data_6NYY
# 
_entry.id   6NYY 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.320 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   6NYY         
WWPDB D_1000238836 
EMDB  EMD-0552     
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.details        'human m-AAA protease AFG3L2, substrate-bound' 
_pdbx_database_related.db_id          EMD-0552 
_pdbx_database_related.content_type   'associated EM volume' 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        6NYY 
_pdbx_database_status.recvd_initial_deposition_date   2019-02-12 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
_audit_author.identifier_ORCID 
'Lander, G.C.' 1 0000-0003-4921-1135 
'Puchades, C.' 2 0000-0003-3240-4176 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Mol.Cell 
_citation.journal_id_ASTM           MOCEFL 
_citation.journal_id_CSD            2168 
_citation.journal_id_ISSN           1097-2765 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            75 
_citation.language                  ? 
_citation.page_first                1073 
_citation.page_last                 ? 
_citation.title                     
'Unique Structural Features of the Mitochondrial AAA+ Protease AFG3L2 Reveal the Molecular Basis for Activity in Health and Disease.' 
_citation.year                      2019 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1016/j.molcel.2019.06.016 
_citation.pdbx_database_id_PubMed   31327635 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Puchades, C.'  1 ? 
primary 'Ding, B.'      2 ? 
primary 'Song, A.'      3 ? 
primary 'Wiseman, R.L.' 4 ? 
primary 'Lander, G.C.'  5 ? 
primary 'Glynn, S.E.'   6 ? 
# 
_cell.angle_alpha                  90.00 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.00 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.00 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     6NYY 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     1.0 
_cell.length_a_esd                 ? 
_cell.length_b                     1.0 
_cell.length_b_esd                 ? 
_cell.length_c                     1.0 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        1 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         6NYY 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'AFG3-like protein 2'                         58331.629 6 3.4.24.- ? ? ? 
2 polymer     man Substrate                                     799.871   4 ?        ? ? ? 
3 non-polymer syn 'ZINC ION'                                    65.409    6 ?        ? ? ? 
4 non-polymer syn 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' 506.196   3 ?        ? ? ? 
5 non-polymer syn 'MAGNESIUM ION'                               24.305    3 ?        ? ? ? 
6 non-polymer syn "ADENOSINE-5'-DIPHOSPHATE"                    427.201   1 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Paraplegin-like protein' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;SNARRGPAGIGRTGRGMGGLFSVGETTAKVLKDEIDVKFKDVAGCEEAKLEIMEFVNFLKNPKQYQDLGAKIPKGAILTG
PPGTGKTLLAKATAGEANVPFITVSGSEFLEMFVGVGPARVRDLFALARKNAPCILFIDQIDAVGRKRGRGNFGGQSEQE
NTLNQLLVEMDGFNTTTNVVILAGTNRPDILDPALLRPGRFDRQIFIGPPDIKGRASIFKVHLRPLKLDSTLEKDKLARK
LASLTPGFSGADVANVCNEAALIAARHLSDSINQKHFEQAIERVIGGLEKKTQVLQPEEKKTVAYHQAGHAVAGWYLEHA
DPLLKVSIIPRGKGLGYAQYLPKEQYLYTKEQLLDRMCMTLGGRVSEEIFFGRITTGAQDDLRKVTQSAYAQIVQFGMNE
KVGQISFDLPRQGDMVLEKPYSEATARLIDDEVRILINDAYKRTVALLTEKKADVEKVALLLLEKEVLDKNDMVELLGPR
PFAEKSTYEEFVEGTGSLDEDTSLPEGLKDWNKEREKEKEEPPGEKVAN
;
;SNARRGPAGIGRTGRGMGGLFSVGETTAKVLKDEIDVKFKDVAGCEEAKLEIMEFVNFLKNPKQYQDLGAKIPKGAILTG
PPGTGKTLLAKATAGEANVPFITVSGSEFLEMFVGVGPARVRDLFALARKNAPCILFIDQIDAVGRKRGRGNFGGQSEQE
NTLNQLLVEMDGFNTTTNVVILAGTNRPDILDPALLRPGRFDRQIFIGPPDIKGRASIFKVHLRPLKLDSTLEKDKLARK
LASLTPGFSGADVANVCNEAALIAARHLSDSINQKHFEQAIERVIGGLEKKTQVLQPEEKKTVAYHQAGHAVAGWYLEHA
DPLLKVSIIPRGKGLGYAQYLPKEQYLYTKEQLLDRMCMTLGGRVSEEIFFGRITTGAQDDLRKVTQSAYAQIVQFGMNE
KVGQISFDLPRQGDMVLEKPYSEATARLIDDEVRILINDAYKRTVALLTEKKADVEKVALLLLEKEVLDKNDMVELLGPR
PFAEKSTYEEFVEGTGSLDEDTSLPEGLKDWNKEREKEKEEPPGEKVAN
;
A,B,C,D,E,F ? 
2 'polypeptide(L)' no no AAAAAAAAAAA AAAAAAAAAAA G,H,I,J     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ASN n 
1 3   ALA n 
1 4   ARG n 
1 5   ARG n 
1 6   GLY n 
1 7   PRO n 
1 8   ALA n 
1 9   GLY n 
1 10  ILE n 
1 11  GLY n 
1 12  ARG n 
1 13  THR n 
1 14  GLY n 
1 15  ARG n 
1 16  GLY n 
1 17  MET n 
1 18  GLY n 
1 19  GLY n 
1 20  LEU n 
1 21  PHE n 
1 22  SER n 
1 23  VAL n 
1 24  GLY n 
1 25  GLU n 
1 26  THR n 
1 27  THR n 
1 28  ALA n 
1 29  LYS n 
1 30  VAL n 
1 31  LEU n 
1 32  LYS n 
1 33  ASP n 
1 34  GLU n 
1 35  ILE n 
1 36  ASP n 
1 37  VAL n 
1 38  LYS n 
1 39  PHE n 
1 40  LYS n 
1 41  ASP n 
1 42  VAL n 
1 43  ALA n 
1 44  GLY n 
1 45  CYS n 
1 46  GLU n 
1 47  GLU n 
1 48  ALA n 
1 49  LYS n 
1 50  LEU n 
1 51  GLU n 
1 52  ILE n 
1 53  MET n 
1 54  GLU n 
1 55  PHE n 
1 56  VAL n 
1 57  ASN n 
1 58  PHE n 
1 59  LEU n 
1 60  LYS n 
1 61  ASN n 
1 62  PRO n 
1 63  LYS n 
1 64  GLN n 
1 65  TYR n 
1 66  GLN n 
1 67  ASP n 
1 68  LEU n 
1 69  GLY n 
1 70  ALA n 
1 71  LYS n 
1 72  ILE n 
1 73  PRO n 
1 74  LYS n 
1 75  GLY n 
1 76  ALA n 
1 77  ILE n 
1 78  LEU n 
1 79  THR n 
1 80  GLY n 
1 81  PRO n 
1 82  PRO n 
1 83  GLY n 
1 84  THR n 
1 85  GLY n 
1 86  LYS n 
1 87  THR n 
1 88  LEU n 
1 89  LEU n 
1 90  ALA n 
1 91  LYS n 
1 92  ALA n 
1 93  THR n 
1 94  ALA n 
1 95  GLY n 
1 96  GLU n 
1 97  ALA n 
1 98  ASN n 
1 99  VAL n 
1 100 PRO n 
1 101 PHE n 
1 102 ILE n 
1 103 THR n 
1 104 VAL n 
1 105 SER n 
1 106 GLY n 
1 107 SER n 
1 108 GLU n 
1 109 PHE n 
1 110 LEU n 
1 111 GLU n 
1 112 MET n 
1 113 PHE n 
1 114 VAL n 
1 115 GLY n 
1 116 VAL n 
1 117 GLY n 
1 118 PRO n 
1 119 ALA n 
1 120 ARG n 
1 121 VAL n 
1 122 ARG n 
1 123 ASP n 
1 124 LEU n 
1 125 PHE n 
1 126 ALA n 
1 127 LEU n 
1 128 ALA n 
1 129 ARG n 
1 130 LYS n 
1 131 ASN n 
1 132 ALA n 
1 133 PRO n 
1 134 CYS n 
1 135 ILE n 
1 136 LEU n 
1 137 PHE n 
1 138 ILE n 
1 139 ASP n 
1 140 GLN n 
1 141 ILE n 
1 142 ASP n 
1 143 ALA n 
1 144 VAL n 
1 145 GLY n 
1 146 ARG n 
1 147 LYS n 
1 148 ARG n 
1 149 GLY n 
1 150 ARG n 
1 151 GLY n 
1 152 ASN n 
1 153 PHE n 
1 154 GLY n 
1 155 GLY n 
1 156 GLN n 
1 157 SER n 
1 158 GLU n 
1 159 GLN n 
1 160 GLU n 
1 161 ASN n 
1 162 THR n 
1 163 LEU n 
1 164 ASN n 
1 165 GLN n 
1 166 LEU n 
1 167 LEU n 
1 168 VAL n 
1 169 GLU n 
1 170 MET n 
1 171 ASP n 
1 172 GLY n 
1 173 PHE n 
1 174 ASN n 
1 175 THR n 
1 176 THR n 
1 177 THR n 
1 178 ASN n 
1 179 VAL n 
1 180 VAL n 
1 181 ILE n 
1 182 LEU n 
1 183 ALA n 
1 184 GLY n 
1 185 THR n 
1 186 ASN n 
1 187 ARG n 
1 188 PRO n 
1 189 ASP n 
1 190 ILE n 
1 191 LEU n 
1 192 ASP n 
1 193 PRO n 
1 194 ALA n 
1 195 LEU n 
1 196 LEU n 
1 197 ARG n 
1 198 PRO n 
1 199 GLY n 
1 200 ARG n 
1 201 PHE n 
1 202 ASP n 
1 203 ARG n 
1 204 GLN n 
1 205 ILE n 
1 206 PHE n 
1 207 ILE n 
1 208 GLY n 
1 209 PRO n 
1 210 PRO n 
1 211 ASP n 
1 212 ILE n 
1 213 LYS n 
1 214 GLY n 
1 215 ARG n 
1 216 ALA n 
1 217 SER n 
1 218 ILE n 
1 219 PHE n 
1 220 LYS n 
1 221 VAL n 
1 222 HIS n 
1 223 LEU n 
1 224 ARG n 
1 225 PRO n 
1 226 LEU n 
1 227 LYS n 
1 228 LEU n 
1 229 ASP n 
1 230 SER n 
1 231 THR n 
1 232 LEU n 
1 233 GLU n 
1 234 LYS n 
1 235 ASP n 
1 236 LYS n 
1 237 LEU n 
1 238 ALA n 
1 239 ARG n 
1 240 LYS n 
1 241 LEU n 
1 242 ALA n 
1 243 SER n 
1 244 LEU n 
1 245 THR n 
1 246 PRO n 
1 247 GLY n 
1 248 PHE n 
1 249 SER n 
1 250 GLY n 
1 251 ALA n 
1 252 ASP n 
1 253 VAL n 
1 254 ALA n 
1 255 ASN n 
1 256 VAL n 
1 257 CYS n 
1 258 ASN n 
1 259 GLU n 
1 260 ALA n 
1 261 ALA n 
1 262 LEU n 
1 263 ILE n 
1 264 ALA n 
1 265 ALA n 
1 266 ARG n 
1 267 HIS n 
1 268 LEU n 
1 269 SER n 
1 270 ASP n 
1 271 SER n 
1 272 ILE n 
1 273 ASN n 
1 274 GLN n 
1 275 LYS n 
1 276 HIS n 
1 277 PHE n 
1 278 GLU n 
1 279 GLN n 
1 280 ALA n 
1 281 ILE n 
1 282 GLU n 
1 283 ARG n 
1 284 VAL n 
1 285 ILE n 
1 286 GLY n 
1 287 GLY n 
1 288 LEU n 
1 289 GLU n 
1 290 LYS n 
1 291 LYS n 
1 292 THR n 
1 293 GLN n 
1 294 VAL n 
1 295 LEU n 
1 296 GLN n 
1 297 PRO n 
1 298 GLU n 
1 299 GLU n 
1 300 LYS n 
1 301 LYS n 
1 302 THR n 
1 303 VAL n 
1 304 ALA n 
1 305 TYR n 
1 306 HIS n 
1 307 GLN n 
1 308 ALA n 
1 309 GLY n 
1 310 HIS n 
1 311 ALA n 
1 312 VAL n 
1 313 ALA n 
1 314 GLY n 
1 315 TRP n 
1 316 TYR n 
1 317 LEU n 
1 318 GLU n 
1 319 HIS n 
1 320 ALA n 
1 321 ASP n 
1 322 PRO n 
1 323 LEU n 
1 324 LEU n 
1 325 LYS n 
1 326 VAL n 
1 327 SER n 
1 328 ILE n 
1 329 ILE n 
1 330 PRO n 
1 331 ARG n 
1 332 GLY n 
1 333 LYS n 
1 334 GLY n 
1 335 LEU n 
1 336 GLY n 
1 337 TYR n 
1 338 ALA n 
1 339 GLN n 
1 340 TYR n 
1 341 LEU n 
1 342 PRO n 
1 343 LYS n 
1 344 GLU n 
1 345 GLN n 
1 346 TYR n 
1 347 LEU n 
1 348 TYR n 
1 349 THR n 
1 350 LYS n 
1 351 GLU n 
1 352 GLN n 
1 353 LEU n 
1 354 LEU n 
1 355 ASP n 
1 356 ARG n 
1 357 MET n 
1 358 CYS n 
1 359 MET n 
1 360 THR n 
1 361 LEU n 
1 362 GLY n 
1 363 GLY n 
1 364 ARG n 
1 365 VAL n 
1 366 SER n 
1 367 GLU n 
1 368 GLU n 
1 369 ILE n 
1 370 PHE n 
1 371 PHE n 
1 372 GLY n 
1 373 ARG n 
1 374 ILE n 
1 375 THR n 
1 376 THR n 
1 377 GLY n 
1 378 ALA n 
1 379 GLN n 
1 380 ASP n 
1 381 ASP n 
1 382 LEU n 
1 383 ARG n 
1 384 LYS n 
1 385 VAL n 
1 386 THR n 
1 387 GLN n 
1 388 SER n 
1 389 ALA n 
1 390 TYR n 
1 391 ALA n 
1 392 GLN n 
1 393 ILE n 
1 394 VAL n 
1 395 GLN n 
1 396 PHE n 
1 397 GLY n 
1 398 MET n 
1 399 ASN n 
1 400 GLU n 
1 401 LYS n 
1 402 VAL n 
1 403 GLY n 
1 404 GLN n 
1 405 ILE n 
1 406 SER n 
1 407 PHE n 
1 408 ASP n 
1 409 LEU n 
1 410 PRO n 
1 411 ARG n 
1 412 GLN n 
1 413 GLY n 
1 414 ASP n 
1 415 MET n 
1 416 VAL n 
1 417 LEU n 
1 418 GLU n 
1 419 LYS n 
1 420 PRO n 
1 421 TYR n 
1 422 SER n 
1 423 GLU n 
1 424 ALA n 
1 425 THR n 
1 426 ALA n 
1 427 ARG n 
1 428 LEU n 
1 429 ILE n 
1 430 ASP n 
1 431 ASP n 
1 432 GLU n 
1 433 VAL n 
1 434 ARG n 
1 435 ILE n 
1 436 LEU n 
1 437 ILE n 
1 438 ASN n 
1 439 ASP n 
1 440 ALA n 
1 441 TYR n 
1 442 LYS n 
1 443 ARG n 
1 444 THR n 
1 445 VAL n 
1 446 ALA n 
1 447 LEU n 
1 448 LEU n 
1 449 THR n 
1 450 GLU n 
1 451 LYS n 
1 452 LYS n 
1 453 ALA n 
1 454 ASP n 
1 455 VAL n 
1 456 GLU n 
1 457 LYS n 
1 458 VAL n 
1 459 ALA n 
1 460 LEU n 
1 461 LEU n 
1 462 LEU n 
1 463 LEU n 
1 464 GLU n 
1 465 LYS n 
1 466 GLU n 
1 467 VAL n 
1 468 LEU n 
1 469 ASP n 
1 470 LYS n 
1 471 ASN n 
1 472 ASP n 
1 473 MET n 
1 474 VAL n 
1 475 GLU n 
1 476 LEU n 
1 477 LEU n 
1 478 GLY n 
1 479 PRO n 
1 480 ARG n 
1 481 PRO n 
1 482 PHE n 
1 483 ALA n 
1 484 GLU n 
1 485 LYS n 
1 486 SER n 
1 487 THR n 
1 488 TYR n 
1 489 GLU n 
1 490 GLU n 
1 491 PHE n 
1 492 VAL n 
1 493 GLU n 
1 494 GLY n 
1 495 THR n 
1 496 GLY n 
1 497 SER n 
1 498 LEU n 
1 499 ASP n 
1 500 GLU n 
1 501 ASP n 
1 502 THR n 
1 503 SER n 
1 504 LEU n 
1 505 PRO n 
1 506 GLU n 
1 507 GLY n 
1 508 LEU n 
1 509 LYS n 
1 510 ASP n 
1 511 TRP n 
1 512 ASN n 
1 513 LYS n 
1 514 GLU n 
1 515 ARG n 
1 516 GLU n 
1 517 LYS n 
1 518 GLU n 
1 519 LYS n 
1 520 GLU n 
1 521 GLU n 
1 522 PRO n 
1 523 PRO n 
1 524 GLY n 
1 525 GLU n 
1 526 LYS n 
1 527 VAL n 
1 528 ALA n 
1 529 ASN n 
2 1   ALA n 
2 2   ALA n 
2 3   ALA n 
2 4   ALA n 
2 5   ALA n 
2 6   ALA n 
2 7   ALA n 
2 8   ALA n 
2 9   ALA n 
2 10  ALA n 
2 11  ALA n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1 529 Human ? AFG3L2 ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample 'Biological sequence' 1 11  Human ? ?      ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? 
? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP AFG32_HUMAN Q9Y4W6 ? 1 
;RRGPAGIGRTGRGMGGLFSVGETTAKVLKDEIDVKFKDVAGCEEAKLEIMEFVNFLKNPKQYQDLGAKIPKGAILTGPPG
TGKTLLAKATAGEANVPFITVSGSEFLEMFVGVGPARVRDLFALARKNAPCILFIDEIDAVGRKRGRGNFGGQSEQENTL
NQLLVEMDGFNTTTNVVILAGTNRPDILDPALLRPGRFDRQIFIGPPDIKGRASIFKVHLRPLKLDSTLEKDKLARKLAS
LTPGFSGADVANVCNEAALIAARHLSDSINQKHFEQAIERVIGGLEKKTQVLQPEEKKTVAYHEAGHAVAGWYLEHADPL
LKVSIIPRGKGLGYAQYLPKEQYLYTKEQLLDRMCMTLGGRVSEEIFFGRITTGAQDDLRKVTQSAYAQIVQFGMNEKVG
QISFDLPRQGDMVLEKPYSEATARLIDDEVRILINDAYKRTVALLTEKKADVEKVALLLLEKEVLDKNDMVELLGPRPFA
EKSTYEEFVEGTGSLDEDTSLPEGLKDWNKEREKEKEEPPGEKVAN
;
272 
2 PDB 6NYY        6NYY   ? 2 ? 1   
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 6NYY A 4 ? 529 ? Q9Y4W6 272 ? 797 ? 272 797 
2  1 6NYY B 4 ? 529 ? Q9Y4W6 272 ? 797 ? 272 797 
3  1 6NYY C 4 ? 529 ? Q9Y4W6 272 ? 797 ? 272 797 
4  1 6NYY D 4 ? 529 ? Q9Y4W6 272 ? 797 ? 272 797 
5  1 6NYY E 4 ? 529 ? Q9Y4W6 272 ? 797 ? 272 797 
6  1 6NYY F 4 ? 529 ? Q9Y4W6 272 ? 797 ? 272 797 
7  2 6NYY G 1 ? 11  ? 6NYY   1   ? 11  ? 1   11  
8  2 6NYY H 1 ? 11  ? 6NYY   1   ? 11  ? 1   11  
9  2 6NYY I 1 ? 11  ? 6NYY   1   ? 11  ? 1   11  
10 2 6NYY J 1 ? 11  ? 6NYY   1   ? 11  ? 1   11  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 6NYY SER A 1   ? UNP Q9Y4W6 ?   ?   'expression tag' 269 1  
1 6NYY ASN A 2   ? UNP Q9Y4W6 ?   ?   'expression tag' 270 2  
1 6NYY ALA A 3   ? UNP Q9Y4W6 ?   ?   'expression tag' 271 3  
1 6NYY GLN A 140 ? UNP Q9Y4W6 GLU 408 conflict         408 4  
1 6NYY GLN A 307 ? UNP Q9Y4W6 GLU 575 conflict         575 5  
2 6NYY SER B 1   ? UNP Q9Y4W6 ?   ?   'expression tag' 269 6  
2 6NYY ASN B 2   ? UNP Q9Y4W6 ?   ?   'expression tag' 270 7  
2 6NYY ALA B 3   ? UNP Q9Y4W6 ?   ?   'expression tag' 271 8  
2 6NYY GLN B 140 ? UNP Q9Y4W6 GLU 408 conflict         408 9  
2 6NYY GLN B 307 ? UNP Q9Y4W6 GLU 575 conflict         575 10 
3 6NYY SER C 1   ? UNP Q9Y4W6 ?   ?   'expression tag' 269 11 
3 6NYY ASN C 2   ? UNP Q9Y4W6 ?   ?   'expression tag' 270 12 
3 6NYY ALA C 3   ? UNP Q9Y4W6 ?   ?   'expression tag' 271 13 
3 6NYY GLN C 140 ? UNP Q9Y4W6 GLU 408 conflict         408 14 
3 6NYY GLN C 307 ? UNP Q9Y4W6 GLU 575 conflict         575 15 
4 6NYY SER D 1   ? UNP Q9Y4W6 ?   ?   'expression tag' 269 16 
4 6NYY ASN D 2   ? UNP Q9Y4W6 ?   ?   'expression tag' 270 17 
4 6NYY ALA D 3   ? UNP Q9Y4W6 ?   ?   'expression tag' 271 18 
4 6NYY GLN D 140 ? UNP Q9Y4W6 GLU 408 conflict         408 19 
4 6NYY GLN D 307 ? UNP Q9Y4W6 GLU 575 conflict         575 20 
5 6NYY SER E 1   ? UNP Q9Y4W6 ?   ?   'expression tag' 269 21 
5 6NYY ASN E 2   ? UNP Q9Y4W6 ?   ?   'expression tag' 270 22 
5 6NYY ALA E 3   ? UNP Q9Y4W6 ?   ?   'expression tag' 271 23 
5 6NYY GLN E 140 ? UNP Q9Y4W6 GLU 408 conflict         408 24 
5 6NYY GLN E 307 ? UNP Q9Y4W6 GLU 575 conflict         575 25 
6 6NYY SER F 1   ? UNP Q9Y4W6 ?   ?   'expression tag' 269 26 
6 6NYY ASN F 2   ? UNP Q9Y4W6 ?   ?   'expression tag' 270 27 
6 6NYY ALA F 3   ? UNP Q9Y4W6 ?   ?   'expression tag' 271 28 
6 6NYY GLN F 140 ? UNP Q9Y4W6 GLU 408 conflict         408 29 
6 6NYY GLN F 307 ? UNP Q9Y4W6 GLU 575 conflict         575 30 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ADP non-polymer         n "ADENOSINE-5'-DIPHOSPHATE"                    ? 'C10 H15 N5 O10 P2' 427.201 
ALA 'L-peptide linking' y ALANINE                                       ? 'C3 H7 N O2'        89.093  
ANP non-polymer         . 'PHOSPHOAMINOPHOSPHONIC ACID-ADENYLATE ESTER' ? 'C10 H17 N6 O12 P3' 506.196 
ARG 'L-peptide linking' y ARGININE                                      ? 'C6 H15 N4 O2 1'    175.209 
ASN 'L-peptide linking' y ASPARAGINE                                    ? 'C4 H8 N2 O3'       132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                               ? 'C4 H7 N O4'        133.103 
CYS 'L-peptide linking' y CYSTEINE                                      ? 'C3 H7 N O2 S'      121.158 
GLN 'L-peptide linking' y GLUTAMINE                                     ? 'C5 H10 N2 O3'      146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                               ? 'C5 H9 N O4'        147.129 
GLY 'peptide linking'   y GLYCINE                                       ? 'C2 H5 N O2'        75.067  
HIS 'L-peptide linking' y HISTIDINE                                     ? 'C6 H10 N3 O2 1'    156.162 
ILE 'L-peptide linking' y ISOLEUCINE                                    ? 'C6 H13 N O2'       131.173 
LEU 'L-peptide linking' y LEUCINE                                       ? 'C6 H13 N O2'       131.173 
LYS 'L-peptide linking' y LYSINE                                        ? 'C6 H15 N2 O2 1'    147.195 
MET 'L-peptide linking' y METHIONINE                                    ? 'C5 H11 N O2 S'     149.211 
MG  non-polymer         . 'MAGNESIUM ION'                               ? 'Mg 2'              24.305  
PHE 'L-peptide linking' y PHENYLALANINE                                 ? 'C9 H11 N O2'       165.189 
PRO 'L-peptide linking' y PROLINE                                       ? 'C5 H9 N O2'        115.130 
SER 'L-peptide linking' y SERINE                                        ? 'C3 H7 N O3'        105.093 
THR 'L-peptide linking' y THREONINE                                     ? 'C4 H9 N O3'        119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                    ? 'C11 H12 N2 O2'     204.225 
TYR 'L-peptide linking' y TYROSINE                                      ? 'C9 H11 N O3'       181.189 
VAL 'L-peptide linking' y VALINE                                        ? 'C5 H11 N O2'       117.146 
ZN  non-polymer         . 'ZINC ION'                                    ? 'Zn 2'              65.409  
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   6NYY 
_exptl.crystals_number            ? 
