.809 142.335 119.007 1.00 208.64 ? 125 DG  J "C3'" 1 
ATOM   8731  O "O3'" . DG  I 6 126 ? 154.770 142.114 117.985 1.00 208.64 ? 125 DG  J "O3'" 1 
ATOM   8732  C "C2'" . DG  I 6 126 ? 152.599 143.097 118.488 1.00 208.64 ? 125 DG  J "C2'" 1 
ATOM   8733  C "C1'" . DG  I 6 126 ? 151.752 141.995 117.860 1.00 208.64 ? 125 DG  J "C1'" 1 
ATOM   8734  N N9    . DG  I 6 126 ? 150.342 142.146 118.154 1.00 208.64 ? 125 DG  J N9    1 
ATOM   8735  C C8    . DG  I 6 126 ? 149.792 142.613 119.311 1.00 208.64 ? 125 DG  J C8    1 
ATOM   8736  N N7    . DG  I 6 126 ? 148.494 142.649 119.291 1.00 208.64 ? 125 DG  J N7    1 
ATOM   8737  C C5    . DG  I 6 126 ? 148.169 142.172 118.039 1.00 208.64 ? 125 DG  J C5    1 
ATOM   8738  C C6    . DG  I 6 126 ? 146.913 141.977 117.446 1.00 208.64 ? 125 DG  J C6    1 
ATOM   8739  O O6    . DG  I 6 126 ? 145.798 142.197 117.926 1.00 208.64 ? 125 DG  J O6    1 
ATOM   8740  N N1    . DG  I 6 126 ? 147.026 141.475 116.163 1.00 208.64 ? 125 DG  J N1    1 
ATOM   8741  C C2    . DG  I 6 126 ? 148.209 141.198 115.533 1.00 208.64 ? 125 DG  J C2    1 
ATOM   8742  N N2    . DG  I 6 126 ? 148.128 140.713 114.292 1.00 208.64 ? 125 DG  J N2    1 
ATOM   8743  N N3    . DG  I 6 126 ? 149.394 141.373 116.082 1.00 208.64 ? 125 DG  J N3    1 
ATOM   8744  C C4    . DG  I 6 126 ? 149.296 141.860 117.329 1.00 208.64 ? 125 DG  J C4    1 
ATOM   8745  P P     . DT  I 6 127 ? 155.475 143.337 117.216 1.00 209.58 ? 126 DT  J P     1 
ATOM   8746  O OP1   . DT  I 6 127 ? 156.792 142.830 116.781 1.00 209.58 ? 126 DT  J OP1   1 
ATOM   8747  O OP2   . DT  I 6 127 ? 155.422 144.568 118.031 1.00 209.58 ? 126 DT  J OP2   1 
ATOM   8748  O "O5'" . DT  I 6 127 ? 154.575 143.521 115.911 1.00 209.58 ? 126 DT  J "O5'" 1 
ATOM   8749  C "C5'" . DT  I 6 127 ? 154.284 142.389 115.114 1.00 209.58 ? 126 DT  J "C5'" 1 
ATOM   8750  C "C4'" . DT  I 6 127 ? 153.454 142.763 113.906 1.00 209.58 ? 126 DT  J "C4'" 1 
ATOM   8751  O "O4'" . DT  I 6 127 ? 152.054 142.814 114.265 1.00 209.58 ? 126 DT  J "O4'" 1 
ATOM   8752  C "C3'" . DT  I 6 127 ? 153.787 144.111 113.280 1.00 209.58 ? 126 DT  J "C3'" 1 
ATOM   8753  O "O3'" . DT  I 6 127 ? 153.903 143.952 111.881 1.00 209.58 ? 126 DT  J "O3'" 1 
ATOM   8754  C "C2'" . DT  I 6 127 ? 152.587 144.979 113.654 1.00 209.58 ? 126 DT  J "C2'" 1 
ATOM   8755  C "C1'" . DT  I 6 127 ? 151.475 143.957 113.701 1.00 209.58 ? 126 DT  J "C1'" 1 
ATOM   8756  N N1    . DT  I 6 127 ? 150.377 144.353 114.564 1.00 209.58 ? 126 DT  J N1    1 
ATOM   8757  C C2    . DT  I 6 127 ? 149.090 144.204 114.127 1.00 209.58 ? 126 DT  J C2    1 
ATOM   8758  O O2    . DT  I 6 127 ? 148.805 143.766 113.032 1.00 209.58 ? 126 DT  J O2    1 
ATOM   8759  N N3    . DT  I 6 127 ? 148.141 144.590 115.025 1.00 209.58 ? 126 DT  J N3    1 
ATOM   8760  C C4    . DT  I 6 127 ? 148.350 145.097 116.287 1.00 209.58 ? 126 DT  J C4    1 
ATOM   8761  O O4    . DT  I 6 127 ? 147.431 145.418 117.026 1.00 209.58 ? 126 DT  J O4    1 
ATOM   8762  C C5    . DT  I 6 127 ? 149.724 145.222 116.679 1.00 209.58 ? 126 DT  J C5    1 
ATOM   8763  C C7    . DT  I 6 127 ? 150.072 145.774 118.026 1.00 209.58 ? 126 DT  J C7    1 
ATOM   8764  C C6    . DT  I 6 127 ? 150.661 144.844 115.810 1.00 209.58 ? 126 DT  J C6    1 
ATOM   8765  P P     . DG  I 6 128 ? 154.287 145.193 110.941 1.00 209.19 ? 127 DG  J P     1 
ATOM   8766  O OP1   . DG  I 6 128 ? 155.055 144.633 109.810 1.00 209.19 ? 127 DG  J OP1   1 
ATOM   8767  O OP2   . DG  I 6 128 ? 154.878 146.275 111.757 1.00 209.19 ? 127 DG  J OP2   1 
ATOM   8768  O "O5'" . DG  I 6 128 ? 152.878 145.681 110.379 1.00 209.19 ? 127 DG  J "O5'" 1 
ATOM   8769  C "C5'" . DG  I 6 128 ? 152.158 144.837 109.505 1.00 209.19 ? 127 DG  J "C5'" 1 
ATOM   8770  C "C4'" . DG  I 6 128 ? 150.809 145.428 109.149 1.00 209.19 ? 127 DG  J "C4'" 1 
ATOM   8771  O "O4'" . DG  I 6 128 ? 149.986 145.537 110.332 1.00 209.19 ? 127 DG  J "O4'" 1 
ATOM   8772  C "C3'" . DG  I 6 128 ? 150.837 146.823 108.528 1.00 209.19 ? 127 DG  J "C3'" 1 
ATOM   8773  O "O3'" . DG  I 6 128 ? 149.870 146.868 107.503 1.00 209.19 ? 127 DG  J "O3'" 1 
ATOM   8774  C "C2'" . DG  I 6 128 ? 150.435 147.715 109.699 1.00 209.19 ? 127 DG  J "C2'" 1 
ATOM   8775  C "C1'" . DG  I 6 128 ? 149.424 146.824 110.379 1.00 209.19 ? 127 DG  J "C1'" 1 
ATOM   8776  N N9    . DG  I 6 128 ? 149.179 147.146 111.768 1.00 209.19 ? 127 DG  J N9    1 
ATOM   8777  C C8    . DG  I 6 128 ? 150.109 147.299 112.760 1.00 209.19 ? 127 DG  J C8    1 
ATOM   8778  N N7    . DG  I 6 128 ? 149.584 147.544 113.925 1.00 209.19 ? 127 DG  J N7    1 
ATOM   8779  C C5    . DG  I 6 128 ? 148.221 147.539 113.684 1.00 209.19 ? 127 DG  J C5    1 
ATOM   8780  C C6    . DG  I 6 128 ? 147.148 147.743 114.565 1.00 209.19 ? 127 DG  J C6    1 
ATOM   8781  O O6    . DG  I 6 128 ? 147.188 147.983 115.774 1.00 209.19 ? 127 DG  J O6    1 
ATOM   8782  N N1    . DG  I 6 128 ? 145.925 147.657 113.913 1.00 209.19 ? 127 DG  J N1    1 
ATOM   8783  C C2    . DG  I 6 128 ? 145.763 147.397 112.577 1.00 209.19 ? 127 DG  J C2    1 
ATOM   8784  N N2    . DG  I 6 128 ? 144.504 147.339 112.125 1.00 209.19 ? 127 DG  J N2    1 
ATOM   8785  N N3    . DG  I 6 128 ? 146.765 147.199 111.742 1.00 209.19 ? 127 DG  J N3    1 
ATOM   8786  C C4    . DG  I 6 128 ? 147.959 147.284 112.364 1.00 209.19 ? 127 DG  J C4    1 
ATOM   8787  P P     . DT  I 6 129 ? 149.940 147.958 106.328 1.00 210.19 ? 128 DT  J P     1 
ATOM   8788  O OP1   . DT  I 6 129 ? 150.421 147.257 105.122 1.00 210.19 ? 128 DT  J OP1   1 
ATOM   8789  O OP2   . DT  I 6 129 ? 150.641 149.171 106.801 1.00 210.19 ? 128 DT  J OP2   1 
ATOM   8790  O "O5'" . DT  I 6 129 ? 148.407 148.333 106.117 1.00 210.19 ? 128 DT  J "O5'" 1 
ATOM   8791  C "C5'" . DT  I 6 129 ? 147.452 147.877 107.059 1.00 210.19 ? 128 DT  J "C5'" 1 
ATOM   8792  C "C4'" . DT  I 6 129 ? 146.277 148.823 107.139 1.00 210.19 ? 128 DT  J "C4'" 1 
ATOM   8793  O "O4'" . DT  I 6 129 ? 145.964 149.085 108.534 1.00 210.19 ? 128 DT  J "O4'" 1 
ATOM   8794  C "C3'" . DT  I 6 129 ? 146.518 150.198 106.541 1.00 210.19 ? 128 DT  J "C3'" 1 
ATOM   8795  O "O3'" . DT  I 6 129 ? 145.267 150.776 106.235 1.00 210.19 ? 128 DT  J "O3'" 1 
ATOM   8796  C "C2'" . DT  I 6 129 ? 147.154 150.904 107.720 1.00 210.19 ? 128 DT  J "C2'" 1 
ATOM   8797  C "C1'" . DT  I 6 129 ? 146.196 150.453 108.804 1.00 210.19 ? 128 DT  J "C1'" 1 
ATOM   8798  N N1    . DT  I 6 129 ? 146.711 150.580 110.183 1.00 210.19 ? 128 DT  J N1    1 
ATOM   8799  C C2    . DT  I 6 129 ? 145.814 150.668 111.212 1.00 210.19 ? 128 DT  J C2    1 
ATOM   8800  O O2    . DT  I 6 129 ? 144.610 150.659 111.047 1.00 210.19 ? 128 DT  J O2    1 
ATOM   8801  N N3    . DT  I 6 129 ? 146.369 150.768 112.448 1.00 210.19 ? 128 DT  J N3    1 
ATOM   8802  C C4    . DT  I 6 129 ? 147.707 150.787 112.757 1.00 210.19 ? 128 DT  J C4    1 
ATOM   8803  O O4    . DT  I 6 129 ? 148.107 150.883 113.908 1.00 210.19 ? 128 DT  J O4    1 
ATOM   8804  C C5    . DT  I 6 129 ? 148.600 150.691 111.634 1.00 210.19 ? 128 DT  J C5    1 
ATOM   8805  C C7    . DT  I 6 129 ? 150.079 150.707 111.851 1.00 210.19 ? 128 DT  J C7    1 
ATOM   8806  C C6    . DT  I 6 129 ? 148.066 150.591 110.412 1.00 210.19 ? 128 DT  J C6    1 
ATOM   8807  P P     . DC  I 6 130 ? 145.130 151.894 105.094 1.00 206.79 ? 129 DC  J P     1 
ATOM   8808  O OP1   . DC  I 6 130 ? 145.469 151.259 103.804 1.00 206.79 ? 129 DC  J OP1   1 
ATOM   8809  O OP2   . DC  I 6 130 ? 145.868 153.093 105.541 1.00 206.79 ? 129 DC  J OP2   1 
ATOM   8810  O "O5'" . DC  I 6 130 ? 143.570 152.246 105.112 1.00 206.79 ? 129 DC  J "O5'" 1 
ATOM   8811  C "C5'" . DC  I 6 130 ? 142.723 151.662 106.104 1.00 206.79 ? 129 DC  J "C5'" 1 
ATOM   8812  C "C4'" . DC  I 6 130 ? 142.113 152.712 107.027 1.00 206.79 ? 129 DC  J "C4'" 1 
ATOM   8813  O "O4'" . DC  I 6 130 ? 142.868 152.787 108.264 1.00 206.79 ? 129 DC  J "O4'" 1 
ATOM   8814  C "C3'" . DC  I 6 130 ? 142.075 154.141 106.492 1.00 206.79 ? 129 DC  J "C3'" 1 
ATOM   8815  O "O3'" . DC  I 6 130 ? 140.932 154.785 107.000 1.00 206.79 ? 129 DC  J "O3'" 1 
ATOM   8816  C "C2'" . DC  I 6 130 ? 143.326 154.738 107.110 1.00 206.79 ? 129 DC  J "C2'" 1 
ATOM   8817  C "C1'" . DC  I 6 130 ? 143.234 154.130 108.490 1.00 206.79 ? 129 DC  J "C1'" 1 
ATOM   8818  N N1    . DC  I 6 130 ? 144.497 154.142 109.242 1.00 206.79 ? 129 DC  J N1    1 
ATOM   8819  C C2    . DC  I 6 130 ? 144.460 154.219 110.629 1.00 206.79 ? 129 DC  J C2    1 
ATOM   8820  O O2    . DC  I 6 130 ? 143.369 154.286 111.193 1.00 206.79 ? 129 DC  J O2    1 
ATOM   8821  N N3    . DC  I 6 130 ? 145.619 154.214 111.314 1.00 206.79 ? 129 DC  J N3    1 
ATOM   8822  C C4    . DC  I 6 130 ? 146.773 154.137 110.662 1.00 206.79 ? 129 DC  J C4    1 
ATOM   8823  N N4    . DC  I 6 130 ? 147.897 154.138 111.377 1.00 206.79 ? 129 DC  J N4    1 
ATOM   8824  C C5    . DC  I 6 130 ? 146.832 154.064 109.247 1.00 206.79 ? 129 DC  J C5    1 
ATOM   8825  C C6    . DC  I 6 130 ? 145.679 154.063 108.583 1.00 206.79 ? 129 DC  J C6    1 
ATOM   8826  P P     . DA  I 6 131 ? 139.657 155.030 106.062 1.00 201.50 ? 130 DA  J P     1 
ATOM   8827  O OP1   . DA  I 6 131 ? 138.952 153.739 105.928 1.00 201.50 ? 130 DA  J OP1   1 
ATOM   8828  O OP2   . DA  I 6 131 ? 140.141 155.730 104.854 1.00 201.50 ? 130 DA  J OP2   1 
ATOM   8829  O "O5'" . DA  I 6 131 ? 138.753 156.058 106.897 1.00 201.50 ? 130 DA  J "O5'" 1 
ATOM   8830  C "C5'" . DA  I 6 131 ? 138.009 155.619 108.054 1.00 201.50 ? 130 DA  J "C5'" 1 
ATOM   8831  C "C4'" . DA  I 6 131 ? 138.122 156.587 109.241 1.00 201.50 ? 130 DA  J "C4'" 1 
ATOM   8832  O "O4'" . DA  I 6 131 ? 139.491 156.664 109.697 1.00 201.50 ? 130 DA  J "O4'" 1 
ATOM   8833  C "C3'" . DA  I 6 131 ? 137.705 158.036 108.999 1.00 201.50 ? 130 DA  J "C3'" 1 
ATOM   8834  O "O3'" . DA  I 6 131 ? 137.243 158.591 110.220 1.00 201.50 ? 130 DA  J "O3'" 1 
ATOM   8835  C "C2'" . DA  I 6 131 ? 139.028 158.672 108.620 1.00 201.50 ? 130 DA  J "C2'" 1 
ATOM   8836  C "C1'" . DA  I 6 131 ? 139.922 158.006 109.644 1.00 201.50 ? 130 DA  J "C1'" 1 
ATOM   8837  N N9    . DA  I 6 131 ? 141.324 157.986 109.302 1.00 201.50 ? 130 DA  J N9    1 
ATOM   8838  C C8    . DA  I 6 131 ? 141.874 157.916 108.060 1.00 201.50 ? 130 DA  J C8    1 
ATOM   8839  N N7    . DA  I 6 131 ? 143.183 157.879 108.070 1.00 201.50 ? 130 DA  J N7    1 
ATOM   8840  C C5    . DA  I 6 131 ? 143.499 157.893 109.410 1.00 201.50 ? 130 DA  J C5    1 
ATOM   8841  C C6    . DA  I 6 131 ? 144.721 157.866 110.095 1.00 201.50 ? 130 DA  J C6    1 
ATOM   8842  N N6    . DA  I 6 131 ? 145.902 157.805 109.482 1.00 201.50 ? 130 DA  J N6    1 
ATOM   8843  N N1    . DA  I 6 131 ? 144.683 157.902 111.442 1.00 201.50 ? 130 DA  J N1    1 
ATOM   8844  C C2    . DA  I 6 131 ? 143.500 157.962 112.051 1.00 201.50 ? 130 DA  J C2    1 
ATOM   8845  N N3    . DA  I 6 131 ? 142.290 157.994 111.511 1.00 201.50 ? 130 DA  J N3    1 
ATOM   8846  C C4    . DA  I 6 131 ? 142.363 157.955 110.178 1.00 201.50 ? 130 DA  J C4    1 
ATOM   8847  P P     . DG  I 6 132 ? 135.674 158.688 110.538 1.00 201.28 ? 131 DG  J P     1 
ATOM   8848  O OP1   . DG  I 6 132 ? 135.151 157.309 110.638 1.00 201.28 ? 131 DG  J OP1   1 
ATOM   8849  O OP2   . DG  I 6 132 ? 135.093 159.634 109.564 1.00 201.28 ? 131 DG  J OP2   1 
ATOM   8850  O "O5'" . DG  I 6 132 ? 135.611 159.380 111.981 1.00 201.28 ? 131 DG  J "O5'" 1 
ATOM   8851  C "C5'" . DG  I 6 132 ? 136.361 158.842 113.074 1.00 201.28 ? 131 DG  J "C5'" 1 
ATOM   8852  C "C4'" . DG  I 6 132 ? 137.001 159.929 113.944 1.00 201.28 ? 131 DG  J "C4'" 1 
ATOM   8853  O "O4'" . DG  I 6 132 ? 138.370 160.146 113.536 1.00 201.28 ? 131 DG  J "O4'" 1 
ATOM   8854  C "C3'" . DG  I 6 132 ? 136.350 161.312 113.926 1.00 201.28 ? 131 DG  J "C3'" 1 
ATOM   8855  O "O3'" . DG  I 6 132 ? 136.591 161.957 115.169 1.00 201.28 ? 131 DG  J "O3'" 1 
ATOM   8856  C "C2'" . DG  I 6 132 ? 137.147 162.010 112.830 1.00 201.28 ? 131 DG  J "C2'" 1 
ATOM   8857  C "C1'" . DG  I 6 132 ? 138.539 161.490 113.141 1.00 201.28 ? 131 DG  J "C1'" 1 
ATOM   8858  N N9    . DG  I 6 132 ? 139.440 161.489 112.015 1.00 201.28 ? 131 DG  J N9    1 
ATOM   8859  C C8    . DG  I 6 132 ? 139.114 161.506 110.691 1.00 201.28 ? 131 DG  J C8    1 
ATOM   8860  N N7    . DG  I 6 132 ? 140.151 161.462 109.908 1.00 201.28 ? 131 DG  J N7    1 
ATOM   8861  C C5    . DG  I 6 132 ? 141.221 161.382 110.772 1.00 201.28 ? 131 DG  J C5    1 
ATOM   8862  C C6    . DG  I 6 132 ? 142.595 161.306 110.502 1.00 201.28 ? 131 DG  J C6    1 
ATOM   8863  O O6    . DG  I 6 132 ? 143.161 161.280 109.407 1.00 201.28 ? 131 DG  J O6    1 
ATOM   8864  N N1    . DG  I 6 132 ? 143.340 161.255 111.667 1.00 201.28 ? 131 DG  J N1    1 
ATOM   8865  C C2    . DG  I 6 132 ? 142.820 161.276 112.931 1.00 201.28 ? 131 DG  J C2    1 
ATOM   8866  N N2    . DG  I 6 132 ? 143.695 161.216 113.937 1.00 201.28 ? 131 DG  J N2    1 
ATOM   8867  N N3    . DG  I 6 132 ? 141.533 161.348 113.195 1.00 201.28 ? 131 DG  J N3    1 
ATOM   8868  C C4    . DG  I 6 132 ? 140.798 161.397 112.070 1.00 201.28 ? 131 DG  J C4    1 
ATOM   8869  P P     . DA  I 6 133 ? 135.596 161.812 116.422 1.00 197.72 ? 132 DA  J P     1 
ATOM   8870  O OP1   . DA  I 6 133 ? 134.979 160.472 116.452 1.00 197.72 ? 132 DA  J OP1   1 
ATOM   8871  O OP2   . DA  I 6 133 ? 134.738 163.011 116.429 1.00 197.72 ? 132 DA  J OP2   1 
ATOM   8872  O "O5'" . DA  I 6 133 ? 136.588 161.933 117.662 1.00 197.72 ? 132 DA  J "O5'" 1 
ATOM   8873  C "C5'" . DA  I 6 133 ? 137.936 161.553 117.481 1.00 197.72 ? 132 DA  J "C5'" 1 
ATOM   8874  C "C4'" . DA  I 6 133 ? 138.847 162.125 118.552 1.00 197.72 ? 132 DA  J "C4'" 1 
ATOM   8875  O "O4'" . DA  I 6 133 ? 139.993 162.724 117.927 1.00 197.72 ? 132 DA  J "O4'" 1 
ATOM   8876  C "C3'" . DA  I 6 133 ? 138.279 163.232 119.406 1.00 197.72 ? 132 DA  J "C3'" 1 
ATOM   8877  O "O3'" . DA  I 6 133 ? 139.048 163.293 120.608 1.00 197.72 ? 132 DA  J "O3'" 1 
ATOM   8878  C "C2'" . DA  I 6 133 ? 138.489 164.456 118.514 1.00 197.72 ? 132 DA  J "C2'" 1 
ATOM   8879  C "C1'" . DA  I 6 133 ? 139.748 164.099 117.726 1.00 197.72 ? 132 DA  J "C1'" 1 
ATOM   8880  N N9    . DA  I 6 133 ? 139.608 164.317 116.300 1.00 197.72 ? 132 DA  J N9    1 
ATOM   8881  C C8    . DA  I 6 133 ? 138.447 164.476 115.610 1.00 197.72 ? 132 DA  J C8    1 
ATOM   8882  N N7    . DA  I 6 133 ? 138.616 164.627 114.325 1.00 197.72 ? 132 DA  J N7    1 
ATOM   8883  C C5    . DA  I 6 133 ? 139.982 164.545 114.160 1.00 197.72 ? 132 DA  J C5    1 
ATOM   8884  C C6    . DA  I 6 133 ? 140.801 164.621 113.026 1.00 197.72 ? 132 DA  J C6    1 
ATOM   8885  N N6    . DA  I 6 133 ? 140.327 164.801 111.792 1.00 197.72 ? 132 DA  J N6    1 
ATOM   8886  N N1    . DA  I 6 133 ? 142.129 164.505 113.205 1.00 197.72 ? 132 DA  J N1    1 
