data_6NEA
# 
_entry.id   6NEA 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.329 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6NEA         
WWPDB D_1000238635 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6NEA 
_pdbx_database_status.recvd_initial_deposition_date   2018-12-17 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Bester, S.M.' 1 0000-0001-7137-0090 
'McGuire, J.'  2 0000-0002-7589-7268 
'Height, J.J.' 3 0000-0003-2100-9146 
'Pegan, S.D.'  4 0000-0002-2958-5319 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            'Acs Med.Chem.Lett.' 
_citation.journal_id_ASTM           ? 
_citation.journal_id_CSD            ? 
_citation.journal_id_ISSN           1948-5875 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            10 
_citation.language                  ? 
_citation.page_first                761 
_citation.page_last                 766 
_citation.title                     'Synthesis and Molecular Properties of Nerve Agent Reactivator HLo-7 Dimethanesulfonate.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acsmedchemlett.9b00021 
_citation.pdbx_database_id_PubMed   31097996 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Hsu, F.L.'      1 ? 
primary 'Bae, S.Y.'      2 ? 
primary 'McGuire, J.'    3 ? 
primary 'Anderson, D.R.' 4 ? 
primary 'Bester, S.M.'   5 ? 
primary 'Height, J.J.'   6 ? 
primary 'Pegan, S.D.'    7 ? 
primary 'Walz, A.J.'     8 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  120.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6NEA 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     104.730 
_cell.length_a_esd                 ? 
_cell.length_b                     104.730 
_cell.length_b_esd                 ? 
_cell.length_c                     324.247 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        12 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6NEA 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                152 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 31 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man Acetylcholinesterase 59447.105 2   3.1.1.7 ? ? ? 
2 branched    man 
'2-acetamido-2-deoxy-beta-D-glucopyranose-(1-4)-[alpha-L-fucopyranose-(1-6)]2-acetamido-2-deoxy-beta-D-glucopyranose' 570.542   2 
?       ? ? ? 
3 non-polymer man 2-acetamido-2-deoxy-beta-D-glucopyranose 221.208   4   ?       ? ? ? 
4 non-polymer syn '1-[({2,4-BIS[(E)-(HYDROXYIMINO)METHYL]PYRIDINIUM-1-YL}METHOXY)METHYL]-4-CARBAMOYLPYRIDINIUM' 331.327   2   ? ? 
? ? 
5 non-polymer man alpha-L-fucopyranose 164.156   1   ?       ? ? ? 
6 water       nat water 18.015    633 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        AChE 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   ARG n 
1 3   GLU n 
1 4   ASP n 
1 5   ALA n 
1 6   GLU n 
1 7   LEU n 
1 8   LEU n 
1 9   VAL n 
1 10  THR n 
1 11  VAL n 
1 12  ARG n 
1 13  GLY n 
1 14  GLY n 
1 15  ARG n 
1 16  LEU n 
1 17  ARG n 
1 18  GLY n 
1 19  ILE n 
1 20  ARG n 
1 21  LEU n 
1 22  LYS n 
1 23  THR n 
1 24  PRO n 
1 25  GLY n 
1 26  GLY n 
1 27  PRO n 
1 28  VAL n 
1 29  SER n 
1 30  ALA n 
1 31  PHE n 
1 32  LEU n 
1 33  GLY n 
1 34  ILE n 
1 35  PRO n 
1 36  PHE n 
1 37  ALA n 
1 38  GLU n 
1 39  PRO n 
1 40  PRO n 
1 41  MET n 
1 42  GLY n 
1 43  PRO n 
1 44  ARG n 
1 45  ARG n 
1 46  PHE n 
1 47  LEU n 
1 48  PRO n 
1 49  PRO n 
1 50  GLU n 
1 51  PRO n 
1 52  LYS n 
1 53  GLN n 
1 54  PRO n 
1 55  TRP n 
1 56  SER n 
1 57  GLY n 
1 58  VAL n 
1 59  VAL n 
1 60  ASP n 
1 61  ALA n 
1 62  THR n 
1 63  THR n 
1 64  PHE n 
1 65  GLN n 
1 66  SER n 
1 67  VAL n 
1 68  CYS n 
1 69  TYR n 
1 70  GLN n 
1 71  TYR n 
1 72  VAL n 
1 73  ASP n 
1 74  THR n 
1 75  LEU n 
1 76  TYR n 
1 77  PRO n 
1 78  GLY n 
1 79  PHE n 
1 80  GLU n 
1 81  GLY n 
1 82  THR n 
1 83  GLU n 
1 84  MET n 
1 85  TRP n 
1 86  ASN n 
1 87  PRO n 
1 88  ASN n 
1 89  ARG n 
1 90  GLU n 
1 91  LEU n 
1 92  SER n 
1 93  GLU n 
1 94  ASP n 
1 95  CYS n 
1 96  LEU n 
1 97  TYR n 
1 98  LEU n 
1 99  ASN n 
1 100 VAL n 
1 101 TRP n 
1 102 THR n 
1 103 PRO n 
1 104 TYR n 
1 105 PRO n 
1 106 ARG n 
1 107 PRO n 
1 108 THR n 
1 109 SER n 
1 110 PRO n 
1 111 THR n 
1 112 PRO n 
1 113 VAL n 
1 114 LEU n 
1 115 VAL n 
1 116 TRP n 
1 117 ILE n 
1 118 TYR n 
1 119 GLY n 
1 120 GLY n 
1 121 GLY n 
1 122 PHE n 
1 123 TYR n 
1 124 SER n 
1 125 GLY n 
1 126 ALA n 
1 127 SER n 
1 128 SER n 
1 129 LEU n 
1 130 ASP n 
1 131 VAL n 
1 132 TYR n 
1 133 ASP n 
1 134 GLY n 
1 135 ARG n 
1 136 PHE n 
1 137 LEU n 
1 138 VAL n 
1 139 GLN n 
1 140 ALA n 
1 141 GLU n 
1 142 ARG n 
1 143 THR n 
1 144 VAL n 
1 145 LEU n 
1 146 VAL n 
1 147 SER n 
1 148 MET n 
1 149 ASN n 
1 150 TYR n 
1 151 ARG n 
1 152 VAL n 
1 153 GLY n 
1 154 ALA n 
1 155 PHE n 
1 156 GLY n 
1 157 PHE n 
1 158 LEU n 
1 159 ALA n 
1 160 LEU n 
1 161 PRO n 
1 162 GLY n 
1 163 SER n 
1 164 ARG n 
1 165 GLU n 
1 166 ALA n 
1 167 PRO n 
1 168 GLY n 
1 169 ASN n 
1 170 VAL n 
1 171 GLY n 
1 172 LEU n 
1 173 LEU n 
1 174 ASP n 
1 175 GLN n 
1 176 ARG n 
1 177 LEU n 
1 178 ALA n 
1 179 LEU n 
1 180 GLN n 
1 181 TRP n 
1 182 VAL n 
1 183 GLN n 
1 184 GLU n 
1 185 ASN n 
1 186 VAL n 
1 187 ALA n 
1 188 ALA n 
1 189 PHE n 
1 190 GLY n 
1 191 GLY n 
1 192 ASP n 
1 193 PRO n 
1 194 THR n 
1 195 SER n 
1 196 VAL n 
1 197 THR n 
1 198 LEU n 
1 199 PHE n 
1 200 GLY n 
1 201 GLU n 
1 202 SER n 
1 203 ALA n 
1 204 GLY n 
1 205 ALA n 
1 206 ALA n 
1 207 SER n 
1 208 VAL n 
1 209 GLY n 
1 210 MET n 
1 211 HIS n 
1 212 LEU n 
1 213 LEU n 
1 214 SER n 
1 215 PRO n 
1 216 PRO n 
1 217 SER n 
1 218 ARG n 
1 219 GLY n 
1 220 LEU n 
1 221 PHE n 
1 222 HIS n 
1 223 ARG n 
1 224 ALA n 
1 225 VAL n 
1 226 LEU n 
1 227 GLN n 
1 228 SER n 
1 229 GLY n 
1 230 ALA n 
1 231 PRO n 
1 232 ASN n 
1 233 GLY n 
1 234 PRO n 
1 235 TRP n 
1 236 ALA n 
1 237 THR n 
1 238 VAL n 
1 239 GLY n 
1 240 MET n 
1 241 GLY n 
1 242 GLU n 
1 243 ALA n 
1 244 ARG n 
1 245 ARG n 
1 246 ARG n 
1 247 ALA n 
1 248 THR n 
1 249 GLN n 
1 250 LEU n 
1 251 ALA n 
1 252 HIS n 
1 253 LEU n 
1 254 VAL n 
1 255 GLY n 
1 256 CYS n 
1 257 PRO n 
1 258 PRO n 
1 259 GLY n 
1 260 GLY n 
1 261 THR n 
1 262 GLY n 
1 263 GLY n 
1 264 ASN n 
1 265 ASP n 
1 266 THR n 
1 267 GLU n 
1 268 LEU n 
1 269 VAL n 
1 270 ALA n 
1 271 CYS n 
1 272 LEU n 
1 273 ARG n 
1 274 THR n 
1 275 ARG n 
1 276 PRO n 
1 277 ALA n 
1 278 GLN n 
1 279 VAL n 
1 280 LEU n 
1 281 VAL n 
1 282 ASN n 
1 283 HIS n 
1 284 GLU n 
1 285 TRP n 
1 286 HIS n 
1 287 VAL n 
1 288 LEU n 
1 289 PRO n 
1 290 GLN n 
1 291 GLU n 
1 292 SER n 
1 293 VAL n 
1 294 PHE n 
1 295 ARG n 
1 296 PHE n 
1 297 SER n 
1 298 PHE n 
1 299 VAL n 
1 300 PRO n 
1 301 VAL n 
1 302 VAL n 
1 303 ASP n 
1 304 GLY n 
1 305 ASP n 
1 306 PHE n 
1 307 LEU n 
1 308 SER n 
1 309 ASP n 
1 310 THR n 
1 311 PRO n 
1 312 GLU n 
1 313 ALA n 
1 314 LEU n 
1 315 ILE n 
1 316 ASN n 
1 317 ALA n 
1 318 GLY n 
1 319 ASP n 
1 320 PHE n 
1 321 HIS n 
1 322 GLY n 
1 323 LEU n 
1 324 GLN n 
1 325 VAL n 
1 326 LEU n 
1 327 VAL n 
1 328 GLY n 
1 329 VAL n 
1 330 VAL n 
1 331 LYS n 
1 332 ASP n 
1 333 GLU n 
1 334 GLY n 
1 335 SER n 
1 336 TYR n 
1 337 PHE n 
1 338 LEU n 
1 339 VAL n 
1 340 TYR n 
1 341 GLY n 
1 342 ALA n 
1 343 PRO n 
1 344 GLY n 
1 345 PHE n 
1 346 SER n 
1 347 LYS n 
1 348 ASP n 
1 349 ASN n 
1 350 GLU n 
1 351 SER n 
1 352 LEU n 
1 353 ILE n 
1 354 SER n 
1 355 ARG n 
1 356 ALA n 
1 357 GLU n 
1 358 PHE n 
1 359 LEU n 
1 360 ALA n 
1 361 GLY n 
1 362 VAL n 
1 363 ARG n 
1 364 VAL n 
1 365 GLY n 
1 366 VAL n 
1 367 PRO n 
1 368 GLN n 
1 369 VAL n 
1 370 SER n 
1 371 ASP n 
1 372 LEU n 
1 373 ALA n 
1 374 ALA n 
1 375 GLU n 
1 376 ALA n 
1 377 VAL n 
1 378 VAL n 
1 379 LEU n 
1 380 HIS n 
1 381 TYR n 
1 382 THR n 
1 383 ASP n 
1 384 TRP n 
1 385 LEU n 
1 386 HIS n 
1 387 PRO n 
1 388 GLU n 
1 389 ASP n 
1 390 PRO n 
1 391 ALA n 
1 392 ARG n 
1 393 LEU n 
1 394 ARG n 
1 395 GLU n 
1 396 ALA n 
1 397 LEU n 
1 398 SER n 
1 399 ASP n 
1 400 VAL n 
1 401 VAL n 
1 402 GLY n 
1 403 ASP n 
1 404 HIS n 
1 405 ASN n 
1 406 VAL n 
1 407 VAL n 
1 408 CYS n 
1 409 PRO n 
1 410 VAL n 
1 411 ALA n 
1 412 GLN n 
1 413 LEU n 
1 414 ALA n 
1 415 GLY n 
1 416 ARG n 
1 417 LEU n 
1 418 ALA n 
1 419 ALA n 
1 420 GLN n 
1 421 GLY n 
1 422 ALA n 
1 423 ARG n 
1 424 VAL n 
1 425 TYR n 
1 426 ALA n 
1 427 TYR n 
1 428 VAL n 
1 429 PHE n 
1 430 GLU n 
1 431 HIS n 
1 432 ARG n 
1 433 ALA n 
1 434 SER n 
1 435 THR n 
1 436 LEU n 
1 437 SER n 
1 438 TRP n 
1 439 PRO n 
1 440 LEU n 
1 441 TRP n 
1 442 MET n 
1 443 GLY n 
1 444 VAL n 
1 445 PRO n 
1 446 HIS n 
1 447 GLY n 
1 448 TYR n 
1 449 GLU n 
1 450 ILE n 
1 451 GLU n 
1 452 PHE n 
1 453 ILE n 
1 454 PHE n 
1 455 GLY n 
1 456 ILE n 
1 457 PRO n 
1 458 LEU n 
1 459 ASP n 
1 460 PRO n 
1 461 SER n 
1 462 ARG n 
1 463 ASN n 
1 464 TYR n 
1 465 THR n 
1 466 ALA n 
1 467 GLU n 
1 468 GLU n 
1 469 LYS n 
1 470 ILE n 
1 471 PHE n 
1 472 ALA n 
1 473 GLN n 
1 474 ARG n 
1 475 LEU n 
1 476 MET n 
1 477 ARG n 
1 478 TYR n 
1 479 TRP n 
1 480 ALA n 
1 481 ASN n 
1 482 PHE n 
1 483 ALA n 
1 484 ARG n 
1 485 THR n 
1 486 GLY n 
1 487 ASP n 
1 488 PRO n 
1 489 ASN n 
1 490 GLU n 
1 491 PRO n 
1 492 ARG n 
1 493 ASP n 
1 494 PRO n 
1 495 LYS n 
1 496 ALA n 
1 497 PRO n 
1 498 GLN n 
1 499 TRP n 
1 500 PRO n 
1 501 PRO n 
1 502 TYR n 
1 503 THR n 
1 504 ALA n 
1 505 GLY n 
1 506 ALA n 
1 507 GLN n 
1 508 GLN n 
1 509 TYR n 
1 510 VAL n 
1 511 SER n 
1 512 LEU n 
1 513 ASP n 
1 514 LEU n 
1 515 ARG n 
1 516 PRO n 
1 517 LEU n 
1 518 GLU n 
1 519 VAL n 
1 520 ARG n 
1 521 ARG n 
1 522 GLY n 
1 523 LEU n 
1 524 ARG n 
1 525 ALA n 
1 526 GLN n 
1 527 ALA n 
1 528 CYS n 
1 529 ALA n 
1 530 PHE n 
1 531 TRP n 
1 532 ASN n 
1 533 ARG n 
1 534 PHE n 
1 535 LEU n 
1 536 PRO n 
1 537 LYS n 
1 538 LEU n 
1 539 LEU n 
1 540 SER n 
1 541 ALA n 
1 542 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      'Biological sequence' 
_entity_src_gen.pdbx_beg_seq_num                   1 
_entity_src_gen.pdbx_end_seq_num                   542 
_entity_src_gen.gene_src_common_name               Human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 ACHE 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     9606 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACES_HUMAN 
_struct_ref.pdbx_db_accession          P22303 
_struct_ref.pdbx_db_isoform            ? 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GREDAELLVTVRGGRLRGIRLKTPGGPVSAFLGIPFAEPPMGPRRFLPPEPKQPWSGVVDATTFQSVCYQYVDTLYPGFE
GTEMWNPNRELSEDCLYLNVWTPYPRPTSPTPVLVWIYGGGFYSGASSLDVYDGRFLVQAERTVLVSMNYRVGAFGFLAL
PGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSVTLFGESAGAASVGMHLLSPPSRGLFHRAVLQSGAPNGPWATVGM
GEARRRATQLAHLVGCPPGGTGGNDTELVACLRTRPAQVLVNHEWHVLPQESVFRFSFVPVVDGDFLSDTPEALINAGDF
HGLQVLVGVVKDEGSYFLVYGAPGFSKDNESLISRAEFLAGVRVGVPQVSDLAAEAVVLHYTDWLHPEDPARLREALSDV
VGDHNVVCPVAQLAGRLAAQGARVYAYVFEHRASTLSWPLWMGVPHGYEIEFIFGIPLDPSRNYTAEEKIFAQRLMRYWA
NFARTGDPNEPRDPKAPQWPPYTAGAQQYVSLDLRPLEVRRGLRAQACAFWNRFLPKLLSAT
;
_struct_ref.pdbx_align_begin           33 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 6NEA A 1 ? 542 ? P22303 33 ? 574 ? 2 543 
2 1 6NEA B 1 ? 542 ? P22303 33 ? 574 ? 2 543 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking'           y ALANINE                                                                                       
? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking'           y ARGININE                                                                                      
? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking'           y ASPARAGINE                                                                                    
? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking'           y 'ASPARTIC ACID'                                                                               
? 'C4 H7 N O4'      133.103 
CYS 'L-peptide linking'           y CYSTEINE                                                                                      
? 'C3 H7 N O2 S'    121.158 
FUC 'L-saccharide, alpha linking' . alpha-L-fucopyranose                                                                          
? 'C6 H12 O5'       164.156 
GLN 'L-peptide linking'           y GLUTAMINE                                                                                     
? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking'           y 'GLUTAMIC ACID'                                                                               
? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'             y GLYCINE                                                                                       
? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking'           y HISTIDINE                                                                                     
? 'C6 H10 N3 O2 1'  156.162 
HLO non-polymer                   . '1-[({2,4-BIS[(E)-(HYDROXYIMINO)METHYL]PYRIDINIUM-1-YL}METHOXY)METHYL]-4-CARBAMOYLPYRIDINIUM' 
? 'C15 H17 N5 O4 2' 331.327 
HOH non-polymer                   . WATER                                                                                         
? 'H2 O'            18.015  
ILE 'L-peptide linking'           y ISOLEUCINE                                                                                    
? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking'           y LEUCINE                                                                                       
? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking'           y LYSINE                                                                                        
? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking'           y METHIONINE                                                                                    
? 'C5 H11 N O2 S'   149.211 
NAG 'D-saccharide, beta linking'  . 2-acetamido-2-deoxy-beta-D-glucopyranose                                                      
? 'C8 H15 N O6'     221.208 
PHE 'L-peptide linking'           y PHENYLALANINE                                                                                 
? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking'           y PROLINE                                                                                       
? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking'           y SERINE                                                                                        
? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking'           y THREONINE                                                                                     
? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking'           y TRYPTOPHAN                                                                                    
? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking'           y TYROSINE                                                                                      
? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking'           y VALINE                                                                                        
? 'C5 H11 N O2'     117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6NEA 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            4.32 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         71.51 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              7 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    
'15 to 21% PEG 3350, 0.17 - 0.2M potassium nitrate, pH 7.0, VAPOR DIFFUSION, SITTING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment              ? 
_diffrn.ambient_temp                     100 
_diffrn.ambient_temp_details             ? 
_diffrn.ambient_temp_esd                 ? 
_diffrn.crystal_id                       1 
_diffrn.crystal_support                  ? 
_diffrn.crystal_treatment                ? 
_diffrn.details                          ? 
_diffrn.id                               1 
_diffrn.ambient_pressure                 ? 
_diffrn.ambient_pressure_esd             ? 
_diffrn.ambient_pressure_gt              ? 
_diffrn.ambient_pressure_lt              ? 
_diffrn.ambient_temp_gt                  ? 
_diffrn.ambient_temp_lt                  ? 
_diffrn.pdbx_serial_crystal_experiment   N 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'MARMOSAIC 300 mm CCD' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2016-10-16 
_diffrn_detector.pdbx_frequency               ? 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'APS BEAMLINE 22-ID' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   22-ID 
_diffrn_source.pdbx_synchrotron_site       APS 
# 
_reflns.B_iso_Wilson_estimate            ? 
_reflns.entry_id                         6NEA 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                2.419 
_reflns.d_resolution_low                 50.0 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       79654 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             99.5 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  5.6 
_reflns.pdbx_Rmerge_I_obs                0.111 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         ? 
_reflns.pdbx_netI_over_sigmaI            12.89 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 ? 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  ? 
_reflns.pdbx_Rpim_I_all                  0.052 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         ? 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
_reflns_shell.d_res_high                  2.419 
_reflns_shell.d_res_low                   2.46 
_reflns_shell.meanI_over_sigI_all         ? 
_reflns_shell.meanI_over_sigI_obs         2.55 
_reflns_shell.number_measured_all         ? 
_reflns_shell.number_measured_obs         ? 
_reflns_shell.number_possible             ? 
_reflns_shell.number_unique_all           ? 
_reflns_shell.number_unique_obs           ? 
_reflns_shell.percent_possible_all        93.3 
_reflns_shell.percent_possible_obs        ? 
_reflns_shell.Rmerge_F_all                ? 
_reflns_shell.Rmerge_F_obs                ? 
_reflns_shell.Rmerge_I_all                ? 
_reflns_shell.Rmerge_I_obs                0.629 
_reflns_shell.meanI_over_sigI_gt          ? 
_reflns_shell.meanI_over_uI_all           ? 
_reflns_shell.meanI_over_uI_gt            ? 
_reflns_shell.number_measured_gt          ? 
_reflns_shell.number_unique_gt            ? 
_reflns_shell.percent_possible_gt         ? 
_reflns_shell.Rmerge_F_gt                 ? 
_reflns_shell.Rmerge_I_gt                 ? 
_reflns_shell.pdbx_redundancy             4.4 
_reflns_shell.pdbx_Rsym_value             ? 
_reflns_shell.pdbx_chi_squared            ? 
_reflns_shell.pdbx_netI_over_sigmaI_all   ? 
_reflns_shell.pdbx_netI_over_sigmaI_obs   ? 
_reflns_shell.pdbx_Rrim_I_all             ? 
_reflns_shell.pdbx_Rpim_I_all             0.335 
_reflns_shell.pdbx_rejects                ? 
_reflns_shell.pdbx_ordinal                1 
_reflns_shell.pdbx_diffrn_id              1 
_reflns_shell.pdbx_CC_half                0.816 
_reflns_shell.pdbx_R_split                ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                ? 
_refine.B_iso_mean                               ? 
_refine.B_iso_min                                ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 6NEA 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            2.419 
_refine.ls_d_res_low                             41.252 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     79534 
_refine.ls_number_reflns_R_free                  3962 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    99.59 
_refine.ls_percent_reflns_R_free                 4.98 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.1772 
_refine.ls_R_factor_R_free                       0.2054 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1757 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.34 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4EY4 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 21.35 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.23 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8249 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         190 
_refine_hist.number_atoms_solvent             633 
_refine_hist.number_atoms_total               9072 
_refine_hist.d_res_high                       2.419 
_refine_hist.d_res_low                        41.252 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.003 ? 8742  ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 0.689 ? 11965 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 4.865 ? 6948  ? f_dihedral_angle_d ? ? 
'X-RAY DIFFRACTION' ? 0.047 ? 1295  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.005 ? 1568  ? f_plane_restr      ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 2.4191 2.4486  . . 124 2529 94.00  . . . 0.2918 . 0.2500 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4486 2.4796  . . 135 2673 100.00 . . . 0.3038 . 0.2418 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.4796 2.5122  . . 133 2666 100.00 . . . 0.2740 . 0.2216 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5122 2.5466  . . 152 2661 100.00 . . . 0.2741 . 0.2120 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5466 2.5830  . . 158 2634 100.00 . . . 0.2518 . 0.2061 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.5830 2.6215  . . 148 2713 100.00 . . . 0.2488 . 0.1992 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6215 2.6625  . . 152 2632 100.00 . . . 0.2261 . 0.1986 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.6625 2.7061  . . 126 2680 100.00 . . . 0.2740 . 0.2035 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7061 2.7528  . . 137 2711 100.00 . . . 0.2587 . 0.2009 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.7528 2.8028  . . 147 2634 100.00 . . . 0.2443 . 0.2011 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8028 2.8567  . . 136 2700 100.00 . . . 0.2677 . 0.2055 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.8567 2.9150  . . 157 2681 100.00 . . . 0.2508 . 0.1995 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9150 2.9784  . . 107 2706 100.00 . . . 0.2823 . 0.2009 . . . . . . . . . . 
'X-RAY DIFFRACTION' 2.9784 3.0477  . . 142 2660 100.00 . . . 0.2261 . 0.1868 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.0477 3.1239  . . 141 2677 100.00 . . . 0.2152 . 0.1818 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.1239 3.2083  . . 129 2703 100.00 . . . 0.2199 . 0.1834 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.2083 3.3027  . . 172 2686 100.00 . . . 0.2012 . 0.1874 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.3027 3.4092  . . 127 2715 100.00 . . . 0.2283 . 0.1802 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.4092 3.5310  . . 121 2708 100.00 . . . 0.1898 . 0.1795 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.5310 3.6723  . . 141 2684 100.00 . . . 0.1970 . 0.1714 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.6723 3.8393  . . 151 2719 100.00 . . . 0.1877 . 0.1563 . . . . . . . . . . 
'X-RAY DIFFRACTION' 3.8393 4.0416  . . 141 2721 100.00 . . . 0.1843 . 0.1502 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.0416 4.2945  . . 151 2691 100.00 . . . 0.1742 . 0.1451 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.2945 4.6257  . . 145 2731 100.00 . . . 0.1312 . 0.1337 . . . . . . . . . . 
'X-RAY DIFFRACTION' 4.6257 5.0904  . . 156 2748 100.00 . . . 0.1641 . 0.1434 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.0904 5.8253  . . 129 2802 100.00 . . . 0.2061 . 0.1733 . . . . . . . . . . 
'X-RAY DIFFRACTION' 5.8253 7.3325  . . 154 2791 100.00 . . . 0.2216 . 0.1870 . . . . . . . . . . 
'X-RAY DIFFRACTION' 7.3325 41.2585 . . 150 2916 98.00  . . . 0.1940 . 0.1827 . . . . . . . . . . 
# 
_struct.entry_id                     6NEA 
_struct.title                        'Human Acetylcholinesterase in complex with reactivator, HLo7' 
_struct.pdbx_descriptor              'Acetylcholinesterase (E.C.3.1.1.7)' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6NEA 
_struct_keywords.text            Hydrolase 
_struct_keywords.pdbx_keywords   HYDROLASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 4 ? 
G N N 5 ? 
H N N 3 ? 
I N N 3 ? 
J N N 3 ? 
K N N 4 ? 
L N N 6 ? 
M N N 6 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASP A 4   ? GLU A 6   ? ASP A 5   GLU A 7   5 ? 3  
HELX_P HELX_P2  AA2 MET A 41  ? ARG A 45  ? MET A 42  ARG A 46  5 ? 5  
HELX_P HELX_P3  AA3 PHE A 79  ? MET A 84  ? PHE A 80  MET A 85  1 ? 6  
HELX_P HELX_P4  AA4 LEU A 129 ? ASP A 133 ? LEU A 130 ASP A 134 5 ? 5  
HELX_P HELX_P5  AA5 GLY A 134 ? ARG A 142 ? GLY A 135 ARG A 143 1 ? 9  
HELX_P HELX_P6  AA6 GLY A 153 ? LEU A 158 ? GLY A 154 LEU A 159 1 ? 6  
HELX_P HELX_P7  AA7 ASN A 169 ? VAL A 186 ? ASN A 170 VAL A 187 1 ? 18 
HELX_P HELX_P8  AA8 ALA A 187 ? PHE A 189 ? ALA A 188 PHE A 190 5 ? 3  
HELX_P HELX_P9  AA9 SER A 202 ? SER A 214 ? SER A 203 SER A 215 1 ? 13 
HELX_P HELX_P10 AB1 SER A 214 ? GLY A 219 ? SER A 215 GLY A 220 1 ? 6  
HELX_P HELX_P11 AB2 MET A 240 ? VAL A 254 ? MET A 241 VAL A 255 1 ? 15 
HELX_P HELX_P12 AB3 ASN A 264 ? THR A 274 ? ASN A 265 THR A 275 1 ? 11 
HELX_P HELX_P13 AB4 PRO A 276 ? GLU A 284 ? PRO A 277 GLU A 285 1 ? 9  
HELX_P HELX_P14 AB5 TRP A 285 ? LEU A 288 ? TRP A 286 LEU A 289 5 ? 4  
HELX_P HELX_P15 AB6 THR A 310 ? ALA A 317 ? THR A 311 ALA A 318 1 ? 8  
HELX_P HELX_P16 AB7 GLY A 334 ? VAL A 339 ? GLY A 335 VAL A 340 1 ? 6  
HELX_P HELX_P17 AB8 SER A 354 ? VAL A 366 ? SER A 355 VAL A 367 1 ? 13 
HELX_P HELX_P18 AB9 SER A 370 ? THR A 382 ? SER A 371 THR A 383 1 ? 13 
HELX_P HELX_P19 AC1 ASP A 389 ? VAL A 406 ? ASP A 390 VAL A 407 1 ? 18 
HELX_P HELX_P20 AC2 VAL A 406 ? GLN A 420 ? VAL A 407 GLN A 421 1 ? 15 
HELX_P HELX_P21 AC3 PRO A 439 ? GLY A 443 ? PRO A 440 GLY A 444 5 ? 5  
HELX_P HELX_P22 AC4 GLU A 449 ? PHE A 454 ? GLU A 450 PHE A 455 1 ? 6  
HELX_P HELX_P23 AC5 GLY A 455 ? ASP A 459 ? GLY A 456 ASP A 460 5 ? 5  
HELX_P HELX_P24 AC6 THR A 465 ? GLY A 486 ? THR A 466 GLY A 487 1 ? 22 
HELX_P HELX_P25 AC7 ARG A 524 ? ARG A 533 ? ARG A 525 ARG A 534 1 ? 10 
HELX_P HELX_P26 AC8 ARG A 533 ? ALA A 541 ? ARG A 534 ALA A 542 1 ? 9  
HELX_P HELX_P27 AC9 ASP B 4   ? GLU B 6   ? ASP B 5   GLU B 7   5 ? 3  
HELX_P HELX_P28 AD1 MET B 41  ? ARG B 45  ? MET B 42  ARG B 46  5 ? 5  
HELX_P HELX_P29 AD2 PHE B 79  ? MET B 84  ? PHE B 80  MET B 85  1 ? 6  
HELX_P HELX_P30 AD3 LEU B 129 ? ASP B 133 ? LEU B 130 ASP B 134 5 ? 5  
HELX_P HELX_P31 AD4 GLY B 134 ? ARG B 142 ? GLY B 135 ARG B 143 1 ? 9  
HELX_P HELX_P32 AD5 GLY B 153 ? LEU B 158 ? GLY B 154 LEU B 159 1 ? 6  
HELX_P HELX_P33 AD6 ASN B 169 ? VAL B 186 ? ASN B 170 VAL B 187 1 ? 18 
HELX_P HELX_P34 AD7 ALA B 187 ? PHE B 189 ? ALA B 188 PHE B 190 5 ? 3  
HELX_P HELX_P35 AD8 SER B 202 ? LEU B 213 ? SER B 203 LEU B 214 1 ? 12 
HELX_P HELX_P36 AD9 SER B 214 ? GLY B 219 ? SER B 215 GLY B 220 1 ? 6  
HELX_P HELX_P37 AE1 GLY B 239 ? VAL B 254 ? GLY B 240 VAL B 255 1 ? 16 
HELX_P HELX_P38 AE2 ASP B 265 ? THR B 274 ? ASP B 266 THR B 275 1 ? 10 
HELX_P HELX_P39 AE3 PRO B 276 ? GLU B 284 ? PRO B 277 GLU B 285 1 ? 9  
HELX_P HELX_P40 AE4 TRP B 285 ? LEU B 288 ? TRP B 286 LEU B 289 5 ? 4  
HELX_P HELX_P41 AE5 THR B 310 ? ALA B 317 ? THR B 311 ALA B 318 1 ? 8  
HELX_P HELX_P42 AE6 GLY B 334 ? GLY B 341 ? GLY B 335 GLY B 342 5 ? 8  
HELX_P HELX_P43 AE7 SER B 354 ? VAL B 366 ? SER B 355 VAL B 367 1 ? 13 
HELX_P HELX_P44 AE8 SER B 370 ? THR B 382 ? SER B 371 THR B 383 1 ? 13 
HELX_P HELX_P45 AE9 ASP B 389 ? VAL B 406 ? ASP B 390 VAL B 407 1 ? 18 
HELX_P HELX_P46 AF1 VAL B 406 ? GLN B 420 ? VAL B 407 GLN B 421 1 ? 15 
HELX_P HELX_P47 AF2 PRO B 439 ? GLY B 443 ? PRO B 440 GLY B 444 5 ? 5  
HELX_P HELX_P48 AF3 GLU B 449 ? PHE B 454 ? GLU B 450 PHE B 455 1 ? 6  
HELX_P HELX_P49 AF4 GLY B 455 ? ASP B 459 ? GLY B 456 ASP B 460 5 ? 5  
HELX_P HELX_P50 AF5 THR B 465 ? GLY B 486 ? THR B 466 GLY B 487 1 ? 22 
HELX_P HELX_P51 AF6 ARG B 524 ? ARG B 533 ? ARG B 525 ARG B 534 1 ? 10 
HELX_P HELX_P52 AF7 ARG B 533 ? SER B 540 ? ARG B 534 SER B 541 1 ? 8  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
disulf1 disulf ?    ? A CYS 68  SG  ? ? ? 1_555 A CYS 95  SG ? ? A CYS 69  A CYS 96  1_555 ? ? ? ? ? ? ? 2.044 ? ?               
disulf2 disulf ?    ? A CYS 256 SG  ? ? ? 1_555 A CYS 271 SG ? ? A CYS 257 A CYS 272 1_555 ? ? ? ? ? ? ? 2.040 ? ?               
disulf3 disulf ?    ? A CYS 408 SG  ? ? ? 1_555 A CYS 528 SG ? ? A CYS 409 A CYS 529 1_555 ? ? ? ? ? ? ? 2.001 ? ?               
disulf4 disulf ?    ? B CYS 68  SG  ? ? ? 1_555 B CYS 95  SG ? ? B CYS 69  B CYS 96  1_555 ? ? ? ? ? ? ? 2.049 ? ?               
disulf5 disulf ?    ? B CYS 256 SG  ? ? ? 1_555 B CYS 271 SG ? ? B CYS 257 B CYS 272 1_555 ? ? ? ? ? ? ? 2.033 ? ?               
disulf6 disulf ?    ? B CYS 408 SG  ? ? ? 1_555 B CYS 528 SG ? ? B CYS 409 B CYS 529 1_555 ? ? ? ? ? ? ? 2.047 ? ?               
covale1 covale one  ? A ASN 349 ND2 ? ? ? 1_555 C NAG .   C1 ? ? A ASN 350 C NAG 1   1_555 ? ? ? ? ? ? ? 1.447 ? N-Glycosylation 
covale2 covale one  ? A ASN 463 ND2 ? ? ? 1_555 E NAG .   C1 ? ? A ASN 464 A NAG 604 1_555 ? ? ? ? ? ? ? 1.430 ? N-Glycosylation 
covale3 covale one  ? B ASN 349 ND2 ? ? ? 1_555 D NAG .   C1 ? ? B ASN 350 D NAG 1   1_555 ? ? ? ? ? ? ? 1.443 ? N-Glycosylation 
covale4 covale one  ? B ASN 463 ND2 ? ? ? 1_555 J NAG .   C1 ? ? B ASN 464 B NAG 604 1_555 ? ? ? ? ? ? ? 1.452 ? N-Glycosylation 
covale5 covale both ? C NAG .   O4  ? ? ? 1_555 C NAG .   C1 ? ? C NAG 1   C NAG 2   1_555 ? ? ? ? ? ? ? 1.456 ? ?               
covale6 covale one  ? C NAG .   O6  ? ? ? 1_555 C FUC .   C1 ? ? C NAG 1   C FUC 3   1_555 ? ? ? ? ? ? ? 1.441 ? ?               
covale7 covale both ? D NAG .   O4  ? ? ? 1_555 D NAG .   C1 ? ? D NAG 1   D NAG 2   1_555 ? ? ? ? ? ? ? 1.439 ? ?               
covale8 covale one  ? D NAG .   O6  ? ? ? 1_555 D FUC .   C1 ? ? D NAG 1   D FUC 3   1_555 ? ? ? ? ? ? ? 1.446 ? ?               
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
disulf ? ? 
covale ? ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 TYR 104 A . ? TYR 105 A PRO 105 A ? PRO 106 A 1 0.87  
2 CYS 256 A . ? CYS 257 A PRO 257 A ? PRO 258 A 1 -2.36 
3 TYR 104 B . ? TYR 105 B PRO 105 B ? PRO 106 B 1 -1.74 
4 ALA 496 B . ? ALA 497 B PRO 497 B ? PRO 498 B 1 0.95  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 3  ? 
AA2 ? 11 ? 
AA3 ? 2  ? 
AA4 ? 2  ? 
AA5 ? 3  ? 
AA6 ? 11 ? 
AA7 ? 2  ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1  2  ? anti-parallel 
AA1 2  3  ? parallel      
AA2 1  2  ? anti-parallel 
AA2 2  3  ? anti-parallel 
AA2 3  4  ? anti-parallel 
AA2 4  5  ? parallel      
AA2 5  6  ? parallel      
AA2 6  7  ? parallel      
AA2 7  8  ? parallel      
AA2 8  9  ? parallel      
AA2 9  10 ? parallel      
AA2 10 11 ? anti-parallel 
AA3 1  2  ? parallel      
AA4 1  2  ? parallel      
AA5 1  2  ? anti-parallel 
AA5 2  3  ? parallel      
AA6 1  2  ? anti-parallel 
AA6 2  3  ? anti-parallel 
AA6 3  4  ? anti-parallel 
AA6 4  5  ? parallel      
AA6 5  6  ? parallel      
AA6 6  7  ? parallel      
AA6 7  8  ? parallel      
AA6 8  9  ? parallel      
AA6 9  10 ? parallel      
AA6 10 11 ? anti-parallel 
AA7 1  2  ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1  LEU A 8   ? VAL A 11  ? LEU A 9   VAL A 12  
AA1 2  GLY A 14  ? ARG A 17  ? GLY A 15  ARG A 18  
AA1 3  VAL A 58  ? ASP A 60  ? VAL A 59  ASP A 61  
AA2 1  ILE A 19  ? LYS A 22  ? ILE A 20  LYS A 23  
AA2 2  PRO A 27  ? PRO A 35  ? PRO A 28  PRO A 36  
AA2 3  TYR A 97  ? PRO A 103 ? TYR A 98  PRO A 104 
AA2 4  VAL A 144 ? MET A 148 ? VAL A 145 MET A 149 
AA2 5  THR A 111 ? ILE A 117 ? THR A 112 ILE A 118 
AA2 6  GLY A 191 ? GLU A 201 ? GLY A 192 GLU A 202 
AA2 7  ARG A 223 ? GLN A 227 ? ARG A 224 GLN A 228 
AA2 8  GLN A 324 ? VAL A 330 ? GLN A 325 VAL A 331 
AA2 9  ARG A 423 ? PHE A 429 ? ARG A 424 PHE A 430 
AA2 10 GLN A 508 ? LEU A 512 ? GLN A 509 LEU A 513 
AA2 11 GLU A 518 ? ARG A 521 ? GLU A 519 ARG A 522 
AA3 1  VAL A 67  ? CYS A 68  ? VAL A 68  CYS A 69  
AA3 2  LEU A 91  ? SER A 92  ? LEU A 92  SER A 93  
AA4 1  VAL A 238 ? GLY A 239 ? VAL A 239 GLY A 240 
AA4 2  VAL A 301 ? VAL A 302 ? VAL A 302 VAL A 303 
AA5 1  LEU B 8   ? VAL B 11  ? LEU B 9   VAL B 12  
AA5 2  GLY B 14  ? ARG B 17  ? GLY B 15  ARG B 18  
AA5 3  VAL B 58  ? ASP B 60  ? VAL B 59  ASP B 61  
AA6 1  ILE B 19  ? THR B 23  ? ILE B 20  THR B 24  
AA6 2  GLY B 26  ? PRO B 35  ? GLY B 27  PRO B 36  
AA6 3  TYR B 97  ? PRO B 103 ? TYR B 98  PRO B 104 
AA6 4  VAL B 144 ? MET B 148 ? VAL B 145 MET B 149 
AA6 5  THR B 111 ? ILE B 117 ? THR B 112 ILE B 118 
AA6 6  GLY B 191 ? GLU B 201 ? GLY B 192 GLU B 202 
AA6 7  ARG B 223 ? GLN B 227 ? ARG B 224 GLN B 228 
AA6 8  GLN B 324 ? VAL B 330 ? GLN B 325 VAL B 331 
AA6 9  ARG B 423 ? PHE B 429 ? ARG B 424 PHE B 430 
AA6 10 GLN B 508 ? LEU B 512 ? GLN B 509 LEU B 513 
AA6 11 GLU B 518 ? ARG B 521 ? GLU B 519 ARG B 522 
AA7 1  VAL B 67  ? CYS B 68  ? VAL B 68  CYS B 69  
AA7 2  LEU B 91  ? SER B 92  ? LEU B 92  SER B 93  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1  2  N VAL A 9   ? N VAL A 10  O LEU A 16  ? O LEU A 17  
AA1 2  3  N ARG A 15  ? N ARG A 16  O VAL A 59  ? O VAL A 60  
AA2 1  2  N LEU A 21  ? N LEU A 22  O VAL A 28  ? O VAL A 29  
AA2 2  3  N SER A 29  ? N SER A 30  O THR A 102 ? O THR A 103 
AA2 3  4  N ASN A 99  ? N ASN A 100 O SER A 147 ? O SER A 148 
AA2 4  5  O VAL A 146 ? O VAL A 147 N TRP A 116 ? N TRP A 117 
AA2 5  6  N THR A 111 ? N THR A 112 O ASP A 192 ? O ASP A 193 
AA2 6  7  N LEU A 198 ? N LEU A 199 O ARG A 223 ? O ARG A 224 
AA2 7  8  N LEU A 226 ? N LEU A 227 O LEU A 326 ? O LEU A 327 
AA2 8  9  N VAL A 329 ? N VAL A 330 O PHE A 429 ? O PHE A 430 
AA2 9  10 N VAL A 428 ? N VAL A 429 O LEU A 512 ? O LEU A 513 
AA2 10 11 N TYR A 509 ? N TYR A 510 O ARG A 520 ? O ARG A 521 
AA3 1  2  N VAL A 67  ? N VAL A 68  O SER A 92  ? O SER A 93  
AA4 1  2  N VAL A 238 ? N VAL A 239 O VAL A 302 ? O VAL A 303 
AA5 1  2  N VAL B 9   ? N VAL B 10  O LEU B 16  ? O LEU B 17  
AA5 2  3  N ARG B 15  ? N ARG B 16  O VAL B 59  ? O VAL B 60  
AA6 1  2  N LEU B 21  ? N LEU B 22  O VAL B 28  ? O VAL B 29  
AA6 2  3  N SER B 29  ? N SER B 30  O THR B 102 ? O THR B 103 
AA6 3  4  N ASN B 99  ? N ASN B 100 O SER B 147 ? O SER B 148 
AA6 4  5  O VAL B 146 ? O VAL B 147 N LEU B 114 ? N LEU B 115 
AA6 5  6  N THR B 111 ? N THR B 112 O ASP B 192 ? O ASP B 193 
AA6 6  7  N LEU B 198 ? N LEU B 199 O ARG B 223 ? O ARG B 224 
AA6 7  8  N LEU B 226 ? N LEU B 227 O LEU B 326 ? O LEU B 327 
AA6 8  9  N VAL B 329 ? N VAL B 330 O PHE B 429 ? O PHE B 430 
AA6 9  10 N VAL B 428 ? N VAL B 429 O LEU B 512 ? O LEU B 513 
AA6 10 11 N TYR B 509 ? N TYR B 510 O ARG B 520 ? O ARG B 521 
AA7 1  2  N VAL B 67  ? N VAL B 68  O SER B 92  ? O SER B 93  
# 
_atom_sites.entry_id                    6NEA 
_atom_sites.fract_transf_matrix[1][1]   0.009548 
_atom_sites.fract_transf_matrix[1][2]   0.005513 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.011025 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003084 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ARG A 1 2   ? -28.831 50.099 380.399 1.00 86.56  ? 3    ARG A N   1 
ATOM   2    C CA  . ARG A 1 2   ? -27.468 50.092 380.914 1.00 94.64  ? 3    ARG A CA  1 
ATOM   3    C C   . ARG A 1 2   ? -26.446 50.305 379.795 1.00 101.20 ? 3    ARG A C   1 
ATOM   4    O O   . ARG A 1 2   ? -26.048 51.439 379.526 1.00 102.02 ? 3    ARG A O   1 
ATOM   5    C CB  . ARG A 1 2   ? -27.184 48.783 381.653 1.00 95.22  ? 3    ARG A CB  1 
ATOM   6    C CG  . ARG A 1 2   ? -26.201 48.913 382.807 1.00 93.57  ? 3    ARG A CG  1 
ATOM   7    C CD  . ARG A 1 2   ? -25.694 47.547 383.231 1.00 100.75 ? 3    ARG A CD  1 
ATOM   8    N NE  . ARG A 1 2   ? -25.382 46.717 382.070 1.00 113.08 ? 3    ARG A NE  1 
ATOM   9    C CZ  . ARG A 1 2   ? -24.977 45.453 382.136 1.00 120.52 ? 3    ARG A CZ  1 
ATOM   10   N NH1 . ARG A 1 2   ? -24.832 44.861 383.314 1.00 124.03 ? 3    ARG A NH1 1 
ATOM   11   N NH2 . ARG A 1 2   ? -24.721 44.779 381.023 1.00 121.21 ? 3    ARG A NH2 1 
ATOM   12   N N   . GLU A 1 3   ? -26.028 49.222 379.136 1.00 99.29  ? 4    GLU A N   1 
ATOM   13   C CA  . GLU A 1 3   ? -24.992 49.305 378.115 1.00 91.27  ? 4    GLU A CA  1 
ATOM   14   C C   . GLU A 1 3   ? -25.363 48.462 376.902 1.00 87.12  ? 4    GLU A C   1 
ATOM   15   O O   . GLU A 1 3   ? -26.119 47.492 377.001 1.00 82.67  ? 4    GLU A O   1 
ATOM   16   C CB  . GLU A 1 3   ? -23.626 48.858 378.659 1.00 86.04  ? 4    GLU A CB  1 
ATOM   17   C CG  . GLU A 1 3   ? -22.900 49.924 379.472 1.00 92.71  ? 4    GLU A CG  1 
ATOM   18   C CD  . GLU A 1 3   ? -21.927 50.745 378.637 1.00 88.37  ? 4    GLU A CD  1 
ATOM   19   O OE1 . GLU A 1 3   ? -22.253 51.064 377.474 1.00 88.64  ? 4    GLU A OE1 1 
ATOM   20   O OE2 . GLU A 1 3   ? -20.835 51.076 379.147 1.00 72.92  ? 4    GLU A OE2 1 
ATOM   21   N N   . ASP A 1 4   ? -24.811 48.849 375.752 1.00 84.84  ? 5    ASP A N   1 
ATOM   22   C CA  . ASP A 1 4   ? -24.975 48.132 374.492 1.00 74.26  ? 5    ASP A CA  1 
ATOM   23   C C   . ASP A 1 4   ? -23.690 47.362 374.206 1.00 69.58  ? 5    ASP A C   1 
ATOM   24   O O   . ASP A 1 4   ? -22.627 47.967 374.027 1.00 62.16  ? 5    ASP A O   1 
ATOM   25   C CB  . ASP A 1 4   ? -25.295 49.104 373.355 1.00 61.67  ? 5    ASP A CB  1 
ATOM   26   C CG  . ASP A 1 4   ? -25.665 48.401 372.050 1.00 75.17  ? 5    ASP A CG  1 
ATOM   27   O OD1 . ASP A 1 4   ? -26.217 49.077 371.154 1.00 70.22  ? 5    ASP A OD1 1 
ATOM   28   O OD2 . ASP A 1 4   ? -25.411 47.186 371.908 1.00 64.91  ? 5    ASP A OD2 1 
ATOM   29   N N   . ALA A 1 5   ? -23.794 46.032 374.151 1.00 69.67  ? 6    ALA A N   1 
ATOM   30   C CA  . ALA A 1 5   ? -22.602 45.199 374.020 1.00 65.27  ? 6    ALA A CA  1 
ATOM   31   C C   . ALA A 1 5   ? -21.912 45.387 372.674 1.00 66.30  ? 6    ALA A C   1 
ATOM   32   O O   . ALA A 1 5   ? -20.691 45.216 372.580 1.00 60.95  ? 6    ALA A O   1 
ATOM   33   C CB  . ALA A 1 5   ? -22.965 43.729 374.230 1.00 63.05  ? 6    ALA A CB  1 
ATOM   34   N N   . GLU A 1 6   ? -22.664 45.738 371.628 1.00 65.41  ? 7    GLU A N   1 
ATOM   35   C CA  . GLU A 1 6   ? -22.056 45.934 370.316 1.00 56.05  ? 7    GLU A CA  1 
ATOM   36   C C   . GLU A 1 6   ? -21.095 47.115 370.291 1.00 64.56  ? 7    GLU A C   1 
ATOM   37   O O   . GLU A 1 6   ? -20.222 47.168 369.418 1.00 50.42  ? 7    GLU A O   1 
ATOM   38   C CB  . GLU A 1 6   ? -23.140 46.127 369.254 1.00 60.81  ? 7    GLU A CB  1 
ATOM   39   C CG  . GLU A 1 6   ? -23.967 44.880 368.978 1.00 77.10  ? 7    GLU A CG  1 
ATOM   40   C CD  . GLU A 1 6   ? -23.117 43.694 368.561 1.00 79.56  ? 7    GLU A CD  1 
ATOM   41   O OE1 . GLU A 1 6   ? -22.165 43.889 367.779 1.00 80.42  ? 7    GLU A OE1 1 
ATOM   42   O OE2 . GLU A 1 6   ? -23.400 42.566 369.016 1.00 90.86  ? 7    GLU A OE2 1 
ATOM   43   N N   . LEU A 1 7   ? -21.224 48.051 371.229 1.00 53.80  ? 8    LEU A N   1 
ATOM   44   C CA  . LEU A 1 7   ? -20.373 49.231 371.277 1.00 44.28  ? 8    LEU A CA  1 
ATOM   45   C C   . LEU A 1 7   ? -19.242 49.099 372.288 1.00 46.06  ? 8    LEU A C   1 
ATOM   46   O O   . LEU A 1 7   ? -18.554 50.086 372.567 1.00 49.14  ? 8    LEU A O   1 
ATOM   47   C CB  . LEU A 1 7   ? -21.216 50.466 371.585 1.00 44.15  ? 8    LEU A CB  1 
ATOM   48   C CG  . LEU A 1 7   ? -22.389 50.644 370.620 1.00 47.35  ? 8    LEU A CG  1 
ATOM   49   C CD1 . LEU A 1 7   ? -23.198 51.882 370.966 1.00 36.96  ? 8    LEU A CD1 1 
ATOM   50   C CD2 . LEU A 1 7   ? -21.877 50.700 369.185 1.00 38.60  ? 8    LEU A CD2 1 
ATOM   51   N N   . LEU A 1 8   ? -19.032 47.904 372.837 1.00 44.54  ? 9    LEU A N   1 
ATOM   52   C CA  . LEU A 1 8   ? -17.977 47.645 373.808 1.00 53.18  ? 9    LEU A CA  1 
ATOM   53   C C   . LEU A 1 8   ? -17.035 46.605 373.225 1.00 45.31  ? 9    LEU A C   1 
ATOM   54   O O   . LEU A 1 8   ? -17.469 45.509 372.854 1.00 50.57  ? 9    LEU A O   1 
ATOM   55   C CB  . LEU A 1 8   ? -18.557 47.159 375.140 1.00 46.58  ? 9    LEU A CB  1 
ATOM   56   C CG  . LEU A 1 8   ? -19.459 48.141 375.885 1.00 50.40  ? 9    LEU A CG  1 
ATOM   57   C CD1 . LEU A 1 8   ? -20.055 47.487 377.125 1.00 49.25  ? 9    LEU A CD1 1 
ATOM   58   C CD2 . LEU A 1 8   ? -18.683 49.397 376.254 1.00 49.58  ? 9    LEU A CD2 1 
ATOM   59   N N   . VAL A 1 9   ? -15.753 46.950 373.132 1.00 38.34  ? 10   VAL A N   1 
ATOM   60   C CA  . VAL A 1 9   ? -14.739 46.060 372.578 1.00 45.01  ? 10   VAL A CA  1 
ATOM   61   C C   . VAL A 1 9   ? -13.494 46.150 373.446 1.00 39.57  ? 10   VAL A C   1 
ATOM   62   O O   . VAL A 1 9   ? -13.169 47.217 373.978 1.00 41.96  ? 10   VAL A O   1 
ATOM   63   C CB  . VAL A 1 9   ? -14.408 46.407 371.107 1.00 42.60  ? 10   VAL A CB  1 
ATOM   64   C CG1 . VAL A 1 9   ? -13.399 45.427 370.531 1.00 48.03  ? 10   VAL A CG1 1 
ATOM   65   C CG2 . VAL A 1 9   ? -15.661 46.402 370.263 1.00 45.13  ? 10   VAL A CG2 1 
ATOM   66   N N   . THR A 1 10  ? -12.797 45.029 373.587 1.00 38.96  ? 11   THR A N   1 
ATOM   67   C CA  . THR A 1 10  ? -11.530 44.970 374.299 1.00 43.56  ? 11   THR A CA  1 
ATOM   68   C C   . THR A 1 10  ? -10.407 44.769 373.289 1.00 36.03  ? 11   THR A C   1 
ATOM   69   O O   . THR A 1 10  ? -10.445 43.823 372.496 1.00 45.63  ? 11   THR A O   1 
ATOM   70   C CB  . THR A 1 10  ? -11.535 43.843 375.332 1.00 53.20  ? 11   THR A CB  1 
ATOM   71   O OG1 . THR A 1 10  ? -12.610 44.054 376.257 1.00 57.51  ? 11   THR A OG1 1 
ATOM   72   C CG2 . THR A 1 10  ? -10.214 43.811 376.091 1.00 37.98  ? 11   THR A CG2 1 
ATOM   73   N N   . VAL A 1 11  ? -9.422  45.665 373.310 1.00 40.28  ? 12   VAL A N   1 
ATOM   74   C CA  . VAL A 1 11  ? -8.217  45.504 372.504 1.00 44.10  ? 12   VAL A CA  1 
ATOM   75   C C   . VAL A 1 11  ? -7.048  45.242 373.444 1.00 47.87  ? 12   VAL A C   1 
ATOM   76   O O   . VAL A 1 11  ? -7.233  45.150 374.663 1.00 56.63  ? 12   VAL A O   1 
ATOM   77   C CB  . VAL A 1 11  ? -7.960  46.735 371.612 1.00 49.91  ? 12   VAL A CB  1 
ATOM   78   C CG1 . VAL A 1 11  ? -9.041  46.853 370.544 1.00 34.22  ? 12   VAL A CG1 1 
ATOM   79   C CG2 . VAL A 1 11  ? -7.897  47.999 372.453 1.00 47.99  ? 12   VAL A CG2 1 
ATOM   80   N N   . ARG A 1 12  ? -5.839  45.114 372.887 1.00 55.78  ? 13   ARG A N   1 
ATOM   81   C CA  . ARG A 1 12  ? -4.673  44.805 373.713 1.00 57.13  ? 13   ARG A CA  1 
ATOM   82   C C   . ARG A 1 12  ? -4.445  45.869 374.779 1.00 55.41  ? 13   ARG A C   1 
ATOM   83   O O   . ARG A 1 12  ? -4.043  45.554 375.905 1.00 55.64  ? 13   ARG A O   1 
ATOM   84   C CB  . ARG A 1 12  ? -3.426  44.664 372.840 1.00 50.89  ? 13   ARG A CB  1 
ATOM   85   C CG  . ARG A 1 12  ? -3.544  43.629 371.741 1.00 83.15  ? 13   ARG A CG  1 
ATOM   86   C CD  . ARG A 1 12  ? -3.379  42.218 372.272 1.00 80.09  ? 13   ARG A CD  1 
ATOM   87   N NE  . ARG A 1 12  ? -3.265  41.250 371.184 1.00 95.03  ? 13   ARG A NE  1 
ATOM   88   C CZ  . ARG A 1 12  ? -2.145  41.010 370.509 1.00 93.10  ? 13   ARG A CZ  1 
ATOM   89   N NH1 . ARG A 1 12  ? -1.032  41.667 370.808 1.00 88.71  ? 13   ARG A NH1 1 
ATOM   90   N NH2 . ARG A 1 12  ? -2.137  40.112 369.533 1.00 86.74  ? 13   ARG A NH2 1 
ATOM   91   N N   . GLY A 1 13  ? -4.699  47.136 374.444 1.00 54.02  ? 14   GLY A N   1 
ATOM   92   C CA  . GLY A 1 13  ? -4.452  48.212 375.386 1.00 54.71  ? 14   GLY A CA  1 
ATOM   93   C C   . GLY A 1 13  ? -5.487  48.353 376.480 1.00 52.95  ? 14   GLY A C   1 
ATOM   94   O O   . GLY A 1 13  ? -5.182  48.925 377.530 1.00 42.34  ? 14   GLY A O   1 
ATOM   95   N N   . GLY A 1 14  ? -6.696  47.859 376.265 1.00 50.59  ? 15   GLY A N   1 
ATOM   96   C CA  . GLY A 1 14  ? -7.754  48.003 377.242 1.00 37.94  ? 15   GLY A CA  1 
ATOM   97   C C   . GLY A 1 14  ? -9.111  47.989 376.565 1.00 43.60  ? 15   GLY A C   1 
ATOM   98   O O   . GLY A 1 14  ? -9.248  47.543 375.430 1.00 48.73  ? 15   GLY A O   1 
ATOM   99   N N   . ARG A 1 15  ? -10.106 48.495 377.286 1.00 46.02  ? 16   ARG A N   1 
ATOM   100  C CA  . ARG A 1 15  ? -11.490 48.463 376.840 1.00 41.34  ? 16   ARG A CA  1 
ATOM   101  C C   . ARG A 1 15  ? -11.868 49.764 376.143 1.00 47.20  ? 16   ARG A C   1 
ATOM   102  O O   . ARG A 1 15  ? -11.370 50.842 376.482 1.00 39.70  ? 16   ARG A O   1 
ATOM   103  C CB  . ARG A 1 15  ? -12.429 48.208 378.019 1.00 55.07  ? 16   ARG A CB  1 
ATOM   104  C CG  . ARG A 1 15  ? -12.289 46.821 378.622 1.00 55.90  ? 16   ARG A CG  1 
ATOM   105  C CD  . ARG A 1 15  ? -13.240 46.631 379.785 1.00 49.40  ? 16   ARG A CD  1 
ATOM   106  N NE  . ARG A 1 15  ? -12.816 47.385 380.960 1.00 64.71  ? 16   ARG A NE  1 
ATOM   107  C CZ  . ARG A 1 15  ? -13.651 47.897 381.858 1.00 69.05  ? 16   ARG A CZ  1 
ATOM   108  N NH1 . ARG A 1 15  ? -14.960 47.738 381.716 1.00 60.43  ? 16   ARG A NH1 1 
ATOM   109  N NH2 . ARG A 1 15  ? -13.176 48.571 382.898 1.00 63.17  ? 16   ARG A NH2 1 
ATOM   110  N N   . LEU A 1 16  ? -12.765 49.649 375.162 1.00 39.80  ? 17   LEU A N   1 
ATOM   111  C CA  . LEU A 1 16  ? -13.200 50.775 374.351 1.00 36.34  ? 17   LEU A CA  1 
ATOM   112  C C   . LEU A 1 16  ? -14.719 50.844 374.331 1.00 41.42  ? 17   LEU A C   1 
ATOM   113  O O   . LEU A 1 16  ? -15.405 49.826 374.461 1.00 35.03  ? 17   LEU A O   1 
ATOM   114  C CB  . LEU A 1 16  ? -12.687 50.667 372.904 1.00 42.53  ? 17   LEU A CB  1 
ATOM   115  C CG  . LEU A 1 16  ? -11.176 50.680 372.679 1.00 41.90  ? 17   LEU A CG  1 
ATOM   116  C CD1 . LEU A 1 16  ? -10.852 50.303 371.243 1.00 43.41  ? 17   LEU A CD1 1 
ATOM   117  C CD2 . LEU A 1 16  ? -10.598 52.042 373.019 1.00 40.26  ? 17   LEU A CD2 1 
ATOM   118  N N   . ARG A 1 17  ? -15.234 52.058 374.146 1.00 36.35  ? 18   ARG A N   1 
ATOM   119  C CA  . ARG A 1 17  ? -16.659 52.298 373.967 1.00 41.95  ? 18   ARG A CA  1 
ATOM   120  C C   . ARG A 1 17  ? -16.858 53.126 372.706 1.00 36.70  ? 18   ARG A C   1 
ATOM   121  O O   . ARG A 1 17  ? -16.217 54.169 372.540 1.00 39.57  ? 18   ARG A O   1 
ATOM   122  C CB  . ARG A 1 17  ? -17.262 53.016 375.184 1.00 42.99  ? 18   ARG A CB  1 
ATOM   123  C CG  . ARG A 1 17  ? -18.757 53.290 375.068 1.00 46.63  ? 18   ARG A CG  1 
ATOM   124  C CD  . ARG A 1 17  ? -19.291 54.065 376.268 1.00 53.77  ? 18   ARG A CD  1 
ATOM   125  N NE  . ARG A 1 17  ? -19.194 53.298 377.507 1.00 56.58  ? 18   ARG A NE  1 
ATOM   126  C CZ  . ARG A 1 17  ? -18.347 53.572 378.496 1.00 57.48  ? 18   ARG A CZ  1 
ATOM   127  N NH1 . ARG A 1 17  ? -17.522 54.606 378.405 1.00 50.36  ? 18   ARG A NH1 1 
ATOM   128  N NH2 . ARG A 1 17  ? -18.331 52.813 379.583 1.00 53.01  ? 18   ARG A NH2 1 
ATOM   129  N N   . GLY A 1 18  ? -17.742 52.661 371.819 1.00 40.94  ? 19   GLY A N   1 
ATOM   130  C CA  . GLY A 1 18  ? -18.028 53.327 370.573 1.00 35.28  ? 19   GLY A CA  1 
ATOM   131  C C   . GLY A 1 18  ? -19.436 53.884 370.516 1.00 48.65  ? 19   GLY A C   1 
ATOM   132  O O   . GLY A 1 18  ? -20.108 54.067 371.540 1.00 52.89  ? 19   GLY A O   1 
ATOM   133  N N   . ILE A 1 19  ? -19.893 54.162 369.291 1.00 37.91  ? 20   ILE A N   1 
ATOM   134  C CA  . ILE A 1 19  ? -21.214 54.732 369.061 1.00 46.65  ? 20   ILE A CA  1 
ATOM   135  C C   . ILE A 1 19  ? -21.902 54.004 367.915 1.00 40.75  ? 20   ILE A C   1 
ATOM   136  O O   . ILE A 1 19  ? -21.264 53.411 367.042 1.00 49.25  ? 20   ILE A O   1 
ATOM   137  C CB  . ILE A 1 19  ? -21.165 56.247 368.761 1.00 49.33  ? 20   ILE A CB  1 
ATOM   138  C CG1 . ILE A 1 19  ? -20.269 56.531 367.555 1.00 52.67  ? 20   ILE A CG1 1 
ATOM   139  C CG2 . ILE A 1 19  ? -20.692 57.025 369.968 1.00 45.50  ? 20   ILE A CG2 1 
ATOM   140  C CD1 . ILE A 1 19  ? -20.616 57.816 366.843 1.00 63.76  ? 20   ILE A CD1 1 
ATOM   141  N N   . ARG A 1 20  ? -23.229 54.067 367.931 1.00 52.30  ? 21   ARG A N   1 
ATOM   142  C CA  . ARG A 1 20  ? -24.065 53.517 366.871 1.00 47.06  ? 21   ARG A CA  1 
ATOM   143  C C   . ARG A 1 20  ? -24.389 54.648 365.902 1.00 53.16  ? 21   ARG A C   1 
ATOM   144  O O   . ARG A 1 20  ? -25.105 55.589 366.256 1.00 51.69  ? 21   ARG A O   1 
ATOM   145  C CB  . ARG A 1 20  ? -25.330 52.900 367.460 1.00 52.59  ? 21   ARG A CB  1 
ATOM   146  C CG  . ARG A 1 20  ? -26.343 52.392 366.449 1.00 55.73  ? 21   ARG A CG  1 
ATOM   147  C CD  . ARG A 1 20  ? -27.638 51.995 367.155 1.00 67.27  ? 21   ARG A CD  1 
ATOM   148  N NE  . ARG A 1 20  ? -28.534 51.219 366.302 1.00 62.87  ? 21   ARG A NE  1 
ATOM   149  C CZ  . ARG A 1 20  ? -29.588 51.723 365.668 1.00 61.62  ? 21   ARG A CZ  1 
ATOM   150  N NH1 . ARG A 1 20  ? -29.884 53.011 365.790 1.00 68.14  ? 21   ARG A NH1 1 
ATOM   151  N NH2 . ARG A 1 20  ? -30.349 50.942 364.913 1.00 58.27  ? 21   ARG A NH2 1 
ATOM   152  N N   . LEU A 1 21  ? -23.850 54.565 364.688 1.00 55.02  ? 22   LEU A N   1 
ATOM   153  C CA  . LEU A 1 21  ? -23.995 55.627 363.704 1.00 52.76  ? 22   LEU A CA  1 
ATOM   154  C C   . LEU A 1 21  ? -25.187 55.372 362.796 1.00 48.42  ? 22   LEU A C   1 
ATOM   155  O O   . LEU A 1 21  ? -25.417 54.245 362.349 1.00 50.31  ? 22   LEU A O   1 
ATOM   156  C CB  . LEU A 1 21  ? -22.726 55.760 362.860 1.00 52.86  ? 22   LEU A CB  1 
ATOM   157  C CG  . LEU A 1 21  ? -21.699 56.769 363.372 1.00 62.85  ? 22   LEU A CG  1 
ATOM   158  C CD1 . LEU A 1 21  ? -20.588 56.934 362.358 1.00 66.32  ? 22   LEU A CD1 1 
ATOM   159  C CD2 . LEU A 1 21  ? -22.363 58.107 363.666 1.00 55.48  ? 22   LEU A CD2 1 
ATOM   160  N N   . LYS A 1 22  ? -25.933 56.434 362.513 1.00 52.96  ? 23   LYS A N   1 
ATOM   161  C CA  . LYS A 1 22  ? -27.067 56.376 361.601 1.00 60.88  ? 23   LYS A CA  1 
ATOM   162  C C   . LYS A 1 22  ? -26.582 56.613 360.175 1.00 60.23  ? 23   LYS A C   1 
ATOM   163  O O   . LYS A 1 22  ? -25.936 57.629 359.896 1.00 68.73  ? 23   LYS A O   1 
ATOM   164  C CB  . LYS A 1 22  ? -28.115 57.422 361.980 1.00 59.30  ? 23   LYS A CB  1 
ATOM   165  C CG  . LYS A 1 22  ? -28.774 57.202 363.329 1.00 69.93  ? 23   LYS A CG  1 
ATOM   166  C CD  . LYS A 1 22  ? -30.112 57.926 363.403 1.00 77.49  ? 23   LYS A CD  1 
ATOM   167  C CE  . LYS A 1 22  ? -30.648 57.967 364.827 1.00 79.85  ? 23   LYS A CE  1 
ATOM   168  N NZ  . LYS A 1 22  ? -30.058 59.084 365.621 1.00 86.38  ? 23   LYS A NZ  1 
ATOM   169  N N   . THR A 1 23  ? -26.881 55.680 359.280 1.00 47.99  ? 24   THR A N   1 
ATOM   170  C CA  . THR A 1 23  ? -26.672 55.860 357.853 1.00 61.28  ? 24   THR A CA  1 
ATOM   171  C C   . THR A 1 23  ? -27.990 55.646 357.120 1.00 60.70  ? 24   THR A C   1 
ATOM   172  O O   . THR A 1 23  ? -28.901 54.991 357.641 1.00 68.15  ? 24   THR A O   1 
ATOM   173  C CB  . THR A 1 23  ? -25.609 54.896 357.301 1.00 50.81  ? 24   THR A CB  1 
ATOM   174  O OG1 . THR A 1 23  ? -26.217 53.644 356.964 1.00 50.84  ? 24   THR A OG1 1 
ATOM   175  C CG2 . THR A 1 23  ? -24.510 54.668 358.322 1.00 51.86  ? 24   THR A CG2 1 
ATOM   176  N N   . PRO A 1 24  ? -28.134 56.204 355.915 1.00 69.21  ? 25   PRO A N   1 
ATOM   177  C CA  . PRO A 1 24  ? -29.371 55.984 355.146 1.00 64.37  ? 25   PRO A CA  1 
ATOM   178  C C   . PRO A 1 24  ? -29.723 54.520 354.952 1.00 54.98  ? 25   PRO A C   1 
ATOM   179  O O   . PRO A 1 24  ? -30.912 54.184 354.881 1.00 74.07  ? 25   PRO A O   1 
ATOM   180  C CB  . PRO A 1 24  ? -29.068 56.670 353.808 1.00 68.90  ? 25   PRO A CB  1 
ATOM   181  C CG  . PRO A 1 24  ? -28.083 57.730 354.149 1.00 69.68  ? 25   PRO A CG  1 
ATOM   182  C CD  . PRO A 1 24  ? -27.249 57.194 355.276 1.00 69.14  ? 25   PRO A CD  1 
ATOM   183  N N   . GLY A 1 25  ? -28.733 53.636 354.876 1.00 59.38  ? 26   GLY A N   1 
ATOM   184  C CA  . GLY A 1 25  ? -29.002 52.228 354.663 1.00 52.97  ? 26   GLY A CA  1 
ATOM   185  C C   . GLY A 1 25  ? -29.207 51.431 355.935 1.00 67.13  ? 26   GLY A C   1 
ATOM   186  O O   . GLY A 1 25  ? -29.832 50.366 355.905 1.00 75.40  ? 26   GLY A O   1 
ATOM   187  N N   . GLY A 1 26  ? -28.686 51.920 357.059 1.00 52.35  ? 27   GLY A N   1 
ATOM   188  C CA  . GLY A 1 26  ? -28.796 51.205 358.309 1.00 60.39  ? 27   GLY A CA  1 
ATOM   189  C C   . GLY A 1 26  ? -27.730 51.580 359.321 1.00 62.75  ? 27   GLY A C   1 
ATOM   190  O O   . GLY A 1 26  ? -26.868 52.428 359.071 1.00 62.81  ? 27   GLY A O   1 
ATOM   191  N N   . PRO A 1 27  ? -27.772 50.945 360.492 1.00 60.89  ? 28   PRO A N   1 
ATOM   192  C CA  . PRO A 1 27  ? -26.851 51.323 361.568 1.00 57.07  ? 28   PRO A CA  1 
ATOM   193  C C   . PRO A 1 27  ? -25.431 50.832 361.328 1.00 46.87  ? 28   PRO A C   1 
ATOM   194  O O   . PRO A 1 27  ? -25.193 49.812 360.678 1.00 46.08  ? 28   PRO A O   1 
ATOM   195  C CB  . PRO A 1 27  ? -27.464 50.659 362.806 1.00 50.46  ? 28   PRO A CB  1 
ATOM   196  C CG  . PRO A 1 27  ? -28.229 49.501 362.262 1.00 57.80  ? 28   PRO A CG  1 
ATOM   197  C CD  . PRO A 1 27  ? -28.776 49.965 360.941 1.00 59.98  ? 28   PRO A CD  1 
ATOM   198  N N   . VAL A 1 28  ? -24.484 51.581 361.887 1.00 53.19  ? 29   VAL A N   1 
ATOM   199  C CA  . VAL A 1 28  ? -23.058 51.315 361.769 1.00 45.65  ? 29   VAL A CA  1 
ATOM   200  C C   . VAL A 1 28  ? -22.425 51.500 363.142 1.00 48.89  ? 29   VAL A C   1 
ATOM   201  O O   . VAL A 1 28  ? -22.752 52.445 363.865 1.00 45.78  ? 29   VAL A O   1 
ATOM   202  C CB  . VAL A 1 28  ? -22.397 52.249 360.730 1.00 46.94  ? 29   VAL A CB  1 
ATOM   203  C CG1 . VAL A 1 28  ? -20.894 52.316 360.945 1.00 43.22  ? 29   VAL A CG1 1 
ATOM   204  C CG2 . VAL A 1 28  ? -22.718 51.778 359.321 1.00 41.41  ? 29   VAL A CG2 1 
ATOM   205  N N   . SER A 1 29  ? -21.533 50.587 363.513 1.00 44.98  ? 30   SER A N   1 
ATOM   206  C CA  . SER A 1 29  ? -20.741 50.740 364.724 1.00 41.10  ? 30   SER A CA  1 
ATOM   207  C C   . SER A 1 29  ? -19.453 51.483 364.390 1.00 43.02  ? 30   SER A C   1 
ATOM   208  O O   . SER A 1 29  ? -18.714 51.082 363.487 1.00 43.06  ? 30   SER A O   1 
ATOM   209  C CB  . SER A 1 29  ? -20.430 49.377 365.340 1.00 41.99  ? 30   SER A CB  1 
ATOM   210  O OG  . SER A 1 29  ? -21.469 48.953 366.198 1.00 54.25  ? 30   SER A OG  1 
ATOM   211  N N   . ALA A 1 30  ? -19.193 52.570 365.113 1.00 42.62  ? 31   ALA A N   1 
ATOM   212  C CA  . ALA A 1 30  ? -18.034 53.416 364.862 1.00 32.54  ? 31   ALA A CA  1 
ATOM   213  C C   . ALA A 1 30  ? -17.234 53.578 366.144 1.00 42.38  ? 31   ALA A C   1 
ATOM   214  O O   . ALA A 1 30  ? -17.802 53.837 367.209 1.00 42.51  ? 31   ALA A O   1 
ATOM   215  C CB  . ALA A 1 30  ? -18.454 54.787 364.327 1.00 34.25  ? 31   ALA A CB  1 
ATOM   216  N N   . PHE A 1 31  ? -15.917 53.430 366.033 1.00 40.50  ? 32   PHE A N   1 
ATOM   217  C CA  . PHE A 1 31  ? -14.983 53.607 367.140 1.00 32.68  ? 32   PHE A CA  1 
ATOM   218  C C   . PHE A 1 31  ? -13.976 54.666 366.700 1.00 37.17  ? 32   PHE A C   1 
ATOM   219  O O   . PHE A 1 31  ? -12.962 54.351 366.073 1.00 40.80  ? 32   PHE A O   1 
ATOM   220  C CB  . PHE A 1 31  ? -14.314 52.285 367.503 1.00 39.16  ? 32   PHE A CB  1 
ATOM   221  C CG  . PHE A 1 31  ? -15.273 51.240 367.992 1.00 35.70  ? 32   PHE A CG  1 
ATOM   222  C CD1 . PHE A 1 31  ? -15.523 51.091 369.346 1.00 40.14  ? 32   PHE A CD1 1 
ATOM   223  C CD2 . PHE A 1 31  ? -15.938 50.416 367.098 1.00 42.02  ? 32   PHE A CD2 1 
ATOM   224  C CE1 . PHE A 1 31  ? -16.413 50.133 369.800 1.00 43.40  ? 32   PHE A CE1 1 
ATOM   225  C CE2 . PHE A 1 31  ? -16.828 49.457 367.546 1.00 41.08  ? 32   PHE A CE2 1 
ATOM   226  C CZ  . PHE A 1 31  ? -17.065 49.317 368.901 1.00 46.49  ? 32   PHE A CZ  1 
ATOM   227  N N   . LEU A 1 32  ? -14.262 55.921 367.032 1.00 30.51  ? 33   LEU A N   1 
ATOM   228  C CA  . LEU A 1 32  ? -13.519 57.068 366.529 1.00 32.98  ? 33   LEU A CA  1 
ATOM   229  C C   . LEU A 1 32  ? -12.611 57.628 367.614 1.00 38.55  ? 33   LEU A C   1 
ATOM   230  O O   . LEU A 1 32  ? -13.062 57.888 368.733 1.00 46.63  ? 33   LEU A O   1 
ATOM   231  C CB  . LEU A 1 32  ? -14.475 58.154 366.038 1.00 37.08  ? 33   LEU A CB  1 
ATOM   232  C CG  . LEU A 1 32  ? -15.617 57.681 365.142 1.00 36.58  ? 33   LEU A CG  1 
ATOM   233  C CD1 . LEU A 1 32  ? -16.530 58.848 364.824 1.00 39.38  ? 33   LEU A CD1 1 
ATOM   234  C CD2 . LEU A 1 32  ? -15.076 57.048 363.863 1.00 35.84  ? 33   LEU A CD2 1 
ATOM   235  N N   . GLY A 1 33  ? -11.341 57.831 367.274 1.00 37.21  ? 34   GLY A N   1 
ATOM   236  C CA  . GLY A 1 33  ? -10.393 58.399 368.212 1.00 28.15  ? 34   GLY A CA  1 
ATOM   237  C C   . GLY A 1 33  ? -9.737  57.383 369.125 1.00 35.20  ? 34   GLY A C   1 
ATOM   238  O O   . GLY A 1 33  ? -9.538  57.647 370.315 1.00 42.01  ? 34   GLY A O   1 
ATOM   239  N N   . ILE A 1 34  ? -9.391  56.220 368.582 1.00 34.41  ? 35   ILE A N   1 
ATOM   240  C CA  . ILE A 1 34  ? -8.693  55.179 369.335 1.00 29.09  ? 35   ILE A CA  1 
ATOM   241  C C   . ILE A 1 34  ? -7.202  55.497 369.374 1.00 35.97  ? 35   ILE A C   1 
ATOM   242  O O   . ILE A 1 34  ? -6.562  55.589 368.318 1.00 44.88  ? 35   ILE A O   1 
ATOM   243  C CB  . ILE A 1 34  ? -8.935  53.792 368.720 1.00 39.74  ? 35   ILE A CB  1 
ATOM   244  C CG1 . ILE A 1 34  ? -10.433 53.502 368.618 1.00 38.38  ? 35   ILE A CG1 1 
ATOM   245  C CG2 . ILE A 1 34  ? -8.223  52.719 369.528 1.00 37.32  ? 35   ILE A CG2 1 
ATOM   246  C CD1 . ILE A 1 34  ? -10.752 52.225 367.856 1.00 33.85  ? 35   ILE A CD1 1 
ATOM   247  N N   . PRO A 1 35  ? -6.607  55.667 370.554 1.00 42.31  ? 36   PRO A N   1 
ATOM   248  C CA  . PRO A 1 35  ? -5.163  55.937 370.618 1.00 40.26  ? 36   PRO A CA  1 
ATOM   249  C C   . PRO A 1 35  ? -4.360  54.686 370.290 1.00 46.61  ? 36   PRO A C   1 
ATOM   250  O O   . PRO A 1 35  ? -4.608  53.611 370.840 1.00 41.59  ? 36   PRO A O   1 
ATOM   251  C CB  . PRO A 1 35  ? -4.951  56.383 372.068 1.00 44.27  ? 36   PRO A CB  1 
ATOM   252  C CG  . PRO A 1 35  ? -6.061  55.712 372.827 1.00 39.75  ? 36   PRO A CG  1 
ATOM   253  C CD  . PRO A 1 35  ? -7.238  55.671 371.887 1.00 38.33  ? 36   PRO A CD  1 
ATOM   254  N N   . PHE A 1 36  ? -3.402  54.826 369.372 1.00 38.37  ? 37   PHE A N   1 
ATOM   255  C CA  . PHE A 1 36  ? -2.506  53.729 369.041 1.00 41.40  ? 37   PHE A CA  1 
ATOM   256  C C   . PHE A 1 36  ? -1.048  54.048 369.339 1.00 37.08  ? 37   PHE A C   1 
ATOM   257  O O   . PHE A 1 36  ? -0.195  53.163 369.208 1.00 38.43  ? 37   PHE A O   1 
ATOM   258  C CB  . PHE A 1 36  ? -2.668  53.319 367.566 1.00 39.74  ? 37   PHE A CB  1 
ATOM   259  C CG  . PHE A 1 36  ? -2.218  54.363 366.577 1.00 40.88  ? 37   PHE A CG  1 
ATOM   260  C CD1 . PHE A 1 36  ? -0.933  54.338 366.057 1.00 42.54  ? 37   PHE A CD1 1 
ATOM   261  C CD2 . PHE A 1 36  ? -3.090  55.349 366.145 1.00 36.88  ? 37   PHE A CD2 1 
ATOM   262  C CE1 . PHE A 1 36  ? -0.517  55.290 365.138 1.00 41.61  ? 37   PHE A CE1 1 
ATOM   263  C CE2 . PHE A 1 36  ? -2.683  56.303 365.225 1.00 38.21  ? 37   PHE A CE2 1 
ATOM   264  C CZ  . PHE A 1 36  ? -1.393  56.273 364.720 1.00 39.98  ? 37   PHE A CZ  1 
ATOM   265  N N   . ALA A 1 37  ? -0.741  55.273 369.755 1.00 40.97  ? 38   ALA A N   1 
ATOM   266  C CA  . ALA A 1 37  ? 0.623   55.646 370.091 1.00 36.11  ? 38   ALA A CA  1 
ATOM   267  C C   . ALA A 1 37  ? 0.602   56.683 371.202 1.00 50.18  ? 38   ALA A C   1 
ATOM   268  O O   . ALA A 1 37  ? -0.382  57.407 371.382 1.00 41.44  ? 38   ALA A O   1 
ATOM   269  C CB  . ALA A 1 37  ? 1.372   56.195 368.873 1.00 36.61  ? 38   ALA A CB  1 
ATOM   270  N N   . GLU A 1 38  ? 1.702   56.744 371.946 1.00 41.61  ? 39   GLU A N   1 
ATOM   271  C CA  . GLU A 1 38  ? 1.875   57.806 372.924 1.00 44.17  ? 39   GLU A CA  1 
ATOM   272  C C   . GLU A 1 38  ? 1.972   59.153 372.210 1.00 45.60  ? 39   GLU A C   1 
ATOM   273  O O   . GLU A 1 38  ? 2.539   59.234 371.115 1.00 53.18  ? 39   GLU A O   1 
ATOM   274  C CB  . GLU A 1 38  ? 3.130   57.566 373.764 1.00 51.57  ? 39   GLU A CB  1 
ATOM   275  C CG  . GLU A 1 38  ? 3.032   56.369 374.696 1.00 49.37  ? 39   GLU A CG  1 
ATOM   276  C CD  . GLU A 1 38  ? 2.000   56.566 375.790 1.00 65.87  ? 39   GLU A CD  1 
ATOM   277  O OE1 . GLU A 1 38  ? 1.937   57.680 376.354 1.00 68.39  ? 39   GLU A OE1 1 
ATOM   278  O OE2 . GLU A 1 38  ? 1.249   55.610 376.081 1.00 58.04  ? 39   GLU A OE2 1 
ATOM   279  N N   . PRO A 1 39  ? 1.428   60.217 372.795 1.00 49.39  ? 40   PRO A N   1 
ATOM   280  C CA  . PRO A 1 39  ? 1.417   61.525 372.123 1.00 43.51  ? 40   PRO A CA  1 
ATOM   281  C C   . PRO A 1 39  ? 2.824   62.003 371.814 1.00 44.83  ? 40   PRO A C   1 
ATOM   282  O O   . PRO A 1 39  ? 3.654   62.159 372.722 1.00 48.34  ? 40   PRO A O   1 
ATOM   283  C CB  . PRO A 1 39  ? 0.728   62.440 373.146 1.00 41.16  ? 40   PRO A CB  1 
ATOM   284  C CG  . PRO A 1 39  ? -0.119  61.517 373.955 1.00 42.35  ? 40   PRO A CG  1 
ATOM   285  C CD  . PRO A 1 39  ? 0.658   60.232 374.050 1.00 38.84  ? 40   PRO A CD  1 
ATOM   286  N N   . PRO A 1 40  ? 3.129   62.256 370.537 1.00 52.17  ? 41   PRO A N   1 
ATOM   287  C CA  . PRO A 1 40  ? 4.482   62.680 370.131 1.00 45.45  ? 41   PRO A CA  1 
ATOM   288  C C   . PRO A 1 40  ? 4.745   64.156 370.416 1.00 48.78  ? 41   PRO A C   1 
ATOM   289  O O   . PRO A 1 40  ? 4.987   64.961 369.511 1.00 50.88  ? 41   PRO A O   1 
ATOM   290  C CB  . PRO A 1 40  ? 4.481   62.367 368.630 1.00 47.93  ? 41   PRO A CB  1 
ATOM   291  C CG  . PRO A 1 40  ? 3.057   62.575 368.223 1.00 50.70  ? 41   PRO A CG  1 
ATOM   292  C CD  . PRO A 1 40  ? 2.223   62.104 369.386 1.00 39.54  ? 41   PRO A CD  1 
ATOM   293  N N   . MET A 1 41  ? 4.703   64.521 371.693 1.00 48.11  ? 42   MET A N   1 
ATOM   294  C CA  . MET A 1 41  ? 4.856   65.905 372.117 1.00 56.19  ? 42   MET A CA  1 
ATOM   295  C C   . MET A 1 41  ? 6.108   66.065 372.968 1.00 51.77  ? 42   MET A C   1 
ATOM   296  O O   . MET A 1 41  ? 6.695   65.091 373.448 1.00 48.17  ? 42   MET A O   1 
ATOM   297  C CB  . MET A 1 41  ? 3.627   66.380 372.901 1.00 63.67  ? 42   MET A CB  1 
ATOM   298  C CG  . MET A 1 41  ? 2.312   65.873 372.351 1.00 60.95  ? 42   MET A CG  1 
ATOM   299  S SD  . MET A 1 41  ? 0.934   66.822 373.003 1.00 98.32  ? 42   MET A SD  1 
ATOM   300  C CE  . MET A 1 41  ? 1.276   68.414 372.260 1.00 77.04  ? 42   MET A CE  1 
ATOM   301  N N   . GLY A 1 42  ? 6.499   67.326 373.158 1.00 48.06  ? 43   GLY A N   1 
ATOM   302  C CA  . GLY A 1 42  ? 7.643   67.669 373.967 1.00 49.55  ? 43   GLY A CA  1 
ATOM   303  C C   . GLY A 1 42  ? 8.909   66.990 373.490 1.00 58.94  ? 43   GLY A C   1 
ATOM   304  O O   . GLY A 1 42  ? 9.363   67.190 372.359 1.00 47.10  ? 43   GLY A O   1 
ATOM   305  N N   . PRO A 1 43  ? 9.504   66.161 374.352 1.00 59.35  ? 44   PRO A N   1 
ATOM   306  C CA  . PRO A 1 43  ? 10.718  65.432 373.956 1.00 60.31  ? 44   PRO A CA  1 
ATOM   307  C C   . PRO A 1 43  ? 10.477  64.366 372.900 1.00 57.57  ? 44   PRO A C   1 
ATOM   308  O O   . PRO A 1 43  ? 11.450  63.892 372.297 1.00 51.68  ? 44   PRO A O   1 
ATOM   309  C CB  . PRO A 1 43  ? 11.195  64.808 375.275 1.00 56.39  ? 44   PRO A CB  1 
ATOM   310  C CG  . PRO A 1 43  ? 9.951   64.676 376.091 1.00 45.01  ? 44   PRO A CG  1 
ATOM   311  C CD  . PRO A 1 43  ? 9.115   65.878 375.745 1.00 38.14  ? 44   PRO A CD  1 
ATOM   312  N N   . ARG A 1 44  ? 9.229   63.975 372.655 1.00 48.61  ? 45   ARG A N   1 
ATOM   313  C CA  . ARG A 1 44  ? 8.916   62.952 371.667 1.00 47.39  ? 45   ARG A CA  1 
ATOM   314  C C   . ARG A 1 44  ? 8.693   63.520 370.272 1.00 52.36  ? 45   ARG A C   1 
ATOM   315  O O   . ARG A 1 44  ? 8.453   62.750 369.334 1.00 39.46  ? 45   ARG A O   1 
ATOM   316  C CB  . ARG A 1 44  ? 7.683   62.158 372.107 1.00 52.95  ? 45   ARG A CB  1 
ATOM   317  C CG  . ARG A 1 44  ? 7.934   61.224 373.281 1.00 48.53  ? 45   ARG A CG  1 
ATOM   318  C CD  . ARG A 1 44  ? 6.657   60.499 373.675 1.00 67.90  ? 45   ARG A CD  1 
ATOM   319  N NE  . ARG A 1 44  ? 6.920   59.298 374.462 1.00 73.86  ? 45   ARG A NE  1 
ATOM   320  C CZ  . ARG A 1 44  ? 6.848   59.245 375.788 1.00 78.24  ? 45   ARG A CZ  1 
ATOM   321  N NH1 . ARG A 1 44  ? 6.523   60.329 376.479 1.00 82.88  ? 45   ARG A NH1 1 
ATOM   322  N NH2 . ARG A 1 44  ? 7.102   58.109 376.423 1.00 84.33  ? 45   ARG A NH2 1 
ATOM   323  N N   . ARG A 1 45  ? 8.763   64.841 370.116 1.00 42.42  ? 46   ARG A N   1 
ATOM   324  C CA  . ARG A 1 45  ? 8.648   65.453 368.801 1.00 47.36  ? 46   ARG A CA  1 
ATOM   325  C C   . ARG A 1 45  ? 9.791   64.990 367.902 1.00 47.98  ? 46   ARG A C   1 
ATOM   326  O O   . ARG A 1 45  ? 10.925  64.816 368.356 1.00 49.22  ? 46   ARG A O   1 
ATOM   327  C CB  . ARG A 1 45  ? 8.652   66.979 368.937 1.00 37.03  ? 46   ARG A CB  1 
ATOM   328  C CG  . ARG A 1 45  ? 8.343   67.726 367.649 1.00 43.93  ? 46   ARG A CG  1 
ATOM   329  C CD  . ARG A 1 45  ? 8.598   69.219 367.797 1.00 40.96  ? 46   ARG A CD  1 
ATOM   330  N NE  . ARG A 1 45  ? 7.407   69.949 368.216 1.00 37.74  ? 46   ARG A NE  1 
ATOM   331  C CZ  . ARG A 1 45  ? 7.375   71.261 368.437 1.00 48.57  ? 46   ARG A CZ  1 
ATOM   332  N NH1 . ARG A 1 45  ? 8.472   71.991 368.284 1.00 42.71  ? 46   ARG A NH1 1 
ATOM   333  N NH2 . ARG A 1 45  ? 6.246   71.844 368.815 1.00 43.69  ? 46   ARG A NH2 1 
ATOM   334  N N   . PHE A 1 46  ? 9.480   64.769 366.623 1.00 43.43  ? 47   PHE A N   1 
ATOM   335  C CA  . PHE A 1 46  ? 10.393  64.287 365.587 1.00 42.00  ? 47   PHE A CA  1 
ATOM   336  C C   . PHE A 1 46  ? 10.850  62.849 365.810 1.00 44.88  ? 47   PHE A C   1 
ATOM   337  O O   . PHE A 1 46  ? 11.621  62.329 364.994 1.00 42.84  ? 47   PHE A O   1 
ATOM   338  C CB  . PHE A 1 46  ? 11.644  65.168 365.440 1.00 37.04  ? 47   PHE A CB  1 
ATOM   339  C CG  . PHE A 1 46  ? 11.345  66.629 365.271 1.00 39.65  ? 47   PHE A CG  1 
ATOM   340  C CD1 . PHE A 1 46  ? 10.575  67.073 364.209 1.00 37.29  ? 47   PHE A CD1 1 
ATOM   341  C CD2 . PHE A 1 46  ? 11.841  67.560 366.169 1.00 35.93  ? 47   PHE A CD2 1 
ATOM   342  C CE1 . PHE A 1 46  ? 10.300  68.420 364.044 1.00 34.72  ? 47   PHE A CE1 1 
ATOM   343  C CE2 . PHE A 1 46  ? 11.573  68.909 366.012 1.00 42.45  ? 47   PHE A CE2 1 
ATOM   344  C CZ  . PHE A 1 46  ? 10.800  69.340 364.946 1.00 47.82  ? 47   PHE A CZ  1 
ATOM   345  N N   . LEU A 1 47  ? 10.411  62.191 366.876 1.00 38.84  ? 48   LEU A N   1 
ATOM   346  C CA  . LEU A 1 47  ? 10.844  60.840 367.193 1.00 40.50  ? 48   LEU A CA  1 
ATOM   347  C C   . LEU A 1 47  ? 9.867   59.817 366.634 1.00 39.24  ? 48   LEU A C   1 
ATOM   348  O O   . LEU A 1 47  ? 8.706   60.135 366.357 1.00 41.01  ? 48   LEU A O   1 
ATOM   349  C CB  . LEU A 1 47  ? 10.964  60.671 368.708 1.00 40.74  ? 48   LEU A CB  1 
ATOM   350  C CG  . LEU A 1 47  ? 12.103  61.420 369.400 1.00 56.28  ? 48   LEU A CG  1 
ATOM   351  C CD1 . LEU A 1 47  ? 12.228  60.985 370.857 1.00 46.13  ? 48   LEU A CD1 1 
ATOM   352  C CD2 . LEU A 1 47  ? 13.410  61.231 368.642 1.00 52.66  ? 48   LEU A CD2 1 
ATOM   353  N N   . PRO A 1 48  ? 10.312  58.575 366.446 1.00 41.00  ? 49   PRO A N   1 
ATOM   354  C CA  . PRO A 1 48  ? 9.392   57.534 365.999 1.00 37.61  ? 49   PRO A CA  1 
ATOM   355  C C   . PRO A 1 48  ? 8.300   57.310 367.021 1.00 46.03  ? 49   PRO A C   1 
ATOM   356  O O   . PRO A 1 48  ? 8.485   57.571 368.225 1.00 50.55  ? 49   PRO A O   1 
ATOM   357  C CB  . PRO A 1 48  ? 10.296  56.299 365.863 1.00 38.75  ? 49   PRO A CB  1 
ATOM   358  C CG  . PRO A 1 48  ? 11.667  56.840 365.694 1.00 39.27  ? 49   PRO A CG  1 
ATOM   359  C CD  . PRO A 1 48  ? 11.709  58.107 366.488 1.00 40.05  ? 49   PRO A CD  1 
ATOM   360  N N   . PRO A 1 49  ? 7.142   56.812 366.594 1.00 52.76  ? 50   PRO A N   1 
ATOM   361  C CA  . PRO A 1 49  ? 6.047   56.581 367.543 1.00 43.11  ? 50   PRO A CA  1 
ATOM   362  C C   . PRO A 1 49  ? 6.314   55.368 368.420 1.00 47.58  ? 50   PRO A C   1 
ATOM   363  O O   . PRO A 1 49  ? 6.770   54.324 367.949 1.00 55.64  ? 50   PRO A O   1 
ATOM   364  C CB  . PRO A 1 49  ? 4.839   56.349 366.631 1.00 45.45  ? 50   PRO A CB  1 
ATOM   365  C CG  . PRO A 1 49  ? 5.449   55.734 365.390 1.00 38.04  ? 50   PRO A CG  1 
ATOM   366  C CD  . PRO A 1 49  ? 6.769   56.443 365.216 1.00 40.26  ? 50   PRO A CD  1 
ATOM   367  N N   . GLU A 1 50  ? 6.020   55.510 369.712 1.00 49.11  ? 51   GLU A N   1 
ATOM   368  C CA  . GLU A 1 50  ? 6.066   54.332 370.561 1.00 58.54  ? 51   GLU A CA  1 
ATOM   369  C C   . GLU A 1 50  ? 4.651   53.866 370.896 1.00 52.23  ? 51   GLU A C   1 
ATOM   370  O O   . GLU A 1 50  ? 3.728   54.683 370.983 1.00 44.73  ? 51   GLU A O   1 
ATOM   371  C CB  . GLU A 1 50  ? 6.845   54.593 371.855 1.00 57.90  ? 51   GLU A CB  1 
ATOM   372  C CG  . GLU A 1 50  ? 6.394   55.800 372.645 1.00 72.68  ? 51   GLU A CG  1 
ATOM   373  C CD  . GLU A 1 50  ? 7.226   56.000 373.897 1.00 98.17  ? 51   GLU A CD  1 
ATOM   374  O OE1 . GLU A 1 50  ? 7.217   55.104 374.769 1.00 89.55  ? 51   GLU A OE1 1 
ATOM   375  O OE2 . GLU A 1 50  ? 7.899   57.047 374.004 1.00 92.61  ? 51   GLU A OE2 1 
ATOM   376  N N   . PRO A 1 51  ? 4.448   52.558 371.064 1.00 45.70  ? 52   PRO A N   1 
ATOM   377  C CA  . PRO A 1 51  ? 3.084   52.033 371.211 1.00 48.13  ? 52   PRO A CA  1 
ATOM   378  C C   . PRO A 1 51  ? 2.361   52.611 372.419 1.00 51.97  ? 52   PRO A C   1 
ATOM   379  O O   . PRO A 1 51  ? 2.969   52.970 373.430 1.00 50.57  ? 52   PRO A O   1 
ATOM   380  C CB  . PRO A 1 51  ? 3.300   50.523 371.365 1.00 55.56  ? 52   PRO A CB  1 
ATOM   381  C CG  . PRO A 1 51  ? 4.611   50.260 370.707 1.00 58.89  ? 52   PRO A CG  1 
ATOM   382  C CD  . PRO A 1 51  ? 5.448   51.482 370.950 1.00 45.61  ? 52   PRO A CD  1 
ATOM   383  N N   . LYS A 1 52  ? 1.039   52.703 372.294 1.00 52.03  ? 53   LYS A N   1 
ATOM   384  C CA  . LYS A 1 52  ? 0.203   53.196 373.380 1.00 50.74  ? 53   LYS A CA  1 
ATOM   385  C C   . LYS A 1 52  ? 0.224   52.202 374.535 1.00 52.96  ? 53   LYS A C   1 
ATOM   386  O O   . LYS A 1 52  ? -0.097  51.022 374.357 1.00 47.95  ? 53   LYS A O   1 
ATOM   387  C CB  . LYS A 1 52  ? -1.223  53.419 372.882 1.00 47.27  ? 53   LYS A CB  1 
ATOM   388  C CG  . LYS A 1 52  ? -2.208  53.830 373.965 1.00 48.81  ? 53   LYS A CG  1 
ATOM   389  C CD  . LYS A 1 52  ? -1.900  55.219 374.494 1.00 47.24  ? 53   LYS A CD  1 
ATOM   390  C CE  . LYS A 1 52  ? -2.985  55.703 375.446 1.00 59.42  ? 53   LYS A CE  1 
ATOM   391  N NZ  . LYS A 1 52  ? -2.751  57.108 375.889 1.00 64.68  ? 53   LYS A NZ  1 
ATOM   392  N N   . GLN A 1 53  ? 0.602   52.675 375.714 1.00 48.13  ? 54   GLN A N   1 
ATOM   393  C CA  . GLN A 1 53  ? 0.662   51.792 376.866 1.00 57.56  ? 54   GLN A CA  1 
ATOM   394  C C   . GLN A 1 53  ? -0.742  51.461 377.371 1.00 45.49  ? 54   GLN A C   1 
ATOM   395  O O   . GLN A 1 53  ? -1.658  52.282 377.262 1.00 48.84  ? 54   GLN A O   1 
ATOM   396  C CB  . GLN A 1 53  ? 1.484   52.432 377.976 1.00 52.69  ? 54   GLN A CB  1 
ATOM   397  C CG  . GLN A 1 53  ? 2.802   53.002 377.471 1.00 67.19  ? 54   GLN A CG  1 
ATOM   398  C CD  . GLN A 1 53  ? 3.776   53.321 378.584 1.00 91.37  ? 54   GLN A CD  1 
ATOM   399  O OE1 . GLN A 1 53  ? 4.051   54.487 378.867 1.00 92.51  ? 54   GLN A OE1 1 
ATOM   400  N NE2 . GLN A 1 53  ? 4.313   52.283 379.218 1.00 102.73 ? 54   GLN A NE2 1 
ATOM   401  N N   . PRO A 1 54  ? -0.935  50.255 377.910 1.00 52.30  ? 55   PRO A N   1 
ATOM   402  C CA  . PRO A 1 54  ? -2.278  49.837 378.334 1.00 48.99  ? 55   PRO A CA  1 
ATOM   403  C C   . PRO A 1 54  ? -2.903  50.806 379.329 1.00 56.18  ? 55   PRO A C   1 
ATOM   404  O O   . PRO A 1 54  ? -2.212  51.546 380.034 1.00 35.02  ? 55   PRO A O   1 
ATOM   405  C CB  . PRO A 1 54  ? -2.036  48.465 378.974 1.00 56.07  ? 55   PRO A CB  1 
ATOM   406  C CG  . PRO A 1 54  ? -0.797  47.957 378.315 1.00 63.06  ? 55   PRO A CG  1 
ATOM   407  C CD  . PRO A 1 54  ? 0.050   49.164 378.016 1.00 44.61  ? 55   PRO A CD  1 
ATOM   408  N N   . TRP A 1 55  ? -4.234  50.798 379.368 1.00 46.33  ? 56   TRP A N   1 
ATOM   409  C CA  . TRP A 1 55  ? -5.007  51.687 380.219 1.00 41.39  ? 56   TRP A CA  1 
ATOM   410  C C   . TRP A 1 55  ? -6.056  50.891 380.982 1.00 52.16  ? 56   TRP A C   1 
ATOM   411  O O   . TRP A 1 55  ? -6.563  49.875 380.497 1.00 40.93  ? 56   TRP A O   1 
ATOM   412  C CB  . TRP A 1 55  ? -5.697  52.792 379.402 1.00 38.50  ? 56   TRP A CB  1 
ATOM   413  C CG  . TRP A 1 55  ? -6.700  52.271 378.401 1.00 53.06  ? 56   TRP A CG  1 
ATOM   414  C CD1 . TRP A 1 55  ? -8.017  51.985 378.629 1.00 50.27  ? 56   TRP A CD1 1 
ATOM   415  C CD2 . TRP A 1 55  ? -6.462  51.976 377.018 1.00 43.19  ? 56   TRP A CD2 1 
ATOM   416  N NE1 . TRP A 1 55  ? -8.612  51.530 377.474 1.00 42.86  ? 56   TRP A NE1 1 
ATOM   417  C CE2 . TRP A 1 55  ? -7.679  51.516 376.471 1.00 52.69  ? 56   TRP A CE2 1 
ATOM   418  C CE3 . TRP A 1 55  ? -5.339  52.058 376.189 1.00 44.06  ? 56   TRP A CE3 1 
ATOM   419  C CZ2 . TRP A 1 55  ? -7.803  51.140 375.132 1.00 48.86  ? 56   TRP A CZ2 1 
ATOM   420  C CZ3 . TRP A 1 55  ? -5.464  51.682 374.859 1.00 50.81  ? 56   TRP A CZ3 1 
ATOM   421  C CH2 . TRP A 1 55  ? -6.687  51.229 374.346 1.00 40.25  ? 56   TRP A CH2 1 
ATOM   422  N N   . SER A 1 56  ? -6.376  51.365 382.182 1.00 41.31  ? 57   SER A N   1 
ATOM   423  C CA  . SER A 1 56  ? -7.469  50.809 382.963 1.00 53.54  ? 57   SER A CA  1 
ATOM   424  C C   . SER A 1 56  ? -8.744  51.598 382.693 1.00 49.28  ? 57   SER A C   1 
ATOM   425  O O   . SER A 1 56  ? -8.702  52.774 382.317 1.00 53.41  ? 57   SER A O   1 
ATOM   426  C CB  . SER A 1 56  ? -7.141  50.832 384.458 1.00 40.33  ? 57   SER A CB  1 
ATOM   427  O OG  . SER A 1 56  ? -6.982  52.161 384.920 1.00 60.53  ? 57   SER A OG  1 
ATOM   428  N N   . GLY A 1 57  ? -9.883  50.941 382.886 1.00 44.29  ? 58   GLY A N   1 
ATOM   429  C CA  . GLY A 1 57  ? -11.153 51.568 382.580 1.00 46.18  ? 58   GLY A CA  1 
ATOM   430  C C   . GLY A 1 57  ? -11.487 51.483 381.099 1.00 61.04  ? 58   GLY A C   1 
ATOM   431  O O   . GLY A 1 57  ? -10.892 50.716 380.332 1.00 39.57  ? 58   GLY A O   1 
ATOM   432  N N   . VAL A 1 58  ? -12.457 52.299 380.693 1.00 42.94  ? 59   VAL A N   1 
ATOM   433  C CA  . VAL A 1 58  ? -12.983 52.287 379.334 1.00 53.63  ? 59   VAL A CA  1 
ATOM   434  C C   . VAL A 1 58  ? -12.658 53.617 378.669 1.00 56.51  ? 59   VAL A C   1 
ATOM   435  O O   . VAL A 1 58  ? -12.958 54.683 379.219 1.00 46.76  ? 59   VAL A O   1 
ATOM   436  C CB  . VAL A 1 58  ? -14.500 52.025 379.312 1.00 51.49  ? 59   VAL A CB  1 
ATOM   437  C CG1 . VAL A 1 58  ? -14.979 51.839 377.882 1.00 39.09  ? 59   VAL A CG1 1 
ATOM   438  C CG2 . VAL A 1 58  ? -14.845 50.808 380.159 1.00 36.09  ? 59   VAL A CG2 1 
ATOM   439  N N   . VAL A 1 59  ? -12.047 53.550 377.490 1.00 49.17  ? 60   VAL A N   1 
ATOM   440  C CA  . VAL A 1 59  ? -11.761 54.733 376.689 1.00 44.52  ? 60   VAL A CA  1 
ATOM   441  C C   . VAL A 1 59  ? -12.944 54.989 375.766 1.00 40.71  ? 60   VAL A C   1 
ATOM   442  O O   . VAL A 1 59  ? -13.389 54.087 375.046 1.00 42.20  ? 60   VAL A O   1 
ATOM   443  C CB  . VAL A 1 59  ? -10.459 54.553 375.889 1.00 53.70  ? 60   VAL A CB  1 
ATOM   444  C CG1 . VAL A 1 59  ? -10.412 55.521 374.714 1.00 40.84  ? 60   VAL A CG1 1 
ATOM   445  C CG2 . VAL A 1 59  ? -9.251  54.748 376.793 1.00 41.58  ? 60   VAL A CG2 1 
ATOM   446  N N   . ASP A 1 60  ? -13.461 56.215 375.792 1.00 33.39  ? 61   ASP A N   1 
ATOM   447  C CA  . ASP A 1 60  ? -14.587 56.598 374.942 1.00 43.30  ? 61   ASP A CA  1 
ATOM   448  C C   . ASP A 1 60  ? -14.063 56.921 373.547 1.00 44.28  ? 61   ASP A C   1 
ATOM   449  O O   . ASP A 1 60  ? -13.509 57.997 373.309 1.00 39.85  ? 61   ASP A O   1 
ATOM   450  C CB  . ASP A 1 60  ? -15.334 57.785 375.541 1.00 46.68  ? 61   ASP A CB  1 
ATOM   451  C CG  . ASP A 1 60  ? -16.223 57.389 376.707 1.00 61.37  ? 61   ASP A CG  1 
ATOM   452  O OD1 . ASP A 1 60  ? -17.257 56.729 376.473 1.00 57.85  ? 61   ASP A OD1 1 
ATOM   453  O OD2 . ASP A 1 60  ? -15.887 57.738 377.859 1.00 69.17  ? 61   ASP A OD2 1 
ATOM   454  N N   . ALA A 1 61  ? -14.229 55.983 372.618 1.00 42.79  ? 62   ALA A N   1 
ATOM   455  C CA  . ALA A 1 61  ? -13.907 56.223 371.213 1.00 41.29  ? 62   ALA A CA  1 
ATOM   456  C C   . ALA A 1 61  ? -15.177 56.633 370.471 1.00 41.05  ? 62   ALA A C   1 
ATOM   457  O O   . ALA A 1 61  ? -15.735 55.896 369.658 1.00 33.45  ? 62   ALA A O   1 
ATOM   458  C CB  . ALA A 1 61  ? -13.266 54.984 370.594 1.00 34.95  ? 62   ALA A CB  1 
ATOM   459  N N   . THR A 1 62  ? -15.630 57.852 370.768 1.00 39.14  ? 63   THR A N   1 
ATOM   460  C CA  . THR A 1 62  ? -16.942 58.306 370.330 1.00 40.19  ? 63   THR A CA  1 
ATOM   461  C C   . THR A 1 62  ? -16.916 59.511 369.398 1.00 39.86  ? 63   THR A C   1 
ATOM   462  O O   . THR A 1 62  ? -17.989 59.967 368.982 1.00 42.05  ? 63   THR A O   1 
ATOM   463  C CB  . THR A 1 62  ? -17.816 58.629 371.551 1.00 43.96  ? 63   THR A CB  1 
ATOM   464  O OG1 . THR A 1 62  ? -17.187 59.653 372.328 1.00 39.14  ? 63   THR A OG1 1 
ATOM   465  C CG2 . THR A 1 62  ? -18.014 57.384 372.417 1.00 29.90  ? 63   THR A CG2 1 
ATOM   466  N N   . THR A 1 63  ? -15.743 60.043 369.059 1.00 35.84  ? 64   THR A N   1 
ATOM   467  C CA  . THR A 1 63  ? -15.663 61.121 368.079 1.00 38.34  ? 64   THR A CA  1 
ATOM   468  C C   . THR A 1 63  ? -14.221 61.263 367.616 1.00 36.34  ? 64   THR A C   1 
ATOM   469  O O   . THR A 1 63  ? -13.287 60.793 368.274 1.00 43.39  ? 64   THR A O   1 
ATOM   470  C CB  . THR A 1 63  ? -16.175 62.454 368.642 1.00 39.54  ? 64   THR A CB  1 
ATOM   471  O OG1 . THR A 1 63  ? -16.240 63.426 367.593 1.00 51.14  ? 64   THR A OG1 1 
ATOM   472  C CG2 . THR A 1 63  ? -15.239 62.971 369.712 1.00 38.90  ? 64   THR A CG2 1 
ATOM   473  N N   . PHE A 1 64  ? -14.056 61.931 366.474 1.00 38.09  ? 65   PHE A N   1 
ATOM   474  C CA  . PHE A 1 64  ? -12.737 62.127 365.888 1.00 40.90  ? 65   PHE A CA  1 
ATOM   475  C C   . PHE A 1 64  ? -11.848 62.945 366.814 1.00 37.81  ? 65   PHE A C   1 
ATOM   476  O O   . PHE A 1 64  ? -12.287 63.928 367.417 1.00 41.95  ? 65   PHE A O   1 
ATOM   477  C CB  . PHE A 1 64  ? -12.857 62.838 364.540 1.00 39.51  ? 65   PHE A CB  1 
ATOM   478  C CG  . PHE A 1 64  ? -13.394 61.976 363.440 1.00 37.79  ? 65   PHE A CG  1 
ATOM   479  C CD1 . PHE A 1 64  ? -12.706 60.845 363.031 1.00 36.69  ? 65   PHE A CD1 1 
ATOM   480  C CD2 . PHE A 1 64  ? -14.579 62.307 362.800 1.00 31.18  ? 65   PHE A CD2 1 
ATOM   481  C CE1 . PHE A 1 64  ? -13.194 60.051 362.011 1.00 42.39  ? 65   PHE A CE1 1 
ATOM   482  C CE2 . PHE A 1 64  ? -15.075 61.517 361.780 1.00 33.08  ? 65   PHE A CE2 1 
ATOM   483  C CZ  . PHE A 1 64  ? -14.381 60.386 361.383 1.00 40.35  ? 65   PHE A CZ  1 
ATOM   484  N N   . GLN A 1 65  ? -10.582 62.547 366.905 1.00 42.39  ? 66   GLN A N   1 
ATOM   485  C CA  . GLN A 1 65  ? -9.609  63.272 367.703 1.00 33.95  ? 66   GLN A CA  1 
ATOM   486  C C   . GLN A 1 65  ? -8.989  64.404 366.884 1.00 36.04  ? 66   GLN A C   1 
ATOM   487  O O   . GLN A 1 65  ? -9.356  64.654 365.733 1.00 34.58  ? 66   GLN A O   1 
ATOM   488  C CB  . GLN A 1 65  ? -8.540  62.318 368.228 1.00 40.49  ? 66   GLN A CB  1 
ATOM   489  C CG  . GLN A 1 65  ? -8.767  61.858 369.659 1.00 44.04  ? 66   GLN A CG  1 
ATOM   490  C CD  . GLN A 1 65  ? -8.362  62.900 370.682 1.00 51.13  ? 66   GLN A CD  1 
ATOM   491  O OE1 . GLN A 1 65  ? -7.946  64.004 370.332 1.00 51.83  ? 66   GLN A OE1 1 
ATOM   492  N NE2 . GLN A 1 65  ? -8.475  62.549 371.956 1.00 46.59  ? 66   GLN A NE2 1 
ATOM   493  N N   . SER A 1 66  ? -8.016  65.084 367.486 1.00 36.33  ? 67   SER A N   1 
ATOM   494  C CA  . SER A 1 66  ? -7.448  66.292 366.902 1.00 37.05  ? 67   SER A CA  1 
ATOM   495  C C   . SER A 1 66  ? -6.695  66.004 365.605 1.00 41.99  ? 67   SER A C   1 
ATOM   496  O O   . SER A 1 66  ? -6.172  64.909 365.385 1.00 41.25  ? 67   SER A O   1 
ATOM   497  C CB  . SER A 1 66  ? -6.507  66.969 367.900 1.00 36.47  ? 67   SER A CB  1 
ATOM   498  O OG  . SER A 1 66  ? -7.086  67.024 369.189 1.00 48.41  ? 67   SER A OG  1 
ATOM   499  N N   . VAL A 1 67  ? -6.643  67.015 364.747 1.00 39.24  ? 68   VAL A N   1 
ATOM   500  C CA  . VAL A 1 67  ? -5.862  66.963 363.518 1.00 44.06  ? 68   VAL A CA  1 
ATOM   501  C C   . VAL A 1 67  ? -4.401  67.250 363.844 1.00 45.18  ? 68   VAL A C   1 
ATOM   502  O O   . VAL A 1 67  ? -4.097  68.158 364.626 1.00 38.99  ? 68   VAL A O   1 
ATOM   503  C CB  . VAL A 1 67  ? -6.417  67.975 362.500 1.00 43.00  ? 68   VAL A CB  1 
ATOM   504  C CG1 . VAL A 1 67  ? -5.534  68.043 361.264 1.00 43.69  ? 68   VAL A CG1 1 
ATOM   505  C CG2 . VAL A 1 67  ? -7.856  67.636 362.134 1.00 39.60  ? 68   VAL A CG2 1 
ATOM   506  N N   . CYS A 1 68  ? -3.489  66.470 363.257 1.00 33.44  ? 69   CYS A N   1 
ATOM   507  C CA  . CYS A 1 68  ? -2.065  66.730 363.442 1.00 39.58  ? 69   CYS A CA  1 
ATOM   508  C C   . CYS A 1 68  ? -1.729  68.131 362.947 1.00 36.50  ? 69   CYS A C   1 
ATOM   509  O O   . CYS A 1 68  ? -2.221  68.563 361.901 1.00 44.94  ? 69   CYS A O   1 
ATOM   510  C CB  . CYS A 1 68  ? -1.222  65.695 362.689 1.00 33.85  ? 69   CYS A CB  1 
ATOM   511  S SG  . CYS A 1 68  ? -1.325  63.986 363.291 1.00 42.73  ? 69   CYS A SG  1 
ATOM   512  N N   . TYR A 1 69  ? -0.884  68.837 363.705 1.00 36.99  ? 70   TYR A N   1 
ATOM   513  C CA  . TYR A 1 69  ? -0.571  70.232 363.404 1.00 42.30  ? 70   TYR A CA  1 
ATOM   514  C C   . TYR A 1 69  ? -0.079  70.388 361.968 1.00 38.71  ? 70   TYR A C   1 
ATOM   515  O O   . TYR A 1 69  ? 0.825   69.673 361.525 1.00 33.50  ? 70   TYR A O   1 
ATOM   516  C CB  . TYR A 1 69  ? 0.475   70.767 364.387 1.00 37.54  ? 70   TYR A CB  1 
ATOM   517  C CG  . TYR A 1 69  ? 0.137   72.149 364.902 1.00 45.21  ? 70   TYR A CG  1 
ATOM   518  C CD1 . TYR A 1 69  ? -0.269  72.347 366.218 1.00 43.18  ? 70   TYR A CD1 1 
ATOM   519  C CD2 . TYR A 1 69  ? 0.198   73.251 364.063 1.00 42.12  ? 70   TYR A CD2 1 
ATOM   520  C CE1 . TYR A 1 69  ? -0.594  73.613 366.683 1.00 53.26  ? 70   TYR A CE1 1 
ATOM   521  C CE2 . TYR A 1 69  ? -0.125  74.516 364.517 1.00 58.89  ? 70   TYR A CE2 1 
ATOM   522  C CZ  . TYR A 1 69  ? -0.520  74.694 365.825 1.00 54.59  ? 70   TYR A CZ  1 
ATOM   523  O OH  . TYR A 1 69  ? -0.840  75.956 366.274 1.00 77.78  ? 70   TYR A OH  1 
ATOM   524  N N   . GLN A 1 70  ? -0.682  71.324 361.239 1.00 37.04  ? 71   GLN A N   1 
ATOM   525  C CA  . GLN A 1 70  ? -0.429  71.432 359.809 1.00 38.54  ? 71   GLN A CA  1 
ATOM   526  C C   . GLN A 1 70  ? -0.816  72.821 359.326 1.00 43.00  ? 71   GLN A C   1 
ATOM   527  O O   . GLN A 1 70  ? -1.525  73.568 360.005 1.00 44.06  ? 71   GLN A O   1 
ATOM   528  C CB  . GLN A 1 70  ? -1.197  70.362 359.031 1.00 36.09  ? 71   GLN A CB  1 
ATOM   529  C CG  . GLN A 1 70  ? -2.707  70.511 359.107 1.00 36.49  ? 71   GLN A CG  1 
ATOM   530  C CD  . GLN A 1 70  ? -3.435  69.358 358.446 1.00 42.42  ? 71   GLN A CD  1 
ATOM   531  O OE1 . GLN A 1 70  ? -4.202  69.553 357.504 1.00 36.95  ? 71   GLN A OE1 1 
ATOM   532  N NE2 . GLN A 1 70  ? -3.194  68.146 358.935 1.00 36.28  ? 71   GLN A NE2 1 
ATOM   533  N N   . TYR A 1 71  ? -0.344  73.147 358.127 1.00 39.03  ? 72   TYR A N   1 
ATOM   534  C CA  . TYR A 1 71  ? -0.689  74.400 357.472 1.00 41.14  ? 72   TYR A CA  1 
ATOM   535  C C   . TYR A 1 71  ? -2.163  74.412 357.075 1.00 40.04  ? 72   TYR A C   1 
ATOM   536  O O   . TYR A 1 71  ? -2.755  73.376 356.762 1.00 41.45  ? 72   TYR A O   1 
ATOM   537  C CB  . TYR A 1 71  ? 0.204   74.597 356.245 1.00 41.16  ? 72   TYR A CB  1 
ATOM   538  C CG  . TYR A 1 71  ? -0.178  75.741 355.335 1.00 45.21  ? 72   TYR A CG  1 
ATOM   539  C CD1 . TYR A 1 71  ? 0.159   77.050 355.653 1.00 40.02  ? 72   TYR A CD1 1 
ATOM   540  C CD2 . TYR A 1 71  ? -0.849  75.508 354.139 1.00 37.04  ? 72   TYR A CD2 1 
ATOM   541  C CE1 . TYR A 1 71  ? -0.177  78.098 354.816 1.00 41.19  ? 72   TYR A CE1 1 
ATOM   542  C CE2 . TYR A 1 71  ? -1.189  76.547 353.297 1.00 42.72  ? 72   TYR A CE2 1 
ATOM   543  C CZ  . TYR A 1 71  ? -0.851  77.840 353.640 1.00 53.72  ? 72   TYR A CZ  1 
ATOM   544  O OH  . TYR A 1 71  ? -1.192  78.876 352.800 1.00 54.51  ? 72   TYR A OH  1 
ATOM   545  N N   . VAL A 1 72  ? -2.761  75.601 357.098 1.00 41.50  ? 73   VAL A N   1 
ATOM   546  C CA  . VAL A 1 72  ? -4.164  75.789 356.739 1.00 41.53  ? 73   VAL A CA  1 
ATOM   547  C C   . VAL A 1 72  ? -4.225  76.688 355.512 1.00 44.69  ? 73   VAL A C   1 
ATOM   548  O O   . VAL A 1 72  ? -3.701  77.809 355.530 1.00 47.84  ? 73   VAL A O   1 
ATOM   549  C CB  . VAL A 1 72  ? -4.978  76.383 357.900 1.00 47.38  ? 73   VAL A CB  1 
ATOM   550  C CG1 . VAL A 1 72  ? -6.406  76.668 357.458 1.00 44.78  ? 73   VAL A CG1 1 
ATOM   551  C CG2 . VAL A 1 72  ? -4.970  75.434 359.086 1.00 43.89  ? 73   VAL A CG2 1 
ATOM   552  N N   . ASP A 1 73  ? -4.867  76.199 354.453 1.00 44.50  ? 74   ASP A N   1 
ATOM   553  C CA  . ASP A 1 73  ? -4.935  76.935 353.197 1.00 46.00  ? 74   ASP A CA  1 
ATOM   554  C C   . ASP A 1 73  ? -5.757  78.210 353.351 1.00 52.54  ? 74   ASP A C   1 
ATOM   555  O O   . ASP A 1 73  ? -6.838  78.204 353.946 1.00 53.84  ? 74   ASP A O   1 
ATOM   556  C CB  . ASP A 1 73  ? -5.540  76.055 352.103 1.00 48.18  ? 74   ASP A CB  1 
ATOM   557  C CG  . ASP A 1 73  ? -5.627  76.762 350.765 1.00 56.18  ? 74   ASP A CG  1 
ATOM   558  O OD1 . ASP A 1 73  ? -6.748  77.124 350.348 1.00 66.40  ? 74   ASP A OD1 1 
ATOM   559  O OD2 . ASP A 1 73  ? -4.570  76.958 350.132 1.00 58.49  ? 74   ASP A OD2 1 
ATOM   560  N N   . THR A 1 74  ? -5.239  79.311 352.796 1.00 61.17  ? 75   THR A N   1 
ATOM   561  C CA  . THR A 1 74  ? -5.901  80.609 352.879 1.00 57.65  ? 75   THR A CA  1 
ATOM   562  C C   . THR A 1 74  ? -6.010  81.311 351.529 1.00 59.12  ? 75   THR A C   1 
ATOM   563  O O   . THR A 1 74  ? -6.305  82.512 351.495 1.00 54.11  ? 75   THR A O   1 
ATOM   564  C CB  . THR A 1 74  ? -5.170  81.528 353.866 1.00 57.85  ? 75   THR A CB  1 
ATOM   565  O OG1 . THR A 1 74  ? -3.789  81.630 353.491 1.00 57.13  ? 75   THR A OG1 1 
ATOM   566  C CG2 . THR A 1 74  ? -5.277  80.990 355.289 1.00 56.52  ? 75   THR A CG2 1 
ATOM   567  N N   . LEU A 1 75  ? -5.783  80.605 350.418 1.00 45.98  ? 76   LEU A N   1 
ATOM   568  C CA  . LEU A 1 75  ? -5.830  81.253 349.110 1.00 47.82  ? 76   LEU A CA  1 
ATOM   569  C C   . LEU A 1 75  ? -7.237  81.740 348.785 1.00 51.10  ? 76   LEU A C   1 
ATOM   570  O O   . LEU A 1 75  ? -7.422  82.876 348.331 1.00 56.97  ? 76   LEU A O   1 
ATOM   571  C CB  . LEU A 1 75  ? -5.329  80.298 348.026 1.00 52.83  ? 76   LEU A CB  1 
ATOM   572  C CG  . LEU A 1 75  ? -5.388  80.847 346.596 1.00 55.81  ? 76   LEU A CG  1 
ATOM   573  C CD1 . LEU A 1 75  ? -4.534  82.099 346.457 1.00 54.55  ? 76   LEU A CD1 1 
ATOM   574  C CD2 . LEU A 1 75  ? -4.960  79.798 345.590 1.00 48.42  ? 76   LEU A CD2 1 
ATOM   575  N N   . TYR A 1 76  ? -8.244  80.894 349.009 1.00 47.67  ? 77   TYR A N   1 
ATOM   576  C CA  . TYR A 1 76  ? -9.645  81.224 348.751 1.00 54.34  ? 77   TYR A CA  1 
ATOM   577  C C   . TYR A 1 76  ? -10.426 81.049 350.048 1.00 53.31  ? 77   TYR A C   1 
ATOM   578  O O   . TYR A 1 76  ? -11.058 80.004 350.269 1.00 48.87  ? 77   TYR A O   1 
ATOM   579  C CB  . TYR A 1 76  ? -10.219 80.355 347.635 1.00 48.26  ? 77   TYR A CB  1 
ATOM   580  C CG  . TYR A 1 76  ? -9.493  80.499 346.318 1.00 52.46  ? 77   TYR A CG  1 
ATOM   581  C CD1 . TYR A 1 76  ? -9.364  81.739 345.707 1.00 44.45  ? 77   TYR A CD1 1 
ATOM   582  C CD2 . TYR A 1 76  ? -8.934  79.395 345.686 1.00 50.82  ? 77   TYR A CD2 1 
ATOM   583  C CE1 . TYR A 1 76  ? -8.703  81.876 344.503 1.00 56.04  ? 77   TYR A CE1 1 
ATOM   584  C CE2 . TYR A 1 76  ? -8.270  79.523 344.480 1.00 55.24  ? 77   TYR A CE2 1 
ATOM   585  C CZ  . TYR A 1 76  ? -8.158  80.766 343.893 1.00 58.48  ? 77   TYR A CZ  1 
ATOM   586  O OH  . TYR A 1 76  ? -7.499  80.901 342.693 1.00 56.13  ? 77   TYR A OH  1 
ATOM   587  N N   . PRO A 1 77  ? -10.412 82.054 350.926 1.00 51.25  ? 78   PRO A N   1 
ATOM   588  C CA  . PRO A 1 77  ? -11.041 81.899 352.248 1.00 56.96  ? 78   PRO A CA  1 
ATOM   589  C C   . PRO A 1 77  ? -12.550 81.737 352.136 1.00 53.78  ? 78   PRO A C   1 
ATOM   590  O O   . PRO A 1 77  ? -13.232 82.540 351.497 1.00 51.87  ? 78   PRO A O   1 
ATOM   591  C CB  . PRO A 1 77  ? -10.667 83.197 352.976 1.00 50.33  ? 78   PRO A CB  1 
ATOM   592  C CG  . PRO A 1 77  ? -9.511  83.764 352.207 1.00 65.71  ? 78   PRO A CG  1 
ATOM   593  C CD  . PRO A 1 77  ? -9.728  83.349 350.785 1.00 55.16  ? 78   PRO A CD  1 
ATOM   594  N N   . GLY A 1 78  ? -13.070 80.690 352.777 1.00 58.16  ? 79   GLY A N   1 
ATOM   595  C CA  . GLY A 1 78  ? -14.484 80.391 352.730 1.00 51.63  ? 79   GLY A CA  1 
ATOM   596  C C   . GLY A 1 78  ? -14.942 79.611 351.517 1.00 54.67  ? 79   GLY A C   1 
ATOM   597  O O   . GLY A 1 78  ? -16.129 79.268 351.437 1.00 51.43  ? 79   GLY A O   1 
ATOM   598  N N   . PHE A 1 79  ? -14.047 79.313 350.577 1.00 51.10  ? 80   PHE A N   1 
ATOM   599  C CA  . PHE A 1 79  ? -14.419 78.610 349.357 1.00 45.27  ? 80   PHE A CA  1 
ATOM   600  C C   . PHE A 1 79  ? -14.571 77.117 349.630 1.00 48.51  ? 80   PHE A C   1 
ATOM   601  O O   . PHE A 1 79  ? -13.684 76.489 350.216 1.00 51.68  ? 80   PHE A O   1 
ATOM   602  C CB  . PHE A 1 79  ? -13.374 78.855 348.270 1.00 48.03  ? 80   PHE A CB  1 
ATOM   603  C CG  . PHE A 1 79  ? -13.642 78.124 346.985 1.00 51.20  ? 80   PHE A CG  1 
ATOM   604  C CD1 . PHE A 1 79  ? -14.826 78.320 346.292 1.00 47.29  ? 80   PHE A CD1 1 
ATOM   605  C CD2 . PHE A 1 79  ? -12.700 77.256 346.458 1.00 49.38  ? 80   PHE A CD2 1 
ATOM   606  C CE1 . PHE A 1 79  ? -15.072 77.654 345.106 1.00 45.96  ? 80   PHE A CE1 1 
ATOM   607  C CE2 . PHE A 1 79  ? -12.939 76.588 345.271 1.00 53.23  ? 80   PHE A CE2 1 
ATOM   608  C CZ  . PHE A 1 79  ? -14.128 76.787 344.594 1.00 51.22  ? 80   PHE A CZ  1 
ATOM   609  N N   . GLU A 1 80  ? -15.699 76.555 349.192 1.00 46.71  ? 81   GLU A N   1 
ATOM   610  C CA  . GLU A 1 80  ? -16.005 75.152 349.461 1.00 44.40  ? 81   GLU A CA  1 
ATOM   611  C C   . GLU A 1 80  ? -14.929 74.218 348.914 1.00 56.15  ? 81   GLU A C   1 
ATOM   612  O O   . GLU A 1 80  ? -14.599 73.205 349.544 1.00 46.29  ? 81   GLU A O   1 
ATOM   613  C CB  . GLU A 1 80  ? -17.368 74.808 348.861 1.00 48.80  ? 81   GLU A CB  1 
ATOM   614  C CG  . GLU A 1 80  ? -17.814 73.374 349.060 1.00 65.20  ? 81   GLU A CG  1 
ATOM   615  C CD  . GLU A 1 80  ? -19.097 73.066 348.311 1.00 91.77  ? 81   GLU A CD  1 
ATOM   616  O OE1 . GLU A 1 80  ? -19.994 73.937 348.286 1.00 97.83  ? 81   GLU A OE1 1 
ATOM   617  O OE2 . GLU A 1 80  ? -19.211 71.957 347.748 1.00 92.54  ? 81   GLU A OE2 1 
ATOM   618  N N   . GLY A 1 81  ? -14.371 74.539 347.744 1.00 49.41  ? 82   GLY A N   1 
ATOM   619  C CA  . GLY A 1 81  ? -13.416 73.644 347.112 1.00 39.27  ? 82   GLY A CA  1 
ATOM   620  C C   . GLY A 1 81  ? -12.130 73.465 347.893 1.00 47.84  ? 82   GLY A C   1 
ATOM   621  O O   . GLY A 1 81  ? -11.493 72.411 347.809 1.00 45.52  ? 82   GLY A O   1 
ATOM   622  N N   . THR A 1 82  ? -11.726 74.478 348.658 1.00 41.17  ? 83   THR A N   1 
ATOM   623  C CA  . THR A 1 82  ? -10.518 74.378 349.466 1.00 45.39  ? 83   THR A CA  1 
ATOM   624  C C   . THR A 1 82  ? -10.795 74.069 350.931 1.00 45.72  ? 83   THR A C   1 
ATOM   625  O O   . THR A 1 82  ? -9.998  73.365 351.560 1.00 44.86  ? 83   THR A O   1 
ATOM   626  C CB  . THR A 1 82  ? -9.698  75.672 349.370 1.00 42.86  ? 83   THR A CB  1 
ATOM   627  O OG1 . THR A 1 82  ? -10.535 76.799 349.655 1.00 51.58  ? 83   THR A OG1 1 
ATOM   628  C CG2 . THR A 1 82  ? -9.113  75.826 347.975 1.00 52.62  ? 83   THR A CG2 1 
ATOM   629  N N   . GLU A 1 83  ? -11.906 74.565 351.487 1.00 43.77  ? 84   GLU A N   1 
ATOM   630  C CA  . GLU A 1 83  ? -12.202 74.333 352.898 1.00 48.64  ? 84   GLU A CA  1 
ATOM   631  C C   . GLU A 1 83  ? -12.489 72.868 353.203 1.00 44.35  ? 84   GLU A C   1 
ATOM   632  O O   . GLU A 1 83  ? -12.290 72.437 354.343 1.00 46.69  ? 84   GLU A O   1 
ATOM   633  C CB  . GLU A 1 83  ? -13.390 75.191 353.348 1.00 41.69  ? 84   GLU A CB  1 
ATOM   634  C CG  . GLU A 1 83  ? -13.158 76.697 353.277 1.00 46.72  ? 84   GLU A CG  1 
ATOM   635  C CD  . GLU A 1 83  ? -12.098 77.191 354.245 1.00 55.62  ? 84   GLU A CD  1 
ATOM   636  O OE1 . GLU A 1 83  ? -11.602 78.322 354.049 1.00 63.50  ? 84   GLU A OE1 1 
ATOM   637  O OE2 . GLU A 1 83  ? -11.763 76.460 355.203 1.00 57.00  ? 84   GLU A OE2 1 
ATOM   638  N N   . MET A 1 84  ? -12.948 72.094 352.217 1.00 39.79  ? 85   MET A N   1 
ATOM   639  C CA  . MET A 1 84  ? -13.219 70.679 352.444 1.00 33.88  ? 85   MET A CA  1 
ATOM   640  C C   . MET A 1 84  ? -11.961 69.886 352.779 1.00 41.34  ? 85   MET A C   1 
ATOM   641  O O   . MET A 1 84  ? -12.069 68.791 353.338 1.00 45.21  ? 85   MET A O   1 
ATOM   642  C CB  . MET A 1 84  ? -13.898 70.070 351.215 1.00 36.40  ? 85   MET A CB  1 
ATOM   643  C CG  . MET A 1 84  ? -13.091 70.205 349.930 1.00 41.89  ? 85   MET A CG  1 
ATOM   644  S SD  . MET A 1 84  ? -13.904 69.447 348.508 1.00 49.59  ? 85   MET A SD  1 
ATOM   645  C CE  . MET A 1 84  ? -13.899 67.723 349.003 1.00 39.14  ? 85   MET A CE  1 
ATOM   646  N N   . TRP A 1 85  ? -10.777 70.402 352.444 1.00 35.55  ? 86   TRP A N   1 
ATOM   647  C CA  . TRP A 1 85  ? -9.525  69.726 352.750 1.00 39.59  ? 86   TRP A CA  1 
ATOM   648  C C   . TRP A 1 85  ? -8.862  70.250 354.015 1.00 43.13  ? 86   TRP A C   1 
ATOM   649  O O   . TRP A 1 85  ? -7.898  69.638 354.491 1.00 37.66  ? 86   TRP A O   1 
ATOM   650  C CB  . TRP A 1 85  ? -8.550  69.853 351.570 1.00 28.37  ? 86   TRP A CB  1 
ATOM   651  C CG  . TRP A 1 85  ? -9.145  69.432 350.254 1.00 36.98  ? 86   TRP A CG  1 
ATOM   652  C CD1 . TRP A 1 85  ? -9.456  70.240 349.198 1.00 35.97  ? 86   TRP A CD1 1 
ATOM   653  C CD2 . TRP A 1 85  ? -9.501  68.101 349.856 1.00 38.19  ? 86   TRP A CD2 1 
ATOM   654  N NE1 . TRP A 1 85  ? -9.981  69.496 348.169 1.00 38.39  ? 86   TRP A NE1 1 
ATOM   655  C CE2 . TRP A 1 85  ? -10.020 68.180 348.547 1.00 35.10  ? 86   TRP A CE2 1 
ATOM   656  C CE3 . TRP A 1 85  ? -9.430  66.851 350.479 1.00 35.86  ? 86   TRP A CE3 1 
ATOM   657  C CZ2 . TRP A 1 85  ? -10.466 67.058 347.851 1.00 32.35  ? 86   TRP A CZ2 1 
ATOM   658  C CZ3 . TRP A 1 85  ? -9.874  65.736 349.784 1.00 40.52  ? 86   TRP A CZ3 1 
ATOM   659  C CH2 . TRP A 1 85  ? -10.384 65.848 348.485 1.00 36.11  ? 86   TRP A CH2 1 
ATOM   660  N N   . ASN A 1 86  ? -9.358  71.352 354.568 1.00 36.58  ? 87   ASN A N   1 
ATOM   661  C CA  . ASN A 1 86  ? -8.762  71.984 355.730 1.00 37.10  ? 87   ASN A CA  1 
ATOM   662  C C   . ASN A 1 86  ? -9.181  71.267 357.011 1.00 38.36  ? 87   ASN A C   1 
ATOM   663  O O   . ASN A 1 86  ? -10.189 70.557 357.035 1.00 38.45  ? 87   ASN A O   1 
ATOM   664  C CB  . ASN A 1 86  ? -9.168  73.454 355.781 1.00 49.19  ? 87   ASN A CB  1 
ATOM   665  C CG  . ASN A 1 86  ? -8.231  74.343 354.985 1.00 49.21  ? 87   ASN A CG  1 
ATOM   666  O OD1 . ASN A 1 86  ? -7.071  73.996 354.759 1.00 48.68  ? 87   ASN A OD1 1 
ATOM   667  N ND2 . ASN A 1 86  ? -8.728  75.499 354.561 1.00 44.11  ? 87   ASN A ND2 1 
ATOM   668  N N   . PRO A 1 87  ? -8.412  71.429 358.089 1.00 43.48  ? 88   PRO A N   1 
ATOM   669  C CA  . PRO A 1 87  ? -8.745  70.740 359.344 1.00 42.56  ? 88   PRO A CA  1 
ATOM   670  C C   . PRO A 1 87  ? -10.135 71.107 359.846 1.00 46.61  ? 88   PRO A C   1 
ATOM   671  O O   . PRO A 1 87  ? -10.496 72.282 359.930 1.00 42.87  ? 88   PRO A O   1 
ATOM   672  C CB  . PRO A 1 87  ? -7.655  71.220 360.309 1.00 37.12  ? 88   PRO A CB  1 
ATOM   673  C CG  . PRO A 1 87  ? -6.511  71.587 359.432 1.00 46.54  ? 88   PRO A CG  1 
ATOM   674  C CD  . PRO A 1 87  ? -7.111  72.118 358.164 1.00 40.65  ? 88   PRO A CD  1 
ATOM   675  N N   . ASN A 1 88  ? -10.920 70.080 360.172 1.00 42.31  ? 89   ASN A N   1 
ATOM   676  C CA  . ASN A 1 88  ? -12.231 70.247 360.784 1.00 47.38  ? 89   ASN A CA  1 
ATOM   677  C C   . ASN A 1 88  ? -12.223 69.886 362.262 1.00 43.67  ? 89   ASN A C   1 
ATOM   678  O O   . ASN A 1 88  ? -13.289 69.701 362.857 1.00 47.65  ? 89   ASN A O   1 
ATOM   679  C CB  . ASN A 1 88  ? -13.273 69.410 360.041 1.00 41.72  ? 89   ASN A CB  1 
ATOM   680  C CG  . ASN A 1 88  ? -12.980 67.926 360.106 1.00 50.58  ? 89   ASN A CG  1 
ATOM   681  O OD1 . ASN A 1 88  ? -11.855 67.515 360.397 1.00 42.51  ? 89   ASN A OD1 1 
ATOM   682  N ND2 . ASN A 1 88  ? -13.991 67.110 359.831 1.00 47.69  ? 89   ASN A ND2 1 
ATOM   683  N N   . ARG A 1 89  ? -11.042 69.755 362.856 1.00 44.17  ? 90   ARG A N   1 
ATOM   684  C CA  . ARG A 1 89  ? -10.884 69.565 364.287 1.00 42.64  ? 90   ARG A CA  1 
ATOM   685  C C   . ARG A 1 89  ? -9.732  70.442 364.738 1.00 45.29  ? 90   ARG A C   1 
ATOM   686  O O   . ARG A 1 89  ? -9.022  71.037 363.922 1.00 44.87  ? 90   ARG A O   1 
ATOM   687  C CB  . ARG A 1 89  ? -10.615 68.100 364.651 1.00 42.99  ? 90   ARG A CB  1 
ATOM   688  C CG  . ARG A 1 89  ? -11.810 67.183 364.480 1.00 55.97  ? 90   ARG A CG  1 
ATOM   689  C CD  . ARG A 1 89  ? -12.942 67.581 365.407 1.00 58.20  ? 90   ARG A CD  1 
ATOM   690  N NE  . ARG A 1 89  ? -13.907 66.501 365.590 1.00 61.87  ? 90   ARG A NE  1 
ATOM   691  C CZ  . ARG A 1 89  ? -14.922 66.261 364.767 1.00 59.25  ? 90   ARG A CZ  1 
ATOM   692  N NH1 . ARG A 1 89  ? -15.112 67.029 363.702 1.00 53.84  ? 90   ARG A NH1 1 
ATOM   693  N NH2 . ARG A 1 89  ? -15.751 65.255 365.012 1.00 64.98  ? 90   ARG A NH2 1 
ATOM   694  N N   . GLU A 1 90  ? -9.538  70.519 366.049 1.00 39.26  ? 91   GLU A N   1 
ATOM   695  C CA  . GLU A 1 90  ? -8.493  71.392 366.555 1.00 48.94  ? 91   GLU A CA  1 
ATOM   696  C C   . GLU A 1 90  ? -7.125  70.823 366.203 1.00 52.12  ? 91   GLU A C   1 
ATOM   697  O O   . GLU A 1 90  ? -6.934  69.602 366.153 1.00 38.07  ? 91   GLU A O   1 
ATOM   698  C CB  . GLU A 1 90  ? -8.610  71.578 368.064 1.00 41.54  ? 91   GLU A CB  1 
ATOM   699  C CG  . GLU A 1 90  ? -8.410  70.329 368.876 1.00 66.37  ? 91   GLU A CG  1 
ATOM   700  C CD  . GLU A 1 90  ? -7.871  70.647 370.247 1.00 86.92  ? 91   GLU A CD  1 
ATOM   701  O OE1 . GLU A 1 90  ? -7.121  71.640 370.384 1.00 86.88  ? 91   GLU A OE1 1 
ATOM   702  O OE2 . GLU A 1 90  ? -8.209  69.910 371.194 1.00 89.76  ? 91   GLU A OE2 1 
ATOM   703  N N   . LEU A 1 91  ? -6.175  71.717 365.941 1.00 40.35  ? 92   LEU A N   1 
ATOM   704  C CA  . LEU A 1 91  ? -4.806  71.317 365.647 1.00 42.27  ? 92   LEU A CA  1 
ATOM   705  C C   . LEU A 1 91  ? -4.078  70.963 366.937 1.00 43.75  ? 92   LEU A C   1 
ATOM   706  O O   . LEU A 1 91  ? -4.205  71.663 367.945 1.00 43.01  ? 92   LEU A O   1 
ATOM   707  C CB  . LEU A 1 91  ? -4.066  72.446 364.933 1.00 36.90  ? 92   LEU A CB  1 
ATOM   708  C CG  . LEU A 1 91  ? -4.607  72.888 363.573 1.00 45.96  ? 92   LEU A CG  1 
ATOM   709  C CD1 . LEU A 1 91  ? -3.685  73.920 362.950 1.00 36.20  ? 92   LEU A CD1 1 
ATOM   710  C CD2 . LEU A 1 91  ? -4.779  71.694 362.652 1.00 35.84  ? 92   LEU A CD2 1 
ATOM   711  N N   . SER A 1 92  ? -3.310  69.875 366.906 1.00 42.82  ? 93   SER A N   1 
ATOM   712  C CA  . SER A 1 92  ? -2.490  69.517 368.058 1.00 40.97  ? 93   SER A CA  1 
ATOM   713  C C   . SER A 1 92  ? -1.469  68.469 367.643 1.00 43.28  ? 93   SER A C   1 
ATOM   714  O O   . SER A 1 92  ? -1.692  67.707 366.698 1.00 50.82  ? 93   SER A O   1 
ATOM   715  C CB  . SER A 1 92  ? -3.344  68.988 369.218 1.00 38.23  ? 93   SER A CB  1 
ATOM   716  O OG  . SER A 1 92  ? -2.632  68.028 369.979 1.00 44.50  ? 93   SER A OG  1 
ATOM   717  N N   . GLU A 1 93  ? -0.344  68.443 368.363 1.00 43.16  ? 94   GLU A N   1 
ATOM   718  C CA  . GLU A 1 93  ? 0.635   67.381 368.172 1.00 41.51  ? 94   GLU A CA  1 
ATOM   719  C C   . GLU A 1 93  ? 0.169   66.067 368.786 1.00 46.32  ? 94   GLU A C   1 
ATOM   720  O O   . GLU A 1 93  ? 0.621   65.000 368.358 1.00 45.67  ? 94   GLU A O   1 
ATOM   721  C CB  . GLU A 1 93  ? 1.982   67.792 368.769 1.00 42.62  ? 94   GLU A CB  1 
ATOM   722  C CG  . GLU A 1 93  ? 2.755   68.804 367.938 1.00 43.54  ? 94   GLU A CG  1 
ATOM   723  C CD  . GLU A 1 93  ? 4.110   69.135 368.541 1.00 60.86  ? 94   GLU A CD  1 
ATOM   724  O OE1 . GLU A 1 93  ? 5.099   68.452 368.200 1.00 52.76  ? 94   GLU A OE1 1 
ATOM   725  O OE2 . GLU A 1 93  ? 4.187   70.084 369.351 1.00 52.24  ? 94   GLU A OE2 1 
ATOM   726  N N   . ASP A 1 94  ? -0.715  66.122 369.782 1.00 39.58  ? 95   ASP A N   1 
ATOM   727  C CA  . ASP A 1 94  ? -1.371  64.929 370.314 1.00 42.93  ? 95   ASP A CA  1 
ATOM   728  C C   . ASP A 1 94  ? -2.421  64.513 369.293 1.00 48.91  ? 95   ASP A C   1 
ATOM   729  O O   . ASP A 1 94  ? -3.582  64.914 369.362 1.00 45.01  ? 95   ASP A O   1 
ATOM   730  C CB  . ASP A 1 94  ? -1.981  65.210 371.682 1.00 40.42  ? 95   ASP A CB  1 
ATOM   731  C CG  . ASP A 1 94  ? -2.663  63.993 372.286 1.00 50.65  ? 95   ASP A CG  1 
ATOM   732  O OD1 . ASP A 1 94  ? -2.486  62.874 371.757 1.00 50.54  ? 95   ASP A OD1 1 
ATOM   733  O OD2 . ASP A 1 94  ? -3.372  64.153 373.301 1.00 64.61  ? 95   ASP A OD2 1 
ATOM   734  N N   . CYS A 1 95  ? -2.012  63.714 368.313 1.00 39.83  ? 96   CYS A N   1 
ATOM   735  C CA  . CYS A 1 95  ? -2.875  63.468 367.170 1.00 36.35  ? 96   CYS A CA  1 
ATOM   736  C C   . CYS A 1 95  ? -2.869  62.026 366.680 1.00 32.33  ? 96   CYS A C   1 
ATOM   737  O O   . CYS A 1 95  ? -3.558  61.731 365.698 1.00 39.22  ? 96   CYS A O   1 
ATOM   738  C CB  . CYS A 1 95  ? -2.489  64.412 366.015 1.00 38.17  ? 96   CYS A CB  1 
ATOM   739  S SG  . CYS A 1 95  ? -0.858  64.105 365.277 1.00 43.84  ? 96   CYS A SG  1 
ATOM   740  N N   . LEU A 1 96  ? -2.137  61.118 367.326 1.00 34.19  ? 97   LEU A N   1 
ATOM   741  C CA  . LEU A 1 96  ? -1.974  59.754 366.816 1.00 36.51  ? 97   LEU A CA  1 
ATOM   742  C C   . LEU A 1 96  ? -3.141  58.884 367.287 1.00 32.71  ? 97   LEU A C   1 
ATOM   743  O O   . LEU A 1 96  ? -3.054  58.124 368.254 1.00 37.32  ? 97   LEU A O   1 
ATOM   744  C CB  . LEU A 1 96  ? -0.622  59.194 367.243 1.00 31.80  ? 97   LEU A CB  1 
ATOM   745  C CG  . LEU A 1 96  ? 0.549   59.913 366.565 1.00 38.11  ? 97   LEU A CG  1 
ATOM   746  C CD1 . LEU A 1 96  ? 1.868   59.235 366.885 1.00 34.26  ? 97   LEU A CD1 1 
ATOM   747  C CD2 . LEU A 1 96  ? 0.327   59.976 365.056 1.00 36.55  ? 97   LEU A CD2 1 
ATOM   748  N N   . TYR A 1 97  ? -4.259  59.003 366.570 1.00 34.05  ? 98   TYR A N   1 
ATOM   749  C CA  . TYR A 1 97  ? -5.460  58.222 366.833 1.00 28.15  ? 98   TYR A CA  1 
ATOM   750  C C   . TYR A 1 97  ? -5.970  57.633 365.525 1.00 35.36  ? 98   TYR A C   1 
ATOM   751  O O   . TYR A 1 97  ? -5.759  58.201 364.450 1.00 33.71  ? 98   TYR A O   1 
ATOM   752  C CB  . TYR A 1 97  ? -6.564  59.077 367.492 1.00 27.63  ? 98   TYR A CB  1 
ATOM   753  C CG  . TYR A 1 97  ? -6.127  59.744 368.777 1.00 31.39  ? 98   TYR A CG  1 
ATOM   754  C CD1 . TYR A 1 97  ? -6.420  59.177 370.012 1.00 38.32  ? 98   TYR A CD1 1 
ATOM   755  C CD2 . TYR A 1 97  ? -5.413  60.936 368.756 1.00 34.33  ? 98   TYR A CD2 1 
ATOM   756  C CE1 . TYR A 1 97  ? -6.015  59.783 371.191 1.00 33.97  ? 98   TYR A CE1 1 
ATOM   757  C CE2 . TYR A 1 97  ? -5.004  61.547 369.923 1.00 37.45  ? 98   TYR A CE2 1 
ATOM   758  C CZ  . TYR A 1 97  ? -5.307  60.968 371.138 1.00 42.79  ? 98   TYR A CZ  1 
ATOM   759  O OH  . TYR A 1 97  ? -4.895  61.581 372.295 1.00 42.64  ? 98   TYR A OH  1 
ATOM   760  N N   . LEU A 1 98  ? -6.636  56.483 365.620 1.00 34.40  ? 99   LEU A N   1 
ATOM   761  C CA  . LEU A 1 98  ? -7.216  55.832 364.454 1.00 38.20  ? 99   LEU A CA  1 
ATOM   762  C C   . LEU A 1 98  ? -8.703  55.586 364.684 1.00 38.84  ? 99   LEU A C   1 
ATOM   763  O O   . LEU A 1 98  ? -9.222  55.740 365.792 1.00 39.17  ? 99   LEU A O   1 
ATOM   764  C CB  . LEU A 1 98  ? -6.484  54.522 364.117 1.00 38.34  ? 99   LEU A CB  1 
ATOM   765  C CG  . LEU A 1 98  ? -6.338  53.404 365.149 1.00 40.05  ? 99   LEU A CG  1 
ATOM   766  C CD1 . LEU A 1 98  ? -7.573  52.520 365.186 1.00 40.21  ? 99   LEU A CD1 1 
ATOM   767  C CD2 . LEU A 1 98  ? -5.107  52.572 364.826 1.00 36.17  ? 99   LEU A CD2 1 
ATOM   768  N N   . ASN A 1 99  ? -9.387  55.194 363.611 1.00 36.50  ? 100  ASN A N   1 
ATOM   769  C CA  . ASN A 1 99  ? -10.830 55.016 363.618 1.00 37.05  ? 100  ASN A CA  1 
ATOM   770  C C   . ASN A 1 99  ? -11.187 53.672 363.005 1.00 34.36  ? 100  ASN A C   1 
ATOM   771  O O   . ASN A 1 99  ? -10.518 53.196 362.086 1.00 45.17  ? 100  ASN A O   1 
ATOM   772  C CB  . ASN A 1 99  ? -11.528 56.142 362.851 1.00 29.40  ? 100  ASN A CB  1 
ATOM   773  C CG  . ASN A 1 99  ? -10.899 57.494 363.116 1.00 45.19  ? 100  ASN A CG  1 
ATOM   774  O OD1 . ASN A 1 99  ? -11.034 58.052 364.207 1.00 40.70  ? 100  ASN A OD1 1 
ATOM   775  N ND2 . ASN A 1 99  ? -10.200 58.028 362.121 1.00 35.17  ? 100  ASN A ND2 1 
ATOM   776  N N   . VAL A 1 100 ? -12.244 53.056 363.529 1.00 40.98  ? 101  VAL A N   1 
ATOM   777  C CA  . VAL A 1 100 ? -12.711 51.757 363.057 1.00 31.90  ? 101  VAL A CA  1 
ATOM   778  C C   . VAL A 1 100 ? -14.216 51.829 362.860 1.00 38.05  ? 101  VAL A C   1 
ATOM   779  O O   . VAL A 1 100 ? -14.960 52.062 363.820 1.00 40.01  ? 101  VAL A O   1 
ATOM   780  C CB  . VAL A 1 100 ? -12.365 50.618 364.029 1.00 35.96  ? 101  VAL A CB  1 
ATOM   781  C CG1 . VAL A 1 100 ? -12.938 49.305 363.508 1.00 26.97  ? 101  VAL A CG1 1 
ATOM   782  C CG2 . VAL A 1 100 ? -10.863 50.511 364.239 1.00 24.54  ? 101  VAL A CG2 1 
ATOM   783  N N   . TRP A 1 101 ? -14.663 51.618 361.629 1.00 38.08  ? 102  TRP A N   1 
ATOM   784  C CA  . TRP A 1 101 ? -16.075 51.429 361.332 1.00 32.84  ? 102  TRP A CA  1 
ATOM   785  C C   . TRP A 1 101 ? -16.327 49.954 361.065 1.00 38.78  ? 102  TRP A C   1 
ATOM   786  O O   . TRP A 1 101 ? -15.563 49.306 360.343 1.00 47.96  ? 102  TRP A O   1 
ATOM   787  C CB  . TRP A 1 101 ? -16.499 52.237 360.111 1.00 32.65  ? 102  TRP A CB  1 
ATOM   788  C CG  . TRP A 1 101 ? -16.568 53.715 360.283 1.00 33.55  ? 102  TRP A CG  1 
ATOM   789  C CD1 . TRP A 1 101 ? -17.665 54.452 360.617 1.00 31.89  ? 102  TRP A CD1 1 
ATOM   790  C CD2 . TRP A 1 101 ? -15.500 54.650 360.088 1.00 34.45  ? 102  TRP A CD2 1 
ATOM   791  N NE1 . TRP A 1 101 ? -17.346 55.788 360.650 1.00 38.28  ? 102  TRP A NE1 1 
ATOM   792  C CE2 . TRP A 1 101 ? -16.022 55.936 360.329 1.00 33.61  ? 102  TRP A CE2 1 
ATOM   793  C CE3 . TRP A 1 101 ? -14.152 54.522 359.740 1.00 32.97  ? 102  TRP A CE3 1 
ATOM   794  C CZ2 . TRP A 1 101 ? -15.243 57.087 360.231 1.00 37.26  ? 102  TRP A CZ2 1 
ATOM   795  C CZ3 . TRP A 1 101 ? -13.381 55.669 359.639 1.00 37.55  ? 102  TRP A CZ3 1 
ATOM   796  C CH2 . TRP A 1 101 ? -13.928 56.933 359.886 1.00 32.28  ? 102  TRP A CH2 1 
ATOM   797  N N   . THR A 1 102 ? -17.404 49.430 361.637 1.00 39.92  ? 103  THR A N   1 
ATOM   798  C CA  . THR A 1 102 ? -17.754 48.028 361.489 1.00 38.41  ? 103  THR A CA  1 
ATOM   799  C C   . THR A 1 102 ? -19.269 47.909 361.389 1.00 44.64  ? 103  THR A C   1 
ATOM   800  O O   . THR A 1 102 ? -19.994 48.808 361.834 1.00 46.26  ? 103  THR A O   1 
ATOM   801  C CB  . THR A 1 102 ? -17.211 47.198 362.668 1.00 49.49  ? 103  THR A CB  1 
ATOM   802  O OG1 . THR A 1 102 ? -17.103 45.819 362.291 1.00 56.83  ? 103  THR A OG1 1 
ATOM   803  C CG2 . THR A 1 102 ? -18.102 47.313 363.885 1.00 52.21  ? 103  THR A CG2 1 
ATOM   804  N N   . PRO A 1 103 ? -19.774 46.846 360.761 1.00 49.41  ? 104  PRO A N   1 
ATOM   805  C CA  . PRO A 1 103 ? -21.229 46.681 360.663 1.00 48.81  ? 104  PRO A CA  1 
ATOM   806  C C   . PRO A 1 103 ? -21.876 46.500 362.027 1.00 49.21  ? 104  PRO A C   1 
ATOM   807  O O   . PRO A 1 103 ? -21.259 46.017 362.979 1.00 48.71  ? 104  PRO A O   1 
ATOM   808  C CB  . PRO A 1 103 ? -21.390 45.426 359.797 1.00 46.26  ? 104  PRO A CB  1 
ATOM   809  C CG  . PRO A 1 103 ? -20.119 45.326 359.032 1.00 47.19  ? 104  PRO A CG  1 
ATOM   810  C CD  . PRO A 1 103 ? -19.051 45.868 359.930 1.00 45.40  ? 104  PRO A CD  1 
ATOM   811  N N   . TYR A 1 104 ? -23.143 46.907 362.111 1.00 57.69  ? 105  TYR A N   1 
ATOM   812  C CA  . TYR A 1 104 ? -23.964 46.738 363.302 1.00 54.77  ? 105  TYR A CA  1 
ATOM   813  C C   . TYR A 1 104 ? -25.108 45.789 362.979 1.00 52.77  ? 105  TYR A C   1 
ATOM   814  O O   . TYR A 1 104 ? -25.941 46.116 362.121 1.00 59.31  ? 105  TYR A O   1 
ATOM   815  C CB  . TYR A 1 104 ? -24.505 48.088 363.778 1.00 54.49  ? 105  TYR A CB  1 
ATOM   816  C CG  . TYR A 1 104 ? -25.159 48.077 365.148 1.00 65.22  ? 105  TYR A CG  1 
ATOM   817  C CD1 . TYR A 1 104 ? -26.389 47.463 365.354 1.00 59.52  ? 105  TYR A CD1 1 
ATOM   818  C CD2 . TYR A 1 104 ? -24.555 48.706 366.229 1.00 61.30  ? 105  TYR A CD2 1 
ATOM   819  C CE1 . TYR A 1 104 ? -26.988 47.460 366.599 1.00 67.13  ? 105  TYR A CE1 1 
ATOM   820  C CE2 . TYR A 1 104 ? -25.147 48.709 367.477 1.00 70.04  ? 105  TYR A CE2 1 
ATOM   821  C CZ  . TYR A 1 104 ? -26.363 48.085 367.656 1.00 73.56  ? 105  TYR A CZ  1 
ATOM   822  O OH  . TYR A 1 104 ? -26.954 48.088 368.898 1.00 60.03  ? 105  TYR A OH  1 
ATOM   823  N N   . PRO A 1 105 ? -25.209 44.618 363.627 1.00 64.92  ? 106  PRO A N   1 
ATOM   824  C CA  . PRO A 1 105 ? -24.316 44.116 364.678 1.00 69.62  ? 106  PRO A CA  1 
ATOM   825  C C   . PRO A 1 105 ? -22.977 43.605 364.149 1.00 53.30  ? 106  PRO A C   1 
ATOM   826  O O   . PRO A 1 105 ? -22.831 43.382 362.945 1.00 61.27  ? 106  PRO A O   1 
ATOM   827  C CB  . PRO A 1 105 ? -25.126 42.975 365.295 1.00 64.39  ? 106  PRO A CB  1 
ATOM   828  C CG  . PRO A 1 105 ? -25.939 42.468 364.166 1.00 54.95  ? 106  PRO A CG  1 
ATOM   829  C CD  . PRO A 1 105 ? -26.329 43.692 363.381 1.00 62.59  ? 106  PRO A CD  1 
ATOM   830  N N   . ARG A 1 106 ? -22.027 43.424 365.062 1.00 57.31  ? 107  ARG A N   1 
ATOM   831  C CA  . ARG A 1 106 ? -20.672 43.041 364.695 1.00 49.63  ? 107  ARG A CA  1 
ATOM   832  C C   . ARG A 1 106 ? -20.689 41.751 363.876 1.00 57.60  ? 107  ARG A C   1 
ATOM   833  O O   . ARG A 1 106 ? -21.452 40.828 364.186 1.00 73.68  ? 107  ARG A O   1 
ATOM   834  C CB  . ARG A 1 106 ? -19.824 42.857 365.954 1.00 53.43  ? 107  ARG A CB  1 
ATOM   835  C CG  . ARG A 1 106 ? -18.328 42.995 365.761 1.00 64.13  ? 107  ARG A CG  1 
ATOM   836  C CD  . ARG A 1 106 ? -17.636 43.082 367.108 1.00 69.08  ? 107  ARG A CD  1 
ATOM   837  N NE  . ARG A 1 106 ? -18.232 44.132 367.930 1.00 62.15  ? 107  ARG A NE  1 
ATOM   838  C CZ  . ARG A 1 106 ? -18.079 44.233 369.246 1.00 71.18  ? 107  ARG A CZ  1 
ATOM   839  N NH1 . ARG A 1 106 ? -17.343 43.344 369.900 1.00 60.69  ? 107  ARG A NH1 1 
ATOM   840  N NH2 . ARG A 1 106 ? -18.665 45.219 369.911 1.00 62.31  ? 107  ARG A NH2 1 
ATOM   841  N N   . PRO A 1 107 ? -19.880 41.660 362.821 1.00 73.42  ? 108  PRO A N   1 
ATOM   842  C CA  . PRO A 1 107 ? -19.850 40.430 362.025 1.00 75.17  ? 108  PRO A CA  1 
ATOM   843  C C   . PRO A 1 107 ? -19.441 39.256 362.892 1.00 76.55  ? 108  PRO A C   1 
ATOM   844  O O   . PRO A 1 107 ? -18.572 39.380 363.764 1.00 73.61  ? 108  PRO A O   1 
ATOM   845  C CB  . PRO A 1 107 ? -18.794 40.725 360.953 1.00 68.79  ? 108  PRO A CB  1 
ATOM   846  C CG  . PRO A 1 107 ? -18.637 42.210 360.941 1.00 61.95  ? 108  PRO A CG  1 
ATOM   847  C CD  . PRO A 1 107 ? -18.902 42.654 362.344 1.00 64.32  ? 108  PRO A CD  1 
ATOM   848  N N   . THR A 1 108 ? -20.066 38.097 362.656 1.00 83.63  ? 109  THR A N   1 
ATOM   849  C CA  . THR A 1 108 ? -19.647 36.939 363.437 1.00 89.60  ? 109  THR A CA  1 
ATOM   850  C C   . THR A 1 108 ? -18.573 36.131 362.734 1.00 85.54  ? 109  THR A C   1 
ATOM   851  O O   . THR A 1 108 ? -17.789 35.438 363.402 1.00 94.38  ? 109  THR A O   1 
ATOM   852  C CB  . THR A 1 108 ? -20.840 36.058 363.796 1.00 94.99  ? 109  THR A CB  1 
ATOM   853  O OG1 . THR A 1 108 ? -21.605 35.752 362.613 1.00 101.90 ? 109  THR A OG1 1 
ATOM   854  C CG2 . THR A 1 108 ? -21.715 36.783 364.783 1.00 93.53  ? 109  THR A CG2 1 
ATOM   855  N N   . SER A 1 109 ? -18.422 36.255 361.405 1.00 80.86  ? 110  SER A N   1 
ATOM   856  C CA  . SER A 1 109 ? -17.290 35.660 360.710 1.00 76.42  ? 110  SER A CA  1 
ATOM   857  C C   . SER A 1 109 ? -16.302 36.740 360.297 1.00 79.17  ? 110  SER A C   1 
ATOM   858  O O   . SER A 1 109 ? -16.680 37.903 360.124 1.00 71.78  ? 110  SER A O   1 
ATOM   859  C CB  . SER A 1 109 ? -17.751 34.871 359.475 1.00 74.55  ? 110  SER A CB  1 
ATOM   860  O OG  . SER A 1 109 ? -18.652 35.604 358.660 1.00 78.00  ? 110  SER A OG  1 
ATOM   861  N N   . PRO A 1 110 ? -15.023 36.393 360.143 1.00 75.98  ? 111  PRO A N   1 
ATOM   862  C CA  . PRO A 1 110 ? -14.014 37.400 359.785 1.00 60.66  ? 111  PRO A CA  1 
ATOM   863  C C   . PRO A 1 110 ? -14.358 38.116 358.487 1.00 64.11  ? 111  PRO A C   1 
ATOM   864  O O   . PRO A 1 110 ? -14.739 37.493 357.494 1.00 56.54  ? 111  PRO A O   1 
ATOM   865  C CB  . PRO A 1 110 ? -12.728 36.578 359.651 1.00 73.10  ? 111  PRO A CB  1 
ATOM   866  C CG  . PRO A 1 110 ? -12.958 35.383 360.512 1.00 62.47  ? 111  PRO A CG  1 
ATOM   867  C CD  . PRO A 1 110 ? -14.422 35.077 360.418 1.00 67.84  ? 111  PRO A CD  1 
ATOM   868  N N   . THR A 1 111 ? -14.208 39.441 358.502 1.00 57.39  ? 112  THR A N   1 
ATOM   869  C CA  . THR A 1 111 ? -14.613 40.300 357.404 1.00 57.31  ? 112  THR A CA  1 
ATOM   870  C C   . THR A 1 111 ? -13.413 41.061 356.846 1.00 50.36  ? 112  THR A C   1 
ATOM   871  O O   . THR A 1 111 ? -12.576 41.547 357.615 1.00 51.03  ? 112  THR A O   1 
ATOM   872  C CB  . THR A 1 111 ? -15.696 41.290 357.879 1.00 56.24  ? 112  THR A CB  1 
ATOM   873  O OG1 . THR A 1 111 ? -16.810 40.554 358.402 1.00 66.43  ? 112  THR A OG1 1 
ATOM   874  C CG2 . THR A 1 111 ? -16.190 42.170 356.745 1.00 51.16  ? 112  THR A CG2 1 
ATOM   875  N N   . PRO A 1 112 ? -13.291 41.156 355.518 1.00 54.90  ? 113  PRO A N   1 
ATOM   876  C CA  . PRO A 1 112 ? -12.161 41.884 354.923 1.00 52.96  ? 113  PRO A CA  1 
ATOM   877  C C   . PRO A 1 112 ? -12.093 43.330 355.393 1.00 42.56  ? 113  PRO A C   1 
ATOM   878  O O   . PRO A 1 112 ? -13.112 43.978 355.645 1.00 44.38  ? 113  PRO A O   1 
ATOM   879  C CB  . PRO A 1 112 ? -12.443 41.798 353.417 1.00 55.73  ? 113  PRO A CB  1 
ATOM   880  C CG  . PRO A 1 112 ? -13.912 41.458 353.323 1.00 63.38  ? 113  PRO A CG  1 
ATOM   881  C CD  . PRO A 1 112 ? -14.137 40.544 354.482 1.00 51.05  ? 113  PRO A CD  1 
ATOM   882  N N   . VAL A 1 113 ? -10.866 43.835 355.498 1.00 39.03  ? 114  VAL A N   1 
ATOM   883  C CA  . VAL A 1 113 ? -10.587 45.139 356.087 1.00 40.57  ? 114  VAL A CA  1 
ATOM   884  C C   . VAL A 1 113 ? -10.040 46.080 355.022 1.00 42.90  ? 114  VAL A C   1 
ATOM   885  O O   . VAL A 1 113 ? -9.169  45.702 354.231 1.00 45.53  ? 114  VAL A O   1 
ATOM   886  C CB  . VAL A 1 113 ? -9.596  45.016 357.260 1.00 44.61  ? 114  VAL A CB  1 
ATOM   887  C CG1 . VAL A 1 113 ? -9.407  46.366 357.939 1.00 36.37  ? 114  VAL A CG1 1 
ATOM   888  C CG2 . VAL A 1 113 ? -10.076 43.959 358.251 1.00 40.81  ? 114  VAL A CG2 1 
ATOM   889  N N   . LEU A 1 114 ? -10.550 47.310 355.015 1.00 43.43  ? 115  LEU A N   1 
ATOM   890  C CA  . LEU A 1 114 ? -10.054 48.394 354.176 1.00 35.50  ? 115  LEU A CA  1 
ATOM   891  C C   . LEU A 1 114 ? -9.399  49.440 355.072 1.00 42.34  ? 115  LEU A C   1 
ATOM   892  O O   . LEU A 1 114 ? -10.043 49.961 355.988 1.00 41.78  ? 115  LEU A O   1 
ATOM   893  C CB  . LEU A 1 114 ? -11.193 49.025 353.375 1.00 41.65  ? 115  LEU A CB  1 
ATOM   894  C CG  . LEU A 1 114 ? -11.675 48.305 352.119 1.00 50.52  ? 115  LEU A CG  1 
ATOM   895  C CD1 . LEU A 1 114 ? -13.025 48.854 351.684 1.00 45.38  ? 115  LEU A CD1 1 
ATOM   896  C CD2 . LEU A 1 114 ? -10.652 48.455 351.009 1.00 51.93  ? 115  LEU A CD2 1 
ATOM   897  N N   . VAL A 1 115 ? -8.134  49.754 354.807 1.00 39.00  ? 116  VAL A N   1 
ATOM   898  C CA  . VAL A 1 115 ? -7.384  50.720 355.606 1.00 39.38  ? 116  VAL A CA  1 
ATOM   899  C C   . VAL A 1 115 ? -7.088  51.940 354.743 1.00 34.15  ? 116  VAL A C   1 
ATOM   900  O O   . VAL A 1 115 ? -6.381  51.839 353.734 1.00 40.69  ? 116  VAL A O   1 