_exptl.details                    ? 
_exptl.method                     'ELECTRON MICROSCOPY' 
_exptl.method_details             ? 
# 
_struct.entry_id                     6NYY 
_struct.title                        'human m-AAA protease AFG3L2, substrate-bound' 
_struct.pdbx_descriptor              'AFG3-like protein 2 (E.C.3.4.24.-), Substrate' 
_struct.pdbx_model_details           ? 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               N 
# 
_struct_keywords.entry_id        6NYY 
_struct_keywords.text            
;AAA+, ATPase, protease, mitochondria, protein quality control, neurodegeneration, inner membrane, AFG3L2, m/AAA protease, translocase
;
_struct_keywords.pdbx_keywords   TRANSLOCASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 1 ? 
F N N 1 ? 
G N N 2 ? 
H N N 2 ? 
I N N 2 ? 
J N N 2 ? 
K N N 3 ? 
L N N 4 ? 
M N N 5 ? 
N N N 3 ? 
O N N 5 ? 
P N N 3 ? 
Q N N 4 ? 
R N N 4 ? 
S N N 5 ? 
T N N 3 ? 
U N N 6 ? 
V N N 3 ? 
W N N 3 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  AA1 ASN A 258 ? ALA A 265 ? ASN A 526 ALA A 533 1 ? 8  
HELX_P HELX_P2  AA2 GLN A 274 ? ILE A 285 ? GLN A 542 ILE A 553 1 ? 12 
HELX_P HELX_P3  AA3 GLN A 296 ? LEU A 317 ? GLN A 564 LEU A 585 1 ? 22 
HELX_P HELX_P4  AA4 THR A 349 ? LEU A 361 ? THR A 617 LEU A 629 1 ? 13 
HELX_P HELX_P5  AA5 LEU A 361 ? PHE A 370 ? LEU A 629 PHE A 638 1 ? 10 
HELX_P HELX_P6  AA6 ALA A 378 ? VAL A 394 ? ALA A 646 VAL A 662 1 ? 17 
HELX_P HELX_P7  AA7 SER A 422 ? LYS A 451 ? SER A 690 LYS A 719 1 ? 30 
HELX_P HELX_P8  AA8 LYS A 451 ? GLU A 466 ? LYS A 719 GLU A 734 1 ? 16 
HELX_P HELX_P9  AA9 ASP A 469 ? GLY A 478 ? ASP A 737 GLY A 746 1 ? 10 
HELX_P HELX_P10 AB1 LYS B 38  ? VAL B 42  ? LYS B 306 VAL B 310 5 ? 5  
HELX_P HELX_P11 AB2 LYS B 49  ? ASN B 61  ? LYS B 317 ASN B 329 1 ? 13 
HELX_P HELX_P12 AB3 THR B 87  ? ALA B 97  ? THR B 355 ALA B 365 1 ? 11 
HELX_P HELX_P13 AB4 SER B 107 ? PHE B 109 ? SER B 375 PHE B 377 5 ? 3  
HELX_P HELX_P14 AB5 VAL B 116 ? ASN B 131 ? VAL B 384 ASN B 399 1 ? 16 
HELX_P HELX_P15 AB6 ILE B 141 ? VAL B 144 ? ILE B 409 VAL B 412 5 ? 4  
HELX_P HELX_P16 AB7 PHE B 153 ? GLY B 172 ? PHE B 421 GLY B 440 1 ? 20 
HELX_P HELX_P17 AB8 ASP B 211 ? LEU B 223 ? ASP B 479 LEU B 491 1 ? 13 
HELX_P HELX_P18 AB9 ASP B 235 ? THR B 245 ? ASP B 503 THR B 513 1 ? 11 
HELX_P HELX_P19 AC1 SER B 249 ? HIS B 267 ? SER B 517 HIS B 535 1 ? 19 
HELX_P HELX_P20 AC2 ASN B 273 ? GLY B 287 ? ASN B 541 GLY B 555 1 ? 15 
HELX_P HELX_P21 AC3 GLU B 298 ? LEU B 317 ? GLU B 566 LEU B 585 1 ? 20 
HELX_P HELX_P22 AC4 THR B 349 ? LEU B 361 ? THR B 617 LEU B 629 1 ? 13 
HELX_P HELX_P23 AC5 LEU B 361 ? PHE B 371 ? LEU B 629 PHE B 639 1 ? 11 
HELX_P HELX_P24 AC6 GLN B 379 ? VAL B 394 ? GLN B 647 VAL B 662 1 ? 16 
HELX_P HELX_P25 AC7 SER B 422 ? LYS B 451 ? SER B 690 LYS B 719 1 ? 30 
HELX_P HELX_P26 AC8 LYS B 451 ? GLU B 466 ? LYS B 719 GLU B 734 1 ? 16 
HELX_P HELX_P27 AC9 LYS B 470 ? GLY B 478 ? LYS B 738 GLY B 746 1 ? 9  
HELX_P HELX_P28 AD1 THR B 487 ? VAL B 492 ? THR B 755 VAL B 760 1 ? 6  
HELX_P HELX_P29 AD2 LYS C 38  ? VAL C 42  ? LYS C 306 VAL C 310 5 ? 5  
HELX_P HELX_P30 AD3 CYS C 45  ? ASN C 61  ? CYS C 313 ASN C 329 1 ? 17 
HELX_P HELX_P31 AD4 PRO C 62  ? ASP C 67  ? PRO C 330 ASP C 335 1 ? 6  
HELX_P HELX_P32 AD5 THR C 87  ? ALA C 97  ? THR C 355 ALA C 365 1 ? 11 
HELX_P HELX_P33 AD6 GLY C 117 ? ASN C 131 ? GLY C 385 ASN C 399 1 ? 15 
HELX_P HELX_P34 AD7 ILE C 141 ? VAL C 144 ? ILE C 409 VAL C 412 5 ? 4  
HELX_P HELX_P35 AD8 PHE C 153 ? ASP C 171 ? PHE C 421 ASP C 439 1 ? 19 
HELX_P HELX_P36 AD9 ARG C 187 ? LEU C 191 ? ARG C 455 LEU C 459 5 ? 5  
HELX_P HELX_P37 AE1 ASP C 211 ? LEU C 223 ? ASP C 479 LEU C 491 1 ? 13 
HELX_P HELX_P38 AE2 GLU C 233 ? LEU C 244 ? GLU C 501 LEU C 512 1 ? 12 
HELX_P HELX_P39 AE3 ALA C 251 ? ALA C 265 ? ALA C 519 ALA C 533 1 ? 15 
HELX_P HELX_P40 AE4 GLN C 274 ? GLY C 286 ? GLN C 542 GLY C 554 1 ? 13 
HELX_P HELX_P41 AE5 GLU C 299 ? LEU C 317 ? GLU C 567 LEU C 585 1 ? 19 
HELX_P HELX_P42 AE6 THR C 349 ? LEU C 361 ? THR C 617 LEU C 629 1 ? 13 
HELX_P HELX_P43 AE7 LEU C 361 ? PHE C 371 ? LEU C 629 PHE C 639 1 ? 11 
HELX_P HELX_P44 AE8 ALA C 378 ? ALA C 391 ? ALA C 646 ALA C 659 1 ? 14 
HELX_P HELX_P45 AE9 SER C 422 ? ALA C 446 ? SER C 690 ALA C 714 1 ? 25 
HELX_P HELX_P46 AF1 LYS C 451 ? GLU C 466 ? LYS C 719 GLU C 734 1 ? 16 
HELX_P HELX_P47 AF2 ASP C 469 ? GLY C 478 ? ASP C 737 GLY C 746 1 ? 10 
HELX_P HELX_P48 AF3 PRO C 505 ? LYS C 509 ? PRO C 773 LYS C 777 5 ? 5  
HELX_P HELX_P49 AF4 LYS D 38  ? VAL D 42  ? LYS D 306 VAL D 310 5 ? 5  
HELX_P HELX_P50 AF5 CYS D 45  ? ASN D 61  ? CYS D 313 ASN D 329 1 ? 17 
HELX_P HELX_P51 AF6 ASN D 61  ? ASP D 67  ? ASN D 329 ASP D 335 1 ? 7  
HELX_P HELX_P52 AF7 THR D 87  ? ALA D 97  ? THR D 355 ALA D 365 1 ? 11 
HELX_P HELX_P53 AF8 SER D 107 ? PHE D 109 ? SER D 375 PHE D 377 5 ? 3  
HELX_P HELX_P54 AF9 GLY D 117 ? ASN D 131 ? GLY D 385 ASN D 399 1 ? 15 
HELX_P HELX_P55 AG1 ILE D 141 ? VAL D 144 ? ILE D 409 VAL D 412 5 ? 4  
HELX_P HELX_P56 AG2 GLN D 156 ? ASP D 171 ? GLN D 424 ASP D 439 1 ? 16 
HELX_P HELX_P57 AG3 ASP D 211 ? LEU D 223 ? ASP D 479 LEU D 491 1 ? 13 
HELX_P HELX_P58 AG4 GLU D 233 ? THR D 245 ? GLU D 501 THR D 513 1 ? 13 
HELX_P HELX_P59 AG5 SER D 249 ? HIS D 267 ? SER D 517 HIS D 535 1 ? 19 
HELX_P HELX_P60 AG6 GLN D 274 ? GLY D 287 ? GLN D 542 GLY D 555 1 ? 14 
HELX_P HELX_P61 AG7 GLN D 296 ? LEU D 317 ? GLN D 564 LEU D 585 1 ? 22 
HELX_P HELX_P62 AG8 THR D 349 ? LEU D 361 ? THR D 617 LEU D 629 1 ? 13 
HELX_P HELX_P63 AG9 LEU D 361 ? PHE D 370 ? LEU D 629 PHE D 638 1 ? 10 
HELX_P HELX_P64 AH1 ALA D 378 ? VAL D 394 ? ALA D 646 VAL D 662 1 ? 17 
HELX_P HELX_P65 AH2 SER D 422 ? ALA D 446 ? SER D 690 ALA D 714 1 ? 25 
HELX_P HELX_P66 AH3 LYS D 451 ? LYS D 465 ? LYS D 719 LYS D 733 1 ? 15 
HELX_P HELX_P67 AH4 LYS D 470 ? GLY D 478 ? LYS D 738 GLY D 746 1 ? 9  
HELX_P HELX_P68 AH5 THR D 487 ? GLU D 493 ? THR D 755 GLU D 761 1 ? 7  
HELX_P HELX_P69 AH6 PRO D 505 ? LYS D 509 ? PRO D 773 LYS D 777 5 ? 5  
HELX_P HELX_P70 AH7 LYS E 38  ? VAL E 42  ? LYS E 306 VAL E 310 5 ? 5  
HELX_P HELX_P71 AH8 CYS E 45  ? ASN E 61  ? CYS E 313 ASN E 329 1 ? 17 
HELX_P HELX_P72 AH9 ASN E 61  ? ASP E 67  ? ASN E 329 ASP E 335 1 ? 7  
HELX_P HELX_P73 AI1 GLY E 85  ? ASN E 98  ? GLY E 353 ASN E 366 1 ? 14 
HELX_P HELX_P74 AI2 GLY E 115 ? ASN E 131 ? GLY E 383 ASN E 399 1 ? 17 
HELX_P HELX_P75 AI3 ILE E 141 ? VAL E 144 ? ILE E 409 VAL E 412 5 ? 4  
HELX_P HELX_P76 AI4 GLN E 156 ? ASP E 171 ? GLN E 424 ASP E 439 1 ? 16 
HELX_P HELX_P77 AI5 ARG E 187 ? LEU E 191 ? ARG E 455 LEU E 459 5 ? 5  
HELX_P HELX_P78 AI6 ASP E 211 ? ARG E 224 ? ASP E 479 ARG E 492 1 ? 14 
HELX_P HELX_P79 AI7 GLU E 233 ? ALA E 242 ? GLU E 501 ALA E 510 1 ? 10 
HELX_P HELX_P80 AI8 SER E 249 ? HIS E 267 ? SER E 517 HIS E 535 1 ? 19 
HELX_P HELX_P81 AI9 ASN E 273 ? GLY E 286 ? ASN E 541 GLY E 554 1 ? 14 
HELX_P HELX_P82 AJ1 GLN E 296 ? LEU E 317 ? GLN E 564 LEU E 585 1 ? 22 
HELX_P HELX_P83 AJ2 LYS E 350 ? LEU E 361 ? LYS E 618 LEU E 629 1 ? 12 
HELX_P HELX_P84 AJ3 LEU E 361 ? PHE E 370 ? LEU E 629 PHE E 638 1 ? 10 
HELX_P HELX_P85 AJ4 THR E 376 ? ALA E 378 ? THR E 644 ALA E 646 5 ? 3  
HELX_P HELX_P86 AJ5 GLN E 379 ? VAL E 394 ? GLN E 647 VAL E 662 1 ? 16 
HELX_P HELX_P87 AJ6 SER E 422 ? THR E 449 ? SER E 690 THR E 717 1 ? 28 
HELX_P HELX_P88 AJ7 LYS E 451 ? LEU E 463 ? LYS E 719 LEU E 731 1 ? 13 
HELX_P HELX_P89 AJ8 ASP E 469 ? GLY E 478 ? ASP E 737 GLY E 746 1 ? 10 
HELX_P HELX_P90 AJ9 GLN F 296 ? GLY F 314 ? GLN F 564 GLY F 582 1 ? 19 
HELX_P HELX_P91 AK1 THR F 349 ? LEU F 361 ? THR F 617 LEU F 629 1 ? 13 
HELX_P HELX_P92 AK2 LEU F 361 ? PHE F 371 ? LEU F 629 PHE F 639 1 ? 11 
HELX_P HELX_P93 AK3 ALA F 378 ? GLN F 392 ? ALA F 646 GLN F 660 1 ? 15 
HELX_P HELX_P94 AK4 SER F 422 ? THR F 449 ? SER F 690 THR F 717 1 ? 28 
HELX_P HELX_P95 AK5 LYS F 451 ? GLU F 466 ? LYS F 719 GLU F 734 1 ? 16 
HELX_P HELX_P96 AK6 ASP F 469 ? GLY F 478 ? ASP F 737 GLY F 746 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1  metalc ? ? A HIS 306 NE2 ? ? ? 1_555 K ZN  . ZN  ? ? A HIS 574 A ZN  801 1_555 ? ? ? ? ? ? ? 2.243 ? 
metalc2  metalc ? ? A ASP 381 OD2 ? ? ? 1_555 K ZN  . ZN  ? ? A ASP 649 A ZN  801 1_555 ? ? ? ? ? ? ? 2.142 ? 
metalc3  metalc ? ? B THR 87  OG1 ? ? ? 1_555 M MG  . MG  ? ? B THR 355 B MG  802 1_555 ? ? ? ? ? ? ? 2.101 ? 
metalc4  metalc ? ? B HIS 306 NE2 ? ? ? 1_555 N ZN  . ZN  ? ? B HIS 574 B ZN  803 1_555 ? ? ? ? ? ? ? 2.203 ? 
metalc5  metalc ? ? B HIS 310 NE2 ? ? ? 1_555 N ZN  . ZN  ? ? B HIS 578 B ZN  803 1_555 ? ? ? ? ? ? ? 2.655 ? 
metalc6  metalc ? ? B ASP 381 OD2 ? ? ? 1_555 N ZN  . ZN  ? ? B ASP 649 B ZN  803 1_555 ? ? ? ? ? ? ? 2.123 ? 
metalc7  metalc ? ? C THR 87  OG1 ? ? ? 1_555 O MG  . MG  ? ? C THR 355 C MG  801 1_555 ? ? ? ? ? ? ? 2.213 ? 
metalc8  metalc ? ? C HIS 306 NE2 ? ? ? 1_555 P ZN  . ZN  ? ? C HIS 574 C ZN  802 1_555 ? ? ? ? ? ? ? 2.252 ? 
metalc9  metalc ? ? C HIS 310 NE2 ? ? ? 1_555 P ZN  . ZN  ? ? C HIS 578 C ZN  802 1_555 ? ? ? ? ? ? ? 2.212 ? 
metalc10 metalc ? ? C ASP 381 OD2 ? ? ? 1_555 P ZN  . ZN  ? ? C ASP 649 C ZN  802 1_555 ? ? ? ? ? ? ? 2.131 ? 
metalc11 metalc ? ? D THR 87  OG1 ? ? ? 1_555 S MG  . MG  ? ? D THR 355 D MG  802 1_555 ? ? ? ? ? ? ? 2.152 ? 
metalc12 metalc ? ? D HIS 306 NE2 ? ? ? 1_555 T ZN  . ZN  ? ? D HIS 574 D ZN  803 1_555 ? ? ? ? ? ? ? 2.293 ? 
metalc13 metalc ? ? D HIS 310 NE2 ? ? ? 1_555 T ZN  . ZN  ? ? D HIS 578 D ZN  803 1_555 ? ? ? ? ? ? ? 2.180 ? 
metalc14 metalc ? ? D ASP 381 OD2 ? ? ? 1_555 T ZN  . ZN  ? ? D ASP 649 D ZN  803 1_555 ? ? ? ? ? ? ? 2.119 ? 
metalc15 metalc ? ? E HIS 306 NE2 ? ? ? 1_555 V ZN  . ZN  ? ? E HIS 574 E ZN  802 1_555 ? ? ? ? ? ? ? 2.247 ? 
metalc16 metalc ? ? E ASP 381 OD2 ? ? ? 1_555 V ZN  . ZN  ? ? E ASP 649 E ZN  802 1_555 ? ? ? ? ? ? ? 2.114 ? 
metalc17 metalc ? ? F HIS 306 NE2 ? ? ? 1_555 W ZN  . ZN  ? ? F HIS 574 F ZN  801 1_555 ? ? ? ? ? ? ? 2.219 ? 
metalc18 metalc ? ? F HIS 310 NE2 ? ? ? 1_555 W ZN  . ZN  ? ? F HIS 578 F ZN  801 1_555 ? ? ? ? ? ? ? 2.507 ? 
metalc19 metalc ? ? F ASP 381 OD2 ? ? ? 1_555 W ZN  . ZN  ? ? F ASP 649 F ZN  801 1_555 ? ? ? ? ? ? ? 2.194 ? 
metalc20 metalc ? ? I ALA 5   O   ? ? ? 1_555 P ZN  . ZN  ? ? I ALA 5   C ZN  802 1_555 ? ? ? ? ? ? ? 2.133 ? 
metalc21 metalc ? ? J ALA 5   O   ? ? ? 1_555 T ZN  . ZN  ? ? J ALA 5   D ZN  803 1_555 ? ? ? ? ? ? ? 2.129 ? 
metalc22 metalc ? ? L ANP .   O1G ? ? ? 1_555 M MG  . MG  ? ? B ANP 801 B MG  802 1_555 ? ? ? ? ? ? ? 2.144 ? 
metalc23 metalc ? ? L ANP .   O3G ? ? ? 1_555 M MG  . MG  ? ? B ANP 801 B MG  802 1_555 ? ? ? ? ? ? ? 2.122 ? 
metalc24 metalc ? ? L ANP .   O1B ? ? ? 1_555 M MG  . MG  ? ? B ANP 801 B MG  802 1_555 ? ? ? ? ? ? ? 2.086 ? 
metalc25 metalc ? ? O MG  .   MG  ? ? ? 1_555 Q ANP . O1B ? ? C MG  801 C ANP 803 1_555 ? ? ? ? ? ? ? 2.334 ? 
metalc26 metalc ? ? O MG  .   MG  ? ? ? 1_555 Q ANP . O3G ? ? C MG  801 C ANP 803 1_555 ? ? ? ? ? ? ? 2.080 ? 
metalc27 metalc ? ? R ANP .   O3G ? ? ? 1_555 S MG  . MG  ? ? D ANP 801 D MG  802 1_555 ? ? ? ? ? ? ? 2.078 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
AA1 ? 2 ? 