ATOM   8887  C C2    . DA  I 6 133 ? 142.600 164.328 114.442 1.00 197.72 ? 132 DA  J C2    1 
ATOM   8888  N N3    . DA  I 6 133 ? 141.925 164.237 115.583 1.00 197.72 ? 132 DA  J N3    1 
ATOM   8889  C C4    . DA  I 6 133 ? 140.609 164.354 115.369 1.00 197.72 ? 132 DA  J C4    1 
ATOM   8890  P P     . DT  I 6 134 ? 139.011 164.554 121.601 1.00 198.00 ? 133 DT  J P     1 
ATOM   8891  O OP1   . DT  I 6 134 ? 139.411 164.037 122.921 1.00 198.00 ? 133 DT  J OP1   1 
ATOM   8892  O OP2   . DT  I 6 134 ? 137.724 165.276 121.510 1.00 198.00 ? 133 DT  J OP2   1 
ATOM   8893  O "O5'" . DT  I 6 134 ? 140.217 165.462 121.085 1.00 198.00 ? 133 DT  J "O5'" 1 
ATOM   8894  C "C5'" . DT  I 6 134 ? 141.510 164.878 120.913 1.00 198.00 ? 133 DT  J "C5'" 1 
ATOM   8895  C "C4'" . DT  I 6 134 ? 142.501 165.823 120.232 1.00 198.00 ? 133 DT  J "C4'" 1 
ATOM   8896  O "O4'" . DT  I 6 134 ? 142.235 165.923 118.805 1.00 198.00 ? 133 DT  J "O4'" 1 
ATOM   8897  C "C3'" . DT  I 6 134 ? 142.524 167.265 120.733 1.00 198.00 ? 133 DT  J "C3'" 1 
ATOM   8898  O "O3'" . DT  I 6 134 ? 143.838 167.755 120.610 1.00 198.00 ? 133 DT  J "O3'" 1 
ATOM   8899  C "C2'" . DT  I 6 134 ? 141.647 167.945 119.699 1.00 198.00 ? 133 DT  J "C2'" 1 
ATOM   8900  C "C1'" . DT  I 6 134 ? 142.224 167.287 118.470 1.00 198.00 ? 133 DT  J "C1'" 1 
ATOM   8901  N N1    . DT  I 6 134 ? 141.451 167.491 117.230 1.00 198.00 ? 133 DT  J N1    1 
ATOM   8902  C C2    . DT  I 6 134 ? 142.120 167.584 116.038 1.00 198.00 ? 133 DT  J C2    1 
ATOM   8903  O O2    . DT  I 6 134 ? 143.328 167.503 115.944 1.00 198.00 ? 133 DT  J O2    1 
ATOM   8904  N N3    . DT  I 6 134 ? 141.323 167.769 114.951 1.00 198.00 ? 133 DT  J N3    1 
ATOM   8905  C C4    . DT  I 6 134 ? 139.953 167.878 114.935 1.00 198.00 ? 133 DT  J C4    1 
ATOM   8906  O O4    . DT  I 6 134 ? 139.322 168.048 113.899 1.00 198.00 ? 133 DT  J O4    1 
ATOM   8907  C C5    . DT  I 6 134 ? 139.312 167.777 116.219 1.00 198.00 ? 133 DT  J C5    1 
ATOM   8908  C C7    . DT  I 6 134 ? 137.822 167.882 116.328 1.00 198.00 ? 133 DT  J C7    1 
ATOM   8909  C C6    . DT  I 6 134 ? 140.086 167.602 117.293 1.00 198.00 ? 133 DT  J C6    1 
ATOM   8910  P P     . DA  I 6 135 ? 144.860 167.753 121.845 1.00 215.51 ? 134 DA  J P     1 
ATOM   8911  O OP1   . DA  I 6 135 ? 145.138 166.348 122.204 1.00 215.51 ? 134 DA  J OP1   1 
ATOM   8912  O OP2   . DA  I 6 135 ? 144.350 168.692 122.864 1.00 215.51 ? 134 DA  J OP2   1 
ATOM   8913  O "O5'" . DA  I 6 135 ? 146.186 168.378 121.213 1.00 215.51 ? 134 DA  J "O5'" 1 
ATOM   8914  C "C5'" . DA  I 6 135 ? 146.825 167.712 120.135 1.00 215.51 ? 134 DA  J "C5'" 1 
ATOM   8915  C "C4'" . DA  I 6 135 ? 147.442 168.692 119.145 1.00 215.51 ? 134 DA  J "C4'" 1 
ATOM   8916  O "O4'" . DA  I 6 135 ? 146.509 168.981 118.075 1.00 215.51 ? 134 DA  J "O4'" 1 
ATOM   8917  C "C3'" . DA  I 6 135 ? 147.873 170.036 119.713 1.00 215.51 ? 134 DA  J "C3'" 1 
ATOM   8918  O "O3'" . DA  I 6 135 ? 149.118 170.395 119.130 1.00 215.51 ? 134 DA  J "O3'" 1 
ATOM   8919  C "C2'" . DA  I 6 135 ? 146.741 170.975 119.288 1.00 215.51 ? 134 DA  J "C2'" 1 
ATOM   8920  C "C1'" . DA  I 6 135 ? 146.292 170.371 117.971 1.00 215.51 ? 134 DA  J "C1'" 1 
ATOM   8921  N N9    . DA  I 6 135 ? 144.880 170.556 117.715 1.00 215.51 ? 134 DA  J N9    1 
ATOM   8922  C C8    . DA  I 6 135 ? 143.870 170.428 118.611 1.00 215.51 ? 134 DA  J C8    1 
ATOM   8923  N N7    . DA  I 6 135 ? 142.684 170.633 118.101 1.00 215.51 ? 134 DA  J N7    1 
ATOM   8924  C C5    . DA  I 6 135 ? 142.933 170.865 116.774 1.00 215.51 ? 134 DA  J C5    1 
ATOM   8925  C C6    . DA  I 6 135 ? 142.089 171.137 115.695 1.00 215.51 ? 134 DA  J C6    1 
ATOM   8926  N N6    . DA  I 6 135 ? 140.763 171.210 115.802 1.00 215.51 ? 134 DA  J N6    1 
ATOM   8927  N N1    . DA  I 6 135 ? 142.659 171.334 114.497 1.00 215.51 ? 134 DA  J N1    1 
ATOM   8928  C C2    . DA  I 6 135 ? 143.988 171.275 114.398 1.00 215.51 ? 134 DA  J C2    1 
ATOM   8929  N N3    . DA  I 6 135 ? 144.883 171.012 115.339 1.00 215.51 ? 134 DA  J N3    1 
ATOM   8930  C C4    . DA  I 6 135 ? 144.284 170.822 116.515 1.00 215.51 ? 134 DA  J C4    1 
ATOM   8931  P P     . DT  I 6 136 ? 149.818 171.805 119.446 1.00 232.16 ? 135 DT  J P     1 
ATOM   8932  O OP1   . DT  I 6 136 ? 151.273 171.599 119.291 1.00 232.16 ? 135 DT  J OP1   1 
ATOM   8933  O OP2   . DT  I 6 136 ? 149.300 172.352 120.718 1.00 232.16 ? 135 DT  J OP2   1 
ATOM   8934  O "O5'" . DT  I 6 136 ? 149.333 172.726 118.240 1.00 232.16 ? 135 DT  J "O5'" 1 
ATOM   8935  C "C5'" . DT  I 6 136 ? 149.384 172.212 116.925 1.00 232.16 ? 135 DT  J "C5'" 1 
ATOM   8936  C "C4'" . DT  I 6 136 ? 148.971 173.261 115.921 1.00 232.16 ? 135 DT  J "C4'" 1 
ATOM   8937  O "O4'" . DT  I 6 136 ? 147.549 173.184 115.691 1.00 232.16 ? 135 DT  J "O4'" 1 
ATOM   8938  C "C3'" . DT  I 6 136 ? 149.267 174.700 116.338 1.00 232.16 ? 135 DT  J "C3'" 1 
ATOM   8939  O "O3'" . DT  I 6 136 ? 150.042 175.321 115.325 1.00 232.16 ? 135 DT  J "O3'" 1 
ATOM   8940  C "C2'" . DT  I 6 136 ? 147.878 175.335 116.488 1.00 232.16 ? 135 DT  J "C2'" 1 
ATOM   8941  C "C1'" . DT  I 6 136 ? 147.034 174.480 115.568 1.00 232.16 ? 135 DT  J "C1'" 1 
ATOM   8942  N N1    . DT  I 6 136 ? 145.624 174.425 115.955 1.00 232.16 ? 135 DT  J N1    1 
ATOM   8943  C C2    . DT  I 6 136 ? 144.663 174.610 115.000 1.00 232.16 ? 135 DT  J C2    1 
ATOM   8944  O O2    . DT  I 6 136 ? 144.916 174.848 113.836 1.00 232.16 ? 135 DT  J O2    1 
ATOM   8945  N N3    . DT  I 6 136 ? 143.385 174.520 115.458 1.00 232.16 ? 135 DT  J N3    1 
ATOM   8946  C C4    . DT  I 6 136 ? 142.981 174.258 116.747 1.00 232.16 ? 135 DT  J C4    1 
ATOM   8947  O O4    . DT  I 6 136 ? 141.801 174.198 117.061 1.00 232.16 ? 135 DT  J O4    1 
ATOM   8948  C C5    . DT  I 6 136 ? 144.041 174.068 117.699 1.00 232.16 ? 135 DT  J C5    1 
ATOM   8949  C C7    . DT  I 6 136 ? 143.721 173.793 119.134 1.00 232.16 ? 135 DT  J C7    1 
ATOM   8950  C C6    . DT  I 6 136 ? 145.299 174.155 117.261 1.00 232.16 ? 135 DT  J C6    1 
ATOM   8951  P P     . DA  I 6 137 ? 150.483 176.860 115.434 1.00 246.69 ? 136 DA  J P     1 
ATOM   8952  O OP1   . DA  I 6 137 ? 151.764 176.979 114.708 1.00 246.69 ? 136 DA  J OP1   1 
ATOM   8953  O OP2   . DA  I 6 137 ? 150.411 177.322 116.838 1.00 246.69 ? 136 DA  J OP2   1 
ATOM   8954  O "O5'" . DA  I 6 137 ? 149.366 177.608 114.584 1.00 246.69 ? 136 DA  J "O5'" 1 
ATOM   8955  C "C5'" . DA  I 6 137 ? 148.956 177.053 113.348 1.00 246.69 ? 136 DA  J "C5'" 1 
ATOM   8956  C "C4'" . DA  I 6 137 ? 148.082 178.025 112.595 1.00 246.69 ? 136 DA  J "C4'" 1 
ATOM   8957  O "O4'" . DA  I 6 137 ? 146.693 177.695 112.816 1.00 246.69 ? 136 DA  J "O4'" 1 
ATOM   8958  C "C3'" . DA  I 6 137 ? 148.266 179.479 113.001 1.00 246.69 ? 136 DA  J "C3'" 1 
ATOM   8959  O "O3'" . DA  I 6 137 ? 148.385 180.287 111.848 1.00 246.69 ? 136 DA  J "O3'" 1 
ATOM   8960  C "C2'" . DA  I 6 137 ? 147.013 179.810 113.812 1.00 246.69 ? 136 DA  J "C2'" 1 
ATOM   8961  C "C1'" . DA  I 6 137 ? 145.988 178.805 113.313 1.00 246.69 ? 136 DA  J "C1'" 1 
ATOM   8962  N N9    . DA  I 6 137 ? 145.118 178.329 114.370 1.00 246.69 ? 136 DA  J N9    1 
ATOM   8963  C C8    . DA  I 6 137 ? 145.500 177.841 115.584 1.00 246.69 ? 136 DA  J C8    1 
ATOM   8964  N N7    . DA  I 6 137 ? 144.500 177.485 116.348 1.00 246.69 ? 136 DA  J N7    1 
ATOM   8965  C C5    . DA  I 6 137 ? 143.389 177.740 115.571 1.00 246.69 ? 136 DA  J C5    1 
ATOM   8966  C C6    . DA  I 6 137 ? 142.018 177.569 115.800 1.00 246.69 ? 136 DA  J C6    1 
ATOM   8967  N N6    . DA  I 6 137 ? 141.519 177.079 116.936 1.00 246.69 ? 136 DA  J N6    1 
ATOM   8968  N N1    . DA  I 6 137 ? 141.172 177.927 114.819 1.00 246.69 ? 136 DA  J N1    1 
ATOM   8969  C C2    . DA  I 6 137 ? 141.668 178.421 113.682 1.00 246.69 ? 136 DA  J C2    1 
ATOM   8970  N N3    . DA  I 6 137 ? 142.937 178.626 113.351 1.00 246.69 ? 136 DA  J N3    1 
ATOM   8971  C C4    . DA  I 6 137 ? 143.753 178.261 114.349 1.00 246.69 ? 136 DA  J C4    1 
ATOM   8972  P P     . DT  I 6 138 ? 148.779 181.838 111.980 1.00 261.55 ? 137 DT  J P     1 
ATOM   8973  O OP1   . DT  I 6 138 ? 149.592 182.188 110.796 1.00 261.55 ? 137 DT  J OP1   1 
ATOM   8974  O OP2   . DT  I 6 138 ? 149.317 182.090 113.335 1.00 261.55 ? 137 DT  J OP2   1 
ATOM   8975  O "O5'" . DT  I 6 138 ? 147.374 182.572 111.851 1.00 261.55 ? 137 DT  J "O5'" 1 
ATOM   8976  C "C5'" . DT  I 6 138 ? 146.474 182.153 110.847 1.00 261.55 ? 137 DT  J "C5'" 1 
ATOM   8977  C "C4'" . DT  I 6 138 ? 145.117 182.779 111.056 1.00 261.55 ? 137 DT  J "C4'" 1 
ATOM   8978  O "O4'" . DT  I 6 138 ? 144.370 182.018 112.032 1.00 261.55 ? 137 DT  J "O4'" 1 
ATOM   8979  C "C3'" . DT  I 6 138 ? 145.147 184.221 111.565 1.00 261.55 ? 137 DT  J "C3'" 1 
ATOM   8980  O "O3'" . DT  I 6 138 ? 144.434 185.046 110.654 1.00 261.55 ? 137 DT  J "O3'" 1 
ATOM   8981  C "C2'" . DT  I 6 138 ? 144.467 184.138 112.940 1.00 261.55 ? 137 DT  J "C2'" 1 
ATOM   8982  C "C1'" . DT  I 6 138 ? 143.599 182.908 112.787 1.00 261.55 ? 137 DT  J "C1'" 1 
ATOM   8983  N N1    . DT  I 6 138 ? 143.273 182.261 114.065 1.00 261.55 ? 137 DT  J N1    1 
ATOM   8984  C C2    . DT  I 6 138 ? 141.964 182.009 114.372 1.00 261.55 ? 137 DT  J C2    1 
ATOM   8985  O O2    . DT  I 6 138 ? 141.038 182.294 113.638 1.00 261.55 ? 137 DT  J O2    1 
ATOM   8986  N N3    . DT  I 6 138 ? 141.772 181.405 115.577 1.00 261.55 ? 137 DT  J N3    1 
ATOM   8987  C C4    . DT  I 6 138 ? 142.736 181.032 116.483 1.00 261.55 ? 137 DT  J C4    1 
ATOM   8988  O O4    . DT  I 6 138 ? 142.461 180.497 117.546 1.00 261.55 ? 137 DT  J O4    1 
ATOM   8989  C C5    . DT  I 6 138 ? 144.088 181.330 116.100 1.00 261.55 ? 137 DT  J C5    1 
ATOM   8990  C C7    . DT  I 6 138 ? 145.221 180.982 117.012 1.00 261.55 ? 137 DT  J C7    1 
ATOM   8991  C C6    . DT  I 6 138 ? 144.290 181.922 114.921 1.00 261.55 ? 137 DT  J C6    1 
ATOM   8992  P P     . DA  I 6 139 ? 144.182 186.605 110.949 1.00 268.94 ? 138 DA  J P     1 
ATOM   8993  O OP1   . DA  I 6 139 ? 144.072 187.262 109.630 1.00 268.94 ? 138 DA  J OP1   1 
ATOM   8994  O OP2   . DA  I 6 139 ? 145.172 187.116 111.923 1.00 268.94 ? 138 DA  J OP2   1 
ATOM   8995  O "O5'" . DA  I 6 139 ? 142.734 186.614 111.614 1.00 268.94 ? 138 DA  J "O5'" 1 
ATOM   8996  C "C5'" . DA  I 6 139 ? 141.719 185.786 111.070 1.00 268.94 ? 138 DA  J "C5'" 1 
ATOM   8997  C "C4'" . DA  I 6 139 ? 140.354 186.165 111.603 1.00 268.94 ? 138 DA  J "C4'" 1 
ATOM   8998  O "O4'" . DA  I 6 139 ? 140.023 185.337 112.739 1.00 268.94 ? 138 DA  J "O4'" 1 
ATOM   8999  C "C3'" . DA  I 6 139 ? 140.208 187.609 112.054 1.00 268.94 ? 138 DA  J "C3'" 1 
ATOM   9000  O "O3'" . DA  I 6 139 ? 138.947 188.103 111.639 1.00 268.94 ? 138 DA  J "O3'" 1 
ATOM   9001  C "C2'" . DA  I 6 139 ? 140.326 187.533 113.579 1.00 268.94 ? 138 DA  J "C2'" 1 
ATOM   9002  C "C1'" . DA  I 6 139 ? 139.863 186.119 113.901 1.00 268.94 ? 138 DA  J "C1'" 1 
ATOM   9003  N N9    . DA  I 6 139 ? 140.637 185.491 114.958 1.00 268.94 ? 138 DA  J N9    1 
ATOM   9004  C C8    . DA  I 6 139 ? 141.996 185.451 115.072 1.00 268.94 ? 138 DA  J C8    1 
ATOM   9005  N N7    . DA  I 6 139 ? 142.420 184.794 116.123 1.00 268.94 ? 138 DA  J N7    1 
ATOM   9006  C C5    . DA  I 6 139 ? 141.258 184.374 116.735 1.00 268.94 ? 138 DA  J C5    1 
ATOM   9007  C C6    . DA  I 6 139 ? 141.015 183.626 117.898 1.00 268.94 ? 138 DA  J C6    1 
ATOM   9008  N N6    . DA  I 6 139 ? 141.983 183.156 118.689 1.00 268.94 ? 138 DA  J N6    1 
ATOM   9009  N N1    . DA  I 6 139 ? 139.731 183.383 118.223 1.00 268.94 ? 138 DA  J N1    1 
ATOM   9010  C C2    . DA  I 6 139 ? 138.761 183.854 117.436 1.00 268.94 ? 138 DA  J C2    1 
ATOM   9011  N N3    . DA  I 6 139 ? 138.865 184.566 116.324 1.00 268.94 ? 138 DA  J N3    1 
ATOM   9012  C C4    . DA  I 6 139 ? 140.150 184.789 116.024 1.00 268.94 ? 138 DA  J C4    1 
ATOM   9013  P P     . DC  I 6 140 ? 138.517 189.623 111.924 1.00 270.51 ? 139 DC  J P     1 
ATOM   9014  O OP1   . DC  I 6 140 ? 137.653 190.041 110.801 1.00 270.51 ? 139 DC  J OP1   1 
ATOM   9015  O OP2   . DC  I 6 140 ? 139.709 190.432 112.262 1.00 270.51 ? 139 DC  J OP2   1 
ATOM   9016  O "O5'" . DC  I 6 140 ? 137.604 189.494 113.220 1.00 270.51 ? 139 DC  J "O5'" 1 
ATOM   9017  C "C5'" . DC  I 6 140 ? 136.676 188.426 113.311 1.00 270.51 ? 139 DC  J "C5'" 1 
ATOM   9018  C "C4'" . DC  I 6 140 ? 136.044 188.367 114.685 1.00 270.51 ? 139 DC  J "C4'" 1 
ATOM   9019  O "O4'" . DC  I 6 140 ? 136.873 187.580 115.582 1.00 270.51 ? 139 DC  J "O4'" 1 
ATOM   9020  C "C3'" . DC  I 6 140 ? 135.857 189.719 115.375 1.00 270.51 ? 139 DC  J "C3'" 1 
ATOM   9021  O "O3'" . DC  I 6 140 ? 134.605 189.729 116.028 1.00 270.51 ? 139 DC  J "O3'" 1 
ATOM   9022  C "C2'" . DC  I 6 140 ? 136.997 189.728 116.387 1.00 270.51 ? 139 DC  J "C2'" 1 
ATOM   9023  C "C1'" . DC  I 6 140 ? 136.979 188.277 116.797 1.00 270.51 ? 139 DC  J "C1'" 1 
ATOM   9024  N N1    . DC  I 6 140 ? 138.188 187.833 117.508 1.00 270.51 ? 139 DC  J N1    1 
ATOM   9025  C C2    . DC  I 6 140 ? 138.050 187.103 118.686 1.00 270.51 ? 139 DC  J C2    1 
ATOM   9026  O O2    . DC  I 6 140 ? 136.913 186.851 119.099 1.00 270.51 ? 139 DC  J O2    1 
ATOM   9027  N N3    . DC  I 6 140 ? 139.160 186.696 119.335 1.00 270.51 ? 139 DC  J N3    1 
ATOM   9028  C C4    . DC  I 6 140 ? 140.360 186.996 118.845 1.00 270.51 ? 139 DC  J C4    1 
ATOM   9029  N N4    . DC  I 6 140 ? 141.430 186.575 119.516 1.00 270.51 ? 139 DC  J N4    1 
ATOM   9030  C C5    . DC  I 6 140 ? 140.520 187.745 117.646 1.00 270.51 ? 139 DC  J C5    1 
ATOM   9031  C C6    . DC  I 6 140 ? 139.416 188.138 117.016 1.00 270.51 ? 139 DC  J C6    1 
ATOM   9032  P P     . DA  I 6 141 ? 133.850 191.110 116.341 1.00 273.88 ? 140 DA  J P     1 
ATOM   9033  O OP1   . DA  I 6 141 ? 132.798 191.273 115.316 1.00 273.88 ? 140 DA  J OP1   1 
ATOM   9034  O OP2   . DA  I 6 141 ? 134.851 192.178 116.544 1.00 273.88 ? 140 DA  J OP2   1 
ATOM   9035  O "O5'" . DA  I 6 141 ? 133.144 190.833 117.745 1.00 273.88 ? 140 DA  J "O5'" 1 
ATOM   9036  C "C5'" . DA  I 6 141 ? 132.083 189.890 117.829 1.00 273.88 ? 140 DA  J "C5'" 1 
ATOM   9037  C "C4'" . DA  I 6 141 ? 132.104 189.135 119.151 1.00 273.88 ? 140 DA  J "C4'" 1 
ATOM   9038  O "O4'" . DA  I 6 141 ? 133.453 188.710 119.466 1.00 273.88 ? 140 DA  J "O4'" 1 
ATOM   9039  C "C3'" . DA  I 6 141 ? 131.630 189.912 120.369 1.00 273.88 ? 140 DA  J "C3'" 1 
ATOM   9040  O "O3'" . DA  I 6 141 ? 131.026 189.005 121.263 1.00 273.88 ? 140 DA  J "O3'" 1 
ATOM   9041  C "C2'" . DA  I 6 141 ? 132.938 190.463 120.936 1.00 273.88 ? 140 DA  J "C2'" 1 
ATOM   9042  C "C1'" . DA  I 6 141 ? 133.874 189.296 120.685 1.00 273.88 ? 140 DA  J "C1'" 1 