ATOM   901  C CB  . VAL A 1 115 ? -6.089  50.115 356.169 1.00 42.52  ? 116  VAL A CB  1 
ATOM   902  C CG1 . VAL A 1 115 ? -5.298  51.174 356.921 1.00 34.34  ? 116  VAL A CG1 1 
ATOM   903  C CG2 . VAL A 1 115 ? -6.403  48.942 357.082 1.00 31.60  ? 116  VAL A CG2 1 
ATOM   904  N N   . TRP A 1 116 ? -7.613  53.096 355.151 1.00 30.03  ? 117  TRP A N   1 
ATOM   905  C CA  . TRP A 1 116 ? -7.482  54.337 354.398 1.00 33.22  ? 117  TRP A CA  1 
ATOM   906  C C   . TRP A 1 116 ? -6.309  55.166 354.905 1.00 35.62  ? 117  TRP A C   1 
ATOM   907  O O   . TRP A 1 116 ? -6.127  55.330 356.116 1.00 38.53  ? 117  TRP A O   1 
ATOM   908  C CB  . TRP A 1 116 ? -8.769  55.161 354.486 1.00 29.39  ? 117  TRP A CB  1 
ATOM   909  C CG  . TRP A 1 116 ? -8.651  56.539 353.897 1.00 31.80  ? 117  TRP A CG  1 
ATOM   910  C CD1 . TRP A 1 116 ? -8.627  57.722 354.577 1.00 35.14  ? 117  TRP A CD1 1 
ATOM   911  C CD2 . TRP A 1 116 ? -8.543  56.874 352.505 1.00 31.65  ? 117  TRP A CD2 1 
ATOM   912  N NE1 . TRP A 1 116 ? -8.514  58.773 353.695 1.00 31.43  ? 117  TRP A NE1 1 
ATOM   913  C CE2 . TRP A 1 116 ? -8.460  58.279 352.418 1.00 29.57  ? 117  TRP A CE2 1 
ATOM   914  C CE3 . TRP A 1 116 ? -8.508  56.122 351.325 1.00 31.05  ? 117  TRP A CE3 1 
ATOM   915  C CZ2 . TRP A 1 116 ? -8.342  58.947 351.198 1.00 37.05  ? 117  TRP A CZ2 1 
ATOM   916  C CZ3 . TRP A 1 116 ? -8.393  56.789 350.111 1.00 34.42  ? 117  TRP A CZ3 1 
ATOM   917  C CH2 . TRP A 1 116 ? -8.310  58.188 350.059 1.00 33.30  ? 117  TRP A CH2 1 
ATOM   918  N N   . ILE A 1 117 ? -5.521  55.696 353.971 1.00 34.17  ? 118  ILE A N   1 
ATOM   919  C CA  . ILE A 1 117 ? -4.422  56.610 354.273 1.00 30.40  ? 118  ILE A CA  1 
ATOM   920  C C   . ILE A 1 117 ? -4.676  57.894 353.498 1.00 35.73  ? 118  ILE A C   1 
ATOM   921  O O   . ILE A 1 117 ? -4.598  57.904 352.262 1.00 37.40  ? 118  ILE A O   1 
ATOM   922  C CB  . ILE A 1 117 ? -3.053  56.017 353.914 1.00 35.57  ? 118  ILE A CB  1 
ATOM   923  C CG1 . ILE A 1 117 ? -2.837  54.683 354.632 1.00 34.65  ? 118  ILE A CG1 1 
ATOM   924  C CG2 . ILE A 1 117 ? -1.939  56.996 354.265 1.00 34.20  ? 118  ILE A CG2 1 
ATOM   925  C CD1 . ILE A 1 117 ? -1.480  54.061 354.361 1.00 37.90  ? 118  ILE A CD1 1 
ATOM   926  N N   . TYR A 1 118 ? -4.972  58.977 354.210 1.00 31.61  ? 119  TYR A N   1 
ATOM   927  C CA  . TYR A 1 118 ? -5.301  60.218 353.527 1.00 30.93  ? 119  TYR A CA  1 
ATOM   928  C C   . TYR A 1 118 ? -4.058  60.831 352.887 1.00 37.44  ? 119  TYR A C   1 
ATOM   929  O O   . TYR A 1 118 ? -2.919  60.546 353.269 1.00 34.76  ? 119  TYR A O   1 
ATOM   930  C CB  . TYR A 1 118 ? -5.948  61.222 354.487 1.00 30.53  ? 119  TYR A CB  1 
ATOM   931  C CG  . TYR A 1 118 ? -5.133  61.569 355.720 1.00 30.94  ? 119  TYR A CG  1 
ATOM   932  C CD1 . TYR A 1 118 ? -4.046  62.437 355.644 1.00 34.16  ? 119  TYR A CD1 1 
ATOM   933  C CD2 . TYR A 1 118 ? -5.471  61.056 356.967 1.00 32.33  ? 119  TYR A CD2 1 
ATOM   934  C CE1 . TYR A 1 118 ? -3.303  62.762 356.770 1.00 32.34  ? 119  TYR A CE1 1 
ATOM   935  C CE2 . TYR A 1 118 ? -4.734  61.379 358.103 1.00 35.36  ? 119  TYR A CE2 1 
ATOM   936  C CZ  . TYR A 1 118 ? -3.653  62.233 357.996 1.00 35.00  ? 119  TYR A CZ  1 
ATOM   937  O OH  . TYR A 1 118 ? -2.916  62.556 359.114 1.00 35.54  ? 119  TYR A OH  1 
ATOM   938  N N   . GLY A 1 119 ? -4.300  61.687 351.893 1.00 40.40  ? 120  GLY A N   1 
ATOM   939  C CA  . GLY A 1 119 ? -3.250  62.427 351.232 1.00 34.66  ? 120  GLY A CA  1 
ATOM   940  C C   . GLY A 1 119 ? -3.204  63.880 351.675 1.00 29.54  ? 120  GLY A C   1 
ATOM   941  O O   . GLY A 1 119 ? -3.825  64.288 352.657 1.00 38.34  ? 120  GLY A O   1 
ATOM   942  N N   . GLY A 1 120 ? -2.447  64.671 350.922 1.00 40.10  ? 121  GLY A N   1 
ATOM   943  C CA  . GLY A 1 120 ? -2.258  66.066 351.260 1.00 29.61  ? 121  GLY A CA  1 
ATOM   944  C C   . GLY A 1 120 ? -0.810  66.512 351.211 1.00 33.53  ? 121  GLY A C   1 
ATOM   945  O O   . GLY A 1 120 ? -0.381  67.331 352.030 1.00 38.15  ? 121  GLY A O   1 
ATOM   946  N N   . GLY A 1 121 ? -0.047  65.975 350.258 1.00 41.26  ? 122  GLY A N   1 
ATOM   947  C CA  . GLY A 1 121 ? 1.333   66.382 350.053 1.00 39.47  ? 122  GLY A CA  1 
ATOM   948  C C   . GLY A 1 121 ? 2.259   66.170 351.231 1.00 42.56  ? 122  GLY A C   1 
ATOM   949  O O   . GLY A 1 121 ? 3.287   66.846 351.324 1.00 39.93  ? 122  GLY A O   1 
ATOM   950  N N   . PHE A 1 122 ? 1.925   65.251 352.137 1.00 33.21  ? 123  PHE A N   1 
ATOM   951  C CA  . PHE A 1 122 ? 2.686   64.967 353.352 1.00 32.79  ? 123  PHE A CA  1 
ATOM   952  C C   . PHE A 1 122 ? 2.766   66.164 354.297 1.00 35.35  ? 123  PHE A C   1 
ATOM   953  O O   . PHE A 1 122 ? 3.486   66.105 355.300 1.00 37.21  ? 123  PHE A O   1 
ATOM   954  C CB  . PHE A 1 122 ? 4.103   64.463 353.034 1.00 32.52  ? 123  PHE A CB  1 
ATOM   955  C CG  . PHE A 1 122 ? 4.136   63.113 352.368 1.00 31.39  ? 123  PHE A CG  1 
ATOM   956  C CD1 . PHE A 1 122 ? 3.827   61.968 353.082 1.00 28.63  ? 123  PHE A CD1 1 
ATOM   957  C CD2 . PHE A 1 122 ? 4.481   62.991 351.031 1.00 33.50  ? 123  PHE A CD2 1 
ATOM   958  C CE1 . PHE A 1 122 ? 3.855   60.724 352.478 1.00 33.85  ? 123  PHE A CE1 1 
ATOM   959  C CE2 . PHE A 1 122 ? 4.513   61.749 350.417 1.00 30.03  ? 123  PHE A CE2 1 
ATOM   960  C CZ  . PHE A 1 122 ? 4.200   60.614 351.141 1.00 33.81  ? 123  PHE A CZ  1 
ATOM   961  N N   . TYR A 1 123 ? 2.043   67.249 354.011 1.00 32.09  ? 124  TYR A N   1 
ATOM   962  C CA  . TYR A 1 123 ? 2.023   68.417 354.880 1.00 40.87  ? 124  TYR A CA  1 
ATOM   963  C C   . TYR A 1 123 ? 0.650   68.712 355.469 1.00 40.93  ? 124  TYR A C   1 
ATOM   964  O O   . TYR A 1 123 ? 0.524   69.652 356.261 1.00 37.52  ? 124  TYR A O   1 
ATOM   965  C CB  . TYR A 1 123 ? 2.516   69.660 354.125 1.00 34.23  ? 124  TYR A CB  1 
ATOM   966  C CG  . TYR A 1 123 ? 1.563   70.147 353.055 1.00 42.33  ? 124  TYR A CG  1 
ATOM   967  C CD1 . TYR A 1 123 ? 0.542   71.046 353.355 1.00 35.44  ? 124  TYR A CD1 1 
ATOM   968  C CD2 . TYR A 1 123 ? 1.687   69.714 351.741 1.00 37.20  ? 124  TYR A CD2 1 
ATOM   969  C CE1 . TYR A 1 123 ? -0.332  71.488 352.382 1.00 36.22  ? 124  TYR A CE1 1 
ATOM   970  C CE2 . TYR A 1 123 ? 0.820   70.156 350.759 1.00 35.63  ? 124  TYR A CE2 1 
ATOM   971  C CZ  . TYR A 1 123 ? -0.186  71.044 351.086 1.00 44.11  ? 124  TYR A CZ  1 
ATOM   972  O OH  . TYR A 1 123 ? -1.054  71.491 350.118 1.00 46.64  ? 124  TYR A OH  1 
ATOM   973  N N   . SER A 1 124 ? -0.381  67.961 355.097 1.00 29.88  ? 125  SER A N   1 
ATOM   974  C CA  . SER A 1 124 ? -1.733  68.247 355.554 1.00 33.94  ? 125  SER A CA  1 
ATOM   975  C C   . SER A 1 124 ? -2.559  66.973 355.458 1.00 36.97  ? 125  SER A C   1 
ATOM   976  O O   . SER A 1 124 ? -2.073  65.922 355.031 1.00 32.93  ? 125  SER A O   1 
ATOM   977  C CB  . SER A 1 124 ? -2.362  69.374 354.735 1.00 34.02  ? 125  SER A CB  1 
ATOM   978  O OG  . SER A 1 124 ? -2.497  68.977 353.383 1.00 36.68  ? 125  SER A OG  1 
ATOM   979  N N   . GLY A 1 125 ? -3.818  67.081 355.850 1.00 32.86  ? 126  GLY A N   1 
ATOM   980  C CA  . GLY A 1 125 ? -4.746  65.975 355.804 1.00 31.68  ? 126  GLY A CA  1 
ATOM   981  C C   . GLY A 1 125 ? -5.168  65.531 357.195 1.00 39.50  ? 126  GLY A C   1 
ATOM   982  O O   . GLY A 1 125 ? -4.504  65.801 358.202 1.00 35.45  ? 126  GLY A O   1 
ATOM   983  N N   . ALA A 1 126 ? -6.299  64.832 357.239 1.00 39.82  ? 127  ALA A N   1 
ATOM   984  C CA  . ALA A 1 126 ? -6.823  64.303 358.488 1.00 40.31  ? 127  ALA A CA  1 
ATOM   985  C C   . ALA A 1 126 ? -7.842  63.221 358.171 1.00 44.14  ? 127  ALA A C   1 
ATOM   986  O O   . ALA A 1 126 ? -8.551  63.296 357.164 1.00 39.70  ? 127  ALA A O   1 
ATOM   987  C CB  . ALA A 1 126 ? -7.460  65.402 359.344 1.00 32.58  ? 127  ALA A CB  1 
ATOM   988  N N   . SER A 1 127 ? -7.905  62.210 359.040 1.00 38.65  ? 128  SER A N   1 
ATOM   989  C CA  . SER A 1 127 ? -8.887  61.150 358.858 1.00 40.43  ? 128  SER A CA  1 
ATOM   990  C C   . SER A 1 127 ? -10.293 61.592 359.236 1.00 37.88  ? 128  SER A C   1 
ATOM   991  O O   . SER A 1 127 ? -11.245 60.837 359.006 1.00 36.89  ? 128  SER A O   1 
ATOM   992  C CB  . SER A 1 127 ? -8.489  59.918 359.673 1.00 32.25  ? 128  SER A CB  1 
ATOM   993  O OG  . SER A 1 127 ? -8.506  60.196 361.063 1.00 43.57  ? 128  SER A OG  1 
ATOM   994  N N   . SER A 1 128 ? -10.444 62.796 359.785 1.00 37.29  ? 129  SER A N   1 
ATOM   995  C CA  . SER A 1 128 ? -11.723 63.302 360.264 1.00 37.40  ? 129  SER A CA  1 
ATOM   996  C C   . SER A 1 128 ? -12.515 64.059 359.204 1.00 36.96  ? 129  SER A C   1 
ATOM   997  O O   . SER A 1 128 ? -13.670 64.418 359.461 1.00 42.72  ? 129  SER A O   1 
ATOM   998  C CB  . SER A 1 128 ? -11.494 64.209 361.480 1.00 25.64  ? 129  SER A CB  1 
ATOM   999  O OG  . SER A 1 128 ? -10.872 65.425 361.106 1.00 36.98  ? 129  SER A OG  1 
ATOM   1000 N N   . LEU A 1 129 ? -11.933 64.308 358.031 1.00 37.07  ? 130  LEU A N   1 
ATOM   1001 C CA  . LEU A 1 129 ? -12.626 65.063 356.992 1.00 41.52  ? 130  LEU A CA  1 
ATOM   1002 C C   . LEU A 1 129 ? -13.913 64.363 356.571 1.00 42.13  ? 130  LEU A C   1 
ATOM   1003 O O   . LEU A 1 129 ? -13.974 63.132 356.491 1.00 38.73  ? 130  LEU A O   1 
ATOM   1004 C CB  . LEU A 1 129 ? -11.716 65.250 355.778 1.00 35.56  ? 130  LEU A CB  1 
ATOM   1005 C CG  . LEU A 1 129 ? -10.395 65.981 356.022 1.00 50.84  ? 130  LEU A CG  1 
ATOM   1006 C CD1 . LEU A 1 129 ? -9.697  66.271 354.702 1.00 41.51  ? 130  LEU A CD1 1 
ATOM   1007 C CD2 . LEU A 1 129 ? -10.616 67.263 356.818 1.00 39.98  ? 130  LEU A CD2 1 
ATOM   1008 N N   . ASP A 1 130 ? -14.943 65.168 356.284 1.00 37.34  ? 131  ASP A N   1 
ATOM   1009 C CA  . ASP A 1 130 ? -16.252 64.625 355.932 1.00 44.22  ? 131  ASP A CA  1 
ATOM   1010 C C   . ASP A 1 130 ? -16.181 63.727 354.708 1.00 41.32  ? 131  ASP A C   1 
ATOM   1011 O O   . ASP A 1 130 ? -16.947 62.763 354.597 1.00 50.93  ? 131  ASP A O   1 
ATOM   1012 C CB  . ASP A 1 130 ? -17.246 65.761 355.684 1.00 44.63  ? 131  ASP A CB  1 
ATOM   1013 C CG  . ASP A 1 130 ? -17.421 66.659 356.892 1.00 57.88  ? 131  ASP A CG  1 
ATOM   1014 O OD1 . ASP A 1 130 ? -17.235 66.178 358.032 1.00 55.26  ? 131  ASP A OD1 1 
ATOM   1015 O OD2 . ASP A 1 130 ? -17.750 67.849 356.700 1.00 68.57  ? 131  ASP A OD2 1 
ATOM   1016 N N   . VAL A 1 131 ? -15.266 64.023 353.783 1.00 42.72  ? 132  VAL A N   1 
ATOM   1017 C CA  . VAL A 1 131 ? -15.132 63.229 352.569 1.00 37.93  ? 132  VAL A CA  1 
ATOM   1018 C C   . VAL A 1 131 ? -14.522 61.859 352.830 1.00 39.93  ? 132  VAL A C   1 
ATOM   1019 O O   . VAL A 1 131 ? -14.580 60.988 351.956 1.00 39.47  ? 132  VAL A O   1 
ATOM   1020 C CB  . VAL A 1 131 ? -14.313 64.034 351.537 1.00 42.33  ? 132  VAL A CB  1 
ATOM   1021 C CG1 . VAL A 1 131 ? -12.838 64.054 351.914 1.00 49.53  ? 132  VAL A CG1 1 
ATOM   1022 C CG2 . VAL A 1 131 ? -14.516 63.489 350.145 1.00 46.06  ? 132  VAL A CG2 1 
ATOM   1023 N N   . TYR A 1 132 ? -13.953 61.634 354.016 1.00 39.49  ? 133  TYR A N   1 
ATOM   1024 C CA  . TYR A 1 132 ? -13.416 60.330 354.386 1.00 41.15  ? 133  TYR A CA  1 
ATOM   1025 C C   . TYR A 1 132 ? -14.352 59.560 355.313 1.00 40.89  ? 133  TYR A C   1 
ATOM   1026 O O   . TYR A 1 132 ? -13.924 58.588 355.945 1.00 40.99  ? 133  TYR A O   1 
ATOM   1027 C CB  . TYR A 1 132 ? -12.039 60.479 355.040 1.00 37.92  ? 133  TYR A CB  1 
ATOM   1028 C CG  . TYR A 1 132 ? -11.018 61.220 354.201 1.00 35.58  ? 133  TYR A CG  1 
ATOM   1029 C CD1 . TYR A 1 132 ? -11.029 61.137 352.814 1.00 43.13  ? 133  TYR A CD1 1 
ATOM   1030 C CD2 . TYR A 1 132 ? -10.050 62.013 354.801 1.00 35.78  ? 133  TYR A CD2 1 
ATOM   1031 C CE1 . TYR A 1 132 ? -10.098 61.823 352.049 1.00 37.85  ? 133  TYR A CE1 1 
ATOM   1032 C CE2 . TYR A 1 132 ? -9.119  62.701 354.050 1.00 31.95  ? 133  TYR A CE2 1 
ATOM   1033 C CZ  . TYR A 1 132 ? -9.144  62.604 352.677 1.00 44.20  ? 133  TYR A CZ  1 
ATOM   1034 O OH  . TYR A 1 132 ? -8.209  63.295 351.942 1.00 39.39  ? 133  TYR A OH  1 
ATOM   1035 N N   . ASP A 1 133 ? -15.614 59.977 355.407 1.00 46.59  ? 134  ASP A N   1 
ATOM   1036 C CA  . ASP A 1 133 ? -16.584 59.298 356.260 1.00 39.68  ? 134  ASP A CA  1 
ATOM   1037 C C   . ASP A 1 133 ? -16.775 57.857 355.804 1.00 43.70  ? 134  ASP A C   1 
ATOM   1038 O O   . ASP A 1 133 ? -17.242 57.605 354.689 1.00 49.55  ? 134  ASP A O   1 
ATOM   1039 C CB  . ASP A 1 133 ? -17.915 60.050 356.231 1.00 54.03  ? 134  ASP A CB  1 
ATOM   1040 C CG  . ASP A 1 133 ? -18.845 59.643 357.363 1.00 56.68  ? 134  ASP A CG  1 
ATOM   1041 O OD1 . ASP A 1 133 ? -18.584 58.613 358.020 1.00 39.42  ? 134  ASP A OD1 1 
ATOM   1042 O OD2 . ASP A 1 133 ? -19.842 60.361 357.594 1.00 59.30  ? 134  ASP A OD2 1 
ATOM   1043 N N   . GLY A 1 134 ? -16.422 56.914 356.674 1.00 37.21  ? 135  GLY A N   1 
ATOM   1044 C CA  . GLY A 1 134 ? -16.458 55.503 356.356 1.00 37.33  ? 135  GLY A CA  1 
ATOM   1045 C C   . GLY A 1 134 ? -17.768 54.792 356.608 1.00 44.61  ? 135  GLY A C   1 
ATOM   1046 O O   . GLY A 1 134 ? -17.847 53.576 356.403 1.00 47.18  ? 135  GLY A O   1 
ATOM   1047 N N   . ARG A 1 135 ? -18.812 55.507 357.035 1.00 40.86  ? 136  ARG A N   1 
ATOM   1048 C CA  . ARG A 1 135 ? -20.063 54.840 357.386 1.00 42.23  ? 136  ARG A CA  1 
ATOM   1049 C C   . ARG A 1 135 ? -20.787 54.299 356.156 1.00 44.83  ? 136  ARG A C   1 
ATOM   1050 O O   . ARG A 1 135 ? -21.439 53.252 356.239 1.00 47.58  ? 136  ARG A O   1 
ATOM   1051 C CB  . ARG A 1 135 ? -20.966 55.797 358.167 1.00 40.83  ? 136  ARG A CB  1 
ATOM   1052 C CG  . ARG A 1 135 ? -21.567 56.915 357.334 1.00 52.28  ? 136  ARG A CG  1 
ATOM   1053 C CD  . ARG A 1 135 ? -22.423 57.838 358.176 1.00 48.48  ? 136  ARG A CD  1 
ATOM   1054 N NE  . ARG A 1 135 ? -21.614 58.721 359.007 1.00 54.34  ? 136  ARG A NE  1 
ATOM   1055 C CZ  . ARG A 1 135 ? -22.101 59.489 359.975 1.00 64.15  ? 136  ARG A CZ  1 
ATOM   1056 N NH1 . ARG A 1 135 ? -23.401 59.481 360.241 1.00 56.92  ? 136  ARG A NH1 1 
ATOM   1057 N NH2 . ARG A 1 135 ? -21.288 60.266 360.679 1.00 59.02  ? 136  ARG A NH2 1 
ATOM   1058 N N   . PHE A 1 136 ? -20.674 54.977 355.010 1.00 42.79  ? 137  PHE A N   1 
ATOM   1059 C CA  . PHE A 1 136 ? -21.413 54.551 353.824 1.00 38.34  ? 137  PHE A CA  1 
ATOM   1060 C C   . PHE A 1 136 ? -20.796 53.305 353.200 1.00 37.35  ? 137  PHE A C   1 
ATOM   1061 O O   . PHE A 1 136 ? -21.518 52.387 352.791 1.00 41.60  ? 137  PHE A O   1 
ATOM   1062 C CB  . PHE A 1 136 ? -21.476 55.692 352.809 1.00 36.65  ? 137  PHE A CB  1 
ATOM   1063 C CG  . PHE A 1 136 ? -21.998 56.980 353.384 1.00 37.02  ? 137  PHE A CG  1 
ATOM   1064 C CD1 . PHE A 1 136 ? -21.137 58.033 353.651 1.00 37.30  ? 137  PHE A CD1 1 
ATOM   1065 C CD2 . PHE A 1 136 ? -23.347 57.134 353.667 1.00 40.73  ? 137  PHE A CD2 1 
ATOM   1066 C CE1 . PHE A 1 136 ? -21.613 59.222 354.189 1.00 49.00  ? 137  PHE A CE1 1 
ATOM   1067 C CE2 . PHE A 1 136 ? -23.830 58.319 354.203 1.00 50.72  ? 137  PHE A CE2 1 
ATOM   1068 C CZ  . PHE A 1 136 ? -22.961 59.365 354.464 1.00 47.75  ? 137  PHE A CZ  1 
ATOM   1069 N N   . LEU A 1 137 ? -19.465 53.256 353.115 1.00 37.01  ? 138  LEU A N   1 
ATOM   1070 C CA  . LEU A 1 137 ? -18.794 52.067 352.601 1.00 32.35  ? 138  LEU A CA  1 
ATOM   1071 C C   . LEU A 1 137 ? -19.110 50.853 353.460 1.00 43.16  ? 138  LEU A C   1 
ATOM   1072 O O   . LEU A 1 137 ? -19.418 49.773 352.948 1.00 44.20  ? 138  LEU A O   1 
ATOM   1073 C CB  . LEU A 1 137 ? -17.283 52.302 352.552 1.00 37.37  ? 138  LEU A CB  1 
ATOM   1074 C CG  . LEU A 1 137 ? -16.650 52.588 351.192 1.00 53.05  ? 138  LEU A CG  1 
ATOM   1075 C CD1 . LEU A 1 137 ? -15.173 52.921 351.355 1.00 41.45  ? 138  LEU A CD1 1 
ATOM   1076 C CD2 . LEU A 1 137 ? -16.841 51.405 350.259 1.00 47.55  ? 138  LEU A CD2 1 
ATOM   1077 N N   . VAL A 1 138 ? -19.041 51.021 354.779 1.00 41.41  ? 139  VAL A N   1 
ATOM   1078 C CA  . VAL A 1 138 ? -19.259 49.906 355.696 1.00 35.64  ? 139  VAL A CA  1 
ATOM   1079 C C   . VAL A 1 138 ? -20.678 49.382 355.577 1.00 36.48  ? 139  VAL A C   1 
ATOM   1080 O O   . VAL A 1 138 ? -20.906 48.164 355.549 1.00 43.33  ? 139  VAL A O   1 
ATOM   1081 C CB  . VAL A 1 138 ? -18.915 50.341 357.130 1.00 47.43  ? 139  VAL A CB  1 
ATOM   1082 C CG1 . VAL A 1 138 ? -19.436 49.327 358.130 1.00 36.87  ? 139  VAL A CG1 1 
ATOM   1083 C CG2 . VAL A 1 138 ? -17.407 50.497 357.260 1.00 41.18  ? 139  VAL A CG2 1 
ATOM   1084 N N   . GLN A 1 139 ? -21.656 50.284 355.497 1.00 39.35  ? 140  GLN A N   1 
ATOM   1085 C CA  . GLN A 1 139 ? -23.045 49.857 355.420 1.00 41.93  ? 140  GLN A CA  1 
ATOM   1086 C C   . GLN A 1 139 ? -23.354 49.188 354.083 1.00 57.86  ? 140  GLN A C   1 
ATOM   1087 O O   . GLN A 1 139 ? -24.049 48.166 354.040 1.00 50.45  ? 140  GLN A O   1 
ATOM   1088 C CB  . GLN A 1 139 ? -23.959 51.056 355.647 1.00 43.93  ? 140  GLN A CB  1 
ATOM   1089 C CG  . GLN A 1 139 ? -25.339 50.706 356.170 1.00 68.27  ? 140  GLN A CG  1 
ATOM   1090 C CD  . GLN A 1 139 ? -26.223 50.104 355.105 1.00 69.94  ? 140  GLN A CD  1 
ATOM   1091 O OE1 . GLN A 1 139 ? -26.175 50.506 353.942 1.00 61.70  ? 140  GLN A OE1 1 
ATOM   1092 N NE2 . GLN A 1 139 ? -27.040 49.135 355.495 1.00 70.24  ? 140  GLN A NE2 1 
ATOM   1093 N N   . ALA A 1 140 ? -22.848 49.748 352.981 1.00 47.61  ? 141  ALA A N   1 
ATOM   1094 C CA  . ALA A 1 140 ? -23.235 49.268 351.658 1.00 46.13  ? 141  ALA A CA  1 
ATOM   1095 C C   . ALA A 1 140 ? -22.551 47.955 351.299 1.00 48.40  ? 141  ALA A C   1 
ATOM   1096 O O   . ALA A 1 140 ? -23.156 47.097 350.645 1.00 53.61  ? 141  ALA A O   1 
ATOM   1097 C CB  . ALA A 1 140 ? -22.923 50.329 350.601 1.00 43.69  ? 141  ALA A CB  1 
ATOM   1098 N N   . GLU A 1 141 ? -21.298 47.775 351.710 1.00 44.30  ? 142  GLU A N   1 
ATOM   1099 C CA  . GLU A 1 141 ? -20.521 46.619 351.292 1.00 41.50  ? 142  GLU A CA  1 
ATOM   1100 C C   . GLU A 1 141 ? -20.114 45.713 352.442 1.00 48.38  ? 142  GLU A C   1 
ATOM   1101 O O   . GLU A 1 141 ? -19.465 44.687 352.201 1.00 48.70  ? 142  GLU A O   1 
ATOM   1102 C CB  . GLU A 1 141 ? -19.273 47.073 350.526 1.00 42.86  ? 142  GLU A CB  1 
ATOM   1103 C CG  . GLU A 1 141 ? -19.590 47.779 349.211 1.00 49.57  ? 142  GLU A CG  1 
ATOM   1104 C CD  . GLU A 1 141 ? -20.269 46.867 348.204 1.00 54.47  ? 142  GLU A CD  1 
ATOM   1105 O OE1 . GLU A 1 141 ? -19.957 45.656 348.183 1.00 51.32  ? 142  GLU A OE1 1 
ATOM   1106 O OE2 . GLU A 1 141 ? -21.119 47.362 347.434 1.00 55.77  ? 142  GLU A OE2 1 
ATOM   1107 N N   . ARG A 1 142 ? -20.479 46.058 353.674 1.00 59.10  ? 143  ARG A N   1 
ATOM   1108 C CA  . ARG A 1 142 ? -20.253 45.221 354.851 1.00 51.28  ? 143  ARG A CA  1 
ATOM   1109 C C   . ARG A 1 142 ? -18.790 44.790 354.951 1.00 51.41  ? 143  ARG A C   1 
ATOM   1110 O O   . ARG A 1 142 ? -18.456 43.606 355.001 1.00 54.27  ? 143  ARG A O   1 
ATOM   1111 C CB  . ARG A 1 142 ? -21.202 44.020 354.857 1.00 46.01  ? 143  ARG A CB  1 
ATOM   1112 C CG  . ARG A 1 142 ? -22.626 44.394 355.269 1.00 70.63  ? 143  ARG A CG  1 
ATOM   1113 C CD  . ARG A 1 142 ? -23.477 43.166 355.563 1.00 89.68  ? 143  ARG A CD  1 
ATOM   1114 N NE  . ARG A 1 142 ? -23.790 43.039 356.985 1.00 96.80  ? 143  ARG A NE  1 
ATOM   1115 C CZ  . ARG A 1 142 ? -23.029 42.389 357.861 1.00 101.85 ? 143  ARG A CZ  1 
ATOM   1116 N NH1 . ARG A 1 142 ? -21.908 41.802 357.462 1.00 93.75  ? 143  ARG A NH1 1 
ATOM   1117 N NH2 . ARG A 1 142 ? -23.389 42.323 359.136 1.00 106.89 ? 143  ARG A NH2 1 
ATOM   1118 N N   . THR A 1 143 ? -17.923 45.793 354.978 1.00 48.59  ? 144  THR A N   1 
ATOM   1119 C CA  . THR A 1 143 ? -16.508 45.637 355.268 1.00 46.39  ? 144  THR A CA  1 
ATOM   1120 C C   . THR A 1 143 ? -16.200 46.280 356.612 1.00 40.64  ? 144  THR A C   1 
ATOM   1121 O O   . THR A 1 143 ? -17.057 46.905 357.241 1.00 46.80  ? 144  THR A O   1 
ATOM   1122 C CB  . THR A 1 143 ? -15.643 46.281 354.178 1.00 47.90  ? 144  THR A CB  1 
ATOM   1123 O OG1 . THR A 1 143 ? -16.265 47.491 353.728 1.00 58.03  ? 144  THR A OG1 1 
ATOM   1124 C CG2 . THR A 1 143 ? -15.475 45.339 352.998 1.00 54.63  ? 144  THR A CG2 1 
ATOM   1125 N N   . VAL A 1 144 ? -14.961 46.113 357.055 1.00 44.14  ? 145  VAL A N   1 
ATOM   1126 C CA  . VAL A 1 144 ? -14.422 46.871 358.176 1.00 46.77  ? 145  VAL A CA  1 
ATOM   1127 C C   . VAL A 1 144 ? -13.467 47.903 357.598 1.00 46.14  ? 145  VAL A C   1 
ATOM   1128 O O   . VAL A 1 144 ? -12.539 47.553 356.858 1.00 41.72  ? 145  VAL A O   1 
ATOM   1129 C CB  . VAL A 1 144 ? -13.715 45.967 359.197 1.00 47.94  ? 145  VAL A CB  1 
ATOM   1130 C CG1 . VAL A 1 144 ? -13.077 46.814 360.289 1.00 40.55  ? 145  VAL A CG1 1 
ATOM   1131 C CG2 . VAL A 1 144 ? -14.696 44.973 359.794 1.00 40.98  ? 145  VAL A CG2 1 
ATOM   1132 N N   . LEU A 1 145 ? -13.698 49.173 357.914 1.00 42.42  ? 146  LEU A N   1 
ATOM   1133 C CA  . LEU A 1 145 ? -12.853 50.250 357.423 1.00 33.15  ? 146  LEU A CA  1 
ATOM   1134 C C   . LEU A 1 145 ? -12.084 50.870 358.580 1.00 36.55  ? 146  LEU A C   1 
ATOM   1135 O O   . LEU A 1 145 ? -12.670 51.211 359.613 1.00 37.59  ? 146  LEU A O   1 
ATOM   1136 C CB  . LEU A 1 145 ? -13.670 51.318 356.697 1.00 39.28  ? 146  LEU A CB  1 
ATOM   1137 C CG  . LEU A 1 145 ? -12.771 52.378 356.056 1.00 46.40  ? 146  LEU A CG  1 
ATOM   1138 C CD1 . LEU A 1 145 ? -12.984 52.422 354.554 1.00 47.52  ? 146  LEU A CD1 1 
ATOM   1139 C CD2 . LEU A 1 145 ? -13.015 53.741 356.663 1.00 49.26  ? 146  LEU A CD2 1 
ATOM   1140 N N   . VAL A 1 146 ? -10.773 51.012 358.396 1.00 38.51  ? 147  VAL A N   1 
ATOM   1141 C CA  . VAL A 1 146 ? -9.881  51.625 359.369 1.00 28.15  ? 147  VAL A CA  1 
ATOM   1142 C C   . VAL A 1 146 ? -9.215  52.830 358.719 1.00 38.30  ? 147  VAL A C   1 
ATOM   1143 O O   . VAL A 1 146 ? -8.825  52.777 357.548 1.00 38.14  ? 147  VAL A O   1 
ATOM   1144 C CB  . VAL A 1 146 ? -8.820  50.621 359.872 1.00 37.64  ? 147  VAL A CB  1 
ATOM   1145 C CG1 . VAL A 1 146 ? -7.930  51.260 360.927 1.00 32.30  ? 147  VAL A CG1 1 
ATOM   1146 C CG2 . VAL A 1 146 ? -9.486  49.363 360.414 1.00 34.17  ? 147  VAL A CG2 1 
ATOM   1147 N N   . SER A 1 147 ? -9.098  53.920 359.472 1.00 37.01  ? 148  SER A N   1 
ATOM   1148 C CA  . SER A 1 147 ? -8.340  55.081 359.030 1.00 38.74  ? 148  SER A CA  1 
ATOM   1149 C C   . SER A 1 147 ? -7.567  55.624 360.219 1.00 40.76  ? 148  SER A C   1 
ATOM   1150 O O   . SER A 1 147 ? -8.050  55.574 361.353 1.00 41.02  ? 148  SER A O   1 
ATOM   1151 C CB  . SER A 1 147 ? -9.244  56.171 358.432 1.00 40.04  ? 148  SER A CB  1 
ATOM   1152 O OG  . SER A 1 147 ? -10.040 56.799 359.423 1.00 41.24  ? 148  SER A OG  1 
ATOM   1153 N N   . MET A 1 148 ? -6.363  56.128 359.963 1.00 33.53  ? 149  MET A N   1 
ATOM   1154 C CA  . MET A 1 148 ? -5.510  56.628 361.029 1.00 36.60  ? 149  MET A CA  1 
ATOM   1155 C C   . MET A 1 148 ? -5.007  58.022 360.687 1.00 42.59  ? 149  MET A C   1 
ATOM   1156 O O   . MET A 1 148 ? -4.958  58.425 359.521 1.00 36.19  ? 149  MET A O   1 
ATOM   1157 C CB  . MET A 1 148 ? -4.320  55.688 361.287 1.00 30.79  ? 149  MET A CB  1 
ATOM   1158 C CG  . MET A 1 148 ? -3.076  55.999 360.464 1.00 39.84  ? 149  MET A CG  1 
ATOM   1159 S SD  . MET A 1 148 ? -3.308  55.736 358.695 1.00 41.41  ? 149  MET A SD  1 
ATOM   1160 C CE  . MET A 1 148 ? -3.443  53.951 358.622 1.00 31.55  ? 149  MET A CE  1 
ATOM   1161 N N   . ASN A 1 149 ? -4.650  58.759 361.733 1.00 35.65  ? 150  ASN A N   1 
ATOM   1162 C CA  . ASN A 1 149 ? -3.929  60.013 361.590 1.00 34.43  ? 150  ASN A CA  1 
ATOM   1163 C C   . ASN A 1 149 ? -2.432  59.746 361.663 1.00 30.96  ? 150  ASN A C   1 
ATOM   1164 O O   . ASN A 1 149 ? -1.981  58.869 362.403 1.00 36.79  ? 150  ASN A O   1 
ATOM   1165 C CB  . ASN A 1 149 ? -4.338  61.000 362.683 1.00 36.17  ? 150  ASN A CB  1 
ATOM   1166 C CG  . ASN A 1 149 ? -5.545  61.821 362.300 1.00 41.30  ? 150  ASN A CG  1 
ATOM   1167 O OD1 . ASN A 1 149 ? -6.226  61.521 361.321 1.00 43.55  ? 150  ASN A OD1 1 
ATOM   1168 N ND2 . ASN A 1 149 ? -5.816  62.867 363.068 1.00 43.13  ? 150  ASN A ND2 1 
ATOM   1169 N N   . TYR A 1 150 ? -1.665  60.496 360.879 1.00 41.45  ? 151  TYR A N   1 
ATOM   1170 C CA  . TYR A 1 150 ? -0.215  60.406 360.924 1.00 31.49  ? 151  TYR A CA  1 
ATOM   1171 C C   . TYR A 1 150 ? 0.366   61.807 360.836 1.00 32.34  ? 151  TYR A C   1 
ATOM   1172 O O   . TYR A 1 150 ? -0.244  62.712 360.259 1.00 36.41  ? 151  TYR A O   1 
ATOM   1173 C CB  . TYR A 1 150 ? 0.343   59.512 359.805 1.00 36.75  ? 151  TYR A CB  1 
ATOM   1174 C CG  . TYR A 1 150 ? 0.059   59.994 358.397 1.00 31.91  ? 151  TYR A CG  1 
ATOM   1175 C CD1 . TYR A 1 150 ? -1.083  59.590 357.719 1.00 27.59  ? 151  TYR A CD1 1 
ATOM   1176 C CD2 . TYR A 1 150 ? 0.944   60.838 357.740 1.00 28.68  ? 151  TYR A CD2 1 
ATOM   1177 C CE1 . TYR A 1 150 ? -1.341  60.025 356.426 1.00 27.08  ? 151  TYR A CE1 1 
ATOM   1178 C CE2 . TYR A 1 150 ? 0.697   61.273 356.449 1.00 34.60  ? 151  TYR A CE2 1 
ATOM   1179 C CZ  . TYR A 1 150 ? -0.444  60.867 355.796 1.00 33.55  ? 151  TYR A CZ  1 
ATOM   1180 O OH  . TYR A 1 150 ? -0.680  61.311 354.511 1.00 32.37  ? 151  TYR A OH  1 
ATOM   1181 N N   . ARG A 1 151 ? 1.547   61.978 361.422 1.00 31.66  ? 152  ARG A N   1 
ATOM   1182 C CA  . ARG A 1 151 ? 2.166   63.294 361.480 1.00 35.19  ? 152  ARG A CA  1 
ATOM   1183 C C   . ARG A 1 151 ? 2.570   63.764 360.089 1.00 36.56  ? 152  ARG A C   1 
ATOM   1184 O O   . ARG A 1 151 ? 3.027   62.979 359.253 1.00 36.67  ? 152  ARG A O   1 
ATOM   1185 C CB  . ARG A 1 151 ? 3.380   63.266 362.407 1.00 32.52  ? 152  ARG A CB  1 
ATOM   1186 C CG  . ARG A 1 151 ? 3.019   63.228 363.887 1.00 32.97  ? 152  ARG A CG  1 
ATOM   1187 C CD  . ARG A 1 151 ? 4.256   63.013 364.752 1.00 33.64  ? 152  ARG A CD  1 
ATOM   1188 N NE  . ARG A 1 151 ? 4.655   61.608 364.797 1.00 37.17  ? 152  ARG A NE  1 
ATOM   1189 C CZ  . ARG A 1 151 ? 5.772   61.168 365.368 1.00 42.07  ? 152  ARG A CZ  1 
ATOM   1190 N NH1 . ARG A 1 151 ? 6.611   62.025 365.937 1.00 33.46  ? 152  ARG A NH1 1 
ATOM   1191 N NH2 . ARG A 1 151 ? 6.054   59.871 365.367 1.00 38.70  ? 152  ARG A NH2 1 
ATOM   1192 N N   . VAL A 1 152 ? 2.394   65.060 359.845 1.00 35.74  ? 153  VAL A N   1 
ATOM   1193 C CA  . VAL A 1 152 ? 2.636   65.663 358.545 1.00 33.98  ? 153  VAL A CA  1 
ATOM   1194 C C   . VAL A 1 152 ? 3.597   66.832 358.725 1.00 41.17  ? 153  VAL A C   1 
ATOM   1195 O O   . VAL A 1 152 ? 3.883   67.266 359.842 1.00 35.49  ? 153  VAL A O   1 
ATOM   1196 C CB  . VAL A 1 152 ? 1.334   66.129 357.867 1.00 35.46  ? 153  VAL A CB  1 
ATOM   1197 C CG1 . VAL A 1 152 ? 0.554   64.937 357.341 1.00 33.44  ? 153  VAL A CG1 1 
ATOM   1198 C CG2 . VAL A 1 152 ? 0.494   66.941 358.836 1.00 32.89  ? 153  VAL A CG2 1 
ATOM   1199 N N   . GLY A 1 153 ? 4.088   67.344 357.598 1.00 40.29  ? 154  GLY A N   1 
ATOM   1200 C CA  . GLY A 1 153 ? 5.010   68.462 357.608 1.00 35.74  ? 154  GLY A CA  1 
ATOM   1201 C C   . GLY A 1 153 ? 6.298   68.121 358.334 1.00 41.94  ? 154  GLY A C   1 
ATOM   1202 O O   . GLY A 1 153 ? 6.764   66.975 358.341 1.00 39.13  ? 154  GLY A O   1 
ATOM   1203 N N   . ALA A 1 154 ? 6.885   69.140 358.966 1.00 32.72  ? 155  ALA A N   1 
ATOM   1204 C CA  . ALA A 1 154 ? 8.130   68.924 359.694 1.00 37.39  ? 155  ALA A CA  1 
ATOM   1205 C C   . ALA A 1 154 ? 7.948   67.935 360.836 1.00 41.64  ? 155  ALA A C   1 
ATOM   1206 O O   . ALA A 1 154 ? 8.860   67.155 361.130 1.00 44.73  ? 155  ALA A O   1 
ATOM   1207 C CB  . ALA A 1 154 ? 8.672   70.253 360.221 1.00 31.99  ? 155  ALA A CB  1 
ATOM   1208 N N   . PHE A 1 155 ? 6.777   67.934 361.479 1.00 35.83  ? 156  PHE A N   1 
ATOM   1209 C CA  . PHE A 1 155 ? 6.552   67.031 362.602 1.00 38.63  ? 156  PHE A CA  1 
ATOM   1210 C C   . PHE A 1 155 ? 6.620   65.568 362.189 1.00 39.61  ? 156  PHE A C   1 
ATOM   1211 O O   . PHE A 1 155 ? 6.918   64.710 363.027 1.00 36.44  ? 156  PHE A O   1 
ATOM   1212 C CB  . PHE A 1 155 ? 5.201   67.336 363.253 1.00 39.05  ? 156  PHE A CB  1 
ATOM   1213 C CG  . PHE A 1 155 ? 5.009   68.787 363.574 1.00 41.61  ? 156  PHE A CG  1 
ATOM   1214 C CD1 . PHE A 1 155 ? 4.315   69.614 362.707 1.00 38.25  ? 156  PHE A CD1 1 
ATOM   1215 C CD2 . PHE A 1 155 ? 5.542   69.331 364.731 1.00 37.51  ? 156  PHE A CD2 1 
ATOM   1216 C CE1 . PHE A 1 155 ? 4.147   70.955 362.993 1.00 43.57  ? 156  PHE A CE1 1 
ATOM   1217 C CE2 . PHE A 1 155 ? 5.377   70.670 365.021 1.00 39.37  ? 156  PHE A CE2 1 
ATOM   1218 C CZ  . PHE A 1 155 ? 4.679   71.482 364.150 1.00 39.14  ? 156  PHE A CZ  1 
ATOM   1219 N N   . GLY A 1 156 ? 6.370   65.264 360.920 1.00 36.62  ? 157  GLY A N   1 
ATOM   1220 C CA  . GLY A 1 156 ? 6.358   63.883 360.491 1.00 36.39  ? 157  GLY A CA  1 
ATOM   1221 C C   . GLY A 1 156 ? 7.515   63.499 359.596 1.00 36.52  ? 157  GLY A C   1 
ATOM   1222 O O   . GLY A 1 156 ? 7.836   62.312 359.473 1.00 33.57  ? 157  GLY A O   1 
ATOM   1223 N N   . PHE A 1 157 ? 8.158   64.489 358.966 1.00 33.38  ? 158  PHE A N   1 
ATOM   1224 C CA  . PHE A 1 157 ? 9.129   64.185 357.923 1.00 40.02  ? 158  PHE A CA  1 
ATOM   1225 C C   . PHE A 1 157 ? 10.343  65.105 357.913 1.00 42.28  ? 158  PHE A C   1 
ATOM   1226 O O   . PHE A 1 157 ? 11.122  65.057 356.952 1.00 38.31  ? 158  PHE A O   1 
ATOM   1227 C CB  . PHE A 1 157 ? 8.447   64.208 356.548 1.00 26.96  ? 158  PHE A CB  1 
ATOM   1228 C CG  . PHE A 1 157 ? 7.334   63.213 356.425 1.00 32.99  ? 158  PHE A CG  1 
ATOM   1229 C CD1 . PHE A 1 157 ? 6.015   63.605 356.580 1.00 29.18  ? 158  PHE A CD1 1 
ATOM   1230 C CD2 . PHE A 1 157 ? 7.609   61.875 356.198 1.00 31.80  ? 158  PHE A CD2 1 
ATOM   1231 C CE1 . PHE A 1 157 ? 4.987   62.683 356.484 1.00 31.33  ? 158  PHE A CE1 1 
ATOM   1232 C CE2 . PHE A 1 157 ? 6.588   60.948 356.103 1.00 40.85  ? 158  PHE A CE2 1 
ATOM   1233 C CZ  . PHE A 1 157 ? 5.273   61.354 356.247 1.00 34.93  ? 158  PHE A CZ  1 
ATOM   1234 N N   . LEU A 1 158 ? 10.537  65.938 358.933 1.00 37.92  ? 159  LEU A N   1 
ATOM   1235 C CA  . LEU A 1 158 ? 11.812  66.626 359.071 1.00 39.19  ? 159  LEU A CA  1 
ATOM   1236 C C   . LEU A 1 158 ? 12.888  65.594 359.374 1.00 48.10  ? 159  LEU A C   1 
ATOM   1237 O O   . LEU A 1 158 ? 12.752  64.796 360.306 1.00 48.52  ? 159  LEU A O   1 
ATOM   1238 C CB  . LEU A 1 158 ? 11.751  67.680 360.174 1.00 42.59  ? 159  LEU A CB  1 
ATOM   1239 C CG  . LEU A 1 158 ? 13.079  68.374 360.489 1.00 47.04  ? 159  LEU A CG  1 
ATOM   1240 C CD1 . LEU A 1 158 ? 12.902  69.883 360.549 1.00 35.40  ? 159  LEU A CD1 1 
ATOM   1241 C CD2 . LEU A 1 158 ? 13.672  67.847 361.789 1.00 38.83  ? 159  LEU A CD2 1 
ATOM   1242 N N   . ALA A 1 159 ? 13.951  65.594 358.577 1.00 42.60  ? 160  ALA A N   1 
ATOM   1243 C CA  . ALA A 1 159 ? 14.972  64.563 358.674 1.00 47.14  ? 160  ALA A CA  1 
ATOM   1244 C C   . ALA A 1 159 ? 16.347  65.194 358.807 1.00 48.44  ? 160  ALA A C   1 
ATOM   1245 O O   . ALA A 1 159 ? 16.727  66.046 357.998 1.00 49.36  ? 160  ALA A O   1 
ATOM   1246 C CB  . ALA A 1 159 ? 14.935  63.635 357.455 1.00 49.76  ? 160  ALA A CB  1 
ATOM   1247 N N   . LEU A 1 160 ? 17.075  64.785 359.838 1.00 41.73  ? 161  LEU A N   1 
ATOM   1248 C CA  . LEU A 1 160 ? 18.514  64.995 359.908 1.00 43.16  ? 161  LEU A CA  1 
ATOM   1249 C C   . LEU A 1 160 ? 19.156  63.617 359.811 1.00 42.66  ? 161  LEU A C   1 
ATOM   1250 O O   . LEU A 1 160 ? 19.462  62.999 360.839 1.00 44.55  ? 161  LEU A O   1 
ATOM   1251 C CB  . LEU A 1 160 ? 18.908  65.720 361.194 1.00 39.55  ? 161  LEU A CB  1 
ATOM   1252 C CG  . LEU A 1 160 ? 18.462  67.183 361.257 1.00 40.24  ? 161  LEU A CG  1 
ATOM   1253 C CD1 . LEU A 1 160 ? 18.705  67.766 362.634 1.00 50.08  ? 161  LEU A CD1 1 
ATOM   1254 C CD2 . LEU A 1 160 ? 19.177  68.001 360.197 1.00 40.87  ? 161  LEU A CD2 1 
ATOM   1255 N N   . PRO A 1 161 ? 19.353  63.103 358.596 1.00 48.38  ? 162  PRO A N   1 
ATOM   1256 C CA  . PRO A 1 161 ? 19.679  61.679 358.434 1.00 46.36  ? 162  PRO A CA  1 
ATOM   1257 C C   . PRO A 1 161 ? 20.938  61.287 359.193 1.00 54.60  ? 162  PRO A C   1 
ATOM   1258 O O   . PRO A 1 161 ? 21.915  62.038 359.250 1.00 44.01  ? 162  PRO A O   1 
ATOM   1259 C CB  . PRO A 1 161 ? 19.863  61.528 356.919 1.00 49.41  ? 162  PRO A CB  1 
ATOM   1260 C CG  . PRO A 1 161 ? 19.086  62.664 356.324 1.00 48.79  ? 162  PRO A CG  1 
ATOM   1261 C CD  . PRO A 1 161 ? 19.202  63.795 357.304 1.00 42.24  ? 162  PRO A CD  1 
ATOM   1262 N N   . GLY A 1 162 ? 20.899  60.094 359.786 1.00 56.77  ? 163  GLY A N   1 
ATOM   1263 C CA  . GLY A 1 162 ? 21.948  59.608 360.649 1.00 54.55  ? 163  GLY A CA  1 
ATOM   1264 C C   . GLY A 1 162 ? 21.735  59.907 362.120 1.00 60.34  ? 163  GLY A C   1 
ATOM   1265 O O   . GLY A 1 162 ? 22.154  59.117 362.973 1.00 60.66  ? 163  GLY A O   1 
ATOM   1266 N N   . SER A 1 163 ? 21.094  61.030 362.437 1.00 51.79  ? 164  SER A N   1 
ATOM   1267 C CA  . SER A 1 163 ? 20.816  61.369 363.825 1.00 60.63  ? 164  SER A CA  1 
ATOM   1268 C C   . SER A 1 163 ? 19.711  60.481 364.380 1.00 53.50  ? 164  SER A C   1 
ATOM   1269 O O   . SER A 1 163 ? 18.859  59.972 363.648 1.00 55.26  ? 164  SER A O   1 
ATOM   1270 C CB  . SER A 1 163 ? 20.404  62.834 363.951 1.00 55.32  ? 164  SER A CB  1 
ATOM   1271 O OG  . SER A 1 163 ? 19.087  63.032 363.459 1.00 55.51  ? 164  SER A OG  1 
ATOM   1272 N N   . ARG A 1 164 ? 19.724  60.300 365.694 1.00 54.24  ? 165  ARG A N   1 
ATOM   1273 C CA  . ARG A 1 164 ? 18.648  59.550 366.325 1.00 64.68  ? 165  ARG A CA  1 
ATOM   1274 C C   . ARG A 1 164 ? 17.539  60.442 366.854 1.00 47.87  ? 165  ARG A C   1 
ATOM   1275 O O   . ARG A 1 164 ? 16.446  59.940 367.140 1.00 51.41  ? 165  ARG A O   1 
ATOM   1276 C CB  . ARG A 1 164 ? 19.203  58.674 367.450 1.00 69.65  ? 165  ARG A CB  1 
ATOM   1277 C CG  . ARG A 1 164 ? 19.650  59.432 368.687 1.00 93.27  ? 165  ARG A CG  1 
ATOM   1278 C CD  . ARG A 1 164 ? 19.361  58.673 369.992 1.00 106.03 ? 165  ARG A CD  1 
ATOM   1279 N NE  . ARG A 1 164 ? 17.988  58.844 370.515 1.00 114.54 ? 165  ARG A NE  1 
ATOM   1280 C CZ  . ARG A 1 164 ? 17.768  59.536 371.612 1.00 119.57 ? 165  ARG A CZ  1 
ATOM   1281 N NH1 . ARG A 1 164 ? 18.794  60.086 372.247 1.00 121.05 ? 165  ARG A NH1 1 
ATOM   1282 N NH2 . ARG A 1 164 ? 16.530  59.662 372.036 1.00 118.43 ? 165  ARG A NH2 1 
ATOM   1283 N N   . GLU A 1 165 ? 17.779  61.751 366.956 1.00 41.46  ? 166  GLU A N   1 
ATOM   1284 C CA  . GLU A 1 165 ? 16.764  62.678 367.435 1.00 48.52  ? 166  GLU A CA  1 
ATOM   1285 C C   . GLU A 1 165 ? 15.791  63.114 366.349 1.00 57.66  ? 166  GLU A C   1 
ATOM   1286 O O   . GLU A 1 165 ? 14.687  63.564 366.674 1.00 51.02  ? 166  GLU A O   1 
ATOM   1287 C CB  . GLU A 1 165 ? 17.423  63.914 368.046 1.00 50.53  ? 166  GLU A CB  1 
ATOM   1288 C CG  . GLU A 1 165 ? 18.145  63.653 369.355 1.00 74.05  ? 166  GLU A CG  1 
ATOM   1289 C CD  . GLU A 1 165 ? 17.265  63.007 370.423 1.00 94.38  ? 166  GLU A CD  1 
ATOM   1290 O OE1 . GLU A 1 165 ? 17.840  62.401 371.348 1.00 105.19 ? 166  GLU A OE1 1 
ATOM   1291 O OE2 . GLU A 1 165 ? 16.018  63.114 370.363 1.00 85.82  ? 166  GLU A OE2 1 
ATOM   1292 N N   . ALA A 1 166 ? 16.175  63.014 365.076 1.00 45.28  ? 167  ALA A N   1 
ATOM   1293 C CA  . ALA A 1 166 ? 15.286  63.345 363.963 1.00 42.29  ? 167  ALA A CA  1 
ATOM   1294 C C   . ALA A 1 166 ? 15.613  62.429 362.794 1.00 42.83  ? 167  ALA A C   1 
ATOM   1295 O O   . ALA A 1 166 ? 16.137  62.865 361.763 1.00 41.55  ? 167  ALA A O   1 
ATOM   1296 C CB  . ALA A 1 166 ? 15.424  64.816 363.573 1.00 41.31  ? 167  ALA A CB  1 
ATOM   1297 N N   . PRO A 1 167 ? 15.308  61.134 362.923 1.00 44.68  ? 168  PRO A N   1 
ATOM   1298 C CA  . PRO A 1 167 ? 15.716  60.178 361.882 1.00 42.33  ? 168  PRO A CA  1 
ATOM   1299 C C   . PRO A 1 167 ? 14.949  60.324 360.582 1.00 51.25  ? 168  PRO A C   1 
ATOM   1300 O O   . PRO A 1 167 ? 15.411  59.815 359.552 1.00 49.59  ? 168  PRO A O   1 
ATOM   1301 C CB  . PRO A 1 167 ? 15.446  58.817 362.536 1.00 46.31  ? 168  PRO A CB  1 
ATOM   1302 C CG  . PRO A 1 167 ? 14.311  59.090 363.473 1.00 44.18  ? 168  PRO A CG  1 
ATOM   1303 C CD  . PRO A 1 167 ? 14.545  60.484 364.003 1.00 38.81  ? 168  PRO A CD  1 
ATOM   1304 N N   . GLY A 1 168 ? 13.804  60.995 360.591 1.00 50.58  ? 169  GLY A N   1 
ATOM   1305 C CA  . GLY A 1 168 ? 12.980  61.112 359.410 1.00 41.16  ? 169  GLY A CA  1 
ATOM   1306 C C   . GLY A 1 168 ? 12.037  59.934 359.243 1.00 45.09  ? 169  GLY A C   1 
ATOM   1307 O O   . GLY A 1 168 ? 12.161  58.889 359.886 1.00 42.85  ? 169  GLY A O   1 
ATOM   1308 N N   . ASN A 1 169 ? 11.058  60.130 358.361 1.00 42.93  ? 170  ASN A N   1 
ATOM   1309 C CA  . ASN A 1 169 ? 10.068  59.117 358.007 1.00 36.97  ? 170  ASN A CA  1 
ATOM   1310 C C   . ASN A 1 169 ? 9.207   58.683 359.194 1.00 39.94  ? 170  ASN A C   1 
ATOM   1311 O O   . ASN A 1 169 ? 8.575   57.621 359.142 1.00 38.53  ? 170  ASN A O   1 
ATOM   1312 C CB  . ASN A 1 169 ? 10.736  57.894 357.365 1.00 38.80  ? 170  ASN A CB  1 
ATOM   1313 C CG  . ASN A 1 169 ? 11.421  58.230 356.050 1.00 46.64  ? 170  ASN A CG  1 
ATOM   1314 O OD1 . ASN A 1 169 ? 11.055  59.193 355.383 1.00 39.30  ? 170  ASN A OD1 1 
ATOM   1315 N ND2 . ASN A 1 169 ? 12.418  57.435 355.674 1.00 37.51  ? 170  ASN A ND2 1 
ATOM   1316 N N   . VAL A 1 170 ? 9.145   59.481 360.268 1.00 32.83  ? 171  VAL A N   1 
ATOM   1317 C CA  . VAL A 1 170 ? 8.354   59.057 361.424 1.00 38.92  ? 171  VAL A CA  1 
ATOM   1318 C C   . VAL A 1 170 ? 6.864   59.068 361.089 1.00 45.08  ? 171  VAL A C   1 
ATOM   1319 O O   . VAL A 1 170 ? 6.090   58.279 361.648 1.00 33.91  ? 171  VAL A O   1 
ATOM   1320 C CB  . VAL A 1 170 ? 8.676   59.910 362.673 1.00 34.97  ? 171  VAL A CB  1 
ATOM   1321 C CG1 . VAL A 1 170 ? 10.169  59.853 362.994 1.00 34.53  ? 171  VAL A CG1 1 
ATOM   1322 C CG2 . VAL A 1 170 ? 8.219   61.353 362.509 1.00 35.32  ? 171  VAL A CG2 1 
ATOM   1323 N N   . GLY A 1 171 ? 6.440   59.927 360.156 1.00 37.56  ? 172  GLY A N   1 
ATOM   1324 C CA  . GLY A 1 171 ? 5.059   59.878 359.696 1.00 29.64  ? 172  GLY A CA  1 
ATOM   1325 C C   . GLY A 1 171 ? 4.697   58.542 359.071 1.00 38.52  ? 172  GLY A C   1 
ATOM   1326 O O   . GLY A 1 171 ? 3.577   58.048 359.239 1.00 34.40  ? 172  GLY A O   1 
ATOM   1327 N N   . LEU A 1 172 ? 5.637   57.938 358.340 1.00 33.68  ? 173  LEU A N   1 
ATOM   1328 C CA  . LEU A 1 172 ? 5.394   56.608 357.790 1.00 36.09  ? 173  LEU A CA  1 
ATOM   1329 C C   . LEU A 1 172 ? 5.379   55.562 358.896 1.00 32.04  ? 173  LEU A C   1 
ATOM   1330 O O   . LEU A 1 172 ? 4.602   54.601 358.843 1.00 40.06  ? 173  LEU A O   1 
ATOM   1331 C CB  . LEU A 1 172 ? 6.451   56.264 356.736 1.00 33.90  ? 173  LEU A CB  1 
ATOM   1332 C CG  . LEU A 1 172 ? 6.433   57.050 355.423 1.00 39.21  ? 173  LEU A CG  1 
ATOM   1333 C CD1 . LEU A 1 172 ? 7.653   56.715 354.574 1.00 38.35  ? 173  LEU A CD1 1 
ATOM   1334 C CD2 . LEU A 1 172 ? 5.155   56.763 354.654 1.00 34.58  ? 173  LEU A CD2 1 
ATOM   1335 N N   . LEU A 1 173 ? 6.230   55.736 359.908 1.00 33.58  ? 174  LEU A N   1 
ATOM   1336 C CA  . LEU A 1 173 ? 6.207   54.836 361.056 1.00 42.66  ? 174  LEU A CA  1 
ATOM   1337 C C   . LEU A 1 173 ? 4.898   54.950 361.827 1.00 34.79  ? 174  LEU A C   1 
ATOM   1338 O O   . LEU A 1 173 ? 4.429   53.955 362.391 1.00 41.22  ? 174  LEU A O   1 
ATOM   1339 C CB  . LEU A 1 173 ? 7.402   55.118 361.966 1.00 32.61  ? 174  LEU A CB  1 
ATOM   1340 C CG  . LEU A 1 173 ? 8.769   54.921 361.302 1.00 44.91  ? 174  LEU A CG  1 
ATOM   1341 C CD1 . LEU A 1 173 ? 9.899   55.322 362.233 1.00 36.46  ? 174  LEU A CD1 1 
ATOM   1342 C CD2 . LEU A 1 173 ? 8.941   53.480 360.841 1.00 41.57  ? 174  LEU A CD2 1 
ATOM   1343 N N   . ASP A 1 174 ? 4.294   56.143 361.863 1.00 35.59  ? 175  ASP A N   1 
ATOM   1344 C CA  . ASP A 1 174 ? 2.944   56.272 362.407 1.00 35.44  ? 175  ASP A CA  1 
ATOM   1345 C C   . ASP A 1 174 ? 1.977   55.362 361.661 1.00 37.76  ? 175  ASP A C   1 
ATOM   1346 O O   . ASP A 1 174 ? 1.186   54.636 362.275 1.00 40.80  ? 175  ASP A O   1 
ATOM   1347 C CB  . ASP A 1 174 ? 2.466   57.725 362.329 1.00 35.31  ? 175  ASP A CB  1 
ATOM   1348 C CG  . ASP A 1 174 ? 3.309   58.674 363.163 1.00 44.61  ? 175  ASP A CG  1 
ATOM   1349 O OD1 . ASP A 1 174 ? 4.025   58.208 364.074 1.00 37.76  ? 175  ASP A OD1 1 
ATOM   1350 O OD2 . ASP A 1 174 ? 3.249   59.897 362.903 1.00 41.48  ? 175  ASP A OD2 1 
ATOM   1351 N N   . GLN A 1 175 ? 2.030   55.386 360.326 1.00 39.25  ? 176  GLN A N   1 
ATOM   1352 C CA  . GLN A 1 175 ? 1.156   54.522 359.541 1.00 29.26  ? 176  GLN A CA  1 
ATOM   1353 C C   . GLN A 1 175 ? 1.459   53.053 359.804 1.00 34.01  ? 176  GLN A C   1 
ATOM   1354 O O   . GLN A 1 175 ? 0.541   52.241 359.970 1.00 37.15  ? 176  GLN A O   1 
ATOM   1355 C CB  . GLN A 1 175 ? 1.298   54.838 358.052 1.00 42.38  ? 176  GLN A CB  1 
ATOM   1356 C CG  . GLN A 1 175 ? 1.049   56.288 357.681 1.00 32.65  ? 176  GLN A CG  1 
ATOM   1357 C CD  . GLN A 1 175 ? 1.400   56.565 356.232 1.00 38.21  ? 176  GLN A CD  1 
ATOM   1358 O OE1 . GLN A 1 175 ? 1.744   55.648 355.488 1.00 40.00  ? 176  GLN A OE1 1 
ATOM   1359 N NE2 . GLN A 1 175 ? 1.334   57.832 355.828 1.00 28.51  ? 176  GLN A NE2 1 
ATOM   1360 N N   . ARG A 1 176 ? 2.744   52.695 359.851 1.00 35.35  ? 177  ARG A N   1 
ATOM   1361 C CA  . ARG A 1 176 ? 3.112   51.304 360.085 1.00 41.57  ? 177  ARG A CA  1 
ATOM   1362 C C   . ARG A 1 176 ? 2.622   50.829 361.447 1.00 42.60  ? 177  ARG A C   1 
ATOM   1363 O O   . ARG A 1 176 ? 2.119   49.706 361.575 1.00 37.32  ? 177  ARG A O   1 
ATOM   1364 C CB  . ARG A 1 176 ? 4.625   51.133 359.969 1.00 34.75  ? 177  ARG A CB  1 
ATOM   1365 C CG  . ARG A 1 176 ? 5.101   49.720 360.257 1.00 40.71  ? 177  ARG A CG  1 
ATOM   1366 C CD  . ARG A 1 176 ? 6.604   49.607 360.107 1.00 51.39  ? 177  ARG A CD  1 
ATOM   1367 N NE  . ARG A 1 176 ? 7.017   49.606 358.709 1.00 59.55  ? 177  ARG A NE  1 
ATOM   1368 C CZ  . ARG A 1 176 ? 8.280   49.681 358.306 1.00 57.88  ? 177  ARG A CZ  1 
ATOM   1369 N NH1 . ARG A 1 176 ? 9.255   49.770 359.200 1.00 47.66  ? 177  ARG A NH1 1 
ATOM   1370 N NH2 . ARG A 1 176 ? 8.567   49.668 357.010 1.00 51.31  ? 177  ARG A NH2 1 
ATOM   1371 N N   . LEU A 1 177 ? 2.755   51.673 362.474 1.00 39.22  ? 178  LEU A N   1 
ATOM   1372 C CA  . LEU A 1 177 ? 2.268   51.303 363.800 1.00 42.73  ? 178  LEU A CA  1 
ATOM   1373 C C   . LEU A 1 177 ? 0.761   51.079 363.784 1.00 44.70  ? 178  LEU A C   1 
ATOM   1374 O O   . LEU A 1 177 ? 0.257   50.149 364.424 1.00 40.61  ? 178  LEU A O   1 
ATOM   1375 C CB  . LEU A 1 177 ? 2.647   52.380 364.819 1.00 34.81  ? 178  LEU A CB  1 
ATOM   1376 C CG  . LEU A 1 177 ? 2.238   52.133 366.273 1.00 43.51  ? 178  LEU A CG  1 
ATOM   1377 C CD1 . LEU A 1 177 ? 2.788   50.803 366.754 1.00 35.91  ? 178  LEU A CD1 1 
ATOM   1378 C CD2 . LEU A 1 177 ? 2.710   53.265 367.180 1.00 32.90  ? 178  LEU A CD2 1 
ATOM   1379 N N   . ALA A 1 178 ? 0.027   51.910 363.041 1.00 37.37  ? 179  ALA A N   1 
ATOM   1380 C CA  . ALA A 1 178 ? -1.412  51.707 362.920 1.00 39.47  ? 179  ALA A CA  1 
ATOM   1381 C C   . ALA A 1 178 ? -1.725  50.391 362.218 1.00 42.07  ? 179  ALA A C   1 
ATOM   1382 O O   . ALA A 1 178 ? -2.674  49.691 362.593 1.00 44.08  ? 179  ALA A O   1 
ATOM   1383 C CB  . ALA A 1 178 ? -2.048  52.883 362.178 1.00 37.94  ? 179  ALA A CB  1 
ATOM   1384 N N   . LEU A 1 179 ? -0.933  50.033 361.202 1.00 40.45  ? 180  LEU A N   1 
ATOM   1385 C CA  . LEU A 1 179 ? -1.133  48.758 360.519 1.00 44.75  ? 180  LEU A CA  1 
ATOM   1386 C C   . LEU A 1 179 ? -0.825  47.584 361.442 1.00 44.38  ? 180  LEU A C   1 
ATOM   1387 O O   . LEU A 1 179 ? -1.492  46.544 361.376 1.00 43.95  ? 180  LEU A O   1 
ATOM   1388 C CB  . LEU A 1 179 ? -0.267  48.693 359.260 1.00 40.07  ? 180  LEU A CB  1 
ATOM   1389 C CG  . LEU A 1 179 ? -0.601  49.714 358.173 1.00 42.03  ? 180  LEU A CG  1 
ATOM   1390 C CD1 . LEU A 1 179 ? 0.306   49.545 356.961 1.00 39.64  ? 180  LEU A CD1 1 
ATOM   1391 C CD2 . LEU A 1 179 ? -2.063  49.599 357.780 1.00 45.33  ? 180  LEU A CD2 1 
ATOM   1392 N N   . GLN A 1 180 ? 0.187   47.727 362.300 1.00 43.87  ? 181  GLN A N   1 
ATOM   1393 C CA  . GLN A 1 180 ? 0.451   46.698 363.301 1.00 53.55  ? 181  GLN A CA  1 
ATOM   1394 C C   . GLN A 1 180 ? -0.697  46.602 364.298 1.00 49.04  ? 181  GLN A C   1 
ATOM   1395 O O   . GLN A 1 180 ? -1.069  45.501 364.722 1.00 48.35  ? 181  GLN A O   1 
ATOM   1396 C CB  . GLN A 1 180 ? 1.770   46.989 364.017 1.00 41.80  ? 181  GLN A CB  1 
ATOM   1397 C CG  . GLN A 1 180 ? 2.987   46.875 363.113 1.00 59.81  ? 181  GLN A CG  1 
ATOM   1398 C CD  . GLN A 1 180 ? 4.231   47.494 363.719 1.00 61.56  ? 181  GLN A CD  1 
ATOM   1399 O OE1 . GLN A 1 180 ? 4.147   48.377 364.571 1.00 61.11  ? 181  GLN A OE1 1 
ATOM   1400 N NE2 . GLN A 1 180 ? 5.395   47.034 363.276 1.00 59.39  ? 181  GLN A NE2 1 
ATOM   1401 N N   . TRP A 1 181 ? -1.271  47.747 364.676 1.00 38.42  ? 182  TRP A N   1 
ATOM   1402 C CA  . TRP A 1 181 ? -2.453  47.745 365.532 1.00 40.51  ? 182  TRP A CA  1 
ATOM   1403 C C   . TRP A 1 181 ? -3.599  46.983 364.878 1.00 43.50  ? 182  TRP A C   1 
ATOM   1404 O O   . TRP A 1 181 ? -4.322  46.236 365.549 1.00 44.22  ? 182  TRP A O   1 
ATOM   1405 C CB  . TRP A 1 181 ? -2.865  49.185 365.841 1.00 36.40  ? 182  TRP A CB  1 
ATOM   1406 C CG  . TRP A 1 181 ? -3.972  49.319 366.838 1.00 43.19  ? 182  TRP A CG  1 
ATOM   1407 C CD1 . TRP A 1 181 ? -3.846  49.571 368.175 1.00 38.34  ? 182  TRP A CD1 1 
ATOM   1408 C CD2 . TRP A 1 181 ? -5.379  49.223 366.579 1.00 36.93  ? 182  TRP A CD2 1 
ATOM   1409 N NE1 . TRP A 1 181 ? -5.084  49.631 368.762 1.00 43.00  ? 182  TRP A NE1 1 
ATOM   1410 C CE2 . TRP A 1 181 ? -6.043  49.421 367.805 1.00 42.01  ? 182  TRP A CE2 1 
ATOM   1411 C CE3 . TRP A 1 181 ? -6.142  48.989 365.429 1.00 35.87  ? 182  TRP A CE3 1 
ATOM   1412 C CZ2 . TRP A 1 181 ? -7.433  49.391 367.917 1.00 38.70  ? 182  TRP A CZ2 1 
ATOM   1413 C CZ3 . TRP A 1 181 ? -7.522  48.957 365.541 1.00 38.15  ? 182  TRP A CZ3 1 
ATOM   1414 C CH2 . TRP A 1 181 ? -8.153  49.156 366.776 1.00 41.99  ? 182  TRP A CH2 1 
ATOM   1415 N N   . VAL A 1 182 ? -3.777  47.158 363.566 1.00 44.16  ? 183  VAL A N   1 
ATOM   1416 C CA  . VAL A 1 182 ? -4.831  46.443 362.849 1.00 36.52  ? 183  VAL A CA  1 
ATOM   1417 C C   . VAL A 1 182 ? -4.611  44.938 362.935 1.00 49.59  ? 183  VAL A C   1 
ATOM   1418 O O   . VAL A 1 182 ? -5.552  44.171 363.176 1.00 49.81  ? 183  VAL A O   1 
ATOM   1419 C CB  . VAL A 1 182 ? -4.900  46.925 361.387 1.00 42.25  ? 183  VAL A CB  1 
ATOM   1420 C CG1 . VAL A 1 182 ? -5.783  46.003 360.557 1.00 37.90  ? 183  VAL A CG1 1 
ATOM   1421 C CG2 . VAL A 1 182 ? -5.410  48.362 361.321 1.00 39.34  ? 183  VAL A CG2 1 
ATOM   1422 N N   . GLN A 1 183 ? -3.364  44.492 362.755 1.00 43.85  ? 184  GLN A N   1 
ATOM   1423 C CA  . GLN A 1 183 ? -3.069  43.062 362.792 1.00 51.97  ? 184  GLN A CA  1 
ATOM   1424 C C   . GLN A 1 183 ? -3.376  42.454 364.155 1.00 55.86  ? 184  GLN A C   1 
ATOM   1425 O O   . GLN A 1 183 ? -3.818  41.302 364.239 1.00 43.90  ? 184  GLN A O   1 
ATOM   1426 C CB  . GLN A 1 183 ? -1.603  42.820 362.422 1.00 47.57  ? 184  GLN A CB  1 
ATOM   1427 C CG  . GLN A 1 183 ? -1.324  42.871 360.928 1.00 51.00  ? 184  GLN A CG  1 
ATOM   1428 C CD  . GLN A 1 183 ? -2.061  41.788 360.170 1.00 51.12  ? 184  GLN A CD  1 
ATOM   1429 O OE1 . GLN A 1 183 ? -2.015  40.615 360.541 1.00 59.79  ? 184  GLN A OE1 1 
ATOM   1430 N NE2 . GLN A 1 183 ? -2.758  42.176 359.111 1.00 49.80  ? 184  GLN A NE2 1 
ATOM   1431 N N   . GLU A 1 184 ? -3.163  43.206 365.228 1.00 48.52  ? 185  GLU A N   1 
ATOM   1432 C CA  . GLU A 1 184 ? -3.350  42.661 366.563 1.00 58.61  ? 185  GLU A CA  1 
ATOM   1433 C C   . GLU A 1 184 ? -4.769  42.823 367.093 1.00 51.82  ? 185  GLU A C   1 
ATOM   1434 O O   . GLU A 1 184 ? -5.161  42.077 367.995 1.00 54.39  ? 185  GLU A O   1 
ATOM   1435 C CB  . GLU A 1 184 ? -2.368  43.319 367.535 1.00 55.94  ? 185  GLU A CB  1 
ATOM   1436 C CG  . GLU A 1 184 ? -0.915  42.947 367.286 1.00 72.98  ? 185  GLU A CG  1 
ATOM   1437 C CD  . GLU A 1 184 ? 0.053   43.861 368.012 1.00 94.48  ? 185  GLU A CD  1 
ATOM   1438 O OE1 . GLU A 1 184 ? 1.240   43.907 367.622 1.00 93.60  ? 185  GLU A OE1 1 
ATOM   1439 O OE2 . GLU A 1 184 ? -0.374  44.537 368.972 1.00 100.01 ? 185  GLU A OE2 1 
ATOM   1440 N N   . ASN A 1 185 ? -5.552  43.756 366.551 1.00 47.64  ? 186  ASN A N   1 
ATOM   1441 C CA  . ASN A 1 185 ? -6.798  44.161 367.190 1.00 36.60  ? 186  ASN A CA  1 
ATOM   1442 C C   . ASN A 1 185 ? -8.029  44.119 366.301 1.00 42.40  ? 186  ASN A C   1 
ATOM   1443 O O   . ASN A 1 185 ? -9.142  44.113 366.840 1.00 47.54  ? 186  ASN A O   1 
ATOM   1444 C CB  . ASN A 1 185 ? -6.661  45.582 367.757 1.00 37.92  ? 186  ASN A CB  1 
ATOM   1445 C CG  . ASN A 1 185 ? -5.625  45.670 368.857 1.00 48.84  ? 186  ASN A CG  1 
ATOM   1446 O OD1 . ASN A 1 185 ? -5.693  44.939 369.844 1.00 52.32  ? 186  ASN A OD1 1 
ATOM   1447 N ND2 . ASN A 1 185 ? -4.655  46.563 368.691 1.00 37.44  ? 186  ASN A ND2 1 
ATOM   1448 N N   . VAL A 1 186 ? -7.885  44.094 364.973 1.00 40.46  ? 187  VAL A N   1 
ATOM   1449 C CA  . VAL A 1 186 ? -9.058  44.217 364.116 1.00 38.60  ? 187  VAL A CA  1 
ATOM   1450 C C   . VAL A 1 186 ? -9.988  43.019 364.254 1.00 45.59  ? 187  VAL A C   1 
ATOM   1451 O O   . VAL A 1 186 ? -11.187 43.139 363.974 1.00 46.27  ? 187  VAL A O   1 
ATOM   1452 C CB  . VAL A 1 186 ? -8.644  44.429 362.645 1.00 40.73  ? 187  VAL A CB  1 
ATOM   1453 C CG1 . VAL A 1 186 ? -8.354  43.097 361.959 1.00 43.83  ? 187  VAL A CG1 1 
ATOM   1454 C CG2 . VAL A 1 186 ? -9.724  45.199 361.896 1.00 35.51  ? 187  VAL A CG2 1 
ATOM   1455 N N   . ALA A 1 187 ? -9.476  41.867 364.700 1.00 43.02  ? 188  ALA A N   1 
ATOM   1456 C CA  . ALA A 1 187 ? -10.338 40.702 364.865 1.00 46.68  ? 188  ALA A CA  1 
ATOM   1457 C C   . ALA A 1 187 ? -11.343 40.904 365.994 1.00 45.15  ? 188  ALA A C   1 
ATOM   1458 O O   . ALA A 1 187 ? -12.422 40.302 365.975 1.00 44.90  ? 188  ALA A O   1 
ATOM   1459 C CB  . ALA A 1 187 ? -9.496  39.451 365.110 1.00 36.53  ? 188  ALA A CB  1 
ATOM   1460 N N   . ALA A 1 188 ? -11.015 41.749 366.975 1.00 39.48  ? 189  ALA A N   1 
ATOM   1461 C CA  . ALA A 1 188 ? -11.964 42.061 368.038 1.00 44.44  ? 189  ALA A CA  1 
ATOM   1462 C C   . ALA A 1 188 ? -13.171 42.835 367.523 1.00 48.17  ? 189  ALA A C   1 
ATOM   1463 O O   . ALA A 1 188 ? -14.227 42.808 368.165 1.00 48.45  ? 189  ALA A O   1 
ATOM   1464 C CB  . ALA A 1 188 ? -11.270 42.851 369.149 1.00 31.74  ? 189  ALA A CB  1 
ATOM   1465 N N   . PHE A 1 189 ? -13.038 43.519 366.389 1.00 43.90  ? 190  PHE A N   1 
ATOM   1466 C CA  . PHE A 1 189 ? -14.144 44.208 365.737 1.00 40.44  ? 190  PHE A CA  1 
ATOM   1467 C C   . PHE A 1 189 ? -14.808 43.360 364.661 1.00 52.63  ? 190  PHE A C   1 
ATOM   1468 O O   . PHE A 1 189 ? -15.716 43.848 363.978 1.00 48.84  ? 190  PHE A O   1 
ATOM   1469 C CB  . PHE A 1 189 ? -13.656 45.523 365.114 1.00 44.16  ? 190  PHE A CB  1 
ATOM   1470 C CG  . PHE A 1 189 ? -13.005 46.456 366.093 1.00 45.66  ? 190  PHE A CG  1 
ATOM   1471 C CD1 . PHE A 1 189 ? -11.665 46.315 366.419 1.00 43.88  ? 190  PHE A CD1 1 
ATOM   1472 C CD2 . PHE A 1 189 ? -13.729 47.479 366.680 1.00 40.67  ? 190  PHE A CD2 1 
ATOM   1473 C CE1 . PHE A 1 189 ? -11.063 47.171 367.321 1.00 37.59  ? 190  PHE A CE1 1 
ATOM   1474 C CE2 . PHE A 1 189 ? -13.132 48.339 367.579 1.00 42.50  ? 190  PHE A CE2 1 
ATOM   1475 C CZ  . PHE A 1 189 ? -11.797 48.185 367.900 1.00 36.43  ? 190  PHE A CZ  1 
ATOM   1476 N N   . GLY A 1 190 ? -14.379 42.113 364.489 1.00 43.62  ? 191  GLY A N   1 
ATOM   1477 C CA  . GLY A 1 190 ? -14.883 41.273 363.424 1.00 47.91  ? 191  GLY A CA  1 
ATOM   1478 C C   . GLY A 1 190 ? -14.104 41.347 362.131 1.00 53.64  ? 191  GLY A C   1 
ATOM   1479 O O   . GLY A 1 190 ? -14.550 40.783 361.125 1.00 44.82  ? 191  GLY A O   1 
ATOM   1480 N N   . GLY A 1 191 ? -12.956 42.024 362.123 1.00 47.57  ? 192  GLY A N   1 
ATOM   1481 C CA  . GLY A 1 191 ? -12.172 42.135 360.913 1.00 44.07  ? 192  GLY A CA  1 
ATOM   1482 C C   . GLY A 1 191 ? -11.260 40.942 360.703 1.00 52.06  ? 192  GLY A C   1 
ATOM   1483 O O   . GLY A 1 191 ? -10.871 40.247 361.640 1.00 57.55  ? 192  GLY A O   1 
ATOM   1484 N N   . ASP A 1 192 ? -10.917 40.707 359.439 1.00 58.23  ? 193  ASP A N   1 
ATOM   1485 C CA  . ASP A 1 192 ? -10.040 39.607 359.076 1.00 51.09  ? 193  ASP A CA  1 
ATOM   1486 C C   . ASP A 1 192 ? -8.626  40.132 358.879 1.00 50.82  ? 193  ASP A C   1 
ATOM   1487 O O   . ASP A 1 192 ? -8.356  40.784 357.859 1.00 58.13  ? 193  ASP A O   1 
ATOM   1488 C CB  . ASP A 1 192 ? -10.538 38.927 357.804 1.00 51.13  ? 193  ASP A CB  1 
ATOM   1489 C CG  . ASP A 1 192 ? -9.845  37.607 357.538 1.00 58.02  ? 193  ASP A CG  1 
ATOM   1490 O OD1 . ASP A 1 192 ? -8.871  37.285 358.253 1.00 55.69  ? 193  ASP A OD1 1 
ATOM   1491 O OD2 . ASP A 1 192 ? -10.275 36.887 356.613 1.00 60.68  ? 193  ASP A OD2 1 
ATOM   1492 N N   . PRO A 1 193 ? -7.694  39.873 359.802 1.00 51.66  ? 194  PRO A N   1 
ATOM   1493 C CA  . PRO A 1 193 ? -6.311  40.334 359.602 1.00 51.88  ? 194  PRO A CA  1 
ATOM   1494 C C   . PRO A 1 193 ? -5.581  39.618 358.475 1.00 57.80  ? 194  PRO A C   1 
ATOM   1495 O O   . PRO A 1 193 ? -4.501  40.077 358.079 1.00 55.10  ? 194  PRO A O   1 
ATOM   1496 C CB  . PRO A 1 193 ? -5.651  40.055 360.959 1.00 50.99  ? 194  PRO A CB  1 
ATOM   1497 C CG  . PRO A 1 193 ? -6.441  38.928 361.528 1.00 47.20  ? 194  PRO A CG  1 
ATOM   1498 C CD  . PRO A 1 193 ? -7.859  39.153 361.077 1.00 52.70  ? 194  PRO A CD  1 
ATOM   1499 N N   . THR A 1 194 ? -6.125  38.520 357.950 1.00 51.61  ? 195  THR A N   1 
ATOM   1500 C CA  . THR A 1 194 ? -5.539  37.826 356.811 1.00 55.16  ? 195  THR A CA  1 
ATOM   1501 C C   . THR A 1 194 ? -6.035  38.362 355.475 1.00 55.72  ? 195  THR A C   1 
ATOM   1502 O O   . THR A 1 194 ? -5.692  37.797 354.431 1.00 63.95  ? 195  THR A O   1 
ATOM   1503 C CB  . THR A 1 194 ? -5.827  36.321 356.889 1.00 51.73  ? 195  THR A CB  1 
ATOM   1504 O OG1 . THR A 1 194 ? -7.221  36.084 356.648 1.00 51.35  ? 195  THR A OG1 1 
ATOM   1505 C CG2 . THR A 1 194 ? -5.448  35.771 358.258 1.00 43.99  ? 195  THR A CG2 1 
ATOM   1506 N N   . SER A 1 195 ? -6.831  39.440 355.481 1.00 58.23  ? 196  SER A N   1 
ATOM   1507 C CA  . SER A 1 195 ? -7.334  40.062 354.254 1.00 51.24  ? 196  SER A CA  1 
ATOM   1508 C C   . SER A 1 195 ? -7.436  41.568 354.521 1.00 54.09  ? 196  SER A C   1 
ATOM   1509 O O   . SER A 1 195 ? -8.500  42.112 354.830 1.00 47.55  ? 196  SER A O   1 
ATOM   1510 C CB  . SER A 1 195 ? -8.675  39.471 353.821 1.00 55.74  ? 196  SER A CB  1 
ATOM   1511 O OG  . SER A 1 195 ? -9.311  40.288 352.851 1.00 58.07  ? 196  SER A OG  1 
ATOM   1512 N N   . VAL A 1 196 ? -6.299  42.249 354.394 1.00 50.56  ? 197  VAL A N   1 
ATOM   1513 C CA  . VAL A 1 196 ? -6.191  43.677 354.664 1.00 40.72  ? 197  VAL A CA  1 
ATOM   1514 C C   . VAL A 1 196 ? -5.792  44.379 353.374 1.00 47.21  ? 197  VAL A C   1 
ATOM   1515 O O   . VAL A 1 196 ? -4.753  44.059 352.780 1.00 43.89  ? 197  VAL A O   1 
ATOM   1516 C CB  . VAL A 1 196 ? -5.179  43.971 355.780 1.00 45.04  ? 197  VAL A CB  1 
ATOM   1517 C CG1 . VAL A 1 196 ? -4.886  45.464 355.845 1.00 33.17  ? 197  VAL A CG1 1 
ATOM   1518 C CG2 . VAL A 1 196 ? -5.694  43.448 357.118 1.00 34.17  ? 197  VAL A CG2 1 
ATOM   1519 N N   . THR A 1 197 ? -6.603  45.345 352.952 1.00 41.16  ? 198  THR A N   1 
ATOM   1520 C CA  . THR A 1 197 ? -6.377  46.097 351.725 1.00 42.54  ? 198  THR A CA  1 
ATOM   1521 C C   . THR A 1 197 ? -6.076  47.551 352.070 1.00 42.59  ? 198  THR A C   1 
ATOM   1522 O O   . THR A 1 197 ? -6.925  48.245 352.639 1.00 49.70  ? 198  THR A O   1 
ATOM   1523 C CB  . THR A 1 197 ? -7.593  46.010 350.803 1.00 45.44  ? 198  THR A CB  1 
ATOM   1524 O OG1 . THR A 1 197 ? -7.768  44.656 350.365 1.00 41.83  ? 198  THR A OG1 1 
ATOM   1525 C CG2 . THR A 1 197 ? -7.409  46.915 349.591 1.00 28.92  ? 198  THR A CG2 1 
ATOM   1526 N N   . LEU A 1 198 ? -4.874  48.005 351.725 1.00 37.75  ? 199  LEU A N   1 
ATOM   1527 C CA  . LEU A 1 198 ? -4.516  49.407 351.877 1.00 35.64  ? 199  LEU A CA  1 
ATOM   1528 C C   . LEU A 1 198 ? -5.017  50.212 350.687 1.00 40.54  ? 199  LEU A C   1 
ATOM   1529 O O   . LEU A 1 198 ? -4.896  49.782 349.537 1.00 43.73  ? 199  LEU A O   1 
ATOM   1530 C CB  . LEU A 1 198 ? -3.001  49.571 351.983 1.00 37.46  ? 199  LEU A CB  1 
ATOM   1531 C CG  . LEU A 1 198 ? -2.267  48.912 353.140 1.00 45.49  ? 199  LEU A CG  1 
ATOM   1532 C CD1 . LEU A 1 198 ? -0.898  49.555 353.296 1.00 41.10  ? 199  LEU A CD1 1 
ATOM   1533 C CD2 . LEU A 1 198 ? -3.083  49.036 354.412 1.00 43.93  ? 199  LEU A CD2 1 
ATOM   1534 N N   . PHE A 1 199 ? -5.567  51.391 350.960 1.00 33.31  ? 200  PHE A N   1 
ATOM   1535 C CA  . PHE A 1 199 ? -5.908  52.295 349.872 1.00 35.16  ? 200  PHE A CA  1 
ATOM   1536 C C   . PHE A 1 199 ? -5.766  53.733 350.345 1.00 34.05  ? 200  PHE A C   1 
ATOM   1537 O O   . PHE A 1 199 ? -6.053  54.051 351.502 1.00 38.77  ? 200  PHE A O   1 
ATOM   1538 C CB  . PHE A 1 199 ? -7.312  52.010 349.306 1.00 38.62  ? 200  PHE A CB  1 
ATOM   1539 C CG  . PHE A 1 199 ? -8.450  52.339 350.226 1.00 41.56  ? 200  PHE A CG  1 
ATOM   1540 C CD1 . PHE A 1 199 ? -9.451  53.209 349.817 1.00 35.59  ? 200  PHE A CD1 1 
ATOM   1541 C CD2 . PHE A 1 199 ? -8.547  51.754 351.477 1.00 47.88  ? 200  PHE A CD2 1 
ATOM   1542 C CE1 . PHE A 1 199 ? -10.516 53.504 350.652 1.00 56.34  ? 200  PHE A CE1 1 
ATOM   1543 C CE2 . PHE A 1 199 ? -9.603  52.048 352.316 1.00 47.33  ? 200  PHE A CE2 1 
ATOM   1544 C CZ  . PHE A 1 199 ? -10.590 52.923 351.904 1.00 33.66  ? 200  PHE A CZ  1 
ATOM   1545 N N   . GLY A 1 200 ? -5.284  54.585 349.445 1.00 36.70  ? 201  GLY A N   1 
ATOM   1546 C CA  . GLY A 1 200 ? -5.015  55.977 349.752 1.00 26.85  ? 201  GLY A CA  1 
ATOM   1547 C C   . GLY A 1 200 ? -4.972  56.782 348.475 1.00 36.19  ? 201  GLY A C   1 
ATOM   1548 O O   . GLY A 1 200 ? -4.960  56.236 347.369 1.00 33.76  ? 201  GLY A O   1 
ATOM   1549 N N   . GLU A 1 201 ? -4.945  58.102 348.641 1.00 34.17  ? 202  GLU A N   1 
ATOM   1550 C CA  . GLU A 1 201 ? -4.972  59.028 347.519 1.00 31.95  ? 202  GLU A CA  1 
ATOM   1551 C C   . GLU A 1 201 ? -3.850  60.047 347.667 1.00 37.05  ? 202  GLU A C   1 
ATOM   1552 O O   . GLU A 1 201 ? -3.563  60.504 348.776 1.00 36.75  ? 202  GLU A O   1 
ATOM   1553 C CB  . GLU A 1 201 ? -6.335  59.737 347.425 1.00 36.71  ? 202  GLU A CB  1 
ATOM   1554 C CG  . GLU A 1 201 ? -6.551  60.539 346.150 1.00 36.89  ? 202  GLU A CG  1 
ATOM   1555 C CD  . GLU A 1 201 ? -6.136  61.989 346.304 1.00 47.89  ? 202  GLU A CD  1 
ATOM   1556 O OE1 . GLU A 1 201 ? -6.061  62.707 345.282 1.00 44.81  ? 202  GLU A OE1 1 
ATOM   1557 O OE2 . GLU A 1 201 ? -5.878  62.408 347.453 1.00 40.83  ? 202  GLU A OE2 1 
ATOM   1558 N N   . SER A 1 202 ? -3.216  60.389 346.543 1.00 35.25  ? 203  SER A N   1 
ATOM   1559 C CA  . SER A 1 202 ? -2.133  61.381 346.480 1.00 36.29  ? 203  SER A CA  1 
ATOM   1560 C C   . SER A 1 202 ? -1.008  60.934 347.407 1.00 30.99  ? 203  SER A C   1 
ATOM   1561 O O   . SER A 1 202 ? -0.495  59.815 347.227 1.00 31.48  ? 203  SER A O   1 
ATOM   1562 C CB  . SER A 1 202 ? -2.716  62.766 346.765 1.00 36.75  ? 203  SER A CB  1 
ATOM   1563 O OG  . SER A 1 202 ? -1.734  63.631 347.312 1.00 69.13  ? 203  SER A OG  1 
ATOM   1564 N N   . ALA A 1 203 ? -0.593  61.740 348.391 1.00 30.37  ? 204  ALA A N   1 
ATOM   1565 C CA  . ALA A 1 203 ? 0.454   61.311 349.314 1.00 36.43  ? 204  ALA A CA  1 
ATOM   1566 C C   . ALA A 1 203 ? 0.069   60.034 350.050 1.00 36.45  ? 204  ALA A C   1 
ATOM   1567 O O   . ALA A 1 203 ? 0.947   59.255 350.440 1.00 33.14  ? 204  ALA A O   1 
ATOM   1568 C CB  . ALA A 1 203 ? 0.766   62.425 350.314 1.00 35.12  ? 204  ALA A CB  1 
ATOM   1569 N N   . GLY A 1 204 ? -1.228  59.802 350.254 1.00 30.03  ? 205  GLY A N   1 
ATOM   1570 C CA  . GLY A 1 204 ? -1.655  58.526 350.801 1.00 28.85  ? 205  GLY A CA  1 
ATOM   1571 C C   . GLY A 1 204 ? -1.372  57.377 349.853 1.00 36.18  ? 205  GLY A C   1 
ATOM   1572 O O   . GLY A 1 204 ? -0.946  56.300 350.276 1.00 33.92  ? 205  GLY A O   1 
ATOM   1573 N N   . ALA A 1 205 ? -1.596  57.596 348.555 1.00 32.03  ? 206  ALA A N   1 
ATOM   1574 C CA  . ALA A 1 205 ? -1.251  56.576 347.571 1.00 32.69  ? 206  ALA A CA  1 
ATOM   1575 C C   . ALA A 1 205 ? 0.255   56.355 347.520 1.00 40.12  ? 206  ALA A C   1 
ATOM   1576 O O   . ALA A 1 205 ? 0.719   55.210 347.457 1.00 31.62  ? 206  ALA A O   1 
ATOM   1577 C CB  . ALA A 1 205 ? -1.788  56.968 346.196 1.00 36.46  ? 206  ALA A CB  1 
ATOM   1578 N N   . ALA A 1 206 ? 1.034   57.439 347.559 1.00 28.87  ? 207  ALA A N   1 
ATOM   1579 C CA  . ALA A 1 206 ? 2.484   57.299 347.655 1.00 37.53  ? 207  ALA A CA  1 
ATOM   1580 C C   . ALA A 1 206 ? 2.881   56.555 348.926 1.00 42.80  ? 207  ALA A C   1 
ATOM   1581 O O   . ALA A 1 206 ? 3.802   55.730 348.908 1.00 39.19  ? 207  ALA A O   1 
ATOM   1582 C CB  . ALA A 1 206 ? 3.151   58.675 347.601 1.00 31.35  ? 207  ALA A CB  1 
ATOM   1583 N N   . SER A 1 207 ? 2.189   56.825 350.039 1.00 31.18  ? 208  SER A N   1 
ATOM   1584 C CA  . SER A 1 207 ? 2.467   56.096 351.273 1.00 32.74  ? 208  SER A CA  1 
ATOM   1585 C C   . SER A 1 207 ? 2.178   54.610 351.101 1.00 42.71  ? 208  SER A C   1 
ATOM   1586 O O   . SER A 1 207 ? 2.977   53.759 351.507 1.00 34.51  ? 208  SER A O   1 
ATOM   1587 C CB  . SER A 1 207 ? 1.644   56.671 352.429 1.00 32.55  ? 208  SER A CB  1 
ATOM   1588 O OG  . SER A 1 207 ? 2.032   58.000 352.735 1.00 36.30  ? 208  SER A OG  1 
ATOM   1589 N N   . VAL A 1 208 ? 1.032   54.281 350.495 1.00 29.23  ? 209  VAL A N   1 
ATOM   1590 C CA  . VAL A 1 208 ? 0.696   52.883 350.236 1.00 36.70  ? 209  VAL A CA  1 
ATOM   1591 C C   . VAL A 1 208 ? 1.814   52.200 349.456 1.00 47.32  ? 209  VAL A C   1 
ATOM   1592 O O   . VAL A 1 208 ? 2.212   51.070 349.769 1.00 41.70  ? 209  VAL A O   1 
ATOM   1593 C CB  . VAL A 1 208 ? -0.648  52.783 349.491 1.00 38.54  ? 209  VAL A CB  1 
ATOM   1594 C CG1 . VAL A 1 208 ? -0.920  51.342 349.090 1.00 37.40  ? 209  VAL A CG1 1 
ATOM   1595 C CG2 . VAL A 1 208 ? -1.781  53.317 350.352 1.00 35.73  ? 209  VAL A CG2 1 
ATOM   1596 N N   . GLY A 1 209 ? 2.343   52.880 348.437 1.00 36.44  ? 210  GLY A N   1 
ATOM   1597 C CA  . GLY A 1 209 ? 3.399   52.287 347.632 1.00 40.26  ? 210  GLY A CA  1 
ATOM   1598 C C   . GLY A 1 209 ? 4.678   52.049 348.413 1.00 38.55  ? 210  GLY A C   1 
ATOM   1599 O O   . GLY A 1 209 ? 5.347   51.030 348.227 1.00 41.88  ? 210  GLY A O   1 
ATOM   1600 N N   . MET A 1 210 ? 5.035   52.980 349.301 1.00 35.63  ? 211  MET A N   1 
ATOM   1601 C CA  . MET A 1 210 ? 6.247   52.800 350.095 1.00 43.63  ? 211  MET A CA  1 
ATOM   1602 C C   . MET A 1 210 ? 6.117   51.640 351.072 1.00 44.38  ? 211  MET A C   1 
ATOM   1603 O O   . MET A 1 210 ? 7.115   50.975 351.372 1.00 50.36  ? 211  MET A O   1 
ATOM   1604 C CB  . MET A 1 210 ? 6.591   54.089 350.837 1.00 37.70  ? 211  MET A CB  1 
ATOM   1605 C CG  . MET A 1 210 ? 6.938   55.228 349.903 1.00 44.18  ? 211  MET A CG  1 
ATOM   1606 S SD  . MET A 1 210 ? 7.115   56.799 350.752 1.00 55.13  ? 211  MET A SD  1 
ATOM   1607 C CE  . MET A 1 210 ? 7.108   57.930 349.362 1.00 49.99  ? 211  MET A CE  1 
ATOM   1608 N N   . HIS A 1 211 ? 4.908   51.384 351.580 1.00 39.66  ? 212  HIS A N   1 
ATOM   1609 C CA  . HIS A 1 211 ? 4.697   50.200 352.407 1.00 42.30  ? 212  HIS A CA  1 
ATOM   1610 C C   . HIS A 1 211 ? 4.862   48.920 351.595 1.00 46.36  ? 212  HIS A C   1 
ATOM   1611 O O   . HIS A 1 211 ? 5.345   47.911 352.122 1.00 41.76  ? 212  HIS A O   1 
ATOM   1612 C CB  . HIS A 1 211 ? 3.313   50.249 353.059 1.00 41.24  ? 212  HIS A CB  1 
ATOM   1613 C CG  . HIS A 1 211 ? 3.184   51.297 354.122 1.00 45.04  ? 212  HIS A CG  1 
ATOM   1614 N ND1 . HIS A 1 211 ? 3.915   51.266 355.290 1.00 41.38  ? 212  HIS A ND1 1 
ATOM   1615 C CD2 . HIS A 1 211 ? 2.413   52.408 354.191 1.00 31.69  ? 212  HIS A CD2 1 
ATOM   1616 C CE1 . HIS A 1 211 ? 3.601   52.314 356.032 1.00 36.96  ? 212  HIS A CE1 1 
ATOM   1617 N NE2 . HIS A 1 211 ? 2.692   53.022 355.387 1.00 38.63  ? 212  HIS A NE2 1 
ATOM   1618 N N   . LEU A 1 212 ? 4.475   48.945 350.316 1.00 41.05  ? 213  LEU A N   1 
ATOM   1619 C CA  . LEU A 1 212 ? 4.709   47.799 349.442 1.00 48.27  ? 213  LEU A CA  1 
ATOM   1620 C C   . LEU A 1 212 ? 6.197   47.515 349.293 1.00 44.65  ? 213  LEU A C   1 
ATOM   1621 O O   . LEU A 1 212 ? 6.611   46.355 349.197 1.00 48.93  ? 213  LEU A O   1 
ATOM   1622 C CB  . LEU A 1 212 ? 4.085   48.046 348.069 1.00 41.21  ? 213  LEU A CB  1 
ATOM   1623 C CG  . LEU A 1 212 ? 2.591   47.771 347.907 1.00 61.56  ? 213  LEU A CG  1 
ATOM   1624 C CD1 . LEU A 1 212 ? 2.094   48.333 346.585 1.00 42.77  ? 213  LEU A CD1 1 
ATOM   1625 C CD2 . LEU A 1 212 ? 2.306   46.278 348.002 1.00 51.11  ? 213  LEU A CD2 1 
ATOM   1626 N N   . LEU A 1 213 ? 7.013   48.564 349.271 1.00 44.62  ? 214  LEU A N   1 
ATOM   1627 C CA  . LEU A 1 213 ? 8.442   48.446 349.020 1.00 39.65  ? 214  LEU A CA  1 
ATOM   1628 C C   . LEU A 1 213 ? 9.262   48.310 350.296 1.00 47.70  ? 214  LEU A C   1 
ATOM   1629 O O   . LEU A 1 213 ? 10.481  48.124 350.214 1.00 50.69  ? 214  LEU A O   1 
ATOM   1630 C CB  . LEU A 1 213 ? 8.924   49.654 348.211 1.00 36.45  ? 214  LEU A CB  1 
ATOM   1631 C CG  . LEU A 1 213 ? 8.134   49.921 346.922 1.00 41.86  ? 214  LEU A CG  1 
ATOM   1632 C CD1 . LEU A 1 213 ? 8.552   51.227 346.268 1.00 39.50  ? 214  LEU A CD1 1 
ATOM   1633 C CD2 . LEU A 1 213 ? 8.293   48.764 345.951 1.00 37.67  ? 214  LEU A CD2 1 
ATOM   1634 N N   . SER A 1 214 ? 8.630   48.393 351.464 1.00 41.27  ? 215  SER A N   1 
ATOM   1635 C CA  . SER A 1 214 ? 9.331   48.270 352.737 1.00 43.56  ? 215  SER A CA  1 
ATOM   1636 C C   . SER A 1 214 ? 8.968   46.941 353.382 1.00 50.99  ? 215  SER A C   1 
ATOM   1637 O O   . SER A 1 214 ? 7.803   46.742 353.765 1.00 55.55  ? 215  SER A O   1 
ATOM   1638 C CB  . SER A 1 214 ? 8.975   49.433 353.664 1.00 42.44  ? 215  SER A CB  1 
ATOM   1639 O OG  . SER A 1 214 ? 9.816   49.452 354.801 1.00 55.71  ? 215  SER A OG  1 
ATOM   1640 N N   . PRO A 1 215 ? 9.912   46.013 353.517 1.00 60.87  ? 216  PRO A N   1 
ATOM   1641 C CA  . PRO A 1 215 ? 9.583   44.650 353.976 1.00 58.06  ? 216  PRO A CA  1 
ATOM   1642 C C   . PRO A 1 215 ? 8.884   44.620 355.329 1.00 54.86  ? 216  PRO A C   1 
ATOM   1643 O O   . PRO A 1 215 ? 7.943   43.830 355.502 1.00 50.98  ? 216  PRO A O   1 
ATOM   1644 C CB  . PRO A 1 215 ? 10.954  43.958 354.030 1.00 60.00  ? 216  PRO A CB  1 
ATOM   1645 C CG  . PRO A 1 215 ? 11.758  44.667 352.990 1.00 52.65  ? 216  PRO A CG  1 
ATOM   1646 C CD  . PRO A 1 215 ? 11.289  46.105 352.998 1.00 56.77  ? 216  PRO A CD  1 
ATOM   1647 N N   . PRO A 1 216 ? 9.294   45.427 356.322 1.00 40.50  ? 217  PRO A N   1 
ATOM   1648 C CA  . PRO A 1 216 ? 8.569   45.387 357.608 1.00 49.23  ? 217  PRO A CA  1 
ATOM   1649 C C   . PRO A 1 216 ? 7.112   45.805 357.502 1.00 52.74  ? 217  PRO A C   1 
ATOM   1650 O O   . PRO A 1 216 ? 6.313   45.432 358.370 1.00 59.19  ? 217  PRO A O   1 
ATOM   1651 C CB  . PRO A 1 216 ? 9.363   46.353 358.501 1.00 39.32  ? 217  PRO A CB  1 
ATOM   1652 C CG  . PRO A 1 216 ? 10.707  46.414 357.891 1.00 45.94  ? 217  PRO A CG  1 
ATOM   1653 C CD  . PRO A 1 216 ? 10.464  46.325 356.417 1.00 46.48  ? 217  PRO A CD  1 
ATOM   1654 N N   . SER A 1 217 ? 6.738   46.565 356.473 1.00 48.98  ? 218  SER A N   1 
ATOM   1655 C CA  . SER A 1 217 ? 5.344   46.933 356.260 1.00 46.65  ? 218  SER A CA  1 
ATOM   1656 C C   . SER A 1 217 ? 4.611   45.946 355.363 1.00 48.46  ? 218  SER A C   1 
ATOM   1657 O O   . SER A 1 217 ? 3.398   45.758 355.521 1.00 46.25  ? 218  SER A O   1 
ATOM   1658 C CB  . SER A 1 217 ? 5.258   48.330 355.640 1.00 39.26  ? 218  SER A CB  1 
ATOM   1659 O OG  . SER A 1 217 ? 5.285   49.338 356.634 1.00 52.13  ? 218  SER A OG  1 
ATOM   1660 N N   . ARG A 1 218 ? 5.329   45.308 354.434 1.00 57.57  ? 219  ARG A N   1 
ATOM   1661 C CA  . ARG A 1 218 ? 4.690   44.468 353.425 1.00 56.02  ? 219  ARG A CA  1 
ATOM   1662 C C   . ARG A 1 218 ? 3.934   43.301 354.049 1.00 49.84  ? 219  ARG A C   1 
ATOM   1663 O O   . ARG A 1 218 ? 2.911   42.864 353.508 1.00 53.12  ? 219  ARG A O   1 
ATOM   1664 C CB  . ARG A 1 218 ? 5.742   43.962 352.434 1.00 52.72  ? 219  ARG A CB  1 
ATOM   1665 C CG  . ARG A 1 218 ? 5.198   43.091 351.315 1.00 60.33  ? 219  ARG A CG  1 
ATOM   1666 C CD  . ARG A 1 218 ? 4.141   43.821 350.506 1.00 59.28  ? 219  ARG A CD  1 
ATOM   1667 N NE  . ARG A 1 218 ? 3.585   42.975 349.455 1.00 66.49  ? 219  ARG A NE  1 
ATOM   1668 C CZ  . ARG A 1 218 ? 2.545   42.165 349.623 1.00 63.57  ? 219  ARG A CZ  1 
ATOM   1669 N NH1 . ARG A 1 218 ? 1.946   42.090 350.803 1.00 67.00  ? 219  ARG A NH1 1 
ATOM   1670 N NH2 . ARG A 1 218 ? 2.105   41.428 348.613 1.00 69.63  ? 219  ARG A NH2 1 
ATOM   1671 N N   . GLY A 1 219 ? 4.409   42.789 355.180 1.00 47.41  ? 220  GLY A N   1 
ATOM   1672 C CA  . GLY A 1 219 ? 3.724   41.697 355.839 1.00 50.32  ? 220  GLY A CA  1 
ATOM   1673 C C   . GLY A 1 219 ? 2.455   42.065 356.574 1.00 55.55  ? 220  GLY A C   1 
ATOM   1674 O O   . GLY A 1 219 ? 1.785   41.178 357.108 1.00 49.21  ? 220  GLY A O   1 
ATOM   1675 N N   . LEU A 1 220 ? 2.094   43.346 356.611 1.00 46.51  ? 221  LEU A N   1 
ATOM   1676 C CA  . LEU A 1 220 ? 0.940   43.811 357.367 1.00 47.58  ? 221  LEU A CA  1 
ATOM   1677 C C   . LEU A 1 220 ? -0.315  43.954 356.515 1.00 57.62  ? 221  LEU A C   1 
ATOM   1678 O O   . LEU A 1 220 ? -1.377  44.280 357.053 1.00 48.61  ? 221  LEU A O   1 
ATOM   1679 C CB  . LEU A 1 220 ? 1.263   45.149 358.041 1.00 52.39  ? 221  LEU A CB  1 
ATOM   1680 C CG  . LEU A 1 220 ? 2.526   45.154 358.907 1.00 51.04  ? 221  LEU A CG  1 
ATOM   1681 C CD1 . LEU A 1 220 ? 2.815   46.541 359.467 1.00 34.21  ? 221  LEU A CD1 1 
ATOM   1682 C CD2 . LEU A 1 220 ? 2.405   44.132 360.025 1.00 44.36  ? 221  LEU A CD2 1 
ATOM   1683 N N   . PHE A 1 221 ? -0.225  43.723 355.208 1.00 49.88  ? 222  PHE A N   1 
ATOM   1684 C CA  . PHE A 1 221 ? -1.391  43.816 354.343 1.00 43.95  ? 222  PHE A CA  1 
ATOM   1685 C C   . PHE A 1 221 ? -1.201  42.878 353.160 1.00 48.00  ? 222  PHE A C   1 
ATOM   1686 O O   . PHE A 1 221 ? -0.147  42.260 352.992 1.00 48.96  ? 222  PHE A O   1 
ATOM   1687 C CB  . PHE A 1 221 ? -1.638  45.259 353.887 1.00 47.71  ? 222  PHE A CB  1 
ATOM   1688 C CG  . PHE A 1 221 ? -0.514  45.847 353.084 1.00 44.17  ? 222  PHE A CG  1 
ATOM   1689 C CD1 . PHE A 1 221 ? 0.624   46.333 353.709 1.00 42.39  ? 222  PHE A CD1 1 
ATOM   1690 C CD2 . PHE A 1 221 ? -0.600  45.926 351.704 1.00 42.91  ? 222  PHE A CD2 1 
ATOM   1691 C CE1 . PHE A 1 221 ? 1.658   46.878 352.971 1.00 42.69  ? 222  PHE A CE1 1 
ATOM   1692 C CE2 . PHE A 1 221 ? 0.430   46.470 350.963 1.00 42.59  ? 222  PHE A CE2 1 
ATOM   1693 C CZ  . PHE A 1 221 ? 1.560   46.947 351.596 1.00 38.82  ? 222  PHE A CZ  1 
ATOM   1694 N N   . HIS A 1 222 ? -2.241  42.778 352.333 1.00 42.17  ? 223  HIS A N   1 
ATOM   1695 C CA  . HIS A 1 222 ? -2.236  41.797 351.255 1.00 55.22  ? 223  HIS A CA  1 
ATOM   1696 C C   . HIS A 1 222 ? -2.525  42.423 349.896 1.00 45.92  ? 223  HIS A C   1 
ATOM   1697 O O   . HIS A 1 222 ? -2.111  41.885 348.865 1.00 55.56  ? 223  HIS A O   1 
ATOM   1698 C CB  . HIS A 1 222 ? -3.246  40.690 351.559 1.00 54.63  ? 223  HIS A CB  1 
ATOM   1699 C CG  . HIS A 1 222 ? -3.137  40.146 352.949 1.00 66.18  ? 223  HIS A CG  1 
ATOM   1700 N ND1 . HIS A 1 222 ? -3.654  40.799 354.047 1.00 59.12  ? 223  HIS A ND1 1 
ATOM   1701 C CD2 . HIS A 1 222 ? -2.551  39.021 353.423 1.00 60.00  ? 223  HIS A CD2 1 
ATOM   1702 C CE1 . HIS A 1 222 ? -3.398  40.097 355.136 1.00 53.45  ? 223  HIS A CE1 1 
ATOM   1703 N NE2 . HIS A 1 222 ? -2.732  39.012 354.784 1.00 64.10  ? 223  HIS A NE2 1 
ATOM   1704 N N   . ARG A 1 223 ? -3.231  43.552 349.880 1.00 47.60  ? 224  ARG A N   1 
ATOM   1705 C CA  . ARG A 1 223 ? -3.604  44.209 348.637 1.00 43.72  ? 224  ARG A CA  1 
ATOM   1706 C C   . ARG A 1 223 ? -3.449  45.713 348.797 1.00 43.66  ? 224  ARG A C   1 
ATOM   1707 O O   . ARG A 1 223 ? -3.432  46.240 349.911 1.00 40.65  ? 224  ARG A O   1 
ATOM   1708 C CB  . ARG A 1 223 ? -5.040  43.863 348.229 1.00 37.96  ? 224  ARG A CB  1 
ATOM   1709 C CG  . ARG A 1 223 ? -5.170  42.481 347.654 1.00 48.85  ? 224  ARG A CG  1 
ATOM   1710 C CD  . ARG A 1 223 ? -6.557  42.238 347.091 1.00 53.51  ? 224  ARG A CD  1 
ATOM   1711 N NE  . ARG A 1 223 ? -7.509  41.717 348.073 1.00 55.05  ? 224  ARG A NE  1 
ATOM   1712 C CZ  . ARG A 1 223 ? -7.328  40.635 348.829 1.00 70.25  ? 224  ARG A CZ  1 
ATOM   1713 N NH1 . ARG A 1 223 ? -6.224  39.904 348.734 1.00 69.65  ? 224  ARG A NH1 1 
ATOM   1714 N NH2 . ARG A 1 223 ? -8.273  40.269 349.685 1.00 75.98  ? 224  ARG A NH2 1 
ATOM   1715 N N   . ALA A 1 224 ? -3.348  46.402 347.662 1.00 37.80  ? 225  ALA A N   1 
ATOM   1716 C CA  . ALA A 1 224 ? -3.084  47.832 347.657 1.00 42.10  ? 225  ALA A CA  1 
ATOM   1717 C C   . ALA A 1 224 ? -3.927  48.513 346.591 1.00 40.63  ? 225  ALA A C   1 
ATOM   1718 O O   . ALA A 1 224 ? -4.233  47.930 345.548 1.00 41.64  ? 225  ALA A O   1 
ATOM   1719 C CB  . ALA A 1 224 ? -1.596  48.124 347.419 1.00 43.06  ? 225  ALA A CB  1 
ATOM   1720 N N   . VAL A 1 225 ? -4.310  49.756 346.876 1.00 36.86  ? 226  VAL A N   1 
ATOM   1721 C CA  . VAL A 1 225 ? -5.020  50.619 345.937 1.00 33.87  ? 226  VAL A CA  1 
ATOM   1722 C C   . VAL A 1 225 ? -4.357  51.987 345.987 1.00 36.03  ? 226  VAL A C   1 
ATOM   1723 O O   . VAL A 1 225 ? -4.305  52.615 347.051 1.00 41.99  ? 226  VAL A O   1 
ATOM   1724 C CB  . VAL A 1 225 ? -6.518  50.736 346.265 1.00 35.69  ? 226  VAL A CB  1 
ATOM   1725 C CG1 . VAL A 1 225 ? -7.209  51.691 345.296 1.00 36.15  ? 226  VAL A CG1 1 
ATOM   1726 C CG2 . VAL A 1 225 ? -7.188  49.372 346.267 1.00 37.48  ? 226  VAL A CG2 1 
ATOM   1727 N N   . LEU A 1 226 ? -3.845  52.447 344.848 1.00 34.53  ? 227  LEU A N   1 
ATOM   1728 C CA  . LEU A 1 226 ? -3.138  53.721 344.756 1.00 37.57  ? 227  LEU A CA  1 
ATOM   1729 C C   . LEU A 1 226 ? -3.935  54.645 343.846 1.00 39.97  ? 227  LEU A C   1 
ATOM   1730 O O   . LEU A 1 226 ? -4.008  54.416 342.634 1.00 44.48  ? 227  LEU A O   1 
ATOM   1731 C CB  . LEU A 1 226 ? -1.716  53.527 344.232 1.00 31.98  ? 227  LEU A CB  1 
ATOM   1732 C CG  . LEU A 1 226 ? -0.732  52.757 345.117 1.00 39.82  ? 227  LEU A CG  1 
ATOM   1733 C CD1 . LEU A 1 226 ? -0.860  51.254 344.908 1.00 35.51  ? 227  LEU A CD1 1 
ATOM   1734 C CD2 . LEU A 1 226 ? 0.692   53.213 344.846 1.00 40.94  ? 227  LEU A CD2 1 
ATOM   1735 N N   . GLN A 1 227 ? -4.525  55.687 344.423 1.00 30.68  ? 228  GLN A N   1 
ATOM   1736 C CA  . GLN A 1 227 ? -5.366  56.629 343.691 1.00 39.16  ? 228  GLN A CA  1 
ATOM   1737 C C   . GLN A 1 227 ? -4.606  57.940 343.522 1.00 33.66  ? 228  GLN A C   1 
ATOM   1738 O O   . GLN A 1 227 ? -4.319  58.626 344.509 1.00 39.14  ? 228  GLN A O   1 
ATOM   1739 C CB  . GLN A 1 227 ? -6.689  56.854 344.422 1.00 36.49  ? 228  GLN A CB  1 
ATOM   1740 C CG  . GLN A 1 227 ? -7.421  55.573 344.802 1.00 39.67  ? 228  GLN A CG  1 
ATOM   1741 C CD  . GLN A 1 227 ? -8.652  55.827 345.659 1.00 59.78  ? 228  GLN A CD  1 
ATOM   1742 O OE1 . GLN A 1 227 ? -9.178  54.911 346.292 1.00 37.49  ? 228  GLN A OE1 1 
ATOM   1743 N NE2 . GLN A 1 227 ? -9.116  57.074 345.683 1.00 48.31  ? 228  GLN A NE2 1 
ATOM   1744 N N   . SER A 1 228 ? -4.278  58.281 342.274 1.00 36.62  ? 229  SER A N   1 
ATOM   1745 C CA  . SER A 1 228 ? -3.687  59.581 341.936 1.00 32.49  ? 229  SER A CA  1 
ATOM   1746 C C   . SER A 1 228 ? -2.381  59.828 342.692 1.00 34.16  ? 229  SER A C   1 
ATOM   1747 O O   . SER A 1 228 ? -2.112  60.938 343.157 1.00 35.45  ? 229  SER A O   1 
ATOM   1748 C CB  . SER A 1 228 ? -4.678  60.717 342.199 1.00 36.31  ? 229  SER A CB  1 
ATOM   1749 O OG  . SER A 1 228 ? -5.854  60.558 341.428 1.00 41.33  ? 229  SER A OG  1 
ATOM   1750 N N   . GLY A 1 229 ? -1.566  58.789 342.831 1.00 28.41  ? 230  GLY A N   1 
ATOM   1751 C CA  . GLY A 1 229 ? -0.313  58.941 343.544 1.00 27.48  ? 230  GLY A CA  1 
ATOM   1752 C C   . GLY A 1 229 ? 0.554   57.706 343.456 1.00 34.98  ? 230  GLY A C   1 
ATOM   1753 O O   . GLY A 1 229 ? 0.047   56.597 343.267 1.00 35.15  ? 230  GLY A O   1 
ATOM   1754 N N   . ALA A 1 230 ? 1.864   57.888 343.594 1.00 31.79  ? 231  ALA A N   1 
ATOM   1755 C CA  . ALA A 1 230 ? 2.818   56.800 343.461 1.00 32.99  ? 231  ALA A CA  1 
ATOM   1756 C C   . ALA A 1 230 ? 4.058   57.150 344.262 1.00 31.37  ? 231  ALA A C   1 
ATOM   1757 O O   . ALA A 1 230 ? 4.404   58.331 344.377 1.00 34.52  ? 231  ALA A O   1 
ATOM   1758 C CB  . ALA A 1 230 ? 3.188   56.550 341.991 1.00 37.00  ? 231  ALA A CB  1 
ATOM   1759 N N   . PRO A 1 231 ? 4.743   56.155 344.833 1.00 37.15  ? 232  PRO A N   1 
ATOM   1760 C CA  . PRO A 1 231 ? 5.953   56.455 345.614 1.00 42.09  ? 232  PRO A CA  1 
ATOM   1761 C C   . PRO A 1 231 ? 7.120   56.932 344.770 1.00 41.54  ? 232  PRO A C   1 
ATOM   1762 O O   . PRO A 1 231 ? 8.020   57.588 345.309 1.00 38.19  ? 232  PRO A O   1 
ATOM   1763 C CB  . PRO A 1 231 ? 6.270   55.117 346.293 1.00 32.51  ? 232  PRO A CB  1 
ATOM   1764 C CG  . PRO A 1 231 ? 5.700   54.097 345.367 1.00 39.27  ? 232  PRO A CG  1 
ATOM   1765 C CD  . PRO A 1 231 ? 4.440   54.715 344.815 1.00 37.05  ? 232  PRO A CD  1 
ATOM   1766 N N   . ASN A 1 232 ? 7.134   56.625 343.473 1.00 41.20  ? 233  ASN A N   1 
ATOM   1767 C CA  . ASN A 1 232 ? 8.212   57.017 342.575 1.00 40.13  ? 233  ASN A CA  1 
ATOM   1768 C C   . ASN A 1 232 ? 8.017   58.410 341.984 1.00 48.76  ? 233  ASN A C   1 
ATOM   1769 O O   . ASN A 1 232 ? 8.720   58.773 341.036 1.00 40.70  ? 233  ASN A O   1 
ATOM   1770 C CB  . ASN A 1 232 ? 8.360   55.989 341.446 1.00 34.36  ? 233  ASN A CB  1 
ATOM   1771 C CG  . ASN A 1 232 ? 7.028   55.593 340.836 1.00 36.69  ? 233  ASN A CG  1 
ATOM   1772 O OD1 . ASN A 1 232 ? 6.096   55.214 341.544 1.00 42.50  ? 233  ASN A OD1 1 
ATOM   1773 N ND2 . ASN A 1 232 ? 6.933   55.678 339.513 1.00 36.10  ? 233  ASN A ND2 1 
ATOM   1774 N N   . GLY A 1 233 ? 7.088   59.196 342.519 1.00 42.66  ? 234  GLY A N   1 
ATOM   1775 C CA  . GLY A 1 233 ? 6.881   60.547 342.058 1.00 44.51  ? 234  GLY A CA  1 
ATOM   1776 C C   . GLY A 1 233 ? 8.006   61.485 342.454 1.00 52.63  ? 234  GLY A C   1 
ATOM   1777 O O   . GLY A 1 233 ? 8.607   61.357 343.526 1.00 57.17  ? 234  GLY A O   1 
ATOM   1778 N N   . PRO A 1 234 ? 8.301   62.463 341.591 1.00 45.12  ? 235  PRO A N   1 
ATOM   1779 C CA  . PRO A 1 234 ? 9.383   63.420 341.891 1.00 40.01  ? 235  PRO A CA  1 
ATOM   1780 C C   . PRO A 1 234 ? 9.128   64.271 343.126 1.00 34.55  ? 235  PRO A C   1 
ATOM   1781 O O   . PRO A 1 234 ? 10.047  64.967 343.578 1.00 42.96  ? 235  PRO A O   1 
ATOM   1782 C CB  . PRO A 1 234 ? 9.443   64.288 340.626 1.00 34.52  ? 235  PRO A CB  1 
ATOM   1783 C CG  . PRO A 1 234 ? 8.077   64.155 340.019 1.00 36.28  ? 235  PRO A CG  1 
ATOM   1784 C CD  . PRO A 1 234 ? 7.652   62.747 340.301 1.00 32.72  ? 235  PRO A CD  1 
ATOM   1785 N N   . TRP A 1 235 ? 7.916   64.235 343.679 1.00 36.96  ? 236  TRP A N   1 
ATOM   1786 C CA  . TRP A 1 235 ? 7.563   64.977 344.882 1.00 36.39  ? 236  TRP A CA  1 
ATOM   1787 C C   . TRP A 1 235 ? 7.497   64.104 346.127 1.00 34.03  ? 236  TRP A C   1 
ATOM   1788 O O   . TRP A 1 235 ? 7.525   64.638 347.241 1.00 36.97  ? 236  TRP A O   1 
ATOM   1789 C CB  . TRP A 1 235 ? 6.200   65.651 344.692 1.00 28.23  ? 236  TRP A CB  1 
ATOM   1790 C CG  . TRP A 1 235 ? 5.149   64.656 344.288 1.00 35.93  ? 236  TRP A CG  1 
ATOM   1791 C CD1 . TRP A 1 235 ? 4.833   64.269 343.018 1.00 34.23  ? 236  TRP A CD1 1 
ATOM   1792 C CD2 . TRP A 1 235 ? 4.311   63.885 345.162 1.00 31.93  ? 236  TRP A CD2 1 
ATOM   1793 N NE1 . TRP A 1 235 ? 3.836   63.324 343.046 1.00 35.00  ? 236  TRP A NE1 1 
ATOM   1794 C CE2 . TRP A 1 235 ? 3.500   63.069 344.349 1.00 35.59  ? 236  TRP A CE2 1 
ATOM   1795 C CE3 . TRP A 1 235 ? 4.161   63.816 346.552 1.00 34.54  ? 236  TRP A CE3 1 
ATOM   1796 C CZ2 . TRP A 1 235 ? 2.551   62.195 344.878 1.00 31.89  ? 236  TRP A CZ2 1 
ATOM   1797 C CZ3 . TRP A 1 235 ? 3.219   62.948 347.076 1.00 35.84  ? 236  TRP A CZ3 1 
ATOM   1798 C CH2 . TRP A 1 235 ? 2.426   62.149 346.240 1.00 40.79  ? 236  TRP A CH2 1 
ATOM   1799 N N   . ALA A 1 236 ? 7.412   62.782 345.959 1.00 35.72  ? 237  ALA A N   1 
ATOM   1800 C CA  . ALA A 1 236 ? 7.095   61.888 347.067 1.00 31.11  ? 237  ALA A CA  1 
ATOM   1801 C C   . ALA A 1 236 ? 8.292   61.611 347.969 1.00 37.26  ? 237  ALA A C   1 
ATOM   1802 O O   . ALA A 1 236 ? 8.109   61.314 349.154 1.00 46.05  ? 237  ALA A O   1 
ATOM   1803 C CB  . ALA A 1 236 ? 6.535   60.571 346.528 1.00 31.07  ? 237  ALA A CB  1 
ATOM   1804 N N   . THR A 1 237 ? 9.511   61.685 347.443 1.00 30.37  ? 238  THR A N   1 
ATOM   1805 C CA  . THR A 1 237 ? 10.701  61.436 348.243 1.00 37.41  ? 238  THR A CA  1 
ATOM   1806 C C   . THR A 1 237 ? 11.722  62.539 348.012 1.00 37.72  ? 238  THR A C   1 
ATOM   1807 O O   . THR A 1 237 ? 11.595  63.363 347.103 1.00 44.96  ? 238  THR A O   1 
ATOM   1808 C CB  . THR A 1 237 ? 11.337  60.072 347.928 1.00 38.90  ? 238  THR A CB  1 
ATOM   1809 O OG1 . THR A 1 237 ? 11.662  59.999 346.532 1.00 46.60  ? 238  THR A OG1 1 
ATOM   1810 C CG2 . THR A 1 237 ? 10.401  58.929 348.300 1.00 36.95  ? 238  THR A CG2 1 
ATOM   1811 N N   . VAL A 1 238 ? 12.757  62.526 348.847 1.00 40.70  ? 239  VAL A N   1 
ATOM   1812 C CA  . VAL A 1 238 ? 13.837  63.498 348.769 1.00 32.67  ? 239  VAL A CA  1 
ATOM   1813 C C   . VAL A 1 238 ? 15.126  62.789 349.164 1.00 44.19  ? 239  VAL A C   1 
ATOM   1814 O O   . VAL A 1 238 ? 15.104  61.780 349.876 1.00 43.77  ? 239  VAL A O   1 
ATOM   1815 C CB  . VAL A 1 238 ? 13.538  64.725 349.664 1.00 36.59  ? 239  VAL A CB  1 
ATOM   1816 C CG1 . VAL A 1 238 ? 13.796  64.401 351.137 1.00 39.11  ? 239  VAL A CG1 1 
ATOM   1817 C CG2 . VAL A 1 238 ? 14.331  65.934 349.212 1.00 37.98  ? 239  VAL A CG2 1 
ATOM   1818 N N   . GLY A 1 239 ? 16.252  63.299 348.667 1.00 40.34  ? 240  GLY A N   1 
ATOM   1819 C CA  . GLY A 1 239 ? 17.535  62.738 349.035 1.00 40.09  ? 240  GLY A CA  1 
ATOM   1820 C C   . GLY A 1 239 ? 17.964  63.148 350.433 1.00 46.81  ? 240  GLY A C   1 
ATOM   1821 O O   . GLY A 1 239 ? 17.479  64.124 351.005 1.00 36.81  ? 240  GLY A O   1 
ATOM   1822 N N   . MET A 1 240 ? 18.902  62.375 350.988 1.00 40.28  ? 241  MET A N   1 
ATOM   1823 C CA  . MET A 1 240 ? 19.380  62.640 352.344 1.00 47.36  ? 241  MET A CA  1 
ATOM   1824 C C   . MET A 1 240 ? 20.009  64.023 352.453 1.00 44.10  ? 241  MET A C   1 
ATOM   1825 O O   . MET A 1 240 ? 19.838  64.713 353.466 1.00 42.85  ? 241  MET A O   1 
ATOM   1826 C CB  . MET A 1 240 ? 20.385  61.569 352.766 1.00 45.71  ? 241  MET A CB  1 
ATOM   1827 C CG  . MET A 1 240 ? 19.759  60.285 353.267 1.00 52.26  ? 241  MET A CG  1 
ATOM   1828 S SD  . MET A 1 240 ? 20.996  59.079 353.781 1.00 62.33  ? 241  MET A SD  1 
ATOM   1829 C CE  . MET A 1 240 ? 21.688  58.600 352.204 1.00 59.89  ? 241  MET A CE  1 
ATOM   1830 N N   . GLY A 1 241 ? 20.739  64.446 351.421 1.00 37.89  ? 242  GLY A N   1 
ATOM   1831 C CA  . GLY A 1 241 ? 21.402  65.738 351.479 1.00 36.28  ? 242  GLY A CA  1 
ATOM   1832 C C   . GLY A 1 241 ? 20.434  66.901 351.392 1.00 44.24  ? 242  GLY A C   1 
ATOM   1833 O O   . GLY A 1 241 ? 20.583  67.899 352.104 1.00 47.07  ? 242  GLY A O   1 
ATOM   1834 N N   . GLU A 1 242 ? 19.433  66.797 350.516 1.00 45.56  ? 243  GLU A N   1 
ATOM   1835 C CA  . GLU A 1 242 ? 18.438  67.858 350.425 1.00 43.42  ? 243  GLU A CA  1 
ATOM   1836 C C   . GLU A 1 242 ? 17.531  67.872 351.650 1.00 41.49  ? 243  GLU A C   1 
ATOM   1837 O O   . GLU A 1 242 ? 17.103  68.945 352.088 1.00 41.53  ? 243  GLU A O   1 
ATOM   1838 C CB  . GLU A 1 242 ? 17.626  67.706 349.137 1.00 38.58  ? 243  GLU A CB  1 
ATOM   1839 C CG  . GLU A 1 242 ? 16.530  68.747 348.945 1.00 39.13  ? 243  GLU A CG  1 
ATOM   1840 C CD  . GLU A 1 242 ? 17.064  70.148 348.710 1.00 49.64  ? 243  GLU A CD  1 
ATOM   1841 O OE1 . GLU A 1 242 ? 18.274  70.297 348.434 1.00 63.85  ? 243  GLU A OE1 1 
ATOM   1842 O OE2 . GLU A 1 242 ? 16.262  71.103 348.796 1.00 50.55  ? 243  GLU A OE2 1 
ATOM   1843 N N   . ALA A 1 243 ? 17.244  66.699 352.223 1.00 33.87  ? 244  ALA A N   1 
ATOM   1844 C CA  . ALA A 1 243 ? 16.478  66.648 353.465 1.00 46.33  ? 244  ALA A CA  1 
ATOM   1845 C C   . ALA A 1 243 ? 17.201  67.380 354.588 1.00 41.71  ? 244  ALA A C   1 
ATOM   1846 O O   . ALA A 1 243 ? 16.583  68.135 355.348 1.00 43.31  ? 244  ALA A O   1 
ATOM   1847 C CB  . ALA A 1 243 ? 16.210  65.195 353.862 1.00 37.64  ? 244  ALA A CB  1 
ATOM   1848 N N   . ARG A 1 244 ? 18.515  67.171 354.704 1.00 46.75  ? 245  ARG A N   1 
ATOM   1849 C CA  . ARG A 1 244 ? 19.287  67.846 355.741 1.00 43.00  ? 245  ARG A CA  1 
ATOM   1850 C C   . ARG A 1 244 ? 19.349  69.348 355.493 1.00 42.17  ? 245  ARG A C   1 
ATOM   1851 O O   . ARG A 1 244 ? 19.292  70.142 356.439 1.00 45.23  ? 245  ARG A O   1 
ATOM   1852 C CB  . ARG A 1 244 ? 20.693  67.247 355.814 1.00 48.64  ? 245  ARG A CB  1 
ATOM   1853 C CG  . ARG A 1 244 ? 21.655  67.997 356.720 1.00 46.23  ? 245  ARG A CG  1 
ATOM   1854 C CD  . ARG A 1 244 ? 22.895  67.165 357.020 1.00 43.92  ? 245  ARG A CD  1 
ATOM   1855 N NE  . ARG A 1 244 ? 22.599  66.000 357.850 1.00 44.57  ? 245  ARG A NE  1 
ATOM   1856 C CZ  . ARG A 1 244 ? 22.553  66.018 359.180 1.00 45.31  ? 245  ARG A CZ  1 
ATOM   1857 N NH1 . ARG A 1 244 ? 22.778  67.144 359.843 1.00 33.73  ? 245  ARG A NH1 1 
ATOM   1858 N NH2 . ARG A 1 244 ? 22.279  64.905 359.848 1.00 35.99  ? 245  ARG A NH2 1 
ATOM   1859 N N   . ARG A 1 245 ? 19.458  69.757 354.227 1.00 36.08  ? 246  ARG A N   1 
ATOM   1860 C CA  . ARG A 1 245 ? 19.508  71.181 353.913 1.00 43.41  ? 246  ARG A CA  1 
ATOM   1861 C C   . ARG A 1 245 ? 18.213  71.882 354.310 1.00 44.05  ? 246  ARG A C   1 
ATOM   1862 O O   . ARG A 1 245 ? 18.243  72.976 354.887 1.00 44.07  ? 246  ARG A O   1 
ATOM   1863 C CB  . ARG A 1 245 ? 19.790  71.381 352.423 1.00 39.04  ? 246  ARG A CB  1 
ATOM   1864 C CG  . ARG A 1 245 ? 20.042  72.830 352.041 1.00 43.63  ? 246  ARG A CG  1 
ATOM   1865 C CD  . ARG A 1 245 ? 19.897  73.055 350.545 1.00 49.44  ? 246  ARG A CD  1 
ATOM   1866 N NE  . ARG A 1 245 ? 18.526  72.860 350.082 1.00 52.87  ? 246  ARG A NE  1 
ATOM   1867 C CZ  . ARG A 1 245 ? 17.542  73.737 350.257 1.00 52.91  ? 246  ARG A CZ  1 
ATOM   1868 N NH1 . ARG A 1 245 ? 17.768  74.880 350.895 1.00 43.32  ? 246  ARG A NH1 1 
ATOM   1869 N NH2 . ARG A 1 245 ? 16.327  73.470 349.796 1.00 41.13  ? 246  ARG A NH2 1 
ATOM   1870 N N   . ARG A 1 246 ? 17.066  71.265 354.012 1.00 44.78  ? 247  ARG A N   1 
ATOM   1871 C CA  . ARG A 1 246 ? 15.784  71.878 354.347 1.00 40.24  ? 247  ARG A CA  1 
ATOM   1872 C C   . ARG A 1 246 ? 15.556  71.909 355.855 1.00 45.89  ? 247  ARG A C   1 
ATOM   1873 O O   . ARG A 1 246 ? 15.029  72.893 356.388 1.00 43.69  ? 247  ARG A O   1 
ATOM   1874 C CB  . ARG A 1 246 ? 14.649  71.132 353.648 1.00 36.66  ? 247  ARG A CB  1 
ATOM   1875 C CG  . ARG A 1 246 ? 14.729  71.169 352.127 1.00 44.46  ? 247  ARG A CG  1 
ATOM   1876 C CD  . ARG A 1 246 ? 13.590  70.382 351.506 1.00 33.10  ? 247  ARG A CD  1 
ATOM   1877 N NE  . ARG A 1 246 ? 13.651  70.376 350.049 1.00 42.54  ? 247  ARG A NE  1 
ATOM   1878 C CZ  . ARG A 1 246 ? 12.761  69.769 349.272 1.00 38.77  ? 247  ARG A CZ  1 
ATOM   1879 N NH1 . ARG A 1 246 ? 11.736  69.125 349.815 1.00 34.54  ? 247  ARG A NH1 1 
ATOM   1880 N NH2 . ARG A 1 246 ? 12.893  69.807 347.953 1.00 46.30  ? 247  ARG A NH2 1 
ATOM   1881 N N   . ALA A 1 247 ? 15.939  70.841 356.560 1.00 36.56  ? 248  ALA A N   1 
ATOM   1882 C CA  . ALA A 1 247 ? 15.813  70.837 358.015 1.00 42.16  ? 248  ALA A CA  1 
ATOM   1883 C C   . ALA A 1 247 ? 16.722  71.882 358.648 1.00 44.93  ? 248  ALA A C   1 
ATOM   1884 O O   . ALA A 1 247 ? 16.320  72.576 359.589 1.00 47.59  ? 248  ALA A O   1 
ATOM   1885 C CB  . ALA A 1 247 ? 16.128  69.447 358.568 1.00 29.24  ? 248  ALA A CB  1 
ATOM   1886 N N   . THR A 1 248 ? 17.948  72.014 358.139 1.00 52.83  ? 249  THR A N   1 
ATOM   1887 C CA  . THR A 1 248 ? 18.881  72.990 358.691 1.00 45.14  ? 249  THR A CA  1 
ATOM   1888 C C   . THR A 1 248 ? 18.412  74.414 358.424 1.00 48.10  ? 249  THR A C   1 
ATOM   1889 O O   . THR A 1 248 ? 18.508  75.279 359.303 1.00 48.85  ? 249  THR A O   1 
ATOM   1890 C CB  . THR A 1 248 ? 20.277  72.764 358.108 1.00 52.18  ? 249  THR A CB  1 
ATOM   1891 O OG1 . THR A 1 248 ? 20.776  71.494 358.547 1.00 49.39  ? 249  THR A OG1 1 
ATOM   1892 C CG2 . THR A 1 248 ? 21.232  73.860 358.551 1.00 43.07  ? 249  THR A CG2 1 
ATOM   1893 N N   . GLN A 1 249 ? 17.900  74.678 357.218 1.00 46.26  ? 250  GLN A N   1 
ATOM   1894 C CA  . GLN A 1 249 ? 17.415  76.018 356.909 1.00 47.69  ? 250  GLN A CA  1 
ATOM   1895 C C   . GLN A 1 249 ? 16.162  76.354 357.706 1.00 47.07  ? 250  GLN A C   1 
ATOM   1896 O O   . GLN A 1 249 ? 15.966  77.509 358.101 1.00 50.70  ? 250  GLN A O   1 
ATOM   1897 C CB  . GLN A 1 249 ? 17.147  76.164 355.413 1.00 37.27  ? 250  GLN A CB  1 
ATOM   1898 C CG  . GLN A 1 249 ? 17.403  77.573 354.899 1.00 54.38  ? 250  GLN A CG  1 
ATOM   1899 C CD  . GLN A 1 249 ? 16.459  77.976 353.782 1.00 77.90  ? 250  GLN A CD  1 
ATOM   1900 O OE1 . GLN A 1 249 ? 16.004  77.136 353.004 1.00 76.62  ? 250  GLN A OE1 1 
ATOM   1901 N NE2 . GLN A 1 249 ? 16.166  79.268 353.691 1.00 69.64  ? 250  GLN A NE2 1 
ATOM   1902 N N   . LEU A 1 250 ? 15.296  75.364 357.940 1.00 43.26  ? 251  LEU A N   1 
ATOM   1903 C CA  . LEU A 1 250 ? 14.119  75.606 358.768 1.00 48.92  ? 251  LEU A CA  1 
ATOM   1904 C C   . LEU A 1 250 ? 14.523  75.975 360.188 1.00 56.14  ? 251  LEU A C   1 
ATOM   1905 O O   . LEU A 1 250 ? 13.980  76.921 360.773 1.00 52.74  ? 251  LEU A O   1 
ATOM   1906 C CB  . LEU A 1 250 ? 13.213  74.377 358.780 1.00 45.98  ? 251  LEU A CB  1 
ATOM   1907 C CG  . LEU A 1 250 ? 12.041  74.484 359.760 1.00 40.53  ? 251  LEU A CG  1 
ATOM   1908 C CD1 . LEU A 1 250 ? 11.034  75.512 359.271 1.00 45.02  ? 251  LEU A CD1 1 
ATOM   1909 C CD2 . LEU A 1 250 ? 11.380  73.135 359.998 1.00 46.88  ? 251  LEU A CD2 1 
ATOM   1910 N N   . ALA A 1 251 ? 15.477  75.237 360.758 1.00 47.17  ? 252  ALA A N   1 
ATOM   1911 C CA  . ALA A 1 251 ? 15.975  75.566 362.087 1.00 56.51  ? 252  ALA A CA  1 
ATOM   1912 C C   . ALA A 1 251 ? 16.641  76.936 362.102 1.00 55.36  ? 252  ALA A C   1 
ATOM   1913 O O   . ALA A 1 251 ? 16.497  77.694 363.068 1.00 54.48  ? 252  ALA A O   1 
ATOM   1914 C CB  . ALA A 1 251 ? 16.946  74.487 362.558 1.00 47.65  ? 252  ALA A CB  1 
ATOM   1915 N N   . HIS A 1 252 ? 17.371  77.273 361.037 1.00 47.52  ? 253  HIS A N   1 
ATOM   1916 C CA  . HIS A 1 252 ? 18.007  78.583 360.963 1.00 57.44  ? 253  HIS A CA  1 
ATOM   1917 C C   . HIS A 1 252 ? 16.970  79.699 360.919 1.00 59.03  ? 253  HIS A C   1 
ATOM   1918 O O   . HIS A 1 252 ? 17.183  80.775 361.490 1.00 62.64  ? 253  HIS A O   1 
ATOM   1919 C CB  . HIS A 1 252 ? 18.925  78.648 359.741 1.00 60.23  ? 253  HIS A CB  1 
ATOM   1920 C CG  . HIS A 1 252 ? 19.569  79.984 359.535 1.00 71.57  ? 253  HIS A CG  1 
ATOM   1921 N ND1 . HIS A 1 252 ? 20.741  80.350 360.163 1.00 76.38  ? 253  HIS A ND1 1 
ATOM   1922 C CD2 . HIS A 1 252 ? 19.206  81.040 358.770 1.00 66.50  ? 253  HIS A CD2 1 
ATOM   1923 C CE1 . HIS A 1 252 ? 21.071  81.575 359.794 1.00 83.28  ? 253  HIS A CE1 1 
ATOM   1924 N NE2 . HIS A 1 252 ? 20.156  82.016 358.949 1.00 79.64  ? 253  HIS A NE2 1 
ATOM   1925 N N   . LEU A 1 253 ? 15.838  79.459 360.256 1.00 59.62  ? 254  LEU A N   1 
ATOM   1926 C CA  . LEU A 1 253 ? 14.805  80.479 360.126 1.00 66.08  ? 254  LEU A CA  1 
ATOM   1927 C C   . LEU A 1 253 ? 14.035  80.714 361.418 1.00 57.93  ? 254  LEU A C   1 
ATOM   1928 O O   . LEU A 1 253 ? 13.319  81.716 361.515 1.00 51.51  ? 254  LEU A O   1 
ATOM   1929 C CB  . LEU A 1 253 ? 13.832  80.097 359.010 1.00 55.40  ? 254  LEU A CB  1 
ATOM   1930 C CG  . LEU A 1 253 ? 14.302  80.373 357.581 1.00 57.13  ? 254  LEU A CG  1 
ATOM   1931 C CD1 . LEU A 1 253 ? 13.464  79.592 356.579 1.00 48.43  ? 254  LEU A CD1 1 
ATOM   1932 C CD2 . LEU A 1 253 ? 14.246  81.861 357.284 1.00 50.49  ? 254  LEU A CD2 1 
ATOM   1933 N N   . VAL A 1 254 ? 14.157  79.824 362.403 1.00 49.77  ? 255  VAL A N   1 
ATOM   1934 C CA  . VAL A 1 254 ? 13.481  79.966 363.683 1.00 61.80  ? 255  VAL A CA  1 
ATOM   1935 C C   . VAL A 1 254 ? 14.466  80.145 364.833 1.00 66.78  ? 255  VAL A C   1 
ATOM   1936 O O   . VAL A 1 254 ? 14.069  80.089 365.997 1.00 69.82  ? 255  VAL A O   1 
ATOM   1937 C CB  . VAL A 1 254 ? 12.538  78.775 363.952 1.00 57.13  ? 255  VAL A CB  1 
ATOM   1938 C CG1 . VAL A 1 254 ? 11.455  78.707 362.887 1.00 45.13  ? 255  VAL A CG1 1 
ATOM   1939 C CG2 . VAL A 1 254 ? 13.324  77.477 364.007 1.00 47.01  ? 255  VAL A CG2 1 
ATOM   1940 N N   . GLY A 1 255 ? 15.747  80.347 364.529 1.00 63.75  ? 256  GLY A N   1 
ATOM   1941 C CA  . GLY A 1 255 ? 16.730  80.649 365.551 1.00 57.34  ? 256  GLY A CA  1 
ATOM   1942 C C   . GLY A 1 255 ? 17.458  79.467 366.150 1.00 60.73  ? 256  GLY A C   1 
ATOM   1943 O O   . GLY A 1 255 ? 17.879  79.540 367.312 1.00 87.42  ? 256  GLY A O   1 
ATOM   1944 N N   . CYS A 1 256 ? 17.638  78.383 365.394 1.00 54.11  ? 257  CYS A N   1 
ATOM   1945 C CA  . CYS A 1 256 ? 18.324  77.189 365.879 1.00 67.06  ? 257  CYS A CA  1 
ATOM   1946 C C   . CYS A 1 256 ? 19.448  76.844 364.911 1.00 79.54  ? 257  CYS A C   1 
ATOM   1947 O O   . CYS A 1 256 ? 19.189  76.676 363.701 1.00 83.85  ? 257  CYS A O   1 
ATOM   1948 C CB  . CYS A 1 256 ? 17.349  76.020 366.031 1.00 68.52  ? 257  CYS A CB  1 
ATOM   1949 S SG  . CYS A 1 256 ? 16.035  76.277 367.247 1.00 78.37  ? 257  CYS A SG  1 
ATOM   1950 N N   . PRO A 1 257 ? 20.702  76.732 365.378 1.00 95.88  ? 258  PRO A N   1 
ATOM   1951 C CA  . PRO A 1 257 ? 21.065  76.974 366.776 1.00 100.30 ? 258  PRO A CA  1 
ATOM   1952 C C   . PRO A 1 257 ? 21.303  78.460 367.031 1.00 102.70 ? 258  PRO A C   1 
ATOM   1953 O O   . PRO A 1 257 ? 21.560  79.201 366.080 1.00 96.04  ? 258  PRO A O   1 
ATOM   1954 C CB  . PRO A 1 257 ? 22.349  76.161 366.944 1.00 96.00  ? 258  PRO A CB  1 
ATOM   1955 C CG  . PRO A 1 257 ? 22.990  76.242 365.599 1.00 95.21  ? 258  PRO A CG  1 
ATOM   1956 C CD  . PRO A 1 257 ? 21.862  76.274 364.587 1.00 86.25  ? 258  PRO A CD  1 
ATOM   1957 N N   . PRO A 1 258 ? 21.200  78.896 368.296 1.00 109.76 ? 259  PRO A N   1 
ATOM   1958 C CA  . PRO A 1 258 ? 21.432  80.302 368.645 1.00 105.00 ? 259  PRO A CA  1 
ATOM   1959 C C   . PRO A 1 258 ? 22.877  80.730 368.408 1.00 103.02 ? 259  PRO A C   1 
ATOM   1960 O O   . PRO A 1 258 ? 23.146  81.396 367.407 1.00 101.22 ? 259  PRO A O   1 
ATOM   1961 C CB  . PRO A 1 258 ? 21.086  80.359 370.138 1.00 108.42 ? 259  PRO A CB  1 
ATOM   1962 C CG  . PRO A 1 258 ? 20.251  79.144 370.395 1.00 105.97 ? 259  PRO A CG  1 
ATOM   1963 C CD  . PRO A 1 258 ? 20.775  78.103 369.462 1.00 104.07 ? 259  PRO A CD  1 
ATOM   1964 N N   . GLY A 1 262 ? 24.041  75.001 361.394 1.00 48.19  ? 263  GLY A N   1 
ATOM   1965 C CA  . GLY A 1 262 ? 23.744  73.618 361.719 1.00 71.60  ? 263  GLY A CA  1 
ATOM   1966 C C   . GLY A 1 262 ? 24.549  73.098 362.893 1.00 78.60  ? 263  GLY A C   1 
ATOM   1967 O O   . GLY A 1 262 ? 24.147  73.244 364.047 1.00 76.18  ? 263  GLY A O   1 
ATOM   1968 N N   . GLY A 1 263 ? 25.693  72.485 362.596 1.00 89.39  ? 264  GLY A N   1 
ATOM   1969 C CA  . GLY A 1 263 ? 26.574  71.982 363.631 1.00 88.06  ? 264  GLY A CA  1 
ATOM   1970 C C   . GLY A 1 263 ? 26.136  70.655 364.214 1.00 85.03  ? 264  GLY A C   1 
ATOM   1971 O O   . GLY A 1 263 ? 26.089  69.642 363.510 1.00 85.91  ? 264  GLY A O   1 
ATOM   1972 N N   . ASN A 1 264 ? 25.806  70.649 365.501 1.00 80.81  ? 265  ASN A N   1 
ATOM   1973 C CA  . ASN A 1 264 ? 25.467  69.420 366.203 1.00 64.10  ? 265  ASN A CA  1 
ATOM   1974 C C   . ASN A 1 264 ? 23.978  69.123 366.072 1.00 72.98  ? 265  ASN A C   1 
ATOM   1975 O O   . ASN A 1 264 ? 23.137  70.001 366.300 1.00 57.37  ? 265  ASN A O   1 
ATOM   1976 C CB  . ASN A 1 264 ? 25.852  69.525 367.674 1.00 83.32  ? 265  ASN A CB  1 
ATOM   1977 C CG  . ASN A 1 264 ? 25.386  68.333 368.478 1.00 85.64  ? 265  ASN A CG  1 
ATOM   1978 O OD1 . ASN A 1 264 ? 25.110  67.260 367.934 1.00 102.83 ? 265  ASN A OD1 1 
ATOM   1979 N ND2 . ASN A 1 264 ? 25.297  68.514 369.785 1.00 95.56  ? 265  ASN A ND2 1 
ATOM   1980 N N   . ASP A 1 265 ? 23.659  67.869 365.741 1.00 49.65  ? 266  ASP A N   1 
ATOM   1981 C CA  . ASP A 1 265 ? 22.267  67.486 365.525 1.00 54.72  ? 266  ASP A CA  1 
ATOM   1982 C C   . ASP A 1 265 ? 21.482  67.481 366.831 1.00 63.94  ? 266  ASP A C   1 
ATOM   1983 O O   . ASP A 1 265 ? 20.348  67.969 366.879 1.00 53.28  ? 266  ASP A O   1 
ATOM   1984 C CB  . ASP A 1 265 ? 22.199  66.113 364.853 1.00 47.20  ? 266  ASP A CB  1 
ATOM   1985 C CG  . ASP A 1 265 ? 22.385  66.183 363.342 1.00 65.10  ? 266  ASP A CG  1 
ATOM   1986 O OD1 . ASP A 1 265 ? 22.570  67.295 362.798 1.00 54.57  ? 266  ASP A OD1 1 
ATOM   1987 O OD2 . ASP A 1 265 ? 22.353  65.113 362.696 1.00 56.63  ? 266  ASP A OD2 1 
ATOM   1988 N N   . THR A 1 266 ? 22.071  66.936 367.899 1.00 70.25  ? 267  THR A N   1 
ATOM   1989 C CA  . THR A 1 266 ? 21.358  66.819 369.170 1.00 52.25  ? 267  THR A CA  1 
ATOM   1990 C C   . THR A 1 266 ? 20.930  68.183 369.701 1.00 46.49  ? 267  THR A C   1 
ATOM   1991 O O   . THR A 1 266 ? 19.770  68.370 370.088 1.00 62.11  ? 267  THR A O   1 
ATOM   1992 C CB  . THR A 1 266 ? 22.227  66.087 370.194 1.00 64.40  ? 267  THR A CB  1 
ATOM   1993 O OG1 . THR A 1 266 ? 22.572  64.788 369.692 1.00 63.54  ? 267  THR A OG1 1 
ATOM   1994 C CG2 . THR A 1 266 ? 21.484  65.930 371.508 1.00 61.85  ? 267  THR A CG2 1 
ATOM   1995 N N   . GLU A 1 267 ? 21.851  69.156 369.726 1.00 52.68  ? 268  GLU A N   1 
ATOM   1996 C CA  . GLU A 1 267 ? 21.483  70.496 370.181 1.00 58.58  ? 268  GLU A CA  1 
ATOM   1997 C C   . GLU A 1 267 ? 20.502  71.167 369.229 1.00 50.38  ? 268  GLU A C   1 
ATOM   1998 O O   . GLU A 1 267 ? 19.620  71.909 369.673 1.00 53.35  ? 268  GLU A O   1 
ATOM   1999 C CB  . GLU A 1 267 ? 22.722  71.379 370.355 1.00 62.31  ? 268  GLU A CB  1 
ATOM   2000 C CG  . GLU A 1 267 ? 23.795  70.768 371.235 1.00 97.44  ? 268  GLU A CG  1 
ATOM   2001 C CD  . GLU A 1 267 ? 25.186  71.289 370.927 1.00 117.43 ? 268  GLU A CD  1 
ATOM   2002 O OE1 . GLU A 1 267 ? 25.374  71.883 369.844 1.00 114.14 ? 268  GLU A OE1 1 
ATOM   2003 O OE2 . GLU A 1 267 ? 26.107  71.044 371.735 1.00 118.51 ? 268  GLU A OE2 1 
ATOM   2004 N N   . LEU A 1 268 ? 20.633  70.914 367.925 1.00 54.18  ? 269  LEU A N   1 
ATOM   2005 C CA  . LEU A 1 268 ? 19.771  71.561 366.939 1.00 54.02  ? 269  LEU A CA  1 
ATOM   2006 C C   . LEU A 1 268 ? 18.335  71.056 367.054 1.00 56.36  ? 269  LEU A C   1 
ATOM   2007 O O   . LEU A 1 268 ? 17.388  71.851 367.041 1.00 49.07  ? 269  LEU A O   1 
ATOM   2008 C CB  . LEU A 1 268 ? 20.359  71.327 365.539 1.00 62.77  ? 269  LEU A CB  1 
ATOM   2009 C CG  . LEU A 1 268 ? 19.870  71.975 364.242 1.00 52.81  ? 269  LEU A CG  1 
ATOM   2010 C CD1 . LEU A 1 268 ? 18.559  71.389 363.752 1.00 50.09  ? 269  LEU A CD1 1 
ATOM   2011 C CD2 . LEU A 1 268 ? 19.741  73.474 364.436 1.00 71.77  ? 269  LEU A CD2 1 
ATOM   2012 N N   . VAL A 1 269 ? 18.154  69.740 367.190 1.00 37.03  ? 270  VAL A N   1 
ATOM   2013 C CA  . VAL A 1 269 ? 16.813  69.191 367.377 1.00 43.97  ? 270  VAL A CA  1 
ATOM   2014 C C   . VAL A 1 269 ? 16.221  69.668 368.697 1.00 56.64  ? 270  VAL A C   1 
ATOM   2015 O O   . VAL A 1 269 ? 15.045  70.049 368.765 1.00 47.69  ? 270  VAL A O   1 
ATOM   2016 C CB  . VAL A 1 269 ? 16.846  67.653 367.296 1.00 53.92  ? 270  VAL A CB  1 
ATOM   2017 C CG1 . VAL A 1 269 ? 15.452  67.080 367.512 1.00 50.52  ? 270  VAL A CG1 1 
ATOM   2018 C CG2 . VAL A 1 269 ? 17.396  67.203 365.955 1.00 55.45  ? 270  VAL A CG2 1 
ATOM   2019 N N   . ALA A 1 270 ? 17.025  69.658 369.765 1.00 50.56  ? 271  ALA A N   1 
ATOM   2020 C CA  . ALA A 1 270 ? 16.536  70.096 371.069 1.00 51.77  ? 271  ALA A CA  1 
ATOM   2021 C C   . ALA A 1 270 ? 16.071  71.545 371.027 1.00 48.60  ? 271  ALA A C   1 
ATOM   2022 O O   . ALA A 1 270 ? 15.087  71.908 371.680 1.00 59.33  ? 271  ALA A O   1 
ATOM   2023 C CB  . ALA A 1 270 ? 17.625  69.911 372.126 1.00 40.39  ? 271  ALA A CB  1 
ATOM   2024 N N   . CYS A 1 271 ? 16.760  72.388 370.255 1.00 48.80  ? 272  CYS A N   1 
ATOM   2025 C CA  . CYS A 1 271 ? 16.315  73.767 370.096 1.00 43.59  ? 272  CYS A CA  1 
ATOM   2026 C C   . CYS A 1 271 ? 15.006  73.833 369.317 1.00 63.03  ? 272  CYS A C   1 
ATOM   2027 O O   . CYS A 1 271 ? 14.134  74.654 369.627 1.00 53.54  ? 272  CYS A O   1 
ATOM   2028 C CB  . CYS A 1 271 ? 17.403  74.588 369.404 1.00 46.86  ? 272  CYS A CB  1 
ATOM   2029 S SG  . CYS A 1 271 ? 16.978  76.312 369.056 1.00 100.29 ? 272  CYS A SG  1 
ATOM   2030 N N   . LEU A 1 272 ? 14.850  72.976 368.302 1.00 51.21  ? 273  LEU A N   1 
ATOM   2031 C CA  . LEU A 1 272 ? 13.616  72.958 367.520 1.00 57.09  ? 273  LEU A CA  1 
ATOM   2032 C C   . LEU A 1 272 ? 12.426  72.498 368.354 1.00 51.57  ? 273  LEU A C   1 
ATOM   2033 O O   . LEU A 1 272 ? 11.298  72.949 368.124 1.00 48.78  ? 273  LEU A O   1 
ATOM   2034 C CB  . LEU A 1 272 ? 13.783  72.057 366.294 1.00 50.34  ? 273  LEU A CB  1 
ATOM   2035 C CG  . LEU A 1 272 ? 14.378  72.695 365.037 1.00 49.79  ? 273  LEU A CG  1 
ATOM   2036 C CD1 . LEU A 1 272 ? 14.298  71.739 363.860 1.00 49.77  ? 273  LEU A CD1 1 
ATOM   2037 C CD2 . LEU A 1 272 ? 13.670  73.995 364.711 1.00 54.61  ? 273  LEU A CD2 1 
ATOM   2038 N N   . ARG A 1 273 ? 12.658  71.610 369.324 1.00 45.09  ? 274  ARG A N   1 
ATOM   2039 C CA  . ARG A 1 273 ? 11.579  71.128 370.178 1.00 57.68  ? 274  ARG A CA  1 
ATOM   2040 C C   . ARG A 1 273 ? 11.029  72.210 371.098 1.00 50.42  ? 274  ARG A C   1 
ATOM   2041 O O   . ARG A 1 273 ? 9.881   72.099 371.542 1.00 52.67  ? 274  ARG A O   1 
ATOM   2042 C CB  . ARG A 1 273 ? 12.059  69.934 371.003 1.00 37.51  ? 274  ARG A CB  1 
ATOM   2043 C CG  . ARG A 1 273 ? 12.177  68.663 370.181 1.00 46.60  ? 274  ARG A CG  1 
ATOM   2044 C CD  . ARG A 1 273 ? 12.201  67.437 371.061 1.00 43.56  ? 274  ARG A CD  1 
ATOM   2045 N NE  . ARG A 1 273 ? 13.544  66.888 371.191 1.00 63.62  ? 274  ARG A NE  1 
ATOM   2046 C CZ  . ARG A 1 273 ? 14.016  65.878 370.468 1.00 63.81  ? 274  ARG A CZ  1 
ATOM   2047 N NH1 . ARG A 1 273 ? 13.253  65.285 369.559 1.00 50.46  ? 274  ARG A NH1 1 
ATOM   2048 N NH2 . ARG A 1 273 ? 15.256  65.454 370.662 1.00 65.33  ? 274  ARG A NH2 1 
ATOM   2049 N N   . THR A 1 274 ? 11.813  73.248 371.393 1.00 46.61  ? 275  THR A N   1 
ATOM   2050 C CA  . THR A 1 274 ? 11.335  74.351 372.218 1.00 50.32  ? 275  THR A CA  1 
ATOM   2051 C C   . THR A 1 274 ? 10.491  75.347 371.436 1.00 52.82  ? 275  THR A C   1 
ATOM   2052 O O   . THR A 1 274 ? 9.911   76.256 372.040 1.00 49.40  ? 275  THR A O   1 
ATOM   2053 C CB  . THR A 1 274 ? 12.515  75.090 372.858 1.00 45.48  ? 275  THR A CB  1 
ATOM   2054 O OG1 . THR A 1 274 ? 13.240  75.799 371.845 1.00 49.21  ? 275  THR A OG1 1 
ATOM   2055 C CG2 . THR A 1 274 ? 13.451  74.111 373.563 1.00 37.71  ? 275  THR A CG2 1 
ATOM   2056 N N   . ARG A 1 275 ? 10.413  75.206 370.119 1.00 58.76  ? 276  ARG A N   1 
ATOM   2057 C CA  . ARG A 1 275 ? 9.656   76.149 369.309 1.00 52.48  ? 276  ARG A CA  1 
ATOM   2058 C C   . ARG A 1 275 ? 8.187   75.740 369.250 1.00 51.14  ? 276  ARG A C   1 
ATOM   2059 O O   . ARG A 1 275 ? 7.879   74.548 369.142 1.00 51.87  ? 276  ARG A O   1 
ATOM   2060 C CB  . ARG A 1 275 ? 10.223  76.215 367.896 1.00 50.18  ? 276  ARG A CB  1 
ATOM   2061 C CG  . ARG A 1 275 ? 11.627  76.784 367.825 1.00 55.89  ? 276  ARG A CG  1 
ATOM   2062 C CD  . ARG A 1 275 ? 11.668  78.201 368.360 1.00 57.12  ? 276  ARG A CD  1 
ATOM   2063 N NE  . ARG A 1 275 ? 12.993  78.797 368.227 1.00 64.38  ? 276  ARG A NE  1 
ATOM   2064 C CZ  . ARG A 1 275 ? 13.948  78.706 369.146 1.00 67.75  ? 276  ARG A CZ  1 
ATOM   2065 N NH1 . ARG A 1 275 ? 13.728  78.039 370.272 1.00 69.04  ? 276  ARG A NH1 1 
ATOM   2066 N NH2 . ARG A 1 275 ? 15.124  79.282 368.940 1.00 62.45  ? 276  ARG A NH2 1 
ATOM   2067 N N   . PRO A 1 276 ? 7.273   76.707 369.327 1.00 50.96  ? 277  PRO A N   1 
ATOM   2068 C CA  . PRO A 1 276 ? 5.849   76.384 369.184 1.00 51.39  ? 277  PRO A CA  1 
ATOM   2069 C C   . PRO A 1 276 ? 5.564   75.775 367.819 1.00 56.74  ? 277  PRO A C   1 
ATOM   2070 O O   . PRO A 1 276 ? 6.210   76.102 366.820 1.00 41.95  ? 277  PRO A O   1 
ATOM   2071 C CB  . PRO A 1 276 ? 5.155   77.743 369.347 1.00 42.01  ? 277  PRO A CB  1 
ATOM   2072 C CG  . PRO A 1 276 ? 6.151   78.605 370.060 1.00 45.28  ? 277  PRO A CG  1 
ATOM   2073 C CD  . PRO A 1 276 ? 7.497   78.137 369.595 1.00 51.12  ? 277  PRO A CD  1 
ATOM   2074 N N   . ALA A 1 277 ? 4.576   74.876 367.788 1.00 50.59  ? 278  ALA A N   1 
ATOM   2075 C CA  . ALA A 1 277 ? 4.255   74.161 366.556 1.00 40.46  ? 278  ALA A CA  1 
ATOM   2076 C C   . ALA A 1 277 ? 3.909   75.120 365.425 1.00 46.33  ? 278  ALA A C   1 
ATOM   2077 O O   . ALA A 1 277 ? 4.329   74.917 364.279 1.00 46.64  ? 278  ALA A O   1 
ATOM   2078 C CB  . ALA A 1 277 ? 3.104   73.185 366.803 1.00 36.46  ? 278  ALA A CB  1 
ATOM   2079 N N   . GLN A 1 278 ? 3.151   76.178 365.726 1.00 48.58  ? 279  GLN A N   1 
ATOM   2080 C CA  . GLN A 1 278 ? 2.762   77.122 364.685 1.00 51.29  ? 279  GLN A CA  1 
ATOM   2081 C C   . GLN A 1 278 ? 3.971   77.825 364.079 1.00 50.99  ? 279  GLN A C   1 
ATOM   2082 O O   . GLN A 1 278 ? 3.970   78.143 362.884 1.00 52.84  ? 279  GLN A O   1 
ATOM   2083 C CB  . GLN A 1 278 ? 1.777   78.146 365.249 1.00 43.48  ? 279  GLN A CB  1 
ATOM   2084 C CG  . GLN A 1 278 ? 1.144   79.038 364.196 1.00 48.00  ? 279  GLN A CG  1 
ATOM   2085 C CD  . GLN A 1 278 ? 0.365   78.248 363.161 1.00 60.17  ? 279  GLN A CD  1 
ATOM   2086 O OE1 . GLN A 1 278 ? -0.506  77.446 363.502 1.00 58.33  ? 279  GLN A OE1 1 
ATOM   2087 N NE2 . GLN A 1 278 ? 0.675   78.470 361.889 1.00 46.31  ? 279  GLN A NE2 1 
ATOM   2088 N N   . VAL A 1 279 ? 5.011   78.068 364.881 1.00 48.61  ? 280  VAL A N   1 
ATOM   2089 C CA  . VAL A 1 279 ? 6.206   78.739 364.374 1.00 50.74  ? 280  VAL A CA  1 
ATOM   2090 C C   . VAL A 1 279 ? 6.873   77.899 363.290 1.00 55.25  ? 280  VAL A C   1 
ATOM   2091 O O   . VAL A 1 279 ? 7.308   78.424 362.257 1.00 49.18  ? 280  VAL A O   1 
ATOM   2092 C CB  . VAL A 1 279 ? 7.171   79.050 365.533 1.00 55.81  ? 280  VAL A CB  1 
ATOM   2093 C CG1 . VAL A 1 279 ? 8.479   79.619 365.008 1.00 50.68  ? 280  VAL A CG1 1 
ATOM   2094 C CG2 . VAL A 1 279 ? 6.523   80.017 366.508 1.00 51.26  ? 280  VAL A CG2 1 
ATOM   2095 N N   . LEU A 1 280 ? 6.958   76.582 363.501 1.00 44.21  ? 281  LEU A N   1 
ATOM   2096 C CA  . LEU A 1 280 ? 7.523   75.707 362.479 1.00 46.64  ? 281  LEU A CA  1 
ATOM   2097 C C   . LEU A 1 280 ? 6.654   75.691 361.227 1.00 46.50  ? 281  LEU A C   1 
ATOM   2098 O O   . LEU A 1 280 ? 7.168   75.714 360.105 1.00 54.38  ? 281  LEU A O   1 
ATOM   2099 C CB  . LEU A 1 280 ? 7.689   74.290 363.032 1.00 39.71  ? 281  LEU A CB  1 
ATOM   2100 C CG  . LEU A 1 280 ? 8.545   74.123 364.290 1.00 42.81  ? 281  LEU A CG  1 
ATOM   2101 C CD1 . LEU A 1 280 ? 8.682   72.653 364.659 1.00 39.63  ? 281  LEU A CD1 1 
ATOM   2102 C CD2 . LEU A 1 280 ? 9.913   74.760 364.107 1.00 37.46  ? 281  LEU A CD2 1 
ATOM   2103 N N   . VAL A 1 281 ? 5.333   75.658 361.405 1.00 46.09  ? 282  VAL A N   1 
ATOM   2104 C CA  . VAL A 1 281 ? 4.407   75.672 360.271 1.00 44.15  ? 282  VAL A CA  1 
ATOM   2105 C C   . VAL A 1 281 ? 4.601   76.924 359.429 1.00 44.81  ? 282  VAL A C   1 
ATOM   2106 O O   . VAL A 1 281 ? 4.566   76.870 358.191 1.00 49.10  ? 282  VAL A O   1 
ATOM   2107 C CB  . VAL A 1 281 ? 2.956   75.538 360.776 1.00 48.99  ? 282  VAL A CB  1 
ATOM   2108 C CG1 . VAL A 1 281 ? 1.967   75.764 359.641 1.00 43.26  ? 282  VAL A CG1 1 
ATOM   2109 C CG2 . VAL A 1 281 ? 2.740   74.171 361.418 1.00 38.08  ? 282  VAL A CG2 1 
ATOM   2110 N N   . ASN A 1 282 ? 4.814   78.074 360.078 1.00 44.67  ? 283  ASN A N   1 
ATOM   2111 C CA  . ASN A 1 282 ? 4.857   79.340 359.360 1.00 50.79  ? 283  ASN A CA  1 
ATOM   2112 C C   . ASN A 1 282 ? 6.079   79.470 358.459 1.00 51.48  ? 283  ASN A C   1 
ATOM   2113 O O   . ASN A 1 282 ? 6.058   80.280 357.526 1.00 57.96  ? 283  ASN A O   1 
ATOM   2114 C CB  . ASN A 1 282 ? 4.824   80.504 360.348 1.00 52.92  ? 283  ASN A CB  1 
ATOM   2115 C CG  . ASN A 1 282 ? 3.494   80.622 361.064 1.00 58.71  ? 283  ASN A CG  1 
ATOM   2116 O OD1 . ASN A 1 282 ? 2.461   80.183 360.558 1.00 59.39  ? 283  ASN A OD1 1 
ATOM   2117 N ND2 . ASN A 1 282 ? 3.517   81.198 362.259 1.00 61.70  ? 283  ASN A ND2 1 
ATOM   2118 N N   . HIS A 1 283 ? 7.133   78.697 358.708 1.00 53.53  ? 284  HIS A N   1 
ATOM   2119 C CA  . HIS A 1 283 ? 8.375   78.820 357.957 1.00 61.84  ? 284  HIS A CA  1 
ATOM   2120 C C   . HIS A 1 283 ? 8.690   77.599 357.104 1.00 53.55  ? 284  HIS A C   1 
ATOM   2121 O O   . HIS A 1 283 ? 9.693   77.609 356.382 1.00 54.54  ? 284  HIS A O   1 
ATOM   2122 C CB  . HIS A 1 283 ? 9.540   79.091 358.920 1.00 49.43  ? 284  HIS A CB  1 
ATOM   2123 C CG  . HIS A 1 283 ? 9.446   80.409 359.625 1.00 61.94  ? 284  HIS A CG  1 
ATOM   2124 N ND1 . HIS A 1 283 ? 8.835   80.557 360.852 1.00 60.58  ? 284  HIS A ND1 1 
ATOM   2125 C CD2 . HIS A 1 283 ? 9.884   81.641 359.273 1.00 54.29  ? 284  HIS A CD2 1 
ATOM   2126 C CE1 . HIS A 1 283 ? 8.902   81.822 361.226 1.00 58.85  ? 284  HIS A CE1 1 
ATOM   2127 N NE2 . HIS A 1 283 ? 9.534   82.501 360.285 1.00 64.86  ? 284  HIS A NE2 1 
ATOM   2128 N N   . GLU A 1 284 ? 7.857   76.554 357.152 1.00 41.91  ? 285  GLU A N   1 
ATOM   2129 C CA  . GLU A 1 284 ? 8.213   75.296 356.501 1.00 51.52  ? 285  GLU A CA  1 
ATOM   2130 C C   . GLU A 1 284 ? 8.304   75.443 354.987 1.00 56.71  ? 285  GLU A C   1 
ATOM   2131 O O   . GLU A 1 284 ? 9.045   74.696 354.336 1.00 51.84  ? 285  GLU A O   1 
ATOM   2132 C CB  . GLU A 1 284 ? 7.209   74.202 356.872 1.00 42.80  ? 285  GLU A CB  1 
ATOM   2133 C CG  . GLU A 1 284 ? 6.256   73.836 355.747 1.00 64.41  ? 285  GLU A CG  1 
ATOM   2134 C CD  . GLU A 1 284 ? 5.206   72.819 356.156 1.00 74.78  ? 285  GLU A CD  1 
ATOM   2135 O OE1 . GLU A 1 284 ? 5.562   71.802 356.788 1.00 68.56  ? 285  GLU A OE1 1 
ATOM   2136 O OE2 . GLU A 1 284 ? 4.016   73.043 355.843 1.00 65.28  ? 285  GLU A OE2 1 
ATOM   2137 N N   . TRP A 1 285 ? 7.585   76.399 354.407 1.00 46.27  ? 286  TRP A N   1 
ATOM   2138 C CA  . TRP A 1 285 ? 7.583   76.549 352.959 1.00 46.35  ? 286  TRP A CA  1 
ATOM   2139 C C   . TRP A 1 285 ? 8.712   77.428 352.442 1.00 46.97  ? 286  TRP A C   1 
ATOM   2140 O O   . TRP A 1 285 ? 8.923   77.482 351.227 1.00 50.24  ? 286  TRP A O   1 
ATOM   2141 C CB  . TRP A 1 285 ? 6.241   77.110 352.486 1.00 44.00  ? 286  TRP A CB  1 
ATOM   2142 C CG  . TRP A 1 285 ? 5.626   76.299 351.394 1.00 53.05  ? 286  TRP A CG  1 
ATOM   2143 C CD1 . TRP A 1 285 ? 5.267   76.736 350.154 1.00 54.22  ? 286  TRP A CD1 1 
ATOM   2144 C CD2 . TRP A 1 285 ? 5.308   74.900 351.436 1.00 48.39  ? 286  TRP A CD2 1 
ATOM   2145 N NE1 . TRP A 1 285 ? 4.738   75.700 349.423 1.00 55.47  ? 286  TRP A NE1 1 
ATOM   2146 C CE2 . TRP A 1 285 ? 4.753   74.562 350.187 1.00 45.32  ? 286  TRP A CE2 1 
ATOM   2147 C CE3 . TRP A 1 285 ? 5.439   73.902 352.409 1.00 47.67  ? 286  TRP A CE3 1 
ATOM   2148 C CZ2 . TRP A 1 285 ? 4.326   73.270 349.884 1.00 39.97  ? 286  TRP A CZ2 1 
ATOM   2149 C CZ3 . TRP A 1 285 ? 5.013   72.621 352.109 1.00 48.39  ? 286  TRP A CZ3 1 
ATOM   2150 C CH2 . TRP A 1 285 ? 4.463   72.317 350.857 1.00 54.38  ? 286  TRP A CH2 1 
ATOM   2151 N N   . HIS A 1 286 ? 9.445   78.104 353.324 1.00 41.81  ? 287  HIS A N   1 
ATOM   2152 C CA  . HIS A 1 286 ? 10.563  78.937 352.905 1.00 47.09  ? 287  HIS A CA  1 
ATOM   2153 C C   . HIS A 1 286 ? 11.827  78.137 352.622 1.00 54.28  ? 287  HIS A C   1 
ATOM   2154 O O   . HIS A 1 286 ? 12.817  78.719 352.165 1.00 53.90  ? 287  HIS A O   1 
ATOM   2155 C CB  . HIS A 1 286 ? 10.849  79.994 353.973 1.00 58.04  ? 287  HIS A CB  1 
ATOM   2156 C CG  . HIS A 1 286 ? 9.714   80.942 354.197 1.00 70.48  ? 287  HIS A CG  1 
ATOM   2157 N ND1 . HIS A 1 286 ? 9.273   81.292 355.455 1.00 73.82  ? 287  HIS A ND1 1 
ATOM   2158 C CD2 . HIS A 1 286 ? 8.926   81.611 353.322 1.00 62.85  ? 287  HIS A CD2 1 
ATOM   2159 C CE1 . HIS A 1 286 ? 8.262   82.135 355.345 1.00 71.13  ? 287  HIS A CE1 1 
ATOM   2160 N NE2 . HIS A 1 286 ? 8.033   82.346 354.062 1.00 74.67  ? 287  HIS A NE2 1 
ATOM   2161 N N   . VAL A 1 287 ? 11.823  76.823 352.878 1.00 41.92  ? 288  VAL A N   1 
ATOM   2162 C CA  . VAL A 1 287 ? 13.006  76.002 352.639 1.00 43.58  ? 288  VAL A CA  1 
ATOM   2163 C C   . VAL A 1 287 ? 13.016  75.376 351.249 1.00 52.57  ? 288  VAL A C   1 
ATOM   2164 O O   . VAL A 1 287 ? 13.977  74.674 350.905 1.00 48.05  ? 288  VAL A O   1 
ATOM   2165 C CB  . VAL A 1 287 ? 13.142  74.900 353.711 1.00 41.47  ? 288  VAL A CB  1 
ATOM   2166 C CG1 . VAL A 1 287 ? 13.063  75.502 355.106 1.00 43.28  ? 288  VAL A CG1 1 
ATOM   2167 C CG2 . VAL A 1 287 ? 12.078  73.829 353.523 1.00 38.06  ? 288  VAL A CG2 1 
ATOM   2168 N N   . LEU A 1 288 ? 11.990  75.611 350.438 1.00 48.94  ? 289  LEU A N   1 
ATOM   2169 C CA  . LEU A 1 288 ? 11.971  75.048 349.096 1.00 49.67  ? 289  LEU A CA  1 
ATOM   2170 C C   . LEU A 1 288 ? 12.999  75.758 348.215 1.00 48.10  ? 289  LEU A C   1 
ATOM   2171 O O   . LEU A 1 288 ? 13.139  76.982 348.287 1.00 53.63  ? 289  LEU A O   1 
ATOM   2172 C CB  . LEU A 1 288 ? 10.577  75.166 348.482 1.00 38.28  ? 289  LEU A CB  1 
ATOM   2173 C CG  . LEU A 1 288 ? 9.584   74.098 348.953 1.00 50.47  ? 289  LEU A CG  1 
ATOM   2174 C CD1 . LEU A 1 288 ? 8.212   74.302 348.330 1.00 40.49  ? 289  LEU A CD1 1 
ATOM   2175 C CD2 . LEU A 1 288 ? 10.110  72.696 348.659 1.00 35.82  ? 289  LEU A CD2 1 
ATOM   2176 N N   . PRO A 1 289 ? 13.728  75.019 347.374 1.00 58.61  ? 290  PRO A N   1 
ATOM   2177 C CA  . PRO A 1 289 ? 14.817  75.644 346.598 1.00 63.77  ? 290  PRO A CA  1 
ATOM   2178 C C   . PRO A 1 289 ? 14.360  76.692 345.594 1.00 59.27  ? 290  PRO A C   1 
ATOM   2179 O O   . PRO A 1 289 ? 15.129  77.622 345.303 1.00 63.32  ? 290  PRO A O   1 
ATOM   2180 C CB  . PRO A 1 289 ? 15.477  74.442 345.904 1.00 60.29  ? 290  PRO A CB  1 
ATOM   2181 C CG  . PRO A 1 289 ? 14.413  73.386 345.873 1.00 62.64  ? 290  PRO A CG  1 
ATOM   2182 C CD  . PRO A 1 289 ? 13.651  73.565 347.150 1.00 60.10  ? 290  PRO A CD  1 
ATOM   2183 N N   . GLN A 1 290 ? 13.147  76.578 345.053 1.00 51.95  ? 291  GLN A N   1 
ATOM   2184 C CA  . GLN A 1 290 ? 12.637  77.526 344.070 1.00 63.59  ? 291  GLN A CA  1 
ATOM   2185 C C   . GLN A 1 290 ? 11.118  77.568 344.180 1.00 64.59  ? 291  GLN A C   1 
ATOM   2186 O O   . GLN A 1 290 ? 10.488  76.718 344.822 1.00 59.78  ? 291  GLN A O   1 
ATOM   2187 C CB  . GLN A 1 290 ? 13.075  77.150 342.650 1.00 51.85  ? 291  GLN A CB  1 
ATOM   2188 C CG  . GLN A 1 290 ? 12.237  76.053 342.031 1.00 55.94  ? 291  GLN A CG  1 
ATOM   2189 C CD  . GLN A 1 290 ? 12.235  76.103 340.517 1.00 75.57  ? 291  GLN A CD  1 
ATOM   2190 O OE1 . GLN A 1 290 ? 13.189  75.668 339.870 1.00 74.87  ? 291  GLN A OE1 1 
ATOM   2191 N NE2 . GLN A 1 290 ? 11.158  76.629 339.941 1.00 60.94  ? 291  GLN A NE2 1 
ATOM   2192 N N   . GLU A 1 291 ? 10.526  78.601 343.572 1.00 60.17  ? 292  GLU A N   1 