AA2 ? 5 ? 
AA3 ? 3 ? 
AA4 ? 6 ? 
AA5 ? 2 ? 
AA6 ? 6 ? 
AA7 ? 4 ? 
AA8 ? 5 ? 
AA9 ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA2 1 2 ? anti-parallel 
AA2 2 3 ? parallel      
AA2 3 4 ? parallel      
AA2 4 5 ? parallel      
AA3 1 2 ? anti-parallel 
AA3 2 3 ? anti-parallel 
AA4 1 2 ? anti-parallel 
AA4 2 3 ? parallel      
AA4 3 4 ? parallel      
AA4 4 5 ? parallel      
AA4 5 6 ? parallel      
AA5 1 2 ? anti-parallel 
AA6 1 2 ? anti-parallel 
AA6 2 3 ? parallel      
AA6 3 4 ? parallel      
AA6 4 5 ? parallel      
AA6 5 6 ? parallel      
AA7 1 2 ? anti-parallel 
AA7 2 3 ? anti-parallel 
AA7 3 4 ? anti-parallel 
AA8 1 2 ? parallel      
AA8 2 3 ? parallel      
AA8 3 4 ? parallel      
AA8 4 5 ? parallel      
AA9 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 LEU A 323 ? SER A 327 ? LEU A 591 SER A 595 
AA1 2 TYR A 337 ? TYR A 340 ? TYR A 605 TYR A 608 
AA2 1 LYS B 29  ? LEU B 31  ? LYS B 297 LEU B 299 
AA2 2 PHE B 101 ? SER B 105 ? PHE B 369 SER B 373 
AA2 3 ILE B 135 ? ASP B 139 ? ILE B 403 ASP B 407 
AA2 4 LEU B 182 ? GLY B 184 ? LEU B 450 GLY B 452 
AA2 5 ILE B 77  ? LEU B 78  ? ILE B 345 LEU B 346 
AA3 1 TYR B 337 ? TYR B 340 ? TYR B 605 TYR B 608 
AA3 2 LEU B 323 ? SER B 327 ? LEU B 591 SER B 595 
AA3 3 VAL B 467 ? ASP B 469 ? VAL B 735 ASP B 737 
AA4 1 LYS C 29  ? VAL C 30  ? LYS C 297 VAL C 298 
AA4 2 PHE C 101 ? SER C 105 ? PHE C 369 SER C 373 
AA4 3 ILE C 135 ? ASP C 139 ? ILE C 403 ASP C 407 
AA4 4 VAL C 180 ? GLY C 184 ? VAL C 448 GLY C 452 
AA4 5 GLY C 75  ? THR C 79  ? GLY C 343 THR C 347 
AA4 6 ARG C 203 ? PHE C 206 ? ARG C 471 PHE C 474 
AA5 1 GLY C 334 ? TYR C 337 ? GLY C 602 TYR C 605 
AA5 2 ALA I 5   ? ALA I 7   ? ALA I 5   ALA I 7   
AA6 1 LYS D 29  ? VAL D 30  ? LYS D 297 VAL D 298 
AA6 2 PHE D 101 ? SER D 105 ? PHE D 369 SER D 373 
AA6 3 ILE D 135 ? ASP D 139 ? ILE D 403 ASP D 407 
AA6 4 VAL D 180 ? THR D 185 ? VAL D 448 THR D 453 
AA6 5 GLY D 75  ? THR D 79  ? GLY D 343 THR D 347 
AA6 6 ARG D 203 ? PHE D 206 ? ARG D 471 PHE D 474 
AA7 1 VAL D 467 ? LEU D 468 ? VAL D 735 LEU D 736 
AA7 2 LEU D 323 ? SER D 327 ? LEU D 591 SER D 595 
AA7 3 TYR D 337 ? TYR D 340 ? TYR D 605 TYR D 608 
AA7 4 ALA J 3   ? ALA J 4   ? ALA J 3   ALA J 4   
AA8 1 PHE E 101 ? SER E 105 ? PHE E 369 SER E 373 
AA8 2 ILE E 135 ? ASP E 139 ? ILE E 403 ASP E 407 
AA8 3 VAL E 180 ? THR E 185 ? VAL E 448 THR E 453 
AA8 4 ALA E 76  ? THR E 79  ? ALA E 344 THR E 347 
AA8 5 ARG E 203 ? PHE E 206 ? ARG E 471 PHE E 474 
AA9 1 VAL F 326 ? SER F 327 ? VAL F 594 SER F 595 
AA9 2 VAL F 467 ? LEU F 468 ? VAL F 735 LEU F 736 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N LYS A 325 ? N LYS A 593 O GLN A 339 ? O GLN A 607 
AA2 1 2 N LEU B 31  ? N LEU B 299 O PHE B 101 ? O PHE B 369 
AA2 2 3 N VAL B 104 ? N VAL B 372 O ASP B 139 ? O ASP B 407 
AA2 3 4 N ILE B 138 ? N ILE B 406 O GLY B 184 ? O GLY B 452 
AA2 4 5 O ALA B 183 ? O ALA B 451 N LEU B 78  ? N LEU B 346 
AA3 1 2 O GLN B 339 ? O GLN B 607 N LYS B 325 ? N LYS B 593 
AA3 2 3 N VAL B 326 ? N VAL B 594 O LEU B 468 ? O LEU B 736 
AA4 1 2 N LYS C 29  ? N LYS C 297 O THR C 103 ? O THR C 371 
AA4 2 3 N VAL C 104 ? N VAL C 372 O ASP C 139 ? O ASP C 407 
AA4 3 4 N ILE C 138 ? N ILE C 406 O LEU C 182 ? O LEU C 450 
AA4 4 5 O ALA C 183 ? O ALA C 451 N LEU C 78  ? N LEU C 346 
AA4 5 6 N THR C 79  ? N THR C 347 O ILE C 205 ? O ILE C 473 
AA5 1 2 N LEU C 335 ? N LEU C 603 O ALA I 6   ? O ALA I 6   
AA6 1 2 O LYS D 29  ? O LYS D 297 N THR D 103 ? N THR D 371 
AA6 2 3 N VAL D 104 ? N VAL D 372 O PHE D 137 ? O PHE D 405 
AA6 3 4 N LEU D 136 ? N LEU D 404 O VAL D 180 ? O VAL D 448 
AA6 4 5 O THR D 185 ? O THR D 453 N LEU D 78  ? N LEU D 346 
AA6 5 6 N THR D 79  ? N THR D 347 O ILE D 205 ? O ILE D 473 
AA7 1 2 O LEU D 468 ? O LEU D 736 N VAL D 326 ? N VAL D 594 
AA7 2 3 N SER D 327 ? N SER D 595 O TYR D 337 ? O TYR D 605 
AA7 3 4 N ALA D 338 ? N ALA D 606 O ALA J 4   ? O ALA J 4   
AA8 1 2 N VAL E 104 ? N VAL E 372 O ASP E 139 ? O ASP E 407 
AA8 2 3 N LEU E 136 ? N LEU E 404 O LEU E 182 ? O LEU E 450 
AA8 3 4 O ALA E 183 ? O ALA E 451 N LEU E 78  ? N LEU E 346 
AA8 4 5 N ILE E 77  ? N ILE E 345 O ARG E 203 ? O ARG E 471 
AA9 1 2 N VAL F 326 ? N VAL F 594 O LEU F 468 ? O LEU F 736 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A ZN  801 ? 3  'binding site for residue ZN A 801'                   
AC2 Software B ANP 801 ? 17 'binding site for residue ANP B 801'                  
AC3 Software B MG  802 ? 3  'binding site for residue MG B 802'                   
AC4 Software B ZN  803 ? 4  'binding site for residue ZN B 803'                   
AC5 Software C MG  801 ? 2  'binding site for residue MG C 801'                   
AC6 Software C ZN  802 ? 4  'binding site for residue ZN C 802'                   
AC7 Software D ANP 801 ? 18 'binding site for residue ANP D 801'                  
AC8 Software D MG  802 ? 4  'binding site for residue MG D 802'                   
AC9 Software D ZN  803 ? 4  'binding site for residue ZN D 803'                   
AD1 Software E ADP 801 ? 12 'binding site for residue ADP E 801'                  
AD2 Software E ZN  802 ? 3  'binding site for residue ZN E 802'                   
AD3 Software F ZN  801 ? 3  'binding site for residue ZN F 801'                   
AD4 Software C ANP 803 ? 17 'binding site for Di-peptide ANP C 803 and GLY C 353' 
AD5 Software C ANP 803 ? 39 'binding site for Di-peptide ANP C 803 and ARG D 468' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1   AC1 3  HIS A 306 ? HIS A 574 . ? 1_555 ? 