ATOM   9043  N N9    . DA  I 6 141 ? 135.271 189.656 120.521 1.00 273.88 ? 140 DA  J N9    1 
ATOM   9044  C C8    . DA  I 6 141 ? 135.802 190.472 119.569 1.00 273.88 ? 140 DA  J C8    1 
ATOM   9045  N N7    . DA  I 6 141 ? 137.109 190.568 119.626 1.00 273.88 ? 140 DA  J N7    1 
ATOM   9046  C C5    . DA  I 6 141 ? 137.453 189.742 120.675 1.00 273.88 ? 140 DA  J C5    1 
ATOM   9047  C C6    . DA  I 6 141 ? 138.690 189.400 121.251 1.00 273.88 ? 140 DA  J C6    1 
ATOM   9048  N N6    . DA  I 6 141 ? 139.859 189.878 120.824 1.00 273.88 ? 140 DA  J N6    1 
ATOM   9049  N N1    . DA  I 6 141 ? 138.678 188.547 122.292 1.00 273.88 ? 140 DA  J N1    1 
ATOM   9050  C C2    . DA  I 6 141 ? 137.509 188.080 122.720 1.00 273.88 ? 140 DA  J C2    1 
ATOM   9051  N N3    . DA  I 6 141 ? 136.289 188.317 122.258 1.00 273.88 ? 140 DA  J N3    1 
ATOM   9052  C C4    . DA  I 6 141 ? 136.331 189.165 121.229 1.00 273.88 ? 140 DA  J C4    1 
ATOM   9053  P P     . DT  I 6 142 ? 130.043 189.510 122.425 1.00 279.94 ? 141 DT  J P     1 
ATOM   9054  O OP1   . DT  I 6 142 ? 128.709 188.950 122.126 1.00 279.94 ? 141 DT  J OP1   1 
ATOM   9055  O OP2   . DT  I 6 142 ? 130.199 190.968 122.618 1.00 279.94 ? 141 DT  J OP2   1 
ATOM   9056  O "O5'" . DT  I 6 142 ? 130.622 188.782 123.720 1.00 279.94 ? 141 DT  J "O5'" 1 
ATOM   9057  C "C5'" . DT  I 6 142 ? 131.897 188.159 123.660 1.00 279.94 ? 141 DT  J "C5'" 1 
ATOM   9058  C "C4'" . DT  I 6 142 ? 132.490 188.038 125.042 1.00 279.94 ? 141 DT  J "C4'" 1 
ATOM   9059  O "O4'" . DT  I 6 142 ? 133.921 188.279 124.981 1.00 279.94 ? 141 DT  J "O4'" 1 
ATOM   9060  C "C3'" . DT  I 6 142 ? 131.955 189.044 126.043 1.00 279.94 ? 141 DT  J "C3'" 1 
ATOM   9061  O "O3'" . DT  I 6 142 ? 132.016 188.486 127.331 1.00 279.94 ? 141 DT  J "O3'" 1 
ATOM   9062  C "C2'" . DT  I 6 142 ? 132.939 190.192 125.889 1.00 279.94 ? 141 DT  J "C2'" 1 
ATOM   9063  C "C1'" . DT  I 6 142 ? 134.240 189.418 125.752 1.00 279.94 ? 141 DT  J "C1'" 1 
ATOM   9064  N N1    . DT  I 6 142 ? 135.319 190.161 125.053 1.00 279.94 ? 141 DT  J N1    1 
ATOM   9065  C C2    . DT  I 6 142 ? 136.630 189.927 125.398 1.00 279.94 ? 141 DT  J C2    1 
ATOM   9066  O O2    . DT  I 6 142 ? 136.965 189.143 126.265 1.00 279.94 ? 141 DT  J O2    1 
ATOM   9067  N N3    . DT  I 6 142 ? 137.543 190.641 124.679 1.00 279.94 ? 141 DT  J N3    1 
ATOM   9068  C C4    . DT  I 6 142 ? 137.286 191.542 123.674 1.00 279.94 ? 141 DT  J C4    1 
ATOM   9069  O O4    . DT  I 6 142 ? 138.175 192.138 123.085 1.00 279.94 ? 141 DT  J O4    1 
ATOM   9070  C C5    . DT  I 6 142 ? 135.896 191.743 123.365 1.00 279.94 ? 141 DT  J C5    1 
ATOM   9071  C C7    . DT  I 6 142 ? 135.501 192.711 122.295 1.00 279.94 ? 141 DT  J C7    1 
ATOM   9072  C C6    . DT  I 6 142 ? 134.989 191.049 124.058 1.00 279.94 ? 141 DT  J C6    1 
ATOM   9073  P P     . DC  I 6 143 ? 130.777 188.637 128.337 1.00 283.15 ? 142 DC  J P     1 
ATOM   9074  O OP1   . DC  I 6 143 ? 130.147 187.308 128.491 1.00 283.15 ? 142 DC  J OP1   1 
ATOM   9075  O OP2   . DC  I 6 143 ? 129.975 189.795 127.884 1.00 283.15 ? 142 DC  J OP2   1 
ATOM   9076  O "O5'" . DC  I 6 143 ? 131.478 189.036 129.708 1.00 283.15 ? 142 DC  J "O5'" 1 
ATOM   9077  C "C5'" . DC  I 6 143 ? 132.640 189.826 129.671 1.00 283.15 ? 142 DC  J "C5'" 1 
ATOM   9078  C "C4'" . DC  I 6 143 ? 133.848 189.042 130.137 1.00 283.15 ? 142 DC  J "C4'" 1 
ATOM   9079  O "O4'" . DC  I 6 143 ? 134.969 189.316 129.257 1.00 283.15 ? 142 DC  J "O4'" 1 
ATOM   9080  C "C3'" . DC  I 6 143 ? 134.359 189.467 131.484 1.00 283.15 ? 142 DC  J "C3'" 1 
ATOM   9081  O "O3'" . DC  I 6 143 ? 135.309 188.520 131.938 1.00 283.15 ? 142 DC  J "O3'" 1 
ATOM   9082  C "C2'" . DC  I 6 143 ? 135.035 190.763 131.088 1.00 283.15 ? 142 DC  J "C2'" 1 
ATOM   9083  C "C1'" . DC  I 6 143 ? 135.808 190.287 129.870 1.00 283.15 ? 142 DC  J "C1'" 1 
ATOM   9084  N N1    . DC  I 6 143 ? 136.116 191.331 128.844 1.00 283.15 ? 142 DC  J N1    1 
ATOM   9085  C C2    . DC  I 6 143 ? 137.444 191.646 128.543 1.00 283.15 ? 142 DC  J C2    1 
ATOM   9086  O O2    . DC  I 6 143 ? 138.350 191.108 129.179 1.00 283.15 ? 142 DC  J O2    1 
ATOM   9087  N N3    . DC  I 6 143 ? 137.698 192.554 127.569 1.00 283.15 ? 142 DC  J N3    1 
ATOM   9088  C C4    . DC  I 6 143 ? 136.692 193.119 126.906 1.00 283.15 ? 142 DC  J C4    1 
ATOM   9089  N N4    . DC  I 6 143 ? 136.985 194.008 125.952 1.00 283.15 ? 142 DC  J N4    1 
ATOM   9090  C C5    . DC  I 6 143 ? 135.339 192.797 127.187 1.00 283.15 ? 142 DC  J C5    1 
ATOM   9091  C C6    . DC  I 6 143 ? 135.102 191.909 128.152 1.00 283.15 ? 142 DC  J C6    1 
ATOM   9092  P P     . DC  I 6 144 ? 135.363 188.099 133.486 1.00 287.61 ? 143 DC  J P     1 
ATOM   9093  O OP1   . DC  I 6 144 ? 135.269 186.626 133.560 1.00 287.61 ? 143 DC  J OP1   1 
ATOM   9094  O OP2   . DC  I 6 144 ? 134.395 188.949 134.213 1.00 287.61 ? 143 DC  J OP2   1 
ATOM   9095  O "O5'" . DC  I 6 144 ? 136.824 188.540 133.945 1.00 287.61 ? 143 DC  J "O5'" 1 
ATOM   9096  C "C5'" . DC  I 6 144 ? 137.151 189.906 133.971 1.00 287.61 ? 143 DC  J "C5'" 1 
ATOM   9097  C "C4'" . DC  I 6 144 ? 138.626 190.108 134.216 1.00 287.61 ? 143 DC  J "C4'" 1 
ATOM   9098  O "O4'" . DC  I 6 144 ? 139.176 190.903 133.140 1.00 287.61 ? 143 DC  J "O4'" 1 
ATOM   9099  C "C3'" . DC  I 6 144 ? 138.936 190.916 135.446 1.00 287.61 ? 143 DC  J "C3'" 1 
ATOM   9100  O "O3'" . DC  I 6 144 ? 140.311 190.790 135.747 1.00 287.61 ? 143 DC  J "O3'" 1 
ATOM   9101  C "C2'" . DC  I 6 144 ? 138.612 192.308 134.938 1.00 287.61 ? 143 DC  J "C2'" 1 
ATOM   9102  C "C1'" . DC  I 6 144 ? 139.263 192.256 133.558 1.00 287.61 ? 143 DC  J "C1'" 1 
ATOM   9103  N N1    . DC  I 6 144 ? 138.608 193.100 132.515 1.00 287.61 ? 143 DC  J N1    1 
ATOM   9104  C C2    . DC  I 6 144 ? 139.399 193.831 131.633 1.00 287.61 ? 143 DC  J C2    1 
ATOM   9105  O O2    . DC  I 6 144 ? 140.623 193.787 131.757 1.00 287.61 ? 143 DC  J O2    1 
ATOM   9106  N N3    . DC  I 6 144 ? 138.801 194.567 130.665 1.00 287.61 ? 143 DC  J N3    1 
ATOM   9107  C C4    . DC  I 6 144 ? 137.476 194.581 130.565 1.00 287.61 ? 143 DC  J C4    1 
ATOM   9108  N N4    . DC  I 6 144 ? 136.925 195.322 129.600 1.00 287.61 ? 143 DC  J N4    1 
ATOM   9109  C C5    . DC  I 6 144 ? 136.655 193.843 131.455 1.00 287.61 ? 143 DC  J C5    1 
ATOM   9110  C C6    . DC  I 6 144 ? 137.257 193.113 132.397 1.00 287.61 ? 143 DC  J C6    1 
ATOM   9111  P P     . DT  I 6 145 ? 140.818 190.849 137.268 1.00 293.42 ? 144 DT  J P     1 
ATOM   9112  O OP1   . DT  I 6 145 ? 141.381 189.528 137.617 1.00 293.42 ? 144 DT  J OP1   1 
ATOM   9113  O OP2   . DT  I 6 145 ? 139.727 191.436 138.073 1.00 293.42 ? 144 DT  J OP2   1 
ATOM   9114  O "O5'" . DT  I 6 145 ? 142.007 191.905 137.221 1.00 293.42 ? 144 DT  J "O5'" 1 
ATOM   9115  C "C5'" . DT  I 6 145 ? 141.778 193.163 136.647 1.00 293.42 ? 144 DT  J "C5'" 1 
ATOM   9116  C "C4'" . DT  I 6 145 ? 143.072 193.798 136.209 1.00 293.42 ? 144 DT  J "C4'" 1 
ATOM   9117  O "O4'" . DT  I 6 145 ? 142.853 194.475 134.953 1.00 293.42 ? 144 DT  J "O4'" 1 
ATOM   9118  C "C3'" . DT  I 6 145 ? 143.563 194.893 137.116 1.00 293.42 ? 144 DT  J "C3'" 1 
ATOM   9119  O "O3'" . DT  I 6 145 ? 144.884 195.214 136.747 1.00 293.42 ? 144 DT  J "O3'" 1 
ATOM   9120  C "C2'" . DT  I 6 145 ? 142.607 196.000 136.717 1.00 293.42 ? 144 DT  J "C2'" 1 
ATOM   9121  C "C1'" . DT  I 6 145 ? 142.679 195.859 135.202 1.00 293.42 ? 144 DT  J "C1'" 1 
ATOM   9122  N N1    . DT  I 6 145 ? 141.477 196.310 134.450 1.00 293.42 ? 144 DT  J N1    1 
ATOM   9123  C C2    . DT  I 6 145 ? 141.654 197.090 133.334 1.00 293.42 ? 144 DT  J C2    1 
ATOM   9124  O O2    . DT  I 6 145 ? 142.744 197.470 132.956 1.00 293.42 ? 144 DT  J O2    1 
ATOM   9125  N N3    . DT  I 6 145 ? 140.508 197.425 132.679 1.00 293.42 ? 144 DT  J N3    1 
ATOM   9126  C C4    . DT  I 6 145 ? 139.225 197.046 133.008 1.00 293.42 ? 144 DT  J C4    1 
ATOM   9127  O O4    . DT  I 6 145 ? 138.251 197.400 132.360 1.00 293.42 ? 144 DT  J O4    1 
ATOM   9128  C C5    . DT  I 6 145 ? 139.103 196.228 134.179 1.00 293.42 ? 144 DT  J C5    1 
ATOM   9129  C C7    . DT  I 6 145 ? 137.748 195.790 134.632 1.00 293.42 ? 144 DT  J C7    1 
ATOM   9130  C C6    . DT  I 6 145 ? 140.223 195.890 134.835 1.00 293.42 ? 144 DT  J C6    1 
ATOM   9131  P P     . DG  I 6 146 ? 145.875 195.921 137.786 1.00 309.08 ? 145 DG  J P     1 
ATOM   9132  O OP1   . DG  I 6 146 ? 147.222 195.350 137.584 1.00 309.08 ? 145 DG  J OP1   1 
ATOM   9133  O OP2   . DG  I 6 146 ? 145.228 195.865 139.112 1.00 309.08 ? 145 DG  J OP2   1 
ATOM   9134  O "O5'" . DG  I 6 146 ? 145.903 197.440 137.306 1.00 309.08 ? 145 DG  J "O5'" 1 
ATOM   9135  C "C5'" . DG  I 6 146 ? 145.809 197.744 135.921 1.00 309.08 ? 145 DG  J "C5'" 1 
ATOM   9136  C "C4'" . DG  I 6 146 ? 145.772 199.244 135.680 1.00 309.08 ? 145 DG  J "C4'" 1 
ATOM   9137  O "O4'" . DG  I 6 146 ? 144.543 199.610 134.996 1.00 309.08 ? 145 DG  J "O4'" 1 
ATOM   9138  C "C3'" . DG  I 6 146 ? 145.796 200.112 136.923 1.00 309.08 ? 145 DG  J "C3'" 1 
ATOM   9139  O "O3'" . DG  I 6 146 ? 146.336 201.352 136.575 1.00 309.08 ? 145 DG  J "O3'" 1 
ATOM   9140  C "C2'" . DG  I 6 146 ? 144.314 200.246 137.225 1.00 309.08 ? 145 DG  J "C2'" 1 
ATOM   9141  C "C1'" . DG  I 6 146 ? 143.783 200.475 135.823 1.00 309.08 ? 145 DG  J "C1'" 1 
ATOM   9142  N N9    . DG  I 6 146 ? 142.378 200.133 135.654 1.00 309.08 ? 145 DG  J N9    1 
ATOM   9143  C C8    . DG  I 6 146 ? 141.635 199.282 136.426 1.00 309.08 ? 145 DG  J C8    1 
ATOM   9144  N N7    . DG  I 6 146 ? 140.413 199.127 136.005 1.00 309.08 ? 145 DG  J N7    1 
ATOM   9145  C C5    . DG  I 6 146 ? 140.342 199.931 134.880 1.00 309.08 ? 145 DG  J C5    1 
ATOM   9146  C C6    . DG  I 6 146 ? 139.263 200.179 134.010 1.00 309.08 ? 145 DG  J C6    1 
ATOM   9147  O O6    . DG  I 6 146 ? 138.118 199.717 134.061 1.00 309.08 ? 145 DG  J O6    1 
ATOM   9148  N N1    . DG  I 6 146 ? 139.613 201.055 132.993 1.00 309.08 ? 145 DG  J N1    1 
ATOM   9149  C C2    . DG  I 6 146 ? 140.848 201.632 132.845 1.00 309.08 ? 145 DG  J C2    1 
ATOM   9150  N N2    . DG  I 6 146 ? 140.998 202.459 131.804 1.00 309.08 ? 145 DG  J N2    1 
ATOM   9151  N N3    . DG  I 6 146 ? 141.869 201.412 133.656 1.00 309.08 ? 145 DG  J N3    1 
ATOM   9152  C C4    . DG  I 6 146 ? 141.545 200.552 134.647 1.00 309.08 ? 145 DG  J C4    1 
ATOM   9153  P P     . DT  I 6 147 ? 147.168 202.214 137.636 1.00 354.40 ? 146 DT  J P     1 
ATOM   9154  O OP1   . DT  I 6 147 ? 148.461 201.533 137.865 1.00 354.40 ? 146 DT  J OP1   1 
ATOM   9155  O OP2   . DT  I 6 147 ? 146.268 202.507 138.773 1.00 354.40 ? 146 DT  J OP2   1 
ATOM   9156  O "O5'" . DT  I 6 147 ? 147.452 203.568 136.843 1.00 354.40 ? 146 DT  J "O5'" 1 
ATOM   9157  C "C5'" . DT  I 6 147 ? 146.903 203.743 135.544 1.00 354.40 ? 146 DT  J "C5'" 1 
ATOM   9158  C "C4'" . DT  I 6 147 ? 145.802 204.779 135.570 1.00 354.40 ? 146 DT  J "C4'" 1 
ATOM   9159  O "O4'" . DT  I 6 147 ? 144.503 204.139 135.468 1.00 354.40 ? 146 DT  J "O4'" 1 
ATOM   9160  C "C3'" . DT  I 6 147 ? 145.751 205.627 136.851 1.00 354.40 ? 146 DT  J "C3'" 1 
ATOM   9161  O "O3'" . DT  I 6 147 ? 145.555 206.986 136.514 1.00 354.40 ? 146 DT  J "O3'" 1 
ATOM   9162  C "C2'" . DT  I 6 147 ? 144.522 205.070 137.564 1.00 354.40 ? 146 DT  J "C2'" 1 
ATOM   9163  C "C1'" . DT  I 6 147 ? 143.649 204.793 136.362 1.00 354.40 ? 146 DT  J "C1'" 1 
ATOM   9164  N N1    . DT  I 6 147 ? 142.454 203.955 136.630 1.00 354.40 ? 146 DT  J N1    1 
ATOM   9165  C C2    . DT  I 6 147 ? 141.395 204.023 135.766 1.00 354.40 ? 146 DT  J C2    1 
ATOM   9166  O O2    . DT  I 6 147 ? 141.385 204.734 134.782 1.00 354.40 ? 146 DT  J O2    1 
ATOM   9167  N N3    . DT  I 6 147 ? 140.342 203.218 136.086 1.00 354.40 ? 146 DT  J N3    1 
ATOM   9168  C C4    . DT  I 6 147 ? 140.237 202.376 137.167 1.00 354.40 ? 146 DT  J C4    1 
ATOM   9169  O O4    . DT  I 6 147 ? 139.243 201.689 137.365 1.00 354.40 ? 146 DT  J O4    1 
ATOM   9170  C C5    . DT  I 6 147 ? 141.380 202.355 138.040 1.00 354.40 ? 146 DT  J C5    1 
ATOM   9171  C C7    . DT  I 6 147 ? 141.383 201.474 139.251 1.00 354.40 ? 146 DT  J C7    1 
ATOM   9172  C C6    . DT  I 6 147 ? 142.415 203.153 137.743 1.00 354.40 ? 146 DT  J C6    1 
ATOM   9173  P P     . DG  I 6 148 ? 146.798 207.956 136.203 1.00 413.79 ? 147 DG  J P     1 
ATOM   9174  O OP1   . DG  I 6 148 ? 148.008 207.162 135.899 1.00 413.79 ? 147 DG  J OP1   1 
ATOM   9175  O OP2   . DG  I 6 148 ? 146.840 208.954 137.291 1.00 413.79 ? 147 DG  J OP2   1 
ATOM   9176  O "O5'" . DG  I 6 148 ? 146.332 208.714 134.881 1.00 413.79 ? 147 DG  J "O5'" 1 
ATOM   9177  C "C5'" . DG  I 6 148 ? 145.265 208.178 134.116 1.00 413.79 ? 147 DG  J "C5'" 1 
ATOM   9178  C "C4'" . DG  I 6 148 ? 144.293 209.263 133.702 1.00 413.79 ? 147 DG  J "C4'" 1 
ATOM   9179  O "O4'" . DG  I 6 148 ? 142.940 208.856 134.021 1.00 413.79 ? 147 DG  J "O4'" 1 
ATOM   9180  C "C3'" . DG  I 6 148 ? 144.479 210.596 134.391 1.00 413.79 ? 147 DG  J "C3'" 1 
ATOM   9181  O "O3'" . DG  I 6 148 ? 144.009 211.620 133.531 1.00 413.79 ? 147 DG  J "O3'" 1 
ATOM   9182  C "C2'" . DG  I 6 148 ? 143.609 210.441 135.637 1.00 413.79 ? 147 DG  J "C2'" 1 
ATOM   9183  C "C1'" . DG  I 6 148 ? 142.449 209.599 135.123 1.00 413.79 ? 147 DG  J "C1'" 1 
ATOM   9184  N N9    . DG  I 6 148 ? 141.945 208.647 136.102 1.00 413.79 ? 147 DG  J N9    1 
ATOM   9185  C C8    . DG  I 6 148 ? 142.659 208.064 137.112 1.00 413.79 ? 147 DG  J C8    1 
ATOM   9186  N N7    . DG  I 6 148 ? 141.962 207.226 137.823 1.00 413.79 ? 147 DG  J N7    1 
ATOM   9187  C C5    . DG  I 6 148 ? 140.714 207.227 137.228 1.00 413.79 ? 147 DG  J C5    1 
ATOM   9188  C C6    . DG  I 6 148 ? 139.551 206.510 137.571 1.00 413.79 ? 147 DG  J C6    1 
ATOM   9189  O O6    . DG  I 6 148 ? 139.406 205.692 138.482 1.00 413.79 ? 147 DG  J O6    1 
ATOM   9190  N N1    . DG  I 6 148 ? 138.490 206.812 136.731 1.00 413.79 ? 147 DG  J N1    1 
ATOM   9191  C C2    . DG  I 6 148 ? 138.543 207.706 135.690 1.00 413.79 ? 147 DG  J C2    1 
ATOM   9192  N N2    . DG  I 6 148 ? 137.413 207.864 134.984 1.00 413.79 ? 147 DG  J N2    1 
ATOM   9193  N N3    . DG  I 6 148 ? 139.634 208.390 135.355 1.00 413.79 ? 147 DG  J N3    1 
ATOM   9194  C C4    . DG  I 6 148 ? 140.678 208.103 136.170 1.00 413.79 ? 147 DG  J C4    1 
ATOM   9195  P P     . DC  I 6 149 ? 144.044 213.167 133.962 1.00 456.47 ? 148 DC  J P     1 
ATOM   9196  O OP1   . DC  I 6 149 ? 144.349 213.925 132.731 1.00 456.47 ? 148 DC  J OP1   1 
ATOM   9197  O OP2   . DC  I 6 149 ? 144.889 213.368 135.159 1.00 456.47 ? 148 DC  J OP2   1 
ATOM   9198  O "O5'" . DC  I 6 149 ? 142.528 213.461 134.347 1.00 456.47 ? 148 DC  J "O5'" 1 