ATOM   2193 C CA  . GLU A 1 291 ? 9.072   78.694 343.511 1.00 71.67  ? 292  GLU A CA  1 
ATOM   2194 C C   . GLU A 1 291 ? 8.540   77.633 342.558 1.00 61.05  ? 292  GLU A C   1 
ATOM   2195 O O   . GLU A 1 291 ? 9.078   77.453 341.459 1.00 61.31  ? 292  GLU A O   1 
ATOM   2196 C CB  . GLU A 1 291 ? 8.631   80.095 343.098 1.00 78.92  ? 292  GLU A CB  1 
ATOM   2197 C CG  . GLU A 1 291 ? 8.956   80.508 341.664 1.00 91.22  ? 292  GLU A CG  1 
ATOM   2198 C CD  . GLU A 1 291 ? 8.098   81.666 341.216 1.00 102.36 ? 292  GLU A CD  1 
ATOM   2199 O OE1 . GLU A 1 291 ? 7.657   81.652 340.052 1.00 111.23 ? 292  GLU A OE1 1 
ATOM   2200 O OE2 . GLU A 1 291 ? 7.833   82.566 342.047 1.00 119.96 ? 292  GLU A OE2 1 
ATOM   2201 N N   . SER A 1 292 ? 7.502   76.916 342.988 1.00 52.60  ? 293  SER A N   1 
ATOM   2202 C CA  . SER A 1 292 ? 7.109   75.702 342.290 1.00 49.65  ? 293  SER A CA  1 
ATOM   2203 C C   . SER A 1 292 ? 5.659   75.395 342.629 1.00 49.55  ? 293  SER A C   1 
ATOM   2204 O O   . SER A 1 292 ? 5.047   76.072 343.465 1.00 48.12  ? 293  SER A O   1 
ATOM   2205 C CB  . SER A 1 292 ? 8.018   74.534 342.681 1.00 43.78  ? 293  SER A CB  1 
ATOM   2206 O OG  . SER A 1 292 ? 8.167   74.476 344.094 1.00 53.26  ? 293  SER A OG  1 
ATOM   2207 N N   . VAL A 1 293 ? 5.116   74.389 341.966 1.00 39.12  ? 294  VAL A N   1 
ATOM   2208 C CA  . VAL A 1 293 ? 3.851   73.780 342.351 1.00 40.00  ? 294  VAL A CA  1 
ATOM   2209 C C   . VAL A 1 293 ? 4.075   72.278 342.443 1.00 40.55  ? 294  VAL A C   1 
ATOM   2210 O O   . VAL A 1 293 ? 4.993   71.737 341.821 1.00 40.78  ? 294  VAL A O   1 
ATOM   2211 C CB  . VAL A 1 293 ? 2.706   74.105 341.363 1.00 45.02  ? 294  VAL A CB  1 
ATOM   2212 C CG1 . VAL A 1 293 ? 2.357   75.587 341.422 1.00 44.79  ? 294  VAL A CG1 1 
ATOM   2213 C CG2 . VAL A 1 293 ? 3.104   73.709 339.955 1.00 40.05  ? 294  VAL A CG2 1 
ATOM   2214 N N   . PHE A 1 294 ? 3.241   71.605 343.238 1.00 38.30  ? 295  PHE A N   1 
ATOM   2215 C CA  . PHE A 1 294 ? 3.370   70.165 343.478 1.00 46.14  ? 295  PHE A CA  1 
ATOM   2216 C C   . PHE A 1 294 ? 4.752   69.811 344.034 1.00 40.12  ? 295  PHE A C   1 
ATOM   2217 O O   . PHE A 1 294 ? 5.333   68.777 343.697 1.00 39.70  ? 295  PHE A O   1 
ATOM   2218 C CB  . PHE A 1 294 ? 3.069   69.348 342.213 1.00 41.16  ? 295  PHE A CB  1 
ATOM   2219 C CG  . PHE A 1 294 ? 2.322   68.065 342.480 1.00 40.97  ? 295  PHE A CG  1 
ATOM   2220 C CD1 . PHE A 1 294 ? 1.145   67.766 341.805 1.00 37.89  ? 295  PHE A CD1 1 
ATOM   2221 C CD2 . PHE A 1 294 ? 2.781   67.174 343.437 1.00 39.03  ? 295  PHE A CD2 1 
ATOM   2222 C CE1 . PHE A 1 294 ? 0.460   66.582 342.067 1.00 39.84  ? 295  PHE A CE1 1 
ATOM   2223 C CE2 . PHE A 1 294 ? 2.100   66.001 343.707 1.00 35.40  ? 295  PHE A CE2 1 
ATOM   2224 C CZ  . PHE A 1 294 ? 0.941   65.704 343.024 1.00 37.66  ? 295  PHE A CZ  1 
ATOM   2225 N N   . ARG A 1 295 ? 5.287   70.675 344.895 1.00 34.99  ? 296  ARG A N   1 
ATOM   2226 C CA  . ARG A 1 295 ? 6.528   70.397 345.609 1.00 40.05  ? 296  ARG A CA  1 
ATOM   2227 C C   . ARG A 1 295 ? 6.323   70.712 347.083 1.00 40.24  ? 296  ARG A C   1 
ATOM   2228 O O   . ARG A 1 295 ? 5.764   71.759 347.423 1.00 40.83  ? 296  ARG A O   1 
ATOM   2229 C CB  . ARG A 1 295 ? 7.696   71.207 345.039 1.00 35.71  ? 296  ARG A CB  1 
ATOM   2230 C CG  . ARG A 1 295 ? 8.175   70.716 343.683 1.00 43.98  ? 296  ARG A CG  1 
ATOM   2231 C CD  . ARG A 1 295 ? 8.588   69.247 343.726 1.00 36.14  ? 296  ARG A CD  1 
ATOM   2232 N NE  . ARG A 1 295 ? 9.169   68.816 342.456 1.00 45.85  ? 296  ARG A NE  1 
ATOM   2233 C CZ  . ARG A 1 295 ? 8.475   68.297 341.447 1.00 43.82  ? 296  ARG A CZ  1 
ATOM   2234 N NH1 . ARG A 1 295 ? 7.163   68.133 341.551 1.00 35.39  ? 296  ARG A NH1 1 
ATOM   2235 N NH2 . ARG A 1 295 ? 9.093   67.939 340.329 1.00 47.07  ? 296  ARG A NH2 1 
ATOM   2236 N N   . PHE A 1 296 ? 6.772   69.807 347.954 1.00 33.08  ? 297  PHE A N   1 
ATOM   2237 C CA  . PHE A 1 296 ? 6.497   69.897 349.382 1.00 35.52  ? 297  PHE A CA  1 
ATOM   2238 C C   . PHE A 1 296 ? 7.789   69.790 350.178 1.00 36.09  ? 297  PHE A C   1 
ATOM   2239 O O   . PHE A 1 296 ? 8.680   69.005 349.838 1.00 43.24  ? 297  PHE A O   1 
ATOM   2240 C CB  . PHE A 1 296 ? 5.505   68.810 349.806 1.00 34.33  ? 297  PHE A CB  1 
ATOM   2241 C CG  . PHE A 1 296 ? 4.429   68.558 348.788 1.00 36.51  ? 297  PHE A CG  1 
ATOM   2242 C CD1 . PHE A 1 296 ? 4.381   67.364 348.087 1.00 33.02  ? 297  PHE A CD1 1 
ATOM   2243 C CD2 . PHE A 1 296 ? 3.481   69.531 348.511 1.00 36.60  ? 297  PHE A CD2 1 
ATOM   2244 C CE1 . PHE A 1 296 ? 3.395   67.139 347.138 1.00 36.90  ? 297  PHE A CE1 1 
ATOM   2245 C CE2 . PHE A 1 296 ? 2.494   69.312 347.564 1.00 44.67  ? 297  PHE A CE2 1 
ATOM   2246 C CZ  . PHE A 1 296 ? 2.452   68.114 346.877 1.00 28.35  ? 297  PHE A CZ  1 
ATOM   2247 N N   . SER A 1 297 ? 7.872   70.575 351.254 1.00 37.05  ? 298  SER A N   1 
ATOM   2248 C CA  . SER A 1 297 ? 9.142   70.775 351.945 1.00 41.17  ? 298  SER A CA  1 
ATOM   2249 C C   . SER A 1 297 ? 9.631   69.499 352.615 1.00 39.87  ? 298  SER A C   1 
ATOM   2250 O O   . SER A 1 297 ? 10.795  69.112 352.460 1.00 42.25  ? 298  SER A O   1 
ATOM   2251 C CB  . SER A 1 297 ? 9.004   71.894 352.974 1.00 35.68  ? 298  SER A CB  1 
ATOM   2252 O OG  . SER A 1 297 ? 8.824   73.142 352.333 1.00 47.59  ? 298  SER A OG  1 
ATOM   2253 N N   . PHE A 1 298 ? 8.766   68.838 353.375 1.00 30.05  ? 299  PHE A N   1 
ATOM   2254 C CA  . PHE A 1 298 ? 9.169   67.701 354.191 1.00 34.46  ? 299  PHE A CA  1 
ATOM   2255 C C   . PHE A 1 298 ? 8.372   66.482 353.751 1.00 39.61  ? 299  PHE A C   1 
ATOM   2256 O O   . PHE A 1 298 ? 7.151   66.424 353.940 1.00 43.79  ? 299  PHE A O   1 
ATOM   2257 C CB  . PHE A 1 298 ? 8.985   68.021 355.672 1.00 35.48  ? 299  PHE A CB  1 
ATOM   2258 C CG  . PHE A 1 298 ? 9.812   69.189 356.124 1.00 37.45  ? 299  PHE A CG  1 
ATOM   2259 C CD1 . PHE A 1 298 ? 11.174  69.042 356.342 1.00 37.02  ? 299  PHE A CD1 1 
ATOM   2260 C CD2 . PHE A 1 298 ? 9.243   70.442 356.288 1.00 34.94  ? 299  PHE A CD2 1 
ATOM   2261 C CE1 . PHE A 1 298 ? 11.950  70.116 356.738 1.00 31.21  ? 299  PHE A CE1 1 
ATOM   2262 C CE2 . PHE A 1 298 ? 10.012  71.523 356.687 1.00 36.24  ? 299  PHE A CE2 1 
ATOM   2263 C CZ  . PHE A 1 298 ? 11.368  71.360 356.911 1.00 42.98  ? 299  PHE A CZ  1 
ATOM   2264 N N   . VAL A 1 299 ? 9.069   65.521 353.156 1.00 32.34  ? 300  VAL A N   1 
ATOM   2265 C CA  . VAL A 1 299 ? 8.467   64.336 352.553 1.00 33.54  ? 300  VAL A CA  1 
ATOM   2266 C C   . VAL A 1 299 ? 9.328   63.146 352.965 1.00 35.47  ? 300  VAL A C   1 
ATOM   2267 O O   . VAL A 1 299 ? 10.398  63.351 353.555 1.00 30.91  ? 300  VAL A O   1 
ATOM   2268 C CB  . VAL A 1 299 ? 8.380   64.475 351.023 1.00 37.71  ? 300  VAL A CB  1 
ATOM   2269 C CG1 . VAL A 1 299 ? 7.449   65.621 350.634 1.00 24.55  ? 300  VAL A CG1 1 
ATOM   2270 C CG2 . VAL A 1 299 ? 9.770   64.674 350.432 1.00 32.82  ? 300  VAL A CG2 1 
ATOM   2271 N N   . PRO A 1 300 ? 8.910   61.905 352.704 1.00 35.90  ? 301  PRO A N   1 
ATOM   2272 C CA  . PRO A 1 300 ? 9.771   60.758 353.020 1.00 28.49  ? 301  PRO A CA  1 
ATOM   2273 C C   . PRO A 1 300 ? 11.168  60.911 352.430 1.00 39.04  ? 301  PRO A C   1 
ATOM   2274 O O   . PRO A 1 300 ? 11.354  61.487 351.356 1.00 37.34  ? 301  PRO A O   1 
ATOM   2275 C CB  . PRO A 1 300 ? 9.021   59.578 352.397 1.00 29.21  ? 301  PRO A CB  1 
ATOM   2276 C CG  . PRO A 1 300 ? 7.584   59.977 352.487 1.00 30.16  ? 301  PRO A CG  1 
ATOM   2277 C CD  . PRO A 1 300 ? 7.541   61.479 352.346 1.00 26.07  ? 301  PRO A CD  1 
ATOM   2278 N N   . VAL A 1 301 ? 12.160  60.397 353.152 1.00 36.24  ? 302  VAL A N   1 
ATOM   2279 C CA  . VAL A 1 301 ? 13.562  60.515 352.773 1.00 40.50  ? 302  VAL A CA  1 
ATOM   2280 C C   . VAL A 1 301 ? 14.110  59.127 352.474 1.00 43.06  ? 302  VAL A C   1 
ATOM   2281 O O   . VAL A 1 301 ? 13.811  58.160 353.187 1.00 43.15  ? 302  VAL A O   1 
ATOM   2282 C CB  . VAL A 1 301 ? 14.384  61.218 353.874 1.00 38.82  ? 302  VAL A CB  1 
ATOM   2283 C CG1 . VAL A 1 301 ? 14.231  60.499 355.207 1.00 43.73  ? 302  VAL A CG1 1 
ATOM   2284 C CG2 . VAL A 1 301 ? 15.847  61.311 353.479 1.00 46.73  ? 302  VAL A CG2 1 
ATOM   2285 N N   . VAL A 1 302 ? 14.896  59.025 351.403 1.00 43.48  ? 303  VAL A N   1 
ATOM   2286 C CA  . VAL A 1 302 ? 15.553  57.776 351.028 1.00 49.24  ? 303  VAL A CA  1 
ATOM   2287 C C   . VAL A 1 302 ? 16.870  57.718 351.796 1.00 55.89  ? 303  VAL A C   1 
ATOM   2288 O O   . VAL A 1 302 ? 17.850  58.362 351.420 1.00 51.65  ? 303  VAL A O   1 
ATOM   2289 C CB  . VAL A 1 302 ? 15.774  57.681 349.518 1.00 49.90  ? 303  VAL A CB  1 
ATOM   2290 C CG1 . VAL A 1 302 ? 16.345  56.319 349.153 1.00 50.02  ? 303  VAL A CG1 1 
ATOM   2291 C CG2 . VAL A 1 302 ? 14.475  57.942 348.768 1.00 41.94  ? 303  VAL A CG2 1 
ATOM   2292 N N   . ASP A 1 303 ? 16.894  56.938 352.882 1.00 49.29  ? 304  ASP A N   1 
ATOM   2293 C CA  . ASP A 1 303 ? 18.060  56.879 353.755 1.00 57.60  ? 304  ASP A CA  1 
ATOM   2294 C C   . ASP A 1 303 ? 18.536  55.456 354.032 1.00 50.54  ? 304  ASP A C   1 
ATOM   2295 O O   . ASP A 1 303 ? 19.352  55.258 354.939 1.00 67.25  ? 304  ASP A O   1 
ATOM   2296 C CB  . ASP A 1 303 ? 17.770  57.593 355.082 1.00 60.58  ? 304  ASP A CB  1 
ATOM   2297 C CG  . ASP A 1 303 ? 16.724  56.876 355.914 1.00 58.59  ? 304  ASP A CG  1 
ATOM   2298 O OD1 . ASP A 1 303 ? 15.896  56.140 355.335 1.00 53.64  ? 304  ASP A OD1 1 
ATOM   2299 O OD2 . ASP A 1 303 ? 16.729  57.049 357.152 1.00 77.91  ? 304  ASP A OD2 1 
ATOM   2300 N N   . GLY A 1 304 ? 18.053  54.462 353.288 1.00 47.37  ? 305  GLY A N   1 
ATOM   2301 C CA  . GLY A 1 304 ? 18.492  53.095 353.463 1.00 50.94  ? 305  GLY A CA  1 
ATOM   2302 C C   . GLY A 1 304 ? 17.763  52.308 354.532 1.00 60.68  ? 305  GLY A C   1 
ATOM   2303 O O   . GLY A 1 304 ? 17.979  51.093 354.636 1.00 68.55  ? 305  GLY A O   1 
ATOM   2304 N N   . ASP A 1 305 ? 16.906  52.949 355.326 1.00 56.12  ? 306  ASP A N   1 
ATOM   2305 C CA  . ASP A 1 305 ? 16.198  52.253 356.394 1.00 58.93  ? 306  ASP A CA  1 
ATOM   2306 C C   . ASP A 1 305 ? 14.790  51.862 355.961 1.00 53.45  ? 306  ASP A C   1 
ATOM   2307 O O   . ASP A 1 305 ? 14.567  50.727 355.527 1.00 50.26  ? 306  ASP A O   1 
ATOM   2308 C CB  . ASP A 1 305 ? 16.149  53.118 357.653 1.00 56.73  ? 306  ASP A CB  1 
ATOM   2309 C CG  . ASP A 1 305 ? 15.673  52.348 358.867 1.00 69.48  ? 306  ASP A CG  1 
ATOM   2310 O OD1 . ASP A 1 305 ? 15.495  51.116 358.760 1.00 74.85  ? 306  ASP A OD1 1 
ATOM   2311 O OD2 . ASP A 1 305 ? 15.482  52.974 359.931 1.00 79.38  ? 306  ASP A OD2 1 
ATOM   2312 N N   . PHE A 1 306 ? 13.832  52.785 356.091 1.00 48.38  ? 307  PHE A N   1 
ATOM   2313 C CA  . PHE A 1 306 ? 12.479  52.512 355.611 1.00 44.42  ? 307  PHE A CA  1 
ATOM   2314 C C   . PHE A 1 306 ? 12.493  52.171 354.127 1.00 50.00  ? 307  PHE A C   1 
ATOM   2315 O O   . PHE A 1 306 ? 11.851  51.208 353.692 1.00 49.36  ? 307  PHE A O   1 
ATOM   2316 C CB  . PHE A 1 306 ? 11.565  53.710 355.882 1.00 43.37  ? 307  PHE A CB  1 
ATOM   2317 C CG  . PHE A 1 306 ? 10.095  53.370 355.861 1.00 41.81  ? 307  PHE A CG  1 
ATOM   2318 C CD1 . PHE A 1 306 ? 9.420   53.220 354.660 1.00 44.10  ? 307  PHE A CD1 1 
ATOM   2319 C CD2 . PHE A 1 306 ? 9.392   53.199 357.042 1.00 42.58  ? 307  PHE A CD2 1 
ATOM   2320 C CE1 . PHE A 1 306 ? 8.072   52.902 354.638 1.00 41.13  ? 307  PHE A CE1 1 
ATOM   2321 C CE2 . PHE A 1 306 ? 8.045   52.885 357.025 1.00 46.70  ? 307  PHE A CE2 1 
ATOM   2322 C CZ  . PHE A 1 306 ? 7.384   52.737 355.821 1.00 45.71  ? 307  PHE A CZ  1 
ATOM   2323 N N   . LEU A 1 307 ? 13.228  52.953 353.337 1.00 46.60  ? 308  LEU A N   1 
ATOM   2324 C CA  . LEU A 1 307 ? 13.454  52.683 351.921 1.00 57.69  ? 308  LEU A CA  1 
ATOM   2325 C C   . LEU A 1 307 ? 14.918  52.298 351.750 1.00 61.06  ? 308  LEU A C   1 
ATOM   2326 O O   . LEU A 1 307 ? 15.805  53.150 351.855 1.00 50.75  ? 308  LEU A O   1 
ATOM   2327 C CB  . LEU A 1 307 ? 13.097  53.895 351.062 1.00 40.38  ? 308  LEU A CB  1 
ATOM   2328 C CG  . LEU A 1 307 ? 11.722  54.521 351.289 1.00 51.54  ? 308  LEU A CG  1 
ATOM   2329 C CD1 . LEU A 1 307 ? 11.634  55.916 350.677 1.00 39.86  ? 308  LEU A CD1 1 
ATOM   2330 C CD2 . LEU A 1 307 ? 10.641  53.610 350.727 1.00 41.25  ? 308  LEU A CD2 1 
ATOM   2331 N N   . SER A 1 308 ? 15.165  51.012 351.502 1.00 57.07  ? 309  SER A N   1 
ATOM   2332 C CA  . SER A 1 308 ? 16.528  50.542 351.278 1.00 58.07  ? 309  SER A CA  1 
ATOM   2333 C C   . SER A 1 308 ? 17.198  51.283 350.128 1.00 62.25  ? 309  SER A C   1 
ATOM   2334 O O   . SER A 1 308 ? 18.419  51.483 350.139 1.00 77.96  ? 309  SER A O   1 
ATOM   2335 C CB  . SER A 1 308 ? 16.510  49.043 350.997 1.00 49.16  ? 309  SER A CB  1 
ATOM   2336 O OG  . SER A 1 308 ? 16.534  48.815 349.599 1.00 83.92  ? 309  SER A OG  1 
ATOM   2337 N N   . ASP A 1 309 ? 16.417  51.684 349.129 1.00 55.42  ? 310  ASP A N   1 
ATOM   2338 C CA  . ASP A 1 309 ? 16.904  52.430 347.980 1.00 59.21  ? 310  ASP A CA  1 
ATOM   2339 C C   . ASP A 1 309 ? 15.765  53.329 347.510 1.00 58.29  ? 310  ASP A C   1 
ATOM   2340 O O   . ASP A 1 309 ? 14.702  53.389 348.135 1.00 54.62  ? 310  ASP A O   1 
ATOM   2341 C CB  . ASP A 1 309 ? 17.396  51.472 346.885 1.00 67.16  ? 310  ASP A CB  1 
ATOM   2342 C CG  . ASP A 1 309 ? 18.209  52.169 345.801 1.00 73.11  ? 310  ASP A CG  1 
ATOM   2343 O OD1 . ASP A 1 309 ? 18.354  53.410 345.852 1.00 78.73  ? 310  ASP A OD1 1 
ATOM   2344 O OD2 . ASP A 1 309 ? 18.710  51.466 344.897 1.00 80.35  ? 310  ASP A OD2 1 
ATOM   2345 N N   . THR A 1 310 ? 15.990  54.038 346.406 1.00 50.10  ? 311  THR A N   1 
ATOM   2346 C CA  . THR A 1 310 ? 14.940  54.863 345.832 1.00 50.00  ? 311  THR A CA  1 
ATOM   2347 C C   . THR A 1 310 ? 13.741  53.993 345.454 1.00 56.07  ? 311  THR A C   1 
ATOM   2348 O O   . THR A 1 310 ? 13.898  52.810 345.136 1.00 51.98  ? 311  THR A O   1 
ATOM   2349 C CB  . THR A 1 310 ? 15.447  55.604 344.598 1.00 48.42  ? 311  THR A CB  1 
ATOM   2350 O OG1 . THR A 1 310 ? 15.831  54.649 343.603 1.00 61.21  ? 311  THR A OG1 1 
ATOM   2351 C CG2 . THR A 1 310 ? 16.645  56.474 344.947 1.00 48.76  ? 311  THR A CG2 1 
ATOM   2352 N N   . PRO A 1 311 ? 12.526  54.550 345.499 1.00 47.78  ? 312  PRO A N   1 
ATOM   2353 C CA  . PRO A 1 311 ? 11.351  53.753 345.107 1.00 51.25  ? 312  PRO A CA  1 
ATOM   2354 C C   . PRO A 1 311 ? 11.449  53.199 343.698 1.00 51.09  ? 312  PRO A C   1 
ATOM   2355 O O   . PRO A 1 311 ? 10.999  52.075 343.444 1.00 50.16  ? 312  PRO A O   1 
ATOM   2356 C CB  . PRO A 1 311 ? 10.191  54.748 345.256 1.00 47.64  ? 312  PRO A CB  1 
ATOM   2357 C CG  . PRO A 1 311 ? 10.676  55.736 346.275 1.00 49.18  ? 312  PRO A CG  1 
ATOM   2358 C CD  . PRO A 1 311 ? 12.154  55.864 346.052 1.00 44.13  ? 312  PRO A CD  1 
ATOM   2359 N N   . GLU A 1 312 ? 12.046  53.952 342.773 1.00 55.17  ? 313  GLU A N   1 
ATOM   2360 C CA  . GLU A 1 312 ? 12.173  53.470 341.402 1.00 57.43  ? 313  GLU A CA  1 
ATOM   2361 C C   . GLU A 1 312 ? 13.056  52.229 341.329 1.00 57.83  ? 313  GLU A C   1 
ATOM   2362 O O   . GLU A 1 312 ? 12.725  51.263 340.633 1.00 54.72  ? 313  GLU A O   1 
ATOM   2363 C CB  . GLU A 1 312 ? 12.724  54.578 340.509 1.00 65.56  ? 313  GLU A CB  1 
ATOM   2364 C CG  . GLU A 1 312 ? 12.858  54.175 339.056 1.00 84.81  ? 313  GLU A CG  1 
ATOM   2365 C CD  . GLU A 1 312 ? 13.302  55.321 338.175 1.00 104.14 ? 313  GLU A CD  1 
ATOM   2366 O OE1 . GLU A 1 312 ? 14.527  55.499 338.004 1.00 109.29 ? 313  GLU A OE1 1 
ATOM   2367 O OE2 . GLU A 1 312 ? 12.427  56.043 337.652 1.00 113.53 ? 313  GLU A OE2 1 
ATOM   2368 N N   . ALA A 1 313 ? 14.182  52.233 342.047 1.00 48.26  ? 314  ALA A N   1 
ATOM   2369 C CA  . ALA A 1 313 ? 15.056  51.065 342.048 1.00 52.17  ? 314  ALA A CA  1 
ATOM   2370 C C   . ALA A 1 313 ? 14.381  49.864 342.701 1.00 60.85  ? 314  ALA A C   1 
ATOM   2371 O O   . ALA A 1 313 ? 14.528  48.730 342.229 1.00 66.10  ? 314  ALA A O   1 
ATOM   2372 C CB  . ALA A 1 313 ? 16.370  51.392 342.757 1.00 46.63  ? 314  ALA A CB  1 
ATOM   2373 N N   . LEU A 1 314 ? 13.639  50.091 343.788 1.00 64.74  ? 315  LEU A N   1 
ATOM   2374 C CA  . LEU A 1 314 ? 12.942  48.993 344.450 1.00 53.64  ? 315  LEU A CA  1 
ATOM   2375 C C   . LEU A 1 314 ? 11.815  48.449 343.580 1.00 51.71  ? 315  LEU A C   1 
ATOM   2376 O O   . LEU A 1 314 ? 11.548  47.242 343.580 1.00 47.66  ? 315  LEU A O   1 
ATOM   2377 C CB  . LEU A 1 314 ? 12.401  49.456 345.802 1.00 52.15  ? 315  LEU A CB  1 
ATOM   2378 C CG  . LEU A 1 314 ? 13.454  49.870 346.830 1.00 59.13  ? 315  LEU A CG  1 
ATOM   2379 C CD1 . LEU A 1 314 ? 12.797  50.481 348.057 1.00 53.11  ? 315  LEU A CD1 1 
ATOM   2380 C CD2 . LEU A 1 314 ? 14.310  48.675 347.215 1.00 50.91  ? 315  LEU A CD2 1 
ATOM   2381 N N   . ILE A 1 315 ? 11.142  49.328 342.835 1.00 48.99  ? 316  ILE A N   1 
ATOM   2382 C CA  . ILE A 1 315 ? 10.082  48.883 341.935 1.00 53.85  ? 316  ILE A CA  1 
ATOM   2383 C C   . ILE A 1 315 ? 10.657  48.003 340.832 1.00 57.80  ? 316  ILE A C   1 
ATOM   2384 O O   . ILE A 1 315 ? 10.091  46.957 340.492 1.00 54.30  ? 316  ILE A O   1 
ATOM   2385 C CB  . ILE A 1 315 ? 9.329   50.101 341.364 1.00 47.49  ? 316  ILE A CB  1 
ATOM   2386 C CG1 . ILE A 1 315 ? 8.415   50.712 342.429 1.00 46.81  ? 316  ILE A CG1 1 
ATOM   2387 C CG2 . ILE A 1 315 ? 8.516   49.713 340.147 1.00 39.30  ? 316  ILE A CG2 1 
ATOM   2388 C CD1 . ILE A 1 315 ? 7.949   52.113 342.092 1.00 41.68  ? 316  ILE A CD1 1 
ATOM   2389 N N   . ASN A 1 316 ? 11.803  48.401 340.271 1.00 62.44  ? 317  ASN A N   1 
ATOM   2390 C CA  . ASN A 1 316 ? 12.390  47.652 339.164 1.00 67.97  ? 317  ASN A CA  1 
ATOM   2391 C C   . ASN A 1 316 ? 12.966  46.317 339.620 1.00 63.50  ? 317  ASN A C   1 
ATOM   2392 O O   . ASN A 1 316 ? 12.949  45.345 338.857 1.00 67.28  ? 317  ASN A O   1 
ATOM   2393 C CB  . ASN A 1 316 ? 13.476  48.486 338.482 1.00 52.06  ? 317  ASN A CB  1 
ATOM   2394 C CG  . ASN A 1 316 ? 12.930  49.746 337.838 1.00 56.26  ? 317  ASN A CG  1 
ATOM   2395 O OD1 . ASN A 1 316 ? 11.756  49.813 337.474 1.00 62.44  ? 317  ASN A OD1 1 
ATOM   2396 N ND2 . ASN A 1 316 ? 13.784  50.753 337.690 1.00 57.04  ? 317  ASN A ND2 1 
ATOM   2397 N N   . ALA A 1 317 ? 13.475  46.247 340.848 1.00 60.07  ? 318  ALA A N   1 
ATOM   2398 C CA  . ALA A 1 317 ? 14.113  45.046 341.365 1.00 65.43  ? 318  ALA A CA  1 
ATOM   2399 C C   . ALA A 1 317 ? 13.174  44.186 342.200 1.00 71.50  ? 318  ALA A C   1 
ATOM   2400 O O   . ALA A 1 317 ? 13.622  43.206 342.804 1.00 72.13  ? 318  ALA A O   1 
ATOM   2401 C CB  . ALA A 1 317 ? 15.343  45.422 342.194 1.00 62.40  ? 318  ALA A CB  1 
ATOM   2402 N N   . GLY A 1 318 ? 11.889  44.521 342.247 1.00 62.15  ? 319  GLY A N   1 
ATOM   2403 C CA  . GLY A 1 318 ? 10.964  43.829 343.120 1.00 60.15  ? 319  GLY A CA  1 
ATOM   2404 C C   . GLY A 1 318 ? 10.271  42.654 342.453 1.00 63.95  ? 319  GLY A C   1 
ATOM   2405 O O   . GLY A 1 318 ? 10.005  42.659 341.255 1.00 57.01  ? 319  GLY A O   1 
ATOM   2406 N N   . ASP A 1 319 ? 9.986   41.636 343.260 1.00 64.24  ? 320  ASP A N   1 
ATOM   2407 C CA  . ASP A 1 319 ? 9.197   40.480 342.847 1.00 59.22  ? 320  ASP A CA  1 
ATOM   2408 C C   . ASP A 1 319 ? 7.823   40.615 343.490 1.00 62.85  ? 320  ASP A C   1 
ATOM   2409 O O   . ASP A 1 319 ? 7.697   40.554 344.718 1.00 67.29  ? 320  ASP A O   1 
ATOM   2410 C CB  . ASP A 1 319 ? 9.876   39.174 343.254 1.00 69.42  ? 320  ASP A CB  1 
ATOM   2411 C CG  . ASP A 1 319 ? 9.043   37.951 342.917 1.00 72.85  ? 320  ASP A CG  1 
ATOM   2412 O OD1 . ASP A 1 319 ? 8.192   38.034 342.006 1.00 71.69  ? 320  ASP A OD1 1 
ATOM   2413 O OD2 . ASP A 1 319 ? 9.240   36.903 343.567 1.00 87.63  ? 320  ASP A OD2 1 
ATOM   2414 N N   . PHE A 1 320 ? 6.797   40.799 342.661 1.00 56.32  ? 321  PHE A N   1 
ATOM   2415 C CA  . PHE A 1 320 ? 5.455   41.109 343.135 1.00 55.20  ? 321  PHE A CA  1 
ATOM   2416 C C   . PHE A 1 320 ? 4.462   39.988 342.841 1.00 57.94  ? 321  PHE A C   1 
ATOM   2417 O O   . PHE A 1 320 ? 3.275   40.244 342.624 1.00 63.80  ? 321  PHE A O   1 
ATOM   2418 C CB  . PHE A 1 320 ? 4.978   42.428 342.529 1.00 54.21  ? 321  PHE A CB  1 
ATOM   2419 C CG  . PHE A 1 320 ? 5.909   43.580 342.786 1.00 55.20  ? 321  PHE A CG  1 
ATOM   2420 C CD1 . PHE A 1 320 ? 5.864   44.272 343.986 1.00 47.01  ? 321  PHE A CD1 1 
ATOM   2421 C CD2 . PHE A 1 320 ? 6.836   43.964 341.832 1.00 48.83  ? 321  PHE A CD2 1 
ATOM   2422 C CE1 . PHE A 1 320 ? 6.723   45.329 344.226 1.00 50.47  ? 321  PHE A CE1 1 
ATOM   2423 C CE2 . PHE A 1 320 ? 7.699   45.020 342.066 1.00 49.91  ? 321  PHE A CE2 1 
ATOM   2424 C CZ  . PHE A 1 320 ? 7.642   45.703 343.264 1.00 48.82  ? 321  PHE A CZ  1 
ATOM   2425 N N   . HIS A 1 321 ? 4.932   38.745 342.835 1.00 58.12  ? 322  HIS A N   1 
ATOM   2426 C CA  . HIS A 1 321 ? 4.030   37.613 342.679 1.00 57.91  ? 322  HIS A CA  1 
ATOM   2427 C C   . HIS A 1 321 ? 3.197   37.426 343.941 1.00 66.75  ? 322  HIS A C   1 
ATOM   2428 O O   . HIS A 1 321 ? 3.710   37.502 345.062 1.00 60.93  ? 322  HIS A O   1 
ATOM   2429 C CB  . HIS A 1 321 ? 4.819   36.342 342.366 1.00 63.27  ? 322  HIS A CB  1 
ATOM   2430 C CG  . HIS A 1 321 ? 5.120   36.165 340.910 1.00 75.74  ? 322  HIS A CG  1 
ATOM   2431 N ND1 . HIS A 1 321 ? 6.311   36.564 340.342 1.00 65.68  ? 322  HIS A ND1 1 
ATOM   2432 C CD2 . HIS A 1 321 ? 4.380   35.640 339.905 1.00 64.26  ? 322  HIS A CD2 1 
ATOM   2433 C CE1 . HIS A 1 321 ? 6.294   36.288 339.050 1.00 68.30  ? 322  HIS A CE1 1 
ATOM   2434 N NE2 . HIS A 1 321 ? 5.134   35.728 338.759 1.00 71.01  ? 322  HIS A NE2 1 
ATOM   2435 N N   . GLY A 1 322 ? 1.903   37.188 343.753 1.00 65.68  ? 323  GLY A N   1 
ATOM   2436 C CA  . GLY A 1 322 ? 0.974   37.081 344.858 1.00 61.77  ? 323  GLY A CA  1 
ATOM   2437 C C   . GLY A 1 322 ? 0.353   38.386 345.301 1.00 61.52  ? 323  GLY A C   1 
ATOM   2438 O O   . GLY A 1 322 ? -0.307  38.415 346.347 1.00 67.67  ? 323  GLY A O   1 
ATOM   2439 N N   . LEU A 1 323 ? 0.535   39.461 344.540 1.00 65.05  ? 324  LEU A N   1 
ATOM   2440 C CA  . LEU A 1 323 ? 0.063   40.788 344.908 1.00 61.90  ? 324  LEU A CA  1 
ATOM   2441 C C   . LEU A 1 323 ? -0.934  41.281 343.871 1.00 53.83  ? 324  LEU A C   1 
ATOM   2442 O O   . LEU A 1 323 ? -0.698  41.151 342.665 1.00 67.31  ? 324  LEU A O   1 
ATOM   2443 C CB  . LEU A 1 323 ? 1.233   41.767 345.024 1.00 59.13  ? 324  LEU A CB  1 
ATOM   2444 C CG  . LEU A 1 323 ? 0.881   43.249 345.165 1.00 60.73  ? 324  LEU A CG  1 
ATOM   2445 C CD1 . LEU A 1 323 ? 0.271   43.539 346.532 1.00 51.36  ? 324  LEU A CD1 1 
ATOM   2446 C CD2 . LEU A 1 323 ? 2.111   44.110 344.925 1.00 53.18  ? 324  LEU A CD2 1 
ATOM   2447 N N   . GLN A 1 324 ? -2.047  41.835 344.342 1.00 54.69  ? 325  GLN A N   1 
ATOM   2448 C CA  . GLN A 1 324 ? -3.039  42.480 343.495 1.00 49.35  ? 325  GLN A CA  1 
ATOM   2449 C C   . GLN A 1 324 ? -3.081  43.964 343.832 1.00 47.68  ? 325  GLN A C   1 
ATOM   2450 O O   . GLN A 1 324 ? -3.057  44.341 345.007 1.00 46.43  ? 325  GLN A O   1 
ATOM   2451 C CB  . GLN A 1 324 ? -4.425  41.852 343.680 1.00 57.13  ? 325  GLN A CB  1 
ATOM   2452 C CG  . GLN A 1 324 ? -4.470  40.347 343.447 1.00 51.45  ? 325  GLN A CG  1 
ATOM   2453 C CD  . GLN A 1 324 ? -4.149  39.557 344.701 1.00 66.33  ? 325  GLN A CD  1 
ATOM   2454 O OE1 . GLN A 1 324 ? -4.706  39.814 345.768 1.00 59.51  ? 325  GLN A OE1 1 
ATOM   2455 N NE2 . GLN A 1 324 ? -3.242  38.593 344.579 1.00 67.86  ? 325  GLN A NE2 1 
ATOM   2456 N N   . VAL A 1 325 ? -3.123  44.804 342.802 1.00 41.17  ? 326  VAL A N   1 
ATOM   2457 C CA  . VAL A 1 325 ? -3.028  46.250 342.969 1.00 40.90  ? 326  VAL A CA  1 
ATOM   2458 C C   . VAL A 1 325 ? -4.035  46.920 342.045 1.00 41.24  ? 326  VAL A C   1 
ATOM   2459 O O   . VAL A 1 325 ? -4.207  46.511 340.893 1.00 47.55  ? 326  VAL A O   1 
ATOM   2460 C CB  . VAL A 1 325 ? -1.596  46.761 342.687 1.00 45.23  ? 326  VAL A CB  1 
ATOM   2461 C CG1 . VAL A 1 325 ? -1.562  48.270 342.670 1.00 46.46  ? 326  VAL A CG1 1 
ATOM   2462 C CG2 . VAL A 1 325 ? -0.620  46.240 343.726 1.00 54.11  ? 326  VAL A CG2 1 
ATOM   2463 N N   . LEU A 1 326 ? -4.706  47.949 342.559 1.00 39.55  ? 327  LEU A N   1 
ATOM   2464 C CA  . LEU A 1 326 ? -5.644  48.763 341.796 1.00 31.31  ? 327  LEU A CA  1 
ATOM   2465 C C   . LEU A 1 326 ? -5.124  50.194 341.777 1.00 37.39  ? 327  LEU A C   1 
ATOM   2466 O O   . LEU A 1 326 ? -4.928  50.797 342.837 1.00 39.60  ? 327  LEU A O   1 
ATOM   2467 C CB  . LEU A 1 326 ? -7.045  48.694 342.412 1.00 40.35  ? 327  LEU A CB  1 
ATOM   2468 C CG  . LEU A 1 326 ? -8.137  49.582 341.813 1.00 44.02  ? 327  LEU A CG  1 
ATOM   2469 C CD1 . LEU A 1 326 ? -8.442  49.156 340.400 1.00 53.62  ? 327  LEU A CD1 1 
ATOM   2470 C CD2 . LEU A 1 326 ? -9.397  49.545 342.660 1.00 41.07  ? 327  LEU A CD2 1 
ATOM   2471 N N   . VAL A 1 327 ? -4.888  50.733 340.578 1.00 40.24  ? 328  VAL A N   1 
ATOM   2472 C CA  . VAL A 1 327 ? -4.314  52.063 340.412 1.00 42.18  ? 328  VAL A CA  1 
ATOM   2473 C C   . VAL A 1 327 ? -5.199  52.875 339.478 1.00 40.42  ? 328  VAL A C   1 
ATOM   2474 O O   . VAL A 1 327 ? -5.979  52.332 338.693 1.00 41.76  ? 328  VAL A O   1 
ATOM   2475 C CB  . VAL A 1 327 ? -2.869  52.021 339.862 1.00 44.36  ? 328  VAL A CB  1 
ATOM   2476 C CG1 . VAL A 1 327 ? -1.970  51.225 340.784 1.00 36.63  ? 328  VAL A CG1 1 
ATOM   2477 C CG2 . VAL A 1 327 ? -2.850  51.438 338.455 1.00 36.49  ? 328  VAL A CG2 1 
ATOM   2478 N N   . GLY A 1 328 ? -5.059  54.192 339.558 1.00 30.02  ? 329  GLY A N   1 
ATOM   2479 C CA  . GLY A 1 328 ? -5.852  55.057 338.705 1.00 30.09  ? 329  GLY A CA  1 
ATOM   2480 C C   . GLY A 1 328 ? -5.551  56.515 338.966 1.00 31.56  ? 329  GLY A C   1 
ATOM   2481 O O   . GLY A 1 328 ? -4.809  56.872 339.887 1.00 38.32  ? 329  GLY A O   1 
ATOM   2482 N N   . VAL A 1 329 ? -6.150  57.359 338.123 1.00 30.24  ? 330  VAL A N   1 
ATOM   2483 C CA  . VAL A 1 329 ? -5.960  58.803 338.147 1.00 33.19  ? 330  VAL A CA  1 
ATOM   2484 C C   . VAL A 1 329 ? -7.290  59.456 337.790 1.00 37.95  ? 330  VAL A C   1 
ATOM   2485 O O   . VAL A 1 329 ? -8.216  58.805 337.305 1.00 42.27  ? 330  VAL A O   1 
ATOM   2486 C CB  . VAL A 1 329 ? -4.860  59.265 337.162 1.00 38.48  ? 330  VAL A CB  1 
ATOM   2487 C CG1 . VAL A 1 329 ? -3.511  58.642 337.506 1.00 32.12  ? 330  VAL A CG1 1 
ATOM   2488 C CG2 . VAL A 1 329 ? -5.254  58.925 335.730 1.00 30.88  ? 330  VAL A CG2 1 
ATOM   2489 N N   . VAL A 1 330 ? -7.376  60.765 338.027 1.00 40.27  ? 331  VAL A N   1 
ATOM   2490 C CA  . VAL A 1 330 ? -8.519  61.542 337.557 1.00 41.87  ? 331  VAL A CA  1 
ATOM   2491 C C   . VAL A 1 330 ? -8.184  62.110 336.183 1.00 42.92  ? 331  VAL A C   1 
ATOM   2492 O O   . VAL A 1 330 ? -7.035  62.037 335.736 1.00 42.34  ? 331  VAL A O   1 
ATOM   2493 C CB  . VAL A 1 330 ? -8.896  62.663 338.541 1.00 37.57  ? 331  VAL A CB  1 
ATOM   2494 C CG1 . VAL A 1 330 ? -9.229  62.079 339.910 1.00 39.23  ? 331  VAL A CG1 1 
ATOM   2495 C CG2 . VAL A 1 330 ? -7.778  63.688 338.632 1.00 33.43  ? 331  VAL A CG2 1 
ATOM   2496 N N   . LYS A 1 331 ? -9.182  62.693 335.510 1.00 37.12  ? 332  LYS A N   1 
ATOM   2497 C CA  . LYS A 1 331 ? -8.989  63.142 334.135 1.00 44.86  ? 332  LYS A CA  1 
ATOM   2498 C C   . LYS A 1 331 ? -8.063  64.352 334.049 1.00 43.65  ? 332  LYS A C   1 
ATOM   2499 O O   . LYS A 1 331 ? -7.337  64.501 333.061 1.00 39.21  ? 332  LYS A O   1 
ATOM   2500 C CB  . LYS A 1 331 ? -10.341 63.462 333.494 1.00 47.91  ? 332  LYS A CB  1 
ATOM   2501 C CG  . LYS A 1 331 ? -10.270 63.799 332.009 1.00 47.78  ? 332  LYS A CG  1 
ATOM   2502 C CD  . LYS A 1 331 ? -11.659 63.922 331.390 1.00 66.33  ? 332  LYS A CD  1 
ATOM   2503 C CE  . LYS A 1 331 ? -12.450 65.073 332.005 1.00 77.35  ? 332  LYS A CE  1 
ATOM   2504 N NZ  . LYS A 1 331 ? -11.839 66.408 331.737 1.00 63.68  ? 332  LYS A NZ  1 
ATOM   2505 N N   . ASP A 1 332 ? -8.065  65.222 335.064 1.00 39.18  ? 333  ASP A N   1 
ATOM   2506 C CA  . ASP A 1 332 ? -7.280  66.463 335.041 1.00 40.87  ? 333  ASP A CA  1 
ATOM   2507 C C   . ASP A 1 332 ? -6.479  66.560 336.337 1.00 41.65  ? 333  ASP A C   1 
ATOM   2508 O O   . ASP A 1 332 ? -6.849  67.283 337.265 1.00 47.24  ? 333  ASP A O   1 
ATOM   2509 C CB  . ASP A 1 332 ? -8.188  67.663 334.837 1.00 46.73  ? 333  ASP A CB  1 
ATOM   2510 C CG  . ASP A 1 332 ? -9.001  67.558 333.562 1.00 59.55  ? 333  ASP A CG  1 
ATOM   2511 O OD1 . ASP A 1 332 ? -8.426  67.762 332.471 1.00 62.10  ? 333  ASP A OD1 1 
ATOM   2512 O OD2 . ASP A 1 332 ? -10.210 67.257 333.649 1.00 62.84  ? 333  ASP A OD2 1 
ATOM   2513 N N   . GLU A 1 333 ? -5.358  65.838 336.384 1.00 44.77  ? 334  GLU A N   1 
ATOM   2514 C CA  . GLU A 1 333 ? -4.565  65.771 337.606 1.00 41.50  ? 334  GLU A CA  1 
ATOM   2515 C C   . GLU A 1 333 ? -3.882  67.095 337.931 1.00 47.09  ? 334  GLU A C   1 
ATOM   2516 O O   . GLU A 1 333 ? -3.619  67.378 339.106 1.00 39.65  ? 334  GLU A O   1 
ATOM   2517 C CB  . GLU A 1 333 ? -3.519  64.663 337.484 1.00 35.82  ? 334  GLU A CB  1 
ATOM   2518 C CG  . GLU A 1 333 ? -4.088  63.257 337.538 1.00 37.55  ? 334  GLU A CG  1 
ATOM   2519 C CD  . GLU A 1 333 ? -4.469  62.839 338.946 1.00 50.42  ? 334  GLU A CD  1 
ATOM   2520 O OE1 . GLU A 1 333 ? -4.084  63.541 339.907 1.00 50.27  ? 334  GLU A OE1 1 
ATOM   2521 O OE2 . GLU A 1 333 ? -5.146  61.799 339.095 1.00 47.24  ? 334  GLU A OE2 1 
ATOM   2522 N N   . GLY A 1 334 ? -3.591  67.917 336.924 1.00 33.47  ? 335  GLY A N   1 
ATOM   2523 C CA  . GLY A 1 334 ? -2.743  69.072 337.145 1.00 41.33  ? 335  GLY A CA  1 
ATOM   2524 C C   . GLY A 1 334 ? -3.441  70.398 337.365 1.00 40.74  ? 335  GLY A C   1 
ATOM   2525 O O   . GLY A 1 334 ? -2.813  71.352 337.834 1.00 43.88  ? 335  GLY A O   1 
ATOM   2526 N N   . SER A 1 335 ? -4.739  70.470 337.049 1.00 50.26  ? 336  SER A N   1 
ATOM   2527 C CA  . SER A 1 335 ? -5.434  71.756 337.022 1.00 49.85  ? 336  SER A CA  1 
ATOM   2528 C C   . SER A 1 335 ? -5.466  72.417 338.398 1.00 40.25  ? 336  SER A C   1 
ATOM   2529 O O   . SER A 1 335 ? -5.246  73.628 338.516 1.00 49.01  ? 336  SER A O   1 
ATOM   2530 C CB  . SER A 1 335 ? -6.854  71.571 336.487 1.00 46.57  ? 336  SER A CB  1 
ATOM   2531 O OG  . SER A 1 335 ? -7.611  70.726 337.336 1.00 55.38  ? 336  SER A OG  1 
ATOM   2532 N N   . TYR A 1 336 ? -5.745  71.640 339.447 1.00 42.31  ? 337  TYR A N   1 
ATOM   2533 C CA  . TYR A 1 336 ? -5.825  72.192 340.798 1.00 39.81  ? 337  TYR A CA  1 
ATOM   2534 C C   . TYR A 1 336 ? -4.558  72.958 341.169 1.00 47.03  ? 337  TYR A C   1 
ATOM   2535 O O   . TYR A 1 336 ? -4.627  74.052 341.740 1.00 44.50  ? 337  TYR A O   1 
ATOM   2536 C CB  . TYR A 1 336 ? -6.084  71.054 341.794 1.00 48.14  ? 337  TYR A CB  1 
ATOM   2537 C CG  . TYR A 1 336 ? -6.467  71.454 343.213 1.00 52.43  ? 337  TYR A CG  1 
ATOM   2538 C CD1 . TYR A 1 336 ? -7.605  70.932 343.816 1.00 60.70  ? 337  TYR A CD1 1 
ATOM   2539 C CD2 . TYR A 1 336 ? -5.681  72.319 343.959 1.00 58.07  ? 337  TYR A CD2 1 
ATOM   2540 C CE1 . TYR A 1 336 ? -7.953  71.277 345.112 1.00 63.53  ? 337  TYR A CE1 1 
ATOM   2541 C CE2 . TYR A 1 336 ? -6.024  72.672 345.246 1.00 65.09  ? 337  TYR A CE2 1 
ATOM   2542 C CZ  . TYR A 1 336 ? -7.156  72.149 345.822 1.00 66.53  ? 337  TYR A CZ  1 
ATOM   2543 O OH  . TYR A 1 336 ? -7.484  72.505 347.113 1.00 64.49  ? 337  TYR A OH  1 
ATOM   2544 N N   . PHE A 1 337 ? -3.390  72.406 340.840 1.00 43.27  ? 338  PHE A N   1 
ATOM   2545 C CA  . PHE A 1 337 ? -2.132  72.956 341.333 1.00 44.15  ? 338  PHE A CA  1 
ATOM   2546 C C   . PHE A 1 337 ? -1.709  74.232 340.614 1.00 44.43  ? 338  PHE A C   1 
ATOM   2547 O O   . PHE A 1 337 ? -0.875  74.974 341.145 1.00 41.43  ? 338  PHE A O   1 
ATOM   2548 C CB  . PHE A 1 337 ? -1.032  71.894 341.225 1.00 39.42  ? 338  PHE A CB  1 
ATOM   2549 C CG  . PHE A 1 337 ? -1.338  70.640 341.994 1.00 39.23  ? 338  PHE A CG  1 
ATOM   2550 C CD1 . PHE A 1 337 ? -2.097  69.628 341.423 1.00 36.58  ? 338  PHE A CD1 1 
ATOM   2551 C CD2 . PHE A 1 337 ? -0.898  70.488 343.301 1.00 41.81  ? 338  PHE A CD2 1 
ATOM   2552 C CE1 . PHE A 1 337 ? -2.399  68.478 342.138 1.00 38.77  ? 338  PHE A CE1 1 
ATOM   2553 C CE2 . PHE A 1 337 ? -1.193  69.339 344.019 1.00 37.69  ? 338  PHE A CE2 1 
ATOM   2554 C CZ  . PHE A 1 337 ? -1.948  68.338 343.441 1.00 46.80  ? 338  PHE A CZ  1 
ATOM   2555 N N   . LEU A 1 338 ? -2.279  74.518 339.441 1.00 37.91  ? 339  LEU A N   1 
ATOM   2556 C CA  . LEU A 1 338 ? -1.834  75.668 338.659 1.00 43.00  ? 339  LEU A CA  1 
ATOM   2557 C C   . LEU A 1 338 ? -2.230  76.997 339.296 1.00 49.89  ? 339  LEU A C   1 
ATOM   2558 O O   . LEU A 1 338 ? -1.558  78.010 339.071 1.00 42.26  ? 339  LEU A O   1 
ATOM   2559 C CB  . LEU A 1 338 ? -2.391  75.576 337.239 1.00 40.86  ? 339  LEU A CB  1 
ATOM   2560 C CG  . LEU A 1 338 ? -1.944  74.335 336.465 1.00 50.82  ? 339  LEU A CG  1 
ATOM   2561 C CD1 . LEU A 1 338 ? -2.565  74.301 335.080 1.00 50.93  ? 339  LEU A CD1 1 
ATOM   2562 C CD2 . LEU A 1 338 ? -0.427  74.282 336.382 1.00 45.04  ? 339  LEU A CD2 1 
ATOM   2563 N N   . VAL A 1 339 ? -3.302  77.027 340.088 1.00 43.34  ? 340  VAL A N   1 
ATOM   2564 C CA  . VAL A 1 339 ? -3.774  78.286 340.655 1.00 47.39  ? 340  VAL A CA  1 
ATOM   2565 C C   . VAL A 1 339 ? -3.005  78.604 341.930 1.00 45.76  ? 340  VAL A C   1 
ATOM   2566 O O   . VAL A 1 339 ? -3.330  79.563 342.639 1.00 50.27  ? 340  VAL A O   1 
ATOM   2567 C CB  . VAL A 1 339 ? -5.289  78.257 340.924 1.00 51.26  ? 340  VAL A CB  1 
ATOM   2568 C CG1 . VAL A 1 339 ? -6.045  78.082 339.625 1.00 45.61  ? 340  VAL A CG1 1 
ATOM   2569 C CG2 . VAL A 1 339 ? -5.636  77.156 341.909 1.00 48.27  ? 340  VAL A CG2 1 
ATOM   2570 N N   . TYR A 1 340 ? -1.978  77.809 342.227 1.00 46.05  ? 341  TYR A N   1 
ATOM   2571 C CA  . TYR A 1 340 ? -1.148  78.022 343.405 1.00 50.07  ? 341  TYR A CA  1 
ATOM   2572 C C   . TYR A 1 340 ? 0.265   78.474 343.051 1.00 50.29  ? 341  TYR A C   1 
ATOM   2573 O O   . TYR A 1 340 ? 1.192   78.260 343.837 1.00 56.40  ? 341  TYR A O   1 
ATOM   2574 C CB  . TYR A 1 340 ? -1.097  76.752 344.254 1.00 50.22  ? 341  TYR A CB  1 
ATOM   2575 C CG  . TYR A 1 340 ? -2.322  76.554 345.113 1.00 55.88  ? 341  TYR A CG  1 
ATOM   2576 C CD1 . TYR A 1 340 ? -2.446  77.195 346.338 1.00 50.04  ? 341  TYR A CD1 1 
ATOM   2577 C CD2 . TYR A 1 340 ? -3.358  75.731 344.697 1.00 49.54  ? 341  TYR A CD2 1 
ATOM   2578 C CE1 . TYR A 1 340 ? -3.565  77.016 347.130 1.00 44.44  ? 341  TYR A CE1 1 
ATOM   2579 C CE2 . TYR A 1 340 ? -4.481  75.550 345.479 1.00 63.03  ? 341  TYR A CE2 1 
ATOM   2580 C CZ  . TYR A 1 340 ? -4.581  76.193 346.694 1.00 59.67  ? 341  TYR A CZ  1 
ATOM   2581 O OH  . TYR A 1 340 ? -5.700  76.011 347.474 1.00 60.84  ? 341  TYR A OH  1 
ATOM   2582 N N   . GLY A 1 341 ? 0.452   79.097 341.888 1.00 47.58  ? 342  GLY A N   1 
ATOM   2583 C CA  . GLY A 1 341 ? 1.765   79.611 341.550 1.00 50.69  ? 342  GLY A CA  1 
ATOM   2584 C C   . GLY A 1 341 ? 2.055   79.798 340.074 1.00 51.50  ? 342  GLY A C   1 
ATOM   2585 O O   . GLY A 1 341 ? 2.970   80.545 339.717 1.00 60.16  ? 342  GLY A O   1 
ATOM   2586 N N   . ALA A 1 342 ? 1.309   79.127 339.208 1.00 42.48  ? 343  ALA A N   1 
ATOM   2587 C CA  . ALA A 1 342 ? 1.544   79.274 337.777 1.00 54.03  ? 343  ALA A CA  1 
ATOM   2588 C C   . ALA A 1 342 ? 1.058   80.644 337.316 1.00 61.77  ? 343  ALA A C   1 
ATOM   2589 O O   . ALA A 1 342 ? -0.089  81.015 337.595 1.00 57.43  ? 343  ALA A O   1 
ATOM   2590 C CB  . ALA A 1 342 ? 0.847   78.168 336.992 1.00 43.31  ? 343  ALA A CB  1 
ATOM   2591 N N   . PRO A 1 343 ? 1.891   81.422 336.628 1.00 63.88  ? 344  PRO A N   1 
ATOM   2592 C CA  . PRO A 1 343 ? 1.488   82.782 336.245 1.00 56.44  ? 344  PRO A CA  1 
ATOM   2593 C C   . PRO A 1 343 ? 0.307   82.771 335.285 1.00 53.34  ? 344  PRO A C   1 
ATOM   2594 O O   . PRO A 1 343 ? 0.273   82.007 334.318 1.00 44.29  ? 344  PRO A O   1 
ATOM   2595 C CB  . PRO A 1 343 ? 2.751   83.353 335.589 1.00 48.76  ? 344  PRO A CB  1 
ATOM   2596 C CG  . PRO A 1 343 ? 3.553   82.153 335.190 1.00 49.52  ? 344  PRO A CG  1 
ATOM   2597 C CD  . PRO A 1 343 ? 3.281   81.127 336.243 1.00 45.68  ? 344  PRO A CD  1 
ATOM   2598 N N   . GLY A 1 344 ? -0.671  83.630 335.569 1.00 57.30  ? 345  GLY A N   1 
ATOM   2599 C CA  . GLY A 1 344 ? -1.847  83.768 334.738 1.00 55.89  ? 345  GLY A CA  1 
ATOM   2600 C C   . GLY A 1 344 ? -3.015  82.883 335.110 1.00 57.06  ? 345  GLY A C   1 
ATOM   2601 O O   . GLY A 1 344 ? -4.040  82.916 334.417 1.00 55.17  ? 345  GLY A O   1 
ATOM   2602 N N   . PHE A 1 345 ? -2.908  82.103 336.181 1.00 51.01  ? 346  PHE A N   1 
ATOM   2603 C CA  . PHE A 1 345 ? -3.931  81.134 336.546 1.00 56.26  ? 346  PHE A CA  1 
ATOM   2604 C C   . PHE A 1 345 ? -4.710  81.604 337.766 1.00 55.66  ? 346  PHE A C   1 
ATOM   2605 O O   . PHE A 1 345 ? -4.135  82.151 338.714 1.00 56.61  ? 346  PHE A O   1 
ATOM   2606 C CB  . PHE A 1 345 ? -3.310  79.764 336.822 1.00 45.17  ? 346  PHE A CB  1 
ATOM   2607 C CG  . PHE A 1 345 ? -3.012  78.980 335.583 1.00 45.77  ? 346  PHE A CG  1 
ATOM   2608 C CD1 . PHE A 1 345 ? -3.951  78.108 335.059 1.00 41.16  ? 346  PHE A CD1 1 
ATOM   2609 C CD2 . PHE A 1 345 ? -1.797  79.121 334.935 1.00 45.55  ? 346  PHE A CD2 1 
ATOM   2610 C CE1 . PHE A 1 345 ? -3.681  77.388 333.914 1.00 40.91  ? 346  PHE A CE1 1 
ATOM   2611 C CE2 . PHE A 1 345 ? -1.520  78.402 333.792 1.00 48.18  ? 346  PHE A CE2 1 
ATOM   2612 C CZ  . PHE A 1 345 ? -2.463  77.535 333.279 1.00 53.18  ? 346  PHE A CZ  1 
ATOM   2613 N N   . SER A 1 346 ? -6.021  81.385 337.731 1.00 58.37  ? 347  SER A N   1 
ATOM   2614 C CA  . SER A 1 346 ? -6.887  81.650 338.870 1.00 61.21  ? 347  SER A CA  1 
ATOM   2615 C C   . SER A 1 346 ? -8.176  80.870 338.677 1.00 48.30  ? 347  SER A C   1 
ATOM   2616 O O   . SER A 1 346 ? -8.582  80.592 337.546 1.00 56.49  ? 347  SER A O   1 
ATOM   2617 C CB  . SER A 1 346 ? -7.184  83.146 339.027 1.00 60.19  ? 347  SER A CB  1 
ATOM   2618 O OG  . SER A 1 346 ? -8.313  83.355 339.858 1.00 66.26  ? 347  SER A OG  1 
ATOM   2619 N N   . LYS A 1 347 ? -8.813  80.516 339.794 1.00 49.07  ? 348  LYS A N   1 
ATOM   2620 C CA  . LYS A 1 347 ? -10.098 79.835 339.712 1.00 58.50  ? 348  LYS A CA  1 
ATOM   2621 C C   . LYS A 1 347 ? -11.222 80.775 339.295 1.00 52.59  ? 348  LYS A C   1 
ATOM   2622 O O   . LYS A 1 347 ? -12.285 80.300 338.882 1.00 52.87  ? 348  LYS A O   1 
ATOM   2623 C CB  . LYS A 1 347 ? -10.438 79.184 341.055 1.00 52.77  ? 348  LYS A CB  1 
ATOM   2624 C CG  . LYS A 1 347 ? -11.154 80.108 342.029 1.00 41.58  ? 348  LYS A CG  1 
ATOM   2625 C CD  . LYS A 1 347 ? -11.572 79.373 343.293 1.00 60.54  ? 348  LYS A CD  1 
ATOM   2626 C CE  . LYS A 1 347 ? -12.379 80.268 344.220 1.00 52.46  ? 348  LYS A CE  1 
ATOM   2627 N NZ  . LYS A 1 347 ? -13.700 80.614 343.626 1.00 53.80  ? 348  LYS A NZ  1 
ATOM   2628 N N   . ASP A 1 348 ? -11.009 82.089 339.378 1.00 45.79  ? 349  ASP A N   1 
ATOM   2629 C CA  . ASP A 1 348 ? -12.067 83.068 339.160 1.00 57.65  ? 349  ASP A CA  1 
ATOM   2630 C C   . ASP A 1 348 ? -12.073 83.656 337.754 1.00 64.61  ? 349  ASP A C   1 
ATOM   2631 O O   . ASP A 1 348 ? -12.912 84.514 337.463 1.00 67.01  ? 349  ASP A O   1 
ATOM   2632 C CB  . ASP A 1 348 ? -11.957 84.192 340.192 1.00 47.10  ? 349  ASP A CB  1 
ATOM   2633 C CG  . ASP A 1 348 ? -12.281 83.721 341.595 1.00 65.25  ? 349  ASP A CG  1 
ATOM   2634 O OD1 . ASP A 1 348 ? -13.189 82.877 341.745 1.00 65.35  ? 349  ASP A OD1 1 
ATOM   2635 O OD2 . ASP A 1 348 ? -11.622 84.189 342.548 1.00 61.96  ? 349  ASP A OD2 1 
ATOM   2636 N N   . ASN A 1 349 ? -11.156 83.239 336.885 1.00 60.89  ? 350  ASN A N   1 
ATOM   2637 C CA  . ASN A 1 349 ? -11.261 83.516 335.458 1.00 60.59  ? 350  ASN A CA  1 
ATOM   2638 C C   . ASN A 1 349 ? -10.892 82.241 334.711 1.00 63.38  ? 350  ASN A C   1 
ATOM   2639 O O   . ASN A 1 349 ? -10.575 81.214 335.318 1.00 58.99  ? 350  ASN A O   1 
ATOM   2640 C CB  . ASN A 1 349 ? -10.426 84.746 335.046 1.00 48.31  ? 350  ASN A CB  1 
ATOM   2641 C CG  . ASN A 1 349 ? -8.908  84.550 335.179 1.00 62.33  ? 350  ASN A CG  1 
ATOM   2642 O OD1 . ASN A 1 349 ? -8.371  83.456 335.005 1.00 64.25  ? 350  ASN A OD1 1 
ATOM   2643 N ND2 . ASN A 1 349 ? -8.217  85.651 335.486 1.00 65.32  ? 350  ASN A ND2 1 
ATOM   2644 N N   . GLU A 1 350 ? -10.949 82.295 333.384 1.00 50.73  ? 351  GLU A N   1 
ATOM   2645 C CA  . GLU A 1 350 ? -10.737 81.073 332.621 1.00 58.68  ? 351  GLU A CA  1 
ATOM   2646 C C   . GLU A 1 350 ? -9.264  80.753 332.402 1.00 48.72  ? 351  GLU A C   1 
ATOM   2647 O O   . GLU A 1 350 ? -8.961  79.713 331.809 1.00 48.69  ? 351  GLU A O   1 
ATOM   2648 C CB  . GLU A 1 350 ? -11.473 81.148 331.283 1.00 50.96  ? 351  GLU A CB  1 
ATOM   2649 C CG  . GLU A 1 350 ? -12.898 80.649 331.406 1.00 66.92  ? 351  GLU A CG  1 
ATOM   2650 C CD  . GLU A 1 350 ? -13.450 80.085 330.109 1.00 99.37  ? 351  GLU A CD  1 
ATOM   2651 O OE1 . GLU A 1 350 ? -14.356 80.716 329.526 1.00 107.33 ? 351  GLU A OE1 1 
ATOM   2652 O OE2 . GLU A 1 350 ? -12.983 79.009 329.675 1.00 95.05  ? 351  GLU A OE2 1 
ATOM   2653 N N   . SER A 1 351 ? -8.352  81.600 332.890 1.00 46.45  ? 352  SER A N   1 
ATOM   2654 C CA  . SER A 1 351 ? -6.916  81.304 332.911 1.00 55.36  ? 352  SER A CA  1 
ATOM   2655 C C   . SER A 1 351 ? -6.369  81.032 331.510 1.00 52.15  ? 352  SER A C   1 
ATOM   2656 O O   . SER A 1 351 ? -5.590  80.101 331.297 1.00 49.39  ? 352  SER A O   1 
ATOM   2657 C CB  . SER A 1 351 ? -6.615  80.132 333.849 1.00 40.04  ? 352  SER A CB  1 
ATOM   2658 O OG  . SER A 1 351 ? -7.304  80.281 335.076 1.00 49.20  ? 352  SER A OG  1 
ATOM   2659 N N   . LEU A 1 352 ? -6.781  81.852 330.546 1.00 58.71  ? 353  LEU A N   1 
ATOM   2660 C CA  . LEU A 1 352 ? -6.319  81.737 329.163 1.00 46.67  ? 353  LEU A CA  1 
ATOM   2661 C C   . LEU A 1 352 ? -4.973  82.444 329.055 1.00 46.31  ? 353  LEU A C   1 
ATOM   2662 O O   . LEU A 1 352 ? -4.893  83.649 328.818 1.00 60.02  ? 353  LEU A O   1 
ATOM   2663 C CB  . LEU A 1 352 ? -7.350  82.324 328.207 1.00 44.70  ? 353  LEU A CB  1 
ATOM   2664 C CG  . LEU A 1 352 ? -8.701  81.604 328.193 1.00 48.44  ? 353  LEU A CG  1 
ATOM   2665 C CD1 . LEU A 1 352 ? -9.748  82.412 327.435 1.00 43.21  ? 353  LEU A CD1 1 
ATOM   2666 C CD2 . LEU A 1 352 ? -8.557  80.213 327.593 1.00 47.28  ? 353  LEU A CD2 1 
ATOM   2667 N N   . ILE A 1 353 ? -3.899  81.677 329.227 1.00 46.31  ? 354  ILE A N   1 
ATOM   2668 C CA  . ILE A 1 353 ? -2.567  82.240 329.396 1.00 45.76  ? 354  ILE A CA  1 
ATOM   2669 C C   . ILE A 1 353 ? -1.918  82.488 328.039 1.00 46.77  ? 354  ILE A C   1 
ATOM   2670 O O   . ILE A 1 353 ? -2.315  81.935 327.010 1.00 42.38  ? 354  ILE A O   1 
ATOM   2671 C CB  . ILE A 1 353 ? -1.685  81.324 330.267 1.00 48.72  ? 354  ILE A CB  1 
ATOM   2672 C CG1 . ILE A 1 353 ? -1.574  79.937 329.628 1.00 47.11  ? 354  ILE A CG1 1 
ATOM   2673 C CG2 . ILE A 1 353 ? -2.252  81.230 331.672 1.00 45.28  ? 354  ILE A CG2 1 
ATOM   2674 C CD1 . ILE A 1 353 ? -0.631  78.995 330.350 1.00 34.10  ? 354  ILE A CD1 1 
ATOM   2675 N N   . SER A 1 354 ? -0.893  83.332 328.047 1.00 44.38  ? 355  SER A N   1 
ATOM   2676 C CA  . SER A 1 354 ? -0.113  83.627 326.858 1.00 50.83  ? 355  SER A CA  1 
ATOM   2677 C C   . SER A 1 354 ? 1.022   82.617 326.700 1.00 53.41  ? 355  SER A C   1 
ATOM   2678 O O   . SER A 1 354 ? 1.262   81.768 327.562 1.00 49.54  ? 355  SER A O   1 
ATOM   2679 C CB  . SER A 1 354 ? 0.447   85.047 326.925 1.00 41.70  ? 355  SER A CB  1 
ATOM   2680 O OG  . SER A 1 354 ? 1.370   85.173 327.994 1.00 50.50  ? 355  SER A OG  1 
ATOM   2681 N N   . ARG A 1 355 ? 1.726   82.723 325.571 1.00 48.75  ? 356  ARG A N   1 
ATOM   2682 C CA  . ARG A 1 355 ? 2.875   81.856 325.332 1.00 46.23  ? 356  ARG A CA  1 
ATOM   2683 C C   . ARG A 1 355 ? 3.964   82.095 326.368 1.00 49.17  ? 356  ARG A C   1 
ATOM   2684 O O   . ARG A 1 355 ? 4.570   81.143 326.876 1.00 50.15  ? 356  ARG A O   1 
ATOM   2685 C CB  . ARG A 1 355 ? 3.414   82.085 323.919 1.00 50.60  ? 356  ARG A CB  1 
ATOM   2686 C CG  . ARG A 1 355 ? 4.634   81.251 323.565 1.00 50.18  ? 356  ARG A CG  1 
ATOM   2687 C CD  . ARG A 1 355 ? 4.277   79.782 323.398 1.00 53.36  ? 356  ARG A CD  1 
ATOM   2688 N NE  . ARG A 1 355 ? 5.428   78.984 322.982 1.00 53.65  ? 356  ARG A NE  1 
ATOM   2689 C CZ  . ARG A 1 355 ? 5.397   77.670 322.785 1.00 48.33  ? 356  ARG A CZ  1 
ATOM   2690 N NH1 . ARG A 1 355 ? 4.269   76.997 322.966 1.00 40.44  ? 356  ARG A NH1 1 
ATOM   2691 N NH2 . ARG A 1 355 ? 6.494   77.027 322.411 1.00 44.02  ? 356  ARG A NH2 1 
ATOM   2692 N N   . ALA A 1 356 ? 4.221   83.362 326.702 1.00 46.56  ? 357  ALA A N   1 
ATOM   2693 C CA  . ALA A 1 356 ? 5.253   83.677 327.682 1.00 43.12  ? 357  ALA A CA  1 
ATOM   2694 C C   . ALA A 1 356 ? 4.888   83.144 329.063 1.00 51.97  ? 357  ALA A C   1 
ATOM   2695 O O   . ALA A 1 356 ? 5.763   82.687 329.808 1.00 56.14  ? 357  ALA A O   1 
ATOM   2696 C CB  . ALA A 1 356 ? 5.485   85.187 327.731 1.00 37.52  ? 357  ALA A CB  1 
ATOM   2697 N N   . GLU A 1 357 ? 3.604   83.197 329.425 1.00 42.41  ? 358  GLU A N   1 
ATOM   2698 C CA  . GLU A 1 357 ? 3.191   82.646 330.712 1.00 51.35  ? 358  GLU A CA  1 
ATOM   2699 C C   . GLU A 1 357 ? 3.280   81.128 330.717 1.00 44.10  ? 358  GLU A C   1 
ATOM   2700 O O   . GLU A 1 357 ? 3.551   80.525 331.761 1.00 47.33  ? 358  GLU A O   1 
ATOM   2701 C CB  . GLU A 1 357 ? 1.771   83.100 331.049 1.00 40.46  ? 358  GLU A CB  1 
ATOM   2702 C CG  . GLU A 1 357 ? 1.653   84.585 331.345 1.00 48.28  ? 358  GLU A CG  1 
ATOM   2703 C CD  . GLU A 1 357 ? 0.216   85.029 331.526 1.00 60.03  ? 358  GLU A CD  1 
ATOM   2704 O OE1 . GLU A 1 357 ? -0.660  84.520 330.794 1.00 54.84  ? 358  GLU A OE1 1 
ATOM   2705 O OE2 . GLU A 1 357 ? -0.038  85.886 332.398 1.00 63.83  ? 358  GLU A OE2 1 
ATOM   2706 N N   . PHE A 1 358 ? 3.059   80.498 329.564 1.00 41.88  ? 359  PHE A N   1 
ATOM   2707 C CA  . PHE A 1 358 ? 3.225   79.053 329.458 1.00 42.03  ? 359  PHE A CA  1 
ATOM   2708 C C   . PHE A 1 358 ? 4.682   78.657 329.665 1.00 46.91  ? 359  PHE A C   1 
ATOM   2709 O O   . PHE A 1 358 ? 4.982   77.742 330.439 1.00 43.81  ? 359  PHE A O   1 
ATOM   2710 C CB  . PHE A 1 358 ? 2.713   78.580 328.097 1.00 38.50  ? 359  PHE A CB  1 
ATOM   2711 C CG  . PHE A 1 358 ? 3.039   77.149 327.778 1.00 41.23  ? 359  PHE A CG  1 
ATOM   2712 C CD1 . PHE A 1 358 ? 2.281   76.117 328.306 1.00 40.93  ? 359  PHE A CD1 1 
ATOM   2713 C CD2 . PHE A 1 358 ? 4.085   76.836 326.923 1.00 50.71  ? 359  PHE A CD2 1 
ATOM   2714 C CE1 . PHE A 1 358 ? 2.570   74.798 328.002 1.00 41.66  ? 359  PHE A CE1 1 
ATOM   2715 C CE2 . PHE A 1 358 ? 4.380   75.518 326.614 1.00 40.13  ? 359  PHE A CE2 1 
ATOM   2716 C CZ  . PHE A 1 358 ? 3.622   74.498 327.155 1.00 37.74  ? 359  PHE A CZ  1 
ATOM   2717 N N   . LEU A 1 359 ? 5.604   79.347 328.985 1.00 44.52  ? 360  LEU A N   1 
ATOM   2718 C CA  . LEU A 1 359 ? 7.022   79.036 329.135 1.00 42.99  ? 360  LEU A CA  1 
ATOM   2719 C C   . LEU A 1 359 ? 7.488   79.278 330.562 1.00 45.91  ? 360  LEU A C   1 
ATOM   2720 O O   . LEU A 1 359 ? 8.299   78.513 331.098 1.00 55.75  ? 360  LEU A O   1 
ATOM   2721 C CB  . LEU A 1 359 ? 7.850   79.867 328.155 1.00 40.17  ? 360  LEU A CB  1 
ATOM   2722 C CG  . LEU A 1 359 ? 7.524   79.692 326.672 1.00 48.97  ? 360  LEU A CG  1 
ATOM   2723 C CD1 . LEU A 1 359 ? 8.337   80.661 325.822 1.00 41.77  ? 360  LEU A CD1 1 
ATOM   2724 C CD2 . LEU A 1 359 ? 7.769   78.255 326.245 1.00 43.82  ? 360  LEU A CD2 1 
ATOM   2725 N N   . ALA A 1 360 ? 6.987   80.340 331.196 1.00 46.24  ? 361  ALA A N   1 
ATOM   2726 C CA  . ALA A 1 360 ? 7.330   80.584 332.592 1.00 47.68  ? 361  ALA A CA  1 
ATOM   2727 C C   . ALA A 1 360 ? 6.707   79.533 333.502 1.00 45.94  ? 361  ALA A C   1 
ATOM   2728 O O   . ALA A 1 360 ? 7.334   79.096 334.474 1.00 46.00  ? 361  ALA A O   1 
ATOM   2729 C CB  . ALA A 1 360 ? 6.893   81.989 333.004 1.00 44.34  ? 361  ALA A CB  1 
ATOM   2730 N N   . GLY A 1 361 ? 5.480   79.103 333.195 1.00 48.31  ? 362  GLY A N   1 
ATOM   2731 C CA  . GLY A 1 361 ? 4.839   78.075 333.997 1.00 40.37  ? 362  GLY A CA  1 
ATOM   2732 C C   . GLY A 1 361 ? 5.530   76.728 333.919 1.00 47.41  ? 362  GLY A C   1 
ATOM   2733 O O   . GLY A 1 361 ? 5.467   75.941 334.868 1.00 44.80  ? 362  GLY A O   1 
ATOM   2734 N N   . VAL A 1 362 ? 6.196   76.441 332.797 1.00 41.73  ? 363  VAL A N   1 
ATOM   2735 C CA  . VAL A 1 362 ? 6.913   75.175 332.660 1.00 41.84  ? 363  VAL A CA  1 
ATOM   2736 C C   . VAL A 1 362 ? 8.005   75.058 333.718 1.00 38.77  ? 363  VAL A C   1 
ATOM   2737 O O   . VAL A 1 362 ? 8.203   73.990 334.311 1.00 45.71  ? 363  VAL A O   1 
ATOM   2738 C CB  . VAL A 1 362 ? 7.482   75.036 331.236 1.00 43.29  ? 363  VAL A CB  1 
ATOM   2739 C CG1 . VAL A 1 362 ? 8.514   73.918 331.175 1.00 36.59  ? 363  VAL A CG1 1 
ATOM   2740 C CG2 . VAL A 1 362 ? 6.361   74.780 330.244 1.00 39.86  ? 363  VAL A CG2 1 
ATOM   2741 N N   . ARG A 1 363 ? 8.727   76.153 333.977 1.00 40.65  ? 364  ARG A N   1 
ATOM   2742 C CA  . ARG A 1 363 ? 9.781   76.124 334.987 1.00 48.50  ? 364  ARG A CA  1 
ATOM   2743 C C   . ARG A 1 363 ? 9.208   75.996 336.391 1.00 48.28  ? 364  ARG A C   1 
ATOM   2744 O O   . ARG A 1 363 ? 9.871   75.459 337.286 1.00 44.26  ? 364  ARG A O   1 
ATOM   2745 C CB  . ARG A 1 363 ? 10.649  77.381 334.889 1.00 48.79  ? 364  ARG A CB  1 
ATOM   2746 C CG  . ARG A 1 363 ? 11.203  77.656 333.504 1.00 48.17  ? 364  ARG A CG  1 
ATOM   2747 C CD  . ARG A 1 363 ? 11.834  76.411 332.901 1.00 51.49  ? 364  ARG A CD  1 
ATOM   2748 N NE  . ARG A 1 363 ? 12.962  75.907 333.681 1.00 55.97  ? 364  ARG A NE  1 
ATOM   2749 C CZ  . ARG A 1 363 ? 14.235  76.203 333.434 1.00 59.31  ? 364  ARG A CZ  1 
ATOM   2750 N NH1 . ARG A 1 363 ? 14.550  77.011 332.429 1.00 48.08  ? 364  ARG A NH1 1 
ATOM   2751 N NH2 . ARG A 1 363 ? 15.195  75.691 334.191 1.00 51.18  ? 364  ARG A NH2 1 
ATOM   2752 N N   . VAL A 1 364 ? 7.990   76.489 336.603 1.00 44.44  ? 365  VAL A N   1 
ATOM   2753 C CA  . VAL A 1 364 ? 7.333   76.319 337.891 1.00 48.14  ? 365  VAL A CA  1 
ATOM   2754 C C   . VAL A 1 364 ? 6.775   74.907 338.023 1.00 45.24  ? 365  VAL A C   1 
ATOM   2755 O O   . VAL A 1 364 ? 6.869   74.287 339.088 1.00 46.65  ? 365  VAL A O   1 
ATOM   2756 C CB  . VAL A 1 364 ? 6.239   77.388 338.064 1.00 45.12  ? 365  VAL A CB  1 
ATOM   2757 C CG1 . VAL A 1 364 ? 5.470   77.167 339.354 1.00 50.37  ? 365  VAL A CG1 1 
ATOM   2758 C CG2 . VAL A 1 364 ? 6.853   78.781 338.032 1.00 45.95  ? 365  VAL A CG2 1 
ATOM   2759 N N   . GLY A 1 365 ? 6.206   74.372 336.939 1.00 41.76  ? 366  GLY A N   1 
ATOM   2760 C CA  . GLY A 1 365 ? 5.640   73.035 336.986 1.00 36.55  ? 366  GLY A CA  1 
ATOM   2761 C C   . GLY A 1 365 ? 6.674   71.933 336.937 1.00 41.70  ? 366  GLY A C   1 
ATOM   2762 O O   . GLY A 1 365 ? 6.417   70.820 337.409 1.00 42.92  ? 366  GLY A O   1 
ATOM   2763 N N   . VAL A 1 366 ? 7.838   72.207 336.360 1.00 38.92  ? 367  VAL A N   1 
ATOM   2764 C CA  . VAL A 1 366 ? 8.939   71.246 336.358 1.00 44.56  ? 367  VAL A CA  1 
ATOM   2765 C C   . VAL A 1 366 ? 10.144  71.924 336.998 1.00 45.30  ? 367  VAL A C   1 
ATOM   2766 O O   . VAL A 1 366 ? 11.083  72.318 336.293 1.00 41.84  ? 367  VAL A O   1 
ATOM   2767 C CB  . VAL A 1 366 ? 9.257   70.747 334.938 1.00 41.80  ? 367  VAL A CB  1 
ATOM   2768 C CG1 . VAL A 1 366 ? 10.046  69.445 335.000 1.00 36.22  ? 367  VAL A CG1 1 
ATOM   2769 C CG2 . VAL A 1 366 ? 7.976   70.552 334.140 1.00 33.59  ? 367  VAL A CG2 1 
ATOM   2770 N N   . PRO A 1 367 ? 10.163  72.076 338.317 1.00 47.98  ? 368  PRO A N   1 
ATOM   2771 C CA  . PRO A 1 367 ? 11.236  72.837 338.959 1.00 35.72  ? 368  PRO A CA  1 
ATOM   2772 C C   . PRO A 1 367 ? 12.532  72.044 339.041 1.00 44.43  ? 368  PRO A C   1 
ATOM   2773 O O   . PRO A 1 367 ? 12.547  70.811 339.023 1.00 44.94  ? 368  PRO A O   1 
ATOM   2774 C CB  . PRO A 1 367 ? 10.673  73.114 340.357 1.00 52.22  ? 368  PRO A CB  1 
ATOM   2775 C CG  . PRO A 1 367 ? 9.794   71.942 340.627 1.00 48.08  ? 368  PRO A CG  1 
ATOM   2776 C CD  . PRO A 1 367 ? 9.191   71.557 339.296 1.00 42.64  ? 368  PRO A CD  1 
ATOM   2777 N N   . GLN A 1 368 ? 13.633  72.795 339.116 1.00 40.72  ? 369  GLN A N   1 
ATOM   2778 C CA  . GLN A 1 368 ? 14.966  72.248 339.388 1.00 58.20  ? 369  GLN A CA  1 
ATOM   2779 C C   . GLN A 1 368 ? 15.436  71.299 338.286 1.00 55.83  ? 369  GLN A C   1 
ATOM   2780 O O   . GLN A 1 368 ? 15.994  70.233 338.557 1.00 49.79  ? 369  GLN A O   1 
ATOM   2781 C CB  . GLN A 1 368 ? 15.008  71.554 340.752 1.00 51.70  ? 369  GLN A CB  1 
ATOM   2782 C CG  . GLN A 1 368 ? 14.625  72.450 341.920 1.00 66.41  ? 369  GLN A CG  1 
ATOM   2783 C CD  . GLN A 1 368 ? 15.652  73.530 342.188 1.00 73.02  ? 369  GLN A CD  1 
ATOM   2784 O OE1 . GLN A 1 368 ? 16.727  73.259 342.725 1.00 83.58  ? 369  GLN A OE1 1 
ATOM   2785 N NE2 . GLN A 1 368 ? 15.329  74.763 341.813 1.00 58.81  ? 369  GLN A NE2 1 
ATOM   2786 N N   . VAL A 1 369 ? 15.218  71.685 337.030 1.00 52.64  ? 370  VAL A N   1 
ATOM   2787 C CA  . VAL A 1 369 ? 15.770  70.959 335.895 1.00 45.84  ? 370  VAL A CA  1 
ATOM   2788 C C   . VAL A 1 369 ? 16.550  71.938 335.030 1.00 41.14  ? 370  VAL A C   1 
ATOM   2789 O O   . VAL A 1 369 ? 16.330  73.151 335.064 1.00 55.83  ? 370  VAL A O   1 
ATOM   2790 C CB  . VAL A 1 369 ? 14.693  70.237 335.053 1.00 46.04  ? 370  VAL A CB  1 
ATOM   2791 C CG1 . VAL A 1 369 ? 13.972  69.191 335.891 1.00 45.61  ? 370  VAL A CG1 1 
ATOM   2792 C CG2 . VAL A 1 369 ? 13.712  71.239 334.458 1.00 44.37  ? 370  VAL A CG2 1 
ATOM   2793 N N   . SER A 1 370 ? 17.481  71.391 334.254 1.00 50.84  ? 371  SER A N   1 
ATOM   2794 C CA  . SER A 1 370 ? 18.283  72.209 333.359 1.00 46.61  ? 371  SER A CA  1 
ATOM   2795 C C   . SER A 1 370 ? 17.401  72.857 332.296 1.00 49.28  ? 371  SER A C   1 
ATOM   2796 O O   . SER A 1 370 ? 16.283  72.412 332.019 1.00 48.65  ? 371  SER A O   1 
ATOM   2797 C CB  . SER A 1 370 ? 19.370  71.367 332.694 1.00 54.96  ? 371  SER A CB  1 
ATOM   2798 O OG  . SER A 1 370 ? 18.799  70.324 331.922 1.00 49.15  ? 371  SER A OG  1 
ATOM   2799 N N   . ASP A 1 371 ? 17.922  73.928 331.693 1.00 48.27  ? 372  ASP A N   1 
ATOM   2800 C CA  . ASP A 1 371 ? 17.179  74.594 330.629 1.00 49.45  ? 372  ASP A CA  1 
ATOM   2801 C C   . ASP A 1 371 ? 16.979  73.677 329.430 1.00 47.49  ? 372  ASP A C   1 
ATOM   2802 O O   . ASP A 1 371 ? 15.977  73.800 328.716 1.00 47.80  ? 372  ASP A O   1 
ATOM   2803 C CB  . ASP A 1 371 ? 17.890  75.881 330.209 1.00 47.43  ? 372  ASP A CB  1 
ATOM   2804 C CG  . ASP A 1 371 ? 18.250  76.758 331.393 1.00 60.03  ? 372  ASP A CG  1 
ATOM   2805 O OD1 . ASP A 1 371 ? 19.123  77.637 331.237 1.00 78.41  ? 372  ASP A OD1 1 
ATOM   2806 O OD2 . ASP A 1 371 ? 17.667  76.566 332.482 1.00 74.94  ? 372  ASP A OD2 1 
ATOM   2807 N N   . LEU A 1 372 ? 17.908  72.747 329.200 1.00 36.75  ? 373  LEU A N   1 
ATOM   2808 C CA  . LEU A 1 372 ? 17.719  71.767 328.135 1.00 48.90  ? 373  LEU A CA  1 
ATOM   2809 C C   . LEU A 1 372 ? 16.527  70.865 328.428 1.00 50.24  ? 373  LEU A C   1 
ATOM   2810 O O   . LEU A 1 372 ? 15.730  70.562 327.531 1.00 46.08  ? 373  LEU A O   1 
ATOM   2811 C CB  . LEU A 1 372 ? 18.991  70.938 327.952 1.00 33.84  ? 373  LEU A CB  1 
ATOM   2812 C CG  . LEU A 1 372 ? 18.946  69.889 326.841 1.00 50.15  ? 373  LEU A CG  1 
ATOM   2813 C CD1 . LEU A 1 372 ? 18.799  70.553 325.475 1.00 48.69  ? 373  LEU A CD1 1 
ATOM   2814 C CD2 . LEU A 1 372 ? 20.183  69.005 326.886 1.00 55.30  ? 373  LEU A CD2 1 
ATOM   2815 N N   . ALA A 1 373 ? 16.387  70.428 329.683 1.00 45.30  ? 374  ALA A N   1 
ATOM   2816 C CA  . ALA A 1 373 ? 15.244  69.603 330.058 1.00 43.79  ? 374  ALA A CA  1 
ATOM   2817 C C   . ALA A 1 373 ? 13.935  70.359 329.869 1.00 38.90  ? 374  ALA A C   1 
ATOM   2818 O O   . ALA A 1 373 ? 12.953  69.802 329.364 1.00 40.91  ? 374  ALA A O   1 
ATOM   2819 C CB  . ALA A 1 373 ? 15.389  69.132 331.506 1.00 40.82  ? 374  ALA A CB  1 
ATOM   2820 N N   . ALA A 1 374 ? 13.906  71.635 330.259 1.00 39.56  ? 375  ALA A N   1 
ATOM   2821 C CA  . ALA A 1 374 ? 12.717  72.453 330.043 1.00 38.88  ? 375  ALA A CA  1 
ATOM   2822 C C   . ALA A 1 374 ? 12.410  72.603 328.557 1.00 46.35  ? 375  ALA A C   1 
ATOM   2823 O O   . ALA A 1 374 ? 11.239  72.615 328.157 1.00 45.37  ? 375  ALA A O   1 
ATOM   2824 C CB  . ALA A 1 374 ? 12.899  73.822 330.696 1.00 33.81  ? 375  ALA A CB  1 
ATOM   2825 N N   . GLU A 1 375 ? 13.448  72.718 327.722 1.00 41.54  ? 376  GLU A N   1 
ATOM   2826 C CA  . GLU A 1 375 ? 13.223  72.813 326.281 1.00 43.31  ? 376  GLU A CA  1 
ATOM   2827 C C   . GLU A 1 375 ? 12.601  71.534 325.735 1.00 37.99  ? 376  GLU A C   1 
ATOM   2828 O O   . GLU A 1 375 ? 11.755  71.583 324.833 1.00 43.61  ? 376  GLU A O   1 
ATOM   2829 C CB  . GLU A 1 375 ? 14.535  73.123 325.557 1.00 50.26  ? 376  GLU A CB  1 
ATOM   2830 C CG  . GLU A 1 375 ? 15.034  74.548 325.753 1.00 53.66  ? 376  GLU A CG  1 
ATOM   2831 C CD  . GLU A 1 375 ? 14.116  75.580 325.126 1.00 77.18  ? 376  GLU A CD  1 
ATOM   2832 O OE1 . GLU A 1 375 ? 13.450  75.256 324.119 1.00 94.72  ? 376  GLU A OE1 1 
ATOM   2833 O OE2 . GLU A 1 375 ? 14.055  76.715 325.645 1.00 75.96  ? 376  GLU A OE2 1 
ATOM   2834 N N   . ALA A 1 376 ? 13.004  70.379 326.270 1.00 37.68  ? 377  ALA A N   1 
ATOM   2835 C CA  . ALA A 1 376 ? 12.383  69.122 325.864 1.00 38.73  ? 377  ALA A CA  1 
ATOM   2836 C C   . ALA A 1 376 ? 10.911  69.084 326.255 1.00 39.98  ? 377  ALA A C   1 
ATOM   2837 O O   . ALA A 1 376 ? 10.075  68.567 325.505 1.00 49.28  ? 377  ALA A O   1 
ATOM   2838 C CB  . ALA A 1 376 ? 13.131  67.940 326.482 1.00 31.17  ? 377  ALA A CB  1 
ATOM   2839 N N   . VAL A 1 377 ? 10.579  69.623 327.431 1.00 36.94  ? 378  VAL A N   1 
ATOM   2840 C CA  . VAL A 1 377 ? 9.186   69.679 327.861 1.00 42.14  ? 378  VAL A CA  1 
ATOM   2841 C C   . VAL A 1 377 ? 8.383   70.582 326.934 1.00 39.17  ? 378  VAL A C   1 
ATOM   2842 O O   . VAL A 1 377 ? 7.280   70.230 326.500 1.00 38.54  ? 378  VAL A O   1 
ATOM   2843 C CB  . VAL A 1 377 ? 9.093   70.150 329.324 1.00 44.60  ? 378  VAL A CB  1 
ATOM   2844 C CG1 . VAL A 1 377 ? 7.639   70.362 329.722 1.00 36.21  ? 378  VAL A CG1 1 
ATOM   2845 C CG2 . VAL A 1 377 ? 9.766   69.151 330.252 1.00 32.02  ? 378  VAL A CG2 1 
ATOM   2846 N N   . VAL A 1 378 ? 8.928   71.761 326.619 1.00 38.69  ? 379  VAL A N   1 
ATOM   2847 C CA  . VAL A 1 378 ? 8.237   72.695 325.735 1.00 39.07  ? 379  VAL A CA  1 
ATOM   2848 C C   . VAL A 1 378 ? 8.006   72.066 324.368 1.00 43.62  ? 379  VAL A C   1 
ATOM   2849 O O   . VAL A 1 378 ? 6.922   72.189 323.787 1.00 46.98  ? 379  VAL A O   1 
ATOM   2850 C CB  . VAL A 1 378 ? 9.030   74.011 325.621 1.00 36.99  ? 379  VAL A CB  1 
ATOM   2851 C CG1 . VAL A 1 378 ? 8.471   74.873 324.497 1.00 36.17  ? 379  VAL A CG1 1 
ATOM   2852 C CG2 . VAL A 1 378 ? 9.000   74.764 326.937 1.00 37.86  ? 379  VAL A CG2 1 
ATOM   2853 N N   . LEU A 1 379 ? 9.019   71.376 323.837 1.00 38.19  ? 380  LEU A N   1 
ATOM   2854 C CA  . LEU A 1 379 ? 8.887   70.746 322.528 1.00 43.37  ? 380  LEU A CA  1 
ATOM   2855 C C   . LEU A 1 379 ? 7.751   69.732 322.509 1.00 49.21  ? 380  LEU A C   1 
ATOM   2856 O O   . LEU A 1 379 ? 6.981   69.665 321.544 1.00 40.67  ? 380  LEU A O   1 
ATOM   2857 C CB  . LEU A 1 379 ? 10.201  70.070 322.137 1.00 39.80  ? 380  LEU A CB  1 
ATOM   2858 C CG  . LEU A 1 379 ? 10.094  69.104 320.954 1.00 47.20  ? 380  LEU A CG  1 
ATOM   2859 C CD1 . LEU A 1 379 ? 10.045  69.878 319.649 1.00 28.77  ? 380  LEU A CD1 1 
ATOM   2860 C CD2 . LEU A 1 379 ? 11.239  68.104 320.950 1.00 43.24  ? 380  LEU A CD2 1 
ATOM   2861 N N   . HIS A 1 380 ? 7.626   68.939 323.572 1.00 45.90  ? 381  HIS A N   1 
ATOM   2862 C CA  . HIS A 1 380 ? 6.663   67.847 323.559 1.00 41.71  ? 381  HIS A CA  1 
ATOM   2863 C C   . HIS A 1 380 ? 5.233   68.329 323.770 1.00 43.28  ? 381  HIS A C   1 
ATOM   2864 O O   . HIS A 1 380 ? 4.300   67.740 323.212 1.00 45.89  ? 381  HIS A O   1 
ATOM   2865 C CB  . HIS A 1 380 ? 7.038   66.813 324.619 1.00 39.46  ? 381  HIS A CB  1 
ATOM   2866 C CG  . HIS A 1 380 ? 6.349   65.496 324.446 1.00 58.25  ? 381  HIS A CG  1 
ATOM   2867 N ND1 . HIS A 1 380 ? 5.016   65.309 324.744 1.00 68.07  ? 381  HIS A ND1 1 
ATOM   2868 C CD2 . HIS A 1 380 ? 6.808   64.300 324.008 1.00 64.15  ? 381  HIS A CD2 1 
ATOM   2869 C CE1 . HIS A 1 380 ? 4.683   64.055 324.496 1.00 61.52  ? 381  HIS A CE1 1 
ATOM   2870 N NE2 . HIS A 1 380 ? 5.752   63.421 324.049 1.00 77.29  ? 381  HIS A NE2 1 
ATOM   2871 N N   . TYR A 1 381 ? 5.035   69.391 324.550 1.00 36.14  ? 382  TYR A N   1 
ATOM   2872 C CA  . TYR A 1 381 ? 3.697   69.847 324.903 1.00 45.55  ? 382  TYR A CA  1 
ATOM   2873 C C   . TYR A 1 381 ? 3.239   71.048 324.090 1.00 40.39  ? 382  TYR A C   1 
ATOM   2874 O O   . TYR A 1 381 ? 2.131   71.544 324.312 1.00 51.68  ? 382  TYR A O   1 
ATOM   2875 C CB  . TYR A 1 381 ? 3.627   70.165 326.402 1.00 35.68  ? 382  TYR A CB  1 
ATOM   2876 C CG  . TYR A 1 381 ? 3.572   68.908 327.233 1.00 42.40  ? 382  TYR A CG  1 
ATOM   2877 C CD1 . TYR A 1 381 ? 2.355   68.347 327.597 1.00 35.79  ? 382  TYR A CD1 1 
ATOM   2878 C CD2 . TYR A 1 381 ? 4.736   68.261 327.625 1.00 37.90  ? 382  TYR A CD2 1 
ATOM   2879 C CE1 . TYR A 1 381 ? 2.299   67.183 328.341 1.00 28.66  ? 382  TYR A CE1 1 
ATOM   2880 C CE2 . TYR A 1 381 ? 4.691   67.098 328.370 1.00 39.20  ? 382  TYR A CE2 1 
ATOM   2881 C CZ  . TYR A 1 381 ? 3.469   66.564 328.724 1.00 34.14  ? 382  TYR A CZ  1 
ATOM   2882 O OH  . TYR A 1 381 ? 3.414   65.406 329.461 1.00 39.28  ? 382  TYR A OH  1 
ATOM   2883 N N   . THR A 1 382 ? 4.052   71.520 323.154 1.00 42.28  ? 383  THR A N   1 
ATOM   2884 C CA  . THR A 1 382 ? 3.636   72.571 322.240 1.00 46.04  ? 383  THR A CA  1 
ATOM   2885 C C   . THR A 1 382 ? 3.030   71.942 320.992 1.00 37.02  ? 383  THR A C   1 
ATOM   2886 O O   . THR A 1 382 ? 3.589   70.991 320.436 1.00 40.26  ? 383  THR A O   1 
ATOM   2887 C CB  . THR A 1 382 ? 4.819   73.461 321.862 1.00 48.22  ? 383  THR A CB  1 
ATOM   2888 O OG1 . THR A 1 382 ? 5.295   74.151 323.027 1.00 37.88  ? 383  THR A OG1 1 
ATOM   2889 C CG2 . THR A 1 382 ? 4.413   74.469 320.798 1.00 35.99  ? 383  THR A CG2 1 
ATOM   2890 N N   . ASP A 1 383 ? 1.868   72.446 320.582 1.00 42.70  ? 384  ASP A N   1 
ATOM   2891 C CA  . ASP A 1 383 ? 1.314   72.157 319.263 1.00 45.49  ? 384  ASP A CA  1 
ATOM   2892 C C   . ASP A 1 383 ? 1.897   73.186 318.302 1.00 46.51  ? 384  ASP A C   1 
ATOM   2893 O O   . ASP A 1 383 ? 1.511   74.358 318.332 1.00 46.64  ? 384  ASP A O   1 
ATOM   2894 C CB  . ASP A 1 383 ? -0.213  72.209 319.281 1.00 55.57  ? 384  ASP A CB  1 
ATOM   2895 C CG  . ASP A 1 383 ? -0.842  71.689 317.989 1.00 62.31  ? 384  ASP A CG  1 
ATOM   2896 O OD1 . ASP A 1 383 ? -0.156  71.663 316.944 1.00 58.28  ? 384  ASP A OD1 1 
ATOM   2897 O OD2 . ASP A 1 383 ? -2.032  71.309 318.015 1.00 64.75  ? 384  ASP A OD2 1 
ATOM   2898 N N   . TRP A 1 384 ? 2.831   72.756 317.459 1.00 43.55  ? 385  TRP A N   1 
ATOM   2899 C CA  . TRP A 1 384 ? 3.558   73.691 316.608 1.00 53.68  ? 385  TRP A CA  1 
ATOM   2900 C C   . TRP A 1 384 ? 2.742   74.182 315.418 1.00 39.98  ? 385  TRP A C   1 
ATOM   2901 O O   . TRP A 1 384 ? 3.239   75.010 314.649 1.00 48.88  ? 385  TRP A O   1 
ATOM   2902 C CB  . TRP A 1 384 ? 4.873   73.052 316.156 1.00 41.65  ? 385  TRP A CB  1 
ATOM   2903 C CG  . TRP A 1 384 ? 5.752   72.783 317.336 1.00 40.05  ? 385  TRP A CG  1 
ATOM   2904 C CD1 . TRP A 1 384 ? 5.915   71.594 317.986 1.00 42.57  ? 385  TRP A CD1 1 
ATOM   2905 C CD2 . TRP A 1 384 ? 6.548   73.741 318.043 1.00 38.34  ? 385  TRP A CD2 1 
ATOM   2906 N NE1 . TRP A 1 384 ? 6.781   71.748 319.045 1.00 44.46  ? 385  TRP A NE1 1 
ATOM   2907 C CE2 . TRP A 1 384 ? 7.183   73.057 319.101 1.00 40.02  ? 385  TRP A CE2 1 
ATOM   2908 C CE3 . TRP A 1 384 ? 6.794   75.108 317.879 1.00 35.20  ? 385  TRP A CE3 1 
ATOM   2909 C CZ2 . TRP A 1 384 ? 8.047   73.693 319.988 1.00 34.98  ? 385  TRP A CZ2 1 
ATOM   2910 C CZ3 . TRP A 1 384 ? 7.652   75.738 318.762 1.00 41.86  ? 385  TRP A CZ3 1 
ATOM   2911 C CH2 . TRP A 1 384 ? 8.268   75.030 319.803 1.00 43.29  ? 385  TRP A CH2 1 
ATOM   2912 N N   . LEU A 1 385 ? 1.506   73.710 315.257 1.00 49.97  ? 386  LEU A N   1 
ATOM   2913 C CA  . LEU A 1 385 ? 0.560   74.338 314.343 1.00 50.04  ? 386  LEU A CA  1 
ATOM   2914 C C   . LEU A 1 385 ? -0.258  75.433 315.013 1.00 57.74  ? 386  LEU A C   1 
ATOM   2915 O O   . LEU A 1 385 ? -0.796  76.303 314.317 1.00 51.31  ? 386  LEU A O   1 
ATOM   2916 C CB  . LEU A 1 385 ? -0.385  73.290 313.750 1.00 49.67  ? 386  LEU A CB  1 
ATOM   2917 C CG  . LEU A 1 385 ? 0.245   72.381 312.695 1.00 61.59  ? 386  LEU A CG  1 
ATOM   2918 C CD1 . LEU A 1 385 ? -0.741  71.321 312.238 1.00 52.76  ? 386  LEU A CD1 1 
ATOM   2919 C CD2 . LEU A 1 385 ? 0.741   73.208 311.518 1.00 52.21  ? 386  LEU A CD2 1 
ATOM   2920 N N   . HIS A 1 386 ? -0.365  75.405 316.341 1.00 47.17  ? 387  HIS A N   1 
ATOM   2921 C CA  . HIS A 1 386 ? -1.043  76.447 317.114 1.00 45.37  ? 387  HIS A CA  1 
ATOM   2922 C C   . HIS A 1 386 ? -0.199  76.763 318.340 1.00 52.47  ? 387  HIS A C   1 
ATOM   2923 O O   . HIS A 1 386 ? -0.608  76.510 319.479 1.00 49.43  ? 387  HIS A O   1 
ATOM   2924 C CB  . HIS A 1 386 ? -2.452  75.999 317.512 1.00 45.55  ? 387  HIS A CB  1 
ATOM   2925 C CG  . HIS A 1 386 ? -3.242  75.421 316.382 1.00 51.50  ? 387  HIS A CG  1 
ATOM   2926 N ND1 . HIS A 1 386 ? -4.069  76.185 315.587 1.00 50.04  ? 387  HIS A ND1 1 
ATOM   2927 C CD2 . HIS A 1 386 ? -3.322  74.157 315.905 1.00 48.67  ? 387  HIS A CD2 1 
ATOM   2928 C CE1 . HIS A 1 386 ? -4.630  75.414 314.672 1.00 55.34  ? 387  HIS A CE1 1 
ATOM   2929 N NE2 . HIS A 1 386 ? -4.193  74.179 314.843 1.00 49.66  ? 387  HIS A NE2 1 
ATOM   2930 N N   . PRO A 1 387 ? 0.997   77.325 318.141 1.00 57.48  ? 388  PRO A N   1 
ATOM   2931 C CA  . PRO A 1 387 ? 1.949   77.428 319.260 1.00 45.23  ? 388  PRO A CA  1 
ATOM   2932 C C   . PRO A 1 387 ? 1.557   78.435 320.336 1.00 49.80  ? 388  PRO A C   1 
ATOM   2933 O O   . PRO A 1 387 ? 2.107   78.362 321.441 1.00 51.26  ? 388  PRO A O   1 
ATOM   2934 C CB  . PRO A 1 387 ? 3.256   77.836 318.569 1.00 46.04  ? 388  PRO A CB  1 
ATOM   2935 C CG  . PRO A 1 387 ? 2.812   78.560 317.348 1.00 49.48  ? 388  PRO A CG  1 
ATOM   2936 C CD  . PRO A 1 387 ? 1.559   77.862 316.889 1.00 43.12  ? 388  PRO A CD  1 
ATOM   2937 N N   . GLU A 1 388 ? 0.635   79.362 320.051 1.00 46.78  ? 389  GLU A N   1 
ATOM   2938 C CA  . GLU A 1 388 ? 0.279   80.412 321.007 1.00 54.35  ? 389  GLU A CA  1 
ATOM   2939 C C   . GLU A 1 388 ? -1.226  80.517 321.245 1.00 46.79  ? 389  GLU A C   1 
ATOM   2940 O O   . GLU A 1 388 ? -1.698  81.534 321.757 1.00 50.55  ? 389  GLU A O   1 
ATOM   2941 C CB  . GLU A 1 388 ? 0.840   81.765 320.568 1.00 50.14  ? 389  GLU A CB  1 
ATOM   2942 C CG  . GLU A 1 388 ? 2.235   81.671 319.979 1.00 54.80  ? 389  GLU A CG  1 
ATOM   2943 C CD  . GLU A 1 388 ? 2.883   83.021 319.743 1.00 80.79  ? 389  GLU A CD  1 
ATOM   2944 O OE1 . GLU A 1 388 ? 3.233   83.697 320.737 1.00 83.14  ? 389  GLU A OE1 1 
ATOM   2945 O OE2 . GLU A 1 388 ? 3.059   83.400 318.565 1.00 100.34 ? 389  GLU A OE2 1 
ATOM   2946 N N   . ASP A 1 389 ? -1.973  79.462 320.938 1.00 36.73  ? 390  ASP A N   1 
ATOM   2947 C CA  . ASP A 1 389 ? -3.404  79.438 321.224 1.00 39.66  ? 390  ASP A CA  1 
ATOM   2948 C C   . ASP A 1 389 ? -3.627  79.404 322.732 1.00 49.72  ? 390  ASP A C   1 
ATOM   2949 O O   . ASP A 1 389 ? -3.241  78.422 323.380 1.00 42.49  ? 390  ASP A O   1 
ATOM   2950 C CB  . ASP A 1 389 ? -4.048  78.226 320.559 1.00 45.72  ? 390  ASP A CB  1 
ATOM   2951 C CG  . ASP A 1 389 ? -5.538  78.132 320.839 1.00 62.43  ? 390  ASP A CG  1 
ATOM   2952 O OD1 . ASP A 1 389 ? -6.148  79.171 321.175 1.00 69.47  ? 390  ASP A OD1 1 
ATOM   2953 O OD2 . ASP A 1 389 ? -6.102  77.023 320.730 1.00 71.22  ? 390  ASP A OD2 1 
ATOM   2954 N N   . PRO A 1 390 ? -4.249  80.429 323.326 1.00 50.86  ? 391  PRO A N   1 
ATOM   2955 C CA  . PRO A 1 390 ? -4.333  80.476 324.800 1.00 45.81  ? 391  PRO A CA  1 
ATOM   2956 C C   . PRO A 1 390 ? -5.003  79.259 325.423 1.00 51.52  ? 391  PRO A C   1 
ATOM   2957 O O   . PRO A 1 390 ? -4.513  78.745 326.437 1.00 51.11  ? 391  PRO A O   1 
ATOM   2958 C CB  . PRO A 1 390 ? -5.130  81.763 325.062 1.00 48.25  ? 391  PRO A CB  1 
ATOM   2959 C CG  . PRO A 1 390 ? -4.932  82.600 323.828 1.00 54.07  ? 391  PRO A CG  1 
ATOM   2960 C CD  . PRO A 1 390 ? -4.817  81.632 322.689 1.00 43.66  ? 391  PRO A CD  1 
ATOM   2961 N N   . ALA A 1 391 ? -6.103  78.778 324.840 1.00 51.44  ? 392  ALA A N   1 
ATOM   2962 C CA  . ALA A 1 391 ? -6.779  77.597 325.372 1.00 48.20  ? 392  ALA A CA  1 
ATOM   2963 C C   . ALA A 1 391 ? -5.847  76.391 325.397 1.00 42.93  ? 392  ALA A C   1 
ATOM   2964 O O   . ALA A 1 391 ? -5.633  75.774 326.448 1.00 51.29  ? 392  ALA A O   1 
ATOM   2965 C CB  . ALA A 1 391 ? -8.027  77.294 324.542 1.00 47.90  ? 392  ALA A CB  1 
ATOM   2966 N N   . ARG A 1 392 ? -5.287  76.039 324.233 1.00 50.55  ? 393  ARG A N   1 
ATOM   2967 C CA  . ARG A 1 392 ? -4.387  74.893 324.136 1.00 49.04  ? 393  ARG A CA  1 
ATOM   2968 C C   . ARG A 1 392 ? -3.221  75.008 325.108 1.00 41.14  ? 393  ARG A C   1 
ATOM   2969 O O   . ARG A 1 392 ? -2.776  74.005 325.676 1.00 37.92  ? 393  ARG A O   1 
ATOM   2970 C CB  . ARG A 1 392 ? -3.859  74.756 322.707 1.00 50.88  ? 393  ARG A CB  1 
ATOM   2971 C CG  . ARG A 1 392 ? -4.852  74.188 321.712 1.00 42.15  ? 393  ARG A CG  1 
ATOM   2972 C CD  . ARG A 1 392 ? -4.210  74.059 320.337 1.00 50.02  ? 393  ARG A CD  1 
ATOM   2973 N NE  . ARG A 1 392 ? -5.032  73.284 319.413 1.00 59.25  ? 393  ARG A NE  1 
ATOM   2974 C CZ  . ARG A 1 392 ? -5.870  73.823 318.534 1.00 62.04  ? 393  ARG A CZ  1 
ATOM   2975 N NH1 . ARG A 1 392 ? -5.995  75.141 318.464 1.00 56.26  ? 393  ARG A NH1 1 
ATOM   2976 N NH2 . ARG A 1 392 ? -6.581  73.048 317.726 1.00 62.82  ? 393  ARG A NH2 1 
ATOM   2977 N N   . LEU A 1 393 ? -2.709  76.225 325.307 1.00 34.83  ? 394  LEU A N   1 
ATOM   2978 C CA  . LEU A 1 393 ? -1.612  76.419 326.249 1.00 43.41  ? 394  LEU A CA  1 
ATOM   2979 C C   . LEU A 1 393 ? -2.048  76.120 327.679 1.00 53.35  ? 394  LEU A C   1 
ATOM   2980 O O   . LEU A 1 393 ? -1.286  75.535 328.458 1.00 46.15  ? 394  LEU A O   1 
ATOM   2981 C CB  . LEU A 1 393 ? -1.072  77.844 326.135 1.00 43.99  ? 394  LEU A CB  1 
ATOM   2982 C CG  . LEU A 1 393 ? -0.330  78.195 324.844 1.00 46.87  ? 394  LEU A CG  1 
ATOM   2983 C CD1 . LEU A 1 393 ? -0.105  79.696 324.755 1.00 43.28  ? 394  LEU A CD1 1 
ATOM   2984 C CD2 . LEU A 1 393 ? 0.992   77.444 324.768 1.00 40.98  ? 394  LEU A CD2 1 
ATOM   2985 N N   . ARG A 1 394 ? -3.272  76.511 328.043 1.00 48.19  ? 395  ARG A N   1 
ATOM   2986 C CA  . ARG A 1 394 ? -3.756  76.260 329.400 1.00 39.79  ? 395  ARG A CA  1 
ATOM   2987 C C   . ARG A 1 394 ? -3.893  74.768 329.670 1.00 45.53  ? 395  ARG A C   1 
ATOM   2988 O O   . ARG A 1 394 ? -3.512  74.290 330.749 1.00 38.23  ? 395  ARG A O   1 
ATOM   2989 C CB  . ARG A 1 394 ? -5.089  76.976 329.614 1.00 41.92  ? 395  ARG A CB  1 
ATOM   2990 C CG  . ARG A 1 394 ? -5.728  76.714 330.967 1.00 45.71  ? 395  ARG A CG  1 
ATOM   2991 C CD  . ARG A 1 394 ? -7.175  77.177 330.990 1.00 38.71  ? 395  ARG A CD  1 
ATOM   2992 N NE  . ARG A 1 394 ? -8.004  76.411 330.064 1.00 42.59  ? 395  ARG A NE  1 
ATOM   2993 C CZ  . ARG A 1 394 ? -9.150  76.849 329.554 1.00 46.25  ? 395  ARG A CZ  1 
ATOM   2994 N NH1 . ARG A 1 394 ? -9.604  78.051 329.878 1.00 54.49  ? 395  ARG A NH1 1 
ATOM   2995 N NH2 . ARG A 1 394 ? -9.839  76.091 328.715 1.00 44.45  ? 395  ARG A NH2 1 
ATOM   2996 N N   . GLU A 1 395 ? -4.434  74.020 328.695 1.00 43.68  ? 396  GLU A N   1 
ATOM   2997 C CA  . GLU A 1 395 ? -4.595  72.577 328.840 1.00 49.02  ? 396  GLU A CA  1 
ATOM   2998 C C   . GLU A 1 395 ? -3.233  71.881 328.821 1.00 40.67  ? 396  GLU A C   1 
ATOM   2999 O O   . GLU A 1 395 ? -3.033  70.868 329.493 1.00 52.36  ? 396  GLU A O   1 
ATOM   3000 C CB  . GLU A 1 395 ? -5.482  72.015 327.718 1.00 40.92  ? 396  GLU A CB  1 
ATOM   3001 C CG  . GLU A 1 395 ? -6.527  70.903 328.077 1.00 76.83  ? 396  GLU A CG  1 
ATOM   3002 C CD  . GLU A 1 395 ? -6.019  69.491 328.038 1.00 97.13  ? 396  GLU A CD  1 
ATOM   3003 O OE1 . GLU A 1 395 ? -6.109  68.773 329.053 1.00 93.40  ? 396  GLU A OE1 1 
ATOM   3004 O OE2 . GLU A 1 395 ? -5.556  69.179 326.872 1.00 94.44  ? 396  GLU A OE2 1 
ATOM   3005 N N   . ALA A 1 396 ? -2.286  72.418 328.051 1.00 44.58  ? 397  ALA A N   1 
ATOM   3006 C CA  . ALA A 1 396 ? -0.964  71.803 327.946 1.00 49.78  ? 397  ALA A CA  1 
ATOM   3007 C C   . ALA A 1 396 ? -0.212  71.886 329.266 1.00 38.31  ? 397  ALA A C   1 
ATOM   3008 O O   . ALA A 1 396 ? 0.373   70.894 329.710 1.00 37.98  ? 397  ALA A O   1 
ATOM   3009 C CB  . ALA A 1 396 ? -0.178  72.481 326.822 1.00 37.81  ? 397  ALA A CB  1 
ATOM   3010 N N   . LEU A 1 397 ? -0.214  73.057 329.907 1.00 34.54  ? 398  LEU A N   1 
ATOM   3011 C CA  . LEU A 1 397 ? 0.473   73.185 331.188 1.00 39.08  ? 398  LEU A CA  1 
ATOM   3012 C C   . LEU A 1 397 ? -0.176  72.302 332.244 1.00 41.37  ? 398  LEU A C   1 
ATOM   3013 O O   . LEU A 1 397 ? 0.516   71.719 333.087 1.00 38.49  ? 398  LEU A O   1 
ATOM   3014 C CB  . LEU A 1 397 ? 0.491   74.643 331.645 1.00 39.50  ? 398  LEU A CB  1 
ATOM   3015 C CG  . LEU A 1 397 ? 1.407   74.933 332.837 1.00 43.80  ? 398  LEU A CG  1 
ATOM   3016 C CD1 . LEU A 1 397 ? 2.844   74.555 332.512 1.00 40.48  ? 398  LEU A CD1 1 
ATOM   3017 C CD2 . LEU A 1 397 ? 1.319   76.393 333.250 1.00 43.87  ? 398  LEU A CD2 1 
ATOM   3018 N N   . SER A 1 398 ? -1.506  72.188 332.213 1.00 36.29  ? 399  SER A N   1 
ATOM   3019 C CA  . SER A 1 398 ? -2.192  71.264 333.108 1.00 44.73  ? 399  SER A CA  1 
ATOM   3020 C C   . SER A 1 398 ? -1.726  69.831 332.880 1.00 45.93  ? 399  SER A C   1 
ATOM   3021 O O   . SER A 1 398 ? -1.519  69.076 333.838 1.00 45.57  ? 399  SER A O   1 
ATOM   3022 C CB  . SER A 1 398 ? -3.703  71.389 332.916 1.00 41.39  ? 399  SER A CB  1 
ATOM   3023 O OG  . SER A 1 398 ? -4.410  70.446 333.707 1.00 40.96  ? 399  SER A OG  1 
ATOM   3024 N N   . ASP A 1 399 ? -1.544  69.442 331.615 1.00 38.08  ? 400  ASP A N   1 
ATOM   3025 C CA  . ASP A 1 399 ? -1.042  68.104 331.315 1.00 41.18  ? 400  ASP A CA  1 
ATOM   3026 C C   . ASP A 1 399 ? 0.413   67.947 331.743 1.00 38.98  ? 400  ASP A C   1 
ATOM   3027 O O   . ASP A 1 399 ? 0.820   66.866 332.179 1.00 38.51  ? 400  ASP A O   1 
ATOM   3028 C CB  . ASP A 1 399 ? -1.190  67.808 329.823 1.00 47.08  ? 400  ASP A CB  1 
ATOM   3029 C CG  . ASP A 1 399 ? -2.622  67.518 329.426 1.00 56.96  ? 400  ASP A CG  1 
ATOM   3030 O OD1 . ASP A 1 399 ? -3.422  67.141 330.309 1.00 65.07  ? 400  ASP A OD1 1 
ATOM   3031 O OD2 . ASP A 1 399 ? -2.947  67.662 328.230 1.00 70.23  ? 400  ASP A OD2 1 
ATOM   3032 N N   . VAL A 1 400 ? 1.213   69.008 331.610 1.00 33.95  ? 401  VAL A N   1 
ATOM   3033 C CA  . VAL A 1 400 ? 2.608   68.955 332.048 1.00 38.99  ? 401  VAL A CA  1 
ATOM   3034 C C   . VAL A 1 400 ? 2.679   68.596 333.526 1.00 40.10  ? 401  VAL A C   1 
ATOM   3035 O O   . VAL A 1 400 ? 3.318   67.615 333.921 1.00 35.22  ? 401  VAL A O   1 
ATOM   3036 C CB  . VAL A 1 400 ? 3.316   70.294 331.768 1.00 39.96  ? 401  VAL A CB  1 
ATOM   3037 C CG1 . VAL A 1 400 ? 4.642   70.352 332.504 1.00 33.20  ? 401  VAL A CG1 1 
ATOM   3038 C CG2 . VAL A 1 400 ? 3.527   70.493 330.275 1.00 34.47  ? 401  VAL A CG2 1 
ATOM   3039 N N   . VAL A 1 401 ? 2.001   69.386 334.360 1.00 36.29  ? 402  VAL A N   1 
ATOM   3040 C CA  . VAL A 1 401 ? 2.027   69.162 335.801 1.00 33.16  ? 402  VAL A CA  1 
ATOM   3041 C C   . VAL A 1 401 ? 1.386   67.824 336.150 1.00 40.99  ? 402  VAL A C   1 
ATOM   3042 O O   . VAL A 1 401 ? 1.866   67.102 337.032 1.00 37.97  ? 402  VAL A O   1 
ATOM   3043 C CB  . VAL A 1 401 ? 1.336   70.333 336.523 1.00 36.95  ? 402  VAL A CB  1 
ATOM   3044 C CG1 . VAL A 1 401 ? 1.272   70.084 338.025 1.00 27.83  ? 402  VAL A CG1 1 
ATOM   3045 C CG2 . VAL A 1 401 ? 2.068   71.630 336.221 1.00 31.69  ? 402  VAL A CG2 1 
ATOM   3046 N N   . GLY A 1 402 ? 0.307   67.463 335.454 1.00 37.04  ? 403  GLY A N   1 
ATOM   3047 C CA  . GLY A 1 402 ? -0.387  66.225 335.777 1.00 32.26  ? 403  GLY A CA  1 
ATOM   3048 C C   . GLY A 1 402 ? 0.398   64.987 335.380 1.00 37.67  ? 403  GLY A C   1 
ATOM   3049 O O   . GLY A 1 402 ? 0.539   64.051 336.172 1.00 37.92  ? 403  GLY A O   1 
ATOM   3050 N N   . ASP A 1 403 ? 0.910   64.961 334.144 1.00 33.52  ? 404  ASP A N   1 
ATOM   3051 C CA  . ASP A 1 403 ? 1.672   63.803 333.678 1.00 34.86  ? 404  ASP A CA  1 
ATOM   3052 C C   . ASP A 1 403 ? 2.959   63.633 334.475 1.00 37.48  ? 404  ASP A C   1 
ATOM   3053 O O   . ASP A 1 403 ? 3.309   62.519 334.884 1.00 36.69  ? 404  ASP A O   1 
ATOM   3054 C CB  . ASP A 1 403 ? 2.000   63.941 332.189 1.00 39.38  ? 404  ASP A CB  1 
ATOM   3055 C CG  . ASP A 1 403 ? 0.764   64.064 331.321 1.00 44.03  ? 404  ASP A CG  1 
ATOM   3056 O OD1 . ASP A 1 403 ? -0.349  63.781 331.812 1.00 48.57  ? 404  ASP A OD1 1 
ATOM   3057 O OD2 . ASP A 1 403 ? 0.911   64.443 330.141 1.00 46.74  ? 404  ASP A OD2 1 
ATOM   3058 N N   . HIS A 1 404 ? 3.683   64.733 334.690 1.00 35.13  ? 405  HIS A N   1 
ATOM   3059 C CA  . HIS A 1 404 ? 4.974   64.674 335.368 1.00 33.69  ? 405  HIS A CA  1 
ATOM   3060 C C   . HIS A 1 404 ? 4.823   64.202 336.810 1.00 38.97  ? 405  HIS A C   1 
ATOM   3061 O O   . HIS A 1 404 ? 5.648   63.427 337.309 1.00 32.81  ? 405  HIS A O   1 
ATOM   3062 C CB  . HIS A 1 404 ? 5.635   66.053 335.309 1.00 33.61  ? 405  HIS A CB  1 
ATOM   3063 C CG  . HIS A 1 404 ? 6.869   66.187 336.146 1.00 38.37  ? 405  HIS A CG  1 
ATOM   3064 N ND1 . HIS A 1 404 ? 7.877   65.247 336.150 1.00 39.87  ? 405  HIS A ND1 1 
ATOM   3065 C CD2 . HIS A 1 404 ? 7.269   67.171 336.987 1.00 32.10  ? 405  HIS A CD2 1 
ATOM   3066 C CE1 . HIS A 1 404 ? 8.839   65.640 336.965 1.00 36.17  ? 405  HIS A CE1 1 
ATOM   3067 N NE2 . HIS A 1 404 ? 8.495   66.804 337.487 1.00 47.65  ? 405  HIS A NE2 1 
ATOM   3068 N N   . ASN A 1 405 ? 3.765   64.637 337.489 1.00 35.84  ? 406  ASN A N   1 
ATOM   3069 C CA  . ASN A 1 405 ? 3.628   64.377 338.916 1.00 37.01  ? 406  ASN A CA  1 
ATOM   3070 C C   . ASN A 1 405 ? 2.761   63.168 339.250 1.00 38.58  ? 406  ASN A C   1 
ATOM   3071 O O   . ASN A 1 405 ? 2.982   62.543 340.290 1.00 34.53  ? 406  ASN A O   1 
ATOM   3072 C CB  . ASN A 1 405 ? 3.067   65.618 339.620 1.00 29.91  ? 406  ASN A CB  1 
ATOM   3073 C CG  . ASN A 1 405 ? 4.083   66.748 339.700 1.00 29.27  ? 406  ASN A CG  1 
ATOM   3074 O OD1 . ASN A 1 405 ? 5.120   66.615 340.346 1.00 35.28  ? 406  ASN A OD1 1 
ATOM   3075 N ND2 . ASN A 1 405 ? 3.786   67.866 339.046 1.00 30.64  ? 406  ASN A ND2 1 
ATOM   3076 N N   . VAL A 1 406 ? 1.792   62.802 338.408 1.00 38.36  ? 407  VAL A N   1 
ATOM   3077 C CA  . VAL A 1 406 ? 0.855   61.742 338.777 1.00 33.12  ? 407  VAL A CA  1 
ATOM   3078 C C   . VAL A 1 406 ? 0.777   60.651 337.713 1.00 41.45  ? 407  VAL A C   1 
ATOM   3079 O O   . VAL A 1 406 ? 1.118   59.491 337.977 1.00 35.54  ? 407  VAL A O   1 
ATOM   3080 C CB  . VAL A 1 406 ? -0.550  62.315 339.052 1.00 40.49  ? 407  VAL A CB  1 
ATOM   3081 C CG1 . VAL A 1 406 ? -1.502  61.197 339.452 1.00 36.66  ? 407  VAL A CG1 1 
ATOM   3082 C CG2 . VAL A 1 406 ? -0.499  63.382 340.134 1.00 31.86  ? 407  VAL A CG2 1 
ATOM   3083 N N   . VAL A 1 407 ? 0.326   61.012 336.507 1.00 34.48  ? 408  VAL A N   1 
ATOM   3084 C CA  . VAL A 1 407 ? -0.120  60.009 335.536 1.00 34.58  ? 408  VAL A CA  1 
ATOM   3085 C C   . VAL A 1 407 ? 1.022   59.080 335.149 1.00 33.31  ? 408  VAL A C   1 
ATOM   3086 O O   . VAL A 1 407 ? 0.864   57.854 335.087 1.00 36.43  ? 408  VAL A O   1 
ATOM   3087 C CB  . VAL A 1 407 ? -0.717  60.691 334.293 1.00 39.27  ? 408  VAL A CB  1 
ATOM   3088 C CG1 . VAL A 1 407 ? -1.205  59.643 333.314 1.00 36.08  ? 408  VAL A CG1 1 
ATOM   3089 C CG2 . VAL A 1 407 ? -1.854  61.623 334.686 1.00 37.56  ? 408  VAL A CG2 1 
ATOM   3090 N N   . CYS A 1 408 ? 2.187   59.645 334.883 1.00 29.22  ? 409  CYS A N   1 
ATOM   3091 C CA  . CYS A 1 408 ? 3.308   58.853 334.371 1.00 32.33  ? 409  CYS A CA  1 
ATOM   3092 C C   . CYS A 1 408 ? 4.041   58.093 335.502 1.00 36.59  ? 409  CYS A C   1 
ATOM   3093 O O   . CYS A 1 408 ? 4.398   56.920 335.345 1.00 39.49  ? 409  CYS A O   1 
ATOM   3094 C CB  . CYS A 1 408 ? 4.243   59.772 333.606 1.00 36.74  ? 409  CYS A CB  1 
ATOM   3095 S SG  . CYS A 1 408 ? 3.507   60.400 332.083 1.00 42.60  ? 409  CYS A SG  1 
ATOM   3096 N N   . PRO A 1 409 ? 4.208   58.680 336.701 1.00 36.88  ? 410  PRO A N   1 
ATOM   3097 C CA  . PRO A 1 409 ? 4.653   57.865 337.860 1.00 35.07  ? 410  PRO A CA  1 
ATOM   3098 C C   . PRO A 1 409 ? 3.742   56.689 338.135 1.00 31.58  ? 410  PRO A C   1 
ATOM   3099 O O   . PRO A 1 409 ? 4.229   55.579 338.383 1.00 29.98  ? 410  PRO A O   1 
ATOM   3100 C CB  . PRO A 1 409 ? 4.647   58.884 339.013 1.00 24.68  ? 410  PRO A CB  1 
ATOM   3101 C CG  . PRO A 1 409 ? 4.936   60.168 338.334 1.00 27.90  ? 410  PRO A CG  1 
ATOM   3102 C CD  . PRO A 1 409 ? 4.234   60.112 337.020 1.00 34.97  ? 410  PRO A CD  1 
ATOM   3103 N N   . VAL A 1 410 ? 2.425   56.893 338.054 1.00 30.68  ? 411  VAL A N   1 
ATOM   3104 C CA  . VAL A 1 410 ? 1.476   55.798 338.242 1.00 29.89  ? 411  VAL A CA  1 
ATOM   3105 C C   . VAL A 1 410 ? 1.603   54.777 337.116 1.00 46.21  ? 411  VAL A C   1 
ATOM   3106 O O   . VAL A 1 410 ? 1.627   53.564 337.359 1.00 39.94  ? 411  VAL A O   1 
ATOM   3107 C CB  . VAL A 1 410 ? 0.040   56.349 338.342 1.00 32.28  ? 411  VAL A CB  1 
ATOM   3108 C CG1 . VAL A 1 410 ? -0.974  55.245 338.082 1.00 32.49  ? 411  VAL A CG1 1 
ATOM   3109 C CG2 . VAL A 1 410 ? -0.195  56.987 339.705 1.00 32.96  ? 411  VAL A CG2 1 
ATOM   3110 N N   . ALA A 1 411 ? 1.670   55.250 335.866 1.00 39.60  ? 412  ALA A N   1 
ATOM   3111 C CA  . ALA A 1 411 ? 1.773   54.330 334.735 1.00 38.31  ? 412  ALA A CA  1 
ATOM   3112 C C   . ALA A 1 411 ? 3.049   53.501 334.813 1.00 42.85  ? 412  ALA A C   1 
ATOM   3113 O O   . ALA A 1 411 ? 3.027   52.286 334.584 1.00 40.34  ? 412  ALA A O   1 
ATOM   3114 C CB  . ALA A 1 411 ? 1.716   55.103 333.416 1.00 42.54  ? 412  ALA A CB  1 
ATOM   3115 N N   . GLN A 1 412 ? 4.169   54.139 335.156 1.00 32.90  ? 413  GLN A N   1 
ATOM   3116 C CA  . GLN A 1 412 ? 5.423   53.406 335.282 1.00 32.74  ? 413  GLN A CA  1 
ATOM   3117 C C   . GLN A 1 412 ? 5.337   52.349 336.376 1.00 46.08  ? 413  GLN A C   1 
ATOM   3118 O O   . GLN A 1 412 ? 5.820   51.224 336.201 1.00 46.50  ? 413  GLN A O   1 
ATOM   3119 C CB  . GLN A 1 412 ? 6.564   54.382 335.557 1.00 33.21  ? 413  GLN A CB  1 
ATOM   3120 C CG  . GLN A 1 412 ? 7.825   53.752 336.101 1.00 33.62  ? 413  GLN A CG  1 
ATOM   3121 C CD  . GLN A 1 412 ? 8.952   54.754 336.199 1.00 61.79  ? 413  GLN A CD  1 
ATOM   3122 O OE1 . GLN A 1 412 ? 9.100   55.444 337.209 1.00 82.30  ? 413  GLN A OE1 1 
ATOM   3123 N NE2 . GLN A 1 412 ? 9.754   54.845 335.145 1.00 70.54  ? 413  GLN A NE2 1 
ATOM   3124 N N   . LEU A 1 413 ? 4.723   52.689 337.512 1.00 41.71  ? 414  LEU A N   1 
ATOM   3125 C CA  . LEU A 1 413 ? 4.559   51.710 338.581 1.00 37.41  ? 414  LEU A CA  1 
ATOM   3126 C C   . LEU A 1 413 ? 3.674   50.555 338.131 1.00 37.25  ? 414  LEU A C   1 
ATOM   3127 O O   . LEU A 1 413 ? 4.026   49.383 338.303 1.00 39.92  ? 414  LEU A O   1 
ATOM   3128 C CB  . LEU A 1 413 ? 3.978   52.382 339.825 1.00 43.42  ? 414  LEU A CB  1 
ATOM   3129 C CG  . LEU A 1 413 ? 3.660   51.468 341.009 1.00 43.49  ? 414  LEU A CG  1 
ATOM   3130 C CD1 . LEU A 1 413 ? 4.278   52.016 342.280 1.00 46.23  ? 414  LEU A CD1 1 
ATOM   3131 C CD2 . LEU A 1 413 ? 2.160   51.322 341.171 1.00 55.09  ? 414  LEU A CD2 1 
ATOM   3132 N N   . ALA A 1 414 ? 2.518   50.870 337.540 1.00 32.25  ? 415  ALA A N   1 
ATOM   3133 C CA  . ALA A 1 414 ? 1.602   49.826 337.094 1.00 41.59  ? 415  ALA A CA  1 
ATOM   3134 C C   . ALA A 1 414 ? 2.254   48.916 336.061 1.00 52.72  ? 415  ALA A C   1 
ATOM   3135 O O   . ALA A 1 414 ? 2.046   47.697 336.079 1.00 46.64  ? 415  ALA A O   1 
ATOM   3136 C CB  . ALA A 1 414 ? 0.329   50.454 336.525 1.00 42.93  ? 415  ALA A CB  1 
ATOM   3137 N N   . GLY A 1 415 ? 3.049   49.489 335.155 1.00 45.35  ? 416  GLY A N   1 
ATOM   3138 C CA  . GLY A 1 415 ? 3.699   48.676 334.141 1.00 45.65  ? 416  GLY A CA  1 
ATOM   3139 C C   . GLY A 1 415 ? 4.756   47.751 334.713 1.00 45.19  ? 416  GLY A C   1 
ATOM   3140 O O   . GLY A 1 415 ? 4.856   46.588 334.314 1.00 45.09  ? 416  GLY A O   1 
ATOM   3141 N N   . ARG A 1 416 ? 5.556   48.247 335.658 1.00 38.22  ? 417  ARG A N   1 
ATOM   3142 C CA  . ARG A 1 416 ? 6.595   47.410 336.247 1.00 45.87  ? 417  ARG A CA  1 
ATOM   3143 C C   . ARG A 1 416 ? 6.001   46.334 337.150 1.00 53.84  ? 417  ARG A C   1 
ATOM   3144 O O   . ARG A 1 416 ? 6.521   45.214 337.210 1.00 59.57  ? 417  ARG A O   1 
ATOM   3145 C CB  . ARG A 1 416 ? 7.587   48.274 337.023 1.00 49.21  ? 417  ARG A CB  1 
ATOM   3146 C CG  . ARG A 1 416 ? 8.390   49.227 336.157 1.00 55.61  ? 417  ARG A CG  1 
ATOM   3147 C CD  . ARG A 1 416 ? 9.089   48.490 335.026 1.00 68.02  ? 417  ARG A CD  1 
ATOM   3148 N NE  . ARG A 1 416 ? 10.011  47.472 335.522 1.00 71.74  ? 417  ARG A NE  1 
ATOM   3149 C CZ  . ARG A 1 416 ? 11.329  47.513 335.356 1.00 74.93  ? 417  ARG A CZ  1 
ATOM   3150 N NH1 . ARG A 1 416 ? 11.885  48.524 334.703 1.00 60.48  ? 417  ARG A NH1 1 
ATOM   3151 N NH2 . ARG A 1 416 ? 12.093  46.542 335.841 1.00 69.55  ? 417  ARG A NH2 1 
ATOM   3152 N N   . LEU A 1 417 ? 4.916   46.653 337.862 1.00 48.90  ? 418  LEU A N   1 
ATOM   3153 C CA  . LEU A 1 417 ? 4.284   45.660 338.727 1.00 48.60  ? 418  LEU A CA  1 
ATOM   3154 C C   . LEU A 1 417 ? 3.687   44.521 337.909 1.00 53.16  ? 418  LEU A C   1 
ATOM   3155 O O   . LEU A 1 417 ? 3.845   43.345 338.255 1.00 51.65  ? 418  LEU A O   1 
ATOM   3156 C CB  . LEU A 1 417 ? 3.202   46.313 339.590 1.00 41.15  ? 418  LEU A CB  1 
ATOM   3157 C CG  . LEU A 1 417 ? 3.596   47.322 340.673 1.00 57.05  ? 418  LEU A CG  1 
ATOM   3158 C CD1 . LEU A 1 417 ? 2.495   47.443 341.712 1.00 42.98  ? 418  LEU A CD1 1 
ATOM   3159 C CD2 . LEU A 1 417 ? 4.903   46.945 341.332 1.00 48.88  ? 418  LEU A CD2 1 
ATOM   3160 N N   . ALA A 1 418 ? 2.990   44.857 336.820 1.00 51.69  ? 419  ALA A N   1 
ATOM   3161 C CA  . ALA A 1 418 ? 2.342   43.834 336.007 1.00 54.73  ? 419  ALA A CA  1 
ATOM   3162 C C   . ALA A 1 418 ? 3.365   42.926 335.336 1.00 51.88  ? 419  ALA A C   1 
ATOM   3163 O O   . ALA A 1 418 ? 3.151   41.713 335.229 1.00 57.52  ? 419  ALA A O   1 
ATOM   3164 C CB  . ALA A 1 418 ? 1.440   44.492 334.963 1.00 43.82  ? 419  ALA A CB  1 
ATOM   3165 N N   . ALA A 1 419 ? 4.486   43.494 334.887 1.00 51.37  ? 420  ALA A N   1 
ATOM   3166 C CA  . ALA A 1 419 ? 5.516   42.700 334.229 1.00 48.65  ? 420  ALA A CA  1 
ATOM   3167 C C   . ALA A 1 419 ? 6.262   41.794 335.196 1.00 52.45  ? 420  ALA A C   1 
ATOM   3168 O O   . ALA A 1 419 ? 6.891   40.825 334.758 1.00 67.75  ? 420  ALA A O   1 
ATOM   3169 C CB  . ALA A 1 419 ? 6.510   43.616 333.513 1.00 33.99  ? 420  ALA A CB  1 
ATOM   3170 N N   . GLN A 1 420 ? 6.204   42.074 336.497 1.00 54.96  ? 421  GLN A N   1 
ATOM   3171 C CA  . GLN A 1 420 ? 6.989   41.345 337.483 1.00 44.53  ? 421  GLN A CA  1 
ATOM   3172 C C   . GLN A 1 420 ? 6.121   40.522 338.430 1.00 47.65  ? 421  GLN A C   1 
ATOM   3173 O O   . GLN A 1 420 ? 6.499   40.286 339.580 1.00 45.60  ? 421  GLN A O   1 
ATOM   3174 C CB  . GLN A 1 420 ? 7.881   42.309 338.262 1.00 47.01  ? 421  GLN A CB  1 
ATOM   3175 C CG  . GLN A 1 420 ? 8.929   42.981 337.386 1.00 47.61  ? 421  GLN A CG  1 
ATOM   3176 C CD  . GLN A 1 420 ? 9.509   44.229 338.016 1.00 58.82  ? 421  GLN A CD  1 
ATOM   3177 O OE1 . GLN A 1 420 ? 9.976   45.128 337.318 1.00 51.41  ? 421  GLN A OE1 1 
ATOM   3178 N NE2 . GLN A 1 420 ? 9.489   44.287 339.342 1.00 62.46  ? 421  GLN A NE2 1 
ATOM   3179 N N   . GLY A 1 421 ? 4.959   40.077 337.961 1.00 56.38  ? 422  GLY A N   1 
ATOM   3180 C CA  . GLY A 1 421 ? 4.184   39.077 338.665 1.00 60.04  ? 422  GLY A CA  1 
ATOM   3181 C C   . GLY A 1 421 ? 2.977   39.562 339.437 1.00 61.89  ? 422  GLY A C   1 
ATOM   3182 O O   . GLY A 1 421 ? 2.365   38.759 340.151 1.00 66.75  ? 422  GLY A O   1 
ATOM   3183 N N   . ALA A 1 422 ? 2.609   40.832 339.320 1.00 49.92  ? 423  ALA A N   1 
ATOM   3184 C CA  . ALA A 1 422 ? 1.459   41.369 340.034 1.00 54.96  ? 423  ALA A CA  1 
ATOM   3185 C C   . ALA A 1 422 ? 0.279   41.534 339.088 1.00 50.64  ? 423  ALA A C   1 
ATOM   3186 O O   . ALA A 1 422 ? 0.454   41.856 337.909 1.00 59.32  ? 423  ALA A O   1 
ATOM   3187 C CB  . ALA A 1 422 ? 1.794   42.712 340.688 1.00 52.24  ? 423  ALA A CB  1 
ATOM   3188 N N   . ARG A 1 423 ? -0.923  41.306 339.611 1.00 44.59  ? 424  ARG A N   1 
ATOM   3189 C CA  . ARG A 1 423 ? -2.150  41.541 338.861 1.00 47.99  ? 424  ARG A CA  1 
ATOM   3190 C C   . ARG A 1 423 ? -2.622  42.965 339.121 1.00 51.32  ? 424  ARG A C   1 
ATOM   3191 O O   . ARG A 1 423 ? -2.879  43.339 340.271 1.00 46.71  ? 424  ARG A O   1 
ATOM   3192 C CB  . ARG A 1 423 ? -3.229  40.532 339.245 1.00 44.47  ? 424  ARG A CB  1 
ATOM   3193 C CG  . ARG A 1 423 ? -4.129  40.153 338.082 1.00 70.88  ? 424  ARG A CG  1 
ATOM   3194 C CD  . ARG A 1 423 ? -3.584  38.949 337.325 1.00 83.52  ? 424  ARG A CD  1 
ATOM   3195 N NE  . ARG A 1 423 ? -4.422  38.590 336.182 1.00 97.80  ? 424  ARG A NE  1 
ATOM   3196 C CZ  . ARG A 1 423 ? -5.642  38.069 336.280 1.00 99.59  ? 424  ARG A CZ  1 
ATOM   3197 N NH1 . ARG A 1 423 ? -6.179  37.843 337.472 1.00 89.79  ? 424  ARG A NH1 1 
ATOM   3198 N NH2 . ARG A 1 423 ? -6.327  37.773 335.183 1.00 93.03  ? 424  ARG A NH2 1 
ATOM   3199 N N   . VAL A 1 424 ? -2.745  43.750 338.053 1.00 41.37  ? 425  VAL A N   1 
ATOM   3200 C CA  . VAL A 1 424 ? -2.981  45.185 338.140 1.00 38.14  ? 425  VAL A CA  1 
ATOM   3201 C C   . VAL A 1 424 ? -4.268  45.533 337.406 1.00 46.49  ? 425  VAL A C   1 
ATOM   3202 O O   . VAL A 1 424 ? -4.519  45.038 336.302 1.00 46.64  ? 425  VAL A O   1 
ATOM   3203 C CB  . VAL A 1 424 ? -1.794  45.980 337.557 1.00 36.86  ? 425  VAL A CB  1 
ATOM   3204 C CG1 . VAL A 1 424 ? -1.903  47.450 337.923 1.00 36.67  ? 425  VAL A CG1 1 
ATOM   3205 C CG2 . VAL A 1 424 ? -0.473  45.400 338.048 1.00 38.49  ? 425  VAL A CG2 1 
ATOM   3206 N N   . TYR A 1 425 ? -5.079  46.389 338.021 1.00 41.24  ? 426  TYR A N   1 
ATOM   3207 C CA  . TYR A 1 425 ? -6.258  46.965 337.388 1.00 35.26  ? 426  TYR A CA  1 
ATOM   3208 C C   . TYR A 1 425 ? -6.118  48.479 337.416 1.00 43.29  ? 426  TYR A C   1 
ATOM   3209 O O   . TYR A 1 425 ? -5.812  49.056 338.465 1.00 46.32  ? 426  TYR A O   1 
ATOM   3210 C CB  . TYR A 1 425 ? -7.545  46.528 338.095 1.00 34.21  ? 426  TYR A CB  1 
ATOM   3211 C CG  . TYR A 1 425 ? -7.793  45.037 338.056 1.00 43.22  ? 426  TYR A CG  1 
ATOM   3212 C CD1 . TYR A 1 425 ? -8.506  44.457 337.012 1.00 46.13  ? 426  TYR A CD1 1 
ATOM   3213 C CD2 . TYR A 1 425 ? -7.311  44.206 339.060 1.00 41.48  ? 426  TYR A CD2 1 
ATOM   3214 C CE1 . TYR A 1 425 ? -8.733  43.092 336.973 1.00 48.95  ? 426  TYR A CE1 1 
ATOM   3215 C CE2 . TYR A 1 425 ? -7.531  42.840 339.028 1.00 43.19  ? 426  TYR A CE2 1 
ATOM   3216 C CZ  . TYR A 1 425 ? -8.243  42.289 337.983 1.00 51.56  ? 426  TYR A CZ  1 
ATOM   3217 O OH  . TYR A 1 425 ? -8.464  40.931 337.949 1.00 51.14  ? 426  TYR A OH  1 
ATOM   3218 N N   . ALA A 1 426 ? -6.324  49.119 336.267 1.00 38.33  ? 427  ALA A N   1 
ATOM   3219 C CA  . ALA A 1 426 ? -6.122  50.553 336.134 1.00 35.37  ? 427  ALA A CA  1 
ATOM   3220 C C   . ALA A 1 426 ? -7.417  51.233 335.714 1.00 35.50  ? 427  ALA A C   1 
ATOM   3221 O O   . ALA A 1 426 ? -8.266  50.631 335.049 1.00 40.07  ? 427  ALA A O   1 
ATOM   3222 C CB  . ALA A 1 426 ? -5.013  50.866 335.124 1.00 37.64  ? 427  ALA A CB  1 
ATOM   3223 N N   . TYR A 1 427 ? -7.563  52.499 336.106 1.00 32.44  ? 428  TYR A N   1 
ATOM   3224 C CA  . TYR A 1 427 ? -8.760  53.265 335.796 1.00 32.47  ? 428  TYR A CA  1 
ATOM   3225 C C   . TYR A 1 427 ? -8.393  54.720 335.545 1.00 36.31  ? 428  TYR A C   1 
ATOM   3226 O O   . TYR A 1 427 ? -7.308  55.184 335.905 1.00 38.45  ? 428  TYR A O   1 
ATOM   3227 C CB  . TYR A 1 427 ? -9.809  53.178 336.923 1.00 38.03  ? 428  TYR A CB  1 
ATOM   3228 C CG  . TYR A 1 427 ? -9.432  53.911 338.203 1.00 40.94  ? 428  TYR A CG  1 
ATOM   3229 C CD1 . TYR A 1 427 ? -9.645  55.280 338.339 1.00 36.33  ? 428  TYR A CD1 1 
ATOM   3230 C CD2 . TYR A 1 427 ? -8.882  53.227 339.280 1.00 34.87  ? 428  TYR A CD2 1 
ATOM   3231 C CE1 . TYR A 1 427 ? -9.301  55.949 339.500 1.00 38.03  ? 428  TYR A CE1 1 
ATOM   3232 C CE2 . TYR A 1 427 ? -8.538  53.890 340.452 1.00 40.41  ? 428  TYR A CE2 1 
ATOM   3233 C CZ  . TYR A 1 427 ? -8.750  55.251 340.553 1.00 41.26  ? 428  TYR A CZ  1 
ATOM   3234 O OH  . TYR A 1 427 ? -8.413  55.922 341.705 1.00 47.37  ? 428  TYR A OH  1 
ATOM   3235 N N   . VAL A 1 428 ? -9.327  55.437 334.926 1.00 41.34  ? 429  VAL A N   1 
ATOM   3236 C CA  . VAL A 1 428 ? -9.281  56.889 334.812 1.00 36.26  ? 429  VAL A CA  1 
ATOM   3237 C C   . VAL A 1 428 ? -10.660 57.413 335.193 1.00 41.96  ? 429  VAL A C   1 
ATOM   3238 O O   . VAL A 1 428 ? -11.656 57.078 334.541 1.00 42.15  ? 429  VAL A O   1 
ATOM   3239 C CB  . VAL A 1 428 ? -8.886  57.355 333.400 1.00 42.55  ? 429  VAL A CB  1 
ATOM   3240 C CG1 . VAL A 1 428 ? -9.089  58.854 333.263 1.00 32.01  ? 429  VAL A CG1 1 
ATOM   3241 C CG2 . VAL A 1 428 ? -7.437  56.990 333.106 1.00 41.98  ? 429  VAL A CG2 1 
ATOM   3242 N N   . PHE A 1 429 ? -10.719 58.210 336.258 1.00 39.66  ? 430  PHE A N   1 
ATOM   3243 C CA  . PHE A 1 429 ? -11.980 58.747 336.756 1.00 38.33  ? 430  PHE A CA  1 
ATOM   3244 C C   . PHE A 1 429 ? -12.333 60.003 335.969 1.00 36.11  ? 430  PHE A C   1 
ATOM   3245 O O   . PHE A 1 429 ? -11.597 60.994 336.014 1.00 46.88  ? 430  PHE A O   1 
ATOM   3246 C CB  . PHE A 1 429 ? -11.870 59.048 338.251 1.00 36.33  ? 430  PHE A CB  1 
ATOM   3247 C CG  . PHE A 1 429 ? -13.170 59.449 338.887 1.00 34.73  ? 430  PHE A CG  1 
ATOM   3248 C CD1 . PHE A 1 429 ? -14.060 58.488 339.338 1.00 41.80  ? 430  PHE A CD1 1 
ATOM   3249 C CD2 . PHE A 1 429 ? -13.503 60.786 339.034 1.00 38.12  ? 430  PHE A CD2 1 
ATOM   3250 C CE1 . PHE A 1 429 ? -15.257 58.852 339.923 1.00 41.21  ? 430  PHE A CE1 1 
ATOM   3251 C CE2 . PHE A 1 429 ? -14.702 61.157 339.620 1.00 43.86  ? 430  PHE A CE2 1 
ATOM   3252 C CZ  . PHE A 1 429 ? -15.580 60.188 340.063 1.00 39.26  ? 430  PHE A CZ  1 
ATOM   3253 N N   . GLU A 1 430 ? -13.463 59.970 335.257 1.00 40.38  ? 431  GLU A N   1 
ATOM   3254 C CA  . GLU A 1 430 ? -13.796 61.008 334.286 1.00 49.21  ? 431  GLU A CA  1 
ATOM   3255 C C   . GLU A 1 430 ? -15.094 61.744 334.594 1.00 49.84  ? 431  GLU A C   1 
ATOM   3256 O O   . GLU A 1 430 ? -15.524 62.574 333.784 1.00 48.68  ? 431  GLU A O   1 
ATOM   3257 C CB  . GLU A 1 430 ? -13.875 60.411 332.877 1.00 46.34  ? 431  GLU A CB  1 
ATOM   3258 C CG  . GLU A 1 430 ? -12.523 60.084 332.266 1.00 56.26  ? 431  GLU A CG  1 
ATOM   3259 C CD  . GLU A 1 430 ? -12.630 59.615 330.828 1.00 66.17  ? 431  GLU A CD  1 
ATOM   3260 O OE1 . GLU A 1 430 ? -13.767 59.418 330.346 1.00 70.38  ? 431  GLU A OE1 1 
ATOM   3261 O OE2 . GLU A 1 430 ? -11.577 59.444 330.179 1.00 79.47  ? 431  GLU A OE2 1 
ATOM   3262 N N   . HIS A 1 431 ? -15.731 61.474 335.726 1.00 49.56  ? 432  HIS A N   1 
ATOM   3263 C CA  . HIS A 1 431 ? -16.977 62.146 336.067 1.00 50.92  ? 432  HIS A CA  1 
ATOM   3264 C C   . HIS A 1 431 ? -16.688 63.409 336.865 1.00 44.86  ? 432  HIS A C   1 
ATOM   3265 O O   . HIS A 1 431 ? -15.996 63.363 337.886 1.00 49.61  ? 432  HIS A O   1 
ATOM   3266 C CB  . HIS A 1 431 ? -17.903 61.227 336.863 1.00 40.46  ? 432  HIS A CB  1 
ATOM   3267 C CG  . HIS A 1 431 ? -19.151 61.906 337.338 1.00 48.29  ? 432  HIS A CG  1 
ATOM   3268 N ND1 . HIS A 1 431 ? -20.111 62.387 336.473 1.00 48.68  ? 432  HIS A ND1 1 
ATOM   3269 C CD2 . HIS A 1 431 ? -19.590 62.196 338.586 1.00 50.72  ? 432  HIS A CD2 1 
ATOM   3270 C CE1 . HIS A 1 431 ? -21.090 62.938 337.167 1.00 45.64  ? 432  HIS A CE1 1 
ATOM   3271 N NE2 . HIS A 1 431 ? -20.799 62.836 338.452 1.00 50.71  ? 432  HIS A NE2 1 
ATOM   3272 N N   . ARG A 1 432 ? -17.218 64.532 336.395 1.00 43.09  ? 433  ARG A N   1 
ATOM   3273 C CA  . ARG A 1 432 ? -17.144 65.786 337.128 1.00 42.64  ? 433  ARG A CA  1 
ATOM   3274 C C   . ARG A 1 432 ? -18.405 65.925 337.971 1.00 54.02  ? 433  ARG A C   1 
ATOM   3275 O O   . ARG A 1 432 ? -19.517 65.949 337.431 1.00 49.13  ? 433  ARG A O   1 
ATOM   3276 C CB  . ARG A 1 432 ? -16.991 66.970 336.174 1.00 46.15  ? 433  ARG A CB  1 
ATOM   3277 C CG  . ARG A 1 432 ? -16.976 68.313 336.880 1.00 49.53  ? 433  ARG A CG  1 
ATOM   3278 C CD  . ARG A 1 432 ? -16.899 69.461 335.895 1.00 44.32  ? 433  ARG A CD  1 
ATOM   3279 N NE  . ARG A 1 432 ? -17.173 70.740 336.544 1.00 45.42  ? 433  ARG A NE  1 
ATOM   3280 C CZ  . ARG A 1 432 ? -16.236 71.583 336.962 1.00 56.56  ? 433  ARG A CZ  1 
ATOM   3281 N NH1 . ARG A 1 432 ? -14.951 71.287 336.798 1.00 50.04  ? 433  ARG A NH1 1 
ATOM   3282 N NH2 . ARG A 1 432 ? -16.583 72.724 337.541 1.00 50.58  ? 433  ARG A NH2 1 
ATOM   3283 N N   . ALA A 1 433 ? -18.231 66.004 339.289 1.00 48.74  ? 434  ALA A N   1 
ATOM   3284 C CA  . ALA A 1 433 ? -19.370 66.048 340.196 1.00 53.32  ? 434  ALA A CA  1 
ATOM   3285 C C   . ALA A 1 433 ? -20.252 67.254 339.902 1.00 59.04  ? 434  ALA A C   1 
ATOM   3286 O O   . ALA A 1 433 ? -19.763 68.348 339.606 1.00 57.77  ? 434  ALA A O   1 
ATOM   3287 C CB  . ALA A 1 433 ? -18.889 66.088 341.649 1.00 43.89  ? 434  ALA A CB  1 
ATOM   3288 N N   . SER A 1 434 ? -21.569 67.044 339.982 1.00 50.72  ? 435  SER A N   1 
ATOM   3289 C CA  . SER A 1 434 ? -22.511 68.130 339.735 1.00 48.72  ? 435  SER A CA  1 
ATOM   3290 C C   . SER A 1 434 ? -22.388 69.231 340.780 1.00 54.49  ? 435  SER A C   1 
ATOM   3291 O O   . SER A 1 434 ? -22.731 70.386 340.503 1.00 57.14  ? 435  SER A O   1 
ATOM   3292 C CB  . SER A 1 434 ? -23.941 67.590 339.707 1.00 57.07  ? 435  SER A CB  1 
ATOM   3293 O OG  . SER A 1 434 ? -24.323 67.084 340.977 1.00 57.36  ? 435  SER A OG  1 
ATOM   3294 N N   . THR A 1 435 ? -21.906 68.898 341.975 1.00 55.76  ? 436  THR A N   1 
ATOM   3295 C CA  . THR A 1 435 ? -21.763 69.855 343.062 1.00 48.03  ? 436  THR A CA  1 
ATOM   3296 C C   . THR A 1 435 ? -20.383 70.503 343.107 1.00 48.69  ? 436  THR A C   1 
ATOM   3297 O O   . THR A 1 435 ? -20.088 71.227 344.063 1.00 58.82  ? 436  THR A O   1 
ATOM   3298 C CB  . THR A 1 435 ? -22.056 69.174 344.405 1.00 51.24  ? 436  THR A CB  1 
ATOM   3299 O OG1 . THR A 1 435 ? -21.116 68.113 344.619 1.00 59.49  ? 436  THR A OG1 1 
ATOM   3300 C CG2 . THR A 1 435 ? -23.466 68.599 344.422 1.00 58.06  ? 436  THR A CG2 1 
ATOM   3301 N N   . LEU A 1 436 ? -19.542 70.271 342.101 1.00 43.34  ? 437  LEU A N   1 
ATOM   3302 C CA  . LEU A 1 436 ? -18.163 70.738 342.163 1.00 52.48  ? 437  LEU A CA  1 
ATOM   3303 C C   . LEU A 1 436 ? -18.098 72.259 342.116 1.00 47.49  ? 437  LEU A C   1 
ATOM   3304 O O   . LEU A 1 436 ? -18.648 72.892 341.210 1.00 57.62  ? 437  LEU A O   1 
ATOM   3305 C CB  . LEU A 1 436 ? -17.337 70.142 341.028 1.00 53.28  ? 437  LEU A CB  1 
ATOM   3306 C CG  . LEU A 1 436 ? -15.831 70.163 341.309 1.00 61.15  ? 437  LEU A CG  1 
ATOM   3307 C CD1 . LEU A 1 436 ? -15.457 69.000 342.183 1.00 64.54  ? 437  LEU A CD1 1 
ATOM   3308 C CD2 . LEU A 1 436 ? -15.026 70.116 340.030 1.00 55.34  ? 437  LEU A CD2 1 
ATOM   3309 N N   . SER A 1 437 ? -17.409 72.836 343.092 1.00 43.60  ? 438  SER A N   1 
ATOM   3310 C CA  . SER A 1 437 ? -17.304 74.278 343.238 1.00 50.51  ? 438  SER A CA  1 
ATOM   3311 C C   . SER A 1 437 ? -16.227 74.891 342.351 1.00 49.91  ? 438  SER A C   1 
ATOM   3312 O O   . SER A 1 437 ? -16.268 76.097 342.094 1.00 49.43  ? 438  SER A O   1 
ATOM   3313 C CB  . SER A 1 437 ? -16.991 74.610 344.705 1.00 45.39  ? 438  SER A CB  1 
ATOM   3314 O OG  . SER A 1 437 ? -16.095 73.638 345.227 1.00 69.22  ? 438  SER A OG  1 
ATOM   3315 N N   . TRP A 1 438 ? -15.263 74.088 341.908 1.00 45.83  ? 439  TRP A N   1 
ATOM   3316 C CA  . TRP A 1 438 ? -14.161 74.610 341.120 1.00 43.01  ? 439  TRP A CA  1 
ATOM   3317 C C   . TRP A 1 438 ? -14.642 75.021 339.725 1.00 48.88  ? 439  TRP A C   1 
ATOM   3318 O O   . TRP A 1 438 ? -15.650 74.507 339.233 1.00 44.24  ? 439  TRP A O   1 
ATOM   3319 C CB  . TRP A 1 438 ? -13.052 73.563 341.016 1.00 40.41  ? 439  TRP A CB  1 
ATOM   3320 C CG  . TRP A 1 438 ? -12.286 73.373 342.300 1.00 43.17  ? 439  TRP A CG  1 
ATOM   3321 C CD1 . TRP A 1 438 ? -12.411 72.341 343.186 1.00 45.88  ? 439  TRP A CD1 1 
ATOM   3322 C CD2 . TRP A 1 438 ? -11.277 74.238 342.832 1.00 44.84  ? 439  TRP A CD2 1 
ATOM   3323 N NE1 . TRP A 1 438 ? -11.543 72.513 344.239 1.00 46.71  ? 439  TRP A NE1 1 
ATOM   3324 C CE2 . TRP A 1 438 ? -10.835 73.670 344.045 1.00 47.79  ? 439  TRP A CE2 1 
ATOM   3325 C CE3 . TRP A 1 438 ? -10.705 75.438 342.403 1.00 39.97  ? 439  TRP A CE3 1 
ATOM   3326 C CZ2 . TRP A 1 438 ? -9.848  74.262 344.830 1.00 44.16  ? 439  TRP A CZ2 1 
ATOM   3327 C CZ3 . TRP A 1 438 ? -9.726  76.023 343.181 1.00 45.50  ? 439  TRP A CZ3 1 
ATOM   3328 C CH2 . TRP A 1 438 ? -9.308  75.436 344.381 1.00 48.05  ? 439  TRP A CH2 1 
ATOM   3329 N N   . PRO A 1 439 ? -13.953 75.964 339.075 1.00 44.93  ? 440  PRO A N   1 
ATOM   3330 C CA  . PRO A 1 439 ? -14.371 76.386 337.733 1.00 42.89  ? 440  PRO A CA  1 
ATOM   3331 C C   . PRO A 1 439 ? -14.371 75.216 336.763 1.00 48.25  ? 440  PRO A C   1 
ATOM   3332 O O   . PRO A 1 439 ? -13.775 74.163 337.010 1.00 47.97  ? 440  PRO A O   1 
ATOM   3333 C CB  . PRO A 1 439 ? -13.323 77.440 337.347 1.00 41.58  ? 440  PRO A CB  1 
ATOM   3334 C CG  . PRO A 1 439 ? -12.152 77.154 338.226 1.00 52.95  ? 440  PRO A CG  1 
ATOM   3335 C CD  . PRO A 1 439 ? -12.742 76.679 339.520 1.00 49.23  ? 440  PRO A CD  1 
ATOM   3336 N N   . LEU A 1 440 ? -15.054 75.415 335.629 1.00 49.23  ? 441  LEU A N   1 
ATOM   3337 C CA  . LEU A 1 440 ? -15.291 74.307 334.711 1.00 53.83  ? 441  LEU A CA  1 
ATOM   3338 C C   . LEU A 1 440 ? -14.052 73.992 333.881 1.00 51.01  ? 441  LEU A C   1 
ATOM   3339 O O   . LEU A 1 440 ? -13.875 72.847 333.441 1.00 51.23  ? 441  LEU A O   1 
ATOM   3340 C CB  . LEU A 1 440 ? -16.480 74.610 333.806 1.00 59.17  ? 441  LEU A CB  1 
ATOM   3341 C CG  . LEU A 1 440 ? -16.773 73.604 332.689 1.00 69.00  ? 441  LEU A CG  1 
ATOM   3342 C CD1 . LEU A 1 440 ? -17.730 72.528 333.195 1.00 63.36  ? 441  LEU A CD1 1 
ATOM   3343 C CD2 . LEU A 1 440 ? -17.375 74.310 331.493 1.00 74.59  ? 441  LEU A CD2 1 
ATOM   3344 N N   . TRP A 1 441 ? -13.154 74.969 333.677 1.00 44.66  ? 442  TRP A N   1 
ATOM   3345 C CA  . TRP A 1 441 ? -11.943 74.694 332.907 1.00 42.73  ? 442  TRP A CA  1 
ATOM   3346 C C   . TRP A 1 441 ? -11.019 73.719 333.623 1.00 51.10  ? 442  TRP A C   1 
ATOM   3347 O O   . TRP A 1 441 ? -10.154 73.125 332.971 1.00 49.15  ? 442  TRP A O   1 
ATOM   3348 C CB  . TRP A 1 441 ? -11.196 75.994 332.579 1.00 44.31  ? 442  TRP A CB  1 
ATOM   3349 C CG  . TRP A 1 441 ? -10.582 76.710 333.755 1.00 41.86  ? 442  TRP A CG  1 
ATOM   3350 C CD1 . TRP A 1 441 ? -11.115 77.764 334.435 1.00 52.09  ? 442  TRP A CD1 1 
ATOM   3351 C CD2 . TRP A 1 441 ? -9.313  76.434 334.376 1.00 48.61  ? 442  TRP A CD2 1 
ATOM   3352 N NE1 . TRP A 1 441 ? -10.268 78.158 335.443 1.00 51.56  ? 442  TRP A NE1 1 
ATOM   3353 C CE2 . TRP A 1 441 ? -9.157  77.358 335.429 1.00 41.08  ? 442  TRP A CE2 1 
ATOM   3354 C CE3 . TRP A 1 441 ? -8.301  75.496 334.147 1.00 45.75  ? 442  TRP A CE3 1 
ATOM   3355 C CZ2 . TRP A 1 441 ? -8.032  77.369 336.253 1.00 43.51  ? 442  TRP A CZ2 1 
ATOM   3356 C CZ3 . TRP A 1 441 ? -7.182  75.510 334.970 1.00 42.94  ? 442  TRP A CZ3 1 
ATOM   3357 C CH2 . TRP A 1 441 ? -7.059  76.440 336.008 1.00 45.24  ? 442  TRP A CH2 1 
ATOM   3358 N N   . MET A 1 442 ? -11.176 73.532 334.935 1.00 48.57  ? 443  MET A N   1 
ATOM   3359 C CA  . MET A 1 442 ? -10.347 72.578 335.662 1.00 42.76  ? 443  MET A CA  1 
ATOM   3360 C C   . MET A 1 442 ? -10.763 71.133 335.433 1.00 47.68  ? 443  MET A C   1 
ATOM   3361 O O   . MET A 1 442 ? -10.012 70.228 335.815 1.00 41.06  ? 443  MET A O   1 
ATOM   3362 C CB  . MET A 1 442 ? -10.375 72.878 337.161 1.00 36.92  ? 443  MET A CB  1 
ATOM   3363 C CG  . MET A 1 442 ? -9.749  74.201 337.545 1.00 41.51  ? 443  MET A CG  1 
ATOM   3364 S SD  . MET A 1 442 ? -9.543  74.356 339.329 1.00 52.83  ? 443  MET A SD  1 
ATOM   3365 C CE  . MET A 1 442 ? -8.899  76.016 339.443 1.00 52.00  ? 443  MET A CE  1 
ATOM   3366 N N   . GLY A 1 443 ? -11.930 70.895 334.837 1.00 42.67  ? 444  GLY A N   1 
ATOM   3367 C CA  . GLY A 1 443 ? -12.346 69.529 334.547 1.00 35.00  ? 444  GLY A CA  1 
ATOM   3368 C C   . GLY A 1 443 ? -12.590 68.740 335.820 1.00 46.33  ? 444  GLY A C   1 
ATOM   3369 O O   . GLY A 1 443 ? -13.326 69.169 336.716 1.00 45.49  ? 444  GLY A O   1 
ATOM   3370 N N   . VAL A 1 444 ? -11.967 67.569 335.903 1.00 39.79  ? 445  VAL A N   1 
ATOM   3371 C CA  . VAL A 1 444 ? -12.064 66.705 337.077 1.00 43.48  ? 445  VAL A CA  1 
ATOM   3372 C C   . VAL A 1 444 ? -10.761 66.814 337.862 1.00 43.48  ? 445  VAL A C   1 
ATOM   3373 O O   . VAL A 1 444 ? -9.785  66.119 337.544 1.00 35.73  ? 445  VAL A O   1 
ATOM   3374 C CB  . VAL A 1 444 ? -12.361 65.254 336.674 1.00 46.60  ? 445  VAL A CB  1 
ATOM   3375 C CG1 . VAL A 1 444 ? -12.635 64.407 337.903 1.00 36.38  ? 445  VAL A CG1 1 
ATOM   3376 C CG2 . VAL A 1 444 ? -13.540 65.206 335.710 1.00 43.78  ? 445  VAL A CG2 1 
ATOM   3377 N N   . PRO A 1 445 ? -10.701 67.655 338.889 1.00 40.07  ? 446  PRO A N   1 
ATOM   3378 C CA  . PRO A 1 445 ? -9.418  67.975 339.522 1.00 44.98  ? 446  PRO A CA  1 
ATOM   3379 C C   . PRO A 1 445 ? -8.916  66.858 340.431 1.00 41.23  ? 446  PRO A C   1 
ATOM   3380 O O   . PRO A 1 445 ? -9.586  65.857 340.685 1.00 37.41  ? 446  PRO A O   1 
ATOM   3381 C CB  . PRO A 1 445 ? -9.721  69.244 340.332 1.00 39.51  ? 446  PRO A CB  1 
ATOM   3382 C CG  . PRO A 1 445 ? -11.083 69.710 339.865 1.00 38.15  ? 446  PRO A CG  1 
ATOM   3383 C CD  . PRO A 1 445 ? -11.795 68.476 339.426 1.00 40.55  ? 446  PRO A CD  1 
ATOM   3384 N N   . HIS A 1 446 ? -7.700  67.069 340.922 1.00 46.01  ? 447  HIS A N   1 
ATOM   3385 C CA  . HIS A 1 446 ? -7.040  66.131 341.820 1.00 44.37  ? 447  HIS A CA  1 
ATOM   3386 C C   . HIS A 1 446 ? -7.863  65.917 343.087 1.00 44.53  ? 447  HIS A C   1 
ATOM   3387 O O   . HIS A 1 446 ? -8.232  66.877 343.772 1.00 40.63  ? 447  HIS A O   1 
ATOM   3388 C CB  . HIS A 1 446 ? -5.653  66.673 342.163 1.00 43.18  ? 447  HIS A CB  1 
ATOM   3389 C CG  . HIS A 1 446 ? -4.786  65.714 342.914 1.00 44.84  ? 447  HIS A CG  1 
ATOM   3390 N ND1 . HIS A 1 446 ? -4.302  64.550 342.355 1.00 40.80  ? 447  HIS A ND1 1 
ATOM   3391 C CD2 . HIS A 1 446 ? -4.296  65.758 344.176 1.00 34.82  ? 447  HIS A CD2 1 
ATOM   3392 C CE1 . HIS A 1 446 ? -3.560  63.914 343.242 1.00 43.35  ? 447  HIS A CE1 1 
ATOM   3393 N NE2 . HIS A 1 446 ? -3.539  64.626 344.355 1.00 54.09  ? 447  HIS A NE2 1 
ATOM   3394 N N   . GLY A 1 447 ? -8.160  64.655 343.390 1.00 37.03  ? 448  GLY A N   1 
ATOM   3395 C CA  . GLY A 1 447 ? -8.801  64.297 344.636 1.00 35.15  ? 448  GLY A CA  1 
ATOM   3396 C C   . GLY A 1 447 ? -10.313 64.250 344.624 1.00 43.80  ? 448  GLY A C   1 
ATOM   3397 O O   . GLY A 1 447 ? -10.911 63.977 345.673 1.00 41.68  ? 448  GLY A O   1 
ATOM   3398 N N   . TYR A 1 448 ? -10.962 64.490 343.486 1.00 40.31  ? 449  TYR A N   1 
ATOM   3399 C CA  . TYR A 1 448 ? -12.415 64.584 343.471 1.00 41.79  ? 449  TYR A CA  1 
ATOM   3400 C C   . TYR A 1 448 ? -13.087 63.312 342.970 1.00 33.34  ? 449  TYR A C   1 
ATOM   3401 O O   . TYR A 1 448 ? -14.266 63.341 342.606 1.00 39.62  ? 449  TYR A O   1 
ATOM   3402 C CB  . TYR A 1 448 ? -12.854 65.808 342.673 1.00 32.15  ? 449  TYR A CB  1 
ATOM   3403 C CG  . TYR A 1 448 ? -12.642 67.063 343.485 1.00 46.85  ? 449  TYR A CG  1 
ATOM   3404 C CD1 . TYR A 1 448 ? -13.568 67.456 344.443 1.00 42.01  ? 449  TYR A CD1 1 
ATOM   3405 C CD2 . TYR A 1 448 ? -11.490 67.822 343.338 1.00 39.19  ? 449  TYR A CD2 1 
ATOM   3406 C CE1 . TYR A 1 448 ? -13.371 68.593 345.204 1.00 42.93  ? 449  TYR A CE1 1 
ATOM   3407 C CE2 . TYR A 1 448 ? -11.283 68.961 344.096 1.00 41.91  ? 449  TYR A CE2 1 
ATOM   3408 C CZ  . TYR A 1 448 ? -12.227 69.340 345.029 1.00 46.58  ? 449  TYR A CZ  1 
ATOM   3409 O OH  . TYR A 1 448 ? -12.028 70.468 345.791 1.00 47.73  ? 449  TYR A OH  1 
ATOM   3410 N N   . GLU A 1 449 ? -12.367 62.194 342.972 1.00 36.51  ? 450  GLU A N   1 
ATOM   3411 C CA  . GLU A 1 449 ? -12.988 60.881 342.918 1.00 33.07  ? 450  GLU A CA  1 
ATOM   3412 C C   . GLU A 1 449 ? -13.247 60.304 344.307 1.00 42.87  ? 450  GLU A C   1 
ATOM   3413 O O   . GLU A 1 449 ? -14.019 59.347 344.428 1.00 44.68  ? 450  GLU A O   1 
ATOM   3414 C CB  . GLU A 1 449 ? -12.106 59.916 342.119 1.00 29.92  ? 450  GLU A CB  1 
ATOM   3415 C CG  . GLU A 1 449 ? -11.089 59.134 342.949 1.00 37.20  ? 450  GLU A CG  1 
ATOM   3416 C CD  . GLU A 1 449 ? -9.898  59.970 343.410 1.00 50.01  ? 450  GLU A CD  1 
ATOM   3417 O OE1 . GLU A 1 449 ? -9.961  61.219 343.353 1.00 44.21  ? 450  GLU A OE1 1 
ATOM   3418 O OE2 . GLU A 1 449 ? -8.888  59.367 343.833 1.00 47.60  ? 450  GLU A OE2 1 
ATOM   3419 N N   . ILE A 1 450 ? -12.638 60.877 345.351 1.00 43.51  ? 451  ILE A N   1 
ATOM   3420 C CA  . ILE A 1 450 ? -12.681 60.274 346.684 1.00 45.27  ? 451  ILE A CA  1 
ATOM   3421 C C   . ILE A 1 450 ? -14.112 60.212 347.205 1.00 41.27  ? 451  ILE A C   1 
ATOM   3422 O O   . ILE A 1 450 ? -14.554 59.183 347.731 1.00 36.42  ? 451  ILE A O   1 
ATOM   3423 C CB  . ILE A 1 450 ? -11.772 61.052 347.651 1.00 47.80  ? 451  ILE A CB  1 
ATOM   3424 C CG1 . ILE A 1 450 ? -10.319 61.017 347.173 1.00 47.68  ? 451  ILE A CG1 1 
ATOM   3425 C CG2 . ILE A 1 450 ? -11.896 60.499 349.062 1.00 39.40  ? 451  ILE A CG2 1 
ATOM   3426 C CD1 . ILE A 1 450 ? -9.388  61.833 348.039 1.00 35.05  ? 451  ILE A CD1 1 
ATOM   3427 N N   . GLU A 1 451 ? -14.852 61.318 347.072 1.00 34.08  ? 452  GLU A N   1 
ATOM   3428 C CA  . GLU A 1 451 ? -16.205 61.387 347.618 1.00 41.41  ? 452  GLU A CA  1 
ATOM   3429 C C   . GLU A 1 451 ? -17.117 60.320 347.024 1.00 40.69  ? 452  GLU A C   1 
ATOM   3430 O O   . GLU A 1 451 ? -18.038 59.849 347.700 1.00 39.65  ? 452  GLU A O   1 
ATOM   3431 C CB  . GLU A 1 451 ? -16.793 62.781 347.386 1.00 38.85  ? 452  GLU A CB  1 
ATOM   3432 C CG  . GLU A 1 451 ? -16.830 63.215 345.926 1.00 39.89  ? 452  GLU A CG  1 
ATOM   3433 C CD  . GLU A 1 451 ? -16.887 64.726 345.772 1.00 52.52  ? 452  GLU A CD  1 
ATOM   3434 O OE1 . GLU A 1 451 ? -15.990 65.416 346.302 1.00 59.06  ? 452  GLU A OE1 1 
ATOM   3435 O OE2 . GLU A 1 451 ? -17.833 65.228 345.128 1.00 57.16  ? 452  GLU A OE2 1 
ATOM   3436 N N   . PHE A 1 452 ? -16.881 59.922 345.773 1.00 33.80  ? 453  PHE A N   1 
ATOM   3437 C CA  . PHE A 1 452 ? -17.670 58.845 345.191 1.00 31.84  ? 453  PHE A CA  1 
ATOM   3438 C C   . PHE A 1 452 ? -17.223 57.483 345.704 1.00 42.88  ? 453  PHE A C   1 
ATOM   3439 O O   . PHE A 1 452 ? -18.058 56.592 345.893 1.00 44.32  ? 453  PHE A O   1 
ATOM   3440 C CB  . PHE A 1 452 ? -17.594 58.903 343.660 1.00 43.24  ? 453  PHE A CB  1 
ATOM   3441 C CG  . PHE A 1 452 ? -18.315 60.085 343.071 1.00 42.29  ? 453  PHE A CG  1 
ATOM   3442 C CD1 . PHE A 1 452 ? -17.659 61.291 342.888 1.00 39.28  ? 453  PHE A CD1 1 
ATOM   3443 C CD2 . PHE A 1 452 ? -19.655 59.997 342.724 1.00 37.82  ? 453  PHE A CD2 1 
ATOM   3444 C CE1 . PHE A 1 452 ? -18.320 62.388 342.363 1.00 43.27  ? 453  PHE A CE1 1 
ATOM   3445 C CE2 . PHE A 1 452 ? -20.323 61.091 342.197 1.00 38.66  ? 453  PHE A CE2 1 
ATOM   3446 C CZ  . PHE A 1 452 ? -19.655 62.287 342.016 1.00 42.91  ? 453  PHE A CZ  1 
ATOM   3447 N N   . ILE A 1 453 ? -15.922 57.310 345.948 1.00 41.32  ? 454  ILE A N   1 
ATOM   3448 C CA  . ILE A 1 453 ? -15.423 56.048 346.483 1.00 39.09  ? 454  ILE A CA  1 
ATOM   3449 C C   . ILE A 1 453 ? -15.991 55.791 347.875 1.00 42.84  ? 454  ILE A C   1 
ATOM   3450 O O   . ILE A 1 453 ? -16.342 54.656 348.216 1.00 45.43  ? 454  ILE A O   1 
ATOM   3451 C CB  . ILE A 1 453 ? -13.883 56.047 346.494 1.00 55.58  ? 454  ILE A CB  1 
ATOM   3452 C CG1 . ILE A 1 453 ? -13.336 56.285 345.082 1.00 39.79  ? 454  ILE A CG1 1 
ATOM   3453 C CG2 . ILE A 1 453 ? -13.349 54.749 347.088 1.00 37.42  ? 454  ILE A CG2 1 
ATOM   3454 C CD1 . ILE A 1 453 ? -13.747 55.238 344.089 1.00 50.98  ? 454  ILE A CD1 1 
ATOM   3455 N N   . PHE A 1 454 ? -16.088 56.834 348.700 1.00 35.06  ? 455  PHE A N   1 
ATOM   3456 C CA  . PHE A 1 454 ? -16.592 56.683 350.061 1.00 37.64  ? 455  PHE A CA  1 
ATOM   3457 C C   . PHE A 1 454 ? -18.112 56.737 350.146 1.00 41.49  ? 455  PHE A C   1 
ATOM   3458 O O   . PHE A 1 454 ? -18.654 56.647 351.253 1.00 43.10  ? 455  PHE A O   1 
ATOM   3459 C CB  . PHE A 1 454 ? -15.982 57.756 350.970 1.00 32.08  ? 455  PHE A CB  1 
ATOM   3460 C CG  . PHE A 1 454 ? -14.624 57.395 351.502 1.00 46.50  ? 455  PHE A CG  1 
ATOM   3461 C CD1 . PHE A 1 454 ? -13.484 57.635 350.749 1.00 40.77  ? 455  PHE A CD1 1 
ATOM   3462 C CD2 . PHE A 1 454 ? -14.486 56.809 352.750 1.00 41.87  ? 455  PHE A CD2 1 
ATOM   3463 C CE1 . PHE A 1 454 ? -12.232 57.298 351.232 1.00 43.57  ? 455  PHE A CE1 1 
ATOM   3464 C CE2 . PHE A 1 454 ? -13.233 56.470 353.240 1.00 40.64  ? 455  PHE A CE2 1 
ATOM   3465 C CZ  . PHE A 1 454 ? -12.106 56.716 352.480 1.00 37.82  ? 455  PHE A CZ  1 
ATOM   3466 N N   . GLY A 1 455 ? -18.809 56.882 349.021 1.00 37.31  ? 456  GLY A N   1 
ATOM   3467 C CA  . GLY A 1 455 ? -20.259 56.880 349.036 1.00 42.51  ? 456  GLY A CA  1 
ATOM   3468 C C   . GLY A 1 455 ? -20.899 58.129 349.593 1.00 51.08  ? 456  GLY A C   1 
ATOM   3469 O O   . GLY A 1 455 ? -22.073 58.094 349.975 1.00 48.82  ? 456  GLY A O   1 
ATOM   3470 N N   . ILE A 1 456 ? -20.163 59.236 349.644 1.00 43.58  ? 457  ILE A N   1 
ATOM   3471 C CA  . ILE A 1 456 ? -20.654 60.515 350.158 1.00 42.37  ? 457  ILE A CA  1 
ATOM   3472 C C   . ILE A 1 456 ? -21.943 60.966 349.466 1.00 47.39  ? 457  ILE A C   1 
ATOM   3473 O O   . ILE A 1 456 ? -22.788 61.591 350.124 1.00 45.14  ? 457  ILE A O   1 
ATOM   3474 C CB  . ILE A 1 456 ? -19.561 61.594 350.049 1.00 39.32  ? 457  ILE A CB  1 
ATOM   3475 C CG1 . ILE A 1 456 ? -18.276 61.114 350.727 1.00 44.72  ? 457  ILE A CG1 1 
ATOM   3476 C CG2 . ILE A 1 456 ? -20.016 62.907 350.660 1.00 32.99  ? 457  ILE A CG2 1 
ATOM   3477 C CD1 . ILE A 1 456 ? -18.457 60.732 352.182 1.00 37.79  ? 457  ILE A CD1 1 
ATOM   3478 N N   . PRO A 1 457 ? -22.153 60.706 348.167 1.00 53.99  ? 458  PRO A N   1 
ATOM   3479 C CA  . PRO A 1 457 ? -23.442 61.087 347.559 1.00 53.93  ? 458  PRO A CA  1 
ATOM   3480 C C   . PRO A 1 457 ? -24.671 60.496 348.240 1.00 54.81  ? 458  PRO A C   1 
ATOM   3481 O O   . PRO A 1 457 ? -25.769 61.038 348.062 1.00 46.98  ? 458  PRO A O   1 
ATOM   3482 C CB  . PRO A 1 457 ? -23.307 60.585 346.117 1.00 52.10  ? 458  PRO A CB  1 
ATOM   3483 C CG  . PRO A 1 457 ? -21.869 60.735 345.833 1.00 51.24  ? 458  PRO A CG  1 
ATOM   3484 C CD  . PRO A 1 457 ? -21.154 60.402 347.122 1.00 45.24  ? 458  PRO A CD  1 
ATOM   3485 N N   . LEU A 1 458 ? -24.533 59.416 349.011 1.00 48.04  ? 459  LEU A N   1 