2   AC1 3  HIS A 310 ? HIS A 578 . ? 1_555 ? 
3   AC1 3  ASP A 381 ? ASP A 649 . ? 1_555 ? 
4   AC2 17 ASP B 41  ? ASP B 309 . ? 1_555 ? 
5   AC2 17 VAL B 42  ? VAL B 310 . ? 1_555 ? 
6   AC2 17 GLY B 83  ? GLY B 351 . ? 1_555 ? 
7   AC2 17 THR B 84  ? THR B 352 . ? 1_555 ? 
8   AC2 17 GLY B 85  ? GLY B 353 . ? 1_555 ? 
9   AC2 17 LYS B 86  ? LYS B 354 . ? 1_555 ? 
10  AC2 17 THR B 87  ? THR B 355 . ? 1_555 ? 
11  AC2 17 LEU B 88  ? LEU B 356 . ? 1_555 ? 
12  AC2 17 GLN B 140 ? GLN B 408 . ? 1_555 ? 
13  AC2 17 ASN B 186 ? ASN B 454 . ? 1_555 ? 
14  AC2 17 ILE B 218 ? ILE B 486 . ? 1_555 ? 
15  AC2 17 HIS B 222 ? HIS B 490 . ? 1_555 ? 
16  AC2 17 GLY B 250 ? GLY B 518 . ? 1_555 ? 
17  AC2 17 MG  M .   ? MG  B 802 . ? 1_555 ? 
18  AC2 17 ASP C 171 ? ASP C 439 . ? 1_555 ? 
19  AC2 17 ARG C 197 ? ARG C 465 . ? 1_555 ? 
20  AC2 17 ARG C 200 ? ARG C 468 . ? 1_555 ? 
21  AC3 3  THR B 87  ? THR B 355 . ? 1_555 ? 
22  AC3 3  ASP B 139 ? ASP B 407 . ? 1_555 ? 
23  AC3 3  ANP L .   ? ANP B 801 . ? 1_555 ? 
24  AC4 4  HIS B 306 ? HIS B 574 . ? 1_555 ? 
25  AC4 4  HIS B 310 ? HIS B 578 . ? 1_555 ? 
26  AC4 4  ASP B 381 ? ASP B 649 . ? 1_555 ? 
27  AC4 4  ALA H 6   ? ALA H 6   . ? 1_555 ? 
28  AC5 2  THR C 87  ? THR C 355 . ? 1_555 ? 
29  AC5 2  ANP Q .   ? ANP C 803 . ? 1_555 ? 
30  AC6 4  HIS C 306 ? HIS C 574 . ? 1_555 ? 
31  AC6 4  HIS C 310 ? HIS C 578 . ? 1_555 ? 
32  AC6 4  ASP C 381 ? ASP C 649 . ? 1_555 ? 
33  AC6 4  ALA I 5   ? ALA I 5   . ? 1_555 ? 
34  AC7 18 ASP D 41  ? ASP D 309 . ? 1_555 ? 
35  AC7 18 ALA D 43  ? ALA D 311 . ? 1_555 ? 
36  AC7 18 GLY D 83  ? GLY D 351 . ? 1_555 ? 
37  AC7 18 THR D 84  ? THR D 352 . ? 1_555 ? 
38  AC7 18 GLY D 85  ? GLY D 353 . ? 1_555 ? 
39  AC7 18 LYS D 86  ? LYS D 354 . ? 1_555 ? 
40  AC7 18 THR D 87  ? THR D 355 . ? 1_555 ? 
41  AC7 18 LEU D 88  ? LEU D 356 . ? 1_555 ? 
42  AC7 18 GLN D 140 ? GLN D 408 . ? 1_555 ? 
43  AC7 18 ASN D 186 ? ASN D 454 . ? 1_555 ? 
44  AC7 18 ILE D 218 ? ILE D 486 . ? 1_555 ? 
45  AC7 18 HIS D 222 ? HIS D 490 . ? 1_555 ? 
46  AC7 18 GLY D 250 ? GLY D 518 . ? 1_555 ? 
47  AC7 18 ALA D 251 ? ALA D 519 . ? 1_555 ? 
48  AC7 18 MG  S .   ? MG  D 802 . ? 1_555 ? 
49  AC7 18 ASP E 171 ? ASP E 439 . ? 1_555 ? 
50  AC7 18 ARG E 197 ? ARG E 465 . ? 1_555 ? 
51  AC7 18 ARG E 200 ? ARG E 468 . ? 1_555 ? 
52  AC8 4  THR D 87  ? THR D 355 . ? 1_555 ? 
53  AC8 4  ASP D 139 ? ASP D 407 . ? 1_555 ? 
54  AC8 4  ANP R .   ? ANP D 801 . ? 1_555 ? 
55  AC8 4  ASP E 171 ? ASP E 439 . ? 1_555 ? 
56  AC9 4  HIS D 306 ? HIS D 574 . ? 1_555 ? 
57  AC9 4  HIS D 310 ? HIS D 578 . ? 1_555 ? 
58  AC9 4  ASP D 381 ? ASP D 649 . ? 1_555 ? 
59  AC9 4  ALA J 5   ? ALA J 5   . ? 1_555 ? 
60  AD1 12 ASP E 41  ? ASP E 309 . ? 1_555 ? 
61  AD1 12 ALA E 43  ? ALA E 311 . ? 1_555 ? 
62  AD1 12 GLY E 83  ? GLY E 351 . ? 1_555 ? 
63  AD1 12 THR E 84  ? THR E 352 . ? 1_555 ? 
64  AD1 12 GLY E 85  ? GLY E 353 . ? 1_555 ? 
65  AD1 12 LYS E 86  ? LYS E 354 . ? 1_555 ? 
66  AD1 12 THR E 87  ? THR E 355 . ? 1_555 ? 
67  AD1 12 LEU E 88  ? LEU E 356 . ? 1_555 ? 
68  AD1 12 ILE E 218 ? ILE E 486 . ? 1_555 ? 
69  AD1 12 HIS E 222 ? HIS E 490 . ? 1_555 ? 
70  AD1 12 GLY E 250 ? GLY E 518 . ? 1_555 ? 
71  AD1 12 ALA E 251 ? ALA E 519 . ? 1_555 ? 
72  AD2 3  HIS E 306 ? HIS E 574 . ? 1_555 ? 
73  AD2 3  HIS E 310 ? HIS E 578 . ? 1_555 ? 
74  AD2 3  ASP E 381 ? ASP E 649 . ? 1_555 ? 
75  AD3 3  HIS F 306 ? HIS F 574 . ? 1_555 ? 
76  AD3 3  HIS F 310 ? HIS F 578 . ? 1_555 ? 
77  AD3 3  ASP F 381 ? ASP F 649 . ? 1_555 ? 
78  AD4 17 ASP C 41  ? ASP C 309 . ? 1_555 ? 
79  AD4 17 ALA C 43  ? ALA C 311 . ? 1_555 ? 
80  AD4 17 PRO C 82  ? PRO C 350 . ? 1_555 ? 
81  AD4 17 GLY C 83  ? GLY C 351 . ? 1_555 ? 
82  AD4 17 THR C 84  ? THR C 352 . ? 1_555 ? 
83  AD4 17 LYS C 86  ? LYS C 354 . ? 1_555 ? 
84  AD4 17 THR C 87  ? THR C 355 . ? 1_555 ? 
85  AD4 17 LEU C 88  ? LEU C 356 . ? 1_555 ? 
86  AD4 17 LEU C 89  ? LEU C 357 . ? 1_555 ? 
87  AD4 17 GLN C 140 ? GLN C 408 . ? 1_555 ? 
88  AD4 17 ILE C 218 ? ILE C 486 . ? 1_555 ? 
89  AD4 17 HIS C 222 ? HIS C 490 . ? 1_555 ? 
90  AD4 17 GLY C 250 ? GLY C 518 . ? 1_555 ? 
91  AD4 17 ALA C 251 ? ALA C 519 . ? 1_555 ? 
92  AD4 17 MG  O .   ? MG  C 801 . ? 1_555 ? 
93  AD4 17 ARG D 197 ? ARG D 465 . ? 1_555 ? 
94  AD4 17 ARG D 200 ? ARG D 468 . ? 1_555 ? 
95  AD5 39 ANP L .   ? ANP B 801 . ? 1_555 ? 
96  AD5 39 ASP C 41  ? ASP C 309 . ? 1_555 ? 
97  AD5 39 ALA C 43  ? ALA C 311 . ? 1_555 ? 
98  AD5 39 LYS C 74  ? LYS C 342 . ? 1_555 ? 
99  AD5 39 PRO C 82  ? PRO C 350 . ? 1_555 ? 
100 AD5 39 GLY C 83  ? GLY C 351 . ? 1_555 ? 
101 AD5 39 THR C 84  ? THR C 352 . ? 1_555 ? 
102 AD5 39 GLY C 85  ? GLY C 353 . ? 1_555 ? 
103 AD5 39 LYS C 86  ? LYS C 354 . ? 1_555 ? 
104 AD5 39 THR C 87  ? THR C 355 . ? 1_555 ? 
105 AD5 39 LEU C 88  ? LEU C 356 . ? 1_555 ? 
106 AD5 39 GLN C 140 ? GLN C 408 . ? 1_555 ? 
107 AD5 39 LEU C 167 ? LEU C 435 . ? 1_555 ? 
108 AD5 39 MET C 170 ? MET C 438 . ? 1_555 ? 
109 AD5 39 ASP C 171 ? ASP C 439 . ? 1_555 ? 
110 AD5 39 ALA C 194 ? ALA C 462 . ? 1_555 ? 
111 AD5 39 LEU C 195 ? LEU C 463 . ? 1_555 ? 
112 AD5 39 ARG C 197 ? ARG C 465 . ? 1_555 ? 
113 AD5 39 PRO C 198 ? PRO C 466 . ? 1_555 ? 
114 AD5 39 GLY C 199 ? GLY C 467 . ? 1_555 ? 
115 AD5 39 PHE C 201 ? PHE C 469 . ? 1_555 ? 
116 AD5 39 ILE C 218 ? ILE C 486 . ? 1_555 ? 
117 AD5 39 HIS C 222 ? HIS C 490 . ? 1_555 ? 
118 AD5 39 GLY C 250 ? GLY C 518 . ? 1_555 ? 
119 AD5 39 ALA C 251 ? ALA C 519 . ? 1_555 ? 
120 AD5 39 MG  O .   ? MG  C 801 . ? 1_555 ? 
121 AD5 39 LEU D 167 ? LEU D 435 . ? 1_555 ? 
122 AD5 39 MET D 170 ? MET D 438 . ? 1_555 ? 
123 AD5 39 ASP D 171 ? ASP D 439 . ? 1_555 ? 
124 AD5 39 ALA D 194 ? ALA D 462 . ? 1_555 ? 
125 AD5 39 LEU D 195 ? LEU D 463 . ? 1_555 ? 
126 AD5 39 ARG D 197 ? ARG D 465 . ? 1_555 ? 
127 AD5 39 PRO D 198 ? PRO D 466 . ? 1_555 ? 
128 AD5 39 GLY D 199 ? GLY D 467 . ? 1_555 ? 
129 AD5 39 PHE D 201 ? PHE D 469 . ? 1_555 ? 
130 AD5 39 HIS D 306 ? HIS D 574 . ? 1_555 ? 
131 AD5 39 HIS D 310 ? HIS D 578 . ? 1_555 ? 
132 AD5 39 ASP D 381 ? ASP D 649 . ? 1_555 ? 
133 AD5 39 ALA J 5   ? ALA J 5   . ? 1_555 ? 
# 
_atom_sites.entry_id                    6NYY 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1     C  CA    . PHE A 1 21  ? 68.830  48.210  123.232 1.00 105.55 ? 289 PHE A CA    1 
ATOM   2     C  CA    . SER A 1 22  ? 67.159  45.278  121.435 1.00 102.38 ? 290 SER A CA    1 
ATOM   3     C  CA    . VAL A 1 23  ? 66.748  47.092  118.078 1.00 95.30  ? 291 VAL A CA    1 
ATOM   4     C  CA    . GLY A 1 24  ? 69.675  45.293  116.510 1.00 90.34  ? 292 GLY A CA    1 
ATOM   5     C  CA    . GLU A 1 25  ? 67.717  42.364  115.176 1.00 87.71  ? 293 GLU A CA    1 
ATOM   6     C  CA    . THR A 1 26  ? 67.787  41.584  111.481 1.00 81.91  ? 294 THR A CA    1 
ATOM   7     C  CA    . THR A 1 27  ? 63.977  40.942  111.205 1.00 78.32  ? 295 THR A CA    1 
ATOM   8     C  CA    . ALA A 1 28  ? 64.827  38.129  108.767 1.00 76.59  ? 296 ALA A CA    1 
ATOM   9     C  CA    . LYS A 1 29  ? 63.012  34.814  109.059 1.00 75.46  ? 297 LYS A CA    1 
ATOM   10    C  CA    . VAL A 1 30  ? 64.990  31.608  108.647 1.00 73.13  ? 298 VAL A CA    1 
ATOM   11    C  CA    . LEU A 1 31  ? 62.477  30.043  106.258 1.00 78.33  ? 299 LEU A CA    1 
ATOM   12    C  CA    . LYS A 1 32  ? 61.364  26.742  107.791 1.00 91.46  ? 300 LYS A CA    1 
ATOM   13    C  CA    . ASP A 1 33  ? 58.100  26.419  105.850 1.00 93.87  ? 301 ASP A CA    1 
ATOM   14    C  CA    . GLU A 1 34  ? 58.253  23.757  103.149 1.00 90.82  ? 302 GLU A CA    1 
ATOM   15    C  CA    . ILE A 1 35  ? 57.586  25.873  100.069 1.00 83.11  ? 303 ILE A CA    1 
ATOM   16    C  CA    . ASP A 1 36  ? 55.925  23.668  97.448  1.00 83.59  ? 304 ASP A CA    1 
ATOM   17    C  CA    . VAL A 1 37  ? 57.339  25.562  94.447  1.00 72.21  ? 305 VAL A CA    1 
ATOM   18    C  CA    . LYS A 1 38  ? 59.804  23.384  92.561  1.00 70.28  ? 306 LYS A CA    1 
ATOM   19    C  CA    . PHE A 1 39  ? 61.739  24.442  89.477  1.00 70.10  ? 307 PHE A CA    1 
ATOM   20    C  CA    . LYS A 1 40  ? 59.016  22.897  87.312  1.00 68.68  ? 308 LYS A CA    1 
ATOM   21    C  CA    . ASP A 1 41  ? 56.737  25.795  88.274  1.00 68.56  ? 309 ASP A CA    1 
ATOM   22    C  CA    . VAL A 1 42  ? 59.139  28.455  86.954  1.00 66.50  ? 310 VAL A CA    1 
ATOM   23    C  CA    . ALA A 1 43  ? 58.766  28.459  83.177  1.00 65.82  ? 311 ALA A CA    1 
ATOM   24    C  CA    . GLY A 1 44  ? 59.709  30.879  80.438  1.00 71.89  ? 312 GLY A CA    1 
ATOM   25    C  CA    . CYS A 1 45  ? 63.026  32.077  81.878  1.00 76.85  ? 313 CYS A CA    1 
ATOM   26    C  CA    . GLU A 1 46  ? 64.906  28.970  80.838  1.00 80.97  ? 314 GLU A CA    1 
ATOM   27    C  CA    . GLU A 1 47  ? 68.467  30.297  80.632  1.00 84.01  ? 315 GLU A CA    1 
ATOM   28    C  CA    . ALA A 1 48  ? 67.916  32.322  83.801  1.00 78.23  ? 316 ALA A CA    1 
ATOM   29    C  CA    . LYS A 1 49  ? 66.818  29.393  85.965  1.00 75.62  ? 317 LYS A CA    1 
ATOM   30    C  CA    . LEU A 1 50  ? 69.886  27.440  84.846  1.00 76.94  ? 318 LEU A CA    1 
ATOM   31    C  CA    . GLU A 1 51  ? 72.200  29.911  86.572  1.00 79.20  ? 319 GLU A CA    1 
ATOM   32    C  CA    . ILE A 1 52  ? 70.193  29.634  89.809  1.00 74.79  ? 320 ILE A CA    1 
ATOM   33    C  CA    . MET A 1 53  ? 70.241  25.841  89.743  1.00 78.53  ? 321 MET A CA    1 
ATOM   34    C  CA    . GLU A 1 54  ? 74.050  25.964  89.668  1.00 78.30  ? 322 GLU A CA    1 
ATOM   35    C  CA    . PHE A 1 55  ? 73.896  27.536  93.116  1.00 76.06  ? 323 PHE A CA    1 
ATOM   36    C  CA    . VAL A 1 56  ? 71.854  24.511  94.168  1.00 77.75  ? 324 VAL A CA    1 
ATOM   37    C  CA    . ASN A 1 57  ? 74.029  22.157  92.105  1.00 80.93  ? 325 ASN A CA    1 
ATOM   38    C  CA    . PHE A 1 58  ? 77.169  23.374  93.872  1.00 79.61  ? 326 PHE A CA    1 
ATOM   39    C  CA    . LEU A 1 59  ? 75.826  23.093  97.421  1.00 76.80  ? 327 LEU A CA    1 
ATOM   40    C  CA    . LYS A 1 60  ? 74.362  19.636  96.722  1.00 79.27  ? 328 LYS A CA    1 
ATOM   41    C  CA    . ASN A 1 61  ? 77.194  18.156  94.604  1.00 79.81  ? 329 ASN A CA    1 
ATOM   42    C  CA    . PRO A 1 62  ? 80.470  20.043  95.158  1.00 78.22  ? 330 PRO A CA    1 
ATOM   43    C  CA    . LYS A 1 63  ? 82.558  17.275  93.557  1.00 79.78  ? 331 LYS A CA    1 
ATOM   44    C  CA    . GLN A 1 64  ? 81.760  18.260  89.955  1.00 80.56  ? 332 GLN A CA    1 
ATOM   45    C  CA    . TYR A 1 65  ? 83.119  21.776  90.508  1.00 80.52  ? 333 TYR A CA    1 
ATOM   46    C  CA    . GLN A 1 66  ? 85.835  21.408  93.151  1.00 80.66  ? 334 GLN A CA    1 
ATOM   47    C  CA    . ASP A 1 67  ? 87.690  18.935  90.931  1.00 81.68  ? 335 ASP A CA    1 
ATOM   48    C  CA    . LEU A 1 68  ? 88.176  21.795  88.443  1.00 80.14  ? 336 LEU A CA    1 
ATOM   49    C  CA    . GLY A 1 69  ? 89.102  24.335  91.116  1.00 79.63  ? 337 GLY A CA    1 
ATOM   50    C  CA    . ALA A 1 70  ? 85.818  26.226  90.811  1.00 78.67  ? 338 ALA A CA    1 
ATOM   51    C  CA    . LYS A 1 71  ? 85.120  28.321  93.882  1.00 76.74  ? 339 LYS A CA    1 
ATOM   52    C  CA    . ILE A 1 72  ? 81.577  29.000  95.006  1.00 76.12  ? 340 ILE A CA    1 
ATOM   53    C  CA    . PRO A 1 73  ? 80.053  32.016  93.231  1.00 72.28  ? 341 PRO A CA    1 
ATOM   54    C  CA    . LYS A 1 74  ? 79.271  34.688  95.769  1.00 71.08  ? 342 LYS A CA    1 
ATOM   55    C  CA    . GLY A 1 75  ? 75.858  35.963  94.723  1.00 70.27  ? 343 GLY A CA    1 
ATOM   56    C  CA    . ALA A 1 76  ? 73.427  37.000  92.025  1.00 66.68  ? 344 ALA A CA    1 
ATOM   57    C  CA    . ILE A 1 77  ? 71.157  39.897  91.093  1.00 67.35  ? 345 ILE A CA    1 
ATOM   58    C  CA    . LEU A 1 78  ? 67.777  39.165  89.544  1.00 66.10  ? 346 LEU A CA    1 
ATOM   59    C  CA    . THR A 1 79  ? 66.739  42.125  87.396  1.00 66.94  ? 347 THR A CA    1 
ATOM   60    C  CA    . GLY A 1 80  ? 63.919  42.706  84.957  1.00 63.63  ? 348 GLY A CA    1 
ATOM   61    C  CA    . PRO A 1 81  ? 60.533  44.370  84.577  1.00 60.84  ? 349 PRO A CA    1 
ATOM   62    C  CA    . PRO A 1 82  ? 58.045  43.789  87.406  1.00 60.04  ? 350 PRO A CA    1 
ATOM   63    C  CA    . GLY A 1 83  ? 56.023  40.597  87.305  1.00 59.19  ? 351 GLY A CA    1 
ATOM   64    C  CA    . THR A 1 84  ? 58.548  38.268  85.735  1.00 58.62  ? 352 THR A CA    1 
ATOM   65    C  CA    . GLY A 1 85  ? 59.258  35.674  88.404  1.00 61.52  ? 353 GLY A CA    1 
ATOM   66    C  CA    . LYS A 1 86  ? 62.439  36.872  90.033  1.00 62.58  ? 354 LYS A CA    1 
ATOM   67    C  CA    . THR A 1 87  ? 60.840  36.285  93.439  1.00 62.69  ? 355 THR A CA    1 
ATOM   68    C  CA    . LEU A 1 88  ? 59.254  33.047  92.211  1.00 63.20  ? 356 LEU A CA    1 
ATOM   69    C  CA    . LEU A 1 89  ? 62.679  31.938  91.007  1.00 64.40  ? 357 LEU A CA    1 
ATOM   70    C  CA    . ALA A 1 90  ? 63.853  32.578  94.555  1.00 65.48  ? 358 ALA A CA    1 
ATOM   71    C  CA    . LYS A 1 91  ? 60.829  30.641  95.827  1.00 67.69  ? 359 LYS A CA    1 
ATOM   72    C  CA    . ALA A 1 92  ? 61.935  27.667  93.743  1.00 69.04  ? 360 ALA A CA    1 
ATOM   73    C  CA    . THR A 1 93  ? 65.361  27.662  95.384  1.00 66.69  ? 361 THR A CA    1 
ATOM   74    C  CA    . ALA A 1 94  ? 63.876  27.584  98.892  1.00 69.81  ? 362 ALA A CA    1 
ATOM   75    C  CA    . GLY A 1 95  ? 61.729  24.587  98.015  1.00 75.64  ? 363 GLY A CA    1 
ATOM   76    C  CA    . GLU A 1 96  ? 64.444  22.634  96.213  1.00 76.95  ? 364 GLU A CA    1 
ATOM   77    C  CA    . ALA A 1 97  ? 67.830  23.314  97.819  1.00 73.07  ? 365 ALA A CA    1 
ATOM   78    C  CA    . ASN A 1 98  ? 68.300  21.377  101.061 1.00 74.71  ? 366 ASN A CA    1 
ATOM   79    C  CA    . VAL A 1 99  ? 70.342  24.193  102.638 1.00 70.08  ? 367 VAL A CA    1 
ATOM   80    C  CA    . PRO A 1 100 ? 68.844  26.683  105.119 1.00 68.30  ? 368 PRO A CA    1 
ATOM   81    C  CA    . PHE A 1 101 ? 67.255  29.646  103.384 1.00 67.34  ? 369 PHE A CA    1 
ATOM   82    C  CA    . ILE A 1 102 ? 66.486  33.044  104.883 1.00 66.29  ? 370 ILE A CA    1 
ATOM   83    C  CA    . THR A 1 103 ? 64.594  36.003  103.439 1.00 67.73  ? 371 THR A CA    1 
ATOM   84    C  CA    . VAL A 1 104 ? 64.835  39.737  104.049 1.00 66.90  ? 372 VAL A CA    1 
ATOM   85    C  CA    . SER A 1 105 ? 63.554  42.839  102.288 1.00 68.28  ? 373 SER A CA    1 
ATOM   86    C  CA    . GLY A 1 106 ? 65.825  45.646  101.170 1.00 70.14  ? 374 GLY A CA    1 
ATOM   87    C  CA    . SER A 1 107 ? 63.798  48.301  102.985 1.00 71.16  ? 375 SER A CA    1 
ATOM   88    C  CA    . GLU A 1 108 ? 63.918  46.550  106.361 1.00 73.53  ? 376 GLU A CA    1 
ATOM   89    C  CA    . PHE A 1 109 ? 67.336  47.881  107.339 1.00 71.45  ? 377 PHE A CA    1 
ATOM   90    C  CA    . LEU A 1 110 ? 66.609  51.573  107.886 1.00 77.22  ? 378 LEU A CA    1 
ATOM   91    C  CA    . GLU A 1 111 ? 64.684  52.635  110.978 1.00 83.57  ? 379 GLU A CA    1 
ATOM   92    C  CA    . MET A 1 112 ? 64.437  55.838  113.032 1.00 84.85  ? 380 MET A CA    1 
ATOM   93    C  CA    . PHE A 1 113 ? 67.935  55.793  114.520 1.00 82.55  ? 381 PHE A CA    1 
ATOM   94    C  CA    . VAL A 1 114 ? 71.594  56.151  113.512 1.00 82.85  ? 382 VAL A CA    1 
ATOM   95    C  CA    . GLY A 1 115 ? 73.169  52.802  114.359 1.00 82.77  ? 383 GLY A CA    1 
ATOM   96    C  CA    . VAL A 1 116 ? 70.228  50.850  112.932 1.00 78.45  ? 384 VAL A CA    1 
ATOM   97    C  CA    . GLY A 1 117 ? 70.872  50.075  109.332 1.00 75.81  ? 385 GLY A CA    1 
ATOM   98    C  CA    . PRO A 1 118 ? 74.551  49.144  109.628 1.00 75.01  ? 386 PRO A CA    1 
ATOM   99    C  CA    . ALA A 1 119 ? 73.868  47.343  112.923 1.00 71.85  ? 387 ALA A CA    1 
ATOM   100   C  CA    . ARG A 1 120 ? 71.190  45.308  111.130 1.00 75.07  ? 388 ARG A CA    1 
ATOM   101   C  CA    . VAL A 1 121 ? 73.224  44.127  108.132 1.00 71.64  ? 389 VAL A CA    1 