ATOM   9199  C "C5'" . DC  I 6 149 ? 141.506 213.082 133.444 1.00 456.47 ? 148 DC  J "C5'" 1 
ATOM   9200  C "C4'" . DC  I 6 149 ? 140.164 213.020 134.138 1.00 456.47 ? 148 DC  J "C4'" 1 
ATOM   9201  O "O4'" . DC  I 6 149 ? 140.115 211.873 135.025 1.00 456.47 ? 148 DC  J "O4'" 1 
ATOM   9202  C "C3'" . DC  I 6 149 ? 139.827 214.236 135.006 1.00 456.47 ? 148 DC  J "C3'" 1 
ATOM   9203  O "O3'" . DC  I 6 149 ? 138.488 214.613 134.782 1.00 456.47 ? 148 DC  J "O3'" 1 
ATOM   9204  C "C2'" . DC  I 6 149 ? 140.002 213.694 136.418 1.00 456.47 ? 148 DC  J "C2'" 1 
ATOM   9205  C "C1'" . DC  I 6 149 ? 139.500 212.284 136.208 1.00 456.47 ? 148 DC  J "C1'" 1 
ATOM   9206  N N1    . DC  I 6 149 ? 139.826 211.355 137.316 1.00 456.47 ? 148 DC  J N1    1 
ATOM   9207  C C2    . DC  I 6 149 ? 138.852 210.462 137.764 1.00 456.47 ? 148 DC  J C2    1 
ATOM   9208  O O2    . DC  I 6 149 ? 137.755 210.447 137.199 1.00 456.47 ? 148 DC  J O2    1 
ATOM   9209  N N3    . DC  I 6 149 ? 139.148 209.632 138.791 1.00 456.47 ? 148 DC  J N3    1 
ATOM   9210  C C4    . DC  I 6 149 ? 140.348 209.690 139.368 1.00 456.47 ? 148 DC  J C4    1 
ATOM   9211  N N4    . DC  I 6 149 ? 140.601 208.851 140.375 1.00 456.47 ? 148 DC  J N4    1 
ATOM   9212  C C5    . DC  I 6 149 ? 141.349 210.603 138.930 1.00 456.47 ? 148 DC  J C5    1 
ATOM   9213  C C6    . DC  I 6 149 ? 141.042 211.416 137.918 1.00 456.47 ? 148 DC  J C6    1 
ATOM   9214  P P     . DA  I 6 150 ? 138.141 215.822 133.787 1.00 514.70 ? 149 DA  J P     1 
ATOM   9215  O OP1   . DA  I 6 150 ? 138.702 215.502 132.456 1.00 514.70 ? 149 DA  J OP1   1 
ATOM   9216  O OP2   . DA  I 6 150 ? 138.530 217.075 134.468 1.00 514.70 ? 149 DA  J OP2   1 
ATOM   9217  O "O5'" . DA  I 6 150 ? 136.546 215.781 133.696 1.00 514.70 ? 149 DA  J "O5'" 1 
ATOM   9218  C "C5'" . DA  I 6 150 ? 135.882 214.540 133.496 1.00 514.70 ? 149 DA  J "C5'" 1 
ATOM   9219  C "C4'" . DA  I 6 150 ? 134.619 214.458 134.336 1.00 514.70 ? 149 DA  J "C4'" 1 
ATOM   9220  O "O4'" . DA  I 6 150 ? 134.793 213.460 135.382 1.00 514.70 ? 149 DA  J "O4'" 1 
ATOM   9221  C "C3'" . DA  I 6 150 ? 134.228 215.753 135.046 1.00 514.70 ? 149 DA  J "C3'" 1 
ATOM   9222  O "O3'" . DA  I 6 150 ? 132.809 215.911 135.025 1.00 514.70 ? 149 DA  J "O3'" 1 
ATOM   9223  C "C2'" . DA  I 6 150 ? 134.754 215.531 136.457 1.00 514.70 ? 149 DA  J "C2'" 1 
ATOM   9224  C "C1'" . DA  I 6 150 ? 134.542 214.040 136.643 1.00 514.70 ? 149 DA  J "C1'" 1 
ATOM   9225  N N9    . DA  I 6 150 ? 135.475 213.476 137.603 1.00 514.70 ? 149 DA  J N9    1 
ATOM   9226  C C8    . DA  I 6 150 ? 136.780 213.817 137.728 1.00 514.70 ? 149 DA  J C8    1 
ATOM   9227  N N7    . DA  I 6 150 ? 137.411 213.178 138.670 1.00 514.70 ? 149 DA  J N7    1 
ATOM   9228  C C5    . DA  I 6 150 ? 136.453 212.352 139.210 1.00 514.70 ? 149 DA  J C5    1 
ATOM   9229  C C6    . DA  I 6 150 ? 136.511 211.417 140.246 1.00 514.70 ? 149 DA  J C6    1 
ATOM   9230  N N6    . DA  I 6 150 ? 137.626 211.175 140.930 1.00 514.70 ? 149 DA  J N6    1 
ATOM   9231  N N1    . DA  I 6 150 ? 135.383 210.748 140.558 1.00 514.70 ? 149 DA  J N1    1 
ATOM   9232  C C2    . DA  I 6 150 ? 134.265 211.001 139.858 1.00 514.70 ? 149 DA  J C2    1 
ATOM   9233  N N3    . DA  I 6 150 ? 134.092 211.870 138.850 1.00 514.70 ? 149 DA  J N3    1 
ATOM   9234  C C4    . DA  I 6 150 ? 135.242 212.517 138.573 1.00 514.70 ? 149 DA  J C4    1 
ATOM   9235  P P     . DT  I 6 151 ? 132.086 217.097 135.841 1.00 562.52 ? 150 DT  J P     1 
ATOM   9236  O OP1   . DT  I 6 151 ? 130.831 217.390 135.117 1.00 562.52 ? 150 DT  J OP1   1 
ATOM   9237  O OP2   . DT  I 6 151 ? 133.026 218.212 136.095 1.00 562.52 ? 150 DT  J OP2   1 
ATOM   9238  O "O5'" . DT  I 6 151 ? 131.696 216.410 137.231 1.00 562.52 ? 150 DT  J "O5'" 1 
ATOM   9239  C "C5'" . DT  I 6 151 ? 130.803 215.299 137.235 1.00 562.52 ? 150 DT  J "C5'" 1 
ATOM   9240  C "C4'" . DT  I 6 151 ? 130.850 214.530 138.548 1.00 562.52 ? 150 DT  J "C4'" 1 
ATOM   9241  O "O4'" . DT  I 6 151 ? 132.224 214.229 138.915 1.00 562.52 ? 150 DT  J "O4'" 1 
ATOM   9242  C "C3'" . DT  I 6 151 ? 130.260 215.250 139.770 1.00 562.52 ? 150 DT  J "C3'" 1 
ATOM   9243  O "O3'" . DT  I 6 151 ? 129.665 214.282 140.643 1.00 562.52 ? 150 DT  J "O3'" 1 
ATOM   9244  C "C2'" . DT  I 6 151 ? 131.519 215.807 140.412 1.00 562.52 ? 150 DT  J "C2'" 1 
ATOM   9245  C "C1'" . DT  I 6 151 ? 132.367 214.568 140.264 1.00 562.52 ? 150 DT  J "C1'" 1 
ATOM   9246  N N1    . DT  I 6 151 ? 133.802 214.701 140.623 1.00 562.52 ? 150 DT  J N1    1 
ATOM   9247  C C2    . DT  I 6 151 ? 134.291 213.880 141.596 1.00 562.52 ? 150 DT  J C2    1 
ATOM   9248  O O2    . DT  I 6 151 ? 133.605 213.057 142.169 1.00 562.52 ? 150 DT  J O2    1 
ATOM   9249  N N3    . DT  I 6 151 ? 135.607 214.039 141.881 1.00 562.52 ? 150 DT  J N3    1 
ATOM   9250  C C4    . DT  I 6 151 ? 136.483 214.926 141.301 1.00 562.52 ? 150 DT  J C4    1 
ATOM   9251  O O4    . DT  I 6 151 ? 137.662 214.983 141.635 1.00 562.52 ? 150 DT  J O4    1 
ATOM   9252  C C5    . DT  I 6 151 ? 135.912 215.771 140.273 1.00 562.52 ? 150 DT  J C5    1 
ATOM   9253  C C7    . DT  I 6 151 ? 136.765 216.783 139.564 1.00 562.52 ? 150 DT  J C7    1 
ATOM   9254  C C6    . DT  I 6 151 ? 134.606 215.620 139.989 1.00 562.52 ? 150 DT  J C6    1 
ATOM   9255  P P     . DG  I 6 152 ? 128.173 213.728 140.404 1.00 633.90 ? 151 DG  J P     1 
ATOM   9256  O OP1   . DG  I 6 152 ? 128.171 212.790 139.261 1.00 633.90 ? 151 DG  J OP1   1 
ATOM   9257  O OP2   . DG  I 6 152 ? 127.259 214.890 140.415 1.00 633.90 ? 151 DG  J OP2   1 
ATOM   9258  O "O5'" . DG  I 6 152 ? 127.885 212.861 141.717 1.00 633.90 ? 151 DG  J "O5'" 1 
ATOM   9259  C "C5'" . DG  I 6 152 ? 128.884 211.964 142.210 1.00 633.90 ? 151 DG  J "C5'" 1 
ATOM   9260  C "C4'" . DG  I 6 152 ? 128.680 211.650 143.688 1.00 633.90 ? 151 DG  J "C4'" 1 
ATOM   9261  O "O4'" . DG  I 6 152 ? 129.936 211.831 144.386 1.00 633.90 ? 151 DG  J "O4'" 1 
ATOM   9262  C "C3'" . DG  I 6 152 ? 127.706 212.555 144.422 1.00 633.90 ? 151 DG  J "C3'" 1 
ATOM   9263  O "O3'" . DG  I 6 152 ? 127.245 211.915 145.613 1.00 633.90 ? 151 DG  J "O3'" 1 
ATOM   9264  C "C2'" . DG  I 6 152 ? 128.593 213.737 144.753 1.00 633.90 ? 151 DG  J "C2'" 1 
ATOM   9265  C "C1'" . DG  I 6 152 ? 129.902 213.045 145.119 1.00 633.90 ? 151 DG  J "C1'" 1 
ATOM   9266  N N9    . DG  I 6 152 ? 131.064 213.832 144.750 1.00 633.90 ? 151 DG  J N9    1 
ATOM   9267  C C8    . DG  I 6 152 ? 131.159 214.685 143.687 1.00 633.90 ? 151 DG  J C8    1 
ATOM   9268  N N7    . DG  I 6 152 ? 132.312 215.274 143.594 1.00 633.90 ? 151 DG  J N7    1 
ATOM   9269  C C5    . DG  I 6 152 ? 133.042 214.760 144.647 1.00 633.90 ? 151 DG  J C5    1 
ATOM   9270  C C6    . DG  I 6 152 ? 134.364 215.028 145.035 1.00 633.90 ? 151 DG  J C6    1 
ATOM   9271  O O6    . DG  I 6 152 ? 135.179 215.786 144.496 1.00 633.90 ? 151 DG  J O6    1 
ATOM   9272  N N1    . DG  I 6 152 ? 134.718 214.314 146.172 1.00 633.90 ? 151 DG  J N1    1 
ATOM   9273  C C2    . DG  I 6 152 ? 133.892 213.441 146.844 1.00 633.90 ? 151 DG  J C2    1 
ATOM   9274  N N2    . DG  I 6 152 ? 134.412 212.837 147.919 1.00 633.90 ? 151 DG  J N2    1 
ATOM   9275  N N3    . DG  I 6 152 ? 132.643 213.180 146.485 1.00 633.90 ? 151 DG  J N3    1 
ATOM   9276  C C4    . DG  I 6 152 ? 132.286 213.875 145.380 1.00 633.90 ? 151 DG  J C4    1 
ATOM   9277  P P     . DT  I 6 153 ? 125.886 212.398 146.327 1.00 681.65 ? 152 DT  J P     1 
ATOM   9278  O OP1   . DT  I 6 153 ? 125.568 211.421 147.392 1.00 681.65 ? 152 DT  J OP1   1 
ATOM   9279  O OP2   . DT  I 6 153 ? 124.897 212.659 145.258 1.00 681.65 ? 152 DT  J OP2   1 
ATOM   9280  O "O5'" . DT  I 6 153 ? 126.263 213.806 146.997 1.00 681.65 ? 152 DT  J "O5'" 1 
ATOM   9281  C "C5'" . DT  I 6 153 ? 126.310 213.948 148.419 1.00 681.65 ? 152 DT  J "C5'" 1 
ATOM   9282  C "C4'" . DT  I 6 153 ? 127.668 213.541 148.967 1.00 681.65 ? 152 DT  J "C4'" 1 
ATOM   9283  O "O4'" . DT  I 6 153 ? 128.724 214.000 148.073 1.00 681.65 ? 152 DT  J "O4'" 1 
ATOM   9284  C "C3'" . DT  I 6 153 ? 128.012 214.110 150.351 1.00 681.65 ? 152 DT  J "C3'" 1 
ATOM   9285  O "O3'" . DT  I 6 153 ? 128.560 213.040 151.194 1.00 681.65 ? 152 DT  J "O3'" 1 
ATOM   9286  C "C2'" . DT  I 6 153 ? 129.014 215.213 150.006 1.00 681.65 ? 152 DT  J "C2'" 1 
ATOM   9287  C "C1'" . DT  I 6 153 ? 129.742 214.582 148.850 1.00 681.65 ? 152 DT  J "C1'" 1 
ATOM   9288  N N1    . DT  I 6 153 ? 130.532 215.545 148.013 1.00 681.65 ? 152 DT  J N1    1 
ATOM   9289  C C2    . DT  I 6 153 ? 131.854 215.776 148.326 1.00 681.65 ? 152 DT  J C2    1 
ATOM   9290  O O2    . DT  I 6 153 ? 132.417 215.253 149.271 1.00 681.65 ? 152 DT  J O2    1 
ATOM   9291  N N3    . DT  I 6 153 ? 132.496 216.655 147.491 1.00 681.65 ? 152 DT  J N3    1 
ATOM   9292  C C4    . DT  I 6 153 ? 131.958 217.314 146.401 1.00 681.65 ? 152 DT  J C4    1 
ATOM   9293  O O4    . DT  I 6 153 ? 132.617 218.082 145.707 1.00 681.65 ? 152 DT  J O4    1 
ATOM   9294  C C5    . DT  I 6 153 ? 130.572 217.020 146.124 1.00 681.65 ? 152 DT  J C5    1 
ATOM   9295  C C7    . DT  I 6 153 ? 129.879 217.674 144.963 1.00 681.65 ? 152 DT  J C7    1 
ATOM   9296  C C6    . DT  I 6 153 ? 129.933 216.168 146.940 1.00 681.65 ? 152 DT  J C6    1 
ATOM   9297  P P     . DA  I 6 154 ? 129.685 213.255 152.340 1.00 727.91 ? 153 DA  J P     1 
ATOM   9298  O OP1   . DA  I 6 154 ? 131.006 213.262 151.667 1.00 727.91 ? 153 DA  J OP1   1 
ATOM   9299  O OP2   . DA  I 6 154 ? 129.434 212.200 153.345 1.00 727.91 ? 153 DA  J OP2   1 
ATOM   9300  O "O5'" . DA  I 6 154 ? 129.332 214.650 153.069 1.00 727.91 ? 153 DA  J "O5'" 1 
ATOM   9301  C "C5'" . DA  I 6 154 ? 129.945 215.015 154.319 1.00 727.91 ? 153 DA  J "C5'" 1 
ATOM   9302  C "C4'" . DA  I 6 154 ? 131.416 215.380 154.148 1.00 727.91 ? 153 DA  J "C4'" 1 
ATOM   9303  O "O4'" . DA  I 6 154 ? 131.675 215.819 152.785 1.00 727.91 ? 153 DA  J "O4'" 1 
ATOM   9304  C "C3'" . DA  I 6 154 ? 131.923 216.514 155.044 1.00 727.91 ? 153 DA  J "C3'" 1 
ATOM   9305  O "O3'" . DA  I 6 154 ? 133.246 216.207 155.472 1.00 727.91 ? 153 DA  J "O3'" 1 
ATOM   9306  C "C2'" . DA  I 6 154 ? 131.917 217.707 154.087 1.00 727.91 ? 153 DA  J "C2'" 1 
ATOM   9307  C "C1'" . DA  I 6 154 ? 132.408 217.019 152.832 1.00 727.91 ? 153 DA  J "C1'" 1 
ATOM   9308  N N9    . DA  I 6 154 ? 132.186 217.752 151.588 1.00 727.91 ? 153 DA  J N9    1 
ATOM   9309  C C8    . DA  I 6 154 ? 131.022 217.847 150.885 1.00 727.91 ? 153 DA  J C8    1 
ATOM   9310  N N7    . DA  I 6 154 ? 131.122 218.543 149.778 1.00 727.91 ? 153 DA  J N7    1 
ATOM   9311  C C5    . DA  I 6 154 ? 132.448 218.930 149.752 1.00 727.91 ? 153 DA  J C5    1 
ATOM   9312  C C6    . DA  I 6 154 ? 133.195 219.694 148.837 1.00 727.91 ? 153 DA  J C6    1 
ATOM   9313  N N6    . DA  I 6 154 ? 132.676 220.225 147.723 1.00 727.91 ? 153 DA  J N6    1 
ATOM   9314  N N1    . DA  I 6 154 ? 134.503 219.895 149.110 1.00 727.91 ? 153 DA  J N1    1 
ATOM   9315  C C2    . DA  I 6 154 ? 135.021 219.361 150.223 1.00 727.91 ? 153 DA  J C2    1 
ATOM   9316  N N3    . DA  I 6 154 ? 134.418 218.626 151.156 1.00 727.91 ? 153 DA  J N3    1 
ATOM   9317  C C4    . DA  I 6 154 ? 133.122 218.444 150.857 1.00 727.91 ? 153 DA  J C4    1 
ATOM   9318  P P     . DT  I 6 155 ? 133.861 216.868 156.802 1.00 757.22 ? 154 DT  J P     1 
ATOM   9319  O OP1   . DT  I 6 155 ? 134.038 215.774 157.782 1.00 757.22 ? 154 DT  J OP1   1 
ATOM   9320  O OP2   . DT  I 6 155 ? 133.050 218.050 157.166 1.00 757.22 ? 154 DT  J OP2   1 
ATOM   9321  O "O5'" . DT  I 6 155 ? 135.306 217.380 156.337 1.00 757.22 ? 154 DT  J "O5'" 1 
ATOM   9322  C "C5'" . DT  I 6 155 ? 135.477 217.934 155.036 1.00 757.22 ? 154 DT  J "C5'" 1 
ATOM   9323  C "C4'" . DT  I 6 155 ? 136.521 219.033 155.046 1.00 757.22 ? 154 DT  J "C4'" 1 
ATOM   9324  O "O4'" . DT  I 6 155 ? 136.448 219.777 153.801 1.00 757.22 ? 154 DT  J "O4'" 1 
ATOM   9325  C "C3'" . DT  I 6 155 ? 136.354 220.068 156.150 1.00 757.22 ? 154 DT  J "C3'" 1 
ATOM   9326  O "O3'" . DT  I 6 155 ? 137.631 220.575 156.530 1.00 757.22 ? 154 DT  J "O3'" 1 
ATOM   9327  C "C2'" . DT  I 6 155 ? 135.499 221.131 155.471 1.00 757.22 ? 154 DT  J "C2'" 1 
ATOM   9328  C "C1'" . DT  I 6 155 ? 136.057 221.113 154.057 1.00 757.22 ? 154 DT  J "C1'" 1 
ATOM   9329  N N1    . DT  I 6 155 ? 135.059 221.519 153.031 1.00 757.22 ? 154 DT  J N1    1 
ATOM   9330  C C2    . DT  I 6 155 ? 135.468 222.246 151.936 1.00 757.22 ? 154 DT  J C2    1 
ATOM   9331  O O2    . DT  I 6 155 ? 136.625 222.575 151.744 1.00 757.22 ? 154 DT  J O2    1 
ATOM   9332  N N3    . DT  I 6 155 ? 134.465 222.562 151.057 1.00 757.22 ? 154 DT  J N3    1 
ATOM   9333  C C4    . DT  I 6 155 ? 133.125 222.241 151.166 1.00 757.22 ? 154 DT  J C4    1 
ATOM   9334  O O4    . DT  I 6 155 ? 132.301 222.574 150.323 1.00 757.22 ? 154 DT  J O4    1 
ATOM   9335  C C5    . DT  I 6 155 ? 132.765 221.487 152.340 1.00 757.22 ? 154 DT  J C5    1 
ATOM   9336  C C7    . DT  I 6 155 ? 131.339 221.083 152.564 1.00 757.22 ? 154 DT  J C7    1 
ATOM   9337  C C6    . DT  I 6 155 ? 133.735 221.168 153.206 1.00 757.22 ? 154 DT  J C6    1 
ATOM   9338  P P     . DT  I 6 156 ? 137.773 221.759 157.611 1.00 774.35 ? 155 DT  J P     1 
ATOM   9339  O OP1   . DT  I 6 156 ? 139.088 221.575 158.261 1.00 774.35 ? 155 DT  J OP1   1 
ATOM   9340  O OP2   . DT  I 6 156 ? 136.560 221.815 158.459 1.00 774.35 ? 155 DT  J OP2   1 
ATOM   9341  O "O5'" . DT  I 6 156 ? 137.845 223.080 156.712 1.00 774.35 ? 155 DT  J "O5'" 1 
ATOM   9342  C "C5'" . DT  I 6 156 ? 138.795 223.152 155.655 1.00 774.35 ? 155 DT  J "C5'" 1 
ATOM   9343  C "C4'" . DT  I 6 156 ? 138.526 224.335 154.743 1.00 774.35 ? 155 DT  J "C4'" 1 
ATOM   9344  O "O4'" . DT  I 6 156 ? 137.176 224.278 154.234 1.00 774.35 ? 155 DT  J "O4'" 1 
ATOM   9345  C "C3'" . DT  I 6 156 ? 138.662 225.716 155.400 1.00 774.35 ? 155 DT  J "C3'" 1 
ATOM   9346  O "O3'" . DT  I 6 156 ? 139.779 226.411 154.854 1.00 774.35 ? 155 DT  J "O3'" 1 
ATOM   9347  C "C2'" . DT  I 6 156 ? 137.342 226.426 155.062 1.00 774.35 ? 155 DT  J "C2'" 1 
ATOM   9348  C "C1'" . DT  I 6 156 ? 136.807 225.586 153.916 1.00 774.35 ? 155 DT  J "C1'" 1 
ATOM   9349  N N1    . DT  I 6 156 ? 135.341 225.669 153.768 1.00 774.35 ? 155 DT  J N1    1 
ATOM   9350  C C2    . DT  I 6 156 ? 134.827 226.290 152.661 1.00 774.35 ? 155 DT  J C2    1 
ATOM   9351  O O2    . DT  I 6 156 ? 135.520 226.761 151.780 1.00 774.35 ? 155 DT  J O2    1 
ATOM   9352  N N3    . DT  I 6 156 ? 133.464 226.344 152.616 1.00 774.35 ? 155 DT  J N3    1 
ATOM   9353  C C4    . DT  I 6 156 ? 132.579 225.851 153.551 1.00 774.35 ? 155 DT  J C4    1 
ATOM   9354  O O4    . DT  I 6 156 ? 131.362 225.948 153.413 1.00 774.35 ? 155 DT  J O4    1 