ATOM   3486 C CA  . LEU A 1 458 ? -25.689 58.869 349.710 1.00 49.77  ? 459  LEU A CA  1 
ATOM   3487 C C   . LEU A 1 458 ? -26.058 59.660 350.960 1.00 54.56  ? 459  LEU A C   1 
ATOM   3488 O O   . LEU A 1 458 ? -27.106 59.390 351.556 1.00 52.65  ? 459  LEU A O   1 
ATOM   3489 C CB  . LEU A 1 458 ? -25.449 57.401 350.067 1.00 38.49  ? 459  LEU A CB  1 
ATOM   3490 C CG  . LEU A 1 458 ? -24.984 56.541 348.891 1.00 50.35  ? 459  LEU A CG  1 
ATOM   3491 C CD1 . LEU A 1 458 ? -24.470 55.200 349.379 1.00 52.40  ? 459  LEU A CD1 1 
ATOM   3492 C CD2 . LEU A 1 458 ? -26.101 56.359 347.874 1.00 52.00  ? 459  LEU A CD2 1 
ATOM   3493 N N   . ASP A 1 459 ? -25.242 60.626 351.356 1.00 50.22  ? 460  ASP A N   1 
ATOM   3494 C CA  . ASP A 1 459 ? -25.589 61.522 352.449 1.00 59.66  ? 460  ASP A CA  1 
ATOM   3495 C C   . ASP A 1 459 ? -26.825 62.331 352.070 1.00 63.92  ? 460  ASP A C   1 
ATOM   3496 O O   . ASP A 1 459 ? -26.777 63.104 351.101 1.00 60.02  ? 460  ASP A O   1 
ATOM   3497 C CB  . ASP A 1 459 ? -24.414 62.451 352.758 1.00 60.56  ? 460  ASP A CB  1 
ATOM   3498 C CG  . ASP A 1 459 ? -24.581 63.208 354.066 1.00 64.55  ? 460  ASP A CG  1 
ATOM   3499 O OD1 . ASP A 1 459 ? -25.725 63.360 354.544 1.00 74.97  ? 460  ASP A OD1 1 
ATOM   3500 O OD2 . ASP A 1 459 ? -23.557 63.667 354.614 1.00 69.36  ? 460  ASP A OD2 1 
ATOM   3501 N N   . PRO A 1 460 ? -27.939 62.192 352.793 1.00 67.34  ? 461  PRO A N   1 
ATOM   3502 C CA  . PRO A 1 460 ? -29.142 62.964 352.444 1.00 59.16  ? 461  PRO A CA  1 
ATOM   3503 C C   . PRO A 1 460 ? -28.963 64.464 352.600 1.00 57.37  ? 461  PRO A C   1 
ATOM   3504 O O   . PRO A 1 460 ? -29.692 65.229 351.958 1.00 71.90  ? 461  PRO A O   1 
ATOM   3505 C CB  . PRO A 1 460 ? -30.198 62.421 353.415 1.00 70.14  ? 461  PRO A CB  1 
ATOM   3506 C CG  . PRO A 1 460 ? -29.402 61.925 354.582 1.00 71.13  ? 461  PRO A CG  1 
ATOM   3507 C CD  . PRO A 1 460 ? -28.144 61.358 353.989 1.00 65.31  ? 461  PRO A CD  1 
ATOM   3508 N N   . SER A 1 461 ? -28.016 64.909 353.431 1.00 62.49  ? 462  SER A N   1 
ATOM   3509 C CA  . SER A 1 461 ? -27.764 66.335 353.598 1.00 58.95  ? 462  SER A CA  1 
ATOM   3510 C C   . SER A 1 461 ? -27.185 66.976 352.344 1.00 72.35  ? 462  SER A C   1 
ATOM   3511 O O   . SER A 1 461 ? -27.316 68.192 352.167 1.00 73.55  ? 462  SER A O   1 
ATOM   3512 C CB  . SER A 1 461 ? -26.817 66.564 354.776 1.00 55.23  ? 462  SER A CB  1 
ATOM   3513 O OG  . SER A 1 461 ? -25.470 66.648 354.340 1.00 78.96  ? 462  SER A OG  1 
ATOM   3514 N N   . ARG A 1 462 ? -26.547 66.195 351.480 1.00 62.86  ? 463  ARG A N   1 
ATOM   3515 C CA  . ARG A 1 462 ? -25.951 66.730 350.269 1.00 71.90  ? 463  ARG A CA  1 
ATOM   3516 C C   . ARG A 1 462 ? -26.919 66.618 349.096 1.00 71.00  ? 463  ARG A C   1 
ATOM   3517 O O   . ARG A 1 462 ? -27.982 65.996 349.183 1.00 74.97  ? 463  ARG A O   1 
ATOM   3518 C CB  . ARG A 1 462 ? -24.634 66.016 349.966 1.00 60.61  ? 463  ARG A CB  1 
ATOM   3519 C CG  . ARG A 1 462 ? -23.487 66.503 350.836 1.00 64.46  ? 463  ARG A CG  1 
ATOM   3520 C CD  . ARG A 1 462 ? -22.502 65.400 351.157 1.00 52.77  ? 463  ARG A CD  1 
ATOM   3521 N NE  . ARG A 1 462 ? -21.817 65.644 352.425 1.00 71.16  ? 463  ARG A NE  1 
ATOM   3522 C CZ  . ARG A 1 462 ? -20.705 66.361 352.553 1.00 69.80  ? 463  ARG A CZ  1 
ATOM   3523 N NH1 . ARG A 1 462 ? -20.141 66.916 351.488 1.00 69.10  ? 463  ARG A NH1 1 
ATOM   3524 N NH2 . ARG A 1 462 ? -20.158 66.526 353.749 1.00 72.86  ? 463  ARG A NH2 1 
ATOM   3525 N N   . ASN A 1 463 ? -26.538 67.240 347.982 1.00 61.33  ? 464  ASN A N   1 
ATOM   3526 C CA  . ASN A 1 463 ? -27.421 67.341 346.826 1.00 59.35  ? 464  ASN A CA  1 
ATOM   3527 C C   . ASN A 1 463 ? -26.853 66.700 345.574 1.00 46.52  ? 464  ASN A C   1 
ATOM   3528 O O   . ASN A 1 463 ? -26.804 67.347 344.525 1.00 56.38  ? 464  ASN A O   1 
ATOM   3529 C CB  . ASN A 1 463 ? -27.716 68.793 346.480 1.00 67.11  ? 464  ASN A CB  1 
ATOM   3530 C CG  . ASN A 1 463 ? -28.310 69.560 347.613 1.00 81.85  ? 464  ASN A CG  1 
ATOM   3531 O OD1 . ASN A 1 463 ? -29.285 69.131 348.230 1.00 77.20  ? 464  ASN A OD1 1 
ATOM   3532 N ND2 . ASN A 1 463 ? -27.741 70.723 347.895 1.00 94.35  ? 464  ASN A ND2 1 
ATOM   3533 N N   . TYR A 1 464 ? -26.424 65.446 345.650 1.00 48.21  ? 465  TYR A N   1 
ATOM   3534 C CA  . TYR A 1 464 ? -26.038 64.786 344.418 1.00 45.54  ? 465  TYR A CA  1 
ATOM   3535 C C   . TYR A 1 464 ? -27.285 64.332 343.664 1.00 55.43  ? 465  TYR A C   1 
ATOM   3536 O O   . TYR A 1 464 ? -28.375 64.212 344.229 1.00 57.90  ? 465  TYR A O   1 
ATOM   3537 C CB  . TYR A 1 464 ? -25.115 63.602 344.707 1.00 46.35  ? 465  TYR A CB  1 
ATOM   3538 C CG  . TYR A 1 464 ? -23.752 64.005 345.227 1.00 53.20  ? 465  TYR A CG  1 
ATOM   3539 C CD1 . TYR A 1 464 ? -23.563 64.316 346.567 1.00 49.56  ? 465  TYR A CD1 1 
ATOM   3540 C CD2 . TYR A 1 464 ? -22.654 64.072 344.379 1.00 46.66  ? 465  TYR A CD2 1 
ATOM   3541 C CE1 . TYR A 1 464 ? -22.320 64.679 347.051 1.00 48.22  ? 465  TYR A CE1 1 
ATOM   3542 C CE2 . TYR A 1 464 ? -21.405 64.438 344.853 1.00 47.62  ? 465  TYR A CE2 1 
ATOM   3543 C CZ  . TYR A 1 464 ? -21.245 64.740 346.191 1.00 62.04  ? 465  TYR A CZ  1 
ATOM   3544 O OH  . TYR A 1 464 ? -20.006 65.104 346.669 1.00 47.75  ? 465  TYR A OH  1 
ATOM   3545 N N   . THR A 1 465 ? -27.122 64.101 342.367 1.00 47.72  ? 466  THR A N   1 
ATOM   3546 C CA  . THR A 1 465 ? -28.231 63.579 341.588 1.00 48.10  ? 466  THR A CA  1 
ATOM   3547 C C   . THR A 1 465 ? -28.430 62.097 341.886 1.00 54.43  ? 466  THR A C   1 
ATOM   3548 O O   . THR A 1 465 ? -27.560 61.426 342.451 1.00 50.12  ? 466  THR A O   1 
ATOM   3549 C CB  . THR A 1 465 ? -27.992 63.784 340.093 1.00 43.07  ? 466  THR A CB  1 
ATOM   3550 O OG1 . THR A 1 465 ? -27.023 62.833 339.635 1.00 46.15  ? 466  THR A OG1 1 
ATOM   3551 C CG2 . THR A 1 465 ? -27.492 65.197 339.826 1.00 46.35  ? 466  THR A CG2 1 
ATOM   3552 N N   . ALA A 1 466 ? -29.602 61.587 341.502 1.00 50.12  ? 467  ALA A N   1 
ATOM   3553 C CA  . ALA A 1 466 ? -29.890 60.175 341.727 1.00 53.13  ? 467  ALA A CA  1 
ATOM   3554 C C   . ALA A 1 466 ? -28.938 59.279 340.945 1.00 54.28  ? 467  ALA A C   1 
ATOM   3555 O O   . ALA A 1 466 ? -28.584 58.190 341.413 1.00 60.11  ? 467  ALA A O   1 
ATOM   3556 C CB  . ALA A 1 466 ? -31.342 59.872 341.357 1.00 48.93  ? 467  ALA A CB  1 
ATOM   3557 N N   . GLU A 1 467 ? -28.504 59.723 339.763 1.00 46.96  ? 468  GLU A N   1 
ATOM   3558 C CA  . GLU A 1 467 ? -27.569 58.938 338.964 1.00 60.89  ? 468  GLU A CA  1 
ATOM   3559 C C   . GLU A 1 467 ? -26.174 58.945 339.578 1.00 55.40  ? 468  GLU A C   1 
ATOM   3560 O O   . GLU A 1 467 ? -25.454 57.942 339.498 1.00 48.32  ? 468  GLU A O   1 
ATOM   3561 C CB  . GLU A 1 467 ? -27.527 59.468 337.529 1.00 55.05  ? 468  GLU A CB  1 
ATOM   3562 C CG  . GLU A 1 467 ? -28.895 59.692 336.886 1.00 84.79  ? 468  GLU A CG  1 
ATOM   3563 C CD  . GLU A 1 467 ? -29.598 60.944 337.392 1.00 106.03 ? 468  GLU A CD  1 
ATOM   3564 O OE1 . GLU A 1 467 ? -30.709 60.820 337.950 1.00 113.16 ? 468  GLU A OE1 1 
ATOM   3565 O OE2 . GLU A 1 467 ? -29.035 62.049 337.244 1.00 108.72 ? 468  GLU A OE2 1 
ATOM   3566 N N   . GLU A 1 468 ? -25.776 60.060 340.195 1.00 43.22  ? 469  GLU A N   1 
ATOM   3567 C CA  . GLU A 1 468 ? -24.502 60.089 340.903 1.00 55.47  ? 469  GLU A CA  1 
ATOM   3568 C C   . GLU A 1 468 ? -24.500 59.145 342.100 1.00 46.88  ? 469  GLU A C   1 
ATOM   3569 O O   . GLU A 1 468 ? -23.443 58.619 342.467 1.00 44.65  ? 469  GLU A O   1 
ATOM   3570 C CB  . GLU A 1 468 ? -24.182 61.514 341.346 1.00 44.29  ? 469  GLU A CB  1 
ATOM   3571 C CG  . GLU A 1 468 ? -23.766 62.423 340.204 1.00 42.56  ? 469  GLU A CG  1 
ATOM   3572 C CD  . GLU A 1 468 ? -23.587 63.861 340.638 1.00 48.36  ? 469  GLU A CD  1 
ATOM   3573 O OE1 . GLU A 1 468 ? -24.446 64.368 341.390 1.00 51.55  ? 469  GLU A OE1 1 
ATOM   3574 O OE2 . GLU A 1 468 ? -22.587 64.485 340.226 1.00 54.68  ? 469  GLU A OE2 1 
ATOM   3575 N N   . LYS A 1 469 ? -25.662 58.910 342.717 1.00 39.51  ? 470  LYS A N   1 
ATOM   3576 C CA  . LYS A 1 469 ? -25.720 57.973 343.838 1.00 45.22  ? 470  LYS A CA  1 
ATOM   3577 C C   . LYS A 1 469 ? -25.572 56.534 343.361 1.00 42.30  ? 470  LYS A C   1 
ATOM   3578 O O   . LYS A 1 469 ? -24.926 55.716 344.030 1.00 44.06  ? 470  LYS A O   1 
ATOM   3579 C CB  . LYS A 1 469 ? -27.025 58.155 344.615 1.00 41.97  ? 470  LYS A CB  1 
ATOM   3580 C CG  . LYS A 1 469 ? -27.181 59.534 345.234 1.00 47.47  ? 470  LYS A CG  1 
ATOM   3581 C CD  . LYS A 1 469 ? -28.573 59.744 345.803 1.00 45.65  ? 470  LYS A CD  1 
ATOM   3582 C CE  . LYS A 1 469 ? -28.737 61.173 346.289 1.00 49.34  ? 470  LYS A CE  1 
ATOM   3583 N NZ  . LYS A 1 469 ? -30.111 61.449 346.777 1.00 47.30  ? 470  LYS A NZ  1 
ATOM   3584 N N   . ILE A 1 470 ? -26.169 56.204 342.212 1.00 45.93  ? 471  ILE A N   1 
ATOM   3585 C CA  . ILE A 1 470 ? -25.966 54.887 341.616 1.00 46.27  ? 471  ILE A CA  1 
ATOM   3586 C C   . ILE A 1 470 ? -24.507 54.711 341.216 1.00 47.45  ? 471  ILE A C   1 
ATOM   3587 O O   . ILE A 1 470 ? -23.919 53.637 341.393 1.00 46.74  ? 471  ILE A O   1 
ATOM   3588 C CB  . ILE A 1 470 ? -26.918 54.693 340.419 1.00 55.07  ? 471  ILE A CB  1 
ATOM   3589 C CG1 . ILE A 1 470 ? -28.360 54.544 340.912 1.00 57.17  ? 471  ILE A CG1 1 
ATOM   3590 C CG2 . ILE A 1 470 ? -26.517 53.482 339.588 1.00 48.35  ? 471  ILE A CG2 1 
ATOM   3591 C CD1 . ILE A 1 470 ? -29.392 55.115 339.969 1.00 72.91  ? 471  ILE A CD1 1 
ATOM   3592 N N   . PHE A 1 471 ? -23.901 55.770 340.678 1.00 46.66  ? 472  PHE A N   1 
ATOM   3593 C CA  . PHE A 1 471 ? -22.480 55.738 340.350 1.00 45.40  ? 472  PHE A CA  1 
ATOM   3594 C C   . PHE A 1 471 ? -21.636 55.477 341.593 1.00 41.51  ? 472  PHE A C   1 
ATOM   3595 O O   . PHE A 1 471 ? -20.726 54.640 341.572 1.00 37.94  ? 472  PHE A O   1 
ATOM   3596 C CB  . PHE A 1 471 ? -22.086 57.057 339.680 1.00 45.35  ? 472  PHE A CB  1 
ATOM   3597 C CG  . PHE A 1 471 ? -20.654 57.121 339.245 1.00 47.47  ? 472  PHE A CG  1 
ATOM   3598 C CD1 . PHE A 1 471 ? -20.090 56.091 338.510 1.00 42.97  ? 472  PHE A CD1 1 
ATOM   3599 C CD2 . PHE A 1 471 ? -19.874 58.225 339.552 1.00 50.67  ? 472  PHE A CD2 1 
ATOM   3600 C CE1 . PHE A 1 471 ? -18.769 56.155 338.102 1.00 47.53  ? 472  PHE A CE1 1 
ATOM   3601 C CE2 . PHE A 1 471 ? -18.553 58.296 339.146 1.00 43.63  ? 472  PHE A CE2 1 
ATOM   3602 C CZ  . PHE A 1 471 ? -18.001 57.258 338.417 1.00 38.56  ? 472  PHE A CZ  1 
ATOM   3603 N N   . ALA A 1 472 ? -21.936 56.171 342.695 1.00 35.56  ? 473  ALA A N   1 
ATOM   3604 C CA  . ALA A 1 472 ? -21.195 55.943 343.933 1.00 37.82  ? 473  ALA A CA  1 
ATOM   3605 C C   . ALA A 1 472 ? -21.337 54.503 344.406 1.00 37.66  ? 473  ALA A C   1 
ATOM   3606 O O   . ALA A 1 472 ? -20.351 53.873 344.807 1.00 47.13  ? 473  ALA A O   1 
ATOM   3607 C CB  . ALA A 1 472 ? -21.666 56.909 345.018 1.00 42.37  ? 473  ALA A CB  1 
ATOM   3608 N N   . GLN A 1 473 ? -22.557 53.960 344.362 1.00 34.90  ? 474  GLN A N   1 
ATOM   3609 C CA  . GLN A 1 473 ? -22.760 52.577 344.781 1.00 48.35  ? 474  GLN A CA  1 
ATOM   3610 C C   . GLN A 1 473 ? -21.991 51.605 343.895 1.00 46.03  ? 474  GLN A C   1 
ATOM   3611 O O   . GLN A 1 473 ? -21.494 50.582 344.381 1.00 43.15  ? 474  GLN A O   1 
ATOM   3612 C CB  . GLN A 1 473 ? -24.253 52.244 344.777 1.00 41.84  ? 474  GLN A CB  1 
ATOM   3613 C CG  . GLN A 1 473 ? -25.023 52.902 345.910 1.00 55.70  ? 474  GLN A CG  1 
ATOM   3614 C CD  . GLN A 1 473 ? -26.524 52.724 345.785 1.00 54.35  ? 474  GLN A CD  1 
ATOM   3615 O OE1 . GLN A 1 473 ? -27.069 52.690 344.681 1.00 57.84  ? 474  GLN A OE1 1 
ATOM   3616 N NE2 . GLN A 1 473 ? -27.200 52.611 346.920 1.00 57.85  ? 474  GLN A NE2 1 
ATOM   3617 N N   . ARG A 1 474 ? -21.874 51.908 342.600 1.00 40.17  ? 475  ARG A N   1 
ATOM   3618 C CA  . ARG A 1 474 ? -21.127 51.034 341.702 1.00 40.77  ? 475  ARG A CA  1 
ATOM   3619 C C   . ARG A 1 474 ? -19.632 51.077 342.002 1.00 46.97  ? 475  ARG A C   1 
ATOM   3620 O O   . ARG A 1 474 ? -18.954 50.043 341.952 1.00 42.78  ? 475  ARG A O   1 
ATOM   3621 C CB  . ARG A 1 474 ? -21.406 51.422 340.247 1.00 47.47  ? 475  ARG A CB  1 
ATOM   3622 C CG  . ARG A 1 474 ? -20.624 50.613 339.224 1.00 59.52  ? 475  ARG A CG  1 
ATOM   3623 C CD  . ARG A 1 474 ? -21.319 50.593 337.867 1.00 51.75  ? 475  ARG A CD  1 
ATOM   3624 N NE  . ARG A 1 474 ? -21.325 51.910 337.242 1.00 47.48  ? 475  ARG A NE  1 
ATOM   3625 C CZ  . ARG A 1 474 ? -20.365 52.360 336.441 1.00 50.63  ? 475  ARG A CZ  1 
ATOM   3626 N NH1 . ARG A 1 474 ? -19.313 51.599 336.162 1.00 40.98  ? 475  ARG A NH1 1 
ATOM   3627 N NH2 . ARG A 1 474 ? -20.456 53.576 335.921 1.00 43.60  ? 475  ARG A NH2 1 
ATOM   3628 N N   . LEU A 1 475 ? -19.103 52.260 342.329 1.00 39.48  ? 476  LEU A N   1 
ATOM   3629 C CA  . LEU A 1 475 ? -17.681 52.372 342.645 1.00 38.01  ? 476  LEU A CA  1 
ATOM   3630 C C   . LEU A 1 475 ? -17.351 51.712 343.978 1.00 48.01  ? 476  LEU A C   1 
ATOM   3631 O O   . LEU A 1 475 ? -16.315 51.047 344.106 1.00 47.63  ? 476  LEU A O   1 
ATOM   3632 C CB  . LEU A 1 475 ? -17.257 53.840 342.661 1.00 39.27  ? 476  LEU A CB  1 
ATOM   3633 C CG  . LEU A 1 475 ? -17.293 54.559 341.312 1.00 44.58  ? 476  LEU A CG  1 
ATOM   3634 C CD1 . LEU A 1 475 ? -16.687 55.942 341.446 1.00 55.53  ? 476  LEU A CD1 1 
ATOM   3635 C CD2 . LEU A 1 475 ? -16.570 53.752 340.246 1.00 46.55  ? 476  LEU A CD2 1 
ATOM   3636 N N   . MET A 1 476 ? -18.208 51.895 344.988 1.00 36.00  ? 477  MET A N   1 
ATOM   3637 C CA  . MET A 1 476 ? -17.999 51.206 346.258 1.00 41.27  ? 477  MET A CA  1 
ATOM   3638 C C   . MET A 1 476 ? -17.989 49.698 346.065 1.00 46.84  ? 477  MET A C   1 
ATOM   3639 O O   . MET A 1 476 ? -17.258 48.983 346.761 1.00 39.38  ? 477  MET A O   1 
ATOM   3640 C CB  . MET A 1 476 ? -19.084 51.595 347.262 1.00 38.02  ? 477  MET A CB  1 
ATOM   3641 C CG  . MET A 1 476 ? -19.023 53.037 347.725 1.00 45.24  ? 477  MET A CG  1 
ATOM   3642 S SD  . MET A 1 476 ? -20.083 53.336 349.156 1.00 55.24  ? 477  MET A SD  1 
ATOM   3643 C CE  . MET A 1 476 ? -21.696 53.153 348.401 1.00 55.69  ? 477  MET A CE  1 
ATOM   3644 N N   . ARG A 1 477 ? -18.786 49.205 345.116 1.00 44.90  ? 478  ARG A N   1 
ATOM   3645 C CA  . ARG A 1 477 ? -18.810 47.777 344.828 1.00 39.50  ? 478  ARG A CA  1 
ATOM   3646 C C   . ARG A 1 477 ? -17.506 47.322 344.185 1.00 49.43  ? 478  ARG A C   1 
ATOM   3647 O O   . ARG A 1 477 ? -16.987 46.250 344.520 1.00 46.42  ? 478  ARG A O   1 
ATOM   3648 C CB  . ARG A 1 477 ? -20.000 47.455 343.927 1.00 48.50  ? 478  ARG A CB  1 
ATOM   3649 C CG  . ARG A 1 477 ? -20.062 46.011 343.486 1.00 51.35  ? 478  ARG A CG  1 
ATOM   3650 C CD  . ARG A 1 477 ? -20.190 45.068 344.674 1.00 67.69  ? 478  ARG A CD  1 
ATOM   3651 N NE  . ARG A 1 477 ? -21.363 45.368 345.492 1.00 72.19  ? 478  ARG A NE  1 
ATOM   3652 C CZ  . ARG A 1 477 ? -22.600 44.963 345.215 1.00 76.74  ? 478  ARG A CZ  1 
ATOM   3653 N NH1 . ARG A 1 477 ? -22.842 44.235 344.132 1.00 80.25  ? 478  ARG A NH1 1 
ATOM   3654 N NH2 . ARG A 1 477 ? -23.599 45.289 346.024 1.00 77.96  ? 478  ARG A NH2 1 
ATOM   3655 N N   . TYR A 1 478 ? -16.971 48.116 343.251 1.00 45.62  ? 479  TYR A N   1 
ATOM   3656 C CA  . TYR A 1 478 ? -15.671 47.810 342.656 1.00 46.51  ? 479  TYR A CA  1 
ATOM   3657 C C   . TYR A 1 478 ? -14.591 47.711 343.726 1.00 41.93  ? 479  TYR A C   1 
ATOM   3658 O O   . TYR A 1 478 ? -13.844 46.726 343.786 1.00 38.89  ? 479  TYR A O   1 
ATOM   3659 C CB  . TYR A 1 478 ? -15.288 48.883 341.634 1.00 49.60  ? 479  TYR A CB  1 
ATOM   3660 C CG  . TYR A 1 478 ? -16.087 48.880 340.351 1.00 40.12  ? 479  TYR A CG  1 
ATOM   3661 C CD1 . TYR A 1 478 ? -16.508 47.694 339.769 1.00 48.89  ? 479  TYR A CD1 1 
ATOM   3662 C CD2 . TYR A 1 478 ? -16.413 50.073 339.719 1.00 42.38  ? 479  TYR A CD2 1 
ATOM   3663 C CE1 . TYR A 1 478 ? -17.236 47.698 338.592 1.00 49.42  ? 479  TYR A CE1 1 
ATOM   3664 C CE2 . TYR A 1 478 ? -17.139 50.087 338.547 1.00 46.98  ? 479  TYR A CE2 1 
ATOM   3665 C CZ  . TYR A 1 478 ? -17.548 48.898 337.987 1.00 53.52  ? 479  TYR A CZ  1 
ATOM   3666 O OH  . TYR A 1 478 ? -18.273 48.914 336.818 1.00 57.51  ? 479  TYR A OH  1 
ATOM   3667 N N   . TRP A 1 479 ? -14.490 48.734 344.578 1.00 39.58  ? 480  TRP A N   1 
ATOM   3668 C CA  . TRP A 1 479 ? -13.437 48.759 345.588 1.00 47.48  ? 480  TRP A CA  1 
ATOM   3669 C C   . TRP A 1 479 ? -13.575 47.597 346.565 1.00 42.30  ? 480  TRP A C   1 
ATOM   3670 O O   . TRP A 1 479 ? -12.575 46.980 346.951 1.00 41.58  ? 480  TRP A O   1 
ATOM   3671 C CB  . TRP A 1 479 ? -13.462 50.095 346.331 1.00 38.07  ? 480  TRP A CB  1 
ATOM   3672 C CG  . TRP A 1 479 ? -12.455 51.096 345.826 1.00 48.05  ? 480  TRP A CG  1 
ATOM   3673 C CD1 . TRP A 1 479 ? -11.458 51.690 346.547 1.00 41.33  ? 480  TRP A CD1 1 
ATOM   3674 C CD2 . TRP A 1 479 ? -12.349 51.620 344.492 1.00 34.86  ? 480  TRP A CD2 1 
ATOM   3675 N NE1 . TRP A 1 479 ? -10.741 52.549 345.747 1.00 43.43  ? 480  TRP A NE1 1 
ATOM   3676 C CE2 . TRP A 1 479 ? -11.267 52.524 344.482 1.00 44.58  ? 480  TRP A CE2 1 
ATOM   3677 C CE3 . TRP A 1 479 ? -13.064 51.412 343.306 1.00 47.07  ? 480  TRP A CE3 1 
ATOM   3678 C CZ2 . TRP A 1 479 ? -10.880 53.217 343.333 1.00 44.51  ? 480  TRP A CZ2 1 
ATOM   3679 C CZ3 . TRP A 1 479 ? -12.680 52.103 342.166 1.00 44.95  ? 480  TRP A CZ3 1 
ATOM   3680 C CH2 . TRP A 1 479 ? -11.598 52.994 342.189 1.00 39.86  ? 480  TRP A CH2 1 
ATOM   3681 N N   . ALA A 1 480 ? -14.807 47.273 346.966 1.00 38.36  ? 481  ALA A N   1 
ATOM   3682 C CA  . ALA A 1 480 ? -14.999 46.205 347.943 1.00 41.40  ? 481  ALA A CA  1 
ATOM   3683 C C   . ALA A 1 480 ? -14.804 44.832 347.313 1.00 44.74  ? 481  ALA A C   1 
ATOM   3684 O O   . ALA A 1 480 ? -14.309 43.909 347.971 1.00 43.20  ? 481  ALA A O   1 
ATOM   3685 C CB  . ALA A 1 480 ? -16.383 46.312 348.579 1.00 34.38  ? 481  ALA A CB  1 
ATOM   3686 N N   . ASN A 1 481 ? -15.198 44.672 346.046 1.00 45.62  ? 482  ASN A N   1 
ATOM   3687 C CA  . ASN A 1 481 ? -14.912 43.426 345.342 1.00 43.63  ? 482  ASN A CA  1 
ATOM   3688 C C   . ASN A 1 481 ? -13.411 43.186 345.255 1.00 42.64  ? 482  ASN A C   1 
ATOM   3689 O O   . ASN A 1 481 ? -12.942 42.054 345.421 1.00 49.66  ? 482  ASN A O   1 
ATOM   3690 C CB  . ASN A 1 481 ? -15.528 43.448 343.942 1.00 50.11  ? 482  ASN A CB  1 
ATOM   3691 C CG  . ASN A 1 481 ? -17.029 43.225 343.956 1.00 53.43  ? 482  ASN A CG  1 
ATOM   3692 O OD1 . ASN A 1 481 ? -17.588 42.720 344.930 1.00 52.60  ? 482  ASN A OD1 1 
ATOM   3693 N ND2 . ASN A 1 481 ? -17.689 43.595 342.865 1.00 50.44  ? 482  ASN A ND2 1 
ATOM   3694 N N   . PHE A 1 482 ? -12.641 44.247 345.004 1.00 40.82  ? 483  PHE A N   1 
ATOM   3695 C CA  . PHE A 1 482 ? -11.191 44.108 344.964 1.00 41.66  ? 483  PHE A CA  1 
ATOM   3696 C C   . PHE A 1 482 ? -10.633 43.759 346.339 1.00 49.47  ? 483  PHE A C   1 
ATOM   3697 O O   . PHE A 1 482 ? -9.747  42.906 346.455 1.00 45.01  ? 483  PHE A O   1 
ATOM   3698 C CB  . PHE A 1 482 ? -10.555 45.391 344.429 1.00 40.48  ? 483  PHE A CB  1 
ATOM   3699 C CG  . PHE A 1 482 ? -9.057  45.369 344.448 1.00 46.66  ? 483  PHE A CG  1 
ATOM   3700 C CD1 . PHE A 1 482 ? -8.350  44.701 343.462 1.00 40.42  ? 483  PHE A CD1 1 
ATOM   3701 C CD2 . PHE A 1 482 ? -8.354  46.003 345.460 1.00 33.19  ? 483  PHE A CD2 1 
ATOM   3702 C CE1 . PHE A 1 482 ? -6.969  44.669 343.482 1.00 34.75  ? 483  PHE A CE1 1 
ATOM   3703 C CE2 . PHE A 1 482 ? -6.973  45.973 345.484 1.00 41.19  ? 483  PHE A CE2 1 
ATOM   3704 C CZ  . PHE A 1 482 ? -6.280  45.305 344.491 1.00 34.91  ? 483  PHE A CZ  1 
ATOM   3705 N N   . ALA A 1 483 ? -11.141 44.406 347.392 1.00 39.58  ? 484  ALA A N   1 
ATOM   3706 C CA  . ALA A 1 483 ? -10.673 44.100 348.741 1.00 41.50  ? 484  ALA A CA  1 
ATOM   3707 C C   . ALA A 1 483 ? -10.965 42.651 349.115 1.00 43.78  ? 484  ALA A C   1 
ATOM   3708 O O   . ALA A 1 483 ? -10.134 41.986 349.743 1.00 44.11  ? 484  ALA A O   1 
ATOM   3709 C CB  . ALA A 1 483 ? -11.316 45.052 349.749 1.00 39.80  ? 484  ALA A CB  1 
ATOM   3710 N N   . ARG A 1 484 ? -12.134 42.142 348.721 1.00 45.17  ? 485  ARG A N   1 
ATOM   3711 C CA  . ARG A 1 484 ? -12.520 40.780 349.083 1.00 50.66  ? 485  ARG A CA  1 
ATOM   3712 C C   . ARG A 1 484 ? -11.726 39.743 348.295 1.00 51.01  ? 485  ARG A C   1 
ATOM   3713 O O   . ARG A 1 484 ? -11.166 38.805 348.875 1.00 52.80  ? 485  ARG A O   1 
ATOM   3714 C CB  . ARG A 1 484 ? -14.019 40.583 348.854 1.00 46.83  ? 485  ARG A CB  1 
ATOM   3715 C CG  . ARG A 1 484 ? -14.899 41.238 349.898 1.00 46.78  ? 485  ARG A CG  1 
ATOM   3716 C CD  . ARG A 1 484 ? -16.360 40.903 349.668 1.00 46.60  ? 485  ARG A CD  1 
ATOM   3717 N NE  . ARG A 1 484 ? -16.916 41.634 348.534 1.00 43.59  ? 485  ARG A NE  1 
ATOM   3718 C CZ  . ARG A 1 484 ? -17.662 42.728 348.644 1.00 43.71  ? 485  ARG A CZ  1 
ATOM   3719 N NH1 . ARG A 1 484 ? -17.947 43.222 349.840 1.00 45.23  ? 485  ARG A NH1 1 
ATOM   3720 N NH2 . ARG A 1 484 ? -18.126 43.328 347.557 1.00 40.03  ? 485  ARG A NH2 1 
ATOM   3721 N N   . THR A 1 485 ? -11.671 39.890 346.969 1.00 47.68  ? 486  THR A N   1 
ATOM   3722 C CA  . THR A 1 485 ? -11.161 38.844 346.094 1.00 51.54  ? 486  THR A CA  1 
ATOM   3723 C C   . THR A 1 485 ? -9.920  39.223 345.298 1.00 56.15  ? 486  THR A C   1 
ATOM   3724 O O   . THR A 1 485 ? -9.367  38.355 344.614 1.00 51.53  ? 486  THR A O   1 
ATOM   3725 C CB  . THR A 1 485 ? -12.244 38.410 345.096 1.00 52.51  ? 486  THR A CB  1 
ATOM   3726 O OG1 . THR A 1 485 ? -12.358 39.402 344.067 1.00 47.67  ? 486  THR A OG1 1 
ATOM   3727 C CG2 . THR A 1 485 ? -13.590 38.254 345.791 1.00 46.81  ? 486  THR A CG2 1 
ATOM   3728 N N   . GLY A 1 486 ? -9.469  40.474 345.350 1.00 57.88  ? 487  GLY A N   1 
ATOM   3729 C CA  . GLY A 1 486 ? -8.408  40.910 344.465 1.00 43.50  ? 487  GLY A CA  1 
ATOM   3730 C C   . GLY A 1 486 ? -8.843  41.154 343.041 1.00 49.23  ? 487  GLY A C   1 
ATOM   3731 O O   . GLY A 1 486 ? -7.991  41.252 342.152 1.00 47.95  ? 487  GLY A O   1 
ATOM   3732 N N   . ASP A 1 487 ? -10.142 41.253 342.799 1.00 48.43  ? 488  ASP A N   1 
ATOM   3733 C CA  . ASP A 1 487 ? -10.707 41.433 341.473 1.00 46.81  ? 488  ASP A CA  1 
ATOM   3734 C C   . ASP A 1 487 ? -11.910 42.360 341.583 1.00 46.78  ? 488  ASP A C   1 
ATOM   3735 O O   . ASP A 1 487 ? -12.887 42.034 342.269 1.00 47.20  ? 488  ASP A O   1 
ATOM   3736 C CB  . ASP A 1 487 ? -11.104 40.081 340.876 1.00 57.37  ? 488  ASP A CB  1 
ATOM   3737 C CG  . ASP A 1 487 ? -11.410 40.156 339.392 1.00 48.21  ? 488  ASP A CG  1 
ATOM   3738 O OD1 . ASP A 1 487 ? -11.863 41.220 338.919 1.00 48.88  ? 488  ASP A OD1 1 
ATOM   3739 O OD2 . ASP A 1 487 ? -11.209 39.137 338.700 1.00 61.35  ? 488  ASP A OD2 1 
ATOM   3740 N N   . PRO A 1 488 ? -11.876 43.522 340.928 1.00 45.33  ? 489  PRO A N   1 
ATOM   3741 C CA  . PRO A 1 488 ? -13.020 44.443 341.016 1.00 49.43  ? 489  PRO A CA  1 
ATOM   3742 C C   . PRO A 1 488 ? -14.258 43.941 340.296 1.00 51.32  ? 489  PRO A C   1 
ATOM   3743 O O   . PRO A 1 488 ? -15.348 44.478 340.529 1.00 50.77  ? 489  PRO A O   1 
ATOM   3744 C CB  . PRO A 1 488 ? -12.483 45.729 340.374 1.00 46.46  ? 489  PRO A CB  1 
ATOM   3745 C CG  . PRO A 1 488 ? -11.426 45.243 339.417 1.00 44.46  ? 489  PRO A CG  1 
ATOM   3746 C CD  . PRO A 1 488 ? -10.789 44.055 340.086 1.00 40.60  ? 489  PRO A CD  1 
ATOM   3747 N N   . ASN A 1 489 ? -14.129 42.932 339.440 1.00 48.32  ? 490  ASN A N   1 
ATOM   3748 C CA  . ASN A 1 489 ? -15.263 42.426 338.685 1.00 60.21  ? 490  ASN A CA  1 
ATOM   3749 C C   . ASN A 1 489 ? -16.166 41.585 339.573 1.00 67.25  ? 490  ASN A C   1 
ATOM   3750 O O   . ASN A 1 489 ? -15.715 40.931 340.520 1.00 65.22  ? 490  ASN A O   1 
ATOM   3751 C CB  . ASN A 1 489 ? -14.784 41.598 337.498 1.00 60.61  ? 490  ASN A CB  1 
ATOM   3752 C CG  . ASN A 1 489 ? -14.057 42.434 336.471 1.00 53.09  ? 490  ASN A CG  1 
ATOM   3753 O OD1 . ASN A 1 489 ? -14.676 43.172 335.707 1.00 54.30  ? 490  ASN A OD1 1 
ATOM   3754 N ND2 . ASN A 1 489 ? -12.731 42.334 336.457 1.00 49.89  ? 490  ASN A ND2 1 
ATOM   3755 N N   . GLU A 1 490 ? -17.452 41.603 339.254 1.00 82.81  ? 491  GLU A N   1 
ATOM   3756 C CA  . GLU A 1 490 ? -18.410 40.858 340.056 1.00 108.99 ? 491  GLU A CA  1 
ATOM   3757 C C   . GLU A 1 490 ? -18.408 39.384 339.681 1.00 115.07 ? 491  GLU A C   1 
ATOM   3758 O O   . GLU A 1 490 ? -18.445 39.048 338.487 1.00 112.86 ? 491  GLU A O   1 
ATOM   3759 C CB  . GLU A 1 490 ? -19.814 41.432 339.917 1.00 114.40 ? 491  GLU A CB  1 
ATOM   3760 C CG  . GLU A 1 490 ? -19.950 42.859 340.413 1.00 116.50 ? 491  GLU A CG  1 
ATOM   3761 C CD  . GLU A 1 490 ? -20.781 42.943 341.675 1.00 122.02 ? 491  GLU A CD  1 
ATOM   3762 O OE1 . GLU A 1 490 ? -21.503 43.946 341.844 1.00 119.24 ? 491  GLU A OE1 1 
ATOM   3763 O OE2 . GLU A 1 490 ? -20.691 42.020 342.511 1.00 122.39 ? 491  GLU A OE2 1 
ATOM   3764 N N   . PRO A 1 491 ? -18.369 38.473 340.669 1.00 115.30 ? 492  PRO A N   1 
ATOM   3765 C CA  . PRO A 1 491 ? -18.462 37.018 340.517 1.00 117.16 ? 492  PRO A CA  1 
ATOM   3766 C C   . PRO A 1 491 ? -19.721 36.584 339.771 1.00 125.79 ? 492  PRO A C   1 
ATOM   3767 O O   . PRO A 1 491 ? -19.699 36.484 338.546 1.00 116.63 ? 492  PRO A O   1 
ATOM   3768 C CB  . PRO A 1 491 ? -18.501 36.520 341.967 1.00 117.16 ? 492  PRO A CB  1 
ATOM   3769 C CG  . PRO A 1 491 ? -17.791 37.571 342.747 1.00 99.93  ? 492  PRO A CG  1 
ATOM   3770 C CD  . PRO A 1 491 ? -18.146 38.866 342.072 1.00 99.36  ? 492  PRO A CD  1 
ATOM   3771 N N   . ALA A 1 496 ? -22.657 42.006 332.336 1.00 107.82 ? 497  ALA A N   1 
ATOM   3772 C CA  . ALA A 1 496 ? -21.871 43.040 333.001 1.00 109.90 ? 497  ALA A CA  1 
ATOM   3773 C C   . ALA A 1 496 ? -20.542 43.260 332.285 1.00 110.68 ? 497  ALA A C   1 
ATOM   3774 O O   . ALA A 1 496 ? -19.775 42.315 332.096 1.00 107.34 ? 497  ALA A O   1 
ATOM   3775 C CB  . ALA A 1 496 ? -21.633 42.669 334.457 1.00 100.05 ? 497  ALA A CB  1 
ATOM   3776 N N   . PRO A 1 497 ? -20.271 44.504 331.888 1.00 106.43 ? 498  PRO A N   1 
ATOM   3777 C CA  . PRO A 1 497 ? -18.994 44.802 331.226 1.00 94.16  ? 498  PRO A CA  1 
ATOM   3778 C C   . PRO A 1 497 ? -17.830 44.502 332.158 1.00 85.06  ? 498  PRO A C   1 
ATOM   3779 O O   . PRO A 1 497 ? -17.836 44.882 333.331 1.00 91.73  ? 498  PRO A O   1 
ATOM   3780 C CB  . PRO A 1 497 ? -19.094 46.299 330.901 1.00 88.32  ? 498  PRO A CB  1 
ATOM   3781 C CG  . PRO A 1 497 ? -20.539 46.659 331.082 1.00 93.39  ? 498  PRO A CG  1 
ATOM   3782 C CD  . PRO A 1 497 ? -21.085 45.712 332.098 1.00 94.16  ? 498  PRO A CD  1 
ATOM   3783 N N   . GLN A 1 498 ? -16.831 43.804 331.629 1.00 72.36  ? 499  GLN A N   1 
ATOM   3784 C CA  . GLN A 1 498 ? -15.727 43.330 332.447 1.00 66.04  ? 499  GLN A CA  1 
ATOM   3785 C C   . GLN A 1 498 ? -14.590 44.342 332.473 1.00 74.96  ? 499  GLN A C   1 
ATOM   3786 O O   . GLN A 1 498 ? -14.395 45.123 331.536 1.00 58.89  ? 499  GLN A O   1 
ATOM   3787 C CB  . GLN A 1 498 ? -15.217 41.980 331.940 1.00 61.56  ? 499  GLN A CB  1 
ATOM   3788 C CG  . GLN A 1 498 ? -16.167 40.824 332.223 1.00 73.73  ? 499  GLN A CG  1 
ATOM   3789 C CD  . GLN A 1 498 ? -16.580 40.753 333.683 1.00 73.82  ? 499  GLN A CD  1 
ATOM   3790 O OE1 . GLN A 1 498 ? -15.844 40.237 334.525 1.00 77.28  ? 499  GLN A OE1 1 
ATOM   3791 N NE2 . GLN A 1 498 ? -17.763 41.274 333.990 1.00 75.74  ? 499  GLN A NE2 1 
ATOM   3792 N N   . TRP A 1 499 ? -13.846 44.324 333.576 1.00 63.00  ? 500  TRP A N   1 
ATOM   3793 C CA  . TRP A 1 499 ? -12.686 45.184 333.782 1.00 46.00  ? 500  TRP A CA  1 
ATOM   3794 C C   . TRP A 1 499 ? -11.432 44.340 333.598 1.00 47.37  ? 500  TRP A C   1 
ATOM   3795 O O   . TRP A 1 499 ? -11.076 43.555 334.491 1.00 53.25  ? 500  TRP A O   1 
ATOM   3796 C CB  . TRP A 1 499 ? -12.731 45.804 335.182 1.00 59.81  ? 500  TRP A CB  1 
ATOM   3797 C CG  . TRP A 1 499 ? -11.658 46.813 335.492 1.00 50.63  ? 500  TRP A CG  1 
ATOM   3798 C CD1 . TRP A 1 499 ? -10.460 46.971 334.856 1.00 49.23  ? 500  TRP A CD1 1 
ATOM   3799 C CD2 . TRP A 1 499 ? -11.695 47.803 336.527 1.00 50.12  ? 500  TRP A CD2 1 
ATOM   3800 N NE1 . TRP A 1 499 ? -9.750  47.994 335.431 1.00 45.54  ? 500  TRP A NE1 1 
ATOM   3801 C CE2 . TRP A 1 499 ? -10.485 48.522 336.460 1.00 51.61  ? 500  TRP A CE2 1 
ATOM   3802 C CE3 . TRP A 1 499 ? -12.634 48.151 337.505 1.00 43.59  ? 500  TRP A CE3 1 
ATOM   3803 C CZ2 . TRP A 1 499 ? -10.190 49.570 337.331 1.00 50.45  ? 500  TRP A CZ2 1 
ATOM   3804 C CZ3 . TRP A 1 499 ? -12.339 49.190 338.369 1.00 46.83  ? 500  TRP A CZ3 1 
ATOM   3805 C CH2 . TRP A 1 499 ? -11.127 49.888 338.276 1.00 49.09  ? 500  TRP A CH2 1 
ATOM   3806 N N   . PRO A 1 500 ? -10.735 44.454 332.472 1.00 47.15  ? 501  PRO A N   1 
ATOM   3807 C CA  . PRO A 1 500 ? -9.587  43.579 332.212 1.00 47.04  ? 501  PRO A CA  1 
ATOM   3808 C C   . PRO A 1 500 ? -8.360  44.041 332.973 1.00 43.18  ? 501  PRO A C   1 
ATOM   3809 O O   . PRO A 1 500 ? -8.210  45.237 333.264 1.00 46.72  ? 501  PRO A O   1 
ATOM   3810 C CB  . PRO A 1 500 ? -9.382  43.714 330.696 1.00 42.03  ? 501  PRO A CB  1 
ATOM   3811 C CG  . PRO A 1 500 ? -9.870  45.091 330.393 1.00 40.78  ? 501  PRO A CG  1 
ATOM   3812 C CD  . PRO A 1 500 ? -11.032 45.333 331.328 1.00 47.09  ? 501  PRO A CD  1 
ATOM   3813 N N   . PRO A 1 501 ? -7.457  43.122 333.312 1.00 48.00  ? 502  PRO A N   1 
ATOM   3814 C CA  . PRO A 1 501 ? -6.220  43.519 333.993 1.00 45.03  ? 502  PRO A CA  1 
ATOM   3815 C C   . PRO A 1 501 ? -5.348  44.398 333.108 1.00 49.46  ? 502  PRO A C   1 
ATOM   3816 O O   . PRO A 1 501 ? -5.401  44.335 331.878 1.00 58.32  ? 502  PRO A O   1 
ATOM   3817 C CB  . PRO A 1 501 ? -5.533  42.181 334.296 1.00 43.34  ? 502  PRO A CB  1 
ATOM   3818 C CG  . PRO A 1 501 ? -6.625  41.156 334.224 1.00 50.32  ? 502  PRO A CG  1 
ATOM   3819 C CD  . PRO A 1 501 ? -7.593  41.660 333.202 1.00 41.78  ? 502  PRO A CD  1 
ATOM   3820 N N   . TYR A 1 502 ? -4.536  45.227 333.758 1.00 46.19  ? 503  TYR A N   1 
ATOM   3821 C CA  . TYR A 1 502 ? -3.569  46.074 333.074 1.00 49.15  ? 503  TYR A CA  1 
ATOM   3822 C C   . TYR A 1 502 ? -2.255  45.317 332.920 1.00 48.09  ? 503  TYR A C   1 
ATOM   3823 O O   . TYR A 1 502 ? -1.736  44.759 333.892 1.00 57.14  ? 503  TYR A O   1 
ATOM   3824 C CB  . TYR A 1 502 ? -3.354  47.369 333.859 1.00 40.25  ? 503  TYR A CB  1 
ATOM   3825 C CG  . TYR A 1 502 ? -2.368  48.340 333.246 1.00 41.86  ? 503  TYR A CG  1 
ATOM   3826 C CD1 . TYR A 1 502 ? -1.003  48.215 333.475 1.00 43.63  ? 503  TYR A CD1 1 
ATOM   3827 C CD2 . TYR A 1 502 ? -2.806  49.397 332.458 1.00 39.21  ? 503  TYR A CD2 1 
ATOM   3828 C CE1 . TYR A 1 502 ? -0.099  49.106 332.922 1.00 33.33  ? 503  TYR A CE1 1 
ATOM   3829 C CE2 . TYR A 1 502 ? -1.910  50.292 331.904 1.00 43.28  ? 503  TYR A CE2 1 
ATOM   3830 C CZ  . TYR A 1 502 ? -0.557  50.142 332.140 1.00 42.49  ? 503  TYR A CZ  1 
ATOM   3831 O OH  . TYR A 1 502 ? 0.342   51.030 331.593 1.00 41.93  ? 503  TYR A OH  1 
ATOM   3832 N N   . THR A 1 503 ? -1.722  45.297 331.701 1.00 53.22  ? 504  THR A N   1 
ATOM   3833 C CA  . THR A 1 503 ? -0.439  44.667 331.425 1.00 62.10  ? 504  THR A CA  1 
ATOM   3834 C C   . THR A 1 503 ? 0.437   45.624 330.628 1.00 58.80  ? 504  THR A C   1 
ATOM   3835 O O   . THR A 1 503 ? -0.055  46.511 329.926 1.00 54.81  ? 504  THR A O   1 
ATOM   3836 C CB  . THR A 1 503 ? -0.603  43.347 330.659 1.00 50.81  ? 504  THR A CB  1 
ATOM   3837 O OG1 . THR A 1 503 ? -1.298  43.591 329.431 1.00 53.26  ? 504  THR A OG1 1 
ATOM   3838 C CG2 . THR A 1 503 ? -1.385  42.338 331.490 1.00 44.24  ? 504  THR A CG2 1 
ATOM   3839 N N   . ALA A 1 504 ? 1.753   45.419 330.735 1.00 53.26  ? 505  ALA A N   1 
ATOM   3840 C CA  . ALA A 1 504 ? 2.711   46.334 330.124 1.00 50.80  ? 505  ALA A CA  1 
ATOM   3841 C C   . ALA A 1 504 ? 2.572   46.411 328.608 1.00 53.19  ? 505  ALA A C   1 
ATOM   3842 O O   . ALA A 1 504 ? 2.973   47.416 328.012 1.00 61.59  ? 505  ALA A O   1 
ATOM   3843 C CB  . ALA A 1 504 ? 4.136   45.925 330.496 1.00 59.16  ? 505  ALA A CB  1 
ATOM   3844 N N   . GLY A 1 505 ? 2.016   45.383 327.971 1.00 56.65  ? 506  GLY A N   1 
ATOM   3845 C CA  . GLY A 1 505 ? 1.845   45.399 326.531 1.00 47.65  ? 506  GLY A CA  1 
ATOM   3846 C C   . GLY A 1 505 ? 0.548   46.038 326.077 1.00 51.54  ? 506  GLY A C   1 
ATOM   3847 O O   . GLY A 1 505 ? 0.563   47.046 325.363 1.00 59.27  ? 506  GLY A O   1 
ATOM   3848 N N   . ALA A 1 506 ? -0.585  45.463 326.487 1.00 50.88  ? 507  ALA A N   1 
ATOM   3849 C CA  . ALA A 1 506 ? -1.876  45.986 326.049 1.00 45.35  ? 507  ALA A CA  1 
ATOM   3850 C C   . ALA A 1 506 ? -2.207  47.310 326.731 1.00 47.91  ? 507  ALA A C   1 
ATOM   3851 O O   . ALA A 1 506 ? -2.828  48.187 326.120 1.00 43.78  ? 507  ALA A O   1 
ATOM   3852 C CB  . ALA A 1 506 ? -2.975  44.955 326.309 1.00 51.10  ? 507  ALA A CB  1 
ATOM   3853 N N   . GLN A 1 507 ? -1.813  47.466 328.000 1.00 46.75  ? 508  GLN A N   1 
ATOM   3854 C CA  . GLN A 1 507 ? -1.999  48.715 328.746 1.00 45.03  ? 508  GLN A CA  1 
ATOM   3855 C C   . GLN A 1 507 ? -3.471  49.120 328.816 1.00 41.01  ? 508  GLN A C   1 
ATOM   3856 O O   . GLN A 1 507 ? -3.822  50.287 328.628 1.00 43.13  ? 508  GLN A O   1 
ATOM   3857 C CB  . GLN A 1 507 ? -1.153  49.844 328.148 1.00 44.62  ? 508  GLN A CB  1 
ATOM   3858 C CG  . GLN A 1 507 ? 0.335   49.535 328.083 1.00 57.77  ? 508  GLN A CG  1 
ATOM   3859 C CD  . GLN A 1 507 ? 1.109   50.535 327.242 1.00 56.83  ? 508  GLN A CD  1 
ATOM   3860 O OE1 . GLN A 1 507 ? 0.731   51.702 327.132 1.00 54.65  ? 508  GLN A OE1 1 
ATOM   3861 N NE2 . GLN A 1 507 ? 2.199   50.078 326.640 1.00 68.88  ? 508  GLN A NE2 1 
ATOM   3862 N N   . GLN A 1 508 ? -4.339  48.154 329.102 1.00 35.93  ? 509  GLN A N   1 
ATOM   3863 C CA  . GLN A 1 508 ? -5.773  48.408 329.136 1.00 45.21  ? 509  GLN A CA  1 
ATOM   3864 C C   . GLN A 1 508 ? -6.210  48.968 330.487 1.00 49.48  ? 509  GLN A C   1 
ATOM   3865 O O   . GLN A 1 508 ? -5.733  48.538 331.540 1.00 39.72  ? 509  GLN A O   1 
ATOM   3866 C CB  . GLN A 1 508 ? -6.545  47.123 328.842 1.00 50.88  ? 509  GLN A CB  1 
ATOM   3867 C CG  . GLN A 1 508 ? -6.210  46.489 327.508 1.00 55.36  ? 509  GLN A CG  1 
ATOM   3868 C CD  . GLN A 1 508 ? -6.860  45.134 327.345 1.00 54.30  ? 509  GLN A CD  1 
ATOM   3869 O OE1 . GLN A 1 508 ? -6.274  44.106 327.687 1.00 49.81  ? 509  GLN A OE1 1 
ATOM   3870 N NE2 . GLN A 1 508 ? -8.083  45.124 326.829 1.00 51.29  ? 509  GLN A NE2 1 
ATOM   3871 N N   . TYR A 1 509 ? -7.130  49.931 330.444 1.00 46.51  ? 510  TYR A N   1 
ATOM   3872 C CA  . TYR A 1 509 ? -7.724  50.516 331.639 1.00 46.88  ? 510  TYR A CA  1 
ATOM   3873 C C   . TYR A 1 509 ? -9.175  50.852 331.319 1.00 50.24  ? 510  TYR A C   1 
ATOM   3874 O O   . TYR A 1 509 ? -9.594  50.811 330.161 1.00 45.78  ? 510  TYR A O   1 
ATOM   3875 C CB  . TYR A 1 509 ? -6.959  51.763 332.098 1.00 40.84  ? 510  TYR A CB  1 
ATOM   3876 C CG  . TYR A 1 509 ? -7.036  52.921 331.125 1.00 39.13  ? 510  TYR A CG  1 
ATOM   3877 C CD1 . TYR A 1 509 ? -6.153  53.016 330.056 1.00 38.52  ? 510  TYR A CD1 1 
ATOM   3878 C CD2 . TYR A 1 509 ? -7.996  53.917 331.270 1.00 39.20  ? 510  TYR A CD2 1 
ATOM   3879 C CE1 . TYR A 1 509 ? -6.222  54.071 329.160 1.00 35.76  ? 510  TYR A CE1 1 
ATOM   3880 C CE2 . TYR A 1 509 ? -8.074  54.973 330.377 1.00 42.00  ? 510  TYR A CE2 1 
ATOM   3881 C CZ  . TYR A 1 509 ? -7.182  55.047 329.326 1.00 46.28  ? 510  TYR A CZ  1 
ATOM   3882 O OH  . TYR A 1 509 ? -7.254  56.098 328.438 1.00 46.66  ? 510  TYR A OH  1 
ATOM   3883 N N   . VAL A 1 510 ? -9.946  51.195 332.351 1.00 39.65  ? 511  VAL A N   1 
ATOM   3884 C CA  . VAL A 1 510 ? -11.360 51.489 332.156 1.00 39.69  ? 511  VAL A CA  1 
ATOM   3885 C C   . VAL A 1 510 ? -11.643 52.940 332.520 1.00 41.36  ? 511  VAL A C   1 
ATOM   3886 O O   . VAL A 1 510 ? -10.944 53.554 333.330 1.00 40.81  ? 511  VAL A O   1 
ATOM   3887 C CB  . VAL A 1 510 ? -12.278 50.546 332.965 1.00 46.50  ? 511  VAL A CB  1 
ATOM   3888 C CG1 . VAL A 1 510 ? -12.038 49.096 332.565 1.00 48.02  ? 511  VAL A CG1 1 
ATOM   3889 C CG2 . VAL A 1 510 ? -12.077 50.745 334.462 1.00 42.35  ? 511  VAL A CG2 1 
ATOM   3890 N N   . SER A 1 511 ? -12.685 53.483 331.903 1.00 44.29  ? 512  SER A N   1 
ATOM   3891 C CA  . SER A 1 511 ? -13.194 54.807 332.224 1.00 42.39  ? 512  SER A CA  1 
ATOM   3892 C C   . SER A 1 511 ? -14.257 54.679 333.306 1.00 46.66  ? 512  SER A C   1 
ATOM   3893 O O   . SER A 1 511 ? -15.158 53.840 333.205 1.00 44.62  ? 512  SER A O   1 
ATOM   3894 C CB  . SER A 1 511 ? -13.801 55.460 330.988 1.00 42.61  ? 512  SER A CB  1 
ATOM   3895 O OG  . SER A 1 511 ? -14.629 54.514 330.340 1.00 66.15  ? 512  SER A OG  1 
ATOM   3896 N N   . LEU A 1 512 ? -14.153 55.515 334.331 1.00 47.03  ? 513  LEU A N   1 
ATOM   3897 C CA  . LEU A 1 512 ? -15.114 55.547 335.425 1.00 36.76  ? 513  LEU A CA  1 
ATOM   3898 C C   . LEU A 1 512 ? -15.934 56.823 335.298 1.00 46.14  ? 513  LEU A C   1 
ATOM   3899 O O   . LEU A 1 512 ? -15.425 57.923 335.541 1.00 41.80  ? 513  LEU A O   1 
ATOM   3900 C CB  . LEU A 1 512 ? -14.407 55.475 336.777 1.00 35.04  ? 513  LEU A CB  1 
ATOM   3901 C CG  . LEU A 1 512 ? -13.672 54.171 337.092 1.00 45.55  ? 513  LEU A CG  1 
ATOM   3902 C CD1 . LEU A 1 512 ? -13.112 54.204 338.505 1.00 31.68  ? 513  LEU A CD1 1 
ATOM   3903 C CD2 . LEU A 1 512 ? -14.594 52.977 336.898 1.00 37.67  ? 513  LEU A CD2 1 
ATOM   3904 N N   . ASP A 1 513 ? -17.196 56.673 334.909 1.00 39.82  ? 514  ASP A N   1 
ATOM   3905 C CA  . ASP A 1 513 ? -18.128 57.789 334.820 1.00 43.49  ? 514  ASP A CA  1 
ATOM   3906 C C   . ASP A 1 513 ? -19.544 57.223 334.844 1.00 48.10  ? 514  ASP A C   1 
ATOM   3907 O O   . ASP A 1 513 ? -19.750 56.038 335.129 1.00 41.37  ? 514  ASP A O   1 
ATOM   3908 C CB  . ASP A 1 513 ? -17.865 58.632 333.568 1.00 57.09  ? 514  ASP A CB  1 
ATOM   3909 C CG  . ASP A 1 513 ? -17.708 57.788 332.318 1.00 63.62  ? 514  ASP A CG  1 
ATOM   3910 O OD1 . ASP A 1 513 ? -16.815 58.102 331.502 1.00 88.78  ? 514  ASP A OD1 1 
ATOM   3911 O OD2 . ASP A 1 513 ? -18.472 56.815 332.146 1.00 64.81  ? 514  ASP A OD2 1 
ATOM   3912 N N   . LEU A 1 514 ? -20.523 58.075 334.525 1.00 45.01  ? 515  LEU A N   1 
ATOM   3913 C CA  . LEU A 1 514 ? -21.922 57.663 334.575 1.00 52.65  ? 515  LEU A CA  1 
ATOM   3914 C C   . LEU A 1 514 ? -22.240 56.590 333.540 1.00 52.38  ? 515  LEU A C   1 
ATOM   3915 O O   . LEU A 1 514 ? -23.147 55.777 333.754 1.00 55.62  ? 515  LEU A O   1 
ATOM   3916 C CB  . LEU A 1 514 ? -22.829 58.877 334.374 1.00 43.36  ? 515  LEU A CB  1 
ATOM   3917 C CG  . LEU A 1 514 ? -22.715 59.983 335.425 1.00 53.64  ? 515  LEU A CG  1 
ATOM   3918 C CD1 . LEU A 1 514 ? -23.751 61.071 335.178 1.00 42.46  ? 515  LEU A CD1 1 
ATOM   3919 C CD2 . LEU A 1 514 ? -22.863 59.404 336.823 1.00 46.68  ? 515  LEU A CD2 1 
ATOM   3920 N N   . ARG A 1 515 ? -21.521 56.574 332.420 1.00 45.09  ? 516  ARG A N   1 
ATOM   3921 C CA  . ARG A 1 515 ? -21.716 55.548 331.412 1.00 47.70  ? 516  ARG A CA  1 
ATOM   3922 C C   . ARG A 1 515 ? -21.148 54.217 331.902 1.00 56.78  ? 516  ARG A C   1 
ATOM   3923 O O   . ARG A 1 515 ? -20.361 54.180 332.850 1.00 56.17  ? 516  ARG A O   1 
ATOM   3924 C CB  . ARG A 1 515 ? -21.043 55.959 330.103 1.00 50.34  ? 516  ARG A CB  1 
ATOM   3925 C CG  . ARG A 1 515 ? -21.213 57.428 329.743 1.00 60.86  ? 516  ARG A CG  1 
ATOM   3926 C CD  . ARG A 1 515 ? -20.509 57.751 328.434 1.00 74.19  ? 516  ARG A CD  1 
ATOM   3927 N NE  . ARG A 1 515 ? -19.256 57.012 328.298 1.00 80.78  ? 516  ARG A NE  1 
ATOM   3928 C CZ  . ARG A 1 515 ? -18.072 57.458 328.710 1.00 85.26  ? 516  ARG A CZ  1 
ATOM   3929 N NH1 . ARG A 1 515 ? -17.969 58.650 329.284 1.00 86.23  ? 516  ARG A NH1 1 
ATOM   3930 N NH2 . ARG A 1 515 ? -16.987 56.711 328.546 1.00 71.42  ? 516  ARG A NH2 1 
ATOM   3931 N N   . PRO A 1 516 ? -21.543 53.104 331.280 1.00 55.63  ? 517  PRO A N   1 
ATOM   3932 C CA  . PRO A 1 516 ? -20.942 51.811 331.632 1.00 42.74  ? 517  PRO A CA  1 
ATOM   3933 C C   . PRO A 1 516 ? -19.450 51.793 331.330 1.00 52.22  ? 517  PRO A C   1 
ATOM   3934 O O   . PRO A 1 516 ? -18.904 52.679 330.669 1.00 51.08  ? 517  PRO A O   1 
ATOM   3935 C CB  . PRO A 1 516 ? -21.706 50.809 330.760 1.00 56.91  ? 517  PRO A CB  1 
ATOM   3936 C CG  . PRO A 1 516 ? -22.994 51.489 330.440 1.00 58.49  ? 517  PRO A CG  1 
ATOM   3937 C CD  . PRO A 1 516 ? -22.674 52.950 330.347 1.00 50.14  ? 517  PRO A CD  1 
ATOM   3938 N N   . LEU A 1 517 ? -18.786 50.751 331.833 1.00 49.42  ? 518  LEU A N   1 
ATOM   3939 C CA  . LEU A 1 517 ? -17.338 50.631 331.705 1.00 50.94  ? 518  LEU A CA  1 
ATOM   3940 C C   . LEU A 1 517 ? -16.918 50.616 330.241 1.00 60.22  ? 518  LEU A C   1 
ATOM   3941 O O   . LEU A 1 517 ? -17.512 49.915 329.417 1.00 55.20  ? 518  LEU A O   1 
ATOM   3942 C CB  . LEU A 1 517 ? -16.851 49.355 332.391 1.00 50.00  ? 518  LEU A CB  1 
ATOM   3943 C CG  . LEU A 1 517 ? -16.709 49.367 333.911 1.00 51.93  ? 518  LEU A CG  1 
ATOM   3944 C CD1 . LEU A 1 517 ? -15.950 48.134 334.375 1.00 44.91  ? 518  LEU A CD1 1 
ATOM   3945 C CD2 . LEU A 1 517 ? -16.014 50.634 334.372 1.00 54.46  ? 518  LEU A CD2 1 
ATOM   3946 N N   . GLU A 1 518 ? -15.882 51.386 329.922 1.00 51.17  ? 519  GLU A N   1 
ATOM   3947 C CA  . GLU A 1 518 ? -15.337 51.456 328.572 1.00 57.75  ? 519  GLU A CA  1 
ATOM   3948 C C   . GLU A 1 518 ? -13.844 51.178 328.642 1.00 59.54  ? 519  GLU A C   1 
ATOM   3949 O O   . GLU A 1 518 ? -13.122 51.850 329.384 1.00 52.92  ? 519  GLU A O   1 
ATOM   3950 C CB  . GLU A 1 518 ? -15.608 52.823 327.938 1.00 50.15  ? 519  GLU A CB  1 
ATOM   3951 C CG  . GLU A 1 518 ? -14.940 53.048 326.598 1.00 64.20  ? 519  GLU A CG  1 
ATOM   3952 C CD  . GLU A 1 518 ? -14.952 54.510 326.185 1.00 80.08  ? 519  GLU A CD  1 
ATOM   3953 O OE1 . GLU A 1 518 ? -14.205 54.872 325.251 1.00 80.99  ? 519  GLU A OE1 1 
ATOM   3954 O OE2 . GLU A 1 518 ? -15.700 55.299 326.801 1.00 75.16  ? 519  GLU A OE2 1 
ATOM   3955 N N   . VAL A 1 519 ? -13.390 50.191 327.876 1.00 52.72  ? 520  VAL A N   1 
ATOM   3956 C CA  . VAL A 1 519 ? -11.987 49.791 327.876 1.00 46.35  ? 520  VAL A CA  1 
ATOM   3957 C C   . VAL A 1 519 ? -11.217 50.686 326.914 1.00 54.35  ? 520  VAL A C   1 
ATOM   3958 O O   . VAL A 1 519 ? -11.636 50.893 325.769 1.00 57.43  ? 520  VAL A O   1 
ATOM   3959 C CB  . VAL A 1 519 ? -11.845 48.310 327.489 1.00 49.84  ? 520  VAL A CB  1 
ATOM   3960 C CG1 . VAL A 1 519 ? -10.379 47.914 327.407 1.00 39.04  ? 520  VAL A CG1 1 
ATOM   3961 C CG2 . VAL A 1 519 ? -12.593 47.428 328.476 1.00 45.34  ? 520  VAL A CG2 1 
ATOM   3962 N N   . ARG A 1 520 ? -10.094 51.232 327.378 1.00 45.76  ? 521  ARG A N   1 
ATOM   3963 C CA  . ARG A 1 520 ? -9.192  52.008 326.542 1.00 40.98  ? 521  ARG A CA  1 
ATOM   3964 C C   . ARG A 1 520 ? -7.778  51.466 326.706 1.00 45.95  ? 521  ARG A C   1 
ATOM   3965 O O   . ARG A 1 520 ? -7.518  50.593 327.537 1.00 48.07  ? 521  ARG A O   1 
ATOM   3966 C CB  . ARG A 1 520 ? -9.239  53.499 326.892 1.00 33.66  ? 521  ARG A CB  1 
ATOM   3967 C CG  . ARG A 1 520 ? -10.635 54.027 327.153 1.00 49.71  ? 521  ARG A CG  1 
ATOM   3968 C CD  . ARG A 1 520 ? -10.761 55.472 326.727 1.00 50.58  ? 521  ARG A CD  1 
ATOM   3969 N NE  . ARG A 1 520 ? -12.070 56.025 327.057 1.00 53.11  ? 521  ARG A NE  1 
ATOM   3970 C CZ  . ARG A 1 520 ? -12.264 57.041 327.889 1.00 55.14  ? 521  ARG A CZ  1 
ATOM   3971 N NH1 . ARG A 1 520 ? -11.229 57.626 328.477 1.00 65.98  ? 521  ARG A NH1 1 
ATOM   3972 N NH2 . ARG A 1 520 ? -13.493 57.479 328.125 1.00 63.80  ? 521  ARG A NH2 1 
ATOM   3973 N N   . ARG A 1 521 ? -6.860  51.998 325.901 1.00 44.44  ? 522  ARG A N   1 
ATOM   3974 C CA  . ARG A 1 521 ? -5.465  51.580 325.893 1.00 44.49  ? 522  ARG A CA  1 
ATOM   3975 C C   . ARG A 1 521 ? -4.553  52.779 326.115 1.00 46.95  ? 522  ARG A C   1 
ATOM   3976 O O   . ARG A 1 521 ? -4.802  53.870 325.589 1.00 47.12  ? 522  ARG A O   1 
ATOM   3977 C CB  . ARG A 1 521 ? -5.091  50.904 324.568 1.00 55.65  ? 522  ARG A CB  1 
ATOM   3978 C CG  . ARG A 1 521 ? -5.636  49.503 324.392 1.00 56.54  ? 522  ARG A CG  1 
ATOM   3979 C CD  . ARG A 1 521 ? -4.907  48.771 323.272 1.00 44.24  ? 522  ARG A CD  1 
ATOM   3980 N NE  . ARG A 1 521 ? -3.504  48.529 323.599 1.00 51.37  ? 522  ARG A NE  1 
ATOM   3981 C CZ  . ARG A 1 521 ? -2.478  48.943 322.863 1.00 64.63  ? 522  ARG A CZ  1 
ATOM   3982 N NH1 . ARG A 1 521 ? -2.691  49.622 321.742 1.00 61.31  ? 522  ARG A NH1 1 
ATOM   3983 N NH2 . ARG A 1 521 ? -1.236  48.673 323.245 1.00 48.06  ? 522  ARG A NH2 1 
ATOM   3984 N N   . GLY A 1 522 ? -3.492  52.568 326.890 1.00 44.54  ? 523  GLY A N   1 
ATOM   3985 C CA  . GLY A 1 522 ? -2.460  53.572 327.053 1.00 43.18  ? 523  GLY A CA  1 
ATOM   3986 C C   . GLY A 1 522 ? -2.796  54.698 328.009 1.00 47.48  ? 523  GLY A C   1 
ATOM   3987 O O   . GLY A 1 522 ? -3.669  55.524 327.729 1.00 56.09  ? 523  GLY A O   1 
ATOM   3988 N N   . LEU A 1 523 ? -2.103  54.745 329.147 1.00 47.81  ? 524  LEU A N   1 
ATOM   3989 C CA  . LEU A 1 523 ? -2.210  55.868 330.076 1.00 56.38  ? 524  LEU A CA  1 
ATOM   3990 C C   . LEU A 1 523 ? -1.254  56.956 329.596 1.00 44.69  ? 524  LEU A C   1 
ATOM   3991 O O   . LEU A 1 523 ? -0.145  57.129 330.107 1.00 51.08  ? 524  LEU A O   1 
ATOM   3992 C CB  . LEU A 1 523 ? -1.902  55.430 331.502 1.00 50.42  ? 524  LEU A CB  1 
ATOM   3993 C CG  . LEU A 1 523 ? -2.823  54.345 332.062 1.00 61.15  ? 524  LEU A CG  1 
ATOM   3994 C CD1 . LEU A 1 523 ? -2.115  53.540 333.137 1.00 55.20  ? 524  LEU A CD1 1 
ATOM   3995 C CD2 . LEU A 1 523 ? -4.105  54.961 332.603 1.00 55.01  ? 524  LEU A CD2 1 
ATOM   3996 N N   . ARG A 1 524 ? -1.711  57.699 328.588 1.00 48.55  ? 525  ARG A N   1 
ATOM   3997 C CA  A ARG A 1 524 ? -0.916  58.739 327.939 0.52 58.31  ? 525  ARG A CA  1 
ATOM   3998 C CA  B ARG A 1 524 ? -0.915  58.740 327.943 0.48 53.28  ? 525  ARG A CA  1 
ATOM   3999 C C   . ARG A 1 524 ? 0.481   58.217 327.604 1.00 44.37  ? 525  ARG A C   1 
ATOM   4000 O O   . ARG A 1 524 ? 1.504   58.735 328.059 1.00 45.61  ? 525  ARG A O   1 
ATOM   4001 C CB  A ARG A 1 524 ? -0.856  59.997 328.809 0.52 54.93  ? 525  ARG A CB  1 
ATOM   4002 C CB  B ARG A 1 524 ? -0.850  59.991 328.822 0.48 49.75  ? 525  ARG A CB  1 
ATOM   4003 C CG  A ARG A 1 524 ? -2.188  60.728 328.897 0.52 52.78  ? 525  ARG A CG  1 
ATOM   4004 C CG  B ARG A 1 524 ? -2.221  60.533 329.194 0.48 52.57  ? 525  ARG A CG  1 
ATOM   4005 C CD  A ARG A 1 524 ? -2.063  62.042 329.644 0.52 54.26  ? 525  ARG A CD  1 
ATOM   4006 C CD  B ARG A 1 524 ? -2.122  61.804 330.015 0.48 53.91  ? 525  ARG A CD  1 
ATOM   4007 N NE  A ARG A 1 524 ? -1.092  62.942 329.026 0.52 54.35  ? 525  ARG A NE  1 
ATOM   4008 N NE  B ARG A 1 524 ? -3.432  62.255 330.476 0.48 50.61  ? 525  ARG A NE  1 
ATOM   4009 C CZ  A ARG A 1 524 ? -1.371  63.788 328.040 0.52 41.38  ? 525  ARG A CZ  1 
ATOM   4010 C CZ  B ARG A 1 524 ? -3.739  63.522 330.737 0.48 48.74  ? 525  ARG A CZ  1 
ATOM   4011 N NH1 A ARG A 1 524 ? -2.600  63.855 327.544 0.52 48.72  ? 525  ARG A NH1 1 
ATOM   4012 N NH1 B ARG A 1 524 ? -2.827  64.473 330.588 0.48 46.35  ? 525  ARG A NH1 1 
ATOM   4013 N NH2 A ARG A 1 524 ? -0.420  64.568 327.548 0.52 28.21  ? 525  ARG A NH2 1 
ATOM   4014 N NH2 B ARG A 1 524 ? -4.959  63.837 331.149 0.48 43.95  ? 525  ARG A NH2 1 
ATOM   4015 N N   . ALA A 1 525 ? 0.492   57.157 326.789 1.00 43.57  ? 526  ALA A N   1 
ATOM   4016 C CA  . ALA A 1 525 ? 1.724   56.437 326.486 1.00 45.03  ? 526  ALA A CA  1 
ATOM   4017 C C   . ALA A 1 525 ? 2.780   57.344 325.867 1.00 47.72  ? 526  ALA A C   1 
ATOM   4018 O O   . ALA A 1 525 ? 3.959   57.268 326.235 1.00 43.93  ? 526  ALA A O   1 
ATOM   4019 C CB  . ALA A 1 525 ? 1.419   55.259 325.561 1.00 46.85  ? 526  ALA A CB  1 
ATOM   4020 N N   . GLN A 1 526 ? 2.385   58.202 324.923 1.00 42.75  ? 527  GLN A N   1 
ATOM   4021 C CA  . GLN A 1 526 ? 3.366   59.062 324.263 1.00 49.21  ? 527  GLN A CA  1 
ATOM   4022 C C   . GLN A 1 526 ? 4.004   60.023 325.257 1.00 38.20  ? 527  GLN A C   1 
ATOM   4023 O O   . GLN A 1 526 ? 5.232   60.148 325.318 1.00 44.69  ? 527  GLN A O   1 
ATOM   4024 C CB  . GLN A 1 526 ? 2.718   59.832 323.107 1.00 49.11  ? 527  GLN A CB  1 
ATOM   4025 C CG  . GLN A 1 526 ? 1.881   58.988 322.160 1.00 44.87  ? 527  GLN A CG  1 
ATOM   4026 C CD  . GLN A 1 526 ? 2.686   57.919 321.451 1.00 52.78  ? 527  GLN A CD  1 
ATOM   4027 O OE1 . GLN A 1 526 ? 3.890   58.068 321.237 1.00 56.37  ? 527  GLN A OE1 1 
ATOM   4028 N NE2 . GLN A 1 526 ? 2.024   56.826 321.088 1.00 55.41  ? 527  GLN A NE2 1 
ATOM   4029 N N   . ALA A 1 527 ? 3.183   60.707 326.054 1.00 43.06  ? 528  ALA A N   1 
ATOM   4030 C CA  . ALA A 1 527 ? 3.722   61.653 327.030 1.00 47.94  ? 528  ALA A CA  1 
ATOM   4031 C C   . ALA A 1 527 ? 4.562   60.952 328.089 1.00 47.09  ? 528  ALA A C   1 
ATOM   4032 O O   . ALA A 1 527 ? 5.641   61.423 328.453 1.00 49.30  ? 528  ALA A O   1 
ATOM   4033 C CB  . ALA A 1 527 ? 2.584   62.441 327.676 1.00 47.11  ? 528  ALA A CB  1 
ATOM   4034 N N   . CYS A 1 528 ? 4.097   59.813 328.573 1.00 31.99  ? 529  CYS A N   1 
ATOM   4035 C CA  . CYS A 1 528 ? 4.758   59.094 329.656 1.00 40.93  ? 529  CYS A CA  1 
ATOM   4036 C C   . CYS A 1 528 ? 6.057   58.429 329.190 1.00 43.80  ? 529  CYS A C   1 
ATOM   4037 O O   . CYS A 1 528 ? 6.993   58.246 329.982 1.00 42.02  ? 529  CYS A O   1 
ATOM   4038 C CB  . CYS A 1 528 ? 3.801   58.056 330.219 1.00 51.62  ? 529  CYS A CB  1 
ATOM   4039 S SG  . CYS A 1 528 ? 2.574   58.865 331.202 1.00 46.37  ? 529  CYS A SG  1 
ATOM   4040 N N   . ALA A 1 529 ? 6.180   58.143 327.887 1.00 37.19  ? 530  ALA A N   1 
ATOM   4041 C CA  . ALA A 1 529 ? 7.453   57.695 327.327 1.00 38.83  ? 530  ALA A CA  1 
ATOM   4042 C C   . ALA A 1 529 ? 8.510   58.779 327.464 1.00 33.59  ? 530  ALA A C   1 
ATOM   4043 O O   . ALA A 1 529 ? 9.677   58.493 327.757 1.00 38.70  ? 530  ALA A O   1 
ATOM   4044 C CB  . ALA A 1 529 ? 7.248   57.306 325.864 1.00 34.79  ? 530  ALA A CB  1 
ATOM   4045 N N   . PHE A 1 530 ? 8.105   60.037 327.302 1.00 32.63  ? 531  PHE A N   1 
ATOM   4046 C CA  . PHE A 1 530 ? 9.033   61.143 327.494 1.00 32.53  ? 531  PHE A CA  1 
ATOM   4047 C C   . PHE A 1 530 ? 9.493   61.233 328.946 1.00 36.19  ? 531  PHE A C   1 
ATOM   4048 O O   . PHE A 1 530 ? 10.690  61.374 329.216 1.00 42.62  ? 531  PHE A O   1 
ATOM   4049 C CB  . PHE A 1 530 ? 8.385   62.452 327.042 1.00 36.35  ? 531  PHE A CB  1 
ATOM   4050 C CG  . PHE A 1 530 ? 9.099   63.679 327.523 1.00 41.93  ? 531  PHE A CG  1 
ATOM   4051 C CD1 . PHE A 1 530 ? 10.268  64.099 326.913 1.00 40.89  ? 531  PHE A CD1 1 
ATOM   4052 C CD2 . PHE A 1 530 ? 8.600   64.417 328.583 1.00 46.80  ? 531  PHE A CD2 1 
ATOM   4053 C CE1 . PHE A 1 530 ? 10.928  65.228 327.353 1.00 45.27  ? 531  PHE A CE1 1 
ATOM   4054 C CE2 . PHE A 1 530 ? 9.256   65.546 329.028 1.00 45.01  ? 531  PHE A CE2 1 
ATOM   4055 C CZ  . PHE A 1 530 ? 10.421  65.952 328.410 1.00 50.52  ? 531  PHE A CZ  1 
ATOM   4056 N N   . TRP A 1 531 ? 8.557   61.136 329.898 1.00 39.31  ? 532  TRP A N   1 
ATOM   4057 C CA  . TRP A 1 531 ? 8.901   61.331 331.306 1.00 42.89  ? 532  TRP A CA  1 
ATOM   4058 C C   . TRP A 1 531 ? 9.639   60.132 331.894 1.00 39.17  ? 532  TRP A C   1 
ATOM   4059 O O   . TRP A 1 531 ? 10.546  60.304 332.715 1.00 41.18  ? 532  TRP A O   1 
ATOM   4060 C CB  . TRP A 1 531 ? 7.643   61.613 332.131 1.00 34.87  ? 532  TRP A CB  1 
ATOM   4061 C CG  . TRP A 1 531 ? 6.959   62.902 331.792 1.00 36.38  ? 532  TRP A CG  1 
ATOM   4062 C CD1 . TRP A 1 531 ? 5.805   63.053 331.082 1.00 32.48  ? 532  TRP A CD1 1 
ATOM   4063 C CD2 . TRP A 1 531 ? 7.383   64.221 332.156 1.00 30.44  ? 532  TRP A CD2 1 
ATOM   4064 N NE1 . TRP A 1 531 ? 5.483   64.385 330.978 1.00 31.67  ? 532  TRP A NE1 1 
ATOM   4065 C CE2 . TRP A 1 531 ? 6.436   65.123 331.629 1.00 33.21  ? 532  TRP A CE2 1 
ATOM   4066 C CE3 . TRP A 1 531 ? 8.470   64.728 332.875 1.00 29.36  ? 532  TRP A CE3 1 
ATOM   4067 C CZ2 . TRP A 1 531 ? 6.543   66.500 331.798 1.00 29.17  ? 532  TRP A CZ2 1 
ATOM   4068 C CZ3 . TRP A 1 531 ? 8.574   66.095 333.041 1.00 33.24  ? 532  TRP A CZ3 1 
ATOM   4069 C CH2 . TRP A 1 531 ? 7.616   66.966 332.504 1.00 38.38  ? 532  TRP A CH2 1 
ATOM   4070 N N   . ASN A 1 532 ? 9.266   58.915 331.494 1.00 42.60  ? 533  ASN A N   1 
ATOM   4071 C CA  . ASN A 1 532 ? 9.782   57.709 332.131 1.00 42.95  ? 533  ASN A CA  1 
ATOM   4072 C C   . ASN A 1 532 ? 10.962  57.078 331.402 1.00 49.53  ? 533  ASN A C   1 
ATOM   4073 O O   . ASN A 1 532 ? 11.731  56.344 332.031 1.00 45.58  ? 533  ASN A O   1 
ATOM   4074 C CB  . ASN A 1 532 ? 8.670   56.660 332.265 1.00 45.61  ? 533  ASN A CB  1 
ATOM   4075 C CG  . ASN A 1 532 ? 7.527   57.132 333.142 1.00 39.18  ? 533  ASN A CG  1 
ATOM   4076 O OD1 . ASN A 1 532 ? 7.730   57.899 334.082 1.00 51.45  ? 533  ASN A OD1 1 
ATOM   4077 N ND2 . ASN A 1 532 ? 6.316   56.680 332.836 1.00 36.97  ? 533  ASN A ND2 1 
ATOM   4078 N N   . ARG A 1 533 ? 11.125  57.335 330.105 1.00 44.10  ? 534  ARG A N   1 
ATOM   4079 C CA  . ARG A 1 533 ? 12.193  56.725 329.323 1.00 42.35  ? 534  ARG A CA  1 
ATOM   4080 C C   . ARG A 1 533 ? 13.274  57.711 328.909 1.00 43.43  ? 534  ARG A C   1 
ATOM   4081 O O   . ARG A 1 533 ? 14.461  57.444 329.115 1.00 50.61  ? 534  ARG A O   1 
ATOM   4082 C CB  . ARG A 1 533 ? 11.608  56.047 328.075 1.00 45.23  ? 534  ARG A CB  1 
ATOM   4083 C CG  . ARG A 1 533 ? 10.584  54.970 328.381 1.00 44.90  ? 534  ARG A CG  1 
ATOM   4084 C CD  . ARG A 1 533 ? 9.895   54.491 327.119 1.00 56.37  ? 534  ARG A CD  1 
ATOM   4085 N NE  . ARG A 1 533 ? 8.914   53.447 327.395 1.00 63.40  ? 534  ARG A NE  1 
ATOM   4086 C CZ  . ARG A 1 533 ? 9.178   52.146 327.344 1.00 69.66  ? 534  ARG A CZ  1 
ATOM   4087 N NH1 . ARG A 1 533 ? 10.397  51.726 327.027 1.00 62.07  ? 534  ARG A NH1 1 
ATOM   4088 N NH2 . ARG A 1 533 ? 8.224   51.263 327.608 1.00 60.36  ? 534  ARG A NH2 1 
ATOM   4089 N N   . PHE A 1 534 ? 12.903  58.853 328.331 1.00 44.77  ? 535  PHE A N   1 
ATOM   4090 C CA  . PHE A 1 534 ? 13.906  59.741 327.754 1.00 49.44  ? 535  PHE A CA  1 
ATOM   4091 C C   . PHE A 1 534 ? 14.469  60.742 328.759 1.00 41.96  ? 535  PHE A C   1 
ATOM   4092 O O   . PHE A 1 534 ? 15.688  60.830 328.923 1.00 51.37  ? 535  PHE A O   1 
ATOM   4093 C CB  . PHE A 1 534 ? 13.331  60.497 326.552 1.00 37.35  ? 535  PHE A CB  1 
ATOM   4094 C CG  . PHE A 1 534 ? 14.256  61.552 326.021 1.00 39.43  ? 535  PHE A CG  1 
ATOM   4095 C CD1 . PHE A 1 534 ? 15.441  61.197 325.395 1.00 43.75  ? 535  PHE A CD1 1 
ATOM   4096 C CD2 . PHE A 1 534 ? 13.957  62.896 326.171 1.00 39.98  ? 535  PHE A CD2 1 
ATOM   4097 C CE1 . PHE A 1 534 ? 16.306  62.163 324.913 1.00 42.88  ? 535  PHE A CE1 1 
ATOM   4098 C CE2 . PHE A 1 534 ? 14.816  63.870 325.690 1.00 45.98  ? 535  PHE A CE2 1 
ATOM   4099 C CZ  . PHE A 1 534 ? 15.992  63.503 325.061 1.00 49.17  ? 535  PHE A CZ  1 
ATOM   4100 N N   . LEU A 1 535 ? 13.603  61.515 329.413 1.00 40.34  ? 536  LEU A N   1 
ATOM   4101 C CA  . LEU A 1 535 ? 14.082  62.586 330.286 1.00 56.09  ? 536  LEU A CA  1 
ATOM   4102 C C   . LEU A 1 535 ? 15.052  62.121 331.370 1.00 54.07  ? 536  LEU A C   1 
ATOM   4103 O O   . LEU A 1 535 ? 15.993  62.877 331.673 1.00 51.97  ? 536  LEU A O   1 
ATOM   4104 C CB  . LEU A 1 535 ? 12.893  63.326 330.912 1.00 48.98  ? 536  LEU A CB  1 
ATOM   4105 C CG  . LEU A 1 535 ? 13.283  64.650 331.573 1.00 54.11  ? 536  LEU A CG  1 
ATOM   4106 C CD1 . LEU A 1 535 ? 13.195  65.798 330.578 1.00 59.70  ? 536  LEU A CD1 1 
ATOM   4107 C CD2 . LEU A 1 535 ? 12.407  64.925 332.777 1.00 60.09  ? 536  LEU A CD2 1 
ATOM   4108 N N   . PRO A 1 536 ? 14.900  60.944 331.991 1.00 49.21  ? 537  PRO A N   1 
ATOM   4109 C CA  . PRO A 1 536 ? 15.974  60.478 332.889 1.00 58.24  ? 537  PRO A CA  1 
ATOM   4110 C C   . PRO A 1 536 ? 17.320  60.356 332.195 1.00 54.96  ? 537  PRO A C   1 
ATOM   4111 O O   . PRO A 1 536 ? 18.353  60.680 332.795 1.00 52.98  ? 537  PRO A O   1 
ATOM   4112 C CB  . PRO A 1 536 ? 15.453  59.120 333.382 1.00 42.12  ? 537  PRO A CB  1 
ATOM   4113 C CG  . PRO A 1 536 ? 13.971  59.245 333.298 1.00 50.21  ? 537  PRO A CG  1 
ATOM   4114 C CD  . PRO A 1 536 ? 13.707  60.080 332.078 1.00 47.93  ? 537  PRO A CD  1 
ATOM   4115 N N   . LYS A 1 537 ? 17.339  59.903 330.937 1.00 59.26  ? 538  LYS A N   1 
ATOM   4116 C CA  . LYS A 1 537 ? 18.594  59.840 330.194 1.00 42.15  ? 538  LYS A CA  1 
ATOM   4117 C C   . LYS A 1 537 ? 19.168  61.233 329.971 1.00 45.75  ? 538  LYS A C   1 
ATOM   4118 O O   . LYS A 1 537 ? 20.390  61.424 329.997 1.00 57.14  ? 538  LYS A O   1 
ATOM   4119 C CB  . LYS A 1 537 ? 18.382  59.132 328.857 1.00 52.98  ? 538  LYS A CB  1 
ATOM   4120 C CG  . LYS A 1 537 ? 18.057  57.652 328.968 1.00 52.06  ? 538  LYS A CG  1 
ATOM   4121 C CD  . LYS A 1 537 ? 17.781  57.067 327.589 1.00 63.82  ? 538  LYS A CD  1 
ATOM   4122 C CE  . LYS A 1 537 ? 17.712  55.549 327.618 1.00 72.18  ? 538  LYS A CE  1 
ATOM   4123 N NZ  . LYS A 1 537 ? 16.654  55.051 328.537 1.00 74.21  ? 538  LYS A NZ  1 
ATOM   4124 N N   . LEU A 1 538 ? 18.299  62.221 329.755 1.00 57.54  ? 539  LEU A N   1 
ATOM   4125 C CA  . LEU A 1 538 ? 18.764  63.587 329.547 1.00 55.53  ? 539  LEU A CA  1 
ATOM   4126 C C   . LEU A 1 538 ? 19.347  64.170 330.827 1.00 50.61  ? 539  LEU A C   1 
ATOM   4127 O O   . LEU A 1 538 ? 20.325  64.926 330.782 1.00 63.04  ? 539  LEU A O   1 
ATOM   4128 C CB  . LEU A 1 538 ? 17.614  64.450 329.028 1.00 51.35  ? 539  LEU A CB  1 
ATOM   4129 C CG  . LEU A 1 538 ? 17.928  65.859 328.522 1.00 57.89  ? 539  LEU A CG  1 
ATOM   4130 C CD1 . LEU A 1 538 ? 16.997  66.217 327.383 1.00 52.36  ? 539  LEU A CD1 1 
ATOM   4131 C CD2 . LEU A 1 538 ? 17.806  66.880 329.640 1.00 51.80  ? 539  LEU A CD2 1 
ATOM   4132 N N   . LEU A 1 539 ? 18.761  63.833 331.979 1.00 66.63  ? 540  LEU A N   1 
ATOM   4133 C CA  . LEU A 1 539 ? 19.266  64.357 333.244 1.00 66.75  ? 540  LEU A CA  1 
ATOM   4134 C C   . LEU A 1 539 ? 20.601  63.729 333.625 1.00 67.41  ? 540  LEU A C   1 
ATOM   4135 O O   . LEU A 1 539 ? 21.392  64.353 334.342 1.00 72.00  ? 540  LEU A O   1 
ATOM   4136 C CB  . LEU A 1 539 ? 18.239  64.136 334.354 1.00 67.13  ? 540  LEU A CB  1 
ATOM   4137 C CG  . LEU A 1 539 ? 16.978  64.999 334.274 1.00 76.68  ? 540  LEU A CG  1 
ATOM   4138 C CD1 . LEU A 1 539 ? 16.072  64.754 335.474 1.00 55.18  ? 540  LEU A CD1 1 
ATOM   4139 C CD2 . LEU A 1 539 ? 17.345  66.476 334.160 1.00 56.21  ? 540  LEU A CD2 1 
ATOM   4140 N N   . SER A 1 540 ? 20.869  62.506 333.160 1.00 66.17  ? 541  SER A N   1 
ATOM   4141 C CA  . SER A 1 540 ? 22.145  61.861 333.452 1.00 69.29  ? 541  SER A CA  1 
ATOM   4142 C C   . SER A 1 540 ? 23.281  62.455 332.627 1.00 87.47  ? 541  SER A C   1 
ATOM   4143 O O   . SER A 1 540 ? 24.402  62.602 333.128 1.00 90.80  ? 541  SER A O   1 
ATOM   4144 C CB  . SER A 1 540 ? 22.042  60.355 333.204 1.00 69.01  ? 541  SER A CB  1 
ATOM   4145 O OG  . SER A 1 540 ? 20.889  59.816 333.826 1.00 81.13  ? 541  SER A OG  1 
ATOM   4146 N N   . ALA A 1 541 ? 23.017  62.800 331.370 1.00 80.52  ? 542  ALA A N   1 
ATOM   4147 C CA  . ALA A 1 541 ? 24.030  63.409 330.514 1.00 85.55  ? 542  ALA A CA  1 
ATOM   4148 C C   . ALA A 1 541 ? 24.239  64.877 330.874 1.00 85.26  ? 542  ALA A C   1 
ATOM   4149 O O   . ALA A 1 541 ? 23.374  65.506 331.484 1.00 86.51  ? 542  ALA A O   1 
ATOM   4150 C CB  . ALA A 1 541 ? 23.640  63.270 329.052 1.00 75.99  ? 542  ALA A CB  1 
ATOM   4151 N N   . ASP B 1 4   ? -49.058 55.356 390.943 1.00 78.90  ? 5    ASP B N   1 
ATOM   4152 C CA  . ASP B 1 4   ? -48.166 54.672 390.012 1.00 61.41  ? 5    ASP B CA  1 
ATOM   4153 C C   . ASP B 1 4   ? -47.549 55.669 389.036 1.00 64.83  ? 5    ASP B C   1 
ATOM   4154 O O   . ASP B 1 4   ? -48.159 56.019 388.025 1.00 65.13  ? 5    ASP B O   1 
ATOM   4155 C CB  . ASP B 1 4   ? -48.919 53.576 389.254 1.00 48.00  ? 5    ASP B CB  1 
ATOM   4156 C CG  . ASP B 1 4   ? -47.988 52.607 388.540 1.00 64.95  ? 5    ASP B CG  1 
ATOM   4157 O OD1 . ASP B 1 4   ? -46.769 52.878 388.453 1.00 60.27  ? 5    ASP B OD1 1 
ATOM   4158 O OD2 . ASP B 1 4   ? -48.480 51.559 388.068 1.00 59.55  ? 5    ASP B OD2 1 
ATOM   4159 N N   . ALA B 1 5   ? -46.325 56.106 389.344 1.00 62.93  ? 6    ALA B N   1 
ATOM   4160 C CA  . ALA B 1 5   ? -45.662 57.137 388.552 1.00 68.39  ? 6    ALA B CA  1 
ATOM   4161 C C   . ALA B 1 5   ? -45.450 56.722 387.101 1.00 61.21  ? 6    ALA B C   1 
ATOM   4162 O O   . ALA B 1 5   ? -45.281 57.591 386.240 1.00 64.13  ? 6    ALA B O   1 
ATOM   4163 C CB  . ALA B 1 5   ? -44.319 57.502 389.188 1.00 45.27  ? 6    ALA B CB  1 
ATOM   4164 N N   . GLU B 1 6   ? -45.451 55.419 386.809 1.00 60.45  ? 7    GLU B N   1 
ATOM   4165 C CA  . GLU B 1 6   ? -45.245 54.971 385.436 1.00 59.84  ? 7    GLU B CA  1 
ATOM   4166 C C   . GLU B 1 6   ? -46.412 55.347 384.533 1.00 55.48  ? 7    GLU B C   1 
ATOM   4167 O O   . GLU B 1 6   ? -46.235 55.473 383.316 1.00 58.53  ? 7    GLU B O   1 
ATOM   4168 C CB  . GLU B 1 6   ? -45.018 53.460 385.401 1.00 60.36  ? 7    GLU B CB  1 
ATOM   4169 C CG  . GLU B 1 6   ? -43.777 53.000 386.143 1.00 54.59  ? 7    GLU B CG  1 
ATOM   4170 C CD  . GLU B 1 6   ? -42.498 53.501 385.502 1.00 76.08  ? 7    GLU B CD  1 
ATOM   4171 O OE1 . GLU B 1 6   ? -41.501 53.687 386.233 1.00 73.88  ? 7    GLU B OE1 1 
ATOM   4172 O OE2 . GLU B 1 6   ? -42.489 53.706 384.268 1.00 69.21  ? 7    GLU B OE2 1 
ATOM   4173 N N   . LEU B 1 7   ? -47.599 55.532 385.102 1.00 43.69  ? 8    LEU B N   1 
ATOM   4174 C CA  . LEU B 1 7   ? -48.796 55.866 384.345 1.00 46.25  ? 8    LEU B CA  1 
ATOM   4175 C C   . LEU B 1 7   ? -49.069 57.365 384.301 1.00 47.36  ? 8    LEU B C   1 
ATOM   4176 O O   . LEU B 1 7   ? -50.106 57.781 383.774 1.00 48.49  ? 8    LEU B O   1 
ATOM   4177 C CB  . LEU B 1 7   ? -50.001 55.131 384.929 1.00 47.03  ? 8    LEU B CB  1 
ATOM   4178 C CG  . LEU B 1 7   ? -49.813 53.619 385.060 1.00 54.01  ? 8    LEU B CG  1 
ATOM   4179 C CD1 . LEU B 1 7   ? -51.041 52.983 385.693 1.00 50.22  ? 8    LEU B CD1 1 
ATOM   4180 C CD2 . LEU B 1 7   ? -49.508 52.996 383.696 1.00 43.42  ? 8    LEU B CD2 1 
ATOM   4181 N N   . LEU B 1 8   ? -48.168 58.181 384.840 1.00 51.20  ? 9    LEU B N   1 
ATOM   4182 C CA  . LEU B 1 8   ? -48.311 59.631 384.837 1.00 51.22  ? 9    LEU B CA  1 
ATOM   4183 C C   . LEU B 1 8   ? -47.281 60.216 383.882 1.00 40.48  ? 9    LEU B C   1 
ATOM   4184 O O   . LEU B 1 8   ? -46.076 60.002 384.055 1.00 53.12  ? 9    LEU B O   1 
ATOM   4185 C CB  . LEU B 1 8   ? -48.138 60.204 386.243 1.00 43.84  ? 9    LEU B CB  1 
ATOM   4186 C CG  . LEU B 1 8   ? -49.243 59.861 387.244 1.00 57.33  ? 9    LEU B CG  1 
ATOM   4187 C CD1 . LEU B 1 8   ? -48.865 60.345 388.633 1.00 45.44  ? 9    LEU B CD1 1 
ATOM   4188 C CD2 . LEU B 1 8   ? -50.575 60.458 386.807 1.00 51.04  ? 9    LEU B CD2 1 
ATOM   4189 N N   . VAL B 1 9   ? -47.754 60.939 382.872 1.00 43.10  ? 10   VAL B N   1 
ATOM   4190 C CA  . VAL B 1 9   ? -46.898 61.522 381.848 1.00 40.48  ? 10   VAL B CA  1 
ATOM   4191 C C   . VAL B 1 9   ? -47.339 62.959 381.617 1.00 37.35  ? 10   VAL B C   1 
ATOM   4192 O O   . VAL B 1 9   ? -48.538 63.259 381.627 1.00 37.53  ? 10   VAL B O   1 
ATOM   4193 C CB  . VAL B 1 9   ? -46.949 60.712 380.533 1.00 45.06  ? 10   VAL B CB  1 
ATOM   4194 C CG1 . VAL B 1 9   ? -46.150 61.402 379.431 1.00 45.53  ? 10   VAL B CG1 1 
ATOM   4195 C CG2 . VAL B 1 9   ? -46.421 59.309 380.757 1.00 56.52  ? 10   VAL B CG2 1 
ATOM   4196 N N   . THR B 1 10  ? -46.370 63.847 381.425 1.00 37.34  ? 11   THR B N   1 
ATOM   4197 C CA  . THR B 1 10  ? -46.633 65.235 381.079 1.00 38.99  ? 11   THR B CA  1 
ATOM   4198 C C   . THR B 1 10  ? -46.207 65.464 379.635 1.00 42.69  ? 11   THR B C   1 
ATOM   4199 O O   . THR B 1 10  ? -45.043 65.241 379.282 1.00 41.35  ? 11   THR B O   1 
ATOM   4200 C CB  . THR B 1 10  ? -45.895 66.191 382.018 1.00 43.19  ? 11   THR B CB  1 
ATOM   4201 O OG1 . THR B 1 10  ? -46.393 66.031 383.354 1.00 52.29  ? 11   THR B OG1 1 
ATOM   4202 C CG2 . THR B 1 10  ? -46.101 67.636 381.577 1.00 33.88  ? 11   THR B CG2 1 
ATOM   4203 N N   . VAL B 1 11  ? -47.154 65.885 378.801 1.00 36.96  ? 12   VAL B N   1 
ATOM   4204 C CA  . VAL B 1 11  ? -46.843 66.300 377.439 1.00 44.82  ? 12   VAL B CA  1 
ATOM   4205 C C   . VAL B 1 11  ? -46.960 67.816 377.385 1.00 47.48  ? 12   VAL B C   1 
ATOM   4206 O O   . VAL B 1 11  ? -47.260 68.459 378.398 1.00 48.13  ? 12   VAL B O   1 
ATOM   4207 C CB  . VAL B 1 11  ? -47.760 65.618 376.407 1.00 36.44  ? 12   VAL B CB  1 
ATOM   4208 C CG1 . VAL B 1 11  ? -47.520 64.120 376.407 1.00 38.58  ? 12   VAL B CG1 1 
ATOM   4209 C CG2 . VAL B 1 11  ? -49.226 65.925 376.695 1.00 37.46  ? 12   VAL B CG2 1 
ATOM   4210 N N   . ARG B 1 12  ? -46.724 68.397 376.206 1.00 33.88  ? 13   ARG B N   1 
ATOM   4211 C CA  . ARG B 1 12  ? -46.717 69.851 376.094 1.00 48.26  ? 13   ARG B CA  1 
ATOM   4212 C C   . ARG B 1 12  ? -48.076 70.456 376.416 1.00 46.64  ? 13   ARG B C   1 
ATOM   4213 O O   . ARG B 1 12  ? -48.144 71.592 376.897 1.00 58.38  ? 13   ARG B O   1 
ATOM   4214 C CB  . ARG B 1 12  ? -46.261 70.269 374.694 1.00 37.93  ? 13   ARG B CB  1 
ATOM   4215 C CG  . ARG B 1 12  ? -44.802 69.950 374.435 1.00 62.80  ? 13   ARG B CG  1 
ATOM   4216 C CD  . ARG B 1 12  ? -44.266 70.673 373.216 1.00 65.30  ? 13   ARG B CD  1 
ATOM   4217 N NE  . ARG B 1 12  ? -42.955 70.160 372.830 1.00 82.80  ? 13   ARG B NE  1 
ATOM   4218 C CZ  . ARG B 1 12  ? -42.244 70.619 371.805 1.00 75.35  ? 13   ARG B CZ  1 
ATOM   4219 N NH1 . ARG B 1 12  ? -42.717 71.607 371.058 1.00 72.29  ? 13   ARG B NH1 1 
ATOM   4220 N NH2 . ARG B 1 12  ? -41.063 70.086 371.524 1.00 75.35  ? 13   ARG B NH2 1 
ATOM   4221 N N   . GLY B 1 13  ? -49.162 69.719 376.177 1.00 47.87  ? 14   GLY B N   1 
ATOM   4222 C CA  . GLY B 1 13  ? -50.482 70.254 376.456 1.00 38.97  ? 14   GLY B CA  1 
ATOM   4223 C C   . GLY B 1 13  ? -50.907 70.155 377.903 1.00 45.53  ? 14   GLY B C   1 
ATOM   4224 O O   . GLY B 1 13  ? -51.803 70.893 378.326 1.00 45.90  ? 14   GLY B O   1 
ATOM   4225 N N   . GLY B 1 14  ? -50.291 69.266 378.667 1.00 34.44  ? 15   GLY B N   1 
ATOM   4226 C CA  . GLY B 1 14  ? -50.652 69.073 380.054 1.00 38.95  ? 15   GLY B CA  1 
ATOM   4227 C C   . GLY B 1 14  ? -50.331 67.659 380.496 1.00 40.62  ? 15   GLY B C   1 
ATOM   4228 O O   . GLY B 1 14  ? -49.540 66.963 379.867 1.00 44.98  ? 15   GLY B O   1 
ATOM   4229 N N   . ARG B 1 15  ? -50.977 67.256 381.585 1.00 39.44  ? 16   ARG B N   1 
ATOM   4230 C CA  . ARG B 1 15  ? -50.700 65.994 382.253 1.00 53.01  ? 16   ARG B CA  1 
ATOM   4231 C C   . ARG B 1 15  ? -51.696 64.921 381.824 1.00 48.41  ? 16   ARG B C   1 
ATOM   4232 O O   . ARG B 1 15  ? -52.864 65.206 381.546 1.00 40.32  ? 16   ARG B O   1 
ATOM   4233 C CB  . ARG B 1 15  ? -50.748 66.171 383.774 1.00 44.21  ? 16   ARG B CB  1 
ATOM   4234 C CG  . ARG B 1 15  ? -49.651 67.071 384.335 1.00 58.82  ? 16   ARG B CG  1 
ATOM   4235 C CD  . ARG B 1 15  ? -49.741 67.178 385.856 1.00 49.31  ? 16   ARG B CD  1 
ATOM   4236 N NE  . ARG B 1 15  ? -50.902 67.955 386.280 1.00 51.00  ? 16   ARG B NE  1 
ATOM   4237 C CZ  . ARG B 1 15  ? -51.534 67.786 387.438 1.00 59.93  ? 16   ARG B CZ  1 
ATOM   4238 N NH1 . ARG B 1 15  ? -51.120 66.860 388.294 1.00 59.97  ? 16   ARG B NH1 1 
ATOM   4239 N NH2 . ARG B 1 15  ? -52.584 68.538 387.738 1.00 58.81  ? 16   ARG B NH2 1 
ATOM   4240 N N   . LEU B 1 16  ? -51.221 63.674 381.792 1.00 38.85  ? 17   LEU B N   1 
ATOM   4241 C CA  . LEU B 1 16  ? -52.024 62.529 381.385 1.00 43.63  ? 17   LEU B CA  1 
ATOM   4242 C C   . LEU B 1 16  ? -51.910 61.414 382.415 1.00 43.05  ? 17   LEU B C   1 
ATOM   4243 O O   . LEU B 1 16  ? -50.886 61.270 383.088 1.00 44.49  ? 17   LEU B O   1 
ATOM   4244 C CB  . LEU B 1 16  ? -51.582 61.979 380.020 1.00 40.64  ? 17   LEU B CB  1 
ATOM   4245 C CG  . LEU B 1 16  ? -51.488 62.953 378.849 1.00 40.97  ? 17   LEU B CG  1 
ATOM   4246 C CD1 . LEU B 1 16  ? -50.822 62.281 377.656 1.00 33.74  ? 17   LEU B CD1 1 
ATOM   4247 C CD2 . LEU B 1 16  ? -52.867 63.472 378.478 1.00 48.04  ? 17   LEU B CD2 1 
ATOM   4248 N N   . ARG B 1 17  ? -52.969 60.611 382.512 1.00 38.10  ? 18   ARG B N   1 
ATOM   4249 C CA  A ARG B 1 17  ? -52.996 59.440 383.381 0.50 46.41  ? 18   ARG B CA  1 
ATOM   4250 C CA  B ARG B 1 17  ? -52.997 59.440 383.381 0.50 45.28  ? 18   ARG B CA  1 
ATOM   4251 C C   . ARG B 1 17  ? -53.363 58.225 382.545 1.00 42.52  ? 18   ARG B C   1 
ATOM   4252 O O   . ARG B 1 17  ? -54.459 58.166 381.980 1.00 42.64  ? 18   ARG B O   1 
ATOM   4253 C CB  A ARG B 1 17  ? -53.992 59.622 384.530 0.50 48.16  ? 18   ARG B CB  1 
ATOM   4254 C CB  B ARG B 1 17  ? -53.994 59.624 384.529 0.50 46.22  ? 18   ARG B CB  1 
ATOM   4255 C CG  A ARG B 1 17  ? -54.284 58.346 385.305 0.50 51.95  ? 18   ARG B CG  1 
ATOM   4256 C CG  B ARG B 1 17  ? -53.953 58.512 385.566 0.50 53.45  ? 18   ARG B CG  1 
ATOM   4257 C CD  A ARG B 1 17  ? -55.022 58.644 386.603 0.50 60.97  ? 18   ARG B CD  1 
ATOM   4258 C CD  B ARG B 1 17  ? -55.102 58.632 386.560 0.50 61.29  ? 18   ARG B CD  1 
ATOM   4259 N NE  A ARG B 1 17  ? -56.031 59.685 386.427 0.50 58.75  ? 18   ARG B NE  1 
ATOM   4260 N NE  B ARG B 1 17  ? -55.295 60.005 387.020 0.50 56.92  ? 18   ARG B NE  1 
ATOM   4261 C CZ  A ARG B 1 17  ? -57.274 59.459 386.015 0.50 48.37  ? 18   ARG B CZ  1 
ATOM   4262 C CZ  B ARG B 1 17  ? -54.580 60.579 387.982 0.50 45.80  ? 18   ARG B CZ  1 
ATOM   4263 N NH1 A ARG B 1 17  ? -57.668 58.224 385.735 0.50 44.79  ? 18   ARG B NH1 1 
ATOM   4264 N NH1 B ARG B 1 17  ? -53.621 59.898 388.594 0.50 51.66  ? 18   ARG B NH1 1 
ATOM   4265 N NH2 A ARG B 1 17  ? -58.123 60.468 385.882 0.50 48.97  ? 18   ARG B NH2 1 
ATOM   4266 N NH2 B ARG B 1 17  ? -54.826 61.833 388.335 0.50 41.02  ? 18   ARG B NH2 1 
ATOM   4267 N N   . GLY B 1 18  ? -52.449 57.257 382.468 1.00 36.81  ? 19   GLY B N   1 
ATOM   4268 C CA  . GLY B 1 18  ? -52.652 56.060 381.684 1.00 41.24  ? 19   GLY B CA  1 
ATOM   4269 C C   . GLY B 1 18  ? -53.183 54.897 382.505 1.00 46.97  ? 19   GLY B C   1 
ATOM   4270 O O   . GLY B 1 18  ? -53.636 55.044 383.642 1.00 44.93  ? 19   GLY B O   1 
ATOM   4271 N N   . ILE B 1 19  ? -53.118 53.713 381.901 1.00 43.55  ? 20   ILE B N   1 
ATOM   4272 C CA  . ILE B 1 19  ? -53.613 52.487 382.513 1.00 38.27  ? 20   ILE B CA  1 
ATOM   4273 C C   . ILE B 1 19  ? -52.626 51.366 382.220 1.00 52.01  ? 20   ILE B C   1 
ATOM   4274 O O   . ILE B 1 19  ? -52.003 51.334 381.152 1.00 52.34  ? 20   ILE B O   1 
ATOM   4275 C CB  . ILE B 1 19  ? -55.030 52.132 382.010 1.00 47.17  ? 20   ILE B CB  1 
ATOM   4276 C CG1 . ILE B 1 19  ? -55.571 50.892 382.728 1.00 45.31  ? 20   ILE B CG1 1 
ATOM   4277 C CG2 . ILE B 1 19  ? -55.042 51.931 380.490 1.00 42.40  ? 20   ILE B CG2 1 
ATOM   4278 C CD1 . ILE B 1 19  ? -56.945 50.458 382.250 1.00 44.51  ? 20   ILE B CD1 1 
ATOM   4279 N N   . ARG B 1 20  ? -52.471 50.457 383.178 1.00 45.79  ? 21   ARG B N   1 
ATOM   4280 C CA  . ARG B 1 20  ? -51.614 49.290 383.020 1.00 43.90  ? 21   ARG B CA  1 
ATOM   4281 C C   . ARG B 1 20  ? -52.435 48.131 382.466 1.00 45.84  ? 21   ARG B C   1 
ATOM   4282 O O   . ARG B 1 20  ? -53.477 47.778 383.028 1.00 53.71  ? 21   ARG B O   1 
ATOM   4283 C CB  . ARG B 1 20  ? -50.979 48.913 384.360 1.00 41.73  ? 21   ARG B CB  1 
ATOM   4284 C CG  . ARG B 1 20  ? -49.997 47.757 384.294 1.00 54.35  ? 21   ARG B CG  1 
ATOM   4285 C CD  . ARG B 1 20  ? -49.255 47.582 385.616 1.00 60.24  ? 21   ARG B CD  1 
ATOM   4286 N NE  . ARG B 1 20  ? -50.135 47.744 386.771 1.00 52.21  ? 21   ARG B NE  1 
ATOM   4287 C CZ  . ARG B 1 20  ? -50.932 46.793 387.249 1.00 67.08  ? 21   ARG B CZ  1 
ATOM   4288 N NH1 . ARG B 1 20  ? -50.967 45.596 386.676 1.00 62.43  ? 21   ARG B NH1 1 
ATOM   4289 N NH2 . ARG B 1 20  ? -51.698 47.040 388.303 1.00 66.31  ? 21   ARG B NH2 1 
ATOM   4290 N N   . LEU B 1 21  ? -51.975 47.555 381.360 1.00 38.08  ? 22   LEU B N   1 
ATOM   4291 C CA  . LEU B 1 21  ? -52.648 46.443 380.703 1.00 40.77  ? 22   LEU B CA  1 
ATOM   4292 C C   . LEU B 1 21  ? -51.844 45.164 380.884 1.00 40.72  ? 22   LEU B C   1 
ATOM   4293 O O   . LEU B 1 21  ? -50.634 45.195 381.122 1.00 46.25  ? 22   LEU B O   1 
ATOM   4294 C CB  . LEU B 1 21  ? -52.836 46.720 379.206 1.00 44.97  ? 22   LEU B CB  1 
ATOM   4295 C CG  . LEU B 1 21  ? -53.613 47.975 378.815 1.00 46.95  ? 22   LEU B CG  1 
ATOM   4296 C CD1 . LEU B 1 21  ? -53.685 48.091 377.304 1.00 48.92  ? 22   LEU B CD1 1 
ATOM   4297 C CD2 . LEU B 1 21  ? -55.004 47.952 379.417 1.00 37.83  ? 22   LEU B CD2 1 
ATOM   4298 N N   . LYS B 1 22  ? -52.523 44.029 380.745 1.00 47.59  ? 23   LYS B N   1 
ATOM   4299 C CA  . LYS B 1 22  ? -51.885 42.726 380.874 1.00 55.30  ? 23   LYS B CA  1 
ATOM   4300 C C   . LYS B 1 22  ? -51.804 42.010 379.539 1.00 46.15  ? 23   LYS B C   1 
ATOM   4301 O O   . LYS B 1 22  ? -52.738 42.059 378.732 1.00 48.99  ? 23   LYS B O   1 
ATOM   4302 C CB  . LYS B 1 22  ? -52.633 41.833 381.847 1.00 50.45  ? 23   LYS B CB  1 
ATOM   4303 C CG  . LYS B 1 22  ? -53.000 42.536 383.095 1.00 63.33  ? 23   LYS B CG  1 
ATOM   4304 C CD  . LYS B 1 22  ? -54.238 41.920 383.675 1.00 72.20  ? 23   LYS B CD  1 
ATOM   4305 C CE  . LYS B 1 22  ? -54.244 40.394 383.599 1.00 70.27  ? 23   LYS B CE  1 
ATOM   4306 N NZ  . LYS B 1 22  ? -55.629 39.855 383.685 1.00 78.43  ? 23   LYS B NZ  1 
ATOM   4307 N N   . THR B 1 23  ? -50.688 41.331 379.335 1.00 39.01  ? 24   THR B N   1 
ATOM   4308 C CA  . THR B 1 23  ? -50.453 40.432 378.221 1.00 45.93  ? 24   THR B CA  1 
ATOM   4309 C C   . THR B 1 23  ? -49.902 39.136 378.789 1.00 53.21  ? 24   THR B C   1 
ATOM   4310 O O   . THR B 1 23  ? -49.419 39.104 379.927 1.00 45.39  ? 24   THR B O   1 
ATOM   4311 C CB  . THR B 1 23  ? -49.462 41.021 377.203 1.00 40.27  ? 24   THR B CB  1 
ATOM   4312 O OG1 . THR B 1 23  ? -48.120 40.812 377.660 1.00 42.19  ? 24   THR B OG1 1 
ATOM   4313 C CG2 . THR B 1 23  ? -49.702 42.509 377.001 1.00 38.99  ? 24   THR B CG2 1 
ATOM   4314 N N   . PRO B 1 24  ? -49.975 38.041 378.029 1.00 48.81  ? 25   PRO B N   1 
ATOM   4315 C CA  . PRO B 1 24  ? -49.371 36.785 378.504 1.00 50.01  ? 25   PRO B CA  1 
ATOM   4316 C C   . PRO B 1 24  ? -47.884 36.891 378.795 1.00 47.93  ? 25   PRO B C   1 
ATOM   4317 O O   . PRO B 1 24  ? -47.369 36.100 379.595 1.00 64.11  ? 25   PRO B O   1 
ATOM   4318 C CB  . PRO B 1 24  ? -49.646 35.809 377.353 1.00 54.17  ? 25   PRO B CB  1 
ATOM   4319 C CG  . PRO B 1 24  ? -50.850 36.358 376.679 1.00 48.78  ? 25   PRO B CG  1 
ATOM   4320 C CD  . PRO B 1 24  ? -50.756 37.849 376.795 1.00 47.34  ? 25   PRO B CD  1 
ATOM   4321 N N   . GLY B 1 25  ? -47.177 37.834 378.177 1.00 51.17  ? 26   GLY B N   1 
ATOM   4322 C CA  . GLY B 1 25  ? -45.766 38.034 378.423 1.00 52.70  ? 26   GLY B CA  1 
ATOM   4323 C C   . GLY B 1 25  ? -45.429 39.104 379.436 1.00 51.58  ? 26   GLY B C   1 
ATOM   4324 O O   . GLY B 1 25  ? -44.246 39.400 379.634 1.00 40.56  ? 26   GLY B O   1 
ATOM   4325 N N   . GLY B 1 26  ? -46.426 39.697 380.087 1.00 40.31  ? 27   GLY B N   1 
ATOM   4326 C CA  . GLY B 1 26  ? -46.183 40.760 381.032 1.00 44.31  ? 27   GLY B CA  1 
ATOM   4327 C C   . GLY B 1 26  ? -47.012 41.999 380.757 1.00 43.53  ? 27   GLY B C   1 
ATOM   4328 O O   . GLY B 1 26  ? -47.782 42.067 379.794 1.00 43.77  ? 27   GLY B O   1 
ATOM   4329 N N   . PRO B 1 27  ? -46.864 43.009 381.609 1.00 47.43  ? 28   PRO B N   1 
ATOM   4330 C CA  . PRO B 1 27  ? -47.659 44.231 381.476 1.00 34.67  ? 28   PRO B CA  1 
ATOM   4331 C C   . PRO B 1 27  ? -47.055 45.226 380.492 1.00 41.33  ? 28   PRO B C   1 
ATOM   4332 O O   . PRO B 1 27  ? -45.862 45.202 380.185 1.00 41.85  ? 28   PRO B O   1 
ATOM   4333 C CB  . PRO B 1 27  ? -47.640 44.799 382.902 1.00 38.82  ? 28   PRO B CB  1 
ATOM   4334 C CG  . PRO B 1 27  ? -46.302 44.381 383.420 1.00 38.11  ? 28   PRO B CG  1 
ATOM   4335 C CD  . PRO B 1 27  ? -46.037 43.015 382.830 1.00 38.27  ? 28   PRO B CD  1 
ATOM   4336 N N   . VAL B 1 28  ? -47.923 46.104 379.984 1.00 32.18  ? 29   VAL B N   1 
ATOM   4337 C CA  . VAL B 1 28  ? -47.516 47.238 379.166 1.00 33.02  ? 29   VAL B CA  1 
ATOM   4338 C C   . VAL B 1 28  ? -48.272 48.465 379.655 1.00 36.37  ? 29   VAL B C   1 
ATOM   4339 O O   . VAL B 1 28  ? -49.324 48.364 380.289 1.00 42.87  ? 29   VAL B O   1 
ATOM   4340 C CB  . VAL B 1 28  ? -47.765 47.023 377.647 1.00 39.74  ? 29   VAL B CB  1 
ATOM   4341 C CG1 . VAL B 1 28  ? -47.225 45.678 377.181 1.00 28.18  ? 29   VAL B CG1 1 
ATOM   4342 C CG2 . VAL B 1 28  ? -49.240 47.159 377.311 1.00 27.19  ? 29   VAL B CG2 1 
ATOM   4343 N N   . SER B 1 29  ? -47.717 49.636 379.352 1.00 40.36  ? 30   SER B N   1 
ATOM   4344 C CA  . SER B 1 29  ? -48.339 50.913 379.681 1.00 30.90  ? 30   SER B CA  1 
ATOM   4345 C C   . SER B 1 29  ? -49.110 51.422 378.471 1.00 42.19  ? 30   SER B C   1 
ATOM   4346 O O   . SER B 1 29  ? -48.597 51.392 377.348 1.00 38.54  ? 30   SER B O   1 
ATOM   4347 C CB  . SER B 1 29  ? -47.288 51.942 380.099 1.00 35.09  ? 30   SER B CB  1 
ATOM   4348 O OG  . SER B 1 29  ? -46.589 51.524 381.256 1.00 59.48  ? 30   SER B OG  1 
ATOM   4349 N N   . ALA B 1 30  ? -50.331 51.899 378.701 1.00 42.19  ? 31   ALA B N   1 
ATOM   4350 C CA  . ALA B 1 30  ? -51.187 52.395 377.633 1.00 37.42  ? 31   ALA B CA  1 
ATOM   4351 C C   . ALA B 1 30  ? -51.737 53.765 377.994 1.00 38.31  ? 31   ALA B C   1 
ATOM   4352 O O   . ALA B 1 30  ? -52.097 54.020 379.147 1.00 41.27  ? 31   ALA B O   1 
ATOM   4353 C CB  . ALA B 1 30  ? -52.345 51.434 377.351 1.00 36.12  ? 31   ALA B CB  1 
ATOM   4354 N N   . PHE B 1 31  ? -51.801 54.643 376.996 1.00 34.32  ? 32   PHE B N   1 
ATOM   4355 C CA  . PHE B 1 31  ? -52.349 55.990 377.145 1.00 31.28  ? 32   PHE B CA  1 
ATOM   4356 C C   . PHE B 1 31  ? -53.324 56.184 375.990 1.00 37.51  ? 32   PHE B C   1 
ATOM   4357 O O   . PHE B 1 31  ? -52.908 56.425 374.852 1.00 37.57  ? 32   PHE B O   1 
ATOM   4358 C CB  . PHE B 1 31  ? -51.241 57.041 377.150 1.00 32.17  ? 32   PHE B CB  1 
ATOM   4359 C CG  . PHE B 1 31  ? -50.251 56.862 378.270 1.00 36.66  ? 32   PHE B CG  1 
ATOM   4360 C CD1 . PHE B 1 31  ? -49.184 55.985 378.140 1.00 38.69  ? 32   PHE B CD1 1 
ATOM   4361 C CD2 . PHE B 1 31  ? -50.396 57.558 379.458 1.00 39.40  ? 32   PHE B CD2 1 
ATOM   4362 C CE1 . PHE B 1 31  ? -48.279 55.809 379.170 1.00 35.06  ? 32   PHE B CE1 1 
ATOM   4363 C CE2 . PHE B 1 31  ? -49.492 57.388 380.495 1.00 45.56  ? 32   PHE B CE2 1 
ATOM   4364 C CZ  . PHE B 1 31  ? -48.433 56.511 380.350 1.00 37.62  ? 32   PHE B CZ  1 
ATOM   4365 N N   . LEU B 1 32  ? -54.616 56.056 376.282 1.00 33.30  ? 33   LEU B N   1 
ATOM   4366 C CA  . LEU B 1 32  ? -55.659 55.998 375.269 1.00 37.89  ? 33   LEU B CA  1 
ATOM   4367 C C   . LEU B 1 32  ? -56.543 57.233 375.347 1.00 35.74  ? 33   LEU B C   1 
ATOM   4368 O O   . LEU B 1 32  ? -56.903 57.680 376.437 1.00 39.91  ? 33   LEU B O   1 
ATOM   4369 C CB  . LEU B 1 32  ? -56.515 54.740 375.443 1.00 35.85  ? 33   LEU B CB  1 
ATOM   4370 C CG  . LEU B 1 32  ? -55.733 53.457 375.726 1.00 37.30  ? 33   LEU B CG  1 
ATOM   4371 C CD1 . LEU B 1 32  ? -56.678 52.320 376.079 1.00 37.15  ? 33   LEU B CD1 1 
ATOM   4372 C CD2 . LEU B 1 32  ? -54.861 53.088 374.531 1.00 38.88  ? 33   LEU B CD2 1 
ATOM   4373 N N   . GLY B 1 33  ? -56.901 57.776 374.189 1.00 36.06  ? 34   GLY B N   1 
ATOM   4374 C CA  . GLY B 1 33  ? -57.762 58.940 374.165 1.00 30.33  ? 34   GLY B CA  1 
ATOM   4375 C C   . GLY B 1 33  ? -57.057 60.249 374.433 1.00 38.62  ? 34   GLY B C   1 
ATOM   4376 O O   . GLY B 1 33  ? -57.662 61.163 375.001 1.00 44.16  ? 34   GLY B O   1 
ATOM   4377 N N   . ILE B 1 34  ? -55.793 60.363 374.048 1.00 38.63  ? 35   ILE B N   1 
ATOM   4378 C CA  . ILE B 1 34  ? -55.068 61.633 374.175 1.00 31.31  ? 35   ILE B CA  1 
ATOM   4379 C C   . ILE B 1 34  ? -55.555 62.596 373.098 1.00 34.40  ? 35   ILE B C   1 
ATOM   4380 O O   . ILE B 1 34  ? -55.474 62.269 371.901 1.00 37.33  ? 35   ILE B O   1 
ATOM   4381 C CB  . ILE B 1 34  ? -53.562 61.400 374.047 1.00 31.51  ? 35   ILE B CB  1 
ATOM   4382 C CG1 . ILE B 1 34  ? -53.098 60.308 375.012 1.00 31.43  ? 35   ILE B CG1 1 
ATOM   4383 C CG2 . ILE B 1 34  ? -52.804 62.703 374.261 1.00 28.87  ? 35   ILE B CG2 1 
ATOM   4384 C CD1 . ILE B 1 34  ? -51.664 59.879 374.790 1.00 35.06  ? 35   ILE B CD1 1 
ATOM   4385 N N   . PRO B 1 35  ? -56.045 63.783 373.453 1.00 39.81  ? 36   PRO B N   1 
ATOM   4386 C CA  . PRO B 1 35  ? -56.451 64.752 372.423 1.00 29.86  ? 36   PRO B CA  1 
ATOM   4387 C C   . PRO B 1 35  ? -55.235 65.407 371.782 1.00 39.67  ? 36   PRO B C   1 
ATOM   4388 O O   . PRO B 1 35  ? -54.363 65.935 372.474 1.00 37.49  ? 36   PRO B O   1 
ATOM   4389 C CB  . PRO B 1 35  ? -57.289 65.771 373.203 1.00 35.22  ? 36   PRO B CB  1 
ATOM   4390 C CG  . PRO B 1 35  ? -56.749 65.700 374.603 1.00 38.57  ? 36   PRO B CG  1 
ATOM   4391 C CD  . PRO B 1 35  ? -56.311 64.271 374.820 1.00 35.79  ? 36   PRO B CD  1 
ATOM   4392 N N   . PHE B 1 36  ? -55.176 65.362 370.449 1.00 37.09  ? 37   PHE B N   1 
ATOM   4393 C CA  . PHE B 1 36  ? -54.115 66.026 369.705 1.00 38.36  ? 37   PHE B CA  1 
ATOM   4394 C C   . PHE B 1 36  ? -54.625 67.178 368.852 1.00 33.85  ? 37   PHE B C   1 
ATOM   4395 O O   . PHE B 1 36  ? -53.818 67.869 368.223 1.00 41.24  ? 37   PHE B O   1 
ATOM   4396 C CB  . PHE B 1 36  ? -53.348 65.015 368.833 1.00 34.34  ? 37   PHE B CB  1 
ATOM   4397 C CG  . PHE B 1 36  ? -54.090 64.566 367.599 1.00 37.59  ? 37   PHE B CG  1 
ATOM   4398 C CD1 . PHE B 1 36  ? -53.901 65.212 366.387 1.00 30.92  ? 37   PHE B CD1 1 
ATOM   4399 C CD2 . PHE B 1 36  ? -54.941 63.471 367.642 1.00 36.17  ? 37   PHE B CD2 1 
ATOM   4400 C CE1 . PHE B 1 36  ? -54.569 64.799 365.248 1.00 36.81  ? 37   PHE B CE1 1 
ATOM   4401 C CE2 . PHE B 1 36  ? -55.610 63.047 366.503 1.00 32.49  ? 37   PHE B CE2 1 
ATOM   4402 C CZ  . PHE B 1 36  ? -55.423 63.714 365.304 1.00 35.59  ? 37   PHE B CZ  1 
ATOM   4403 N N   . ALA B 1 37  ? -55.934 67.416 368.828 1.00 33.46  ? 38   ALA B N   1 
ATOM   4404 C CA  . ALA B 1 37  ? -56.495 68.511 368.053 1.00 33.68  ? 38   ALA B CA  1 
ATOM   4405 C C   . ALA B 1 37  ? -57.724 69.054 368.763 1.00 39.15  ? 38   ALA B C   1 
ATOM   4406 O O   . ALA B 1 37  ? -58.337 68.377 369.592 1.00 38.19  ? 38   ALA B O   1 
ATOM   4407 C CB  . ALA B 1 37  ? -56.865 68.068 366.631 1.00 31.77  ? 38   ALA B CB  1 
ATOM   4408 N N   . GLU B 1 38  ? -58.078 70.291 368.422 1.00 42.75  ? 39   GLU B N   1 
ATOM   4409 C CA  . GLU B 1 38  ? -59.347 70.848 368.869 1.00 47.55  ? 39   GLU B CA  1 
ATOM   4410 C C   . GLU B 1 38  ? -60.499 70.136 368.161 1.00 50.90  ? 39   GLU B C   1 
ATOM   4411 O O   . GLU B 1 38  ? -60.386 69.803 366.975 1.00 46.04  ? 39   GLU B O   1 
ATOM   4412 C CB  . GLU B 1 38  ? -59.408 72.349 368.584 1.00 46.50  ? 39   GLU B CB  1 
ATOM   4413 C CG  . GLU B 1 38  ? -58.518 73.188 369.490 1.00 56.58  ? 39   GLU B CG  1 
ATOM   4414 C CD  . GLU B 1 38  ? -58.977 73.167 370.938 1.00 64.45  ? 39   GLU B CD  1 
ATOM   4415 O OE1 . GLU B 1 38  ? -60.165 73.460 371.192 1.00 70.20  ? 39   GLU B OE1 1 
ATOM   4416 O OE2 . GLU B 1 38  ? -58.152 72.849 371.822 1.00 53.61  ? 39   GLU B OE2 1 
ATOM   4417 N N   . PRO B 1 39  ? -61.607 69.884 368.854 1.00 52.64  ? 40   PRO B N   1 
ATOM   4418 C CA  . PRO B 1 39  ? -62.730 69.153 368.243 1.00 43.43  ? 40   PRO B CA  1 
ATOM   4419 C C   . PRO B 1 39  ? -63.225 69.843 366.985 1.00 47.52  ? 40   PRO B C   1 
ATOM   4420 O O   . PRO B 1 39  ? -63.624 71.017 367.020 1.00 46.40  ? 40   PRO B O   1 
ATOM   4421 C CB  . PRO B 1 39  ? -63.798 69.165 369.346 1.00 43.82  ? 40   PRO B CB  1 
ATOM   4422 C CG  . PRO B 1 39  ? -63.009 69.267 370.620 1.00 49.21  ? 40   PRO B CG  1 
ATOM   4423 C CD  . PRO B 1 39  ? -61.817 70.128 370.293 1.00 44.18  ? 40   PRO B CD  1 
ATOM   4424 N N   . PRO B 1 40  ? -63.212 69.142 365.847 1.00 46.35  ? 41   PRO B N   1 
ATOM   4425 C CA  . PRO B 1 40  ? -63.621 69.728 364.553 1.00 46.42  ? 41   PRO B CA  1 
ATOM   4426 C C   . PRO B 1 40  ? -65.135 69.718 364.371 1.00 50.47  ? 41   PRO B C   1 
ATOM   4427 O O   . PRO B 1 40  ? -65.700 69.038 363.511 1.00 49.65  ? 41   PRO B O   1 
ATOM   4428 C CB  . PRO B 1 40  ? -62.901 68.824 363.550 1.00 45.26  ? 41   PRO B CB  1 
ATOM   4429 C CG  . PRO B 1 40  ? -62.925 67.483 364.218 1.00 43.29  ? 41   PRO B CG  1 
ATOM   4430 C CD  . PRO B 1 40  ? -62.761 67.748 365.698 1.00 32.21  ? 41   PRO B CD  1 
ATOM   4431 N N   . MET B 1 41  ? -65.825 70.493 365.200 1.00 52.76  ? 42   MET B N   1 
ATOM   4432 C CA  . MET B 1 41  ? -67.278 70.534 365.201 1.00 54.34  ? 42   MET B CA  1 
ATOM   4433 C C   . MET B 1 41  ? -67.767 71.935 364.862 1.00 57.17  ? 42   MET B C   1 
ATOM   4434 O O   . MET B 1 41  ? -67.009 72.909 364.884 1.00 55.77  ? 42   MET B O   1 
ATOM   4435 C CB  . MET B 1 41  ? -67.839 70.090 366.557 1.00 60.08  ? 42   MET B CB  1 
ATOM   4436 C CG  . MET B 1 41  ? -67.044 68.977 367.209 1.00 49.72  ? 42   MET B CG  1 
ATOM   4437 S SD  . MET B 1 41  ? -67.832 68.350 368.699 1.00 88.97  ? 42   MET B SD  1 
ATOM   4438 C CE  . MET B 1 41  ? -69.264 67.531 368.002 1.00 65.18  ? 42   MET B CE  1 
ATOM   4439 N N   . GLY B 1 42  ? -69.059 72.020 364.545 1.00 48.29  ? 43   GLY B N   1 
ATOM   4440 C CA  . GLY B 1 42  ? -69.691 73.276 364.225 1.00 43.83  ? 43   GLY B CA  1 
ATOM   4441 C C   . GLY B 1 42  ? -69.039 73.962 363.044 1.00 56.13  ? 43   GLY B C   1 
ATOM   4442 O O   . GLY B 1 42  ? -68.979 73.422 361.934 1.00 43.49  ? 43   GLY B O   1 
ATOM   4443 N N   . PRO B 1 43  ? -68.522 75.174 363.266 1.00 54.14  ? 44   PRO B N   1 
ATOM   4444 C CA  . PRO B 1 43  ? -67.871 75.909 362.171 1.00 49.00  ? 44   PRO B CA  1 
ATOM   4445 C C   . PRO B 1 43  ? -66.541 75.314 361.745 1.00 49.18  ? 44   PRO B C   1 
ATOM   4446 O O   . PRO B 1 43  ? -65.996 75.739 360.718 1.00 49.93  ? 44   PRO B O   1 
ATOM   4447 C CB  . PRO B 1 43  ? -67.689 77.316 362.756 1.00 46.04  ? 44   PRO B CB  1 
ATOM   4448 C CG  . PRO B 1 43  ? -67.587 77.086 364.229 1.00 45.81  ? 44   PRO B CG  1 
ATOM   4449 C CD  . PRO B 1 43  ? -68.513 75.934 364.529 1.00 40.58  ? 44   PRO B CD  1 
ATOM   4450 N N   . ARG B 1 44  ? -66.007 74.348 362.487 1.00 51.77  ? 45   ARG B N   1 
ATOM   4451 C CA  . ARG B 1 44  ? -64.734 73.720 362.161 1.00 62.52  ? 45   ARG B CA  1 
ATOM   4452 C C   . ARG B 1 44  ? -64.891 72.440 361.354 1.00 54.60  ? 45   ARG B C   1 
ATOM   4453 O O   . ARG B 1 44  ? -63.885 71.802 361.025 1.00 45.41  ? 45   ARG B O   1 
ATOM   4454 C CB  . ARG B 1 44  ? -63.954 73.433 363.443 1.00 46.52  ? 45   ARG B CB  1 
ATOM   4455 C CG  . ARG B 1 44  ? -63.550 74.694 364.169 1.00 72.67  ? 45   ARG B CG  1 
ATOM   4456 C CD  . ARG B 1 44  ? -62.048 74.903 364.119 1.00 87.36  ? 45   ARG B CD  1 
ATOM   4457 N NE  . ARG B 1 44  ? -61.591 75.813 365.166 1.00 102.11 ? 45   ARG B NE  1 
ATOM   4458 C CZ  . ARG B 1 44  ? -61.682 75.576 366.473 1.00 92.06  ? 45   ARG B CZ  1 
ATOM   4459 N NH1 . ARG B 1 44  ? -62.194 74.438 366.924 1.00 88.40  ? 45   ARG B NH1 1 
ATOM   4460 N NH2 . ARG B 1 44  ? -61.232 76.478 367.335 1.00 97.62  ? 45   ARG B NH2 1 
ATOM   4461 N N   . ARG B 1 45  ? -66.122 72.043 361.042 1.00 47.76  ? 46   ARG B N   1 
ATOM   4462 C CA  . ARG B 1 45  ? -66.335 70.928 360.134 1.00 49.28  ? 46   ARG B CA  1 
ATOM   4463 C C   . ARG B 1 45  ? -65.767 71.270 358.760 1.00 40.05  ? 46   ARG B C   1 
ATOM   4464 O O   . ARG B 1 45  ? -65.864 72.411 358.302 1.00 46.55  ? 46   ARG B O   1 
ATOM   4465 C CB  . ARG B 1 45  ? -67.826 70.607 360.038 1.00 44.27  ? 46   ARG B CB  1 
ATOM   4466 C CG  . ARG B 1 45  ? -68.160 69.422 359.151 1.00 46.47  ? 46   ARG B CG  1 
ATOM   4467 C CD  . ARG B 1 45  ? -69.660 69.269 358.988 1.00 43.65  ? 46   ARG B CD  1 
ATOM   4468 N NE  . ARG B 1 45  ? -70.278 68.596 360.126 1.00 45.97  ? 46   ARG B NE  1 
ATOM   4469 C CZ  . ARG B 1 45  ? -71.583 68.363 360.232 1.00 43.06  ? 46   ARG B CZ  1 
ATOM   4470 N NH1 . ARG B 1 45  ? -72.407 68.751 359.268 1.00 44.92  ? 46   ARG B NH1 1 
ATOM   4471 N NH2 . ARG B 1 45  ? -72.065 67.741 361.299 1.00 37.01  ? 46   ARG B NH2 1 
ATOM   4472 N N   . PHE B 1 46  ? -65.142 70.278 358.122 1.00 33.89  ? 47   PHE B N   1 
ATOM   4473 C CA  . PHE B 1 46  ? -64.485 70.364 356.817 1.00 43.17  ? 47   PHE B CA  1 
ATOM   4474 C C   . PHE B 1 46  ? -63.211 71.203 356.840 1.00 44.28  ? 47   PHE B C   1 
ATOM   4475 O O   . PHE B 1 46  ? -62.574 71.358 355.791 1.00 41.16  ? 47   PHE B O   1 
ATOM   4476 C CB  . PHE B 1 46  ? -65.415 70.918 355.724 1.00 29.91  ? 47   PHE B CB  1 
ATOM   4477 C CG  . PHE B 1 46  ? -66.742 70.220 355.650 1.00 33.39  ? 47   PHE B CG  1 
ATOM   4478 C CD1 . PHE B 1 46  ? -66.809 68.840 355.556 1.00 29.60  ? 47   PHE B CD1 1 
ATOM   4479 C CD2 . PHE B 1 46  ? -67.925 70.943 355.697 1.00 40.51  ? 47   PHE B CD2 1 
ATOM   4480 C CE1 . PHE B 1 46  ? -68.030 68.191 355.494 1.00 35.26  ? 47   PHE B CE1 1 
ATOM   4481 C CE2 . PHE B 1 46  ? -69.152 70.301 355.637 1.00 34.19  ? 47   PHE B CE2 1 
ATOM   4482 C CZ  . PHE B 1 46  ? -69.204 68.924 355.535 1.00 39.94  ? 47   PHE B CZ  1 
ATOM   4483 N N   . LEU B 1 47  ? -62.810 71.744 357.991 1.00 34.28  ? 48   LEU B N   1 
ATOM   4484 C CA  . LEU B 1 47  ? -61.646 72.611 358.090 1.00 44.54  ? 48   LEU B CA  1 
ATOM   4485 C C   . LEU B 1 47  ? -60.425 71.840 358.572 1.00 43.94  ? 48   LEU B C   1 
ATOM   4486 O O   . LEU B 1 47  ? -60.548 70.798 359.225 1.00 38.16  ? 48   LEU B O   1 
ATOM   4487 C CB  . LEU B 1 47  ? -61.929 73.775 359.048 1.00 48.33  ? 48   LEU B CB  1 
ATOM   4488 C CG  . LEU B 1 47  ? -62.777 74.922 358.498 1.00 54.60  ? 48   LEU B CG  1 
ATOM   4489 C CD1 . LEU B 1 47  ? -62.771 76.094 359.467 1.00 46.93  ? 48   LEU B CD1 1 
ATOM   4490 C CD2 . LEU B 1 47  ? -62.279 75.353 357.130 1.00 38.43  ? 48   LEU B CD2 1 
ATOM   4491 N N   . PRO B 1 48  ? -59.225 72.326 358.256 1.00 41.98  ? 49   PRO B N   1 
ATOM   4492 C CA  . PRO B 1 48  ? -58.019 71.653 358.730 1.00 37.41  ? 49   PRO B CA  1 
ATOM   4493 C C   . PRO B 1 48  ? -57.979 71.613 360.243 1.00 47.14  ? 49   PRO B C   1 
ATOM   4494 O O   . PRO B 1 48  ? -58.568 72.474 360.924 1.00 47.03  ? 49   PRO B O   1 
ATOM   4495 C CB  . PRO B 1 48  ? -56.887 72.519 358.160 1.00 36.93  ? 49   PRO B CB  1 
ATOM   4496 C CG  . PRO B 1 48  ? -57.475 73.148 356.943 1.00 44.64  ? 49   PRO B CG  1 
ATOM   4497 C CD  . PRO B 1 48  ? -58.927 73.373 357.262 1.00 43.14  ? 49   PRO B CD  1 
ATOM   4498 N N   . PRO B 1 49  ? -57.290 70.630 360.818 1.00 41.34  ? 50   PRO B N   1 
ATOM   4499 C CA  . PRO B 1 49  ? -57.276 70.498 362.279 1.00 34.51  ? 50   PRO B CA  1 
ATOM   4500 C C   . PRO B 1 49  ? -56.420 71.570 362.934 1.00 45.27  ? 50   PRO B C   1 
ATOM   4501 O O   . PRO B 1 49  ? -55.364 71.951 362.423 1.00 47.42  ? 50   PRO B O   1 
ATOM   4502 C CB  . PRO B 1 49  ? -56.680 69.103 362.497 1.00 33.48  ? 50   PRO B CB  1 
ATOM   4503 C CG  . PRO B 1 49  ? -55.788 68.911 361.314 1.00 32.81  ? 50   PRO B CG  1 
ATOM   4504 C CD  . PRO B 1 49  ? -56.506 69.568 360.161 1.00 39.12  ? 50   PRO B CD  1 
ATOM   4505 N N   . GLU B 1 50  ? -56.888 72.051 364.083 1.00 44.56  ? 51   GLU B N   1 
ATOM   4506 C CA  . GLU B 1 50  ? -56.164 72.977 364.941 1.00 54.31  ? 51   GLU B CA  1 
ATOM   4507 C C   . GLU B 1 50  ? -55.493 72.221 366.077 1.00 46.69  ? 51   GLU B C   1 
ATOM   4508 O O   . GLU B 1 50  ? -56.085 71.289 366.636 1.00 47.73  ? 51   GLU B O   1 
ATOM   4509 C CB  . GLU B 1 50  ? -57.102 74.030 365.532 1.00 50.73  ? 51   GLU B CB  1 
ATOM   4510 C CG  . GLU B 1 50  ? -57.654 75.010 364.519 1.00 77.77  ? 51   GLU B CG  1 
ATOM   4511 C CD  . GLU B 1 50  ? -58.029 76.344 365.139 1.00 96.52  ? 51   GLU B CD  1 
ATOM   4512 O OE1 . GLU B 1 50  ? -57.164 77.242 365.203 1.00 107.45 ? 51   GLU B OE1 1 
ATOM   4513 O OE2 . GLU B 1 50  ? -59.194 76.501 365.555 1.00 92.73  ? 51   GLU B OE2 1 
ATOM   4514 N N   . PRO B 1 51  ? -54.266 72.584 366.441 1.00 45.86  ? 52   PRO B N   1 
ATOM   4515 C CA  . PRO B 1 51  ? -53.611 71.912 367.569 1.00 46.80  ? 52   PRO B CA  1 
ATOM   4516 C C   . PRO B 1 51  ? -54.424 72.065 368.845 1.00 46.19  ? 52   PRO B C   1 
ATOM   4517 O O   . PRO B 1 51  ? -55.066 73.092 369.080 1.00 42.47  ? 52   PRO B O   1 
ATOM   4518 C CB  . PRO B 1 51  ? -52.256 72.624 367.669 1.00 42.14  ? 52   PRO B CB  1 
ATOM   4519 C CG  . PRO B 1 51  ? -52.028 73.203 366.307 1.00 47.28  ? 52   PRO B CG  1 
ATOM   4520 C CD  . PRO B 1 51  ? -53.386 73.565 365.784 1.00 38.34  ? 52   PRO B CD  1 
ATOM   4521 N N   . LYS B 1 52  ? -54.414 71.013 369.660 1.00 43.82  ? 53   LYS B N   1 
ATOM   4522 C CA  . LYS B 1 52  ? -55.143 71.032 370.920 1.00 44.28  ? 53   LYS B CA  1 
ATOM   4523 C C   . LYS B 1 52  ? -54.541 72.070 371.857 1.00 44.37  ? 53   LYS B C   1 
ATOM   4524 O O   . LYS B 1 52  ? -53.332 72.072 372.103 1.00 44.66  ? 53   LYS B O   1 
ATOM   4525 C CB  . LYS B 1 52  ? -55.111 69.649 371.569 1.00 45.92  ? 53   LYS B CB  1 
ATOM   4526 C CG  . LYS B 1 52  ? -55.729 69.595 372.957 1.00 42.68  ? 53   LYS B CG  1 
ATOM   4527 C CD  . LYS B 1 52  ? -57.229 69.820 372.904 1.00 44.42  ? 53   LYS B CD  1 
ATOM   4528 C CE  . LYS B 1 52  ? -57.874 69.573 374.259 1.00 42.19  ? 53   LYS B CE  1 
ATOM   4529 N NZ  . LYS B 1 52  ? -59.359 69.683 374.192 1.00 49.40  ? 53   LYS B NZ  1 
ATOM   4530 N N   . GLN B 1 53  ? -55.388 72.958 372.369 1.00 41.68  ? 54   GLN B N   1 
ATOM   4531 C CA  . GLN B 1 53  ? -54.928 73.974 373.301 1.00 61.55  ? 54   GLN B CA  1 
ATOM   4532 C C   . GLN B 1 53  ? -54.546 73.336 374.639 1.00 54.18  ? 54   GLN B C   1 
ATOM   4533 O O   . GLN B 1 53  ? -55.134 72.329 375.045 1.00 47.96  ? 54   GLN B O   1 
ATOM   4534 C CB  . GLN B 1 53  ? -56.009 75.031 373.515 1.00 53.52  ? 54   GLN B CB  1 
ATOM   4535 C CG  . GLN B 1 53  ? -56.192 75.980 372.334 1.00 58.68  ? 54   GLN B CG  1 
ATOM   4536 C CD  . GLN B 1 53  ? -54.952 76.815 372.061 1.00 83.16  ? 54   GLN B CD  1 
ATOM   4537 O OE1 . GLN B 1 53  ? -54.240 76.589 371.082 1.00 67.58  ? 54   GLN B OE1 1 
ATOM   4538 N NE2 . GLN B 1 53  ? -54.690 77.786 372.930 1.00 84.54  ? 54   GLN B NE2 1 
ATOM   4539 N N   . PRO B 1 54  ? -53.555 73.898 375.334 1.00 51.84  ? 55   PRO B N   1 
ATOM   4540 C CA  . PRO B 1 54  ? -53.144 73.331 376.626 1.00 48.03  ? 55   PRO B CA  1 
ATOM   4541 C C   . PRO B 1 54  ? -54.292 73.287 377.625 1.00 49.65  ? 55   PRO B C   1 
ATOM   4542 O O   . PRO B 1 54  ? -55.196 74.125 377.610 1.00 51.11  ? 55   PRO B O   1 
ATOM   4543 C CB  . PRO B 1 54  ? -52.035 74.280 377.095 1.00 43.09  ? 55   PRO B CB  1 
ATOM   4544 C CG  . PRO B 1 54  ? -51.506 74.894 375.841 1.00 53.18  ? 55   PRO B CG  1 
ATOM   4545 C CD  . PRO B 1 54  ? -52.673 74.994 374.898 1.00 51.82  ? 55   PRO B CD  1 
ATOM   4546 N N   . TRP B 1 55  ? -54.243 72.289 378.503 1.00 41.22  ? 56   TRP B N   1 
ATOM   4547 C CA  . TRP B 1 55  ? -55.279 72.061 379.497 1.00 52.52  ? 56   TRP B CA  1 
ATOM   4548 C C   . TRP B 1 55  ? -54.677 72.028 380.896 1.00 51.87  ? 56   TRP B C   1 
ATOM   4549 O O   . TRP B 1 55  ? -53.498 71.707 381.079 1.00 41.17  ? 56   TRP B O   1 
ATOM   4550 C CB  . TRP B 1 55  ? -56.021 70.742 379.233 1.00 38.14  ? 56   TRP B CB  1 
ATOM   4551 C CG  . TRP B 1 55  ? -55.125 69.540 379.304 1.00 45.08  ? 56   TRP B CG  1 
ATOM   4552 C CD1 . TRP B 1 55  ? -54.802 68.821 380.418 1.00 39.07  ? 56   TRP B CD1 1 
ATOM   4553 C CD2 . TRP B 1 55  ? -54.428 68.922 378.213 1.00 42.41  ? 56   TRP B CD2 1 
ATOM   4554 N NE1 . TRP B 1 55  ? -53.950 67.795 380.091 1.00 42.72  ? 56   TRP B NE1 1 
ATOM   4555 C CE2 . TRP B 1 55  ? -53.705 67.834 378.743 1.00 44.58  ? 56   TRP B CE2 1 
ATOM   4556 C CE3 . TRP B 1 55  ? -54.347 69.182 376.841 1.00 38.38  ? 56   TRP B CE3 1 
ATOM   4557 C CZ2 . TRP B 1 55  ? -52.913 67.007 377.949 1.00 42.28  ? 56   TRP B CZ2 1 
ATOM   4558 C CZ3 . TRP B 1 55  ? -53.558 68.360 376.055 1.00 41.25  ? 56   TRP B CZ3 1 
ATOM   4559 C CH2 . TRP B 1 55  ? -52.852 67.286 376.611 1.00 40.97  ? 56   TRP B CH2 1 
ATOM   4560 N N   . SER B 1 56  ? -55.502 72.362 381.880 1.00 45.93  ? 57   SER B N   1 
ATOM   4561 C CA  . SER B 1 56  ? -55.155 72.203 383.283 1.00 56.12  ? 57   SER B CA  1 
ATOM   4562 C C   . SER B 1 56  ? -55.773 70.917 383.819 1.00 51.54  ? 57   SER B C   1 
ATOM   4563 O O   . SER B 1 56  ? -56.711 70.362 383.242 1.00 64.56  ? 57   SER B O   1 
ATOM   4564 C CB  . SER B 1 56  ? -55.628 73.405 384.105 1.00 46.80  ? 57   SER B CB  1 
ATOM   4565 O OG  . SER B 1 56  ? -57.023 73.605 383.960 1.00 60.59  ? 57   SER B OG  1 
ATOM   4566 N N   . GLY B 1 57  ? -55.234 70.446 384.933 1.00 53.58  ? 58   GLY B N   1 
ATOM   4567 C CA  . GLY B 1 57  ? -55.664 69.175 385.466 1.00 55.97  ? 58   GLY B CA  1 
ATOM   4568 C C   . GLY B 1 57  ? -55.032 68.015 384.720 1.00 57.63  ? 58   GLY B C   1 
ATOM   4569 O O   . GLY B 1 57  ? -54.080 68.167 383.950 1.00 55.50  ? 58   GLY B O   1 
ATOM   4570 N N   . VAL B 1 58  ? -55.585 66.829 384.956 1.00 46.11  ? 59   VAL B N   1 
ATOM   4571 C CA  . VAL B 1 58  ? -55.051 65.590 384.403 1.00 49.01  ? 59   VAL B CA  1 
ATOM   4572 C C   . VAL B 1 58  ? -56.092 64.983 383.475 1.00 55.52  ? 59   VAL B C   1 
ATOM   4573 O O   . VAL B 1 58  ? -57.201 64.648 383.909 1.00 58.00  ? 59   VAL B O   1 
ATOM   4574 C CB  . VAL B 1 58  ? -54.656 64.597 385.506 1.00 52.16  ? 59   VAL B CB  1 
ATOM   4575 C CG1 . VAL B 1 58  ? -53.702 63.550 384.952 1.00 49.46  ? 59   VAL B CG1 1 
ATOM   4576 C CG2 . VAL B 1 58  ? -54.023 65.333 386.678 1.00 42.60  ? 59   VAL B CG2 1 
ATOM   4577 N N   . VAL B 1 59  ? -55.732 64.839 382.200 1.00 50.06  ? 60   VAL B N   1 
ATOM   4578 C CA  . VAL B 1 59  ? -56.606 64.174 381.244 1.00 37.31  ? 60   VAL B CA  1 
ATOM   4579 C C   . VAL B 1 59  ? -56.617 62.680 381.536 1.00 48.18  ? 60   VAL B C   1 
ATOM   4580 O O   . VAL B 1 59  ? -55.561 62.056 381.717 1.00 42.13  ? 60   VAL B O   1 
ATOM   4581 C CB  . VAL B 1 59  ? -56.150 64.464 379.805 1.00 45.35  ? 60   VAL B CB  1 
ATOM   4582 C CG1 . VAL B 1 59  ? -56.661 63.394 378.853 1.00 45.88  ? 60   VAL B CG1 1 
ATOM   4583 C CG2 . VAL B 1 59  ? -56.625 65.839 379.363 1.00 43.37  ? 60   VAL B CG2 1 
ATOM   4584 N N   . ASP B 1 60  ? -57.813 62.100 381.602 1.00 41.43  ? 61   ASP B N   1 
ATOM   4585 C CA  . ASP B 1 60  ? -57.965 60.666 381.814 1.00 40.99  ? 61   ASP B CA  1 
ATOM   4586 C C   . ASP B 1 60  ? -57.660 59.941 380.508 1.00 47.22  ? 61   ASP B C   1 
ATOM   4587 O O   . ASP B 1 60  ? -58.425 60.035 379.544 1.00 44.69  ? 61   ASP B O   1 
ATOM   4588 C CB  . ASP B 1 60  ? -59.375 60.349 382.306 1.00 56.13  ? 61   ASP B CB  1 
ATOM   4589 C CG  . ASP B 1 60  ? -59.673 58.861 382.310 1.00 71.73  ? 61   ASP B CG  1 
ATOM   4590 O OD1 . ASP B 1 60  ? -58.768 58.071 382.653 1.00 72.46  ? 61   ASP B OD1 1 
ATOM   4591 O OD2 . ASP B 1 60  ? -60.814 58.481 381.974 1.00 83.56  ? 61   ASP B OD2 1 
ATOM   4592 N N   . ALA B 1 61  ? -56.543 59.218 380.471 1.00 43.07  ? 62   ALA B N   1 
ATOM   4593 C CA  . ALA B 1 61  ? -56.160 58.488 379.269 1.00 36.64  ? 62   ALA B CA  1 
ATOM   4594 C C   . ALA B 1 61  ? -56.191 56.984 379.511 1.00 38.54  ? 62   ALA B C   1 
ATOM   4595 O O   . ALA B 1 61  ? -55.209 56.286 379.241 1.00 38.10  ? 62   ALA B O   1 
ATOM   4596 C CB  . ALA B 1 61  ? -54.770 58.918 378.796 1.00 38.05  ? 62   ALA B CB  1 
ATOM   4597 N N   . THR B 1 62  ? -57.315 56.475 380.013 1.00 41.51  ? 63   THR B N   1 
ATOM   4598 C CA  . THR B 1 62  ? -57.429 55.073 380.380 1.00 40.32  ? 63   THR B CA  1 
ATOM   4599 C C   . THR B 1 62  ? -58.359 54.277 379.477 1.00 44.64  ? 63   THR B C   1 
ATOM   4600 O O   . THR B 1 62  ? -58.404 53.048 379.598 1.00 42.68  ? 63   THR B O   1 
ATOM   4601 C CB  . THR B 1 62  ? -57.909 54.937 381.834 1.00 48.08  ? 63   THR B CB  1 
ATOM   4602 O OG1 . THR B 1 62  ? -59.138 55.655 382.001 1.00 44.56  ? 63   THR B OG1 1 
ATOM   4603 C CG2 . THR B 1 62  ? -56.869 55.491 382.803 1.00 37.51  ? 63   THR B CG2 1 
ATOM   4604 N N   . THR B 1 63  ? -59.097 54.929 378.580 1.00 42.28  ? 64   THR B N   1 
ATOM   4605 C CA  . THR B 1 63  ? -59.988 54.213 377.681 1.00 50.21  ? 64   THR B CA  1 
ATOM   4606 C C   . THR B 1 63  ? -60.024 54.898 376.320 1.00 45.57  ? 64   THR B C   1 
ATOM   4607 O O   . THR B 1 63  ? -59.708 56.083 376.183 1.00 41.12  ? 64   THR B O   1 
ATOM   4608 C CB  . THR B 1 63  ? -61.404 54.105 378.266 1.00 48.31  ? 64   THR B CB  1 
ATOM   4609 O OG1 . THR B 1 63  ? -62.196 53.233 377.447 1.00 81.79  ? 64   THR B OG1 1 
ATOM   4610 C CG2 . THR B 1 63  ? -62.062 55.474 378.329 1.00 36.27  ? 64   THR B CG2 1 
ATOM   4611 N N   . PHE B 1 64  ? -60.422 54.127 375.309 1.00 42.63  ? 65   PHE B N   1 
ATOM   4612 C CA  . PHE B 1 64  ? -60.511 54.644 373.951 1.00 43.16  ? 65   PHE B CA  1 
ATOM   4613 C C   . PHE B 1 64  ? -61.578 55.728 373.853 1.00 38.76  ? 65   PHE B C   1 
ATOM   4614 O O   . PHE B 1 64  ? -62.608 55.684 374.530 1.00 42.45  ? 65   PHE B O   1 
ATOM   4615 C CB  . PHE B 1 64  ? -60.831 53.516 372.971 1.00 38.90  ? 65   PHE B CB  1 
ATOM   4616 C CG  . PHE B 1 64  ? -59.664 52.620 372.672 1.00 42.25  ? 65   PHE B CG  1 
ATOM   4617 C CD1 . PHE B 1 64  ? -58.549 53.110 372.012 1.00 32.91  ? 65   PHE B CD1 1 
ATOM   4618 C CD2 . PHE B 1 64  ? -59.690 51.282 373.037 1.00 35.40  ? 65   PHE B CD2 1 
ATOM   4619 C CE1 . PHE B 1 64  ? -57.472 52.284 371.729 1.00 37.41  ? 65   PHE B CE1 1 
ATOM   4620 C CE2 . PHE B 1 64  ? -58.617 50.450 372.757 1.00 37.07  ? 65   PHE B CE2 1 
ATOM   4621 C CZ  . PHE B 1 64  ? -57.507 50.951 372.102 1.00 39.23  ? 65   PHE B CZ  1 
ATOM   4622 N N   . GLN B 1 65  ? -61.326 56.708 372.992 1.00 40.62  ? 66   GLN B N   1 
ATOM   4623 C CA  . GLN B 1 65  ? -62.272 57.787 372.781 1.00 39.49  ? 66   GLN B CA  1 
ATOM   4624 C C   . GLN B 1 65  ? -63.238 57.421 371.653 1.00 43.95  ? 66   GLN B C   1 
ATOM   4625 O O   . GLN B 1 65  ? -63.196 56.324 371.092 1.00 39.01  ? 66   GLN B O   1 
ATOM   4626 C CB  . GLN B 1 65  ? -61.531 59.090 372.490 1.00 44.48  ? 66   GLN B CB  1 
ATOM   4627 C CG  . GLN B 1 65  ? -61.278 59.941 373.726 1.00 43.22  ? 66   GLN B CG  1 
ATOM   4628 C CD  . GLN B 1 65  ? -62.544 60.583 374.260 1.00 54.79  ? 66   GLN B CD  1 
ATOM   4629 O OE1 . GLN B 1 65  ? -63.576 60.597 373.591 1.00 54.03  ? 66   GLN B OE1 1 
ATOM   4630 N NE2 . GLN B 1 65  ? -62.469 61.123 375.472 1.00 49.86  ? 66   GLN B NE2 1 
ATOM   4631 N N   . SER B 1 66  ? -64.116 58.361 371.314 1.00 31.11  ? 67   SER B N   1 
ATOM   4632 C CA  . SER B 1 66  ? -65.165 58.104 370.339 1.00 43.93  ? 67   SER B CA  1 
ATOM   4633 C C   . SER B 1 66  ? -64.597 57.898 368.936 1.00 47.08  ? 67   SER B C   1 
ATOM   4634 O O   . SER B 1 66  ? -63.530 58.407 368.584 1.00 45.52  ? 67   SER B O   1 
ATOM   4635 C CB  . SER B 1 66  ? -66.168 59.255 370.337 1.00 47.97  ? 67   SER B CB  1 
ATOM   4636 O OG  . SER B 1 66  ? -66.373 59.750 371.650 1.00 54.55  ? 67   SER B OG  1 
ATOM   4637 N N   . VAL B 1 67  ? -65.334 57.142 368.133 1.00 45.67  ? 68   VAL B N   1 
ATOM   4638 C CA  . VAL B 1 67  ? -65.004 56.876 366.737 1.00 39.39  ? 68   VAL B CA  1 
ATOM   4639 C C   . VAL B 1 67  ? -65.549 58.012 365.881 1.00 35.84  ? 68   VAL B C   1 
ATOM   4640 O O   . VAL B 1 67  ? -66.660 58.500 366.121 1.00 38.29  ? 68   VAL B O   1 
ATOM   4641 C CB  . VAL B 1 67  ? -65.586 55.514 366.307 1.00 36.99  ? 68   VAL B CB  1 
ATOM   4642 C CG1 . VAL B 1 67  ? -65.307 55.230 364.838 1.00 39.43  ? 68   VAL B CG1 1 
ATOM   4643 C CG2 . VAL B 1 67  ? -65.037 54.401 367.195 1.00 38.66  ? 68   VAL B CG2 1 
ATOM   4644 N N   . CYS B 1 68  ? -64.764 58.458 364.895 1.00 34.38  ? 69   CYS B N   1 
ATOM   4645 C CA  . CYS B 1 68  ? -65.234 59.495 363.981 1.00 36.36  ? 69   CYS B CA  1 
ATOM   4646 C C   . CYS B 1 68  ? -66.454 58.986 363.231 1.00 35.36  ? 69   CYS B C   1 
ATOM   4647 O O   . CYS B 1 68  ? -66.515 57.809 362.871 1.00 37.97  ? 69   CYS B O   1 
ATOM   4648 C CB  . CYS B 1 68  ? -64.137 59.879 362.983 1.00 32.37  ? 69   CYS B CB  1 
ATOM   4649 S SG  . CYS B 1 68  ? -62.608 60.517 363.698 1.00 44.01  ? 69   CYS B SG  1 
ATOM   4650 N N   . TYR B 1 69  ? -67.419 59.879 362.982 1.00 31.38  ? 70   TYR B N   1 
ATOM   4651 C CA  . TYR B 1 69  ? -68.687 59.476 362.373 1.00 39.03  ? 70   TYR B CA  1 
ATOM   4652 C C   . TYR B 1 69  ? -68.465 58.801 361.022 1.00 42.54  ? 70   TYR B C   1 
ATOM   4653 O O   . TYR B 1 69  ? -67.790 59.344 360.142 1.00 39.66  ? 70   TYR B O   1 
ATOM   4654 C CB  . TYR B 1 69  ? -69.610 60.687 362.209 1.00 40.48  ? 70   TYR B CB  1 
ATOM   4655 C CG  . TYR B 1 69  ? -70.763 60.704 363.187 1.00 56.43  ? 70   TYR B CG  1 
ATOM   4656 C CD1 . TYR B 1 69  ? -70.710 61.486 364.334 1.00 50.86  ? 70   TYR B CD1 1 
ATOM   4657 C CD2 . TYR B 1 69  ? -71.900 59.933 362.970 1.00 52.22  ? 70   TYR B CD2 1 
ATOM   4658 C CE1 . TYR B 1 69  ? -71.756 61.501 365.240 1.00 59.07  ? 70   TYR B CE1 1 
ATOM   4659 C CE2 . TYR B 1 69  ? -72.954 59.942 363.875 1.00 57.54  ? 70   TYR B CE2 1 
ATOM   4660 C CZ  . TYR B 1 69  ? -72.874 60.729 365.008 1.00 68.92  ? 70   TYR B CZ  1 
ATOM   4661 O OH  . TYR B 1 69  ? -73.910 60.752 365.916 1.00 105.14 ? 70   TYR B OH  1 
ATOM   4662 N N   . GLN B 1 70  ? -69.052 57.617 360.856 1.00 45.03  ? 71   GLN B N   1 
ATOM   4663 C CA  . GLN B 1 70  ? -68.820 56.814 359.664 1.00 37.57  ? 71   GLN B CA  1 
ATOM   4664 C C   . GLN B 1 70  ? -69.986 55.860 359.451 1.00 45.16  ? 71   GLN B C   1 
ATOM   4665 O O   . GLN B 1 70  ? -70.771 55.592 360.364 1.00 40.63  ? 71   GLN B O   1 
ATOM   4666 C CB  . GLN B 1 70  ? -67.510 56.032 359.779 1.00 32.91  ? 71   GLN B CB  1 
ATOM   4667 C CG  . GLN B 1 70  ? -67.481 55.092 360.970 1.00 31.47  ? 71   GLN B CG  1 
ATOM   4668 C CD  . GLN B 1 70  ? -66.115 54.486 361.197 1.00 37.78  ? 71   GLN B CD  1 
ATOM   4669 O OE1 . GLN B 1 70  ? -65.924 53.281 361.034 1.00 33.95  ? 71   GLN B OE1 1 
ATOM   4670 N NE2 . GLN B 1 70  ? -65.155 55.318 361.583 1.00 36.46  ? 71   GLN B NE2 1 
ATOM   4671 N N   . TYR B 1 71  ? -70.076 55.347 358.225 1.00 38.65  ? 72   TYR B N   1 
ATOM   4672 C CA  . TYR B 1 71  ? -71.065 54.339 357.873 1.00 34.72  ? 72   TYR B CA  1 
ATOM   4673 C C   . TYR B 1 71  ? -70.790 53.034 358.616 1.00 38.98  ? 72   TYR B C   1 
ATOM   4674 O O   . TYR B 1 71  ? -69.639 52.671 358.873 1.00 48.87  ? 72   TYR B O   1 
ATOM   4675 C CB  . TYR B 1 71  ? -71.050 54.106 356.356 1.00 47.14  ? 72   TYR B CB  1 
ATOM   4676 C CG  . TYR B 1 71  ? -71.913 52.962 355.865 1.00 45.55  ? 72   TYR B CG  1 
ATOM   4677 C CD1 . TYR B 1 71  ? -73.282 53.125 355.687 1.00 44.48  ? 72   TYR B CD1 1 
ATOM   4678 C CD2 . TYR B 1 71  ? -71.357 51.721 355.569 1.00 44.21  ? 72   TYR B CD2 1 
ATOM   4679 C CE1 . TYR B 1 71  ? -74.075 52.084 355.233 1.00 45.80  ? 72   TYR B CE1 1 
ATOM   4680 C CE2 . TYR B 1 71  ? -72.143 50.673 355.116 1.00 49.37  ? 72   TYR B CE2 1 
ATOM   4681 C CZ  . TYR B 1 71  ? -73.502 50.860 354.950 1.00 56.13  ? 72   TYR B CZ  1 
ATOM   4682 O OH  . TYR B 1 71  ? -74.289 49.823 354.500 1.00 59.35  ? 72   TYR B OH  1 
ATOM   4683 N N   . VAL B 1 72  ? -71.864 52.328 358.967 1.00 36.98  ? 73   VAL B N   1 
ATOM   4684 C CA  . VAL B 1 72  ? -71.781 51.041 359.657 1.00 39.16  ? 73   VAL B CA  1 
ATOM   4685 C C   . VAL B 1 72  ? -72.346 49.971 358.730 1.00 39.45  ? 73   VAL B C   1 
ATOM   4686 O O   . VAL B 1 72  ? -73.492 50.078 358.278 1.00 50.54  ? 73   VAL B O   1 
ATOM   4687 C CB  . VAL B 1 72  ? -72.532 51.059 361.000 1.00 48.00  ? 73   VAL B CB  1 
ATOM   4688 C CG1 . VAL B 1 72  ? -72.418 49.711 361.698 1.00 39.66  ? 73   VAL B CG1 1 
ATOM   4689 C CG2 . VAL B 1 72  ? -71.996 52.165 361.897 1.00 34.90  ? 73   VAL B CG2 1 
ATOM   4690 N N   . ASP B 1 73  ? -71.544 48.943 358.452 1.00 46.00  ? 74   ASP B N   1 
ATOM   4691 C CA  . ASP B 1 73  ? -71.961 47.876 357.550 1.00 43.62  ? 74   ASP B CA  1 
ATOM   4692 C C   . ASP B 1 73  ? -73.126 47.086 358.138 1.00 54.17  ? 74   ASP B C   1 
ATOM   4693 O O   . ASP B 1 73  ? -73.142 46.766 359.330 1.00 49.99  ? 74   ASP B O   1 
ATOM   4694 C CB  . ASP B 1 73  ? -70.788 46.937 357.261 1.00 46.31  ? 74   ASP B CB  1 
ATOM   4695 C CG  . ASP B 1 73  ? -71.028 46.058 356.045 1.00 58.02  ? 74   ASP B CG  1 
ATOM   4696 O OD1 . ASP B 1 73  ? -70.826 44.829 356.143 1.00 51.45  ? 74   ASP B OD1 1 
ATOM   4697 O OD2 . ASP B 1 73  ? -71.420 46.599 354.990 1.00 63.15  ? 74   ASP B OD2 1 
ATOM   4698 N N   . THR B 1 74  ? -74.105 46.766 357.287 1.00 53.69  ? 75   THR B N   1 
ATOM   4699 C CA  . THR B 1 74  ? -75.297 46.043 357.716 1.00 68.45  ? 75   THR B CA  1 
ATOM   4700 C C   . THR B 1 74  ? -75.648 44.876 356.800 1.00 54.40  ? 75   THR B C   1 
ATOM   4701 O O   . THR B 1 74  ? -76.761 44.346 356.896 1.00 60.31  ? 75   THR B O   1 
ATOM   4702 C CB  . THR B 1 74  ? -76.502 46.989 357.812 1.00 62.70  ? 75   THR B CB  1 
ATOM   4703 O OG1 . THR B 1 74  ? -76.622 47.740 356.597 1.00 64.20  ? 75   THR B OG1 1 
ATOM   4704 C CG2 . THR B 1 74  ? -76.347 47.944 358.986 1.00 55.28  ? 75   THR B CG2 1 
ATOM   4705 N N   . LEU B 1 75  ? -74.737 44.458 355.920 1.00 57.64  ? 76   LEU B N   1 
ATOM   4706 C CA  . LEU B 1 75  ? -75.065 43.381 354.991 1.00 64.49  ? 76   LEU B CA  1 
ATOM   4707 C C   . LEU B 1 75  ? -75.225 42.049 355.717 1.00 59.70  ? 76   LEU B C   1 
ATOM   4708 O O   . LEU B 1 75  ? -76.132 41.271 355.401 1.00 64.77  ? 76   LEU B O   1 
ATOM   4709 C CB  . LEU B 1 75  ? -74.000 43.287 353.898 1.00 58.84  ? 76   LEU B CB  1 
ATOM   4710 C CG  . LEU B 1 75  ? -74.266 42.258 352.797 1.00 65.25  ? 76   LEU B CG  1 
ATOM   4711 C CD1 . LEU B 1 75  ? -75.279 42.801 351.800 1.00 53.13  ? 76   LEU B CD1 1 
ATOM   4712 C CD2 . LEU B 1 75  ? -72.974 41.900 352.089 1.00 63.34  ? 76   LEU B CD2 1 
ATOM   4713 N N   . TYR B 1 76  ? -74.371 41.776 356.701 1.00 56.86  ? 77   TYR B N   1 
ATOM   4714 C CA  . TYR B 1 76  ? -74.445 40.554 357.504 1.00 56.55  ? 77   TYR B CA  1 
ATOM   4715 C C   . TYR B 1 76  ? -74.478 40.933 358.980 1.00 57.79  ? 77   TYR B C   1 
ATOM   4716 O O   . TYR B 1 76  ? -73.450 40.881 359.670 1.00 56.48  ? 77   TYR B O   1 
ATOM   4717 C CB  . TYR B 1 76  ? -73.271 39.621 357.206 1.00 45.46  ? 77   TYR B CB  1 
ATOM   4718 C CG  . TYR B 1 76  ? -73.135 39.208 355.758 1.00 62.28  ? 77   TYR B CG  1 
ATOM   4719 C CD1 . TYR B 1 76  ? -74.135 38.482 355.124 1.00 63.00  ? 77   TYR B CD1 1 
ATOM   4720 C CD2 . TYR B 1 76  ? -71.994 39.522 355.033 1.00 60.22  ? 77   TYR B CD2 1 
ATOM   4721 C CE1 . TYR B 1 76  ? -74.007 38.094 353.800 1.00 59.46  ? 77   TYR B CE1 1 
ATOM   4722 C CE2 . TYR B 1 76  ? -71.855 39.137 353.713 1.00 55.17  ? 77   TYR B CE2 1 
ATOM   4723 C CZ  . TYR B 1 76  ? -72.864 38.425 353.100 1.00 65.83  ? 77   TYR B CZ  1 
ATOM   4724 O OH  . TYR B 1 76  ? -72.724 38.044 351.783 1.00 65.34  ? 77   TYR B OH  1 
ATOM   4725 N N   . PRO B 1 77  ? -75.644 41.313 359.499 1.00 55.76  ? 78   PRO B N   1 
ATOM   4726 C CA  . PRO B 1 77  ? -75.721 41.740 360.904 1.00 54.43  ? 78   PRO B CA  1 
ATOM   4727 C C   . PRO B 1 77  ? -75.366 40.603 361.853 1.00 52.34  ? 78   PRO B C   1 
ATOM   4728 O O   . PRO B 1 77  ? -75.864 39.482 361.722 1.00 54.06  ? 78   PRO B O   1 
ATOM   4729 C CB  . PRO B 1 77  ? -77.182 42.177 361.063 1.00 52.19  ? 78   PRO B CB  1 
ATOM   4730 C CG  . PRO B 1 77  ? -77.668 42.434 359.669 1.00 57.54  ? 78   PRO B CG  1 
ATOM   4731 C CD  . PRO B 1 77  ? -76.928 41.469 358.797 1.00 55.09  ? 78   PRO B CD  1 
ATOM   4732 N N   . GLY B 1 78  ? -74.492 40.904 362.814 1.00 52.58  ? 79   GLY B N   1 
ATOM   4733 C CA  . GLY B 1 78  ? -74.030 39.930 363.781 1.00 44.25  ? 79   GLY B CA  1 
ATOM   4734 C C   . GLY B 1 78  ? -72.928 39.015 363.295 1.00 54.04  ? 79   GLY B C   1 
ATOM   4735 O O   . GLY B 1 78  ? -72.427 38.201 364.081 1.00 48.04  ? 79   GLY B O   1 
ATOM   4736 N N   . PHE B 1 79  ? -72.534 39.120 362.030 1.00 51.18  ? 80   PHE B N   1 
ATOM   4737 C CA  . PHE B 1 79  ? -71.490 38.270 361.478 1.00 47.43  ? 80   PHE B CA  1 
ATOM   4738 C C   . PHE B 1 79  ? -70.124 38.791 361.908 1.00 46.81  ? 80   PHE B C   1 
ATOM   4739 O O   . PHE B 1 79  ? -69.830 39.981 361.761 1.00 48.80  ? 80   PHE B O   1 
ATOM   4740 C CB  . PHE B 1 79  ? -71.614 38.227 359.953 1.00 44.83  ? 80   PHE B CB  1 
ATOM   4741 C CG  . PHE B 1 79  ? -70.516 37.470 359.264 1.00 41.65  ? 80   PHE B CG  1 
ATOM   4742 C CD1 . PHE B 1 79  ? -70.275 36.138 359.563 1.00 42.47  ? 80   PHE B CD1 1 
ATOM   4743 C CD2 . PHE B 1 79  ? -69.740 38.086 358.295 1.00 47.69  ? 80   PHE B CD2 1 
ATOM   4744 C CE1 . PHE B 1 79  ? -69.265 35.438 358.922 1.00 46.26  ? 80   PHE B CE1 1 
ATOM   4745 C CE2 . PHE B 1 79  ? -68.730 37.391 357.646 1.00 44.41  ? 80   PHE B CE2 1 
ATOM   4746 C CZ  . PHE B 1 79  ? -68.492 36.067 357.961 1.00 46.80  ? 80   PHE B CZ  1 
ATOM   4747 N N   . GLU B 1 80  ? -69.293 37.897 362.449 1.00 39.13  ? 81   GLU B N   1 
ATOM   4748 C CA  . GLU B 1 80  ? -68.011 38.316 363.008 1.00 41.69  ? 81   GLU B CA  1 
ATOM   4749 C C   . GLU B 1 80  ? -67.084 38.895 361.947 1.00 56.20  ? 81   GLU B C   1 
ATOM   4750 O O   . GLU B 1 80  ? -66.316 39.820 362.237 1.00 39.38  ? 81   GLU B O   1 
ATOM   4751 C CB  . GLU B 1 80  ? -67.336 37.138 363.710 1.00 45.55  ? 81   GLU B CB  1 
ATOM   4752 C CG  . GLU B 1 80  ? -66.291 37.550 364.733 1.00 79.95  ? 81   GLU B CG  1 
ATOM   4753 C CD  . GLU B 1 80  ? -65.112 36.600 364.773 1.00 91.26  ? 81   GLU B CD  1 
ATOM   4754 O OE1 . GLU B 1 80  ? -65.322 35.402 365.056 1.00 88.54  ? 81   GLU B OE1 1 
ATOM   4755 O OE2 . GLU B 1 80  ? -63.975 37.054 364.524 1.00 97.29  ? 81   GLU B OE2 1 
ATOM   4756 N N   . GLY B 1 81  ? -67.136 38.368 360.720 1.00 41.13  ? 82   GLY B N   1 
ATOM   4757 C CA  . GLY B 1 81  ? -66.244 38.829 359.671 1.00 41.44  ? 82   GLY B CA  1 
ATOM   4758 C C   . GLY B 1 81  ? -66.421 40.287 359.305 1.00 44.36  ? 82   GLY B C   1 
ATOM   4759 O O   . GLY B 1 81  ? -65.482 40.910 358.798 1.00 43.37  ? 82   GLY B O   1 
ATOM   4760 N N   . THR B 1 82  ? -67.604 40.848 359.549 1.00 45.56  ? 83   THR B N   1 
ATOM   4761 C CA  . THR B 1 82  ? -67.861 42.258 359.294 1.00 42.86  ? 83   THR B CA  1 
ATOM   4762 C C   . THR B 1 82  ? -67.926 43.101 360.557 1.00 47.40  ? 83   THR B C   1 
ATOM   4763 O O   . THR B 1 82  ? -67.569 44.279 360.513 1.00 46.90  ? 83   THR B O   1 
ATOM   4764 C CB  . THR B 1 82  ? -69.173 42.430 358.516 1.00 40.26  ? 83   THR B CB  1 
ATOM   4765 O OG1 . THR B 1 82  ? -70.244 41.810 359.239 1.00 50.50  ? 83   THR B OG1 1 
ATOM   4766 C CG2 . THR B 1 82  ? -69.066 41.794 357.138 1.00 50.43  ? 83   THR B CG2 1 
ATOM   4767 N N   . GLU B 1 83  ? -68.363 42.527 361.683 1.00 40.58  ? 84   GLU B N   1 
ATOM   4768 C CA  . GLU B 1 83  ? -68.501 43.315 362.904 1.00 50.00  ? 84   GLU B CA  1 
ATOM   4769 C C   . GLU B 1 83  ? -67.148 43.728 363.467 1.00 43.06  ? 84   GLU B C   1 
ATOM   4770 O O   . GLU B 1 83  ? -67.055 44.750 364.156 1.00 44.41  ? 84   GLU B O   1 
ATOM   4771 C CB  . GLU B 1 83  ? -69.292 42.535 363.956 1.00 41.62  ? 84   GLU B CB  1 
ATOM   4772 C CG  . GLU B 1 83  ? -70.753 42.288 363.599 1.00 56.55  ? 84   GLU B CG  1 
ATOM   4773 C CD  . GLU B 1 83  ? -71.572 43.564 363.497 1.00 64.82  ? 84   GLU B CD  1 
ATOM   4774 O OE1 . GLU B 1 83  ? -72.646 43.527 362.859 1.00 67.30  ? 84   GLU B OE1 1 
ATOM   4775 O OE2 . GLU B 1 83  ? -71.152 44.599 364.056 1.00 74.29  ? 84   GLU B OE2 1 
ATOM   4776 N N   . MET B 1 84  ? -66.095 42.959 363.181 1.00 43.88  ? 85   MET B N   1 
ATOM   4777 C CA  . MET B 1 84  ? -64.765 43.287 363.683 1.00 35.99  ? 85   MET B CA  1 
ATOM   4778 C C   . MET B 1 84  ? -64.229 44.597 363.114 1.00 45.82  ? 85   MET B C   1 