ATOM   102   C  CA    . ARG A 1 122 ? 75.892  42.908  110.592 1.00 72.96  ? 390 ARG A CA    1 
ATOM   103   C  CA    . ASP A 1 123 ? 73.327  40.623  112.220 1.00 74.60  ? 391 ASP A CA    1 
ATOM   104   C  CA    . LEU A 1 124 ? 71.836  39.591  108.898 1.00 70.35  ? 392 LEU A CA    1 
ATOM   105   C  CA    . PHE A 1 125 ? 75.058  37.761  108.067 1.00 67.58  ? 393 PHE A CA    1 
ATOM   106   C  CA    . ALA A 1 126 ? 75.992  36.690  111.593 1.00 69.92  ? 394 ALA A CA    1 
ATOM   107   C  CA    . LEU A 1 127 ? 72.719  34.796  111.407 1.00 70.32  ? 395 LEU A CA    1 
ATOM   108   C  CA    . ALA A 1 128 ? 73.757  33.643  107.926 1.00 69.68  ? 396 ALA A CA    1 
ATOM   109   C  CA    . ARG A 1 129 ? 77.045  32.294  109.314 1.00 72.36  ? 397 ARG A CA    1 
ATOM   110   C  CA    . LYS A 1 130 ? 75.345  30.193  111.983 1.00 72.72  ? 398 LYS A CA    1 
ATOM   111   C  CA    . ASN A 1 131 ? 73.654  28.505  109.025 1.00 74.32  ? 399 ASN A CA    1 
ATOM   112   C  CA    . ALA A 1 132 ? 76.904  27.730  107.244 1.00 75.59  ? 400 ALA A CA    1 
ATOM   113   C  CA    . PRO A 1 133 ? 75.938  26.545  103.695 1.00 75.17  ? 401 PRO A CA    1 
ATOM   114   C  CA    . CYS A 1 134 ? 72.892  28.837  103.618 1.00 72.19  ? 402 CYS A CA    1 
ATOM   115   C  CA    . ILE A 1 135 ? 71.396  31.004  100.866 1.00 68.47  ? 403 ILE A CA    1 
ATOM   116   C  CA    . LEU A 1 136 ? 69.955  34.417  101.678 1.00 64.99  ? 404 LEU A CA    1 
ATOM   117   C  CA    . PHE A 1 137 ? 67.594  36.482  99.546  1.00 64.42  ? 405 PHE A CA    1 
ATOM   118   C  CA    . ILE A 1 138 ? 67.424  40.280  99.671  1.00 66.05  ? 406 ILE A CA    1 
ATOM   119   C  CA    . ASP A 1 139 ? 64.249  41.439  97.951  1.00 69.76  ? 407 ASP A CA    1 
ATOM   120   C  CA    . GLN A 1 140 ? 64.036  44.979  96.516  1.00 69.13  ? 408 GLN A CA    1 
ATOM   121   C  CA    . ILE A 1 141 ? 67.725  45.695  97.073  1.00 69.55  ? 409 ILE A CA    1 
ATOM   122   C  CA    . ASP A 1 142 ? 67.375  49.181  95.485  1.00 72.53  ? 410 ASP A CA    1 
ATOM   123   C  CA    . ALA A 1 143 ? 66.124  50.488  98.865  1.00 70.94  ? 411 ALA A CA    1 
ATOM   124   C  CA    . VAL A 1 144 ? 69.625  50.319  100.390 1.00 71.71  ? 412 VAL A CA    1 
ATOM   125   C  CA    . GLY A 1 145 ? 71.585  49.842  97.170  1.00 73.02  ? 413 GLY A CA    1 
ATOM   126   C  CA    . ARG A 1 146 ? 71.351  53.461  96.009  1.00 79.74  ? 414 ARG A CA    1 
ATOM   127   C  CA    . LYS A 1 147 ? 74.503  55.050  94.588  1.00 81.71  ? 415 LYS A CA    1 
ATOM   128   C  CA    . ARG A 1 148 ? 76.437  57.162  97.077  1.00 86.42  ? 416 ARG A CA    1 
ATOM   129   C  CA    . GLY A 1 155 ? 76.349  60.918  96.535  1.00 98.30  ? 417 GLY A CA    1 
ATOM   130   C  CA    . GLN A 1 156 ? 71.128  60.252  102.396 1.00 100.58 ? 424 GLN A CA    1 
ATOM   131   C  CA    . SER A 1 157 ? 73.971  59.640  104.863 1.00 93.19  ? 425 SER A CA    1 
ATOM   132   C  CA    . GLU A 1 158 ? 72.221  56.812  106.716 1.00 87.18  ? 426 GLU A CA    1 
ATOM   133   C  CA    . GLN A 1 159 ? 71.625  54.985  103.447 1.00 84.39  ? 427 GLN A CA    1 
ATOM   134   C  CA    . GLU A 1 160 ? 75.337  55.212  102.653 1.00 87.48  ? 428 GLU A CA    1 
ATOM   135   C  CA    . ASN A 1 161 ? 76.366  53.813  106.040 1.00 82.12  ? 429 ASN A CA    1 
ATOM   136   C  CA    . THR A 1 162 ? 74.029  50.850  105.535 1.00 78.28  ? 430 THR A CA    1 
ATOM   137   C  CA    . LEU A 1 163 ? 75.396  50.302  102.030 1.00 75.37  ? 431 LEU A CA    1 
ATOM   138   C  CA    . ASN A 1 164 ? 79.035  50.592  103.156 1.00 77.31  ? 432 ASN A CA    1 
ATOM   139   C  CA    . GLN A 1 165 ? 78.324  48.008  105.838 1.00 72.31  ? 433 GLN A CA    1 
ATOM   140   C  CA    . LEU A 1 166 ? 76.798  45.733  103.198 1.00 71.41  ? 434 LEU A CA    1 
ATOM   141   C  CA    . LEU A 1 167 ? 79.848  46.118  100.958 1.00 73.71  ? 435 LEU A CA    1 
ATOM   142   C  CA    . VAL A 1 168 ? 82.338  45.125  103.657 1.00 76.72  ? 436 VAL A CA    1 
ATOM   143   C  CA    . GLU A 1 169 ? 80.321  42.121  104.817 1.00 74.86  ? 437 GLU A CA    1 
ATOM   144   C  CA    . MET A 1 170 ? 80.004  40.682  101.301 1.00 74.45  ? 438 MET A CA    1 
ATOM   145   C  CA    . ASP A 1 171 ? 83.681  41.027  100.321 1.00 79.53  ? 439 ASP A CA    1 
ATOM   146   C  CA    . GLY A 1 172 ? 86.378  41.969  102.816 1.00 89.64  ? 440 GLY A CA    1 
ATOM   147   C  CA    . PHE A 1 173 ? 87.649  40.720  106.151 1.00 95.58  ? 441 PHE A CA    1 
ATOM   148   C  CA    . ASN A 1 174 ? 85.702  37.961  107.948 1.00 98.06  ? 442 ASN A CA    1 
ATOM   149   C  CA    . THR A 1 175 ? 83.914  37.139  104.681 1.00 88.11  ? 443 THR A CA    1 
ATOM   150   C  CA    . THR A 1 176 ? 83.040  33.465  104.997 1.00 87.38  ? 444 THR A CA    1 
ATOM   151   C  CA    . THR A 1 177 ? 82.361  31.101  102.128 1.00 82.41  ? 445 THR A CA    1 
ATOM   152   C  CA    . ASN A 1 178 ? 79.257  29.009  101.354 1.00 79.74  ? 446 ASN A CA    1 
ATOM   153   C  CA    . VAL A 1 179 ? 76.865  31.985  101.617 1.00 70.15  ? 447 VAL A CA    1 
ATOM   154   C  CA    . VAL A 1 180 ? 75.032  32.581  98.344  1.00 68.71  ? 448 VAL A CA    1 
ATOM   155   C  CA    . ILE A 1 181 ? 73.453  36.028  98.327  1.00 67.57  ? 449 ILE A CA    1 
ATOM   156   C  CA    . LEU A 1 182 ? 70.525  36.182  95.931  1.00 64.19  ? 450 LEU A CA    1 
ATOM   157   C  CA    . ALA A 1 183 ? 69.057  39.597  95.256  1.00 65.59  ? 451 ALA A CA    1 
ATOM   158   C  CA    . GLY A 1 184 ? 66.235  41.057  93.251  1.00 66.52  ? 452 GLY A CA    1 
ATOM   159   C  CA    . THR A 1 185 ? 65.436  44.503  91.920  1.00 67.62  ? 453 THR A CA    1 
ATOM   160   C  CA    . ASN A 1 186 ? 63.781  46.207  88.975  1.00 69.86  ? 454 ASN A CA    1 
ATOM   161   C  CA    . ARG A 1 187 ? 65.929  49.364  88.976  1.00 73.62  ? 455 ARG A CA    1 
ATOM   162   C  CA    . PRO A 1 188 ? 69.510  48.101  88.631  1.00 70.56  ? 456 PRO A CA    1 
ATOM   163   C  CA    . ASP A 1 189 ? 70.679  51.363  87.061  1.00 77.62  ? 457 ASP A CA    1 
ATOM   164   C  CA    . ILE A 1 190 ? 70.447  53.336  90.316  1.00 72.94  ? 458 ILE A CA    1 
ATOM   165   C  CA    . LEU A 1 191 ? 72.591  50.765  92.104  1.00 73.67  ? 459 LEU A CA    1 
ATOM   166   C  CA    . ASP A 1 192 ? 76.088  51.488  93.322  1.00 78.31  ? 460 ASP A CA    1 
ATOM   167   C  CA    . PRO A 1 193 ? 78.877  50.101  91.097  1.00 74.47  ? 461 PRO A CA    1 
ATOM   168   C  CA    . ALA A 1 194 ? 80.459  48.863  94.337  1.00 73.71  ? 462 ALA A CA    1 
ATOM   169   C  CA    . LEU A 1 195 ? 77.587  46.376  94.591  1.00 73.62  ? 463 LEU A CA    1 
ATOM   170   C  CA    . LEU A 1 196 ? 77.679  45.540  90.890  1.00 73.66  ? 464 LEU A CA    1 
ATOM   171   C  CA    . ARG A 1 197 ? 81.308  44.392  90.968  1.00 72.18  ? 465 ARG A CA    1 
ATOM   172   C  CA    . PRO A 1 198 ? 82.201  40.699  90.954  1.00 70.37  ? 466 PRO A CA    1 
ATOM   173   C  CA    . GLY A 1 199 ? 83.073  39.360  94.355  1.00 69.89  ? 467 GLY A CA    1 
ATOM   174   C  CA    . ARG A 1 200 ? 79.857  40.891  95.689  1.00 71.37  ? 468 ARG A CA    1 
ATOM   175   C  CA    . PHE A 1 201 ? 77.404  39.904  92.934  1.00 70.06  ? 469 PHE A CA    1 
ATOM   176   C  CA    . ASP A 1 202 ? 79.250  37.636  90.517  1.00 73.94  ? 470 ASP A CA    1 
ATOM   177   C  CA    . ARG A 1 203 ? 76.281  37.319  88.162  1.00 73.55  ? 471 ARG A CA    1 
ATOM   178   C  CA    . GLN A 1 204 ? 73.672  39.821  87.020  1.00 71.68  ? 472 GLN A CA    1 
ATOM   179   C  CA    . ILE A 1 205 ? 70.746  37.841  85.644  1.00 69.00  ? 473 ILE A CA    1 
ATOM   180   C  CA    . PHE A 1 206 ? 68.201  39.751  83.571  1.00 68.99  ? 474 PHE A CA    1 
ATOM   181   C  CA    . ILE A 1 207 ? 64.818  38.020  83.675  1.00 66.45  ? 475 ILE A CA    1 
ATOM   182   C  CA    . GLY A 1 208 ? 63.049  39.599  80.712  1.00 65.43  ? 476 GLY A CA    1 
ATOM   183   C  CA    . PRO A 1 209 ? 59.341  39.286  79.802  1.00 61.84  ? 477 PRO A CA    1 
ATOM   184   C  CA    . PRO A 1 210 ? 58.025  35.767  78.882  1.00 62.87  ? 478 PRO A CA    1 
ATOM   185   C  CA    . ASP A 1 211 ? 57.204  34.340  75.435  1.00 68.35  ? 479 ASP A CA    1 
ATOM   186   C  CA    . ILE A 1 212 ? 53.893  32.973  74.134  1.00 62.98  ? 480 ILE A CA    1 
ATOM   187   C  CA    . LYS A 1 213 ? 54.668  29.622  75.740  1.00 66.81  ? 481 LYS A CA    1 
ATOM   188   C  CA    . GLY A 1 214 ? 55.355  31.575  78.915  1.00 64.31  ? 482 GLY A CA    1 
ATOM   189   C  CA    . ARG A 1 215 ? 52.130  33.565  78.793  1.00 58.06  ? 483 ARG A CA    1 
ATOM   190   C  CA    . ALA A 1 216 ? 50.093  30.429  78.104  1.00 57.10  ? 484 ALA A CA    1 
ATOM   191   C  CA    . SER A 1 217 ? 51.324  29.019  81.413  1.00 58.85  ? 485 SER A CA    1 
ATOM   192   C  CA    . ILE A 1 218 ? 50.656  32.280  83.244  1.00 57.29  ? 486 ILE A CA    1 
ATOM   193   C  CA    . PHE A 1 219 ? 47.034  32.003  82.087  1.00 55.31  ? 487 PHE A CA    1 
ATOM   194   C  CA    . LYS A 1 220 ? 46.940  28.452  83.492  1.00 56.64  ? 488 LYS A CA    1 
ATOM   195   C  CA    . VAL A 1 221 ? 47.801  29.850  86.926  1.00 55.57  ? 489 VAL A CA    1 
ATOM   196   C  CA    . HIS A 1 222 ? 45.170  32.599  86.855  1.00 55.50  ? 490 HIS A CA    1 
ATOM   197   C  CA    . LEU A 1 223 ? 42.340  30.893  84.971  1.00 55.27  ? 491 LEU A CA    1 
ATOM   198   C  CA    . ARG A 1 224 ? 42.404  28.407  87.842  1.00 57.30  ? 492 ARG A CA    1 
ATOM   199   C  CA    . PRO A 1 225 ? 40.271  30.316  90.429  1.00 55.22  ? 493 PRO A CA    1 
ATOM   200   C  CA    . LEU A 1 226 ? 37.706  31.514  87.858  1.00 58.97  ? 494 LEU A CA    1 
ATOM   201   C  CA    . LYS A 1 227 ? 34.423  29.860  86.846  1.00 64.60  ? 495 LYS A CA    1 
ATOM   202   C  CA    . LEU A 1 228 ? 34.137  29.086  83.146  1.00 68.38  ? 496 LEU A CA    1 
ATOM   203   C  CA    . ASP A 1 229 ? 31.243  27.514  81.226  1.00 75.09  ? 497 ASP A CA    1 
ATOM   204   C  CA    . SER A 1 230 ? 30.253  23.887  80.860  1.00 78.96  ? 498 SER A CA    1 
ATOM   205   C  CA    . THR A 1 231 ? 32.455  24.256  77.785  1.00 77.52  ? 499 THR A CA    1 
ATOM   206   C  CA    . LEU A 1 232 ? 35.772  26.236  77.840  1.00 73.34  ? 500 LEU A CA    1 
ATOM   207   C  CA    . GLU A 1 233 ? 38.277  23.906  79.437  1.00 71.26  ? 501 GLU A CA    1 
ATOM   208   C  CA    . LYS A 1 234 ? 40.900  25.915  81.343  1.00 65.84  ? 502 LYS A CA    1 
ATOM   209   C  CA    . ASP A 1 235 ? 43.753  24.317  79.372  1.00 68.86  ? 503 ASP A CA    1 
ATOM   210   C  CA    . LYS A 1 236 ? 42.660  25.047  75.796  1.00 63.36  ? 504 LYS A CA    1 
ATOM   211   C  CA    . LEU A 1 237 ? 41.542  28.561  76.712  1.00 61.96  ? 505 LEU A CA    1 
ATOM   212   C  CA    . ALA A 1 238 ? 44.990  29.502  78.033  1.00 60.14  ? 506 ALA A CA    1 
ATOM   213   C  CA    . ARG A 1 239 ? 46.425  28.717  74.604  1.00 63.45  ? 507 ARG A CA    1 
ATOM   214   C  CA    . LYS A 1 240 ? 43.768  30.907  72.982  1.00 58.00  ? 508 LYS A CA    1 
ATOM   215   C  CA    . LEU A 1 241 ? 44.287  33.766  75.415  1.00 57.29  ? 509 LEU A CA    1 
ATOM   216   C  CA    . ALA A 1 242 ? 48.056  33.905  74.995  1.00 56.20  ? 510 ALA A CA    1 
ATOM   217   C  CA    . SER A 1 243 ? 47.497  34.232  71.246  1.00 56.64  ? 511 SER A CA    1 
ATOM   218   C  CA    . LEU A 1 244 ? 45.315  37.311  71.664  1.00 54.64  ? 512 LEU A CA    1 
ATOM   219   C  CA    . THR A 1 245 ? 47.836  38.957  74.036  1.00 55.15  ? 513 THR A CA    1 
ATOM   220   C  CA    . PRO A 1 246 ? 51.194  39.585  72.327  1.00 53.56  ? 514 PRO A CA    1 
ATOM   221   C  CA    . GLY A 1 247 ? 53.864  41.436  74.224  1.00 55.59  ? 515 GLY A CA    1 
ATOM   222   C  CA    . PHE A 1 248 ? 52.133  41.323  77.593  1.00 56.15  ? 516 PHE A CA    1 
ATOM   223   C  CA    . SER A 1 249 ? 53.910  40.562  80.841  1.00 57.10  ? 517 SER A CA    1 
ATOM   224   C  CA    . GLY A 1 250 ? 53.372  38.487  83.955  1.00 57.05  ? 518 GLY A CA    1 
ATOM   225   C  CA    . ALA A 1 251 ? 50.928  41.024  85.389  1.00 54.86  ? 519 ALA A CA    1 
ATOM   226   C  CA    . ASP A 1 252 ? 49.095  42.080  82.227  1.00 58.28  ? 520 ASP A CA    1 
ATOM   227   C  CA    . VAL A 1 253 ? 47.828  38.497  82.041  1.00 53.34  ? 521 VAL A CA    1 
ATOM   228   C  CA    . ALA A 1 254 ? 46.652  38.870  85.648  1.00 54.09  ? 522 ALA A CA    1 
ATOM   229   C  CA    . ASN A 1 255 ? 44.200  41.653  84.744  1.00 58.99  ? 523 ASN A CA    1 
ATOM   230   C  CA    . VAL A 1 256 ? 42.826  39.888  81.656  1.00 54.96  ? 524 VAL A CA    1 
ATOM   231   C  CA    . CYS A 1 257 ? 41.915  36.948  83.872  1.00 58.47  ? 525 CYS A CA    1 
ATOM   232   N  N     . ASN A 1 258 ? 41.397  38.665  85.525  1.00 57.71  ? 526 ASN A N     1 
ATOM   233   C  CA    . ASN A 1 258 ? 40.582  39.270  86.570  1.00 57.71  ? 526 ASN A CA    1 
ATOM   234   C  C     . ASN A 1 258 ? 39.447  40.088  85.980  1.00 57.71  ? 526 ASN A C     1 
ATOM   235   O  O     . ASN A 1 258 ? 38.283  39.884  86.333  1.00 57.71  ? 526 ASN A O     1 
ATOM   236   C  CB    . ASN A 1 258 ? 41.435  40.155  87.469  1.00 57.71  ? 526 ASN A CB    1 
ATOM   237   C  CG    . ASN A 1 258 ? 40.733  40.531  88.748  1.00 57.71  ? 526 ASN A CG    1 
ATOM   238   O  OD1   . ASN A 1 258 ? 39.640  40.055  89.035  1.00 57.71  ? 526 ASN A OD1   1 
ATOM   239   N  ND2   . ASN A 1 258 ? 41.350  41.413  89.517  1.00 57.71  ? 526 ASN A ND2   1 
ATOM   240   N  N     . GLU A 1 259 ? 39.763  41.019  85.081  1.00 62.86  ? 527 GLU A N     1 
ATOM   241   C  CA    . GLU A 1 259 ? 38.743  41.941  84.605  1.00 62.86  ? 527 GLU A CA    1 
ATOM   242   C  C     . GLU A 1 259 ? 37.772  41.307  83.625  1.00 62.86  ? 527 GLU A C     1 
ATOM   243   O  O     . GLU A 1 259 ? 36.787  41.953  83.266  1.00 62.86  ? 527 GLU A O     1 
ATOM   244   C  CB    . GLU A 1 259 ? 39.384  43.168  83.968  1.00 62.86  ? 527 GLU A CB    1 
ATOM   245   C  CG    . GLU A 1 259 ? 40.128  44.026  84.965  1.00 62.86  ? 527 GLU A CG    1 
ATOM   246   C  CD    . GLU A 1 259 ? 40.727  45.260  84.337  1.00 62.86  ? 527 GLU A CD    1 
ATOM   247   O  OE1   . GLU A 1 259 ? 40.643  45.397  83.099  1.00 62.86  ? 527 GLU A OE1   1 
ATOM   248   O  OE2   . GLU A 1 259 ? 41.290  46.089  85.081  1.00 62.86  ? 527 GLU A OE2   1 
ATOM   249   N  N     . ALA A 1 260 ? 38.007  40.075  83.192  1.00 59.58  ? 528 ALA A N     1 
ATOM   250   C  CA    . ALA A 1 260 ? 36.966  39.360  82.479  1.00 59.58  ? 528 ALA A CA    1 
ATOM   251   C  C     . ALA A 1 260 ? 35.921  38.796  83.414  1.00 59.58  ? 528 ALA A C     1 
ATOM   252   O  O     . ALA A 1 260 ? 34.808  38.504  82.972  1.00 59.58  ? 528 ALA A O     1 
ATOM   253   C  CB    . ALA A 1 260 ? 37.561  38.227  81.666  1.00 59.58  ? 528 ALA A CB    1 
ATOM   254   N  N     . ALA A 1 261 ? 36.258  38.612  84.686  1.00 59.21  ? 529 ALA A N     1 
ATOM   255   C  CA    . ALA A 1 261 ? 35.258  38.218  85.665  1.00 59.21  ? 529 ALA A CA    1 
ATOM   256   C  C     . ALA A 1 261 ? 34.420  39.404  86.103  1.00 59.21  ? 529 ALA A C     1 
ATOM   257   O  O     . ALA A 1 261 ? 33.227  39.253  86.382  1.00 59.21  ? 529 ALA A O     1 
ATOM   258   C  CB    . ALA A 1 261 ? 35.933  37.571  86.867  1.00 59.21  ? 529 ALA A CB    1 
ATOM   259   N  N     . LEU A 1 262 ? 35.022  40.590  86.147  1.00 59.66  ? 530 LEU A N     1 
ATOM   260   C  CA    . LEU A 1 262 ? 34.294  41.793  86.506  1.00 59.66  ? 530 LEU A CA    1 
ATOM   261   C  C     . LEU A 1 262 ? 33.392  42.277  85.386  1.00 59.66  ? 530 LEU A C     1 
ATOM   262   O  O     . LEU A 1 262 ? 32.469  43.051  85.644  1.00 59.66  ? 530 LEU A O     1 
ATOM   263   C  CB    . LEU A 1 262 ? 35.279  42.884  86.893  1.00 59.66  ? 530 LEU A CB    1 
ATOM   264   C  CG    . LEU A 1 262 ? 36.116  42.477  88.095  1.00 59.66  ? 530 LEU A CG    1 
ATOM   265   C  CD1   . LEU A 1 262 ? 37.191  43.476  88.331  1.00 59.66  ? 530 LEU A CD1   1 
ATOM   266   C  CD2   . LEU A 1 262 ? 35.261  42.338  89.322  1.00 59.66  ? 530 LEU A CD2   1 
ATOM   267   N  N     . ILE A 1 263 ? 33.642  41.848  84.151  1.00 61.66  ? 531 ILE A N     1 
ATOM   268   C  CA    . ILE A 1 263 ? 32.694  42.094  83.072  1.00 61.66  ? 531 ILE A CA    1 