ATOM   9355  C C5    . DT  I 6 156 ? 133.184 225.213 154.697 1.00 774.35 ? 155 DT  J C5    1 
ATOM   9356  C C7    . DT  I 6 156 ? 132.324 224.637 155.784 1.00 774.35 ? 155 DT  J C7    1 
ATOM   9357  C C6    . DT  I 6 156 ? 134.525 225.158 154.751 1.00 774.35 ? 155 DT  J C6    1 
ATOM   9358  P P     . DA  J 7 1   ? 130.169 234.591 145.337 1.00 782.65 ? 52  DA  I P     1 
ATOM   9359  O OP1   . DA  J 7 1   ? 129.999 234.611 146.808 1.00 782.65 ? 52  DA  I OP1   1 
ATOM   9360  O OP2   . DA  J 7 1   ? 130.273 235.864 144.591 1.00 782.65 ? 52  DA  I OP2   1 
ATOM   9361  O "O5'" . DA  J 7 1   ? 131.443 233.694 144.970 1.00 782.65 ? 52  DA  I "O5'" 1 
ATOM   9362  C "C5'" . DA  J 7 1   ? 131.300 232.559 144.119 1.00 782.65 ? 52  DA  I "C5'" 1 
ATOM   9363  C "C4'" . DA  J 7 1   ? 132.388 231.540 144.405 1.00 782.65 ? 52  DA  I "C4'" 1 
ATOM   9364  O "O4'" . DA  J 7 1   ? 132.229 231.032 145.761 1.00 782.65 ? 52  DA  I "O4'" 1 
ATOM   9365  C "C3'" . DA  J 7 1   ? 132.386 230.301 143.501 1.00 782.65 ? 52  DA  I "C3'" 1 
ATOM   9366  O "O3'" . DA  J 7 1   ? 133.735 229.866 143.290 1.00 782.65 ? 52  DA  I "O3'" 1 
ATOM   9367  C "C2'" . DA  J 7 1   ? 131.617 229.299 144.352 1.00 782.65 ? 52  DA  I "C2'" 1 
ATOM   9368  C "C1'" . DA  J 7 1   ? 132.205 229.625 145.709 1.00 782.65 ? 52  DA  I "C1'" 1 
ATOM   9369  N N9    . DA  J 7 1   ? 131.444 229.104 146.841 1.00 782.65 ? 52  DA  I N9    1 
ATOM   9370  C C8    . DA  J 7 1   ? 130.092 229.159 147.035 1.00 782.65 ? 52  DA  I C8    1 
ATOM   9371  N N7    . DA  J 7 1   ? 129.696 228.596 148.155 1.00 782.65 ? 52  DA  I N7    1 
ATOM   9372  C C5    . DA  J 7 1   ? 130.871 228.141 148.731 1.00 782.65 ? 52  DA  I C5    1 
ATOM   9373  C C6    . DA  J 7 1   ? 131.145 227.453 149.934 1.00 782.65 ? 52  DA  I C6    1 
ATOM   9374  N N6    . DA  J 7 1   ? 130.202 227.091 150.811 1.00 782.65 ? 52  DA  I N6    1 
ATOM   9375  N N1    . DA  J 7 1   ? 132.435 227.153 150.202 1.00 782.65 ? 52  DA  I N1    1 
ATOM   9376  C C2    . DA  J 7 1   ? 133.378 227.515 149.328 1.00 782.65 ? 52  DA  I C2    1 
ATOM   9377  N N3    . DA  J 7 1   ? 133.243 228.159 148.174 1.00 782.65 ? 52  DA  I N3    1 
ATOM   9378  C C4    . DA  J 7 1   ? 131.955 228.446 147.932 1.00 782.65 ? 52  DA  I C4    1 
ATOM   9379  P P     . DA  J 7 2   ? 134.137 228.967 142.017 1.00 764.83 ? 53  DA  I P     1 
ATOM   9380  O OP1   . DA  J 7 2   ? 134.335 229.889 140.880 1.00 764.83 ? 53  DA  I OP1   1 
ATOM   9381  O OP2   . DA  J 7 2   ? 133.179 227.847 141.884 1.00 764.83 ? 53  DA  I OP2   1 
ATOM   9382  O "O5'" . DA  J 7 2   ? 135.553 228.335 142.431 1.00 764.83 ? 53  DA  I "O5'" 1 
ATOM   9383  C "C5'" . DA  J 7 2   ? 136.720 229.161 142.491 1.00 764.83 ? 53  DA  I "C5'" 1 
ATOM   9384  C "C4'" . DA  J 7 2   ? 137.550 228.858 143.732 1.00 764.83 ? 53  DA  I "C4'" 1 
ATOM   9385  O "O4'" . DA  J 7 2   ? 136.699 228.285 144.764 1.00 764.83 ? 53  DA  I "O4'" 1 
ATOM   9386  C "C3'" . DA  J 7 2   ? 138.684 227.850 143.539 1.00 764.83 ? 53  DA  I "C3'" 1 
ATOM   9387  O "O3'" . DA  J 7 2   ? 139.767 228.180 144.423 1.00 764.83 ? 53  DA  I "O3'" 1 
ATOM   9388  C "C2'" . DA  J 7 2   ? 138.011 226.543 143.941 1.00 764.83 ? 53  DA  I "C2'" 1 
ATOM   9389  C "C1'" . DA  J 7 2   ? 137.206 227.018 145.135 1.00 764.83 ? 53  DA  I "C1'" 1 
ATOM   9390  N N9    . DA  J 7 2   ? 136.085 226.153 145.482 1.00 764.83 ? 53  DA  I N9    1 
ATOM   9391  C C8    . DA  J 7 2   ? 134.958 225.930 144.745 1.00 764.83 ? 53  DA  I C8    1 
ATOM   9392  N N7    . DA  J 7 2   ? 134.106 225.111 145.316 1.00 764.83 ? 53  DA  I N7    1 
ATOM   9393  C C5    . DA  J 7 2   ? 134.717 224.780 146.515 1.00 764.83 ? 53  DA  I C5    1 
ATOM   9394  C C6    . DA  J 7 2   ? 134.327 223.947 147.583 1.00 764.83 ? 53  DA  I C6    1 
ATOM   9395  N N6    . DA  J 7 2   ? 133.175 223.269 147.602 1.00 764.83 ? 53  DA  I N6    1 
ATOM   9396  N N1    . DA  J 7 2   ? 135.172 223.834 148.632 1.00 764.83 ? 53  DA  I N1    1 
ATOM   9397  C C2    . DA  J 7 2   ? 136.327 224.511 148.610 1.00 764.83 ? 53  DA  I C2    1 
ATOM   9398  N N3    . DA  J 7 2   ? 136.798 225.326 147.665 1.00 764.83 ? 53  DA  I N3    1 
ATOM   9399  C C4    . DA  J 7 2   ? 135.937 225.416 146.635 1.00 764.83 ? 53  DA  I C4    1 
ATOM   9400  P P     . DT  J 7 3   ? 141.087 227.263 144.504 1.00 736.68 ? 54  DT  I P     1 
ATOM   9401  O OP1   . DT  J 7 3   ? 142.192 228.138 144.953 1.00 736.68 ? 54  DT  I OP1   1 
ATOM   9402  O OP2   . DT  J 7 3   ? 141.224 226.515 143.235 1.00 736.68 ? 54  DT  I OP2   1 
ATOM   9403  O "O5'" . DT  J 7 3   ? 140.767 226.219 145.677 1.00 736.68 ? 54  DT  I "O5'" 1 
ATOM   9404  C "C5'" . DT  J 7 3   ? 141.520 225.014 145.790 1.00 736.68 ? 54  DT  I "C5'" 1 
ATOM   9405  C "C4'" . DT  J 7 3   ? 141.217 224.310 147.103 1.00 736.68 ? 54  DT  I "C4'" 1 
ATOM   9406  O "O4'" . DT  J 7 3   ? 139.789 224.046 147.201 1.00 736.68 ? 54  DT  I "O4'" 1 
ATOM   9407  C "C3'" . DT  J 7 3   ? 141.902 222.949 147.288 1.00 736.68 ? 54  DT  I "C3'" 1 
ATOM   9408  O "O3'" . DT  J 7 3   ? 142.308 222.795 148.651 1.00 736.68 ? 54  DT  I "O3'" 1 
ATOM   9409  C "C2'" . DT  J 7 3   ? 140.785 221.977 146.931 1.00 736.68 ? 54  DT  I "C2'" 1 
ATOM   9410  C "C1'" . DT  J 7 3   ? 139.607 222.695 147.553 1.00 736.68 ? 54  DT  I "C1'" 1 
ATOM   9411  N N1    . DT  J 7 3   ? 138.293 222.229 147.057 1.00 736.68 ? 54  DT  I N1    1 
ATOM   9412  C C2    . DT  J 7 3   ? 137.533 221.409 147.857 1.00 736.68 ? 54  DT  I C2    1 
ATOM   9413  O O2    . DT  J 7 3   ? 137.884 221.044 148.965 1.00 736.68 ? 54  DT  I O2    1 
ATOM   9414  N N3    . DT  J 7 3   ? 136.338 221.028 147.313 1.00 736.68 ? 54  DT  I N3    1 
ATOM   9415  C C4    . DT  J 7 3   ? 135.836 221.373 146.071 1.00 736.68 ? 54  DT  I C4    1 
ATOM   9416  O O4    . DT  J 7 3   ? 134.743 220.978 145.676 1.00 736.68 ? 54  DT  I O4    1 
ATOM   9417  C C5    . DT  J 7 3   ? 136.685 222.238 145.280 1.00 736.68 ? 54  DT  I C5    1 
ATOM   9418  C C7    . DT  J 7 3   ? 136.248 222.683 143.915 1.00 736.68 ? 54  DT  I C7    1 
ATOM   9419  C C6    . DT  J 7 3   ? 137.860 222.618 145.806 1.00 736.68 ? 54  DT  I C6    1 
ATOM   9420  P P     . DA  J 7 4   ? 143.457 221.744 149.060 1.00 680.69 ? 55  DA  I P     1 
ATOM   9421  O OP1   . DA  J 7 4   ? 144.603 222.534 149.559 1.00 680.69 ? 55  DA  I OP1   1 
ATOM   9422  O OP2   . DA  J 7 4   ? 143.662 220.790 147.949 1.00 680.69 ? 55  DA  I OP2   1 
ATOM   9423  O "O5'" . DA  J 7 4   ? 142.819 220.934 150.287 1.00 680.69 ? 55  DA  I "O5'" 1 
ATOM   9424  C "C5'" . DA  J 7 4   ? 141.470 220.477 150.216 1.00 680.69 ? 55  DA  I "C5'" 1 
ATOM   9425  C "C4'" . DA  J 7 4   ? 141.316 219.120 150.877 1.00 680.69 ? 55  DA  I "C4'" 1 
ATOM   9426  O "O4'" . DA  J 7 4   ? 139.993 218.595 150.595 1.00 680.69 ? 55  DA  I "O4'" 1 
ATOM   9427  C "C3'" . DA  J 7 4   ? 142.284 218.056 150.389 1.00 680.69 ? 55  DA  I "C3'" 1 
ATOM   9428  O "O3'" . DA  J 7 4   ? 142.533 217.119 151.424 1.00 680.69 ? 55  DA  I "O3'" 1 
ATOM   9429  C "C2'" . DA  J 7 4   ? 141.529 217.425 149.224 1.00 680.69 ? 55  DA  I "C2'" 1 
ATOM   9430  C "C1'" . DA  J 7 4   ? 140.076 217.516 149.679 1.00 680.69 ? 55  DA  I "C1'" 1 
ATOM   9431  N N9    . DA  J 7 4   ? 139.156 217.779 148.577 1.00 680.69 ? 55  DA  I N9    1 
ATOM   9432  C C8    . DA  J 7 4   ? 139.406 218.539 147.471 1.00 680.69 ? 55  DA  I C8    1 
ATOM   9433  N N7    . DA  J 7 4   ? 138.401 218.607 146.636 1.00 680.69 ? 55  DA  I N7    1 
ATOM   9434  C C5    . DA  J 7 4   ? 137.417 217.845 147.239 1.00 680.69 ? 55  DA  I C5    1 
ATOM   9435  C C6    . DA  J 7 4   ? 136.102 217.521 146.854 1.00 680.69 ? 55  DA  I C6    1 
ATOM   9436  N N6    . DA  J 7 4   ? 135.543 217.954 145.720 1.00 680.69 ? 55  DA  I N6    1 
ATOM   9437  N N1    . DA  J 7 4   ? 135.382 216.726 147.677 1.00 680.69 ? 55  DA  I N1    1 
ATOM   9438  C C2    . DA  J 7 4   ? 135.948 216.289 148.812 1.00 680.69 ? 55  DA  I C2    1 
ATOM   9439  N N3    . DA  J 7 4   ? 137.177 216.528 149.278 1.00 680.69 ? 55  DA  I N3    1 
ATOM   9440  C C4    . DA  J 7 4   ? 137.866 217.319 148.435 1.00 680.69 ? 55  DA  I C4    1 
ATOM   9441  P P     . DC  J 7 5   ? 143.615 215.948 151.225 1.00 629.12 ? 56  DC  I P     1 
ATOM   9442  O OP1   . DC  J 7 5   ? 144.284 215.761 152.530 1.00 629.12 ? 56  DC  I OP1   1 
ATOM   9443  O OP2   . DC  J 7 5   ? 144.438 216.228 150.027 1.00 629.12 ? 56  DC  I OP2   1 
ATOM   9444  O "O5'" . DC  J 7 5   ? 142.718 214.657 150.945 1.00 629.12 ? 56  DC  I "O5'" 1 
ATOM   9445  C "C5'" . DC  J 7 5   ? 141.963 214.099 152.007 1.00 629.12 ? 56  DC  I "C5'" 1 
ATOM   9446  C "C4'" . DC  J 7 5   ? 140.790 213.288 151.490 1.00 629.12 ? 56  DC  I "C4'" 1 
ATOM   9447  O "O4'" . DC  J 7 5   ? 140.075 214.029 150.471 1.00 629.12 ? 56  DC  I "O4'" 1 
ATOM   9448  C "C3'" . DC  J 7 5   ? 141.146 211.932 150.857 1.00 629.12 ? 56  DC  I "C3'" 1 
ATOM   9449  O "O3'" . DC  J 7 5   ? 140.516 210.883 151.611 1.00 629.12 ? 56  DC  I "O3'" 1 
ATOM   9450  C "C2'" . DC  J 7 5   ? 140.593 212.043 149.426 1.00 629.12 ? 56  DC  I "C2'" 1 
ATOM   9451  C "C1'" . DC  J 7 5   ? 139.518 213.093 149.595 1.00 629.12 ? 56  DC  I "C1'" 1 
ATOM   9452  N N1    . DC  J 7 5   ? 139.136 213.761 148.331 1.00 629.12 ? 56  DC  I N1    1 
ATOM   9453  C C2    . DC  J 7 5   ? 137.843 213.597 147.847 1.00 629.12 ? 56  DC  I C2    1 
ATOM   9454  O O2    . DC  J 7 5   ? 137.049 212.906 148.496 1.00 629.12 ? 56  DC  I O2    1 
ATOM   9455  N N3    . DC  J 7 5   ? 137.496 214.203 146.688 1.00 629.12 ? 56  DC  I N3    1 
ATOM   9456  C C4    . DC  J 7 5   ? 138.392 214.930 146.020 1.00 629.12 ? 56  DC  I C4    1 
ATOM   9457  N N4    . DC  J 7 5   ? 138.003 215.510 144.882 1.00 629.12 ? 56  DC  I N4    1 
ATOM   9458  C C5    . DC  J 7 5   ? 139.721 215.108 146.499 1.00 629.12 ? 56  DC  I C5    1 
ATOM   9459  C C6    . DC  J 7 5   ? 140.049 214.504 147.645 1.00 629.12 ? 56  DC  I C6    1 
ATOM   9460  P P     . DA  J 7 6   ? 140.478 209.357 151.095 1.00 576.41 ? 57  DA  I P     1 
ATOM   9461  O OP1   . DA  J 7 6   ? 140.346 208.519 152.306 1.00 576.41 ? 57  DA  I OP1   1 
ATOM   9462  O OP2   . DA  J 7 6   ? 141.595 209.081 150.164 1.00 576.41 ? 57  DA  I OP2   1 
ATOM   9463  O "O5'" . DA  J 7 6   ? 139.093 209.269 150.305 1.00 576.41 ? 57  DA  I "O5'" 1 
ATOM   9464  C "C5'" . DA  J 7 6   ? 137.937 209.902 150.847 1.00 576.41 ? 57  DA  I "C5'" 1 
ATOM   9465  C "C4'" . DA  J 7 6   ? 136.659 209.329 150.262 1.00 576.41 ? 57  DA  I "C4'" 1 
ATOM   9466  O "O4'" . DA  J 7 6   ? 136.243 210.109 149.118 1.00 576.41 ? 57  DA  I "O4'" 1 
ATOM   9467  C "C3'" . DA  J 7 6   ? 136.738 207.883 149.801 1.00 576.41 ? 57  DA  I "C3'" 1 
ATOM   9468  O "O3'" . DA  J 7 6   ? 135.542 207.210 150.160 1.00 576.41 ? 57  DA  I "O3'" 1 
ATOM   9469  C "C2'" . DA  J 7 6   ? 136.914 207.983 148.283 1.00 576.41 ? 57  DA  I "C2'" 1 
ATOM   9470  C "C1'" . DA  J 7 6   ? 136.337 209.352 147.930 1.00 576.41 ? 57  DA  I "C1'" 1 
ATOM   9471  N N9    . DA  J 7 6   ? 137.163 210.104 146.993 1.00 576.41 ? 57  DA  I N9    1 
ATOM   9472  C C8    . DA  J 7 6   ? 138.517 210.281 147.044 1.00 576.41 ? 57  DA  I C8    1 
ATOM   9473  N N7    . DA  J 7 6   ? 138.989 211.027 146.073 1.00 576.41 ? 57  DA  I N7    1 
ATOM   9474  C C5    . DA  J 7 6   ? 137.867 211.364 145.339 1.00 576.41 ? 57  DA  I C5    1 
ATOM   9475  C C6    . DA  J 7 6   ? 137.682 212.149 144.181 1.00 576.41 ? 57  DA  I C6    1 
ATOM   9476  N N6    . DA  J 7 6   ? 138.679 212.758 143.527 1.00 576.41 ? 57  DA  I N6    1 
ATOM   9477  N N1    . DA  J 7 6   ? 136.427 212.285 143.718 1.00 576.41 ? 57  DA  I N1    1 
ATOM   9478  C C2    . DA  J 7 6   ? 135.427 211.680 144.366 1.00 576.41 ? 57  DA  I C2    1 
ATOM   9479  N N3    . DA  J 7 6   ? 135.474 210.928 145.460 1.00 576.41 ? 57  DA  I N3    1 
ATOM   9480  C C4    . DA  J 7 6   ? 136.732 210.810 145.901 1.00 576.41 ? 57  DA  I C4    1 
ATOM   9481  P P     . DT  J 7 7   ? 135.320 205.660 149.802 1.00 510.06 ? 58  DT  I P     1 
ATOM   9482  O OP1   . DT  J 7 7   ? 134.452 205.112 150.867 1.00 510.06 ? 58  DT  I OP1   1 
ATOM   9483  O OP2   . DT  J 7 7   ? 136.622 205.009 149.535 1.00 510.06 ? 58  DT  I OP2   1 
ATOM   9484  O "O5'" . DT  J 7 7   ? 134.475 205.721 148.449 1.00 510.06 ? 58  DT  I "O5'" 1 
ATOM   9485  C "C5'" . DT  J 7 7   ? 133.424 206.674 148.332 1.00 510.06 ? 58  DT  I "C5'" 1 
ATOM   9486  C "C4'" . DT  J 7 7   ? 132.621 206.455 147.066 1.00 510.06 ? 58  DT  I "C4'" 1 
ATOM   9487  O "O4'" . DT  J 7 7   ? 133.039 207.400 146.047 1.00 510.06 ? 58  DT  I "O4'" 1 
ATOM   9488  C "C3'" . DT  J 7 7   ? 132.740 205.065 146.453 1.00 510.06 ? 58  DT  I "C3'" 1 
ATOM   9489  O "O3'" . DT  J 7 7   ? 131.445 204.613 146.063 1.00 510.06 ? 58  DT  I "O3'" 1 
ATOM   9490  C "C2'" . DT  J 7 7   ? 133.673 205.284 145.259 1.00 510.06 ? 58  DT  I "C2'" 1 
ATOM   9491  C "C1'" . DT  J 7 7   ? 133.376 206.720 144.859 1.00 510.06 ? 58  DT  I "C1'" 1 
ATOM   9492  N N1    . DT  J 7 7   ? 134.543 207.408 144.267 1.00 510.06 ? 58  DT  I N1    1 
ATOM   9493  C C2    . DT  J 7 7   ? 134.362 208.291 143.225 1.00 510.06 ? 58  DT  I C2    1 
ATOM   9494  O O2    . DT  J 7 7   ? 133.276 208.540 142.738 1.00 510.06 ? 58  DT  I O2    1 
ATOM   9495  N N3    . DT  J 7 7   ? 135.515 208.870 142.770 1.00 510.06 ? 58  DT  I N3    1 
ATOM   9496  C C4    . DT  J 7 7   ? 136.794 208.670 143.258 1.00 510.06 ? 58  DT  I C4    1 
ATOM   9497  O O4    . DT  J 7 7   ? 137.773 209.227 142.790 1.00 510.06 ? 58  DT  I O4    1 
ATOM   9498  C C5    . DT  J 7 7   ? 136.907 207.735 144.338 1.00 510.06 ? 58  DT  I C5    1 
ATOM   9499  C C7    . DT  J 7 7   ? 138.252 207.433 144.924 1.00 510.06 ? 58  DT  I C7    1 
ATOM   9500  C C6    . DT  J 7 7   ? 135.792 207.159 144.789 1.00 510.06 ? 58  DT  I C6    1 
ATOM   9501  P P     . DG  J 7 8   ? 131.240 203.239 145.253 1.00 463.50 ? 59  DG  I P     1 
ATOM   9502  O OP1   . DG  J 7 8   ? 129.887 202.749 145.591 1.00 463.50 ? 59  DG  I OP1   1 
ATOM   9503  O OP2   . DG  J 7 8   ? 132.395 202.336 145.463 1.00 463.50 ? 59  DG  I OP2   1 
ATOM   9504  O "O5'" . DG  J 7 8   ? 131.206 203.724 143.734 1.00 463.50 ? 59  DG  I "O5'" 1 
ATOM   9505  C "C5'" . DG  J 7 8   ? 130.471 204.891 143.396 1.00 463.50 ? 59  DG  I "C5'" 1 
ATOM   9506  C "C4'" . DG  J 7 8   ? 130.766 205.334 141.980 1.00 463.50 ? 59  DG  I "C4'" 1 
ATOM   9507  O "O4'" . DG  J 7 8   ? 132.071 205.962 141.909 1.00 463.50 ? 59  DG  I "O4'" 1 
ATOM   9508  C "C3'" . DG  J 7 8   ? 130.785 204.215 140.947 1.00 463.50 ? 59  DG  I "C3'" 1 
ATOM   9509  O "O3'" . DG  J 7 8   ? 130.123 204.654 139.789 1.00 463.50 ? 59  DG  I "O3'" 1 
ATOM   9510  C "C2'" . DG  J 7 8   ? 132.275 204.015 140.683 1.00 463.50 ? 59  DG  I "C2'" 1 
ATOM   9511  C "C1'" . DG  J 7 8   ? 132.767 205.439 140.804 1.00 463.50 ? 59  DG  I "C1'" 1 