ATOM   4779 O O   . MET B 1 84  ? -63.296 45.166 363.689 1.00 44.41  ? 85   MET B O   1 
ATOM   4780 C CB  . MET B 1 84  ? -63.791 42.150 363.371 1.00 30.01  ? 85   MET B CB  1 
ATOM   4781 C CG  . MET B 1 84  ? -63.645 41.862 361.884 1.00 42.58  ? 85   MET B CG  1 
ATOM   4782 S SD  . MET B 1 84  ? -62.523 40.493 361.538 1.00 52.63  ? 85   MET B SD  1 
ATOM   4783 C CE  . MET B 1 84  ? -60.950 41.174 362.065 1.00 43.10  ? 85   MET B CE  1 
ATOM   4784 N N   . TRP B 1 85  ? -64.790 45.082 362.002 1.00 36.93  ? 86   TRP B N   1 
ATOM   4785 C CA  . TRP B 1 85  ? -64.395 46.352 361.406 1.00 34.84  ? 86   TRP B CA  1 
ATOM   4786 C C   . TRP B 1 85  ? -65.337 47.494 361.760 1.00 35.59  ? 86   TRP B C   1 
ATOM   4787 O O   . TRP B 1 85  ? -64.999 48.656 361.508 1.00 41.21  ? 86   TRP B O   1 
ATOM   4788 C CB  . TRP B 1 85  ? -64.309 46.218 359.875 1.00 30.83  ? 86   TRP B CB  1 
ATOM   4789 C CG  . TRP B 1 85  ? -63.540 45.017 359.436 1.00 29.97  ? 86   TRP B CG  1 
ATOM   4790 C CD1 . TRP B 1 85  ? -64.041 43.887 358.856 1.00 39.59  ? 86   TRP B CD1 1 
ATOM   4791 C CD2 . TRP B 1 85  ? -62.126 44.813 359.553 1.00 39.07  ? 86   TRP B CD2 1 
ATOM   4792 N NE1 . TRP B 1 85  ? -63.027 42.993 358.603 1.00 33.90  ? 86   TRP B NE1 1 
ATOM   4793 C CE2 . TRP B 1 85  ? -61.841 43.539 359.021 1.00 35.71  ? 86   TRP B CE2 1 
ATOM   4794 C CE3 . TRP B 1 85  ? -61.073 45.586 360.051 1.00 34.06  ? 86   TRP B CE3 1 
ATOM   4795 C CZ2 . TRP B 1 85  ? -60.547 43.022 358.975 1.00 40.54  ? 86   TRP B CZ2 1 
ATOM   4796 C CZ3 . TRP B 1 85  ? -59.791 45.070 360.006 1.00 37.08  ? 86   TRP B CZ3 1 
ATOM   4797 C CH2 . TRP B 1 85  ? -59.539 43.800 359.473 1.00 40.54  ? 86   TRP B CH2 1 
ATOM   4798 N N   . ASN B 1 86  ? -66.496 47.198 362.335 1.00 40.27  ? 87   ASN B N   1 
ATOM   4799 C CA  . ASN B 1 86  ? -67.465 48.222 362.684 1.00 39.81  ? 87   ASN B CA  1 
ATOM   4800 C C   . ASN B 1 86  ? -67.044 48.963 363.951 1.00 36.29  ? 87   ASN B C   1 
ATOM   4801 O O   . ASN B 1 86  ? -66.303 48.426 364.780 1.00 35.40  ? 87   ASN B O   1 
ATOM   4802 C CB  . ASN B 1 86  ? -68.841 47.592 362.872 1.00 44.17  ? 87   ASN B CB  1 
ATOM   4803 C CG  . ASN B 1 86  ? -69.545 47.336 361.555 1.00 52.91  ? 87   ASN B CG  1 
ATOM   4804 O OD1 . ASN B 1 86  ? -69.368 48.080 360.590 1.00 41.35  ? 87   ASN B OD1 1 
ATOM   4805 N ND2 . ASN B 1 86  ? -70.349 46.281 361.509 1.00 56.41  ? 87   ASN B ND2 1 
ATOM   4806 N N   . PRO B 1 87  ? -67.502 50.206 364.118 1.00 35.53  ? 88   PRO B N   1 
ATOM   4807 C CA  . PRO B 1 87  ? -67.153 50.972 365.324 1.00 37.25  ? 88   PRO B CA  1 
ATOM   4808 C C   . PRO B 1 87  ? -67.537 50.232 366.599 1.00 45.91  ? 88   PRO B C   1 
ATOM   4809 O O   . PRO B 1 87  ? -68.648 49.713 366.724 1.00 49.66  ? 88   PRO B O   1 
ATOM   4810 C CB  . PRO B 1 87  ? -67.957 52.267 365.166 1.00 32.66  ? 88   PRO B CB  1 
ATOM   4811 C CG  . PRO B 1 87  ? -68.164 52.408 363.691 1.00 33.17  ? 88   PRO B CG  1 
ATOM   4812 C CD  . PRO B 1 87  ? -68.269 51.011 363.148 1.00 34.23  ? 88   PRO B CD  1 
ATOM   4813 N N   . ASN B 1 88  ? -66.598 50.187 367.547 1.00 44.25  ? 89   ASN B N   1 
ATOM   4814 C CA  . ASN B 1 88  ? -66.825 49.604 368.864 1.00 38.83  ? 89   ASN B CA  1 
ATOM   4815 C C   . ASN B 1 88  ? -66.900 50.660 369.961 1.00 43.24  ? 89   ASN B C   1 
ATOM   4816 O O   . ASN B 1 88  ? -66.869 50.315 371.147 1.00 47.59  ? 89   ASN B O   1 
ATOM   4817 C CB  . ASN B 1 88  ? -65.732 48.581 369.190 1.00 45.48  ? 89   ASN B CB  1 
ATOM   4818 C CG  . ASN B 1 88  ? -64.344 49.190 369.193 1.00 47.15  ? 89   ASN B CG  1 
ATOM   4819 O OD1 . ASN B 1 88  ? -64.120 50.259 368.625 1.00 50.77  ? 89   ASN B OD1 1 
ATOM   4820 N ND2 . ASN B 1 88  ? -63.402 48.507 369.830 1.00 46.08  ? 89   ASN B ND2 1 
ATOM   4821 N N   . ARG B 1 89  ? -66.980 51.935 369.592 1.00 43.51  ? 90   ARG B N   1 
ATOM   4822 C CA  . ARG B 1 89  ? -67.243 53.033 370.510 1.00 39.10  ? 90   ARG B CA  1 
ATOM   4823 C C   . ARG B 1 89  ? -68.290 53.935 369.875 1.00 44.73  ? 90   ARG B C   1 
ATOM   4824 O O   . ARG B 1 89  ? -68.588 53.826 368.682 1.00 48.55  ? 90   ARG B O   1 
ATOM   4825 C CB  . ARG B 1 89  ? -65.972 53.838 370.829 1.00 36.85  ? 90   ARG B CB  1 
ATOM   4826 C CG  . ARG B 1 89  ? -64.911 53.072 371.598 1.00 38.54  ? 90   ARG B CG  1 
ATOM   4827 C CD  . ARG B 1 89  ? -65.418 52.660 372.970 1.00 42.52  ? 90   ARG B CD  1 
ATOM   4828 N NE  . ARG B 1 89  ? -64.361 52.090 373.799 1.00 40.13  ? 90   ARG B NE  1 
ATOM   4829 C CZ  . ARG B 1 89  ? -63.968 50.821 373.743 1.00 52.11  ? 90   ARG B CZ  1 
ATOM   4830 N NH1 . ARG B 1 89  ? -64.545 49.983 372.891 1.00 44.96  ? 90   ARG B NH1 1 
ATOM   4831 N NH2 . ARG B 1 89  ? -62.998 50.387 374.540 1.00 44.99  ? 90   ARG B NH2 1 
ATOM   4832 N N   . GLU B 1 90  ? -68.846 54.839 370.676 1.00 40.95  ? 91   GLU B N   1 
ATOM   4833 C CA  . GLU B 1 90  ? -69.877 55.730 370.161 1.00 45.38  ? 91   GLU B CA  1 
ATOM   4834 C C   . GLU B 1 90  ? -69.308 56.636 369.073 1.00 47.62  ? 91   GLU B C   1 
ATOM   4835 O O   . GLU B 1 90  ? -68.120 56.971 369.065 1.00 43.84  ? 91   GLU B O   1 
ATOM   4836 C CB  . GLU B 1 90  ? -70.481 56.564 371.295 1.00 42.89  ? 91   GLU B CB  1 
ATOM   4837 C CG  . GLU B 1 90  ? -69.925 57.976 371.415 1.00 76.23  ? 91   GLU B CG  1 
ATOM   4838 C CD  . GLU B 1 90  ? -70.356 58.671 372.697 1.00 96.11  ? 91   GLU B CD  1 
ATOM   4839 O OE1 . GLU B 1 90  ? -71.068 58.042 373.509 1.00 95.72  ? 91   GLU B OE1 1 
ATOM   4840 O OE2 . GLU B 1 90  ? -69.980 59.846 372.891 1.00 88.31  ? 91   GLU B OE2 1 
ATOM   4841 N N   . LEU B 1 91  ? -70.170 57.013 368.134 1.00 42.16  ? 92   LEU B N   1 
ATOM   4842 C CA  . LEU B 1 91  ? -69.771 57.888 367.044 1.00 37.84  ? 92   LEU B CA  1 
ATOM   4843 C C   . LEU B 1 91  ? -69.828 59.344 367.483 1.00 42.65  ? 92   LEU B C   1 
ATOM   4844 O O   . LEU B 1 91  ? -70.710 59.748 368.245 1.00 43.33  ? 92   LEU B O   1 
ATOM   4845 C CB  . LEU B 1 91  ? -70.673 57.680 365.827 1.00 43.05  ? 92   LEU B CB  1 
ATOM   4846 C CG  . LEU B 1 91  ? -70.652 56.300 365.167 1.00 47.81  ? 92   LEU B CG  1 
ATOM   4847 C CD1 . LEU B 1 91  ? -71.590 56.270 363.964 1.00 36.40  ? 92   LEU B CD1 1 
ATOM   4848 C CD2 . LEU B 1 91  ? -69.237 55.913 364.762 1.00 41.35  ? 92   LEU B CD2 1 
ATOM   4849 N N   . SER B 1 92  ? -68.886 60.136 366.982 1.00 42.28  ? 93   SER B N   1 
ATOM   4850 C CA  . SER B 1 92  ? -68.797 61.543 367.336 1.00 37.41  ? 93   SER B CA  1 
ATOM   4851 C C   . SER B 1 92  ? -67.900 62.249 366.335 1.00 37.89  ? 93   SER B C   1 
ATOM   4852 O O   . SER B 1 92  ? -66.971 61.652 365.787 1.00 38.02  ? 93   SER B O   1 
ATOM   4853 C CB  . SER B 1 92  ? -68.246 61.736 368.752 1.00 32.86  ? 93   SER B CB  1 
ATOM   4854 O OG  . SER B 1 92  ? -68.402 63.080 369.166 1.00 40.21  ? 93   SER B OG  1 
ATOM   4855 N N   . GLU B 1 93  ? -68.194 63.528 366.100 1.00 42.99  ? 94   GLU B N   1 
ATOM   4856 C CA  . GLU B 1 93  ? -67.245 64.379 365.399 1.00 41.75  ? 94   GLU B CA  1 
ATOM   4857 C C   . GLU B 1 93  ? -66.096 64.801 366.304 1.00 46.47  ? 94   GLU B C   1 
ATOM   4858 O O   . GLU B 1 93  ? -65.017 65.131 365.803 1.00 51.47  ? 94   GLU B O   1 
ATOM   4859 C CB  . GLU B 1 93  ? -67.948 65.614 364.832 1.00 42.32  ? 94   GLU B CB  1 
ATOM   4860 C CG  . GLU B 1 93  ? -68.974 65.302 363.749 1.00 44.82  ? 94   GLU B CG  1 
ATOM   4861 C CD  . GLU B 1 93  ? -69.462 66.549 363.032 1.00 48.54  ? 94   GLU B CD  1 
ATOM   4862 O OE1 . GLU B 1 93  ? -68.764 67.021 362.108 1.00 40.03  ? 94   GLU B OE1 1 
ATOM   4863 O OE2 . GLU B 1 93  ? -70.542 67.061 363.395 1.00 45.90  ? 94   GLU B OE2 1 
ATOM   4864 N N   . ASP B 1 94  ? -66.308 64.794 367.620 1.00 46.70  ? 95   ASP B N   1 
ATOM   4865 C CA  . ASP B 1 94  ? -65.242 64.984 368.601 1.00 43.79  ? 95   ASP B CA  1 
ATOM   4866 C C   . ASP B 1 94  ? -64.462 63.675 368.663 1.00 40.69  ? 95   ASP B C   1 
ATOM   4867 O O   . ASP B 1 94  ? -64.704 62.801 369.495 1.00 37.59  ? 95   ASP B O   1 
ATOM   4868 C CB  . ASP B 1 94  ? -65.827 65.365 369.957 1.00 45.09  ? 95   ASP B CB  1 
ATOM   4869 C CG  . ASP B 1 94  ? -64.767 65.748 370.977 1.00 53.02  ? 95   ASP B CG  1 
ATOM   4870 O OD1 . ASP B 1 94  ? -63.560 65.594 370.690 1.00 48.42  ? 95   ASP B OD1 1 
ATOM   4871 O OD2 . ASP B 1 94  ? -65.147 66.216 372.072 1.00 53.10  ? 95   ASP B OD2 1 
ATOM   4872 N N   . CYS B 1 95  ? -63.535 63.512 367.733 1.00 36.72  ? 96   CYS B N   1 
ATOM   4873 C CA  . CYS B 1 95  ? -62.951 62.193 367.555 1.00 38.75  ? 96   CYS B CA  1 
ATOM   4874 C C   . CYS B 1 95  ? -61.440 62.205 367.358 1.00 33.36  ? 96   CYS B C   1 
ATOM   4875 O O   . CYS B 1 95  ? -60.852 61.125 367.217 1.00 32.06  ? 96   CYS B O   1 
ATOM   4876 C CB  . CYS B 1 95  ? -63.628 61.478 366.364 1.00 34.80  ? 96   CYS B CB  1 
ATOM   4877 S SG  . CYS B 1 95  ? -63.210 62.184 364.727 1.00 41.04  ? 96   CYS B SG  1 
ATOM   4878 N N   . LEU B 1 96  ? -60.788 63.375 367.361 1.00 31.04  ? 97   LEU B N   1 
ATOM   4879 C CA  . LEU B 1 96  ? -59.353 63.481 367.071 1.00 34.73  ? 97   LEU B CA  1 
ATOM   4880 C C   . LEU B 1 96  ? -58.544 63.182 368.336 1.00 37.30  ? 97   LEU B C   1 
ATOM   4881 O O   . LEU B 1 96  ? -58.101 64.068 369.072 1.00 32.92  ? 97   LEU B O   1 
ATOM   4882 C CB  . LEU B 1 96  ? -59.033 64.855 366.493 1.00 30.52  ? 97   LEU B CB  1 
ATOM   4883 C CG  . LEU B 1 96  ? -59.720 65.086 365.139 1.00 41.89  ? 97   LEU B CG  1 
ATOM   4884 C CD1 . LEU B 1 96  ? -59.306 66.402 364.483 1.00 32.30  ? 97   LEU B CD1 1 
ATOM   4885 C CD2 . LEU B 1 96  ? -59.450 63.908 364.209 1.00 29.77  ? 97   LEU B CD2 1 
ATOM   4886 N N   . TYR B 1 97  ? -58.350 61.889 368.587 1.00 32.42  ? 98   TYR B N   1 
ATOM   4887 C CA  . TYR B 1 97  ? -57.557 61.404 369.706 1.00 26.36  ? 98   TYR B CA  1 
ATOM   4888 C C   . TYR B 1 97  ? -56.598 60.337 369.202 1.00 32.15  ? 98   TYR B C   1 
ATOM   4889 O O   . TYR B 1 97  ? -56.870 59.654 368.211 1.00 36.67  ? 98   TYR B O   1 
ATOM   4890 C CB  . TYR B 1 97  ? -58.447 60.835 370.833 1.00 34.12  ? 98   TYR B CB  1 
ATOM   4891 C CG  . TYR B 1 97  ? -59.450 61.831 371.372 1.00 34.31  ? 98   TYR B CG  1 
ATOM   4892 C CD1 . TYR B 1 97  ? -59.189 62.552 372.532 1.00 36.20  ? 98   TYR B CD1 1 
ATOM   4893 C CD2 . TYR B 1 97  ? -60.655 62.062 370.715 1.00 40.62  ? 98   TYR B CD2 1 
ATOM   4894 C CE1 . TYR B 1 97  ? -60.105 63.473 373.027 1.00 36.21  ? 98   TYR B CE1 1 
ATOM   4895 C CE2 . TYR B 1 97  ? -61.574 62.980 371.199 1.00 43.07  ? 98   TYR B CE2 1 
ATOM   4896 C CZ  . TYR B 1 97  ? -61.294 63.682 372.354 1.00 49.04  ? 98   TYR B CZ  1 
ATOM   4897 O OH  . TYR B 1 97  ? -62.206 64.594 372.833 1.00 45.20  ? 98   TYR B OH  1 
ATOM   4898 N N   . LEU B 1 98  ? -55.462 60.212 369.876 1.00 31.99  ? 99   LEU B N   1 
ATOM   4899 C CA  . LEU B 1 98  ? -54.485 59.186 369.551 1.00 34.31  ? 99   LEU B CA  1 
ATOM   4900 C C   . LEU B 1 98  ? -54.157 58.373 370.798 1.00 33.37  ? 99   LEU B C   1 
ATOM   4901 O O   . LEU B 1 98  ? -54.514 58.734 371.922 1.00 34.49  ? 99   LEU B O   1 
ATOM   4902 C CB  . LEU B 1 98  ? -53.213 59.797 368.936 1.00 33.61  ? 99   LEU B CB  1 
ATOM   4903 C CG  . LEU B 1 98  ? -52.384 60.851 369.678 1.00 36.00  ? 99   LEU B CG  1 
ATOM   4904 C CD1 . LEU B 1 98  ? -51.479 60.234 370.745 1.00 25.60  ? 99   LEU B CD1 1 
ATOM   4905 C CD2 . LEU B 1 98  ? -51.557 61.640 368.670 1.00 28.82  ? 99   LEU B CD2 1 
ATOM   4906 N N   . ASN B 1 99  ? -53.463 57.260 370.581 1.00 33.27  ? 100  ASN B N   1 
ATOM   4907 C CA  . ASN B 1 99  ? -53.157 56.307 371.633 1.00 29.23  ? 100  ASN B CA  1 
ATOM   4908 C C   . ASN B 1 99  ? -51.676 55.967 371.597 1.00 28.31  ? 100  ASN B C   1 
ATOM   4909 O O   . ASN B 1 99  ? -51.067 55.909 370.527 1.00 40.79  ? 100  ASN B O   1 
ATOM   4910 C CB  . ASN B 1 99  ? -53.993 55.029 371.482 1.00 34.74  ? 100  ASN B CB  1 
ATOM   4911 C CG  . ASN B 1 99  ? -55.417 55.315 371.048 1.00 33.93  ? 100  ASN B CG  1 
ATOM   4912 O OD1 . ASN B 1 99  ? -56.248 55.752 371.845 1.00 36.85  ? 100  ASN B OD1 1 
ATOM   4913 N ND2 . ASN B 1 99  ? -55.708 55.067 369.777 1.00 41.58  ? 100  ASN B ND2 1 
ATOM   4914 N N   . VAL B 1 100 ? -51.102 55.744 372.778 1.00 36.36  ? 101  VAL B N   1 
ATOM   4915 C CA  . VAL B 1 100 ? -49.691 55.402 372.926 1.00 30.56  ? 101  VAL B CA  1 
ATOM   4916 C C   . VAL B 1 100 ? -49.585 54.157 373.794 1.00 33.30  ? 101  VAL B C   1 
ATOM   4917 O O   . VAL B 1 100 ? -50.128 54.122 374.903 1.00 40.92  ? 101  VAL B O   1 
ATOM   4918 C CB  . VAL B 1 100 ? -48.878 56.552 373.552 1.00 36.91  ? 101  VAL B CB  1 
ATOM   4919 C CG1 . VAL B 1 100 ? -47.404 56.182 373.614 1.00 25.53  ? 101  VAL B CG1 1 
ATOM   4920 C CG2 . VAL B 1 100 ? -49.077 57.848 372.785 1.00 27.73  ? 101  VAL B CG2 1 
ATOM   4921 N N   . TRP B 1 101 ? -48.891 53.140 373.289 1.00 31.78  ? 102  TRP B N   1 
ATOM   4922 C CA  . TRP B 1 101 ? -48.543 51.951 374.055 1.00 31.72  ? 102  TRP B CA  1 
ATOM   4923 C C   . TRP B 1 101 ? -47.034 51.930 374.251 1.00 37.09  ? 102  TRP B C   1 
ATOM   4924 O O   . TRP B 1 101 ? -46.281 52.127 373.291 1.00 38.21  ? 102  TRP B O   1 
ATOM   4925 C CB  . TRP B 1 101 ? -48.979 50.668 373.340 1.00 37.76  ? 102  TRP B CB  1 
ATOM   4926 C CG  . TRP B 1 101 ? -50.454 50.386 373.306 1.00 38.52  ? 102  TRP B CG  1 
ATOM   4927 C CD1 . TRP B 1 101 ? -51.166 49.630 374.193 1.00 39.23  ? 102  TRP B CD1 1 
ATOM   4928 C CD2 . TRP B 1 101 ? -51.391 50.824 372.311 1.00 33.31  ? 102  TRP B CD2 1 
ATOM   4929 N NE1 . TRP B 1 101 ? -52.490 49.581 373.820 1.00 33.12  ? 102  TRP B NE1 1 
ATOM   4930 C CE2 . TRP B 1 101 ? -52.653 50.308 372.669 1.00 41.06  ? 102  TRP B CE2 1 
ATOM   4931 C CE3 . TRP B 1 101 ? -51.286 51.610 371.158 1.00 38.68  ? 102  TRP B CE3 1 
ATOM   4932 C CZ2 . TRP B 1 101 ? -53.802 50.552 371.915 1.00 37.78  ? 102  TRP B CZ2 1 
ATOM   4933 C CZ3 . TRP B 1 101 ? -52.428 51.850 370.410 1.00 37.41  ? 102  TRP B CZ3 1 
ATOM   4934 C CH2 . TRP B 1 101 ? -53.668 51.322 370.792 1.00 39.23  ? 102  TRP B CH2 1 
ATOM   4935 N N   . THR B 1 102 ? -46.597 51.703 375.482 1.00 34.53  ? 103  THR B N   1 
ATOM   4936 C CA  . THR B 1 102 ? -45.188 51.594 375.827 1.00 38.07  ? 103  THR B CA  1 
ATOM   4937 C C   . THR B 1 102 ? -44.987 50.381 376.719 1.00 40.94  ? 103  THR B C   1 
ATOM   4938 O O   . THR B 1 102 ? -45.934 49.903 377.354 1.00 45.38  ? 103  THR B O   1 
ATOM   4939 C CB  . THR B 1 102 ? -44.676 52.852 376.549 1.00 42.22  ? 103  THR B CB  1 
ATOM   4940 O OG1 . THR B 1 102 ? -45.143 52.855 377.904 1.00 53.85  ? 103  THR B OG1 1 
ATOM   4941 C CG2 . THR B 1 102 ? -45.154 54.117 375.855 1.00 42.15  ? 103  THR B CG2 1 
ATOM   4942 N N   . PRO B 1 103 ? -43.771 49.837 376.764 1.00 35.23  ? 104  PRO B N   1 
ATOM   4943 C CA  . PRO B 1 103 ? -43.471 48.780 377.737 1.00 45.65  ? 104  PRO B CA  1 
ATOM   4944 C C   . PRO B 1 103 ? -43.635 49.277 379.166 1.00 45.17  ? 104  PRO B C   1 
ATOM   4945 O O   . PRO B 1 103 ? -43.629 50.479 379.442 1.00 48.63  ? 104  PRO B O   1 
ATOM   4946 C CB  . PRO B 1 103 ? -42.009 48.422 377.436 1.00 42.40  ? 104  PRO B CB  1 
ATOM   4947 C CG  . PRO B 1 103 ? -41.804 48.833 376.014 1.00 37.95  ? 104  PRO B CG  1 
ATOM   4948 C CD  . PRO B 1 103 ? -42.667 50.044 375.809 1.00 34.07  ? 104  PRO B CD  1 
ATOM   4949 N N   . TYR B 1 104 ? -43.795 48.325 380.084 1.00 49.41  ? 105  TYR B N   1 
ATOM   4950 C CA  . TYR B 1 104 ? -43.905 48.617 381.510 1.00 44.41  ? 105  TYR B CA  1 
ATOM   4951 C C   . TYR B 1 104 ? -42.718 48.003 382.240 1.00 53.00  ? 105  TYR B C   1 
ATOM   4952 O O   . TYR B 1 104 ? -42.502 46.782 382.138 1.00 54.14  ? 105  TYR B O   1 
ATOM   4953 C CB  . TYR B 1 104 ? -45.219 48.086 382.090 1.00 45.35  ? 105  TYR B CB  1 
ATOM   4954 C CG  . TYR B 1 104 ? -45.502 48.576 383.495 1.00 48.60  ? 105  TYR B CG  1 
ATOM   4955 C CD1 . TYR B 1 104 ? -44.936 47.950 384.601 1.00 50.66  ? 105  TYR B CD1 1 
ATOM   4956 C CD2 . TYR B 1 104 ? -46.331 49.668 383.715 1.00 43.32  ? 105  TYR B CD2 1 
ATOM   4957 C CE1 . TYR B 1 104 ? -45.188 48.398 385.886 1.00 38.17  ? 105  TYR B CE1 1 
ATOM   4958 C CE2 . TYR B 1 104 ? -46.591 50.123 384.997 1.00 52.81  ? 105  TYR B CE2 1 
ATOM   4959 C CZ  . TYR B 1 104 ? -46.017 49.484 386.078 1.00 55.30  ? 105  TYR B CZ  1 
ATOM   4960 O OH  . TYR B 1 104 ? -46.272 49.934 387.355 1.00 55.38  ? 105  TYR B OH  1 
ATOM   4961 N N   . PRO B 1 105 ? -41.918 48.787 382.983 1.00 59.18  ? 106  PRO B N   1 
ATOM   4962 C CA  . PRO B 1 105 ? -42.076 50.239 383.127 1.00 55.00  ? 106  PRO B CA  1 
ATOM   4963 C C   . PRO B 1 105 ? -41.654 50.994 381.869 1.00 41.82  ? 106  PRO B C   1 
ATOM   4964 O O   . PRO B 1 105 ? -41.001 50.404 381.007 1.00 41.48  ? 106  PRO B O   1 
ATOM   4965 C CB  . PRO B 1 105 ? -41.151 50.575 384.298 1.00 42.74  ? 106  PRO B CB  1 
ATOM   4966 C CG  . PRO B 1 105 ? -40.088 49.539 384.230 1.00 44.52  ? 106  PRO B CG  1 
ATOM   4967 C CD  . PRO B 1 105 ? -40.779 48.280 383.771 1.00 55.27  ? 106  PRO B CD  1 
ATOM   4968 N N   . ARG B 1 106 ? -42.024 52.268 381.778 1.00 53.05  ? 107  ARG B N   1 
ATOM   4969 C CA  . ARG B 1 106 ? -41.769 53.036 380.568 1.00 54.00  ? 107  ARG B CA  1 
ATOM   4970 C C   . ARG B 1 106 ? -40.284 52.994 380.217 1.00 46.12  ? 107  ARG B C   1 
ATOM   4971 O O   . ARG B 1 106 ? -39.432 53.039 381.113 1.00 56.33  ? 107  ARG B O   1 
ATOM   4972 C CB  . ARG B 1 106 ? -42.221 54.486 380.742 1.00 50.79  ? 107  ARG B CB  1 
ATOM   4973 C CG  . ARG B 1 106 ? -43.700 54.644 381.044 1.00 56.51  ? 107  ARG B CG  1 
ATOM   4974 C CD  . ARG B 1 106 ? -44.243 55.949 380.482 1.00 59.33  ? 107  ARG B CD  1 
ATOM   4975 N NE  . ARG B 1 106 ? -43.353 57.082 380.735 1.00 52.77  ? 107  ARG B NE  1 
ATOM   4976 C CZ  . ARG B 1 106 ? -43.432 57.875 381.799 1.00 62.14  ? 107  ARG B CZ  1 
ATOM   4977 N NH1 . ARG B 1 106 ? -44.357 57.659 382.725 1.00 66.66  ? 107  ARG B NH1 1 
ATOM   4978 N NH2 . ARG B 1 106 ? -42.583 58.883 381.940 1.00 69.97  ? 107  ARG B NH2 1 
ATOM   4979 N N   . PRO B 1 107 ? -39.940 52.885 378.935 1.00 46.54  ? 108  PRO B N   1 
ATOM   4980 C CA  . PRO B 1 107 ? -38.525 52.875 378.550 1.00 55.35  ? 108  PRO B CA  1 
ATOM   4981 C C   . PRO B 1 107 ? -37.823 54.145 379.003 1.00 55.97  ? 108  PRO B C   1 
ATOM   4982 O O   . PRO B 1 107 ? -38.350 55.252 378.871 1.00 64.20  ? 108  PRO B O   1 
ATOM   4983 C CB  . PRO B 1 107 ? -38.572 52.776 377.020 1.00 51.56  ? 108  PRO B CB  1 
ATOM   4984 C CG  . PRO B 1 107 ? -39.910 52.209 376.709 1.00 40.77  ? 108  PRO B CG  1 
ATOM   4985 C CD  . PRO B 1 107 ? -40.835 52.703 377.779 1.00 44.72  ? 108  PRO B CD  1 
ATOM   4986 N N   . THR B 1 108 ? -36.626 53.971 379.552 1.00 47.72  ? 109  THR B N   1 
ATOM   4987 C CA  . THR B 1 108 ? -35.783 55.095 379.927 1.00 67.95  ? 109  THR B CA  1 
ATOM   4988 C C   . THR B 1 108 ? -34.751 55.435 378.861 1.00 68.51  ? 109  THR B C   1 
ATOM   4989 O O   . THR B 1 108 ? -34.061 56.452 378.989 1.00 69.28  ? 109  THR B O   1 
ATOM   4990 C CB  . THR B 1 108 ? -35.083 54.808 381.260 1.00 58.42  ? 109  THR B CB  1 
ATOM   4991 O OG1 . THR B 1 108 ? -34.440 53.528 381.206 1.00 56.40  ? 109  THR B OG1 1 
ATOM   4992 C CG2 . THR B 1 108 ? -36.093 54.817 382.391 1.00 46.71  ? 109  THR B CG2 1 
ATOM   4993 N N   . SER B 1 109 ? -34.639 54.616 377.817 1.00 60.94  ? 110  SER B N   1 
ATOM   4994 C CA  . SER B 1 109 ? -33.799 54.861 376.660 1.00 67.31  ? 110  SER B CA  1 
ATOM   4995 C C   . SER B 1 109 ? -34.664 54.997 375.410 1.00 61.39  ? 110  SER B C   1 
ATOM   4996 O O   . SER B 1 109 ? -35.709 54.347 375.306 1.00 52.90  ? 110  SER B O   1 
ATOM   4997 C CB  . SER B 1 109 ? -32.786 53.725 376.463 1.00 61.72  ? 110  SER B CB  1 
ATOM   4998 O OG  . SER B 1 109 ? -32.213 53.773 375.169 1.00 92.17  ? 110  SER B OG  1 
ATOM   4999 N N   . PRO B 1 110 ? -34.264 55.852 374.454 1.00 61.95  ? 111  PRO B N   1 
ATOM   5000 C CA  . PRO B 1 110 ? -35.054 56.034 373.225 1.00 65.34  ? 111  PRO B CA  1 
ATOM   5001 C C   . PRO B 1 110 ? -35.410 54.728 372.531 1.00 61.27  ? 111  PRO B C   1 
ATOM   5002 O O   . PRO B 1 110 ? -34.535 53.931 372.180 1.00 59.92  ? 111  PRO B O   1 
ATOM   5003 C CB  . PRO B 1 110 ? -34.136 56.896 372.351 1.00 61.03  ? 111  PRO B CB  1 
ATOM   5004 C CG  . PRO B 1 110 ? -33.334 57.689 373.334 1.00 64.23  ? 111  PRO B CG  1 
ATOM   5005 C CD  . PRO B 1 110 ? -33.154 56.815 374.549 1.00 58.42  ? 111  PRO B CD  1 
ATOM   5006 N N   . THR B 1 111 ? -36.704 54.508 372.333 1.00 51.13  ? 112  THR B N   1 
ATOM   5007 C CA  . THR B 1 111 ? -37.247 53.289 371.766 1.00 50.55  ? 112  THR B CA  1 
ATOM   5008 C C   . THR B 1 111 ? -37.846 53.555 370.386 1.00 44.38  ? 112  THR B C   1 
ATOM   5009 O O   . THR B 1 111 ? -38.535 54.565 370.201 1.00 45.45  ? 112  THR B O   1 
ATOM   5010 C CB  . THR B 1 111 ? -38.322 52.716 372.697 1.00 52.53  ? 112  THR B CB  1 
ATOM   5011 O OG1 . THR B 1 111 ? -37.742 52.440 373.976 1.00 60.44  ? 112  THR B OG1 1 
ATOM   5012 C CG2 . THR B 1 111 ? -38.897 51.439 372.141 1.00 54.60  ? 112  THR B CG2 1 
ATOM   5013 N N   . PRO B 1 112 ? -37.581 52.691 369.402 1.00 54.43  ? 113  PRO B N   1 
ATOM   5014 C CA  . PRO B 1 112 ? -38.183 52.869 368.072 1.00 47.84  ? 113  PRO B CA  1 
ATOM   5015 C C   . PRO B 1 112 ? -39.702 52.933 368.144 1.00 46.05  ? 113  PRO B C   1 
ATOM   5016 O O   . PRO B 1 112 ? -40.336 52.239 368.943 1.00 42.85  ? 113  PRO B O   1 
ATOM   5017 C CB  . PRO B 1 112 ? -37.709 51.631 367.299 1.00 46.28  ? 113  PRO B CB  1 
ATOM   5018 C CG  . PRO B 1 112 ? -37.227 50.665 368.359 1.00 54.33  ? 113  PRO B CG  1 
ATOM   5019 C CD  . PRO B 1 112 ? -36.670 51.536 369.434 1.00 56.59  ? 113  PRO B CD  1 
ATOM   5020 N N   . VAL B 1 113 ? -40.283 53.777 367.292 1.00 38.21  ? 114  VAL B N   1 
ATOM   5021 C CA  . VAL B 1 113 ? -41.703 54.111 367.341 1.00 33.40  ? 114  VAL B CA  1 
ATOM   5022 C C   . VAL B 1 113 ? -42.392 53.585 366.087 1.00 38.46  ? 114  VAL B C   1 
ATOM   5023 O O   . VAL B 1 113 ? -41.918 53.807 364.966 1.00 35.74  ? 114  VAL B O   1 
ATOM   5024 C CB  . VAL B 1 113 ? -41.914 55.628 367.482 1.00 36.62  ? 114  VAL B CB  1 
ATOM   5025 C CG1 . VAL B 1 113 ? -43.399 55.958 367.513 1.00 31.64  ? 114  VAL B CG1 1 
ATOM   5026 C CG2 . VAL B 1 113 ? -41.220 56.146 368.734 1.00 38.66  ? 114  VAL B CG2 1 
ATOM   5027 N N   . LEU B 1 114 ? -43.514 52.895 366.283 1.00 36.20  ? 115  LEU B N   1 
ATOM   5028 C CA  . LEU B 1 114 ? -44.393 52.457 365.207 1.00 31.65  ? 115  LEU B CA  1 
ATOM   5029 C C   . LEU B 1 114 ? -45.673 53.279 365.261 1.00 33.15  ? 115  LEU B C   1 
ATOM   5030 O O   . LEU B 1 114 ? -46.262 53.440 366.336 1.00 36.01  ? 115  LEU B O   1 
ATOM   5031 C CB  . LEU B 1 114 ? -44.716 50.967 365.339 1.00 36.64  ? 115  LEU B CB  1 
ATOM   5032 C CG  . LEU B 1 114 ? -43.654 49.969 364.872 1.00 50.30  ? 115  LEU B CG  1 
ATOM   5033 C CD1 . LEU B 1 114 ? -43.897 48.604 365.491 1.00 54.31  ? 115  LEU B CD1 1 
ATOM   5034 C CD2 . LEU B 1 114 ? -43.641 49.865 363.357 1.00 49.85  ? 115  LEU B CD2 1 
ATOM   5035 N N   . VAL B 1 115 ? -46.100 53.796 364.111 1.00 30.67  ? 116  VAL B N   1 
ATOM   5036 C CA  . VAL B 1 115 ? -47.291 54.637 364.016 1.00 33.23  ? 116  VAL B CA  1 
ATOM   5037 C C   . VAL B 1 115 ? -48.267 53.964 363.058 1.00 31.76  ? 116  VAL B C   1 
ATOM   5038 O O   . VAL B 1 115 ? -47.973 53.808 361.866 1.00 34.41  ? 116  VAL B O   1 
ATOM   5039 C CB  . VAL B 1 115 ? -46.957 56.061 363.555 1.00 29.61  ? 116  VAL B CB  1 
ATOM   5040 C CG1 . VAL B 1 115 ? -48.227 56.886 363.426 1.00 35.80  ? 116  VAL B CG1 1 
ATOM   5041 C CG2 . VAL B 1 115 ? -45.984 56.716 364.527 1.00 31.65  ? 116  VAL B CG2 1 
ATOM   5042 N N   . TRP B 1 116 ? -49.430 53.579 363.573 1.00 32.44  ? 117  TRP B N   1 
ATOM   5043 C CA  . TRP B 1 116 ? -50.429 52.839 362.813 1.00 28.84  ? 117  TRP B CA  1 
ATOM   5044 C C   . TRP B 1 116 ? -51.480 53.788 362.253 1.00 29.83  ? 117  TRP B C   1 
ATOM   5045 O O   . TRP B 1 116 ? -51.992 54.654 362.972 1.00 29.52  ? 117  TRP B O   1 
ATOM   5046 C CB  . TRP B 1 116 ? -51.092 51.781 363.698 1.00 32.81  ? 117  TRP B CB  1 
ATOM   5047 C CG  . TRP B 1 116 ? -52.279 51.102 363.081 1.00 35.07  ? 117  TRP B CG  1 
ATOM   5048 C CD1 . TRP B 1 116 ? -53.590 51.242 363.443 1.00 36.87  ? 117  TRP B CD1 1 
ATOM   5049 C CD2 . TRP B 1 116 ? -52.261 50.168 361.995 1.00 36.47  ? 117  TRP B CD2 1 
ATOM   5050 N NE1 . TRP B 1 116 ? -54.386 50.451 362.651 1.00 35.60  ? 117  TRP B NE1 1 
ATOM   5051 C CE2 . TRP B 1 116 ? -53.595 49.783 361.753 1.00 30.99  ? 117  TRP B CE2 1 
ATOM   5052 C CE3 . TRP B 1 116 ? -51.246 49.621 361.203 1.00 32.05  ? 117  TRP B CE3 1 
ATOM   5053 C CZ2 . TRP B 1 116 ? -53.940 48.874 360.751 1.00 38.91  ? 117  TRP B CZ2 1 
ATOM   5054 C CZ3 . TRP B 1 116 ? -51.590 48.718 360.209 1.00 45.35  ? 117  TRP B CZ3 1 
ATOM   5055 C CH2 . TRP B 1 116 ? -52.925 48.354 359.992 1.00 34.26  ? 117  TRP B CH2 1 
ATOM   5056 N N   . ILE B 1 117 ? -51.793 53.621 360.972 1.00 30.60  ? 118  ILE B N   1 
ATOM   5057 C CA  . ILE B 1 117 ? -52.861 54.355 360.303 1.00 32.10  ? 118  ILE B CA  1 
ATOM   5058 C C   . ILE B 1 117 ? -53.839 53.320 359.766 1.00 30.12  ? 118  ILE B C   1 
ATOM   5059 O O   . ILE B 1 117 ? -53.511 52.577 358.833 1.00 34.18  ? 118  ILE B O   1 
ATOM   5060 C CB  . ILE B 1 117 ? -52.330 55.247 359.174 1.00 34.58  ? 118  ILE B CB  1 
ATOM   5061 C CG1 . ILE B 1 117 ? -51.294 56.236 359.715 1.00 35.73  ? 118  ILE B CG1 1 
ATOM   5062 C CG2 . ILE B 1 117 ? -53.479 55.976 358.490 1.00 30.32  ? 118  ILE B CG2 1 
ATOM   5063 C CD1 . ILE B 1 117 ? -50.677 57.114 358.643 1.00 28.91  ? 118  ILE B CD1 1 
ATOM   5064 N N   . TYR B 1 118 ? -55.032 53.262 360.353 1.00 32.61  ? 119  TYR B N   1 
ATOM   5065 C CA  . TYR B 1 118 ? -56.001 52.249 359.960 1.00 35.39  ? 119  TYR B CA  1 
ATOM   5066 C C   . TYR B 1 118 ? -56.545 52.527 358.562 1.00 32.68  ? 119  TYR B C   1 
ATOM   5067 O O   . TYR B 1 118 ? -56.504 53.653 358.058 1.00 29.35  ? 119  TYR B O   1 
ATOM   5068 C CB  . TYR B 1 118 ? -57.159 52.177 360.962 1.00 32.05  ? 119  TYR B CB  1 
ATOM   5069 C CG  . TYR B 1 118 ? -57.895 53.485 361.200 1.00 32.27  ? 119  TYR B CG  1 
ATOM   5070 C CD1 . TYR B 1 118 ? -58.769 54.003 360.248 1.00 33.69  ? 119  TYR B CD1 1 
ATOM   5071 C CD2 . TYR B 1 118 ? -57.741 54.185 362.391 1.00 30.84  ? 119  TYR B CD2 1 
ATOM   5072 C CE1 . TYR B 1 118 ? -59.448 55.192 360.467 1.00 26.90  ? 119  TYR B CE1 1 
ATOM   5073 C CE2 . TYR B 1 118 ? -58.418 55.374 362.619 1.00 30.75  ? 119  TYR B CE2 1 
ATOM   5074 C CZ  . TYR B 1 118 ? -59.268 55.873 361.654 1.00 30.68  ? 119  TYR B CZ  1 
ATOM   5075 O OH  . TYR B 1 118 ? -59.940 57.056 361.874 1.00 33.24  ? 119  TYR B OH  1 
ATOM   5076 N N   . GLY B 1 119 ? -57.079 51.474 357.940 1.00 33.02  ? 120  GLY B N   1 
ATOM   5077 C CA  . GLY B 1 119 ? -57.746 51.582 356.663 1.00 33.12  ? 120  GLY B CA  1 
ATOM   5078 C C   . GLY B 1 119 ? -59.258 51.633 356.803 1.00 33.33  ? 120  GLY B C   1 
ATOM   5079 O O   . GLY B 1 119 ? -59.812 51.844 357.885 1.00 39.55  ? 120  GLY B O   1 
ATOM   5080 N N   . GLY B 1 120 ? -59.933 51.430 355.674 1.00 33.06  ? 121  GLY B N   1 
ATOM   5081 C CA  . GLY B 1 120 ? -61.382 51.497 355.635 1.00 28.79  ? 121  GLY B CA  1 
ATOM   5082 C C   . GLY B 1 120 ? -61.913 52.378 354.521 1.00 33.07  ? 121  GLY B C   1 
ATOM   5083 O O   . GLY B 1 120 ? -62.942 53.043 354.683 1.00 32.77  ? 121  GLY B O   1 
ATOM   5084 N N   . GLY B 1 121 ? -61.208 52.396 353.389 1.00 31.60  ? 122  GLY B N   1 
ATOM   5085 C CA  . GLY B 1 121 ? -61.660 53.102 352.203 1.00 31.67  ? 122  GLY B CA  1 
ATOM   5086 C C   . GLY B 1 121 ? -61.830 54.593 352.371 1.00 37.63  ? 122  GLY B C   1 
ATOM   5087 O O   . GLY B 1 121 ? -62.575 55.212 351.607 1.00 32.09  ? 122  GLY B O   1 
ATOM   5088 N N   . PHE B 1 122 ? -61.159 55.188 353.356 1.00 32.88  ? 123  PHE B N   1 
ATOM   5089 C CA  . PHE B 1 122 ? -61.285 56.600 353.709 1.00 31.67  ? 123  PHE B CA  1 
ATOM   5090 C C   . PHE B 1 122 ? -62.694 56.976 354.155 1.00 32.56  ? 123  PHE B C   1 
ATOM   5091 O O   . PHE B 1 122 ? -62.986 58.165 354.325 1.00 34.63  ? 123  PHE B O   1 
ATOM   5092 C CB  . PHE B 1 122 ? -60.844 57.514 352.555 1.00 31.06  ? 123  PHE B CB  1 
ATOM   5093 C CG  . PHE B 1 122 ? -59.379 57.422 352.234 1.00 36.51  ? 123  PHE B CG  1 
ATOM   5094 C CD1 . PHE B 1 122 ? -58.433 57.950 353.099 1.00 31.80  ? 123  PHE B CD1 1 
ATOM   5095 C CD2 . PHE B 1 122 ? -58.947 56.816 351.063 1.00 28.59  ? 123  PHE B CD2 1 
ATOM   5096 C CE1 . PHE B 1 122 ? -57.082 57.870 352.808 1.00 34.30  ? 123  PHE B CE1 1 
ATOM   5097 C CE2 . PHE B 1 122 ? -57.597 56.735 350.763 1.00 34.99  ? 123  PHE B CE2 1 
ATOM   5098 C CZ  . PHE B 1 122 ? -56.662 57.263 351.639 1.00 34.73  ? 123  PHE B CZ  1 
ATOM   5099 N N   . TYR B 1 123 ? -63.582 55.996 354.349 1.00 26.09  ? 124  TYR B N   1 
ATOM   5100 C CA  . TYR B 1 123 ? -64.926 56.256 354.845 1.00 40.10  ? 124  TYR B CA  1 
ATOM   5101 C C   . TYR B 1 123 ? -65.206 55.624 356.201 1.00 36.38  ? 124  TYR B C   1 
ATOM   5102 O O   . TYR B 1 123 ? -66.263 55.896 356.780 1.00 35.84  ? 124  TYR B O   1 
ATOM   5103 C CB  . TYR B 1 123 ? -65.985 55.766 353.839 1.00 31.14  ? 124  TYR B CB  1 
ATOM   5104 C CG  . TYR B 1 123 ? -66.093 54.257 353.739 1.00 39.51  ? 124  TYR B CG  1 
ATOM   5105 C CD1 . TYR B 1 123 ? -66.922 53.538 354.594 1.00 41.25  ? 124  TYR B CD1 1 
ATOM   5106 C CD2 . TYR B 1 123 ? -65.371 53.552 352.784 1.00 41.76  ? 124  TYR B CD2 1 
ATOM   5107 C CE1 . TYR B 1 123 ? -67.016 52.161 354.514 1.00 37.82  ? 124  TYR B CE1 1 
ATOM   5108 C CE2 . TYR B 1 123 ? -65.462 52.173 352.693 1.00 35.22  ? 124  TYR B CE2 1 
ATOM   5109 C CZ  . TYR B 1 123 ? -66.288 51.485 353.561 1.00 47.13  ? 124  TYR B CZ  1 
ATOM   5110 O OH  . TYR B 1 123 ? -66.388 50.115 353.481 1.00 51.42  ? 124  TYR B OH  1 
ATOM   5111 N N   . SER B 1 124 ? -64.307 54.790 356.718 1.00 33.36  ? 125  SER B N   1 
ATOM   5112 C CA  . SER B 1 124 ? -64.545 54.066 357.957 1.00 34.37  ? 125  SER B CA  1 
ATOM   5113 C C   . SER B 1 124 ? -63.207 53.771 358.622 1.00 34.00  ? 125  SER B C   1 
ATOM   5114 O O   . SER B 1 124 ? -62.139 54.072 358.082 1.00 35.66  ? 125  SER B O   1 
ATOM   5115 C CB  . SER B 1 124 ? -65.322 52.773 357.693 1.00 41.84  ? 125  SER B CB  1 
ATOM   5116 O OG  . SER B 1 124 ? -64.555 51.879 356.903 1.00 33.22  ? 125  SER B OG  1 
ATOM   5117 N N   . GLY B 1 125 ? -63.275 53.161 359.801 1.00 31.62  ? 126  GLY B N   1 
ATOM   5118 C CA  . GLY B 1 125 ? -62.083 52.797 360.537 1.00 31.88  ? 126  GLY B CA  1 
ATOM   5119 C C   . GLY B 1 125 ? -62.004 53.462 361.894 1.00 31.39  ? 126  GLY B C   1 
ATOM   5120 O O   . GLY B 1 125 ? -62.644 54.492 362.126 1.00 36.15  ? 126  GLY B O   1 
ATOM   5121 N N   . ALA B 1 126 ? -61.216 52.883 362.798 1.00 26.85  ? 127  ALA B N   1 
ATOM   5122 C CA  . ALA B 1 126 ? -61.054 53.419 364.141 1.00 30.93  ? 127  ALA B CA  1 
ATOM   5123 C C   . ALA B 1 126 ? -59.826 52.786 364.776 1.00 37.64  ? 127  ALA B C   1 
ATOM   5124 O O   . ALA B 1 126 ? -59.537 51.610 364.541 1.00 34.62  ? 127  ALA B O   1 
ATOM   5125 C CB  . ALA B 1 126 ? -62.291 53.155 365.008 1.00 32.86  ? 127  ALA B CB  1 
ATOM   5126 N N   . SER B 1 127 ? -59.109 53.571 365.581 1.00 32.78  ? 128  SER B N   1 
ATOM   5127 C CA  . SER B 1 127 ? -57.925 53.054 366.253 1.00 35.88  ? 128  SER B CA  1 
ATOM   5128 C C   . SER B 1 127 ? -58.263 52.171 367.445 1.00 38.58  ? 128  SER B C   1 
ATOM   5129 O O   . SER B 1 127 ? -57.358 51.537 368.001 1.00 38.19  ? 128  SER B O   1 
ATOM   5130 C CB  . SER B 1 127 ? -57.025 54.208 366.703 1.00 41.49  ? 128  SER B CB  1 
ATOM   5131 O OG  . SER B 1 127 ? -57.708 55.076 367.591 1.00 39.92  ? 128  SER B OG  1 
ATOM   5132 N N   . SER B 1 128 ? -59.534 52.103 367.836 1.00 35.55  ? 129  SER B N   1 
ATOM   5133 C CA  . SER B 1 128 ? -59.969 51.357 369.011 1.00 35.18  ? 129  SER B CA  1 
ATOM   5134 C C   . SER B 1 128 ? -60.373 49.919 368.709 1.00 39.03  ? 129  SER B C   1 
ATOM   5135 O O   . SER B 1 128 ? -60.719 49.186 369.640 1.00 38.05  ? 129  SER B O   1 
ATOM   5136 C CB  . SER B 1 128 ? -61.142 52.081 369.676 1.00 32.56  ? 129  SER B CB  1 
ATOM   5137 O OG  . SER B 1 128 ? -62.199 52.282 368.754 1.00 32.33  ? 129  SER B OG  1 
ATOM   5138 N N   . LEU B 1 129 ? -60.347 49.498 367.445 1.00 36.81  ? 130  LEU B N   1 
ATOM   5139 C CA  . LEU B 1 129 ? -60.763 48.145 367.100 1.00 42.48  ? 130  LEU B CA  1 
ATOM   5140 C C   . LEU B 1 129 ? -59.878 47.111 367.789 1.00 37.44  ? 130  LEU B C   1 
ATOM   5141 O O   . LEU B 1 129 ? -58.679 47.321 367.989 1.00 46.54  ? 130  LEU B O   1 
ATOM   5142 C CB  . LEU B 1 129 ? -60.716 47.944 365.585 1.00 38.88  ? 130  LEU B CB  1 
ATOM   5143 C CG  . LEU B 1 129 ? -61.571 48.900 364.753 1.00 42.05  ? 130  LEU B CG  1 
ATOM   5144 C CD1 . LEU B 1 129 ? -61.529 48.505 363.288 1.00 32.07  ? 130  LEU B CD1 1 
ATOM   5145 C CD2 . LEU B 1 129 ? -63.005 48.937 365.265 1.00 41.23  ? 130  LEU B CD2 1 
ATOM   5146 N N   . ASP B 1 130 ? -60.488 45.974 368.140 1.00 39.08  ? 131  ASP B N   1 
ATOM   5147 C CA  . ASP B 1 130 ? -59.775 44.932 368.876 1.00 39.52  ? 131  ASP B CA  1 
ATOM   5148 C C   . ASP B 1 130 ? -58.561 44.429 368.106 1.00 42.02  ? 131  ASP B C   1 
ATOM   5149 O O   . ASP B 1 130 ? -57.524 44.116 368.703 1.00 47.41  ? 131  ASP B O   1 
ATOM   5150 C CB  . ASP B 1 130 ? -60.717 43.768 369.191 1.00 47.64  ? 131  ASP B CB  1 
ATOM   5151 C CG  . ASP B 1 130 ? -61.823 44.154 370.153 1.00 57.01  ? 131  ASP B CG  1 
ATOM   5152 O OD1 . ASP B 1 130 ? -61.678 45.174 370.858 1.00 55.84  ? 131  ASP B OD1 1 
ATOM   5153 O OD2 . ASP B 1 130 ? -62.839 43.428 370.205 1.00 68.87  ? 131  ASP B OD2 1 
ATOM   5154 N N   . VAL B 1 131 ? -58.669 44.343 366.777 1.00 39.60  ? 132  VAL B N   1 
ATOM   5155 C CA  . VAL B 1 131 ? -57.572 43.814 365.974 1.00 36.31  ? 132  VAL B CA  1 
ATOM   5156 C C   . VAL B 1 131 ? -56.413 44.794 365.839 1.00 37.47  ? 132  VAL B C   1 
ATOM   5157 O O   . VAL B 1 131 ? -55.338 44.405 365.362 1.00 39.61  ? 132  VAL B O   1 
ATOM   5158 C CB  . VAL B 1 131 ? -58.139 43.383 364.604 1.00 48.62  ? 132  VAL B CB  1 
ATOM   5159 C CG1 . VAL B 1 131 ? -58.510 44.592 363.769 1.00 44.13  ? 132  VAL B CG1 1 
ATOM   5160 C CG2 . VAL B 1 131 ? -57.175 42.485 363.868 1.00 41.86  ? 132  VAL B CG2 1 
ATOM   5161 N N   . TYR B 1 132 ? -56.579 46.047 366.271 1.00 38.52  ? 133  TYR B N   1 
ATOM   5162 C CA  . TYR B 1 132 ? -55.485 47.014 366.299 1.00 43.10  ? 133  TYR B CA  1 
ATOM   5163 C C   . TYR B 1 132 ? -54.875 47.170 367.691 1.00 43.58  ? 133  TYR B C   1 
ATOM   5164 O O   . TYR B 1 132 ? -54.161 48.148 367.938 1.00 42.04  ? 133  TYR B O   1 
ATOM   5165 C CB  . TYR B 1 132 ? -55.951 48.380 365.787 1.00 29.04  ? 133  TYR B CB  1 
ATOM   5166 C CG  . TYR B 1 132 ? -56.538 48.369 364.392 1.00 36.07  ? 133  TYR B CG  1 
ATOM   5167 C CD1 . TYR B 1 132 ? -56.133 47.433 363.450 1.00 32.16  ? 133  TYR B CD1 1 
ATOM   5168 C CD2 . TYR B 1 132 ? -57.502 49.297 364.023 1.00 25.59  ? 133  TYR B CD2 1 
ATOM   5169 C CE1 . TYR B 1 132 ? -56.676 47.422 362.180 1.00 30.39  ? 133  TYR B CE1 1 
ATOM   5170 C CE2 . TYR B 1 132 ? -58.048 49.296 362.760 1.00 31.45  ? 133  TYR B CE2 1 
ATOM   5171 C CZ  . TYR B 1 132 ? -57.634 48.360 361.843 1.00 35.61  ? 133  TYR B CZ  1 
ATOM   5172 O OH  . TYR B 1 132 ? -58.191 48.370 360.588 1.00 37.42  ? 133  TYR B OH  1 
ATOM   5173 N N   . ASP B 1 133 ? -55.142 46.234 368.602 1.00 47.95  ? 134  ASP B N   1 
ATOM   5174 C CA  . ASP B 1 133 ? -54.617 46.308 369.965 1.00 38.88  ? 134  ASP B CA  1 
ATOM   5175 C C   . ASP B 1 133 ? -53.101 46.162 369.943 1.00 41.39  ? 134  ASP B C   1 
ATOM   5176 O O   . ASP B 1 133 ? -52.576 45.097 369.600 1.00 38.58  ? 134  ASP B O   1 
ATOM   5177 C CB  . ASP B 1 133 ? -55.254 45.228 370.834 1.00 40.72  ? 134  ASP B CB  1 
ATOM   5178 C CG  . ASP B 1 133 ? -54.895 45.371 372.308 1.00 57.69  ? 134  ASP B CG  1 
ATOM   5179 O OD1 . ASP B 1 133 ? -54.280 46.391 372.687 1.00 54.60  ? 134  ASP B OD1 1 
ATOM   5180 O OD2 . ASP B 1 133 ? -55.237 44.459 373.091 1.00 59.66  ? 134  ASP B OD2 1 
ATOM   5181 N N   . GLY B 1 134 ? -52.394 47.219 370.334 1.00 34.28  ? 135  GLY B N   1 
ATOM   5182 C CA  . GLY B 1 134 ? -50.950 47.263 370.254 1.00 32.79  ? 135  GLY B CA  1 
ATOM   5183 C C   . GLY B 1 134 ? -50.195 46.683 371.429 1.00 34.08  ? 135  GLY B C   1 
ATOM   5184 O O   . GLY B 1 134 ? -48.962 46.770 371.451 1.00 33.71  ? 135  GLY B O   1 
ATOM   5185 N N   . ARG B 1 135 ? -50.887 46.076 372.399 1.00 38.81  ? 136  ARG B N   1 
ATOM   5186 C CA  . ARG B 1 135 ? -50.218 45.617 373.614 1.00 38.44  ? 136  ARG B CA  1 
ATOM   5187 C C   . ARG B 1 135 ? -49.280 44.445 373.346 1.00 45.31  ? 136  ARG B C   1 
ATOM   5188 O O   . ARG B 1 135 ? -48.258 44.308 374.028 1.00 39.99  ? 136  ARG B O   1 
ATOM   5189 C CB  . ARG B 1 135 ? -51.253 45.233 374.675 1.00 39.05  ? 136  ARG B CB  1 
ATOM   5190 C CG  . ARG B 1 135 ? -51.964 43.909 374.413 1.00 41.33  ? 136  ARG B CG  1 
ATOM   5191 C CD  . ARG B 1 135 ? -52.935 43.567 375.526 1.00 41.82  ? 136  ARG B CD  1 
ATOM   5192 N NE  . ARG B 1 135 ? -54.128 44.406 375.484 1.00 42.05  ? 136  ARG B NE  1 
ATOM   5193 C CZ  . ARG B 1 135 ? -55.008 44.499 376.473 1.00 52.88  ? 136  ARG B CZ  1 
ATOM   5194 N NH1 . ARG B 1 135 ? -54.825 43.805 377.590 1.00 52.29  ? 136  ARG B NH1 1 
ATOM   5195 N NH2 . ARG B 1 135 ? -56.065 45.288 376.350 1.00 43.01  ? 136  ARG B NH2 1 
ATOM   5196 N N   . PHE B 1 136 ? -49.598 43.595 372.365 1.00 38.46  ? 137  PHE B N   1 
ATOM   5197 C CA  . PHE B 1 136 ? -48.772 42.418 372.120 1.00 36.72  ? 137  PHE B CA  1 
ATOM   5198 C C   . PHE B 1 136 ? -47.493 42.782 371.380 1.00 37.93  ? 137  PHE B C   1 
ATOM   5199 O O   . PHE B 1 136 ? -46.419 42.262 371.701 1.00 45.51  ? 137  PHE B O   1 
ATOM   5200 C CB  . PHE B 1 136 ? -49.565 41.368 371.337 1.00 43.98  ? 137  PHE B CB  1 
ATOM   5201 C CG  . PHE B 1 136 ? -50.841 40.953 372.011 1.00 45.42  ? 137  PHE B CG  1 
ATOM   5202 C CD1 . PHE B 1 136 ? -52.065 41.416 371.553 1.00 40.80  ? 137  PHE B CD1 1 
ATOM   5203 C CD2 . PHE B 1 136 ? -50.817 40.110 373.112 1.00 49.33  ? 137  PHE B CD2 1 
ATOM   5204 C CE1 . PHE B 1 136 ? -53.244 41.042 372.179 1.00 39.18  ? 137  PHE B CE1 1 
ATOM   5205 C CE2 . PHE B 1 136 ? -51.993 39.732 373.743 1.00 38.34  ? 137  PHE B CE2 1 
ATOM   5206 C CZ  . PHE B 1 136 ? -53.208 40.198 373.274 1.00 36.73  ? 137  PHE B CZ  1 
ATOM   5207 N N   . LEU B 1 137 ? -47.592 43.667 370.387 1.00 40.15  ? 138  LEU B N   1 
ATOM   5208 C CA  . LEU B 1 137 ? -46.403 44.126 369.679 1.00 48.54  ? 138  LEU B CA  1 
ATOM   5209 C C   . LEU B 1 137 ? -45.447 44.826 370.632 1.00 41.42  ? 138  LEU B C   1 
ATOM   5210 O O   . LEU B 1 137 ? -44.236 44.581 370.617 1.00 42.11  ? 138  LEU B O   1 
ATOM   5211 C CB  . LEU B 1 137 ? -46.805 45.067 368.543 1.00 42.93  ? 138  LEU B CB  1 
ATOM   5212 C CG  . LEU B 1 137 ? -46.622 44.582 367.109 1.00 43.76  ? 138  LEU B CG  1 
ATOM   5213 C CD1 . LEU B 1 137 ? -47.145 45.642 366.157 1.00 48.28  ? 138  LEU B CD1 1 
ATOM   5214 C CD2 . LEU B 1 137 ? -45.161 44.267 366.831 1.00 39.79  ? 138  LEU B CD2 1 
ATOM   5215 N N   . VAL B 1 138 ? -45.986 45.700 371.477 1.00 34.78  ? 139  VAL B N   1 
ATOM   5216 C CA  . VAL B 1 138 ? -45.148 46.487 372.369 1.00 42.00  ? 139  VAL B CA  1 
ATOM   5217 C C   . VAL B 1 138 ? -44.444 45.590 373.382 1.00 43.51  ? 139  VAL B C   1 
ATOM   5218 O O   . VAL B 1 138 ? -43.263 45.788 373.690 1.00 36.95  ? 139  VAL B O   1 
ATOM   5219 C CB  . VAL B 1 138 ? -46.003 47.574 373.042 1.00 48.01  ? 139  VAL B CB  1 
ATOM   5220 C CG1 . VAL B 1 138 ? -45.292 48.149 374.234 1.00 37.03  ? 139  VAL B CG1 1 
ATOM   5221 C CG2 . VAL B 1 138 ? -46.338 48.663 372.027 1.00 37.67  ? 139  VAL B CG2 1 
ATOM   5222 N N   . GLN B 1 139 ? -45.141 44.574 373.895 1.00 42.77  ? 140  GLN B N   1 
ATOM   5223 C CA  . GLN B 1 139 ? -44.520 43.683 374.870 1.00 42.63  ? 140  GLN B CA  1 
ATOM   5224 C C   . GLN B 1 139 ? -43.465 42.801 374.215 1.00 42.56  ? 140  GLN B C   1 
ATOM   5225 O O   . GLN B 1 139 ? -42.342 42.680 374.719 1.00 49.57  ? 140  GLN B O   1 
ATOM   5226 C CB  . GLN B 1 139 ? -45.585 42.825 375.558 1.00 47.66  ? 140  GLN B CB  1 
ATOM   5227 C CG  . GLN B 1 139 ? -45.100 42.105 376.812 1.00 41.59  ? 140  GLN B CG  1 
ATOM   5228 C CD  . GLN B 1 139 ? -44.265 40.873 376.506 1.00 43.54  ? 140  GLN B CD  1 
ATOM   5229 O OE1 . GLN B 1 139 ? -44.543 40.141 375.557 1.00 44.35  ? 140  GLN B OE1 1 
ATOM   5230 N NE2 . GLN B 1 139 ? -43.228 40.644 377.306 1.00 42.15  ? 140  GLN B NE2 1 
ATOM   5231 N N   . ALA B 1 140 ? -43.810 42.175 373.089 1.00 45.63  ? 141  ALA B N   1 
ATOM   5232 C CA  . ALA B 1 140 ? -42.930 41.172 372.500 1.00 41.19  ? 141  ALA B CA  1 
ATOM   5233 C C   . ALA B 1 140 ? -41.691 41.801 371.875 1.00 48.25  ? 141  ALA B C   1 
ATOM   5234 O O   . ALA B 1 140 ? -40.599 41.224 371.936 1.00 49.29  ? 141  ALA B O   1 
ATOM   5235 C CB  . ALA B 1 140 ? -43.692 40.355 371.458 1.00 55.22  ? 141  ALA B CB  1 
ATOM   5236 N N   . GLU B 1 141 ? -41.834 42.975 371.265 1.00 32.57  ? 142  GLU B N   1 
ATOM   5237 C CA  . GLU B 1 141 ? -40.750 43.568 370.498 1.00 43.95  ? 142  GLU B CA  1 
ATOM   5238 C C   . GLU B 1 141 ? -40.218 44.860 371.099 1.00 42.26  ? 142  GLU B C   1 
ATOM   5239 O O   . GLU B 1 141 ? -39.254 45.422 370.567 1.00 47.06  ? 142  GLU B O   1 
ATOM   5240 C CB  . GLU B 1 141 ? -41.200 43.806 369.050 1.00 43.16  ? 142  GLU B CB  1 
ATOM   5241 C CG  . GLU B 1 141 ? -41.501 42.519 368.287 1.00 33.86  ? 142  GLU B CG  1 
ATOM   5242 C CD  . GLU B 1 141 ? -40.292 41.597 368.194 1.00 56.44  ? 142  GLU B CD  1 
ATOM   5243 O OE1 . GLU B 1 141 ? -39.149 42.105 368.175 1.00 45.71  ? 142  GLU B OE1 1 
ATOM   5244 O OE2 . GLU B 1 141 ? -40.483 40.362 368.141 1.00 52.33  ? 142  GLU B OE2 1 
ATOM   5245 N N   . ARG B 1 142 ? -40.811 45.338 372.189 1.00 44.25  ? 143  ARG B N   1 
ATOM   5246 C CA  . ARG B 1 142 ? -40.311 46.489 372.937 1.00 54.76  ? 143  ARG B CA  1 
ATOM   5247 C C   . ARG B 1 142 ? -40.145 47.709 372.032 1.00 50.41  ? 143  ARG B C   1 
ATOM   5248 O O   . ARG B 1 142 ? -39.058 48.261 371.862 1.00 44.89  ? 143  ARG B O   1 
ATOM   5249 C CB  . ARG B 1 142 ? -39.006 46.142 373.659 1.00 46.01  ? 143  ARG B CB  1 
ATOM   5250 C CG  . ARG B 1 142 ? -39.157 45.019 374.674 1.00 49.34  ? 143  ARG B CG  1 
ATOM   5251 C CD  . ARG B 1 142 ? -37.967 44.952 375.615 1.00 60.77  ? 143  ARG B CD  1 
ATOM   5252 N NE  . ARG B 1 142 ? -37.818 46.173 376.401 1.00 66.48  ? 143  ARG B NE  1 
ATOM   5253 C CZ  . ARG B 1 142 ? -38.493 46.433 377.516 1.00 63.28  ? 143  ARG B CZ  1 
ATOM   5254 N NH1 . ARG B 1 142 ? -39.369 45.554 377.986 1.00 51.21  ? 143  ARG B NH1 1 
ATOM   5255 N NH2 . ARG B 1 142 ? -38.292 47.572 378.162 1.00 62.36  ? 143  ARG B NH2 1 
ATOM   5256 N N   . THR B 1 143 ? -41.259 48.112 371.437 1.00 46.43  ? 144  THR B N   1 
ATOM   5257 C CA  . THR B 1 143 ? -41.346 49.358 370.700 1.00 46.19  ? 144  THR B CA  1 
ATOM   5258 C C   . THR B 1 143 ? -42.448 50.211 371.312 1.00 39.17  ? 144  THR B C   1 
ATOM   5259 O O   . THR B 1 143 ? -43.283 49.725 372.078 1.00 51.42  ? 144  THR B O   1 
ATOM   5260 C CB  . THR B 1 143 ? -41.629 49.120 369.207 1.00 52.73  ? 144  THR B CB  1 
ATOM   5261 O OG1 . THR B 1 143 ? -42.855 48.395 369.062 1.00 53.76  ? 144  THR B OG1 1 
ATOM   5262 C CG2 . THR B 1 143 ? -40.499 48.329 368.562 1.00 54.44  ? 144  THR B CG2 1 
ATOM   5263 N N   . VAL B 1 144 ? -42.432 51.492 370.987 1.00 38.96  ? 145  VAL B N   1 
ATOM   5264 C CA  . VAL B 1 144 ? -43.553 52.370 371.292 1.00 39.36  ? 145  VAL B CA  1 
ATOM   5265 C C   . VAL B 1 144 ? -44.480 52.370 370.087 1.00 40.16  ? 145  VAL B C   1 
ATOM   5266 O O   . VAL B 1 144 ? -44.030 52.544 368.948 1.00 42.02  ? 145  VAL B O   1 
ATOM   5267 C CB  . VAL B 1 144 ? -43.071 53.790 371.627 1.00 36.62  ? 145  VAL B CB  1 
ATOM   5268 C CG1 . VAL B 1 144 ? -44.258 54.728 371.781 1.00 31.73  ? 145  VAL B CG1 1 
ATOM   5269 C CG2 . VAL B 1 144 ? -42.229 53.771 372.895 1.00 35.81  ? 145  VAL B CG2 1 
ATOM   5270 N N   . LEU B 1 145 ? -45.769 52.145 370.326 1.00 33.13  ? 146  LEU B N   1 
ATOM   5271 C CA  . LEU B 1 145 ? -46.759 52.101 369.259 1.00 30.29  ? 146  LEU B CA  1 
ATOM   5272 C C   . LEU B 1 145 ? -47.749 53.240 369.437 1.00 34.06  ? 146  LEU B C   1 
ATOM   5273 O O   . LEU B 1 145 ? -48.297 53.431 370.528 1.00 36.35  ? 146  LEU B O   1 
ATOM   5274 C CB  . LEU B 1 145 ? -47.496 50.759 369.225 1.00 35.31  ? 146  LEU B CB  1 
ATOM   5275 C CG  . LEU B 1 145 ? -48.277 50.525 367.927 1.00 41.95  ? 146  LEU B CG  1 
ATOM   5276 C CD1 . LEU B 1 145 ? -47.988 49.150 367.356 1.00 51.14  ? 146  LEU B CD1 1 
ATOM   5277 C CD2 . LEU B 1 145 ? -49.767 50.709 368.148 1.00 44.71  ? 146  LEU B CD2 1 
ATOM   5278 N N   . VAL B 1 146 ? -47.977 53.988 368.362 1.00 36.67  ? 147  VAL B N   1 
ATOM   5279 C CA  . VAL B 1 146 ? -48.917 55.100 368.349 1.00 32.20  ? 147  VAL B CA  1 
ATOM   5280 C C   . VAL B 1 146 ? -49.939 54.846 367.250 1.00 36.93  ? 147  VAL B C   1 
ATOM   5281 O O   . VAL B 1 146 ? -49.589 54.380 366.160 1.00 34.28  ? 147  VAL B O   1 
ATOM   5282 C CB  . VAL B 1 146 ? -48.197 56.450 368.135 1.00 36.70  ? 147  VAL B CB  1 
ATOM   5283 C CG1 . VAL B 1 146 ? -49.199 57.591 368.029 1.00 30.27  ? 147  VAL B CG1 1 
ATOM   5284 C CG2 . VAL B 1 146 ? -47.204 56.712 369.261 1.00 34.13  ? 147  VAL B CG2 1 
ATOM   5285 N N   . SER B 1 147 ? -51.205 55.125 367.547 1.00 34.52  ? 148  SER B N   1 
ATOM   5286 C CA  . SER B 1 147 ? -52.265 55.075 366.552 1.00 29.48  ? 148  SER B CA  1 
ATOM   5287 C C   . SER B 1 147 ? -53.187 56.258 366.787 1.00 34.06  ? 148  SER B C   1 
ATOM   5288 O O   . SER B 1 147 ? -53.430 56.644 367.934 1.00 31.70  ? 148  SER B O   1 
ATOM   5289 C CB  . SER B 1 147 ? -53.053 53.756 366.614 1.00 36.18  ? 148  SER B CB  1 
ATOM   5290 O OG  . SER B 1 147 ? -53.751 53.619 367.842 1.00 37.04  ? 148  SER B OG  1 
ATOM   5291 N N   . MET B 1 148 ? -53.684 56.844 365.705 1.00 27.12  ? 149  MET B N   1 
ATOM   5292 C CA  . MET B 1 148 ? -54.529 58.021 365.806 1.00 33.43  ? 149  MET B CA  1 
ATOM   5293 C C   . MET B 1 148 ? -55.842 57.791 365.074 1.00 35.27  ? 149  MET B C   1 
ATOM   5294 O O   . MET B 1 148 ? -55.928 56.979 364.147 1.00 36.24  ? 149  MET B O   1 
ATOM   5295 C CB  . MET B 1 148 ? -53.823 59.270 365.243 1.00 28.39  ? 149  MET B CB  1 
ATOM   5296 C CG  . MET B 1 148 ? -54.016 59.495 363.748 1.00 32.89  ? 149  MET B CG  1 
ATOM   5297 S SD  . MET B 1 148 ? -53.203 58.233 362.754 1.00 40.65  ? 149  MET B SD  1 
ATOM   5298 C CE  . MET B 1 148 ? -51.476 58.681 362.944 1.00 35.21  ? 149  MET B CE  1 
ATOM   5299 N N   . ASN B 1 149 ? -56.871 58.504 365.518 1.00 29.92  ? 150  ASN B N   1 
ATOM   5300 C CA  . ASN B 1 149 ? -58.113 58.616 364.770 1.00 37.30  ? 150  ASN B CA  1 
ATOM   5301 C C   . ASN B 1 149 ? -58.021 59.812 363.831 1.00 37.04  ? 150  ASN B C   1 
ATOM   5302 O O   . ASN B 1 149 ? -57.541 60.881 364.217 1.00 39.80  ? 150  ASN B O   1 
ATOM   5303 C CB  . ASN B 1 149 ? -59.305 58.784 365.714 1.00 30.51  ? 150  ASN B CB  1 
ATOM   5304 C CG  . ASN B 1 149 ? -59.879 57.456 366.191 1.00 42.38  ? 150  ASN B CG  1 
ATOM   5305 O OD1 . ASN B 1 149 ? -59.324 56.386 365.935 1.00 37.25  ? 150  ASN B OD1 1 
ATOM   5306 N ND2 . ASN B 1 149 ? -60.999 57.527 366.899 1.00 44.71  ? 150  ASN B ND2 1 
ATOM   5307 N N   . TYR B 1 150 ? -58.470 59.625 362.591 1.00 33.43  ? 151  TYR B N   1 
ATOM   5308 C CA  . TYR B 1 150 ? -58.548 60.708 361.622 1.00 26.70  ? 151  TYR B CA  1 
ATOM   5309 C C   . TYR B 1 150 ? -59.929 60.712 360.983 1.00 35.85  ? 151  TYR B C   1 
ATOM   5310 O O   . TYR B 1 150 ? -60.576 59.668 360.858 1.00 35.07  ? 151  TYR B O   1 
ATOM   5311 C CB  . TYR B 1 150 ? -57.451 60.592 360.547 1.00 30.98  ? 151  TYR B CB  1 
ATOM   5312 C CG  . TYR B 1 150 ? -57.539 59.353 359.685 1.00 33.64  ? 151  TYR B CG  1 
ATOM   5313 C CD1 . TYR B 1 150 ? -56.913 58.172 360.067 1.00 28.24  ? 151  TYR B CD1 1 
ATOM   5314 C CD2 . TYR B 1 150 ? -58.234 59.367 358.480 1.00 27.42  ? 151  TYR B CD2 1 
ATOM   5315 C CE1 . TYR B 1 150 ? -56.986 57.038 359.281 1.00 28.59  ? 151  TYR B CE1 1 
ATOM   5316 C CE2 . TYR B 1 150 ? -58.311 58.238 357.687 1.00 26.62  ? 151  TYR B CE2 1 
ATOM   5317 C CZ  . TYR B 1 150 ? -57.689 57.076 358.092 1.00 34.16  ? 151  TYR B CZ  1 
ATOM   5318 O OH  . TYR B 1 150 ? -57.765 55.950 357.303 1.00 30.19  ? 151  TYR B OH  1 
ATOM   5319 N N   . ARG B 1 151 ? -60.376 61.901 360.585 1.00 30.35  ? 152  ARG B N   1 
ATOM   5320 C CA  . ARG B 1 151 ? -61.709 62.047 360.014 1.00 36.47  ? 152  ARG B CA  1 
ATOM   5321 C C   . ARG B 1 151 ? -61.832 61.280 358.701 1.00 42.51  ? 152  ARG B C   1 
ATOM   5322 O O   . ARG B 1 151 ? -60.933 61.310 357.855 1.00 36.46  ? 152  ARG B O   1 
ATOM   5323 C CB  . ARG B 1 151 ? -62.024 63.527 359.795 1.00 33.96  ? 152  ARG B CB  1 
ATOM   5324 C CG  . ARG B 1 151 ? -62.361 64.281 361.071 1.00 35.30  ? 152  ARG B CG  1 
ATOM   5325 C CD  . ARG B 1 151 ? -62.453 65.774 360.810 1.00 34.98  ? 152  ARG B CD  1 
ATOM   5326 N NE  . ARG B 1 151 ? -61.133 66.386 360.699 1.00 34.63  ? 152  ARG B NE  1 
ATOM   5327 C CZ  . ARG B 1 151 ? -60.925 67.656 360.371 1.00 37.40  ? 152  ARG B CZ  1 
ATOM   5328 N NH1 . ARG B 1 151 ? -61.954 68.454 360.110 1.00 33.00  ? 152  ARG B NH1 1 
ATOM   5329 N NH2 . ARG B 1 151 ? -59.687 68.127 360.299 1.00 31.86  ? 152  ARG B NH2 1 
ATOM   5330 N N   . VAL B 1 152 ? -62.960 60.588 358.536 1.00 34.75  ? 153  VAL B N   1 
ATOM   5331 C CA  . VAL B 1 152 ? -63.234 59.790 357.350 1.00 29.73  ? 153  VAL B CA  1 
ATOM   5332 C C   . VAL B 1 152 ? -64.519 60.298 356.698 1.00 36.23  ? 153  VAL B C   1 
ATOM   5333 O O   . VAL B 1 152 ? -65.244 61.123 357.255 1.00 32.53  ? 153  VAL B O   1 
ATOM   5334 C CB  . VAL B 1 152 ? -63.339 58.283 357.666 1.00 34.16  ? 153  VAL B CB  1 
ATOM   5335 C CG1 . VAL B 1 152 ? -61.993 57.735 358.116 1.00 31.16  ? 153  VAL B CG1 1 
ATOM   5336 C CG2 . VAL B 1 152 ? -64.399 58.030 358.728 1.00 28.85  ? 153  VAL B CG2 1 
ATOM   5337 N N   . GLY B 1 153 ? -64.788 59.788 355.494 1.00 44.23  ? 154  GLY B N   1 
ATOM   5338 C CA  . GLY B 1 153 ? -65.978 60.182 354.765 1.00 29.29  ? 154  GLY B CA  1 
ATOM   5339 C C   . GLY B 1 153 ? -65.940 61.651 354.377 1.00 36.30  ? 154  GLY B C   1 
ATOM   5340 O O   . GLY B 1 153 ? -64.878 62.244 354.170 1.00 37.26  ? 154  GLY B O   1 
ATOM   5341 N N   . ALA B 1 154 ? -67.129 62.251 354.283 1.00 33.55  ? 155  ALA B N   1 
ATOM   5342 C CA  . ALA B 1 154 ? -67.206 63.665 353.936 1.00 35.76  ? 155  ALA B CA  1 
ATOM   5343 C C   . ALA B 1 154 ? -66.512 64.537 354.974 1.00 33.67  ? 155  ALA B C   1 
ATOM   5344 O O   . ALA B 1 154 ? -65.910 65.556 354.621 1.00 34.24  ? 155  ALA B O   1 
ATOM   5345 C CB  . ALA B 1 154 ? -68.665 64.093 353.775 1.00 33.98  ? 155  ALA B CB  1 
ATOM   5346 N N   . PHE B 1 155 ? -66.573 64.147 356.252 1.00 28.97  ? 156  PHE B N   1 
ATOM   5347 C CA  . PHE B 1 155 ? -65.968 64.953 357.308 1.00 32.47  ? 156  PHE B CA  1 
ATOM   5348 C C   . PHE B 1 155 ? -64.463 65.092 357.127 1.00 32.19  ? 156  PHE B C   1 
ATOM   5349 O O   . PHE B 1 155 ? -63.875 66.080 357.580 1.00 40.71  ? 156  PHE B O   1 
ATOM   5350 C CB  . PHE B 1 155 ? -66.282 64.345 358.678 1.00 30.48  ? 156  PHE B CB  1 
ATOM   5351 C CG  . PHE B 1 155 ? -67.736 64.039 358.876 1.00 37.73  ? 156  PHE B CG  1 
ATOM   5352 C CD1 . PHE B 1 155 ? -68.616 65.026 359.286 1.00 34.62  ? 156  PHE B CD1 1 
ATOM   5353 C CD2 . PHE B 1 155 ? -68.228 62.767 358.633 1.00 40.17  ? 156  PHE B CD2 1 
ATOM   5354 C CE1 . PHE B 1 155 ? -69.957 64.748 359.459 1.00 41.43  ? 156  PHE B CE1 1 
ATOM   5355 C CE2 . PHE B 1 155 ? -69.568 62.484 358.802 1.00 42.02  ? 156  PHE B CE2 1 
ATOM   5356 C CZ  . PHE B 1 155 ? -70.433 63.474 359.215 1.00 40.01  ? 156  PHE B CZ  1 
ATOM   5357 N N   . GLY B 1 156 ? -63.826 64.131 356.463 1.00 38.30  ? 157  GLY B N   1 
ATOM   5358 C CA  . GLY B 1 156 ? -62.390 64.182 356.286 1.00 34.30  ? 157  GLY B CA  1 
ATOM   5359 C C   . GLY B 1 156 ? -61.920 64.493 354.879 1.00 36.29  ? 157  GLY B C   1 
ATOM   5360 O O   . GLY B 1 156 ? -60.770 64.902 354.694 1.00 35.85  ? 157  GLY B O   1 
ATOM   5361 N N   . PHE B 1 157 ? -62.783 64.304 353.872 1.00 32.95  ? 158  PHE B N   1 
ATOM   5362 C CA  . PHE B 1 157 ? -62.320 64.406 352.493 1.00 35.98  ? 158  PHE B CA  1 
ATOM   5363 C C   . PHE B 1 157 ? -63.325 65.043 351.539 1.00 36.09  ? 158  PHE B C   1 
ATOM   5364 O O   . PHE B 1 157 ? -63.125 64.964 350.319 1.00 44.20  ? 158  PHE B O   1 
ATOM   5365 C CB  . PHE B 1 157 ? -61.909 63.017 351.974 1.00 29.83  ? 158  PHE B CB  1 
ATOM   5366 C CG  . PHE B 1 157 ? -60.807 62.388 352.778 1.00 38.60  ? 158  PHE B CG  1 
ATOM   5367 C CD1 . PHE B 1 157 ? -61.095 61.476 353.782 1.00 31.97  ? 158  PHE B CD1 1 
ATOM   5368 C CD2 . PHE B 1 157 ? -59.484 62.744 352.561 1.00 34.24  ? 158  PHE B CD2 1 
ATOM   5369 C CE1 . PHE B 1 157 ? -60.081 60.913 354.541 1.00 33.14  ? 158  PHE B CE1 1 
ATOM   5370 C CE2 . PHE B 1 157 ? -58.467 62.185 353.315 1.00 36.56  ? 158  PHE B CE2 1 
ATOM   5371 C CZ  . PHE B 1 157 ? -58.766 61.269 354.306 1.00 34.22  ? 158  PHE B CZ  1 
ATOM   5372 N N   . LEU B 1 158 ? -64.389 65.671 352.034 1.00 40.73  ? 159  LEU B N   1 
ATOM   5373 C CA  . LEU B 1 158 ? -65.229 66.478 351.159 1.00 41.08  ? 159  LEU B CA  1 
ATOM   5374 C C   . LEU B 1 158 ? -64.440 67.700 350.711 1.00 42.66  ? 159  LEU B C   1 
ATOM   5375 O O   . LEU B 1 158 ? -63.834 68.393 351.533 1.00 37.15  ? 159  LEU B O   1 
ATOM   5376 C CB  . LEU B 1 158 ? -66.516 66.901 351.868 1.00 45.53  ? 159  LEU B CB  1 
ATOM   5377 C CG  . LEU B 1 158 ? -67.515 67.734 351.056 1.00 38.92  ? 159  LEU B CG  1 
ATOM   5378 C CD1 . LEU B 1 158 ? -68.942 67.281 351.324 1.00 40.41  ? 159  LEU B CD1 1 
ATOM   5379 C CD2 . LEU B 1 158 ? -67.368 69.215 351.361 1.00 48.02  ? 159  LEU B CD2 1 
ATOM   5380 N N   . ALA B 1 159 ? -64.439 67.962 349.408 1.00 38.55  ? 160  ALA B N   1 
ATOM   5381 C CA  . ALA B 1 159 ? -63.603 69.019 348.861 1.00 44.11  ? 160  ALA B CA  1 
ATOM   5382 C C   . ALA B 1 159 ? -64.384 69.849 347.856 1.00 47.12  ? 160  ALA B C   1 
ATOM   5383 O O   . ALA B 1 159 ? -64.987 69.304 346.927 1.00 40.70  ? 160  ALA B O   1 
ATOM   5384 C CB  . ALA B 1 159 ? -62.347 68.439 348.198 1.00 41.66  ? 160  ALA B CB  1 
ATOM   5385 N N   . LEU B 1 160 ? -64.378 71.165 348.059 1.00 52.31  ? 161  LEU B N   1 
ATOM   5386 C CA  . LEU B 1 160 ? -64.742 72.142 347.038 1.00 51.08  ? 161  LEU B CA  1 
ATOM   5387 C C   . LEU B 1 160 ? -63.450 72.848 346.649 1.00 50.77  ? 161  LEU B C   1 
ATOM   5388 O O   . LEU B 1 160 ? -63.096 73.876 347.244 1.00 54.92  ? 161  LEU B O   1 
ATOM   5389 C CB  . LEU B 1 160 ? -65.782 73.137 347.557 1.00 50.94  ? 161  LEU B CB  1 
ATOM   5390 C CG  . LEU B 1 160 ? -67.184 72.570 347.789 1.00 47.68  ? 161  LEU B CG  1 
ATOM   5391 C CD1 . LEU B 1 160 ? -68.095 73.629 348.382 1.00 56.44  ? 161  LEU B CD1 1 
ATOM   5392 C CD2 . LEU B 1 160 ? -67.769 72.024 346.492 1.00 44.65  ? 161  LEU B CD2 1 
ATOM   5393 N N   . PRO B 1 161 ? -62.701 72.323 345.677 1.00 54.53  ? 162  PRO B N   1 
ATOM   5394 C CA  . PRO B 1 161 ? -61.330 72.803 345.449 1.00 50.34  ? 162  PRO B CA  1 
ATOM   5395 C C   . PRO B 1 161 ? -61.278 74.292 345.135 1.00 56.07  ? 162  PRO B C   1 
ATOM   5396 O O   . PRO B 1 161 ? -62.104 74.822 344.389 1.00 55.27  ? 162  PRO B O   1 
ATOM   5397 C CB  . PRO B 1 161 ? -60.854 71.960 344.261 1.00 46.82  ? 162  PRO B CB  1 
ATOM   5398 C CG  . PRO B 1 161 ? -61.692 70.723 344.315 1.00 52.65  ? 162  PRO B CG  1 
ATOM   5399 C CD  . PRO B 1 161 ? -63.030 71.153 344.845 1.00 48.03  ? 162  PRO B CD  1 
ATOM   5400 N N   . GLY B 1 162 ? -60.285 74.964 345.718 1.00 59.41  ? 163  GLY B N   1 
ATOM   5401 C CA  . GLY B 1 162 ? -60.151 76.397 345.618 1.00 63.32  ? 163  GLY B CA  1 
ATOM   5402 C C   . GLY B 1 162 ? -60.804 77.169 346.744 1.00 63.10  ? 163  GLY B C   1 
ATOM   5403 O O   . GLY B 1 162 ? -60.452 78.333 346.964 1.00 70.18  ? 163  GLY B O   1 
ATOM   5404 N N   . SER B 1 163 ? -61.738 76.555 347.460 1.00 58.88  ? 164  SER B N   1 
ATOM   5405 C CA  . SER B 1 163 ? -62.409 77.187 348.584 1.00 56.11  ? 164  SER B CA  1 
ATOM   5406 C C   . SER B 1 163 ? -61.602 77.001 349.866 1.00 58.26  ? 164  SER B C   1 
ATOM   5407 O O   . SER B 1 163 ? -60.813 76.064 350.003 1.00 61.97  ? 164  SER B O   1 
ATOM   5408 C CB  . SER B 1 163 ? -63.813 76.609 348.766 1.00 61.37  ? 164  SER B CB  1 
ATOM   5409 O OG  . SER B 1 163 ? -63.804 75.554 349.716 1.00 66.30  ? 164  SER B OG  1 
ATOM   5410 N N   . ARG B 1 164 ? -61.815 77.911 350.810 1.00 59.25  ? 165  ARG B N   1 
ATOM   5411 C CA  . ARG B 1 164 ? -61.199 77.796 352.122 1.00 64.78  ? 165  ARG B CA  1 
ATOM   5412 C C   . ARG B 1 164 ? -62.115 77.184 353.171 1.00 55.21  ? 165  ARG B C   1 
ATOM   5413 O O   . ARG B 1 164 ? -61.641 76.851 354.259 1.00 70.07  ? 165  ARG B O   1 
ATOM   5414 C CB  . ARG B 1 164 ? -60.718 79.168 352.608 1.00 65.02  ? 165  ARG B CB  1 
ATOM   5415 C CG  . ARG B 1 164 ? -59.517 79.679 351.849 1.00 93.49  ? 165  ARG B CG  1 
ATOM   5416 C CD  . ARG B 1 164 ? -58.751 80.706 352.661 1.00 103.97 ? 165  ARG B CD  1 
ATOM   5417 N NE  . ARG B 1 164 ? -57.431 80.218 353.052 1.00 115.85 ? 165  ARG B NE  1 
ATOM   5418 C CZ  . ARG B 1 164 ? -57.148 79.694 354.240 1.00 119.57 ? 165  ARG B CZ  1 
ATOM   5419 N NH1 . ARG B 1 164 ? -58.094 79.589 355.164 1.00 114.26 ? 165  ARG B NH1 1 
ATOM   5420 N NH2 . ARG B 1 164 ? -55.917 79.277 354.505 1.00 119.61 ? 165  ARG B NH2 1 
ATOM   5421 N N   . GLU B 1 165 ? -63.401 77.024 352.867 1.00 53.80  ? 166  GLU B N   1 
ATOM   5422 C CA  . GLU B 1 165 ? -64.321 76.426 353.826 1.00 65.84  ? 166  GLU B CA  1 
ATOM   5423 C C   . GLU B 1 165 ? -64.352 74.905 353.714 1.00 50.61  ? 166  GLU B C   1 
ATOM   5424 O O   . GLU B 1 165 ? -64.687 74.217 354.686 1.00 55.63  ? 166  GLU B O   1 
ATOM   5425 C CB  . GLU B 1 165 ? -65.710 77.027 353.645 1.00 55.82  ? 166  GLU B CB  1 
ATOM   5426 C CG  . GLU B 1 165 ? -65.771 78.471 354.093 1.00 83.19  ? 166  GLU B CG  1 
ATOM   5427 C CD  . GLU B 1 165 ? -66.010 79.442 352.933 1.00 94.11  ? 166  GLU B CD  1 
ATOM   5428 O OE1 . GLU B 1 165 ? -65.814 79.033 351.767 1.00 86.25  ? 166  GLU B OE1 1 
ATOM   5429 O OE2 . GLU B 1 165 ? -66.328 80.620 353.193 1.00 100.30 ? 166  GLU B OE2 1 
ATOM   5430 N N   . ALA B 1 166 ? -63.960 74.359 352.559 1.00 46.51  ? 167  ALA B N   1 
ATOM   5431 C CA  . ALA B 1 166 ? -63.803 72.909 352.386 1.00 48.82  ? 167  ALA B CA  1 
ATOM   5432 C C   . ALA B 1 166 ? -62.637 72.651 351.446 1.00 48.44  ? 167  ALA B C   1 
ATOM   5433 O O   . ALA B 1 166 ? -62.822 72.287 350.279 1.00 51.02  ? 167  ALA B O   1 
ATOM   5434 C CB  . ALA B 1 166 ? -65.084 72.282 351.843 1.00 44.91  ? 167  ALA B CB  1 
ATOM   5435 N N   . PRO B 1 167 ? -61.402 72.817 351.932 1.00 51.16  ? 168  PRO B N   1 
ATOM   5436 C CA  . PRO B 1 167 ? -60.241 72.659 351.041 1.00 47.11  ? 168  PRO B CA  1 
ATOM   5437 C C   . PRO B 1 167 ? -59.985 71.220 350.622 1.00 49.82  ? 168  PRO B C   1 
ATOM   5438 O O   . PRO B 1 167 ? -59.421 70.991 349.545 1.00 50.39  ? 168  PRO B O   1 
ATOM   5439 C CB  . PRO B 1 167 ? -59.085 73.216 351.879 1.00 39.27  ? 168  PRO B CB  1 
ATOM   5440 C CG  . PRO B 1 167 ? -59.505 72.939 353.289 1.00 43.70  ? 168  PRO B CG  1 
ATOM   5441 C CD  . PRO B 1 167 ? -61.000 73.125 353.317 1.00 42.08  ? 168  PRO B CD  1 
ATOM   5442 N N   . GLY B 1 168 ? -60.384 70.247 351.430 1.00 46.97  ? 169  GLY B N   1 
ATOM   5443 C CA  . GLY B 1 168 ? -60.117 68.858 351.132 1.00 42.00  ? 169  GLY B CA  1 
ATOM   5444 C C   . GLY B 1 168 ? -58.867 68.350 351.835 1.00 41.38  ? 169  GLY B C   1 
ATOM   5445 O O   . GLY B 1 168 ? -58.025 69.115 352.313 1.00 45.30  ? 169  GLY B O   1 
ATOM   5446 N N   . ASN B 1 169 ? -58.765 67.022 351.909 1.00 39.69  ? 170  ASN B N   1 
ATOM   5447 C CA  . ASN B 1 169 ? -57.618 66.318 352.481 1.00 38.76  ? 170  ASN B CA  1 
ATOM   5448 C C   . ASN B 1 169 ? -57.418 66.609 353.967 1.00 32.32  ? 170  ASN B C   1 
ATOM   5449 O O   . ASN B 1 169 ? -56.334 66.359 354.504 1.00 38.50  ? 170  ASN B O   1 
ATOM   5450 C CB  . ASN B 1 169 ? -56.332 66.634 351.704 1.00 27.63  ? 170  ASN B CB  1 
ATOM   5451 C CG  . ASN B 1 169 ? -56.416 66.211 350.253 1.00 41.60  ? 170  ASN B CG  1 
ATOM   5452 O OD1 . ASN B 1 169 ? -57.070 65.223 349.928 1.00 40.45  ? 170  ASN B OD1 1 
ATOM   5453 N ND2 . ASN B 1 169 ? -55.754 66.955 349.371 1.00 38.26  ? 170  ASN B ND2 1 
ATOM   5454 N N   . VAL B 1 170 ? -58.445 67.115 354.659 1.00 28.81  ? 171  VAL B N   1 
ATOM   5455 C CA  . VAL B 1 170 ? -58.273 67.448 356.071 1.00 34.41  ? 171  VAL B CA  1 
ATOM   5456 C C   . VAL B 1 170 ? -58.115 66.185 356.910 1.00 32.74  ? 171  VAL B C   1 
ATOM   5457 O O   . VAL B 1 170 ? -57.498 66.218 357.981 1.00 34.73  ? 171  VAL B O   1 
ATOM   5458 C CB  . VAL B 1 170 ? -59.433 68.331 356.575 1.00 38.80  ? 171  VAL B CB  1 
ATOM   5459 C CG1 . VAL B 1 170 ? -59.542 69.592 355.729 1.00 31.12  ? 171  VAL B CG1 1 
ATOM   5460 C CG2 . VAL B 1 170 ? -60.753 67.564 356.594 1.00 32.75  ? 171  VAL B CG2 1 
ATOM   5461 N N   . GLY B 1 171 ? -58.650 65.055 356.445 1.00 37.73  ? 172  GLY B N   1 
ATOM   5462 C CA  . GLY B 1 171 ? -58.367 63.795 357.113 1.00 26.50  ? 172  GLY B CA  1 
ATOM   5463 C C   . GLY B 1 171 ? -56.897 63.427 357.040 1.00 35.73  ? 172  GLY B C   1 
ATOM   5464 O O   . GLY B 1 171 ? -56.341 62.861 357.985 1.00 34.81  ? 172  GLY B O   1 
ATOM   5465 N N   . LEU B 1 172 ? -56.248 63.740 355.913 1.00 35.66  ? 173  LEU B N   1 
ATOM   5466 C CA  . LEU B 1 172 ? -54.802 63.560 355.810 1.00 34.31  ? 173  LEU B CA  1 
ATOM   5467 C C   . LEU B 1 172 ? -54.063 64.517 356.734 1.00 35.43  ? 173  LEU B C   1 
ATOM   5468 O O   . LEU B 1 172 ? -53.046 64.149 357.335 1.00 33.26  ? 173  LEU B O   1 
ATOM   5469 C CB  . LEU B 1 172 ? -54.343 63.767 354.367 1.00 29.66  ? 173  LEU B CB  1 
ATOM   5470 C CG  . LEU B 1 172 ? -54.777 62.737 353.327 1.00 37.03  ? 173  LEU B CG  1 
ATOM   5471 C CD1 . LEU B 1 172 ? -54.357 63.179 351.932 1.00 32.01  ? 173  LEU B CD1 1 
ATOM   5472 C CD2 . LEU B 1 172 ? -54.180 61.384 353.666 1.00 32.21  ? 173  LEU B CD2 1 
ATOM   5473 N N   . LEU B 1 173 ? -54.553 65.753 356.853 1.00 28.51  ? 174  LEU B N   1 
ATOM   5474 C CA  . LEU B 1 173 ? -53.939 66.701 357.775 1.00 35.25  ? 174  LEU B CA  1 
ATOM   5475 C C   . LEU B 1 173 ? -54.133 66.281 359.228 1.00 34.75  ? 174  LEU B C   1 
ATOM   5476 O O   . LEU B 1 173 ? -53.291 66.597 360.075 1.00 38.28  ? 174  LEU B O   1 
ATOM   5477 C CB  . LEU B 1 173 ? -54.499 68.103 357.536 1.00 31.40  ? 174  LEU B CB  1 
ATOM   5478 C CG  . LEU B 1 173 ? -54.203 68.698 356.157 1.00 40.05  ? 174  LEU B CG  1 
ATOM   5479 C CD1 . LEU B 1 173 ? -54.810 70.085 356.016 1.00 31.07  ? 174  LEU B CD1 1 
ATOM   5480 C CD2 . LEU B 1 173 ? -52.704 68.738 355.908 1.00 37.73  ? 174  LEU B CD2 1 
ATOM   5481 N N   . ASP B 1 174 ? -55.227 65.575 359.539 1.00 39.96  ? 175  ASP B N   1 
ATOM   5482 C CA  . ASP B 1 174 ? -55.378 64.995 360.873 1.00 33.61  ? 175  ASP B CA  1 
ATOM   5483 C C   . ASP B 1 174 ? -54.228 64.048 361.178 1.00 38.37  ? 175  ASP B C   1 
ATOM   5484 O O   . ASP B 1 174 ? -53.643 64.089 362.268 1.00 35.75  ? 175  ASP B O   1 
ATOM   5485 C CB  . ASP B 1 174 ? -56.708 64.246 360.992 1.00 32.20  ? 175  ASP B CB  1 
ATOM   5486 C CG  . ASP B 1 174 ? -57.912 65.163 360.940 1.00 42.95  ? 175  ASP B CG  1 
ATOM   5487 O OD1 . ASP B 1 174 ? -57.737 66.393 361.063 1.00 36.87  ? 175  ASP B OD1 1 
ATOM   5488 O OD2 . ASP B 1 174 ? -59.039 64.647 360.775 1.00 38.57  ? 175  ASP B OD2 1 
ATOM   5489 N N   . GLN B 1 175 ? -53.893 63.178 360.221 1.00 32.45  ? 176  GLN B N   1 
ATOM   5490 C CA  . GLN B 1 175 ? -52.792 62.243 360.419 1.00 35.49  ? 176  GLN B CA  1 
ATOM   5491 C C   . GLN B 1 175 ? -51.467 62.979 360.564 1.00 35.21  ? 176  GLN B C   1 
ATOM   5492 O O   . GLN B 1 175 ? -50.646 62.633 361.422 1.00 35.31  ? 176  GLN B O   1 
ATOM   5493 C CB  . GLN B 1 175 ? -52.727 61.250 359.259 1.00 28.23  ? 176  GLN B CB  1 
ATOM   5494 C CG  . GLN B 1 175 ? -54.004 60.456 359.011 1.00 32.82  ? 176  GLN B CG  1 
ATOM   5495 C CD  . GLN B 1 175 ? -53.944 59.656 357.717 1.00 44.15  ? 176  GLN B CD  1 
ATOM   5496 O OE1 . GLN B 1 175 ? -52.899 59.589 357.065 1.00 29.82  ? 176  GLN B OE1 1 
ATOM   5497 N NE2 . GLN B 1 175 ? -55.067 59.052 357.337 1.00 25.53  ? 176  GLN B NE2 1 
ATOM   5498 N N   . ARG B 1 176 ? -51.241 64.000 359.732 1.00 31.19  ? 177  ARG B N   1 
ATOM   5499 C CA  . ARG B 1 176 ? -49.986 64.742 359.799 1.00 38.71  ? 177  ARG B CA  1 
ATOM   5500 C C   . ARG B 1 176 ? -49.842 65.453 361.136 1.00 36.00  ? 177  ARG B C   1 
ATOM   5501 O O   . ARG B 1 176 ? -48.747 65.495 361.712 1.00 32.21  ? 177  ARG B O   1 
ATOM   5502 C CB  . ARG B 1 176 ? -49.900 65.748 358.653 1.00 31.58  ? 177  ARG B CB  1 
ATOM   5503 C CG  . ARG B 1 176 ? -48.705 66.686 358.757 1.00 31.20  ? 177  ARG B CG  1 
ATOM   5504 C CD  . ARG B 1 176 ? -48.732 67.732 357.664 1.00 35.20  ? 177  ARG B CD  1 
ATOM   5505 N NE  . ARG B 1 176 ? -48.440 67.156 356.354 1.00 38.22  ? 177  ARG B NE  1 
ATOM   5506 C CZ  . ARG B 1 176 ? -48.593 67.808 355.206 1.00 42.09  ? 177  ARG B CZ  1 
ATOM   5507 N NH1 . ARG B 1 176 ? -49.044 69.055 355.209 1.00 45.57  ? 177  ARG B NH1 1 
ATOM   5508 N NH2 . ARG B 1 176 ? -48.302 67.212 354.057 1.00 35.64  ? 177  ARG B NH2 1 
ATOM   5509 N N   . LEU B 1 177 ? -50.941 66.014 361.648 1.00 35.56  ? 178  LEU B N   1 
ATOM   5510 C CA  . LEU B 1 177 ? -50.905 66.651 362.959 1.00 35.58  ? 178  LEU B CA  1 
ATOM   5511 C C   . LEU B 1 177 ? -50.534 65.649 364.045 1.00 35.96  ? 178  LEU B C   1 
ATOM   5512 O O   . LEU B 1 177 ? -49.770 65.973 364.962 1.00 36.58  ? 178  LEU B O   1 
ATOM   5513 C CB  . LEU B 1 177 ? -52.254 67.303 363.262 1.00 30.01  ? 178  LEU B CB  1 
ATOM   5514 C CG  . LEU B 1 177 ? -52.361 68.042 364.600 1.00 42.11  ? 178  LEU B CG  1 
ATOM   5515 C CD1 . LEU B 1 177 ? -51.382 69.204 364.656 1.00 38.86  ? 178  LEU B CD1 1 
ATOM   5516 C CD2 . LEU B 1 177 ? -53.777 68.532 364.828 1.00 41.01  ? 178  LEU B CD2 1 
ATOM   5517 N N   . ALA B 1 178 ? -51.058 64.423 363.956 1.00 35.74  ? 179  ALA B N   1 
ATOM   5518 C CA  . ALA B 1 178 ? -50.681 63.391 364.915 1.00 31.07  ? 179  ALA B CA  1 
ATOM   5519 C C   . ALA B 1 178 ? -49.207 63.029 364.778 1.00 34.29  ? 179  ALA B C   1 
ATOM   5520 O O   . ALA B 1 178 ? -48.540 62.728 365.775 1.00 34.37  ? 179  ALA B O   1 
ATOM   5521 C CB  . ALA B 1 178 ? -51.561 62.153 364.733 1.00 25.18  ? 179  ALA B CB  1 
ATOM   5522 N N   . LEU B 1 179 ? -48.683 63.058 363.550 1.00 33.06  ? 180  LEU B N   1 
ATOM   5523 C CA  . LEU B 1 179 ? -47.259 62.818 363.339 1.00 37.09  ? 180  LEU B CA  1 
ATOM   5524 C C   . LEU B 1 179 ? -46.416 63.941 363.929 1.00 38.57  ? 180  LEU B C   1 
ATOM   5525 O O   . LEU B 1 179 ? -45.334 63.690 364.473 1.00 34.35  ? 180  LEU B O   1 
ATOM   5526 C CB  . LEU B 1 179 ? -46.969 62.660 361.847 1.00 36.44  ? 180  LEU B CB  1 
ATOM   5527 C CG  . LEU B 1 179 ? -47.520 61.390 361.198 1.00 38.89  ? 180  LEU B CG  1 
ATOM   5528 C CD1 . LEU B 1 179 ? -47.134 61.307 359.725 1.00 35.71  ? 180  LEU B CD1 1 
ATOM   5529 C CD2 . LEU B 1 179 ? -47.020 60.179 361.953 1.00 33.45  ? 180  LEU B CD2 1 
ATOM   5530 N N   . GLN B 1 180 ? -46.885 65.186 363.819 1.00 32.79  ? 181  GLN B N   1 
ATOM   5531 C CA  . GLN B 1 180 ? -46.187 66.288 364.470 1.00 29.86  ? 181  GLN B CA  1 
ATOM   5532 C C   . GLN B 1 180 ? -46.270 66.159 365.985 1.00 41.67  ? 181  GLN B C   1 
ATOM   5533 O O   . GLN B 1 180 ? -45.311 66.481 366.697 1.00 38.25  ? 181  GLN B O   1 
ATOM   5534 C CB  . GLN B 1 180 ? -46.767 67.625 364.010 1.00 33.68  ? 181  GLN B CB  1 
ATOM   5535 C CG  . GLN B 1 180 ? -46.534 67.923 362.537 1.00 51.84  ? 181  GLN B CG  1 
ATOM   5536 C CD  . GLN B 1 180 ? -47.277 69.158 362.064 1.00 58.13  ? 181  GLN B CD  1 
ATOM   5537 O OE1 . GLN B 1 180 ? -48.116 69.706 362.780 1.00 61.95  ? 181  GLN B OE1 1 
ATOM   5538 N NE2 . GLN B 1 180 ? -46.968 69.606 360.853 1.00 45.89  ? 181  GLN B NE2 1 
ATOM   5539 N N   . TRP B 1 181 ? -47.410 65.683 366.490 1.00 28.95  ? 182  TRP B N   1 
ATOM   5540 C CA  . TRP B 1 181 ? -47.549 65.452 367.923 1.00 38.67  ? 182  TRP B CA  1 
ATOM   5541 C C   . TRP B 1 181 ? -46.542 64.415 368.405 1.00 39.83  ? 182  TRP B C   1 
ATOM   5542 O O   . TRP B 1 181 ? -45.985 64.541 369.501 1.00 39.79  ? 182  TRP B O   1 
ATOM   5543 C CB  . TRP B 1 181 ? -48.980 65.011 368.237 1.00 29.20  ? 182  TRP B CB  1 
ATOM   5544 C CG  . TRP B 1 181 ? -49.293 64.917 369.699 1.00 33.33  ? 182  TRP B CG  1 
ATOM   5545 C CD1 . TRP B 1 181 ? -49.898 65.868 370.470 1.00 34.91  ? 182  TRP B CD1 1 
ATOM   5546 C CD2 . TRP B 1 181 ? -49.027 63.807 370.567 1.00 29.51  ? 182  TRP B CD2 1 
ATOM   5547 N NE1 . TRP B 1 181 ? -50.024 65.419 371.762 1.00 36.87  ? 182  TRP B NE1 1 
ATOM   5548 C CE2 . TRP B 1 181 ? -49.497 64.158 371.849 1.00 30.67  ? 182  TRP B CE2 1 
ATOM   5549 C CE3 . TRP B 1 181 ? -48.439 62.551 370.385 1.00 31.75  ? 182  TRP B CE3 1 
ATOM   5550 C CZ2 . TRP B 1 181 ? -49.395 63.301 372.944 1.00 32.85  ? 182  TRP B CZ2 1 
ATOM   5551 C CZ3 . TRP B 1 181 ? -48.337 61.701 371.475 1.00 32.22  ? 182  TRP B CZ3 1 
ATOM   5552 C CH2 . TRP B 1 181 ? -48.814 62.080 372.737 1.00 36.92  ? 182  TRP B CH2 1 
ATOM   5553 N N   . VAL B 1 182 ? -46.289 63.389 367.589 1.00 35.52  ? 183  VAL B N   1 
ATOM   5554 C CA  . VAL B 1 182 ? -45.328 62.354 367.961 1.00 37.26  ? 183  VAL B CA  1 
ATOM   5555 C C   . VAL B 1 182 ? -43.925 62.943 368.048 1.00 39.72  ? 183  VAL B C   1 
ATOM   5556 O O   . VAL B 1 182 ? -43.189 62.697 369.010 1.00 40.27  ? 183  VAL B O   1 
ATOM   5557 C CB  . VAL B 1 182 ? -45.399 61.179 366.968 1.00 36.51  ? 183  VAL B CB  1 
ATOM   5558 C CG1 . VAL B 1 182 ? -44.185 60.260 367.114 1.00 26.83  ? 183  VAL B CG1 1 
ATOM   5559 C CG2 . VAL B 1 182 ? -46.692 60.396 367.175 1.00 26.57  ? 183  VAL B CG2 1 
ATOM   5560 N N   . GLN B 1 183 ? -43.543 63.749 367.053 1.00 35.06  ? 184  GLN B N   1 
ATOM   5561 C CA  . GLN B 1 183 ? -42.221 64.370 367.065 1.00 43.20  ? 184  GLN B CA  1 
ATOM   5562 C C   . GLN B 1 183 ? -41.990 65.192 368.327 1.00 45.08  ? 184  GLN B C   1 
ATOM   5563 O O   . GLN B 1 183 ? -40.873 65.218 368.857 1.00 40.81  ? 184  GLN B O   1 
ATOM   5564 C CB  . GLN B 1 183 ? -42.044 65.249 365.825 1.00 33.60  ? 184  GLN B CB  1 
ATOM   5565 C CG  . GLN B 1 183 ? -41.741 64.468 364.559 1.00 37.30  ? 184  GLN B CG  1 
ATOM   5566 C CD  . GLN B 1 183 ? -40.465 63.663 364.676 1.00 42.31  ? 184  GLN B CD  1 
ATOM   5567 O OE1 . GLN B 1 183 ? -39.402 64.206 364.978 1.00 47.75  ? 184  GLN B OE1 1 
ATOM   5568 N NE2 . GLN B 1 183 ? -40.564 62.359 364.447 1.00 37.37  ? 184  GLN B NE2 1 
ATOM   5569 N N   . GLU B 1 184 ? -43.032 65.843 368.838 1.00 34.29  ? 185  GLU B N   1 
ATOM   5570 C CA  . GLU B 1 184 ? -42.883 66.760 369.958 1.00 48.98  ? 185  GLU B CA  1 
ATOM   5571 C C   . GLU B 1 184 ? -43.084 66.109 371.322 1.00 46.89  ? 185  GLU B C   1 
ATOM   5572 O O   . GLU B 1 184 ? -42.628 66.668 372.325 1.00 55.65  ? 185  GLU B O   1 
ATOM   5573 C CB  . GLU B 1 184 ? -43.868 67.922 369.809 1.00 48.52  ? 185  GLU B CB  1 
ATOM   5574 C CG  . GLU B 1 184 ? -43.328 69.073 368.979 1.00 68.94  ? 185  GLU B CG  1 
ATOM   5575 C CD  . GLU B 1 184 ? -44.402 69.769 368.166 1.00 85.42  ? 185  GLU B CD  1 
ATOM   5576 O OE1 . GLU B 1 184 ? -45.271 70.430 368.772 1.00 88.40  ? 185  GLU B OE1 1 
ATOM   5577 O OE2 . GLU B 1 184 ? -44.370 69.666 366.921 1.00 88.79  ? 185  GLU B OE2 1 
ATOM   5578 N N   . ASN B 1 185 ? -43.742 64.949 371.395 1.00 39.39  ? 186  ASN B N   1 
ATOM   5579 C CA  . ASN B 1 185 ? -44.153 64.398 372.680 1.00 39.30  ? 186  ASN B CA  1 
ATOM   5580 C C   . ASN B 1 185 ? -43.802 62.935 372.904 1.00 41.26  ? 186  ASN B C   1 
ATOM   5581 O O   . ASN B 1 185 ? -43.904 62.475 374.047 1.00 43.59  ? 186  ASN B O   1 
ATOM   5582 C CB  . ASN B 1 185 ? -45.669 64.560 372.871 1.00 33.48  ? 186  ASN B CB  1 
ATOM   5583 C CG  . ASN B 1 185 ? -46.103 66.007 372.860 1.00 40.74  ? 186  ASN B CG  1 
ATOM   5584 O OD1 . ASN B 1 185 ? -45.904 66.730 373.834 1.00 45.64  ? 186  ASN B OD1 1 
ATOM   5585 N ND2 . ASN B 1 185 ? -46.706 66.439 371.757 1.00 39.17  ? 186  ASN B ND2 1 
ATOM   5586 N N   . VAL B 1 186 ? -43.402 62.188 371.872 1.00 35.72  ? 187  VAL B N   1 
ATOM   5587 C CA  . VAL B 1 186 ? -43.205 60.756 372.062 1.00 36.82  ? 187  VAL B CA  1 
ATOM   5588 C C   . VAL B 1 186 ? -42.021 60.461 372.976 1.00 41.50  ? 187  VAL B C   1 
ATOM   5589 O O   . VAL B 1 186 ? -41.982 59.392 373.596 1.00 38.65  ? 187  VAL B O   1 
ATOM   5590 C CB  . VAL B 1 186 ? -43.051 60.034 370.709 1.00 37.18  ? 187  VAL B CB  1 
ATOM   5591 C CG1 . VAL B 1 186 ? -41.631 60.174 370.163 1.00 28.21  ? 187  VAL B CG1 1 
ATOM   5592 C CG2 . VAL B 1 186 ? -43.437 58.566 370.855 1.00 29.48  ? 187  VAL B CG2 1 
ATOM   5593 N N   . ALA B 1 187 ? -41.061 61.385 373.096 1.00 42.94  ? 188  ALA B N   1 
ATOM   5594 C CA  . ALA B 1 187 ? -39.935 61.161 373.997 1.00 42.02  ? 188  ALA B CA  1 
ATOM   5595 C C   . ALA B 1 187 ? -40.365 61.132 375.458 1.00 44.69  ? 188  ALA B C   1 
ATOM   5596 O O   . ALA B 1 187 ? -39.691 60.496 376.275 1.00 44.06  ? 188  ALA B O   1 
ATOM   5597 C CB  . ALA B 1 187 ? -38.862 62.231 373.792 1.00 33.79  ? 188  ALA B CB  1 
ATOM   5598 N N   . ALA B 1 188 ? -41.470 61.800 375.802 1.00 38.58  ? 189  ALA B N   1 
ATOM   5599 C CA  . ALA B 1 188 ? -41.989 61.740 377.164 1.00 38.96  ? 189  ALA B CA  1 
ATOM   5600 C C   . ALA B 1 188 ? -42.485 60.349 377.533 1.00 45.66  ? 189  ALA B C   1 
ATOM   5601 O O   . ALA B 1 188 ? -42.672 60.069 378.722 1.00 47.81  ? 189  ALA B O   1 
ATOM   5602 C CB  . ALA B 1 188 ? -43.120 62.754 377.347 1.00 28.22  ? 189  ALA B CB  1 
ATOM   5603 N N   . PHE B 1 189 ? -42.715 59.482 376.547 1.00 45.06  ? 190  PHE B N   1 
ATOM   5604 C CA  . PHE B 1 189 ? -43.113 58.101 376.784 1.00 44.72  ? 190  PHE B CA  1 
ATOM   5605 C C   . PHE B 1 189 ? -41.961 57.124 376.607 1.00 45.69  ? 190  PHE B C   1 
ATOM   5606 O O   . PHE B 1 189 ? -42.175 55.911 376.694 1.00 41.08  ? 190  PHE B O   1 
ATOM   5607 C CB  . PHE B 1 189 ? -44.261 57.708 375.845 1.00 37.01  ? 190  PHE B CB  1 
ATOM   5608 C CG  . PHE B 1 189 ? -45.461 58.605 375.942 1.00 35.71  ? 190  PHE B CG  1 
ATOM   5609 C CD1 . PHE B 1 189 ? -45.524 59.780 375.212 1.00 33.66  ? 190  PHE B CD1 1 
ATOM   5610 C CD2 . PHE B 1 189 ? -46.528 58.270 376.756 1.00 30.00  ? 190  PHE B CD2 1 
ATOM   5611 C CE1 . PHE B 1 189 ? -46.626 60.606 375.298 1.00 42.67  ? 190  PHE B CE1 1 
ATOM   5612 C CE2 . PHE B 1 189 ? -47.633 59.092 376.846 1.00 31.94  ? 190  PHE B CE2 1 
ATOM   5613 C CZ  . PHE B 1 189 ? -47.682 60.261 376.119 1.00 31.57  ? 190  PHE B CZ  1 
ATOM   5614 N N   . GLY B 1 190 ? -40.750 57.621 376.362 1.00 37.27  ? 191  GLY B N   1 
ATOM   5615 C CA  . GLY B 1 190 ? -39.618 56.771 376.062 1.00 39.78  ? 191  GLY B CA  1 
ATOM   5616 C C   . GLY B 1 190 ? -39.407 56.493 374.592 1.00 52.63  ? 191  GLY B C   1 
ATOM   5617 O O   . GLY B 1 190 ? -38.542 55.678 374.248 1.00 43.40  ? 191  GLY B O   1 
ATOM   5618 N N   . GLY B 1 191 ? -40.167 57.140 373.712 1.00 44.44  ? 192  GLY B N   1 
ATOM   5619 C CA  . GLY B 1 191 ? -40.023 56.887 372.298 1.00 43.03  ? 192  GLY B CA  1 
ATOM   5620 C C   . GLY B 1 191 ? -38.928 57.721 371.671 1.00 46.12  ? 192  GLY B C   1 
ATOM   5621 O O   . GLY B 1 191 ? -38.549 58.782 372.165 1.00 60.66  ? 192  GLY B O   1 
ATOM   5622 N N   . ASP B 1 192 ? -38.414 57.219 370.552 1.00 43.67  ? 193  ASP B N   1 
ATOM   5623 C CA  . ASP B 1 192 ? -37.354 57.895 369.823 1.00 39.49  ? 193  ASP B CA  1 
ATOM   5624 C C   . ASP B 1 192 ? -37.952 58.620 368.629 1.00 48.12  ? 193  ASP B C   1 
ATOM   5625 O O   . ASP B 1 192 ? -38.291 57.967 367.631 1.00 48.56  ? 193  ASP B O   1 
ATOM   5626 C CB  . ASP B 1 192 ? -36.302 56.889 369.364 1.00 36.99  ? 193  ASP B CB  1 
ATOM   5627 C CG  . ASP B 1 192 ? -35.051 57.554 368.826 1.00 46.59  ? 193  ASP B CG  1 
ATOM   5628 O OD1 . ASP B 1 192 ? -34.048 56.839 368.622 1.00 60.90  ? 193  ASP B OD1 1 
ATOM   5629 O OD2 . ASP B 1 192 ? -35.062 58.785 368.611 1.00 52.83  ? 193  ASP B OD2 1 
ATOM   5630 N N   . PRO B 1 193 ? -38.084 59.949 368.665 1.00 47.62  ? 194  PRO B N   1 
ATOM   5631 C CA  . PRO B 1 193 ? -38.644 60.666 367.509 1.00 42.62  ? 194  PRO B CA  1 
ATOM   5632 C C   . PRO B 1 193 ? -37.765 60.616 366.273 1.00 49.62  ? 194  PRO B C   1 
ATOM   5633 O O   . PRO B 1 193 ? -38.233 60.997 365.192 1.00 39.61  ? 194  PRO B O   1 
ATOM   5634 C CB  . PRO B 1 193 ? -38.789 62.103 368.027 1.00 45.98  ? 194  PRO B CB  1 
ATOM   5635 C CG  . PRO B 1 193 ? -37.748 62.216 369.086 1.00 40.88  ? 194  PRO B CG  1 
ATOM   5636 C CD  . PRO B 1 193 ? -37.699 60.867 369.750 1.00 42.16  ? 194  PRO B CD  1 
ATOM   5637 N N   . THR B 1 194 ? -36.516 60.170 366.390 1.00 49.63  ? 195  THR B N   1 
ATOM   5638 C CA  . THR B 1 194 ? -35.628 60.028 365.243 1.00 47.37  ? 195  THR B CA  1 
ATOM   5639 C C   . THR B 1 194 ? -35.764 58.674 364.557 1.00 48.55  ? 195  THR B C   1 
ATOM   5640 O O   . THR B 1 194 ? -35.056 58.421 363.577 1.00 53.69  ? 195  THR B O   1 
ATOM   5641 C CB  . THR B 1 194 ? -34.166 60.236 365.663 1.00 46.18  ? 195  THR B CB  1 
ATOM   5642 O OG1 . THR B 1 194 ? -33.787 59.228 366.607 1.00 51.01  ? 195  THR B OG1 1 
ATOM   5643 C CG2 . THR B 1 194 ? -33.977 61.613 366.291 1.00 43.20  ? 195  THR B CG2 1 
ATOM   5644 N N   . SER B 1 195 ? -36.655 57.795 365.048 1.00 44.01  ? 196  SER B N   1 
ATOM   5645 C CA  . SER B 1 195 ? -36.843 56.456 364.493 1.00 47.18  ? 196  SER B CA  1 
ATOM   5646 C C   . SER B 1 195 ? -38.342 56.133 364.469 1.00 43.60  ? 196  SER B C   1 
ATOM   5647 O O   . SER B 1 195 ? -38.848 55.316 365.237 1.00 45.81  ? 196  SER B O   1 
ATOM   5648 C CB  . SER B 1 195 ? -36.063 55.410 365.293 1.00 42.64  ? 196  SER B CB  1 
ATOM   5649 O OG  . SER B 1 195 ? -35.984 54.186 364.582 1.00 54.39  ? 196  SER B OG  1 
ATOM   5650 N N   . VAL B 1 196 ? -39.069 56.778 363.562 1.00 40.79  ? 197  VAL B N   1 
ATOM   5651 C CA  . VAL B 1 196 ? -40.517 56.632 363.459 1.00 31.22  ? 197  VAL B CA  1 
ATOM   5652 C C   . VAL B 1 196 ? -40.833 55.865 362.181 1.00 41.78  ? 197  VAL B C   1 
ATOM   5653 O O   . VAL B 1 196 ? -40.449 56.284 361.080 1.00 34.24  ? 197  VAL B O   1 
ATOM   5654 C CB  . VAL B 1 196 ? -41.227 57.995 363.484 1.00 31.30  ? 197  VAL B CB  1 
ATOM   5655 C CG1 . VAL B 1 196 ? -42.714 57.829 363.210 1.00 33.24  ? 197  VAL B CG1 1 
ATOM   5656 C CG2 . VAL B 1 196 ? -41.009 58.675 364.826 1.00 37.56  ? 197  VAL B CG2 1 
ATOM   5657 N N   . THR B 1 197 ? -41.534 54.746 362.326 1.00 36.90  ? 198  THR B N   1 
ATOM   5658 C CA  . THR B 1 197 ? -41.938 53.916 361.200 1.00 30.61  ? 198  THR B CA  1 
ATOM   5659 C C   . THR B 1 197 ? -43.450 54.004 361.034 1.00 39.67  ? 198  THR B C   1 
ATOM   5660 O O   . THR B 1 197 ? -44.200 53.709 361.973 1.00 38.36  ? 198  THR B O   1 
ATOM   5661 C CB  . THR B 1 197 ? -41.502 52.463 361.402 1.00 44.43  ? 198  THR B CB  1 
ATOM   5662 O OG1 . THR B 1 197 ? -40.076 52.405 361.529 1.00 41.82  ? 198  THR B OG1 1 
ATOM   5663 C CG2 . THR B 1 197 ? -41.934 51.605 360.214 1.00 37.67  ? 198  THR B CG2 1 
ATOM   5664 N N   . LEU B 1 198 ? -43.892 54.419 359.849 1.00 33.54  ? 199  LEU B N   1 
ATOM   5665 C CA  . LEU B 1 198 ? -45.308 54.429 359.506 1.00 32.66  ? 199  LEU B CA  1 
ATOM   5666 C C   . LEU B 1 198 ? -45.708 53.064 358.966 1.00 33.49  ? 199  LEU B C   1 
ATOM   5667 O O   . LEU B 1 198 ? -45.034 52.520 358.087 1.00 39.26  ? 199  LEU B O   1 
ATOM   5668 C CB  . LEU B 1 198 ? -45.613 55.503 358.461 1.00 33.97  ? 199  LEU B CB  1 
ATOM   5669 C CG  . LEU B 1 198 ? -45.490 56.967 358.870 1.00 38.04  ? 199  LEU B CG  1 
ATOM   5670 C CD1 . LEU B 1 198 ? -46.115 57.870 357.813 1.00 29.65  ? 199  LEU B CD1 1 
ATOM   5671 C CD2 . LEU B 1 198 ? -46.141 57.183 360.219 1.00 42.89  ? 199  LEU B CD2 1 
ATOM   5672 N N   . PHE B 1 199 ? -46.797 52.509 359.494 1.00 32.12  ? 200  PHE B N   1 
ATOM   5673 C CA  . PHE B 1 199 ? -47.370 51.297 358.926 1.00 32.32  ? 200  PHE B CA  1 
ATOM   5674 C C   . PHE B 1 199 ? -48.883 51.433 358.883 1.00 37.34  ? 200  PHE B C   1 
ATOM   5675 O O   . PHE B 1 199 ? -49.495 52.009 359.785 1.00 35.83  ? 200  PHE B O   1 
ATOM   5676 C CB  . PHE B 1 199 ? -46.916 50.016 359.679 1.00 39.98  ? 200  PHE B CB  1 
ATOM   5677 C CG  . PHE B 1 199 ? -47.737 49.648 360.902 1.00 43.85  ? 200  PHE B CG  1 
ATOM   5678 C CD1 . PHE B 1 199 ? -48.269 48.371 361.024 1.00 48.19  ? 200  PHE B CD1 1 
ATOM   5679 C CD2 . PHE B 1 199 ? -47.905 50.533 361.955 1.00 43.67  ? 200  PHE B CD2 1 
ATOM   5680 C CE1 . PHE B 1 199 ? -48.991 48.005 362.151 1.00 73.53  ? 200  PHE B CE1 1 
ATOM   5681 C CE2 . PHE B 1 199 ? -48.630 50.173 363.077 1.00 50.63  ? 200  PHE B CE2 1 
ATOM   5682 C CZ  . PHE B 1 199 ? -49.170 48.908 363.174 1.00 71.38  ? 200  PHE B CZ  1 
ATOM   5683 N N   . GLY B 1 200 ? -49.472 50.937 357.802 1.00 38.87  ? 201  GLY B N   1 
ATOM   5684 C CA  . GLY B 1 200 ? -50.904 51.041 357.608 1.00 30.74  ? 201  GLY B CA  1 
ATOM   5685 C C   . GLY B 1 200 ? -51.368 50.027 356.592 1.00 40.40  ? 201  GLY B C   1 
ATOM   5686 O O   . GLY B 1 200 ? -50.570 49.469 355.831 1.00 32.67  ? 201  GLY B O   1 
ATOM   5687 N N   . GLU B 1 201 ? -52.677 49.791 356.587 1.00 36.45  ? 202  GLU B N   1 
ATOM   5688 C CA  . GLU B 1 201 ? -53.280 48.784 355.729 1.00 36.02  ? 202  GLU B CA  1 
ATOM   5689 C C   . GLU B 1 201 ? -54.401 49.410 354.908 1.00 35.72  ? 202  GLU B C   1 
ATOM   5690 O O   . GLU B 1 201 ? -55.144 50.259 355.405 1.00 31.93  ? 202  GLU B O   1 
ATOM   5691 C CB  . GLU B 1 201 ? -53.809 47.601 356.556 1.00 38.87  ? 202  GLU B CB  1 
ATOM   5692 C CG  . GLU B 1 201 ? -54.234 46.391 355.729 1.00 35.34  ? 202  GLU B CG  1 
ATOM   5693 C CD  . GLU B 1 201 ? -55.714 46.417 355.383 1.00 50.50  ? 202  GLU B CD  1 
ATOM   5694 O OE1 . GLU B 1 201 ? -56.439 47.272 355.934 1.00 44.64  ? 202  GLU B OE1 1 
ATOM   5695 O OE2 . GLU B 1 201 ? -56.150 45.590 354.553 1.00 51.92  ? 202  GLU B OE2 1 
ATOM   5696 N N   . SER B 1 202 ? -54.497 48.993 353.645 1.00 35.17  ? 203  SER B N   1 
ATOM   5697 C CA  . SER B 1 202 ? -55.522 49.443 352.696 1.00 38.26  ? 203  SER B CA  1 
ATOM   5698 C C   . SER B 1 202 ? -55.458 50.963 352.595 1.00 32.39  ? 203  SER B C   1 
ATOM   5699 O O   . SER B 1 202 ? -54.393 51.494 352.236 1.00 38.59  ? 203  SER B O   1 
ATOM   5700 C CB  . SER B 1 202 ? -56.872 48.867 353.115 1.00 38.24  ? 203  SER B CB  1 
ATOM   5701 O OG  . SER B 1 202 ? -57.930 49.577 352.499 1.00 62.52  ? 203  SER B OG  1 
ATOM   5702 N N   . ALA B 1 203 ? -56.534 51.704 352.886 1.00 30.27  ? 204  ALA B N   1 
ATOM   5703 C CA  . ALA B 1 203 ? -56.482 53.160 352.813 1.00 32.52  ? 204  ALA B CA  1 
ATOM   5704 C C   . ALA B 1 203 ? -55.466 53.746 353.783 1.00 38.69  ? 204  ALA B C   1 
ATOM   5705 O O   . ALA B 1 203 ? -54.977 54.857 353.554 1.00 34.16  ? 204  ALA B O   1 
ATOM   5706 C CB  . ALA B 1 203 ? -57.867 53.758 353.081 1.00 24.80  ? 204  ALA B CB  1 
ATOM   5707 N N   . GLY B 1 204 ? -55.138 53.028 354.857 1.00 32.17  ? 205  GLY B N   1 
ATOM   5708 C CA  . GLY B 1 204 ? -54.025 53.441 355.692 1.00 30.77  ? 205  GLY B CA  1 
ATOM   5709 C C   . GLY B 1 204 ? -52.697 53.333 354.967 1.00 36.88  ? 205  GLY B C   1 
ATOM   5710 O O   . GLY B 1 204 ? -51.841 54.215 355.085 1.00 32.01  ? 205  GLY B O   1 
ATOM   5711 N N   . ALA B 1 205 ? -52.508 52.252 354.205 1.00 32.80  ? 206  ALA B N   1 
ATOM   5712 C CA  . ALA B 1 205 ? -51.311 52.128 353.379 1.00 40.55  ? 206  ALA B CA  1 
ATOM   5713 C C   . ALA B 1 205 ? -51.271 53.208 352.307 1.00 39.29  ? 206  ALA B C   1 
ATOM   5714 O O   . ALA B 1 205 ? -50.205 53.763 352.013 1.00 37.93  ? 206  ALA B O   1 
ATOM   5715 C CB  . ALA B 1 205 ? -51.247 50.738 352.745 1.00 32.73  ? 206  ALA B CB  1 
ATOM   5716 N N   . ALA B 1 206 ? -52.424 53.519 351.709 1.00 34.24  ? 207  ALA B N   1 
ATOM   5717 C CA  . ALA B 1 206 ? -52.477 54.616 350.750 1.00 29.05  ? 207  ALA B CA  1 
ATOM   5718 C C   . ALA B 1 206 ? -52.129 55.941 351.418 1.00 36.39  ? 207  ALA B C   1 
ATOM   5719 O O   . ALA B 1 206 ? -51.463 56.792 350.815 1.00 37.11  ? 207  ALA B O   1 
ATOM   5720 C CB  . ALA B 1 206 ? -53.860 54.681 350.101 1.00 25.38  ? 207  ALA B CB  1 
ATOM   5721 N N   . SER B 1 207 ? -52.564 56.129 352.670 1.00 30.34  ? 208  SER B N   1 
ATOM   5722 C CA  . SER B 1 207 ? -52.217 57.345 353.403 1.00 35.27  ? 208  SER B CA  1 
ATOM   5723 C C   . SER B 1 207 ? -50.722 57.412 353.687 1.00 32.95  ? 208  SER B C   1 
ATOM   5724 O O   . SER B 1 207 ? -50.104 58.473 353.534 1.00 36.34  ? 208  SER B O   1 
ATOM   5725 C CB  . SER B 1 207 ? -53.010 57.432 354.711 1.00 29.41  ? 208  SER B CB  1 
ATOM   5726 O OG  . SER B 1 207 ? -54.352 57.008 354.554 1.00 39.95  ? 208  SER B OG  1 
ATOM   5727 N N   . VAL B 1 208 ? -50.129 56.295 354.112 1.00 31.19  ? 209  VAL B N   1 
ATOM   5728 C CA  . VAL B 1 208 ? -48.679 56.239 354.301 1.00 33.99  ? 209  VAL B CA  1 
ATOM   5729 C C   . VAL B 1 208 ? -47.962 56.657 353.021 1.00 35.91  ? 209  VAL B C   1 
ATOM   5730 O O   . VAL B 1 208 ? -47.037 57.479 353.045 1.00 33.95  ? 209  VAL B O   1 
ATOM   5731 C CB  . VAL B 1 208 ? -48.252 54.830 354.750 1.00 31.77  ? 209  VAL B CB  1 
ATOM   5732 C CG1 . VAL B 1 208 ? -46.740 54.702 354.707 1.00 34.36  ? 209  VAL B CG1 1 
ATOM   5733 C CG2 . VAL B 1 208 ? -48.773 54.531 356.148 1.00 31.82  ? 209  VAL B CG2 1 
ATOM   5734 N N   . GLY B 1 209 ? -48.385 56.104 351.883 1.00 32.71  ? 210  GLY B N   1 
ATOM   5735 C CA  . GLY B 1 209 ? -47.763 56.467 350.620 1.00 30.82  ? 210  GLY B CA  1 
ATOM   5736 C C   . GLY B 1 209 ? -47.879 57.948 350.314 1.00 33.48  ? 210  GLY B C   1 
ATOM   5737 O O   . GLY B 1 209 ? -46.940 58.562 349.803 1.00 37.88  ? 210  GLY B O   1 
ATOM   5738 N N   . MET B 1 210 ? -49.026 58.548 350.637 1.00 32.95  ? 211  MET B N   1 
ATOM   5739 C CA  . MET B 1 210 ? -49.200 59.970 350.362 1.00 31.36  ? 211  MET B CA  1 
ATOM   5740 C C   . MET B 1 210 ? -48.333 60.833 351.267 1.00 42.83  ? 211  MET B C   1 
ATOM   5741 O O   . MET B 1 210 ? -47.889 61.909 350.850 1.00 33.46  ? 211  MET B O   1 
ATOM   5742 C CB  . MET B 1 210 ? -50.670 60.353 350.495 1.00 39.19  ? 211  MET B CB  1 
ATOM   5743 C CG  . MET B 1 210 ? -51.517 59.805 349.361 1.00 55.63  ? 211  MET B CG  1 
ATOM   5744 S SD  . MET B 1 210 ? -53.276 60.002 349.646 1.00 53.16  ? 211  MET B SD  1 
ATOM   5745 C CE  . MET B 1 210 ? -53.945 58.790 348.509 1.00 44.48  ? 211  MET B CE  1 
ATOM   5746 N N   . HIS B 1 211 ? -48.081 60.386 352.501 1.00 32.72  ? 212  HIS B N   1 
ATOM   5747 C CA  . HIS B 1 211 ? -47.139 61.101 353.354 1.00 34.67  ? 212  HIS B CA  1 
ATOM   5748 C C   . HIS B 1 211 ? -45.718 61.014 352.808 1.00 35.61  ? 212  HIS B C   1 
ATOM   5749 O O   . HIS B 1 211 ? -44.930 61.949 352.986 1.00 33.80  ? 212  HIS B O   1 
ATOM   5750 C CB  . HIS B 1 211 ? -47.204 60.560 354.784 1.00 33.08  ? 212  HIS B CB  1 
ATOM   5751 C CG  . HIS B 1 211 ? -48.445 60.960 355.518 1.00 36.47  ? 212  HIS B CG  1 
ATOM   5752 N ND1 . HIS B 1 211 ? -48.732 62.270 355.834 1.00 34.48  ? 212  HIS B ND1 1 
ATOM   5753 C CD2 . HIS B 1 211 ? -49.479 60.224 355.990 1.00 28.55  ? 212  HIS B CD2 1 
ATOM   5754 C CE1 . HIS B 1 211 ? -49.888 62.326 356.469 1.00 28.21  ? 212  HIS B CE1 1 
ATOM   5755 N NE2 . HIS B 1 211 ? -50.363 61.098 356.577 1.00 36.07  ? 212  HIS B NE2 1 
ATOM   5756 N N   . LEU B 1 212 ? -45.378 59.907 352.138 1.00 32.91  ? 213  LEU B N   1 
ATOM   5757 C CA  . LEU B 1 212 ? -44.081 59.803 351.475 1.00 45.05  ? 213  LEU B CA  1 
ATOM   5758 C C   . LEU B 1 212 ? -43.945 60.830 350.360 1.00 40.50  ? 213  LEU B C   1 
ATOM   5759 O O   . LEU B 1 212 ? -42.856 61.368 350.132 1.00 48.57  ? 213  LEU B O   1 
ATOM   5760 C CB  . LEU B 1 212 ? -43.888 58.393 350.910 1.00 39.37  ? 213  LEU B CB  1 
ATOM   5761 C CG  . LEU B 1 212 ? -43.430 57.307 351.885 1.00 60.78  ? 213  LEU B CG  1 
ATOM   5762 C CD1 . LEU B 1 212 ? -43.486 55.938 351.224 1.00 46.34  ? 213  LEU B CD1 1 
ATOM   5763 C CD2 . LEU B 1 212 ? -42.030 57.600 352.402 1.00 47.51  ? 213  LEU B CD2 1 
ATOM   5764 N N   . LEU B 1 213 ? -45.035 61.107 349.651 1.00 38.83  ? 214  LEU B N   1 
ATOM   5765 C CA  . LEU B 1 213 ? -45.010 61.966 348.478 1.00 36.46  ? 214  LEU B CA  1 
ATOM   5766 C C   . LEU B 1 213 ? -45.334 63.417 348.800 1.00 41.16  ? 214  LEU B C   1 
ATOM   5767 O O   . LEU B 1 213 ? -45.446 64.234 347.879 1.00 39.82  ? 214  LEU B O   1 
ATOM   5768 C CB  . LEU B 1 213 ? -45.981 61.430 347.425 1.00 32.80  ? 214  LEU B CB  1 
ATOM   5769 C CG  . LEU B 1 213 ? -45.774 59.952 347.080 1.00 37.35  ? 214  LEU B CG  1 
ATOM   5770 C CD1 . LEU B 1 213 ? -46.863 59.447 346.144 1.00 34.21  ? 214  LEU B CD1 1 
ATOM   5771 C CD2 . LEU B 1 213 ? -44.395 59.743 346.469 1.00 37.28  ? 214  LEU B CD2 1 
ATOM   5772 N N   . SER B 1 214 ? -45.480 63.756 350.076 1.00 36.24  ? 215  SER B N   1 
ATOM   5773 C CA  . SER B 1 214 ? -45.786 65.123 350.495 1.00 34.30  ? 215  SER B CA  1 
ATOM   5774 C C   . SER B 1 214 ? -44.660 65.632 351.384 1.00 39.23  ? 215  SER B C   1 
ATOM   5775 O O   . SER B 1 214 ? -44.474 65.114 352.503 1.00 40.79  ? 215  SER B O   1 
ATOM   5776 C CB  . SER B 1 214 ? -47.128 65.178 351.225 1.00 38.02  ? 215  SER B CB  1 
ATOM   5777 O OG  . SER B 1 214 ? -47.557 66.517 351.415 1.00 42.37  ? 215  SER B OG  1 
ATOM   5778 N N   . PRO B 1 215 ? -43.897 66.627 350.939 1.00 45.32  ? 216  PRO B N   1 
ATOM   5779 C CA  . PRO B 1 215 ? -42.686 67.051 351.667 1.00 40.10  ? 216  PRO B CA  1 
ATOM   5780 C C   . PRO B 1 215 ? -42.959 67.473 353.104 1.00 39.31  ? 216  PRO B C   1 
ATOM   5781 O O   . PRO B 1 215 ? -42.167 67.122 353.993 1.00 47.23  ? 216  PRO B O   1 
ATOM   5782 C CB  . PRO B 1 215 ? -42.164 68.223 350.821 1.00 43.47  ? 216  PRO B CB  1 
ATOM   5783 C CG  . PRO B 1 215 ? -42.630 67.898 349.430 1.00 44.93  ? 216  PRO B CG  1 
ATOM   5784 C CD  . PRO B 1 215 ? -43.966 67.209 349.585 1.00 45.77  ? 216  PRO B CD  1 
ATOM   5785 N N   . PRO B 1 216 ? -44.032 68.226 353.400 1.00 47.73  ? 217  PRO B N   1 
ATOM   5786 C CA  . PRO B 1 216 ? -44.269 68.595 354.812 1.00 42.14  ? 217  PRO B CA  1 
ATOM   5787 C C   . PRO B 1 216 ? -44.475 67.408 355.746 1.00 50.76  ? 217  PRO B C   1 
ATOM   5788 O O   . PRO B 1 216 ? -44.220 67.539 356.949 1.00 47.00  ? 217  PRO B O   1 
ATOM   5789 C CB  . PRO B 1 216 ? -45.526 69.476 354.747 1.00 36.68  ? 217  PRO B CB  1 
ATOM   5790 C CG  . PRO B 1 216 ? -45.541 70.006 353.375 1.00 37.23  ? 217  PRO B CG  1 
ATOM   5791 C CD  . PRO B 1 216 ? -45.010 68.893 352.518 1.00 36.43  ? 217  PRO B CD  1 
ATOM   5792 N N   . SER B 1 217 ? -44.937 66.261 355.238 1.00 41.54  ? 218  SER B N   1 
ATOM   5793 C CA  . SER B 1 217 ? -45.047 65.061 356.067 1.00 49.21  ? 218  SER B CA  1 
ATOM   5794 C C   . SER B 1 217 ? -43.811 64.185 355.997 1.00 46.33  ? 218  SER B C   1 
ATOM   5795 O O   . SER B 1 217 ? -43.553 63.415 356.933 1.00 43.94  ? 218  SER B O   1 
ATOM   5796 C CB  . SER B 1 217 ? -46.254 64.212 355.663 1.00 29.94  ? 218  SER B CB  1 
ATOM   5797 O OG  . SER B 1 217 ? -47.402 65.004 355.411 1.00 42.48  ? 218  SER B OG  1 
ATOM   5798 N N   . ARG B 1 218 ? -43.027 64.294 354.919 1.00 46.29  ? 219  ARG B N   1 
ATOM   5799 C CA  . ARG B 1 218 ? -41.903 63.391 354.707 1.00 50.01  ? 219  ARG B CA  1 
ATOM   5800 C C   . ARG B 1 218 ? -40.868 63.502 355.817 1.00 41.70  ? 219  ARG B C   1 
ATOM   5801 O O   . ARG B 1 218 ? -40.204 62.511 356.145 1.00 52.94  ? 219  ARG B O   1 
ATOM   5802 C CB  . ARG B 1 218 ? -41.269 63.673 353.346 1.00 43.38  ? 219  ARG B CB  1 
ATOM   5803 C CG  . ARG B 1 218 ? -40.113 62.754 352.990 1.00 39.86  ? 219  ARG B CG  1 
ATOM   5804 C CD  . ARG B 1 218 ? -40.557 61.306 352.942 1.00 46.77  ? 219  ARG B CD  1 
ATOM   5805 N NE  . ARG B 1 218 ? -39.428 60.393 352.789 1.00 56.00  ? 219  ARG B NE  1 
ATOM   5806 C CZ  . ARG B 1 218 ? -38.792 59.813 353.802 1.00 62.71  ? 219  ARG B CZ  1 
ATOM   5807 N NH1 . ARG B 1 218 ? -39.171 60.046 355.053 1.00 48.49  ? 219  ARG B NH1 1 
ATOM   5808 N NH2 . ARG B 1 218 ? -37.776 58.996 353.562 1.00 54.03  ? 219  ARG B NH2 1 
ATOM   5809 N N   . GLY B 1 219 ? -40.716 64.678 356.413 1.00 43.71  ? 220  GLY B N   1 
ATOM   5810 C CA  . GLY B 1 219 ? -39.767 64.848 357.492 1.00 37.71  ? 220  GLY B CA  1 
ATOM   5811 C C   . GLY B 1 219 ? -40.257 64.470 358.873 1.00 51.38  ? 220  GLY B C   1 
ATOM   5812 O O   . GLY B 1 219 ? -39.568 64.758 359.855 1.00 53.92  ? 220  GLY B O   1 
ATOM   5813 N N   . LEU B 1 220 ? -41.421 63.834 358.990 1.00 47.80  ? 221  LEU B N   1 
ATOM   5814 C CA  . LEU B 1 220 ? -41.971 63.448 360.283 1.00 37.89  ? 221  LEU B CA  1 
ATOM   5815 C C   . LEU B 1 220 ? -41.822 61.961 360.570 1.00 41.82  ? 221  LEU B C   1 
ATOM   5816 O O   . LEU B 1 220 ? -42.273 61.498 361.622 1.00 43.71  ? 221  LEU B O   1 
ATOM   5817 C CB  . LEU B 1 220 ? -43.448 63.841 360.364 1.00 37.50  ? 221  LEU B CB  1 
ATOM   5818 C CG  . LEU B 1 220 ? -43.755 65.319 360.131 1.00 42.19  ? 221  LEU B CG  1 
ATOM   5819 C CD1 . LEU B 1 220 ? -45.254 65.556 360.118 1.00 41.38  ? 221  LEU B CD1 1 
ATOM   5820 C CD2 . LEU B 1 220 ? -43.086 66.164 361.196 1.00 34.86  ? 221  LEU B CD2 1 
ATOM   5821 N N   . PHE B 1 221 ? -41.210 61.205 359.662 1.00 34.18  ? 222  PHE B N   1 
ATOM   5822 C CA  . PHE B 1 221 ? -40.989 59.779 359.857 1.00 41.23  ? 222  PHE B CA  1 
ATOM   5823 C C   . PHE B 1 221 ? -39.785 59.371 359.018 1.00 37.84  ? 222  PHE B C   1 
ATOM   5824 O O   . PHE B 1 221 ? -39.209 60.183 358.290 1.00 45.07  ? 222  PHE B O   1 
ATOM   5825 C CB  . PHE B 1 221 ? -42.242 58.964 359.507 1.00 32.80  ? 222  PHE B CB  1 
ATOM   5826 C CG  . PHE B 1 221 ? -42.640 59.047 358.059 1.00 31.53  ? 222  PHE B CG  1 
ATOM   5827 C CD1 . PHE B 1 221 ? -43.345 60.141 357.579 1.00 33.87  ? 222  PHE B CD1 1 
ATOM   5828 C CD2 . PHE B 1 221 ? -42.319 58.027 357.180 1.00 38.29  ? 222  PHE B CD2 1 
ATOM   5829 C CE1 . PHE B 1 221 ? -43.715 60.219 356.247 1.00 38.47  ? 222  PHE B CE1 1 
ATOM   5830 C CE2 . PHE B 1 221 ? -42.688 58.098 355.844 1.00 42.24  ? 222  PHE B CE2 1 
ATOM   5831 C CZ  . PHE B 1 221 ? -43.385 59.195 355.379 1.00 36.93  ? 222  PHE B CZ  1 
ATOM   5832 N N   . HIS B 1 222 ? -39.409 58.097 359.115 1.00 37.03  ? 223  HIS B N   1 
ATOM   5833 C CA  . HIS B 1 222 ? -38.163 57.654 358.502 1.00 38.92  ? 223  HIS B CA  1 
ATOM   5834 C C   . HIS B 1 222 ? -38.328 56.390 357.666 1.00 37.15  ? 223  HIS B C   1 
ATOM   5835 O O   . HIS B 1 222 ? -37.567 56.171 356.719 1.00 43.72  ? 223  HIS B O   1 
ATOM   5836 C CB  . HIS B 1 222 ? -37.108 57.450 359.592 1.00 40.31  ? 223  HIS B CB  1 
ATOM   5837 C CG  . HIS B 1 222 ? -36.976 58.624 360.511 1.00 58.23  ? 223  HIS B CG  1 
ATOM   5838 N ND1 . HIS B 1 222 ? -37.817 58.828 361.586 1.00 49.39  ? 223  HIS B ND1 1 
ATOM   5839 C CD2 . HIS B 1 222 ? -36.128 59.680 360.493 1.00 54.16  ? 223  HIS B CD2 1 
ATOM   5840 C CE1 . HIS B 1 222 ? -37.483 59.950 362.197 1.00 47.25  ? 223  HIS B CE1 1 
ATOM   5841 N NE2 . HIS B 1 222 ? -36.459 60.485 361.556 1.00 59.21  ? 223  HIS B NE2 1 
ATOM   5842 N N   . ARG B 1 223 ? -39.311 55.554 357.996 1.00 42.85  ? 224  ARG B N   1 
ATOM   5843 C CA  . ARG B 1 223 ? -39.551 54.317 357.267 1.00 40.92  ? 224  ARG B CA  1 
ATOM   5844 C C   . ARG B 1 223 ? -41.052 54.101 357.129 1.00 40.28  ? 224  ARG B C   1 
ATOM   5845 O O   . ARG B 1 223 ? -41.852 54.676 357.871 1.00 36.17  ? 224  ARG B O   1 
ATOM   5846 C CB  . ARG B 1 223 ? -38.892 53.115 357.961 1.00 42.75  ? 224  ARG B CB  1 
ATOM   5847 C CG  . ARG B 1 223 ? -37.386 53.046 357.762 1.00 49.44  ? 224  ARG B CG  1 
ATOM   5848 C CD  . ARG B 1 223 ? -36.752 51.920 358.566 1.00 46.54  ? 224  ARG B CD  1 
ATOM   5849 N NE  . ARG B 1 223 ? -36.770 52.185 360.000 1.00 56.13  ? 224  ARG B NE  1 
ATOM   5850 C CZ  . ARG B 1 223 ? -35.909 52.982 360.623 1.00 64.37  ? 224  ARG B CZ  1 
ATOM   5851 N NH1 . ARG B 1 223 ? -34.958 53.599 359.936 1.00 63.51  ? 224  ARG B NH1 1 
ATOM   5852 N NH2 . ARG B 1 223 ? -36.001 53.167 361.934 1.00 60.65  ? 224  ARG B NH2 1 
ATOM   5853 N N   . ALA B 1 224 ? -41.431 53.255 356.171 1.00 33.06  ? 225  ALA B N   1 
ATOM   5854 C CA  . ALA B 1 224 ? -42.833 53.087 355.816 1.00 38.34  ? 225  ALA B CA  1 
ATOM   5855 C C   . ALA B 1 224 ? -43.151 51.628 355.525 1.00 39.37  ? 225  ALA B C   1 
ATOM   5856 O O   . ALA B 1 224 ? -42.337 50.908 354.939 1.00 34.31  ? 225  ALA B O   1 
ATOM   5857 C CB  . ALA B 1 224 ? -43.198 53.944 354.598 1.00 35.39  ? 225  ALA B CB  1 
ATOM   5858 N N   . VAL B 1 225 ? -44.346 51.203 355.929 1.00 34.71  ? 226  VAL B N   1 
ATOM   5859 C CA  . VAL B 1 225 ? -44.875 49.881 355.612 1.00 29.03  ? 226  VAL B CA  1 
ATOM   5860 C C   . VAL B 1 225 ? -46.247 50.070 354.982 1.00 39.36  ? 226  VAL B C   1 
ATOM   5861 O O   . VAL B 1 225 ? -47.128 50.689 355.590 1.00 34.39  ? 226  VAL B O   1 
ATOM   5862 C CB  . VAL B 1 225 ? -44.979 48.976 356.851 1.00 41.81  ? 226  VAL B CB  1 
ATOM   5863 C CG1 . VAL B 1 225 ? -45.545 47.618 356.460 1.00 34.13  ? 226  VAL B CG1 1 
ATOM   5864 C CG2 . VAL B 1 225 ? -43.625 48.834 357.535 1.00 39.66  ? 226  VAL B CG2 1 
ATOM   5865 N N   . LEU B 1 226 ? -46.428 49.540 353.771 1.00 33.59  ? 227  LEU B N   1 
ATOM   5866 C CA  . LEU B 1 226 ? -47.677 49.655 353.023 1.00 36.62  ? 227  LEU B CA  1 
ATOM   5867 C C   . LEU B 1 226 ? -48.256 48.258 352.837 1.00 37.63  ? 227  LEU B C   1 
ATOM   5868 O O   . LEU B 1 226 ? -47.728 47.462 352.054 1.00 41.89  ? 227  LEU B O   1 
ATOM   5869 C CB  . LEU B 1 226 ? -47.451 50.336 351.674 1.00 39.03  ? 227  LEU B CB  1 
ATOM   5870 C CG  . LEU B 1 226 ? -47.126 51.832 351.665 1.00 39.51  ? 227  LEU B CG  1 
ATOM   5871 C CD1 . LEU B 1 226 ? -45.635 52.062 351.852 1.00 35.82  ? 227  LEU B CD1 1 
ATOM   5872 C CD2 . LEU B 1 226 ? -47.598 52.473 350.374 1.00 32.35  ? 227  LEU B CD2 1 
ATOM   5873 N N   . GLN B 1 227 ? -49.345 47.965 353.545 1.00 36.47  ? 228  GLN B N   1 
ATOM   5874 C CA  . GLN B 1 227 ? -49.977 46.651 353.513 1.00 35.50  ? 228  GLN B CA  1 
ATOM   5875 C C   . GLN B 1 227 ? -51.247 46.732 352.673 1.00 36.66  ? 228  GLN B C   1 
ATOM   5876 O O   . GLN B 1 227 ? -52.206 47.410 353.054 1.00 30.11  ? 228  GLN B O   1 
ATOM   5877 C CB  . GLN B 1 227 ? -50.294 46.163 354.927 1.00 34.46  ? 228  GLN B CB  1 
ATOM   5878 C CG  . GLN B 1 227 ? -49.077 46.029 355.829 1.00 38.13  ? 228  GLN B CG  1 
ATOM   5879 C CD  . GLN B 1 227 ? -49.441 45.788 357.286 1.00 52.58  ? 228  GLN B CD  1 
ATOM   5880 O OE1 . GLN B 1 227 ? -48.626 46.001 358.183 1.00 72.37  ? 228  GLN B OE1 1 
ATOM   5881 N NE2 . GLN B 1 227 ? -50.663 45.328 357.524 1.00 51.71  ? 228  GLN B NE2 1 
ATOM   5882 N N   . SER B 1 228 ? -51.245 46.044 351.530 1.00 36.26  ? 229  SER B N   1 
ATOM   5883 C CA  . SER B 1 228 ? -52.438 45.902 350.693 1.00 33.79  ? 229  SER B CA  1 
ATOM   5884 C C   . SER B 1 228 ? -53.060 47.254 350.350 1.00 35.31  ? 229  SER B C   1 
ATOM   5885 O O   . SER B 1 228 ? -54.283 47.420 350.350 1.00 42.76  ? 229  SER B O   1 
ATOM   5886 C CB  . SER B 1 228 ? -53.475 44.986 351.352 1.00 37.09  ? 229  SER B CB  1 
ATOM   5887 O OG  . SER B 1 228 ? -52.875 43.848 351.938 1.00 45.27  ? 229  SER B OG  1 
ATOM   5888 N N   . GLY B 1 229 ? -52.213 48.221 350.032 1.00 33.62  ? 230  GLY B N   1 
ATOM   5889 C CA  . GLY B 1 229 ? -52.696 49.521 349.620 1.00 31.96  ? 230  GLY B CA  1 
ATOM   5890 C C   . GLY B 1 229 ? -51.555 50.361 349.104 1.00 35.01  ? 230  GLY B C   1 
ATOM   5891 O O   . GLY B 1 229 ? -50.389 50.136 349.443 1.00 41.22  ? 230  GLY B O   1 
ATOM   5892 N N   . ALA B 1 230 ? -51.907 51.337 348.274 1.00 32.79  ? 231  ALA B N   1 
ATOM   5893 C CA  . ALA B 1 230 ? -50.908 52.181 347.637 1.00 34.85  ? 231  ALA B CA  1 
ATOM   5894 C C   . ALA B 1 230 ? -51.564 53.497 347.259 1.00 36.13  ? 231  ALA B C   1 
ATOM   5895 O O   . ALA B 1 230 ? -52.760 53.520 346.952 1.00 34.56  ? 231  ALA B O   1 
ATOM   5896 C CB  . ALA B 1 230 ? -50.315 51.493 346.398 1.00 34.63  ? 231  ALA B CB  1 
ATOM   5897 N N   . PRO B 1 231 ? -50.821 54.608 347.278 1.00 36.56  ? 232  PRO B N   1 
ATOM   5898 C CA  . PRO B 1 231 ? -51.440 55.901 346.951 1.00 33.69  ? 232  PRO B CA  1 
ATOM   5899 C C   . PRO B 1 231 ? -51.785 56.050 345.481 1.00 40.59  ? 232  PRO B C   1 
ATOM   5900 O O   . PRO B 1 231 ? -52.590 56.926 345.139 1.00 38.89  ? 232  PRO B O   1 
ATOM   5901 C CB  . PRO B 1 231 ? -50.375 56.918 347.382 1.00 29.84  ? 232  PRO B CB  1 
ATOM   5902 C CG  . PRO B 1 231 ? -49.089 56.178 347.223 1.00 31.17  ? 232  PRO B CG  1 
ATOM   5903 C CD  . PRO B 1 231 ? -49.389 54.747 347.599 1.00 32.49  ? 232  PRO B CD  1 
ATOM   5904 N N   . ASN B 1 232 ? -51.209 55.228 344.605 1.00 33.69  ? 233  ASN B N   1 
ATOM   5905 C CA  . ASN B 1 232 ? -51.508 55.267 343.179 1.00 41.12  ? 233  ASN B CA  1 
ATOM   5906 C C   . ASN B 1 232 ? -52.662 54.347 342.791 1.00 38.94  ? 233  ASN B C   1 
ATOM   5907 O O   . ASN B 1 232 ? -52.866 54.097 341.600 1.00 34.00  ? 233  ASN B O   1 
ATOM   5908 C CB  . ASN B 1 232 ? -50.261 54.904 342.364 1.00 31.37  ? 233  ASN B CB  1 
ATOM   5909 C CG  . ASN B 1 232 ? -49.571 53.657 342.881 1.00 44.39  ? 233  ASN B CG  1 
ATOM   5910 O OD1 . ASN B 1 232 ? -49.304 53.536 344.076 1.00 40.06  ? 233  ASN B OD1 1 
ATOM   5911 N ND2 . ASN B 1 232 ? -49.284 52.719 341.984 1.00 38.33  ? 233  ASN B ND2 1 
ATOM   5912 N N   . GLY B 1 233 ? -53.415 53.833 343.760 1.00 41.61  ? 234  GLY B N   1 
ATOM   5913 C CA  . GLY B 1 233 ? -54.591 53.050 343.454 1.00 56.29  ? 234  GLY B CA  1 
ATOM   5914 C C   . GLY B 1 233 ? -55.643 53.860 342.718 1.00 50.21  ? 234  GLY B C   1 
ATOM   5915 O O   . GLY B 1 233 ? -55.789 55.068 342.931 1.00 55.56  ? 234  GLY B O   1 
ATOM   5916 N N   . PRO B 1 234 ? -56.402 53.207 341.831 1.00 44.45  ? 235  PRO B N   1 
ATOM   5917 C CA  . PRO B 1 234 ? -57.503 53.909 341.145 1.00 36.78  ? 235  PRO B CA  1 
ATOM   5918 C C   . PRO B 1 234 ? -58.597 54.388 342.088 1.00 41.54  ? 235  PRO B C   1 
ATOM   5919 O O   . PRO B 1 234 ? -59.442 55.192 341.674 1.00 45.60  ? 235  PRO B O   1 
ATOM   5920 C CB  . PRO B 1 234 ? -58.034 52.854 340.165 1.00 28.85  ? 235  PRO B CB  1 
ATOM   5921 C CG  . PRO B 1 234 ? -57.664 51.544 340.792 1.00 34.53  ? 235  PRO B CG  1 
ATOM   5922 C CD  . PRO B 1 234 ? -56.340 51.781 341.467 1.00 38.07  ? 235  PRO B CD  1 
ATOM   5923 N N   . TRP B 1 235 ? -58.601 53.925 343.337 1.00 41.87  ? 236  TRP B N   1 
ATOM   5924 C CA  . TRP B 1 235 ? -59.574 54.326 344.344 1.00 40.44  ? 236  TRP B CA  1 
ATOM   5925 C C   . TRP B 1 235 ? -59.032 55.348 345.333 1.00 42.81  ? 236  TRP B C   1 
ATOM   5926 O O   . TRP B 1 235 ? -59.824 55.983 346.038 1.00 37.85  ? 236  TRP B O   1 
ATOM   5927 C CB  . TRP B 1 235 ? -60.039 53.094 345.128 1.00 31.94  ? 236  TRP B CB  1 
ATOM   5928 C CG  . TRP B 1 235 ? -58.876 52.315 345.675 1.00 35.37  ? 236  TRP B CG  1 
ATOM   5929 C CD1 . TRP B 1 235 ? -58.189 51.315 345.048 1.00 34.85  ? 236  TRP B CD1 1 
ATOM   5930 C CD2 . TRP B 1 235 ? -58.242 52.498 346.948 1.00 30.56  ? 236  TRP B CD2 1 
ATOM   5931 N NE1 . TRP B 1 235 ? -57.179 50.854 345.857 1.00 35.56  ? 236  TRP B NE1 1 
ATOM   5932 C CE2 . TRP B 1 235 ? -57.189 51.565 347.028 1.00 34.96  ? 236  TRP B CE2 1 
ATOM   5933 C CE3 . TRP B 1 235 ? -58.471 53.351 348.031 1.00 33.64  ? 236  TRP B CE3 1 
ATOM   5934 C CZ2 . TRP B 1 235 ? -56.366 51.462 348.148 1.00 35.32  ? 236  TRP B CZ2 1 
ATOM   5935 C CZ3 . TRP B 1 235 ? -57.652 53.250 349.141 1.00 31.48  ? 236  TRP B CZ3 1 
ATOM   5936 C CH2 . TRP B 1 235 ? -56.612 52.312 349.191 1.00 38.05  ? 236  TRP B CH2 1 
ATOM   5937 N N   . ALA B 1 236 ? -57.709 55.517 345.405 1.00 37.23  ? 237  ALA B N   1 
ATOM   5938 C CA  . ALA B 1 236 ? -57.107 56.265 346.503 1.00 35.38  ? 237  ALA B CA  1 
ATOM   5939 C C   . ALA B 1 236 ? -57.244 57.772 346.337 1.00 34.79  ? 237  ALA B C   1 
ATOM   5940 O O   . ALA B 1 236 ? -57.261 58.496 347.338 1.00 36.87  ? 237  ALA B O   1 
ATOM   5941 C CB  . ALA B 1 236 ? -55.631 55.891 346.647 1.00 34.60  ? 237  ALA B CB  1 
ATOM   5942 N N   . THR B 1 237 ? -57.334 58.266 345.104 1.00 31.87  ? 238  THR B N   1 
ATOM   5943 C CA  . THR B 1 237 ? -57.403 59.698 344.851 1.00 41.19  ? 238  THR B CA  1 
ATOM   5944 C C   . THR B 1 237 ? -58.554 60.002 343.903 1.00 40.40  ? 238  THR B C   1 
ATOM   5945 O O   . THR B 1 237 ? -59.137 59.110 343.281 1.00 44.79  ? 238  THR B O   1 
ATOM   5946 C CB  . THR B 1 237 ? -56.088 60.244 344.264 1.00 38.90  ? 238  THR B CB  1 
ATOM   5947 O OG1 . THR B 1 237 ? -55.809 59.596 343.018 1.00 37.53  ? 238  THR B OG1 1 
ATOM   5948 C CG2 . THR B 1 237 ? -54.932 60.021 345.220 1.00 39.26  ? 238  THR B CG2 1 
ATOM   5949 N N   . VAL B 1 238 ? -58.873 61.291 343.797 1.00 40.22  ? 239  VAL B N   1 
ATOM   5950 C CA  . VAL B 1 238 ? -59.912 61.767 342.894 1.00 44.04  ? 239  VAL B CA  1 
ATOM   5951 C C   . VAL B 1 238 ? -59.487 63.131 342.369 1.00 41.76  ? 239  VAL B C   1 
ATOM   5952 O O   . VAL B 1 238 ? -58.775 63.880 343.043 1.00 41.69  ? 239  VAL B O   1 
ATOM   5953 C CB  . VAL B 1 238 ? -61.295 61.825 343.593 1.00 45.80  ? 239  VAL B CB  1 
ATOM   5954 C CG1 . VAL B 1 238 ? -61.374 63.001 344.560 1.00 46.68  ? 239  VAL B CG1 1 
ATOM   5955 C CG2 . VAL B 1 238 ? -62.409 61.895 342.571 1.00 52.51  ? 239  VAL B CG2 1 
ATOM   5956 N N   . GLY B 1 239 ? -59.907 63.441 341.142 1.00 47.33  ? 240  GLY B N   1 
ATOM   5957 C CA  . GLY B 1 239 ? -59.589 64.726 340.559 1.00 33.18  ? 240  GLY B CA  1 
ATOM   5958 C C   . GLY B 1 239 ? -60.418 65.851 341.152 1.00 48.25  ? 240  GLY B C   1 
ATOM   5959 O O   . GLY B 1 239 ? -61.428 65.636 341.823 1.00 43.34  ? 240  GLY B O   1 
ATOM   5960 N N   . MET B 1 240 ? -59.972 67.083 340.887 1.00 42.68  ? 241  MET B N   1 
ATOM   5961 C CA  . MET B 1 240 ? -60.662 68.253 341.420 1.00 45.56  ? 241  MET B CA  1 
ATOM   5962 C C   . MET B 1 240 ? -62.080 68.364 340.874 1.00 55.05  ? 241  MET B C   1 
ATOM   5963 O O   . MET B 1 240 ? -63.019 68.663 341.622 1.00 48.94  ? 241  MET B O   1 
ATOM   5964 C CB  . MET B 1 240 ? -59.870 69.523 341.103 1.00 42.44  ? 241  MET B CB  1 
ATOM   5965 C CG  . MET B 1 240 ? -58.611 69.697 341.936 1.00 57.15  ? 241  MET B CG  1 
ATOM   5966 S SD  . MET B 1 240 ? -57.739 71.235 341.576 1.00 62.10  ? 241  MET B SD  1 
ATOM   5967 C CE  . MET B 1 240 ? -57.293 70.968 339.858 1.00 59.33  ? 241  MET B CE  1 
ATOM   5968 N N   . GLY B 1 241 ? -62.256 68.129 339.572 1.00 46.52  ? 242  GLY B N   1 
ATOM   5969 C CA  . GLY B 1 241 ? -63.581 68.250 338.982 1.00 33.97  ? 242  GLY B CA  1 
ATOM   5970 C C   . GLY B 1 241 ? -64.574 67.265 339.571 1.00 50.34  ? 242  GLY B C   1 
ATOM   5971 O O   . GLY B 1 241 ? -65.687 67.637 339.951 1.00 42.85  ? 242  GLY B O   1 
ATOM   5972 N N   . GLU B 1 242 ? -64.179 65.992 339.661 1.00 38.65  ? 243  GLU B N   1 
ATOM   5973 C CA  . GLU B 1 242 ? -65.072 64.980 340.215 1.00 45.49  ? 243  GLU B CA  1 
ATOM   5974 C C   . GLU B 1 242 ? -65.306 65.187 341.709 1.00 45.51  ? 243  GLU B C   1 
ATOM   5975 O O   . GLU B 1 242 ? -66.403 64.906 342.205 1.00 43.97  ? 243  GLU B O   1 
ATOM   5976 C CB  . GLU B 1 242 ? -64.513 63.582 339.945 1.00 42.15  ? 243  GLU B CB  1 
ATOM   5977 C CG  . GLU B 1 242 ? -65.316 62.445 340.561 1.00 48.06  ? 243  GLU B CG  1 
ATOM   5978 C CD  . GLU B 1 242 ? -66.626 62.174 339.840 1.00 58.09  ? 243  GLU B CD  1 
ATOM   5979 O OE1 . GLU B 1 242 ? -66.894 62.827 338.809 1.00 62.84  ? 243  GLU B OE1 1 
ATOM   5980 O OE2 . GLU B 1 242 ? -67.389 61.301 340.309 1.00 51.47  ? 243  GLU B OE2 1 
ATOM   5981 N N   . ALA B 1 243 ? -64.301 65.679 342.439 1.00 43.30  ? 244  ALA B N   1 
ATOM   5982 C CA  . ALA B 1 243 ? -64.501 65.959 343.858 1.00 43.99  ? 244  ALA B CA  1 
ATOM   5983 C C   . ALA B 1 243 ? -65.535 67.059 344.059 1.00 47.50  ? 244  ALA B C   1 
ATOM   5984 O O   . ALA B 1 243 ? -66.360 66.986 344.977 1.00 44.96  ? 244  ALA B O   1 
ATOM   5985 C CB  . ALA B 1 243 ? -63.177 66.344 344.518 1.00 34.72  ? 244  ALA B CB  1 
ATOM   5986 N N   . ARG B 1 244 ? -65.506 68.087 343.207 1.00 40.86  ? 245  ARG B N   1 
ATOM   5987 C CA  . ARG B 1 244 ? -66.502 69.148 343.298 1.00 47.23  ? 245  ARG B CA  1 
ATOM   5988 C C   . ARG B 1 244 ? -67.889 68.628 342.944 1.00 43.08  ? 245  ARG B C   1 
ATOM   5989 O O   . ARG B 1 244 ? -68.881 69.012 343.573 1.00 49.04  ? 245  ARG B O   1 
ATOM   5990 C CB  . ARG B 1 244 ? -66.113 70.314 342.389 1.00 44.60  ? 245  ARG B CB  1 
ATOM   5991 C CG  . ARG B 1 244 ? -67.188 71.380 342.244 1.00 46.61  ? 245  ARG B CG  1 
ATOM   5992 C CD  . ARG B 1 244 ? -66.654 72.616 341.536 1.00 44.67  ? 245  ARG B CD  1 
ATOM   5993 N NE  . ARG B 1 244 ? -65.670 73.325 342.347 1.00 53.20  ? 245  ARG B NE  1 
ATOM   5994 C CZ  . ARG B 1 244 ? -65.978 74.218 343.281 1.00 52.05  ? 245  ARG B CZ  1 
ATOM   5995 N NH1 . ARG B 1 244 ? -67.247 74.518 343.523 1.00 52.39  ? 245  ARG B NH1 1 
ATOM   5996 N NH2 . ARG B 1 244 ? -65.017 74.813 343.974 1.00 59.99  ? 245  ARG B NH2 1 
ATOM   5997 N N   . ARG B 1 245 ? -67.976 67.741 341.953 1.00 45.81  ? 246  ARG B N   1 
ATOM   5998 C CA  . ARG B 1 245 ? -69.271 67.186 341.576 1.00 46.45  ? 246  ARG B CA  1 
ATOM   5999 C C   . ARG B 1 245 ? -69.848 66.331 342.697 1.00 41.42  ? 246  ARG B C   1 
ATOM   6000 O O   . ARG B 1 245 ? -71.036 66.435 343.021 1.00 47.99  ? 246  ARG B O   1 
ATOM   6001 C CB  . ARG B 1 245 ? -69.140 66.371 340.290 1.00 45.80  ? 246  ARG B CB  1 
ATOM   6002 C CG  . ARG B 1 245 ? -70.471 65.925 339.714 1.00 41.76  ? 246  ARG B CG  1 
ATOM   6003 C CD  . ARG B 1 245 ? -70.314 64.741 338.772 1.00 45.43  ? 246  ARG B CD  1 
ATOM   6004 N NE  . ARG B 1 245 ? -69.890 63.524 339.460 1.00 49.87  ? 246  ARG B NE  1 
ATOM   6005 C CZ  . ARG B 1 245 ? -70.690 62.757 340.196 1.00 51.82  ? 246  ARG B CZ  1 
ATOM   6006 N NH1 . ARG B 1 245 ? -71.967 63.081 340.357 1.00 59.14  ? 246  ARG B NH1 1 
ATOM   6007 N NH2 . ARG B 1 245 ? -70.213 61.663 340.775 1.00 41.83  ? 246  ARG B NH2 1 
ATOM   6008 N N   . ARG B 1 246 ? -69.018 65.475 343.302 1.00 46.87  ? 247  ARG B N   1 
ATOM   6009 C CA  . ARG B 1 246 ? -69.499 64.614 344.377 1.00 47.28  ? 247  ARG B CA  1 
ATOM   6010 C C   . ARG B 1 246 ? -69.939 65.432 345.584 1.00 43.09  ? 247  ARG B C   1 
ATOM   6011 O O   . ARG B 1 246 ? -70.964 65.132 346.207 1.00 38.19  ? 247  ARG B O   1 
ATOM   6012 C CB  . ARG B 1 246 ? -68.418 63.607 344.773 1.00 41.84  ? 247  ARG B CB  1 
ATOM   6013 C CG  . ARG B 1 246 ? -68.086 62.594 343.685 1.00 46.70  ? 247  ARG B CG  1 
ATOM   6014 C CD  . ARG B 1 246 ? -67.039 61.600 344.158 1.00 39.35  ? 247  ARG B CD  1 
ATOM   6015 N NE  . ARG B 1 246 ? -66.650 60.669 343.105 1.00 44.81  ? 247  ARG B NE  1 
ATOM   6016 C CZ  . ARG B 1 246 ? -65.811 59.654 343.283 1.00 48.91  ? 247  ARG B CZ  1 
ATOM   6017 N NH1 . ARG B 1 246 ? -65.276 59.439 344.477 1.00 36.60  ? 247  ARG B NH1 1 
ATOM   6018 N NH2 . ARG B 1 246 ? -65.508 58.854 342.269 1.00 41.57  ? 247  ARG B NH2 1 
ATOM   6019 N N   . ALA B 1 247 ? -69.181 66.476 345.924 1.00 41.19  ? 248  ALA B N   1 
ATOM   6020 C CA  . ALA B 1 247 ? -69.574 67.344 347.029 1.00 42.62  ? 248  ALA B CA  1 
ATOM   6021 C C   . ALA B 1 247 ? -70.855 68.101 346.706 1.00 49.91  ? 248  ALA B C   1 
ATOM   6022 O O   . ALA B 1 247 ? -71.709 68.291 347.581 1.00 49.21  ? 248  ALA B O   1 
ATOM   6023 C CB  . ALA B 1 247 ? -68.446 68.319 347.360 1.00 38.46  ? 248  ALA B CB  1 
ATOM   6024 N N   . THR B 1 248 ? -71.007 68.537 345.452 1.00 48.08  ? 249  THR B N   1 
ATOM   6025 C CA  . THR B 1 248 ? -72.196 69.289 345.066 1.00 47.04  ? 249  THR B CA  1 
ATOM   6026 C C   . THR B 1 248 ? -73.446 68.416 345.112 1.00 49.31  ? 249  THR B C   1 
ATOM   6027 O O   . THR B 1 248 ? -74.504 68.863 345.569 1.00 53.57  ? 249  THR B O   1 
ATOM   6028 C CB  . THR B 1 248 ? -72.005 69.897 343.674 1.00 52.50  ? 249  THR B CB  1 
ATOM   6029 O OG1 . THR B 1 248 ? -70.966 70.884 343.723 1.00 48.48  ? 249  THR B OG1 1 
ATOM   6030 C CG2 . THR B 1 248 ? -73.286 70.555 343.194 1.00 49.04  ? 249  THR B CG2 1 
ATOM   6031 N N   . GLN B 1 249 ? -73.345 67.164 344.657 1.00 33.92  ? 250  GLN B N   1 
ATOM   6032 C CA  . GLN B 1 249 ? -74.508 66.286 344.705 1.00 48.83  ? 250  GLN B CA  1 
ATOM   6033 C C   . GLN B 1 249 ? -74.869 65.909 346.136 1.00 49.72  ? 250  GLN B C   1 
ATOM   6034 O O   . GLN B 1 249 ? -76.050 65.703 346.440 1.00 49.53  ? 250  GLN B O   1 
ATOM   6035 C CB  . GLN B 1 249 ? -74.268 65.028 343.870 1.00 49.64  ? 250  GLN B CB  1 
ATOM   6036 C CG  . GLN B 1 249 ? -75.557 64.338 343.439 1.00 58.65  ? 250  GLN B CG  1 
ATOM   6037 C CD  . GLN B 1 249 ? -75.350 62.886 343.057 1.00 73.79  ? 250  GLN B CD  1 
ATOM   6038 O OE1 . GLN B 1 249 ? -74.242 62.474 342.711 1.00 79.15  ? 250  GLN B OE1 1 
ATOM   6039 N NE2 . GLN B 1 249 ? -76.419 62.100 343.123 1.00 69.44  ? 250  GLN B NE2 1 
ATOM   6040 N N   . LEU B 1 250 ? -73.877 65.811 347.024 1.00 38.27  ? 251  LEU B N   1 
ATOM   6041 C CA  . LEU B 1 250 ? -74.175 65.520 348.422 1.00 47.72  ? 251  LEU B CA  1 
ATOM   6042 C C   . LEU B 1 250 ? -75.014 66.629 349.043 1.00 42.77  ? 251  LEU B C   1 
ATOM   6043 O O   . LEU B 1 250 ? -75.977 66.356 349.768 1.00 44.90  ? 251  LEU B O   1 
ATOM   6044 C CB  . LEU B 1 250 ? -72.881 65.320 349.212 1.00 43.33  ? 251  LEU B CB  1 
ATOM   6045 C CG  . LEU B 1 250 ? -73.085 65.033 350.702 1.00 42.94  ? 251  LEU B CG  1 
ATOM   6046 C CD1 . LEU B 1 250 ? -73.875 63.742 350.900 1.00 37.03  ? 251  LEU B CD1 1 
ATOM   6047 C CD2 . LEU B 1 250 ? -71.756 64.974 351.437 1.00 39.15  ? 251  LEU B CD2 1 
ATOM   6048 N N   . ALA B 1 251 ? -74.668 67.889 348.759 1.00 42.88  ? 252  ALA B N   1 
ATOM   6049 C CA  . ALA B 1 251 ? -75.459 69.010 349.260 1.00 56.04  ? 252  ALA B CA  1 
ATOM   6050 C C   . ALA B 1 251 ? -76.889 68.958 348.736 1.00 56.82  ? 252  ALA B C   1 
ATOM   6051 O O   . ALA B 1 251 ? -77.841 69.225 349.478 1.00 55.42  ? 252  ALA B O   1 
ATOM   6052 C CB  . ALA B 1 251 ? -74.795 70.332 348.878 1.00 41.36  ? 252  ALA B CB  1 
ATOM   6053 N N   . HIS B 1 252 ? -77.058 68.614 347.457 1.00 49.81  ? 253  HIS B N   1 
ATOM   6054 C CA  . HIS B 1 252 ? -78.397 68.496 346.890 1.00 49.75  ? 253  HIS B CA  1 
ATOM   6055 C C   . HIS B 1 252 ? -79.179 67.368 347.551 1.00 48.66  ? 253  HIS B C   1 
ATOM   6056 O O   . HIS B 1 252 ? -80.377 67.508 347.821 1.00 52.27  ? 253  HIS B O   1 
ATOM   6057 C CB  . HIS B 1 252 ? -78.302 68.274 345.378 1.00 56.21  ? 253  HIS B CB  1 
ATOM   6058 C CG  . HIS B 1 252 ? -79.588 67.840 344.744 1.00 77.77  ? 253  HIS B CG  1 
ATOM   6059 N ND1 . HIS B 1 252 ? -79.932 66.514 344.589 1.00 72.78  ? 253  HIS B ND1 1 
ATOM   6060 C CD2 . HIS B 1 252 ? -80.610 68.557 344.218 1.00 70.25  ? 253  HIS B CD2 1 
ATOM   6061 C CE1 . HIS B 1 252 ? -81.112 66.433 344.000 1.00 75.90  ? 253  HIS B CE1 1 
ATOM   6062 N NE2 . HIS B 1 252 ? -81.545 67.658 343.764 1.00 85.64  ? 253  HIS B NE2 1 
ATOM   6063 N N   . LEU B 1 253 ? -78.513 66.245 347.831 1.00 54.01  ? 254  LEU B N   1 
ATOM   6064 C CA  . LEU B 1 253 ? -79.189 65.093 348.416 1.00 44.19  ? 254  LEU B CA  1 
ATOM   6065 C C   . LEU B 1 253 ? -79.650 65.343 349.846 1.00 52.64  ? 254  LEU B C   1 
ATOM   6066 O O   . LEU B 1 253 ? -80.554 64.644 350.317 1.00 44.92  ? 254  LEU B O   1 
ATOM   6067 C CB  . LEU B 1 253 ? -78.271 63.871 348.385 1.00 48.16  ? 254  LEU B CB  1 
ATOM   6068 C CG  . LEU B 1 253 ? -78.022 63.226 347.022 1.00 47.89  ? 254  LEU B CG  1 
ATOM   6069 C CD1 . LEU B 1 253 ? -77.043 62.070 347.154 1.00 49.27  ? 254  LEU B CD1 1 
ATOM   6070 C CD2 . LEU B 1 253 ? -79.329 62.759 346.403 1.00 42.72  ? 254  LEU B CD2 1 
ATOM   6071 N N   . VAL B 1 254 ? -79.052 66.306 350.546 1.00 44.53  ? 255  VAL B N   1 