ATOM   269   C  C     . ILE A 1 263 ? 31.618  41.016  83.060  1.00 61.66  ? 531 ILE A C     1 
ATOM   270   O  O     . ILE A 1 263 ? 30.443  41.295  82.795  1.00 61.66  ? 531 ILE A O     1 
ATOM   271   C  CB    . ILE A 1 263 ? 33.446  42.188  81.733  1.00 61.66  ? 531 ILE A CB    1 
ATOM   272   C  CG1   . ILE A 1 263 ? 34.348  43.412  81.735  1.00 61.66  ? 531 ILE A CG1   1 
ATOM   273   C  CG2   . ILE A 1 263 ? 32.502  42.289  80.560  1.00 61.66  ? 531 ILE A CG2   1 
ATOM   274   C  CD1   . ILE A 1 263 ? 35.295  43.452  80.576  1.00 61.66  ? 531 ILE A CD1   1 
ATOM   275   N  N     . ALA A 1 264 ? 32.000  39.779  83.392  1.00 62.25  ? 532 ALA A N     1 
ATOM   276   C  CA    . ALA A 1 264 ? 31.042  38.684  83.472  1.00 62.25  ? 532 ALA A CA    1 
ATOM   277   C  C     . ALA A 1 264 ? 30.031  38.897  84.581  1.00 62.25  ? 532 ALA A C     1 
ATOM   278   O  O     . ALA A 1 264 ? 28.877  38.477  84.459  1.00 62.25  ? 532 ALA A O     1 
ATOM   279   C  CB    . ALA A 1 264 ? 31.770  37.365  83.705  1.00 62.25  ? 532 ALA A CB    1 
ATOM   280   N  N     . ALA A 1 265 ? 30.435  39.539  85.663  1.00 62.42  ? 533 ALA A N     1 
ATOM   281   C  CA    . ALA A 1 265 ? 29.526  39.766  86.767  1.00 62.42  ? 533 ALA A CA    1 
ATOM   282   C  C     . ALA A 1 265 ? 28.881  41.140  86.735  1.00 62.42  ? 533 ALA A C     1 
ATOM   283   O  O     . ALA A 1 265 ? 27.976  41.397  87.531  1.00 62.42  ? 533 ALA A O     1 
ATOM   284   C  CB    . ALA A 1 265 ? 30.260  39.565  88.087  1.00 62.42  ? 533 ALA A CB    1 
ATOM   285   N  N     . ARG A 1 266 ? 29.333  42.032  85.855  1.00 67.37  ? 534 ARG A N     1 
ATOM   286   C  CA    . ARG A 1 266 ? 28.611  43.278  85.647  1.00 67.37  ? 534 ARG A CA    1 
ATOM   287   C  C     . ARG A 1 266 ? 27.308  43.022  84.909  1.00 67.37  ? 534 ARG A C     1 
ATOM   288   O  O     . ARG A 1 266 ? 26.278  43.623  85.228  1.00 67.37  ? 534 ARG A O     1 
ATOM   289   C  CB    . ARG A 1 266 ? 29.483  44.276  84.887  1.00 67.37  ? 534 ARG A CB    1 
ATOM   290   C  CG    . ARG A 1 266 ? 28.845  45.631  84.730  1.00 67.37  ? 534 ARG A CG    1 
ATOM   291   C  CD    . ARG A 1 266 ? 29.766  46.680  84.132  1.00 67.37  ? 534 ARG A CD    1 
ATOM   292   N  NE    . ARG A 1 266 ? 30.188  46.388  82.768  1.00 67.37  ? 534 ARG A NE    1 
ATOM   293   C  CZ    . ARG A 1 266 ? 31.456  46.274  82.394  1.00 67.37  ? 534 ARG A CZ    1 
ATOM   294   N  NH1   . ARG A 1 266 ? 32.426  46.441  83.281  1.00 67.37  ? 534 ARG A NH1   1 
ATOM   295   N  NH2   . ARG A 1 266 ? 31.755  46.010  81.129  1.00 67.37  ? 534 ARG A NH2   1 
ATOM   296   N  N     . HIS A 1 267 ? 27.323  42.111  83.941  1.00 68.92  ? 535 HIS A N     1 
ATOM   297   C  CA    . HIS A 1 267 ? 26.104  41.739  83.239  1.00 68.92  ? 535 HIS A CA    1 
ATOM   298   C  C     . HIS A 1 267 ? 25.296  40.683  83.973  1.00 68.92  ? 535 HIS A C     1 
ATOM   299   O  O     . HIS A 1 267 ? 24.267  40.254  83.440  1.00 68.92  ? 535 HIS A O     1 
ATOM   300   C  CB    . HIS A 1 267 ? 26.433  41.236  81.834  1.00 68.92  ? 535 HIS A CB    1 
ATOM   301   C  CG    . HIS A 1 267 ? 27.054  42.274  80.956  1.00 68.92  ? 535 HIS A CG    1 
ATOM   302   N  ND1   . HIS A 1 267 ? 28.415  42.465  80.881  1.00 68.92  ? 535 HIS A ND1   1 
ATOM   303   C  CD2   . HIS A 1 267 ? 26.498  43.190  80.130  1.00 68.92  ? 535 HIS A CD2   1 
ATOM   304   C  CE1   . HIS A 1 267 ? 28.674  43.446  80.036  1.00 68.92  ? 535 HIS A CE1   1 
ATOM   305   N  NE2   . HIS A 1 267 ? 27.527  43.904  79.566  1.00 68.92  ? 535 HIS A NE2   1 
ATOM   306   N  N     . LEU A 1 268 ? 25.744  40.268  85.163  1.00 67.89  ? 536 LEU A N     1 
ATOM   307   C  CA    . LEU A 1 268 ? 25.095  39.276  86.023  1.00 67.89  ? 536 LEU A CA    1 
ATOM   308   C  C     . LEU A 1 268 ? 24.913  37.953  85.271  1.00 67.89  ? 536 LEU A C     1 
ATOM   309   O  O     . LEU A 1 268 ? 23.809  37.517  84.944  1.00 67.89  ? 536 LEU A O     1 
ATOM   310   C  CB    . LEU A 1 268 ? 23.773  39.820  86.583  1.00 67.89  ? 536 LEU A CB    1 
ATOM   311   C  CG    . LEU A 1 268 ? 23.038  39.059  87.688  1.00 67.89  ? 536 LEU A CG    1 
ATOM   312   C  CD1   . LEU A 1 268 ? 23.900  38.972  88.923  1.00 67.89  ? 536 LEU A CD1   1 
ATOM   313   C  CD2   . LEU A 1 268 ? 21.718  39.731  88.007  1.00 67.89  ? 536 LEU A CD2   1 
ATOM   314   N  N     . SER A 1 269 ? 26.053  37.357  84.953  1.00 68.49  ? 537 SER A N     1 
ATOM   315   C  CA    . SER A 1 269 ? 26.102  36.092  84.244  1.00 68.49  ? 537 SER A CA    1 
ATOM   316   C  C     . SER A 1 269 ? 26.605  34.998  85.174  1.00 68.49  ? 537 SER A C     1 
ATOM   317   O  O     . SER A 1 269 ? 27.232  35.263  86.202  1.00 68.49  ? 537 SER A O     1 
ATOM   318   C  CB    . SER A 1 269 ? 26.990  36.192  83.006  1.00 68.49  ? 537 SER A CB    1 
ATOM   319   O  OG    . SER A 1 269 ? 28.330  36.449  83.376  1.00 68.49  ? 537 SER A OG    1 
ATOM   320   N  N     . ASP A 1 270 ? 26.317  33.755  84.799  1.00 74.01  ? 538 ASP A N     1 
ATOM   321   C  CA    . ASP A 1 270 ? 26.631  32.615  85.646  1.00 74.01  ? 538 ASP A CA    1 
ATOM   322   C  C     . ASP A 1 270 ? 28.058  32.123  85.480  1.00 74.01  ? 538 ASP A C     1 
ATOM   323   O  O     . ASP A 1 270 ? 28.654  31.644  86.450  1.00 74.01  ? 538 ASP A O     1 
ATOM   324   C  CB    . ASP A 1 270 ? 25.667  31.465  85.353  1.00 74.01  ? 538 ASP A CB    1 
ATOM   325   C  CG    . ASP A 1 270 ? 24.258  31.762  85.807  1.00 74.01  ? 538 ASP A CG    1 
ATOM   326   O  OD1   . ASP A 1 270 ? 24.100  32.515  86.789  1.00 74.01  ? 538 ASP A OD1   1 
ATOM   327   O  OD2   . ASP A 1 270 ? 23.308  31.245  85.184  1.00 74.01  ? 538 ASP A OD2   1 
ATOM   328   N  N     . SER A 1 271 ? 28.619  32.218  84.278  1.00 71.15  ? 539 SER A N     1 
ATOM   329   C  CA    . SER A 1 271 ? 29.960  31.722  84.029  1.00 71.15  ? 539 SER A CA    1 
ATOM   330   C  C     . SER A 1 271 ? 30.610  32.576  82.954  1.00 71.15  ? 539 SER A C     1 
ATOM   331   O  O     . SER A 1 271 ? 29.931  33.127  82.086  1.00 71.15  ? 539 SER A O     1 
ATOM   332   C  CB    . SER A 1 271 ? 29.940  30.253  83.613  1.00 71.15  ? 539 SER A CB    1 
ATOM   333   O  OG    . SER A 1 271 ? 29.459  29.428  84.659  1.00 71.15  ? 539 SER A OG    1 
ATOM   334   N  N     . ILE A 1 272 ? 31.934  32.664  83.014  1.00 64.54  ? 540 ILE A N     1 
ATOM   335   C  CA    . ILE A 1 272 ? 32.689  33.589  82.178  1.00 64.54  ? 540 ILE A CA    1 
ATOM   336   C  C     . ILE A 1 272 ? 32.815  33.008  80.774  1.00 64.54  ? 540 ILE A C     1 
ATOM   337   O  O     . ILE A 1 272 ? 33.453  31.969  80.577  1.00 64.54  ? 540 ILE A O     1 
ATOM   338   C  CB    . ILE A 1 272 ? 34.067  33.869  82.784  1.00 64.54  ? 540 ILE A CB    1 
ATOM   339   C  CG1   . ILE A 1 272 ? 33.920  34.398  84.204  1.00 64.54  ? 540 ILE A CG1   1 
ATOM   340   C  CG2   . ILE A 1 272 ? 34.786  34.897  81.975  1.00 64.54  ? 540 ILE A CG2   1 
ATOM   341   C  CD1   . ILE A 1 272 ? 35.206  34.436  84.958  1.00 64.54  ? 540 ILE A CD1   1 
ATOM   342   N  N     . ASN A 1 273 ? 32.215  33.680  79.795  1.00 66.55  ? 541 ASN A N     1 
ATOM   343   C  CA    . ASN A 1 273 ? 32.278  33.246  78.409  1.00 66.55  ? 541 ASN A CA    1 
ATOM   344   C  C     . ASN A 1 273 ? 33.629  33.604  77.803  1.00 66.55  ? 541 ASN A C     1 
ATOM   345   O  O     . ASN A 1 273 ? 34.472  34.243  78.433  1.00 66.55  ? 541 ASN A O     1 
ATOM   346   C  CB    . ASN A 1 273 ? 31.159  33.890  77.598  1.00 66.55  ? 541 ASN A CB    1 
ATOM   347   C  CG    . ASN A 1 273 ? 29.791  33.429  78.027  1.00 66.55  ? 541 ASN A CG    1 
ATOM   348   O  OD1   . ASN A 1 273 ? 29.575  32.250  78.290  1.00 66.55  ? 541 ASN A OD1   1 
ATOM   349   N  ND2   . ASN A 1 273 ? 28.852  34.362  78.101  1.00 66.55  ? 541 ASN A ND2   1 
ATOM   350   N  N     . GLN A 1 274 ? 33.839  33.200  76.548  1.00 65.70  ? 542 GLN A N     1 
ATOM   351   C  CA    . GLN A 1 274 ? 35.024  33.663  75.836  1.00 65.70  ? 542 GLN A CA    1 
ATOM   352   C  C     . GLN A 1 274 ? 34.883  35.123  75.437  1.00 65.70  ? 542 GLN A C     1 
ATOM   353   O  O     . GLN A 1 274 ? 35.878  35.856  75.403  1.00 65.70  ? 542 GLN A O     1 
ATOM   354   C  CB    . GLN A 1 274 ? 35.287  32.791  74.610  1.00 65.70  ? 542 GLN A CB    1 
ATOM   355   C  CG    . GLN A 1 274 ? 36.589  33.103  73.889  1.00 65.70  ? 542 GLN A CG    1 
ATOM   356   C  CD    . GLN A 1 274 ? 36.866  32.156  72.751  1.00 65.70  ? 542 GLN A CD    1 
ATOM   357   O  OE1   . GLN A 1 274 ? 36.079  31.252  72.475  1.00 65.70  ? 542 GLN A OE1   1 
ATOM   358   N  NE2   . GLN A 1 274 ? 37.989  32.357  72.075  1.00 65.70  ? 542 GLN A NE2   1 
ATOM   359   N  N     . LYS A 1 275 ? 33.654  35.582  75.187  1.00 64.02  ? 543 LYS A N     1 
ATOM   360   C  CA    . LYS A 1 275 ? 33.400  36.969  74.815  1.00 64.02  ? 543 LYS A CA    1 
ATOM   361   C  C     . LYS A 1 275 ? 33.674  37.955  75.940  1.00 64.02  ? 543 LYS A C     1 
ATOM   362   O  O     . LYS A 1 275 ? 33.696  39.161  75.685  1.00 64.02  ? 543 LYS A O     1 
ATOM   363   C  CB    . LYS A 1 275 ? 31.954  37.134  74.352  1.00 64.02  ? 543 LYS A CB    1 
ATOM   364   C  CG    . LYS A 1 275 ? 31.605  36.327  73.122  1.00 64.02  ? 543 LYS A CG    1 
ATOM   365   C  CD    . LYS A 1 275 ? 32.361  36.834  71.909  1.00 64.02  ? 543 LYS A CD    1 
ATOM   366   C  CE    . LYS A 1 275 ? 31.980  36.065  70.659  1.00 64.02  ? 543 LYS A CE    1 
ATOM   367   N  NZ    . LYS A 1 275 ? 32.762  36.515  69.475  1.00 64.02  ? 543 LYS A NZ    1 
ATOM   368   N  N     . HIS A 1 276 ? 33.874  37.487  77.165  1.00 63.43  ? 544 HIS A N     1 
ATOM   369   C  CA    . HIS A 1 276 ? 34.185  38.365  78.275  1.00 63.43  ? 544 HIS A CA    1 
ATOM   370   C  C     . HIS A 1 276 ? 35.678  38.571  78.459  1.00 63.43  ? 544 HIS A C     1 
ATOM   371   O  O     . HIS A 1 276 ? 36.080  39.580  79.046  1.00 63.43  ? 544 HIS A O     1 
ATOM   372   C  CB    . HIS A 1 276 ? 33.573  37.803  79.555  1.00 63.43  ? 544 HIS A CB    1 
ATOM   373   C  CG    . HIS A 1 276 ? 32.079  37.762  79.529  1.00 63.43  ? 544 HIS A CG    1 
ATOM   374   N  ND1   . HIS A 1 276 ? 31.338  37.024  80.422  1.00 63.43  ? 544 HIS A ND1   1 
ATOM   375   C  CD2   . HIS A 1 276 ? 31.187  38.372  78.714  1.00 63.43  ? 544 HIS A CD2   1 
ATOM   376   C  CE1   . HIS A 1 276 ? 30.053  37.175  80.158  1.00 63.43  ? 544 HIS A CE1   1 
ATOM   377   N  NE2   . HIS A 1 276 ? 29.934  37.990  79.126  1.00 63.43  ? 544 HIS A NE2   1 
ATOM   378   N  N     . PHE A 1 277 ? 36.504  37.647  77.971  1.00 61.42  ? 545 PHE A N     1 
ATOM   379   C  CA    . PHE A 1 277 ? 37.950  37.842  78.006  1.00 61.42  ? 545 PHE A CA    1 
ATOM   380   C  C     . PHE A 1 277 ? 38.397  38.843  76.958  1.00 61.42  ? 545 PHE A C     1 
ATOM   381   O  O     . PHE A 1 277 ? 39.292  39.655  77.214  1.00 61.42  ? 545 PHE A O     1 
ATOM   382   C  CB    . PHE A 1 277 ? 38.672  36.518  77.793  1.00 61.42  ? 545 PHE A CB    1 
ATOM   383   C  CG    . PHE A 1 277 ? 38.559  35.572  78.940  1.00 61.42  ? 545 PHE A CG    1 
ATOM   384   C  CD1   . PHE A 1 277 ? 39.402  35.685  80.029  1.00 61.42  ? 545 PHE A CD1   1 
ATOM   385   C  CD2   . PHE A 1 277 ? 37.614  34.574  78.929  1.00 61.42  ? 545 PHE A CD2   1 
ATOM   386   C  CE1   . PHE A 1 277 ? 39.297  34.823  81.090  1.00 61.42  ? 545 PHE A CE1   1 
ATOM   387   C  CE2   . PHE A 1 277 ? 37.510  33.702  79.981  1.00 61.42  ? 545 PHE A CE2   1 
ATOM   388   C  CZ    . PHE A 1 277 ? 38.353  33.829  81.066  1.00 61.42  ? 545 PHE A CZ    1 
ATOM   389   N  N     . GLU A 1 278 ? 37.793  38.784  75.772  1.00 63.18  ? 546 GLU A N     1 
ATOM   390   C  CA    . GLU A 1 278 ? 38.146  39.704  74.704  1.00 63.18  ? 546 GLU A CA    1 
ATOM   391   C  C     . GLU A 1 278 ? 37.750  41.131  75.045  1.00 63.18  ? 546 GLU A C     1 
ATOM   392   O  O     . GLU A 1 278 ? 38.423  42.077  74.622  1.00 63.18  ? 546 GLU A O     1 
ATOM   393   C  CB    . GLU A 1 278 ? 37.479  39.258  73.410  1.00 63.18  ? 546 GLU A CB    1 
ATOM   394   C  CG    . GLU A 1 278 ? 37.981  37.926  72.905  1.00 63.18  ? 546 GLU A CG    1 
ATOM   395   C  CD    . GLU A 1 278 ? 37.213  37.445  71.692  1.00 63.18  ? 546 GLU A CD    1 
ATOM   396   O  OE1   . GLU A 1 278 ? 36.200  38.084  71.342  1.00 63.18  ? 546 GLU A OE1   1 
ATOM   397   O  OE2   . GLU A 1 278 ? 37.620  36.431  71.088  1.00 63.18  ? 546 GLU A OE2   1 
ATOM   398   N  N     . GLN A 1 279 ? 36.690  41.309  75.826  1.00 60.97  ? 547 GLN A N     1 
ATOM   399   C  CA    . GLN A 1 279 ? 36.349  42.624  76.339  1.00 60.97  ? 547 GLN A CA    1 
ATOM   400   C  C     . GLN A 1 279 ? 37.240  43.043  77.495  1.00 60.97  ? 547 GLN A C     1 
ATOM   401   O  O     . GLN A 1 279 ? 37.224  44.217  77.871  1.00 60.97  ? 547 GLN A O     1 
ATOM   402   C  CB    . GLN A 1 279 ? 34.890  42.652  76.777  1.00 60.97  ? 547 GLN A CB    1 
ATOM   403   C  CG    . GLN A 1 279 ? 33.934  42.457  75.631  1.00 60.97  ? 547 GLN A CG    1 
ATOM   404   C  CD    . GLN A 1 279 ? 32.495  42.445  76.078  1.00 60.97  ? 547 GLN A CD    1 
ATOM   405   O  OE1   . GLN A 1 279 ? 32.206  42.547  77.265  1.00 60.97  ? 547 GLN A OE1   1 
ATOM   406   N  NE2   . GLN A 1 279 ? 31.583  42.308  75.128  1.00 60.97  ? 547 GLN A NE2   1 
ATOM   407   N  N     . ALA A 1 280 ? 38.005  42.123  78.068  1.00 59.25  ? 548 ALA A N     1 
ATOM   408   C  CA    . ALA A 1 280 ? 39.009  42.492  79.051  1.00 59.25  ? 548 ALA A CA    1 
ATOM   409   C  C     . ALA A 1 280 ? 40.346  42.811  78.413  1.00 59.25  ? 548 ALA A C     1 
ATOM   410   O  O     . ALA A 1 280 ? 41.139  43.547  79.006  1.00 59.25  ? 548 ALA A O     1 
ATOM   411   C  CB    . ALA A 1 280 ? 39.185  41.376  80.080  1.00 59.25  ? 548 ALA A CB    1 
ATOM   412   N  N     . ILE A 1 281 ? 40.618  42.265  77.228  1.00 58.73  ? 549 ILE A N     1 
ATOM   413   C  CA    . ILE A 1 281 ? 41.830  42.623  76.500  1.00 58.73  ? 549 ILE A CA    1 
ATOM   414   C  C     . ILE A 1 281 ? 41.706  44.024  75.925  1.00 58.73  ? 549 ILE A C     1 
ATOM   415   O  O     . ILE A 1 281 ? 42.575  44.879  76.129  1.00 58.73  ? 549 ILE A O     1 
ATOM   416   C  CB    . ILE A 1 281 ? 42.115  41.586  75.403  1.00 58.73  ? 549 ILE A CB    1 
ATOM   417   C  CG1   . ILE A 1 281 ? 42.559  40.273  76.030  1.00 58.73  ? 549 ILE A CG1   1 
ATOM   418   C  CG2   . ILE A 1 281 ? 43.147  42.090  74.429  1.00 58.73  ? 549 ILE A CG2   1 
ATOM   419   C  CD1   . ILE A 1 281 ? 42.567  39.123  75.080  1.00 58.73  ? 549 ILE A CD1   1 
ATOM   420   N  N     . GLU A 1 282 ? 40.608  44.283  75.218  1.00 60.72  ? 550 GLU A N     1 
ATOM   421   C  CA    . GLU A 1 282 ? 40.416  45.537  74.507  1.00 60.72  ? 550 GLU A CA    1 
ATOM   422   C  C     . GLU A 1 282 ? 40.216  46.720  75.439  1.00 60.72  ? 550 GLU A C     1 
ATOM   423   O  O     . GLU A 1 282 ? 40.429  47.861  75.023  1.00 60.72  ? 550 GLU A O     1 
ATOM   424   C  CB    . GLU A 1 282 ? 39.228  45.388  73.572  1.00 60.72  ? 550 GLU A CB    1 
ATOM   425   C  CG    . GLU A 1 282 ? 39.463  44.355  72.499  1.00 60.72  ? 550 GLU A CG    1 
ATOM   426   C  CD    . GLU A 1 282 ? 38.233  44.075  71.673  1.00 60.72  ? 550 GLU A CD    1 
ATOM   427   O  OE1   . GLU A 1 282 ? 37.164  44.641  71.985  1.00 60.72  ? 550 GLU A OE1   1 
ATOM   428   O  OE2   . GLU A 1 282 ? 38.333  43.263  70.729  1.00 60.72  ? 550 GLU A OE2   1 
ATOM   429   N  N     . ARG A 1 283 ? 39.815  46.477  76.683  1.00 60.07  ? 551 ARG A N     1 
ATOM   430   C  CA    . ARG A 1 283 ? 39.777  47.546  77.670  1.00 60.07  ? 551 ARG A CA    1 
ATOM   431   C  C     . ARG A 1 283 ? 41.181  47.972  78.078  1.00 60.07  ? 551 ARG A C     1 
ATOM   432   O  O     . ARG A 1 283 ? 41.439  49.164  78.278  1.00 60.07  ? 551 ARG A O     1 
ATOM   433   C  CB    . ARG A 1 283 ? 38.959  47.092  78.877  1.00 60.07  ? 551 ARG A CB    1 
ATOM   434   C  CG    . ARG A 1 283 ? 39.007  48.008  80.074  1.00 60.07  ? 551 ARG A CG    1 