ATOM   9512  N N9    . DG  J 7 8   ? 134.193 205.560 141.065 1.00 463.50 ? 59  DG  I N9    1 
ATOM   9513  C C8    . DG  J 7 8   ? 134.919 204.890 142.015 1.00 463.50 ? 59  DG  I C8    1 
ATOM   9514  N N7    . DG  J 7 8   ? 136.178 205.222 142.035 1.00 463.50 ? 59  DG  I N7    1 
ATOM   9515  C C5    . DG  J 7 8   ? 136.293 206.177 141.035 1.00 463.50 ? 59  DG  I C5    1 
ATOM   9516  C C6    . DG  J 7 8   ? 137.424 206.893 140.587 1.00 463.50 ? 59  DG  I C6    1 
ATOM   9517  O O6    . DG  J 7 8   ? 138.584 206.834 141.011 1.00 463.50 ? 59  DG  I O6    1 
ATOM   9518  N N1    . DG  J 7 8   ? 137.107 207.767 139.554 1.00 463.50 ? 59  DG  I N1    1 
ATOM   9519  C C2    . DG  J 7 8   ? 135.855 207.922 139.016 1.00 463.50 ? 59  DG  I C2    1 
ATOM   9520  N N2    . DG  J 7 8   ? 135.741 208.804 138.016 1.00 463.50 ? 59  DG  I N2    1 
ATOM   9521  N N3    . DG  J 7 8   ? 134.786 207.250 139.421 1.00 463.50 ? 59  DG  I N3    1 
ATOM   9522  C C4    . DG  J 7 8   ? 135.079 206.400 140.432 1.00 463.50 ? 59  DG  I C4    1 
ATOM   9523  P P     . DC  J 7 9   ? 128.691 204.048 139.403 1.00 413.65 ? 60  DC  I P     1 
ATOM   9524  O OP1   . DC  J 7 9   ? 127.721 205.166 139.379 1.00 413.65 ? 60  DC  I OP1   1 
ATOM   9525  O OP2   . DC  J 7 9   ? 128.456 202.882 140.282 1.00 413.65 ? 60  DC  I OP2   1 
ATOM   9526  O "O5'" . DC  J 7 9   ? 128.901 203.543 137.905 1.00 413.65 ? 60  DC  I "O5'" 1 
ATOM   9527  C "C5'" . DC  J 7 9   ? 130.200 203.567 137.343 1.00 413.65 ? 60  DC  I "C5'" 1 
ATOM   9528  C "C4'" . DC  J 7 9   ? 130.358 204.737 136.396 1.00 413.65 ? 60  DC  I "C4'" 1 
ATOM   9529  O "O4'" . DC  J 7 9   ? 131.571 205.467 136.726 1.00 413.65 ? 60  DC  I "O4'" 1 
ATOM   9530  C "C3'" . DC  J 7 9   ? 130.560 204.331 134.960 1.00 413.65 ? 60  DC  I "C3'" 1 
ATOM   9531  O "O3'" . DC  J 7 9   ? 130.325 205.440 134.119 1.00 413.65 ? 60  DC  I "O3'" 1 
ATOM   9532  C "C2'" . DC  J 7 9   ? 132.031 203.962 134.991 1.00 413.65 ? 60  DC  I "C2'" 1 
ATOM   9533  C "C1'" . DC  J 7 9   ? 132.593 205.124 135.800 1.00 413.65 ? 60  DC  I "C1'" 1 
ATOM   9534  N N1    . DC  J 7 9   ? 133.826 204.802 136.579 1.00 413.65 ? 60  DC  I N1    1 
ATOM   9535  C C2    . DC  J 7 9   ? 134.984 205.583 136.427 1.00 413.65 ? 60  DC  I C2    1 
ATOM   9536  O O2    . DC  J 7 9   ? 134.989 206.513 135.613 1.00 413.65 ? 60  DC  I O2    1 
ATOM   9537  N N3    . DC  J 7 9   ? 136.074 205.285 137.178 1.00 413.65 ? 60  DC  I N3    1 
ATOM   9538  C C4    . DC  J 7 9   ? 136.031 204.274 138.044 1.00 413.65 ? 60  DC  I C4    1 
ATOM   9539  N N4    . DC  J 7 9   ? 137.125 204.014 138.764 1.00 413.65 ? 60  DC  I N4    1 
ATOM   9540  C C5    . DC  J 7 9   ? 134.864 203.481 138.215 1.00 413.65 ? 60  DC  I C5    1 
ATOM   9541  C C6    . DC  J 7 9   ? 133.798 203.778 137.471 1.00 413.65 ? 60  DC  I C6    1 
ATOM   9542  P P     . DA  J 7 10  ? 130.054 205.218 132.553 1.00 368.42 ? 61  DA  I P     1 
ATOM   9543  O OP1   . DA  J 7 10  ? 129.137 206.281 132.090 1.00 368.42 ? 61  DA  I OP1   1 
ATOM   9544  O OP2   . DA  J 7 10  ? 129.700 203.795 132.369 1.00 368.42 ? 61  DA  I OP2   1 
ATOM   9545  O "O5'" . DA  J 7 10  ? 131.483 205.446 131.884 1.00 368.42 ? 61  DA  I "O5'" 1 
ATOM   9546  C "C5'" . DA  J 7 10  ? 132.325 206.501 132.339 1.00 368.42 ? 61  DA  I "C5'" 1 
ATOM   9547  C "C4'" . DA  J 7 10  ? 133.268 206.978 131.245 1.00 368.42 ? 61  DA  I "C4'" 1 
ATOM   9548  O "O4'" . DA  J 7 10  ? 134.632 206.706 131.616 1.00 368.42 ? 61  DA  I "O4'" 1 
ATOM   9549  C "C3'" . DA  J 7 10  ? 133.097 206.321 129.891 1.00 368.42 ? 61  DA  I "C3'" 1 
ATOM   9550  O "O3'" . DA  J 7 10  ? 133.513 207.224 128.883 1.00 368.42 ? 61  DA  I "O3'" 1 
ATOM   9551  C "C2'" . DA  J 7 10  ? 134.021 205.099 129.971 1.00 368.42 ? 61  DA  I "C2'" 1 
ATOM   9552  C "C1'" . DA  J 7 10  ? 135.057 205.494 131.026 1.00 368.42 ? 61  DA  I "C1'" 1 
ATOM   9553  N N9    . DA  J 7 10  ? 135.214 204.522 132.094 1.00 368.42 ? 61  DA  I N9    1 
ATOM   9554  C C8    . DA  J 7 10  ? 134.334 203.553 132.467 1.00 368.42 ? 61  DA  I C8    1 
ATOM   9555  N N7    . DA  J 7 10  ? 134.739 202.843 133.493 1.00 368.42 ? 61  DA  I N7    1 
ATOM   9556  C C5    . DA  J 7 10  ? 135.955 203.403 133.821 1.00 368.42 ? 61  DA  I C5    1 
ATOM   9557  C C6    . DA  J 7 10  ? 136.899 203.109 134.819 1.00 368.42 ? 61  DA  I C6    1 
ATOM   9558  N N6    . DA  J 7 10  ? 136.742 202.135 135.717 1.00 368.42 ? 61  DA  I N6    1 
ATOM   9559  N N1    . DA  J 7 10  ? 138.017 203.862 134.861 1.00 368.42 ? 61  DA  I N1    1 
ATOM   9560  C C2    . DA  J 7 10  ? 138.175 204.828 133.957 1.00 368.42 ? 61  DA  I C2    1 
ATOM   9561  N N3    . DA  J 7 10  ? 137.358 205.200 132.982 1.00 368.42 ? 61  DA  I N3    1 
ATOM   9562  C C4    . DA  J 7 10  ? 136.258 204.441 132.969 1.00 368.42 ? 61  DA  I C4    1 
ATOM   9563  P P     . DC  J 7 11  ? 133.401 206.830 127.332 1.00 336.17 ? 62  DC  I P     1 
ATOM   9564  O OP1   . DC  J 7 11  ? 133.217 208.090 126.582 1.00 336.17 ? 62  DC  I OP1   1 
ATOM   9565  O OP2   . DC  J 7 11  ? 132.416 205.736 127.185 1.00 336.17 ? 62  DC  I OP2   1 
ATOM   9566  O "O5'" . DC  J 7 11  ? 134.846 206.246 126.993 1.00 336.17 ? 62  DC  I "O5'" 1 
ATOM   9567  C "C5'" . DC  J 7 11  ? 136.003 206.982 127.354 1.00 336.17 ? 62  DC  I "C5'" 1 
ATOM   9568  C "C4'" . DC  J 7 11  ? 137.229 206.090 127.404 1.00 336.17 ? 62  DC  I "C4'" 1 
ATOM   9569  O "O4'" . DC  J 7 11  ? 137.223 205.307 128.625 1.00 336.17 ? 62  DC  I "O4'" 1 
ATOM   9570  C "C3'" . DC  J 7 11  ? 137.355 205.073 126.260 1.00 336.17 ? 62  DC  I "C3'" 1 
ATOM   9571  O "O3'" . DC  J 7 11  ? 138.696 204.986 125.870 1.00 336.17 ? 62  DC  I "O3'" 1 
ATOM   9572  C "C2'" . DC  J 7 11  ? 136.932 203.777 126.930 1.00 336.17 ? 62  DC  I "C2'" 1 
ATOM   9573  C "C1'" . DC  J 7 11  ? 137.565 203.996 128.283 1.00 336.17 ? 62  DC  I "C1'" 1 
ATOM   9574  N N1    . DC  J 7 11  ? 137.125 203.043 129.332 1.00 336.17 ? 62  DC  I N1    1 
ATOM   9575  C C2    . DC  J 7 11  ? 137.912 202.874 130.465 1.00 336.17 ? 62  DC  I C2    1 
ATOM   9576  O O2    . DC  J 7 11  ? 138.942 203.532 130.585 1.00 336.17 ? 62  DC  I O2    1 
ATOM   9577  N N3    . DC  J 7 11  ? 137.528 201.991 131.404 1.00 336.17 ? 62  DC  I N3    1 
ATOM   9578  C C4    . DC  J 7 11  ? 136.410 201.294 131.243 1.00 336.17 ? 62  DC  I C4    1 
ATOM   9579  N N4    . DC  J 7 11  ? 136.070 200.440 132.205 1.00 336.17 ? 62  DC  I N4    1 
ATOM   9580  C C5    . DC  J 7 11  ? 135.595 201.436 130.086 1.00 336.17 ? 62  DC  I C5    1 
ATOM   9581  C C6    . DC  J 7 11  ? 135.995 202.305 129.158 1.00 336.17 ? 62  DC  I C6    1 
ATOM   9582  P P     . DA  J 7 12  ? 139.203 205.687 124.523 1.00 309.97 ? 63  DA  I P     1 
ATOM   9583  O OP1   . DA  J 7 12  ? 138.817 207.114 124.590 1.00 309.97 ? 63  DA  I OP1   1 
ATOM   9584  O OP2   . DA  J 7 12  ? 138.752 204.849 123.391 1.00 309.97 ? 63  DA  I OP2   1 
ATOM   9585  O "O5'" . DA  J 7 12  ? 140.790 205.561 124.631 1.00 309.97 ? 63  DA  I "O5'" 1 
ATOM   9586  C "C5'" . DA  J 7 12  ? 141.414 205.689 125.899 1.00 309.97 ? 63  DA  I "C5'" 1 
ATOM   9587  C "C4'" . DA  J 7 12  ? 142.530 204.678 126.058 1.00 309.97 ? 63  DA  I "C4'" 1 
ATOM   9588  O "O4'" . DA  J 7 12  ? 142.230 203.785 127.160 1.00 309.97 ? 63  DA  I "O4'" 1 
ATOM   9589  C "C3'" . DA  J 7 12  ? 142.781 203.797 124.842 1.00 309.97 ? 63  DA  I "C3'" 1 
ATOM   9590  O "O3'" . DA  J 7 12  ? 144.182 203.675 124.639 1.00 309.97 ? 63  DA  I "O3'" 1 
ATOM   9591  C "C2'" . DA  J 7 12  ? 142.121 202.470 125.225 1.00 309.97 ? 63  DA  I "C2'" 1 
ATOM   9592  C "C1'" . DA  J 7 12  ? 142.272 202.441 126.734 1.00 309.97 ? 63  DA  I "C1'" 1 
ATOM   9593  N N9    . DA  J 7 12  ? 141.179 201.748 127.388 1.00 309.97 ? 63  DA  I N9    1 
ATOM   9594  C C8    . DA  J 7 12  ? 139.873 201.786 127.026 1.00 309.97 ? 63  DA  I C8    1 
ATOM   9595  N N7    . DA  J 7 12  ? 139.087 201.084 127.797 1.00 309.97 ? 63  DA  I N7    1 
ATOM   9596  C C5    . DA  J 7 12  ? 139.938 200.547 128.735 1.00 309.97 ? 63  DA  I C5    1 
ATOM   9597  C C6    . DA  J 7 12  ? 139.716 199.710 129.835 1.00 309.97 ? 63  DA  I C6    1 
ATOM   9598  N N6    . DA  J 7 12  ? 138.515 199.240 130.157 1.00 309.97 ? 63  DA  I N6    1 
ATOM   9599  N N1    . DA  J 7 12  ? 140.782 199.331 130.563 1.00 309.97 ? 63  DA  I N1    1 
ATOM   9600  C C2    . DA  J 7 12  ? 141.994 199.786 130.221 1.00 309.97 ? 63  DA  I C2    1 
ATOM   9601  N N3    . DA  J 7 12  ? 142.325 200.595 129.211 1.00 309.97 ? 63  DA  I N3    1 
ATOM   9602  C C4    . DA  J 7 12  ? 141.238 200.939 128.499 1.00 309.97 ? 63  DA  I C4    1 
ATOM   9603  P P     . DG  J 7 13  ? 144.795 202.666 123.547 1.00 296.68 ? 64  DG  I P     1 
ATOM   9604  O OP1   . DG  J 7 13  ? 146.090 203.249 123.139 1.00 296.68 ? 64  DG  I OP1   1 
ATOM   9605  O OP2   . DG  J 7 13  ? 143.801 202.337 122.498 1.00 296.68 ? 64  DG  I OP2   1 
ATOM   9606  O "O5'" . DG  J 7 13  ? 145.113 201.364 124.406 1.00 296.68 ? 64  DG  I "O5'" 1 
ATOM   9607  C "C5'" . DG  J 7 13  ? 145.738 201.510 125.671 1.00 296.68 ? 64  DG  I "C5'" 1 
ATOM   9608  C "C4'" . DG  J 7 13  ? 145.862 200.179 126.380 1.00 296.68 ? 64  DG  I "C4'" 1 
ATOM   9609  O "O4'" . DG  J 7 13  ? 144.597 199.821 126.990 1.00 296.68 ? 64  DG  I "O4'" 1 
ATOM   9610  C "C3'" . DG  J 7 13  ? 146.249 199.007 125.486 1.00 296.68 ? 64  DG  I "C3'" 1 
ATOM   9611  O "O3'" . DG  J 7 13  ? 147.212 198.228 126.145 1.00 296.68 ? 64  DG  I "O3'" 1 
ATOM   9612  C "C2'" . DG  J 7 13  ? 144.935 198.247 125.330 1.00 296.68 ? 64  DG  I "C2'" 1 
ATOM   9613  C "C1'" . DG  J 7 13  ? 144.319 198.478 126.691 1.00 296.68 ? 64  DG  I "C1'" 1 
ATOM   9614  N N9    . DG  J 7 13  ? 142.879 198.287 126.740 1.00 296.68 ? 64  DG  I N9    1 
ATOM   9615  C C8    . DG  J 7 13  ? 141.934 198.822 125.902 1.00 296.68 ? 64  DG  I C8    1 
ATOM   9616  N N7    . DG  J 7 13  ? 140.715 198.481 126.214 1.00 296.68 ? 64  DG  I N7    1 
ATOM   9617  C C5    . DG  J 7 13  ? 140.867 197.675 127.332 1.00 296.68 ? 64  DG  I C5    1 
ATOM   9618  C C6    . DG  J 7 13  ? 139.900 197.007 128.112 1.00 296.68 ? 64  DG  I C6    1 
ATOM   9619  O O6    . DG  J 7 13  ? 138.673 197.005 127.978 1.00 296.68 ? 64  DG  I O6    1 
ATOM   9620  N N1    . DG  J 7 13  ? 140.483 196.307 129.160 1.00 296.68 ? 64  DG  I N1    1 
ATOM   9621  C C2    . DG  J 7 13  ? 141.831 196.246 129.406 1.00 296.68 ? 64  DG  I C2    1 
ATOM   9622  N N2    . DG  J 7 13  ? 142.218 195.516 130.458 1.00 296.68 ? 64  DG  I N2    1 
ATOM   9623  N N3    . DG  J 7 13  ? 142.743 196.862 128.679 1.00 296.68 ? 64  DG  I N3    1 
ATOM   9624  C C4    . DG  J 7 13  ? 142.192 197.551 127.664 1.00 296.68 ? 64  DG  I C4    1 
ATOM   9625  P P     . DG  J 7 14  ? 148.313 197.419 125.309 1.00 286.75 ? 65  DG  I P     1 
ATOM   9626  O OP1   . DG  J 7 14  ? 149.629 198.034 125.587 1.00 286.75 ? 65  DG  I OP1   1 
ATOM   9627  O OP2   . DG  J 7 14  ? 147.834 197.292 123.917 1.00 286.75 ? 65  DG  I OP2   1 
ATOM   9628  O "O5'" . DG  J 7 14  ? 148.272 195.974 125.972 1.00 286.75 ? 65  DG  I "O5'" 1 
ATOM   9629  C "C5'" . DG  J 7 14  ? 148.186 195.864 127.375 1.00 286.75 ? 65  DG  I "C5'" 1 
ATOM   9630  C "C4'" . DG  J 7 14  ? 147.451 194.605 127.774 1.00 286.75 ? 65  DG  I "C4'" 1 
ATOM   9631  O "O4'" . DG  J 7 14  ? 146.021 194.821 127.699 1.00 286.75 ? 65  DG  I "O4'" 1 
ATOM   9632  C "C3'" . DG  J 7 14  ? 147.742 193.384 126.906 1.00 286.75 ? 65  DG  I "C3'" 1 
ATOM   9633  O "O3'" . DG  J 7 14  ? 147.956 192.273 127.740 1.00 286.75 ? 65  DG  I "O3'" 1 
ATOM   9634  C "C2'" . DG  J 7 14  ? 146.459 193.228 126.090 1.00 286.75 ? 65  DG  I "C2'" 1 
ATOM   9635  C "C1'" . DG  J 7 14  ? 145.431 193.706 127.088 1.00 286.75 ? 65  DG  I "C1'" 1 
ATOM   9636  N N9    . DG  J 7 14  ? 144.178 194.132 126.494 1.00 286.75 ? 65  DG  I N9    1 
ATOM   9637  C C8    . DG  J 7 14  ? 144.013 194.921 125.391 1.00 286.75 ? 65  DG  I C8    1 
ATOM   9638  N N7    . DG  J 7 14  ? 142.767 195.161 125.109 1.00 286.75 ? 65  DG  I N7    1 
ATOM   9639  C C5    . DG  J 7 14  ? 142.064 194.486 126.090 1.00 286.75 ? 65  DG  I C5    1 
ATOM   9640  C C6    . DG  J 7 14  ? 140.677 194.374 126.299 1.00 286.75 ? 65  DG  I C6    1 
ATOM   9641  O O6    . DG  J 7 14  ? 139.760 194.867 125.635 1.00 286.75 ? 65  DG  I O6    1 
ATOM   9642  N N1    . DG  J 7 14  ? 140.385 193.592 127.410 1.00 286.75 ? 65  DG  I N1    1 
ATOM   9643  C C2    . DG  J 7 14  ? 141.321 193.000 128.218 1.00 286.75 ? 65  DG  I C2    1 
ATOM   9644  N N2    . DG  J 7 14  ? 140.850 192.280 129.245 1.00 286.75 ? 65  DG  I N2    1 
ATOM   9645  N N3    . DG  J 7 14  ? 142.625 193.094 128.027 1.00 286.75 ? 65  DG  I N3    1 
ATOM   9646  C C4    . DG  J 7 14  ? 142.921 193.851 126.951 1.00 286.75 ? 65  DG  I C4    1 
ATOM   9647  P P     . DA  J 7 15  ? 148.853 191.040 127.247 1.00 274.73 ? 66  DA  I P     1 
ATOM   9648  O OP1   . DA  J 7 15  ? 150.072 191.023 128.080 1.00 274.73 ? 66  DA  I OP1   1 
ATOM   9649  O OP2   . DA  J 7 15  ? 148.972 191.104 125.778 1.00 274.73 ? 66  DA  I OP2   1 
ATOM   9650  O "O5'" . DA  J 7 15  ? 147.962 189.774 127.624 1.00 274.73 ? 66  DA  I "O5'" 1 
ATOM   9651  C "C5'" . DA  J 7 15  ? 147.612 189.556 128.975 1.00 274.73 ? 66  DA  I "C5'" 1 
ATOM   9652  C "C4'" . DA  J 7 15  ? 146.231 188.941 129.105 1.00 274.73 ? 66  DA  I "C4'" 1 
ATOM   9653  O "O4'" . DA  J 7 15  ? 145.236 189.784 128.467 1.00 274.73 ? 66  DA  I "O4'" 1 
ATOM   9654  C "C3'" . DA  J 7 15  ? 146.058 187.557 128.483 1.00 274.73 ? 66  DA  I "C3'" 1 
ATOM   9655  O "O3'" . DA  J 7 15  ? 145.257 186.792 129.350 1.00 274.73 ? 66  DA  I "O3'" 1 
ATOM   9656  C "C2'" . DA  J 7 15  ? 145.310 187.874 127.190 1.00 274.73 ? 66  DA  I "C2'" 1 
ATOM   9657  C "C1'" . DA  J 7 15  ? 144.396 188.964 127.693 1.00 274.73 ? 66  DA  I "C1'" 1 
ATOM   9658  N N9    . DA  J 7 15  ? 143.784 189.776 126.653 1.00 274.73 ? 66  DA  I N9    1 
ATOM   9659  C C8    . DA  J 7 15  ? 144.417 190.436 125.643 1.00 274.73 ? 66  DA  I C8    1 
ATOM   9660  N N7    . DA  J 7 15  ? 143.609 191.119 124.872 1.00 274.73 ? 66  DA  I N7    1 
ATOM   9661  C C5    . DA  J 7 15  ? 142.361 190.893 125.419 1.00 274.73 ? 66  DA  I C5    1 
ATOM   9662  C C6    . DA  J 7 15  ? 141.077 191.329 125.058 1.00 274.73 ? 66  DA  I C6    1 
ATOM   9663  N N6    . DA  J 7 15  ? 140.846 192.129 124.019 1.00 274.73 ? 66  DA  I N6    1 
ATOM   9664  N N1    . DA  J 7 15  ? 140.038 190.921 125.815 1.00 274.73 ? 66  DA  I N1    1 
ATOM   9665  C C2    . DA  J 7 15  ? 140.275 190.118 126.853 1.00 274.73 ? 66  DA  I C2    1 
ATOM   9666  N N3    . DA  J 7 15  ? 141.439 189.643 127.289 1.00 274.73 ? 66  DA  I N3    1 
ATOM   9667  C C4    . DA  J 7 15  ? 142.450 190.070 126.517 1.00 274.73 ? 66  DA  I C4    1 