ATOM   6072 C CA  . VAL B 1 254 ? -79.410 66.606 351.927 1.00 50.05  ? 255  VAL B CA  1 
ATOM   6073 C C   . VAL B 1 254 ? -80.204 67.902 352.037 1.00 48.99  ? 255  VAL B C   1 
ATOM   6074 O O   . VAL B 1 254 ? -80.420 68.399 353.147 1.00 42.96  ? 255  VAL B O   1 
ATOM   6075 C CB  . VAL B 1 254 ? -78.168 66.645 352.837 1.00 45.62  ? 255  VAL B CB  1 
ATOM   6076 C CG1 . VAL B 1 254 ? -77.452 65.305 352.813 1.00 32.24  ? 255  VAL B CG1 1 
ATOM   6077 C CG2 . VAL B 1 254 ? -77.229 67.768 352.423 1.00 45.52  ? 255  VAL B CG2 1 
ATOM   6078 N N   . GLY B 1 255 ? -80.639 68.467 350.913 1.00 43.76  ? 256  GLY B N   1 
ATOM   6079 C CA  . GLY B 1 255 ? -81.509 69.625 350.939 1.00 43.34  ? 256  GLY B CA  1 
ATOM   6080 C C   . GLY B 1 255 ? -80.819 70.969 351.000 1.00 44.15  ? 256  GLY B C   1 
ATOM   6081 O O   . GLY B 1 255 ? -81.403 71.925 351.525 1.00 54.87  ? 256  GLY B O   1 
ATOM   6082 N N   . CYS B 1 256 ? -79.605 71.085 350.473 1.00 43.24  ? 257  CYS B N   1 
ATOM   6083 C CA  . CYS B 1 256 ? -78.897 72.351 350.551 1.00 47.87  ? 257  CYS B CA  1 
ATOM   6084 C C   . CYS B 1 256 ? -78.585 72.877 349.154 1.00 68.43  ? 257  CYS B C   1 
ATOM   6085 O O   . CYS B 1 256 ? -78.332 72.092 348.235 1.00 65.10  ? 257  CYS B O   1 
ATOM   6086 C CB  . CYS B 1 256 ? -77.597 72.200 351.352 1.00 53.87  ? 257  CYS B CB  1 
ATOM   6087 S SG  . CYS B 1 256 ? -77.867 72.128 353.137 1.00 70.66  ? 257  CYS B SG  1 
ATOM   6088 N N   . PRO B 1 257 ? -78.583 74.210 348.967 1.00 81.50  ? 258  PRO B N   1 
ATOM   6089 C CA  . PRO B 1 257 ? -78.428 74.877 347.666 1.00 82.06  ? 258  PRO B CA  1 
ATOM   6090 C C   . PRO B 1 257 ? -77.286 74.339 346.810 1.00 95.51  ? 258  PRO B C   1 
ATOM   6091 O O   . PRO B 1 257 ? -76.127 74.505 347.186 1.00 95.91  ? 258  PRO B O   1 
ATOM   6092 C CB  . PRO B 1 257 ? -78.157 76.332 348.056 1.00 86.99  ? 258  PRO B CB  1 
ATOM   6093 C CG  . PRO B 1 257 ? -78.850 76.498 349.354 1.00 72.76  ? 258  PRO B CG  1 
ATOM   6094 C CD  . PRO B 1 257 ? -78.711 75.186 350.066 1.00 79.39  ? 258  PRO B CD  1 
ATOM   6095 N N   . ASN B 1 264 ? -72.459 78.905 344.882 1.00 63.73  ? 265  ASN B N   1 
ATOM   6096 C CA  . ASN B 1 264 ? -71.443 79.554 345.704 1.00 71.81  ? 265  ASN B CA  1 
ATOM   6097 C C   . ASN B 1 264 ? -70.960 78.622 346.814 1.00 76.17  ? 265  ASN B C   1 
ATOM   6098 O O   . ASN B 1 264 ? -71.762 78.066 347.565 1.00 67.96  ? 265  ASN B O   1 
ATOM   6099 C CB  . ASN B 1 264 ? -71.987 80.853 346.298 1.00 79.84  ? 265  ASN B CB  1 
ATOM   6100 C CG  . ASN B 1 264 ? -70.949 81.605 347.106 1.00 84.24  ? 265  ASN B CG  1 
ATOM   6101 O OD1 . ASN B 1 264 ? -71.221 82.058 348.217 1.00 80.90  ? 265  ASN B OD1 1 
ATOM   6102 N ND2 . ASN B 1 264 ? -69.749 81.740 346.551 1.00 96.16  ? 265  ASN B ND2 1 
ATOM   6103 N N   . ASP B 1 265 ? -69.637 78.466 346.914 1.00 72.87  ? 266  ASP B N   1 
ATOM   6104 C CA  . ASP B 1 265 ? -69.070 77.505 347.857 1.00 67.73  ? 266  ASP B CA  1 
ATOM   6105 C C   . ASP B 1 265 ? -69.337 77.908 349.302 1.00 73.56  ? 266  ASP B C   1 
ATOM   6106 O O   . ASP B 1 265 ? -69.564 77.045 350.158 1.00 60.34  ? 266  ASP B O   1 
ATOM   6107 C CB  . ASP B 1 265 ? -67.566 77.356 347.618 1.00 68.63  ? 266  ASP B CB  1 
ATOM   6108 C CG  . ASP B 1 265 ? -67.247 76.684 346.296 1.00 75.81  ? 266  ASP B CG  1 
ATOM   6109 O OD1 . ASP B 1 265 ? -66.121 76.878 345.790 1.00 70.41  ? 266  ASP B OD1 1 
ATOM   6110 O OD2 . ASP B 1 265 ? -68.118 75.963 345.763 1.00 76.78  ? 266  ASP B OD2 1 
ATOM   6111 N N   . THR B 1 266 ? -69.311 79.210 349.596 1.00 74.25  ? 267  THR B N   1 
ATOM   6112 C CA  . THR B 1 266 ? -69.505 79.663 350.970 1.00 60.16  ? 267  THR B CA  1 
ATOM   6113 C C   . THR B 1 266 ? -70.896 79.300 351.479 1.00 62.68  ? 267  THR B C   1 
ATOM   6114 O O   . THR B 1 266 ? -71.039 78.676 352.537 1.00 61.59  ? 267  THR B O   1 
ATOM   6115 C CB  . THR B 1 266 ? -69.275 81.171 351.065 1.00 66.07  ? 267  THR B CB  1 
ATOM   6116 O OG1 . THR B 1 266 ? -67.990 81.496 350.520 1.00 77.96  ? 267  THR B OG1 1 
ATOM   6117 C CG2 . THR B 1 266 ? -69.337 81.626 352.516 1.00 52.22  ? 267  THR B CG2 1 
ATOM   6118 N N   . GLU B 1 267 ? -71.937 79.683 350.734 1.00 67.01  ? 268  GLU B N   1 
ATOM   6119 C CA  . GLU B 1 267 ? -73.302 79.365 351.138 1.00 62.65  ? 268  GLU B CA  1 
ATOM   6120 C C   . GLU B 1 267 ? -73.549 77.863 351.188 1.00 63.78  ? 268  GLU B C   1 
ATOM   6121 O O   . GLU B 1 267 ? -74.427 77.412 351.933 1.00 60.13  ? 268  GLU B O   1 
ATOM   6122 C CB  . GLU B 1 267 ? -74.301 80.030 350.185 1.00 70.62  ? 268  GLU B CB  1 
ATOM   6123 C CG  . GLU B 1 267 ? -74.736 79.141 349.023 1.00 98.89  ? 268  GLU B CG  1 
ATOM   6124 C CD  . GLU B 1 267 ? -75.302 79.918 347.848 1.00 111.67 ? 268  GLU B CD  1 
ATOM   6125 O OE1 . GLU B 1 267 ? -74.986 81.119 347.713 1.00 113.80 ? 268  GLU B OE1 1 
ATOM   6126 O OE2 . GLU B 1 267 ? -76.056 79.320 347.050 1.00 102.06 ? 268  GLU B OE2 1 
ATOM   6127 N N   . LEU B 1 268 ? -72.783 77.080 350.428 1.00 58.27  ? 269  LEU B N   1 
ATOM   6128 C CA  . LEU B 1 268 ? -73.019 75.643 350.350 1.00 59.28  ? 269  LEU B CA  1 
ATOM   6129 C C   . LEU B 1 268 ? -72.448 74.916 351.562 1.00 56.51  ? 269  LEU B C   1 
ATOM   6130 O O   . LEU B 1 268 ? -73.128 74.082 352.171 1.00 49.04  ? 269  LEU B O   1 
ATOM   6131 C CB  . LEU B 1 268 ? -72.418 75.096 349.055 1.00 64.25  ? 269  LEU B CB  1 
ATOM   6132 C CG  . LEU B 1 268 ? -72.825 73.695 348.602 1.00 65.17  ? 269  LEU B CG  1 
ATOM   6133 C CD1 . LEU B 1 268 ? -72.785 73.626 347.088 1.00 57.72  ? 269  LEU B CD1 1 
ATOM   6134 C CD2 . LEU B 1 268 ? -71.914 72.636 349.199 1.00 63.13  ? 269  LEU B CD2 1 
ATOM   6135 N N   . VAL B 1 269 ? -71.196 75.208 351.919 1.00 49.10  ? 270  VAL B N   1 
ATOM   6136 C CA  . VAL B 1 269 ? -70.598 74.573 353.090 1.00 49.36  ? 270  VAL B CA  1 
ATOM   6137 C C   . VAL B 1 269 ? -71.335 74.998 354.352 1.00 54.94  ? 270  VAL B C   1 
ATOM   6138 O O   . VAL B 1 269 ? -71.520 74.201 355.280 1.00 47.34  ? 270  VAL B O   1 
ATOM   6139 C CB  . VAL B 1 269 ? -69.095 74.899 353.170 1.00 56.25  ? 270  VAL B CB  1 
ATOM   6140 C CG1 . VAL B 1 269 ? -68.440 74.105 354.287 1.00 43.49  ? 270  VAL B CG1 1 
ATOM   6141 C CG2 . VAL B 1 269 ? -68.419 74.601 351.843 1.00 42.53  ? 270  VAL B CG2 1 
ATOM   6142 N N   . ALA B 1 270 ? -71.778 76.259 354.399 1.00 49.93  ? 271  ALA B N   1 
ATOM   6143 C CA  . ALA B 1 270 ? -72.532 76.742 355.550 1.00 50.53  ? 271  ALA B CA  1 
ATOM   6144 C C   . ALA B 1 270 ? -73.791 75.913 355.770 1.00 51.41  ? 271  ALA B C   1 
ATOM   6145 O O   . ALA B 1 270 ? -74.120 75.562 356.910 1.00 48.94  ? 271  ALA B O   1 
ATOM   6146 C CB  . ALA B 1 270 ? -72.882 78.221 355.368 1.00 43.98  ? 271  ALA B CB  1 
ATOM   6147 N N   . CYS B 1 271 ? -74.495 75.569 354.687 1.00 47.05  ? 272  CYS B N   1 
ATOM   6148 C CA  . CYS B 1 271 ? -75.688 74.742 354.819 1.00 49.40  ? 272  CYS B CA  1 
ATOM   6149 C C   . CYS B 1 271 ? -75.324 73.310 355.199 1.00 43.61  ? 272  CYS B C   1 
ATOM   6150 O O   . CYS B 1 271 ? -76.016 72.686 356.011 1.00 53.48  ? 272  CYS B O   1 
ATOM   6151 C CB  . CYS B 1 271 ? -76.493 74.777 353.521 1.00 49.39  ? 272  CYS B CB  1 
ATOM   6152 S SG  . CYS B 1 271 ? -78.139 74.078 353.645 1.00 72.68  ? 272  CYS B SG  1 
ATOM   6153 N N   . LEU B 1 272 ? -74.235 72.775 354.635 1.00 49.17  ? 273  LEU B N   1 
ATOM   6154 C CA  . LEU B 1 272 ? -73.776 71.446 355.035 1.00 46.07  ? 273  LEU B CA  1 
ATOM   6155 C C   . LEU B 1 272 ? -73.402 71.405 356.511 1.00 45.09  ? 273  LEU B C   1 
ATOM   6156 O O   . LEU B 1 272 ? -73.600 70.380 357.174 1.00 49.12  ? 273  LEU B O   1 
ATOM   6157 C CB  . LEU B 1 272 ? -72.582 71.016 354.182 1.00 42.48  ? 273  LEU B CB  1 
ATOM   6158 C CG  . LEU B 1 272 ? -72.873 70.614 352.735 1.00 49.45  ? 273  LEU B CG  1 
ATOM   6159 C CD1 . LEU B 1 272 ? -71.578 70.314 352.004 1.00 35.69  ? 273  LEU B CD1 1 
ATOM   6160 C CD2 . LEU B 1 272 ? -73.809 69.416 352.682 1.00 43.06  ? 273  LEU B CD2 1 
ATOM   6161 N N   . ARG B 1 273 ? -72.868 72.505 357.045 1.00 41.42  ? 274  ARG B N   1 
ATOM   6162 C CA  . ARG B 1 273 ? -72.493 72.545 358.450 1.00 43.90  ? 274  ARG B CA  1 
ATOM   6163 C C   . ARG B 1 273 ? -73.697 72.566 359.382 1.00 50.06  ? 274  ARG B C   1 
ATOM   6164 O O   . ARG B 1 273 ? -73.531 72.306 360.578 1.00 49.01  ? 274  ARG B O   1 
ATOM   6165 C CB  . ARG B 1 273 ? -71.596 73.755 358.719 1.00 44.75  ? 274  ARG B CB  1 
ATOM   6166 C CG  . ARG B 1 273 ? -70.181 73.604 358.170 1.00 52.07  ? 274  ARG B CG  1 
ATOM   6167 C CD  . ARG B 1 273 ? -69.197 74.515 358.889 1.00 49.96  ? 274  ARG B CD  1 
ATOM   6168 N NE  . ARG B 1 273 ? -68.847 75.680 358.085 1.00 65.97  ? 274  ARG B NE  1 
ATOM   6169 C CZ  . ARG B 1 273 ? -67.710 75.809 357.407 1.00 71.43  ? 274  ARG B CZ  1 
ATOM   6170 N NH1 . ARG B 1 273 ? -66.799 74.844 357.437 1.00 52.61  ? 274  ARG B NH1 1 
ATOM   6171 N NH2 . ARG B 1 273 ? -67.482 76.908 356.700 1.00 70.90  ? 274  ARG B NH2 1 
ATOM   6172 N N   . THR B 1 274 ? -74.897 72.859 358.874 1.00 45.23  ? 275  THR B N   1 
ATOM   6173 C CA  . THR B 1 274 ? -76.100 72.796 359.696 1.00 41.56  ? 275  THR B CA  1 
ATOM   6174 C C   . THR B 1 274 ? -76.682 71.391 359.777 1.00 47.98  ? 275  THR B C   1 
ATOM   6175 O O   . THR B 1 274 ? -77.545 71.141 360.625 1.00 48.21  ? 275  THR B O   1 
ATOM   6176 C CB  . THR B 1 274 ? -77.171 73.755 359.159 1.00 43.46  ? 275  THR B CB  1 
ATOM   6177 O OG1 . THR B 1 274 ? -77.652 73.285 357.893 1.00 56.13  ? 275  THR B OG1 1 
ATOM   6178 C CG2 . THR B 1 274 ? -76.607 75.161 358.991 1.00 31.29  ? 275  THR B CG2 1 
ATOM   6179 N N   . ARG B 1 275 ? -76.231 70.477 358.935 1.00 43.20  ? 276  ARG B N   1 
ATOM   6180 C CA  . ARG B 1 275 ? -76.814 69.146 358.896 1.00 37.22  ? 276  ARG B CA  1 
ATOM   6181 C C   . ARG B 1 275 ? -76.176 68.254 359.960 1.00 49.70  ? 276  ARG B C   1 
ATOM   6182 O O   . ARG B 1 275 ? -74.958 68.296 360.157 1.00 44.90  ? 276  ARG B O   1 
ATOM   6183 C CB  . ARG B 1 275 ? -76.627 68.523 357.514 1.00 47.72  ? 276  ARG B CB  1 
ATOM   6184 C CG  . ARG B 1 275 ? -77.404 69.228 356.402 1.00 44.28  ? 276  ARG B CG  1 
ATOM   6185 C CD  . ARG B 1 275 ? -78.896 69.161 356.664 1.00 41.08  ? 276  ARG B CD  1 
ATOM   6186 N NE  . ARG B 1 275 ? -79.684 69.658 355.542 1.00 52.68  ? 276  ARG B NE  1 
ATOM   6187 C CZ  . ARG B 1 275 ? -80.188 70.885 355.468 1.00 54.94  ? 276  ARG B CZ  1 
ATOM   6188 N NH1 . ARG B 1 275 ? -79.984 71.749 356.452 1.00 49.45  ? 276  ARG B NH1 1 
ATOM   6189 N NH2 . ARG B 1 275 ? -80.895 71.249 354.406 1.00 50.65  ? 276  ARG B NH2 1 
ATOM   6190 N N   . PRO B 1 276 ? -76.975 67.458 360.671 1.00 45.62  ? 277  PRO B N   1 
ATOM   6191 C CA  . PRO B 1 276 ? -76.399 66.480 361.600 1.00 43.98  ? 277  PRO B CA  1 
ATOM   6192 C C   . PRO B 1 276 ? -75.463 65.525 360.876 1.00 43.07  ? 277  PRO B C   1 
ATOM   6193 O O   . PRO B 1 276 ? -75.636 65.229 359.691 1.00 42.70  ? 277  PRO B O   1 
ATOM   6194 C CB  . PRO B 1 276 ? -77.627 65.748 362.158 1.00 40.85  ? 277  PRO B CB  1 
ATOM   6195 C CG  . PRO B 1 276 ? -78.757 66.713 361.980 1.00 48.54  ? 277  PRO B CG  1 
ATOM   6196 C CD  . PRO B 1 276 ? -78.448 67.484 360.727 1.00 45.37  ? 277  PRO B CD  1 
ATOM   6197 N N   . ALA B 1 277 ? -74.457 65.045 361.610 1.00 45.17  ? 278  ALA B N   1 
ATOM   6198 C CA  . ALA B 1 277 ? -73.425 64.208 361.007 1.00 44.90  ? 278  ALA B CA  1 
ATOM   6199 C C   . ALA B 1 277 ? -74.019 62.956 360.372 1.00 47.24  ? 278  ALA B C   1 
ATOM   6200 O O   . ALA B 1 277 ? -73.591 62.537 359.289 1.00 40.10  ? 278  ALA B O   1 
ATOM   6201 C CB  . ALA B 1 277 ? -72.381 63.831 362.057 1.00 43.08  ? 278  ALA B CB  1 
ATOM   6202 N N   . GLN B 1 278 ? -75.013 62.351 361.025 1.00 41.50  ? 279  GLN B N   1 
ATOM   6203 C CA  . GLN B 1 278 ? -75.594 61.116 360.509 1.00 42.07  ? 279  GLN B CA  1 
ATOM   6204 C C   . GLN B 1 278 ? -76.280 61.331 359.165 1.00 40.67  ? 279  GLN B C   1 
ATOM   6205 O O   . GLN B 1 278 ? -76.388 60.393 358.367 1.00 39.99  ? 279  GLN B O   1 
ATOM   6206 C CB  . GLN B 1 278 ? -76.577 60.538 361.530 1.00 39.65  ? 279  GLN B CB  1 
ATOM   6207 C CG  . GLN B 1 278 ? -77.131 59.169 361.166 1.00 59.81  ? 279  GLN B CG  1 
ATOM   6208 C CD  . GLN B 1 278 ? -76.042 58.147 360.887 1.00 62.31  ? 279  GLN B CD  1 
ATOM   6209 O OE1 . GLN B 1 278 ? -75.053 58.059 361.615 1.00 58.77  ? 279  GLN B OE1 1 
ATOM   6210 N NE2 . GLN B 1 278 ? -76.220 57.369 359.825 1.00 62.07  ? 279  GLN B NE2 1 
ATOM   6211 N N   . VAL B 1 279 ? -76.739 62.553 358.891 1.00 40.21  ? 280  VAL B N   1 
ATOM   6212 C CA  . VAL B 1 279 ? -77.409 62.830 357.624 1.00 42.69  ? 280  VAL B CA  1 
ATOM   6213 C C   . VAL B 1 279 ? -76.423 62.728 356.465 1.00 49.08  ? 280  VAL B C   1 
ATOM   6214 O O   . VAL B 1 279 ? -76.719 62.124 355.427 1.00 44.61  ? 280  VAL B O   1 
ATOM   6215 C CB  . VAL B 1 279 ? -78.092 64.208 357.669 1.00 45.80  ? 280  VAL B CB  1 
ATOM   6216 C CG1 . VAL B 1 279 ? -78.583 64.607 356.284 1.00 39.59  ? 280  VAL B CG1 1 
ATOM   6217 C CG2 . VAL B 1 279 ? -79.241 64.187 358.663 1.00 38.29  ? 280  VAL B CG2 1 
ATOM   6218 N N   . LEU B 1 280 ? -75.234 63.315 356.626 1.00 42.32  ? 281  LEU B N   1 
ATOM   6219 C CA  . LEU B 1 280 ? -74.224 63.223 355.578 1.00 42.78  ? 281  LEU B CA  1 
ATOM   6220 C C   . LEU B 1 280 ? -73.800 61.777 355.350 1.00 44.36  ? 281  LEU B C   1 
ATOM   6221 O O   . LEU B 1 280 ? -73.592 61.354 354.207 1.00 46.78  ? 281  LEU B O   1 
ATOM   6222 C CB  . LEU B 1 280 ? -73.016 64.089 355.935 1.00 34.97  ? 281  LEU B CB  1 
ATOM   6223 C CG  . LEU B 1 280 ? -73.302 65.553 356.281 1.00 44.90  ? 281  LEU B CG  1 
ATOM   6224 C CD1 . LEU B 1 280 ? -72.005 66.335 356.397 1.00 41.99  ? 281  LEU B CD1 1 
ATOM   6225 C CD2 . LEU B 1 280 ? -74.222 66.191 355.253 1.00 40.05  ? 281  LEU B CD2 1 
ATOM   6226 N N   . VAL B 1 281 ? -73.684 61.002 356.430 1.00 33.37  ? 282  VAL B N   1 
ATOM   6227 C CA  . VAL B 1 281 ? -73.319 59.593 356.312 1.00 41.00  ? 282  VAL B CA  1 
ATOM   6228 C C   . VAL B 1 281 ? -74.357 58.833 355.494 1.00 44.62  ? 282  VAL B C   1 
ATOM   6229 O O   . VAL B 1 281 ? -74.014 57.961 354.686 1.00 49.10  ? 282  VAL B O   1 
ATOM   6230 C CB  . VAL B 1 281 ? -73.144 58.976 357.713 1.00 40.77  ? 282  VAL B CB  1 
ATOM   6231 C CG1 . VAL B 1 281 ? -72.947 57.466 357.620 1.00 38.06  ? 282  VAL B CG1 1 
ATOM   6232 C CG2 . VAL B 1 281 ? -71.986 59.636 358.444 1.00 37.77  ? 282  VAL B CG2 1 
ATOM   6233 N N   . ASN B 1 282 ? -75.641 59.152 355.686 1.00 37.92  ? 283  ASN B N   1 
ATOM   6234 C CA  . ASN B 1 282 ? -76.708 58.389 355.045 1.00 40.66  ? 283  ASN B CA  1 
ATOM   6235 C C   . ASN B 1 282 ? -76.732 58.563 353.533 1.00 41.43  ? 283  ASN B C   1 
ATOM   6236 O O   . ASN B 1 282 ? -77.285 57.708 352.834 1.00 51.49  ? 283  ASN B O   1 
ATOM   6237 C CB  . ASN B 1 282 ? -78.067 58.788 355.625 1.00 44.85  ? 283  ASN B CB  1 
ATOM   6238 C CG  . ASN B 1 282 ? -78.265 58.294 357.046 1.00 64.40  ? 283  ASN B CG  1 
ATOM   6239 O OD1 . ASN B 1 282 ? -77.617 57.341 357.483 1.00 54.89  ? 283  ASN B OD1 1 
ATOM   6240 N ND2 . ASN B 1 282 ? -79.168 58.942 357.776 1.00 54.24  ? 283  ASN B ND2 1 
ATOM   6241 N N   . HIS B 1 283 ? -76.145 59.638 353.013 1.00 40.41  ? 284  HIS B N   1 
ATOM   6242 C CA  . HIS B 1 283 ? -76.195 59.940 351.591 1.00 48.27  ? 284  HIS B CA  1 
ATOM   6243 C C   . HIS B 1 283 ? -74.840 59.863 350.900 1.00 53.40  ? 284  HIS B C   1 
ATOM   6244 O O   . HIS B 1 283 ? -74.768 60.116 349.693 1.00 52.31  ? 284  HIS B O   1 
ATOM   6245 C CB  . HIS B 1 283 ? -76.797 61.333 351.376 1.00 37.46  ? 284  HIS B CB  1 
ATOM   6246 C CG  . HIS B 1 283 ? -78.249 61.422 351.728 1.00 65.31  ? 284  HIS B CG  1 
ATOM   6247 N ND1 . HIS B 1 283 ? -78.689 61.711 353.002 1.00 61.96  ? 284  HIS B ND1 1 
ATOM   6248 C CD2 . HIS B 1 283 ? -79.361 61.249 350.976 1.00 59.35  ? 284  HIS B CD2 1 
ATOM   6249 C CE1 . HIS B 1 283 ? -80.010 61.715 353.018 1.00 69.33  ? 284  HIS B CE1 1 
ATOM   6250 N NE2 . HIS B 1 283 ? -80.443 61.438 351.801 1.00 63.99  ? 284  HIS B NE2 1 
ATOM   6251 N N   . GLU B 1 284 ? -73.769 59.509 351.618 1.00 47.39  ? 285  GLU B N   1 
ATOM   6252 C CA  . GLU B 1 284 ? -72.430 59.668 351.055 1.00 52.00  ? 285  GLU B CA  1 
ATOM   6253 C C   . GLU B 1 284 ? -72.207 58.763 349.849 1.00 58.87  ? 285  GLU B C   1 
ATOM   6254 O O   . GLU B 1 284 ? -71.435 59.112 348.951 1.00 52.64  ? 285  GLU B O   1 
ATOM   6255 C CB  . GLU B 1 284 ? -71.365 59.400 352.124 1.00 45.76  ? 285  GLU B CB  1 
ATOM   6256 C CG  . GLU B 1 284 ? -70.961 57.935 352.237 1.00 64.87  ? 285  GLU B CG  1 
ATOM   6257 C CD  . GLU B 1 284 ? -69.875 57.669 353.266 1.00 70.28  ? 285  GLU B CD  1 
ATOM   6258 O OE1 . GLU B 1 284 ? -68.847 58.381 353.295 1.00 60.47  ? 285  GLU B OE1 1 
ATOM   6259 O OE2 . GLU B 1 284 ? -70.073 56.733 354.067 1.00 64.23  ? 285  GLU B OE2 1 
ATOM   6260 N N   . TRP B 1 285 ? -72.884 57.616 349.792 1.00 47.37  ? 286  TRP B N   1 
ATOM   6261 C CA  . TRP B 1 285 ? -72.624 56.641 348.743 1.00 49.82  ? 286  TRP B CA  1 
ATOM   6262 C C   . TRP B 1 285 ? -73.490 56.831 347.505 1.00 53.44  ? 286  TRP B C   1 
ATOM   6263 O O   . TRP B 1 285 ? -73.240 56.172 346.490 1.00 52.66  ? 286  TRP B O   1 
ATOM   6264 C CB  . TRP B 1 285 ? -72.814 55.222 349.283 1.00 42.30  ? 286  TRP B CB  1 
ATOM   6265 C CG  . TRP B 1 285 ? -71.677 54.307 348.947 1.00 69.41  ? 286  TRP B CG  1 
ATOM   6266 C CD1 . TRP B 1 285 ? -71.725 53.195 348.158 1.00 64.44  ? 286  TRP B CD1 1 
ATOM   6267 C CD2 . TRP B 1 285 ? -70.316 54.435 349.379 1.00 73.00  ? 286  TRP B CD2 1 
ATOM   6268 N NE1 . TRP B 1 285 ? -70.481 52.616 348.081 1.00 81.65  ? 286  TRP B NE1 1 
ATOM   6269 C CE2 . TRP B 1 285 ? -69.599 53.359 348.821 1.00 76.18  ? 286  TRP B CE2 1 
ATOM   6270 C CE3 . TRP B 1 285 ? -69.634 55.357 350.182 1.00 63.72  ? 286  TRP B CE3 1 
ATOM   6271 C CZ2 . TRP B 1 285 ? -68.238 53.175 349.047 1.00 63.87  ? 286  TRP B CZ2 1 
ATOM   6272 C CZ3 . TRP B 1 285 ? -68.282 55.170 350.406 1.00 54.07  ? 286  TRP B CZ3 1 
ATOM   6273 C CH2 . TRP B 1 285 ? -67.600 54.089 349.840 1.00 67.20  ? 286  TRP B CH2 1 
ATOM   6274 N N   . HIS B 1 286 ? -74.488 57.709 347.556 1.00 50.04  ? 287  HIS B N   1 
ATOM   6275 C CA  . HIS B 1 286 ? -75.318 57.982 346.391 1.00 49.65  ? 287  HIS B CA  1 
ATOM   6276 C C   . HIS B 1 286 ? -74.702 59.023 345.463 1.00 50.04  ? 287  HIS B C   1 
ATOM   6277 O O   . HIS B 1 286 ? -75.329 59.385 344.462 1.00 52.25  ? 287  HIS B O   1 
ATOM   6278 C CB  . HIS B 1 286 ? -76.713 58.424 346.841 1.00 48.58  ? 287  HIS B CB  1 
ATOM   6279 C CG  . HIS B 1 286 ? -77.421 57.404 347.677 1.00 59.74  ? 287  HIS B CG  1 
ATOM   6280 N ND1 . HIS B 1 286 ? -77.807 56.177 347.183 1.00 72.74  ? 287  HIS B ND1 1 
ATOM   6281 C CD2 . HIS B 1 286 ? -77.799 57.422 348.977 1.00 70.09  ? 287  HIS B CD2 1 
ATOM   6282 C CE1 . HIS B 1 286 ? -78.398 55.485 348.140 1.00 82.69  ? 287  HIS B CE1 1 
ATOM   6283 N NE2 . HIS B 1 286 ? -78.406 56.217 349.240 1.00 76.78  ? 287  HIS B NE2 1 
ATOM   6284 N N   . VAL B 1 287 ? -73.496 59.509 345.770 1.00 46.02  ? 288  VAL B N   1 
ATOM   6285 C CA  . VAL B 1 287 ? -72.788 60.427 344.887 1.00 41.61  ? 288  VAL B CA  1 
ATOM   6286 C C   . VAL B 1 287 ? -71.804 59.710 343.976 1.00 46.09  ? 288  VAL B C   1 
ATOM   6287 O O   . VAL B 1 287 ? -71.200 60.350 343.105 1.00 47.07  ? 288  VAL B O   1 
ATOM   6288 C CB  . VAL B 1 287 ? -72.064 61.528 345.690 1.00 42.42  ? 288  VAL B CB  1 
ATOM   6289 C CG1 . VAL B 1 287 ? -73.002 62.133 346.716 1.00 48.44  ? 288  VAL B CG1 1 
ATOM   6290 C CG2 . VAL B 1 287 ? -70.813 60.974 346.357 1.00 35.43  ? 288  VAL B CG2 1 
ATOM   6291 N N   . LEU B 1 288 ? -71.623 58.404 344.151 1.00 41.16  ? 289  LEU B N   1 
ATOM   6292 C CA  . LEU B 1 288 ? -70.758 57.652 343.255 1.00 47.25  ? 289  LEU B CA  1 
ATOM   6293 C C   . LEU B 1 288 ? -71.376 57.605 341.859 1.00 51.71  ? 289  LEU B C   1 
ATOM   6294 O O   . LEU B 1 288 ? -72.594 57.456 341.723 1.00 49.62  ? 289  LEU B O   1 
ATOM   6295 C CB  . LEU B 1 288 ? -70.535 56.234 343.783 1.00 42.07  ? 289  LEU B CB  1 
ATOM   6296 C CG  . LEU B 1 288 ? -69.507 56.060 344.904 1.00 46.32  ? 289  LEU B CG  1 
ATOM   6297 C CD1 . LEU B 1 288 ? -69.359 54.591 345.287 1.00 39.90  ? 289  LEU B CD1 1 
ATOM   6298 C CD2 . LEU B 1 288 ? -68.162 56.654 344.510 1.00 38.67  ? 289  LEU B CD2 1 
ATOM   6299 N N   . PRO B 1 289 ? -70.563 57.727 340.805 1.00 59.34  ? 290  PRO B N   1 
ATOM   6300 C CA  . PRO B 1 289 ? -71.133 57.840 339.452 1.00 49.03  ? 290  PRO B CA  1 
ATOM   6301 C C   . PRO B 1 289 ? -71.837 56.583 338.969 1.00 45.59  ? 290  PRO B C   1 
ATOM   6302 O O   . PRO B 1 289 ? -72.740 56.687 338.130 1.00 63.85  ? 290  PRO B O   1 
ATOM   6303 C CB  . PRO B 1 289 ? -69.910 58.170 338.586 1.00 53.33  ? 290  PRO B CB  1 
ATOM   6304 C CG  . PRO B 1 289 ? -68.744 57.642 339.362 1.00 54.42  ? 290  PRO B CG  1 
ATOM   6305 C CD  . PRO B 1 289 ? -69.096 57.853 340.804 1.00 52.10  ? 290  PRO B CD  1 
ATOM   6306 N N   . GLN B 1 290 ? -71.464 55.404 339.462 1.00 50.99  ? 291  GLN B N   1 
ATOM   6307 C CA  . GLN B 1 290 ? -72.082 54.168 339.003 1.00 55.63  ? 291  GLN B CA  1 
ATOM   6308 C C   . GLN B 1 290 ? -71.991 53.116 340.099 1.00 59.70  ? 291  GLN B C   1 
ATOM   6309 O O   . GLN B 1 290 ? -71.269 53.273 341.086 1.00 62.49  ? 291  GLN B O   1 
ATOM   6310 C CB  . GLN B 1 290 ? -71.424 53.655 337.716 1.00 65.29  ? 291  GLN B CB  1 
ATOM   6311 C CG  . GLN B 1 290 ? -70.099 52.936 337.941 1.00 61.58  ? 291  GLN B CG  1 
ATOM   6312 C CD  . GLN B 1 290 ? -69.689 52.067 336.763 1.00 78.64  ? 291  GLN B CD  1 
ATOM   6313 O OE1 . GLN B 1 290 ? -69.256 52.570 335.725 1.00 66.44  ? 291  GLN B OE1 1 
ATOM   6314 N NE2 . GLN B 1 290 ? -69.820 50.753 336.922 1.00 66.59  ? 291  GLN B NE2 1 
ATOM   6315 N N   . GLU B 1 291 ? -72.745 52.035 339.911 1.00 61.03  ? 292  GLU B N   1 
ATOM   6316 C CA  . GLU B 1 291 ? -72.655 50.885 340.801 1.00 67.89  ? 292  GLU B CA  1 
ATOM   6317 C C   . GLU B 1 291 ? -71.286 50.233 340.653 1.00 61.84  ? 292  GLU B C   1 
ATOM   6318 O O   . GLU B 1 291 ? -70.837 49.962 339.534 1.00 65.07  ? 292  GLU B O   1 
ATOM   6319 C CB  . GLU B 1 291 ? -73.763 49.883 340.478 1.00 71.37  ? 292  GLU B CB  1 
ATOM   6320 C CG  . GLU B 1 291 ? -74.563 49.408 341.683 1.00 88.60  ? 292  GLU B CG  1 
ATOM   6321 C CD  . GLU B 1 291 ? -75.482 50.481 342.239 1.00 94.70  ? 292  GLU B CD  1 
ATOM   6322 O OE1 . GLU B 1 291 ? -75.257 50.918 343.387 1.00 101.31 ? 292  GLU B OE1 1 
ATOM   6323 O OE2 . GLU B 1 291 ? -76.428 50.886 341.530 1.00 97.19  ? 292  GLU B OE2 1 
ATOM   6324 N N   . SER B 1 292 ? -70.616 49.983 341.775 1.00 49.64  ? 293  SER B N   1 
ATOM   6325 C CA  . SER B 1 292 ? -69.239 49.512 341.713 1.00 49.39  ? 293  SER B CA  1 
ATOM   6326 C C   . SER B 1 292 ? -68.854 48.843 343.024 1.00 47.06  ? 293  SER B C   1 
ATOM   6327 O O   . SER B 1 292 ? -69.608 48.849 344.000 1.00 48.22  ? 293  SER B O   1 
ATOM   6328 C CB  . SER B 1 292 ? -68.282 50.663 341.394 1.00 46.03  ? 293  SER B CB  1 
ATOM   6329 O OG  . SER B 1 292 ? -68.398 51.690 342.360 1.00 56.99  ? 293  SER B OG  1 
ATOM   6330 N N   . VAL B 1 293 ? -67.661 48.249 343.021 1.00 42.66  ? 294  VAL B N   1 
ATOM   6331 C CA  . VAL B 1 293 ? -67.006 47.769 344.230 1.00 44.79  ? 294  VAL B CA  1 
ATOM   6332 C C   . VAL B 1 293 ? -65.621 48.395 344.291 1.00 43.21  ? 294  VAL B C   1 
ATOM   6333 O O   . VAL B 1 293 ? -65.048 48.780 343.265 1.00 41.38  ? 294  VAL B O   1 
ATOM   6334 C CB  . VAL B 1 293 ? -66.917 46.227 344.286 1.00 47.02  ? 294  VAL B CB  1 
ATOM   6335 C CG1 . VAL B 1 293 ? -68.310 45.618 344.338 1.00 43.61  ? 294  VAL B CG1 1 
ATOM   6336 C CG2 . VAL B 1 293 ? -66.135 45.690 343.095 1.00 36.96  ? 294  VAL B CG2 1 
ATOM   6337 N N   . PHE B 1 294 ? -65.090 48.504 345.511 1.00 38.40  ? 295  PHE B N   1 
ATOM   6338 C CA  . PHE B 1 294 ? -63.795 49.140 345.775 1.00 36.06  ? 295  PHE B CA  1 
ATOM   6339 C C   . PHE B 1 294 ? -63.734 50.548 345.185 1.00 33.58  ? 295  PHE B C   1 
ATOM   6340 O O   . PHE B 1 294 ? -62.738 50.949 344.578 1.00 35.15  ? 295  PHE B O   1 
ATOM   6341 C CB  . PHE B 1 294 ? -62.629 48.287 345.264 1.00 32.42  ? 295  PHE B CB  1 
ATOM   6342 C CG  . PHE B 1 294 ? -61.403 48.342 346.146 1.00 38.94  ? 295  PHE B CG  1 
ATOM   6343 C CD1 . PHE B 1 294 ? -60.787 47.182 346.590 1.00 37.40  ? 295  PHE B CD1 1 
ATOM   6344 C CD2 . PHE B 1 294 ? -60.883 49.561 346.550 1.00 40.81  ? 295  PHE B CD2 1 
ATOM   6345 C CE1 . PHE B 1 294 ? -59.663 47.246 347.404 1.00 38.57  ? 295  PHE B CE1 1 
ATOM   6346 C CE2 . PHE B 1 294 ? -59.774 49.625 347.365 1.00 42.85  ? 295  PHE B CE2 1 
ATOM   6347 C CZ  . PHE B 1 294 ? -59.161 48.470 347.790 1.00 40.42  ? 295  PHE B CZ  1 
ATOM   6348 N N   . ARG B 1 295 ? -64.814 51.306 345.361 1.00 32.99  ? 296  ARG B N   1 
ATOM   6349 C CA  . ARG B 1 295 ? -64.869 52.708 344.967 1.00 37.70  ? 296  ARG B CA  1 
ATOM   6350 C C   . ARG B 1 295 ? -65.498 53.490 346.108 1.00 42.57  ? 296  ARG B C   1 
ATOM   6351 O O   . ARG B 1 295 ? -66.518 53.066 346.655 1.00 37.86  ? 296  ARG B O   1 
ATOM   6352 C CB  . ARG B 1 295 ? -65.673 52.905 343.677 1.00 34.81  ? 296  ARG B CB  1 
ATOM   6353 C CG  . ARG B 1 295 ? -64.923 52.524 342.414 1.00 38.49  ? 296  ARG B CG  1 
ATOM   6354 C CD  . ARG B 1 295 ? -63.628 53.305 342.285 1.00 42.92  ? 296  ARG B CD  1 
ATOM   6355 N NE  . ARG B 1 295 ? -62.889 52.923 341.087 1.00 45.17  ? 296  ARG B NE  1 
ATOM   6356 C CZ  . ARG B 1 295 ? -62.073 51.876 341.017 1.00 44.29  ? 296  ARG B CZ  1 
ATOM   6357 N NH1 . ARG B 1 295 ? -61.887 51.102 342.080 1.00 29.70  ? 296  ARG B NH1 1 
ATOM   6358 N NH2 . ARG B 1 295 ? -61.444 51.601 339.884 1.00 36.93  ? 296  ARG B NH2 1 
ATOM   6359 N N   . PHE B 1 296 ? -64.896 54.623 346.466 1.00 35.61  ? 297  PHE B N   1 
ATOM   6360 C CA  . PHE B 1 296 ? -65.289 55.359 347.660 1.00 36.07  ? 297  PHE B CA  1 
ATOM   6361 C C   . PHE B 1 296 ? -65.535 56.822 347.327 1.00 37.36  ? 297  PHE B C   1 
ATOM   6362 O O   . PHE B 1 296 ? -64.807 57.421 346.530 1.00 44.50  ? 297  PHE B O   1 
ATOM   6363 C CB  . PHE B 1 296 ? -64.226 55.217 348.753 1.00 29.33  ? 297  PHE B CB  1 
ATOM   6364 C CG  . PHE B 1 296 ? -63.682 53.825 348.870 1.00 29.48  ? 297  PHE B CG  1 
ATOM   6365 C CD1 . PHE B 1 296 ? -64.507 52.780 349.254 1.00 36.88  ? 297  PHE B CD1 1 
ATOM   6366 C CD2 . PHE B 1 296 ? -62.359 53.551 348.569 1.00 35.12  ? 297  PHE B CD2 1 
ATOM   6367 C CE1 . PHE B 1 296 ? -64.022 51.489 349.351 1.00 39.17  ? 297  PHE B CE1 1 
ATOM   6368 C CE2 . PHE B 1 296 ? -61.863 52.258 348.664 1.00 36.70  ? 297  PHE B CE2 1 
ATOM   6369 C CZ  . PHE B 1 296 ? -62.698 51.226 349.055 1.00 36.70  ? 297  PHE B CZ  1 
ATOM   6370 N N   . SER B 1 297 ? -66.561 57.393 347.963 1.00 38.18  ? 298  SER B N   1 
ATOM   6371 C CA  . SER B 1 297 ? -67.081 58.692 347.542 1.00 42.99  ? 298  SER B CA  1 
ATOM   6372 C C   . SER B 1 297 ? -66.104 59.818 347.844 1.00 38.94  ? 298  SER B C   1 
ATOM   6373 O O   . SER B 1 297 ? -65.789 60.630 346.966 1.00 37.79  ? 298  SER B O   1 
ATOM   6374 C CB  . SER B 1 297 ? -68.423 58.962 348.223 1.00 41.75  ? 298  SER B CB  1 
ATOM   6375 O OG  . SER B 1 297 ? -69.382 57.972 347.894 1.00 52.75  ? 298  SER B OG  1 
ATOM   6376 N N   . PHE B 1 298 ? -65.629 59.900 349.083 1.00 34.56  ? 299  PHE B N   1 
ATOM   6377 C CA  . PHE B 1 298 ? -64.813 61.022 349.533 1.00 39.12  ? 299  PHE B CA  1 
ATOM   6378 C C   . PHE B 1 298 ? -63.438 60.495 349.925 1.00 39.31  ? 299  PHE B C   1 
ATOM   6379 O O   . PHE B 1 298 ? -63.275 59.876 350.982 1.00 32.78  ? 299  PHE B O   1 
ATOM   6380 C CB  . PHE B 1 298 ? -65.511 61.764 350.667 1.00 33.85  ? 299  PHE B CB  1 
ATOM   6381 C CG  . PHE B 1 298 ? -66.830 62.346 350.256 1.00 36.92  ? 299  PHE B CG  1 
ATOM   6382 C CD1 . PHE B 1 298 ? -66.878 63.453 349.423 1.00 37.86  ? 299  PHE B CD1 1 
ATOM   6383 C CD2 . PHE B 1 298 ? -68.020 61.761 350.657 1.00 42.39  ? 299  PHE B CD2 1 
ATOM   6384 C CE1 . PHE B 1 298 ? -68.089 63.983 349.016 1.00 33.49  ? 299  PHE B CE1 1 
ATOM   6385 C CE2 . PHE B 1 298 ? -69.236 62.286 350.253 1.00 40.70  ? 299  PHE B CE2 1 
ATOM   6386 C CZ  . PHE B 1 298 ? -69.269 63.399 349.431 1.00 36.74  ? 299  PHE B CZ  1 
ATOM   6387 N N   . VAL B 1 299 ? -62.462 60.738 349.054 1.00 33.71  ? 300  VAL B N   1 
ATOM   6388 C CA  . VAL B 1 299 ? -61.097 60.236 349.186 1.00 31.43  ? 300  VAL B CA  1 
ATOM   6389 C C   . VAL B 1 299 ? -60.153 61.419 348.992 1.00 32.52  ? 300  VAL B C   1 
ATOM   6390 O O   . VAL B 1 299 ? -60.621 62.519 348.665 1.00 31.00  ? 300  VAL B O   1 
ATOM   6391 C CB  . VAL B 1 299 ? -60.826 59.106 348.176 1.00 36.01  ? 300  VAL B CB  1 
ATOM   6392 C CG1 . VAL B 1 299 ? -61.744 57.926 348.446 1.00 29.84  ? 300  VAL B CG1 1 
ATOM   6393 C CG2 . VAL B 1 299 ? -60.983 59.613 346.740 1.00 28.26  ? 300  VAL B CG2 1 
ATOM   6394 N N   . PRO B 1 300 ? -58.843 61.267 349.210 1.00 34.20  ? 301  PRO B N   1 
ATOM   6395 C CA  . PRO B 1 300 ? -57.924 62.386 348.966 1.00 32.28  ? 301  PRO B CA  1 
ATOM   6396 C C   . PRO B 1 300 ? -58.053 62.941 347.553 1.00 34.81  ? 301  PRO B C   1 
ATOM   6397 O O   . PRO B 1 300 ? -58.266 62.203 346.589 1.00 31.86  ? 301  PRO B O   1 
ATOM   6398 C CB  . PRO B 1 300 ? -56.545 61.763 349.199 1.00 34.01  ? 301  PRO B CB  1 
ATOM   6399 C CG  . PRO B 1 300 ? -56.793 60.710 350.211 1.00 38.13  ? 301  PRO B CG  1 
ATOM   6400 C CD  . PRO B 1 300 ? -58.179 60.172 349.945 1.00 39.75  ? 301  PRO B CD  1 
ATOM   6401 N N   . VAL B 1 301 ? -57.925 64.260 347.438 1.00 34.81  ? 302  VAL B N   1 
ATOM   6402 C CA  . VAL B 1 301 ? -58.046 64.959 346.166 1.00 44.30  ? 302  VAL B CA  1 
ATOM   6403 C C   . VAL B 1 301 ? -56.678 65.504 345.772 1.00 49.15  ? 302  VAL B C   1 
ATOM   6404 O O   . VAL B 1 301 ? -55.895 65.931 346.630 1.00 36.87  ? 302  VAL B O   1 
ATOM   6405 C CB  . VAL B 1 301 ? -59.101 66.084 346.242 1.00 45.70  ? 302  VAL B CB  1 
ATOM   6406 C CG1 . VAL B 1 301 ? -58.692 67.149 347.251 1.00 39.96  ? 302  VAL B CG1 1 
ATOM   6407 C CG2 . VAL B 1 301 ? -59.339 66.700 344.871 1.00 39.36  ? 302  VAL B CG2 1 
ATOM   6408 N N   . VAL B 1 302 ? -56.385 65.467 344.472 1.00 43.51  ? 303  VAL B N   1 
ATOM   6409 C CA  . VAL B 1 302 ? -55.149 66.018 343.925 1.00 39.75  ? 303  VAL B CA  1 
ATOM   6410 C C   . VAL B 1 302 ? -55.443 67.458 343.518 1.00 43.59  ? 303  VAL B C   1 
ATOM   6411 O O   . VAL B 1 302 ? -56.074 67.710 342.490 1.00 49.51  ? 303  VAL B O   1 
ATOM   6412 C CB  . VAL B 1 302 ? -54.632 65.194 342.745 1.00 50.15  ? 303  VAL B CB  1 
ATOM   6413 C CG1 . VAL B 1 302 ? -53.312 65.758 342.242 1.00 45.28  ? 303  VAL B CG1 1 
ATOM   6414 C CG2 . VAL B 1 302 ? -54.477 63.737 343.141 1.00 45.49  ? 303  VAL B CG2 1 
ATOM   6415 N N   . ASP B 1 303 ? -54.976 68.412 344.326 1.00 45.89  ? 304  ASP B N   1 
ATOM   6416 C CA  . ASP B 1 303 ? -55.262 69.823 344.099 1.00 54.87  ? 304  ASP B CA  1 
ATOM   6417 C C   . ASP B 1 303 ? -54.012 70.697 344.127 1.00 54.12  ? 304  ASP B C   1 
ATOM   6418 O O   . ASP B 1 303 ? -54.133 71.923 344.222 1.00 55.05  ? 304  ASP B O   1 
ATOM   6419 C CB  . ASP B 1 303 ? -56.270 70.337 345.135 1.00 56.05  ? 304  ASP B CB  1 
ATOM   6420 C CG  . ASP B 1 303 ? -55.763 70.200 346.558 1.00 55.47  ? 304  ASP B CG  1 
ATOM   6421 O OD1 . ASP B 1 303 ? -54.785 69.452 346.774 1.00 57.20  ? 304  ASP B OD1 1 
ATOM   6422 O OD2 . ASP B 1 303 ? -56.344 70.836 347.463 1.00 82.94  ? 304  ASP B OD2 1 
ATOM   6423 N N   . GLY B 1 304 ? -52.822 70.106 344.060 1.00 49.45  ? 305  GLY B N   1 
ATOM   6424 C CA  . GLY B 1 304 ? -51.592 70.866 344.029 1.00 53.93  ? 305  GLY B CA  1 
ATOM   6425 C C   . GLY B 1 304 ? -51.020 71.234 345.381 1.00 52.32  ? 305  GLY B C   1 
ATOM   6426 O O   . GLY B 1 304 ? -49.897 71.752 345.437 1.00 53.27  ? 305  GLY B O   1 
ATOM   6427 N N   . ASP B 1 305 ? -51.742 70.983 346.473 1.00 49.20  ? 306  ASP B N   1 
ATOM   6428 C CA  . ASP B 1 305 ? -51.261 71.374 347.793 1.00 55.72  ? 306  ASP B CA  1 
ATOM   6429 C C   . ASP B 1 305 ? -50.633 70.195 348.526 1.00 57.11  ? 306  ASP B C   1 
ATOM   6430 O O   . ASP B 1 305 ? -49.408 70.032 348.508 1.00 59.41  ? 306  ASP B O   1 
ATOM   6431 C CB  . ASP B 1 305 ? -52.395 71.971 348.625 1.00 47.98  ? 306  ASP B CB  1 
ATOM   6432 C CG  . ASP B 1 305 ? -51.897 72.627 349.895 1.00 59.09  ? 306  ASP B CG  1 
ATOM   6433 O OD1 . ASP B 1 305 ? -50.670 72.834 350.014 1.00 70.61  ? 306  ASP B OD1 1 
ATOM   6434 O OD2 . ASP B 1 305 ? -52.728 72.940 350.773 1.00 71.79  ? 306  ASP B OD2 1 
ATOM   6435 N N   . PHE B 1 306 ? -51.459 69.381 349.192 1.00 48.89  ? 307  PHE B N   1 
ATOM   6436 C CA  . PHE B 1 306 ? -50.941 68.177 349.834 1.00 45.06  ? 307  PHE B CA  1 
ATOM   6437 C C   . PHE B 1 306 ? -50.220 67.292 348.826 1.00 48.61  ? 307  PHE B C   1 
ATOM   6438 O O   . PHE B 1 306 ? -49.144 66.754 349.114 1.00 47.59  ? 307  PHE B O   1 
ATOM   6439 C CB  . PHE B 1 306 ? -52.074 67.403 350.511 1.00 40.56  ? 307  PHE B CB  1 
ATOM   6440 C CG  . PHE B 1 306 ? -51.602 66.431 351.562 1.00 37.16  ? 307  PHE B CG  1 
ATOM   6441 C CD1 . PHE B 1 306 ? -51.069 65.202 351.202 1.00 33.87  ? 307  PHE B CD1 1 
ATOM   6442 C CD2 . PHE B 1 306 ? -51.690 66.747 352.907 1.00 30.49  ? 307  PHE B CD2 1 
ATOM   6443 C CE1 . PHE B 1 306 ? -50.630 64.307 352.162 1.00 31.86  ? 307  PHE B CE1 1 
ATOM   6444 C CE2 . PHE B 1 306 ? -51.253 65.855 353.877 1.00 37.05  ? 307  PHE B CE2 1 
ATOM   6445 C CZ  . PHE B 1 306 ? -50.723 64.634 353.503 1.00 35.82  ? 307  PHE B CZ  1 
ATOM   6446 N N   . LEU B 1 307 ? -50.799 67.135 347.639 1.00 43.96  ? 308  LEU B N   1 
ATOM   6447 C CA  . LEU B 1 307 ? -50.173 66.438 346.522 1.00 46.10  ? 308  LEU B CA  1 
ATOM   6448 C C   . LEU B 1 307 ? -50.033 67.435 345.382 1.00 50.49  ? 308  LEU B C   1 
ATOM   6449 O O   . LEU B 1 307 ? -51.034 67.834 344.776 1.00 49.98  ? 308  LEU B O   1 
ATOM   6450 C CB  . LEU B 1 307 ? -50.999 65.226 346.093 1.00 48.29  ? 308  LEU B CB  1 
ATOM   6451 C CG  . LEU B 1 307 ? -51.223 64.145 347.147 1.00 59.60  ? 308  LEU B CG  1 
ATOM   6452 C CD1 . LEU B 1 307 ? -52.238 63.122 346.654 1.00 52.32  ? 308  LEU B CD1 1 
ATOM   6453 C CD2 . LEU B 1 307 ? -49.904 63.478 347.509 1.00 50.98  ? 308  LEU B CD2 1 
ATOM   6454 N N   . SER B 1 308 ? -48.796 67.842 345.094 1.00 48.23  ? 309  SER B N   1 
ATOM   6455 C CA  . SER B 1 308 ? -48.557 68.784 344.006 1.00 51.59  ? 309  SER B CA  1 
ATOM   6456 C C   . SER B 1 308 ? -48.854 68.178 342.642 1.00 48.89  ? 309  SER B C   1 
ATOM   6457 O O   . SER B 1 308 ? -48.963 68.916 341.657 1.00 61.63  ? 309  SER B O   1 
ATOM   6458 C CB  . SER B 1 308 ? -47.113 69.281 344.056 1.00 50.26  ? 309  SER B CB  1 
ATOM   6459 O OG  . SER B 1 308 ? -46.208 68.192 344.020 1.00 58.87  ? 309  SER B OG  1 
ATOM   6460 N N   . ASP B 1 309 ? -48.984 66.859 342.566 1.00 51.21  ? 310  ASP B N   1 
ATOM   6461 C CA  . ASP B 1 309 ? -49.317 66.162 341.333 1.00 51.42  ? 310  ASP B CA  1 
ATOM   6462 C C   . ASP B 1 309 ? -49.947 64.829 341.717 1.00 44.36  ? 310  ASP B C   1 
ATOM   6463 O O   . ASP B 1 309 ? -50.086 64.509 342.901 1.00 49.40  ? 310  ASP B O   1 
ATOM   6464 C CB  . ASP B 1 309 ? -48.079 65.980 340.450 1.00 48.55  ? 310  ASP B CB  1 
ATOM   6465 C CG  . ASP B 1 309 ? -48.427 65.790 338.985 1.00 69.05  ? 310  ASP B CG  1 
ATOM   6466 O OD1 . ASP B 1 309 ? -49.557 65.342 338.693 1.00 63.16  ? 310  ASP B OD1 1 
ATOM   6467 O OD2 . ASP B 1 309 ? -47.569 66.086 338.125 1.00 65.05  ? 310  ASP B OD2 1 
ATOM   6468 N N   . THR B 1 310 ? -50.338 64.054 340.709 1.00 43.02  ? 311  THR B N   1 
ATOM   6469 C CA  . THR B 1 310 ? -50.893 62.739 340.979 1.00 51.32  ? 311  THR B CA  1 
ATOM   6470 C C   . THR B 1 310 ? -49.835 61.867 341.653 1.00 53.62  ? 311  THR B C   1 
ATOM   6471 O O   . THR B 1 310 ? -48.639 62.012 341.382 1.00 50.11  ? 311  THR B O   1 
ATOM   6472 C CB  . THR B 1 310 ? -51.375 62.070 339.693 1.00 50.32  ? 311  THR B CB  1 
ATOM   6473 O OG1 . THR B 1 310 ? -50.249 61.761 338.862 1.00 56.33  ? 311  THR B OG1 1 
ATOM   6474 C CG2 . THR B 1 310 ? -52.339 62.982 338.938 1.00 40.09  ? 311  THR B CG2 1 
ATOM   6475 N N   . PRO B 1 311 ? -50.246 60.969 342.552 1.00 48.24  ? 312  PRO B N   1 
ATOM   6476 C CA  . PRO B 1 311 ? -49.256 60.105 343.217 1.00 46.19  ? 312  PRO B CA  1 
ATOM   6477 C C   . PRO B 1 311 ? -48.398 59.317 342.243 1.00 49.44  ? 312  PRO B C   1 
ATOM   6478 O O   . PRO B 1 311 ? -47.199 59.140 342.485 1.00 50.65  ? 312  PRO B O   1 
ATOM   6479 C CB  . PRO B 1 311 ? -50.125 59.191 344.093 1.00 41.27  ? 312  PRO B CB  1 
ATOM   6480 C CG  . PRO B 1 311 ? -51.382 59.972 344.325 1.00 42.39  ? 312  PRO B CG  1 
ATOM   6481 C CD  . PRO B 1 311 ? -51.610 60.759 343.067 1.00 49.44  ? 312  PRO B CD  1 
ATOM   6482 N N   . GLU B 1 312 ? -48.977 58.859 341.130 1.00 53.62  ? 313  GLU B N   1 
ATOM   6483 C CA  . GLU B 1 312 ? -48.195 58.104 340.158 1.00 58.75  ? 313  GLU B CA  1 
ATOM   6484 C C   . GLU B 1 312 ? -47.146 58.989 339.488 1.00 54.35  ? 313  GLU B C   1 
ATOM   6485 O O   . GLU B 1 312 ? -46.031 58.536 339.207 1.00 49.86  ? 313  GLU B O   1 
ATOM   6486 C CB  . GLU B 1 312 ? -49.118 57.472 339.117 1.00 57.08  ? 313  GLU B CB  1 
ATOM   6487 C CG  . GLU B 1 312 ? -48.437 56.417 338.257 1.00 78.51  ? 313  GLU B CG  1 
ATOM   6488 C CD  . GLU B 1 312 ? -48.347 56.826 336.806 1.00 102.31 ? 313  GLU B CD  1 
ATOM   6489 O OE1 . GLU B 1 312 ? -48.481 58.035 336.531 1.00 102.01 ? 313  GLU B OE1 1 
ATOM   6490 O OE2 . GLU B 1 312 ? -48.130 55.946 335.943 1.00 103.11 ? 313  GLU B OE2 1 
ATOM   6491 N N   . ALA B 1 313 ? -47.476 60.256 339.235 1.00 46.86  ? 314  ALA B N   1 
ATOM   6492 C CA  . ALA B 1 313 ? -46.480 61.171 338.687 1.00 42.23  ? 314  ALA B CA  1 
ATOM   6493 C C   . ALA B 1 313 ? -45.388 61.467 339.706 1.00 49.31  ? 314  ALA B C   1 
ATOM   6494 O O   . ALA B 1 313 ? -44.200 61.474 339.365 1.00 50.36  ? 314  ALA B O   1 
ATOM   6495 C CB  . ALA B 1 313 ? -47.150 62.464 338.224 1.00 41.13  ? 314  ALA B CB  1 
ATOM   6496 N N   . LEU B 1 314 ? -45.770 61.715 340.962 1.00 51.66  ? 315  LEU B N   1 
ATOM   6497 C CA  . LEU B 1 314 ? -44.772 61.974 341.995 1.00 43.32  ? 315  LEU B CA  1 
ATOM   6498 C C   . LEU B 1 314 ? -43.900 60.752 342.246 1.00 42.60  ? 315  LEU B C   1 
ATOM   6499 O O   . LEU B 1 314 ? -42.722 60.892 342.595 1.00 48.87  ? 315  LEU B O   1 
ATOM   6500 C CB  . LEU B 1 314 ? -45.457 62.416 343.287 1.00 44.20  ? 315  LEU B CB  1 
ATOM   6501 C CG  . LEU B 1 314 ? -46.191 63.757 343.248 1.00 47.97  ? 315  LEU B CG  1 
ATOM   6502 C CD1 . LEU B 1 314 ? -46.948 63.985 344.547 1.00 45.88  ? 315  LEU B CD1 1 
ATOM   6503 C CD2 . LEU B 1 314 ? -45.213 64.889 342.999 1.00 42.37  ? 315  LEU B CD2 1 
ATOM   6504 N N   . ILE B 1 315 ? -44.455 59.552 342.069 1.00 40.53  ? 316  ILE B N   1 
ATOM   6505 C CA  . ILE B 1 315 ? -43.675 58.330 342.236 1.00 41.69  ? 316  ILE B CA  1 
ATOM   6506 C C   . ILE B 1 315 ? -42.598 58.237 341.162 1.00 52.77  ? 316  ILE B C   1 
ATOM   6507 O O   . ILE B 1 315 ? -41.434 57.933 341.450 1.00 55.33  ? 316  ILE B O   1 
ATOM   6508 C CB  . ILE B 1 315 ? -44.604 57.102 342.218 1.00 46.98  ? 316  ILE B CB  1 
ATOM   6509 C CG1 . ILE B 1 315 ? -45.320 56.946 343.560 1.00 47.34  ? 316  ILE B CG1 1 
ATOM   6510 C CG2 . ILE B 1 315 ? -43.829 55.836 341.894 1.00 38.56  ? 316  ILE B CG2 1 
ATOM   6511 C CD1 . ILE B 1 315 ? -46.478 55.973 343.515 1.00 45.99  ? 316  ILE B CD1 1 
ATOM   6512 N N   . ASN B 1 316 ? -42.966 58.515 339.908 1.00 53.40  ? 317  ASN B N   1 
ATOM   6513 C CA  . ASN B 1 316 ? -42.030 58.353 338.800 1.00 57.95  ? 317  ASN B CA  1 
ATOM   6514 C C   . ASN B 1 316 ? -40.897 59.371 338.850 1.00 57.84  ? 317  ASN B C   1 
ATOM   6515 O O   . ASN B 1 316 ? -39.783 59.074 338.403 1.00 68.27  ? 317  ASN B O   1 
ATOM   6516 C CB  . ASN B 1 316 ? -42.769 58.463 337.467 1.00 56.93  ? 317  ASN B CB  1 
ATOM   6517 C CG  . ASN B 1 316 ? -43.793 57.364 337.277 1.00 59.76  ? 317  ASN B CG  1 
ATOM   6518 O OD1 . ASN B 1 316 ? -43.683 56.289 337.867 1.00 64.23  ? 317  ASN B OD1 1 
ATOM   6519 N ND2 . ASN B 1 316 ? -44.798 57.628 336.449 1.00 57.65  ? 317  ASN B ND2 1 
ATOM   6520 N N   . ALA B 1 317 ? -41.152 60.564 339.384 1.00 50.38  ? 318  ALA B N   1 
ATOM   6521 C CA  . ALA B 1 317 ? -40.177 61.646 339.377 1.00 45.12  ? 318  ALA B CA  1 
ATOM   6522 C C   . ALA B 1 317 ? -39.365 61.741 340.661 1.00 58.10  ? 318  ALA B C   1 
ATOM   6523 O O   . ALA B 1 317 ? -38.534 62.645 340.784 1.00 64.52  ? 318  ALA B O   1 
ATOM   6524 C CB  . ALA B 1 317 ? -40.879 62.984 339.127 1.00 55.83  ? 318  ALA B CB  1 
ATOM   6525 N N   . GLY B 1 318 ? -39.578 60.842 341.614 1.00 55.46  ? 319  GLY B N   1 
ATOM   6526 C CA  . GLY B 1 318 ? -38.976 60.982 342.923 1.00 58.42  ? 319  GLY B CA  1 
ATOM   6527 C C   . GLY B 1 318 ? -37.615 60.319 343.044 1.00 57.81  ? 319  GLY B C   1 
ATOM   6528 O O   . GLY B 1 318 ? -37.335 59.300 342.417 1.00 51.79  ? 319  GLY B O   1 
ATOM   6529 N N   . ASP B 1 319 ? -36.762 60.933 343.862 1.00 62.63  ? 320  ASP B N   1 
ATOM   6530 C CA  . ASP B 1 319 ? -35.494 60.347 344.282 1.00 58.90  ? 320  ASP B CA  1 
ATOM   6531 C C   . ASP B 1 319 ? -35.738 59.696 345.637 1.00 52.68  ? 320  ASP B C   1 
ATOM   6532 O O   . ASP B 1 319 ? -35.993 60.389 346.627 1.00 45.98  ? 320  ASP B O   1 
ATOM   6533 C CB  . ASP B 1 319 ? -34.395 61.407 344.360 1.00 64.72  ? 320  ASP B CB  1 
ATOM   6534 C CG  . ASP B 1 319 ? -33.017 60.817 344.643 1.00 71.41  ? 320  ASP B CG  1 
ATOM   6535 O OD1 . ASP B 1 319 ? -32.911 59.595 344.888 1.00 65.42  ? 320  ASP B OD1 1 
ATOM   6536 O OD2 . ASP B 1 319 ? -32.030 61.585 344.620 1.00 67.26  ? 320  ASP B OD2 1 
ATOM   6537 N N   . PHE B 1 320 ? -35.670 58.366 345.680 1.00 48.22  ? 321  PHE B N   1 
ATOM   6538 C CA  . PHE B 1 320 ? -36.014 57.618 346.881 1.00 52.45  ? 321  PHE B CA  1 
ATOM   6539 C C   . PHE B 1 320 ? -34.806 56.933 347.513 1.00 59.27  ? 321  PHE B C   1 
ATOM   6540 O O   . PHE B 1 320 ? -34.971 55.961 348.258 1.00 52.15  ? 321  PHE B O   1 
ATOM   6541 C CB  . PHE B 1 320 ? -37.113 56.603 346.566 1.00 45.67  ? 321  PHE B CB  1 
ATOM   6542 C CG  . PHE B 1 320 ? -38.404 57.237 346.134 1.00 42.95  ? 321  PHE B CG  1 
ATOM   6543 C CD1 . PHE B 1 320 ? -39.256 57.808 347.067 1.00 34.41  ? 321  PHE B CD1 1 
ATOM   6544 C CD2 . PHE B 1 320 ? -38.757 57.282 344.796 1.00 42.48  ? 321  PHE B CD2 1 
ATOM   6545 C CE1 . PHE B 1 320 ? -40.441 58.401 346.675 1.00 46.36  ? 321  PHE B CE1 1 
ATOM   6546 C CE2 . PHE B 1 320 ? -39.942 57.875 344.397 1.00 43.07  ? 321  PHE B CE2 1 
ATOM   6547 C CZ  . PHE B 1 320 ? -40.784 58.435 345.336 1.00 47.49  ? 321  PHE B CZ  1 
ATOM   6548 N N   . HIS B 1 321 ? -33.598 57.423 347.239 1.00 51.95  ? 322  HIS B N   1 
ATOM   6549 C CA  . HIS B 1 321 ? -32.419 56.935 347.942 1.00 51.26  ? 322  HIS B CA  1 
ATOM   6550 C C   . HIS B 1 321 ? -32.514 57.279 349.424 1.00 43.69  ? 322  HIS B C   1 
ATOM   6551 O O   . HIS B 1 321 ? -32.973 58.361 349.801 1.00 47.53  ? 322  HIS B O   1 
ATOM   6552 C CB  . HIS B 1 321 ? -31.146 57.536 347.343 1.00 46.17  ? 322  HIS B CB  1 
ATOM   6553 C CG  . HIS B 1 321 ? -30.677 56.840 346.104 1.00 47.05  ? 322  HIS B CG  1 
ATOM   6554 N ND1 . HIS B 1 321 ? -31.042 57.247 344.839 1.00 41.16  ? 322  HIS B ND1 1 
ATOM   6555 C CD2 . HIS B 1 321 ? -29.883 55.757 345.937 1.00 39.73  ? 322  HIS B CD2 1 
ATOM   6556 C CE1 . HIS B 1 321 ? -30.490 56.447 343.945 1.00 43.69  ? 322  HIS B CE1 1 
ATOM   6557 N NE2 . HIS B 1 321 ? -29.781 55.534 344.585 1.00 51.53  ? 322  HIS B NE2 1 
ATOM   6558 N N   . GLY B 1 322 ? -32.083 56.347 350.268 1.00 46.52  ? 323  GLY B N   1 
ATOM   6559 C CA  . GLY B 1 322 ? -32.201 56.530 351.699 1.00 48.60  ? 323  GLY B CA  1 
ATOM   6560 C C   . GLY B 1 322 ? -33.540 56.143 352.279 1.00 51.40  ? 323  GLY B C   1 
ATOM   6561 O O   . GLY B 1 322 ? -33.778 56.386 353.467 1.00 63.37  ? 323  GLY B O   1 
ATOM   6562 N N   . LEU B 1 323 ? -34.421 55.547 351.482 1.00 51.25  ? 324  LEU B N   1 
ATOM   6563 C CA  . LEU B 1 323 ? -35.740 55.127 351.929 1.00 42.96  ? 324  LEU B CA  1 
ATOM   6564 C C   . LEU B 1 323 ? -35.833 53.607 351.921 1.00 41.64  ? 324  LEU B C   1 
ATOM   6565 O O   . LEU B 1 323 ? -35.370 52.952 350.980 1.00 42.72  ? 324  LEU B O   1 
ATOM   6566 C CB  . LEU B 1 323 ? -36.830 55.725 351.036 1.00 51.27  ? 324  LEU B CB  1 
ATOM   6567 C CG  . LEU B 1 323 ? -38.281 55.344 351.334 1.00 51.43  ? 324  LEU B CG  1 
ATOM   6568 C CD1 . LEU B 1 323 ? -38.711 55.885 352.690 1.00 52.57  ? 324  LEU B CD1 1 
ATOM   6569 C CD2 . LEU B 1 323 ? -39.196 55.849 350.229 1.00 47.64  ? 324  LEU B CD2 1 
ATOM   6570 N N   . GLN B 1 324 ? -36.423 53.051 352.977 1.00 34.12  ? 325  GLN B N   1 
ATOM   6571 C CA  . GLN B 1 324 ? -36.721 51.627 353.063 1.00 43.19  ? 325  GLN B CA  1 
ATOM   6572 C C   . GLN B 1 324 ? -38.219 51.452 353.270 1.00 43.34  ? 325  GLN B C   1 
ATOM   6573 O O   . GLN B 1 324 ? -38.804 52.081 354.157 1.00 40.99  ? 325  GLN B O   1 
ATOM   6574 C CB  . GLN B 1 324 ? -35.943 50.959 354.203 1.00 40.71  ? 325  GLN B CB  1 
ATOM   6575 C CG  . GLN B 1 324 ? -34.431 51.100 354.098 1.00 42.63  ? 325  GLN B CG  1 
ATOM   6576 C CD  . GLN B 1 324 ? -33.904 52.293 354.870 1.00 53.85  ? 325  GLN B CD  1 
ATOM   6577 O OE1 . GLN B 1 324 ? -34.312 52.544 356.006 1.00 55.49  ? 325  GLN B OE1 1 
ATOM   6578 N NE2 . GLN B 1 324 ? -32.998 53.042 354.252 1.00 56.31  ? 325  GLN B NE2 1 
ATOM   6579 N N   . VAL B 1 325 ? -38.839 50.609 352.445 1.00 40.35  ? 326  VAL B N   1 
ATOM   6580 C CA  . VAL B 1 325 ? -40.272 50.362 352.515 1.00 38.00  ? 326  VAL B CA  1 
ATOM   6581 C C   . VAL B 1 325 ? -40.511 48.865 352.609 1.00 36.41  ? 326  VAL B C   1 
ATOM   6582 O O   . VAL B 1 325 ? -39.769 48.054 352.045 1.00 40.59  ? 326  VAL B O   1 
ATOM   6583 C CB  . VAL B 1 325 ? -41.040 50.943 351.306 1.00 34.80  ? 326  VAL B CB  1 
ATOM   6584 C CG1 . VAL B 1 325 ? -41.305 52.421 351.499 1.00 43.94  ? 326  VAL B CG1 1 
ATOM   6585 C CG2 . VAL B 1 325 ? -40.276 50.693 350.022 1.00 56.26  ? 326  VAL B CG2 1 
ATOM   6586 N N   . LEU B 1 326 ? -41.567 48.504 353.329 1.00 40.79  ? 327  LEU B N   1 
ATOM   6587 C CA  . LEU B 1 326 ? -42.062 47.136 353.390 1.00 36.05  ? 327  LEU B CA  1 
ATOM   6588 C C   . LEU B 1 326 ? -43.467 47.134 352.805 1.00 35.83  ? 327  LEU B C   1 
ATOM   6589 O O   . LEU B 1 326 ? -44.366 47.787 353.344 1.00 41.06  ? 327  LEU B O   1 
ATOM   6590 C CB  . LEU B 1 326 ? -42.056 46.618 354.830 1.00 40.04  ? 327  LEU B CB  1 
ATOM   6591 C CG  . LEU B 1 326 ? -42.536 45.185 355.064 1.00 43.32  ? 327  LEU B CG  1 
ATOM   6592 C CD1 . LEU B 1 326 ? -41.709 44.211 354.257 1.00 47.53  ? 327  LEU B CD1 1 
ATOM   6593 C CD2 . LEU B 1 326 ? -42.478 44.840 356.540 1.00 47.50  ? 327  LEU B CD2 1 
ATOM   6594 N N   . VAL B 1 327 ? -43.651 46.425 351.691 1.00 37.15  ? 328  VAL B N   1 
ATOM   6595 C CA  . VAL B 1 327 ? -44.935 46.380 351.003 1.00 35.20  ? 328  VAL B CA  1 
ATOM   6596 C C   . VAL B 1 327 ? -45.359 44.927 350.839 1.00 36.72  ? 328  VAL B C   1 
ATOM   6597 O O   . VAL B 1 327 ? -44.531 44.014 350.793 1.00 36.28  ? 328  VAL B O   1 
ATOM   6598 C CB  . VAL B 1 327 ? -44.888 47.091 349.636 1.00 35.88  ? 328  VAL B CB  1 
ATOM   6599 C CG1 . VAL B 1 327 ? -44.546 48.562 349.813 1.00 36.01  ? 328  VAL B CG1 1 
ATOM   6600 C CG2 . VAL B 1 327 ? -43.885 46.414 348.713 1.00 33.97  ? 328  VAL B CG2 1 
ATOM   6601 N N   . GLY B 1 328 ? -46.667 44.717 350.749 1.00 28.36  ? 329  GLY B N   1 
ATOM   6602 C CA  . GLY B 1 328 ? -47.171 43.370 350.549 1.00 28.04  ? 329  GLY B CA  1 
ATOM   6603 C C   . GLY B 1 328 ? -48.669 43.358 350.341 1.00 35.03  ? 329  GLY B C   1 
ATOM   6604 O O   . GLY B 1 328 ? -49.347 44.388 350.425 1.00 29.62  ? 329  GLY B O   1 
ATOM   6605 N N   . VAL B 1 329 ? -49.172 42.155 350.059 1.00 30.41  ? 330  VAL B N   1 
ATOM   6606 C CA  . VAL B 1 329 ? -50.579 41.904 349.774 1.00 33.88  ? 330  VAL B CA  1 
ATOM   6607 C C   . VAL B 1 329 ? -50.950 40.560 350.386 1.00 38.07  ? 330  VAL B C   1 
ATOM   6608 O O   . VAL B 1 329 ? -50.087 39.756 350.744 1.00 36.98  ? 330  VAL B O   1 
ATOM   6609 C CB  . VAL B 1 329 ? -50.878 41.887 348.258 1.00 36.78  ? 330  VAL B CB  1 
ATOM   6610 C CG1 . VAL B 1 329 ? -50.632 43.250 347.634 1.00 31.13  ? 330  VAL B CG1 1 
ATOM   6611 C CG2 . VAL B 1 329 ? -50.033 40.820 347.570 1.00 29.45  ? 330  VAL B CG2 1 
ATOM   6612 N N   . VAL B 1 330 ? -52.254 40.309 350.486 1.00 38.73  ? 331  VAL B N   1 
ATOM   6613 C CA  . VAL B 1 330 ? -52.722 38.984 350.877 1.00 37.19  ? 331  VAL B CA  1 
ATOM   6614 C C   . VAL B 1 330 ? -52.991 38.163 349.620 1.00 36.60  ? 331  VAL B C   1 
ATOM   6615 O O   . VAL B 1 330 ? -52.968 38.690 348.502 1.00 36.87  ? 331  VAL B O   1 
ATOM   6616 C CB  . VAL B 1 330 ? -53.970 39.060 351.773 1.00 40.41  ? 331  VAL B CB  1 
ATOM   6617 C CG1 . VAL B 1 330 ? -53.623 39.700 353.117 1.00 34.42  ? 331  VAL B CG1 1 
ATOM   6618 C CG2 . VAL B 1 330 ? -55.088 39.812 351.072 1.00 30.15  ? 331  VAL B CG2 1 
ATOM   6619 N N   . LYS B 1 331 ? -53.264 36.869 349.801 1.00 46.21  ? 332  LYS B N   1 
ATOM   6620 C CA  . LYS B 1 331 ? -53.384 35.956 348.668 1.00 44.34  ? 332  LYS B CA  1 
ATOM   6621 C C   . LYS B 1 331 ? -54.594 36.270 347.793 1.00 43.39  ? 332  LYS B C   1 
ATOM   6622 O O   . LYS B 1 331 ? -54.534 36.079 346.573 1.00 47.92  ? 332  LYS B O   1 
ATOM   6623 C CB  . LYS B 1 331 ? -53.455 34.515 349.175 1.00 51.34  ? 332  LYS B CB  1 
ATOM   6624 C CG  . LYS B 1 331 ? -53.110 33.456 348.142 1.00 53.92  ? 332  LYS B CG  1 
ATOM   6625 C CD  . LYS B 1 331 ? -52.932 32.099 348.811 1.00 67.63  ? 332  LYS B CD  1 
ATOM   6626 C CE  . LYS B 1 331 ? -52.543 31.024 347.811 1.00 67.99  ? 332  LYS B CE  1 
ATOM   6627 N NZ  . LYS B 1 331 ? -53.618 30.787 346.808 1.00 79.62  ? 332  LYS B NZ  1 
ATOM   6628 N N   . ASP B 1 332 ? -55.698 36.750 348.382 1.00 41.29  ? 333  ASP B N   1 
ATOM   6629 C CA  . ASP B 1 332 ? -56.952 36.980 347.650 1.00 45.20  ? 333  ASP B CA  1 
ATOM   6630 C C   . ASP B 1 332 ? -57.483 38.372 347.993 1.00 42.87  ? 333  ASP B C   1 
ATOM   6631 O O   . ASP B 1 332 ? -58.400 38.519 348.803 1.00 50.91  ? 333  ASP B O   1 
ATOM   6632 C CB  . ASP B 1 332 ? -57.970 35.889 347.972 1.00 39.18  ? 333  ASP B CB  1 
ATOM   6633 C CG  . ASP B 1 332 ? -57.445 34.499 347.673 1.00 57.01  ? 333  ASP B CG  1 
ATOM   6634 O OD1 . ASP B 1 332 ? -57.483 34.084 346.493 1.00 62.30  ? 333  ASP B OD1 1 
ATOM   6635 O OD2 . ASP B 1 332 ? -56.983 33.827 348.620 1.00 47.43  ? 333  ASP B OD2 1 
ATOM   6636 N N   . GLU B 1 333 ? -56.918 39.391 347.338 1.00 44.26  ? 334  GLU B N   1 
ATOM   6637 C CA  . GLU B 1 333 ? -57.242 40.776 347.668 1.00 38.21  ? 334  GLU B CA  1 
ATOM   6638 C C   . GLU B 1 333 ? -58.675 41.148 347.300 1.00 44.69  ? 334  GLU B C   1 
ATOM   6639 O O   . GLU B 1 333 ? -59.277 42.000 347.964 1.00 46.03  ? 334  GLU B O   1 
ATOM   6640 C CB  . GLU B 1 333 ? -56.265 41.725 346.965 1.00 38.73  ? 334  GLU B CB  1 
ATOM   6641 C CG  . GLU B 1 333 ? -54.871 41.757 347.576 1.00 41.95  ? 334  GLU B CG  1 
ATOM   6642 C CD  . GLU B 1 333 ? -54.839 42.474 348.917 1.00 62.00  ? 334  GLU B CD  1 
ATOM   6643 O OE1 . GLU B 1 333 ? -55.825 43.170 349.241 1.00 50.10  ? 334  GLU B OE1 1 
ATOM   6644 O OE2 . GLU B 1 333 ? -53.835 42.335 349.653 1.00 48.26  ? 334  GLU B OE2 1 
ATOM   6645 N N   . GLY B 1 334 ? -59.237 40.538 346.260 1.00 43.91  ? 335  GLY B N   1 
ATOM   6646 C CA  . GLY B 1 334 ? -60.516 40.994 345.746 1.00 38.89  ? 335  GLY B CA  1 
ATOM   6647 C C   . GLY B 1 334 ? -61.742 40.238 346.220 1.00 39.21  ? 335  GLY B C   1 
ATOM   6648 O O   . GLY B 1 334 ? -62.857 40.766 346.148 1.00 35.22  ? 335  GLY B O   1 
ATOM   6649 N N   . SER B 1 335 ? -61.550 39.009 346.711 1.00 37.30  ? 336  SER B N   1 
ATOM   6650 C CA  . SER B 1 335 ? -62.680 38.133 347.014 1.00 50.75  ? 336  SER B CA  1 
ATOM   6651 C C   . SER B 1 335 ? -63.654 38.787 347.986 1.00 46.61  ? 336  SER B C   1 
ATOM   6652 O O   . SER B 1 335 ? -64.872 38.594 347.889 1.00 47.12  ? 336  SER B O   1 
ATOM   6653 C CB  . SER B 1 335 ? -62.179 36.806 347.586 1.00 59.13  ? 336  SER B CB  1 
ATOM   6654 O OG  . SER B 1 335 ? -61.608 36.990 348.874 1.00 48.54  ? 336  SER B OG  1 
ATOM   6655 N N   . TYR B 1 336 ? -63.132 39.574 348.924 1.00 52.62  ? 337  TYR B N   1 
ATOM   6656 C CA  . TYR B 1 336 ? -63.977 40.196 349.935 1.00 37.40  ? 337  TYR B CA  1 
ATOM   6657 C C   . TYR B 1 336 ? -64.972 41.166 349.305 1.00 48.83  ? 337  TYR B C   1 
ATOM   6658 O O   . TYR B 1 336 ? -66.151 41.191 349.678 1.00 45.14  ? 337  TYR B O   1 
ATOM   6659 C CB  . TYR B 1 336 ? -63.084 40.897 350.962 1.00 59.88  ? 337  TYR B CB  1 
ATOM   6660 C CG  . TYR B 1 336 ? -63.778 41.497 352.165 1.00 59.15  ? 337  TYR B CG  1 
ATOM   6661 C CD1 . TYR B 1 336 ? -63.428 41.110 353.451 1.00 75.18  ? 337  TYR B CD1 1 
ATOM   6662 C CD2 . TYR B 1 336 ? -64.748 42.476 352.022 1.00 71.25  ? 337  TYR B CD2 1 
ATOM   6663 C CE1 . TYR B 1 336 ? -64.049 41.666 354.555 1.00 77.68  ? 337  TYR B CE1 1 
ATOM   6664 C CE2 . TYR B 1 336 ? -65.377 43.019 353.108 1.00 71.90  ? 337  TYR B CE2 1 
ATOM   6665 C CZ  . TYR B 1 336 ? -65.021 42.625 354.374 1.00 74.15  ? 337  TYR B CZ  1 
ATOM   6666 O OH  . TYR B 1 336 ? -65.653 43.193 355.458 1.00 71.29  ? 337  TYR B OH  1 
ATOM   6667 N N   . PHE B 1 337 ? -64.518 41.969 348.346 1.00 39.50  ? 338  PHE B N   1 
ATOM   6668 C CA  . PHE B 1 337 ? -65.351 43.030 347.797 1.00 48.43  ? 338  PHE B CA  1 
ATOM   6669 C C   . PHE B 1 337 ? -66.458 42.518 346.883 1.00 46.34  ? 338  PHE B C   1 
ATOM   6670 O O   . PHE B 1 337 ? -67.398 43.268 346.603 1.00 42.21  ? 338  PHE B O   1 
ATOM   6671 C CB  . PHE B 1 337 ? -64.463 44.030 347.053 1.00 45.29  ? 338  PHE B CB  1 
ATOM   6672 C CG  . PHE B 1 337 ? -63.507 44.755 347.953 1.00 47.93  ? 338  PHE B CG  1 
ATOM   6673 C CD1 . PHE B 1 337 ? -62.309 44.167 348.330 1.00 37.89  ? 338  PHE B CD1 1 
ATOM   6674 C CD2 . PHE B 1 337 ? -63.822 46.007 348.454 1.00 47.52  ? 338  PHE B CD2 1 
ATOM   6675 C CE1 . PHE B 1 337 ? -61.435 44.823 349.176 1.00 43.58  ? 338  PHE B CE1 1 
ATOM   6676 C CE2 . PHE B 1 337 ? -62.953 46.668 349.300 1.00 38.64  ? 338  PHE B CE2 1 
ATOM   6677 C CZ  . PHE B 1 337 ? -61.759 46.074 349.663 1.00 42.07  ? 338  PHE B CZ  1 
ATOM   6678 N N   . LEU B 1 338 ? -66.389 41.262 346.436 1.00 43.94  ? 339  LEU B N   1 
ATOM   6679 C CA  . LEU B 1 338 ? -67.345 40.780 345.444 1.00 54.56  ? 339  LEU B CA  1 
ATOM   6680 C C   . LEU B 1 338 ? -68.751 40.636 346.018 1.00 48.68  ? 339  LEU B C   1 
ATOM   6681 O O   . LEU B 1 338 ? -69.731 40.731 345.272 1.00 51.25  ? 339  LEU B O   1 
ATOM   6682 C CB  . LEU B 1 338 ? -66.859 39.452 344.866 1.00 45.71  ? 339  LEU B CB  1 
ATOM   6683 C CG  . LEU B 1 338 ? -65.520 39.568 344.135 1.00 54.34  ? 339  LEU B CG  1 
ATOM   6684 C CD1 . LEU B 1 338 ? -65.048 38.225 343.604 1.00 51.81  ? 339  LEU B CD1 1 
ATOM   6685 C CD2 . LEU B 1 338 ? -65.626 40.588 343.013 1.00 36.51  ? 339  LEU B CD2 1 
ATOM   6686 N N   . VAL B 1 339 ? -68.878 40.430 347.327 1.00 43.60  ? 340  VAL B N   1 
ATOM   6687 C CA  . VAL B 1 339 ? -70.188 40.200 347.930 1.00 47.30  ? 340  VAL B CA  1 
ATOM   6688 C C   . VAL B 1 339 ? -70.882 41.521 348.240 1.00 44.47  ? 340  VAL B C   1 
ATOM   6689 O O   . VAL B 1 339 ? -71.936 41.540 348.886 1.00 58.56  ? 340  VAL B O   1 
ATOM   6690 C CB  . VAL B 1 339 ? -70.069 39.339 349.200 1.00 45.86  ? 340  VAL B CB  1 
ATOM   6691 C CG1 . VAL B 1 339 ? -69.606 37.934 348.844 1.00 51.06  ? 340  VAL B CG1 1 
ATOM   6692 C CG2 . VAL B 1 339 ? -69.124 39.985 350.192 1.00 48.40  ? 340  VAL B CG2 1 
ATOM   6693 N N   . TYR B 1 340 ? -70.312 42.633 347.776 1.00 46.08  ? 341  TYR B N   1 
ATOM   6694 C CA  . TYR B 1 340 ? -70.908 43.947 347.981 1.00 45.26  ? 341  TYR B CA  1 
ATOM   6695 C C   . TYR B 1 340 ? -71.368 44.594 346.677 1.00 46.95  ? 341  TYR B C   1 
ATOM   6696 O O   . TYR B 1 340 ? -71.480 45.823 346.607 1.00 49.38  ? 341  TYR B O   1 
ATOM   6697 C CB  . TYR B 1 340 ? -69.928 44.864 348.713 1.00 48.95  ? 341  TYR B CB  1 
ATOM   6698 C CG  . TYR B 1 340 ? -69.802 44.541 350.182 1.00 51.44  ? 341  TYR B CG  1 
ATOM   6699 C CD1 . TYR B 1 340 ? -70.677 45.090 351.110 1.00 53.34  ? 341  TYR B CD1 1 
ATOM   6700 C CD2 . TYR B 1 340 ? -68.817 43.676 350.640 1.00 49.84  ? 341  TYR B CD2 1 
ATOM   6701 C CE1 . TYR B 1 340 ? -70.571 44.791 352.456 1.00 46.87  ? 341  TYR B CE1 1 
ATOM   6702 C CE2 . TYR B 1 340 ? -68.702 43.372 351.983 1.00 60.66  ? 341  TYR B CE2 1 
ATOM   6703 C CZ  . TYR B 1 340 ? -69.581 43.933 352.887 1.00 57.63  ? 341  TYR B CZ  1 
ATOM   6704 O OH  . TYR B 1 340 ? -69.471 43.634 354.225 1.00 55.30  ? 341  TYR B OH  1 
ATOM   6705 N N   . GLY B 1 341 ? -71.642 43.799 345.645 1.00 48.75  ? 342  GLY B N   1 
ATOM   6706 C CA  . GLY B 1 341 ? -72.178 44.365 344.422 1.00 50.10  ? 342  GLY B CA  1 
ATOM   6707 C C   . GLY B 1 341 ? -71.986 43.533 343.170 1.00 53.05  ? 342  GLY B C   1 
ATOM   6708 O O   . GLY B 1 341 ? -72.624 43.799 342.148 1.00 59.04  ? 342  GLY B O   1 
ATOM   6709 N N   . ALA B 1 342 ? -71.112 42.539 343.222 1.00 52.02  ? 343  ALA B N   1 
ATOM   6710 C CA  . ALA B 1 342 ? -70.910 41.692 342.053 1.00 45.33  ? 343  ALA B CA  1 
ATOM   6711 C C   . ALA B 1 342 ? -72.060 40.699 341.934 1.00 58.46  ? 343  ALA B C   1 
ATOM   6712 O O   . ALA B 1 342 ? -72.358 39.985 342.898 1.00 48.23  ? 343  ALA B O   1 
ATOM   6713 C CB  . ALA B 1 342 ? -69.582 40.951 342.137 1.00 38.69  ? 343  ALA B CB  1 
ATOM   6714 N N   . PRO B 1 343 ? -72.721 40.623 340.778 1.00 48.84  ? 344  PRO B N   1 
ATOM   6715 C CA  . PRO B 1 343 ? -73.903 39.758 340.653 1.00 52.23  ? 344  PRO B CA  1 
ATOM   6716 C C   . PRO B 1 343 ? -73.538 38.284 340.769 1.00 53.31  ? 344  PRO B C   1 
ATOM   6717 O O   . PRO B 1 343 ? -72.610 37.802 340.113 1.00 48.88  ? 344  PRO B O   1 
ATOM   6718 C CB  . PRO B 1 343 ? -74.444 40.099 339.260 1.00 46.35  ? 344  PRO B CB  1 
ATOM   6719 C CG  . PRO B 1 343 ? -73.258 40.633 338.520 1.00 55.53  ? 344  PRO B CG  1 
ATOM   6720 C CD  . PRO B 1 343 ? -72.442 41.368 339.540 1.00 45.21  ? 344  PRO B CD  1 
ATOM   6721 N N   . GLY B 1 344 ? -74.281 37.571 341.614 1.00 48.18  ? 345  GLY B N   1 
ATOM   6722 C CA  . GLY B 1 344 ? -74.092 36.152 341.812 1.00 49.83  ? 345  GLY B CA  1 
ATOM   6723 C C   . GLY B 1 344 ? -73.212 35.771 342.980 1.00 54.51  ? 345  GLY B C   1 
ATOM   6724 O O   . GLY B 1 344 ? -73.017 34.573 343.219 1.00 56.60  ? 345  GLY B O   1 
ATOM   6725 N N   . PHE B 1 345 ? -72.681 36.741 343.719 1.00 46.05  ? 346  PHE B N   1 
ATOM   6726 C CA  . PHE B 1 345 ? -71.748 36.471 344.804 1.00 58.22  ? 346  PHE B CA  1 
ATOM   6727 C C   . PHE B 1 345 ? -72.433 36.593 346.158 1.00 49.00  ? 346  PHE B C   1 
ATOM   6728 O O   . PHE B 1 345 ? -73.290 37.459 346.361 1.00 60.17  ? 346  PHE B O   1 
ATOM   6729 C CB  . PHE B 1 345 ? -70.553 37.423 344.742 1.00 50.20  ? 346  PHE B CB  1 
ATOM   6730 C CG  . PHE B 1 345 ? -69.533 37.039 343.714 1.00 47.70  ? 346  PHE B CG  1 
ATOM   6731 C CD1 . PHE B 1 345 ? -68.471 36.215 344.046 1.00 45.61  ? 346  PHE B CD1 1 
ATOM   6732 C CD2 . PHE B 1 345 ? -69.644 37.491 342.409 1.00 45.51  ? 346  PHE B CD2 1 
ATOM   6733 C CE1 . PHE B 1 345 ? -67.533 35.853 343.096 1.00 43.68  ? 346  PHE B CE1 1 
ATOM   6734 C CE2 . PHE B 1 345 ? -68.710 37.137 341.456 1.00 45.84  ? 346  PHE B CE2 1 
ATOM   6735 C CZ  . PHE B 1 345 ? -67.652 36.317 341.799 1.00 45.70  ? 346  PHE B CZ  1 
ATOM   6736 N N   . SER B 1 346 ? -72.043 35.718 347.081 1.00 53.14  ? 347  SER B N   1 
ATOM   6737 C CA  . SER B 1 346 ? -72.496 35.779 348.463 1.00 55.90  ? 347  SER B CA  1 
ATOM   6738 C C   . SER B 1 346 ? -71.540 34.959 349.317 1.00 44.33  ? 347  SER B C   1 
ATOM   6739 O O   . SER B 1 346 ? -70.927 34.002 348.837 1.00 51.98  ? 347  SER B O   1 
ATOM   6740 C CB  . SER B 1 346 ? -73.930 35.261 348.618 1.00 59.72  ? 347  SER B CB  1 
ATOM   6741 O OG  . SER B 1 346 ? -74.151 34.761 349.926 1.00 69.89  ? 347  SER B OG  1 
ATOM   6742 N N   . LYS B 1 347 ? -71.418 35.343 350.587 1.00 48.72  ? 348  LYS B N   1 
ATOM   6743 C CA  . LYS B 1 347 ? -70.586 34.569 351.500 1.00 50.04  ? 348  LYS B CA  1 
ATOM   6744 C C   . LYS B 1 347 ? -71.245 33.258 351.905 1.00 50.76  ? 348  LYS B C   1 
ATOM   6745 O O   . LYS B 1 347 ? -70.561 32.362 352.409 1.00 53.77  ? 348  LYS B O   1 
ATOM   6746 C CB  . LYS B 1 347 ? -70.258 35.396 352.744 1.00 48.15  ? 348  LYS B CB  1 
ATOM   6747 C CG  . LYS B 1 347 ? -71.317 35.319 353.834 1.00 43.23  ? 348  LYS B CG  1 
ATOM   6748 C CD  . LYS B 1 347 ? -70.872 36.032 355.101 1.00 56.60  ? 348  LYS B CD  1 
ATOM   6749 C CE  . LYS B 1 347 ? -71.805 35.735 356.265 1.00 42.26  ? 348  LYS B CE  1 
ATOM   6750 N NZ  . LYS B 1 347 ? -71.762 34.299 356.662 1.00 51.77  ? 348  LYS B NZ  1 
ATOM   6751 N N   . ASP B 1 348 ? -72.549 33.120 351.682 1.00 44.78  ? 349  ASP B N   1 
ATOM   6752 C CA  . ASP B 1 348 ? -73.302 31.979 352.178 1.00 54.80  ? 349  ASP B CA  1 
ATOM   6753 C C   . ASP B 1 348 ? -73.461 30.864 351.152 1.00 57.92  ? 349  ASP B C   1 
ATOM   6754 O O   . ASP B 1 348 ? -74.041 29.824 351.478 1.00 57.97  ? 349  ASP B O   1 
ATOM   6755 C CB  . ASP B 1 348 ? -74.676 32.438 352.674 1.00 48.20  ? 349  ASP B CB  1 
ATOM   6756 C CG  . ASP B 1 348 ? -74.585 33.265 353.946 1.00 63.17  ? 349  ASP B CG  1 
ATOM   6757 O OD1 . ASP B 1 348 ? -73.825 32.871 354.859 1.00 46.02  ? 349  ASP B OD1 1 
ATOM   6758 O OD2 . ASP B 1 348 ? -75.265 34.309 354.031 1.00 57.37  ? 349  ASP B OD2 1 
ATOM   6759 N N   . ASN B 1 349 ? -72.966 31.042 349.927 1.00 51.21  ? 350  ASN B N   1 
ATOM   6760 C CA  . ASN B 1 349 ? -72.920 29.943 348.973 1.00 63.82  ? 350  ASN B CA  1 
ATOM   6761 C C   . ASN B 1 349 ? -71.583 29.977 348.241 1.00 61.80  ? 350  ASN B C   1 
ATOM   6762 O O   . ASN B 1 349 ? -70.722 30.822 348.509 1.00 54.15  ? 350  ASN B O   1 
ATOM   6763 C CB  . ASN B 1 349 ? -74.141 29.955 348.030 1.00 67.92  ? 350  ASN B CB  1 
ATOM   6764 C CG  . ASN B 1 349 ? -74.156 31.116 347.032 1.00 63.15  ? 350  ASN B CG  1 
ATOM   6765 O OD1 . ASN B 1 349 ? -73.123 31.601 346.571 1.00 62.13  ? 350  ASN B OD1 1 
ATOM   6766 N ND2 . ASN B 1 349 ? -75.368 31.550 346.685 1.00 70.95  ? 350  ASN B ND2 1 
ATOM   6767 N N   . GLU B 1 350 ? -71.405 29.030 347.319 1.00 56.34  ? 351  GLU B N   1 
ATOM   6768 C CA  . GLU B 1 350 ? -70.127 28.855 346.640 1.00 49.76  ? 351  GLU B CA  1 
ATOM   6769 C C   . GLU B 1 350 ? -69.844 29.937 345.606 1.00 47.66  ? 351  GLU B C   1 
ATOM   6770 O O   . GLU B 1 350 ? -68.709 30.021 345.126 1.00 52.78  ? 351  GLU B O   1 
ATOM   6771 C CB  . GLU B 1 350 ? -70.078 27.478 345.976 1.00 59.09  ? 351  GLU B CB  1 
ATOM   6772 C CG  . GLU B 1 350 ? -69.899 26.328 346.954 1.00 61.90  ? 351  GLU B CG  1 
ATOM   6773 C CD  . GLU B 1 350 ? -68.441 26.046 347.258 1.00 86.94  ? 351  GLU B CD  1 
ATOM   6774 O OE1 . GLU B 1 350 ? -68.059 26.086 348.447 1.00 71.35  ? 351  GLU B OE1 1 
ATOM   6775 O OE2 . GLU B 1 350 ? -67.677 25.782 346.305 1.00 91.98  ? 351  GLU B OE2 1 
ATOM   6776 N N   . SER B 1 351 ? -70.839 30.751 345.251 1.00 42.41  ? 352  SER B N   1 
ATOM   6777 C CA  . SER B 1 351 ? -70.662 31.849 344.300 1.00 48.76  ? 352  SER B CA  1 
ATOM   6778 C C   . SER B 1 351 ? -70.087 31.360 342.969 1.00 52.34  ? 352  SER B C   1 
ATOM   6779 O O   . SER B 1 351 ? -69.191 31.981 342.392 1.00 50.34  ? 352  SER B O   1 
ATOM   6780 C CB  . SER B 1 351 ? -69.788 32.955 344.899 1.00 46.41  ? 352  SER B CB  1 
ATOM   6781 O OG  . SER B 1 351 ? -70.473 33.653 345.924 1.00 49.53  ? 352  SER B OG  1 
ATOM   6782 N N   . LEU B 1 352 ? -70.604 30.235 342.476 1.00 51.03  ? 353  LEU B N   1 
ATOM   6783 C CA  . LEU B 1 352 ? -70.214 29.706 341.168 1.00 51.65  ? 353  LEU B CA  1 
ATOM   6784 C C   . LEU B 1 352 ? -71.014 30.447 340.106 1.00 45.68  ? 353  LEU B C   1 
ATOM   6785 O O   . LEU B 1 352 ? -72.103 30.032 339.708 1.00 59.37  ? 353  LEU B O   1 
ATOM   6786 C CB  . LEU B 1 352 ? -70.441 28.202 341.106 1.00 49.75  ? 353  LEU B CB  1 
ATOM   6787 C CG  . LEU B 1 352 ? -69.590 27.438 342.121 1.00 44.04  ? 353  LEU B CG  1 
ATOM   6788 C CD1 . LEU B 1 352 ? -70.094 26.020 342.311 1.00 52.54  ? 353  LEU B CD1 1 
ATOM   6789 C CD2 . LEU B 1 352 ? -68.131 27.440 341.690 1.00 46.77  ? 353  LEU B CD2 1 
ATOM   6790 N N   . ILE B 1 353 ? -70.457 31.565 339.642 1.00 44.35  ? 354  ILE B N   1 
ATOM   6791 C CA  . ILE B 1 353 ? -71.162 32.479 338.751 1.00 51.16  ? 354  ILE B CA  1 
ATOM   6792 C C   . ILE B 1 353 ? -71.119 31.970 337.316 1.00 56.81  ? 354  ILE B C   1 
ATOM   6793 O O   . ILE B 1 353 ? -70.339 31.071 336.982 1.00 54.64  ? 354  ILE B O   1 
ATOM   6794 C CB  . ILE B 1 353 ? -70.573 33.898 338.843 1.00 54.21  ? 354  ILE B CB  1 
ATOM   6795 C CG1 . ILE B 1 353 ? -69.098 33.887 338.428 1.00 40.30  ? 354  ILE B CG1 1 
ATOM   6796 C CG2 . ILE B 1 353 ? -70.737 34.446 340.254 1.00 50.54  ? 354  ILE B CG2 1 
ATOM   6797 C CD1 . ILE B 1 353 ? -68.486 35.262 338.297 1.00 49.64  ? 354  ILE B CD1 1 
ATOM   6798 N N   . SER B 1 354 ? -71.957 32.545 336.463 1.00 52.42  ? 355  SER B N   1 
ATOM   6799 C CA  . SER B 1 354 ? -72.005 32.211 335.049 1.00 53.91  ? 355  SER B CA  1 
ATOM   6800 C C   . SER B 1 354 ? -71.169 33.198 334.244 1.00 54.27  ? 355  SER B C   1 
ATOM   6801 O O   . SER B 1 354 ? -70.698 34.219 334.752 1.00 44.31  ? 355  SER B O   1 
ATOM   6802 C CB  . SER B 1 354 ? -73.451 32.213 334.548 1.00 54.91  ? 355  SER B CB  1 
ATOM   6803 O OG  . SER B 1 354 ? -74.002 33.519 334.621 1.00 50.61  ? 355  SER B OG  1 
ATOM   6804 N N   . ARG B 1 355 ? -70.995 32.879 332.959 1.00 52.76  ? 356  ARG B N   1 
ATOM   6805 C CA  . ARG B 1 355 ? -70.273 33.776 332.062 1.00 49.28  ? 356  ARG B CA  1 
ATOM   6806 C C   . ARG B 1 355 ? -70.939 35.145 332.000 1.00 46.48  ? 356  ARG B C   1 
ATOM   6807 O O   . ARG B 1 355 ? -70.257 36.177 332.012 1.00 49.58  ? 356  ARG B O   1 
ATOM   6808 C CB  . ARG B 1 355 ? -70.183 33.153 330.667 1.00 52.58  ? 356  ARG B CB  1 
ATOM   6809 C CG  . ARG B 1 355 ? -69.428 33.989 329.647 1.00 48.77  ? 356  ARG B CG  1 
ATOM   6810 C CD  . ARG B 1 355 ? -67.940 33.985 329.930 1.00 52.25  ? 356  ARG B CD  1 
ATOM   6811 N NE  . ARG B 1 355 ? -67.186 34.753 328.943 1.00 58.29  ? 356  ARG B NE  1 
ATOM   6812 C CZ  . ARG B 1 355 ? -65.869 34.928 328.987 1.00 51.17  ? 356  ARG B CZ  1 
ATOM   6813 N NH1 . ARG B 1 355 ? -65.160 34.386 329.968 1.00 43.36  ? 356  ARG B NH1 1 
ATOM   6814 N NH2 . ARG B 1 355 ? -65.260 35.644 328.054 1.00 38.58  ? 356  ARG B NH2 1 
ATOM   6815 N N   . ALA B 1 356 ? -72.274 35.175 331.943 1.00 44.34  ? 357  ALA B N   1 
ATOM   6816 C CA  . ALA B 1 356 ? -72.984 36.448 331.879 1.00 47.94  ? 357  ALA B CA  1 
ATOM   6817 C C   . ALA B 1 356 ? -72.763 37.272 333.142 1.00 49.99  ? 357  ALA B C   1 
ATOM   6818 O O   . ALA B 1 356 ? -72.545 38.487 333.068 1.00 50.85  ? 357  ALA B O   1 
ATOM   6819 C CB  . ALA B 1 356 ? -74.476 36.206 331.647 1.00 41.50  ? 357  ALA B CB  1 
ATOM   6820 N N   . GLU B 1 357 ? -72.817 36.629 334.313 1.00 47.67  ? 358  GLU B N   1 
ATOM   6821 C CA  . GLU B 1 357 ? -72.550 37.343 335.559 1.00 56.53  ? 358  GLU B CA  1 
ATOM   6822 C C   . GLU B 1 357 ? -71.100 37.809 335.627 1.00 54.46  ? 358  GLU B C   1 
ATOM   6823 O O   . GLU B 1 357 ? -70.815 38.900 336.136 1.00 43.01  ? 358  GLU B O   1 
ATOM   6824 C CB  . GLU B 1 357 ? -72.885 36.455 336.759 1.00 51.42  ? 358  GLU B CB  1 
ATOM   6825 C CG  . GLU B 1 357 ? -74.371 36.178 336.937 1.00 49.33  ? 358  GLU B CG  1 
ATOM   6826 C CD  . GLU B 1 357 ? -74.650 35.144 338.016 1.00 66.19  ? 358  GLU B CD  1 
ATOM   6827 O OE1 . GLU B 1 357 ? -73.907 34.142 338.096 1.00 64.92  ? 358  GLU B OE1 1 
ATOM   6828 O OE2 . GLU B 1 357 ? -75.615 35.334 338.786 1.00 68.69  ? 358  GLU B OE2 1 
ATOM   6829 N N   . PHE B 1 358 ? -70.172 36.997 335.116 1.00 42.78  ? 359  PHE B N   1 
ATOM   6830 C CA  . PHE B 1 358 ? -68.771 37.402 335.069 1.00 41.65  ? 359  PHE B CA  1 
ATOM   6831 C C   . PHE B 1 358 ? -68.596 38.663 334.230 1.00 46.77  ? 359  PHE B C   1 
ATOM   6832 O O   . PHE B 1 358 ? -67.934 39.617 334.654 1.00 51.17  ? 359  PHE B O   1 
ATOM   6833 C CB  . PHE B 1 358 ? -67.918 36.257 334.520 1.00 46.01  ? 359  PHE B CB  1 
ATOM   6834 C CG  . PHE B 1 358 ? -66.490 36.635 334.235 1.00 43.18  ? 359  PHE B CG  1 
ATOM   6835 C CD1 . PHE B 1 358 ? -65.544 36.639 335.247 1.00 45.43  ? 359  PHE B CD1 1 
ATOM   6836 C CD2 . PHE B 1 358 ? -66.089 36.969 332.951 1.00 36.20  ? 359  PHE B CD2 1 
ATOM   6837 C CE1 . PHE B 1 358 ? -64.227 36.976 334.986 1.00 39.32  ? 359  PHE B CE1 1 
ATOM   6838 C CE2 . PHE B 1 358 ? -64.774 37.308 332.684 1.00 44.12  ? 359  PHE B CE2 1 
ATOM   6839 C CZ  . PHE B 1 358 ? -63.843 37.313 333.701 1.00 45.19  ? 359  PHE B CZ  1 
ATOM   6840 N N   . LEU B 1 359 ? -69.190 38.685 333.033 1.00 42.72  ? 360  LEU B N   1 
ATOM   6841 C CA  . LEU B 1 359 ? -69.089 39.865 332.179 1.00 48.76  ? 360  LEU B CA  1 
ATOM   6842 C C   . LEU B 1 359 ? -69.725 41.080 332.841 1.00 46.27  ? 360  LEU B C   1 
ATOM   6843 O O   . LEU B 1 359 ? -69.203 42.197 332.739 1.00 52.25  ? 360  LEU B O   1 
ATOM   6844 C CB  . LEU B 1 359 ? -69.743 39.594 330.822 1.00 42.17  ? 360  LEU B CB  1 
ATOM   6845 C CG  . LEU B 1 359 ? -69.094 38.518 329.948 1.00 60.40  ? 360  LEU B CG  1 
ATOM   6846 C CD1 . LEU B 1 359 ? -69.885 38.313 328.665 1.00 42.29  ? 360  LEU B CD1 1 
ATOM   6847 C CD2 . LEU B 1 359 ? -67.647 38.875 329.634 1.00 42.43  ? 360  LEU B CD2 1 
ATOM   6848 N N   . ALA B 1 360 ? -70.855 40.883 333.521 1.00 50.19  ? 361  ALA B N   1 
ATOM   6849 C CA  . ALA B 1 360 ? -71.489 41.991 334.226 1.00 47.07  ? 361  ALA B CA  1 
ATOM   6850 C C   . ALA B 1 360 ? -70.646 42.441 335.413 1.00 50.18  ? 361  ALA B C   1 
ATOM   6851 O O   . ALA B 1 360 ? -70.543 43.643 335.689 1.00 46.85  ? 361  ALA B O   1 
ATOM   6852 C CB  . ALA B 1 360 ? -72.892 41.589 334.681 1.00 50.27  ? 361  ALA B CB  1 
ATOM   6853 N N   . GLY B 1 361 ? -70.030 41.493 336.123 1.00 37.39  ? 362  GLY B N   1 
ATOM   6854 C CA  . GLY B 1 361 ? -69.183 41.843 337.247 1.00 45.11  ? 362  GLY B CA  1 
ATOM   6855 C C   . GLY B 1 361 ? -67.932 42.605 336.862 1.00 48.87  ? 362  GLY B C   1 
ATOM   6856 O O   . GLY B 1 361 ? -67.376 43.325 337.699 1.00 46.24  ? 362  GLY B O   1 
ATOM   6857 N N   . VAL B 1 362 ? -67.477 42.461 335.616 1.00 47.07  ? 363  VAL B N   1 
ATOM   6858 C CA  . VAL B 1 362 ? -66.292 43.186 335.168 1.00 39.13  ? 363  VAL B CA  1 
ATOM   6859 C C   . VAL B 1 362 ? -66.566 44.683 335.125 1.00 41.72  ? 363  VAL B C   1 
ATOM   6860 O O   . VAL B 1 362 ? -65.721 45.493 335.521 1.00 46.82  ? 363  VAL B O   1 
ATOM   6861 C CB  . VAL B 1 362 ? -65.828 42.646 333.802 1.00 42.71  ? 363  VAL B CB  1 
ATOM   6862 C CG1 . VAL B 1 362 ? -64.884 43.631 333.118 1.00 34.63  ? 363  VAL B CG1 1 
ATOM   6863 C CG2 . VAL B 1 362 ? -65.157 41.292 333.979 1.00 38.25  ? 363  VAL B CG2 1 
ATOM   6864 N N   . ARG B 1 363 ? -67.755 45.074 334.657 1.00 42.46  ? 364  ARG B N   1 
ATOM   6865 C CA  . ARG B 1 363 ? -68.116 46.490 334.634 1.00 37.71  ? 364  ARG B CA  1 
ATOM   6866 C C   . ARG B 1 363 ? -68.285 47.055 336.041 1.00 45.99  ? 364  ARG B C   1 
ATOM   6867 O O   . ARG B 1 363 ? -68.036 48.249 336.260 1.00 44.44  ? 364  ARG B O   1 
ATOM   6868 C CB  . ARG B 1 363 ? -69.397 46.699 333.827 1.00 40.40  ? 364  ARG B CB  1 
ATOM   6869 C CG  . ARG B 1 363 ? -69.386 46.062 332.446 1.00 50.01  ? 364  ARG B CG  1 
ATOM   6870 C CD  . ARG B 1 363 ? -68.114 46.405 331.684 1.00 46.73  ? 364  ARG B CD  1 
ATOM   6871 N NE  . ARG B 1 363 ? -67.925 47.841 331.495 1.00 44.60  ? 364  ARG B NE  1 
ATOM   6872 C CZ  . ARG B 1 363 ? -68.290 48.503 330.401 1.00 61.44  ? 364  ARG B CZ  1 
ATOM   6873 N NH1 . ARG B 1 363 ? -68.872 47.857 329.399 1.00 48.89  ? 364  ARG B NH1 1 
ATOM   6874 N NH2 . ARG B 1 363 ? -68.073 49.809 330.306 1.00 44.07  ? 364  ARG B NH2 1 
ATOM   6875 N N   . VAL B 1 364 ? -68.715 46.227 336.996 1.00 37.64  ? 365  VAL B N   1 
ATOM   6876 C CA  . VAL B 1 364 ? -68.817 46.686 338.375 1.00 48.93  ? 365  VAL B CA  1 
ATOM   6877 C C   . VAL B 1 364 ? -67.434 46.718 339.024 1.00 50.12  ? 365  VAL B C   1 
ATOM   6878 O O   . VAL B 1 364 ? -67.095 47.649 339.754 1.00 43.08  ? 365  VAL B O   1 
ATOM   6879 C CB  . VAL B 1 364 ? -69.789 45.787 339.163 1.00 48.70  ? 365  VAL B CB  1 
ATOM   6880 C CG1 . VAL B 1 364 ? -69.874 46.213 340.612 1.00 48.74  ? 365  VAL B CG1 1 
ATOM   6881 C CG2 . VAL B 1 364 ? -71.163 45.824 338.532 1.00 46.47  ? 365  VAL B CG2 1 
ATOM   6882 N N   . GLY B 1 365 ? -66.608 45.711 338.734 1.00 46.47  ? 366  GLY B N   1 
ATOM   6883 C CA  . GLY B 1 365 ? -65.263 45.664 339.290 1.00 38.06  ? 366  GLY B CA  1 
ATOM   6884 C C   . GLY B 1 365 ? -64.286 46.611 338.628 1.00 40.06  ? 366  GLY B C   1 
ATOM   6885 O O   . GLY B 1 365 ? -63.306 47.025 339.253 1.00 37.46  ? 366  GLY B O   1 
ATOM   6886 N N   . VAL B 1 366 ? -64.520 46.964 337.366 1.00 41.34  ? 367  VAL B N   1 
ATOM   6887 C CA  . VAL B 1 366 ? -63.694 47.955 336.677 1.00 39.29  ? 367  VAL B CA  1 
ATOM   6888 C C   . VAL B 1 366 ? -64.592 49.101 336.229 1.00 47.56  ? 367  VAL B C   1 
ATOM   6889 O O   . VAL B 1 366 ? -64.862 49.247 335.026 1.00 39.15  ? 367  VAL B O   1 
ATOM   6890 C CB  . VAL B 1 366 ? -62.944 47.342 335.482 1.00 40.62  ? 367  VAL B CB  1 
ATOM   6891 C CG1 . VAL B 1 366 ? -61.830 48.277 335.016 1.00 34.71  ? 367  VAL B CG1 1 
ATOM   6892 C CG2 . VAL B 1 366 ? -62.379 45.983 335.849 1.00 39.11  ? 367  VAL B CG2 1 
ATOM   6893 N N   . PRO B 1 367 ? -65.061 49.941 337.145 1.00 42.42  ? 368  PRO B N   1 
ATOM   6894 C CA  . PRO B 1 367 ? -66.059 50.951 336.787 1.00 35.45  ? 368  PRO B CA  1 
ATOM   6895 C C   . PRO B 1 367 ? -65.453 52.134 336.047 1.00 39.98  ? 368  PRO B C   1 
ATOM   6896 O O   . PRO B 1 367 ? -64.261 52.430 336.147 1.00 54.76  ? 368  PRO B O   1 
ATOM   6897 C CB  . PRO B 1 367 ? -66.612 51.386 338.148 1.00 51.92  ? 368  PRO B CB  1 
ATOM   6898 C CG  . PRO B 1 367 ? -65.453 51.208 339.076 1.00 40.73  ? 368  PRO B CG  1 
ATOM   6899 C CD  . PRO B 1 367 ? -64.698 50.002 338.574 1.00 43.46  ? 368  PRO B CD  1 
ATOM   6900 N N   . GLN B 1 368 ? -66.316 52.806 335.283 1.00 43.01  ? 369  GLN B N   1 
ATOM   6901 C CA  . GLN B 1 368 ? -65.999 54.091 334.659 1.00 58.80  ? 369  GLN B CA  1 
ATOM   6902 C C   . GLN B 1 368 ? -64.880 53.975 333.623 1.00 58.78  ? 369  GLN B C   1 
ATOM   6903 O O   . GLN B 1 368 ? -64.006 54.839 333.532 1.00 57.83  ? 369  GLN B O   1 
ATOM   6904 C CB  . GLN B 1 368 ? -65.648 55.141 335.716 1.00 55.43  ? 369  GLN B CB  1 
ATOM   6905 C CG  . GLN B 1 368 ? -66.783 55.464 336.676 1.00 64.22  ? 369  GLN B CG  1 
ATOM   6906 C CD  . GLN B 1 368 ? -67.918 56.208 336.001 1.00 77.12  ? 369  GLN B CD  1 
ATOM   6907 O OE1 . GLN B 1 368 ? -68.939 55.617 335.645 1.00 58.74  ? 369  GLN B OE1 1 
ATOM   6908 N NE2 . GLN B 1 368 ? -67.744 57.514 335.819 1.00 72.17  ? 369  GLN B NE2 1 
ATOM   6909 N N   . VAL B 1 369 ? -64.905 52.905 332.824 1.00 54.81  ? 370  VAL B N   1 
ATOM   6910 C CA  . VAL B 1 369 ? -63.988 52.773 331.698 1.00 51.17  ? 370  VAL B CA  1 
ATOM   6911 C C   . VAL B 1 369 ? -64.782 52.417 330.449 1.00 48.02  ? 370  VAL B C   1 
ATOM   6912 O O   . VAL B 1 369 ? -65.908 51.919 330.516 1.00 50.16  ? 370  VAL B O   1 
ATOM   6913 C CB  . VAL B 1 369 ? -62.872 51.729 331.937 1.00 47.81  ? 370  VAL B CB  1 
ATOM   6914 C CG1 . VAL B 1 369 ? -62.109 52.033 333.220 1.00 45.83  ? 370  VAL B CG1 1 
ATOM   6915 C CG2 . VAL B 1 369 ? -63.442 50.318 331.950 1.00 38.82  ? 370  VAL B CG2 1 
ATOM   6916 N N   . SER B 1 370 ? -64.163 52.671 329.298 1.00 50.04  ? 371  SER B N   1 
ATOM   6917 C CA  . SER B 1 370 ? -64.815 52.453 328.016 1.00 44.89  ? 371  SER B CA  1 
ATOM   6918 C C   . SER B 1 370 ? -65.100 50.970 327.791 1.00 50.90  ? 371  SER B C   1 
ATOM   6919 O O   . SER B 1 370 ? -64.528 50.089 328.442 1.00 47.42  ? 371  SER B O   1 
ATOM   6920 C CB  . SER B 1 370 ? -63.948 52.999 326.881 1.00 52.29  ? 371  SER B CB  1 
ATOM   6921 O OG  . SER B 1 370 ? -62.687 52.351 326.846 1.00 57.49  ? 371  SER B OG  1 
ATOM   6922 N N   . ASP B 1 371 ? -66.009 50.702 326.850 1.00 53.14  ? 372  ASP B N   1 
ATOM   6923 C CA  . ASP B 1 371 ? -66.320 49.322 326.494 1.00 54.32  ? 372  ASP B CA  1 
ATOM   6924 C C   . ASP B 1 371 ? -65.084 48.597 325.980 1.00 46.39  ? 372  ASP B C   1 
ATOM   6925 O O   . ASP B 1 371 ? -64.895 47.405 326.251 1.00 48.58  ? 372  ASP B O   1 
ATOM   6926 C CB  . ASP B 1 371 ? -67.432 49.284 325.445 1.00 56.97  ? 372  ASP B CB  1 
ATOM   6927 C CG  . ASP B 1 371 ? -68.763 49.765 325.987 1.00 74.35  ? 372  ASP B CG  1 
ATOM   6928 O OD1 . ASP B 1 371 ? -68.885 49.912 327.222 1.00 76.87  ? 372  ASP B OD1 1 
ATOM   6929 O OD2 . ASP B 1 371 ? -69.687 49.995 325.178 1.00 75.17  ? 372  ASP B OD2 1 
ATOM   6930 N N   . LEU B 1 372 ? -64.227 49.306 325.244 1.00 36.76  ? 373  LEU B N   1 
ATOM   6931 C CA  . LEU B 1 372 ? -63.001 48.697 324.743 1.00 50.83  ? 373  LEU B CA  1 
ATOM   6932 C C   . LEU B 1 372 ? -62.085 48.281 325.889 1.00 46.80  ? 373  LEU B C   1 
ATOM   6933 O O   . LEU B 1 372 ? -61.524 47.178 325.876 1.00 44.09  ? 373  LEU B O   1 
ATOM   6934 C CB  . LEU B 1 372 ? -62.288 49.664 323.798 1.00 44.12  ? 373  LEU B CB  1 
ATOM   6935 C CG  . LEU B 1 372 ? -60.990 49.165 323.165 1.00 53.10  ? 373  LEU B CG  1 
ATOM   6936 C CD1 . LEU B 1 372 ? -61.248 47.926 322.317 1.00 42.06  ? 373  LEU B CD1 1 
ATOM   6937 C CD2 . LEU B 1 372 ? -60.350 50.270 322.337 1.00 54.54  ? 373  LEU B CD2 1 
ATOM   6938 N N   . ALA B 1 373 ? -61.931 49.145 326.897 1.00 44.97  ? 374  ALA B N   1 
ATOM   6939 C CA  . ALA B 1 373 ? -61.118 48.790 328.058 1.00 44.73  ? 374  ALA B CA  1 
ATOM   6940 C C   . ALA B 1 373 ? -61.682 47.570 328.775 1.00 33.36  ? 374  ALA B C   1 
ATOM   6941 O O   . ALA B 1 373 ? -60.925 46.710 329.242 1.00 41.27  ? 374  ALA B O   1 
ATOM   6942 C CB  . ALA B 1 373 ? -61.018 49.976 329.016 1.00 39.58  ? 374  ALA B CB  1 
ATOM   6943 N N   . ALA B 1 374 ? -63.010 47.473 328.866 1.00 37.43  ? 375  ALA B N   1 
ATOM   6944 C CA  . ALA B 1 374 ? -63.623 46.308 329.496 1.00 33.64  ? 375  ALA B CA  1 
ATOM   6945 C C   . ALA B 1 374 ? -63.364 45.039 328.691 1.00 42.52  ? 375  ALA B C   1 
ATOM   6946 O O   . ALA B 1 374 ? -63.100 43.977 329.268 1.00 43.03  ? 375  ALA B O   1 
ATOM   6947 C CB  . ALA B 1 374 ? -65.124 46.535 329.671 1.00 36.79  ? 375  ALA B CB  1 
ATOM   6948 N N   . GLU B 1 375 ? -63.435 45.127 327.358 1.00 41.60  ? 376  GLU B N   1 
ATOM   6949 C CA  . GLU B 1 375 ? -63.159 43.958 326.527 1.00 42.89  ? 376  GLU B CA  1 
ATOM   6950 C C   . GLU B 1 375 ? -61.720 43.489 326.696 1.00 38.55  ? 376  GLU B C   1 
ATOM   6951 O O   . GLU B 1 375 ? -61.448 42.283 326.682 1.00 37.29  ? 376  GLU B O   1 
ATOM   6952 C CB  . GLU B 1 375 ? -63.448 44.268 325.057 1.00 52.20  ? 376  GLU B CB  1 
ATOM   6953 C CG  . GLU B 1 375 ? -64.911 44.558 324.751 1.00 69.32  ? 376  GLU B CG  1 
ATOM   6954 C CD  . GLU B 1 375 ? -65.777 43.310 324.751 1.00 92.24  ? 376  GLU B CD  1 
ATOM   6955 O OE1 . GLU B 1 375 ? -65.227 42.193 324.872 1.00 85.43  ? 376  GLU B OE1 1 
ATOM   6956 O OE2 . GLU B 1 375 ? -67.013 43.448 324.633 1.00 104.26 ? 376  GLU B OE2 1 
ATOM   6957 N N   . ALA B 1 376 ? -60.786 44.429 326.860 1.00 36.31  ? 377  ALA B N   1 
ATOM   6958 C CA  . ALA B 1 376 ? -59.399 44.056 327.117 1.00 34.94  ? 377  ALA B CA  1 
ATOM   6959 C C   . ALA B 1 376 ? -59.261 43.308 328.439 1.00 39.42  ? 377  ALA B C   1 
ATOM   6960 O O   . ALA B 1 376 ? -58.463 42.370 328.545 1.00 39.23  ? 377  ALA B O   1 
ATOM   6961 C CB  . ALA B 1 376 ? -58.507 45.298 327.103 1.00 33.98  ? 377  ALA B CB  1 
ATOM   6962 N N   . VAL B 1 377 ? -60.029 43.709 329.460 1.00 34.42  ? 378  VAL B N   1 
ATOM   6963 C CA  . VAL B 1 377 ? -60.006 42.989 330.734 1.00 33.58  ? 378  VAL B CA  1 
ATOM   6964 C C   . VAL B 1 377 ? -60.512 41.565 330.540 1.00 38.36  ? 378  VAL B C   1 
ATOM   6965 O O   . VAL B 1 377 ? -59.897 40.596 331.005 1.00 37.71  ? 378  VAL B O   1 
ATOM   6966 C CB  . VAL B 1 377 ? -60.835 43.731 331.801 1.00 37.28  ? 378  VAL B CB  1 
ATOM   6967 C CG1 . VAL B 1 377 ? -60.855 42.936 333.104 1.00 30.88  ? 378  VAL B CG1 1 
ATOM   6968 C CG2 . VAL B 1 377 ? -60.296 45.134 332.040 1.00 32.28  ? 378  VAL B CG2 1 
ATOM   6969 N N   . VAL B 1 378 ? -61.645 41.422 329.848 1.00 38.11  ? 379  VAL B N   1 
ATOM   6970 C CA  . VAL B 1 378 ? -62.232 40.104 329.624 1.00 40.02  ? 379  VAL B CA  1 
ATOM   6971 C C   . VAL B 1 378 ? -61.259 39.208 328.872 1.00 40.66  ? 379  VAL B C   1 
ATOM   6972 O O   . VAL B 1 378 ? -61.144 38.010 329.158 1.00 43.42  ? 379  VAL B O   1 
ATOM   6973 C CB  . VAL B 1 378 ? -63.570 40.240 328.874 1.00 43.36  ? 379  VAL B CB  1 
ATOM   6974 C CG1 . VAL B 1 378 ? -64.133 38.869 328.541 1.00 44.06  ? 379  VAL B CG1 1 
ATOM   6975 C CG2 . VAL B 1 378 ? -64.561 41.042 329.703 1.00 38.21  ? 379  VAL B CG2 1 
ATOM   6976 N N   . LEU B 1 379 ? -60.533 39.778 327.909 1.00 38.34  ? 380  LEU B N   1 
ATOM   6977 C CA  . LEU B 1 379 ? -59.582 38.998 327.126 1.00 42.01  ? 380  LEU B CA  1 
ATOM   6978 C C   . LEU B 1 379 ? -58.480 38.422 328.007 1.00 43.09  ? 380  LEU B C   1 
ATOM   6979 O O   . LEU B 1 379 ? -58.130 37.242 327.896 1.00 42.54  ? 380  LEU B O   1 
ATOM   6980 C CB  . LEU B 1 379 ? -58.980 39.873 326.026 1.00 40.14  ? 380  LEU B CB  1 
ATOM   6981 C CG  . LEU B 1 379 ? -57.680 39.361 325.405 1.00 43.19  ? 380  LEU B CG  1 
ATOM   6982 C CD1 . LEU B 1 379 ? -57.966 38.203 324.459 1.00 41.79  ? 380  LEU B CD1 1 
ATOM   6983 C CD2 . LEU B 1 379 ? -56.935 40.483 324.697 1.00 41.94  ? 380  LEU B CD2 1 
ATOM   6984 N N   . HIS B 1 380 ? -57.929 39.241 328.900 1.00 40.69  ? 381  HIS B N   1 
ATOM   6985 C CA  A HIS B 1 380 ? -56.788 38.813 329.702 0.62 52.91  ? 381  HIS B CA  1 
ATOM   6986 C CA  B HIS B 1 380 ? -56.789 38.786 329.682 0.38 51.82  ? 381  HIS B CA  1 
ATOM   6987 C C   . HIS B 1 380 ? -57.194 37.841 330.804 1.00 43.99  ? 381  HIS B C   1 
ATOM   6988 O O   . HIS B 1 380 ? -56.405 36.966 331.178 1.00 47.10  ? 381  HIS B O   1 
ATOM   6989 C CB  A HIS B 1 380 ? -56.089 40.036 330.296 0.62 59.14  ? 381  HIS B CB  1 
ATOM   6990 C CB  B HIS B 1 380 ? -56.025 39.985 330.241 0.38 62.42  ? 381  HIS B CB  1 
ATOM   6991 C CG  A HIS B 1 380 ? -54.835 39.714 331.045 0.62 47.79  ? 381  HIS B CG  1 
ATOM   6992 C CG  B HIS B 1 380 ? -55.077 40.594 329.257 0.38 52.57  ? 381  HIS B CG  1 
ATOM   6993 N ND1 A HIS B 1 380 ? -53.611 39.575 330.427 0.62 53.25  ? 381  HIS B ND1 1 
ATOM   6994 N ND1 B HIS B 1 380 ? -55.486 41.473 328.277 0.38 48.61  ? 381  HIS B ND1 1 
ATOM   6995 C CD2 A HIS B 1 380 ? -54.615 39.503 332.365 0.62 49.13  ? 381  HIS B CD2 1 
ATOM   6996 C CD2 B HIS B 1 380 ? -53.743 40.436 329.088 0.38 52.26  ? 381  HIS B CD2 1 
ATOM   6997 C CE1 A HIS B 1 380 ? -52.692 39.293 331.332 0.62 47.66  ? 381  HIS B CE1 1 
ATOM   6998 C CE1 B HIS B 1 380 ? -54.443 41.838 327.553 0.38 44.35  ? 381  HIS B CE1 1 
ATOM   6999 N NE2 A HIS B 1 380 ? -53.275 39.242 332.516 0.62 51.18  ? 381  HIS B NE2 1 
ATOM   7000 N NE2 B HIS B 1 380 ? -53.374 41.221 328.024 0.38 54.32  ? 381  HIS B NE2 1 
ATOM   7001 N N   . TYR B 1 381 ? -58.409 37.972 331.335 1.00 41.51  ? 382  TYR B N   1 
ATOM   7002 C CA  . TYR B 1 381 ? -58.837 37.160 332.466 1.00 46.45  ? 382  TYR B CA  1 
ATOM   7003 C C   . TYR B 1 381 ? -59.761 36.015 332.071 1.00 40.42  ? 382  TYR B C   1 
ATOM   7004 O O   . TYR B 1 381 ? -60.321 35.354 332.950 1.00 44.07  ? 382  TYR B O   1 
ATOM   7005 C CB  . TYR B 1 381 ? -59.502 38.045 333.521 1.00 35.24  ? 382  TYR B CB  1 
ATOM   7006 C CG  . TYR B 1 381 ? -58.506 38.882 334.289 1.00 40.92  ? 382  TYR B CG  1 
ATOM   7007 C CD1 . TYR B 1 381 ? -57.999 38.448 335.506 1.00 41.45  ? 382  TYR B CD1 1 
ATOM   7008 C CD2 . TYR B 1 381 ? -58.058 40.099 333.787 1.00 37.30  ? 382  TYR B CD2 1 
ATOM   7009 C CE1 . TYR B 1 381 ? -57.083 39.205 336.209 1.00 36.81  ? 382  TYR B CE1 1 
ATOM   7010 C CE2 . TYR B 1 381 ? -57.142 40.863 334.482 1.00 42.25  ? 382  TYR B CE2 1 
ATOM   7011 C CZ  . TYR B 1 381 ? -56.658 40.409 335.694 1.00 42.67  ? 382  TYR B CZ  1 
ATOM   7012 O OH  . TYR B 1 381 ? -55.744 41.159 336.397 1.00 36.46  ? 382  TYR B OH  1 
ATOM   7013 N N   . THR B 1 382 ? -59.925 35.756 330.779 1.00 44.72  ? 383  THR B N   1 
ATOM   7014 C CA  . THR B 1 382 ? -60.663 34.591 330.311 1.00 40.78  ? 383  THR B CA  1 
ATOM   7015 C C   . THR B 1 382 ? -59.679 33.494 329.932 1.00 39.76  ? 383  THR B C   1 
ATOM   7016 O O   . THR B 1 382 ? -58.708 33.749 329.212 1.00 48.92  ? 383  THR B O   1 
ATOM   7017 C CB  . THR B 1 382 ? -61.546 34.935 329.110 1.00 44.60  ? 383  THR B CB  1 
ATOM   7018 O OG1 . THR B 1 382 ? -62.548 35.884 329.498 1.00 45.94  ? 383  THR B OG1 1 
ATOM   7019 C CG2 . THR B 1 382 ? -62.219 33.684 328.564 1.00 37.79  ? 383  THR B CG2 1 
ATOM   7020 N N   . ASP B 1 383 ? -59.916 32.287 330.438 1.00 45.56  ? 384  ASP B N   1 
ATOM   7021 C CA  . ASP B 1 383 ? -59.250 31.092 329.925 1.00 48.76  ? 384  ASP B CA  1 
ATOM   7022 C C   . ASP B 1 383 ? -60.057 30.614 328.727 1.00 47.68  ? 384  ASP B C   1 
ATOM   7023 O O   . ASP B 1 383 ? -61.130 30.029 328.879 1.00 43.16  ? 384  ASP B O   1 
ATOM   7024 C CB  . ASP B 1 383 ? -59.150 30.016 331.001 1.00 50.41  ? 384  ASP B CB  1 
ATOM   7025 C CG  . ASP B 1 383 ? -58.254 28.855 330.590 1.00 63.00  ? 384  ASP B CG  1 
ATOM   7026 O OD1 . ASP B 1 383 ? -58.054 28.642 329.374 1.00 60.43  ? 384  ASP B OD1 1 
ATOM   7027 O OD2 . ASP B 1 383 ? -57.750 28.148 331.487 1.00 61.82  ? 384  ASP B OD2 1 
ATOM   7028 N N   . TRP B 1 384 ? -59.547 30.862 327.525 1.00 39.96  ? 385  TRP B N   1 
ATOM   7029 C CA  . TRP B 1 384 ? -60.306 30.555 326.320 1.00 51.56  ? 385  TRP B CA  1 
ATOM   7030 C C   . TRP B 1 384 ? -60.336 29.068 325.990 1.00 45.22  ? 385  TRP B C   1 
ATOM   7031 O O   . TRP B 1 384 ? -60.939 28.686 324.982 1.00 57.74  ? 385  TRP B O   1 
ATOM   7032 C CB  . TRP B 1 384 ? -59.753 31.365 325.150 1.00 41.40  ? 385  TRP B CB  1 
ATOM   7033 C CG  . TRP B 1 384 ? -59.896 32.829 325.401 1.00 42.41  ? 385  TRP B CG  1 
ATOM   7034 C CD1 . TRP B 1 384 ? -58.932 33.682 325.852 1.00 35.63  ? 385  TRP B CD1 1 
ATOM   7035 C CD2 . TRP B 1 384 ? -61.088 33.610 325.255 1.00 34.47  ? 385  TRP B CD2 1 
ATOM   7036 N NE1 . TRP B 1 384 ? -59.445 34.951 325.977 1.00 40.59  ? 385  TRP B NE1 1 
ATOM   7037 C CE2 . TRP B 1 384 ? -60.767 34.933 325.618 1.00 39.00  ? 385  TRP B CE2 1 
ATOM   7038 C CE3 . TRP B 1 384 ? -62.393 33.321 324.846 1.00 38.47  ? 385  TRP B CE3 1 
ATOM   7039 C CZ2 . TRP B 1 384 ? -61.703 35.965 325.583 1.00 37.84  ? 385  TRP B CZ2 1 
ATOM   7040 C CZ3 . TRP B 1 384 ? -63.323 34.349 324.810 1.00 36.09  ? 385  TRP B CZ3 1 
ATOM   7041 C CH2 . TRP B 1 384 ? -62.973 35.653 325.177 1.00 39.04  ? 385  TRP B CH2 1 
ATOM   7042 N N   . LEU B 1 385 ? -59.711 28.226 326.812 1.00 45.11  ? 386  LEU B N   1 
ATOM   7043 C CA  . LEU B 1 385 ? -59.963 26.793 326.775 1.00 49.90  ? 386  LEU B CA  1 
ATOM   7044 C C   . LEU B 1 385 ? -61.118 26.383 327.679 1.00 58.47  ? 386  LEU B C   1 
ATOM   7045 O O   . LEU B 1 385 ? -61.727 25.332 327.448 1.00 53.02  ? 386  LEU B O   1 
ATOM   7046 C CB  . LEU B 1 385 ? -58.701 26.022 327.177 1.00 52.00  ? 386  LEU B CB  1 
ATOM   7047 C CG  . LEU B 1 385 ? -57.566 26.018 326.150 1.00 56.97  ? 386  LEU B CG  1 
ATOM   7048 C CD1 . LEU B 1 385 ? -56.293 25.422 326.735 1.00 68.36  ? 386  LEU B CD1 1 
ATOM   7049 C CD2 . LEU B 1 385 ? -57.995 25.262 324.908 1.00 56.92  ? 386  LEU B CD2 1 
ATOM   7050 N N   . HIS B 1 386 ? -61.425 27.183 328.703 1.00 57.04  ? 387  HIS B N   1 
ATOM   7051 C CA  . HIS B 1 386 ? -62.554 26.941 329.605 1.00 47.55  ? 387  HIS B CA  1 
ATOM   7052 C C   . HIS B 1 386 ? -63.273 28.262 329.845 1.00 52.61  ? 387  HIS B C   1 
ATOM   7053 O O   . HIS B 1 386 ? -63.281 28.793 330.961 1.00 48.75  ? 387  HIS B O   1 
ATOM   7054 C CB  . HIS B 1 386 ? -62.079 26.327 330.924 1.00 44.70  ? 387  HIS B CB  1 
ATOM   7055 C CG  . HIS B 1 386 ? -61.096 25.210 330.758 1.00 50.00  ? 387  HIS B CG  1 
ATOM   7056 N ND1 . HIS B 1 386 ? -61.483 23.904 330.547 1.00 50.92  ? 387  HIS B ND1 1 
ATOM   7057 C CD2 . HIS B 1 386 ? -59.742 25.203 330.779 1.00 51.40  ? 387  HIS B CD2 1 
ATOM   7058 C CE1 . HIS B 1 386 ? -60.410 23.141 330.441 1.00 51.68  ? 387  HIS B CE1 1 
ATOM   7059 N NE2 . HIS B 1 386 ? -59.340 23.904 330.577 1.00 55.84  ? 387  HIS B NE2 1 
ATOM   7060 N N   . PRO B 1 387 ? -63.892 28.828 328.803 1.00 53.99  ? 388  PRO B N   1 
ATOM   7061 C CA  . PRO B 1 387 ? -64.409 30.202 328.919 1.00 47.56  ? 388  PRO B CA  1 
ATOM   7062 C C   . PRO B 1 387 ? -65.624 30.340 329.817 1.00 53.81  ? 388  PRO B C   1 
ATOM   7063 O O   . PRO B 1 387 ? -65.947 31.466 330.215 1.00 47.99  ? 388  PRO B O   1 
ATOM   7064 C CB  . PRO B 1 387 ? -64.750 30.569 327.469 1.00 48.61  ? 388  PRO B CB  1 
ATOM   7065 C CG  . PRO B 1 387 ? -65.061 29.261 326.826 1.00 37.34  ? 388  PRO B CG  1 
ATOM   7066 C CD  . PRO B 1 387 ? -64.134 28.260 327.465 1.00 49.44  ? 388  PRO B CD  1 
ATOM   7067 N N   . GLU B 1 388 ? -66.306 29.246 330.153 1.00 52.03  ? 389  GLU B N   1 
ATOM   7068 C CA  . GLU B 1 388 ? -67.546 29.323 330.918 1.00 56.44  ? 389  GLU B CA  1 
ATOM   7069 C C   . GLU B 1 388 ? -67.502 28.523 332.215 1.00 51.28  ? 389  GLU B C   1 
ATOM   7070 O O   . GLU B 1 388 ? -68.554 28.311 332.830 1.00 48.87  ? 389  GLU B O   1 
ATOM   7071 C CB  . GLU B 1 388 ? -68.725 28.862 330.053 1.00 46.82  ? 389  GLU B CB  1 
ATOM   7072 C CG  . GLU B 1 388 ? -68.831 29.593 328.721 1.00 59.66  ? 389  GLU B CG  1 
ATOM   7073 C CD  . GLU B 1 388 ? -70.265 29.766 328.252 1.00 87.16  ? 389  GLU B CD  1 
ATOM   7074 O OE1 . GLU B 1 388 ? -71.186 29.296 328.953 1.00 88.68  ? 389  GLU B OE1 1 
ATOM   7075 O OE2 . GLU B 1 388 ? -70.470 30.377 327.182 1.00 88.57  ? 389  GLU B OE2 1 
ATOM   7076 N N   . ASP B 1 389 ? -66.328 28.082 332.648 1.00 40.13  ? 390  ASP B N   1 
ATOM   7077 C CA  . ASP B 1 389 ? -66.218 27.290 333.869 1.00 50.17  ? 390  ASP B CA  1 
ATOM   7078 C C   . ASP B 1 389 ? -66.529 28.154 335.087 1.00 50.25  ? 390  ASP B C   1 
ATOM   7079 O O   . ASP B 1 389 ? -65.797 29.117 335.354 1.00 45.70  ? 390  ASP B O   1 
ATOM   7080 C CB  . ASP B 1 389 ? -64.819 26.688 333.977 1.00 53.28  ? 390  ASP B CB  1 
ATOM   7081 C CG  . ASP B 1 389 ? -64.667 25.774 335.179 1.00 64.93  ? 390  ASP B CG  1 
ATOM   7082 O OD1 . ASP B 1 389 ? -65.698 25.318 335.718 1.00 67.60  ? 390  ASP B OD1 1 
ATOM   7083 O OD2 . ASP B 1 389 ? -63.515 25.510 335.586 1.00 66.24  ? 390  ASP B OD2 1 
ATOM   7084 N N   . PRO B 1 390 ? -67.585 27.851 335.849 1.00 56.51  ? 391  PRO B N   1 
ATOM   7085 C CA  . PRO B 1 390 ? -67.965 28.742 336.963 1.00 58.44  ? 391  PRO B CA  1 
ATOM   7086 C C   . PRO B 1 390 ? -66.868 28.951 337.996 1.00 51.92  ? 391  PRO B C   1 
ATOM   7087 O O   . PRO B 1 390 ? -66.649 30.089 338.432 1.00 45.40  ? 391  PRO B O   1 
ATOM   7088 C CB  . PRO B 1 390 ? -69.189 28.037 337.567 1.00 50.09  ? 391  PRO B CB  1 
ATOM   7089 C CG  . PRO B 1 390 ? -69.731 27.186 336.457 1.00 54.47  ? 391  PRO B CG  1 
ATOM   7090 C CD  . PRO B 1 390 ? -68.547 26.753 335.652 1.00 56.04  ? 391  PRO B CD  1 
ATOM   7091 N N   . ALA B 1 391 ? -66.168 27.887 338.400 1.00 49.59  ? 392  ALA B N   1 
ATOM   7092 C CA  . ALA B 1 391 ? -65.112 28.031 339.398 1.00 44.52  ? 392  ALA B CA  1 
ATOM   7093 C C   . ALA B 1 391 ? -63.978 28.914 338.889 1.00 53.65  ? 392  ALA B C   1 
ATOM   7094 O O   . ALA B 1 391 ? -63.403 29.700 339.652 1.00 49.05  ? 392  ALA B O   1 
ATOM   7095 C CB  . ALA B 1 391 ? -64.580 26.657 339.803 1.00 45.37  ? 392  ALA B CB  1 
ATOM   7096 N N   . ARG B 1 392 ? -63.637 28.795 337.604 1.00 55.69  ? 393  ARG B N   1 
ATOM   7097 C CA  . ARG B 1 392 ? -62.592 29.641 337.037 1.00 44.71  ? 393  ARG B CA  1 
ATOM   7098 C C   . ARG B 1 392 ? -63.048 31.088 336.907 1.00 43.89  ? 393  ARG B C   1 
ATOM   7099 O O   . ARG B 1 392 ? -62.228 32.006 337.018 1.00 46.03  ? 393  ARG B O   1 
ATOM   7100 C CB  . ARG B 1 392 ? -62.163 29.107 335.671 1.00 56.91  ? 393  ARG B CB  1 
ATOM   7101 C CG  . ARG B 1 392 ? -61.273 27.880 335.715 1.00 54.43  ? 393  ARG B CG  1 
ATOM   7102 C CD  . ARG B 1 392 ? -60.879 27.467 334.303 1.00 50.41  ? 393  ARG B CD  1 
ATOM   7103 N NE  . ARG B 1 392 ? -59.820 26.463 334.288 1.00 46.40  ? 393  ARG B NE  1 
ATOM   7104 C CZ  . ARG B 1 392 ? -60.036 25.156 334.184 1.00 55.51  ? 393  ARG B CZ  1 
ATOM   7105 N NH1 . ARG B 1 392 ? -61.275 24.694 334.088 1.00 55.30  ? 393  ARG B NH1 1 
ATOM   7106 N NH2 . ARG B 1 392 ? -59.014 24.310 334.174 1.00 57.62  ? 393  ARG B NH2 1 
ATOM   7107 N N   . LEU B 1 393 ? -64.342 31.309 336.660 1.00 41.53  ? 394  LEU B N   1 
ATOM   7108 C CA  . LEU B 1 393 ? -64.852 32.670 336.519 1.00 44.83  ? 394  LEU B CA  1 
ATOM   7109 C C   . LEU B 1 393 ? -64.909 33.381 337.865 1.00 47.93  ? 394  LEU B C   1 
ATOM   7110 O O   . LEU B 1 393 ? -64.571 34.567 337.960 1.00 43.17  ? 394  LEU B O   1 
ATOM   7111 C CB  . LEU B 1 393 ? -66.234 32.648 335.870 1.00 42.22  ? 394  LEU B CB  1 
ATOM   7112 C CG  . LEU B 1 393 ? -66.285 32.165 334.419 1.00 53.04  ? 394  LEU B CG  1 
ATOM   7113 C CD1 . LEU B 1 393 ? -67.724 31.975 333.963 1.00 42.00  ? 394  LEU B CD1 1 
ATOM   7114 C CD2 . LEU B 1 393 ? -65.550 33.136 333.510 1.00 40.01  ? 394  LEU B CD2 1 
ATOM   7115 N N   . ARG B 1 394 ? -65.352 32.679 338.910 1.00 38.95  ? 395  ARG B N   1 
ATOM   7116 C CA  . ARG B 1 394 ? -65.328 33.252 340.252 1.00 48.84  ? 395  ARG B CA  1 
ATOM   7117 C C   . ARG B 1 394 ? -63.908 33.636 340.641 1.00 42.92  ? 395  ARG B C   1 
ATOM   7118 O O   . ARG B 1 394 ? -63.659 34.740 341.136 1.00 38.85  ? 395  ARG B O   1 
ATOM   7119 C CB  . ARG B 1 394 ? -65.918 32.258 341.255 1.00 38.16  ? 395  ARG B CB  1 
ATOM   7120 C CG  . ARG B 1 394 ? -65.843 32.701 342.709 1.00 43.33  ? 395  ARG B CG  1 
ATOM   7121 C CD  . ARG B 1 394 ? -66.148 31.541 343.648 1.00 39.40  ? 395  ARG B CD  1 
ATOM   7122 N NE  . ARG B 1 394 ? -65.109 30.514 343.603 1.00 46.44  ? 395  ARG B NE  1 
ATOM   7123 C CZ  . ARG B 1 394 ? -65.272 29.263 344.026 1.00 45.22  ? 395  ARG B CZ  1 
ATOM   7124 N NH1 . ARG B 1 394 ? -66.437 28.871 344.525 1.00 50.97  ? 395  ARG B NH1 1 
ATOM   7125 N NH2 . ARG B 1 394 ? -64.268 28.401 343.947 1.00 41.93  ? 395  ARG B NH2 1 
ATOM   7126 N N   . GLU B 1 395 ? -62.959 32.731 340.399 1.00 48.29  ? 396  GLU B N   1 
ATOM   7127 C CA  . GLU B 1 395 ? -61.552 33.013 340.654 1.00 47.14  ? 396  GLU B CA  1 
ATOM   7128 C C   . GLU B 1 395 ? -61.063 34.198 339.829 1.00 48.06  ? 396  GLU B C   1 
ATOM   7129 O O   . GLU B 1 395 ? -60.296 35.033 340.323 1.00 48.19  ? 396  GLU B O   1 
ATOM   7130 C CB  . GLU B 1 395 ? -60.730 31.762 340.345 1.00 52.96  ? 396  GLU B CB  1 
ATOM   7131 C CG  . GLU B 1 395 ? -59.305 31.757 340.855 1.00 64.23  ? 396  GLU B CG  1 
ATOM   7132 C CD  . GLU B 1 395 ? -58.530 30.545 340.361 1.00 94.27  ? 396  GLU B CD  1 
ATOM   7133 O OE1 . GLU B 1 395 ? -58.989 29.892 339.397 1.00 86.07  ? 396  GLU B OE1 1 
ATOM   7134 O OE2 . GLU B 1 395 ? -57.465 30.241 340.938 1.00 97.42  ? 396  GLU B OE2 1 
ATOM   7135 N N   . ALA B 1 396 ? -61.505 34.296 338.573 1.00 41.30  ? 397  ALA B N   1 
ATOM   7136 C CA  . ALA B 1 396 ? -60.975 35.323 337.681 1.00 42.51  ? 397  ALA B CA  1 
ATOM   7137 C C   . ALA B 1 396 ? -61.460 36.710 338.083 1.00 41.73  ? 397  ALA B C   1 
ATOM   7138 O O   . ALA B 1 396 ? -60.672 37.662 338.131 1.00 42.42  ? 397  ALA B O   1 
ATOM   7139 C CB  . ALA B 1 396 ? -61.359 35.015 336.232 1.00 37.85  ? 397  ALA B CB  1 
ATOM   7140 N N   . LEU B 1 397 ? -62.758 36.848 338.366 1.00 32.74  ? 398  LEU B N   1 
ATOM   7141 C CA  . LEU B 1 397 ? -63.279 38.149 338.771 1.00 41.82  ? 398  LEU B CA  1 
ATOM   7142 C C   . LEU B 1 397 ? -62.665 38.609 340.086 1.00 47.06  ? 398  LEU B C   1 
ATOM   7143 O O   . LEU B 1 397 ? -62.461 39.812 340.289 1.00 42.09  ? 398  LEU B O   1 
ATOM   7144 C CB  . LEU B 1 397 ? -64.802 38.099 338.878 1.00 36.24  ? 398  LEU B CB  1 
ATOM   7145 C CG  . LEU B 1 397 ? -65.478 39.462 339.037 1.00 44.87  ? 398  LEU B CG  1 
ATOM   7146 C CD1 . LEU B 1 397 ? -65.184 40.351 337.834 1.00 39.96  ? 398  LEU B CD1 1 
ATOM   7147 C CD2 . LEU B 1 397 ? -66.974 39.297 339.232 1.00 51.08  ? 398  LEU B CD2 1 
ATOM   7148 N N   . SER B 1 398 ? -62.358 37.673 340.987 1.00 35.42  ? 399  SER B N   1 
ATOM   7149 C CA  . SER B 1 398 ? -61.645 38.036 342.206 1.00 48.69  ? 399  SER B CA  1 
ATOM   7150 C C   . SER B 1 398 ? -60.256 38.573 341.877 1.00 49.51  ? 399  SER B C   1 
ATOM   7151 O O   . SER B 1 398 ? -59.795 39.545 342.487 1.00 43.31  ? 399  SER B O   1 
ATOM   7152 C CB  . SER B 1 398 ? -61.567 36.827 343.142 1.00 41.14  ? 399  SER B CB  1 
ATOM   7153 O OG  . SER B 1 398 ? -60.567 36.992 344.135 1.00 49.14  ? 399  SER B OG  1 
ATOM   7154 N N   . ASP B 1 399 ? -59.587 37.969 340.891 1.00 42.49  ? 400  ASP B N   1 
ATOM   7155 C CA  . ASP B 1 399 ? -58.288 38.476 340.459 1.00 45.02  ? 400  ASP B CA  1 
ATOM   7156 C C   . ASP B 1 399 ? -58.419 39.836 339.782 1.00 45.05  ? 400  ASP B C   1 
ATOM   7157 O O   . ASP B 1 399 ? -57.542 40.694 339.933 1.00 40.88  ? 400  ASP B O   1 
ATOM   7158 C CB  . ASP B 1 399 ? -57.619 37.476 339.519 1.00 48.53  ? 400  ASP B CB  1 
ATOM   7159 C CG  . ASP B 1 399 ? -57.038 36.284 340.256 1.00 63.83  ? 400  ASP B CG  1 
ATOM   7160 O OD1 . ASP B 1 399 ? -56.734 36.415 341.461 1.00 65.76  ? 400  ASP B OD1 1 
ATOM   7161 O OD2 . ASP B 1 399 ? -56.886 35.214 339.628 1.00 70.45  ? 400  ASP B OD2 1 
ATOM   7162 N N   . VAL B 1 400 ? -59.501 40.052 339.031 1.00 36.80  ? 401  VAL B N   1 
ATOM   7163 C CA  . VAL B 1 400 ? -59.708 41.347 338.384 1.00 43.19  ? 401  VAL B CA  1 
ATOM   7164 C C   . VAL B 1 400 ? -59.749 42.454 339.431 1.00 39.83  ? 401  VAL B C   1 
ATOM   7165 O O   . VAL B 1 400 ? -58.993 43.430 339.364 1.00 38.09  ? 401  VAL B O   1 
ATOM   7166 C CB  . VAL B 1 400 ? -60.993 41.336 337.537 1.00 42.89  ? 401  VAL B CB  1 
ATOM   7167 C CG1 . VAL B 1 400 ? -61.305 42.738 337.040 1.00 28.79  ? 401  VAL B CG1 1 
ATOM   7168 C CG2 . VAL B 1 400 ? -60.861 40.378 336.370 1.00 36.81  ? 401  VAL B CG2 1 
ATOM   7169 N N   . VAL B 1 401 ? -60.631 42.305 340.421 1.00 38.26  ? 402  VAL B N   1 
ATOM   7170 C CA  . VAL B 1 401 ? -60.769 43.321 341.460 1.00 40.18  ? 402  VAL B CA  1 
ATOM   7171 C C   . VAL B 1 401 ? -59.480 43.445 342.263 1.00 38.84  ? 402  VAL B C   1 
ATOM   7172 O O   . VAL B 1 401 ? -59.039 44.554 342.591 1.00 34.19  ? 402  VAL B O   1 
ATOM   7173 C CB  . VAL B 1 401 ? -61.975 42.992 342.360 1.00 42.88  ? 402  VAL B CB  1 
ATOM   7174 C CG1 . VAL B 1 401 ? -62.029 43.933 343.551 1.00 31.60  ? 402  VAL B CG1 1 
ATOM   7175 C CG2 . VAL B 1 401 ? -63.267 43.067 341.556 1.00 32.44  ? 402  VAL B CG2 1 
ATOM   7176 N N   . GLY B 1 402 ? -58.843 42.312 342.568 1.00 38.79  ? 403  GLY B N   1 
ATOM   7177 C CA  . GLY B 1 402 ? -57.646 42.341 343.393 1.00 30.79  ? 403  GLY B CA  1 
ATOM   7178 C C   . GLY B 1 402 ? -56.440 42.944 342.693 1.00 40.16  ? 403  GLY B C   1 
ATOM   7179 O O   . GLY B 1 402 ? -55.705 43.739 343.287 1.00 38.16  ? 403  GLY B O   1 
ATOM   7180 N N   . ASP B 1 403 ? -56.210 42.567 341.431 1.00 33.71  ? 404  ASP B N   1 
ATOM   7181 C CA  . ASP B 1 403 ? -55.057 43.090 340.700 1.00 32.81  ? 404  ASP B CA  1 
ATOM   7182 C C   . ASP B 1 403 ? -55.223 44.576 340.406 1.00 35.91  ? 404  ASP B C   1 
ATOM   7183 O O   . ASP B 1 403 ? -54.292 45.369 340.584 1.00 34.41  ? 404  ASP B O   1 
ATOM   7184 C CB  . ASP B 1 403 ? -54.855 42.319 339.393 1.00 33.39  ? 404  ASP B CB  1 
ATOM   7185 C CG  . ASP B 1 403 ? -54.650 40.826 339.605 1.00 47.53  ? 404  ASP B CG  1 
ATOM   7186 O OD1 . ASP B 1 403 ? -54.348 40.400 340.743 1.00 38.25  ? 404  ASP B OD1 1 
ATOM   7187 O OD2 . ASP B 1 403 ? -54.800 40.074 338.617 1.00 38.83  ? 404  ASP B OD2 1 
ATOM   7188 N N   . HIS B 1 404 ? -56.411 44.967 339.951 1.00 30.64  ? 405  HIS B N   1 
ATOM   7189 C CA  . HIS B 1 404 ? -56.636 46.342 339.528 1.00 34.59  ? 405  HIS B CA  1 
ATOM   7190 C C   . HIS B 1 404 ? -56.581 47.313 340.702 1.00 32.43  ? 405  HIS B C   1 
ATOM   7191 O O   . HIS B 1 404 ? -56.095 48.439 340.552 1.00 36.63  ? 405  HIS B O   1 
ATOM   7192 C CB  . HIS B 1 404 ? -57.978 46.413 338.798 1.00 29.79  ? 405  HIS B CB  1 
ATOM   7193 C CG  . HIS B 1 404 ? -58.502 47.799 338.597 1.00 35.88  ? 405  HIS B CG  1 
ATOM   7194 N ND1 . HIS B 1 404 ? -57.829 48.754 337.866 1.00 38.12  ? 405  HIS B ND1 1 
ATOM   7195 C CD2 . HIS B 1 404 ? -59.660 48.377 338.994 1.00 50.31  ? 405  HIS B CD2 1 
ATOM   7196 C CE1 . HIS B 1 404 ? -58.540 49.867 337.838 1.00 35.80  ? 405  HIS B CE1 1 
ATOM   7197 N NE2 . HIS B 1 404 ? -59.656 49.665 338.514 1.00 46.37  ? 405  HIS B NE2 1 
ATOM   7198 N N   . ASN B 1 405 ? -57.040 46.894 341.877 1.00 30.29  ? 406  ASN B N   1 
ATOM   7199 C CA  . ASN B 1 405 ? -57.152 47.805 343.008 1.00 34.09  ? 406  ASN B CA  1 
ATOM   7200 C C   . ASN B 1 405 ? -55.973 47.747 343.970 1.00 36.90  ? 406  ASN B C   1 
ATOM   7201 O O   . ASN B 1 405 ? -55.634 48.775 344.564 1.00 32.06  ? 406  ASN B O   1 
ATOM   7202 C CB  . ASN B 1 405 ? -58.446 47.525 343.783 1.00 28.33  ? 406  ASN B CB  1 
ATOM   7203 C CG  . ASN B 1 405 ? -59.687 47.913 343.003 1.00 37.72  ? 406  ASN B CG  1 
ATOM   7204 O OD1 . ASN B 1 405 ? -59.979 49.098 342.830 1.00 38.39  ? 406  ASN B OD1 1 
ATOM   7205 N ND2 . ASN B 1 405 ? -60.424 46.914 342.525 1.00 30.10  ? 406  ASN B ND2 1 
ATOM   7206 N N   . VAL B 1 406 ? -55.332 46.589 344.142 1.00 29.58  ? 407  VAL B N   1 
ATOM   7207 C CA  . VAL B 1 406 ? -54.319 46.445 345.185 1.00 32.69  ? 407  VAL B CA  1 
ATOM   7208 C C   . VAL B 1 406 ? -52.995 45.931 344.629 1.00 35.86  ? 407  VAL B C   1 
ATOM   7209 O O   . VAL B 1 406 ? -51.965 46.605 344.737 1.00 35.29  ? 407  VAL B O   1 
ATOM   7210 C CB  . VAL B 1 406 ? -54.812 45.514 346.309 1.00 31.99  ? 407  VAL B CB  1 
ATOM   7211 C CG1 . VAL B 1 406 ? -53.722 45.337 347.349 1.00 35.59  ? 407  VAL B CG1 1 
ATOM   7212 C CG2 . VAL B 1 406 ? -56.084 46.058 346.944 1.00 37.00  ? 407  VAL B CG2 1 
ATOM   7213 N N   . VAL B 1 407 ? -53.017 44.731 344.041 1.00 36.60  ? 408  VAL B N   1 
ATOM   7214 C CA  . VAL B 1 407 ? -51.780 44.015 343.725 1.00 34.52  ? 408  VAL B CA  1 
ATOM   7215 C C   . VAL B 1 407 ? -50.923 44.808 342.741 1.00 36.40  ? 408  VAL B C   1 
ATOM   7216 O O   . VAL B 1 407 ? -49.722 45.007 342.956 1.00 38.52  ? 408  VAL B O   1 
ATOM   7217 C CB  . VAL B 1 407 ? -52.098 42.610 343.183 1.00 35.91  ? 408  VAL B CB  1 
ATOM   7218 C CG1 . VAL B 1 407 ? -50.819 41.891 342.802 1.00 37.39  ? 408  VAL B CG1 1 
ATOM   7219 C CG2 . VAL B 1 407 ? -52.882 41.803 344.210 1.00 29.94  ? 408  VAL B CG2 1 
ATOM   7220 N N   . CYS B 1 408 ? -51.519 45.263 341.651 1.00 29.72  ? 409  CYS B N   1 
ATOM   7221 C CA  . CYS B 1 408 ? -50.726 45.922 340.620 1.00 33.26  ? 409  CYS B CA  1 
ATOM   7222 C C   . CYS B 1 408 ? -50.382 47.369 340.972 1.00 37.79  ? 409  CYS B C   1 
ATOM   7223 O O   . CYS B 1 408 ? -49.313 47.846 340.566 1.00 36.03  ? 409  CYS B O   1 
ATOM   7224 C CB  . CYS B 1 408 ? -51.450 45.829 339.271 1.00 26.02  ? 409  CYS B CB  1 
ATOM   7225 S SG  . CYS B 1 408 ? -51.631 44.108 338.697 1.00 40.95  ? 409  CYS B SG  1 
ATOM   7226 N N   . PRO B 1 409 ? -51.238 48.115 341.683 1.00 39.92  ? 410  PRO B N   1 
ATOM   7227 C CA  . PRO B 1 409 ? -50.752 49.392 342.232 1.00 39.34  ? 410  PRO B CA  1 
ATOM   7228 C C   . PRO B 1 409 ? -49.588 49.215 343.194 1.00 39.93  ? 410  PRO B C   1 
ATOM   7229 O O   . PRO B 1 409 ? -48.652 50.024 343.187 1.00 36.03  ? 410  PRO B O   1 
ATOM   7230 C CB  . PRO B 1 409 ? -51.991 49.972 342.926 1.00 33.39  ? 410  PRO B CB  1 
ATOM   7231 C CG  . PRO B 1 409 ? -53.132 49.408 342.169 1.00 32.15  ? 410  PRO B CG  1 
ATOM   7232 C CD  . PRO B 1 409 ? -52.709 48.012 341.782 1.00 31.12  ? 410  PRO B CD  1 
ATOM   7233 N N   . VAL B 1 410 ? -49.617 48.165 344.019 1.00 33.95  ? 411  VAL B N   1 
ATOM   7234 C CA  . VAL B 1 410 ? -48.504 47.911 344.928 1.00 38.62  ? 411  VAL B CA  1 
ATOM   7235 C C   . VAL B 1 410 ? -47.267 47.483 344.147 1.00 43.31  ? 411  VAL B C   1 
ATOM   7236 O O   . VAL B 1 410 ? -46.150 47.931 344.432 1.00 38.68  ? 411  VAL B O   1 
ATOM   7237 C CB  . VAL B 1 410 ? -48.904 46.865 345.986 1.00 33.24  ? 411  VAL B CB  1 
ATOM   7238 C CG1 . VAL B 1 410 ? -47.674 46.307 346.688 1.00 30.56  ? 411  VAL B CG1 1 
ATOM   7239 C CG2 . VAL B 1 410 ? -49.870 47.474 346.998 1.00 27.50  ? 411  VAL B CG2 1 
ATOM   7240 N N   . ALA B 1 411 ? -47.446 46.623 343.140 1.00 38.04  ? 412  ALA B N   1 
ATOM   7241 C CA  . ALA B 1 411 ? -46.311 46.191 342.330 1.00 41.98  ? 412  ALA B CA  1 
ATOM   7242 C C   . ALA B 1 411 ? -45.680 47.365 341.595 1.00 32.44  ? 412  ALA B C   1 
ATOM   7243 O O   . ALA B 1 411 ? -44.454 47.431 341.448 1.00 39.52  ? 412  ALA B O   1 
ATOM   7244 C CB  . ALA B 1 411 ? -46.749 45.111 341.340 1.00 36.50  ? 412  ALA B CB  1 
ATOM   7245 N N   . GLN B 1 412 ? -46.501 48.306 341.129 1.00 34.81  ? 413  GLN B N   1 
ATOM   7246 C CA  . GLN B 1 412 ? -45.967 49.468 340.429 1.00 38.41  ? 413  GLN B CA  1 
ATOM   7247 C C   . GLN B 1 412 ? -45.176 50.359 341.376 1.00 38.29  ? 413  GLN B C   1 
ATOM   7248 O O   . GLN B 1 412 ? -44.070 50.804 341.049 1.00 40.29  ? 413  GLN B O   1 
ATOM   7249 C CB  . GLN B 1 412 ? -47.099 50.256 339.774 1.00 37.10  ? 413  GLN B CB  1 
ATOM   7250 C CG  . GLN B 1 412 ? -46.674 51.622 339.258 1.00 41.58  ? 413  GLN B CG  1 
ATOM   7251 C CD  . GLN B 1 412 ? -47.713 52.250 338.351 1.00 61.24  ? 413  GLN B CD  1 
ATOM   7252 O OE1 . GLN B 1 412 ? -48.776 52.674 338.806 1.00 60.07  ? 413  GLN B OE1 1 
ATOM   7253 N NE2 . GLN B 1 412 ? -47.411 52.315 337.061 1.00 68.91  ? 413  GLN B NE2 1 
ATOM   7254 N N   . LEU B 1 413 ? -45.730 50.633 342.559 1.00 41.85  ? 414  LEU B N   1 
ATOM   7255 C CA  . LEU B 1 413 ? -45.021 51.454 343.533 1.00 37.01  ? 414  LEU B CA  1 
ATOM   7256 C C   . LEU B 1 413 ? -43.698 50.809 343.927 1.00 41.09  ? 414  LEU B C   1 
ATOM   7257 O O   . LEU B 1 413 ? -42.657 51.475 343.974 1.00 36.42  ? 414  LEU B O   1 
ATOM   7258 C CB  . LEU B 1 413 ? -45.903 51.685 344.761 1.00 42.33  ? 414  LEU B CB  1 
ATOM   7259 C CG  . LEU B 1 413 ? -45.231 52.316 345.983 1.00 39.82  ? 414  LEU B CG  1 
ATOM   7260 C CD1 . LEU B 1 413 ? -46.072 53.452 346.531 1.00 46.12  ? 414  LEU B CD1 1 
ATOM   7261 C CD2 . LEU B 1 413 ? -45.001 51.268 347.052 1.00 47.92  ? 414  LEU B CD2 1 
ATOM   7262 N N   . ALA B 1 414 ? -43.718 49.500 344.192 1.00 30.74  ? 415  ALA B N   1 
ATOM   7263 C CA  . ALA B 1 414 ? -42.506 48.803 344.608 1.00 32.17  ? 415  ALA B CA  1 
ATOM   7264 C C   . ALA B 1 414 ? -41.432 48.862 343.531 1.00 38.72  ? 415  ALA B C   1 
ATOM   7265 O O   . ALA B 1 414 ? -40.254 49.095 343.830 1.00 37.52  ? 415  ALA B O   1 
ATOM   7266 C CB  . ALA B 1 414 ? -42.832 47.350 344.954 1.00 32.01  ? 415  ALA B CB  1 
ATOM   7267 N N   . GLY B 1 415 ? -41.818 48.650 342.272 1.00 39.01  ? 416  GLY B N   1 
ATOM   7268 C CA  . GLY B 1 415 ? -40.838 48.650 341.200 1.00 32.29  ? 416  GLY B CA  1 
ATOM   7269 C C   . GLY B 1 415 ? -40.223 50.015 340.970 1.00 37.03  ? 416  GLY B C   1 
ATOM   7270 O O   . GLY B 1 415 ? -39.018 50.128 340.729 1.00 44.88  ? 416  GLY B O   1 
ATOM   7271 N N   . ARG B 1 416 ? -41.036 51.071 341.052 1.00 39.67  ? 417  ARG B N   1 
ATOM   7272 C CA  . ARG B 1 416 ? -40.520 52.417 340.825 1.00 30.83  ? 417  ARG B CA  1 
ATOM   7273 C C   . ARG B 1 416 ? -39.640 52.878 341.978 1.00 44.56  ? 417  ARG B C   1 
ATOM   7274 O O   . ARG B 1 416 ? -38.593 53.495 341.752 1.00 49.52  ? 417  ARG B O   1 
ATOM   7275 C CB  . ARG B 1 416 ? -41.672 53.395 340.612 1.00 39.16  ? 417  ARG B CB  1 
ATOM   7276 C CG  . ARG B 1 416 ? -42.597 53.021 339.470 1.00 52.03  ? 417  ARG B CG  1 
ATOM   7277 C CD  . ARG B 1 416 ? -41.838 52.908 338.165 1.00 45.47  ? 417  ARG B CD  1 
ATOM   7278 N NE  . ARG B 1 416 ? -41.639 54.211 337.543 1.00 69.35  ? 417  ARG B NE  1 
ATOM   7279 C CZ  . ARG B 1 416 ? -40.521 54.582 336.930 1.00 82.25  ? 417  ARG B CZ  1 
ATOM   7280 N NH1 . ARG B 1 416 ? -39.494 53.744 336.857 1.00 77.60  ? 417  ARG B NH1 1 
ATOM   7281 N NH2 . ARG B 1 416 ? -40.430 55.790 336.390 1.00 61.83  ? 417  ARG B NH2 1 
ATOM   7282 N N   . LEU B 1 417 ? -40.048 52.595 343.219 1.00 39.54  ? 418  LEU B N   1 
ATOM   7283 C CA  . LEU B 1 417 ? -39.230 52.968 344.369 1.00 42.39  ? 418  LEU B CA  1 
ATOM   7284 C C   . LEU B 1 417 ? -37.881 52.258 344.330 1.00 42.40  ? 418  LEU B C   1 
ATOM   7285 O O   . LEU B 1 417 ? -36.831 52.883 344.523 1.00 45.74  ? 418  LEU B O   1 
ATOM   7286 C CB  . LEU B 1 417 ? -39.967 52.649 345.673 1.00 41.68  ? 418  LEU B CB  1 
ATOM   7287 C CG  . LEU B 1 417 ? -41.251 53.405 346.033 1.00 48.31  ? 418  LEU B CG  1 
ATOM   7288 C CD1 . LEU B 1 417 ? -41.737 53.003 347.417 1.00 44.19  ? 418  LEU B CD1 1 
ATOM   7289 C CD2 . LEU B 1 417 ? -41.059 54.904 345.963 1.00 52.67  ? 418  LEU B CD2 1 
ATOM   7290 N N   . ALA B 1 418 ? -37.894 50.946 344.073 1.00 32.89  ? 419  ALA B N   1 
ATOM   7291 C CA  . ALA B 1 418 ? -36.653 50.175 344.043 1.00 41.94  ? 419  ALA B CA  1 
ATOM   7292 C C   . ALA B 1 418 ? -35.715 50.670 342.951 1.00 53.59  ? 419  ALA B C   1 
ATOM   7293 O O   . ALA B 1 418 ? -34.510 50.836 343.183 1.00 53.34  ? 419  ALA B O   1 
ATOM   7294 C CB  . ALA B 1 418 ? -36.961 48.691 343.841 1.00 30.56  ? 419  ALA B CB  1 
ATOM   7295 N N   . ALA B 1 419 ? -36.248 50.912 341.753 1.00 43.80  ? 420  ALA B N   1 
ATOM   7296 C CA  . ALA B 1 419 ? -35.428 51.374 340.641 1.00 54.78  ? 420  ALA B CA  1 
ATOM   7297 C C   . ALA B 1 419 ? -34.952 52.810 340.813 1.00 52.27  ? 420  ALA B C   1 
ATOM   7298 O O   . ALA B 1 419 ? -34.137 53.271 340.007 1.00 63.97  ? 420  ALA B O   1 
ATOM   7299 C CB  . ALA B 1 419 ? -36.202 51.240 339.328 1.00 36.21  ? 420  ALA B CB  1 
ATOM   7300 N N   . GLN B 1 420 ? -35.424 53.521 341.836 1.00 49.22  ? 421  GLN B N   1 
ATOM   7301 C CA  . GLN B 1 420 ? -35.067 54.919 342.041 1.00 48.48  ? 421  GLN B CA  1 
ATOM   7302 C C   . GLN B 1 420 ? -34.455 55.156 343.418 1.00 42.70  ? 421  GLN B C   1 
ATOM   7303 O O   . GLN B 1 420 ? -34.595 56.240 343.990 1.00 43.16  ? 421  GLN B O   1 
ATOM   7304 C CB  . GLN B 1 420 ? -36.281 55.820 341.825 1.00 40.57  ? 421  GLN B CB  1 
ATOM   7305 C CG  . GLN B 1 420 ? -36.764 55.822 340.383 1.00 48.19  ? 421  GLN B CG  1 
ATOM   7306 C CD  . GLN B 1 420 ? -38.172 56.357 340.238 1.00 55.66  ? 421  GLN B CD  1 
ATOM   7307 O OE1 . GLN B 1 420 ? -38.925 55.918 339.371 1.00 54.64  ? 421  GLN B OE1 1 
ATOM   7308 N NE2 . GLN B 1 420 ? -38.535 57.313 341.086 1.00 56.64  ? 421  GLN B NE2 1 
ATOM   7309 N N   . GLY B 1 421 ? -33.772 54.149 343.962 1.00 39.46  ? 422  GLY B N   1 
ATOM   7310 C CA  . GLY B 1 421 ? -32.913 54.332 345.115 1.00 48.87  ? 422  GLY B CA  1 
ATOM   7311 C C   . GLY B 1 421 ? -33.408 53.726 346.407 1.00 47.20  ? 422  GLY B C   1 
ATOM   7312 O O   . GLY B 1 421 ? -32.624 53.631 347.360 1.00 58.42  ? 422  GLY B O   1 
ATOM   7313 N N   . ALA B 1 422 ? -34.668 53.314 346.482 1.00 44.95  ? 423  ALA B N   1 
ATOM   7314 C CA  . ALA B 1 422 ? -35.216 52.765 347.712 1.00 42.62  ? 423  ALA B CA  1 
ATOM   7315 C C   . ALA B 1 422 ? -34.909 51.278 347.825 1.00 42.37  ? 423  ALA B C   1 
ATOM   7316 O O   . ALA B 1 422 ? -34.855 50.556 346.826 1.00 46.21  ? 423  ALA B O   1 
ATOM   7317 C CB  . ALA B 1 422 ? -36.727 52.988 347.776 1.00 43.51  ? 423  ALA B CB  1 
ATOM   7318 N N   . ARG B 1 423 ? -34.698 50.826 349.059 1.00 35.37  ? 424  ARG B N   1 
ATOM   7319 C CA  . ARG B 1 423 ? -34.604 49.401 349.352 1.00 42.44  ? 424  ARG B CA  1 
ATOM   7320 C C   . ARG B 1 423 ? -35.993 48.900 349.732 1.00 41.26  ? 424  ARG B C   1 
ATOM   7321 O O   . ARG B 1 423 ? -36.576 49.360 350.719 1.00 39.27  ? 424  ARG B O   1 
ATOM   7322 C CB  . ARG B 1 423 ? -33.595 49.128 350.469 1.00 35.79  ? 424  ARG B CB  1 
ATOM   7323 C CG  . ARG B 1 423 ? -33.190 47.658 350.571 1.00 44.23  ? 424  ARG B CG  1 
ATOM   7324 C CD  . ARG B 1 423 ? -31.947 47.453 351.427 1.00 59.32  ? 424  ARG B CD  1 
ATOM   7325 N NE  . ARG B 1 423 ? -32.239 47.562 352.853 1.00 65.21  ? 424  ARG B NE  1 
ATOM   7326 C CZ  . ARG B 1 423 ? -31.583 48.358 353.690 1.00 56.13  ? 424  ARG B CZ  1 
ATOM   7327 N NH1 . ARG B 1 423 ? -30.587 49.115 353.248 1.00 59.26  ? 424  ARG B NH1 1 
ATOM   7328 N NH2 . ARG B 1 423 ? -31.921 48.394 354.973 1.00 61.09  ? 424  ARG B NH2 1 
ATOM   7329 N N   . VAL B 1 424 ? -36.523 47.967 348.946 1.00 40.25  ? 425  VAL B N   1 
ATOM   7330 C CA  . VAL B 1 424 ? -37.906 47.521 349.061 1.00 36.16  ? 425  VAL B CA  1 
ATOM   7331 C C   . VAL B 1 424 ? -37.922 46.049 349.449 1.00 43.81  ? 425  VAL B C   1 
ATOM   7332 O O   . VAL B 1 424 ? -37.163 45.246 348.898 1.00 40.89  ? 425  VAL B O   1 
ATOM   7333 C CB  . VAL B 1 424 ? -38.676 47.743 347.740 1.00 33.99  ? 425  VAL B CB  1 
ATOM   7334 C CG1 . VAL B 1 424 ? -40.141 47.369 347.896 1.00 32.36  ? 425  VAL B CG1 1 
ATOM   7335 C CG2 . VAL B 1 424 ? -38.530 49.187 347.264 1.00 32.73  ? 425  VAL B CG2 1 
ATOM   7336 N N   . TYR B 1 425 ? -38.788 45.701 350.400 1.00 37.51  ? 426  TYR B N   1 
ATOM   7337 C CA  . TYR B 1 425 ? -39.053 44.315 350.769 1.00 42.00  ? 426  TYR B CA  1 
ATOM   7338 C C   . TYR B 1 425 ? -40.524 44.017 350.511 1.00 44.48  ? 426  TYR B C   1 
ATOM   7339 O O   . TYR B 1 425 ? -41.398 44.764 350.961 1.00 48.49  ? 426  TYR B O   1 
ATOM   7340 C CB  . TYR B 1 425 ? -38.695 44.052 352.238 1.00 35.74  ? 426  TYR B CB  1 
ATOM   7341 C CG  . TYR B 1 425 ? -37.227 44.240 352.546 1.00 32.75  ? 426  TYR B CG  1 
ATOM   7342 C CD1 . TYR B 1 425 ? -36.333 43.177 352.457 1.00 39.38  ? 426  TYR B CD1 1 
ATOM   7343 C CD2 . TYR B 1 425 ? -36.730 45.484 352.914 1.00 38.12  ? 426  TYR B CD2 1 
ATOM   7344 C CE1 . TYR B 1 425 ? -34.983 43.349 352.733 1.00 31.73  ? 426  TYR B CE1 1 
ATOM   7345 C CE2 . TYR B 1 425 ? -35.383 45.665 353.191 1.00 38.67  ? 426  TYR B CE2 1 
ATOM   7346 C CZ  . TYR B 1 425 ? -34.516 44.597 353.099 1.00 39.09  ? 426  TYR B CZ  1 
ATOM   7347 O OH  . TYR B 1 425 ? -33.180 44.784 353.376 1.00 44.60  ? 426  TYR B OH  1 
ATOM   7348 N N   . ALA B 1 426 ? -40.796 42.934 349.783 1.00 38.51  ? 427  ALA B N   1 
ATOM   7349 C CA  . ALA B 1 426 ? -42.148 42.588 349.370 1.00 40.96  ? 427  ALA B CA  1 
ATOM   7350 C C   . ALA B 1 426 ? -42.539 41.215 349.902 1.00 41.29  ? 427  ALA B C   1 
ATOM   7351 O O   . ALA B 1 426 ? -41.691 40.336 350.083 1.00 36.31  ? 427  ALA B O   1 
ATOM   7352 C CB  . ALA B 1 426 ? -42.287 42.609 347.842 1.00 32.03  ? 427  ALA B CB  1 
ATOM   7353 N N   . TYR B 1 427 ? -43.838 41.035 350.144 1.00 28.86  ? 428  TYR B N   1 
ATOM   7354 C CA  . TYR B 1 427 ? -44.345 39.781 350.682 1.00 32.17  ? 428  TYR B CA  1 
ATOM   7355 C C   . TYR B 1 427 ? -45.733 39.505 350.122 1.00 32.62  ? 428  TYR B C   1 
ATOM   7356 O O   . TYR B 1 427 ? -46.430 40.409 349.655 1.00 36.21  ? 428  TYR B O   1 
ATOM   7357 C CB  . TYR B 1 427 ? -44.401 39.799 352.221 1.00 34.43  ? 428  TYR B CB  1 
ATOM   7358 C CG  . TYR B 1 427 ? -45.450 40.741 352.779 1.00 34.38  ? 428  TYR B CG  1 
ATOM   7359 C CD1 . TYR B 1 427 ? -46.778 40.342 352.912 1.00 33.14  ? 428  TYR B CD1 1 
ATOM   7360 C CD2 . TYR B 1 427 ? -45.114 42.031 353.171 1.00 31.88  ? 428  TYR B CD2 1 
ATOM   7361 C CE1 . TYR B 1 427 ? -47.740 41.202 353.404 1.00 29.62  ? 428  TYR B CE1 1 
ATOM   7362 C CE2 . TYR B 1 427 ? -46.070 42.899 353.675 1.00 30.02  ? 428  TYR B CE2 1 
ATOM   7363 C CZ  . TYR B 1 427 ? -47.381 42.478 353.786 1.00 37.55  ? 428  TYR B CZ  1 