ATOM   435   C  CD    . ARG A 1 283 ? 38.441  49.373  79.774  1.00 60.07  ? 551 ARG A CD    1 
ATOM   436   N  NE    . ARG A 1 283 ? 38.537  50.238  80.942  1.00 60.07  ? 551 ARG A NE    1 
ATOM   437   C  CZ    . ARG A 1 283 ? 39.619  50.935  81.267  1.00 60.07  ? 551 ARG A CZ    1 
ATOM   438   N  NH1   . ARG A 1 283 ? 40.705  50.870  80.514  1.00 60.07  ? 551 ARG A NH1   1 
ATOM   439   N  NH2   . ARG A 1 283 ? 39.616  51.697  82.347  1.00 60.07  ? 551 ARG A NH2   1 
ATOM   440   N  N     . VAL A 1 284 ? 42.112  47.024  78.176  1.00 56.31  ? 552 VAL A N     1 
ATOM   441   C  CA    . VAL A 1 284 ? 43.457  47.367  78.624  1.00 56.31  ? 552 VAL A CA    1 
ATOM   442   C  C     . VAL A 1 284 ? 44.278  47.950  77.479  1.00 56.31  ? 552 VAL A C     1 
ATOM   443   O  O     . VAL A 1 284 ? 45.007  48.931  77.662  1.00 56.31  ? 552 VAL A O     1 
ATOM   444   C  CB    . VAL A 1 284 ? 44.129  46.133  79.249  1.00 56.31  ? 552 VAL A CB    1 
ATOM   445   C  CG1   . VAL A 1 284 ? 45.543  46.448  79.700  1.00 56.31  ? 552 VAL A CG1   1 
ATOM   446   C  CG2   . VAL A 1 284 ? 43.307  45.635  80.416  1.00 56.31  ? 552 VAL A CG2   1 
ATOM   447   N  N     . ILE A 1 285 ? 44.452  47.137  76.440  1.00 57.89  ? 553 ILE A N     1 
ATOM   448   C  CA    . ILE A 1 285 ? 45.150  47.566  75.231  1.00 57.89  ? 553 ILE A CA    1 
ATOM   449   C  C     . ILE A 1 285 ? 44.301  48.509  74.385  1.00 57.89  ? 553 ILE A C     1 
ATOM   450   O  O     . ILE A 1 285 ? 44.758  49.547  73.907  1.00 57.89  ? 553 ILE A O     1 
ATOM   451   C  CB    . ILE A 1 285 ? 45.570  46.364  74.366  1.00 57.89  ? 553 ILE A CB    1 
ATOM   452   C  CG1   . ILE A 1 285 ? 46.477  45.424  75.162  1.00 57.89  ? 553 ILE A CG1   1 
ATOM   453   C  CG2   . ILE A 1 285 ? 46.265  46.837  73.099  1.00 57.89  ? 553 ILE A CG2   1 
ATOM   454   C  CD1   . ILE A 1 285 ? 46.931  44.209  74.383  1.00 57.89  ? 553 ILE A CD1   1 
ATOM   455   N  N     . GLY A 1 286 ? 43.045  48.103  74.220  1.00 129.41 ? 554 GLY A N     1 
ATOM   456   C  CA    . GLY A 1 286 ? 42.048  48.805  73.433  1.00 129.41 ? 554 GLY A CA    1 
ATOM   457   C  C     . GLY A 1 286 ? 41.565  50.160  73.897  1.00 129.41 ? 554 GLY A C     1 
ATOM   458   O  O     . GLY A 1 286 ? 41.345  51.064  73.090  1.00 129.41 ? 554 GLY A O     1 
ATOM   459   N  N     . GLY A 1 287 ? 41.398  50.301  75.205  1.00 127.81 ? 555 GLY A N     1 
ATOM   460   C  CA    . GLY A 1 287 ? 40.867  51.526  75.768  1.00 127.81 ? 555 GLY A CA    1 
ATOM   461   C  C     . GLY A 1 287 ? 39.353  51.409  75.842  1.00 127.81 ? 555 GLY A C     1 
ATOM   462   O  O     . GLY A 1 287 ? 38.784  50.361  75.528  1.00 127.81 ? 555 GLY A O     1 
ATOM   463   N  N     . LEU A 1 288 ? 38.690  52.480  76.259  1.00 121.49 ? 556 LEU A N     1 
ATOM   464   C  CA    . LEU A 1 288 ? 37.238  52.459  76.399  1.00 121.49 ? 556 LEU A CA    1 
ATOM   465   C  C     . LEU A 1 288 ? 36.444  52.277  75.100  1.00 121.49 ? 556 LEU A C     1 
ATOM   466   O  O     . LEU A 1 288 ? 36.773  52.847  74.061  1.00 121.49 ? 556 LEU A O     1 
ATOM   467   C  CB    . LEU A 1 288 ? 36.759  53.722  77.121  1.00 121.49 ? 556 LEU A CB    1 
ATOM   468   C  CG    . LEU A 1 288 ? 37.278  53.928  78.546  1.00 121.49 ? 556 LEU A CG    1 
ATOM   469   C  CD1   . LEU A 1 288 ? 36.811  55.264  79.102  1.00 121.49 ? 556 LEU A CD1   1 
ATOM   470   C  CD2   . LEU A 1 288 ? 36.841  52.784  79.448  1.00 121.49 ? 556 LEU A CD2   1 
ATOM   471   N  N     . GLU A 1 289 ? 35.392  51.468  75.194  1.00 125.31 ? 557 GLU A N     1 
ATOM   472   C  CA    . GLU A 1 289 ? 34.463  51.202  74.097  1.00 125.31 ? 557 GLU A CA    1 
ATOM   473   C  C     . GLU A 1 289 ? 33.171  51.964  74.350  1.00 125.31 ? 557 GLU A C     1 
ATOM   474   O  O     . GLU A 1 289 ? 32.316  51.530  75.124  1.00 125.31 ? 557 GLU A O     1 
ATOM   475   C  CB    . GLU A 1 289 ? 34.204  49.705  73.973  1.00 125.31 ? 557 GLU A CB    1 
ATOM   476   C  CG    . GLU A 1 289 ? 33.284  49.324  72.824  1.00 125.31 ? 557 GLU A CG    1 
ATOM   477   C  CD    . GLU A 1 289 ? 33.078  47.826  72.714  1.00 125.31 ? 557 GLU A CD    1 
ATOM   478   O  OE1   . GLU A 1 289 ? 33.641  47.083  73.545  1.00 125.31 ? 557 GLU A OE1   1 
ATOM   479   O  OE2   . GLU A 1 289 ? 32.350  47.391  71.798  1.00 125.31 ? 557 GLU A OE2   1 
ATOM   480   N  N     . LYS A 1 290 ? 33.030  53.115  73.698  1.00 122.81 ? 558 LYS A N     1 
ATOM   481   C  CA    . LYS A 1 290 ? 31.897  53.998  73.913  1.00 122.81 ? 558 LYS A CA    1 
ATOM   482   C  C     . LYS A 1 290 ? 31.182  54.279  72.598  1.00 122.81 ? 558 LYS A C     1 
ATOM   483   O  O     . LYS A 1 290 ? 31.795  54.313  71.527  1.00 122.81 ? 558 LYS A O     1 
ATOM   484   C  CB    . LYS A 1 290 ? 32.338  55.309  74.578  1.00 122.81 ? 558 LYS A CB    1 
ATOM   485   C  CG    . LYS A 1 290 ? 33.276  56.178  73.770  1.00 122.81 ? 558 LYS A CG    1 
ATOM   486   C  CD    . LYS A 1 290 ? 33.644  57.428  74.551  1.00 122.81 ? 558 LYS A CD    1 
ATOM   487   C  CE    . LYS A 1 290 ? 34.609  57.121  75.677  1.00 122.81 ? 558 LYS A CE    1 
ATOM   488   N  NZ    . LYS A 1 290 ? 35.932  56.677  75.158  1.00 122.81 ? 558 LYS A NZ    1 
ATOM   489   N  N     . LYS A 1 291 ? 29.864  54.455  72.695  1.00 124.05 ? 559 LYS A N     1 
ATOM   490   C  CA    . LYS A 1 291 ? 29.010  54.701  71.544  1.00 124.05 ? 559 LYS A CA    1 
ATOM   491   C  C     . LYS A 1 291 ? 28.514  56.138  71.477  1.00 124.05 ? 559 LYS A C     1 
ATOM   492   O  O     . LYS A 1 291 ? 28.160  56.603  70.388  1.00 124.05 ? 559 LYS A O     1 
ATOM   493   C  CB    . LYS A 1 291 ? 27.817  53.724  71.569  1.00 124.05 ? 559 LYS A CB    1 
ATOM   494   C  CG    . LYS A 1 291 ? 26.953  53.626  70.302  1.00 124.05 ? 559 LYS A CG    1 
ATOM   495   C  CD    . LYS A 1 291 ? 25.674  54.460  70.406  1.00 124.05 ? 559 LYS A CD    1 
ATOM   496   C  CE    . LYS A 1 291 ? 24.755  54.243  69.215  1.00 124.05 ? 559 LYS A CE    1 
ATOM   497   N  NZ    . LYS A 1 291 ? 25.356  54.738  67.945  1.00 124.05 ? 559 LYS A NZ    1 
ATOM   498   N  N     . THR A 1 292 ? 28.531  56.864  72.600  1.00 121.76 ? 560 THR A N     1 
ATOM   499   C  CA    . THR A 1 292 ? 27.979  58.215  72.648  1.00 121.76 ? 560 THR A CA    1 
ATOM   500   C  C     . THR A 1 292 ? 28.791  59.222  71.842  1.00 121.76 ? 560 THR A C     1 
ATOM   501   O  O     . THR A 1 292 ? 28.277  60.305  71.548  1.00 121.76 ? 560 THR A O     1 
ATOM   502   C  CB    . THR A 1 292 ? 27.868  58.691  74.096  1.00 121.76 ? 560 THR A CB    1 
ATOM   503   O  OG1   . THR A 1 292 ? 29.168  58.716  74.697  1.00 121.76 ? 560 THR A OG1   1 
ATOM   504   C  CG2   . THR A 1 292 ? 26.968  57.764  74.888  1.00 121.76 ? 560 THR A CG2   1 
ATOM   505   N  N     . GLN A 1 293 ? 30.036  58.902  71.489  1.00 119.26 ? 561 GLN A N     1 
ATOM   506   C  CA    . GLN A 1 293 ? 30.779  59.719  70.539  1.00 119.26 ? 561 GLN A CA    1 
ATOM   507   C  C     . GLN A 1 293 ? 30.131  59.625  69.168  1.00 119.26 ? 561 GLN A C     1 
ATOM   508   O  O     . GLN A 1 293 ? 30.073  58.544  68.572  1.00 119.26 ? 561 GLN A O     1 
ATOM   509   C  CB    . GLN A 1 293 ? 32.236  59.276  70.464  1.00 119.26 ? 561 GLN A CB    1 
ATOM   510   C  CG    . GLN A 1 293 ? 33.039  59.620  71.686  1.00 119.26 ? 561 GLN A CG    1 
ATOM   511   C  CD    . GLN A 1 293 ? 33.099  61.109  71.927  1.00 119.26 ? 561 GLN A CD    1 
ATOM   512   O  OE1   . GLN A 1 293 ? 32.497  61.621  72.870  1.00 119.26 ? 561 GLN A OE1   1 
ATOM   513   N  NE2   . GLN A 1 293 ? 33.822  61.818  71.070  1.00 119.26 ? 561 GLN A NE2   1 
ATOM   514   N  N     . VAL A 1 294 ? 29.633  60.756  68.672  1.00 117.79 ? 562 VAL A N     1 
ATOM   515   C  CA    . VAL A 1 294 ? 29.060  60.784  67.337  1.00 117.79 ? 562 VAL A CA    1 
ATOM   516   C  C     . VAL A 1 294 ? 30.182  60.696  66.308  1.00 117.79 ? 562 VAL A C     1 
ATOM   517   O  O     . VAL A 1 294 ? 31.263  61.279  66.476  1.00 117.79 ? 562 VAL A O     1 
ATOM   518   C  CB    . VAL A 1 294 ? 28.173  62.034  67.161  1.00 117.79 ? 562 VAL A CB    1 
ATOM   519   C  CG1   . VAL A 1 294 ? 28.954  63.328  67.368  1.00 117.79 ? 562 VAL A CG1   1 
ATOM   520   C  CG2   . VAL A 1 294 ? 27.471  62.035  65.805  1.00 117.79 ? 562 VAL A CG2   1 
ATOM   521   N  N     . LEU A 1 295 ? 29.965  59.883  65.281  1.00 110.93 ? 563 LEU A N     1 
ATOM   522   C  CA    . LEU A 1 295 ? 30.860  59.803  64.140  1.00 110.93 ? 563 LEU A CA    1 
ATOM   523   C  C     . LEU A 1 295 ? 30.025  59.995  62.890  1.00 110.93 ? 563 LEU A C     1 
ATOM   524   O  O     . LEU A 1 295 ? 28.970  59.369  62.747  1.00 110.93 ? 563 LEU A O     1 
ATOM   525   C  CB    . LEU A 1 295 ? 31.596  58.466  64.090  1.00 110.93 ? 563 LEU A CB    1 
ATOM   526   C  CG    . LEU A 1 295 ? 32.575  58.195  65.227  1.00 110.93 ? 563 LEU A CG    1 
ATOM   527   C  CD1   . LEU A 1 295 ? 33.129  56.793  65.092  1.00 110.93 ? 563 LEU A CD1   1 
ATOM   528   C  CD2   . LEU A 1 295 ? 33.691  59.220  65.223  1.00 110.93 ? 563 LEU A CD2   1 
ATOM   529   N  N     . GLN A 1 296 ? 30.476  60.876  62.015  1.00 106.15 ? 564 GLN A N     1 
ATOM   530   C  CA    . GLN A 1 296 ? 29.754  61.123  60.781  1.00 106.15 ? 564 GLN A CA    1 
ATOM   531   C  C     . GLN A 1 296 ? 29.853  59.896  59.885  1.00 106.15 ? 564 GLN A C     1 
ATOM   532   O  O     . GLN A 1 296 ? 30.954  59.372  59.683  1.00 106.15 ? 564 GLN A O     1 
ATOM   533   C  CB    . GLN A 1 296 ? 30.314  62.348  60.068  1.00 106.15 ? 564 GLN A CB    1 
ATOM   534   C  CG    . GLN A 1 296 ? 30.081  63.656  60.798  1.00 106.15 ? 564 GLN A CG    1 
ATOM   535   C  CD    . GLN A 1 296 ? 30.688  64.839  60.068  1.00 106.15 ? 564 GLN A CD    1 
ATOM   536   O  OE1   . GLN A 1 296 ? 31.360  64.676  59.049  1.00 106.15 ? 564 GLN A OE1   1 
ATOM   537   N  NE2   . GLN A 1 296 ? 30.450  66.039  60.584  1.00 106.15 ? 564 GLN A NE2   1 
ATOM   538   N  N     . PRO A 1 297 ? 28.736  59.404  59.342  1.00 103.19 ? 565 PRO A N     1 
ATOM   539   C  CA    . PRO A 1 297 ? 28.793  58.215  58.478  1.00 103.19 ? 565 PRO A CA    1 
ATOM   540   C  C     . PRO A 1 297 ? 29.491  58.451  57.151  1.00 103.19 ? 565 PRO A C     1 
ATOM   541   O  O     . PRO A 1 297 ? 29.795  57.474  56.457  1.00 103.19 ? 565 PRO A O     1 
ATOM   542   C  CB    . PRO A 1 297 ? 27.317  57.862  58.271  1.00 103.19 ? 565 PRO A CB    1 
ATOM   543   C  CG    . PRO A 1 297 ? 26.597  59.147  58.460  1.00 103.19 ? 565 PRO A CG    1 
ATOM   544   C  CD    . PRO A 1 297 ? 27.360  59.896  59.514  1.00 103.19 ? 565 PRO A CD    1 
ATOM   545   N  N     . GLU A 1 298 ? 29.743  59.702  56.770  1.00 99.07  ? 566 GLU A N     1 
ATOM   546   C  CA    . GLU A 1 298 ? 30.637  59.957  55.652  1.00 99.07  ? 566 GLU A CA    1 
ATOM   547   C  C     . GLU A 1 298 ? 32.082  59.659  56.031  1.00 99.07  ? 566 GLU A C     1 
ATOM   548   O  O     . GLU A 1 298 ? 32.870  59.234  55.180  1.00 99.07  ? 566 GLU A O     1 
ATOM   549   C  CB    . GLU A 1 298 ? 30.476  61.404  55.183  1.00 99.07  ? 566 GLU A CB    1 
ATOM   550   C  CG    . GLU A 1 298 ? 31.289  61.792  53.955  1.00 99.07  ? 566 GLU A CG    1 
ATOM   551   C  CD    . GLU A 1 298 ? 30.832  61.090  52.689  1.00 99.07  ? 566 GLU A CD    1 
ATOM   552   O  OE1   . GLU A 1 298 ? 29.637  60.738  52.592  1.00 99.07  ? 566 GLU A OE1   1 
ATOM   553   O  OE2   . GLU A 1 298 ? 31.672  60.889  51.787  1.00 99.07  ? 566 GLU A OE2   1 
ATOM   554   N  N     . GLU A 1 299 ? 32.440  59.840  57.304  1.00 97.52  ? 567 GLU A N     1 
ATOM   555   C  CA    . GLU A 1 299 ? 33.804  59.591  57.749  1.00 97.52  ? 567 GLU A CA    1 
ATOM   556   C  C     . GLU A 1 299 ? 33.992  58.257  58.453  1.00 97.52  ? 567 GLU A C     1 
ATOM   557   O  O     . GLU A 1 299 ? 35.120  57.759  58.493  1.00 97.52  ? 567 GLU A O     1 
ATOM   558   C  CB    . GLU A 1 299 ? 34.285  60.703  58.681  1.00 97.52  ? 567 GLU A CB    1 
ATOM   559   C  CG    . GLU A 1 299 ? 34.557  62.003  57.967  1.00 97.52  ? 567 GLU A CG    1 
ATOM   560   C  CD    . GLU A 1 299 ? 35.111  63.060  58.889  1.00 97.52  ? 567 GLU A CD    1 
ATOM   561   O  OE1   . GLU A 1 299 ? 35.134  62.830  60.116  1.00 97.52  ? 567 GLU A OE1   1 
ATOM   562   O  OE2   . GLU A 1 299 ? 35.545  64.112  58.382  1.00 97.52  ? 567 GLU A OE2   1 
ATOM   563   N  N     . LYS A 1 300 ? 32.938  57.671  59.015  1.00 93.49  ? 568 LYS A N     1 
ATOM   564   C  CA    . LYS A 1 300 ? 33.073  56.325  59.562  1.00 93.49  ? 568 LYS A CA    1 
ATOM   565   C  C     . LYS A 1 300 ? 33.155  55.295  58.444  1.00 93.49  ? 568 LYS A C     1 
ATOM   566   O  O     . LYS A 1 300 ? 33.746  54.226  58.622  1.00 93.49  ? 568 LYS A O     1 
ATOM   567   C  CB    . LYS A 1 300 ? 31.905  56.026  60.498  1.00 93.49  ? 568 LYS A CB    1 
ATOM   568   C  CG    . LYS A 1 300 ? 32.037  54.754  61.305  1.00 93.49  ? 568 LYS A CG    1 
ATOM   569   C  CD    . LYS A 1 300 ? 30.848  54.573  62.223  1.00 93.49  ? 568 LYS A CD    1 
ATOM   570   C  CE    . LYS A 1 300 ? 30.957  53.287  63.018  1.00 93.49  ? 568 LYS A CE    1 
ATOM   571   N  NZ    . LYS A 1 300 ? 29.788  53.100  63.917  1.00 93.49  ? 568 LYS A NZ    1 
ATOM   572   N  N     . LYS A 1 301 ? 32.572  55.606  57.287  1.00 88.38  ? 569 LYS A N     1 
ATOM   573   C  CA    . LYS A 1 301 ? 32.751  54.776  56.105  1.00 88.38  ? 569 LYS A CA    1 
ATOM   574   C  C     . LYS A 1 301 ? 34.187  54.819  55.601  1.00 88.38  ? 569 LYS A C     1 
ATOM   575   O  O     . LYS A 1 301 ? 34.700  53.805  55.112  1.00 88.38  ? 569 LYS A O     1 
ATOM   576   C  CB    . LYS A 1 301 ? 31.790  55.232  55.012  1.00 88.38  ? 569 LYS A CB    1 
ATOM   577   C  CG    . LYS A 1 301 ? 31.788  54.375  53.769  1.00 88.38  ? 569 LYS A CG    1 
ATOM   578   C  CD    . LYS A 1 301 ? 30.879  54.959  52.710  1.00 88.38  ? 569 LYS A CD    1 
ATOM   579   C  CE    . LYS A 1 301 ? 29.422  54.745  53.064  1.00 88.38  ? 569 LYS A CE    1 
ATOM   580   N  NZ    . LYS A 1 301 ? 28.519  55.195  51.971  1.00 88.38  ? 569 LYS A NZ    1 
ATOM   581   N  N     . THR A 1 302 ? 34.856  55.967  55.729  1.00 85.22  ? 570 THR A N     1 
ATOM   582   C  CA    . THR A 1 302 ? 36.221  56.095  55.231  1.00 85.22  ? 570 THR A CA    1 
ATOM   583   C  C     . THR A 1 302 ? 37.204  55.321  56.102  1.00 85.22  ? 570 THR A C     1 
ATOM   584   O  O     . THR A 1 302 ? 38.121  54.673  55.586  1.00 85.22  ? 570 THR A O     1 
ATOM   585   C  CB    . THR A 1 302 ? 36.599  57.572  55.146  1.00 85.22  ? 570 THR A CB    1 
ATOM   586   O  OG1   . THR A 1 302 ? 35.672  58.240  54.284  1.00 85.22  ? 570 THR A OG1   1 
ATOM   587   C  CG2   . THR A 1 302 ? 37.993  57.753  54.580  1.00 85.22  ? 570 THR A CG2   1 
ATOM   588   N  N     . VAL A 1 303 ? 37.013  55.344  57.423  1.00 86.47  ? 571 VAL A N     1 
ATOM   589   C  CA    . VAL A 1 303 ? 37.868  54.558  58.303  1.00 86.47  ? 571 VAL A CA    1 
ATOM   590   C  C     . VAL A 1 303 ? 37.531  53.073  58.183  1.00 86.47  ? 571 VAL A C     1 
ATOM   591   O  O     . VAL A 1 303 ? 38.383  52.213  58.437  1.00 86.47  ? 571 VAL A O     1 
ATOM   592   C  CB    . VAL A 1 303 ? 37.735  55.105  59.741  1.00 86.47  ? 571 VAL A CB    1 
ATOM   593   C  CG1   . VAL A 1 303 ? 38.691  54.432  60.717  1.00 86.47  ? 571 VAL A CG1   1 
ATOM   594   C  CG2   . VAL A 1 303 ? 37.959  56.601  59.746  1.00 86.47  ? 571 VAL A CG2   1 
ATOM   595   N  N     . ALA A 1 304 ? 36.313  52.748  57.744  1.00 84.51  ? 572 ALA A N     1 
ATOM   596   C  CA    . ALA A 1 304 ? 35.978  51.363  57.435  1.00 84.51  ? 572 ALA A CA    1 
ATOM   597   C  C     . ALA A 1 304 ? 36.716  50.881  56.195  1.00 84.51  ? 572 ALA A C     1 
ATOM   598   O  O     . ALA A 1 304 ? 37.273  49.781  56.191  1.00 84.51  ? 572 ALA A O     1 
ATOM   599   C  CB    . ALA A 1 304 ? 34.473  51.212  57.243  1.00 84.51  ? 572 ALA A CB    1 
ATOM   600   N  N     . TYR A 1 305 ? 36.739  51.691  55.137  1.00 82.40  ? 573 TYR A N     1 
ATOM   601   C  CA    . TYR A 1 305 ? 37.456  51.297  53.932  1.00 82.40  ? 573 TYR A CA    1 