ATOM   9668  P P     . DT  J 7 16  ? 145.264 185.189 129.314 1.00 273.73 ? 67  DT  I P     1 
ATOM   9669  O OP1   . DT  J 7 16  ? 146.286 184.735 130.278 1.00 273.73 ? 67  DT  I OP1   1 
ATOM   9670  O OP2   . DT  J 7 16  ? 145.317 184.716 127.916 1.00 273.73 ? 67  DT  I OP2   1 
ATOM   9671  O "O5'" . DT  J 7 16  ? 143.819 184.831 129.883 1.00 273.73 ? 67  DT  I "O5'" 1 
ATOM   9672  C "C5'" . DT  J 7 16  ? 142.794 185.821 129.847 1.00 273.73 ? 67  DT  I "C5'" 1 
ATOM   9673  C "C4'" . DT  J 7 16  ? 141.597 185.323 129.065 1.00 273.73 ? 67  DT  I "C4'" 1 
ATOM   9674  O "O4'" . DT  J 7 16  ? 141.250 186.281 128.019 1.00 273.73 ? 67  DT  I "O4'" 1 
ATOM   9675  C "C3'" . DT  J 7 16  ? 141.820 183.996 128.343 1.00 273.73 ? 67  DT  I "C3'" 1 
ATOM   9676  O "O3'" . DT  J 7 16  ? 140.616 183.257 128.339 1.00 273.73 ? 67  DT  I "O3'" 1 
ATOM   9677  C "C2'" . DT  J 7 16  ? 142.172 184.464 126.941 1.00 273.73 ? 67  DT  I "C2'" 1 
ATOM   9678  C "C1'" . DT  J 7 16  ? 141.161 185.582 126.801 1.00 273.73 ? 67  DT  I "C1'" 1 
ATOM   9679  N N1    . DT  J 7 16  ? 141.415 186.510 125.663 1.00 273.73 ? 67  DT  I N1    1 
ATOM   9680  C C2    . DT  J 7 16  ? 140.373 187.244 125.159 1.00 273.73 ? 67  DT  I C2    1 
ATOM   9681  O O2    . DT  J 7 16  ? 139.247 187.200 125.613 1.00 273.73 ? 67  DT  I O2    1 
ATOM   9682  N N3    . DT  J 7 16  ? 140.702 188.066 124.118 1.00 273.73 ? 67  DT  I N3    1 
ATOM   9683  C C4    . DT  J 7 16  ? 141.936 188.202 123.525 1.00 273.73 ? 67  DT  I C4    1 
ATOM   9684  O O4    . DT  J 7 16  ? 142.130 188.965 122.587 1.00 273.73 ? 67  DT  I O4    1 
ATOM   9685  C C5    . DT  J 7 16  ? 142.983 187.394 124.093 1.00 273.73 ? 67  DT  I C5    1 
ATOM   9686  C C7    . DT  J 7 16  ? 144.369 187.461 123.535 1.00 273.73 ? 67  DT  I C7    1 
ATOM   9687  C C6    . DT  J 7 16  ? 142.675 186.591 125.118 1.00 273.73 ? 67  DT  I C6    1 
ATOM   9688  P P     . DG  J 7 17  ? 140.591 181.749 128.880 1.00 271.33 ? 68  DG  I P     1 
ATOM   9689  O OP1   . DG  J 7 17  ? 140.746 181.800 130.348 1.00 271.33 ? 68  DG  I OP1   1 
ATOM   9690  O OP2   . DG  J 7 17  ? 141.547 180.969 128.067 1.00 271.33 ? 68  DG  I OP2   1 
ATOM   9691  O "O5'" . DG  J 7 17  ? 139.114 181.249 128.532 1.00 271.33 ? 68  DG  I "O5'" 1 
ATOM   9692  C "C5'" . DG  J 7 17  ? 137.987 181.939 129.062 1.00 271.33 ? 68  DG  I "C5'" 1 
ATOM   9693  C "C4'" . DG  J 7 17  ? 136.887 182.107 128.020 1.00 271.33 ? 68  DG  I "C4'" 1 
ATOM   9694  O "O4'" . DG  J 7 17  ? 137.301 183.053 127.007 1.00 271.33 ? 68  DG  I "O4'" 1 
ATOM   9695  C "C3'" . DG  J 7 17  ? 136.475 180.842 127.275 1.00 271.33 ? 68  DG  I "C3'" 1 
ATOM   9696  O "O3'" . DG  J 7 17  ? 135.073 180.842 127.100 1.00 271.33 ? 68  DG  I "O3'" 1 
ATOM   9697  C "C2'" . DG  J 7 17  ? 137.203 180.968 125.939 1.00 271.33 ? 68  DG  I "C2'" 1 
ATOM   9698  C "C1'" . DG  J 7 17  ? 137.200 182.470 125.726 1.00 271.33 ? 68  DG  I "C1'" 1 
ATOM   9699  N N9    . DG  J 7 17  ? 138.329 182.943 124.949 1.00 271.33 ? 68  DG  I N9    1 
ATOM   9700  C C8    . DG  J 7 17  ? 139.653 182.746 125.226 1.00 271.33 ? 68  DG  I C8    1 
ATOM   9701  N N7    . DG  J 7 17  ? 140.450 183.300 124.362 1.00 271.33 ? 68  DG  I N7    1 
ATOM   9702  C C5    . DG  J 7 17  ? 139.601 183.923 123.469 1.00 271.33 ? 68  DG  I C5    1 
ATOM   9703  C C6    . DG  J 7 17  ? 139.897 184.680 122.321 1.00 271.33 ? 68  DG  I C6    1 
ATOM   9704  O O6    . DG  J 7 17  ? 141.009 184.967 121.863 1.00 271.33 ? 68  DG  I O6    1 
ATOM   9705  N N1    . DG  J 7 17  ? 138.743 185.120 121.687 1.00 271.33 ? 68  DG  I N1    1 
ATOM   9706  C C2    . DG  J 7 17  ? 137.461 184.857 122.113 1.00 271.33 ? 68  DG  I C2    1 
ATOM   9707  N N2    . DG  J 7 17  ? 136.469 185.362 121.369 1.00 271.33 ? 68  DG  I N2    1 
ATOM   9708  N N3    . DG  J 7 17  ? 137.172 184.143 123.190 1.00 271.33 ? 68  DG  I N3    1 
ATOM   9709  C C4    . DG  J 7 17  ? 138.288 183.709 123.814 1.00 271.33 ? 68  DG  I C4    1 
ATOM   9710  P P     . DT  J 7 18  ? 134.337 179.574 126.447 1.00 267.82 ? 69  DT  I P     1 
ATOM   9711  O OP1   . DT  J 7 18  ? 132.961 179.538 126.986 1.00 267.82 ? 69  DT  I OP1   1 
ATOM   9712  O OP2   . DT  J 7 18  ? 135.226 178.402 126.595 1.00 267.82 ? 69  DT  I OP2   1 
ATOM   9713  O "O5'" . DT  J 7 18  ? 134.255 179.941 124.896 1.00 267.82 ? 69  DT  I "O5'" 1 
ATOM   9714  C "C5'" . DT  J 7 18  ? 133.634 181.143 124.495 1.00 267.82 ? 69  DT  I "C5'" 1 
ATOM   9715  C "C4'" . DT  J 7 18  ? 133.765 181.349 123.001 1.00 267.82 ? 69  DT  I "C4'" 1 
ATOM   9716  O "O4'" . DT  J 7 18  ? 135.084 181.865 122.684 1.00 267.82 ? 69  DT  I "O4'" 1 
ATOM   9717  C "C3'" . DT  J 7 18  ? 133.595 180.087 122.142 1.00 267.82 ? 69  DT  I "C3'" 1 
ATOM   9718  O "O3'" . DT  J 7 18  ? 132.798 180.400 121.020 1.00 267.82 ? 69  DT  I "O3'" 1 
ATOM   9719  C "C2'" . DT  J 7 18  ? 135.027 179.786 121.715 1.00 267.82 ? 69  DT  I "C2'" 1 
ATOM   9720  C "C1'" . DT  J 7 18  ? 135.527 181.196 121.537 1.00 267.82 ? 69  DT  I "C1'" 1 
ATOM   9721  N N1    . DT  J 7 18  ? 136.985 181.311 121.426 1.00 267.82 ? 69  DT  I N1    1 
ATOM   9722  C C2    . DT  J 7 18  ? 137.496 182.111 120.451 1.00 267.82 ? 69  DT  I C2    1 
ATOM   9723  O O2    . DT  J 7 18  ? 136.798 182.739 119.678 1.00 267.82 ? 69  DT  I O2    1 
ATOM   9724  N N3    . DT  J 7 18  ? 138.848 182.169 120.407 1.00 267.82 ? 69  DT  I N3    1 
ATOM   9725  C C4    . DT  J 7 18  ? 139.734 181.503 121.219 1.00 267.82 ? 69  DT  I C4    1 
ATOM   9726  O O4    . DT  J 7 18  ? 140.944 181.623 121.093 1.00 267.82 ? 69  DT  I O4    1 
ATOM   9727  C C5    . DT  J 7 18  ? 139.135 180.669 122.229 1.00 267.82 ? 69  DT  I C5    1 
ATOM   9728  C C7    . DT  J 7 18  ? 139.997 179.896 123.176 1.00 267.82 ? 69  DT  I C7    1 
ATOM   9729  C C6    . DT  J 7 18  ? 137.799 180.610 122.282 1.00 267.82 ? 69  DT  I C6    1 
ATOM   9730  P P     . DA  J 7 19  ? 132.046 179.253 120.185 1.00 260.95 ? 70  DA  I P     1 
ATOM   9731  O OP1   . DA  J 7 19  ? 130.963 178.723 121.038 1.00 260.95 ? 70  DA  I OP1   1 
ATOM   9732  O OP2   . DA  J 7 19  ? 133.038 178.333 119.591 1.00 260.95 ? 70  DA  I OP2   1 
ATOM   9733  O "O5'" . DA  J 7 19  ? 131.406 180.066 118.976 1.00 260.95 ? 70  DA  I "O5'" 1 
ATOM   9734  C "C5'" . DA  J 7 19  ? 132.064 181.231 118.506 1.00 260.95 ? 70  DA  I "C5'" 1 
ATOM   9735  C "C4'" . DA  J 7 19  ? 132.093 181.264 116.993 1.00 260.95 ? 70  DA  I "C4'" 1 
ATOM   9736  O "O4'" . DA  J 7 19  ? 133.426 181.603 116.553 1.00 260.95 ? 70  DA  I "O4'" 1 
ATOM   9737  C "C3'" . DA  J 7 19  ? 131.779 179.944 116.317 1.00 260.95 ? 70  DA  I "C3'" 1 
ATOM   9738  O "O3'" . DA  J 7 19  ? 131.281 180.178 115.015 1.00 260.95 ? 70  DA  I "O3'" 1 
ATOM   9739  C "C2'" . DA  J 7 19  ? 133.140 179.265 116.280 1.00 260.95 ? 70  DA  I "C2'" 1 
ATOM   9740  C "C1'" . DA  J 7 19  ? 134.095 180.442 116.103 1.00 260.95 ? 70  DA  I "C1'" 1 
ATOM   9741  N N9    . DA  J 7 19  ? 135.305 180.286 116.884 1.00 260.95 ? 70  DA  I N9    1 
ATOM   9742  C C8    . DA  J 7 19  ? 135.389 179.902 118.186 1.00 260.95 ? 70  DA  I C8    1 
ATOM   9743  N N7    . DA  J 7 19  ? 136.613 179.810 118.627 1.00 260.95 ? 70  DA  I N7    1 
ATOM   9744  C C5    . DA  J 7 19  ? 137.382 180.211 117.557 1.00 260.95 ? 70  DA  I C5    1 
ATOM   9745  C C6    . DA  J 7 19  ? 138.767 180.351 117.384 1.00 260.95 ? 70  DA  I C6    1 
ATOM   9746  N N6    . DA  J 7 19  ? 139.654 180.106 118.346 1.00 260.95 ? 70  DA  I N6    1 
ATOM   9747  N N1    . DA  J 7 19  ? 139.209 180.753 116.177 1.00 260.95 ? 70  DA  I N1    1 
ATOM   9748  C C2    . DA  J 7 19  ? 138.321 181.002 115.213 1.00 260.95 ? 70  DA  I C2    1 
ATOM   9749  N N3    . DA  J 7 19  ? 136.997 180.895 115.254 1.00 260.95 ? 70  DA  I N3    1 
ATOM   9750  C C4    . DA  J 7 19  ? 136.591 180.493 116.466 1.00 260.95 ? 70  DA  I C4    1 
ATOM   9751  P P     . DT  J 7 20  ? 130.819 178.947 114.094 1.00 246.91 ? 71  DT  I P     1 
ATOM   9752  O OP1   . DT  J 7 20  ? 129.776 179.463 113.185 1.00 246.91 ? 71  DT  I OP1   1 
ATOM   9753  O OP2   . DT  J 7 20  ? 130.526 177.791 114.968 1.00 246.91 ? 71  DT  I OP2   1 
ATOM   9754  O "O5'" . DT  J 7 20  ? 132.118 178.617 113.225 1.00 246.91 ? 71  DT  I "O5'" 1 
ATOM   9755  C "C5'" . DT  J 7 20  ? 132.700 179.641 112.447 1.00 246.91 ? 71  DT  I "C5'" 1 
ATOM   9756  C "C4'" . DT  J 7 20  ? 133.967 179.170 111.762 1.00 246.91 ? 71  DT  I "C4'" 1 
ATOM   9757  O "O4'" . DT  J 7 20  ? 135.077 179.202 112.690 1.00 246.91 ? 71  DT  I "O4'" 1 
ATOM   9758  C "C3'" . DT  J 7 20  ? 133.930 177.749 111.200 1.00 246.91 ? 71  DT  I "C3'" 1 
ATOM   9759  O "O3'" . DT  J 7 20  ? 134.518 177.756 109.922 1.00 246.91 ? 71  DT  I "O3'" 1 
ATOM   9760  C "C2'" . DT  J 7 20  ? 134.794 176.977 112.190 1.00 246.91 ? 71  DT  I "C2'" 1 
ATOM   9761  C "C1'" . DT  J 7 20  ? 135.823 178.031 112.513 1.00 246.91 ? 71  DT  I "C1'" 1 
ATOM   9762  N N1    . DT  J 7 20  ? 136.569 177.774 113.735 1.00 246.91 ? 71  DT  I N1    1 
ATOM   9763  C C2    . DT  J 7 20  ? 137.918 177.971 113.736 1.00 246.91 ? 71  DT  I C2    1 
ATOM   9764  O O2    . DT  J 7 20  ? 138.540 178.319 112.752 1.00 246.91 ? 71  DT  I O2    1 
ATOM   9765  N N3    . DT  J 7 20  ? 138.531 177.704 114.917 1.00 246.91 ? 71  DT  I N3    1 
ATOM   9766  C C4    . DT  J 7 20  ? 137.936 177.293 116.088 1.00 246.91 ? 71  DT  I C4    1 
ATOM   9767  O O4    . DT  J 7 20  ? 138.579 177.089 117.107 1.00 246.91 ? 71  DT  I O4    1 
ATOM   9768  C C5    . DT  J 7 20  ? 136.510 177.117 116.025 1.00 246.91 ? 71  DT  I C5    1 
ATOM   9769  C C7    . DT  J 7 20  ? 135.753 176.656 117.231 1.00 246.91 ? 71  DT  I C7    1 
ATOM   9770  C C6    . DT  J 7 20  ? 135.900 177.367 114.862 1.00 246.91 ? 71  DT  I C6    1 
ATOM   9771  P P     . DA  J 7 21  ? 134.174 176.605 108.860 1.00 235.00 ? 72  DA  I P     1 
ATOM   9772  O OP1   . DA  J 7 21  ? 133.463 177.258 107.740 1.00 235.00 ? 72  DA  I OP1   1 
ATOM   9773  O OP2   . DA  J 7 21  ? 133.531 175.482 109.574 1.00 235.00 ? 72  DA  I OP2   1 
ATOM   9774  O "O5'" . DA  J 7 21  ? 135.611 176.126 108.349 1.00 235.00 ? 72  DA  I "O5'" 1 
ATOM   9775  C "C5'" . DA  J 7 21  ? 136.342 176.939 107.441 1.00 235.00 ? 72  DA  I "C5'" 1 
ATOM   9776  C "C4'" . DA  J 7 21  ? 137.831 176.639 107.495 1.00 235.00 ? 72  DA  I "C4'" 1 
ATOM   9777  O "O4'" . DA  J 7 21  ? 138.309 176.740 108.858 1.00 235.00 ? 72  DA  I "O4'" 1 
ATOM   9778  C "C3'" . DA  J 7 21  ? 138.249 175.250 107.013 1.00 235.00 ? 72  DA  I "C3'" 1 
ATOM   9779  O "O3'" . DA  J 7 21  ? 139.483 175.361 106.331 1.00 235.00 ? 72  DA  I "O3'" 1 
ATOM   9780  C "C2'" . DA  J 7 21  ? 138.416 174.485 108.322 1.00 235.00 ? 72  DA  I "C2'" 1 
ATOM   9781  C "C1'" . DA  J 7 21  ? 139.023 175.571 109.182 1.00 235.00 ? 72  DA  I "C1'" 1 
ATOM   9782  N N9    . DA  J 7 21  ? 138.896 175.357 110.609 1.00 235.00 ? 72  DA  I N9    1 
ATOM   9783  C C8    . DA  J 7 21  ? 137.743 175.255 111.328 1.00 235.00 ? 72  DA  I C8    1 
ATOM   9784  N N7    . DA  J 7 21  ? 137.938 175.097 112.611 1.00 235.00 ? 72  DA  I N7    1 
ATOM   9785  C C5    . DA  J 7 21  ? 139.313 175.136 112.742 1.00 235.00 ? 72  DA  I C5    1 
ATOM   9786  C C6    . DA  J 7 21  ? 140.163 175.030 113.850 1.00 235.00 ? 72  DA  I C6    1 
ATOM   9787  N N6    . DA  J 7 21  ? 139.724 174.869 115.094 1.00 235.00 ? 72  DA  I N6    1 
ATOM   9788  N N1    . DA  J 7 21  ? 141.488 175.095 113.630 1.00 235.00 ? 72  DA  I N1    1 
ATOM   9789  C C2    . DA  J 7 21  ? 141.930 175.252 112.383 1.00 235.00 ? 72  DA  I C2    1 
ATOM   9790  N N3    . DA  J 7 21  ? 141.228 175.362 111.264 1.00 235.00 ? 72  DA  I N3    1 
ATOM   9791  C C4    . DA  J 7 21  ? 139.915 175.294 111.517 1.00 235.00 ? 72  DA  I C4    1 
ATOM   9792  P P     . DT  J 7 22  ? 139.901 174.302 105.201 1.00 229.13 ? 73  DT  I P     1 
ATOM   9793  O OP1   . DT  J 7 22  ? 139.643 174.927 103.887 1.00 229.13 ? 73  DT  I OP1   1 
ATOM   9794  O OP2   . DT  J 7 22  ? 139.299 172.994 105.528 1.00 229.13 ? 73  DT  I OP2   1 
ATOM   9795  O "O5'" . DT  J 7 22  ? 141.475 174.165 105.396 1.00 229.13 ? 73  DT  I "O5'" 1 
ATOM   9796  C "C5'" . DT  J 7 22  ? 142.026 174.319 106.686 1.00 229.13 ? 73  DT  I "C5'" 1 
ATOM   9797  C "C4'" . DT  J 7 22  ? 142.919 173.151 107.019 1.00 229.13 ? 73  DT  I "C4'" 1 
ATOM   9798  O "O4'" . DT  J 7 22  ? 142.892 172.918 108.450 1.00 229.13 ? 73  DT  I "O4'" 1 
ATOM   9799  C "C3'" . DT  J 7 22  ? 142.483 171.827 106.406 1.00 229.13 ? 73  DT  I "C3'" 1 
ATOM   9800  O "O3'" . DT  J 7 22  ? 143.580 170.916 106.383 1.00 229.13 ? 73  DT  I "O3'" 1 
ATOM   9801  C "C2'" . DT  J 7 22  ? 141.471 171.376 107.440 1.00 229.13 ? 73  DT  I "C2'" 1 
ATOM   9802  C "C1'" . DT  J 7 22  ? 142.278 171.672 108.692 1.00 229.13 ? 73  DT  I "C1'" 1 
ATOM   9803  N N1    . DT  J 7 22  ? 141.496 171.768 109.934 1.00 229.13 ? 73  DT  I N1    1 
ATOM   9804  C C2    . DT  J 7 22  ? 142.169 171.894 111.114 1.00 229.13 ? 73  DT  I C2    1 
ATOM   9805  O O2    . DT  J 7 22  ? 143.381 171.928 111.185 1.00 229.13 ? 73  DT  I O2    1 
ATOM   9806  N N3    . DT  J 7 22  ? 141.381 171.976 112.216 1.00 229.13 ? 73  DT  I N3    1 
ATOM   9807  C C4    . DT  J 7 22  ? 140.009 171.944 112.259 1.00 229.13 ? 73  DT  I C4    1 
ATOM   9808  O O4    . DT  J 7 22  ? 139.391 172.025 113.309 1.00 229.13 ? 73  DT  I O4    1 
ATOM   9809  C C5    . DT  J 7 22  ? 139.357 171.812 110.984 1.00 229.13 ? 73  DT  I C5    1 
ATOM   9810  C C7    . DT  J 7 22  ? 137.864 171.765 110.904 1.00 229.13 ? 73  DT  I C7    1 
ATOM   9811  C C6    . DT  J 7 22  ? 140.124 171.729 109.892 1.00 229.13 ? 73  DT  I C6    1 
ATOM   9812  P P     . DA  J 7 23  ? 144.859 171.132 105.433 1.00 223.13 ? 74  DA  I P     1 
ATOM   9813  O OP1   . DA  J 7 23  ? 144.611 172.200 104.440 1.00 223.13 ? 74  DA  I OP1   1 
ATOM   9814  O OP2   . DA  J 7 23  ? 145.233 169.788 104.950 1.00 223.13 ? 74  DA  I OP2   1 
ATOM   9815  O "O5'" . DA  J 7 23  ? 146.009 171.565 106.454 1.00 223.13 ? 74  DA  I "O5'" 1 
ATOM   9816  C "C5'" . DA  J 7 23  ? 145.902 171.194 107.821 1.00 223.13 ? 74  DA  I "C5'" 1 
ATOM   9817  C "C4'" . DA  J 7 23  ? 147.125 170.442 108.295 1.00 223.13 ? 74  DA  I "C4'" 1 
ATOM   9818  O "O4'" . DA  J 7 23  ? 146.784 169.673 109.463 1.00 223.13 ? 74  DA  I "O4'" 1 
ATOM   9819  C "C3'" . DA  J 7 23  ? 147.664 169.404 107.344 1.00 223.13 ? 74  DA  I "C3'" 1 
ATOM   9820  O "O3'" . DA  J 7 23  ? 149.023 169.122 107.726 1.00 223.13 ? 74  DA  I "O3'" 1 
ATOM   9821  C "C2'" . DA  J 7 23  ? 146.704 168.231 107.589 1.00 223.13 ? 74  DA  I "C2'" 1 
ATOM   9822  C "C1'" . DA  J 7 23  ? 146.326 168.395 109.061 1.00 223.13 ? 74  DA  I "C1'" 1 
ATOM   9823  N N9    . DA  J 7 23  ? 144.892 168.356 109.297 1.00 223.13 ? 74  DA  I N9    1 