ATOM   7364 O OH  . TYR B 1 427 ? -48.338 43.333 354.279 1.00 42.12  ? 428  TYR B OH  1 
ATOM   7365 N N   . VAL B 1 428 ? -46.136 38.241 350.204 1.00 34.01  ? 429  VAL B N   1 
ATOM   7366 C CA  . VAL B 1 428 ? -47.516 37.832 349.975 1.00 33.53  ? 429  VAL B CA  1 
ATOM   7367 C C   . VAL B 1 428 ? -47.953 37.010 351.180 1.00 41.20  ? 429  VAL B C   1 
ATOM   7368 O O   . VAL B 1 428 ? -47.306 36.012 351.523 1.00 41.63  ? 429  VAL B O   1 
ATOM   7369 C CB  . VAL B 1 428 ? -47.681 37.028 348.674 1.00 35.20  ? 429  VAL B CB  1 
ATOM   7370 C CG1 . VAL B 1 428 ? -49.095 36.479 348.573 1.00 39.59  ? 429  VAL B CG1 1 
ATOM   7371 C CG2 . VAL B 1 428 ? -47.377 37.906 347.475 1.00 41.01  ? 429  VAL B CG2 1 
ATOM   7372 N N   . PHE B 1 429 ? -49.035 37.434 351.827 1.00 34.69  ? 430  PHE B N   1 
ATOM   7373 C CA  . PHE B 1 429 ? -49.545 36.768 353.020 1.00 40.98  ? 430  PHE B CA  1 
ATOM   7374 C C   . PHE B 1 429 ? -50.513 35.674 352.582 1.00 37.85  ? 430  PHE B C   1 
ATOM   7375 O O   . PHE B 1 429 ? -51.591 35.965 352.054 1.00 41.32  ? 430  PHE B O   1 
ATOM   7376 C CB  . PHE B 1 429 ? -50.221 37.775 353.947 1.00 38.71  ? 430  PHE B CB  1 
ATOM   7377 C CG  . PHE B 1 429 ? -50.616 37.206 355.279 1.00 41.76  ? 430  PHE B CG  1 
ATOM   7378 C CD1 . PHE B 1 429 ? -49.721 37.195 356.336 1.00 44.00  ? 430  PHE B CD1 1 
ATOM   7379 C CD2 . PHE B 1 429 ? -51.886 36.686 355.474 1.00 42.49  ? 430  PHE B CD2 1 
ATOM   7380 C CE1 . PHE B 1 429 ? -50.085 36.674 357.567 1.00 47.77  ? 430  PHE B CE1 1 
ATOM   7381 C CE2 . PHE B 1 429 ? -52.256 36.164 356.702 1.00 53.86  ? 430  PHE B CE2 1 
ATOM   7382 C CZ  . PHE B 1 429 ? -51.355 36.157 357.749 1.00 50.07  ? 430  PHE B CZ  1 
ATOM   7383 N N   . GLU B 1 430 ? -50.136 34.416 352.812 1.00 41.44  ? 431  GLU B N   1 
ATOM   7384 C CA  . GLU B 1 430 ? -50.860 33.279 352.254 1.00 52.28  ? 431  GLU B CA  1 
ATOM   7385 C C   . GLU B 1 430 ? -51.490 32.381 353.308 1.00 52.68  ? 431  GLU B C   1 
ATOM   7386 O O   . GLU B 1 430 ? -52.025 31.322 352.960 1.00 54.06  ? 431  GLU B O   1 
ATOM   7387 C CB  . GLU B 1 430 ? -49.934 32.444 351.366 1.00 48.39  ? 431  GLU B CB  1 
ATOM   7388 C CG  . GLU B 1 430 ? -49.392 33.186 350.161 1.00 54.00  ? 431  GLU B CG  1 
ATOM   7389 C CD  . GLU B 1 430 ? -48.753 32.254 349.152 1.00 64.84  ? 431  GLU B CD  1 
ATOM   7390 O OE1 . GLU B 1 430 ? -49.118 32.327 347.959 1.00 79.11  ? 431  GLU B OE1 1 
ATOM   7391 O OE2 . GLU B 1 430 ? -47.890 31.444 349.554 1.00 71.32  ? 431  GLU B OE2 1 
ATOM   7392 N N   . HIS B 1 431 ? -51.446 32.762 354.580 1.00 48.96  ? 432  HIS B N   1 
ATOM   7393 C CA  . HIS B 1 431 ? -52.013 31.934 355.633 1.00 44.22  ? 432  HIS B CA  1 
ATOM   7394 C C   . HIS B 1 431 ? -53.461 32.327 355.895 1.00 44.91  ? 432  HIS B C   1 
ATOM   7395 O O   . HIS B 1 431 ? -53.760 33.498 356.145 1.00 44.13  ? 432  HIS B O   1 
ATOM   7396 C CB  . HIS B 1 431 ? -51.203 32.047 356.922 1.00 41.20  ? 432  HIS B CB  1 
ATOM   7397 C CG  . HIS B 1 431 ? -51.778 31.256 358.053 1.00 54.09  ? 432  HIS B CG  1 
ATOM   7398 N ND1 . HIS B 1 431 ? -51.842 29.880 358.038 1.00 60.42  ? 432  HIS B ND1 1 
ATOM   7399 C CD2 . HIS B 1 431 ? -52.341 31.647 359.221 1.00 48.92  ? 432  HIS B CD2 1 
ATOM   7400 C CE1 . HIS B 1 431 ? -52.406 29.456 359.155 1.00 51.59  ? 432  HIS B CE1 1 
ATOM   7401 N NE2 . HIS B 1 431 ? -52.719 30.508 359.889 1.00 51.96  ? 432  HIS B NE2 1 
ATOM   7402 N N   . ARG B 1 432 ? -54.353 31.343 355.836 1.00 43.79  ? 433  ARG B N   1 
ATOM   7403 C CA  . ARG B 1 432 ? -55.749 31.533 356.201 1.00 37.80  ? 433  ARG B CA  1 
ATOM   7404 C C   . ARG B 1 432 ? -55.915 31.169 357.671 1.00 48.66  ? 433  ARG B C   1 
ATOM   7405 O O   . ARG B 1 432 ? -55.596 30.045 358.077 1.00 47.01  ? 433  ARG B O   1 
ATOM   7406 C CB  . ARG B 1 432 ? -56.662 30.678 355.321 1.00 42.64  ? 433  ARG B CB  1 
ATOM   7407 C CG  . ARG B 1 432 ? -58.132 30.788 355.671 1.00 50.49  ? 433  ARG B CG  1 
ATOM   7408 C CD  . ARG B 1 432 ? -58.985 29.868 354.813 1.00 44.59  ? 433  ARG B CD  1 
ATOM   7409 N NE  . ARG B 1 432 ? -60.352 29.794 355.320 1.00 53.00  ? 433  ARG B NE  1 
ATOM   7410 C CZ  . ARG B 1 432 ? -61.367 30.507 354.845 1.00 48.61  ? 433  ARG B CZ  1 
ATOM   7411 N NH1 . ARG B 1 432 ? -61.177 31.349 353.840 1.00 47.69  ? 433  ARG B NH1 1 
ATOM   7412 N NH2 . ARG B 1 432 ? -62.576 30.377 355.375 1.00 54.67  ? 433  ARG B NH2 1 
ATOM   7413 N N   . ALA B 1 433 ? -56.395 32.121 358.466 1.00 44.12  ? 434  ALA B N   1 
ATOM   7414 C CA  . ALA B 1 433 ? -56.530 31.898 359.898 1.00 55.21  ? 434  ALA B CA  1 
ATOM   7415 C C   . ALA B 1 433 ? -57.552 30.804 360.178 1.00 58.86  ? 434  ALA B C   1 
ATOM   7416 O O   . ALA B 1 433 ? -58.610 30.742 359.547 1.00 53.67  ? 434  ALA B O   1 
ATOM   7417 C CB  . ALA B 1 433 ? -56.940 33.193 360.601 1.00 46.52  ? 434  ALA B CB  1 
ATOM   7418 N N   . SER B 1 434 ? -57.226 29.934 361.139 1.00 45.41  ? 435  SER B N   1 
ATOM   7419 C CA  . SER B 1 434 ? -58.142 28.868 361.525 1.00 48.81  ? 435  SER B CA  1 
ATOM   7420 C C   . SER B 1 434 ? -59.448 29.409 362.089 1.00 49.65  ? 435  SER B C   1 
ATOM   7421 O O   . SER B 1 434 ? -60.464 28.705 362.058 1.00 50.01  ? 435  SER B O   1 
ATOM   7422 C CB  . SER B 1 434 ? -57.477 27.952 362.551 1.00 48.48  ? 435  SER B CB  1 
ATOM   7423 O OG  . SER B 1 434 ? -57.166 28.667 363.735 1.00 62.89  ? 435  SER B OG  1 
ATOM   7424 N N   . THR B 1 435 ? -59.445 30.636 362.599 1.00 53.59  ? 436  THR B N   1 
ATOM   7425 C CA  . THR B 1 435 ? -60.632 31.264 363.163 1.00 42.08  ? 436  THR B CA  1 
ATOM   7426 C C   . THR B 1 435 ? -61.426 32.064 362.140 1.00 45.30  ? 436  THR B C   1 
ATOM   7427 O O   . THR B 1 435 ? -62.433 32.680 362.507 1.00 49.18  ? 436  THR B O   1 
ATOM   7428 C CB  . THR B 1 435 ? -60.234 32.181 364.323 1.00 59.07  ? 436  THR B CB  1 
ATOM   7429 O OG1 . THR B 1 435 ? -59.343 33.197 363.842 1.00 50.38  ? 436  THR B OG1 1 
ATOM   7430 C CG2 . THR B 1 435 ? -59.540 31.383 365.419 1.00 50.11  ? 436  THR B CG2 1 
ATOM   7431 N N   . LEU B 1 436 ? -61.001 32.073 360.878 1.00 45.75  ? 437  LEU B N   1 
ATOM   7432 C CA  . LEU B 1 436 ? -61.655 32.900 359.873 1.00 42.34  ? 437  LEU B CA  1 
ATOM   7433 C C   . LEU B 1 436 ? -63.094 32.450 359.659 1.00 50.83  ? 437  LEU B C   1 
ATOM   7434 O O   . LEU B 1 436 ? -63.360 31.269 359.415 1.00 49.04  ? 437  LEU B O   1 
ATOM   7435 C CB  . LEU B 1 436 ? -60.877 32.842 358.557 1.00 39.79  ? 437  LEU B CB  1 
ATOM   7436 C CG  . LEU B 1 436 ? -61.328 33.802 357.454 1.00 51.60  ? 437  LEU B CG  1 
ATOM   7437 C CD1 . LEU B 1 436 ? -61.264 35.238 357.937 1.00 45.66  ? 437  LEU B CD1 1 
ATOM   7438 C CD2 . LEU B 1 436 ? -60.485 33.624 356.204 1.00 53.00  ? 437  LEU B CD2 1 
ATOM   7439 N N   . SER B 1 437 ? -64.023 33.401 359.750 1.00 43.96  ? 438  SER B N   1 
ATOM   7440 C CA  . SER B 1 437 ? -65.444 33.123 359.594 1.00 48.23  ? 438  SER B CA  1 
ATOM   7441 C C   . SER B 1 437 ? -65.926 33.236 358.153 1.00 51.82  ? 438  SER B C   1 
ATOM   7442 O O   . SER B 1 437 ? -67.049 32.812 357.858 1.00 52.78  ? 438  SER B O   1 
ATOM   7443 C CB  . SER B 1 437 ? -66.264 34.070 360.477 1.00 45.19  ? 438  SER B CB  1 
ATOM   7444 O OG  . SER B 1 437 ? -65.855 35.414 360.296 1.00 49.34  ? 438  SER B OG  1 
ATOM   7445 N N   . TRP B 1 438 ? -65.121 33.799 357.258 1.00 50.46  ? 439  TRP B N   1 
ATOM   7446 C CA  . TRP B 1 438 ? -65.524 33.919 355.867 1.00 48.14  ? 439  TRP B CA  1 
ATOM   7447 C C   . TRP B 1 438 ? -65.462 32.556 355.177 1.00 49.41  ? 439  TRP B C   1 
ATOM   7448 O O   . TRP B 1 438 ? -64.694 31.681 355.586 1.00 49.51  ? 439  TRP B O   1 
ATOM   7449 C CB  . TRP B 1 438 ? -64.630 34.920 355.141 1.00 43.86  ? 439  TRP B CB  1 
ATOM   7450 C CG  . TRP B 1 438 ? -64.865 36.333 355.569 1.00 43.51  ? 439  TRP B CG  1 
ATOM   7451 C CD1 . TRP B 1 438 ? -64.087 37.076 356.411 1.00 40.10  ? 439  TRP B CD1 1 
ATOM   7452 C CD2 . TRP B 1 438 ? -65.959 37.175 355.186 1.00 40.08  ? 439  TRP B CD2 1 
ATOM   7453 N NE1 . TRP B 1 438 ? -64.628 38.330 356.571 1.00 38.02  ? 439  TRP B NE1 1 
ATOM   7454 C CE2 . TRP B 1 438 ? -65.778 38.416 355.830 1.00 46.98  ? 439  TRP B CE2 1 
ATOM   7455 C CE3 . TRP B 1 438 ? -67.074 37.000 354.362 1.00 39.62  ? 439  TRP B CE3 1 
ATOM   7456 C CZ2 . TRP B 1 438 ? -66.669 39.477 355.673 1.00 42.31  ? 439  TRP B CZ2 1 
ATOM   7457 C CZ3 . TRP B 1 438 ? -67.959 38.057 354.208 1.00 38.67  ? 439  TRP B CZ3 1 
ATOM   7458 C CH2 . TRP B 1 438 ? -67.749 39.279 354.859 1.00 40.61  ? 439  TRP B CH2 1 
ATOM   7459 N N   . PRO B 1 439 ? -66.269 32.347 354.134 1.00 47.36  ? 440  PRO B N   1 
ATOM   7460 C CA  . PRO B 1 439 ? -66.272 31.047 353.452 1.00 43.64  ? 440  PRO B CA  1 
ATOM   7461 C C   . PRO B 1 439 ? -64.904 30.707 352.877 1.00 51.22  ? 440  PRO B C   1 
ATOM   7462 O O   . PRO B 1 439 ? -64.062 31.575 352.636 1.00 52.84  ? 440  PRO B O   1 
ATOM   7463 C CB  . PRO B 1 439 ? -67.317 31.226 352.342 1.00 46.28  ? 440  PRO B CB  1 
ATOM   7464 C CG  . PRO B 1 439 ? -67.428 32.713 352.157 1.00 45.36  ? 440  PRO B CG  1 
ATOM   7465 C CD  . PRO B 1 439 ? -67.240 33.278 353.533 1.00 47.37  ? 440  PRO B CD  1 
ATOM   7466 N N   . LEU B 1 440 ? -64.692 29.408 352.661 1.00 52.33  ? 441  LEU B N   1 
ATOM   7467 C CA  . LEU B 1 440 ? -63.391 28.915 352.228 1.00 54.72  ? 441  LEU B CA  1 
ATOM   7468 C C   . LEU B 1 440 ? -63.026 29.366 350.817 1.00 58.98  ? 441  LEU B C   1 
ATOM   7469 O O   . LEU B 1 440 ? -61.835 29.417 350.489 1.00 53.74  ? 441  LEU B O   1 
ATOM   7470 C CB  . LEU B 1 440 ? -63.362 27.388 352.317 1.00 58.52  ? 441  LEU B CB  1 
ATOM   7471 C CG  . LEU B 1 440 ? -61.988 26.718 352.324 1.00 64.15  ? 441  LEU B CG  1 
ATOM   7472 C CD1 . LEU B 1 440 ? -61.933 25.642 353.395 1.00 77.88  ? 441  LEU B CD1 1 
ATOM   7473 C CD2 . LEU B 1 440 ? -61.667 26.134 350.958 1.00 64.43  ? 441  LEU B CD2 1 
ATOM   7474 N N   . TRP B 1 441 ? -64.011 29.698 349.978 1.00 44.29  ? 442  TRP B N   1 
ATOM   7475 C CA  . TRP B 1 441 ? -63.696 30.112 348.616 1.00 49.40  ? 442  TRP B CA  1 
ATOM   7476 C C   . TRP B 1 441 ? -63.077 31.501 348.550 1.00 53.65  ? 442  TRP B C   1 
ATOM   7477 O O   . TRP B 1 441 ? -62.527 31.864 347.504 1.00 46.01  ? 442  TRP B O   1 
ATOM   7478 C CB  . TRP B 1 441 ? -64.946 30.054 347.727 1.00 48.38  ? 442  TRP B CB  1 
ATOM   7479 C CG  . TRP B 1 441 ? -66.005 31.087 348.019 1.00 43.53  ? 442  TRP B CG  1 
ATOM   7480 C CD1 . TRP B 1 441 ? -67.139 30.909 348.760 1.00 52.80  ? 442  TRP B CD1 1 
ATOM   7481 C CD2 . TRP B 1 441 ? -66.043 32.445 347.552 1.00 44.19  ? 442  TRP B CD2 1 
ATOM   7482 N NE1 . TRP B 1 441 ? -67.873 32.072 348.792 1.00 46.93  ? 442  TRP B NE1 1 
ATOM   7483 C CE2 . TRP B 1 441 ? -67.221 33.029 348.060 1.00 38.89  ? 442  TRP B CE2 1 
ATOM   7484 C CE3 . TRP B 1 441 ? -65.192 33.225 346.760 1.00 43.93  ? 442  TRP B CE3 1 
ATOM   7485 C CZ2 . TRP B 1 441 ? -67.568 34.356 347.806 1.00 40.36  ? 442  TRP B CZ2 1 
ATOM   7486 C CZ3 . TRP B 1 441 ? -65.539 34.542 346.508 1.00 35.99  ? 442  TRP B CZ3 1 
ATOM   7487 C CH2 . TRP B 1 441 ? -66.716 35.094 347.029 1.00 45.12  ? 442  TRP B CH2 1 
ATOM   7488 N N   . MET B 1 442 ? -63.148 32.280 349.630 1.00 53.69  ? 443  MET B N   1 
ATOM   7489 C CA  . MET B 1 442 ? -62.530 33.599 349.649 1.00 42.91  ? 443  MET B CA  1 
ATOM   7490 C C   . MET B 1 442 ? -61.044 33.558 349.984 1.00 45.17  ? 443  MET B C   1 
ATOM   7491 O O   . MET B 1 442 ? -60.375 34.589 349.863 1.00 46.78  ? 443  MET B O   1 
ATOM   7492 C CB  . MET B 1 442 ? -63.270 34.510 350.630 1.00 41.45  ? 443  MET B CB  1 
ATOM   7493 C CG  . MET B 1 442 ? -64.644 34.943 350.130 1.00 51.16  ? 443  MET B CG  1 
ATOM   7494 S SD  . MET B 1 442 ? -65.629 35.857 351.335 1.00 55.03  ? 443  MET B SD  1 
ATOM   7495 C CE  . MET B 1 442 ? -64.485 37.159 351.776 1.00 61.16  ? 443  MET B CE  1 
ATOM   7496 N N   . GLY B 1 443 ? -60.516 32.404 350.384 1.00 39.98  ? 444  GLY B N   1 
ATOM   7497 C CA  . GLY B 1 443 ? -59.083 32.288 350.600 1.00 42.51  ? 444  GLY B CA  1 
ATOM   7498 C C   . GLY B 1 443 ? -58.635 33.154 351.762 1.00 53.57  ? 444  GLY B C   1 
ATOM   7499 O O   . GLY B 1 443 ? -59.201 33.107 352.858 1.00 41.07  ? 444  GLY B O   1 
ATOM   7500 N N   . VAL B 1 444 ? -57.600 33.954 351.520 1.00 39.48  ? 445  VAL B N   1 
ATOM   7501 C CA  . VAL B 1 444 ? -57.118 34.907 352.516 1.00 44.87  ? 445  VAL B CA  1 
ATOM   7502 C C   . VAL B 1 444 ? -57.594 36.291 352.094 1.00 38.26  ? 445  VAL B C   1 
ATOM   7503 O O   . VAL B 1 444 ? -56.971 36.926 351.234 1.00 39.84  ? 445  VAL B O   1 
ATOM   7504 C CB  . VAL B 1 444 ? -55.590 34.846 352.659 1.00 41.84  ? 445  VAL B CB  1 
ATOM   7505 C CG1 . VAL B 1 444 ? -55.121 35.792 353.751 1.00 46.31  ? 445  VAL B CG1 1 
ATOM   7506 C CG2 . VAL B 1 444 ? -55.144 33.422 352.955 1.00 50.04  ? 445  VAL B CG2 1 
ATOM   7507 N N   . PRO B 1 445 ? -58.683 36.789 352.668 1.00 39.34  ? 446  PRO B N   1 
ATOM   7508 C CA  . PRO B 1 445 ? -59.298 38.021 352.167 1.00 43.96  ? 446  PRO B CA  1 
ATOM   7509 C C   . PRO B 1 445 ? -58.554 39.266 352.630 1.00 45.71  ? 446  PRO B C   1 
ATOM   7510 O O   . PRO B 1 445 ? -57.645 39.226 353.464 1.00 38.20  ? 446  PRO B O   1 
ATOM   7511 C CB  . PRO B 1 445 ? -60.718 37.981 352.752 1.00 33.50  ? 446  PRO B CB  1 
ATOM   7512 C CG  . PRO B 1 445 ? -60.879 36.604 353.349 1.00 37.51  ? 446  PRO B CG  1 
ATOM   7513 C CD  . PRO B 1 445 ? -59.500 36.163 353.715 1.00 38.74  ? 446  PRO B CD  1 
ATOM   7514 N N   . HIS B 1 446 ? -58.985 40.389 352.064 1.00 47.76  ? 447  HIS B N   1 
ATOM   7515 C CA  . HIS B 1 446 ? -58.416 41.699 352.348 1.00 43.35  ? 447  HIS B CA  1 
ATOM   7516 C C   . HIS B 1 446 ? -58.502 42.026 353.837 1.00 48.35  ? 447  HIS B C   1 
ATOM   7517 O O   . HIS B 1 446 ? -59.588 42.003 354.425 1.00 50.02  ? 447  HIS B O   1 
ATOM   7518 C CB  . HIS B 1 446 ? -59.167 42.742 351.521 1.00 37.91  ? 447  HIS B CB  1 
ATOM   7519 C CG  . HIS B 1 446 ? -58.629 44.132 351.638 1.00 59.51  ? 447  HIS B CG  1 
ATOM   7520 N ND1 . HIS B 1 446 ? -57.430 44.518 351.076 1.00 48.41  ? 447  HIS B ND1 1 
ATOM   7521 C CD2 . HIS B 1 446 ? -59.144 45.239 352.224 1.00 46.02  ? 447  HIS B CD2 1 
ATOM   7522 C CE1 . HIS B 1 446 ? -57.224 45.800 351.321 1.00 44.19  ? 447  HIS B CE1 1 
ATOM   7523 N NE2 . HIS B 1 446 ? -58.249 46.260 352.017 1.00 51.82  ? 447  HIS B NE2 1 
ATOM   7524 N N   . GLY B 1 447 ? -57.353 42.324 354.446 1.00 40.77  ? 448  GLY B N   1 
ATOM   7525 C CA  . GLY B 1 447 ? -57.291 42.785 355.816 1.00 32.26  ? 448  GLY B CA  1 
ATOM   7526 C C   . GLY B 1 447 ? -56.988 41.723 356.854 1.00 42.56  ? 448  GLY B C   1 
ATOM   7527 O O   . GLY B 1 447 ? -56.758 42.070 358.018 1.00 38.68  ? 448  GLY B O   1 
ATOM   7528 N N   . TYR B 1 448 ? -56.965 40.444 356.477 1.00 35.04  ? 449  TYR B N   1 
ATOM   7529 C CA  . TYR B 1 448 ? -56.834 39.362 357.444 1.00 41.09  ? 449  TYR B CA  1 
ATOM   7530 C C   . TYR B 1 448 ? -55.389 38.908 357.631 1.00 42.47  ? 449  TYR B C   1 
ATOM   7531 O O   . TYR B 1 448 ? -55.139 37.753 357.991 1.00 52.97  ? 449  TYR B O   1 
ATOM   7532 C CB  . TYR B 1 448 ? -57.750 38.201 357.059 1.00 32.02  ? 449  TYR B CB  1 
ATOM   7533 C CG  . TYR B 1 448 ? -59.188 38.558 357.356 1.00 40.34  ? 449  TYR B CG  1 
ATOM   7534 C CD1 . TYR B 1 448 ? -59.731 38.343 358.617 1.00 33.59  ? 449  TYR B CD1 1 
ATOM   7535 C CD2 . TYR B 1 448 ? -59.982 39.172 356.399 1.00 29.97  ? 449  TYR B CD2 1 
ATOM   7536 C CE1 . TYR B 1 448 ? -61.035 38.699 358.903 1.00 33.35  ? 449  TYR B CE1 1 
ATOM   7537 C CE2 . TYR B 1 448 ? -61.289 39.532 356.677 1.00 41.93  ? 449  TYR B CE2 1 
ATOM   7538 C CZ  . TYR B 1 448 ? -61.810 39.293 357.931 1.00 41.09  ? 449  TYR B CZ  1 
ATOM   7539 O OH  . TYR B 1 448 ? -63.109 39.651 358.216 1.00 45.06  ? 449  TYR B OH  1 
ATOM   7540 N N   . GLU B 1 449 ? -54.433 39.809 357.411 1.00 41.30  ? 450  GLU B N   1 
ATOM   7541 C CA  . GLU B 1 449 ? -53.080 39.651 357.923 1.00 40.26  ? 450  GLU B CA  1 
ATOM   7542 C C   . GLU B 1 449 ? -52.804 40.540 359.127 1.00 44.63  ? 450  GLU B C   1 
ATOM   7543 O O   . GLU B 1 449 ? -51.798 40.330 359.813 1.00 42.15  ? 450  GLU B O   1 
ATOM   7544 C CB  . GLU B 1 449 ? -52.053 39.961 356.825 1.00 34.55  ? 450  GLU B CB  1 
ATOM   7545 C CG  . GLU B 1 449 ? -51.633 41.426 356.750 1.00 34.86  ? 450  GLU B CG  1 
ATOM   7546 C CD  . GLU B 1 449 ? -52.686 42.326 356.117 1.00 50.63  ? 450  GLU B CD  1 
ATOM   7547 O OE1 . GLU B 1 449 ? -53.854 41.899 355.977 1.00 45.48  ? 450  GLU B OE1 1 
ATOM   7548 O OE2 . GLU B 1 449 ? -52.337 43.467 355.743 1.00 54.57  ? 450  GLU B OE2 1 
ATOM   7549 N N   . ILE B 1 450 ? -53.677 41.514 359.404 1.00 33.36  ? 451  ILE B N   1 
ATOM   7550 C CA  . ILE B 1 450 ? -53.419 42.499 360.453 1.00 43.70  ? 451  ILE B CA  1 
ATOM   7551 C C   . ILE B 1 450 ? -53.362 41.829 361.820 1.00 44.12  ? 451  ILE B C   1 
ATOM   7552 O O   . ILE B 1 450 ? -52.466 42.103 362.627 1.00 42.00  ? 451  ILE B O   1 
ATOM   7553 C CB  . ILE B 1 450 ? -54.488 43.606 360.423 1.00 39.07  ? 451  ILE B CB  1 
ATOM   7554 C CG1 . ILE B 1 450 ? -54.527 44.289 359.056 1.00 34.27  ? 451  ILE B CG1 1 
ATOM   7555 C CG2 . ILE B 1 450 ? -54.245 44.619 361.532 1.00 40.12  ? 451  ILE B CG2 1 
ATOM   7556 C CD1 . ILE B 1 450 ? -55.677 45.268 358.910 1.00 31.97  ? 451  ILE B CD1 1 
ATOM   7557 N N   . GLU B 1 451 ? -54.326 40.946 362.101 1.00 36.48  ? 452  GLU B N   1 
ATOM   7558 C CA  . GLU B 1 451 ? -54.394 40.306 363.412 1.00 42.33  ? 452  GLU B CA  1 
ATOM   7559 C C   . GLU B 1 451 ? -53.115 39.549 363.739 1.00 44.73  ? 452  GLU B C   1 
ATOM   7560 O O   . GLU B 1 451 ? -52.757 39.417 364.914 1.00 44.15  ? 452  GLU B O   1 
ATOM   7561 C CB  . GLU B 1 451 ? -55.599 39.365 363.478 1.00 43.47  ? 452  GLU B CB  1 
ATOM   7562 C CG  . GLU B 1 451 ? -55.624 38.293 362.396 1.00 49.32  ? 452  GLU B CG  1 
ATOM   7563 C CD  . GLU B 1 451 ? -56.986 37.630 362.263 1.00 58.29  ? 452  GLU B CD  1 
ATOM   7564 O OE1 . GLU B 1 451 ? -57.075 36.402 362.475 1.00 59.38  ? 452  GLU B OE1 1 
ATOM   7565 O OE2 . GLU B 1 451 ? -57.967 38.336 361.943 1.00 48.08  ? 452  GLU B OE2 1 
ATOM   7566 N N   . PHE B 1 452 ? -52.411 39.055 362.721 1.00 36.04  ? 453  PHE B N   1 
ATOM   7567 C CA  . PHE B 1 452 ? -51.160 38.354 362.974 1.00 44.32  ? 453  PHE B CA  1 
ATOM   7568 C C   . PHE B 1 452 ? -50.007 39.318 363.222 1.00 48.81  ? 453  PHE B C   1 
ATOM   7569 O O   . PHE B 1 452 ? -49.131 39.025 364.046 1.00 44.93  ? 453  PHE B O   1 
ATOM   7570 C CB  . PHE B 1 452 ? -50.843 37.414 361.808 1.00 37.99  ? 453  PHE B CB  1 
ATOM   7571 C CG  . PHE B 1 452 ? -51.685 36.173 361.797 1.00 46.71  ? 453  PHE B CG  1 
ATOM   7572 C CD1 . PHE B 1 452 ? -52.909 36.157 361.152 1.00 47.79  ? 453  PHE B CD1 1 
ATOM   7573 C CD2 . PHE B 1 452 ? -51.265 35.029 362.458 1.00 49.87  ? 453  PHE B CD2 1 
ATOM   7574 C CE1 . PHE B 1 452 ? -53.694 35.019 361.153 1.00 46.82  ? 453  PHE B CE1 1 
ATOM   7575 C CE2 . PHE B 1 452 ? -52.045 33.887 362.464 1.00 45.32  ? 453  PHE B CE2 1 
ATOM   7576 C CZ  . PHE B 1 452 ? -53.262 33.883 361.810 1.00 51.69  ? 453  PHE B CZ  1 
ATOM   7577 N N   . ILE B 1 453 ? -49.996 40.469 362.542 1.00 32.86  ? 454  ILE B N   1 
ATOM   7578 C CA  . ILE B 1 453 ? -48.927 41.435 362.758 1.00 38.15  ? 454  ILE B CA  1 
ATOM   7579 C C   . ILE B 1 453 ? -49.055 42.081 364.134 1.00 38.41  ? 454  ILE B C   1 
ATOM   7580 O O   . ILE B 1 453 ? -48.051 42.387 364.784 1.00 43.08  ? 454  ILE B O   1 
ATOM   7581 C CB  . ILE B 1 453 ? -48.919 42.485 361.634 1.00 48.85  ? 454  ILE B CB  1 
ATOM   7582 C CG1 . ILE B 1 453 ? -48.635 41.801 360.295 1.00 47.88  ? 454  ILE B CG1 1 
ATOM   7583 C CG2 . ILE B 1 453 ? -47.871 43.554 361.903 1.00 47.14  ? 454  ILE B CG2 1 
ATOM   7584 C CD1 . ILE B 1 453 ? -49.145 42.559 359.105 1.00 44.51  ? 454  ILE B CD1 1 
ATOM   7585 N N   . PHE B 1 454 ? -50.284 42.285 364.604 1.00 40.17  ? 455  PHE B N   1 
ATOM   7586 C CA  . PHE B 1 454 ? -50.491 42.818 365.947 1.00 36.31  ? 455  PHE B CA  1 
ATOM   7587 C C   . PHE B 1 454 ? -50.417 41.743 367.023 1.00 40.87  ? 455  PHE B C   1 
ATOM   7588 O O   . PHE B 1 454 ? -50.627 42.057 368.199 1.00 38.21  ? 455  PHE B O   1 
ATOM   7589 C CB  . PHE B 1 454 ? -51.833 43.549 366.032 1.00 32.21  ? 455  PHE B CB  1 
ATOM   7590 C CG  . PHE B 1 454 ? -51.788 44.947 365.482 1.00 40.33  ? 455  PHE B CG  1 
ATOM   7591 C CD1 . PHE B 1 454 ? -51.888 45.170 364.119 1.00 42.87  ? 455  PHE B CD1 1 
ATOM   7592 C CD2 . PHE B 1 454 ? -51.632 46.039 366.324 1.00 38.91  ? 455  PHE B CD2 1 
ATOM   7593 C CE1 . PHE B 1 454 ? -51.842 46.452 363.603 1.00 35.73  ? 455  PHE B CE1 1 
ATOM   7594 C CE2 . PHE B 1 454 ? -51.586 47.329 365.814 1.00 44.81  ? 455  PHE B CE2 1 
ATOM   7595 C CZ  . PHE B 1 454 ? -51.693 47.533 364.449 1.00 41.00  ? 455  PHE B CZ  1 
ATOM   7596 N N   . GLY B 1 455 ? -50.139 40.494 366.654 1.00 44.46  ? 456  GLY B N   1 
ATOM   7597 C CA  . GLY B 1 455 ? -49.973 39.437 367.630 1.00 43.24  ? 456  GLY B CA  1 
ATOM   7598 C C   . GLY B 1 455 ? -51.227 39.052 368.386 1.00 42.64  ? 456  GLY B C   1 
ATOM   7599 O O   . GLY B 1 455 ? -51.127 38.548 369.507 1.00 41.83  ? 456  GLY B O   1 
ATOM   7600 N N   . ILE B 1 456 ? -52.402 39.279 367.803 1.00 41.61  ? 457  ILE B N   1 
ATOM   7601 C CA  . ILE B 1 456 ? -53.679 38.891 368.405 1.00 42.97  ? 457  ILE B CA  1 
ATOM   7602 C C   . ILE B 1 456 ? -53.713 37.401 368.749 1.00 51.66  ? 457  ILE B C   1 
ATOM   7603 O O   . ILE B 1 456 ? -54.278 37.045 369.793 1.00 51.09  ? 457  ILE B O   1 
ATOM   7604 C CB  . ILE B 1 456 ? -54.850 39.280 367.491 1.00 48.29  ? 457  ILE B CB  1 
ATOM   7605 C CG1 . ILE B 1 456 ? -54.784 40.767 367.144 1.00 44.05  ? 457  ILE B CG1 1 
ATOM   7606 C CG2 . ILE B 1 456 ? -56.188 38.948 368.150 1.00 46.17  ? 457  ILE B CG2 1 
ATOM   7607 C CD1 . ILE B 1 456 ? -54.749 41.676 368.356 1.00 43.22  ? 457  ILE B CD1 1 
ATOM   7608 N N   . PRO B 1 457 ? -53.141 36.486 367.925 1.00 46.49  ? 458  PRO B N   1 
ATOM   7609 C CA  . PRO B 1 457 ? -53.115 35.072 368.334 1.00 49.27  ? 458  PRO B CA  1 
ATOM   7610 C C   . PRO B 1 457 ? -52.504 34.809 369.703 1.00 50.44  ? 458  PRO B C   1 
ATOM   7611 O O   . PRO B 1 457 ? -52.771 33.759 370.293 1.00 51.39  ? 458  PRO B O   1 
ATOM   7612 C CB  . PRO B 1 457 ? -52.283 34.412 367.229 1.00 46.05  ? 458  PRO B CB  1 
ATOM   7613 C CG  . PRO B 1 457 ? -52.603 35.196 366.034 1.00 42.33  ? 458  PRO B CG  1 
ATOM   7614 C CD  . PRO B 1 457 ? -52.757 36.624 366.507 1.00 44.03  ? 458  PRO B CD  1 
ATOM   7615 N N   . LEU B 1 458 ? -51.689 35.730 370.223 1.00 50.84  ? 459  LEU B N   1 
ATOM   7616 C CA  . LEU B 1 458 ? -51.131 35.543 371.558 1.00 47.34  ? 459  LEU B CA  1 
ATOM   7617 C C   . LEU B 1 458 ? -52.183 35.678 372.652 1.00 46.48  ? 459  LEU B C   1 
ATOM   7618 O O   . LEU B 1 458 ? -51.953 35.219 373.775 1.00 54.30  ? 459  LEU B O   1 
ATOM   7619 C CB  . LEU B 1 458 ? -49.996 36.539 371.804 1.00 42.79  ? 459  LEU B CB  1 
ATOM   7620 C CG  . LEU B 1 458 ? -48.766 36.389 370.908 1.00 56.57  ? 459  LEU B CG  1 
ATOM   7621 C CD1 . LEU B 1 458 ? -47.683 37.376 371.317 1.00 50.16  ? 459  LEU B CD1 1 
ATOM   7622 C CD2 . LEU B 1 458 ? -48.242 34.965 370.957 1.00 55.58  ? 459  LEU B CD2 1 
ATOM   7623 N N   . ASP B 1 459 ? -53.324 36.293 372.355 1.00 48.92  ? 460  ASP B N   1 
ATOM   7624 C CA  . ASP B 1 459 ? -54.417 36.401 373.313 1.00 45.66  ? 460  ASP B CA  1 
ATOM   7625 C C   . ASP B 1 459 ? -54.923 35.009 373.680 1.00 62.22  ? 460  ASP B C   1 
ATOM   7626 O O   . ASP B 1 459 ? -55.456 34.302 372.814 1.00 51.75  ? 460  ASP B O   1 
ATOM   7627 C CB  . ASP B 1 459 ? -55.547 37.244 372.724 1.00 51.51  ? 460  ASP B CB  1 
ATOM   7628 C CG  . ASP B 1 459 ? -56.567 37.678 373.765 1.00 64.55  ? 460  ASP B CG  1 
ATOM   7629 O OD1 . ASP B 1 459 ? -56.683 37.024 374.823 1.00 60.04  ? 460  ASP B OD1 1 
ATOM   7630 O OD2 . ASP B 1 459 ? -57.266 38.682 373.513 1.00 63.58  ? 460  ASP B OD2 1 
ATOM   7631 N N   . PRO B 1 460 ? -54.781 34.581 374.937 1.00 68.88  ? 461  PRO B N   1 
ATOM   7632 C CA  . PRO B 1 460 ? -55.236 33.230 375.307 1.00 71.13  ? 461  PRO B CA  1 
ATOM   7633 C C   . PRO B 1 460 ? -56.740 33.063 375.229 1.00 68.46  ? 461  PRO B C   1 
ATOM   7634 O O   . PRO B 1 460 ? -57.216 31.927 375.081 1.00 74.21  ? 461  PRO B O   1 
ATOM   7635 C CB  . PRO B 1 460 ? -54.723 33.068 376.743 1.00 69.84  ? 461  PRO B CB  1 
ATOM   7636 C CG  . PRO B 1 460 ? -54.655 34.474 377.265 1.00 78.62  ? 461  PRO B CG  1 
ATOM   7637 C CD  . PRO B 1 460 ? -54.239 35.319 376.092 1.00 55.47  ? 461  PRO B CD  1 
ATOM   7638 N N   . SER B 1 461 ? -57.502 34.148 375.310 1.00 59.03  ? 462  SER B N   1 
ATOM   7639 C CA  . SER B 1 461 ? -58.953 34.129 375.193 1.00 51.21  ? 462  SER B CA  1 
ATOM   7640 C C   . SER B 1 461 ? -59.446 33.801 373.780 1.00 69.10  ? 462  SER B C   1 
ATOM   7641 O O   . SER B 1 461 ? -60.657 33.865 373.532 1.00 72.05  ? 462  SER B O   1 
ATOM   7642 C CB  . SER B 1 461 ? -59.511 35.487 375.640 1.00 49.63  ? 462  SER B CB  1 
ATOM   7643 O OG  . SER B 1 461 ? -60.666 35.827 374.898 1.00 80.95  ? 462  SER B OG  1 
ATOM   7644 N N   . ARG B 1 462 ? -58.549 33.502 372.843 1.00 60.45  ? 463  ARG B N   1 
ATOM   7645 C CA  . ARG B 1 462 ? -58.909 33.188 371.466 1.00 67.05  ? 463  ARG B CA  1 
ATOM   7646 C C   . ARG B 1 462 ? -58.393 31.795 371.107 1.00 70.80  ? 463  ARG B C   1 
ATOM   7647 O O   . ARG B 1 462 ? -57.586 31.206 371.831 1.00 79.48  ? 463  ARG B O   1 
ATOM   7648 C CB  . ARG B 1 462 ? -58.359 34.254 370.506 1.00 52.58  ? 463  ARG B CB  1 
ATOM   7649 C CG  . ARG B 1 462 ? -58.588 35.671 371.021 1.00 53.75  ? 463  ARG B CG  1 
ATOM   7650 C CD  . ARG B 1 462 ? -58.947 36.634 369.905 1.00 56.73  ? 463  ARG B CD  1 
ATOM   7651 N NE  . ARG B 1 462 ? -59.111 37.999 370.395 1.00 68.68  ? 463  ARG B NE  1 
ATOM   7652 C CZ  . ARG B 1 462 ? -59.872 38.918 369.808 1.00 64.12  ? 463  ARG B CZ  1 
ATOM   7653 N NH1 . ARG B 1 462 ? -60.539 38.621 368.700 1.00 71.12  ? 463  ARG B NH1 1 
ATOM   7654 N NH2 . ARG B 1 462 ? -59.966 40.134 370.327 1.00 65.65  ? 463  ARG B NH2 1 
ATOM   7655 N N   . ASN B 1 463 ? -58.867 31.252 369.980 1.00 64.14  ? 464  ASN B N   1 
ATOM   7656 C CA  . ASN B 1 463 ? -58.657 29.843 369.666 1.00 69.44  ? 464  ASN B CA  1 
ATOM   7657 C C   . ASN B 1 463 ? -57.658 29.639 368.526 1.00 58.56  ? 464  ASN B C   1 
ATOM   7658 O O   . ASN B 1 463 ? -57.822 28.731 367.708 1.00 75.77  ? 464  ASN B O   1 
ATOM   7659 C CB  . ASN B 1 463 ? -59.991 29.165 369.336 1.00 70.76  ? 464  ASN B CB  1 
ATOM   7660 C CG  . ASN B 1 463 ? -61.123 29.614 370.255 1.00 88.41  ? 464  ASN B CG  1 
ATOM   7661 O OD1 . ASN B 1 463 ? -60.949 29.751 371.467 1.00 90.81  ? 464  ASN B OD1 1 
ATOM   7662 N ND2 . ASN B 1 463 ? -62.294 29.843 369.663 1.00 110.57 ? 464  ASN B ND2 1 
ATOM   7663 N N   . TYR B 1 464 ? -56.617 30.465 368.459 1.00 54.42  ? 465  TYR B N   1 
ATOM   7664 C CA  . TYR B 1 464 ? -55.561 30.225 367.486 1.00 57.39  ? 465  TYR B CA  1 
ATOM   7665 C C   . TYR B 1 464 ? -54.717 29.024 367.910 1.00 54.33  ? 465  TYR B C   1 
ATOM   7666 O O   . TYR B 1 464 ? -54.654 28.658 369.086 1.00 64.83  ? 465  TYR B O   1 
ATOM   7667 C CB  . TYR B 1 464 ? -54.676 31.464 367.326 1.00 50.46  ? 465  TYR B CB  1 
ATOM   7668 C CG  . TYR B 1 464 ? -55.370 32.652 366.689 1.00 45.81  ? 465  TYR B CG  1 
ATOM   7669 C CD1 . TYR B 1 464 ? -56.079 33.562 367.462 1.00 40.19  ? 465  TYR B CD1 1 
ATOM   7670 C CD2 . TYR B 1 464 ? -55.312 32.866 365.315 1.00 45.89  ? 465  TYR B CD2 1 
ATOM   7671 C CE1 . TYR B 1 464 ? -56.711 34.652 366.888 1.00 39.74  ? 465  TYR B CE1 1 
ATOM   7672 C CE2 . TYR B 1 464 ? -55.943 33.952 364.731 1.00 40.33  ? 465  TYR B CE2 1 
ATOM   7673 C CZ  . TYR B 1 464 ? -56.640 34.841 365.520 1.00 54.13  ? 465  TYR B CZ  1 
ATOM   7674 O OH  . TYR B 1 464 ? -57.266 35.919 364.937 1.00 44.66  ? 465  TYR B OH  1 
ATOM   7675 N N   . THR B 1 465 ? -54.063 28.405 366.931 1.00 58.49  ? 466  THR B N   1 
ATOM   7676 C CA  . THR B 1 465 ? -53.252 27.231 367.209 1.00 55.51  ? 466  THR B CA  1 
ATOM   7677 C C   . THR B 1 465 ? -51.890 27.633 367.772 1.00 59.10  ? 466  THR B C   1 
ATOM   7678 O O   . THR B 1 465 ? -51.505 28.805 367.774 1.00 63.71  ? 466  THR B O   1 
ATOM   7679 C CB  . THR B 1 465 ? -53.064 26.391 365.947 1.00 56.52  ? 466  THR B CB  1 
ATOM   7680 O OG1 . THR B 1 465 ? -52.196 27.080 365.037 1.00 61.20  ? 466  THR B OG1 1 
ATOM   7681 C CG2 . THR B 1 465 ? -54.405 26.138 365.275 1.00 46.50  ? 466  THR B CG2 1 
ATOM   7682 N N   . ALA B 1 466 ? -51.153 26.630 368.256 1.00 58.28  ? 467  ALA B N   1 
ATOM   7683 C CA  . ALA B 1 466 ? -49.810 26.883 368.766 1.00 56.36  ? 467  ALA B CA  1 
ATOM   7684 C C   . ALA B 1 466 ? -48.871 27.331 367.651 1.00 50.94  ? 467  ALA B C   1 
ATOM   7685 O O   . ALA B 1 466 ? -48.018 28.201 367.862 1.00 55.99  ? 467  ALA B O   1 
ATOM   7686 C CB  . ALA B 1 466 ? -49.270 25.635 369.463 1.00 43.81  ? 467  ALA B CB  1 
ATOM   7687 N N   . GLU B 1 467 ? -49.014 26.752 366.456 1.00 52.20  ? 468  GLU B N   1 
ATOM   7688 C CA  . GLU B 1 467 ? -48.185 27.170 365.330 1.00 64.86  ? 468  GLU B CA  1 
ATOM   7689 C C   . GLU B 1 467 ? -48.564 28.562 364.841 1.00 52.42  ? 468  GLU B C   1 
ATOM   7690 O O   . GLU B 1 467 ? -47.699 29.305 364.362 1.00 45.36  ? 468  GLU B O   1 
ATOM   7691 C CB  . GLU B 1 467 ? -48.295 26.159 364.187 1.00 52.25  ? 468  GLU B CB  1 
ATOM   7692 C CG  . GLU B 1 467 ? -48.356 24.712 364.645 1.00 73.65  ? 468  GLU B CG  1 
ATOM   7693 C CD  . GLU B 1 467 ? -49.779 24.199 364.760 1.00 96.24  ? 468  GLU B CD  1 
ATOM   7694 O OE1 . GLU B 1 467 ? -50.180 23.794 365.872 1.00 105.88 ? 468  GLU B OE1 1 
ATOM   7695 O OE2 . GLU B 1 467 ? -50.496 24.203 363.735 1.00 104.74 ? 468  GLU B OE2 1 
ATOM   7696 N N   . GLU B 1 468 ? -49.842 28.933 364.953 1.00 45.51  ? 469  GLU B N   1 
ATOM   7697 C CA  . GLU B 1 468 ? -50.253 30.284 364.588 1.00 46.43  ? 469  GLU B CA  1 
ATOM   7698 C C   . GLU B 1 468 ? -49.686 31.323 365.549 1.00 58.09  ? 469  GLU B C   1 
ATOM   7699 O O   . GLU B 1 468 ? -49.344 32.433 365.124 1.00 47.16  ? 469  GLU B O   1 
ATOM   7700 C CB  . GLU B 1 468 ? -51.778 30.370 364.543 1.00 35.29  ? 469  GLU B CB  1 
ATOM   7701 C CG  . GLU B 1 468 ? -52.377 29.820 363.258 1.00 50.30  ? 469  GLU B CG  1 
ATOM   7702 C CD  . GLU B 1 468 ? -53.890 29.864 363.254 1.00 60.27  ? 469  GLU B CD  1 
ATOM   7703 O OE1 . GLU B 1 468 ? -54.490 29.713 364.338 1.00 54.43  ? 469  GLU B OE1 1 
ATOM   7704 O OE2 . GLU B 1 468 ? -54.478 30.046 362.167 1.00 53.15  ? 469  GLU B OE2 1 
ATOM   7705 N N   . LYS B 1 469 ? -49.579 30.986 366.839 1.00 49.29  ? 470  LYS B N   1 
ATOM   7706 C CA  . LYS B 1 469 ? -48.924 31.882 367.789 1.00 48.04  ? 470  LYS B CA  1 
ATOM   7707 C C   . LYS B 1 469 ? -47.456 32.071 367.435 1.00 49.17  ? 470  LYS B C   1 
ATOM   7708 O O   . LYS B 1 469 ? -46.943 33.197 367.457 1.00 54.01  ? 470  LYS B O   1 
ATOM   7709 C CB  . LYS B 1 469 ? -49.061 31.333 369.210 1.00 52.15  ? 470  LYS B CB  1 
ATOM   7710 C CG  . LYS B 1 469 ? -50.485 31.278 369.741 1.00 47.38  ? 470  LYS B CG  1 
ATOM   7711 C CD  . LYS B 1 469 ? -50.496 31.227 371.260 1.00 64.68  ? 470  LYS B CD  1 
ATOM   7712 C CE  . LYS B 1 469 ? -51.913 31.134 371.805 1.00 69.11  ? 470  LYS B CE  1 
ATOM   7713 N NZ  . LYS B 1 469 ? -52.259 29.757 372.251 1.00 70.54  ? 470  LYS B NZ  1 
ATOM   7714 N N   . ILE B 1 470 ? -46.761 30.976 367.116 1.00 44.53  ? 471  ILE B N   1 
ATOM   7715 C CA  . ILE B 1 470 ? -45.371 31.071 366.680 1.00 51.71  ? 471  ILE B CA  1 
ATOM   7716 C C   . ILE B 1 470 ? -45.271 31.896 365.403 1.00 51.05  ? 471  ILE B C   1 
ATOM   7717 O O   . ILE B 1 470 ? -44.365 32.726 365.248 1.00 48.79  ? 471  ILE B O   1 
ATOM   7718 C CB  . ILE B 1 470 ? -44.781 29.661 366.492 1.00 59.78  ? 471  ILE B CB  1 
ATOM   7719 C CG1 . ILE B 1 470 ? -44.719 28.924 367.831 1.00 58.98  ? 471  ILE B CG1 1 
ATOM   7720 C CG2 . ILE B 1 470 ? -43.404 29.726 365.845 1.00 54.21  ? 471  ILE B CG2 1 
ATOM   7721 C CD1 . ILE B 1 470 ? -44.492 27.436 367.687 1.00 58.97  ? 471  ILE B CD1 1 
ATOM   7722 N N   . PHE B 1 471 ? -46.205 31.684 364.474 1.00 43.07  ? 472  PHE B N   1 
ATOM   7723 C CA  . PHE B 1 471 ? -46.228 32.457 363.236 1.00 47.15  ? 472  PHE B CA  1 
ATOM   7724 C C   . PHE B 1 471 ? -46.396 33.946 363.520 1.00 48.09  ? 472  PHE B C   1 
ATOM   7725 O O   . PHE B 1 471 ? -45.687 34.780 362.944 1.00 38.50  ? 472  PHE B O   1 
ATOM   7726 C CB  . PHE B 1 471 ? -47.352 31.932 362.339 1.00 40.49  ? 472  PHE B CB  1 
ATOM   7727 C CG  . PHE B 1 471 ? -47.498 32.662 361.035 1.00 40.16  ? 472  PHE B CG  1 
ATOM   7728 C CD1 . PHE B 1 471 ? -46.411 32.843 360.194 1.00 47.71  ? 472  PHE B CD1 1 
ATOM   7729 C CD2 . PHE B 1 471 ? -48.737 33.139 360.634 1.00 41.24  ? 472  PHE B CD2 1 
ATOM   7730 C CE1 . PHE B 1 471 ? -46.555 33.505 358.985 1.00 45.24  ? 472  PHE B CE1 1 
ATOM   7731 C CE2 . PHE B 1 471 ? -48.888 33.801 359.426 1.00 43.29  ? 472  PHE B CE2 1 
ATOM   7732 C CZ  . PHE B 1 471 ? -47.796 33.983 358.600 1.00 38.09  ? 472  PHE B CZ  1 
ATOM   7733 N N   . ALA B 1 472 ? -47.317 34.295 364.422 1.00 36.13  ? 473  ALA B N   1 
ATOM   7734 C CA  . ALA B 1 472 ? -47.520 35.698 364.771 1.00 44.91  ? 473  ALA B CA  1 
ATOM   7735 C C   . ALA B 1 472 ? -46.261 36.309 365.376 1.00 47.05  ? 473  ALA B C   1 
ATOM   7736 O O   . ALA B 1 472 ? -45.923 37.462 365.087 1.00 47.09  ? 473  ALA B O   1 
ATOM   7737 C CB  . ALA B 1 472 ? -48.697 35.834 365.736 1.00 37.45  ? 473  ALA B CB  1 
ATOM   7738 N N   . GLN B 1 473 ? -45.551 35.549 366.213 1.00 41.53  ? 474  GLN B N   1 
ATOM   7739 C CA  . GLN B 1 473 ? -44.322 36.063 366.809 1.00 43.38  ? 474  GLN B CA  1 
ATOM   7740 C C   . GLN B 1 473 ? -43.252 36.291 365.752 1.00 42.82  ? 474  GLN B C   1 
ATOM   7741 O O   . GLN B 1 473 ? -42.474 37.249 365.842 1.00 42.52  ? 474  GLN B O   1 
ATOM   7742 C CB  . GLN B 1 473 ? -43.819 35.107 367.889 1.00 39.43  ? 474  GLN B CB  1 
ATOM   7743 C CG  . GLN B 1 473 ? -44.717 35.043 369.107 1.00 46.17  ? 474  GLN B CG  1 
ATOM   7744 C CD  . GLN B 1 473 ? -44.262 34.007 370.111 1.00 52.65  ? 474  GLN B CD  1 
ATOM   7745 O OE1 . GLN B 1 473 ? -43.895 32.888 369.747 1.00 52.16  ? 474  GLN B OE1 1 
ATOM   7746 N NE2 . GLN B 1 473 ? -44.273 34.377 371.384 1.00 54.37  ? 474  GLN B NE2 1 
ATOM   7747 N N   . ARG B 1 474 ? -43.197 35.421 364.742 1.00 40.09  ? 475  ARG B N   1 
ATOM   7748 C CA  . ARG B 1 474 ? -42.243 35.613 363.656 1.00 42.56  ? 475  ARG B CA  1 
ATOM   7749 C C   . ARG B 1 474 ? -42.589 36.837 362.814 1.00 43.68  ? 475  ARG B C   1 
ATOM   7750 O O   . ARG B 1 474 ? -41.685 37.538 362.343 1.00 38.72  ? 475  ARG B O   1 
ATOM   7751 C CB  . ARG B 1 474 ? -42.183 34.355 362.788 1.00 43.64  ? 475  ARG B CB  1 
ATOM   7752 C CG  . ARG B 1 474 ? -41.130 34.401 361.693 1.00 68.81  ? 475  ARG B CG  1 
ATOM   7753 C CD  . ARG B 1 474 ? -40.778 33.006 361.193 1.00 55.66  ? 475  ARG B CD  1 
ATOM   7754 N NE  . ARG B 1 474 ? -41.945 32.304 360.666 1.00 50.74  ? 475  ARG B NE  1 
ATOM   7755 C CZ  . ARG B 1 474 ? -42.296 32.285 359.383 1.00 54.82  ? 475  ARG B CZ  1 
ATOM   7756 N NH1 . ARG B 1 474 ? -41.571 32.929 358.475 1.00 39.71  ? 475  ARG B NH1 1 
ATOM   7757 N NH2 . ARG B 1 474 ? -43.378 31.617 359.008 1.00 42.60  ? 475  ARG B NH2 1 
ATOM   7758 N N   . LEU B 1 475 ? -43.883 37.118 362.627 1.00 37.61  ? 476  LEU B N   1 
ATOM   7759 C CA  . LEU B 1 475 ? -44.281 38.286 361.847 1.00 43.12  ? 476  LEU B CA  1 
ATOM   7760 C C   . LEU B 1 475 ? -44.006 39.579 362.605 1.00 44.57  ? 476  LEU B C   1 
ATOM   7761 O O   . LEU B 1 475 ? -43.543 40.563 362.018 1.00 38.05  ? 476  LEU B O   1 
ATOM   7762 C CB  . LEU B 1 475 ? -45.759 38.200 361.473 1.00 37.89  ? 476  LEU B CB  1 
ATOM   7763 C CG  . LEU B 1 475 ? -46.126 37.117 360.458 1.00 55.55  ? 476  LEU B CG  1 
ATOM   7764 C CD1 . LEU B 1 475 ? -47.628 37.048 360.303 1.00 64.63  ? 476  LEU B CD1 1 
ATOM   7765 C CD2 . LEU B 1 475 ? -45.457 37.369 359.113 1.00 51.57  ? 476  LEU B CD2 1 
ATOM   7766 N N   . MET B 1 476 ? -44.301 39.600 363.908 1.00 46.97  ? 477  MET B N   1 
ATOM   7767 C CA  . MET B 1 476 ? -43.971 40.765 364.723 1.00 30.78  ? 477  MET B CA  1 
ATOM   7768 C C   . MET B 1 476 ? -42.474 41.030 364.724 1.00 38.31  ? 477  MET B C   1 
ATOM   7769 O O   . MET B 1 476 ? -42.045 42.190 364.748 1.00 37.60  ? 477  MET B O   1 
ATOM   7770 C CB  . MET B 1 476 ? -44.473 40.566 366.155 1.00 46.47  ? 477  MET B CB  1 
ATOM   7771 C CG  . MET B 1 476 ? -45.984 40.509 366.287 1.00 45.48  ? 477  MET B CG  1 
ATOM   7772 S SD  . MET B 1 476 ? -46.529 40.575 368.007 1.00 51.11  ? 477  MET B SD  1 
ATOM   7773 C CE  . MET B 1 476 ? -45.787 39.073 368.644 1.00 48.46  ? 477  MET B CE  1 
ATOM   7774 N N   . ARG B 1 477 ? -41.666 39.971 364.692 1.00 37.49  ? 478  ARG B N   1 
ATOM   7775 C CA  . ARG B 1 477 ? -40.221 40.146 364.640 1.00 41.06  ? 478  ARG B CA  1 
ATOM   7776 C C   . ARG B 1 477 ? -39.784 40.768 363.316 1.00 42.39  ? 478  ARG B C   1 
ATOM   7777 O O   . ARG B 1 477 ? -38.950 41.682 363.304 1.00 40.98  ? 478  ARG B O   1 
ATOM   7778 C CB  . ARG B 1 477 ? -39.530 38.804 364.868 1.00 43.68  ? 478  ARG B CB  1 
ATOM   7779 C CG  . ARG B 1 477 ? -38.021 38.874 364.816 1.00 39.26  ? 478  ARG B CG  1 
ATOM   7780 C CD  . ARG B 1 477 ? -37.460 39.796 365.892 1.00 45.74  ? 478  ARG B CD  1 
ATOM   7781 N NE  . ARG B 1 477 ? -37.845 39.360 367.231 1.00 62.10  ? 478  ARG B NE  1 
ATOM   7782 C CZ  . ARG B 1 477 ? -37.179 38.460 367.947 1.00 60.02  ? 478  ARG B CZ  1 
ATOM   7783 N NH1 . ARG B 1 477 ? -36.087 37.887 367.456 1.00 53.61  ? 478  ARG B NH1 1 
ATOM   7784 N NH2 . ARG B 1 477 ? -37.609 38.127 369.155 1.00 50.16  ? 478  ARG B NH2 1 
ATOM   7785 N N   . TYR B 1 478 ? -40.331 40.287 362.193 1.00 34.17  ? 479  TYR B N   1 
ATOM   7786 C CA  . TYR B 1 478 ? -40.036 40.893 360.894 1.00 32.04  ? 479  TYR B CA  1 
ATOM   7787 C C   . TYR B 1 478 ? -40.347 42.386 360.906 1.00 39.08  ? 479  TYR B C   1 
ATOM   7788 O O   . TYR B 1 478 ? -39.496 43.218 360.569 1.00 33.88  ? 479  TYR B O   1 
ATOM   7789 C CB  . TYR B 1 478 ? -40.843 40.206 359.786 1.00 39.39  ? 479  TYR B CB  1 
ATOM   7790 C CG  . TYR B 1 478 ? -40.402 38.803 359.414 1.00 38.92  ? 479  TYR B CG  1 
ATOM   7791 C CD1 . TYR B 1 478 ? -39.058 38.455 359.368 1.00 37.09  ? 479  TYR B CD1 1 
ATOM   7792 C CD2 . TYR B 1 478 ? -41.342 37.825 359.104 1.00 35.31  ? 479  TYR B CD2 1 
ATOM   7793 C CE1 . TYR B 1 478 ? -38.663 37.165 359.022 1.00 32.78  ? 479  TYR B CE1 1 
ATOM   7794 C CE2 . TYR B 1 478 ? -40.960 36.542 358.761 1.00 34.22  ? 479  TYR B CE2 1 
ATOM   7795 C CZ  . TYR B 1 478 ? -39.622 36.214 358.722 1.00 47.36  ? 479  TYR B CZ  1 
ATOM   7796 O OH  . TYR B 1 478 ? -39.250 34.932 358.381 1.00 48.62  ? 479  TYR B OH  1 
ATOM   7797 N N   . TRP B 1 479 ? -41.572 42.739 361.305 1.00 34.16  ? 480  TRP B N   1 
ATOM   7798 C CA  . TRP B 1 479 ? -41.997 44.134 361.292 1.00 35.66  ? 480  TRP B CA  1 
ATOM   7799 C C   . TRP B 1 479 ? -41.146 44.990 362.225 1.00 42.67  ? 480  TRP B C   1 
ATOM   7800 O O   . TRP B 1 479 ? -40.769 46.114 361.875 1.00 42.37  ? 480  TRP B O   1 
ATOM   7801 C CB  . TRP B 1 479 ? -43.473 44.226 361.680 1.00 35.60  ? 480  TRP B CB  1 
ATOM   7802 C CG  . TRP B 1 479 ? -44.408 44.364 360.515 1.00 39.93  ? 480  TRP B CG  1 
ATOM   7803 C CD1 . TRP B 1 479 ? -45.256 45.403 360.269 1.00 37.10  ? 480  TRP B CD1 1 
ATOM   7804 C CD2 . TRP B 1 479 ? -44.594 43.431 359.439 1.00 35.21  ? 480  TRP B CD2 1 
ATOM   7805 N NE1 . TRP B 1 479 ? -45.957 45.178 359.107 1.00 37.45  ? 480  TRP B NE1 1 
ATOM   7806 C CE2 . TRP B 1 479 ? -45.570 43.974 358.579 1.00 39.01  ? 480  TRP B CE2 1 
ATOM   7807 C CE3 . TRP B 1 479 ? -44.030 42.191 359.119 1.00 34.61  ? 480  TRP B CE3 1 
ATOM   7808 C CZ2 . TRP B 1 479 ? -45.995 43.322 357.421 1.00 37.33  ? 480  TRP B CZ2 1 
ATOM   7809 C CZ3 . TRP B 1 479 ? -44.454 41.543 357.969 1.00 37.30  ? 480  TRP B CZ3 1 
ATOM   7810 C CH2 . TRP B 1 479 ? -45.428 42.111 357.135 1.00 38.06  ? 480  TRP B CH2 1 
ATOM   7811 N N   . ALA B 1 480 ? -40.833 44.477 363.418 1.00 33.84  ? 481  ALA B N   1 
ATOM   7812 C CA  . ALA B 1 480 ? -40.048 45.260 364.367 1.00 33.85  ? 481  ALA B CA  1 
ATOM   7813 C C   . ALA B 1 480 ? -38.592 45.369 363.929 1.00 44.39  ? 481  ALA B C   1 
ATOM   7814 O O   . ALA B 1 480 ? -37.963 46.418 364.115 1.00 39.33  ? 481  ALA B O   1 
ATOM   7815 C CB  . ALA B 1 480 ? -40.146 44.652 365.763 1.00 32.50  ? 481  ALA B CB  1 
ATOM   7816 N N   . ASN B 1 481 ? -38.035 44.295 363.358 1.00 29.39  ? 482  ASN B N   1 
ATOM   7817 C CA  . ASN B 1 481 ? -36.700 44.387 362.773 1.00 45.46  ? 482  ASN B CA  1 
ATOM   7818 C C   . ASN B 1 481 ? -36.639 45.490 361.726 1.00 45.07  ? 482  ASN B C   1 
ATOM   7819 O O   . ASN B 1 481 ? -35.699 46.295 361.715 1.00 35.58  ? 482  ASN B O   1 
ATOM   7820 C CB  . ASN B 1 481 ? -36.298 43.048 362.154 1.00 41.72  ? 482  ASN B CB  1 
ATOM   7821 C CG  . ASN B 1 481 ? -35.812 42.050 363.186 1.00 44.85  ? 482  ASN B CG  1 
ATOM   7822 O OD1 . ASN B 1 481 ? -35.770 42.346 364.379 1.00 44.52  ? 482  ASN B OD1 1 
ATOM   7823 N ND2 . ASN B 1 481 ? -35.455 40.854 362.732 1.00 43.57  ? 482  ASN B ND2 1 
ATOM   7824 N N   . PHE B 1 482 ? -37.644 45.551 360.847 1.00 39.09  ? 483  PHE B N   1 
ATOM   7825 C CA  . PHE B 1 482 ? -37.676 46.589 359.822 1.00 36.34  ? 483  PHE B CA  1 
ATOM   7826 C C   . PHE B 1 482 ? -37.778 47.973 360.447 1.00 36.27  ? 483  PHE B C   1 
ATOM   7827 O O   . PHE B 1 482 ? -37.126 48.918 359.990 1.00 39.25  ? 483  PHE B O   1 
ATOM   7828 C CB  . PHE B 1 482 ? -38.843 46.342 358.862 1.00 35.92  ? 483  PHE B CB  1 
ATOM   7829 C CG  . PHE B 1 482 ? -39.021 47.423 357.833 1.00 34.23  ? 483  PHE B CG  1 
ATOM   7830 C CD1 . PHE B 1 482 ? -38.236 47.450 356.692 1.00 33.51  ? 483  PHE B CD1 1 
ATOM   7831 C CD2 . PHE B 1 482 ? -39.973 48.414 358.008 1.00 35.30  ? 483  PHE B CD2 1 
ATOM   7832 C CE1 . PHE B 1 482 ? -38.399 48.442 355.747 1.00 31.56  ? 483  PHE B CE1 1 
ATOM   7833 C CE2 . PHE B 1 482 ? -40.136 49.411 357.068 1.00 37.71  ? 483  PHE B CE2 1 
ATOM   7834 C CZ  . PHE B 1 482 ? -39.348 49.423 355.935 1.00 38.41  ? 483  PHE B CZ  1 
ATOM   7835 N N   . ALA B 1 483 ? -38.592 48.111 361.495 1.00 37.69  ? 484  ALA B N   1 
ATOM   7836 C CA  . ALA B 1 483 ? -38.711 49.395 362.176 1.00 43.40  ? 484  ALA B CA  1 
ATOM   7837 C C   . ALA B 1 483 ? -37.393 49.824 362.811 1.00 48.36  ? 484  ALA B C   1 
ATOM   7838 O O   . ALA B 1 483 ? -37.085 51.020 362.853 1.00 43.56  ? 484  ALA B O   1 
ATOM   7839 C CB  . ALA B 1 483 ? -39.812 49.323 363.235 1.00 32.16  ? 484  ALA B CB  1 
ATOM   7840 N N   . ARG B 1 484 ? -36.599 48.867 363.299 1.00 42.70  ? 485  ARG B N   1 
ATOM   7841 C CA  . ARG B 1 484 ? -35.360 49.204 363.992 1.00 42.41  ? 485  ARG B CA  1 
ATOM   7842 C C   . ARG B 1 484 ? -34.216 49.483 363.023 1.00 44.46  ? 485  ARG B C   1 
ATOM   7843 O O   . ARG B 1 484 ? -33.415 50.394 363.257 1.00 51.63  ? 485  ARG B O   1 
ATOM   7844 C CB  . ARG B 1 484 ? -34.973 48.076 364.951 1.00 36.43  ? 485  ARG B CB  1 
ATOM   7845 C CG  . ARG B 1 484 ? -35.827 48.013 366.214 1.00 41.00  ? 485  ARG B CG  1 
ATOM   7846 C CD  . ARG B 1 484 ? -35.321 46.948 367.178 1.00 35.01  ? 485  ARG B CD  1 
ATOM   7847 N NE  . ARG B 1 484 ? -35.580 45.598 366.687 1.00 47.19  ? 485  ARG B NE  1 
ATOM   7848 C CZ  . ARG B 1 484 ? -36.594 44.836 367.087 1.00 48.13  ? 485  ARG B CZ  1 
ATOM   7849 N NH1 . ARG B 1 484 ? -37.451 45.288 367.993 1.00 43.82  ? 485  ARG B NH1 1 
ATOM   7850 N NH2 . ARG B 1 484 ? -36.750 43.618 366.582 1.00 40.75  ? 485  ARG B NH2 1 
ATOM   7851 N N   . THR B 1 485 ? -34.117 48.716 361.933 1.00 40.27  ? 486  THR B N   1 
ATOM   7852 C CA  . THR B 1 485 ? -32.951 48.775 361.060 1.00 40.39  ? 486  THR B CA  1 
ATOM   7853 C C   . THR B 1 485 ? -33.263 49.007 359.590 1.00 44.95  ? 486  THR B C   1 
ATOM   7854 O O   . THR B 1 485 ? -32.323 49.185 358.808 1.00 55.20  ? 486  THR B O   1 
ATOM   7855 C CB  . THR B 1 485 ? -32.135 47.477 361.160 1.00 42.08  ? 486  THR B CB  1 
ATOM   7856 O OG1 . THR B 1 485 ? -32.916 46.389 360.650 1.00 45.68  ? 486  THR B OG1 1 
ATOM   7857 C CG2 . THR B 1 485 ? -31.742 47.187 362.604 1.00 38.82  ? 486  THR B CG2 1 
ATOM   7858 N N   . GLY B 1 486 ? -34.528 48.999 359.184 1.00 41.81  ? 487  GLY B N   1 
ATOM   7859 C CA  . GLY B 1 486 ? -34.845 49.019 357.772 1.00 34.54  ? 487  GLY B CA  1 
ATOM   7860 C C   . GLY B 1 486 ? -34.667 47.692 357.073 1.00 40.41  ? 487  GLY B C   1 
ATOM   7861 O O   . GLY B 1 486 ? -34.744 47.642 355.840 1.00 39.42  ? 487  GLY B O   1 
ATOM   7862 N N   . ASP B 1 487 ? -34.434 46.618 357.821 1.00 47.32  ? 488  ASP B N   1 
ATOM   7863 C CA  . ASP B 1 487 ? -34.216 45.279 357.292 1.00 44.04  ? 488  ASP B CA  1 
ATOM   7864 C C   . ASP B 1 487 ? -34.999 44.283 358.141 1.00 44.58  ? 488  ASP B C   1 
ATOM   7865 O O   . ASP B 1 487 ? -34.750 44.169 359.348 1.00 47.10  ? 488  ASP B O   1 
ATOM   7866 C CB  . ASP B 1 487 ? -32.722 44.944 357.292 1.00 46.56  ? 488  ASP B CB  1 
ATOM   7867 C CG  . ASP B 1 487 ? -32.387 43.719 356.457 1.00 49.13  ? 488  ASP B CG  1 
ATOM   7868 O OD1 . ASP B 1 487 ? -31.264 43.665 355.912 1.00 54.55  ? 488  ASP B OD1 1 
ATOM   7869 O OD2 . ASP B 1 487 ? -33.235 42.808 356.349 1.00 51.04  ? 488  ASP B OD2 1 
ATOM   7870 N N   . PRO B 1 488 ? -35.952 43.552 357.557 1.00 39.81  ? 489  PRO B N   1 
ATOM   7871 C CA  . PRO B 1 488 ? -36.730 42.584 358.349 1.00 41.69  ? 489  PRO B CA  1 
ATOM   7872 C C   . PRO B 1 488 ? -35.946 41.345 358.755 1.00 43.31  ? 489  PRO B C   1 
ATOM   7873 O O   . PRO B 1 488 ? -36.400 40.614 359.644 1.00 44.99  ? 489  PRO B O   1 
ATOM   7874 C CB  . PRO B 1 488 ? -37.889 42.219 357.412 1.00 36.47  ? 489  PRO B CB  1 
ATOM   7875 C CG  . PRO B 1 488 ? -37.321 42.427 356.031 1.00 39.36  ? 489  PRO B CG  1 
ATOM   7876 C CD  . PRO B 1 488 ? -36.396 43.612 356.151 1.00 38.13  ? 489  PRO B CD  1 
ATOM   7877 N N   . ASN B 1 489 ? -34.790 41.094 358.149 1.00 42.09  ? 490  ASN B N   1 
ATOM   7878 C CA  . ASN B 1 489 ? -34.062 39.859 358.400 1.00 44.43  ? 490  ASN B CA  1 
ATOM   7879 C C   . ASN B 1 489 ? -33.435 39.860 359.788 1.00 53.17  ? 490  ASN B C   1 
ATOM   7880 O O   . ASN B 1 489 ? -33.042 40.902 360.321 1.00 48.35  ? 490  ASN B O   1 
ATOM   7881 C CB  . ASN B 1 489 ? -32.981 39.660 357.343 1.00 47.40  ? 490  ASN B CB  1 
ATOM   7882 C CG  . ASN B 1 489 ? -33.560 39.356 355.983 1.00 43.14  ? 490  ASN B CG  1 
ATOM   7883 O OD1 . ASN B 1 489 ? -33.998 38.237 355.722 1.00 45.66  ? 490  ASN B OD1 1 
ATOM   7884 N ND2 . ASN B 1 489 ? -33.573 40.354 355.107 1.00 42.18  ? 490  ASN B ND2 1 
ATOM   7885 N N   . GLU B 1 490 ? -33.341 38.671 360.373 1.00 60.73  ? 491  GLU B N   1 
ATOM   7886 C CA  . GLU B 1 490 ? -32.742 38.531 361.692 1.00 73.47  ? 491  GLU B CA  1 
ATOM   7887 C C   . GLU B 1 490 ? -31.224 38.514 361.578 1.00 78.32  ? 491  GLU B C   1 
ATOM   7888 O O   . GLU B 1 490 ? -30.673 37.604 360.945 1.00 80.94  ? 491  GLU B O   1 
ATOM   7889 C CB  . GLU B 1 490 ? -33.224 37.264 362.381 1.00 76.30  ? 491  GLU B CB  1 
ATOM   7890 C CG  . GLU B 1 490 ? -33.054 37.304 363.888 1.00 78.70  ? 491  GLU B CG  1 
ATOM   7891 C CD  . GLU B 1 490 ? -34.091 38.176 364.554 1.00 72.31  ? 491  GLU B CD  1 
ATOM   7892 O OE1 . GLU B 1 490 ? -33.741 39.257 365.075 1.00 82.61  ? 491  GLU B OE1 1 
ATOM   7893 O OE2 . GLU B 1 490 ? -35.268 37.773 364.544 1.00 70.21  ? 491  GLU B OE2 1 
ATOM   7894 N N   . PRO B 1 491 ? -30.515 39.477 362.181 1.00 87.66  ? 492  PRO B N   1 
ATOM   7895 C CA  . PRO B 1 491 ? -29.054 39.594 362.120 1.00 92.69  ? 492  PRO B CA  1 
ATOM   7896 C C   . PRO B 1 491 ? -28.341 38.548 362.976 1.00 94.99  ? 492  PRO B C   1 
ATOM   7897 O O   . PRO B 1 491 ? -28.361 37.364 362.638 1.00 92.59  ? 492  PRO B O   1 
ATOM   7898 C CB  . PRO B 1 491 ? -28.793 41.008 362.665 1.00 77.57  ? 492  PRO B CB  1 
ATOM   7899 C CG  . PRO B 1 491 ? -30.145 41.687 362.737 1.00 68.54  ? 492  PRO B CG  1 
ATOM   7900 C CD  . PRO B 1 491 ? -31.118 40.578 362.946 1.00 63.34  ? 492  PRO B CD  1 
ATOM   7901 N N   . ALA B 1 496 ? -31.776 31.329 357.338 1.00 96.73  ? 497  ALA B N   1 
ATOM   7902 C CA  . ALA B 1 496 ? -33.092 31.402 357.968 1.00 92.52  ? 497  ALA B CA  1 
ATOM   7903 C C   . ALA B 1 496 ? -34.220 30.733 357.158 1.00 92.41  ? 497  ALA B C   1 
ATOM   7904 O O   . ALA B 1 496 ? -35.033 30.012 357.738 1.00 93.59  ? 497  ALA B O   1 
ATOM   7905 C CB  . ALA B 1 496 ? -33.448 32.854 358.263 1.00 88.10  ? 497  ALA B CB  1 
ATOM   7906 N N   . PRO B 1 497 ? -34.289 30.949 355.827 1.00 96.62  ? 498  PRO B N   1 
ATOM   7907 C CA  . PRO B 1 497 ? -33.479 31.716 354.869 1.00 95.07  ? 498  PRO B CA  1 
ATOM   7908 C C   . PRO B 1 497 ? -33.782 33.213 354.862 1.00 71.45  ? 498  PRO B C   1 
ATOM   7909 O O   . PRO B 1 497 ? -34.717 33.673 355.517 1.00 68.01  ? 498  PRO B O   1 
ATOM   7910 C CB  . PRO B 1 497 ? -33.848 31.086 353.526 1.00 93.68  ? 498  PRO B CB  1 
ATOM   7911 C CG  . PRO B 1 497 ? -35.254 30.675 353.706 1.00 92.95  ? 498  PRO B CG  1 
ATOM   7912 C CD  . PRO B 1 497 ? -35.372 30.220 355.140 1.00 96.55  ? 498  PRO B CD  1 
ATOM   7913 N N   . GLN B 1 498 ? -32.988 33.959 354.102 1.00 58.40  ? 499  GLN B N   1 
ATOM   7914 C CA  . GLN B 1 498 ? -33.047 35.410 354.128 1.00 53.45  ? 499  GLN B CA  1 
ATOM   7915 C C   . GLN B 1 498 ? -34.189 35.938 353.267 1.00 61.00  ? 499  GLN B C   1 
ATOM   7916 O O   . GLN B 1 498 ? -34.606 35.313 352.287 1.00 55.38  ? 499  GLN B O   1 
ATOM   7917 C CB  . GLN B 1 498 ? -31.721 36.002 353.649 1.00 49.38  ? 499  GLN B CB  1 
ATOM   7918 C CG  . GLN B 1 498 ? -30.578 35.818 354.629 1.00 61.17  ? 499  GLN B CG  1 
ATOM   7919 C CD  . GLN B 1 498 ? -30.804 36.566 355.926 1.00 63.20  ? 499  GLN B CD  1 
ATOM   7920 O OE1 . GLN B 1 498 ? -31.185 35.977 356.938 1.00 67.33  ? 499  GLN B OE1 1 
ATOM   7921 N NE2 . GLN B 1 498 ? -30.574 37.875 355.902 1.00 64.95  ? 499  GLN B NE2 1 
ATOM   7922 N N   . TRP B 1 499 ? -34.688 37.113 353.651 1.00 49.77  ? 500  TRP B N   1 
ATOM   7923 C CA  . TRP B 1 499 ? -35.701 37.825 352.886 1.00 39.52  ? 500  TRP B CA  1 
ATOM   7924 C C   . TRP B 1 499 ? -34.993 38.813 351.966 1.00 39.58  ? 500  TRP B C   1 
ATOM   7925 O O   . TRP B 1 499 ? -34.494 39.842 352.449 1.00 42.97  ? 500  TRP B O   1 
ATOM   7926 C CB  . TRP B 1 499 ? -36.659 38.544 353.830 1.00 40.76  ? 500  TRP B CB  1 
ATOM   7927 C CG  . TRP B 1 499 ? -37.831 39.243 353.200 1.00 46.58  ? 500  TRP B CG  1 
ATOM   7928 C CD1 . TRP B 1 499 ? -37.968 39.629 351.897 1.00 38.69  ? 500  TRP B CD1 1 
ATOM   7929 C CD2 . TRP B 1 499 ? -39.031 39.655 353.867 1.00 36.30  ? 500  TRP B CD2 1 
ATOM   7930 N NE1 . TRP B 1 499 ? -39.179 40.251 351.713 1.00 36.98  ? 500  TRP B NE1 1 
ATOM   7931 C CE2 . TRP B 1 499 ? -39.850 40.281 352.907 1.00 40.56  ? 500  TRP B CE2 1 
ATOM   7932 C CE3 . TRP B 1 499 ? -39.491 39.555 355.184 1.00 37.14  ? 500  TRP B CE3 1 
ATOM   7933 C CZ2 . TRP B 1 499 ? -41.105 40.801 353.221 1.00 33.23  ? 500  TRP B CZ2 1 
ATOM   7934 C CZ3 . TRP B 1 499 ? -40.738 40.073 355.494 1.00 31.52  ? 500  TRP B CZ3 1 
ATOM   7935 C CH2 . TRP B 1 499 ? -41.529 40.687 354.517 1.00 34.17  ? 500  TRP B CH2 1 
ATOM   7936 N N   . PRO B 1 500 ? -34.920 38.557 350.664 1.00 42.66  ? 501  PRO B N   1 
ATOM   7937 C CA  . PRO B 1 500 ? -34.150 39.429 349.771 1.00 38.94  ? 501  PRO B CA  1 
ATOM   7938 C C   . PRO B 1 500 ? -34.941 40.666 349.390 1.00 39.51  ? 501  PRO B C   1 
ATOM   7939 O O   . PRO B 1 500 ? -36.181 40.654 349.408 1.00 41.57  ? 501  PRO B O   1 
ATOM   7940 C CB  . PRO B 1 500 ? -33.896 38.535 348.550 1.00 44.61  ? 501  PRO B CB  1 
ATOM   7941 C CG  . PRO B 1 500 ? -35.098 37.644 348.513 1.00 49.03  ? 501  PRO B CG  1 
ATOM   7942 C CD  . PRO B 1 500 ? -35.482 37.394 349.953 1.00 42.75  ? 501  PRO B CD  1 
ATOM   7943 N N   . PRO B 1 501 ? -34.259 41.754 349.038 1.00 40.12  ? 502  PRO B N   1 
ATOM   7944 C CA  . PRO B 1 501 ? -34.967 42.962 348.603 1.00 40.38  ? 502  PRO B CA  1 
ATOM   7945 C C   . PRO B 1 501 ? -35.653 42.769 347.258 1.00 43.28  ? 502  PRO B C   1 
ATOM   7946 O O   . PRO B 1 501 ? -35.231 41.964 346.424 1.00 40.87  ? 502  PRO B O   1 
ATOM   7947 C CB  . PRO B 1 501 ? -33.855 44.015 348.505 1.00 38.27  ? 502  PRO B CB  1 
ATOM   7948 C CG  . PRO B 1 501 ? -32.715 43.462 349.316 1.00 41.40  ? 502  PRO B CG  1 
ATOM   7949 C CD  . PRO B 1 501 ? -32.811 41.976 349.184 1.00 38.93  ? 502  PRO B CD  1 
ATOM   7950 N N   . TYR B 1 502 ? -36.728 43.527 347.058 1.00 42.89  ? 503  TYR B N   1 
ATOM   7951 C CA  . TYR B 1 502 ? -37.452 43.523 345.795 1.00 40.09  ? 503  TYR B CA  1 
ATOM   7952 C C   . TYR B 1 502 ? -36.791 44.491 344.821 1.00 44.37  ? 503  TYR B C   1 
ATOM   7953 O O   . TYR B 1 502 ? -36.498 45.636 345.177 1.00 44.35  ? 503  TYR B O   1 
ATOM   7954 C CB  . TYR B 1 502 ? -38.912 43.912 346.025 1.00 46.14  ? 503  TYR B CB  1 
ATOM   7955 C CG  . TYR B 1 502 ? -39.771 43.947 344.778 1.00 42.19  ? 503  TYR B CG  1 
ATOM   7956 C CD1 . TYR B 1 502 ? -39.839 45.088 343.986 1.00 36.89  ? 503  TYR B CD1 1 
ATOM   7957 C CD2 . TYR B 1 502 ? -40.534 42.848 344.407 1.00 39.74  ? 503  TYR B CD2 1 
ATOM   7958 C CE1 . TYR B 1 502 ? -40.627 45.125 342.853 1.00 41.69  ? 503  TYR B CE1 1 
ATOM   7959 C CE2 . TYR B 1 502 ? -41.328 42.878 343.277 1.00 41.46  ? 503  TYR B CE2 1 
ATOM   7960 C CZ  . TYR B 1 502 ? -41.371 44.018 342.503 1.00 40.89  ? 503  TYR B CZ  1 
ATOM   7961 O OH  . TYR B 1 502 ? -42.159 44.051 341.373 1.00 54.90  ? 503  TYR B OH  1 
ATOM   7962 N N   . THR B 1 503 ? -36.557 44.030 343.594 1.00 41.97  ? 504  THR B N   1 
ATOM   7963 C CA  . THR B 1 503 ? -35.954 44.845 342.548 1.00 47.12  ? 504  THR B CA  1 
ATOM   7964 C C   . THR B 1 503 ? -36.836 44.817 341.306 1.00 50.23  ? 504  THR B C   1 
ATOM   7965 O O   . THR B 1 503 ? -37.663 43.919 341.125 1.00 48.25  ? 504  THR B O   1 
ATOM   7966 C CB  . THR B 1 503 ? -34.535 44.365 342.192 1.00 49.19  ? 504  THR B CB  1 
ATOM   7967 O OG1 . THR B 1 503 ? -34.595 43.038 341.654 1.00 52.37  ? 504  THR B OG1 1 
ATOM   7968 C CG2 . THR B 1 503 ? -33.635 44.370 343.426 1.00 44.15  ? 504  THR B CG2 1 
ATOM   7969 N N   . ALA B 1 504 ? -36.647 45.819 340.443 1.00 49.17  ? 505  ALA B N   1 
ATOM   7970 C CA  . ALA B 1 504 ? -37.443 45.901 339.220 1.00 64.23  ? 505  ALA B CA  1 
ATOM   7971 C C   . ALA B 1 504 ? -37.168 44.732 338.278 1.00 50.92  ? 505  ALA B C   1 
ATOM   7972 O O   . ALA B 1 504 ? -38.062 44.318 337.530 1.00 57.02  ? 505  ALA B O   1 
ATOM   7973 C CB  . ALA B 1 504 ? -37.180 47.228 338.508 1.00 55.41  ? 505  ALA B CB  1 
ATOM   7974 N N   . GLY B 1 505 ? -35.954 44.186 338.301 1.00 51.66  ? 506  GLY B N   1 
ATOM   7975 C CA  . GLY B 1 505 ? -35.621 43.069 337.439 1.00 48.25  ? 506  GLY B CA  1 
ATOM   7976 C C   . GLY B 1 505 ? -35.983 41.716 338.019 1.00 51.22  ? 506  GLY B C   1 
ATOM   7977 O O   . GLY B 1 505 ? -36.803 40.988 337.450 1.00 43.36  ? 506  GLY B O   1 
ATOM   7978 N N   . ALA B 1 506 ? -35.379 41.369 339.159 1.00 52.33  ? 507  ALA B N   1 
ATOM   7979 C CA  . ALA B 1 506 ? -35.624 40.059 339.755 1.00 42.55  ? 507  ALA B CA  1 
ATOM   7980 C C   . ALA B 1 506 ? -37.042 39.936 340.302 1.00 48.13  ? 507  ALA B C   1 
ATOM   7981 O O   . ALA B 1 506 ? -37.616 38.840 340.279 1.00 41.66  ? 507  ALA B O   1 
ATOM   7982 C CB  . ALA B 1 506 ? -34.602 39.785 340.857 1.00 39.84  ? 507  ALA B CB  1 
ATOM   7983 N N   . GLN B 1 507 ? -37.614 41.036 340.801 1.00 45.86  ? 508  GLN B N   1 
ATOM   7984 C CA  . GLN B 1 507 ? -38.993 41.063 341.302 1.00 48.79  ? 508  GLN B CA  1 
ATOM   7985 C C   . GLN B 1 507 ? -39.215 40.022 342.399 1.00 47.03  ? 508  GLN B C   1 
ATOM   7986 O O   . GLN B 1 507 ? -40.233 39.326 342.426 1.00 46.25  ? 508  GLN B O   1 
ATOM   7987 C CB  . GLN B 1 507 ? -39.995 40.873 340.160 1.00 42.89  ? 508  GLN B CB  1 
ATOM   7988 C CG  . GLN B 1 507 ? -39.814 41.846 339.003 1.00 54.26  ? 508  GLN B CG  1 
ATOM   7989 C CD  . GLN B 1 507 ? -40.735 41.542 337.834 1.00 58.51  ? 508  GLN B CD  1 
ATOM   7990 O OE1 . GLN B 1 507 ? -41.957 41.540 337.976 1.00 54.04  ? 508  GLN B OE1 1 
ATOM   7991 N NE2 . GLN B 1 507 ? -40.149 41.277 336.672 1.00 52.07  ? 508  GLN B NE2 1 
ATOM   7992 N N   . GLN B 1 508 ? -38.260 39.917 343.318 1.00 38.16  ? 509  GLN B N   1 
ATOM   7993 C CA  . GLN B 1 508 ? -38.307 38.876 344.335 1.00 42.65  ? 509  GLN B CA  1 
ATOM   7994 C C   . GLN B 1 508 ? -39.153 39.305 345.528 1.00 43.19  ? 509  GLN B C   1 
ATOM   7995 O O   . GLN B 1 508 ? -39.074 40.445 345.994 1.00 38.50  ? 509  GLN B O   1 
ATOM   7996 C CB  . GLN B 1 508 ? -36.896 38.519 344.803 1.00 46.77  ? 509  GLN B CB  1 
ATOM   7997 C CG  . GLN B 1 508 ? -36.132 37.615 343.849 1.00 44.17  ? 509  GLN B CG  1 
ATOM   7998 C CD  . GLN B 1 508 ? -34.691 37.405 344.276 1.00 46.31  ? 509  GLN B CD  1 
ATOM   7999 O OE1 . GLN B 1 508 ? -33.950 38.364 344.491 1.00 54.79  ? 509  GLN B OE1 1 
ATOM   8000 N NE2 . GLN B 1 508 ? -34.289 36.147 344.404 1.00 46.36  ? 509  GLN B NE2 1 
ATOM   8001 N N   . TYR B 1 509 ? -39.969 38.375 346.017 1.00 37.49  ? 510  TYR B N   1 
ATOM   8002 C CA  . TYR B 1 509 ? -40.760 38.562 347.221 1.00 41.02  ? 510  TYR B CA  1 
ATOM   8003 C C   . TYR B 1 509 ? -40.795 37.236 347.968 1.00 47.09  ? 510  TYR B C   1 
ATOM   8004 O O   . TYR B 1 509 ? -40.361 36.202 347.453 1.00 49.61  ? 510  TYR B O   1 
ATOM   8005 C CB  . TYR B 1 509 ? -42.178 39.052 346.895 1.00 38.35  ? 510  TYR B CB  1 
ATOM   8006 C CG  . TYR B 1 509 ? -43.026 38.020 346.185 1.00 39.71  ? 510  TYR B CG  1 
ATOM   8007 C CD1 . TYR B 1 509 ? -43.007 37.910 344.799 1.00 38.48  ? 510  TYR B CD1 1 
ATOM   8008 C CD2 . TYR B 1 509 ? -43.840 37.150 346.901 1.00 37.21  ? 510  TYR B CD2 1 
ATOM   8009 C CE1 . TYR B 1 509 ? -43.778 36.961 344.148 1.00 39.59  ? 510  TYR B CE1 1 
ATOM   8010 C CE2 . TYR B 1 509 ? -44.610 36.199 346.259 1.00 49.31  ? 510  TYR B CE2 1 
ATOM   8011 C CZ  . TYR B 1 509 ? -44.579 36.110 344.885 1.00 42.07  ? 510  TYR B CZ  1 
ATOM   8012 O OH  . TYR B 1 509 ? -45.352 35.162 344.254 1.00 49.54  ? 510  TYR B OH  1 
ATOM   8013 N N   . VAL B 1 510 ? -41.321 37.263 349.193 1.00 37.05  ? 511  VAL B N   1 
ATOM   8014 C CA  . VAL B 1 510 ? -41.428 36.057 350.003 1.00 39.65  ? 511  VAL B CA  1 
ATOM   8015 C C   . VAL B 1 510 ? -42.893 35.778 350.299 1.00 37.95  ? 511  VAL B C   1 
ATOM   8016 O O   . VAL B 1 510 ? -43.730 36.686 350.327 1.00 36.20  ? 511  VAL B O   1 
ATOM   8017 C CB  . VAL B 1 510 ? -40.621 36.156 351.317 1.00 43.27  ? 511  VAL B CB  1 
ATOM   8018 C CG1 . VAL B 1 510 ? -39.152 36.415 351.021 1.00 42.76  ? 511  VAL B CG1 1 
ATOM   8019 C CG2 . VAL B 1 510 ? -41.199 37.234 352.225 1.00 35.51  ? 511  VAL B CG2 1 
ATOM   8020 N N   . SER B 1 511 ? -43.200 34.503 350.514 1.00 39.21  ? 512  SER B N   1 
ATOM   8021 C CA  . SER B 1 511 ? -44.521 34.074 350.948 1.00 40.92  ? 512  SER B CA  1 
ATOM   8022 C C   . SER B 1 511 ? -44.522 33.931 352.464 1.00 50.85  ? 512  SER B C   1 
ATOM   8023 O O   . SER B 1 511 ? -43.593 33.352 353.037 1.00 46.24  ? 512  SER B O   1 
ATOM   8024 C CB  . SER B 1 511 ? -44.908 32.751 350.288 1.00 49.53  ? 512  SER B CB  1 
ATOM   8025 O OG  . SER B 1 511 ? -43.951 31.747 350.577 1.00 55.42  ? 512  SER B OG  1 
ATOM   8026 N N   . LEU B 1 512 ? -45.561 34.458 353.106 1.00 47.09  ? 513  LEU B N   1 
ATOM   8027 C CA  . LEU B 1 512 ? -45.686 34.445 354.560 1.00 40.90  ? 513  LEU B CA  1 
ATOM   8028 C C   . LEU B 1 512 ? -46.770 33.449 354.950 1.00 46.95  ? 513  LEU B C   1 
ATOM   8029 O O   . LEU B 1 512 ? -47.960 33.701 354.727 1.00 43.27  ? 513  LEU B O   1 
ATOM   8030 C CB  . LEU B 1 512 ? -46.014 35.841 355.088 1.00 35.62  ? 513  LEU B CB  1 
ATOM   8031 C CG  . LEU B 1 512 ? -44.926 36.900 354.908 1.00 38.89  ? 513  LEU B CG  1 
ATOM   8032 C CD1 . LEU B 1 512 ? -45.362 38.237 355.497 1.00 33.45  ? 513  LEU B CD1 1 
ATOM   8033 C CD2 . LEU B 1 512 ? -43.618 36.432 355.532 1.00 31.44  ? 513  LEU B CD2 1 
ATOM   8034 N N   . ASP B 1 513 ? -46.363 32.325 355.530 1.00 40.66  ? 514  ASP B N   1 
ATOM   8035 C CA  . ASP B 1 513 ? -47.305 31.340 356.051 1.00 50.47  ? 514  ASP B CA  1 
ATOM   8036 C C   . ASP B 1 513 ? -46.594 30.524 357.126 1.00 45.05  ? 514  ASP B C   1 
ATOM   8037 O O   . ASP B 1 513 ? -45.511 30.893 357.592 1.00 50.01  ? 514  ASP B O   1 
ATOM   8038 C CB  . ASP B 1 513 ? -47.865 30.463 354.924 1.00 44.26  ? 514  ASP B CB  1 
ATOM   8039 C CG  . ASP B 1 513 ? -46.780 29.864 354.050 1.00 58.43  ? 514  ASP B CG  1 
ATOM   8040 O OD1 . ASP B 1 513 ? -45.613 29.804 354.490 1.00 64.30  ? 514  ASP B OD1 1 
ATOM   8041 O OD2 . ASP B 1 513 ? -47.097 29.447 352.916 1.00 84.77  ? 514  ASP B OD2 1 
ATOM   8042 N N   . LEU B 1 514 ? -47.203 29.401 357.515 1.00 56.06  ? 515  LEU B N   1 
ATOM   8043 C CA  . LEU B 1 514 ? -46.633 28.558 358.559 1.00 55.98  ? 515  LEU B CA  1 
ATOM   8044 C C   . LEU B 1 514 ? -45.321 27.909 358.136 1.00 51.02  ? 515  LEU B C   1 
ATOM   8045 O O   . LEU B 1 514 ? -44.527 27.524 359.001 1.00 68.88  ? 515  LEU B O   1 
ATOM   8046 C CB  . LEU B 1 514 ? -47.642 27.485 358.968 1.00 51.43  ? 515  LEU B CB  1 
ATOM   8047 C CG  . LEU B 1 514 ? -49.028 28.007 359.352 1.00 56.15  ? 515  LEU B CG  1 
ATOM   8048 C CD1 . LEU B 1 514 ? -49.940 26.866 359.780 1.00 52.93  ? 515  LEU B CD1 1 
ATOM   8049 C CD2 . LEU B 1 514 ? -48.919 29.057 360.450 1.00 44.53  ? 515  LEU B CD2 1 
ATOM   8050 N N   . ARG B 1 515 ? -45.079 27.774 356.839 1.00 47.84  ? 516  ARG B N   1 
ATOM   8051 C CA  . ARG B 1 515 ? -43.823 27.235 356.350 1.00 48.15  ? 516  ARG B CA  1 
ATOM   8052 C C   . ARG B 1 515 ? -42.727 28.291 356.434 1.00 50.47  ? 516  ARG B C   1 
ATOM   8053 O O   . ARG B 1 515 ? -43.013 29.487 356.537 1.00 48.66  ? 516  ARG B O   1 
ATOM   8054 C CB  . ARG B 1 515 ? -43.983 26.765 354.907 1.00 62.27  ? 516  ARG B CB  1 
ATOM   8055 C CG  . ARG B 1 515 ? -45.099 25.761 354.689 1.00 58.47  ? 516  ARG B CG  1 
ATOM   8056 C CD  . ARG B 1 515 ? -45.285 25.468 353.204 1.00 71.46  ? 516  ARG B CD  1 
ATOM   8057 N NE  . ARG B 1 515 ? -45.507 26.685 352.425 1.00 77.73  ? 516  ARG B NE  1 
ATOM   8058 C CZ  . ARG B 1 515 ? -44.621 27.212 351.583 1.00 79.04  ? 516  ARG B CZ  1 
ATOM   8059 N NH1 . ARG B 1 515 ? -43.443 26.631 351.403 1.00 83.75  ? 516  ARG B NH1 1 
ATOM   8060 N NH2 . ARG B 1 515 ? -44.916 28.321 350.919 1.00 74.01  ? 516  ARG B NH2 1 
ATOM   8061 N N   . PRO B 1 516 ? -41.460 27.877 356.397 1.00 55.69  ? 517  PRO B N   1 
ATOM   8062 C CA  . PRO B 1 516 ? -40.367 28.856 356.334 1.00 45.00  ? 517  PRO B CA  1 
ATOM   8063 C C   . PRO B 1 516 ? -40.469 29.722 355.086 1.00 57.69  ? 517  PRO B C   1 
ATOM   8064 O O   . PRO B 1 516 ? -41.214 29.435 354.146 1.00 53.54  ? 517  PRO B O   1 
ATOM   8065 C CB  . PRO B 1 516 ? -39.106 27.985 356.311 1.00 47.93  ? 517  PRO B CB  1 
ATOM   8066 C CG  . PRO B 1 516 ? -39.525 26.698 356.944 1.00 54.80  ? 517  PRO B CG  1 
ATOM   8067 C CD  . PRO B 1 516 ? -40.962 26.499 356.560 1.00 41.75  ? 517  PRO B CD  1 
ATOM   8068 N N   . LEU B 1 517 ? -39.694 30.806 355.090 1.00 52.80  ? 518  LEU B N   1 
ATOM   8069 C CA  . LEU B 1 517 ? -39.728 31.767 353.995 1.00 52.13  ? 518  LEU B CA  1 
ATOM   8070 C C   . LEU B 1 517 ? -39.390 31.097 352.670 1.00 55.33  ? 518  LEU B C   1 
ATOM   8071 O O   . LEU B 1 517 ? -38.413 30.350 352.566 1.00 62.49  ? 518  LEU B O   1 
ATOM   8072 C CB  . LEU B 1 517 ? -38.748 32.907 354.262 1.00 52.12  ? 518  LEU B CB  1 
ATOM   8073 C CG  . LEU B 1 517 ? -39.178 33.995 355.241 1.00 54.16  ? 518  LEU B CG  1 
ATOM   8074 C CD1 . LEU B 1 517 ? -38.194 35.152 355.191 1.00 45.13  ? 518  LEU B CD1 1 
ATOM   8075 C CD2 . LEU B 1 517 ? -40.591 34.466 354.936 1.00 45.82  ? 518  LEU B CD2 1 
ATOM   8076 N N   . GLU B 1 518 ? -40.206 31.371 351.655 1.00 54.26  ? 519  GLU B N   1 
ATOM   8077 C CA  . GLU B 1 518 ? -39.986 30.884 350.300 1.00 58.23  ? 519  GLU B CA  1 
ATOM   8078 C C   . GLU B 1 518 ? -39.912 32.084 349.368 1.00 47.42  ? 519  GLU B C   1 
ATOM   8079 O O   . GLU B 1 518 ? -40.850 32.886 349.310 1.00 54.67  ? 519  GLU B O   1 
ATOM   8080 C CB  . GLU B 1 518 ? -41.101 29.928 349.870 1.00 57.79  ? 519  GLU B CB  1 
ATOM   8081 C CG  . GLU B 1 518 ? -40.963 29.415 348.446 1.00 64.95  ? 519  GLU B CG  1 
ATOM   8082 C CD  . GLU B 1 518 ? -42.149 28.573 348.008 1.00 85.79  ? 519  GLU B CD  1 
ATOM   8083 O OE1 . GLU B 1 518 ? -42.528 28.652 346.820 1.00 72.56  ? 519  GLU B OE1 1 
ATOM   8084 O OE2 . GLU B 1 518 ? -42.701 27.834 348.851 1.00 93.03  ? 519  GLU B OE2 1 
ATOM   8085 N N   . VAL B 1 519 ? -38.801 32.210 348.652 1.00 52.36  ? 520  VAL B N   1 
ATOM   8086 C CA  . VAL B 1 519 ? -38.600 33.329 347.738 1.00 46.03  ? 520  VAL B CA  1 
ATOM   8087 C C   . VAL B 1 519 ? -39.239 32.998 346.396 1.00 45.67  ? 520  VAL B C   1 
ATOM   8088 O O   . VAL B 1 519 ? -39.068 31.893 345.868 1.00 51.79  ? 520  VAL B O   1 
ATOM   8089 C CB  . VAL B 1 519 ? -37.104 33.640 347.582 1.00 48.91  ? 520  VAL B CB  1 
ATOM   8090 C CG1 . VAL B 1 519 ? -36.892 34.782 346.595 1.00 47.52  ? 520  VAL B CG1 1 
ATOM   8091 C CG2 . VAL B 1 519 ? -36.492 33.972 348.934 1.00 39.72  ? 520  VAL B CG2 1 
ATOM   8092 N N   . ARG B 1 520 ? -39.988 33.952 345.847 1.00 53.16  ? 521  ARG B N   1 
ATOM   8093 C CA  . ARG B 1 520 ? -40.629 33.816 344.548 1.00 46.05  ? 521  ARG B CA  1 
ATOM   8094 C C   . ARG B 1 520 ? -40.370 35.072 343.729 1.00 46.90  ? 521  ARG B C   1 
ATOM   8095 O O   . ARG B 1 520 ? -39.885 36.085 344.241 1.00 47.38  ? 521  ARG B O   1 
ATOM   8096 C CB  . ARG B 1 520 ? -42.136 33.569 344.688 1.00 44.20  ? 521  ARG B CB  1 
ATOM   8097 C CG  . ARG B 1 520 ? -42.482 32.313 345.462 1.00 55.09  ? 521  ARG B CG  1 
ATOM   8098 C CD  . ARG B 1 520 ? -43.976 32.197 345.674 1.00 56.52  ? 521  ARG B CD  1 
ATOM   8099 N NE  . ARG B 1 520 ? -44.307 31.104 346.581 1.00 63.62  ? 521  ARG B NE  1 
ATOM   8100 C CZ  . ARG B 1 520 ? -45.499 30.941 347.144 1.00 62.94  ? 521  ARG B CZ  1 
ATOM   8101 N NH1 . ARG B 1 520 ? -46.474 31.805 346.893 1.00 54.24  ? 521  ARG B NH1 1 
ATOM   8102 N NH2 . ARG B 1 520 ? -45.715 29.918 347.959 1.00 59.91  ? 521  ARG B NH2 1 
ATOM   8103 N N   . ARG B 1 521 ? -40.699 34.997 342.440 1.00 42.39  ? 522  ARG B N   1 
ATOM   8104 C CA  . ARG B 1 521 ? -40.477 36.082 341.495 1.00 42.52  ? 522  ARG B CA  1 
ATOM   8105 C C   . ARG B 1 521 ? -41.801 36.547 340.908 1.00 46.69  ? 522  ARG B C   1 
ATOM   8106 O O   . ARG B 1 521 ? -42.673 35.730 340.597 1.00 51.57  ? 522  ARG B O   1 
ATOM   8107 C CB  . ARG B 1 521 ? -39.549 35.650 340.354 1.00 55.33  ? 522  ARG B CB  1 
ATOM   8108 C CG  . ARG B 1 521 ? -38.109 35.419 340.755 1.00 59.66  ? 522  ARG B CG  1 
ATOM   8109 C CD  . ARG B 1 521 ? -37.203 35.376 339.532 1.00 51.10  ? 522  ARG B CD  1 
ATOM   8110 N NE  . ARG B 1 521 ? -37.142 36.662 338.841 1.00 59.35  ? 522  ARG B NE  1 
ATOM   8111 C CZ  . ARG B 1 521 ? -37.606 36.879 337.613 1.00 64.43  ? 522  ARG B CZ  1 
ATOM   8112 N NH1 . ARG B 1 521 ? -38.167 35.891 336.928 1.00 58.15  ? 522  ARG B NH1 1 
ATOM   8113 N NH2 . ARG B 1 521 ? -37.504 38.085 337.066 1.00 42.19  ? 522  ARG B NH2 1 
ATOM   8114 N N   . GLY B 1 522 ? -41.942 37.864 340.756 1.00 47.32  ? 523  GLY B N   1 
ATOM   8115 C CA  . GLY B 1 522 ? -43.085 38.442 340.073 1.00 42.32  ? 523  GLY B CA  1 
ATOM   8116 C C   . GLY B 1 522 ? -44.357 38.554 340.889 1.00 46.83  ? 523  GLY B C   1 
ATOM   8117 O O   . GLY B 1 522 ? -44.953 37.542 341.269 1.00 46.44  ? 523  GLY B O   1 
ATOM   8118 N N   . LEU B 1 523 ? -44.786 39.788 341.164 1.00 51.40  ? 524  LEU B N   1 
ATOM   8119 C CA  . LEU B 1 523 ? -46.080 40.043 341.799 1.00 50.10  ? 524  LEU B CA  1 
ATOM   8120 C C   . LEU B 1 523 ? -47.128 40.126 340.694 1.00 49.99  ? 524  LEU B C   1 
ATOM   8121 O O   . LEU B 1 523 ? -47.542 41.206 340.266 1.00 47.94  ? 524  LEU B O   1 
ATOM   8122 C CB  . LEU B 1 523 ? -46.037 41.324 342.626 1.00 44.37  ? 524  LEU B CB  1 
ATOM   8123 C CG  . LEU B 1 523 ? -45.179 41.351 343.891 1.00 51.70  ? 524  LEU B CG  1 
ATOM   8124 C CD1 . LEU B 1 523 ? -45.056 42.772 344.422 1.00 40.94  ? 524  LEU B CD1 1 
ATOM   8125 C CD2 . LEU B 1 523 ? -45.768 40.435 344.948 1.00 46.87  ? 524  LEU B CD2 1 
ATOM   8126 N N   . ARG B 1 524 ? -47.557 38.954 340.226 1.00 46.62  ? 525  ARG B N   1 
ATOM   8127 C CA  A ARG B 1 524 ? -48.508 38.861 339.121 0.51 50.40  ? 525  ARG B CA  1 
ATOM   8128 C CA  B ARG B 1 524 ? -48.495 38.837 339.112 0.49 49.65  ? 525  ARG B CA  1 
ATOM   8129 C C   . ARG B 1 524 ? -48.031 39.696 337.935 1.00 42.98  ? 525  ARG B C   1 
ATOM   8130 O O   . ARG B 1 524 ? -48.734 40.583 337.446 1.00 48.71  ? 525  ARG B O   1 
ATOM   8131 C CB  A ARG B 1 524 ? -49.907 39.291 339.566 0.51 42.17  ? 525  ARG B CB  1 
ATOM   8132 C CB  B ARG B 1 524 ? -49.913 39.199 339.562 0.49 43.50  ? 525  ARG B CB  1 
ATOM   8133 C CG  A ARG B 1 524 ? -50.440 38.537 340.767 0.51 43.77  ? 525  ARG B CG  1 
ATOM   8134 C CG  B ARG B 1 524 ? -50.343 38.447 340.812 0.49 43.94  ? 525  ARG B CG  1 
ATOM   8135 C CD  A ARG B 1 524 ? -51.333 37.392 340.335 0.51 44.92  ? 525  ARG B CD  1 
ATOM   8136 C CD  B ARG B 1 524 ? -51.853 38.391 340.968 0.49 39.74  ? 525  ARG B CD  1 
ATOM   8137 N NE  A ARG B 1 524 ? -52.486 37.863 339.574 0.51 44.64  ? 525  ARG B NE  1 
ATOM   8138 N NE  B ARG B 1 524 ? -52.244 37.573 342.114 0.49 40.80  ? 525  ARG B NE  1 
ATOM   8139 C CZ  A ARG B 1 524 ? -53.353 37.062 338.963 0.51 46.29  ? 525  ARG B CZ  1 
ATOM   8140 C CZ  B ARG B 1 524 ? -53.500 37.275 342.429 0.49 47.07  ? 525  ARG B CZ  1 
ATOM   8141 N NH1 A ARG B 1 524 ? -53.198 35.747 339.026 0.51 47.41  ? 525  ARG B NH1 1 
ATOM   8142 N NH1 B ARG B 1 524 ? -54.499 37.732 341.685 0.49 41.99  ? 525  ARG B NH1 1 
ATOM   8143 N NH2 A ARG B 1 524 ? -54.374 37.575 338.290 0.51 32.43  ? 525  ARG B NH2 1 
ATOM   8144 N NH2 B ARG B 1 524 ? -53.760 36.522 343.490 0.49 42.98  ? 525  ARG B NH2 1 
ATOM   8145 N N   . ALA B 1 525 ? -46.806 39.404 337.487 1.00 41.40  ? 526  ALA B N   1 
ATOM   8146 C CA  . ALA B 1 525 ? -46.146 40.232 336.482 1.00 43.21  ? 526  ALA B CA  1 
ATOM   8147 C C   . ALA B 1 525 ? -46.950 40.319 335.189 1.00 38.41  ? 526  ALA B C   1 
ATOM   8148 O O   . ALA B 1 525 ? -47.042 41.394 334.584 1.00 39.43  ? 526  ALA B O   1 
ATOM   8149 C CB  . ALA B 1 525 ? -44.742 39.692 336.209 1.00 40.55  ? 526  ALA B CB  1 
ATOM   8150 N N   . GLN B 1 526 ? -47.534 39.204 334.742 1.00 39.52  ? 527  GLN B N   1 
ATOM   8151 C CA  . GLN B 1 526 ? -48.300 39.227 333.499 1.00 43.46  ? 527  GLN B CA  1 
ATOM   8152 C C   . GLN B 1 526 ? -49.547 40.092 333.640 1.00 43.12  ? 527  GLN B C   1 
ATOM   8153 O O   . GLN B 1 526 ? -49.827 40.942 332.786 1.00 45.86  ? 527  GLN B O   1 
ATOM   8154 C CB  . GLN B 1 526 ? -48.674 37.805 333.076 1.00 40.03  ? 527  GLN B CB  1 
ATOM   8155 C CG  . GLN B 1 526 ? -47.497 36.841 332.999 1.00 52.41  ? 527  GLN B CG  1 
ATOM   8156 C CD  . GLN B 1 526 ? -46.433 37.285 332.010 1.00 56.65  ? 527  GLN B CD  1 
ATOM   8157 O OE1 . GLN B 1 526 ? -46.735 37.895 330.984 1.00 53.86  ? 527  GLN B OE1 1 
ATOM   8158 N NE2 . GLN B 1 526 ? -45.177 36.981 332.319 1.00 56.49  ? 527  GLN B NE2 1 
ATOM   8159 N N   . ALA B 1 527 ? -50.305 39.898 334.720 1.00 41.79  ? 528  ALA B N   1 
ATOM   8160 C CA  . ALA B 1 527 ? -51.521 40.682 334.910 1.00 40.76  ? 528  ALA B CA  1 
ATOM   8161 C C   . ALA B 1 527 ? -51.201 42.153 335.149 1.00 38.95  ? 528  ALA B C   1 
ATOM   8162 O O   . ALA B 1 527 ? -51.947 43.036 334.706 1.00 45.66  ? 528  ALA B O   1 
ATOM   8163 C CB  . ALA B 1 527 ? -52.336 40.114 336.072 1.00 50.46  ? 528  ALA B CB  1 
ATOM   8164 N N   . CYS B 1 528 ? -50.094 42.442 335.836 1.00 33.58  ? 529  CYS B N   1 
ATOM   8165 C CA  . CYS B 1 528 ? -49.790 43.826 336.169 1.00 37.77  ? 529  CYS B CA  1 
ATOM   8166 C C   . CYS B 1 528 ? -49.179 44.598 335.006 1.00 37.87  ? 529  CYS B C   1 
ATOM   8167 O O   . CYS B 1 528 ? -49.298 45.827 334.975 1.00 35.45  ? 529  CYS B O   1 
ATOM   8168 C CB  . CYS B 1 528 ? -48.884 43.871 337.402 1.00 45.16  ? 529  CYS B CB  1 
ATOM   8169 S SG  . CYS B 1 528 ? -49.749 43.333 338.919 1.00 45.31  ? 529  CYS B SG  1 
ATOM   8170 N N   . ALA B 1 529 ? -48.537 43.918 334.053 1.00 34.10  ? 530  ALA B N   1 
ATOM   8171 C CA  . ALA B 1 529 ? -48.166 44.598 332.815 1.00 39.04  ? 530  ALA B CA  1 
ATOM   8172 C C   . ALA B 1 529 ? -49.405 45.110 332.092 1.00 31.83  ? 530  ALA B C   1 
ATOM   8173 O O   . ALA B 1 529 ? -49.391 46.199 331.508 1.00 38.68  ? 530  ALA B O   1 
ATOM   8174 C CB  . ALA B 1 529 ? -47.361 43.664 331.910 1.00 31.14  ? 530  ALA B CB  1 
ATOM   8175 N N   . PHE B 1 530 ? -50.493 44.340 332.140 1.00 36.94  ? 531  PHE B N   1 
ATOM   8176 C CA  . PHE B 1 530 ? -51.762 44.771 331.559 1.00 36.07  ? 531  PHE B CA  1 
ATOM   8177 C C   . PHE B 1 530 ? -52.267 46.054 332.215 1.00 36.83  ? 531  PHE B C   1 
ATOM   8178 O O   . PHE B 1 530 ? -52.584 47.032 331.529 1.00 40.81  ? 531  PHE B O   1 
ATOM   8179 C CB  . PHE B 1 530 ? -52.783 43.639 331.703 1.00 37.22  ? 531  PHE B CB  1 
ATOM   8180 C CG  . PHE B 1 530 ? -54.172 44.003 331.276 1.00 40.83  ? 531  PHE B CG  1 
ATOM   8181 C CD1 . PHE B 1 530 ? -54.434 44.395 329.975 1.00 48.21  ? 531  PHE B CD1 1 
ATOM   8182 C CD2 . PHE B 1 530 ? -55.224 43.929 332.174 1.00 42.14  ? 531  PHE B CD2 1 
ATOM   8183 C CE1 . PHE B 1 530 ? -55.718 44.720 329.579 1.00 44.82  ? 531  PHE B CE1 1 
ATOM   8184 C CE2 . PHE B 1 530 ? -56.509 44.253 331.786 1.00 49.38  ? 531  PHE B CE2 1 
ATOM   8185 C CZ  . PHE B 1 530 ? -56.756 44.648 330.485 1.00 52.05  ? 531  PHE B CZ  1 
ATOM   8186 N N   . TRP B 1 531 ? -52.332 46.075 333.549 1.00 38.83  ? 532  TRP B N   1 
ATOM   8187 C CA  . TRP B 1 531 ? -52.924 47.209 334.256 1.00 33.74  ? 532  TRP B CA  1 
ATOM   8188 C C   . TRP B 1 531 ? -51.990 48.415 334.304 1.00 36.88  ? 532  TRP B C   1 
ATOM   8189 O O   . TRP B 1 531 ? -52.447 49.559 334.202 1.00 36.66  ? 532  TRP B O   1 
ATOM   8190 C CB  . TRP B 1 531 ? -53.307 46.801 335.679 1.00 30.18  ? 532  TRP B CB  1 
ATOM   8191 C CG  . TRP B 1 531 ? -54.392 45.772 335.757 1.00 31.23  ? 532  TRP B CG  1 
ATOM   8192 C CD1 . TRP B 1 531 ? -54.244 44.443 336.027 1.00 26.33  ? 532  TRP B CD1 1 
ATOM   8193 C CD2 . TRP B 1 531 ? -55.795 45.990 335.574 1.00 29.69  ? 532  TRP B CD2 1 
ATOM   8194 N NE1 . TRP B 1 531 ? -55.468 43.818 336.019 1.00 29.94  ? 532  TRP B NE1 1 
ATOM   8195 C CE2 . TRP B 1 531 ? -56.437 44.748 335.744 1.00 31.06  ? 532  TRP B CE2 1 
ATOM   8196 C CE3 . TRP B 1 531 ? -56.570 47.116 335.278 1.00 28.87  ? 532  TRP B CE3 1 
ATOM   8197 C CZ2 . TRP B 1 531 ? -57.815 44.600 335.630 1.00 28.03  ? 532  TRP B CZ2 1 
ATOM   8198 C CZ3 . TRP B 1 531 ? -57.937 46.967 335.166 1.00 32.05  ? 532  TRP B CZ3 1 
ATOM   8199 C CH2 . TRP B 1 531 ? -58.547 45.718 335.341 1.00 33.37  ? 532  TRP B CH2 1 
ATOM   8200 N N   . ASN B 1 532 ? -50.687 48.187 334.459 1.00 33.26  ? 533  ASN B N   1 
ATOM   8201 C CA  . ASN B 1 532 ? -49.753 49.284 334.676 1.00 39.32  ? 533  ASN B CA  1 
ATOM   8202 C C   . ASN B 1 532 ? -49.113 49.817 333.401 1.00 35.72  ? 533  ASN B C   1 
ATOM   8203 O O   . ASN B 1 532 ? -48.666 50.969 333.393 1.00 43.46  ? 533  ASN B O   1 
ATOM   8204 C CB  . ASN B 1 532 ? -48.652 48.849 335.648 1.00 34.53  ? 533  ASN B CB  1 
ATOM   8205 C CG  . ASN B 1 532 ? -49.188 48.556 337.031 1.00 38.29  ? 533  ASN B CG  1 
ATOM   8206 O OD1 . ASN B 1 532 ? -50.200 49.120 337.442 1.00 37.78  ? 533  ASN B OD1 1 
ATOM   8207 N ND2 . ASN B 1 532 ? -48.518 47.665 337.756 1.00 32.91  ? 533  ASN B ND2 1 
ATOM   8208 N N   . ARG B 1 533 ? -49.053 49.026 332.329 1.00 37.39  ? 534  ARG B N   1 
ATOM   8209 C CA  . ARG B 1 533 ? -48.374 49.438 331.106 1.00 43.52  ? 534  ARG B CA  1 
ATOM   8210 C C   . ARG B 1 533 ? -49.320 49.684 329.941 1.00 45.47  ? 534  ARG B C   1 
ATOM   8211 O O   . ARG B 1 533 ? -49.224 50.722 329.280 1.00 48.23  ? 534  ARG B O   1 
ATOM   8212 C CB  . ARG B 1 533 ? -47.326 48.390 330.702 1.00 43.48  ? 534  ARG B CB  1 
ATOM   8213 C CG  . ARG B 1 533 ? -46.237 48.167 331.738 1.00 43.37  ? 534  ARG B CG  1 
ATOM   8214 C CD  . ARG B 1 533 ? -45.301 47.041 331.327 1.00 47.92  ? 534  ARG B CD  1 
ATOM   8215 N NE  . ARG B 1 533 ? -44.322 46.745 332.368 1.00 64.85  ? 534  ARG B NE  1 
ATOM   8216 C CZ  . ARG B 1 533 ? -43.111 47.288 332.430 1.00 71.32  ? 534  ARG B CZ  1 
ATOM   8217 N NH1 . ARG B 1 533 ? -42.725 48.158 331.506 1.00 63.05  ? 534  ARG B NH1 1 
ATOM   8218 N NH2 . ARG B 1 533 ? -42.286 46.961 333.416 1.00 76.75  ? 534  ARG B NH2 1 
ATOM   8219 N N   . PHE B 1 534 ? -50.239 48.759 329.669 1.00 39.51  ? 535  PHE B N   1 
ATOM   8220 C CA  . PHE B 1 534 ? -51.053 48.852 328.463 1.00 39.11  ? 535  PHE B CA  1 
ATOM   8221 C C   . PHE B 1 534 ? -52.307 49.699 328.654 1.00 37.95  ? 535  PHE B C   1 
ATOM   8222 O O   . PHE B 1 534 ? -52.577 50.595 327.850 1.00 47.11  ? 535  PHE B O   1 
ATOM   8223 C CB  . PHE B 1 534 ? -51.447 47.453 327.980 1.00 36.11  ? 535  PHE B CB  1 
ATOM   8224 C CG  . PHE B 1 534 ? -52.324 47.470 326.765 1.00 41.09  ? 535  PHE B CG  1 
ATOM   8225 C CD1 . PHE B 1 534 ? -51.840 47.941 325.555 1.00 38.83  ? 535  PHE B CD1 1 
ATOM   8226 C CD2 . PHE B 1 534 ? -53.636 47.036 326.835 1.00 40.19  ? 535  PHE B CD2 1 
ATOM   8227 C CE1 . PHE B 1 534 ? -52.645 47.969 324.434 1.00 38.51  ? 535  PHE B CE1 1 
ATOM   8228 C CE2 . PHE B 1 534 ? -54.448 47.060 325.718 1.00 40.88  ? 535  PHE B CE2 1 
ATOM   8229 C CZ  . PHE B 1 534 ? -53.953 47.526 324.514 1.00 38.72  ? 535  PHE B CZ  1 
ATOM   8230 N N   . LEU B 1 535 ? -53.085 49.417 329.699 1.00 50.83  ? 536  LEU B N   1 
ATOM   8231 C CA  . LEU B 1 535 ? -54.370 50.092 329.866 1.00 52.34  ? 536  LEU B CA  1 
ATOM   8232 C C   . LEU B 1 535 ? -54.270 51.614 329.940 1.00 49.77  ? 536  LEU B C   1 
ATOM   8233 O O   . LEU B 1 535 ? -55.144 52.283 329.361 1.00 52.96  ? 536  LEU B O   1 
ATOM   8234 C CB  . LEU B 1 535 ? -55.087 49.534 331.101 1.00 44.97  ? 536  LEU B CB  1 
ATOM   8235 C CG  . LEU B 1 535 ? -56.552 49.954 331.216 1.00 56.46  ? 536  LEU B CG  1 
ATOM   8236 C CD1 . LEU B 1 535 ? -57.341 49.464 330.016 1.00 58.12  ? 536  LEU B CD1 1 
ATOM   8237 C CD2 . LEU B 1 535 ? -57.164 49.445 332.503 1.00 47.32  ? 536  LEU B CD2 1 
ATOM   8238 N N   . PRO B 1 536 ? -53.283 52.223 330.614 1.00 44.81  ? 537  PRO B N   1 
ATOM   8239 C CA  . PRO B 1 536 ? -53.171 53.692 330.533 1.00 50.78  ? 537  PRO B CA  1 
ATOM   8240 C C   . PRO B 1 536 ? -53.023 54.206 329.111 1.00 41.40  ? 537  PRO B C   1 
ATOM   8241 O O   . PRO B 1 536 ? -53.571 55.265 328.781 1.00 61.46  ? 537  PRO B O   1 
ATOM   8242 C CB  . PRO B 1 536 ? -51.930 53.995 331.386 1.00 38.67  ? 537  PRO B CB  1 
ATOM   8243 C CG  . PRO B 1 536 ? -51.866 52.868 332.361 1.00 37.84  ? 537  PRO B CG  1 
ATOM   8244 C CD  . PRO B 1 536 ? -52.341 51.660 331.602 1.00 47.51  ? 537  PRO B CD  1 
ATOM   8245 N N   . LYS B 1 537 ? -52.295 53.482 328.255 1.00 55.67  ? 538  LYS B N   1 
ATOM   8246 C CA  . LYS B 1 537 ? -52.179 53.889 326.857 1.00 51.03  ? 538  LYS B CA  1 
ATOM   8247 C C   . LYS B 1 537 ? -53.523 53.800 326.146 1.00 45.39  ? 538  LYS B C   1 
ATOM   8248 O O   . LYS B 1 537 ? -53.854 54.659 325.321 1.00 54.19  ? 538  LYS B O   1 
ATOM   8249 C CB  . LYS B 1 537 ? -51.136 53.030 326.142 1.00 43.53  ? 538  LYS B CB  1 
ATOM   8250 C CG  . LYS B 1 537 ? -49.721 53.159 326.693 1.00 43.75  ? 538  LYS B CG  1 
ATOM   8251 C CD  . LYS B 1 537 ? -48.765 52.245 325.940 1.00 52.02  ? 538  LYS B CD  1 
ATOM   8252 C CE  . LYS B 1 537 ? -47.322 52.456 326.373 1.00 52.47  ? 538  LYS B CE  1 
ATOM   8253 N NZ  . LYS B 1 537 ? -47.115 52.134 327.811 1.00 73.60  ? 538  LYS B NZ  1 
ATOM   8254 N N   . LEU B 1 538 ? -54.317 52.777 326.468 1.00 52.47  ? 539  LEU B N   1 
ATOM   8255 C CA  . LEU B 1 538 ? -55.602 52.591 325.803 1.00 55.09  ? 539  LEU B CA  1 
ATOM   8256 C C   . LEU B 1 538 ? -56.591 53.681 326.193 1.00 55.54  ? 539  LEU B C   1 
ATOM   8257 O O   . LEU B 1 538 ? -57.289 54.230 325.332 1.00 69.94  ? 539  LEU B O   1 
ATOM   8258 C CB  . LEU B 1 538 ? -56.160 51.204 326.135 1.00 45.24  ? 539  LEU B CB  1 
ATOM   8259 C CG  . LEU B 1 538 ? -57.454 50.722 325.469 1.00 58.04  ? 539  LEU B CG  1 
ATOM   8260 C CD1 . LEU B 1 538 ? -57.493 49.203 325.475 1.00 64.80  ? 539  LEU B CD1 1 
ATOM   8261 C CD2 . LEU B 1 538 ? -58.700 51.265 326.154 1.00 54.13  ? 539  LEU B CD2 1 
ATOM   8262 N N   . LEU B 1 539 ? -56.670 54.001 327.485 1.00 68.49  ? 540  LEU B N   1 
ATOM   8263 C CA  . LEU B 1 539 ? -57.682 54.945 327.946 1.00 70.93  ? 540  LEU B CA  1 
ATOM   8264 C C   . LEU B 1 539 ? -57.395 56.364 327.475 1.00 69.77  ? 540  LEU B C   1 
ATOM   8265 O O   . LEU B 1 539 ? -58.324 57.167 327.337 1.00 83.94  ? 540  LEU B O   1 
ATOM   8266 C CB  . LEU B 1 539 ? -57.790 54.897 329.472 1.00 56.21  ? 540  LEU B CB  1 
ATOM   8267 C CG  . LEU B 1 539 ? -58.180 53.540 330.062 1.00 71.08  ? 540  LEU B CG  1 
ATOM   8268 C CD1 . LEU B 1 539 ? -57.717 53.415 331.508 1.00 58.94  ? 540  LEU B CD1 1 
ATOM   8269 C CD2 . LEU B 1 539 ? -59.681 53.321 329.949 1.00 77.48  ? 540  LEU B CD2 1 
ATOM   8270 N N   . SER B 1 540 ? -56.132 56.689 327.211 1.00 58.26  ? 541  SER B N   1 
ATOM   8271 C CA  . SER B 1 540 ? -55.763 58.009 326.719 1.00 67.52  ? 541  SER B CA  1 
ATOM   8272 C C   . SER B 1 540 ? -55.752 58.094 325.197 1.00 78.37  ? 541  SER B C   1 
ATOM   8273 O O   . SER B 1 540 ? -55.440 59.159 324.654 1.00 81.97  ? 541  SER B O   1 
ATOM   8274 C CB  . SER B 1 540 ? -54.388 58.409 327.266 1.00 66.42  ? 541  SER B CB  1 
ATOM   8275 O OG  . SER B 1 540 ? -53.349 57.951 326.420 1.00 77.34  ? 541  SER B OG  1 
ATOM   8276 N N   . ALA B 1 541 ? -56.080 57.009 324.502 1.00 77.92  ? 542  ALA B N   1 
ATOM   8277 C CA  . ALA B 1 541 ? -56.066 56.994 323.042 1.00 84.19  ? 542  ALA B CA  1 
ATOM   8278 C C   . ALA B 1 541 ? -57.459 56.739 322.474 1.00 79.57  ? 542  ALA B C   1 
ATOM   8279 O O   . ALA B 1 541 ? -58.453 56.765 323.201 1.00 87.38  ? 542  ALA B O   1 
ATOM   8280 C CB  . ALA B 1 541 ? -55.087 55.945 322.533 1.00 72.43  ? 542  ALA B CB  1 
HETATM 8281 C C1  . NAG C 2 .   ? -6.785  85.768 335.658 1.00 81.59  ? 1    NAG C C1  1 
HETATM 8282 C C2  . NAG C 2 .   ? -6.329  87.067 334.999 1.00 88.15  ? 1    NAG C C2  1 
HETATM 8283 C C3  . NAG C 2 .   ? -4.834  87.266 335.206 1.00 83.53  ? 1    NAG C C3  1 
HETATM 8284 C C4  . NAG C 2 .   ? -4.509  87.256 336.693 1.00 86.10  ? 1    NAG C C4  1 
HETATM 8285 C C5  . NAG C 2 .   ? -5.021  85.963 337.333 1.00 80.33  ? 1    NAG C C5  1 
HETATM 8286 C C6  . NAG C 2 .   ? -4.894  85.969 338.838 1.00 87.08  ? 1    NAG C C6  1 
HETATM 8287 C C7  . NAG C 2 .   ? -7.493  87.997 333.050 1.00 88.77  ? 1    NAG C C7  1 
HETATM 8288 C C8  . NAG C 2 .   ? -8.074  89.002 334.001 1.00 81.28  ? 1    NAG C C8  1 
HETATM 8289 N N2  . NAG C 2 .   ? -6.663  87.093 333.584 1.00 81.79  ? 1    NAG C N2  1 
HETATM 8290 O O3  . NAG C 2 .   ? -4.435  88.504 334.627 1.00 84.17  ? 1    NAG C O3  1 
HETATM 8291 O O4  . NAG C 2 .   ? -3.102  87.387 336.878 1.00 96.65  ? 1    NAG C O4  1 
HETATM 8292 O O5  . NAG C 2 .   ? -6.420  85.780 337.053 1.00 75.08  ? 1    NAG C O5  1 
HETATM 8293 O O6  . NAG C 2 .   ? -5.192  87.262 339.347 1.00 102.78 ? 1    NAG C O6  1 
HETATM 8294 O O7  . NAG C 2 .   ? -7.763  88.003 331.853 1.00 88.13  ? 1    NAG C O7  1 
HETATM 8295 C C1  . NAG C 2 .   ? -2.777  88.491 337.770 1.00 103.89 ? 2    NAG C C1  1 
HETATM 8296 C C2  . NAG C 2 .   ? -1.355  88.266 338.304 1.00 99.37  ? 2    NAG C C2  1 
HETATM 8297 C C3  . NAG C 2 .   ? -0.951  89.412 339.232 1.00 108.39 ? 2    NAG C C3  1 
HETATM 8298 C C4  . NAG C 2 .   ? -1.156  90.759 338.549 1.00 113.39 ? 2    NAG C C4  1 
HETATM 8299 C C5  . NAG C 2 .   ? -2.581  90.871 338.016 1.00 113.78 ? 2    NAG C C5  1 
HETATM 8300 C C6  . NAG C 2 .   ? -2.828  92.145 337.242 1.00 111.88 ? 2    NAG C C6  1 
HETATM 8301 C C7  . NAG C 2 .   ? -0.730  85.894 338.448 1.00 78.30  ? 2    NAG C C7  1 
HETATM 8302 C C8  . NAG C 2 .   ? -0.722  84.667 339.309 1.00 63.50  ? 2    NAG C C8  1 
HETATM 8303 N N2  . NAG C 2 .   ? -1.262  86.991 338.997 1.00 99.40  ? 2    NAG C N2  1 
HETATM 8304 O O3  . NAG C 2 .   ? 0.414   89.260 339.603 1.00 99.20  ? 2    NAG C O3  1 
HETATM 8305 O O4  . NAG C 2 .   ? -0.914  91.816 339.472 1.00 108.98 ? 2    NAG C O4  1 
HETATM 8306 O O5  . NAG C 2 .   ? -2.851  89.779 337.123 1.00 118.98 ? 2    NAG C O5  1 
HETATM 8307 O O6  . NAG C 2 .   ? -2.057  92.192 336.049 1.00 106.70 ? 2    NAG C O6  1 
HETATM 8308 O O7  . NAG C 2 .   ? -0.277  85.891 337.309 1.00 73.62  ? 2    NAG C O7  1 
HETATM 8309 C C1  . FUC C 2 .   ? -5.976  87.196 340.554 1.00 92.62  ? 3    FUC C C1  1 
HETATM 8310 C C2  . FUC C 2 .   ? -6.046  88.643 341.073 1.00 99.21  ? 3    FUC C C2  1 
HETATM 8311 C C3  . FUC C 2 .   ? -6.884  89.510 340.121 1.00 104.14 ? 3    FUC C C3  1 
HETATM 8312 C C4  . FUC C 2 .   ? -8.273  88.902 339.974 1.00 103.07 ? 3    FUC C C4  1 
HETATM 8313 C C5  . FUC C 2 .   ? -8.128  87.474 339.445 1.00 91.92  ? 3    FUC C C5  1 
HETATM 8314 C C6  . FUC C 2 .   ? -9.450  86.731 339.340 1.00 81.85  ? 3    FUC C C6  1 
HETATM 8315 O O2  . FUC C 2 .   ? -4.748  89.200 341.258 1.00 97.38  ? 3    FUC C O2  1 
HETATM 8316 O O3  . FUC C 2 .   ? -7.036  90.827 340.642 1.00 105.60 ? 3    FUC C O3  1 
HETATM 8317 O O4  . FUC C 2 .   ? -8.912  88.879 341.241 1.00 107.98 ? 3    FUC C O4  1 
HETATM 8318 O O5  . FUC C 2 .   ? -7.269  86.676 340.300 1.00 88.49  ? 3    FUC C O5  1 
HETATM 8319 C C1  . NAG D 2 .   ? -75.647 32.603 345.739 1.00 78.60  ? 1    NAG D C1  1 
HETATM 8320 C C2  . NAG D 2 .   ? -76.581 32.011 344.674 1.00 92.55  ? 1    NAG D C2  1 
HETATM 8321 C C3  . NAG D 2 .   ? -77.002 33.079 343.670 1.00 86.45  ? 1    NAG D C3  1 
HETATM 8322 C C4  . NAG D 2 .   ? -77.572 34.298 344.381 1.00 92.36  ? 1    NAG D C4  1 
HETATM 8323 C C5  . NAG D 2 .   ? -76.582 34.806 345.425 1.00 81.08  ? 1    NAG D C5  1 
HETATM 8324 C C6  . NAG D 2 .   ? -77.109 35.977 346.230 1.00 82.54  ? 1    NAG D C6  1 
HETATM 8325 C C7  . NAG D 2 .   ? -76.538 29.709 343.805 1.00 95.55  ? 1    NAG D C7  1 
HETATM 8326 C C8  . NAG D 2 .   ? -77.924 29.569 344.359 1.00 82.98  ? 1    NAG D C8  1 
HETATM 8327 N N2  . NAG D 2 .   ? -75.947 30.895 343.989 1.00 91.63  ? 1    NAG D N2  1 
HETATM 8328 O O3  . NAG D 2 .   ? -77.984 32.533 342.797 1.00 95.74  ? 1    NAG D O3  1 
HETATM 8329 O O4  . NAG D 2 .   ? -77.807 35.314 343.414 1.00 90.22  ? 1    NAG D O4  1 
HETATM 8330 O O5  . NAG D 2 .   ? -76.270 33.752 346.349 1.00 68.37  ? 1    NAG D O5  1 
HETATM 8331 O O6  . NAG D 2 .   ? -77.285 35.677 347.607 1.00 100.93 ? 1    NAG D O6  1 
HETATM 8332 O O7  . NAG D 2 .   ? -75.976 28.788 343.218 1.00 95.36  ? 1    NAG D O7  1 
HETATM 8333 C C1  . NAG D 2 .   ? -79.148 35.821 343.536 1.00 112.07 ? 2    NAG D C1  1 
HETATM 8334 C C2  . NAG D 2 .   ? -79.094 37.231 342.941 1.00 110.98 ? 2    NAG D C2  1 
HETATM 8335 C C3  . NAG D 2 .   ? -80.492 37.864 342.883 1.00 119.81 ? 2    NAG D C3  1 
HETATM 8336 C C4  . NAG D 2 .   ? -81.551 36.891 342.374 1.00 126.22 ? 2    NAG D C4  1 
HETATM 8337 C C5  . NAG D 2 .   ? -81.413 35.535 343.053 1.00 128.18 ? 2    NAG D C5  1 
HETATM 8338 C C6  . NAG D 2 .   ? -82.361 34.486 342.519 1.00 124.67 ? 2    NAG D C6  1 
HETATM 8339 C C7  . NAG D 2 .   ? -77.188 38.769 343.221 1.00 92.19  ? 2    NAG D C7  1 
HETATM 8340 C C8  . NAG D 2 .   ? -76.371 39.551 344.206 1.00 84.16  ? 2    NAG D C8  1 
HETATM 8341 N N2  . NAG D 2 .   ? -78.199 38.059 343.734 1.00 99.91  ? 2    NAG D N2  1 
HETATM 8342 O O3  . NAG D 2 .   ? -80.431 38.985 342.008 1.00 114.68 ? 2    NAG D O3  1 
HETATM 8343 O O4  . NAG D 2 .   ? -82.847 37.410 342.651 1.00 113.28 ? 2    NAG D O4  1 
HETATM 8344 O O5  . NAG D 2 .   ? -80.088 35.046 342.838 1.00 126.34 ? 2    NAG D O5  1 
HETATM 8345 O O6  . NAG D 2 .   ? -82.210 33.261 343.224 1.00 123.51 ? 2    NAG D O6  1 
HETATM 8346 O O7  . NAG D 2 .   ? -76.947 38.785 342.018 1.00 96.26  ? 2    NAG D O7  1 
HETATM 8347 C C1  . FUC D 2 .   ? -78.596 35.120 347.857 1.00 105.31 ? 3    FUC D C1  1 
HETATM 8348 C C2  . FUC D 2 .   ? -78.394 34.172 349.033 1.00 97.86  ? 3    FUC D C2  1 
HETATM 8349 C C3  . FUC D 2 .   ? -79.700 33.492 349.402 1.00 105.65 ? 3    FUC D C3  1 
HETATM 8350 C C4  . FUC D 2 .   ? -80.764 34.543 349.772 1.00 111.53 ? 3    FUC D C4  1 
HETATM 8351 C C5  . FUC D 2 .   ? -80.856 35.677 348.700 1.00 109.08 ? 3    FUC D C5  1 
HETATM 8352 C C6  . FUC D 2 .   ? -81.763 35.344 347.510 1.00 93.13  ? 3    FUC D C6  1 
HETATM 8353 O O2  . FUC D 2 .   ? -77.848 34.848 350.156 1.00 106.65 ? 3    FUC D O2  1 
HETATM 8354 O O3  . FUC D 2 .   ? -80.180 32.717 348.300 1.00 100.09 ? 3    FUC D O3  1 
HETATM 8355 O O4  . FUC D 2 .   ? -82.029 33.918 349.939 1.00 106.92 ? 3    FUC D O4  1 
HETATM 8356 O O5  . FUC D 2 .   ? -79.560 36.118 348.161 1.00 107.12 ? 3    FUC D O5  1 
HETATM 8357 C C1  . NAG E 3 .   ? -28.395 71.449 348.939 1.00 109.66 ? 604  NAG A C1  1 
HETATM 8358 C C2  . NAG E 3 .   ? -27.670 71.998 350.143 1.00 111.47 ? 604  NAG A C2  1 
HETATM 8359 C C3  . NAG E 3 .   ? -28.703 72.466 351.160 1.00 117.57 ? 604  NAG A C3  1 
HETATM 8360 C C4  . NAG E 3 .   ? -29.664 73.465 350.516 1.00 126.27 ? 604  NAG A C4  1 
HETATM 8361 C C5  . NAG E 3 .   ? -30.183 72.986 349.151 1.00 120.49 ? 604  NAG A C5  1 
HETATM 8362 C C6  . NAG E 3 .   ? -30.837 74.085 348.345 1.00 115.57 ? 604  NAG A C6  1 
HETATM 8363 C C7  . NAG E 3 .   ? -25.436 71.194 350.747 1.00 102.36 ? 604  NAG A C7  1 
HETATM 8364 C C8  . NAG E 3 .   ? -24.640 70.098 351.389 1.00 94.54  ? 604  NAG A C8  1 
HETATM 8365 N N2  . NAG E 3 .   ? -26.763 71.023 350.727 1.00 104.69 ? 604  NAG A N2  1 
HETATM 8366 O O3  . NAG E 3 .   ? -28.061 73.042 352.292 1.00 112.55 ? 604  NAG A O3  1 
HETATM 8367 O O4  . NAG E 3 .   ? -30.792 73.656 351.363 1.00 123.40 ? 604  NAG A O4  1 
HETATM 8368 O O5  . NAG E 3 .   ? -29.121 72.477 348.331 1.00 121.12 ? 604  NAG A O5  1 
HETATM 8369 O O6  . NAG E 3 .   ? -31.454 75.056 349.178 1.00 116.30 ? 604  NAG A O6  1 
HETATM 8370 O O7  . NAG E 3 .   ? -24.901 72.188 350.264 1.00 106.67 ? 604  NAG A O7  1 
HETATM 8371 O O3  . HLO F 4 .   ? 3.413   77.452 354.812 1.00 59.56  ? 605  HLO A O3  1 
HETATM 8372 C C14 . HLO F 4 .   ? 3.208   76.295 354.650 1.00 56.20  ? 605  HLO A C14 1 
HETATM 8373 N N4  . HLO F 4 .   ? 3.495   75.345 355.704 1.00 60.10  ? 605  HLO A N4  1 
HETATM 8374 C C11 . HLO F 4 .   ? 2.618   75.809 353.336 1.00 47.02  ? 605  HLO A C11 1 
HETATM 8375 C C10 . HLO F 4 .   ? 2.301   74.502 353.166 1.00 42.27  ? 605  HLO A C10 1 
HETATM 8376 C C9  . HLO F 4 .   ? 1.765   74.084 351.961 1.00 42.89  ? 605  HLO A C9  1 
HETATM 8377 N N3  . HLO F 4 .   ? 1.570   74.982 350.971 1.00 49.97  ? 605  HLO A N3  1 
HETATM 8378 C C13 . HLO F 4 .   ? 1.869   76.285 351.143 1.00 57.19  ? 605  HLO A C13 1 
HETATM 8379 C C12 . HLO F 4 .   ? 2.407   76.705 352.345 1.00 46.15  ? 605  HLO A C12 1 
HETATM 8380 C C8  . HLO F 4 .   ? 0.985   74.568 349.722 1.00 59.64  ? 605  HLO A C8  1 
HETATM 8381 O O2  . HLO F 4 .   ? -0.363  74.865 349.926 1.00 61.58  ? 605  HLO A O2  1 
HETATM 8382 C C7  . HLO F 4 .   ? -1.042  75.402 348.838 1.00 71.02  ? 605  HLO A C7  1 
HETATM 8383 N N2  . HLO F 4 .   ? -1.637  74.294 348.115 1.00 73.30  ? 605  HLO A N2  1 
HETATM 8384 C C2  . HLO F 4 .   ? -2.681  73.610 348.645 1.00 66.21  ? 605  HLO A C2  1 
HETATM 8385 C C1  . HLO F 4 .   ? -3.259  73.981 350.009 1.00 66.93  ? 605  HLO A C1  1 
HETATM 8386 N N1  . HLO F 4 .   ? -3.309  73.104 350.900 1.00 58.90  ? 605  HLO A N1  1 
HETATM 8387 O O1  . HLO F 4 .   ? -3.830  73.385 352.175 1.00 68.00  ? 605  HLO A O1  1 
HETATM 8388 C C3  . HLO F 4 .   ? -3.231  72.548 347.946 1.00 63.08  ? 605  HLO A C3  1 
HETATM 8389 C C4  . HLO F 4 .   ? -2.722  72.204 346.738 1.00 73.39  ? 605  HLO A C4  1 
HETATM 8390 C C5  . HLO F 4 .   ? -1.682  72.893 346.213 1.00 61.80  ? 605  HLO A C5  1 
HETATM 8391 C C6  . HLO F 4 .   ? -1.130  73.950 346.911 1.00 60.38  ? 605  HLO A C6  1 
HETATM 8392 C C22 . HLO F 4 .   ? -3.310  71.040 345.944 1.00 76.98  ? 605  HLO A C22 1 
HETATM 8393 N N5  . HLO F 4 .   ? -4.039  70.177 346.475 1.00 78.83  ? 605  HLO A N5  1 
HETATM 8394 O O4  . HLO F 4 .   ? -4.545  69.136 345.681 1.00 83.60  ? 605  HLO A O4  1 
HETATM 8395 C C1  . FUC G 5 .   ? 26.382  68.480 377.501 1.00 132.44 ? 606  FUC A C1  1 
HETATM 8396 C C2  . FUC G 5 .   ? 27.271  69.160 376.468 1.00 129.95 ? 606  FUC A C2  1 
HETATM 8397 C C3  . FUC G 5 .   ? 26.544  70.332 375.763 1.00 131.40 ? 606  FUC A C3  1 
HETATM 8398 C C4  . FUC G 5 .   ? 25.062  70.020 375.376 1.00 131.86 ? 606  FUC A C4  1 
HETATM 8399 C C5  . FUC G 5 .   ? 24.339  69.076 376.380 1.00 138.37 ? 606  FUC A C5  1 
HETATM 8400 C C6  . FUC G 5 .   ? 23.686  69.809 377.553 1.00 129.43 ? 606  FUC A C6  1 
HETATM 8401 O O2  . FUC G 5 .   ? 27.795  68.237 375.519 1.00 121.26 ? 606  FUC A O2  1 
HETATM 8402 O O3  . FUC G 5 .   ? 26.559  71.499 376.590 1.00 128.97 ? 606  FUC A O3  1 
HETATM 8403 O O4  . FUC G 5 .   ? 24.333  71.235 375.271 1.00 128.59 ? 606  FUC A O4  1 
HETATM 8404 O O5  . FUC G 5 .   ? 25.185  68.047 376.943 1.00 136.48 ? 606  FUC A O5  1 
HETATM 8405 C C1  . NAG H 3 .   ? 27.521  66.622 370.571 1.00 116.19 ? 607  NAG A C1  1 
HETATM 8406 C C2  . NAG H 3 .   ? 28.044  65.205 370.793 1.00 127.34 ? 607  NAG A C2  1 
HETATM 8407 C C3  . NAG H 3 .   ? 26.889  64.251 371.106 1.00 123.06 ? 607  NAG A C3  1 
HETATM 8408 C C4  . NAG H 3 .   ? 26.007  64.803 372.219 1.00 123.20 ? 607  NAG A C4  1 
HETATM 8409 C C5  . NAG H 3 .   ? 25.588  66.234 371.911 1.00 116.99 ? 607  NAG A C5  1 
HETATM 8410 C C6  . NAG H 3 .   ? 24.808  66.882 373.031 1.00 115.41 ? 607  NAG A C6  1 
HETATM 8411 C C7  . NAG H 3 .   ? 29.866  65.347 369.135 1.00 106.80 ? 607  NAG A C7  1 
HETATM 8412 C C8  . NAG H 3 .   ? 30.478  64.712 367.922 1.00 97.21  ? 607  NAG A C8  1 
HETATM 8413 N N2  . NAG H 3 .   ? 28.780  64.739 369.627 1.00 122.72 ? 607  NAG A N2  1 
HETATM 8414 O O3  . NAG H 3 .   ? 27.419  62.991 371.501 1.00 128.09 ? 607  NAG A O3  1 
HETATM 8415 O O4  . NAG H 3 .   ? 24.844  63.995 372.361 1.00 134.44 ? 607  NAG A O4  1 
HETATM 8416 O O5  . NAG H 3 .   ? 26.757  67.036 371.699 1.00 113.59 ? 607  NAG A O5  1 
HETATM 8417 O O6  . NAG H 3 .   ? 25.585  66.990 374.215 1.00 116.57 ? 607  NAG A O6  1 
HETATM 8418 O O7  . NAG H 3 .   ? 30.339  66.360 369.645 1.00 101.93 ? 607  NAG A O7  1 
HETATM 8419 C C1  . NAG I 3 .   ? 26.339  62.814 375.006 1.00 127.45 ? 608  NAG A C1  1 
HETATM 8420 C C2  . NAG I 3 .   ? 25.255  62.395 375.977 1.00 133.07 ? 608  NAG A C2  1 
HETATM 8421 C C3  . NAG I 3 .   ? 25.826  62.246 377.393 1.00 135.45 ? 608  NAG A C3  1 
HETATM 8422 C C4  . NAG I 3 .   ? 27.206  62.888 377.536 1.00 140.31 ? 608  NAG A C4  1 
HETATM 8423 C C5  . NAG I 3 .   ? 28.182  62.468 376.430 1.00 136.96 ? 608  NAG A C5  1 
HETATM 8424 C C6  . NAG I 3 .   ? 29.056  61.300 376.824 1.00 133.16 ? 608  NAG A C6  1 
HETATM 8425 C C7  . NAG I 3 .   ? 23.025  63.149 375.260 1.00 128.04 ? 608  NAG A C7  1 
HETATM 8426 C C8  . NAG I 3 .   ? 22.955  61.884 374.454 1.00 119.67 ? 608  NAG A C8  1 
HETATM 8427 N N2  . NAG I 3 .   ? 24.147  63.337 375.966 1.00 130.19 ? 608  NAG A N2  1 
HETATM 8428 O O3  . NAG I 3 .   ? 25.896  60.865 377.730 1.00 129.30 ? 608  NAG A O3  1 
HETATM 8429 O O4  . NAG I 3 .   ? 27.097  64.307 377.574 1.00 136.55 ? 608  NAG A O4  1 
HETATM 8430 O O5  . NAG I 3 .   ? 27.485  62.070 375.241 1.00 134.17 ? 608  NAG A O5  1 
HETATM 8431 O O6  . NAG I 3 .   ? 29.247  60.411 375.733 1.00 124.21 ? 608  NAG A O6  1 
HETATM 8432 O O7  . NAG I 3 .   ? 22.106  63.963 375.271 1.00 119.04 ? 608  NAG A O7  1 
HETATM 8433 C C1  . NAG J 3 .   ? -63.530 30.352 370.229 1.00 125.71 ? 604  NAG B C1  1 
HETATM 8434 C C2  . NAG J 3 .   ? -64.275 29.725 371.427 1.00 124.90 ? 604  NAG B C2  1 
HETATM 8435 C C3  . NAG J 3 .   ? -65.548 30.527 371.740 1.00 128.06 ? 604  NAG B C3  1 
HETATM 8436 C C4  . NAG J 3 .   ? -65.245 32.018 371.851 1.00 130.32 ? 604  NAG B C4  1 
HETATM 8437 C C5  . NAG J 3 .   ? -64.470 32.490 370.626 1.00 124.96 ? 604  NAG B C5  1 
HETATM 8438 C C6  . NAG J 3 .   ? -64.042 33.937 370.695 1.00 122.15 ? 604  NAG B C6  1 
HETATM 8439 C C7  . NAG J 3 .   ? -65.302 27.858 370.161 1.00 126.57 ? 604  NAG B C7  1 
HETATM 8440 C C8  . NAG J 3 .   ? -65.529 26.376 370.134 1.00 118.25 ? 604  NAG B C8  1 
HETATM 8441 N N2  . NAG J 3 .   ? -64.596 28.321 371.203 1.00 121.72 ? 604  NAG B N2  1 
HETATM 8442 O O3  . NAG J 3 .   ? -66.140 30.058 372.947 1.00 130.54 ? 604  NAG B O3  1 
HETATM 8443 O O4  . NAG J 3 .   ? -66.456 32.759 371.945 1.00 129.49 ? 604  NAG B O4  1 
HETATM 8444 O O5  . NAG J 3 .   ? -63.273 31.718 370.494 1.00 121.69 ? 604  NAG B O5  1 
HETATM 8445 O O6  . NAG J 3 .   ? -63.244 34.279 369.570 1.00 120.98 ? 604  NAG B O6  1 
HETATM 8446 O O7  . NAG J 3 .   ? -65.733 28.596 369.277 1.00 131.74 ? 604  NAG B O7  1 
HETATM 8447 O O3  . HLO K 4 .   ? -74.080 54.513 352.450 1.00 79.36  ? 605  HLO B O3  1 
HETATM 8448 C C14 . HLO K 4 .   ? -72.963 54.653 352.827 1.00 67.15  ? 605  HLO B C14 1 
HETATM 8449 N N4  . HLO K 4 .   ? -72.604 55.789 353.660 1.00 68.40  ? 605  HLO B N4  1 
HETATM 8450 C C11 . HLO K 4 .   ? -71.915 53.603 352.482 1.00 60.88  ? 605  HLO B C11 1 
HETATM 8451 C C10 . HLO K 4 .   ? -72.311 52.482 351.836 1.00 63.87  ? 605  HLO B C10 1 
HETATM 8452 C C9  . HLO K 4 .   ? -71.384 51.507 351.523 1.00 72.27  ? 605  HLO B C9  1 
HETATM 8453 N N3  . HLO K 4 .   ? -70.090 51.678 351.865 1.00 69.80  ? 605  HLO B N3  1 
HETATM 8454 C C13 . HLO K 4 .   ? -69.682 52.789 352.516 1.00 59.79  ? 605  HLO B C13 1 
HETATM 8455 C C12 . HLO K 4 .   ? -70.612 53.766 352.834 1.00 63.96  ? 605  HLO B C12 1 
HETATM 8456 C C8  . HLO K 4 .   ? -69.163 50.627 351.523 1.00 73.81  ? 605  HLO B C8  1 
HETATM 8457 O O2  . HLO K 4 .   ? -69.872 49.435 351.694 1.00 76.34  ? 605  HLO B O2  1 
HETATM 8458 C C7  . HLO K 4 .   ? -69.513 48.436 350.789 1.00 93.39  ? 605  HLO B C7  1 
HETATM 8459 N N2  . HLO K 4 .   ? -68.301 47.855 351.319 1.00 74.51  ? 605  HLO B N2  1 
HETATM 8460 C C2  . HLO K 4 .   ? -67.104 47.817 350.663 1.00 74.71  ? 605  HLO B C2  1 
HETATM 8461 C C1  . HLO K 4 .   ? -66.755 48.369 349.265 1.00 81.48  ? 605  HLO B C1  1 
HETATM 8462 N N1  . HLO K 4 .   ? -67.415 48.614 348.217 1.00 74.00  ? 605  HLO B N1  1 
HETATM 8463 O O1  . HLO K 4 .   ? -68.792 48.455 347.991 1.00 81.84  ? 605  HLO B O1  1 
HETATM 8464 C C3  . HLO K 4 .   ? -66.033 47.242 351.331 1.00 78.26  ? 605  HLO B C3  1 
HETATM 8465 C C4  . HLO K 4 .   ? -66.160 46.724 352.574 1.00 84.48  ? 605  HLO B C4  1 
HETATM 8466 C C5  . HLO K 4 .   ? -67.349 46.765 353.211 1.00 81.40  ? 605  HLO B C5  1 
HETATM 8467 C C6  . HLO K 4 .   ? -68.423 47.344 352.566 1.00 76.74  ? 605  HLO B C6  1 
HETATM 8468 C C22 . HLO K 4 .   ? -64.945 46.105 353.254 1.00 88.69  ? 605  HLO B C22 1 
HETATM 8469 N N5  . HLO K 4 .   ? -63.901 45.917 352.594 1.00 93.15  ? 605  HLO B N5  1 
HETATM 8470 O O4  . HLO K 4 .   ? -62.776 45.348 353.208 1.00 95.06  ? 605  HLO B O4  1 
HETATM 8471 O O   . HOH L 6 .   ? 17.772  47.582 348.298 1.00 62.94  ? 701  HOH A O   1 
HETATM 8472 O O   . HOH L 6 .   ? -8.206  78.889 350.489 1.00 60.93  ? 702  HOH A O   1 
HETATM 8473 O O   . HOH L 6 .   ? -2.154  68.581 326.257 1.00 62.26  ? 703  HOH A O   1 
HETATM 8474 O O   . HOH L 6 .   ? -22.911 51.881 375.369 1.00 68.27  ? 704  HOH A O   1 
HETATM 8475 O O   . HOH L 6 .   ? 23.427  69.495 362.601 1.00 63.91  ? 705  HOH A O   1 
HETATM 8476 O O   . HOH L 6 .   ? -5.928  66.013 331.152 1.00 66.21  ? 706  HOH A O   1 
HETATM 8477 O O   . HOH L 6 .   ? 14.247  55.211 353.852 1.00 58.89  ? 707  HOH A O   1 
HETATM 8478 O O   . HOH L 6 .   ? -14.604 38.909 341.245 1.00 76.12  ? 708  HOH A O   1 
HETATM 8479 O O   . HOH L 6 .   ? -5.315  47.823 380.180 1.00 47.49  ? 709  HOH A O   1 
HETATM 8480 O O   . HOH L 6 .   ? -17.701 57.940 379.484 1.00 48.50  ? 710  HOH A O   1 
HETATM 8481 O O   . HOH L 6 .   ? -30.373 65.575 349.581 1.00 60.92  ? 711  HOH A O   1 
HETATM 8482 O O   . HOH L 6 .   ? -2.261  58.959 370.886 1.00 36.73  ? 712  HOH A O   1 
HETATM 8483 O O   . HOH L 6 .   ? 5.424   70.143 339.591 1.00 42.10  ? 713  HOH A O   1 
HETATM 8484 O O   . HOH L 6 .   ? 5.560   71.746 359.285 1.00 43.97  ? 714  HOH A O   1 
HETATM 8485 O O   . HOH L 6 .   ? -9.136  48.931 380.206 1.00 47.02  ? 715  HOH A O   1 
HETATM 8486 O O   . HOH L 6 .   ? -19.373 46.027 366.732 1.00 53.46  ? 716  HOH A O   1 
HETATM 8487 O O   . HOH L 6 .   ? -17.916 55.519 353.450 1.00 46.10  ? 717  HOH A O   1 
HETATM 8488 O O   . HOH L 6 .   ? -2.816  78.635 350.824 1.00 60.88  ? 718  HOH A O   1 
HETATM 8489 O O   . HOH L 6 .   ? -22.310 49.530 346.898 1.00 46.26  ? 719  HOH A O   1 
HETATM 8490 O O   . HOH L 6 .   ? -10.504 38.338 351.273 1.00 56.34  ? 720  HOH A O   1 
HETATM 8491 O O   . HOH L 6 .   ? -5.360  69.366 331.620 1.00 94.42  ? 721  HOH A O   1 
HETATM 8492 O O   . HOH L 6 .   ? -18.416 58.392 360.554 1.00 50.16  ? 722  HOH A O   1 
HETATM 8493 O O   . HOH L 6 .   ? 9.959   59.406 344.727 1.00 42.79  ? 723  HOH A O   1 
HETATM 8494 O O   . HOH L 6 .   ? 8.005   67.153 347.492 1.00 33.31  ? 724  HOH A O   1 
HETATM 8495 O O   . HOH L 6 .   ? 13.982  55.499 356.935 1.00 54.43  ? 725  HOH A O   1 
HETATM 8496 O O   . HOH L 6 .   ? -1.293  61.291 370.111 1.00 40.56  ? 726  HOH A O   1 
HETATM 8497 O O   . HOH L 6 .   ? -17.321 54.713 330.706 1.00 52.80  ? 727  HOH A O   1 
HETATM 8498 O O   . HOH L 6 .   ? -0.072  50.609 369.584 1.00 52.46  ? 728  HOH A O   1 
HETATM 8499 O O   . HOH L 6 .   ? -18.581 68.013 345.123 1.00 55.04  ? 729  HOH A O   1 
HETATM 8500 O O   . HOH L 6 .   ? -19.413 57.913 375.659 1.00 47.27  ? 730  HOH A O   1 
HETATM 8501 O O   . HOH L 6 .   ? 7.473   59.285 336.257 1.00 43.25  ? 731  HOH A O   1 
HETATM 8502 O O   . HOH L 6 .   ? 2.023   71.514 357.263 1.00 40.45  ? 732  HOH A O   1 
HETATM 8503 O O   . HOH L 6 .   ? 5.462   84.774 321.508 1.00 68.89  ? 733  HOH A O   1 
HETATM 8504 O O   . HOH L 6 .   ? -13.717 42.676 372.961 1.00 53.87  ? 734  HOH A O   1 
HETATM 8505 O O   . HOH L 6 .   ? 11.658  79.129 348.350 1.00 73.97  ? 735  HOH A O   1 
HETATM 8506 O O   . HOH L 6 .   ? -5.637  56.322 325.923 1.00 48.27  ? 736  HOH A O   1 
HETATM 8507 O O   . HOH L 6 .   ? 11.391  65.626 345.813 1.00 42.44  ? 737  HOH A O   1 
HETATM 8508 O O   . HOH L 6 .   ? 5.312   76.601 314.706 1.00 50.05  ? 738  HOH A O   1 
HETATM 8509 O O   . HOH L 6 .   ? 18.949  58.103 361.817 1.00 57.79  ? 739  HOH A O   1 
HETATM 8510 O O   . HOH L 6 .   ? -7.457  61.983 342.930 1.00 39.03  ? 740  HOH A O   1 
HETATM 8511 O O   . HOH L 6 .   ? 2.650   43.173 331.743 1.00 55.66  ? 741  HOH A O   1 
HETATM 8512 O O   . HOH L 6 .   ? 3.376   77.498 345.073 1.00 41.43  ? 742  HOH A O   1 
HETATM 8513 O O   . HOH L 6 .   ? 5.171   67.993 353.235 1.00 40.13  ? 743  HOH A O   1 
HETATM 8514 O O   . HOH L 6 .   ? -2.638  45.324 359.103 1.00 48.37  ? 744  HOH A O   1 
HETATM 8515 O O   . HOH L 6 .   ? -5.483  71.772 353.420 1.00 51.04  ? 745  HOH A O   1 
HETATM 8516 O O   . HOH L 6 .   ? 5.408   73.737 345.733 1.00 55.76  ? 746  HOH A O   1 
HETATM 8517 O O   . HOH L 6 .   ? -19.381 47.095 335.282 1.00 51.88  ? 747  HOH A O   1 
HETATM 8518 O O   . HOH L 6 .   ? -14.164 61.051 358.087 1.00 44.00  ? 748  HOH A O   1 
HETATM 8519 O O   . HOH L 6 .   ? -16.293 64.199 359.488 1.00 48.27  ? 749  HOH A O   1 
HETATM 8520 O O   . HOH L 6 .   ? -16.005 60.514 329.493 1.00 73.80  ? 750  HOH A O   1 
HETATM 8521 O O   . HOH L 6 .   ? -11.495 58.451 357.916 1.00 36.75  ? 751  HOH A O   1 
HETATM 8522 O O   . HOH L 6 .   ? -5.588  65.863 371.031 1.00 45.87  ? 752  HOH A O   1 
HETATM 8523 O O   . HOH L 6 .   ? 24.081  63.416 363.758 1.00 59.57  ? 753  HOH A O   1 
HETATM 8524 O O   . HOH L 6 .   ? 12.035  65.262 354.369 1.00 32.52  ? 754  HOH A O   1 
HETATM 8525 O O   . HOH L 6 .   ? -11.050 59.077 371.961 1.00 45.16  ? 755  HOH A O   1 
HETATM 8526 O O   . HOH L 6 .   ? 5.898   59.425 320.152 1.00 39.32  ? 756  HOH A O   1 
HETATM 8527 O O   . HOH L 6 .   ? 11.405  68.426 338.724 1.00 49.78  ? 757  HOH A O   1 
HETATM 8528 O O   . HOH L 6 .   ? 13.614  76.244 337.305 1.00 58.38  ? 758  HOH A O   1 
HETATM 8529 O O   . HOH L 6 .   ? 5.883   69.644 371.372 1.00 50.65  ? 759  HOH A O   1 
HETATM 8530 O O   . HOH L 6 .   ? 6.809   64.811 365.706 1.00 40.20  ? 760  HOH A O   1 
HETATM 8531 O O   . HOH L 6 .   ? 4.632   66.135 366.923 1.00 42.79  ? 761  HOH A O   1 
HETATM 8532 O O   . HOH L 6 .   ? -6.862  47.628 333.806 1.00 45.19  ? 762  HOH A O   1 
HETATM 8533 O O   . HOH L 6 .   ? -6.476  64.763 353.387 1.00 36.23  ? 763  HOH A O   1 
HETATM 8534 O O   . HOH L 6 .   ? -12.733 70.278 356.188 1.00 44.51  ? 764  HOH A O   1 
HETATM 8535 O O   . HOH L 6 .   ? -4.050  64.839 360.680 1.00 38.68  ? 765  HOH A O   1 
HETATM 8536 O O   . HOH L 6 .   ? -9.403  60.453 373.380 1.00 48.04  ? 766  HOH A O   1 
HETATM 8537 O O   . HOH L 6 .   ? -26.616 63.608 348.008 1.00 45.12  ? 767  HOH A O   1 
HETATM 8538 O O   . HOH L 6 .   ? -14.559 41.673 370.605 1.00 57.07  ? 768  HOH A O   1 
HETATM 8539 O O   . HOH L 6 .   ? 8.736   69.599 371.273 1.00 53.75  ? 769  HOH A O   1 
HETATM 8540 O O   . HOH L 6 .   ? -25.851 51.725 349.105 1.00 61.94  ? 770  HOH A O   1 
HETATM 8541 O O   . HOH L 6 .   ? -26.500 68.677 342.175 1.00 58.16  ? 771  HOH A O   1 
HETATM 8542 O O   . HOH L 6 .   ? -6.595  61.961 350.205 1.00 40.39  ? 772  HOH A O   1 
HETATM 8543 O O   . HOH L 6 .   ? -7.287  73.365 351.324 1.00 48.54  ? 773  HOH A O   1 
HETATM 8544 O O   . HOH L 6 .   ? -2.735  79.209 357.658 1.00 54.21  ? 774  HOH A O   1 
HETATM 8545 O O   . HOH L 6 .   ? -1.989  42.591 335.523 1.00 47.07  ? 775  HOH A O   1 
HETATM 8546 O O   . HOH L 6 .   ? -13.754 63.894 346.634 1.00 43.75  ? 776  HOH A O   1 
HETATM 8547 O O   . HOH L 6 .   ? 14.167  67.456 356.413 1.00 37.68  ? 777  HOH A O   1 
HETATM 8548 O O   . HOH L 6 .   ? 12.423  62.619 362.293 1.00 42.95  ? 778  HOH A O   1 
HETATM 8549 O O   . HOH L 6 .   ? -4.808  71.791 355.914 1.00 47.86  ? 779  HOH A O   1 
HETATM 8550 O O   . HOH L 6 .   ? -9.742  60.194 365.313 1.00 41.43  ? 780  HOH A O   1 
HETATM 8551 O O   . HOH L 6 .   ? -7.804  58.582 341.444 1.00 39.97  ? 781  HOH A O   1 
HETATM 8552 O O   . HOH L 6 .   ? -21.712 43.638 348.777 1.00 64.10  ? 782  HOH A O   1 
HETATM 8553 O O   . HOH L 6 .   ? 13.126  74.144 336.204 1.00 50.27  ? 783  HOH A O   1 
HETATM 8554 O O   . HOH L 6 .   ? 8.369   83.532 329.952 1.00 58.84  ? 784  HOH A O   1 
HETATM 8555 O O   . HOH L 6 .   ? 2.415   71.594 370.804 1.00 52.17  ? 785  HOH A O   1 
HETATM 8556 O O   . HOH L 6 .   ? -6.056  68.727 339.477 1.00 38.82  ? 786  HOH A O   1 
HETATM 8557 O O   . HOH L 6 .   ? -10.013 48.288 383.586 1.00 65.44  ? 787  HOH A O   1 
HETATM 8558 O O   . HOH L 6 .   ? -5.900  57.956 356.901 1.00 32.42  ? 788  HOH A O   1 
HETATM 8559 O O   . HOH L 6 .   ? 9.187   80.610 335.839 1.00 56.09  ? 789  HOH A O   1 
HETATM 8560 O O   . HOH L 6 .   ? -29.121 57.857 350.461 1.00 45.25  ? 790  HOH A O   1 
HETATM 8561 O O   . HOH L 6 .   ? 9.119   49.648 361.954 1.00 59.04  ? 791  HOH A O   1 
HETATM 8562 O O   . HOH L 6 .   ? 15.601  77.643 350.318 1.00 59.15  ? 792  HOH A O   1 
HETATM 8563 O O   . HOH L 6 .   ? -4.784  63.934 333.953 1.00 50.41  ? 793  HOH A O   1 
HETATM 8564 O O   . HOH L 6 .   ? -9.197  66.962 329.939 1.00 66.49  ? 794  HOH A O   1 
HETATM 8565 O O   . HOH L 6 .   ? -1.703  76.190 360.870 1.00 44.47  ? 795  HOH A O   1 
HETATM 8566 O O   . HOH L 6 .   ? -2.073  54.285 379.643 1.00 66.17  ? 796  HOH A O   1 
HETATM 8567 O O   . HOH L 6 .   ? 6.061   78.893 355.127 1.00 49.79  ? 797  HOH A O   1 
HETATM 8568 O O   . HOH L 6 .   ? 1.745   79.729 333.740 1.00 51.51  ? 798  HOH A O   1 
HETATM 8569 O O   . HOH L 6 .   ? -21.918 55.712 372.847 1.00 63.20  ? 799  HOH A O   1 
HETATM 8570 O O   . HOH L 6 .   ? 0.195   52.988 329.530 1.00 48.37  ? 800  HOH A O   1 
HETATM 8571 O O   . HOH L 6 .   ? -8.853  59.702 329.722 1.00 67.86  ? 801  HOH A O   1 
HETATM 8572 O O   . HOH L 6 .   ? -4.381  48.013 371.828 1.00 54.55  ? 802  HOH A O   1 
HETATM 8573 O O   . HOH L 6 .   ? -3.442  71.484 324.713 1.00 50.36  ? 803  HOH A O   1 
HETATM 8574 O O   . HOH L 6 .   ? -24.189 68.732 348.109 1.00 60.66  ? 804  HOH A O   1 
HETATM 8575 O O   . HOH L 6 .   ? -6.662  74.460 366.083 1.00 56.20  ? 805  HOH A O   1 
HETATM 8576 O O   . HOH L 6 .   ? -29.702 64.552 346.665 1.00 54.83  ? 806  HOH A O   1 
HETATM 8577 O O   . HOH L 6 .   ? -16.368 40.322 346.125 1.00 56.09  ? 807  HOH A O   1 
HETATM 8578 O O   . HOH L 6 .   ? -14.432 67.919 356.163 1.00 38.87  ? 808  HOH A O   1 
HETATM 8579 O O   . HOH L 6 .   ? 16.685  48.655 355.112 1.00 58.10  ? 809  HOH A O   1 
HETATM 8580 O O   . HOH L 6 .   ? 16.346  65.139 346.556 1.00 49.48  ? 810  HOH A O   1 
HETATM 8581 O O   . HOH L 6 .   ? -8.702  73.771 363.396 1.00 59.21  ? 811  HOH A O   1 
HETATM 8582 O O   . HOH L 6 .   ? 15.032  57.523 366.966 1.00 61.26  ? 812  HOH A O   1 
HETATM 8583 O O   . HOH L 6 .   ? -17.822 53.787 334.089 1.00 47.66  ? 813  HOH A O   1 
HETATM 8584 O O   . HOH L 6 .   ? -4.491  50.860 371.394 1.00 49.21  ? 814  HOH A O   1 
HETATM 8585 O O   . HOH L 6 .   ? 1.875   67.128 362.106 1.00 34.77  ? 815  HOH A O   1 
HETATM 8586 O O   . HOH L 6 .   ? -6.533  67.522 353.233 1.00 38.98  ? 816  HOH A O   1 
HETATM 8587 O O   . HOH L 6 .   ? 6.305   69.958 354.163 1.00 47.66  ? 817  HOH A O   1 
HETATM 8588 O O   . HOH L 6 .   ? -31.801 63.184 340.762 1.00 66.48  ? 818  HOH A O   1 
HETATM 8589 O O   . HOH L 6 .   ? 19.455  59.850 349.647 1.00 48.60  ? 819  HOH A O   1 
HETATM 8590 O O   . HOH L 6 .   ? -6.201  38.036 351.670 1.00 59.68  ? 820  HOH A O   1 
HETATM 8591 O O   . HOH L 6 .   ? 0.502   40.747 335.217 1.00 55.46  ? 821  HOH A O   1 
HETATM 8592 O O   . HOH L 6 .   ? 20.014  65.034 348.393 1.00 45.79  ? 822  HOH A O   1 
HETATM 8593 O O   . HOH L 6 .   ? -18.571 60.588 361.377 1.00 55.36  ? 823  HOH A O   1 
HETATM 8594 O O   . HOH L 6 .   ? -9.167  74.660 359.185 1.00 55.54  ? 824  HOH A O   1 
HETATM 8595 O O   . HOH L 6 .   ? 14.303  58.957 370.446 1.00 109.25 ? 825  HOH A O   1 
HETATM 8596 O O   . HOH L 6 .   ? -15.255 45.046 376.154 1.00 49.68  ? 826  HOH A O   1 
HETATM 8597 O O   . HOH L 6 .   ? -14.665 76.813 330.262 1.00 69.50  ? 827  HOH A O   1 
HETATM 8598 O O   . HOH L 6 .   ? 13.011  49.180 351.397 1.00 57.21  ? 828  HOH A O   1 
HETATM 8599 O O   . HOH L 6 .   ? -9.459  43.346 352.219 1.00 43.50  ? 829  HOH A O   1 
HETATM 8600 O O   . HOH L 6 .   ? -14.784 78.609 341.931 1.00 55.35  ? 830  HOH A O   1 
HETATM 8601 O O   . HOH L 6 .   ? -6.588  40.982 364.792 1.00 43.03  ? 831  HOH A O   1 
HETATM 8602 O O   . HOH L 6 .   ? -12.257 61.321 370.871 1.00 44.61  ? 832  HOH A O   1 
HETATM 8603 O O   . HOH L 6 .   ? -0.502  64.047 353.563 1.00 34.00  ? 833  HOH A O   1 
HETATM 8604 O O   . HOH L 6 .   ? -3.867  45.376 329.549 1.00 49.29  ? 834  HOH A O   1 
HETATM 8605 O O   . HOH L 6 .   ? 11.350  62.254 356.408 1.00 43.20  ? 835  HOH A O   1 
HETATM 8606 O O   . HOH L 6 .   ? -14.305 77.579 333.415 1.00 60.84  ? 836  HOH A O   1 
HETATM 8607 O O   . HOH L 6 .   ? -13.387 83.683 344.748 1.00 65.87  ? 837  HOH A O   1 
HETATM 8608 O O   . HOH L 6 .   ? 5.174   58.370 370.352 1.00 48.45  ? 838  HOH A O   1 
HETATM 8609 O O   . HOH L 6 .   ? 1.069   74.981 321.683 1.00 49.58  ? 839  HOH A O   1 
HETATM 8610 O O   . HOH L 6 .   ? -17.821 42.158 352.513 1.00 53.06  ? 840  HOH A O   1 
HETATM 8611 O O   . HOH L 6 .   ? -8.517  64.341 362.994 1.00 43.46  ? 841  HOH A O   1 
HETATM 8612 O O   . HOH L 6 .   ? -2.354  56.707 325.450 1.00 62.08  ? 842  HOH A O   1 
HETATM 8613 O O   . HOH L 6 .   ? 1.937   55.134 329.915 1.00 45.00  ? 843  HOH A O   1 
HETATM 8614 O O   . HOH L 6 .   ? 1.335   39.780 352.847 1.00 55.80  ? 844  HOH A O   1 
HETATM 8615 O O   . HOH L 6 .   ? 3.245   74.139 370.253 1.00 57.63  ? 845  HOH A O   1 
HETATM 8616 O O   . HOH L 6 .   ? -15.460 47.827 376.557 1.00 46.68  ? 846  HOH A O   1 
HETATM 8617 O O   . HOH L 6 .   ? -13.130 54.433 382.539 1.00 46.44  ? 847  HOH A O   1 
HETATM 8618 O O   . HOH L 6 .   ? -0.106  83.433 323.266 1.00 61.91  ? 848  HOH A O   1 
HETATM 8619 O O   . HOH L 6 .   ? -4.351  74.541 368.286 1.00 59.13  ? 849  HOH A O   1 
HETATM 8620 O O   . HOH L 6 .   ? -1.032  81.065 340.352 1.00 54.06  ? 850  HOH A O   1 
HETATM 8621 O O   . HOH L 6 .   ? -2.569  65.157 333.403 1.00 50.05  ? 851  HOH A O   1 
HETATM 8622 O O   . HOH L 6 .   ? 7.932   62.072 336.121 1.00 44.55  ? 852  HOH A O   1 
HETATM 8623 O O   . HOH L 6 .   ? 18.360  58.721 359.411 1.00 54.51  ? 853  HOH A O   1 
HETATM 8624 O O   . HOH L 6 .   ? -2.821  38.565 364.238 1.00 70.04  ? 854  HOH A O   1 
HETATM 8625 O O   . HOH L 6 .   ? 7.117   59.955 369.214 1.00 47.94  ? 855  HOH A O   1 
HETATM 8626 O O   . HOH L 6 .   ? 0.409   51.382 381.329 1.00 66.49  ? 856  HOH A O   1 
HETATM 8627 O O   . HOH L 6 .   ? -6.870  68.403 357.110 1.00 47.96  ? 857  HOH A O   1 
HETATM 8628 O O   . HOH L 6 .   ? -20.158 49.300 333.995 1.00 55.96  ? 858  HOH A O   1 
HETATM 8629 O O   . HOH L 6 .   ? -3.982  67.464 333.879 1.00 49.82  ? 859  HOH A O   1 
HETATM 8630 O O   . HOH L 6 .   ? 10.948  73.688 344.653 1.00 52.38  ? 860  HOH A O   1 
HETATM 8631 O O   . HOH L 6 .   ? 2.336   87.482 329.549 1.00 72.71  ? 861  HOH A O   1 
HETATM 8632 O O   . HOH L 6 .   ? -18.500 64.625 333.738 1.00 47.09  ? 862  HOH A O   1 
HETATM 8633 O O   . HOH L 6 .   ? -12.205 77.191 327.324 1.00 71.06  ? 863  HOH A O   1 
HETATM 8634 O O   . HOH L 6 .   ? -19.319 61.533 366.855 1.00 52.28  ? 864  HOH A O   1 
HETATM 8635 O O   . HOH L 6 .   ? 9.266   78.060 322.399 1.00 50.80  ? 865  HOH A O   1 
HETATM 8636 O O   . HOH L 6 .   ? -10.251 39.905 335.826 1.00 69.87  ? 866  HOH A O   1 
HETATM 8637 O O   . HOH L 6 .   ? 4.200   40.038 346.531 1.00 67.46  ? 867  HOH A O   1 
HETATM 8638 O O   . HOH L 6 .   ? -0.168  70.537 370.466 1.00 51.79  ? 868  HOH A O   1 
HETATM 8639 O O   . HOH L 6 .   ? 12.075  69.183 341.946 1.00 64.71  ? 869  HOH A O   1 
HETATM 8640 O O   . HOH L 6 .   ? 6.665   45.130 361.308 1.00 58.50  ? 870  HOH A O   1 
HETATM 8641 O O   . HOH L 6 .   ? -1.023  79.778 317.606 1.00 56.06  ? 871  HOH A O   1 
HETATM 8642 O O   . HOH L 6 .   ? 7.909   80.247 321.886 1.00 49.74  ? 872  HOH A O   1 
HETATM 8643 O O   . HOH L 6 .   ? -19.955 47.682 340.407 1.00 60.16  ? 873  HOH A O   1 
HETATM 8644 O O   . HOH L 6 .   ? -14.519 66.920 353.668 1.00 45.70  ? 874  HOH A O   1 
HETATM 8645 O O   . HOH L 6 .   ? 8.879   44.797 350.383 1.00 60.64  ? 875  HOH A O   1 
HETATM 8646 O O   . HOH L 6 .   ? -12.825 37.599 355.187 1.00 55.34  ? 876  HOH A O   1 
HETATM 8647 O O   . HOH L 6 .   ? -3.163  58.934 373.544 1.00 48.31  ? 877  HOH A O   1 
HETATM 8648 O O   . HOH L 6 .   ? -5.828  60.722 331.434 1.00 60.93  ? 878  HOH A O   1 
HETATM 8649 O O   . HOH L 6 .   ? -26.933 48.259 358.786 1.00 69.10  ? 879  HOH A O   1 
HETATM 8650 O O   . HOH L 6 .   ? -19.845 61.248 333.697 1.00 61.78  ? 880  HOH A O   1 
HETATM 8651 O O   . HOH L 6 .   ? -4.983  84.815 332.274 1.00 57.13  ? 881  HOH A O   1 
HETATM 8652 O O   . HOH L 6 .   ? -0.174  73.154 323.171 1.00 51.70  ? 882  HOH A O   1 
HETATM 8653 O O   . HOH L 6 .   ? 12.462  53.025 359.639 1.00 66.42  ? 883  HOH A O   1 
HETATM 8654 O O   . HOH L 6 .   ? -24.342 55.392 370.427 1.00 62.04  ? 884  HOH A O   1 
HETATM 8655 O O   . HOH L 6 .   ? 12.077  56.984 342.997 1.00 59.39  ? 885  HOH A O   1 
HETATM 8656 O O   . HOH L 6 .   ? -15.104 45.125 328.573 1.00 60.44  ? 886  HOH A O   1 