ATOM   9824  C C8    . DA  J 7 23  ? 143.898 168.344 108.363 1.00 223.13 ? 74  DA  I C8    1 
ATOM   9825  N N7    . DA  J 7 23  ? 142.693 168.344 108.879 1.00 223.13 ? 74  DA  I N7    1 
ATOM   9826  C C5    . DA  J 7 23  ? 142.919 168.380 110.240 1.00 223.13 ? 74  DA  I C5    1 
ATOM   9827  C C6    . DA  J 7 23  ? 142.055 168.390 111.349 1.00 223.13 ? 74  DA  I C6    1 
ATOM   9828  N N6    . DA  J 7 23  ? 140.724 168.382 111.246 1.00 223.13 ? 74  DA  I N6    1 
ATOM   9829  N N1    . DA  J 7 23  ? 142.615 168.414 112.577 1.00 223.13 ? 74  DA  I N1    1 
ATOM   9830  C C2    . DA  J 7 23  ? 143.944 168.404 112.674 1.00 223.13 ? 74  DA  I C2    1 
ATOM   9831  N N3    . DA  J 7 23  ? 144.850 168.416 111.710 1.00 223.13 ? 74  DA  I N3    1 
ATOM   9832  C C4    . DA  J 7 23  ? 144.268 168.390 110.509 1.00 223.13 ? 74  DA  I C4    1 
ATOM   9833  P P     . DT  J 7 24  ? 149.774 167.740 107.386 1.00 211.21 ? 75  DT  I P     1 
ATOM   9834  O OP1   . DT  J 7 24  ? 151.208 168.067 107.477 1.00 211.21 ? 75  DT  I OP1   1 
ATOM   9835  O OP2   . DT  J 7 24  ? 149.303 167.114 106.130 1.00 211.21 ? 75  DT  I OP2   1 
ATOM   9836  O "O5'" . DT  J 7 24  ? 149.452 166.825 108.653 1.00 211.21 ? 75  DT  I "O5'" 1 
ATOM   9837  C "C5'" . DT  J 7 24  ? 149.873 167.255 109.940 1.00 211.21 ? 75  DT  I "C5'" 1 
ATOM   9838  C "C4'" . DT  J 7 24  ? 149.487 166.263 111.024 1.00 211.21 ? 75  DT  I "C4'" 1 
ATOM   9839  O "O4'" . DT  J 7 24  ? 148.060 166.307 111.247 1.00 211.21 ? 75  DT  I "O4'" 1 
ATOM   9840  C "C3'" . DT  J 7 24  ? 149.822 164.798 110.738 1.00 211.21 ? 75  DT  I "C3'" 1 
ATOM   9841  O "O3'" . DT  J 7 24  ? 150.272 164.186 111.925 1.00 211.21 ? 75  DT  I "O3'" 1 
ATOM   9842  C "C2'" . DT  J 7 24  ? 148.473 164.227 110.327 1.00 211.21 ? 75  DT  I "C2'" 1 
ATOM   9843  C "C1'" . DT  J 7 24  ? 147.567 164.995 111.264 1.00 211.21 ? 75  DT  I "C1'" 1 
ATOM   9844  N N1    . DT  J 7 24  ? 146.175 165.040 110.849 1.00 211.21 ? 75  DT  I N1    1 
ATOM   9845  C C2    . DT  J 7 24  ? 145.224 165.305 111.790 1.00 211.21 ? 75  DT  I C2    1 
ATOM   9846  O O2    . DT  J 7 24  ? 145.482 165.491 112.960 1.00 211.21 ? 75  DT  I O2    1 
ATOM   9847  N N3    . DT  J 7 24  ? 143.953 165.344 111.323 1.00 211.21 ? 75  DT  I N3    1 
ATOM   9848  C C4    . DT  J 7 24  ? 143.545 165.154 110.023 1.00 211.21 ? 75  DT  I C4    1 
ATOM   9849  O O4    . DT  J 7 24  ? 142.370 165.215 109.698 1.00 211.21 ? 75  DT  I O4    1 
ATOM   9850  C C5    . DT  J 7 24  ? 144.599 164.887 109.078 1.00 211.21 ? 75  DT  I C5    1 
ATOM   9851  C C7    . DT  J 7 24  ? 144.279 164.660 107.634 1.00 211.21 ? 75  DT  I C7    1 
ATOM   9852  C C6    . DT  J 7 24  ? 145.849 164.842 109.533 1.00 211.21 ? 75  DT  I C6    1 
ATOM   9853  P P     . DC  J 7 25  ? 151.838 163.984 112.202 1.00 199.54 ? 76  DC  I P     1 
ATOM   9854  O OP1   . DC  J 7 25  ? 152.529 165.257 111.917 1.00 199.54 ? 76  DC  I OP1   1 
ATOM   9855  O OP2   . DC  J 7 25  ? 152.253 162.748 111.508 1.00 199.54 ? 76  DC  I OP2   1 
ATOM   9856  O "O5'" . DC  J 7 25  ? 151.900 163.705 113.773 1.00 199.54 ? 76  DC  I "O5'" 1 
ATOM   9857  C "C5'" . DC  J 7 25  ? 150.787 164.043 114.594 1.00 199.54 ? 76  DC  I "C5'" 1 
ATOM   9858  C "C4'" . DC  J 7 25  ? 150.045 162.803 115.068 1.00 199.54 ? 76  DC  I "C4'" 1 
ATOM   9859  O "O4'" . DC  J 7 25  ? 148.873 162.578 114.241 1.00 199.54 ? 76  DC  I "O4'" 1 
ATOM   9860  C "C3'" . DC  J 7 25  ? 150.838 161.494 115.022 1.00 199.54 ? 76  DC  I "C3'" 1 
ATOM   9861  O "O3'" . DC  J 7 25  ? 150.451 160.676 116.107 1.00 199.54 ? 76  DC  I "O3'" 1 
ATOM   9862  C "C2'" . DC  J 7 25  ? 150.347 160.879 113.721 1.00 199.54 ? 76  DC  I "C2'" 1 
ATOM   9863  C "C1'" . DC  J 7 25  ? 148.878 161.233 113.825 1.00 199.54 ? 76  DC  I "C1'" 1 
ATOM   9864  N N1    . DC  J 7 25  ? 148.125 161.118 112.561 1.00 199.54 ? 76  DC  I N1    1 
ATOM   9865  C C2    . DC  J 7 25  ? 146.760 161.365 112.562 1.00 199.54 ? 76  DC  I C2    1 
ATOM   9866  O O2    . DC  J 7 25  ? 146.209 161.673 113.614 1.00 199.54 ? 76  DC  I O2    1 
ATOM   9867  N N3    . DC  J 7 25  ? 146.078 161.266 111.411 1.00 199.54 ? 76  DC  I N3    1 
ATOM   9868  C C4    . DC  J 7 25  ? 146.705 160.929 110.293 1.00 199.54 ? 76  DC  I C4    1 
ATOM   9869  N N4    . DC  J 7 25  ? 145.983 160.844 109.176 1.00 199.54 ? 76  DC  I N4    1 
ATOM   9870  C C5    . DC  J 7 25  ? 148.101 160.665 110.266 1.00 199.54 ? 76  DC  I C5    1 
ATOM   9871  C C6    . DC  J 7 25  ? 148.766 160.771 111.414 1.00 199.54 ? 76  DC  I C6    1 
ATOM   9872  P P     . DT  J 7 26  ? 151.249 160.697 117.498 1.00 195.57 ? 77  DT  I P     1 
ATOM   9873  O OP1   . DT  J 7 26  ? 152.010 161.960 117.595 1.00 195.57 ? 77  DT  I OP1   1 
ATOM   9874  O OP2   . DT  J 7 26  ? 151.951 159.403 117.617 1.00 195.57 ? 77  DT  I OP2   1 
ATOM   9875  O "O5'" . DT  J 7 26  ? 150.077 160.696 118.580 1.00 195.57 ? 77  DT  I "O5'" 1 
ATOM   9876  C "C5'" . DT  J 7 26  ? 148.779 161.148 118.204 1.00 195.57 ? 77  DT  I "C5'" 1 
ATOM   9877  C "C4'" . DT  J 7 26  ? 147.758 160.027 118.281 1.00 195.57 ? 77  DT  I "C4'" 1 
ATOM   9878  O "O4'" . DT  J 7 26  ? 147.263 159.710 116.949 1.00 195.57 ? 77  DT  I "O4'" 1 
ATOM   9879  C "C3'" . DT  J 7 26  ? 148.280 158.710 118.840 1.00 195.57 ? 77  DT  I "C3'" 1 
ATOM   9880  O "O3'" . DT  J 7 26  ? 147.237 158.059 119.519 1.00 195.57 ? 77  DT  I "O3'" 1 
ATOM   9881  C "C2'" . DT  J 7 26  ? 148.628 157.960 117.572 1.00 195.57 ? 77  DT  I "C2'" 1 
ATOM   9882  C "C1'" . DT  J 7 26  ? 147.424 158.331 116.732 1.00 195.57 ? 77  DT  I "C1'" 1 
ATOM   9883  N N1    . DT  J 7 26  ? 147.591 158.087 115.284 1.00 195.57 ? 77  DT  I N1    1 
ATOM   9884  C C2    . DT  J 7 26  ? 146.503 158.175 114.462 1.00 195.57 ? 77  DT  I C2    1 
ATOM   9885  O O2    . DT  J 7 26  ? 145.391 158.443 114.858 1.00 195.57 ? 77  DT  I O2    1 
ATOM   9886  N N3    . DT  J 7 26  ? 146.765 157.938 113.147 1.00 195.57 ? 77  DT  I N3    1 
ATOM   9887  C C4    . DT  J 7 26  ? 147.974 157.623 112.583 1.00 195.57 ? 77  DT  I C4    1 
ATOM   9888  O O4    . DT  J 7 26  ? 148.106 157.426 111.383 1.00 195.57 ? 77  DT  I O4    1 
ATOM   9889  C C5    . DT  J 7 26  ? 149.076 157.544 113.500 1.00 195.57 ? 77  DT  I C5    1 
ATOM   9890  C C7    . DT  J 7 26  ? 150.449 157.209 113.002 1.00 195.57 ? 77  DT  I C7    1 
ATOM   9891  C C6    . DT  J 7 26  ? 148.833 157.771 114.793 1.00 195.57 ? 77  DT  I C6    1 
ATOM   9892  P P     . DG  J 7 27  ? 147.341 157.787 121.093 1.00 187.63 ? 78  DG  I P     1 
ATOM   9893  O OP1   . DG  J 7 27  ? 147.089 159.073 121.772 1.00 187.63 ? 78  DG  I OP1   1 
ATOM   9894  O OP2   . DG  J 7 27  ? 148.584 157.035 121.350 1.00 187.63 ? 78  DG  I OP2   1 
ATOM   9895  O "O5'" . DG  J 7 27  ? 146.107 156.829 121.383 1.00 187.63 ? 78  DG  I "O5'" 1 
ATOM   9896  C "C5'" . DG  J 7 27  ? 144.864 157.397 121.687 1.00 187.63 ? 78  DG  I "C5'" 1 
ATOM   9897  C "C4'" . DG  J 7 27  ? 143.794 156.925 120.726 1.00 187.63 ? 78  DG  I "C4'" 1 
ATOM   9898  O "O4'" . DG  J 7 27  ? 144.316 156.874 119.383 1.00 187.63 ? 78  DG  I "O4'" 1 
ATOM   9899  C "C3'" . DG  J 7 27  ? 143.233 155.541 121.004 1.00 187.63 ? 78  DG  I "C3'" 1 
ATOM   9900  O "O3'" . DG  J 7 27  ? 141.869 155.546 120.713 1.00 187.63 ? 78  DG  I "O3'" 1 
ATOM   9901  C "C2'" . DG  J 7 27  ? 144.000 154.671 120.020 1.00 187.63 ? 78  DG  I "C2'" 1 
ATOM   9902  C "C1'" . DG  J 7 27  ? 144.071 155.602 118.836 1.00 187.63 ? 78  DG  I "C1'" 1 
ATOM   9903  N N9    . DG  J 7 27  ? 145.156 155.324 117.928 1.00 187.63 ? 78  DG  I N9    1 
ATOM   9904  C C8    . DG  J 7 27  ? 146.480 155.209 118.242 1.00 187.63 ? 78  DG  I C8    1 
ATOM   9905  N N7    . DG  J 7 27  ? 147.236 154.989 117.209 1.00 187.63 ? 78  DG  I N7    1 
ATOM   9906  C C5    . DG  J 7 27  ? 146.358 154.996 116.145 1.00 187.63 ? 78  DG  I C5    1 
ATOM   9907  C C6    . DG  J 7 27  ? 146.601 154.811 114.776 1.00 187.63 ? 78  DG  I C6    1 
ATOM   9908  O O6    . DG  J 7 27  ? 147.680 154.615 114.214 1.00 187.63 ? 78  DG  I O6    1 
ATOM   9909  N N1    . DG  J 7 27  ? 145.432 154.876 114.035 1.00 187.63 ? 78  DG  I N1    1 
ATOM   9910  C C2    . DG  J 7 27  ? 144.184 155.087 114.559 1.00 187.63 ? 78  DG  I C2    1 
ATOM   9911  N N2    . DG  J 7 27  ? 143.170 155.119 113.689 1.00 187.63 ? 78  DG  I N2    1 
ATOM   9912  N N3    . DG  J 7 27  ? 143.944 155.260 115.846 1.00 187.63 ? 78  DG  I N3    1 
ATOM   9913  C C4    . DG  J 7 27  ? 145.074 155.199 116.574 1.00 187.63 ? 78  DG  I C4    1 
ATOM   9914  P P     . DA  J 7 28  ? 140.902 154.466 121.388 1.00 193.64 ? 79  DA  I P     1 
ATOM   9915  O OP1   . DA  J 7 28  ? 139.809 155.224 122.015 1.00 193.64 ? 79  DA  I OP1   1 
ATOM   9916  O OP2   . DA  J 7 28  ? 141.719 153.534 122.187 1.00 193.64 ? 79  DA  I OP2   1 
ATOM   9917  O "O5'" . DA  J 7 28  ? 140.295 153.684 120.144 1.00 193.64 ? 79  DA  I "O5'" 1 
ATOM   9918  C "C5'" . DA  J 7 28  ? 139.530 154.391 119.193 1.00 193.64 ? 79  DA  I "C5'" 1 
ATOM   9919  C "C4'" . DA  J 7 28  ? 138.963 153.469 118.126 1.00 193.64 ? 79  DA  I "C4'" 1 
ATOM   9920  O "O4'" . DA  J 7 28  ? 139.937 153.251 117.084 1.00 193.64 ? 79  DA  I "O4'" 1 
ATOM   9921  C "C3'" . DA  J 7 28  ? 138.518 152.099 118.597 1.00 193.64 ? 79  DA  I "C3'" 1 
ATOM   9922  O "O3'" . DA  J 7 28  ? 137.330 151.750 117.914 1.00 193.64 ? 79  DA  I "O3'" 1 
ATOM   9923  C "C2'" . DA  J 7 28  ? 139.690 151.190 118.221 1.00 193.64 ? 79  DA  I "C2'" 1 
ATOM   9924  C "C1'" . DA  J 7 28  ? 140.337 151.903 117.041 1.00 193.64 ? 79  DA  I "C1'" 1 
ATOM   9925  N N9    . DA  J 7 28  ? 141.786 151.890 117.088 1.00 193.64 ? 79  DA  I N9    1 
ATOM   9926  C C8    . DA  J 7 28  ? 142.569 151.985 118.193 1.00 193.64 ? 79  DA  I C8    1 
ATOM   9927  N N7    . DA  J 7 28  ? 143.852 151.974 117.933 1.00 193.64 ? 79  DA  I N7    1 
ATOM   9928  C C5    . DA  J 7 28  ? 143.907 151.883 116.560 1.00 193.64 ? 79  DA  I C5    1 
ATOM   9929  C C6    . DA  J 7 28  ? 144.979 151.818 115.656 1.00 193.64 ? 79  DA  I C6    1 
ATOM   9930  N N6    . DA  J 7 28  ? 146.258 151.850 116.031 1.00 193.64 ? 79  DA  I N6    1 
ATOM   9931  N N1    . DA  J 7 28  ? 144.687 151.721 114.346 1.00 193.64 ? 79  DA  I N1    1 
ATOM   9932  C C2    . DA  J 7 28  ? 143.408 151.685 113.974 1.00 193.64 ? 79  DA  I C2    1 
ATOM   9933  N N3    . DA  J 7 28  ? 142.318 151.729 114.732 1.00 193.64 ? 79  DA  I N3    1 
ATOM   9934  C C4    . DA  J 7 28  ? 142.642 151.826 116.025 1.00 193.64 ? 79  DA  I C4    1 
ATOM   9935  P P     . DC  J 7 29  ? 136.614 150.334 118.157 1.00 201.12 ? 80  DC  I P     1 
ATOM   9936  O OP1   . DC  J 7 29  ? 135.174 150.553 117.913 1.00 201.12 ? 80  DC  I OP1   1 
ATOM   9937  O OP2   . DC  J 7 29  ? 137.049 149.761 119.449 1.00 201.12 ? 80  DC  I OP2   1 
ATOM   9938  O "O5'" . DC  J 7 29  ? 137.179 149.436 116.968 1.00 201.12 ? 80  DC  I "O5'" 1 
ATOM   9939  C "C5'" . DC  J 7 29  ? 137.139 149.942 115.646 1.00 201.12 ? 80  DC  I "C5'" 1 
ATOM   9940  C "C4'" . DC  J 7 29  ? 137.922 149.064 114.693 1.00 201.12 ? 80  DC  I "C4'" 1 
ATOM   9941  O "O4'" . DC  J 7 29  ? 139.341 149.336 114.812 1.00 201.12 ? 80  DC  I "O4'" 1 
ATOM   9942  C "C3'" . DC  J 7 29  ? 137.761 147.561 114.908 1.00 201.12 ? 80  DC  I "C3'" 1 
ATOM   9943  O "O3'" . DC  J 7 29  ? 137.597 146.941 113.658 1.00 201.12 ? 80  DC  I "O3'" 1 
ATOM   9944  C "C2'" . DC  J 7 29  ? 139.092 147.172 115.540 1.00 201.12 ? 80  DC  I "C2'" 1 
ATOM   9945  C "C1'" . DC  J 7 29  ? 140.022 148.114 114.813 1.00 201.12 ? 80  DC  I "C1'" 1 
ATOM   9946  N N1    . DC  J 7 29  ? 141.313 148.299 115.480 1.00 201.12 ? 80  DC  I N1    1 
ATOM   9947  C C2    . DC  J 7 29  ? 142.473 148.415 114.721 1.00 201.12 ? 80  DC  I C2    1 
ATOM   9948  O O2    . DC  J 7 29  ? 142.404 148.347 113.498 1.00 201.12 ? 80  DC  I O2    1 
ATOM   9949  N N3    . DC  J 7 29  ? 143.652 148.584 115.349 1.00 201.12 ? 80  DC  I N3    1 
ATOM   9950  C C4    . DC  J 7 29  ? 143.694 148.637 116.674 1.00 201.12 ? 80  DC  I C4    1 
ATOM   9951  N N4    . DC  J 7 29  ? 144.880 148.816 117.252 1.00 201.12 ? 80  DC  I N4    1 
ATOM   9952  C C5    . DC  J 7 29  ? 142.522 148.530 117.466 1.00 201.12 ? 80  DC  I C5    1 
ATOM   9953  C C6    . DC  J 7 29  ? 141.364 148.356 116.831 1.00 201.12 ? 80  DC  I C6    1 
ATOM   9954  P P     . DA  J 7 30  ? 136.767 145.576 113.514 1.00 206.16 ? 81  DA  I P     1 
ATOM   9955  O OP1   . DA  J 7 30  ? 135.344 145.939 113.352 1.00 206.16 ? 81  DA  I OP1   1 
ATOM   9956  O OP2   . DA  J 7 30  ? 137.174 144.656 114.595 1.00 206.16 ? 81  DA  I OP2   1 
ATOM   9957  O "O5'" . DA  J 7 30  ? 137.316 144.979 112.143 1.00 206.16 ? 81  DA  I "O5'" 1 
ATOM   9958  C "C5'" . DA  J 7 30  ? 138.412 145.619 111.508 1.00 206.16 ? 81  DA  I "C5'" 1 
ATOM   9959  C "C4'" . DA  J 7 30  ? 139.196 144.652 110.649 1.00 206.16 ? 81  DA  I "C4'" 1 
ATOM   9960  O "O4'" . DA  J 7 30  ? 140.607 144.815 110.920 1.00 206.16 ? 81  DA  I "O4'" 1 
ATOM   9961  C "C3'" . DA  J 7 30  ? 138.916 143.186 110.913 1.00 206.16 ? 81  DA  I "C3'" 1 
ATOM   9962  O "O3'" . DA  J 7 30  ? 139.257 142.422 109.766 1.00 206.16 ? 81  DA  I "O3'" 1 
ATOM   9963  C "C2'" . DA  J 7 30  ? 139.854 142.899 112.070 1.00 206.16 ? 81  DA  I "C2'" 1 
ATOM   9964  C "C1'" . DA  J 7 30  ? 141.072 143.738 111.708 1.00 206.16 ? 81  DA  I "C1'" 1 
ATOM   9965  N N9    . DA  J 7 30  ? 141.727 144.285 112.878 1.00 206.16 ? 81  DA  I N9    1 
ATOM   9966  C C8    . DA  J 7 30  ? 141.119 144.862 113.945 1.00 206.16 ? 81  DA  I C8    1 
ATOM   9967  N N7    . DA  J 7 30  ? 141.945 145.269 114.869 1.00 206.16 ? 81  DA  I N7    1 
ATOM   9968  C C5    . DA  J 7 30  ? 143.182 144.930 114.373 1.00 206.16 ? 81  DA  I C5    1 
ATOM   9969  C C6    . DA  J 7 30  ? 144.470 145.084 114.886 1.00 206.16 ? 81  DA  I C6    1 
ATOM   9970  N N6    . DA  J 7 30  ? 144.720 145.666 116.055 1.00 206.16 ? 81  DA  I N6    1 
ATOM   9971  N N1    . DA  J 7 30  ? 145.501 144.637 114.140 1.00 206.16 ? 81  DA  I N1    1 
ATOM   9972  C C2    . DA  J 7 30  ? 145.246 144.064 112.961 1.00 206.16 ? 81  DA  I C2    1 
ATOM   9973  N N3    . DA  J 7 30  ? 144.068 143.854 112.379 1.00 206.16 ? 81  DA  I N3    1 
ATOM   9974  C C4    . DA  J 7 30  ? 143.070 144.325 113.142 1.00 206.16 ? 81  DA  I C4    1 
ATOM   9975  P P     . DC  J 7 31  ? 139.002 140.835 109.724 1.00 210.97 ? 82  DC  I P     1 
ATOM   9976  O OP1   . DC  J 7 31  ? 138.581 140.510 108.348 1.00 210.97 ? 82  DC  I OP1   1 
ATOM   9977  O OP2   . DC  J 7 31  ? 138.141 140.426 110.854 1.00 210.97 ? 82  DC  I OP2   1 
ATOM   9978  O "O5'" . DC  J 7 31  ? 140.456 140.219 109.929 1.00 210.97 ? 82  DC  I "O5'" 1 
ATOM   9979  C "C5'" . DC  J 7 31  ? 141.407 140.337 108.890 1.00 210.97 ? 82  DC  I "C5'" 1 
ATOM   9980  C "C4'" . DC  J 7