HETATM 8657 O O   . HOH L 6 .   ? 10.033  41.864 346.298 1.00 74.82  ? 887  HOH A O   1 
HETATM 8658 O O   . HOH L 6 .   ? 11.903  77.235 327.794 1.00 63.12  ? 888  HOH A O   1 
HETATM 8659 O O   . HOH L 6 .   ? -18.057 78.195 348.016 1.00 64.77  ? 889  HOH A O   1 
HETATM 8660 O O   . HOH L 6 .   ? 8.989   58.476 337.864 1.00 43.74  ? 890  HOH A O   1 
HETATM 8661 O O   . HOH L 6 .   ? -7.833  84.657 331.379 1.00 61.27  ? 891  HOH A O   1 
HETATM 8662 O O   . HOH L 6 .   ? -15.479 48.649 326.165 1.00 49.54  ? 892  HOH A O   1 
HETATM 8663 O O   . HOH L 6 .   ? -7.345  70.706 332.708 1.00 60.75  ? 893  HOH A O   1 
HETATM 8664 O O   . HOH L 6 .   ? -5.936  54.392 322.733 1.00 64.29  ? 894  HOH A O   1 
HETATM 8665 O O   . HOH L 6 .   ? -8.176  41.051 368.062 1.00 56.55  ? 895  HOH A O   1 
HETATM 8666 O O   . HOH L 6 .   ? 3.055   70.608 359.535 1.00 41.19  ? 896  HOH A O   1 
HETATM 8667 O O   . HOH L 6 .   ? -7.101  42.148 370.454 1.00 60.71  ? 897  HOH A O   1 
HETATM 8668 O O   . HOH L 6 .   ? 20.742  74.961 332.590 1.00 59.39  ? 898  HOH A O   1 
HETATM 8669 O O   . HOH L 6 .   ? 18.685  72.715 346.467 1.00 66.77  ? 899  HOH A O   1 
HETATM 8670 O O   . HOH L 6 .   ? -2.881  36.169 346.552 1.00 66.86  ? 900  HOH A O   1 
HETATM 8671 O O   . HOH L 6 .   ? 20.667  74.969 355.169 1.00 57.96  ? 901  HOH A O   1 
HETATM 8672 O O   . HOH L 6 .   ? -1.223  77.799 358.752 1.00 49.92  ? 902  HOH A O   1 
HETATM 8673 O O   . HOH L 6 .   ? 20.851  73.002 330.304 1.00 59.18  ? 903  HOH A O   1 
HETATM 8674 O O   . HOH L 6 .   ? 13.263  67.654 353.777 1.00 44.60  ? 904  HOH A O   1 
HETATM 8675 O O   . HOH L 6 .   ? 11.198  77.781 330.089 1.00 62.06  ? 905  HOH A O   1 
HETATM 8676 O O   . HOH L 6 .   ? 1.614   85.110 323.505 1.00 69.80  ? 906  HOH A O   1 
HETATM 8677 O O   . HOH L 6 .   ? 1.605   73.058 345.519 1.00 50.05  ? 907  HOH A O   1 
HETATM 8678 O O   . HOH L 6 .   ? 6.735   60.778 322.598 1.00 62.97  ? 908  HOH A O   1 
HETATM 8679 O O   . HOH L 6 .   ? 6.912   77.137 346.099 1.00 56.57  ? 909  HOH A O   1 
HETATM 8680 O O   . HOH L 6 .   ? -14.754 82.267 346.129 1.00 71.35  ? 910  HOH A O   1 
HETATM 8681 O O   . HOH L 6 .   ? -16.817 78.048 335.322 1.00 59.76  ? 911  HOH A O   1 
HETATM 8682 O O   . HOH L 6 .   ? 6.223   82.841 362.837 1.00 61.57  ? 912  HOH A O   1 
HETATM 8683 O O   . HOH L 6 .   ? -0.916  58.196 324.088 1.00 62.61  ? 913  HOH A O   1 
HETATM 8684 O O   . HOH L 6 .   ? 1.470   76.381 368.527 1.00 52.34  ? 914  HOH A O   1 
HETATM 8685 O O   . HOH L 6 .   ? 16.793  75.152 337.591 1.00 70.42  ? 915  HOH A O   1 
HETATM 8686 O O   . HOH L 6 .   ? 1.666   67.212 364.926 1.00 44.19  ? 916  HOH A O   1 
HETATM 8687 O O   . HOH L 6 .   ? -29.681 53.876 360.622 1.00 61.54  ? 917  HOH A O   1 
HETATM 8688 O O   . HOH L 6 .   ? -4.605  58.811 327.484 1.00 70.93  ? 918  HOH A O   1 
HETATM 8689 O O   . HOH L 6 .   ? 6.579   51.880 363.775 1.00 53.51  ? 919  HOH A O   1 
HETATM 8690 O O   . HOH L 6 .   ? -25.196 50.599 341.381 1.00 55.96  ? 920  HOH A O   1 
HETATM 8691 O O   . HOH L 6 .   ? -1.626  68.232 347.601 1.00 72.43  ? 921  HOH A O   1 
HETATM 8692 O O   . HOH L 6 .   ? 11.536  53.052 331.886 1.00 70.66  ? 922  HOH A O   1 
HETATM 8693 O O   . HOH L 6 .   ? 5.129   54.386 327.368 1.00 55.23  ? 923  HOH A O   1 
HETATM 8694 O O   . HOH L 6 .   ? -11.518 63.871 371.832 1.00 48.24  ? 924  HOH A O   1 
HETATM 8695 O O   . HOH L 6 .   ? -24.255 55.317 336.850 1.00 52.99  ? 925  HOH A O   1 
HETATM 8696 O O   . HOH L 6 .   ? -19.893 63.355 356.149 1.00 62.50  ? 926  HOH A O   1 
HETATM 8697 O O   . HOH L 6 .   ? 11.856  73.475 321.804 1.00 46.46  ? 927  HOH A O   1 
HETATM 8698 O O   . HOH L 6 .   ? 14.864  60.732 345.966 1.00 65.26  ? 928  HOH A O   1 
HETATM 8699 O O   . HOH L 6 .   ? 1.133   78.025 347.167 1.00 60.77  ? 929  HOH A O   1 
HETATM 8700 O O   . HOH L 6 .   ? -5.210  56.861 378.138 1.00 65.64  ? 930  HOH A O   1 
HETATM 8701 O O   . HOH L 6 .   ? 22.680  63.631 355.477 1.00 55.19  ? 931  HOH A O   1 
HETATM 8702 O O   . HOH L 6 .   ? -6.615  64.432 374.145 1.00 55.02  ? 932  HOH A O   1 
HETATM 8703 O O   . HOH L 6 .   ? -1.531  79.544 313.800 1.00 71.08  ? 933  HOH A O   1 
HETATM 8704 O O   . HOH L 6 .   ? 10.039  81.529 330.425 1.00 66.79  ? 934  HOH A O   1 
HETATM 8705 O O   . HOH L 6 .   ? 21.188  68.236 330.762 1.00 66.12  ? 935  HOH A O   1 
HETATM 8706 O O   . HOH L 6 .   ? -21.073 67.923 348.220 1.00 72.14  ? 936  HOH A O   1 
HETATM 8707 O O   . HOH L 6 .   ? -0.931  47.736 374.214 1.00 65.24  ? 937  HOH A O   1 
HETATM 8708 O O   . HOH L 6 .   ? 3.094   75.394 346.177 1.00 61.04  ? 938  HOH A O   1 
HETATM 8709 O O   . HOH L 6 .   ? -18.674 76.085 339.005 1.00 64.67  ? 939  HOH A O   1 
HETATM 8710 O O   . HOH L 6 .   ? -10.412 51.876 386.142 1.00 55.89  ? 940  HOH A O   1 
HETATM 8711 O O   . HOH L 6 .   ? -5.292  79.112 316.914 1.00 63.82  ? 941  HOH A O   1 
HETATM 8712 O O   . HOH L 6 .   ? -2.598  80.064 362.717 1.00 73.39  ? 942  HOH A O   1 
HETATM 8713 O O   . HOH L 6 .   ? -14.372 81.271 336.315 1.00 74.63  ? 943  HOH A O   1 
HETATM 8714 O O   . HOH L 6 .   ? -0.184  60.730 325.249 1.00 50.61  ? 944  HOH A O   1 
HETATM 8715 O O   . HOH L 6 .   ? -3.767  77.368 362.308 1.00 63.99  ? 945  HOH A O   1 
HETATM 8716 O O   . HOH L 6 .   ? 8.326   53.029 365.125 1.00 56.97  ? 946  HOH A O   1 
HETATM 8717 O O   . HOH L 6 .   ? 10.420  79.560 338.206 1.00 67.36  ? 947  HOH A O   1 
HETATM 8718 O O   . HOH L 6 .   ? -9.359  46.616 380.998 1.00 65.01  ? 948  HOH A O   1 
HETATM 8719 O O   . HOH L 6 .   ? 5.100   65.367 320.701 1.00 64.54  ? 949  HOH A O   1 
HETATM 8720 O O   . HOH L 6 .   ? -11.926 73.182 363.167 1.00 61.25  ? 950  HOH A O   1 
HETATM 8721 O O   . HOH L 6 .   ? 12.257  62.188 343.768 1.00 61.10  ? 951  HOH A O   1 
HETATM 8722 O O   . HOH L 6 .   ? -16.768 67.693 352.310 1.00 54.94  ? 952  HOH A O   1 
HETATM 8723 O O   . HOH L 6 .   ? 10.268  67.627 346.937 1.00 44.17  ? 953  HOH A O   1 
HETATM 8724 O O   . HOH L 6 .   ? -30.666 66.851 343.470 1.00 66.46  ? 954  HOH A O   1 
HETATM 8725 O O   . HOH L 6 .   ? -25.033 49.838 347.680 1.00 56.74  ? 955  HOH A O   1 
HETATM 8726 O O   . HOH L 6 .   ? 3.927   39.522 352.580 1.00 67.83  ? 956  HOH A O   1 
HETATM 8727 O O   . HOH L 6 .   ? -0.021  48.110 368.351 1.00 68.97  ? 957  HOH A O   1 
HETATM 8728 O O   . HOH L 6 .   ? 6.297   62.389 320.587 1.00 69.23  ? 958  HOH A O   1 
HETATM 8729 O O   . HOH L 6 .   ? 6.772   73.552 372.913 1.00 66.14  ? 959  HOH A O   1 
HETATM 8730 O O   . HOH L 6 .   ? -13.545 73.093 357.955 1.00 63.26  ? 960  HOH A O   1 
HETATM 8731 O O   . HOH L 6 .   ? 21.622  57.273 357.467 1.00 71.19  ? 961  HOH A O   1 
HETATM 8732 O O   . HOH L 6 .   ? 4.871   69.628 375.598 1.00 72.69  ? 962  HOH A O   1 
HETATM 8733 O O   . HOH L 6 .   ? -25.980 60.512 357.491 1.00 69.02  ? 963  HOH A O   1 
HETATM 8734 O O   . HOH L 6 .   ? -24.539 48.017 343.618 1.00 65.63  ? 964  HOH A O   1 
HETATM 8735 O O   . HOH L 6 .   ? 11.314  82.976 364.440 1.00 74.25  ? 965  HOH A O   1 
HETATM 8736 O O   . HOH L 6 .   ? 20.700  71.404 336.234 1.00 69.37  ? 966  HOH A O   1 
HETATM 8737 O O   . HOH L 6 .   ? -20.173 40.527 351.352 1.00 60.34  ? 967  HOH A O   1 
HETATM 8738 O O   . HOH L 6 .   ? 2.151   47.390 368.867 1.00 70.91  ? 968  HOH A O   1 
HETATM 8739 O O   . HOH L 6 .   ? 28.064  67.053 365.500 1.00 59.50  ? 969  HOH A O   1 
HETATM 8740 O O   . HOH L 6 .   ? -8.467  36.805 351.420 1.00 59.29  ? 970  HOH A O   1 
HETATM 8741 O O   . HOH L 6 .   ? -20.758 67.669 359.114 1.00 76.60  ? 971  HOH A O   1 
HETATM 8742 O O   . HOH L 6 .   ? 22.307  70.810 330.295 1.00 62.49  ? 972  HOH A O   1 
HETATM 8743 O O   . HOH L 6 .   ? 4.866   53.494 331.105 1.00 55.74  ? 973  HOH A O   1 
HETATM 8744 O O   . HOH L 6 .   ? -25.253 57.582 369.628 1.00 62.65  ? 974  HOH A O   1 
HETATM 8745 O O   . HOH L 6 .   ? -10.887 70.006 330.333 1.00 70.22  ? 975  HOH A O   1 
HETATM 8746 O O   . HOH L 6 .   ? 0.562   68.699 322.039 1.00 67.26  ? 976  HOH A O   1 
HETATM 8747 O O   . HOH L 6 .   ? 17.823  75.191 372.864 1.00 66.22  ? 977  HOH A O   1 
HETATM 8748 O O   . HOH L 6 .   ? 11.826  71.174 344.312 1.00 58.27  ? 978  HOH A O   1 
HETATM 8749 O O   . HOH L 6 .   ? 0.524   35.167 340.574 1.00 69.30  ? 979  HOH A O   1 
HETATM 8750 O O   . HOH L 6 .   ? -25.236 52.824 336.255 1.00 68.64  ? 980  HOH A O   1 
HETATM 8751 O O   . HOH L 6 .   ? -2.445  71.415 322.225 1.00 60.36  ? 981  HOH A O   1 
HETATM 8752 O O   . HOH L 6 .   ? -23.588 48.194 341.477 1.00 60.68  ? 982  HOH A O   1 
HETATM 8753 O O   . HOH L 6 .   ? -17.560 39.820 352.973 1.00 66.83  ? 983  HOH A O   1 
HETATM 8754 O O   . HOH L 6 .   ? 6.095   86.000 323.731 1.00 69.81  ? 984  HOH A O   1 
HETATM 8755 O O   . HOH L 6 .   ? -9.370  79.149 357.884 1.00 62.84  ? 985  HOH A O   1 
HETATM 8756 O O   . HOH L 6 .   ? -33.384 49.862 368.395 1.00 68.53  ? 986  HOH A O   1 
HETATM 8757 O O   . HOH M 6 .   ? -59.495 50.898 353.087 1.00 54.38  ? 701  HOH B O   1 
HETATM 8758 O O   . HOH M 6 .   ? -48.478 59.103 334.639 1.00 67.06  ? 702  HOH B O   1 
HETATM 8759 O O   . HOH M 6 .   ? -51.055 52.544 339.335 1.00 49.54  ? 703  HOH B O   1 
HETATM 8760 O O   . HOH M 6 .   ? -39.971 68.186 372.362 1.00 63.41  ? 704  HOH B O   1 
HETATM 8761 O O   . HOH M 6 .   ? -65.916 77.802 359.571 1.00 67.11  ? 705  HOH B O   1 
HETATM 8762 O O   . HOH M 6 .   ? -53.442 67.484 346.906 1.00 53.50  ? 706  HOH B O   1 
HETATM 8763 O O   . HOH M 6 .   ? -73.585 47.521 354.525 1.00 56.12  ? 707  HOH B O   1 
HETATM 8764 O O   . HOH M 6 .   ? -52.502 69.614 382.836 1.00 55.49  ? 708  HOH B O   1 
HETATM 8765 O O   . HOH M 6 .   ? -73.817 39.608 331.350 1.00 61.88  ? 709  HOH B O   1 
HETATM 8766 O O   . HOH M 6 .   ? -57.797 34.189 337.616 1.00 68.67  ? 710  HOH B O   1 
HETATM 8767 O O   . HOH M 6 .   ? -36.232 54.929 355.101 1.00 57.78  ? 711  HOH B O   1 
HETATM 8768 O O   . HOH M 6 .   ? -50.420 49.698 388.203 1.00 56.00  ? 712  HOH B O   1 
HETATM 8769 O O   . HOH M 6 .   ? -75.294 51.720 358.575 1.00 59.53  ? 713  HOH B O   1 
HETATM 8770 O O   . HOH M 6 .   ? -43.444 42.107 339.865 1.00 54.29  ? 714  HOH B O   1 
HETATM 8771 O O   . HOH M 6 .   ? -42.090 38.486 368.215 1.00 36.57  ? 715  HOH B O   1 
HETATM 8772 O O   . HOH M 6 .   ? -53.205 71.461 385.915 1.00 65.65  ? 716  HOH B O   1 
HETATM 8773 O O   . HOH M 6 .   ? -32.484 43.285 360.736 1.00 60.40  ? 717  HOH B O   1 
HETATM 8774 O O   . HOH M 6 .   ? -59.459 66.263 370.297 1.00 37.57  ? 718  HOH B O   1 
HETATM 8775 O O   . HOH M 6 .   ? -49.619 70.739 356.960 1.00 59.59  ? 719  HOH B O   1 
HETATM 8776 O O   . HOH M 6 .   ? -50.169 44.244 369.366 1.00 38.40  ? 720  HOH B O   1 
HETATM 8777 O O   . HOH M 6 .   ? -45.348 69.614 358.911 1.00 58.90  ? 721  HOH B O   1 
HETATM 8778 O O   . HOH M 6 .   ? -72.282 45.464 335.397 1.00 58.76  ? 722  HOH B O   1 
HETATM 8779 O O   . HOH M 6 .   ? -53.422 37.259 334.098 1.00 66.62  ? 723  HOH B O   1 
HETATM 8780 O O   . HOH M 6 .   ? -41.878 62.912 343.885 1.00 63.29  ? 724  HOH B O   1 
HETATM 8781 O O   . HOH M 6 .   ? -60.356 47.267 371.508 1.00 49.05  ? 725  HOH B O   1 
HETATM 8782 O O   . HOH M 6 .   ? -43.309 30.240 352.912 1.00 58.58  ? 726  HOH B O   1 
HETATM 8783 O O   . HOH M 6 .   ? -60.275 72.061 373.862 1.00 64.97  ? 727  HOH B O   1 
HETATM 8784 O O   . HOH M 6 .   ? -49.998 33.595 345.902 1.00 69.46  ? 728  HOH B O   1 
HETATM 8785 O O   . HOH M 6 .   ? -32.033 63.963 343.638 1.00 60.91  ? 729  HOH B O   1 
HETATM 8786 O O   . HOH M 6 .   ? -33.990 52.560 364.764 1.00 53.06  ? 730  HOH B O   1 
HETATM 8787 O O   . HOH M 6 .   ? -43.474 61.676 363.905 1.00 34.00  ? 731  HOH B O   1 
HETATM 8788 O O   . HOH M 6 .   ? -47.712 71.324 346.761 1.00 58.66  ? 732  HOH B O   1 
HETATM 8789 O O   . HOH M 6 .   ? -35.014 47.174 346.645 1.00 41.51  ? 733  HOH B O   1 
HETATM 8790 O O   . HOH M 6 .   ? -54.708 43.220 353.915 1.00 44.96  ? 734  HOH B O   1 
HETATM 8791 O O   . HOH M 6 .   ? -54.333 57.361 343.267 1.00 45.49  ? 735  HOH B O   1 
HETATM 8792 O O   . HOH M 6 .   ? -54.838 51.118 367.530 1.00 42.59  ? 736  HOH B O   1 
HETATM 8793 O O   . HOH M 6 .   ? -57.855 28.720 334.024 1.00 48.35  ? 737  HOH B O   1 
HETATM 8794 O O   . HOH M 6 .   ? -64.515 78.889 346.196 1.00 64.42  ? 738  HOH B O   1 
HETATM 8795 O O   . HOH M 6 .   ? -46.008 67.996 385.024 1.00 57.33  ? 739  HOH B O   1 
HETATM 8796 O O   . HOH M 6 .   ? -60.304 40.116 349.603 1.00 47.02  ? 740  HOH B O   1 
HETATM 8797 O O   . HOH M 6 .   ? -64.271 49.344 357.461 1.00 41.83  ? 741  HOH B O   1 
HETATM 8798 O O   . HOH M 6 .   ? -82.492 63.449 349.037 1.00 53.99  ? 742  HOH B O   1 
HETATM 8799 O O   . HOH M 6 .   ? -34.360 54.280 369.050 1.00 60.18  ? 743  HOH B O   1 
HETATM 8800 O O   . HOH M 6 .   ? -55.127 32.665 370.580 1.00 51.02  ? 744  HOH B O   1 
HETATM 8801 O O   . HOH M 6 .   ? -68.610 56.993 356.430 1.00 32.38  ? 745  HOH B O   1 
HETATM 8802 O O   . HOH M 6 .   ? -53.997 67.967 389.863 1.00 66.13  ? 746  HOH B O   1 
HETATM 8803 O O   . HOH M 6 .   ? -51.185 72.836 380.611 1.00 51.46  ? 747  HOH B O   1 
HETATM 8804 O O   . HOH M 6 .   ? -47.013 63.864 384.687 1.00 45.52  ? 748  HOH B O   1 
HETATM 8805 O O   . HOH M 6 .   ? -69.147 50.995 333.635 1.00 58.63  ? 749  HOH B O   1 
HETATM 8806 O O   . HOH M 6 .   ? -62.581 24.480 337.813 1.00 61.64  ? 750  HOH B O   1 
HETATM 8807 O O   . HOH M 6 .   ? -57.069 48.886 369.350 1.00 46.62  ? 751  HOH B O   1 
HETATM 8808 O O   . HOH M 6 .   ? -56.133 35.669 344.227 1.00 54.12  ? 752  HOH B O   1 
HETATM 8809 O O   . HOH M 6 .   ? -64.827 51.368 362.465 1.00 39.11  ? 753  HOH B O   1 
HETATM 8810 O O   . HOH M 6 .   ? -58.466 75.095 360.663 1.00 65.49  ? 754  HOH B O   1 
HETATM 8811 O O   . HOH M 6 .   ? -51.009 42.810 353.494 1.00 36.76  ? 755  HOH B O   1 
HETATM 8812 O O   . HOH M 6 .   ? -52.214 49.996 338.922 1.00 45.83  ? 756  HOH B O   1 
HETATM 8813 O O   . HOH M 6 .   ? -70.046 78.031 357.848 1.00 60.68  ? 757  HOH B O   1 
HETATM 8814 O O   . HOH M 6 .   ? -62.237 28.868 359.538 1.00 63.94  ? 758  HOH B O   1 
HETATM 8815 O O   . HOH M 6 .   ? -39.926 54.075 383.682 1.00 54.17  ? 759  HOH B O   1 
HETATM 8816 O O   . HOH M 6 .   ? -56.732 48.859 358.424 1.00 37.24  ? 760  HOH B O   1 
HETATM 8817 O O   . HOH M 6 .   ? -42.099 63.878 349.692 1.00 61.25  ? 761  HOH B O   1 
HETATM 8818 O O   . HOH M 6 .   ? -78.430 42.383 354.648 1.00 66.97  ? 762  HOH B O   1 
HETATM 8819 O O   . HOH M 6 .   ? -60.085 50.195 360.165 1.00 34.99  ? 763  HOH B O   1 
HETATM 8820 O O   . HOH M 6 .   ? -51.489 69.011 368.832 1.00 47.63  ? 764  HOH B O   1 
HETATM 8821 O O   . HOH M 6 .   ? -61.827 48.094 373.842 1.00 61.41  ? 765  HOH B O   1 
HETATM 8822 O O   . HOH M 6 .   ? -40.776 57.479 380.167 1.00 57.27  ? 766  HOH B O   1 
HETATM 8823 O O   . HOH M 6 .   ? -62.995 48.079 341.709 1.00 42.59  ? 767  HOH B O   1 
HETATM 8824 O O   . HOH M 6 .   ? -71.292 48.429 346.056 1.00 44.27  ? 768  HOH B O   1 
HETATM 8825 O O   . HOH M 6 .   ? -47.826 38.135 328.555 1.00 37.71  ? 769  HOH B O   1 
HETATM 8826 O O   . HOH M 6 .   ? -62.875 63.914 347.870 1.00 39.41  ? 770  HOH B O   1 
HETATM 8827 O O   . HOH M 6 .   ? -45.583 28.279 363.082 1.00 62.46  ? 771  HOH B O   1 
HETATM 8828 O O   . HOH M 6 .   ? -70.519 69.715 363.755 1.00 47.20  ? 772  HOH B O   1 
HETATM 8829 O O   . HOH M 6 .   ? -59.300 31.392 337.188 1.00 46.26  ? 773  HOH B O   1 
HETATM 8830 O O   . HOH M 6 .   ? -66.099 67.044 361.726 1.00 41.52  ? 774  HOH B O   1 
HETATM 8831 O O   . HOH M 6 .   ? -64.285 57.289 351.475 1.00 35.29  ? 775  HOH B O   1 
HETATM 8832 O O   . HOH M 6 .   ? -59.737 71.284 364.817 1.00 46.33  ? 776  HOH B O   1 
HETATM 8833 O O   . HOH M 6 .   ? -61.775 65.768 368.674 1.00 38.15  ? 777  HOH B O   1 
HETATM 8834 O O   . HOH M 6 .   ? -39.175 52.822 364.041 1.00 35.81  ? 778  HOH B O   1 
HETATM 8835 O O   . HOH M 6 .   ? -70.997 52.867 367.916 1.00 47.46  ? 779  HOH B O   1 
HETATM 8836 O O   . HOH M 6 .   ? -62.307 69.977 353.322 1.00 42.28  ? 780  HOH B O   1 
HETATM 8837 O O   . HOH M 6 .   ? -69.348 32.756 356.421 1.00 51.12  ? 781  HOH B O   1 
HETATM 8838 O O   . HOH M 6 .   ? -42.476 45.993 339.507 1.00 54.56  ? 782  HOH B O   1 
HETATM 8839 O O   . HOH M 6 .   ? -54.703 54.584 363.128 1.00 30.76  ? 783  HOH B O   1 
HETATM 8840 O O   . HOH M 6 .   ? -73.673 76.998 359.175 1.00 58.84  ? 784  HOH B O   1 
HETATM 8841 O O   . HOH M 6 .   ? -43.352 67.179 378.392 1.00 53.06  ? 785  HOH B O   1 
HETATM 8842 O O   . HOH M 6 .   ? -63.427 57.358 343.201 1.00 44.86  ? 786  HOH B O   1 
HETATM 8843 O O   . HOH M 6 .   ? -64.777 67.854 359.447 1.00 41.39  ? 787  HOH B O   1 
HETATM 8844 O O   . HOH M 6 .   ? -39.745 38.781 371.069 1.00 45.85  ? 788  HOH B O   1 
HETATM 8845 O O   . HOH M 6 .   ? -69.281 60.765 355.074 1.00 52.64  ? 789  HOH B O   1 
HETATM 8846 O O   . HOH M 6 .   ? -80.697 60.955 356.739 1.00 58.50  ? 790  HOH B O   1 
HETATM 8847 O O   . HOH M 6 .   ? -62.627 55.796 345.494 1.00 41.58  ? 791  HOH B O   1 
HETATM 8848 O O   . HOH M 6 .   ? -67.574 51.313 360.041 1.00 40.51  ? 792  HOH B O   1 
HETATM 8849 O O   . HOH M 6 .   ? -55.997 27.336 357.970 1.00 68.81  ? 793  HOH B O   1 
HETATM 8850 O O   . HOH M 6 .   ? -55.834 34.682 357.499 1.00 51.34  ? 794  HOH B O   1 
HETATM 8851 O O   . HOH M 6 .   ? -61.116 57.571 342.156 1.00 48.48  ? 795  HOH B O   1 
HETATM 8852 O O   . HOH M 6 .   ? -31.465 42.663 353.035 1.00 53.85  ? 796  HOH B O   1 
HETATM 8853 O O   . HOH M 6 .   ? -72.309 43.319 357.901 1.00 57.71  ? 797  HOH B O   1 
HETATM 8854 O O   . HOH M 6 .   ? -41.491 67.567 357.311 1.00 59.04  ? 798  HOH B O   1 
HETATM 8855 O O   . HOH M 6 .   ? -40.044 41.248 375.237 1.00 51.07  ? 799  HOH B O   1 
HETATM 8856 O O   . HOH M 6 .   ? -57.915 45.621 378.373 1.00 60.73  ? 800  HOH B O   1 
HETATM 8857 O O   . HOH M 6 .   ? -38.372 66.370 368.626 1.00 56.11  ? 801  HOH B O   1 
HETATM 8858 O O   . HOH M 6 .   ? -76.008 55.146 356.986 1.00 54.28  ? 802  HOH B O   1 
HETATM 8859 O O   . HOH M 6 .   ? -50.167 64.379 387.525 1.00 59.68  ? 803  HOH B O   1 
HETATM 8860 O O   . HOH M 6 .   ? -54.707 49.214 338.286 1.00 37.37  ? 804  HOH B O   1 
HETATM 8861 O O   . HOH M 6 .   ? -73.173 40.876 345.394 1.00 52.37  ? 805  HOH B O   1 
HETATM 8862 O O   . HOH M 6 .   ? -53.845 57.233 330.720 1.00 63.59  ? 806  HOH B O   1 
HETATM 8863 O O   . HOH M 6 .   ? -49.558 68.130 373.933 1.00 46.21  ? 807  HOH B O   1 
HETATM 8864 O O   . HOH M 6 .   ? -38.836 41.142 348.751 1.00 32.95  ? 808  HOH B O   1 
HETATM 8865 O O   . HOH M 6 .   ? -50.440 28.396 356.148 1.00 66.27  ? 809  HOH B O   1 
HETATM 8866 O O   . HOH M 6 .   ? -60.847 51.157 376.132 1.00 49.14  ? 810  HOH B O   1 
HETATM 8867 O O   . HOH M 6 .   ? -60.173 54.656 356.193 1.00 28.58  ? 811  HOH B O   1 
HETATM 8868 O O   . HOH M 6 .   ? -66.318 62.356 362.320 1.00 42.71  ? 812  HOH B O   1 
HETATM 8869 O O   . HOH M 6 .   ? -66.837 49.904 333.167 1.00 54.83  ? 813  HOH B O   1 
HETATM 8870 O O   . HOH M 6 .   ? -58.717 56.988 371.428 1.00 46.00  ? 814  HOH B O   1 
HETATM 8871 O O   . HOH M 6 .   ? -43.441 32.128 355.730 1.00 48.53  ? 815  HOH B O   1 
HETATM 8872 O O   . HOH M 6 .   ? -65.549 61.016 360.043 1.00 31.55  ? 816  HOH B O   1 
HETATM 8873 O O   . HOH M 6 .   ? -64.745 45.423 369.724 1.00 66.63  ? 817  HOH B O   1 
HETATM 8874 O O   . HOH M 6 .   ? -61.701 44.086 365.730 1.00 42.84  ? 818  HOH B O   1 
HETATM 8875 O O   . HOH M 6 .   ? -65.480 46.055 366.086 1.00 47.73  ? 819  HOH B O   1 
HETATM 8876 O O   . HOH M 6 .   ? -54.178 45.809 388.802 1.00 66.72  ? 820  HOH B O   1 
HETATM 8877 O O   . HOH M 6 .   ? -61.151 61.549 339.465 1.00 49.51  ? 821  HOH B O   1 
HETATM 8878 O O   . HOH M 6 .   ? -35.599 41.246 343.724 1.00 41.87  ? 822  HOH B O   1 
HETATM 8879 O O   . HOH M 6 .   ? -68.253 51.173 345.489 1.00 53.05  ? 823  HOH B O   1 
HETATM 8880 O O   . HOH M 6 .   ? -46.661 66.591 346.919 1.00 48.29  ? 824  HOH B O   1 
HETATM 8881 O O   . HOH M 6 .   ? -55.725 39.728 343.256 1.00 53.31  ? 825  HOH B O   1 
HETATM 8882 O O   . HOH M 6 .   ? -51.958 67.295 373.054 1.00 44.77  ? 826  HOH B O   1 
HETATM 8883 O O   . HOH M 6 .   ? -54.502 69.471 349.658 1.00 50.41  ? 827  HOH B O   1 
HETATM 8884 O O   . HOH M 6 .   ? -62.814 49.424 359.885 1.00 32.97  ? 828  HOH B O   1 
HETATM 8885 O O   . HOH M 6 .   ? -54.512 38.725 345.571 1.00 48.48  ? 829  HOH B O   1 
HETATM 8886 O O   . HOH M 6 .   ? -30.293 47.554 357.689 1.00 57.19  ? 830  HOH B O   1 
HETATM 8887 O O   . HOH M 6 .   ? -59.888 61.768 376.652 1.00 48.89  ? 831  HOH B O   1 
HETATM 8888 O O   . HOH M 6 .   ? -65.656 66.090 347.654 1.00 37.04  ? 832  HOH B O   1 
HETATM 8889 O O   . HOH M 6 .   ? -70.662 64.389 367.211 1.00 50.33  ? 833  HOH B O   1 
HETATM 8890 O O   . HOH M 6 .   ? -70.988 71.340 361.402 1.00 45.25  ? 834  HOH B O   1 
HETATM 8891 O O   . HOH M 6 .   ? -65.952 26.455 329.737 1.00 47.67  ? 835  HOH B O   1 
HETATM 8892 O O   . HOH M 6 .   ? -33.367 44.691 365.146 1.00 54.24  ? 836  HOH B O   1 
HETATM 8893 O O   . HOH M 6 .   ? -68.337 35.395 326.420 1.00 66.45  ? 837  HOH B O   1 
HETATM 8894 O O   . HOH M 6 .   ? -62.369 31.502 331.653 1.00 49.29  ? 838  HOH B O   1 
HETATM 8895 O O   . HOH M 6 .   ? -43.402 45.628 378.815 1.00 39.42  ? 839  HOH B O   1 
HETATM 8896 O O   . HOH M 6 .   ? -36.719 41.642 369.588 1.00 57.35  ? 840  HOH B O   1 
HETATM 8897 O O   . HOH M 6 .   ? -72.803 55.925 368.055 1.00 53.25  ? 841  HOH B O   1 
HETATM 8898 O O   . HOH M 6 .   ? -62.054 55.118 368.506 1.00 42.35  ? 842  HOH B O   1 
HETATM 8899 O O   . HOH M 6 .   ? -36.993 61.757 357.423 1.00 58.62  ? 843  HOH B O   1 
HETATM 8900 O O   . HOH M 6 .   ? -36.791 30.192 348.819 1.00 53.12  ? 844  HOH B O   1 
HETATM 8901 O O   . HOH M 6 .   ? -57.991 38.143 344.570 1.00 45.95  ? 845  HOH B O   1 
HETATM 8902 O O   . HOH M 6 .   ? -45.055 34.286 341.241 1.00 57.15  ? 846  HOH B O   1 
HETATM 8903 O O   . HOH M 6 .   ? -65.572 62.427 372.255 1.00 43.36  ? 847  HOH B O   1 
HETATM 8904 O O   . HOH M 6 .   ? -67.484 69.230 338.397 1.00 57.12  ? 848  HOH B O   1 
HETATM 8905 O O   . HOH M 6 .   ? -65.035 63.330 346.387 1.00 41.66  ? 849  HOH B O   1 
HETATM 8906 O O   . HOH M 6 .   ? -60.289 67.741 337.527 1.00 62.32  ? 850  HOH B O   1 
HETATM 8907 O O   . HOH M 6 .   ? -52.655 26.200 362.350 1.00 66.65  ? 851  HOH B O   1 
HETATM 8908 O O   . HOH M 6 .   ? -70.278 38.991 338.949 1.00 45.81  ? 852  HOH B O   1 
HETATM 8909 O O   . HOH M 6 .   ? -45.861 43.027 338.826 1.00 50.98  ? 853  HOH B O   1 
HETATM 8910 O O   . HOH M 6 .   ? -45.715 36.865 338.252 1.00 54.98  ? 854  HOH B O   1 
HETATM 8911 O O   . HOH M 6 .   ? -44.555 37.088 372.280 1.00 59.90  ? 855  HOH B O   1 
HETATM 8912 O O   . HOH M 6 .   ? -66.628 65.016 336.970 1.00 55.36  ? 856  HOH B O   1 
HETATM 8913 O O   . HOH M 6 .   ? -55.336 44.478 381.112 1.00 63.91  ? 857  HOH B O   1 
HETATM 8914 O O   . HOH M 6 .   ? -62.267 56.846 363.733 1.00 37.70  ? 858  HOH B O   1 
HETATM 8915 O O   . HOH M 6 .   ? -36.936 47.498 370.075 1.00 59.58  ? 859  HOH B O   1 
HETATM 8916 O O   . HOH M 6 .   ? -58.240 34.308 342.721 1.00 61.17  ? 860  HOH B O   1 
HETATM 8917 O O   . HOH M 6 .   ? -71.081 49.508 365.193 1.00 44.59  ? 861  HOH B O   1 
HETATM 8918 O O   . HOH M 6 .   ? -63.276 45.572 367.520 1.00 41.12  ? 862  HOH B O   1 
HETATM 8919 O O   . HOH M 6 .   ? -66.787 58.390 351.274 1.00 45.21  ? 863  HOH B O   1 
HETATM 8920 O O   . HOH M 6 .   ? -55.180 29.613 371.944 1.00 72.55  ? 864  HOH B O   1 
HETATM 8921 O O   . HOH M 6 .   ? -63.415 67.575 373.943 1.00 51.93  ? 865  HOH B O   1 
HETATM 8922 O O   . HOH M 6 .   ? -68.343 59.597 357.312 1.00 42.16  ? 866  HOH B O   1 
HETATM 8923 O O   . HOH M 6 .   ? -60.295 65.434 349.908 1.00 39.66  ? 867  HOH B O   1 
HETATM 8924 O O   . HOH M 6 .   ? -62.950 72.834 341.464 1.00 66.81  ? 868  HOH B O   1 
HETATM 8925 O O   . HOH M 6 .   ? -40.656 63.778 371.505 1.00 44.81  ? 869  HOH B O   1 
HETATM 8926 O O   . HOH M 6 .   ? -63.193 29.802 323.520 1.00 56.99  ? 870  HOH B O   1 
HETATM 8927 O O   . HOH M 6 .   ? -63.232 54.653 338.770 1.00 59.25  ? 871  HOH B O   1 
HETATM 8928 O O   . HOH M 6 .   ? -56.029 31.075 348.507 1.00 65.34  ? 872  HOH B O   1 
HETATM 8929 O O   . HOH M 6 .   ? -56.915 40.802 360.757 1.00 49.17  ? 873  HOH B O   1 
HETATM 8930 O O   . HOH M 6 .   ? -43.596 63.134 382.038 1.00 50.76  ? 874  HOH B O   1 
HETATM 8931 O O   . HOH M 6 .   ? -58.919 29.777 374.050 1.00 60.73  ? 875  HOH B O   1 
HETATM 8932 O O   . HOH M 6 .   ? -53.354 28.720 354.991 1.00 51.72  ? 876  HOH B O   1 
HETATM 8933 O O   . HOH M 6 .   ? -55.589 73.136 350.162 1.00 66.06  ? 877  HOH B O   1 
HETATM 8934 O O   . HOH M 6 .   ? -58.672 72.968 347.509 1.00 69.49  ? 878  HOH B O   1 
HETATM 8935 O O   . HOH M 6 .   ? -33.071 49.008 345.081 1.00 57.03  ? 879  HOH B O   1 
HETATM 8936 O O   . HOH M 6 .   ? -49.476 40.755 382.355 1.00 52.37  ? 880  HOH B O   1 
HETATM 8937 O O   . HOH M 6 .   ? -60.165 28.695 358.039 1.00 59.17  ? 881  HOH B O   1 
HETATM 8938 O O   . HOH M 6 .   ? -35.237 59.583 340.371 1.00 65.29  ? 882  HOH B O   1 
HETATM 8939 O O   . HOH M 6 .   ? -68.431 61.101 336.979 1.00 58.46  ? 883  HOH B O   1 
HETATM 8940 O O   . HOH M 6 .   ? -67.467 53.075 325.809 1.00 65.94  ? 884  HOH B O   1 
HETATM 8941 O O   . HOH M 6 .   ? -73.686 55.477 360.943 1.00 42.12  ? 885  HOH B O   1 
HETATM 8942 O O   . HOH M 6 .   ? -49.284 69.816 352.341 1.00 59.80  ? 886  HOH B O   1 
HETATM 8943 O O   . HOH M 6 .   ? -53.775 50.487 385.860 1.00 53.64  ? 887  HOH B O   1 
HETATM 8944 O O   . HOH M 6 .   ? -75.581 74.209 344.268 1.00 66.41  ? 888  HOH B O   1 
HETATM 8945 O O   . HOH M 6 .   ? -74.225 79.618 342.583 1.00 77.51  ? 889  HOH B O   1 
HETATM 8946 O O   . HOH M 6 .   ? -61.978 29.372 342.263 1.00 61.08  ? 890  HOH B O   1 
HETATM 8947 O O   . HOH M 6 .   ? -61.101 71.525 362.244 1.00 46.80  ? 891  HOH B O   1 
HETATM 8948 O O   . HOH M 6 .   ? -58.819 76.109 355.003 1.00 65.37  ? 892  HOH B O   1 
HETATM 8949 O O   . HOH M 6 .   ? -58.433 72.693 381.265 1.00 64.95  ? 893  HOH B O   1 
HETATM 8950 O O   . HOH M 6 .   ? -67.129 24.880 338.340 1.00 62.46  ? 894  HOH B O   1 
HETATM 8951 O O   . HOH M 6 .   ? -33.066 44.729 339.002 1.00 63.22  ? 895  HOH B O   1 
HETATM 8952 O O   . HOH M 6 .   ? -67.007 27.538 353.209 1.00 66.93  ? 896  HOH B O   1 
HETATM 8953 O O   . HOH M 6 .   ? -70.198 35.097 363.173 1.00 53.77  ? 897  HOH B O   1 
HETATM 8954 O O   . HOH M 6 .   ? -62.136 31.089 343.772 1.00 67.57  ? 898  HOH B O   1 
HETATM 8955 O O   . HOH M 6 .   ? -32.303 41.289 346.001 1.00 53.02  ? 899  HOH B O   1 
HETATM 8956 O O   . HOH M 6 .   ? -81.648 74.166 354.780 1.00 64.09  ? 900  HOH B O   1 
HETATM 8957 O O   . HOH M 6 .   ? -51.855 69.258 359.766 1.00 50.26  ? 901  HOH B O   1 
HETATM 8958 O O   . HOH M 6 .   ? -51.724 71.046 352.934 1.00 57.63  ? 902  HOH B O   1 
HETATM 8959 O O   . HOH M 6 .   ? -68.177 54.904 373.646 1.00 53.69  ? 903  HOH B O   1 
HETATM 8960 O O   . HOH M 6 .   ? -51.658 69.611 371.448 1.00 51.45  ? 904  HOH B O   1 
HETATM 8961 O O   . HOH M 6 .   ? -74.647 65.340 364.641 1.00 54.01  ? 905  HOH B O   1 
HETATM 8962 O O   . HOH M 6 .   ? -60.666 67.230 372.893 1.00 53.16  ? 906  HOH B O   1 
HETATM 8963 O O   . HOH M 6 .   ? -71.512 29.912 332.453 1.00 68.45  ? 907  HOH B O   1 
HETATM 8964 O O   . HOH M 6 .   ? -49.561 63.381 384.857 1.00 48.76  ? 908  HOH B O   1 
HETATM 8965 O O   . HOH M 6 .   ? -41.433 32.450 366.084 1.00 49.88  ? 909  HOH B O   1 
HETATM 8966 O O   . HOH M 6 .   ? -75.860 62.848 363.926 1.00 50.75  ? 910  HOH B O   1 
HETATM 8967 O O   . HOH M 6 .   ? -29.834 40.967 355.647 1.00 66.90  ? 911  HOH B O   1 
HETATM 8968 O O   . HOH M 6 .   ? -68.403 43.347 330.011 1.00 59.01  ? 912  HOH B O   1 
HETATM 8969 O O   . HOH M 6 .   ? -43.003 66.197 375.343 1.00 49.37  ? 913  HOH B O   1 
HETATM 8970 O O   . HOH M 6 .   ? -66.643 28.084 350.314 1.00 56.09  ? 914  HOH B O   1 
HETATM 8971 O O   . HOH M 6 .   ? -73.886 32.665 331.150 1.00 59.42  ? 915  HOH B O   1 
HETATM 8972 O O   . HOH M 6 .   ? -30.329 51.665 346.684 1.00 66.44  ? 916  HOH B O   1 
HETATM 8973 O O   . HOH M 6 .   ? -61.703 64.981 338.086 1.00 55.32  ? 917  HOH B O   1 
HETATM 8974 O O   . HOH M 6 .   ? -42.652 63.955 346.555 1.00 54.74  ? 918  HOH B O   1 
HETATM 8975 O O   . HOH M 6 .   ? -47.116 64.948 335.272 1.00 62.02  ? 919  HOH B O   1 
HETATM 8976 O O   . HOH M 6 .   ? -61.312 32.486 333.615 1.00 40.61  ? 920  HOH B O   1 
HETATM 8977 O O   . HOH M 6 .   ? -50.698 37.322 344.798 1.00 54.09  ? 921  HOH B O   1 
HETATM 8978 O O   . HOH M 6 .   ? -73.715 65.610 339.901 1.00 69.32  ? 922  HOH B O   1 
HETATM 8979 O O   . HOH M 6 .   ? -38.796 60.043 379.220 1.00 68.72  ? 923  HOH B O   1 
HETATM 8980 O O   . HOH M 6 .   ? -60.992 53.606 324.557 1.00 67.79  ? 924  HOH B O   1 
HETATM 8981 O O   . HOH M 6 .   ? -70.931 75.738 344.440 1.00 70.44  ? 925  HOH B O   1 
HETATM 8982 O O   . HOH M 6 .   ? -75.168 38.544 349.881 1.00 78.22  ? 926  HOH B O   1 
HETATM 8983 O O   . HOH M 6 .   ? -65.281 64.590 362.710 1.00 43.35  ? 927  HOH B O   1 
HETATM 8984 O O   . HOH M 6 .   ? -67.396 43.265 327.762 1.00 60.48  ? 928  HOH B O   1 
HETATM 8985 O O   . HOH M 6 .   ? -57.137 67.076 339.486 1.00 64.34  ? 929  HOH B O   1 
HETATM 8986 O O   . HOH M 6 .   ? -31.335 39.743 352.291 1.00 63.14  ? 930  HOH B O   1 
HETATM 8987 O O   . HOH M 6 .   ? -61.512 56.081 332.024 1.00 59.67  ? 931  HOH B O   1 
HETATM 8988 O O   . HOH M 6 .   ? -74.515 54.062 358.837 1.00 50.82  ? 932  HOH B O   1 
HETATM 8989 O O   . HOH M 6 .   ? -54.894 33.245 344.862 1.00 63.09  ? 933  HOH B O   1 
HETATM 8990 O O   . HOH M 6 .   ? -38.257 43.640 334.431 1.00 52.99  ? 934  HOH B O   1 
HETATM 8991 O O   . HOH M 6 .   ? -56.458 48.002 374.372 1.00 62.07  ? 935  HOH B O   1 
HETATM 8992 O O   . HOH M 6 .   ? -49.508 37.205 336.257 1.00 52.44  ? 936  HOH B O   1 
HETATM 8993 O O   . HOH M 6 .   ? -41.123 64.705 374.497 1.00 48.55  ? 937  HOH B O   1 
HETATM 8994 O O   . HOH M 6 .   ? -45.661 46.225 337.460 1.00 63.32  ? 938  HOH B O   1 
HETATM 8995 O O   . HOH M 6 .   ? -53.016 41.426 324.837 1.00 59.39  ? 939  HOH B O   1 
HETATM 8996 O O   . HOH M 6 .   ? -73.978 32.096 341.403 1.00 78.33  ? 940  HOH B O   1 
HETATM 8997 O O   . HOH M 6 .   ? -67.954 48.666 355.901 1.00 58.34  ? 941  HOH B O   1 
HETATM 8998 O O   . HOH M 6 .   ? -66.721 37.277 325.686 1.00 50.87  ? 942  HOH B O   1 
HETATM 8999 O O   . HOH M 6 .   ? -43.261 43.359 335.649 1.00 58.40  ? 943  HOH B O   1 
HETATM 9000 O O   . HOH M 6 .   ? -66.018 29.205 357.180 1.00 65.54  ? 944  HOH B O   1 
HETATM 9001 O O   . HOH M 6 .   ? -58.044 73.002 376.570 1.00 69.34  ? 945  HOH B O   1 
HETATM 9002 O O   . HOH M 6 .   ? -67.802 47.398 372.190 1.00 65.61  ? 946  HOH B O   1 
HETATM 9003 O O   . HOH M 6 .   ? -57.059 57.849 340.583 1.00 56.02  ? 947  HOH B O   1 
HETATM 9004 O O   . HOH M 6 .   ? -55.258 35.929 335.629 1.00 62.91  ? 948  HOH B O   1 
HETATM 9005 O O   . HOH M 6 .   ? -45.037 44.737 334.840 1.00 47.30  ? 949  HOH B O   1 
HETATM 9006 O O   . HOH M 6 .   ? -28.921 55.543 350.004 1.00 57.47  ? 950  HOH B O   1 
HETATM 9007 O O   . HOH M 6 .   ? -60.804 34.189 345.809 1.00 67.63  ? 951  HOH B O   1 
HETATM 9008 O O   . HOH M 6 .   ? -71.888 51.489 344.396 1.00 66.39  ? 952  HOH B O   1 
HETATM 9009 O O   . HOH M 6 .   ? -47.760 35.834 341.442 1.00 69.02  ? 953  HOH B O   1 
HETATM 9010 O O   . HOH M 6 .   ? -68.370 78.278 343.436 1.00 73.56  ? 954  HOH B O   1 
HETATM 9011 O O   . HOH M 6 .   ? -45.928 71.023 379.981 1.00 62.02  ? 955  HOH B O   1 
HETATM 9012 O O   . HOH M 6 .   ? -64.935 52.121 323.633 1.00 65.44  ? 956  HOH B O   1 
HETATM 9013 O O   . HOH M 6 .   ? -57.789 42.383 371.532 1.00 64.71  ? 957  HOH B O   1 
HETATM 9014 O O   . HOH M 6 .   ? -66.864 48.882 358.529 1.00 42.34  ? 958  HOH B O   1 
HETATM 9015 O O   . HOH M 6 .   ? -34.254 47.994 341.327 1.00 57.23  ? 959  HOH B O   1 
HETATM 9016 O O   . HOH M 6 .   ? -43.797 29.578 361.643 1.00 64.57  ? 960  HOH B O   1 
HETATM 9017 O O   . HOH M 6 .   ? -62.610 40.230 324.114 1.00 54.86  ? 961  HOH B O   1 
HETATM 9018 O O   . HOH M 6 .   ? -35.798 60.605 372.838 1.00 56.49  ? 962  HOH B O   1 
HETATM 9019 O O   . HOH M 6 .   ? -71.207 76.680 361.858 1.00 65.13  ? 963  HOH B O   1 
HETATM 9020 O O   . HOH M 6 .   ? -39.567 50.294 337.387 1.00 58.23  ? 964  HOH B O   1 
HETATM 9021 O O   . HOH M 6 .   ? -78.024 54.630 360.722 1.00 67.57  ? 965  HOH B O   1 
HETATM 9022 O O   . HOH M 6 .   ? -31.386 36.405 346.164 1.00 71.25  ? 966  HOH B O   1 
HETATM 9023 O O   . HOH M 6 .   ? -60.027 76.314 362.140 1.00 64.98  ? 967  HOH B O   1 
HETATM 9024 O O   . HOH M 6 .   ? -46.479 72.875 370.874 1.00 75.88  ? 968  HOH B O   1 
HETATM 9025 O O   . HOH M 6 .   ? -57.532 47.268 371.968 1.00 57.79  ? 969  HOH B O   1 
HETATM 9026 O O   . HOH M 6 .   ? -43.410 67.183 345.765 1.00 60.75  ? 970  HOH B O   1 
HETATM 9027 O O   . HOH M 6 .   ? -60.845 52.837 336.524 1.00 65.63  ? 971  HOH B O   1 
HETATM 9028 O O   . HOH M 6 .   ? -39.485 64.444 376.837 1.00 57.45  ? 972  HOH B O   1 
HETATM 9029 O O   . HOH M 6 .   ? -56.859 25.696 369.086 1.00 60.46  ? 973  HOH B O   1 
HETATM 9030 O O   . HOH M 6 .   ? -73.674 34.862 359.515 1.00 71.55  ? 974  HOH B O   1 
HETATM 9031 O O   . HOH M 6 .   ? -52.192 57.750 340.382 1.00 54.15  ? 975  HOH B O   1 
HETATM 9032 O O   . HOH M 6 .   ? -58.943 67.922 382.110 1.00 71.36  ? 976  HOH B O   1 
HETATM 9033 O O   . HOH M 6 .   ? -31.264 51.550 342.094 1.00 64.31  ? 977  HOH B O   1 
HETATM 9034 O O   . HOH M 6 .   ? -38.355 63.137 346.069 1.00 59.40  ? 978  HOH B O   1 
HETATM 9035 O O   . HOH M 6 .   ? -72.915 41.675 330.778 1.00 62.63  ? 979  HOH B O   1 
HETATM 9036 O O   . HOH M 6 .   ? -75.209 37.264 359.030 1.00 63.86  ? 980  HOH B O   1 
HETATM 9037 O O   . HOH M 6 .   ? -35.484 45.033 370.937 1.00 62.69  ? 981  HOH B O   1 
HETATM 9038 O O   . HOH M 6 .   ? -42.849 49.160 338.088 1.00 53.70  ? 982  HOH B O   1 
HETATM 9039 O O   . HOH M 6 .   ? -35.999 33.267 343.082 1.00 60.74  ? 983  HOH B O   1 
HETATM 9040 O O   . HOH M 6 .   ? -77.081 71.230 344.702 1.00 70.24  ? 984  HOH B O   1 
HETATM 9041 O O   . HOH M 6 .   ? -70.584 50.961 369.593 1.00 59.65  ? 985  HOH B O   1 
HETATM 9042 O O   . HOH M 6 .   ? -48.195 70.779 366.671 1.00 66.12  ? 986  HOH B O   1 
HETATM 9043 O O   . HOH M 6 .   ? -73.876 72.145 364.178 1.00 67.00  ? 987  HOH B O   1 
HETATM 9044 O O   . HOH M 6 .   ? -54.073 69.956 352.322 1.00 65.09  ? 988  HOH B O   1 
HETATM 9045 O O   . HOH M 6 .   ? -60.860 38.847 364.993 1.00 65.96  ? 989  HOH B O   1 
HETATM 9046 O O   . HOH M 6 .   ? -56.565 74.320 345.442 1.00 67.12  ? 990  HOH B O   1 
HETATM 9047 O O   . HOH M 6 .   ? -65.166 63.542 375.041 1.00 68.86  ? 991  HOH B O   1 
HETATM 9048 O O   . HOH M 6 .   ? -60.057 47.444 356.365 1.00 42.86  ? 992  HOH B O   1 
HETATM 9049 O O   . HOH M 6 .   ? -53.258 71.371 359.488 1.00 52.82  ? 993  HOH B O   1 
HETATM 9050 O O   . HOH M 6 .   ? -34.276 36.004 370.027 1.00 74.21  ? 994  HOH B O   1 
HETATM 9051 O O   . HOH M 6 .   ? -61.460 41.343 366.424 1.00 60.54  ? 995  HOH B O   1 
HETATM 9052 O O   . HOH M 6 .   ? -77.485 77.425 355.723 1.00 66.78  ? 996  HOH B O   1 
HETATM 9053 O O   . HOH M 6 .   ? -41.019 57.332 386.110 1.00 70.17  ? 997  HOH B O   1 
HETATM 9054 O O   . HOH M 6 .   ? -49.065 28.074 372.961 1.00 64.94  ? 998  HOH B O   1 
HETATM 9055 O O   . HOH M 6 .   ? -48.708 68.843 367.895 1.00 55.61  ? 999  HOH B O   1 
HETATM 9056 O O   . HOH M 6 .   ? -48.857 69.453 371.979 1.00 56.10  ? 1000 HOH B O   1 
HETATM 9057 O O   . HOH M 6 .   ? -64.738 78.949 358.148 1.00 95.15  ? 1001 HOH B O   1 
HETATM 9058 O O   . HOH M 6 .   ? -40.701 68.305 359.731 1.00 63.35  ? 1002 HOH B O   1 
HETATM 9059 O O   . HOH M 6 .   ? -63.066 70.083 374.155 1.00 64.15  ? 1003 HOH B O   1 
HETATM 9060 O O   . HOH M 6 .   ? -52.058 69.219 339.588 1.00 66.84  ? 1004 HOH B O   1 
HETATM 9061 O O   . HOH M 6 .   ? -63.055 53.726 323.379 1.00 69.05  ? 1005 HOH B O   1 
HETATM 9062 O O   . HOH M 6 .   ? -66.287 56.759 373.943 1.00 62.70  ? 1006 HOH B O   1 
HETATM 9063 O O   . HOH M 6 .   ? -68.730 46.066 367.681 1.00 64.32  ? 1007 HOH B O   1 
HETATM 9064 O O   . HOH M 6 .   ? -65.318 55.613 339.994 1.00 59.18  ? 1008 HOH B O   1 
HETATM 9065 O O   . HOH M 6 .   ? -67.473 54.730 340.288 1.00 57.90  ? 1009 HOH B O   1 
HETATM 9066 O O   . HOH M 6 .   ? -84.911 68.737 345.163 1.00 64.40  ? 1010 HOH B O   1 
HETATM 9067 O O   . HOH M 6 .   ? -41.568 36.935 370.607 1.00 49.56  ? 1011 HOH B O   1 
HETATM 9068 O O   . HOH M 6 .   ? -59.048 43.768 373.229 1.00 72.43  ? 1012 HOH B O   1 
HETATM 9069 O O   . HOH M 6 .   ? -59.553 68.798 377.900 1.00 57.76  ? 1013 HOH B O   1 
HETATM 9070 O O   . HOH M 6 .   ? -53.996 75.802 380.829 1.00 71.58  ? 1014 HOH B O   1 
HETATM 9071 O O   . HOH M 6 .   ? -65.839 42.514 367.019 1.00 65.53  ? 1015 HOH B O   1 
HETATM 9072 O O   . HOH M 6 .   ? -57.945 60.305 339.827 1.00 67.65  ? 1016 HOH B O   1 
HETATM 9073 O O   . HOH M 6 .   ? -59.054 30.268 346.997 1.00 67.11  ? 1017 HOH B O   1 
HETATM 9074 O O   . HOH M 6 .   ? -52.786 71.312 340.375 1.00 56.44  ? 1018 HOH B O   1 
HETATM 9075 O O   . HOH M 6 .   ? -78.243 75.586 344.105 1.00 68.12  ? 1019 HOH B O   1 
HETATM 9076 O O   . HOH M 6 .   ? -64.173 26.110 348.109 1.00 67.15  ? 1020 HOH B O   1 
HETATM 9077 O O   . HOH M 6 .   ? -43.399 68.277 384.503 1.00 67.88  ? 1021 HOH B O   1 
HETATM 9078 O O   . HOH M 6 .   ? -75.801 39.174 335.135 1.00 65.82  ? 1022 HOH B O   1 
HETATM 9079 O O   . HOH M 6 .   ? -40.363 28.753 360.174 1.00 66.43  ? 1023 HOH B O   1 
HETATM 9080 O O   . HOH M 6 .   ? -39.729 35.098 367.752 1.00 65.65  ? 1024 HOH B O   1 
HETATM 9081 O O   . HOH M 6 .   ? -54.712 43.865 325.214 1.00 67.01  ? 1025 HOH B O   1 
HETATM 9082 O O   . HOH M 6 .   ? -44.696 48.287 336.813 1.00 60.83  ? 1026 HOH B O   1 
HETATM 9083 O O   . HOH M 6 .   ? -36.130 58.384 336.893 1.00 71.27  ? 1027 HOH B O   1 
HETATM 9084 O O   . HOH M 6 .   ? -80.293 59.145 345.998 1.00 64.00  ? 1028 HOH B O   1 
HETATM 9085 O O   . HOH M 6 .   ? -60.382 64.428 376.540 1.00 51.80  ? 1029 HOH B O   1 
HETATM 9086 O O   . HOH M 6 .   ? -74.253 44.358 337.256 1.00 62.60  ? 1030 HOH B O   1 
HETATM 9087 O O   . HOH M 6 .   ? -45.293 35.119 375.303 1.00 78.71  ? 1031 HOH B O   1 
HETATM 9088 O O   . HOH M 6 .   ? -59.069 30.972 334.543 1.00 49.41  ? 1032 HOH B O   1 
HETATM 9089 O O   . HOH M 6 .   ? -55.804 73.257 353.622 1.00 57.18  ? 1033 HOH B O   1 
HETATM 9090 O O   . HOH M 6 .   ? -38.378 65.573 372.227 1.00 62.73  ? 1034 HOH B O   1 
HETATM 9091 O O   . HOH M 6 .   ? -30.889 49.490 347.791 1.00 65.74  ? 1035 HOH B O   1 
HETATM 9092 O O   . HOH M 6 .   ? -82.484 72.132 347.440 1.00 65.65  ? 1036 HOH B O   1 
HETATM 9093 O O   . HOH M 6 .   ? -38.969 34.863 365.483 1.00 60.12  ? 1037 HOH B O   1 
HETATM 9094 O O   . HOH M 6 .   ? -68.293 67.140 336.548 1.00 70.93  ? 1038 HOH B O   1 
HETATM 9095 O O   . HOH M 6 .   ? -76.749 66.833 341.673 1.00 62.10  ? 1039 HOH B O   1 
HETATM 9096 O O   . HOH M 6 .   ? -72.477 68.830 339.457 1.00 59.76  ? 1040 HOH B O   1 
HETATM 9097 O O   . HOH M 6 .   ? -30.363 39.269 347.176 1.00 73.84  ? 1041 HOH B O   1 
HETATM 9098 O O   . HOH M 6 .   ? -52.503 25.256 358.212 1.00 63.32  ? 1042 HOH B O   1 
HETATM 9099 O O   . HOH M 6 .   ? -58.374 53.212 335.626 1.00 66.17  ? 1043 HOH B O   1 
HETATM 9100 O O   . HOH M 6 .   ? -47.919 70.724 383.451 1.00 68.86  ? 1044 HOH B O   1 
HETATM 9101 O O   . HOH M 6 .   ? -41.038 68.745 363.355 1.00 69.70  ? 1045 HOH B O   1 
HETATM 9102 O O   . HOH M 6 .   ? -35.606 63.325 372.347 1.00 68.29  ? 1046 HOH B O   1 
HETATM 9103 O O   . HOH M 6 .   ? -50.986 54.284 396.913 1.00 72.97  ? 1047 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   2   ?   ?   ?   A . n 
A 1 2   ARG 2   3   3   ARG ARG A . n 
A 1 3   GLU 3   4   4   GLU GLU A . n 
A 1 4   ASP 4   5   5   ASP ASP A . n 
A 1 5   ALA 5   6   6   ALA ALA A . n 
A 1 6   GLU 6   7   7   GLU GLU A . n 
A 1 7   LEU 7   8   8   LEU LEU A . n 
A 1 8   LEU 8   9   9   LEU LEU A . n 
A 1 9   VAL 9   10  10  VAL VAL A . n 
A 1 10  THR 10  11  11  THR THR A . n 
A 1 11  VAL 11  12  12  VAL VAL A . n 
A 1 12  ARG 12  13  13  ARG ARG A . n 
A 1 13  GLY 13  14  14  GLY GLY A . n 
A 1 14  GLY 14  15  15  GLY GLY A . n 
A 1 15  ARG 15  16  16  ARG ARG A . n 
A 1 16  LEU 16  17  17  LEU LEU A . n 
A 1 17  ARG 17  18  18  ARG ARG A . n 
A 1 18  GLY 18  19  19  GLY GLY A . n 
A 1 19  ILE 19  20  20  ILE ILE A . n 
A 1 20  ARG 20  21  21  ARG ARG A . n 
A 1 21  LEU 21  22  22  LEU LEU A . n 
A 1 22  LYS 22  23  23  LYS LYS A . n 
A 1 23  THR 23  24  24  THR THR A . n 
A 1 24  PRO 24  25  25  PRO PRO A . n 
A 1 25  GLY 25  26  26  GLY GLY A . n 
A 1 26  GLY 26  27  27  GLY GLY A . n 
A 1 27  PRO 27  28  28  PRO PRO A . n 
A 1 28  VAL 28  29  29  VAL VAL A . n 
A 1 29  SER 29  30  30  SER SER A . n 
A 1 30  ALA 30  31  31  ALA ALA A . n 
A 1 31  PHE 31  32  32  PHE PHE A . n 
A 1 32  LEU 32  33  33  LEU LEU A . n 
A 1 33  GLY 33  34  34  GLY GLY A . n 
A 1 34  ILE 34  35  35  ILE ILE A . n 
A 1 35  PRO 35  36  36  PRO PRO A . n 
A 1 36  PHE 36  37  37  PHE PHE A . n 
A 1 37  ALA 37  38  38  ALA ALA A . n 
A 1 38  GLU 38  39  39  GLU GLU A . n 
A 1 39  PRO 39  40  40  PRO PRO A . n 
A 1 40  PRO 40  41  41  PRO PRO A . n 
A 1 41  MET 41  42  42  MET MET A . n 
A 1 42  GLY 42  43  43  GLY GLY A . n 
A 1 43  PRO 43  44  44  PRO PRO A . n 
A 1 44  ARG 44  45  45  ARG ARG A . n 
A 1 45  ARG 45  46  46  ARG ARG A . n 
A 1 46  PHE 46  47  47  PHE PHE A . n 
A 1 47  LEU 47  48  48  LEU LEU A . n 
A 1 48  PRO 48  49  49  PRO PRO A . n 
A 1 49  PRO 49  50  50  PRO PRO A . n 
A 1 50  GLU 50  51  51  GLU GLU A . n 
A 1 51  PRO 51  52  52  PRO PRO A . n 
A 1 52  LYS 52  53  53  LYS LYS A . n 
A 1 53  GLN 53  54  54  GLN GLN A . n 
A 1 54  PRO 54  55  55  PRO PRO A . n 
A 1 55  TRP 55  56  56  TRP TRP A . n 
A 1 56  SER 56  57  57  SER SER A . n 
A 1 57  GLY 57  58  58  GLY GLY A . n 
A 1 58  VAL 58  59  59  VAL VAL A . n 
A 1 59  VAL 59  60  60  VAL VAL A . n 
A 1 60  ASP 60  61  61  ASP ASP A . n 
A 1 61  ALA 61  62  62  ALA ALA A . n 
A 1 62  THR 62  63  63  THR THR A . n 
A 1 63  THR 63  64  64  THR THR A . n 
A 1 64  PHE 64  65  65  PHE PHE A . n 
A 1 65  GLN 65  66  66  GLN GLN A . n 
A 1 66  SER 66  67  67  SER SER A . n 
A 1 67  VAL 67  68  68  VAL VAL A . n 
A 1 68  CYS 68  69  69  CYS CYS A . n 
A 1 69  TYR 69  70  70  TYR TYR A . n 
A 1 70  GLN 70  71  71  GLN GLN A . n 
A 1 71  TYR 71  72  72  TYR TYR A . n 
A 1 72  VAL 72  73  73  VAL VAL A . n 
A 1 73  ASP 73  74  74  ASP ASP A . n 
A 1 74  THR 74  75  75  THR THR A . n 
A 1 75  LEU 75  76  76  LEU LEU A . n 
A 1 76  TYR 76  77  77  TYR TYR A . n 
A 1 77  PRO 77  78  78  PRO PRO A . n 
A 1 78  GLY 78  79  79  GLY GLY A . n 
A 1 79  PHE 79  80  80  PHE PHE A . n 
A 1 80  GLU 80  81  81  GLU GLU A . n 
A 1 81  GLY 81  82  82  GLY GLY A . n 
A 1 82  THR 82  83  83  THR THR A . n 
A 1 83  GLU 83  84  84  GLU GLU A . n 
A 1 84  MET 84  85  85  MET MET A . n 
A 1 85  TRP 85  86  86  TRP TRP A . n 
A 1 86  ASN 86  87  87  ASN ASN A . n 
A 1 87  PRO 87  88  88  PRO PRO A . n 
A 1 88  ASN 88  89  89  ASN ASN A . n 
A 1 89  ARG 89  90  90  ARG ARG A . n 
A 1 90  GLU 90  91  91  GLU GLU A . n 
A 1 91  LEU 91  92  92  LEU LEU A . n 
A 1 92  SER 92  93  93  SER SER A . n 
A 1 93  GLU 93  94  94  GLU GLU A . n 
A 1 94  ASP 94  95  95  ASP ASP A . n 
A 1 95  CYS 95  96  96  CYS CYS A . n 
A 1 96  LEU 96  97  97  LEU LEU A . n 
A 1 97  TYR 97  98  98  TYR TYR A . n 
A 1 98  LEU 98  99  99  LEU LEU A . n 
A 1 99  ASN 99  100 100 ASN ASN A . n 
A 1 100 VAL 100 101 101 VAL VAL A . n 
A 1 101 TRP 101 102 102 TRP TRP A . n 
A 1 102 THR 102 103 103 THR THR A . n 
A 1 103 PRO 103 104 104 PRO PRO A . n 
A 1 104 TYR 104 105 105 TYR TYR A . n 
A 1 105 PRO 105 106 106 PRO PRO A . n 
A 1 106 ARG 106 107 107 ARG ARG A . n 
A 1 107 PRO 107 108 108 PRO PRO A . n 
A 1 108 THR 108 109 109 THR THR A . n 
A 1 109 SER 109 110 110 SER SER A . n 
A 1 110 PRO 110 111 111 PRO PRO A . n 
A 1 111 THR 111 112 112 THR THR A . n 
A 1 112 PRO 112 113 113 PRO PRO A . n 
A 1 113 VAL 113 114 114 VAL VAL A . n 
A 1 114 LEU 114 115 115 LEU LEU A . n 
A 1 115 VAL 115 116 116 VAL VAL A . n 
A 1 116 TRP 116 117 117 TRP TRP A . n 
A 1 117 ILE 117 118 118 ILE ILE A . n 
A 1 118 TYR 118 119 119 TYR TYR A . n 
A 1 119 GLY 119 120 120 GLY GLY A . n 
A 1 120 GLY 120 121 121 GLY GLY A . n 
A 1 121 GLY 121 122 122 GLY GLY A . n 
A 1 122 PHE 122 123 123 PHE PHE A . n 
A 1 123 TYR 123 124 124 TYR TYR A . n 
A 1 124 SER 124 125 125 SER SER A . n 
A 1 125 GLY 125 126 126 GLY GLY A . n 
A 1 126 ALA 126 127 127 ALA ALA A . n 
A 1 127 SER 127 128 128 SER SER A . n 
A 1 128 SER 128 129 129 SER SER A . n 
A 1 129 LEU 129 130 130 LEU LEU A . n 
A 1 130 ASP 130 131 131 ASP ASP A . n 
A 1 131 VAL 131 132 132 VAL VAL A . n 
A 1 132 TYR 132 133 133 TYR TYR A . n 
A 1 133 ASP 133 134 134 ASP ASP A . n 
A 1 134 GLY 134 135 135 GLY GLY A . n 
A 1 135 ARG 135 136 136 ARG ARG A . n 
A 1 136 PHE 136 137 137 PHE PHE A . n 
A 1 137 LEU 137 138 138 LEU LEU A . n 
A 1 138 VAL 138 139 139 VAL VAL A . n 
A 1 139 GLN 139 140 140 GLN GLN A . n 
A 1 140 ALA 140 141 141 ALA ALA A . n 
A 1 141 GLU 141 142 142 GLU GLU A . n 
A 1 142 ARG 142 143 143 ARG ARG A . n 
A 1 143 THR 143 144 144 THR THR A . n 
A 1 144 VAL 144 145 145 VAL VAL A . n 
A 1 145 LEU 145 146 146 LEU LEU A . n 
A 1 146 VAL 146 147 147 VAL VAL A . n 
A 1 147 SER 147 148 148 SER SER A . n 
A 1 148 MET 148 149 149 MET MET A . n 
A 1 149 ASN 149 150 150 ASN ASN A . n 
A 1 150 TYR 150 151 151 TYR TYR A . n 
A 1 151 ARG 151 152 152 ARG ARG A . n 
A 1 152 VAL 152 153 153 VAL VAL A . n 
A 1 153 GLY 153 154 154 GLY GLY A . n 
A 1 154 ALA 154 155 155 ALA ALA A . n 
A 1 155 PHE 155 156 156 PHE PHE A . n 
A 1 156 GLY 156 157 157 GLY GLY A . n 
A 1 157 PHE 157 158 158 PHE PHE A . n 
A 1 158 LEU 158 159 159 LEU LEU A . n 
A 1 159 ALA 159 160 160 ALA ALA A . n 
A 1 160 LEU 160 161 161 LEU LEU A . n 
A 1 161 PRO 161 162 162 PRO PRO A . n 
A 1 162 GLY 162 163 163 GLY GLY A . n 
A 1 163 SER 163 164 164 SER SER A . n 
A 1 164 ARG 164 165 165 ARG ARG A . n 
A 1 165 GLU 165 166 166 GLU GLU A . n 
A 1 166 ALA 166 167 167 ALA ALA A . n 
A 1 167 PRO 167 168 168 PRO PRO A . n 
A 1 168 GLY 168 169 169 GLY GLY A . n 
A 1 169 ASN 169 170 170 ASN ASN A . n 
A 1 170 VAL 170 171 171 VAL VAL A . n 
A 1 171 GLY 171 172 172 GLY GLY A . n 
A 1 172 LEU 172 173 173 LEU LEU A . n 
A 1 173 LEU 173 174 174 LEU LEU A . n 
A 1 174 ASP 174 175 175 ASP ASP A . n 
A 1 175 GLN 175 176 176 GLN GLN A . n 
A 1 176 ARG 176 177 177 ARG ARG A . n 
A 1 177 LEU 177 178 178 LEU LEU A . n 
A 1 178 ALA 178 179 179 ALA ALA A . n 
A 1 179 LEU 179 180 180 LEU LEU A . n 
A 1 180 GLN 180 181 181 GLN GLN A . n 
A 1 181 TRP 181 182 182 TRP TRP A . n 
A 1 182 VAL 182 183 183 VAL VAL A . n 
A 1 183 GLN 183 184 184 GLN GLN A . n 
A 1 184 GLU 184 185 185 GLU GLU A . n 
A 1 185 ASN 185 186 186 ASN ASN A . n 
A 1 186 VAL 186 187 187 VAL VAL A . n 
A 1 187 ALA 187 188 188 ALA ALA A . n 
A 1 188 ALA 188 189 189 ALA ALA A . n 
A 1 189 PHE 189 190 190 PHE PHE A . n 
A 1 190 GLY 190 191 191 GLY GLY A . n 
A 1 191 GLY 191 192 192 GLY GLY A . n 
A 1 192 ASP 192 193 193 ASP ASP A . n 
A 1 193 PRO 193 194 194 PRO PRO A . n 
A 1 194 THR 194 195 195 THR THR A . n 
A 1 195 SER 195 196 196 SER SER A . n 
A 1 196 VAL 196 197 197 VAL VAL A . n 
A 1 197 THR 197 198 198 THR THR A . n 
A 1 198 LEU 198 199 199 LEU LEU A . n 
A 1 199 PHE 199 200 200 PHE PHE A . n 
A 1 200 GLY 200 201 201 GLY GLY A . n 
A 1 201 GLU 201 202 202 GLU GLU A . n 
A 1 202 SER 202 203 203 SER SER A . n 
A 1 203 ALA 203 204 204 ALA ALA A . n 
A 1 204 GLY 204 205 205 GLY GLY A . n 
A 1 205 ALA 205 206 206 ALA ALA A . n 
A 1 206 ALA 206 207 207 ALA ALA A . n 
A 1 207 SER 207 208 208 SER SER A . n 
A 1 208 VAL 208 209 209 VAL VAL A . n 
A 1 209 GLY 209 210 210 GLY GLY A . n 
A 1 210 MET 210 211 211 MET MET A . n 
A 1 211 HIS 211 212 212 HIS HIS A . n 
A 1 212 LEU 212 213 213 LEU LEU A . n 
A 1 213 LEU 213 214 214 LEU LEU A . n 
A 1 214 SER 214 215 215 SER SER A . n 
A 1 215 PRO 215 216 216 PRO PRO A . n 
A 1 216 PRO 216 217 217 PRO PRO A . n 
A 1 217 SER 217 218 218 SER SER A . n 
A 1 218 ARG 218 219 219 ARG ARG A . n 
A 1 219 GLY 219 220 220 GLY GLY A . n 
A 1 220 LEU 220 221 221 LEU LEU A . n 
A 1 221 PHE 221 222 222 PHE PHE A . n 
A 1 222 HIS 222 223 223 HIS HIS A . n 
A 1 223 ARG 223 224 224 ARG ARG A . n 
A 1 224 ALA 224 225 225 ALA ALA A . n 
A 1 225 VAL 225 226 226 VAL VAL A . n 
A 1 226 LEU 226 227 227 LEU LEU A . n 
A 1 227 GLN 227 228 228 GLN GLN A . n 
A 1 228 SER 228 229 229 SER SER A . n 
A 1 229 GLY 229 230 230 GLY GLY A . n 
A 1 230 ALA 230 231 231 ALA ALA A . n 
A 1 231 PRO 231 232 232 PRO PRO A . n 
A 1 232 ASN 232 233 233 ASN ASN A . n 
A 1 233 GLY 233 234 234 GLY GLY A . n 
A 1 234 PRO 234 235 235 PRO PRO A . n 
A 1 235 TRP 235 236 236 TRP TRP A . n 
A 1 236 ALA 236 237 237 ALA ALA A . n 
A 1 237 THR 237 238 238 THR THR A . n 
A 1 238 VAL 238 239 239 VAL VAL A . n 
A 1 239 GLY 239 240 240 GLY GLY A . n 
A 1 240 MET 240 241 241 MET MET A . n 
A 1 241 GLY 241 242 242 GLY GLY A . n 
A 1 242 GLU 242 243 243 GLU GLU A . n 
A 1 243 ALA 243 244 244 ALA ALA A . n 
A 1 244 ARG 244 245 245 ARG ARG A . n 
A 1 245 ARG 245 246 246 ARG ARG A . n 
A 1 246 ARG 246 247 247 ARG ARG A . n 
A 1 247 ALA 247 248 248 ALA ALA A . n 
A 1 248 THR 248 249 249 THR THR A . n 
A 1 249 GLN 249 250 250 GLN GLN A . n 
A 1 250 LEU 250 251 251 LEU LEU A . n 
A 1 251 ALA 251 252 252 ALA ALA A . n 
A 1 252 HIS 252 253 253 HIS HIS A . n 
A 1 253 LEU 253 254 254 LEU LEU A . n 
A 1 254 VAL 254 255 255 VAL VAL A . n 
A 1 255 GLY 255 256 256 GLY GLY A . n 
A 1 256 CYS 256 257 257 CYS CYS A . n 
A 1 257 PRO 257 258 258 PRO PRO A . n 
A 1 258 PRO 258 259 259 PRO PRO A . n 
A 1 259 GLY 259 260 ?   ?   ?   A . n 
A 1 260 GLY 260 261 ?   ?   ?   A . n 
A 1 261 THR 261 262 ?   ?   ?   A . n 
A 1 262 GLY 262 263 263 GLY GLY A . n 
A 1 263 GLY 263 264 264 GLY GLY A . n 
A 1 264 ASN 264 265 265 ASN ASN A . n 
A 1 265 ASP 265 266 266 ASP ASP A . n 
A 1 266 THR 266 267 267 THR THR A . n 
A 1 267 GLU 267 268 268 GLU GLU A . n 
A 1 268 LEU 268 269 269 LEU LEU A . n 
A 1 269 VAL 269 270 270 VAL VAL A . n 
A 1 270 ALA 270 271 271 ALA ALA A . n 
A 1 271 CYS 271 272 272 CYS CYS A . n 
A 1 272 LEU 272 273 273 LEU LEU A . n 
A 1 273 ARG 273 274 274 ARG ARG A . n 
A 1 274 THR 274 275 275 THR THR A . n 
A 1 275 ARG 275 276 276 ARG ARG A . n 
A 1 276 PRO 276 277 277 PRO PRO A . n 
A 1 277 ALA 277 278 278 ALA ALA A . n 
A 1 278 GLN 278 279 279 GLN GLN A . n 
A 1 279 VAL 279 280 280 VAL VAL A . n 
A 1 280 LEU 280 281 281 LEU LEU A . n 
A 1 281 VAL 281 282 282 VAL VAL A . n 
A 1 282 ASN 282 283 283 ASN ASN A . n 
A 1 283 HIS 283 284 284 HIS HIS A . n 
A 1 284 GLU 284 285 285 GLU GLU A . n 
A 1 285 TRP 285 286 286 TRP TRP A . n 
A 1 286 HIS 286 287 287 HIS HIS A . n 
A 1 287 VAL 287 288 288 VAL VAL A . n 
A 1 288 LEU 288 289 289 LEU LEU A . n 
A 1 289 PRO 289 290 290 PRO PRO A . n 
A 1 290 GLN 290 291 291 GLN GLN A . n 
A 1 291 GLU 291 292 292 GLU GLU A . n 
A 1 292 SER 292 293 293 SER SER A . n 
A 1 293 VAL 293 294 294 VAL VAL A . n 
A 1 294 PHE 294 295 295 PHE PHE A . n 
A 1 295 ARG 295 296 296 ARG ARG A . n 
A 1 296 PHE 296 297 297 PHE PHE A . n 
A 1 297 SER 297 298 298 SER SER A . n 
A 1 298 PHE 298 299 299 PHE PHE A . n 
A 1 299 VAL 299 300 300 VAL VAL A . n 
A 1 300 PRO 300 301 301 PRO PRO A . n 
A 1 301 VAL 301 302 302 VAL VAL A . n 
A 1 302 VAL 302 303 303 VAL VAL A . n 
A 1 303 ASP 303 304 304 ASP ASP A . n 
A 1 304 GLY 304 305 305 GLY GLY A . n 
A 1 305 ASP 305 306 306 ASP ASP A . n 
A 1 306 PHE 306 307 307 PHE PHE A . n 
A 1 307 LEU 307 308 308 LEU LEU A . n 
A 1 308 SER 308 309 309 SER SER A . n 
A 1 309 ASP 309 310 310 ASP ASP A . n 
A 1 310 THR 310 311 311 THR THR A . n 
A 1 311 PRO 311 312 312 PRO PRO A . n 
A 1 312 GLU 312 313 313 GLU GLU A . n 
A 1 313 ALA 313 314 314 ALA ALA A . n 
A 1 314 LEU 314 315 315 LEU LEU A . n 
A 1 315 ILE 315 316 316 ILE ILE A . n 
A 1 316 ASN 316 317 317 ASN ASN A . n 
A 1 317 ALA 317 318 318 ALA ALA A . n 
A 1 318 GLY 318 319 319 GLY GLY A . n 
A 1 319 ASP 319 320 320 ASP ASP A . n 
A 1 320 PHE 320 321 321 PHE PHE A . n 
A 1 321 HIS 321 322 322 HIS HIS A . n 
A 1 322 GLY 322 323 323 GLY GLY A . n 
A 1 323 LEU 323 324 324 LEU LEU A . n 
A 1 324 GLN 324 325 325 GLN GLN A . n 
A 1 325 VAL 325 326 326 VAL VAL A . n 
A 1 326 LEU 326 327 327 LEU LEU A . n 
A 1 327 VAL 327 328 328 VAL VAL A . n 
A 1 328 GLY 328 329 329 GLY GLY A . n 
A 1 329 VAL 329 330 330 VAL VAL A . n 
A 1 330 VAL 330 331 331 VAL VAL A . n 
A 1 331 LYS 331 332 332 LYS LYS A . n 
A 1 332 ASP 332 333 333 ASP ASP A . n 
A 1 333 GLU 333 334 334 GLU GLU A . n 
A 1 334 GLY 334 335 335 GLY GLY A . n 
A 1 335 SER 335 336 336 SER SER A . n 
A 1 336 TYR 336 337 337 TYR TYR A . n 
A 1 337 PHE 337 338 338 PHE PHE A . n 
A 1 338 LEU 338 339 339 LEU LEU A . n 
A 1 339 VAL 339 340 340 VAL VAL A . n 
A 1 340 TYR 340 341 341 TYR TYR A . n 
A 1 341 GLY 341 342 342 GLY GLY A . n 
A 1 342 ALA 342 343 343 ALA ALA A . n 
A 1 343 PRO 343 344 344 PRO PRO A . n 
A 1 344 GLY 344 345 345 GLY GLY A . n 
A 1 345 PHE 345 346 346 PHE PHE A . n 
A 1 346 SER 346 347 347 SER SER A . n 
A 1 347 LYS 347 348 348 LYS LYS A . n 
A 1 348 ASP 348 349 349 ASP ASP A . n 
A 1 349 ASN 349 350 350 ASN ASN A . n 
A 1 350 GLU 350 351 351 GLU GLU A . n 
A 1 351 SER 351 352 352 SER SER A . n 
A 1 352 LEU 352 353 353 LEU LEU A . n 
A 1 353 ILE 353 354 354 ILE ILE A . n 
A 1 354 SER 354 355 355 SER SER A . n 
A 1 355 ARG 355 356 356 ARG ARG A . n 
A 1 356 ALA 356 357 357 ALA ALA A . n 
A 1 357 GLU 357 358 358 GLU GLU A . n 
A 1 358 PHE 358 359 359 PHE PHE A . n 
A 1 359 LEU 359 360 360 LEU LEU A . n 
A 1 360 ALA 360 361 361 ALA ALA A . n 
A 1 361 GLY 361 362 362 GLY GLY A . n 
A 1 362 VAL 362 363 363 VAL VAL A . n 
A 1 363 ARG 363 364 364 ARG ARG A . n 
A 1 364 VAL 364 365 365 VAL VAL A . n 
A 1 365 GLY 365 366 366 GLY GLY A . n 
A 1 366 VAL 366 367 367 VAL VAL A . n 
A 1 367 PRO 367 368 368 PRO PRO A . n 
A 1 368 GLN 368 369 369 GLN GLN A . n 
A 1 369 VAL 369 370 370 VAL VAL A . n 
A 1 370 SER 370 371 371 SER SER A . n 
A 1 371 ASP 371 372 372 ASP ASP A . n 
A 1 372 LEU 372 373 373 LEU LEU A . n 
A 1 373 ALA 373 374 374 ALA ALA A . n 
A 1 374 ALA 374 375 375 ALA ALA A . n 
A 1 375 GLU 375 376 376 GLU GLU A . n 
A 1 376 ALA 376 377 377 ALA ALA A . n 
A 1 377 VAL 377 378 378 VAL VAL A . n 
A 1 378 VAL 378 379 379 VAL VAL A . n 
A 1 379 LEU 379 380 380 LEU LEU A . n 
A 1 380 HIS 380 381 381 HIS HIS A . n 
A 1 381 TYR 381 382 382 TYR TYR A . n 
A 1 382 THR 382 383 383 THR THR A . n 
A 1 383 ASP 383 384 384 ASP ASP A . n 
A 1 384 TRP 384 385 385 TRP TRP A . n 
A 1 385 LEU 385 386 386 LEU LEU A . n 
A 1 386 HIS 386 387 387 HIS HIS A . n 
A 1 387 PRO 387 388 388 PRO PRO A . n 
A 1 388 GLU 388 389 389 GLU GLU A . n 
A 1 389 ASP 389 390 390 ASP ASP A . n 
A 1 390 PRO 390 391 391 PRO PRO A . n 
A 1 391 ALA 391 392 392 ALA ALA A . n 
A 1 392 ARG 392 393 393 ARG ARG A . n 
A 1 393 LEU 393 394 394 LEU LEU A . n 
A 1 394 ARG 394 395 395 ARG ARG A . n 
A 1 395 GLU 395 396 396 GLU GLU A . n 
A 1 396 ALA 396 397 397 ALA ALA A . n 
A 1 397 LEU 397 398 398 LEU LEU A . n 
A 1 398 SER 398 399 399 SER SER A . n 
A 1 399 ASP 399 400 400 ASP ASP A . n 
A 1 400 VAL 400 401 401 VAL VAL A . n 
A 1 401 VAL 401 402 402 VAL VAL A . n 
A 1 402 GLY 402 403 403 GLY GLY A . n 
A 1 403 ASP 403 404 404 ASP ASP A . n 
A 1 404 HIS 404 405 405 HIS HIS A . n 
A 1 405 ASN 405 406 406 ASN ASN A . n 
A 1 406 VAL 406 407 407 VAL VAL A . n 
A 1 407 VAL 407 408 408 VAL VAL A . n 
A 1 408 CYS 408 409 409 CYS CYS A . n 
A 1 409 PRO 409 410 410 PRO PRO A . n 
A 1 410 VAL 410 411 411 VAL VAL A . n 
A 1 411 ALA 411 412 412 ALA ALA A . n 
A 1 412 GLN 412 413 413 GLN GLN A . n 
A 1 413 LEU 413 414 414 LEU LEU A . n 
A 1 414 ALA 414 415 415 ALA ALA A . n 
A 1 415 GLY 415 416 416 GLY GLY A . n 
A 1 416 ARG 416 417 417 ARG ARG A . n 
A 1 417 LEU 417 418 418 LEU LEU A . n 
A 1 418 ALA 418 419 419 ALA ALA A . n 
A 1 419 ALA 419 420 420 ALA ALA A . n 
A 1 420 GLN 420 421 421 GLN GLN A . n 
A 1 421 GLY 421 422 422 GLY GLY A . n 
A 1 422 ALA 422 423 423 ALA ALA A . n 
A 1 423 ARG 423 424 424 ARG ARG A . n 
A 1 424 VAL 424 425 425 VAL VAL A . n 
A 1 425 TYR 425 426 426 TYR TYR A . n 
A 1 426 ALA 426 427 427 ALA ALA A . n 
A 1 427 TYR 427 428 428 TYR TYR A . n 
A 1 428 VAL 428 429 429 VAL VAL A . n 
A 1 429 PHE 429 430 430 PHE PHE A . n 
A 1 430 GLU 430 431 431 GLU GLU A . n 
A 1 431 HIS 431 432 432 HIS HIS A . n 
A 1 432 ARG 432 433 433 ARG ARG A . n 
A 1 433 ALA 433 434 434 ALA ALA A . n 
A 1 434 SER 434 435 435 SER SER A . n 
A 1 435 THR 435 436 436 THR THR A . n 
A 1 436 LEU 436 437 437 LEU LEU A . n 
A 1 437 SER 437 438 438 SER SER A . n 
A 1 438 TRP 438 439 439 TRP TRP A . n 
A 1 439 PRO 439 440 440 PRO PRO A . n 
A 1 440 LEU 440 441 441 LEU LEU A . n 
A 1 441 TRP 441 442 442 TRP TRP A . n 
A 1 442 MET 442 443 443 MET MET A . n 
A 1 443 GLY 443 444 444 GLY GLY A . n 
A 1 444 VAL 444 445 445 VAL VAL A . n 
A 1 445 PRO 445 446 446 PRO PRO A . n 
A 1 446 HIS 446 447 447 HIS HIS A . n 
A 1 447 GLY 447 448 448 GLY GLY A . n 
A 1 448 TYR 448 449 449 TYR TYR A . n 
A 1 449 GLU 449 450 450 GLU GLU A . n 
A 1 450 ILE 450 451 451 ILE ILE A . n 
A 1 451 GLU 451 452 452 GLU GLU A . n 
A 1 452 PHE 452 453 453 PHE PHE A . n 
A 1 453 ILE 453 454 454 ILE ILE A . n 
A 1 454 PHE 454 455 455 PHE PHE A . n 
A 1 455 GLY 455 456 456 GLY GLY A . n 
A 1 456 ILE 456 457 457 ILE ILE A . n 
A 1 457 PRO 457 458 458 PRO PRO A . n 
A 1 458 LEU 458 459 459 LEU LEU A . n 
A 1 459 ASP 459 460 460 ASP ASP A . n 
A 1 460 PRO 460 461 461 PRO PRO A . n 
A 1 461 SER 461 462 462 SER SER A . n 
A 1 462 ARG 462 463 463 ARG ARG A . n 
A 1 463 ASN 463 464 464 ASN ASN A . n 
A 1 464 TYR 464 465 465 TYR TYR A . n 
A 1 465 THR 465 466 466 THR THR A . n 
A 1 466 ALA 466 467 467 ALA ALA A . n 
A 1 467 GLU 467 468 468 GLU GLU A . n 
A 1 468 GLU 468 469 469 GLU GLU A . n 
A 1 469 LYS 469 470 470 LYS LYS A . n 
A 1 470 ILE 470 471 471 ILE ILE A . n 
A 1 471 PHE 471 472 472 PHE PHE A . n 
A 1 472 ALA 472 473 473 ALA ALA A . n 
A 1 473 GLN 473 474 474 GLN GLN A . n 
A 1 474 ARG 474 475 475 ARG ARG A . n 
A 1 475 LEU 475 476 476 LEU LEU A . n 
A 1 476 MET 476 477 477 MET MET A . n 
A 1 477 ARG 477 478 478 ARG ARG A . n 
A 1 478 TYR 478 479 479 TYR TYR A . n 
A 1 479 TRP 479 480 480 TRP TRP A . n 
A 1 480 ALA 480 481 481 ALA ALA A . n 
A 1 481 ASN 481 482 482 ASN ASN A . n 
A 1 482 PHE 482 483 483 PHE PHE A . n 
A 1 483 ALA 483 484 484 ALA ALA A . n 
A 1 484 ARG 484 485 485 ARG ARG A . n 
A 1 485 THR 485 486 486 THR THR A . n 
A 1 486 GLY 486 487 487 GLY GLY A . n 
A 1 487 ASP 487 488 488 ASP ASP A . n 
A 1 488 PRO 488 489 489 PRO PRO A . n 
A 1 489 ASN 489 490 490 ASN ASN A . n 
A 1 490 GLU 490 491 491 GLU GLU A . n 
A 1 491 PRO 491 492 492 PRO PRO A . n 
A 1 492 ARG 492 493 ?   ?   ?   A . n 
A 1 493 ASP 493 494 ?   ?   ?   A . n 
A 1 494 PRO 494 495 ?   ?   ?   A . n 
A 1 495 LYS 495 496 ?   ?   ?   A . n 
A 1 496 ALA 496 497 497 ALA ALA A . n 
A 1 497 PRO 497 498 498 PRO PRO A . n 
A 1 498 GLN 498 499 499 GLN GLN A . n 
A 1 499 TRP 499 500 500 TRP TRP A . n 
A 1 500 PRO 500 501 501 PRO PRO A . n 
A 1 501 PRO 501 502 502 PRO PRO A . n 
A 1 502 TYR 502 503 503 TYR TYR A . n 
A 1 503 THR 503 504 504 THR THR A . n 
A 1 504 ALA 504 505 505 ALA ALA A . n 
A 1 505 GLY 505 506 506 GLY GLY A . n 
A 1 506 ALA 506 507 507 ALA ALA A . n 
A 1 507 GLN 507 508 508 GLN GLN A . n 
A 1 508 GLN 508 509 509 GLN GLN A . n 
A 1 509 TYR 509 510 510 TYR TYR A . n 
A 1 510 VAL 510 511 511 VAL VAL A . n 
A 1 511 SER 511 512 512 SER SER A . n 
A 1 512 LEU 512 513 513 LEU LEU A . n 
A 1 513 ASP 513 514 514 ASP ASP A . n 
A 1 514 LEU 514 515 515 LEU LEU A . n 
A 1 515 ARG 515 516 516 ARG ARG A . n 
A 1 516 PRO 516 517 517 PRO PRO A . n 
A 1 517 LEU 517 518 518 LEU LEU A . n 
A 1 518 GLU 518 519 519 GLU GLU A . n 
A 1 519 VAL 519 520 520 VAL VAL A . n 
A 1 520 ARG 520 521 521 ARG ARG A . n 
A 1 521 ARG 521 522 522 ARG ARG A . n 
A 1 522 GLY 522 523 523 GLY GLY A . n 
A 1 523 LEU 523 524 524 LEU LEU A . n 
A 1 524 ARG 524 525 525 ARG ARG A . n 
A 1 525 ALA 525 526 526 ALA ALA A . n 
A 1 526 GLN 526 527 527 GLN GLN A . n 
A 1 527 ALA 527 528 528 ALA ALA A . n 
A 1 528 CYS 528 529 529 CYS CYS A . n 
A 1 529 ALA 529 530 530 ALA ALA A . n 
A 1 530 PHE 530 531 531 PHE PHE A . n 
A 1 531 TRP 531 532 532 TRP TRP A . n 
A 1 532 ASN 532 533 533 ASN ASN A . n 
A 1 533 ARG 533 534 534 ARG ARG A . n 
A 1 534 PHE 534 535 535 PHE PHE A . n 
A 1 535 LEU 535 536 536 LEU LEU A . n 
A 1 536 PRO 536 537 537 PRO PRO A . n 
A 1 537 LYS 537 538 538 LYS LYS A . n 
A 1 538 LEU 538 539 539 LEU LEU A . n 
A 1 539 LEU 539 540 540 LEU LEU A . n 
A 1 540 SER 540 541 541 SER SER A . n 
A 1 541 ALA 541 542 542 ALA ALA A . n 
A 1 542 THR 542 543 ?   ?   ?   A . n 
B 1 1   GLY 1   2   ?   ?   ?   B . n 
B 1 2   ARG 2   3   ?   ?   ?   B . n 
B 1 3   GLU 3   4   ?   ?   ?   B . n 
B 1 4   ASP 4   5   5   ASP ASP B . n 
B 1 5   ALA 5   6   6   ALA ALA B . n 
B 1 6   GLU 6   7   7   GLU GLU B . n 
B 1 7   LEU 7   8   8   LEU LEU B . n 
B 1 8   LEU 8   9   9   LEU LEU B . n 
B 1 9   VAL 9   10  10  VAL VAL B . n 
B 1 10  THR 10  11  11  THR THR B . n 
B 1 11  VAL 11  12  12  VAL VAL B . n 
B 1 12  ARG 12  13  13  ARG ARG B . n 
B 1 13  GLY 13  14  14  GLY GLY B . n 
B 1 14  GLY 14  15  15  GLY GLY B . n 
B 1 15  ARG 15  16  16  ARG ARG B . n 
B 1 16  LEU 16  17  17  LEU LEU B . n 
B 1 17  ARG 17  18  18  ARG ARG B . n 
B 1 18  GLY 18  19  19  GLY GLY B . n 
B 1 19  ILE 19  20  20  ILE ILE B . n 
B 1 20  ARG 20  21  21  ARG ARG B . n 
B 1 21  LEU 21  22  22  LEU LEU B . n 
B 1 22  LYS 22  23  23  LYS LYS B . n 
B 1 23  THR 23  24  24  THR THR B . n 
B 1 24  PRO 24  25  25  PRO PRO B . n 
B 1 25  GLY 25  26  26  GLY GLY B . n 
B 1 26  GLY 26  27  27  GLY GLY B . n 
B 1 27  PRO 27  28  28  PRO PRO B . n 
B 1 28  VAL 28  29  29  VAL VAL B . n 
B 1 29  SER 29  30  30  SER SER B . n 
B 1 30  ALA 30  31  31  ALA ALA B . n 
B 1 31  PHE 31  32  32  PHE PHE B . n 
B 1 32  LEU 32  33  33  LEU LEU B . n 
B 1 33  GLY 33  34  34  GLY GLY B . n 
B 1 34  ILE 34  35  35  ILE ILE B . n 
B 1 35  PRO 35  36  36  PRO PRO B . n 
B 1 36  PHE 36  37  37  PHE PHE B . n 
B 1 37  ALA 37  38  38  ALA ALA B . n 
B 1 38  GLU 38  39  39  GLU GLU B . n 
B 1 39  PRO 39  40  40  PRO PRO B . n 
B 1 40  PRO 40  41  41  PRO PRO B . n 
B 1 41  MET 41  42  42  MET MET B . n 
B 1 42  GLY 42  43  43  GLY GLY B . n 
B 1 43  PRO 43  44  44  PRO PRO B . n 
B 1 44  ARG 44  45  45  ARG ARG B . n 
B 1 45  ARG 45  46  46  ARG ARG B . n 
B 1 46  PHE 46  47  47  PHE PHE B . n 
B 1 47  LEU 47  48  48  LEU LEU B . n 
B 1 48  PRO 48  49  49  PRO PRO B . n 
B 1 49  PRO 49  50  50  PRO PRO B . n 
B 1 50  GLU 50  51  51  GLU GLU B . n 
B 1 51  PRO 51  52  52  PRO PRO B . n 
B 1 52  LYS 52  53  53  LYS LYS B . n 
B 1 53  GLN 53  54  54  GLN GLN B . n 
B 1 54  PRO 54  55  55  PRO PRO B . n 
B 1 55  TRP 55  56  56  TRP TRP B . n 
B 1 56  SER 56  57  57  SER SER B . n 
B 1 57  GLY 57  58  58  GLY GLY B . n 
B 1 58  VAL 58  59  59  VAL VAL B . n 
B 1 59  VAL 59  60  60  VAL VAL B . n 
B 1 60  ASP 60  61  61  ASP ASP B . n 
B 1 61  ALA 61  62  62  ALA ALA B . n 
B 1 62  THR 62  63  63  THR THR B . n 
B 1 63  THR 63  64  64  THR THR B . n 
B 1 64  PHE 64  65  65  PHE PHE B . n 
B 1 65  GLN 65  66  66  GLN GLN B . n 
B 1 66  SER 66  67  67  SER SER B . n 
B 1 67  VAL 67  68  68  VAL VAL B . n 
B 1 68  CYS 68  69  69  CYS CYS B . n 
B 1 69  TYR 69  70  70  TYR TYR B . n 
B 1 70  GLN 70  71  71  GLN GLN B . n 
B 1 71  TYR 71  72  72  TYR TYR B . n 
B 1 72  VAL 72  73  73  VAL VAL B . n 
B 1 73  ASP 73  74  74  ASP ASP B . n 
B 1 74  THR 74  75  75  THR THR B . n 
B 1 75  LEU 75  76  76  LEU LEU B . n 
B 1 76  TYR 76  77  77  TYR TYR B . n 
B 1 77  PRO 77  78  78  PRO PRO B . n 
B 1 78  GLY 78  79  79  GLY GLY B . n 
B 1 79  PHE 79  80  80  PHE PHE B . n 
B 1 80  GLU 80  81  81  GLU GLU B . n 
B 1 81  GLY 81  82  82  GLY GLY B . n 
B 1 82  THR 82  83  83  THR THR B . n 
B 1 83  GLU 83  84  84  GLU GLU B . n 
B 1 84  MET 84  85  85  MET MET B . n 
B 1 85  TRP 85  86  86  TRP TRP B . n 
B 1 86  ASN 86  87  87  ASN ASN B . n 
B 1 87  PRO 87  88  88  PRO PRO B . n 
B 1 88  ASN 88  89  89  ASN ASN B . n 
B 1 89  ARG 89  90  90  ARG ARG B . n 
B 1 90  GLU 90  91  91  GLU GLU B . n 
B 1 91  LEU 91  92  92  LEU LEU B . n 
B 1 92  SER 92  93  93  SER SER B . n 
B 1 93  GLU 93  94  94  GLU GLU B . n 
B 1 94  ASP 94  95  95  ASP ASP B . n 
B 1 95  CYS 95  96  96  CYS CYS B . n 
B 1 96  LEU 96  97  97  LEU LEU B . n 
B 1 97  TYR 97  98  98  TYR TYR B . n 
B 1 98  LEU 98  99  99  LEU LEU B . n 
B 1 99  ASN 99  100 100 ASN ASN B . n 
B 1 100 VAL 100 101 101 VAL VAL B . n 
B 1 101 TRP 101 102 102 TRP TRP B . n 
B 1 102 THR 102 103 103 THR THR B . n 
B 1 103 PRO 103 104 104 PRO PRO B . n 
B 1 104 TYR 104 105 105 TYR TYR B . n 
B 1 105 PRO 105 106 106 PRO PRO B . n 
B 1 106 ARG 106 107 107 ARG ARG B . n 
B 1 107 PRO 107 108 108 PRO PRO B . n 
B 1 108 THR 108 109 109 THR THR B . n 
B 1 109 SER 109 110 110 SER SER B . n 
B 1 110 PRO 110 111 111 PRO PRO B . n 
B 1 111 THR 111 112 112 THR THR B . n 
B 1 112 PRO 112 113 113 PRO PRO B . n 
B 1 113 VAL 113 114 114 VAL VAL B . n 
B 1 114 LEU 114 115 115 LEU LEU B . n 
B 1 115 VAL 115 116 116 VAL VAL B . n 
B 1 116 TRP 116 117 117 TRP TRP B . n 
B 1 117 ILE 117 118 118 ILE ILE B . n 
B 1 118 TYR 118 119 119 TYR TYR B . n 
B 1 119 GLY 119 120 120 GLY GLY B . n 
B 1 120 GLY 120 121 121 GLY GLY B . n 
B 1 121 GLY 121 122 122 GLY GLY B . n 
B 1 122 PHE 122 123 123 PHE PHE B . n 
B 1 123 TYR 123 124 124 TYR TYR B . n 
B 1 124 SER 124 125 125 SER SER B . n 
B 1 125 GLY 125 126 126 GLY GLY B . n 
B 1 126 ALA 126 127 127 ALA ALA B . n 
B 1 127 SER 127 128 128 SER SER B . n 
B 1 128 SER 128 129 129 SER SER B . n 
B 1 129 LEU 129 130 130 LEU LEU B . n 
B 1 130 ASP 130 131 131 ASP ASP B . n 
B 1 131 VAL 131 132 132 VAL VAL B . n 
B 1 132 TYR 132 133 133 TYR TYR B . n 
B 1 133 ASP 133 134 134 ASP ASP B . n 
B 1 134 GLY 134 135 135 GLY GLY B . n 
B 1 135 ARG 135 136 136 ARG ARG B . n 
B 1 136 PHE 136 137 137 PHE PHE B . n 
B 1 137 LEU 137 138 138 LEU LEU B . n 
B 1 138 VAL 138 139 139 VAL VAL B . n 
B 1 139 GLN 139 140 140 GLN GLN B . n 
B 1 140 ALA 140 141 141 ALA ALA B . n 
B 1 141 GLU 141 142 142 GLU GLU B . n 
B 1 142 ARG 142 143 143 ARG ARG B . n 
B 1 143 THR 143 144 144 THR THR B . n 
B 1 144 VAL 144 145 145 VAL VAL B . n 
B 1 145 LEU 145 146 146 LEU LEU B . n 
B 1 146 VAL 146 147 147 VAL VAL B . n 
B 1 147 SER 147 148 148 SER SER B . n 
B 1 148 MET 148 149 149 MET MET B . n 
B 1 149 ASN 149 150 150 ASN ASN B . n 
B 1 150 TYR 150 151 151 TYR TYR B . n 
B 1 151 ARG 151 152 152 ARG ARG B . n 
B 1 152 VAL 152 153 153 VAL VAL B . n 
B 1 153 GLY 153 154 154 GLY GLY B . n 
B 1 154 ALA 154 155 155 ALA ALA B . n 
B 1 155 PHE 155 156 156 PHE PHE B . n 
B 1 156 GLY 156 157 157 GLY GLY B . n 
B 1 157 PHE 157 158 158 PHE PHE B . n 
B 1 158 LEU 158 159 159 LEU LEU B . n 
B 1 159 ALA 159 160 160 ALA ALA B . n 
B 1 160 LEU 160 161 161 LEU LEU B . n 
B 1 161 PRO 161 162 162 PRO PRO B . n 
B 1 162 GLY 162 163 163 GLY GLY B . n 
B 1 163 SER 163 164 164 SER SER B . n 
B 1 164 ARG 164 165 165 ARG ARG B . n 
B 1 165 GLU 165 166 166 GLU GLU B . n 
B 1 166 ALA 166 167 167 ALA ALA B . n 
B 1 167 PRO 167 168 168 PRO PRO B . n 
B 1 168 GLY 168 169 169 GLY GLY B . n 
B 1 169 ASN 169 170 170 ASN ASN B . n 
B 1 170 VAL 170 171 171 VAL VAL B . n 
B 1 171 GLY 171 172 172 GLY GLY B . n 
B 1 172 LEU 172 173 173 LEU LEU B . n 
B 1 173 LEU 173 174 174 LEU LEU B . n 
B 1 174 ASP 174 175 175 ASP ASP B . n 
B 1 175 GLN 175 176 176 GLN GLN B . n 
B 1 176 ARG 176 177 177 ARG ARG B . n 
B 1 177 LEU 177 178 178 LEU LEU B . n 
B 1 178 ALA 178 179 179 ALA ALA B . n 
B 1 179 LEU 179 180 180 LEU LEU B . n 
B 1 180 GLN 180 181 181 GLN GLN B . n 
B 1 181 TRP 181 182 182 TRP TRP B . n 
B 1 182 VAL 182 183 183 VAL VAL B . n 
B 1 183 GLN 183 184 184 GLN GLN B . n 
B 1 184 GLU 184 185 185 GLU GLU B . n 
B 1 185 ASN 185 186 186 ASN ASN B . n 
B 1 186 VAL 186 187 187 VAL VAL B . n 
B 1 187 ALA 187 188 188 ALA ALA B . n 
B 1 188 ALA 188 189 189 ALA ALA B . n 
B 1 189 PHE 189 190 190 PHE PHE B . n 
B 1 190 GLY 190 191 191 GLY GLY B . n 
B 1 191 GLY 191 192 192 GLY GLY B . n 
B 1 192 ASP 192 193 193 ASP ASP B . n 
B 1 193 PRO 193 194 194 PRO PRO B . n 
B 1 194 THR 194 195 195 THR THR B . n 
B 1 195 SER 195 196 196 SER SER B . n 
B 1 196 VAL 196 197 197 VAL VAL B . n 
B 1 197 THR 197 198 198 THR THR B . n 
B 1 198 LEU 198 199 199 LEU LEU B . n 
B 1 199 PHE 199 200 200 PHE PHE B . n 
B 1 200 GLY 200 201 201 GLY GLY B . n 
B 1 201 GLU 201 202 202 GLU GLU B . n 
B 1 202 SER 202 203 203 SER SER B . n 
B 1 203 ALA 203 204 204 ALA ALA B . n 
B 1 204 GLY 204 205 205 GLY GLY B . n 
B 1 205 ALA 205 206 206 ALA ALA B . n 
B 1 206 ALA 206 207 207 ALA ALA B . n 
B 1 207 SER 207 208 208 SER SER B . n 
B 1 208 VAL 208 209 209 VAL VAL B . n 
B 1 209 GLY 209 210 210 GLY GLY B . n 
B 1 210 MET 210 211 211 MET MET B . n 
B 1 211 HIS 211 212 212 HIS HIS B . n 
B 1 212 LEU 212 213 213 LEU LEU B . n 
B 1 213 LEU 213 214 214 LEU LEU B . n 
B 1 214 SER 214 215 215 SER SER B . n 
B 1 215 PRO 215 216 216 PRO PRO B . n 
B 1 216 PRO 216 217 217 PRO PRO B . n 
B 1 217 SER 217 218 218 SER SER B . n 
B 1 218 ARG 218 219 219 ARG ARG B . n 
B 1 219 GLY 219 220 220 GLY GLY B . n 
B 1 220 LEU 220 221 221 LEU LEU B . n 
B 1 221 PHE 221 222 222 PHE PHE B . n 
B 1 222 HIS 222 223 223 HIS HIS B . n 
B 1 223 ARG 223 224 224 ARG ARG B . n 
B 1 224 ALA 224 225 225 ALA ALA B . n 
B 1 225 VAL 225 226 226 VAL VAL B . n 
B 1 226 LEU 226 227 227 LEU LEU B . n 
B 1 227 GLN 227 228 228 GLN GLN B . n 
B 1 228 SER 228 229 229 SER SER B . n 
B 1 229 GLY 229 230 230 GLY GLY B . n 
B 1 230 ALA 230 231 231 ALA ALA B . n 
B 1 231 PRO 231 232 232 PRO PRO B . n 
B 1 232 ASN 232 233 233 ASN ASN B . n 
B 1 233 GLY 233 234 234 GLY GLY B . n 
B 1 234 PRO 234 235 235 PRO PRO B . n 
B 1 235 TRP 235 236 236 TRP TRP B . n 
B 1 236 ALA 236 237 237 ALA ALA B . n 
B 1 237 THR 237 238 238 THR THR B . n 
B 1 238 VAL 238 239 239 VAL VAL B . n 
B 1 239 GLY 239 240 240 GLY GLY B . n 
B 1 240 MET 240 241 241 MET MET B . n 
B 1 241 GLY 241 242 242 GLY GLY B . n 
B 1 242 GLU 242 243 243 GLU GLU B . n 
B 1 243 ALA 243 244 244 ALA ALA B . n 
B 1 244 ARG 244 245 245 ARG ARG B . n 
B 1 245 ARG 245 246 246 ARG ARG B . n 
B 1 246 ARG 246 247 247 ARG ARG B . n 
B 1 247 ALA 247 248 248 ALA ALA B . n 
B 1 248 THR 248 249 249 THR THR B . n 
B 1 249 GLN 249 250 250 GLN GLN B . n 
B 1 250 LEU 250 251 251 LEU LEU B . n 
B 1 251 ALA 251 252 252 ALA ALA B . n 
B 1 252 HIS 252 253 253 HIS HIS B . n 
B 1 253 LEU 253 254 254 LEU LEU B . n 
B 1 254 VAL 254 255 255 VAL VAL B . n 
B 1 255 GLY 255 256 256 GLY GLY B . n 
B 1 256 CYS 256 257 257 CYS CYS B . n 
B 1 257 PRO 257 258 258 PRO PRO B . n 
B 1 258 PRO 258 259 ?   ?   ?   B . n 
B 1 259 GLY 259 260 ?   ?   ?   B . n 
B 1 260 GLY 260 261 ?   ?   ?   B . n 
B 1 261 THR 261 262 ?   ?   ?   B . n 
B 1 262 GLY 262 263 ?   ?   ?   B . n 
B 1 263 GLY 263 264 ?   ?   ?   B . n 
B 1 264 ASN 264 265 265 ASN ASN B . n 
B 1 265 ASP 265 266 266 ASP ASP B . n 
B 1 266 THR 266 267 267 THR THR B . n 
B 1 267 GLU 267 268 268 GLU GLU B . n 
B 1 268 LEU 268 269 269 LEU LEU B . n 
B 1 269 VAL 269 270 270 VAL VAL B . n 
B 1 270 ALA 270 271 271 ALA ALA B . n 
B 1 271 CYS 271 272 272 CYS CYS B . n 
B 1 272 LEU 272 273 273 LEU LEU B . n 
B 1 273 ARG 273 274 274 ARG ARG B . n 
B 1 274 THR 274 275 275 THR THR B . n 
B 1 275 ARG 275 276 276 ARG ARG B . n 
B 1 276 PRO 276 277 277 PRO PRO B . n 
B 1 277 ALA 277 278 278 ALA ALA B . n 
B 1 278 GLN 278 279 279 GLN GLN B . n 
B 1 279 VAL 279 280 280 VAL VAL B . n 
B 1 280 LEU 280 281 281 LEU LEU B . n 
B 1 281 VAL 281 282 282 VAL VAL B . n 
B 1 282 ASN 282 283 283 ASN ASN B . n 
B 1 283 HIS 283 284 284 HIS HIS B . n 
B 1 284 GLU 284 285 285 GLU GLU B . n 
B 1 285 TRP 285 286 286 TRP TRP B . n 
B 1 286 HIS 286 287 287 HIS HIS B . n 
B 1 287 VAL 287 288 288 VAL VAL B . n 
B 1 288 LEU 288 289 289 LEU LEU B . n 
B 1 289 PRO 289 290 290 PRO PRO B . n 
B 1 290 GLN 290 291 291 GLN GLN B . n 
B 1 291 GLU 291 292 292 GLU GLU B . n 
B 1 292 SER 292 293 293 SER SER B . n 
B 1 293 VAL 293 294 294 VAL VAL B . n 
B 1 294 PHE 294 295 295 PHE PHE B . n 
B 1 295 ARG 295 296 296 ARG ARG B . n 
B 1 296 PHE 296 297 297 PHE PHE B . n 
B 1 297 SER 297 298 298 SER SER B . n 
B 1 298 PHE 298 299 299 PHE PHE B . n 
B 1 299 VAL 299 300 300 VAL VAL B . n 
B 1 300 PRO 300 301 301 PRO PRO B . n 
B 1 301 VAL 301 302 302 VAL VAL B . n 
B 1 302 VAL 302 303 303 VAL VAL B . n 
B 1 303 ASP 303 304 304 ASP ASP B . n 
B 1 304 GLY 304 305 305 GLY GLY B . n 
B 1 305 ASP 305 306 306 ASP ASP B . n 
B 1 306 PHE 306 307 307 PHE PHE B . n 
B 1 307 LEU 307 308 308 LEU LEU B . n 
B 1 308 SER 308 309 309 SER SER B . n 
B 1 309 ASP 309 310 310 ASP ASP B . n 
B 1 310 THR 310 311 311 THR THR B . n 
B 1 311 PRO 311 312 312 PRO PRO B . n 
B 1 312 GLU 312 313 313 GLU GLU B . n 
B 1 313 ALA 313 314 314 ALA ALA B . n 
B 1 314 LEU 314 315 315 LEU LEU B . n 
B 1 315 ILE 315 316 316 ILE ILE B . n 
B 1 316 ASN 316 317 317 ASN ASN B . n 
B 1 317 ALA 317 318 318 ALA ALA B . n 
B 1 318 GLY 318 319 319 GLY GLY B . n 
B 1 319 ASP 319 320 320 ASP ASP B . n 
B 1 320 PHE 320 321 321 PHE PHE B . n 
B 1 321 HIS 321 322 322 HIS HIS B . n 
B 1 322 GLY 322 323 323 GLY GLY B . n 
B 1 323 LEU 323 324 324 LEU LEU B . n 
B 1 324 GLN 324 325 325 GLN GLN B . n 
B 1 325 VAL 325 326 326 VAL VAL B . n 
B 1 326 LEU 326 327 327 LEU LEU B . n 
B 1 327 VAL 327 328 328 VAL VAL B . n 
B 1 328 GLY 328 329 329 GLY GLY B . n 
B 1 329 VAL 329 330 330 VAL VAL B . n 
B 1 330 VAL 330 331 331 VAL VAL B . n 
B 1 331 LYS 331 332 332 LYS LYS B . n 
B 1 332 ASP 332 333 333 ASP ASP B . n 
B 1 333 GLU 333 334 334 GLU GLU B . n 
B 1 334 GLY 334 335 335 GLY GLY B . n 
B 1 335 SER 335 336 336 SER SER B . n 
B 1 336 TYR 336 337 337 TYR TYR B . n 
B 1 337 PHE 337 338 338 PHE PHE B . n 
B 1 338 LEU 338 339 339 LEU LEU B . n 
B 1 339 VAL 339 340 340 VAL VAL B . n 
B 1 340 TYR 340 341 341 TYR TYR B . n 
B 1 341 GLY 341 342 342 GLY GLY B . n 
B 1 342 ALA 342 343 343 ALA ALA B . n 
B 1 343 PRO 343 344 344 PRO PRO B . n 
B 1 344 GLY 344 345 345 GLY GLY B . n 
B 1 345 PHE 345 346 346 PHE PHE B . n 
B 1 346 SER 346 347 347 SER SER B . n 
B 1 347 LYS 347 348 348 LYS LYS B . n 
B 1 348 ASP 348 349 349 ASP ASP B . n 
B 1 349 ASN 349 350 350 ASN ASN B . n 
B 1 350 GLU 350 351 351 GLU GLU B . n 
B 1 351 SER 351 352 352 SER SER B . n 
B 1 352 LEU 352 353 353 LEU LEU B . n 
B 1 353 ILE 353 354 354 ILE ILE B . n 
B 1 354 SER 354 355 355 SER SER B . n 
B 1 355 ARG 355 356 356 ARG ARG B . n 
B 1 356 ALA 356 357 357 ALA ALA B . n 
B 1 357 GLU 357 358 358 GLU GLU B . n 
B 1 358 PHE 358 359 359 PHE PHE B . n 
B 1 359 LEU 359 360 360 LEU LEU B . n 
B 1 360 ALA 360 361 361 ALA ALA B . n 
B 1 361 GLY 361 362 362 GLY GLY B . n 
B 1 362 VAL 362 363 363 VAL VAL B . n 
B 1 363 ARG 363 364 364 ARG ARG B . n 
B 1 364 VAL 364 365 365 VAL VAL B . n 
B 1 365 GLY 365 366 366 GLY GLY B . n 
B 1 366 VAL 366 367 367 VAL VAL B . n 
B 1 367 PRO 367 368 368 PRO PRO B . n 
B 1 368 GLN 368 369 369 GLN GLN B . n 
B 1 369 VAL 369 370 370 VAL VAL B . n 
B 1 370 SER 370 371 371 SER SER B . n 
B 1 371 ASP 371 372 372 ASP ASP B . n 
B 1 372 LEU 372 373 373 LEU LEU B . n 
B 1 373 ALA 373 374 374 ALA ALA B . n 
B 1 374 ALA 374 375 375 ALA ALA B . n 
B 1 375 GLU 375 376 376 GLU GLU B . n 
B 1 376 ALA 376 377 377 ALA ALA B . n 
B 1 377 VAL 377 378 378 VAL VAL B . n 
B 1 378 VAL 378 379 379 VAL VAL B . n 
B 1 379 LEU 379 380 380 LEU LEU B . n 
B 1 380 HIS 380 381 381 HIS HIS B . n 
B 1 381 TYR 381 382 382 TYR TYR B . n 
B 1 382 THR 382 383 383 THR THR B . n 
B 1 383 ASP 383 384 384 ASP ASP B . n 
B 1 384 TRP 384 385 385 TRP TRP B . n 
B 1 385 LEU 385 386 386 LEU LEU B . n 
B 1 386 HIS 386 387 387 HIS HIS B . n 
B 1 387 PRO 387 388 388 PRO PRO B . n 
B 1 388 GLU 388 389 389 GLU GLU B . n 
B 1 389 ASP 389 390 390 ASP ASP B . n 
B 1 390 PRO 390 391 391 PRO PRO B . n 
B 1 391 ALA 391 392 392 ALA ALA B . n 
B 1 392 ARG 392 393 393 ARG ARG B . n 
B 1 393 LEU 393 394 394 LEU LEU B . n 
B 1 394 ARG 394 395 395 ARG ARG B . n 
B 1 395 GLU 395 396 396 GLU GLU B . n 
B 1 396 ALA 396 397 397 ALA ALA B . n 
B 1 397 LEU 397 398 398 LEU LEU B . n 
B 1 398 SER 398 399 399 SER SER B . n 
B 1 399 ASP 399 400 400 ASP ASP B . n 
B 1 400 VAL 400 401 401 VAL VAL B . n 
B 1 401 VAL 401 402 402 VAL VAL B . n 
B 1 402 GLY 402 403 403 GLY GLY B . n 
B 1 403 ASP 403 404 404 ASP ASP B . n 
B 1 404 HIS 404 405 405 HIS HIS B . n 
B 1 405 ASN 405 406 406 ASN ASN B . n 
B 1 406 VAL 406 407 407 VAL VAL B . n 
B 1 407 VAL 407 408 408 VAL VAL B . n 
B 1 408 CYS 408 409 409 CYS CYS B . n 
B 1 409 PRO 409 410 410 PRO PRO B . n 
B 1 410 VAL 410 411 411 VAL VAL B . n 
B 1 411 ALA 411 412 412 ALA ALA B . n 
B 1 412 GLN 412 413 413 GLN GLN B . n 
B 1 413 LEU 413 414 414 LEU LEU B . n 
B 1 414 ALA 414 415 415 ALA ALA B . n 
B 1 415 GLY 415 416 416 GLY GLY B . n 
B 1 416 ARG 416 417 417 ARG ARG B . n 
B 1 417 LEU 417 418 418 LEU LEU B . n 
B 1 418 ALA 418 419 419 ALA ALA B . n 
B 1 419 ALA 419 420 420 ALA ALA B . n 
B 1 420 GLN 420 421 421 GLN GLN B . n 
B 1 421 GLY 421 422 422 GLY GLY B . n 
B 1 422 ALA 422 423 423 ALA ALA B . n 
B 1 423 ARG 423 424 424 ARG ARG B . n 
B 1 424 VAL 424 425 425 VAL VAL B . n 
B 1 425 TYR 425 426 426 TYR TYR B . n 
B 1 426 ALA 426 427 427 ALA ALA B . n 
B 1 427 TYR 427 428 428 TYR TYR B . n 
B 1 428 VAL 428 429 429 VAL VAL B . n 
B 1 429 PHE 429 430 430 PHE PHE B . n 
B 1 430 GLU 430 431 431 GLU GLU B . n 
B 1 431 HIS 431 432 432 HIS HIS B . n 
B 1 432 ARG 432 433 433 ARG ARG B . n 
B 1 433 ALA 433 434 434 ALA ALA B . n 
B 1 434 SER 434 435 435 SER SER B . n 
B 1 435 THR 435 436 436 THR THR B . n 
B 1 436 LEU 436 437 437 LEU LEU B . n 
B 1 437 SER 437 438 438 SER SER B . n 
B 1 438 TRP 438 439 439 TRP TRP B . n 
B 1 439 PRO 439 440 440 PRO PRO B . n 
B 1 440 LEU 440 441 441 LEU LEU B . n 
B 1 441 TRP 441 442 442 TRP TRP B . n 
B 1 442 MET 442 443 443 MET MET B . n 
B 1 443 GLY 443 444 444 GLY GLY B . n 
B 1 444 VAL 444 445 445 VAL VAL B . n 
B 1 445 PRO 445 446 446 PRO PRO B . n 
B 1 446 HIS 446 447 447 HIS HIS B . n 
B 1 447 GLY 447 448 448 GLY GLY B . n 
B 1 448 TYR 448 449 449 TYR TYR B . n 
B 1 449 GLU 449 450 450 GLU GLU B . n 
B 1 450 ILE 450 451 451 ILE ILE B . n 
B 1 451 GLU 451 452 452 GLU GLU B . n 
B 1 452 PHE 452 453 453 PHE PHE B . n 
B 1 453 ILE 453 454 454 ILE ILE B . n 
B 1 454 PHE 454 455 455 PHE PHE B . n 
B 1 455 GLY 455 456 456 GLY GLY B . n 
B 1 456 ILE 456 457 457 ILE ILE B . n 
B 1 457 PRO 457 458 458 PRO PRO B . n 
B 1 458 LEU 458 459 459 LEU LEU B . n 
B 1 459 ASP 459 460 460 ASP ASP B . n 
B 1 460 PRO 460 461 461 PRO PRO B . n 
B 1 461 SER 461 462 462 SER SER B . n 
B 1 462 ARG 462 463 463 ARG ARG B . n 
B 1 463 ASN 463 464 464 ASN ASN B . n 
B 1 464 TYR 464 465 465 TYR TYR B . n 
B 1 465 THR 465 466 466 THR THR B . n 
B 1 466 ALA 466 467 467 ALA ALA B . n 
B 1 467 GLU 467 468 468 GLU GLU B . n 
B 1 468 GLU 468 469 469 GLU GLU B . n 
B 1 469 LYS 469 470 470 LYS LYS B . n 
B 1 470 ILE 470 471 471 ILE ILE B . n 
B 1 471 PHE 471 472 472 PHE PHE B . n 
B 1 472 ALA 472 473 473 ALA ALA B . n 
B 1 473 GLN 473 474 474 GLN GLN B . n 
B 1 474 ARG 474 475 475 ARG ARG B . n 
B 1 475 LEU 475 476 476 LEU LEU B . n 
B 1 476 MET 476 477 477 MET MET B . n 
B 1 477 ARG 477 478 478 ARG ARG B . n 
B 1 478 TYR 478 479 479 TYR TYR B . n 
B 1 479 TRP 479 480 480 TRP TRP B . n 
B 1 480 ALA 480 481 481 ALA ALA B . n 
B 1 481 ASN 481 482 482 ASN ASN B . n 
B 1 482 PHE 482 483 483 PHE PHE B . n 
B 1 483 ALA 483 484 484 ALA ALA B . n 
B 1 484 ARG 484 485 485 ARG ARG B . n 
B 1 485 THR 485 486 486 THR THR B . n 
B 1 486 GLY 486 487 487 GLY GLY B . n 
B 1 487 ASP 487 488 488 ASP ASP B . n 
B 1 488 PRO 488 489 489 PRO PRO B . n 
B 1 489 ASN 489 490 490 ASN ASN B . n 
B 1 490 GLU 490 491 491 GLU GLU B . n 
B 1 491 PRO 491 492 492 PRO PRO B . n 
B 1 492 ARG 492 493 ?   ?   ?   B . n 
B 1 493 ASP 493 494 ?   ?   ?   B . n 
B 1 494 PRO 494 495 ?   ?   ?   B . n 
B 1 495 LYS 495 496 ?   ?   ?   B . n 
B 1 496 ALA 496 497 497 ALA ALA B . n 
B 1 497 PRO 497 498 498 PRO PRO B . n 
B 1 498 GLN 498 499 499 GLN GLN B . n 
B 1 499 TRP 499 500 500 TRP TRP B . n 
B 1 500 PRO 500 501 501 PRO PRO B . n 
B 1 501 PRO 501 502 502 PRO PRO B . n 
B 1 502 TYR 502 503 503 TYR TYR B . n 
B 1 503 THR 503 504 504 THR THR B . n 
B 1 504 ALA 504 505 505 ALA ALA B . n 
B 1 505 GLY 505 506 506 GLY GLY B . n 
B 1 506 ALA 506 507 507 ALA ALA B . n 
B 1 507 GLN 507 508 508 GLN GLN B . n 
B 1 508 GLN 508 509 509 GLN GLN B . n 
B 1 509 TYR 509 510 510 TYR TYR B . n 
B 1 510 VAL 510 511 511 VAL VAL B . n 
B 1 511 SER 511 512 512 SER SER B . n 
B 1 512 LEU 512 513 513 LEU LEU B . n 
B 1 513 ASP 513 514 514 ASP ASP B . n 
B 1 514 LEU 514 515 515 LEU LEU B . n 
B 1 515 ARG 515 516 516 ARG ARG B . n 
B 1 516 PRO 516 517 517 PRO PRO B . n 
B 1 517 LEU 517 518 518 LEU LEU B . n 
B 1 518 GLU 518 519 519 GLU GLU B . n 
B 1 519 VAL 519 520 520 VAL VAL B . n 
B 1 520 ARG 520 521 521 ARG ARG B . n 
B 1 521 ARG 521 522 522 ARG ARG B . n 
B 1 522 GLY 522 523 523 GLY GLY B . n 
B 1 523 LEU 523 524 524 LEU LEU B . n 
B 1 524 ARG 524 525 525 ARG ARG B . n 
B 1 525 ALA 525 526 526 ALA ALA B . n 
B 1 526 GLN 526 527 527 GLN GLN B . n 
B 1 527 ALA 527 528 528 ALA ALA B . n 
B 1 528 CYS 528 529 529 CYS CYS B . n 
B 1 529 ALA 529 530 530 ALA ALA B . n 
B 1 530 PHE 530 531 531 PHE PHE B . n 
B 1 531 TRP 531 532 532 TRP TRP B . n 
B 1 532 ASN 532 533 533 ASN ASN B . n 
B 1 533 ARG 533 534 534 ARG ARG B . n 
B 1 534 PHE 534 535 535 PHE PHE B . n 
B 1 535 LEU 535 536 536 LEU LEU B . n 
B 1 536 PRO 536 537 537 PRO PRO B . n 
B 1 537 LYS 537 538 538 LYS LYS B . n 
B 1 538 LEU 538 539 539 LEU LEU B . n 
B 1 539 LEU 539 540 540 LEU LEU B . n 
B 1 540 SER 540 541 541 SER SER B . n 
B 1 541 ALA 541 542 542 ALA ALA B . n 
B 1 542 THR 542 543 ?   ?   ?   B . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
E 3 NAG 1   604  1   NAG NAG A . 
F 4 HLO 1   605  2   HLO HLO A . 
G 5 FUC 1   606  601 FUC FUC A . 
H 3 NAG 1   607  602 NAG NAG A . 
I 3 NAG 1   608  603 NAG NAG A . 
J 3 NAG 1   604  2   NAG NAG B . 
K 4 HLO 1   605  1   HLO HLO B . 
L 6 HOH 1   701  301 HOH HOH A . 
L 6 HOH 2   702  444 HOH HOH A . 
L 6 HOH 3   703  674 HOH HOH A . 
L 6 HOH 4   704  232 HOH HOH A . 
L 6 HOH 5   705  333 HOH HOH A . 
L 6 HOH 6   706  261 HOH HOH A . 
L 6 HOH 7   707  498 HOH HOH A . 
L 6 HOH 8   708  675 HOH HOH A . 
L 6 HOH 9   709  504 HOH HOH A . 
L 6 HOH 10  710  450 HOH HOH A . 
L 6 HOH 11  711  18  HOH HOH A . 
L 6 HOH 12  712  37  HOH HOH A . 
L 6 HOH 13  713  441 HOH HOH A . 
L 6 HOH 14  714  239 HOH HOH A . 
L 6 HOH 15  715  396 HOH HOH A . 
L 6 HOH 16  716  313 HOH HOH A . 
L 6 HOH 17  717  342 HOH HOH A . 
L 6 HOH 18  718  468 HOH HOH A . 
L 6 HOH 19  719  302 HOH HOH A . 
L 6 HOH 20  720  397 HOH HOH A . 
L 6 HOH 21  721  248 HOH HOH A . 
L 6 HOH 22  722  5   HOH HOH A . 
L 6 HOH 23  723  95  HOH HOH A . 
L 6 HOH 24  724  462 HOH HOH A . 
L 6 HOH 25  725  458 HOH HOH A . 
L 6 HOH 26  726  446 HOH HOH A . 
L 6 HOH 27  727  467 HOH HOH A . 
L 6 HOH 28  728  604 HOH HOH A . 
L 6 HOH 29  729  596 HOH HOH A . 
L 6 HOH 30  730  203 HOH HOH A . 
L 6 HOH 31  731  456 HOH HOH A . 
L 6 HOH 32  732  43  HOH HOH A . 
L 6 HOH 33  733  592 HOH HOH A . 
L 6 HOH 34  734  557 HOH HOH A . 
L 6 HOH 35  735  26  HOH HOH A . 
L 6 HOH 36  736  144 HOH HOH A . 
L 6 HOH 37  737  421 HOH HOH A . 
L 6 HOH 38  738  292 HOH HOH A . 
L 6 HOH 39  739  843 HOH HOH A . 
L 6 HOH 40  740  271 HOH HOH A . 
L 6 HOH 41  741  523 HOH HOH A . 
L 6 HOH 42  742  8   HOH HOH A . 
L 6 HOH 43  743  123 HOH HOH A . 
L 6 HOH 44  744  152 HOH HOH A . 
L 6 HOH 45  745  159 HOH HOH A . 
L 6 HOH 46  746  486 HOH HOH A . 
L 6 HOH 47  747  257 HOH HOH A . 
L 6 HOH 48  748  200 HOH HOH A . 
L 6 HOH 49  749  289 HOH HOH A . 
L 6 HOH 50  750  922 HOH HOH A . 
L 6 HOH 51  751  100 HOH HOH A . 
L 6 HOH 52  752  473 HOH HOH A . 
L 6 HOH 53  753  642 HOH HOH A . 
L 6 HOH 54  754  63  HOH HOH A . 
L 6 HOH 55  755  204 HOH HOH A . 
L 6 HOH 56  756  2   HOH HOH A . 
L 6 HOH 57  757  46  HOH HOH A . 
L 6 HOH 58  758  182 HOH HOH A . 
L 6 HOH 59  759  294 HOH HOH A . 
L 6 HOH 60  760  188 HOH HOH A . 
L 6 HOH 61  761  86  HOH HOH A . 
L 6 HOH 62  762  325 HOH HOH A . 
L 6 HOH 63  763  21  HOH HOH A . 
L 6 HOH 64  764  363 HOH HOH A . 
L 6 HOH 65  765  102 HOH HOH A . 
L 6 HOH 66  766  589 HOH HOH A . 
L 6 HOH 67  767  180 HOH HOH A . 
L 6 HOH 68  768  730 HOH HOH A . 
L 6 HOH 69  769  451 HOH HOH A . 
L 6 HOH 70  770  505 HOH HOH A . 
L 6 HOH 71  771  483 HOH HOH A . 
L 6 HOH 72  772  222 HOH HOH A . 
L 6 HOH 73  773  113 HOH HOH A . 
L 6 HOH 74  774  168 HOH HOH A . 
L 6 HOH 75  775  110 HOH HOH A . 
L 6 HOH 76  776  231 HOH HOH A . 
L 6 HOH 77  777  50  HOH HOH A . 
L 6 HOH 78  778  369 HOH HOH A . 
L 6 HOH 79  779  349 HOH HOH A . 
L 6 HOH 80  780  242 HOH HOH A . 
L 6 HOH 81  781  98  HOH HOH A . 
L 6 HOH 82  782  599 HOH HOH A . 
L 6 HOH 83  783  477 HOH HOH A . 
L 6 HOH 84  784  378 HOH HOH A . 
L 6 HOH 85  785  73  HOH HOH A . 
L 6 HOH 86  786  206 HOH HOH A . 
L 6 HOH 87  787  621 HOH HOH A . 
L 6 HOH 88  788  109 HOH HOH A . 
L 6 HOH 89  789  205 HOH HOH A . 
L 6 HOH 90  790  65  HOH HOH A . 
L 6 HOH 91  791  158 HOH HOH A . 
L 6 HOH 92  792  386 HOH HOH A . 
L 6 HOH 93  793  135 HOH HOH A . 
L 6 HOH 94  794  304 HOH HOH A . 
L 6 HOH 95  795  27  HOH HOH A . 
L 6 HOH 96  796  845 HOH HOH A . 
L 6 HOH 97  797  461 HOH HOH A . 
L 6 HOH 98  798  370 HOH HOH A . 
L 6 HOH 99  799  346 HOH HOH A . 
L 6 HOH 100 800  359 HOH HOH A . 
L 6 HOH 101 801  478 HOH HOH A . 
L 6 HOH 102 802  240 HOH HOH A . 
L 6 HOH 103 803  181 HOH HOH A . 
L 6 HOH 104 804  518 HOH HOH A . 
L 6 HOH 105 805  124 HOH HOH A . 
L 6 HOH 106 806  405 HOH HOH A . 
L 6 HOH 107 807  527 HOH HOH A . 
L 6 HOH 108 808  163 HOH HOH A . 
L 6 HOH 109 809  297 HOH HOH A . 
L 6 HOH 110 810  80  HOH HOH A . 
L 6 HOH 111 811  963 HOH HOH A . 
L 6 HOH 112 812  400 HOH HOH A . 
L 6 HOH 113 813  226 HOH HOH A . 
L 6 HOH 114 814  111 HOH HOH A . 
L 6 HOH 115 815  81  HOH HOH A . 
L 6 HOH 116 816  445 HOH HOH A . 
L 6 HOH 117 817  552 HOH HOH A . 
L 6 HOH 118 818  862 HOH HOH A . 
L 6 HOH 119 819  249 HOH HOH A . 
L 6 HOH 120 820  364 HOH HOH A . 
L 6 HOH 121 821  773 HOH HOH A . 
L 6 HOH 122 822  129 HOH HOH A . 
L 6 HOH 123 823  509 HOH HOH A . 
L 6 HOH 124 824  371 HOH HOH A . 
L 6 HOH 125 825  598 HOH HOH A . 
L 6 HOH 126 826  173 HOH HOH A . 
L 6 HOH 127 827  627 HOH HOH A . 
L 6 HOH 128 828  337 HOH HOH A . 
L 6 HOH 129 829  341 HOH HOH A . 
L 6 HOH 130 830  314 HOH HOH A . 
L 6 HOH 131 831  221 HOH HOH A . 
L 6 HOH 132 832  335 HOH HOH A . 
L 6 HOH 133 833  41  HOH HOH A . 
L 6 HOH 134 834  238 HOH HOH A . 
L 6 HOH 135 835  230 HOH HOH A . 
L 6 HOH 136 836  215 HOH HOH A . 
L 6 HOH 137 837  949 HOH HOH A . 
L 6 HOH 138 838  336 HOH HOH A . 
L 6 HOH 139 839  469 HOH HOH A . 
L 6 HOH 140 840  541 HOH HOH A . 
L 6 HOH 141 841  235 HOH HOH A . 
L 6 HOH 142 842  350 HOH HOH A . 
L 6 HOH 143 843  211 HOH HOH A . 
L 6 HOH 144 844  520 HOH HOH A . 
L 6 HOH 145 845  508 HOH HOH A . 
L 6 HOH 146 846  352 HOH HOH A . 
L 6 HOH 147 847  652 HOH HOH A . 
L 6 HOH 148 848  712 HOH HOH A . 
L 6 HOH 149 849  605 HOH HOH A . 
L 6 HOH 150 850  252 HOH HOH A . 
L 6 HOH 151 851  290 HOH HOH A . 
L 6 HOH 152 852  32  HOH HOH A . 
L 6 HOH 153 853  241 HOH HOH A . 
L 6 HOH 154 854  259 HOH HOH A . 
L 6 HOH 155 855  347 HOH HOH A . 
L 6 HOH 156 856  979 HOH HOH A . 
L 6 HOH 157 857  298 HOH HOH A . 
L 6 HOH 158 858  715 HOH HOH A . 
L 6 HOH 159 859  126 HOH HOH A . 
L 6 HOH 160 860  501 HOH HOH A . 
L 6 HOH 161 861  673 HOH HOH A . 
L 6 HOH 162 862  146 HOH HOH A . 
L 6 HOH 163 863  521 HOH HOH A . 
L 6 HOH 164 864  653 HOH HOH A . 
L 6 HOH 165 865  13  HOH HOH A . 
L 6 HOH 166 866  339 HOH HOH A . 
L 6 HOH 167 867  387 HOH HOH A . 
L 6 HOH 168 868  550 HOH HOH A . 
L 6 HOH 169 869  554 HOH HOH A . 
L 6 HOH 170 870  595 HOH HOH A . 
L 6 HOH 171 871  218 HOH HOH A . 
L 6 HOH 172 872  474 HOH HOH A . 
L 6 HOH 173 873  524 HOH HOH A . 
L 6 HOH 174 874  155 HOH HOH A . 
L 6 HOH 175 875  306 HOH HOH A . 
L 6 HOH 176 876  291 HOH HOH A . 
L 6 HOH 177 877  262 HOH HOH A . 
L 6 HOH 178 878  9   HOH HOH A . 
L 6 HOH 179 879  538 HOH HOH A . 
L 6 HOH 180 880  318 HOH HOH A . 
L 6 HOH 181 881  617 HOH HOH A . 
L 6 HOH 182 882  1   HOH HOH A . 
L 6 HOH 183 883  219 HOH HOH A . 
L 6 HOH 184 884  837 HOH HOH A . 
L 6 HOH 185 885  586 HOH HOH A . 
L 6 HOH 186 886  276 HOH HOH A . 
L 6 HOH 187 887  117 HOH HOH A . 
L 6 HOH 188 888  619 HOH HOH A . 
L 6 HOH 189 889  217 HOH HOH A . 
L 6 HOH 190 890  29  HOH HOH A . 
L 6 HOH 191 891  303 HOH HOH A . 
L 6 HOH 192 892  288 HOH HOH A . 
L 6 HOH 193 893  121 HOH HOH A . 
L 6 HOH 194 894  613 HOH HOH A . 
L 6 HOH 195 895  157 HOH HOH A . 
L 6 HOH 196 896  502 HOH HOH A . 
L 6 HOH 197 897  641 HOH HOH A . 
L 6 HOH 198 898  196 HOH HOH A . 
L 6 HOH 199 899  647 HOH HOH A . 
L 6 HOH 200 900  149 HOH HOH A . 
L 6 HOH 201 901  645 HOH HOH A . 
L 6 HOH 202 902  646 HOH HOH A . 
L 6 HOH 203 903  133 HOH HOH A . 
L 6 HOH 204 904  511 HOH HOH A . 
L 6 HOH 205 905  542 HOH HOH A . 
L 6 HOH 206 906  105 HOH HOH A . 
L 6 HOH 207 907  3   HOH HOH A . 
L 6 HOH 208 908  471 HOH HOH A . 
L 6 HOH 209 909  66  HOH HOH A . 
L 6 HOH 210 910  611 HOH HOH A . 
L 6 HOH 211 911  316 HOH HOH A . 
L 6 HOH 212 912  925 HOH HOH A . 
L 6 HOH 213 913  661 HOH HOH A . 
L 6 HOH 214 914  172 HOH HOH A . 
L 6 HOH 215 915  620 HOH HOH A . 
L 6 HOH 216 916  150 HOH HOH A . 
L 6 HOH 217 917  815 HOH HOH A . 
L 6 HOH 218 918  389 HOH HOH A . 
L 6 HOH 219 919  269 HOH HOH A . 
L 6 HOH 220 920  606 HOH HOH A . 
L 6 HOH 221 921  747 HOH HOH A . 
L 6 HOH 222 922  609 HOH HOH A . 
L 6 HOH 223 923  35  HOH HOH A . 
L 6 HOH 224 924  57  HOH HOH A . 
L 6 HOH 225 925  134 HOH HOH A . 
L 6 HOH 226 926  58  HOH HOH A . 
L 6 HOH 227 927  439 HOH HOH A . 
L 6 HOH 228 928  591 HOH HOH A . 
L 6 HOH 229 929  79  HOH HOH A . 
L 6 HOH 230 930  6   HOH HOH A . 
L 6 HOH 231 931  17  HOH HOH A . 
L 6 HOH 232 932  140 HOH HOH A . 
L 6 HOH 233 933  870 HOH HOH A . 
L 6 HOH 234 934  797 HOH HOH A . 
L 6 HOH 235 935  374 HOH HOH A . 
L 6 HOH 236 936  763 HOH HOH A . 
L 6 HOH 237 937  917 HOH HOH A . 
L 6 HOH 238 938  608 HOH HOH A . 
L 6 HOH 239 939  14  HOH HOH A . 
L 6 HOH 240 940  587 HOH HOH A . 
L 6 HOH 241 941  106 HOH HOH A . 
L 6 HOH 242 942  376 HOH HOH A . 
L 6 HOH 243 943  166 HOH HOH A . 
L 6 HOH 244 944  69  HOH HOH A . 
L 6 HOH 245 945  532 HOH HOH A . 
L 6 HOH 246 946  141 HOH HOH A . 
L 6 HOH 247 947  624 HOH HOH A . 
L 6 HOH 248 948  858 HOH HOH A . 
L 6 HOH 249 949  185 HOH HOH A . 
L 6 HOH 250 950  44  HOH HOH A . 
L 6 HOH 251 951  801 HOH HOH A . 
L 6 HOH 252 952  574 HOH HOH A . 
L 6 HOH 253 953  419 HOH HOH A . 
L 6 HOH 254 954  169 HOH HOH A . 
L 6 HOH 255 955  384 HOH HOH A . 
L 6 HOH 256 956  61  HOH HOH A . 
L 6 HOH 257 957  892 HOH HOH A . 
L 6 HOH 258 958  179 HOH HOH A . 
L 6 HOH 259 959  7   HOH HOH A . 
L 6 HOH 260 960  15  HOH HOH A . 
L 6 HOH 261 961  583 HOH HOH A . 
L 6 HOH 262 962  312 HOH HOH A . 
L 6 HOH 263 963  649 HOH HOH A . 
L 6 HOH 264 964  872 HOH HOH A . 
L 6 HOH 265 965  90  HOH HOH A . 
L 6 HOH 266 966  887 HOH HOH A . 
L 6 HOH 267 967  879 HOH HOH A . 
L 6 HOH 268 968  167 HOH HOH A . 
L 6 HOH 269 969  681 HOH HOH A . 
L 6 HOH 270 970  784 HOH HOH A . 
L 6 HOH 271 971  615 HOH HOH A . 
L 6 HOH 272 972  814 HOH HOH A . 
L 6 HOH 273 973  177 HOH HOH A . 
L 6 HOH 274 974  96  HOH HOH A . 
L 6 HOH 275 975  12  HOH HOH A . 
L 6 HOH 276 976  460 HOH HOH A . 
L 6 HOH 277 977  950 HOH HOH A . 
L 6 HOH 278 978  490 HOH HOH A . 
L 6 HOH 279 979  332 HOH HOH A . 
L 6 HOH 280 980  207 HOH HOH A . 
L 6 HOH 281 981  787 HOH HOH A . 
L 6 HOH 282 982  682 HOH HOH A . 
L 6 HOH 283 983  412 HOH HOH A . 
L 6 HOH 284 984  903 HOH HOH A . 
L 6 HOH 285 985  264 HOH HOH A . 
L 6 HOH 286 986  546 HOH HOH A . 
M 6 HOH 1   701  375 HOH HOH B . 
M 6 HOH 2   702  594 HOH HOH B . 
M 6 HOH 3   703  526 HOH HOH B . 
M 6 HOH 4   704  480 HOH HOH B . 
M 6 HOH 5   705  283 HOH HOH B . 
M 6 HOH 6   706  315 HOH HOH B . 
M 6 HOH 7   707  493 HOH HOH B . 
M 6 HOH 8   708  377 HOH HOH B . 
M 6 HOH 9   709  931 HOH HOH B . 
M 6 HOH 10  710  905 HOH HOH B . 
M 6 HOH 11  711  495 HOH HOH B . 
M 6 HOH 12  712  536 HOH HOH B . 
M 6 HOH 13  713  781 HOH HOH B . 
M 6 HOH 14  714  195 HOH HOH B . 
M 6 HOH 15  715  286 HOH HOH B . 
M 6 HOH 16  716  279 HOH HOH B . 
M 6 HOH 17  717  449 HOH HOH B . 
M 6 HOH 18  718  165 HOH HOH B . 
M 6 HOH 19  719  530 HOH HOH B . 
M 6 HOH 20  720  132 HOH HOH B . 
M 6 HOH 21  721  628 HOH HOH B . 
M 6 HOH 22  722  284 HOH HOH B . 
M 6 HOH 23  723  454 HOH HOH B . 
M 6 HOH 24  724  531 HOH HOH B . 
M 6 HOH 25  725  263 HOH HOH B . 
M 6 HOH 26  726  485 HOH HOH B . 
M 6 HOH 27  727  394 HOH HOH B . 
M 6 HOH 28  728  549 HOH HOH B . 
M 6 HOH 29  729  209 HOH HOH B . 
M 6 HOH 30  730  125 HOH HOH B . 
M 6 HOH 31  731  162 HOH HOH B . 
M 6 HOH 32  732  510 HOH HOH B . 
M 6 HOH 33  733  229 HOH HOH B . 
M 6 HOH 34  734  256 HOH HOH B . 
M 6 HOH 35  735  197 HOH HOH B . 
M 6 HOH 36  736  151 HOH HOH B . 
M 6 HOH 37  737  448 HOH HOH B . 
M 6 HOH 38  738  558 HOH HOH B . 
M 6 HOH 39  739  827 HOH HOH B . 
M 6 HOH 40  740  368 HOH HOH B . 
M 6 HOH 41  741  506 HOH HOH B . 
M 6 HOH 42  742  764 HOH HOH B . 
M 6 HOH 43  743  517 HOH HOH B . 
M 6 HOH 44  744  455 HOH HOH B . 
M 6 HOH 45  745  89  HOH HOH B . 
M 6 HOH 46  746  853 HOH HOH B . 
M 6 HOH 47  747  548 HOH HOH B . 
M 6 HOH 48  748  84  HOH HOH B . 
M 6 HOH 49  749  631 HOH HOH B . 
M 6 HOH 50  750  270 HOH HOH B . 
M 6 HOH 51  751  309 HOH HOH B . 
M 6 HOH 52  752  547 HOH HOH B . 
M 6 HOH 53  753  175 HOH HOH B . 
M 6 HOH 54  754  760 HOH HOH B . 
M 6 HOH 55  755  87  HOH HOH B . 
M 6 HOH 56  756  53  HOH HOH B . 
M 6 HOH 57  757  120 HOH HOH B . 
M 6 HOH 58  758  551 HOH HOH B . 
M 6 HOH 59  759  522 HOH HOH B . 
M 6 HOH 60  760  334 HOH HOH B . 
M 6 HOH 61  761  737 HOH HOH B . 
M 6 HOH 62  762  791 HOH HOH B . 
M 6 HOH 63  763  62  HOH HOH B . 
M 6 HOH 64  764  553 HOH HOH B . 
M 6 HOH 65  765  658 HOH HOH B . 
M 6 HOH 66  766  805 HOH HOH B . 
M 6 HOH 67  767  452 HOH HOH B . 
M 6 HOH 68  768  19  HOH HOH B . 
M 6 HOH 69  769  28  HOH HOH B . 
M 6 HOH 70  770  465 HOH HOH B . 
M 6 HOH 71  771  802 HOH HOH B . 
M 6 HOH 72  772  324 HOH HOH B . 
M 6 HOH 73  773  479 HOH HOH B . 
M 6 HOH 74  774  424 HOH HOH B . 
M 6 HOH 75  775  131 HOH HOH B . 
M 6 HOH 76  776  184 HOH HOH B . 
M 6 HOH 77  777  224 HOH HOH B . 
M 6 HOH 78  778  183 HOH HOH B . 
M 6 HOH 79  779  562 HOH HOH B . 
M 6 HOH 80  780  367 HOH HOH B . 
M 6 HOH 81  781  319 HOH HOH B . 
M 6 HOH 82  782  42  HOH HOH B . 
M 6 HOH 83  783  71  HOH HOH B . 
M 6 HOH 84  784  638 HOH HOH B . 
M 6 HOH 85  785  360 HOH HOH B . 
M 6 HOH 86  786  107 HOH HOH B . 
M 6 HOH 87  787  423 HOH HOH B . 
M 6 HOH 88  788  320 HOH HOH B . 
M 6 HOH 89  789  153 HOH HOH B . 
M 6 HOH 90  790  373 HOH HOH B . 
M 6 HOH 91  791  99  HOH HOH B . 
M 6 HOH 92  792  33  HOH HOH B . 
M 6 HOH 93  793  957 HOH HOH B . 
M 6 HOH 94  794  338 HOH HOH B . 
M 6 HOH 95  795  488 HOH HOH B . 
M 6 HOH 96  796  272 HOH HOH B . 
M 6 HOH 97  797  472 HOH HOH B . 
M 6 HOH 98  798  482 HOH HOH B . 
M 6 HOH 99  799  108 HOH HOH B . 
M 6 HOH 100 800  633 HOH HOH B . 
M 6 HOH 101 801  245 HOH HOH B . 
M 6 HOH 102 802  657 HOH HOH B . 
M 6 HOH 103 803  393 HOH HOH B . 
M 6 HOH 104 804  83  HOH HOH B . 
M 6 HOH 105 805  112 HOH HOH B . 
M 6 HOH 106 806  603 HOH HOH B . 
M 6 HOH 107 807  440 HOH HOH B . 
M 6 HOH 108 808  128 HOH HOH B . 
M 6 HOH 109 809  568 HOH HOH B . 
M 6 HOH 110 810  51  HOH HOH B . 
M 6 HOH 111 811  55  HOH HOH B . 
M 6 HOH 112 812  426 HOH HOH B . 
M 6 HOH 113 813  447 HOH HOH B . 
M 6 HOH 114 814  85  HOH HOH B . 
M 6 HOH 115 815  234 HOH HOH B . 
M 6 HOH 116 816  425 HOH HOH B . 
M 6 HOH 117 817  561 HOH HOH B . 
M 6 HOH 118 818  572 HOH HOH B . 
M 6 HOH 119 819  432 HOH HOH B . 
M 6 HOH 120 820  216 HOH HOH B . 
M 6 HOH 121 821  348 HOH HOH B . 
M 6 HOH 122 822  40  HOH HOH B . 
M 6 HOH 123 823  237 HOH HOH B . 
M 6 HOH 124 824  246 HOH HOH B . 
M 6 HOH 125 825  253 HOH HOH B . 
M 6 HOH 126 826  457 HOH HOH B . 
M 6 HOH 127 827  244 HOH HOH B . 
M 6 HOH 128 828  16  HOH HOH B . 
M 6 HOH 129 829  192 HOH HOH B . 
M 6 HOH 130 830  654 HOH HOH B . 
M 6 HOH 131 831  308 HOH HOH B . 
M 6 HOH 132 832  76  HOH HOH B . 
M 6 HOH 133 833  212 HOH HOH B . 
M 6 HOH 134 834  358 HOH HOH B . 
M 6 HOH 135 835  119 HOH HOH B . 
M 6 HOH 136 836  660 HOH HOH B . 
M 6 HOH 137 837  503 HOH HOH B . 
M 6 HOH 138 838  428 HOH HOH B . 
M 6 HOH 139 839  104 HOH HOH B . 
M 6 HOH 140 840  193 HOH HOH B . 
M 6 HOH 141 841  210 HOH HOH B . 
M 6 HOH 142 842  114 HOH HOH B . 
M 6 HOH 143 843  260 HOH HOH B . 
M 6 HOH 144 844  644 HOH HOH B . 
M 6 HOH 145 845  265 HOH HOH B . 
M 6 HOH 146 846  91  HOH HOH B . 
M 6 HOH 147 847  49  HOH HOH B . 
M 6 HOH 148 848  250 HOH HOH B . 
M 6 HOH 149 849  138 HOH HOH B . 
M 6 HOH 150 850  329 HOH HOH B . 
M 6 HOH 151 851  739 HOH HOH B . 
M 6 HOH 152 852  544 HOH HOH B . 
M 6 HOH 153 853  103 HOH HOH B . 
M 6 HOH 154 854  340 HOH HOH B . 
M 6 HOH 155 855  718 HOH HOH B . 
M 6 HOH 156 856  327 HOH HOH B . 
M 6 HOH 157 857  280 HOH HOH B . 
M 6 HOH 158 858  77  HOH HOH B . 
M 6 HOH 159 859  476 HOH HOH B . 
M 6 HOH 160 860  268 HOH HOH B . 
M 6 HOH 161 861  380 HOH HOH B . 
M 6 HOH 162 862  571 HOH HOH B . 
M 6 HOH 163 863  236 HOH HOH B . 
M 6 HOH 164 864  382 HOH HOH B . 
M 6 HOH 165 865  201 HOH HOH B . 
M 6 HOH 166 866  491 HOH HOH B . 
M 6 HOH 167 867  174 HOH HOH B . 
M 6 HOH 168 868  274 HOH HOH B . 
M 6 HOH 169 869  67  HOH HOH B . 
M 6 HOH 170 870  136 HOH HOH B . 
M 6 HOH 171 871  442 HOH HOH B . 
M 6 HOH 172 872  563 HOH HOH B . 
M 6 HOH 173 873  285 HOH HOH B . 
M 6 HOH 174 874  45  HOH HOH B . 
M 6 HOH 175 875  655 HOH HOH B . 
M 6 HOH 176 876  116 HOH HOH B . 
M 6 HOH 177 877  395 HOH HOH B . 
M 6 HOH 178 878  514 HOH HOH B . 
M 6 HOH 179 879  214 HOH HOH B . 
M 6 HOH 180 880  487 HOH HOH B . 
M 6 HOH 181 881  361 HOH HOH B . 
M 6 HOH 182 882  145 HOH HOH B . 
M 6 HOH 183 883  344 HOH HOH B . 
M 6 HOH 184 884  255 HOH HOH B . 
M 6 HOH 185 885  459 HOH HOH B . 
M 6 HOH 186 886  154 HOH HOH B . 
M 6 HOH 187 887  300 HOH HOH B . 
M 6 HOH 188 888  78  HOH HOH B . 
M 6 HOH 189 889  798 HOH HOH B . 
M 6 HOH 190 890  758 HOH HOH B . 
M 6 HOH 191 891  282 HOH HOH B . 
M 6 HOH 192 892  355 HOH HOH B . 
M 6 HOH 193 893  299 HOH HOH B . 
M 6 HOH 194 894  293 HOH HOH B . 
M 6 HOH 195 895  199 HOH HOH B . 
M 6 HOH 196 896  965 HOH HOH B . 
M 6 HOH 197 897  225 HOH HOH B . 
M 6 HOH 198 898  578 HOH HOH B . 
M 6 HOH 199 899  178 HOH HOH B . 
M 6 HOH 200 900  354 HOH HOH B . 
M 6 HOH 201 901  247 HOH HOH B . 
M 6 HOH 202 902  142 HOH HOH B . 
M 6 HOH 203 903  582 HOH HOH B . 
M 6 HOH 204 904  525 HOH HOH B . 
M 6 HOH 205 905  588 HOH HOH B . 
M 6 HOH 206 906  723 HOH HOH B . 
M 6 HOH 207 907  632 HOH HOH B . 
M 6 HOH 208 908  463 HOH HOH B . 
M 6 HOH 209 909  139 HOH HOH B . 
M 6 HOH 210 910  52  HOH HOH B . 
M 6 HOH 211 911  976 HOH HOH B . 
M 6 HOH 212 912  59  HOH HOH B . 
M 6 HOH 213 913  34  HOH HOH B . 
M 6 HOH 214 914  770 HOH HOH B . 
M 6 HOH 215 915  281 HOH HOH B . 
M 6 HOH 216 916  4   HOH HOH B . 
M 6 HOH 217 917  343 HOH HOH B . 
M 6 HOH 218 918  118 HOH HOH B . 
M 6 HOH 219 919  677 HOH HOH B . 
M 6 HOH 220 920  429 HOH HOH B . 
M 6 HOH 221 921  437 HOH HOH B . 
M 6 HOH 222 922  254 HOH HOH B . 
M 6 HOH 223 923  403 HOH HOH B . 
M 6 HOH 224 924  147 HOH HOH B . 
M 6 HOH 225 925  404 HOH HOH B . 
M 6 HOH 226 926  722 HOH HOH B . 
M 6 HOH 227 927  427 HOH HOH B . 
M 6 HOH 228 928  535 HOH HOH B . 
M 6 HOH 229 929  888 HOH HOH B . 
M 6 HOH 230 930  840 HOH HOH B . 
M 6 HOH 231 931  186 HOH HOH B . 
M 6 HOH 232 932  88  HOH HOH B . 
M 6 HOH 233 933  353 HOH HOH B . 
M 6 HOH 234 934  326 HOH HOH B . 
M 6 HOH 235 935  38  HOH HOH B . 
M 6 HOH 236 936  39  HOH HOH B . 
M 6 HOH 237 937  470 HOH HOH B . 
M 6 HOH 238 938  670 HOH HOH B . 
M 6 HOH 239 939  130 HOH HOH B . 
M 6 HOH 240 940  668 HOH HOH B . 
M 6 HOH 241 941  690 HOH HOH B . 
M 6 HOH 242 942  31  HOH HOH B . 
M 6 HOH 243 943  417 HOH HOH B . 
M 6 HOH 244 944  47  HOH HOH B . 
M 6 HOH 245 945  625 HOH HOH B . 
M 6 HOH 246 946  672 HOH HOH B . 
M 6 HOH 247 947  161 HOH HOH B . 
M 6 HOH 248 948  24  HOH HOH B . 
M 6 HOH 249 949  564 HOH HOH B . 
M 6 HOH 250 950  406 HOH HOH B . 
M 6 HOH 251 951  115 HOH HOH B . 
M 6 HOH 252 952  176 HOH HOH B . 
M 6 HOH 253 953  436 HOH HOH B . 
M 6 HOH 254 954  597 HOH HOH B . 
M 6 HOH 255 955  243 HOH HOH B . 
M 6 HOH 256 956  345 HOH HOH B . 
M 6 HOH 257 957  56  HOH HOH B . 
M 6 HOH 258 958  464 HOH HOH B . 
M 6 HOH 259 959  305 HOH HOH B . 
M 6 HOH 260 960  507 HOH HOH B . 
M 6 HOH 261 961  443 HOH HOH B . 
M 6 HOH 262 962  911 HOH HOH B . 
M 6 HOH 263 963  402 HOH HOH B . 
M 6 HOH 264 964  258 HOH HOH B . 
M 6 HOH 265 965  143 HOH HOH B . 
M 6 HOH 266 966  640 HOH HOH B . 
M 6 HOH 267 967  310 HOH HOH B . 
M 6 HOH 268 968  666 HOH HOH B . 
M 6 HOH 269 969  559 HOH HOH B . 
M 6 HOH 270 970  390 HOH HOH B . 
M 6 HOH 271 971  30  HOH HOH B . 
M 6 HOH 272 972  648 HOH HOH B . 
M 6 HOH 273 973  356 HOH HOH B . 
M 6 HOH 274 974  867 HOH HOH B . 
M 6 HOH 275 975  287 HOH HOH B . 
M 6 HOH 276 976  122 HOH HOH B . 
M 6 HOH 277 977  148 HOH HOH B . 
M 6 HOH 278 978  433 HOH HOH B . 
M 6 HOH 279 979  634 HOH HOH B . 
M 6 HOH 280 980  663 HOH HOH B . 
M 6 HOH 281 981  398 HOH HOH B . 
M 6 HOH 282 982  635 HOH HOH B . 
M 6 HOH 283 983  330 HOH HOH B . 
M 6 HOH 284 984  362 HOH HOH B . 
M 6 HOH 285 985  23  HOH HOH B . 
M 6 HOH 286 986  630 HOH HOH B . 
M 6 HOH 287 987  422 HOH HOH B . 
M 6 HOH 288 988  623 HOH HOH B . 
M 6 HOH 289 989  93  HOH HOH B . 
M 6 HOH 290 990  48  HOH HOH B . 
M 6 HOH 291 991  920 HOH HOH B . 
M 6 HOH 292 992  416 HOH HOH B . 
M 6 HOH 293 993  560 HOH HOH B . 
M 6 HOH 294 994  392 HOH HOH B . 
M 6 HOH 295 995  431 HOH HOH B . 
M 6 HOH 296 996  540 HOH HOH B . 
M 6 HOH 297 997  251 HOH HOH B . 
M 6 HOH 298 998  933 HOH HOH B . 
M 6 HOH 299 999  492 HOH HOH B . 
M 6 HOH 300 1000 580 HOH HOH B . 
M 6 HOH 301 1001 213 HOH HOH B . 
M 6 HOH 302 1002 629 HOH HOH B . 
M 6 HOH 303 1003 565 HOH HOH B . 
M 6 HOH 304 1004 434 HOH HOH B . 
M 6 HOH 305 1005 600 HOH HOH B . 
M 6 HOH 306 1006 481 HOH HOH B . 
M 6 HOH 307 1007 25  HOH HOH B . 
M 6 HOH 308 1008 407 HOH HOH B . 
M 6 HOH 309 1009 515 HOH HOH B . 
M 6 HOH 310 1010 724 HOH HOH B . 
M 6 HOH 311 1011 278 HOH HOH B . 
M 6 HOH 312 1012 750 HOH HOH B . 
M 6 HOH 313 1013 22  HOH HOH B . 
M 6 HOH 314 1014 170 HOH HOH B . 
M 6 HOH 315 1015 94  HOH HOH B . 
M 6 HOH 316 1016 381 HOH HOH B . 
M 6 HOH 317 1017 72  HOH HOH B . 
M 6 HOH 318 1018 435 HOH HOH B . 
M 6 HOH 319 1019 189 HOH HOH B . 
M 6 HOH 320 1020 70  HOH HOH B . 
M 6 HOH 321 1021 391 HOH HOH B . 
M 6 HOH 322 1022 610 HOH HOH B . 
M 6 HOH 323 1023 569 HOH HOH B . 
M 6 HOH 324 1024 755 HOH HOH B . 
M 6 HOH 325 1025 499 HOH HOH B . 
M 6 HOH 326 1026 418 HOH HOH B . 
M 6 HOH 327 1027 198 HOH HOH B . 
M 6 HOH 328 1028 928 HOH HOH B . 
M 6 HOH 329 1029 411 HOH HOH B . 
M 6 HOH 330 1030 826 HOH HOH B . 
M 6 HOH 331 1031 438 HOH HOH B . 
M 6 HOH 332 1032 36  HOH HOH B . 
M 6 HOH 333 1033 409 HOH HOH B . 
M 6 HOH 334 1034 164 HOH HOH B . 
M 6 HOH 335 1035 555 HOH HOH B . 
M 6 HOH 336 1036 160 HOH HOH B . 
M 6 HOH 337 1037 430 HOH HOH B . 
M 6 HOH 338 1038 410 HOH HOH B . 
M 6 HOH 339 1039 413 HOH HOH B . 
M 6 HOH 340 1040 311 HOH HOH B . 
M 6 HOH 341 1041 208 HOH HOH B . 
M 6 HOH 342 1042 983 HOH HOH B . 
M 6 HOH 343 1043 989 HOH HOH B . 
M 6 HOH 344 1044 317 HOH HOH B . 
M 6 HOH 345 1045 414 HOH HOH B . 
M 6 HOH 346 1046 171 HOH HOH B . 
M 6 HOH 347 1047 75  HOH HOH B . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E,F,G,H,I,L 
1 2 B,D,J,K,M       
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 5740  ? 
1 MORE         22    ? 
1 'SSA (A^2)'  38840 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z      1.0000000000  0.0000000000 0.0000000000 0.0000000000   0.0000000000 1.0000000000 
0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000   
2 'crystal symmetry operation' 4_567 y,x+1,-z+2 -0.5000000000 0.8660254038 0.0000000000 -52.3650000000 0.8660254038 0.5000000000 
0.0000000000 90.6988405383 0.0000000000 0.0000000000 -1.0000000000 648.4940000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2019-06-12 
2 'Structure model' 2 0 2020-07-29 
# 
loop_
_pdbx_audit_revision_details.ordinal 
_pdbx_audit_revision_details.revision_ordinal 
_pdbx_audit_revision_details.data_content_type 
_pdbx_audit_revision_details.provider 
_pdbx_audit_revision_details.type 
_pdbx_audit_revision_details.description 
_pdbx_audit_revision_details.details 
1 1 'Structure model' repository 'Initial release' ?                          ? 
2 2 'Structure model' repository Remediation       'Carbohydrate remediation' ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory               
2 2 'Structure model' 'Atomic model'         
3 2 'Structure model' 'Data collection'      
4 2 'Structure model' 'Derived calculations' 
5 2 'Structure model' 'Structure summary'    
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  2 'Structure model' atom_site                     
2  2 'Structure model' chem_comp                     
3  2 'Structure model' entity                        
4  2 'Structure model' pdbx_branch_scheme            
5  2 'Structure model' pdbx_chem_comp_identifier     
6  2 'Structure model' pdbx_entity_branch            
7  2 'Structure model' pdbx_entity_branch_descriptor 
8  2 'Structure model' pdbx_entity_branch_link       
9  2 'Structure model' pdbx_entity_branch_list       
10 2 'Structure model' pdbx_entity_nonpoly           
11 2 'Structure model' pdbx_nonpoly_scheme           
12 2 'Structure model' pdbx_struct_assembly_gen      
13 2 'Structure model' pdbx_unobs_or_zero_occ_atoms  
14 2 'Structure model' struct_asym                   
15 2 'Structure model' struct_conn                   
16 2 'Structure model' struct_site                   
17 2 'Structure model' struct_site_gen               
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  2 'Structure model' '_atom_site.B_iso_or_equiv'                   
2  2 'Structure model' '_atom_site.Cartn_x'                          
3  2 'Structure model' '_atom_site.Cartn_y'                          
4  2 'Structure model' '_atom_site.Cartn_z'                          
5  2 'Structure model' '_atom_site.auth_asym_id'                     
6  2 'Structure model' '_atom_site.auth_atom_id'                     
7  2 'Structure model' '_atom_site.auth_comp_id'                     
8  2 'Structure model' '_atom_site.auth_seq_id'                      
9  2 'Structure model' '_atom_site.label_asym_id'                    
10 2 'Structure model' '_atom_site.label_atom_id'                    
11 2 'Structure model' '_atom_site.label_comp_id'                    
12 2 'Structure model' '_atom_site.label_entity_id'                  
13 2 'Structure model' '_atom_site.type_symbol'                      
14 2 'Structure model' '_chem_comp.name'                             
15 2 'Structure model' '_chem_comp.type'                             
16 2 'Structure model' '_pdbx_entity_nonpoly.comp_id'                
17 2 'Structure model' '_pdbx_entity_nonpoly.entity_id'              
18 2 'Structure model' '_pdbx_entity_nonpoly.name'                   
19 2 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list'      
20 2 'Structure model' '_pdbx_unobs_or_zero_occ_atoms.label_asym_id' 
21 2 'Structure model' '_struct_conn.pdbx_dist_value'                
22 2 'Structure model' '_struct_conn.pdbx_leaving_atom_flag'         
23 2 'Structure model' '_struct_conn.pdbx_role'                      
24 2 'Structure model' '_struct_conn.ptnr1_auth_asym_id'             
25 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id'             
26 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id'              
27 2 'Structure model' '_struct_conn.ptnr1_label_asym_id'            
28 2 'Structure model' '_struct_conn.ptnr1_label_atom_id'            
29 2 'Structure model' '_struct_conn.ptnr1_label_comp_id'            
30 2 'Structure model' '_struct_conn.ptnr2_auth_asym_id'             
31 2 'Structure model' '_struct_conn.ptnr2_auth_comp_id'             
32 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id'              
33 2 'Structure model' '_struct_conn.ptnr2_label_asym_id'            
34 2 'Structure model' '_struct_conn.ptnr2_label_atom_id'            
35 2 'Structure model' '_struct_conn.ptnr2_label_comp_id'            
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? refinement       ? ? ? ? ? ? ? ? ? ? ? PHENIX   ? ? ? '(dev_3311: ???)' 1 
? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .                 2 
? 'data scaling'   ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? .                 3 
? phasing          ? ? ? ? ? ? ? ? ? ? ? PHASER   ? ? ? .                 4 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 OG  B SER 203 ? ? O B HOH 701  ? ? 2.13 
2 1 OE1 B GLU 313 ? ? O B HOH 702  ? ? 2.17 
3 1 O   B HOH 705 ? ? O B HOH 1001 ? ? 2.17 
4 1 OG  A SER 309 ? ? O A HOH 701  ? ? 2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 PHE A 47  ? ? 67.41   -0.43   
2  1 PHE A 158 ? ? -142.66 10.48   
3  1 SER A 203 ? ? 58.10   -122.73 
4  1 ASP A 306 ? ? -98.16  -84.71  
5  1 VAL A 407 ? ? -127.18 -62.85  
6  1 ALA B 62  ? ? -114.37 52.73   
7  1 PHE B 158 ? ? -142.96 12.62   
8  1 SER B 203 ? ? 56.32   -121.67 
9  1 ASP B 306 ? ? -99.36  -84.32  
10 1 VAL B 407 ? ? -126.21 -60.72  
11 1 SER B 462 ? ? -69.45  3.56    
# 
_pdbx_distant_solvent_atoms.id                                1 
_pdbx_distant_solvent_atoms.PDB_model_num                     1 
_pdbx_distant_solvent_atoms.auth_atom_id                      O 
_pdbx_distant_solvent_atoms.label_alt_id                      ? 
_pdbx_distant_solvent_atoms.auth_asym_id                      B 
_pdbx_distant_solvent_atoms.auth_comp_id                      HOH 
_pdbx_distant_solvent_atoms.auth_seq_id                       1047 
_pdbx_distant_solvent_atoms.PDB_ins_code                      ? 
_pdbx_distant_solvent_atoms.neighbor_macromolecule_distance   6.36 
_pdbx_distant_solvent_atoms.neighbor_ligand_distance          . 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1 1 N 1 A FUC 606 ? O1 ? G FUC 1 O1 
2 1 N 1 A NAG 607 ? O1 ? H NAG 1 O1 
3 1 N 1 A NAG 608 ? O1 ? I NAG 1 O1 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 2   ? A GLY 1   
2  1 Y 1 A GLY 260 ? A GLY 259 
3  1 Y 1 A GLY 261 ? A GLY 260 
4  1 Y 1 A THR 262 ? A THR 261 
5  1 Y 1 A ARG 493 ? A ARG 492 
6  1 Y 1 A ASP 494 ? A ASP 493 
7  1 Y 1 A PRO 495 ? A PRO 494 
8  1 Y 1 A LYS 496 ? A LYS 495 
9  1 Y 1 A THR 543 ? A THR 542 
10 1 Y 1 B GLY 2   ? B GLY 1   
11 1 Y 1 B ARG 3   ? B ARG 2   
12 1 Y 1 B GLU 4   ? B GLU 3   
13 1 Y 1 B PRO 259 ? B PRO 258 
14 1 Y 1 B GLY 260 ? B GLY 259 
15 1 Y 1 B GLY 261 ? B GLY 260 
16 1 Y 1 B THR 262 ? B THR 261 
17 1 Y 1 B GLY 263 ? B GLY 262 
18 1 Y 1 B GLY 264 ? B GLY 263 
19 1 Y 1 B ARG 493 ? B ARG 492 
20 1 Y 1 B ASP 494 ? B ASP 493 
21 1 Y 1 B PRO 495 ? B PRO 494 
22 1 Y 1 B LYS 496 ? B LYS 495 
23 1 Y 1 B THR 543 ? B THR 542 
# 
loop_
_pdbx_branch_scheme.asym_id 
_pdbx_branch_scheme.entity_id 
_pdbx_branch_scheme.mon_id 
_pdbx_branch_scheme.num 
_pdbx_branch_scheme.pdb_asym_id 
_pdbx_branch_scheme.pdb_mon_id 
_pdbx_branch_scheme.pdb_seq_num 
_pdbx_branch_scheme.auth_asym_id 
_pdbx_branch_scheme.auth_mon_id 
_pdbx_branch_scheme.auth_seq_num 
_pdbx_branch_scheme.hetero 
C 2 NAG 1 C NAG 1 C NAG 602 n 
C 2 NAG 2 C NAG 2 C NAG 603 n 
C 2 FUC 3 C FUC 3 C FUC 601 n 
D 2 NAG 1 D NAG 1 D NAG 602 n 
D 2 NAG 2 D NAG 2 D NAG 603 n 
D 2 FUC 3 D FUC 3 D FUC 601 n 
# 
loop_
_pdbx_chem_comp_identifier.comp_id 
_pdbx_chem_comp_identifier.type 
_pdbx_chem_comp_identifier.program 
_pdbx_chem_comp_identifier.program_version 
_pdbx_chem_comp_identifier.identifier 
FUC 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 LFucpa                         
FUC 'COMMON NAME'                         GMML     1.0 a-L-fucopyranose               
FUC 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 a-L-Fucp                       
FUC 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 Fuc                            
NAG 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML     1.0 DGlcpNAcb                      
NAG 'COMMON NAME'                         GMML     1.0 N-acetyl-b-D-glucopyranosamine 
NAG 'IUPAC CARBOHYDRATE SYMBOL'           PDB-CARE 1.0 b-D-GlcpNAc                    
NAG 'SNFG CARBOHYDRATE SYMBOL'            GMML     1.0 GlcNAc                         
# 
_pdbx_entity_branch.entity_id   2 
_pdbx_entity_branch.type        oligosaccharide 
# 
loop_
_pdbx_entity_branch_descriptor.ordinal 
_pdbx_entity_branch_descriptor.entity_id 
_pdbx_entity_branch_descriptor.descriptor 
_pdbx_entity_branch_descriptor.type 
_pdbx_entity_branch_descriptor.program 
_pdbx_entity_branch_descriptor.program_version 
1 2 'DGlcpNAcb1-4[LFucpa1-6]DGlcpNAcb1-'                                         'Glycam Condensed Sequence' GMML       1.0   
2 2 'WURCS=2.0/2,3,2/[a2122h-1b_1-5_2*NCC/3=O][a1221m-1a_1-5]/1-1-2/a4-b1_a6-c1' WURCS                       PDB2Glycan 1.1.0 
3 2 '[]{[(4+1)][b-D-GlcpNAc]{[(4+1)][b-D-GlcpNAc]{}[(6+1)][a-L-Fucp]{}}}'        LINUCS                      PDB-CARE   ?     
# 
loop_
_pdbx_entity_branch_link.link_id 
_pdbx_entity_branch_link.entity_id 
_pdbx_entity_branch_link.entity_branch_list_num_1 
_pdbx_entity_branch_link.comp_id_1 
_pdbx_entity_branch_link.atom_id_1 
_pdbx_entity_branch_link.leaving_atom_id_1 
_pdbx_entity_branch_link.entity_branch_list_num_2 
_pdbx_entity_branch_link.comp_id_2 
_pdbx_entity_branch_link.atom_id_2 
_pdbx_entity_branch_link.leaving_atom_id_2 
_pdbx_entity_branch_link.value_order 
_pdbx_entity_branch_link.details 
1 2 2 NAG C1 O1 1 NAG O4 HO4 sing ? 
2 2 3 FUC C1 O1 1 NAG O6 HO6 sing ? 
# 
loop_
_pdbx_entity_branch_list.entity_id 
_pdbx_entity_branch_list.comp_id 
_pdbx_entity_branch_list.num 
_pdbx_entity_branch_list.hetero 
2 NAG 1 n 
2 NAG 2 n 
2 FUC 3 n 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 2-acetamido-2-deoxy-beta-D-glucopyranose                                                      NAG 
4 '1-[({2,4-BIS[(E)-(HYDROXYIMINO)METHYL]PYRIDINIUM-1-YL}METHOXY)METHYL]-4-CARBAMOYLPYRIDINIUM' HLO 
5 alpha-L-fucopyranose                                                                          FUC 
6 water                                                                                         HOH 
# 
_pdbx_struct_assembly_auth_evidence.id                     1 
_pdbx_struct_assembly_auth_evidence.assembly_id            1 
_pdbx_struct_assembly_auth_evidence.experimental_support   none 
_pdbx_struct_assembly_auth_evidence.details                ? 
#