ATOM   602   C  C     . TYR A 1 305 ? 38.968  51.376  54.098  1.00 82.40  ? 573 TYR A C     1 
ATOM   603   O  O     . TYR A 1 305 ? 39.691  50.698  53.365  1.00 82.40  ? 573 TYR A O     1 
ATOM   604   C  CB    . TYR A 1 305 ? 37.026  52.155  52.740  1.00 82.40  ? 573 TYR A CB    1 
ATOM   605   C  CG    . TYR A 1 305 ? 35.667  51.817  52.164  1.00 82.40  ? 573 TYR A CG    1 
ATOM   606   C  CD1   . TYR A 1 305 ? 35.017  50.661  52.518  1.00 82.40  ? 573 TYR A CD1   1 
ATOM   607   C  CD2   . TYR A 1 305 ? 35.050  52.649  51.246  1.00 82.40  ? 573 TYR A CD2   1 
ATOM   608   C  CE1   . TYR A 1 305 ? 33.781  50.336  51.992  1.00 82.40  ? 573 TYR A CE1   1 
ATOM   609   C  CE2   . TYR A 1 305 ? 33.812  52.335  50.707  1.00 82.40  ? 573 TYR A CE2   1 
ATOM   610   C  CZ    . TYR A 1 305 ? 33.186  51.173  51.087  1.00 82.40  ? 573 TYR A CZ    1 
ATOM   611   O  OH    . TYR A 1 305 ? 31.957  50.848  50.566  1.00 82.40  ? 573 TYR A OH    1 
ATOM   612   N  N     . HIS A 1 306 ? 39.463  52.177  55.040  1.00 79.46  ? 574 HIS A N     1 
ATOM   613   C  CA    . HIS A 1 306 ? 40.903  52.267  55.248  1.00 79.46  ? 574 HIS A CA    1 
ATOM   614   C  C     . HIS A 1 306 ? 41.431  51.032  55.956  1.00 79.46  ? 574 HIS A C     1 
ATOM   615   O  O     . HIS A 1 306 ? 42.407  50.423  55.510  1.00 79.46  ? 574 HIS A O     1 
ATOM   616   C  CB    . HIS A 1 306 ? 41.245  53.519  56.051  1.00 79.46  ? 574 HIS A CB    1 
ATOM   617   C  CG    . HIS A 1 306 ? 42.711  53.708  56.275  1.00 79.46  ? 574 HIS A CG    1 
ATOM   618   N  ND1   . HIS A 1 306 ? 43.568  54.102  55.272  1.00 79.46  ? 574 HIS A ND1   1 
ATOM   619   C  CD2   . HIS A 1 306 ? 43.473  53.556  57.383  1.00 79.46  ? 574 HIS A CD2   1 
ATOM   620   C  CE1   . HIS A 1 306 ? 44.794  54.183  55.752  1.00 79.46  ? 574 HIS A CE1   1 
ATOM   621   N  NE2   . HIS A 1 306 ? 44.764  53.861  57.032  1.00 79.46  ? 574 HIS A NE2   1 
ATOM   622   N  N     . GLN A 1 307 ? 40.786  50.641  57.054  1.00 85.91  ? 575 GLN A N     1 
ATOM   623   C  CA    . GLN A 1 307 ? 41.220  49.480  57.818  1.00 85.91  ? 575 GLN A CA    1 
ATOM   624   C  C     . GLN A 1 307 ? 40.967  48.170  57.091  1.00 85.91  ? 575 GLN A C     1 
ATOM   625   O  O     . GLN A 1 307 ? 41.546  47.147  57.466  1.00 85.91  ? 575 GLN A O     1 
ATOM   626   C  CB    . GLN A 1 307 ? 40.513  49.459  59.167  1.00 85.91  ? 575 GLN A CB    1 
ATOM   627   C  CG    . GLN A 1 307 ? 40.905  50.599  60.065  1.00 85.91  ? 575 GLN A CG    1 
ATOM   628   C  CD    . GLN A 1 307 ? 42.327  50.476  60.537  1.00 85.91  ? 575 GLN A CD    1 
ATOM   629   O  OE1   . GLN A 1 307 ? 42.790  49.382  60.845  1.00 85.91  ? 575 GLN A OE1   1 
ATOM   630   N  NE2   . GLN A 1 307 ? 43.036  51.595  60.591  1.00 85.91  ? 575 GLN A NE2   1 
ATOM   631   N  N     . ALA A 1 308 ? 40.116  48.171  56.072  1.00 81.95  ? 576 ALA A N     1 
ATOM   632   C  CA    . ALA A 1 308 ? 39.880  46.974  55.284  1.00 81.95  ? 576 ALA A CA    1 
ATOM   633   C  C     . ALA A 1 308 ? 40.798  46.863  54.083  1.00 81.95  ? 576 ALA A C     1 
ATOM   634   O  O     . ALA A 1 308 ? 41.003  45.754  53.583  1.00 81.95  ? 576 ALA A O     1 
ATOM   635   C  CB    . ALA A 1 308 ? 38.434  46.929  54.806  1.00 81.95  ? 576 ALA A CB    1 
ATOM   636   N  N     . GLY A 1 309 ? 41.340  47.979  53.598  1.00 80.33  ? 577 GLY A N     1 
ATOM   637   C  CA    . GLY A 1 309 ? 42.377  47.899  52.588  1.00 80.33  ? 577 GLY A CA    1 
ATOM   638   C  C     . GLY A 1 309 ? 43.666  47.330  53.135  1.00 80.33  ? 577 GLY A C     1 
ATOM   639   O  O     . GLY A 1 309 ? 44.424  46.692  52.405  1.00 80.33  ? 577 GLY A O     1 
ATOM   640   N  N     . HIS A 1 310 ? 43.940  47.567  54.416  1.00 80.33  ? 578 HIS A N     1 
ATOM   641   C  CA    . HIS A 1 310 ? 45.038  46.877  55.074  1.00 80.33  ? 578 HIS A CA    1 
ATOM   642   C  C     . HIS A 1 310 ? 44.741  45.398  55.237  1.00 80.33  ? 578 HIS A C     1 
ATOM   643   O  O     . HIS A 1 310 ? 45.651  44.569  55.150  1.00 80.33  ? 578 HIS A O     1 
ATOM   644   C  CB    . HIS A 1 310 ? 45.314  47.486  56.445  1.00 80.33  ? 578 HIS A CB    1 
ATOM   645   C  CG    . HIS A 1 310 ? 45.973  48.828  56.404  1.00 80.33  ? 578 HIS A CG    1 
ATOM   646   N  ND1   . HIS A 1 310 ? 45.262  50.004  56.336  1.00 80.33  ? 578 HIS A ND1   1 
ATOM   647   C  CD2   . HIS A 1 310 ? 47.277  49.181  56.463  1.00 80.33  ? 578 HIS A CD2   1 
ATOM   648   C  CE1   . HIS A 1 310 ? 46.101  51.023  56.341  1.00 80.33  ? 578 HIS A CE1   1 
ATOM   649   N  NE2   . HIS A 1 310 ? 47.330  50.551  56.412  1.00 80.33  ? 578 HIS A NE2   1 
ATOM   650   N  N     . ALA A 1 311 ? 43.478  45.051  55.475  1.00 84.22  ? 579 ALA A N     1 
ATOM   651   C  CA    . ALA A 1 311 ? 43.120  43.672  55.781  1.00 84.22  ? 579 ALA A CA    1 
ATOM   652   C  C     . ALA A 1 311 ? 43.144  42.792  54.542  1.00 84.22  ? 579 ALA A C     1 
ATOM   653   O  O     . ALA A 1 311 ? 43.671  41.679  54.584  1.00 84.22  ? 579 ALA A O     1 
ATOM   654   C  CB    . ALA A 1 311 ? 41.742  43.629  56.435  1.00 84.22  ? 579 ALA A CB    1 
ATOM   655   N  N     . VAL A 1 312 ? 42.587  43.278  53.433  1.00 85.23  ? 580 VAL A N     1 
ATOM   656   C  CA    . VAL A 1 312 ? 42.533  42.481  52.213  1.00 85.23  ? 580 VAL A CA    1 
ATOM   657   C  C     . VAL A 1 312 ? 43.912  42.375  51.576  1.00 85.23  ? 580 VAL A C     1 
ATOM   658   O  O     . VAL A 1 312 ? 44.330  41.292  51.150  1.00 85.23  ? 580 VAL A O     1 
ATOM   659   C  CB    . VAL A 1 312 ? 41.494  43.074  51.246  1.00 85.23  ? 580 VAL A CB    1 
ATOM   660   C  CG1   . VAL A 1 312 ? 41.516  42.354  49.916  1.00 85.23  ? 580 VAL A CG1   1 
ATOM   661   C  CG2   . VAL A 1 312 ? 40.117  42.984  51.859  1.00 85.23  ? 580 VAL A CG2   1 
ATOM   662   N  N     . ALA A 1 313 ? 44.654  43.482  51.520  1.00 85.38  ? 581 ALA A N     1 
ATOM   663   C  CA    . ALA A 1 313 ? 45.992  43.433  50.942  1.00 85.38  ? 581 ALA A CA    1 
ATOM   664   C  C     . ALA A 1 313 ? 46.996  42.746  51.857  1.00 85.38  ? 581 ALA A C     1 
ATOM   665   O  O     . ALA A 1 313 ? 48.076  42.376  51.397  1.00 85.38  ? 581 ALA A O     1 
ATOM   666   C  CB    . ALA A 1 313 ? 46.477  44.838  50.600  1.00 85.38  ? 581 ALA A CB    1 
ATOM   667   N  N     . GLY A 1 314 ? 46.671  42.564  53.131  1.00 90.74  ? 582 GLY A N     1 
ATOM   668   C  CA    . GLY A 1 314 ? 47.503  41.776  54.017  1.00 90.74  ? 582 GLY A CA    1 
ATOM   669   C  C     . GLY A 1 314 ? 47.003  40.352  54.140  1.00 90.74  ? 582 GLY A C     1 
ATOM   670   O  O     . GLY A 1 314 ? 47.248  39.671  55.140  1.00 90.74  ? 582 GLY A O     1 
ATOM   671   N  N     . TRP A 1 315 ? 46.290  39.898  53.113  1.00 95.97  ? 583 TRP A N     1 
ATOM   672   C  CA    . TRP A 1 315 ? 45.670  38.584  53.101  1.00 95.97  ? 583 TRP A CA    1 
ATOM   673   C  C     . TRP A 1 315 ? 46.072  37.857  51.830  1.00 95.97  ? 583 TRP A C     1 
ATOM   674   O  O     . TRP A 1 315 ? 46.164  36.628  51.806  1.00 95.97  ? 583 TRP A O     1 
ATOM   675   C  CB    . TRP A 1 315 ? 44.151  38.721  53.182  1.00 95.97  ? 583 TRP A CB    1 
ATOM   676   C  CG    . TRP A 1 315 ? 43.423  37.445  53.320  1.00 95.97  ? 583 TRP A CG    1 
ATOM   677   C  CD1   . TRP A 1 315 ? 42.810  36.743  52.333  1.00 95.97  ? 583 TRP A CD1   1 
ATOM   678   C  CD2   . TRP A 1 315 ? 43.187  36.730  54.531  1.00 95.97  ? 583 TRP A CD2   1 
ATOM   679   N  NE1   . TRP A 1 315 ? 42.229  35.616  52.849  1.00 95.97  ? 583 TRP A NE1   1 
ATOM   680   C  CE2   . TRP A 1 315 ? 42.443  35.587  54.200  1.00 95.97  ? 583 TRP A CE2   1 
ATOM   681   C  CE3   . TRP A 1 315 ? 43.544  36.939  55.864  1.00 95.97  ? 583 TRP A CE3   1 
ATOM   682   C  CZ2   . TRP A 1 315 ? 42.048  34.658  55.151  1.00 95.97  ? 583 TRP A CZ2   1 
ATOM   683   C  CZ3   . TRP A 1 315 ? 43.149  36.016  56.807  1.00 95.97  ? 583 TRP A CZ3   1 
ATOM   684   C  CH2   . TRP A 1 315 ? 42.410  34.890  56.447  1.00 95.97  ? 583 TRP A CH2   1 
ATOM   685   N  N     . TYR A 1 316 ? 46.314  38.622  50.770  1.00 92.19  ? 584 TYR A N     1 
ATOM   686   C  CA    . TYR A 1 316 ? 46.669  38.068  49.474  1.00 92.19  ? 584 TYR A CA    1 
ATOM   687   C  C     . TYR A 1 316 ? 48.151  38.166  49.163  1.00 92.19  ? 584 TYR A C     1 
ATOM   688   O  O     . TYR A 1 316 ? 48.622  37.474  48.255  1.00 92.19  ? 584 TYR A O     1 
ATOM   689   C  CB    . TYR A 1 316 ? 45.878  38.775  48.374  1.00 92.19  ? 584 TYR A CB    1 
ATOM   690   C  CG    . TYR A 1 316 ? 44.419  38.400  48.350  1.00 92.19  ? 584 TYR A CG    1 
ATOM   691   C  CD1   . TYR A 1 316 ? 43.977  37.211  48.913  1.00 92.19  ? 584 TYR A CD1   1 
ATOM   692   C  CD2   . TYR A 1 316 ? 43.480  39.248  47.795  1.00 92.19  ? 584 TYR A CD2   1 
ATOM   693   C  CE1   . TYR A 1 316 ? 42.644  36.869  48.895  1.00 92.19  ? 584 TYR A CE1   1 
ATOM   694   C  CE2   . TYR A 1 316 ? 42.147  38.918  47.782  1.00 92.19  ? 584 TYR A CE2   1 
ATOM   695   C  CZ    . TYR A 1 316 ? 41.735  37.729  48.329  1.00 92.19  ? 584 TYR A CZ    1 
ATOM   696   O  OH    . TYR A 1 316 ? 40.403  37.403  48.311  1.00 92.19  ? 584 TYR A OH    1 
ATOM   697   N  N     . LEU A 1 317 ? 48.886  39.013  49.870  1.00 94.69  ? 585 LEU A N     1 
ATOM   698   C  CA    . LEU A 1 317 ? 50.330  39.074  49.734  1.00 94.69  ? 585 LEU A CA    1 
ATOM   699   C  C     . LEU A 1 317 ? 50.970  38.027  50.629  1.00 94.69  ? 585 LEU A C     1 
ATOM   700   O  O     . LEU A 1 317 ? 50.462  37.710  51.706  1.00 94.69  ? 585 LEU A O     1 
ATOM   701   C  CB    . LEU A 1 317 ? 50.847  40.461  50.091  1.00 94.69  ? 585 LEU A CB    1 
ATOM   702   C  CG    . LEU A 1 317 ? 50.372  41.529  49.118  1.00 94.69  ? 585 LEU A CG    1 
ATOM   703   C  CD1   . LEU A 1 317 ? 50.794  42.881  49.592  1.00 94.69  ? 585 LEU A CD1   1 
ATOM   704   C  CD2   . LEU A 1 317 ? 50.888  41.261  47.721  1.00 94.69  ? 585 LEU A CD2   1 
ATOM   705   N  N     . GLU A 1 318 ? 52.105  37.502  50.175  1.00 97.96  ? 586 GLU A N     1 
ATOM   706   C  CA    . GLU A 1 318 ? 52.667  36.305  50.786  1.00 97.96  ? 586 GLU A CA    1 
ATOM   707   C  C     . GLU A 1 318 ? 53.328  36.600  52.122  1.00 97.96  ? 586 GLU A C     1 
ATOM   708   O  O     . GLU A 1 318 ? 52.995  35.980  53.137  1.00 97.96  ? 586 GLU A O     1 
ATOM   709   C  CB    . GLU A 1 318 ? 53.661  35.651  49.831  1.00 97.96  ? 586 GLU A CB    1 
ATOM   710   C  CG    . GLU A 1 318 ? 54.223  34.348  50.350  1.00 97.96  ? 586 GLU A CG    1 
ATOM   711   C  CD    . GLU A 1 318 ? 55.132  33.670  49.348  1.00 97.96  ? 586 GLU A CD    1 
ATOM   712   O  OE1   . GLU A 1 318 ? 55.336  34.234  48.253  1.00 97.96  ? 586 GLU A OE1   1 
ATOM   713   O  OE2   . GLU A 1 318 ? 55.640  32.572  49.653  1.00 97.96  ? 586 GLU A OE2   1 
ATOM   714   N  N     . HIS A 1 319 ? 54.263  37.539  52.144  1.00 95.81  ? 587 HIS A N     1 
ATOM   715   C  CA    . HIS A 1 319 ? 55.112  37.739  53.305  1.00 95.81  ? 587 HIS A CA    1 
ATOM   716   C  C     . HIS A 1 319 ? 54.587  38.811  54.248  1.00 95.81  ? 587 HIS A C     1 
ATOM   717   O  O     . HIS A 1 319 ? 55.292  39.189  55.186  1.00 95.81  ? 587 HIS A O     1 
ATOM   718   C  CB    . HIS A 1 319 ? 56.527  38.071  52.845  1.00 95.81  ? 587 HIS A CB    1 
ATOM   719   C  CG    . HIS A 1 319 ? 57.142  36.998  52.003  1.00 95.81  ? 587 HIS A CG    1 
ATOM   720   N  ND1   . HIS A 1 319 ? 57.629  35.825  52.535  1.00 95.81  ? 587 HIS A ND1   1 
ATOM   721   C  CD2   . HIS A 1 319 ? 57.326  36.911  50.665  1.00 95.81  ? 587 HIS A CD2   1 
ATOM   722   C  CE1   . HIS A 1 319 ? 58.099  35.067  51.562  1.00 95.81  ? 587 HIS A CE1   1 
ATOM   723   N  NE2   . HIS A 1 319 ? 57.925  35.702  50.417  1.00 95.81  ? 587 HIS A NE2   1 
ATOM   724   N  N     . ALA A 1 320 ? 53.372  39.299  54.029  1.00 98.36  ? 588 ALA A N     1 
ATOM   725   C  CA    . ALA A 1 320 ? 52.764  40.222  54.969  1.00 98.36  ? 588 ALA A CA    1 
ATOM   726   C  C     . ALA A 1 320 ? 52.245  39.464  56.185  1.00 98.36  ? 588 ALA A C     1 
ATOM   727   O  O     . ALA A 1 320 ? 52.076  38.244  56.162  1.00 98.36  ? 588 ALA A O     1 
ATOM   728   C  CB    . ALA A 1 320 ? 51.631  40.999  54.304  1.00 98.36  ? 588 ALA A CB    1 
ATOM   729   N  N     . ASP A 1 321 ? 51.995  40.201  57.254  1.00 103.51 ? 589 ASP A N     1 
ATOM   730   C  CA    . ASP A 1 321 ? 51.526  39.537  58.460  1.00 103.51 ? 589 ASP A CA    1 
ATOM   731   C  C     . ASP A 1 321 ? 50.029  39.256  58.366  1.00 103.51 ? 589 ASP A C     1 
ATOM   732   O  O     . ASP A 1 321 ? 49.280  40.058  57.803  1.00 103.51 ? 589 ASP A O     1 
ATOM   733   C  CB    . ASP A 1 321 ? 51.806  40.386  59.694  1.00 103.51 ? 589 ASP A CB    1 
ATOM   734   C  CG    . ASP A 1 321 ? 53.269  40.412  60.060  1.00 103.51 ? 589 ASP A CG    1 
ATOM   735   O  OD1   . ASP A 1 321 ? 53.972  39.425  59.763  1.00 103.51 ? 589 ASP A OD1   1 
ATOM   736   O  OD2   . ASP A 1 321 ? 53.716  41.415  60.651  1.00 103.51 ? 589 ASP A OD2   1 
ATOM   737   N  N     . PRO A 1 322 ? 49.573  38.126  58.895  1.00 107.98 ? 590 PRO A N     1 
ATOM   738   C  CA    . PRO A 1 322 ? 48.131  37.905  59.013  1.00 107.98 ? 590 PRO A CA    1 
ATOM   739   C  C     . PRO A 1 322 ? 47.546  38.775  60.111  1.00 107.98 ? 590 PRO A C     1 
ATOM   740   O  O     . PRO A 1 322 ? 48.233  39.173  61.053  1.00 107.98 ? 590 PRO A O     1 
ATOM   741   C  CB    . PRO A 1 322 ? 48.028  36.419  59.364  1.00 107.98 ? 590 PRO A CB    1 
ATOM   742   C  CG    . PRO A 1 322 ? 49.315  36.116  60.046  1.00 107.98 ? 590 PRO A CG    1 
ATOM   743   C  CD    . PRO A 1 322 ? 50.351  36.972  59.378  1.00 107.98 ? 590 PRO A CD    1 
ATOM   744   N  N     . LEU A 1 323 ? 46.259  39.066  59.982  1.00 110.72 ? 591 LEU A N     1 
ATOM   745   C  CA    . LEU A 1 323 ? 45.590  39.918  60.948  1.00 110.72 ? 591 LEU A CA    1 
ATOM   746   C  C     . LEU A 1 323 ? 44.991  39.082  62.072  1.00 110.72 ? 591 LEU A C     1 
ATOM   747   O  O     . LEU A 1 323 ? 44.687  37.899  61.909  1.00 110.72 ? 591 LEU A O     1 
ATOM   748   C  CB    . LEU A 1 323 ? 44.510  40.754  60.258  1.00 110.72 ? 591 LEU A CB    1 
ATOM   749   C  CG    . LEU A 1 323 ? 43.288  40.069  59.640  1.00 110.72 ? 591 LEU A CG    1 
ATOM   750   C  CD1   . LEU A 1 323 ? 42.053  40.096  60.557  1.00 110.72 ? 591 LEU A CD1   1 
ATOM   751   C  CD2   . LEU A 1 323 ? 42.979  40.657  58.276  1.00 110.72 ? 591 LEU A CD2   1 
ATOM   752   N  N     . LEU A 1 324 ? 44.826  39.717  63.225  1.00 111.84 ? 592 LEU A N     1 
ATOM   753   C  CA    . LEU A 1 324 ? 44.143  39.105  64.353  1.00 111.84 ? 592 LEU A CA    1 
ATOM   754   C  C     . LEU A 1 324 ? 42.778  39.721  64.602  1.00 111.84 ? 592 LEU A C     1 
ATOM   755   O  O     . LEU A 1 324 ? 41.788  38.997  64.741  1.00 111.84 ? 592 LEU A O     1 
ATOM   756   C  CB    . LEU A 1 324 ? 44.996  39.219  65.619  1.00 111.84 ? 592 LEU A CB    1 
ATOM   757   C  CG    . LEU A 1 324 ? 46.299  38.428  65.628  1.00 111.84 ? 592 LEU A CG    1 
ATOM   758   C  CD1   . LEU A 1 324 ? 47.094  38.737  66.886  1.00 111.84 ? 592 LEU A CD1   1 
ATOM   759   C  CD2   . LEU A 1 324 ? 46.015  36.943  65.523  1.00 111.84 ? 592 LEU A CD2   1 
ATOM   760   N  N     . LYS A 1 325 ? 42.699  41.048  64.645  1.00 115.19 ? 593 LYS A N     1 
ATOM   761   C  CA    . LYS A 1 325 ? 41.456  41.727  64.980  1.00 115.19 ? 593 LYS A CA    1 
ATOM   762   C  C     . LYS A 1 325 ? 41.504  43.140  64.422  1.00 115.19 ? 593 LYS A C     1 
ATOM   763   O  O     . LYS A 1 325 ? 42.450  43.882  64.699  1.00 115.19 ? 593 LYS A O     1 
ATOM   764   C  CB    . LYS A 1 325 ? 41.246  41.751  66.496  1.00 115.19 ? 593 LYS A CB    1 
ATOM   765   C  CG    . LYS A 1 325 ? 39.908  42.303  66.930  1.00 115.19 ? 593 LYS A CG    1 
ATOM   766   C  CD    . LYS A 1 325 ? 39.795  42.319  68.438  1.00 115.19 ? 593 LYS A CD    1 
ATOM   767   C  CE    . LYS A 1 325 ? 39.608  40.922  68.992  1.00 115.19 ? 593 LYS A CE    1 
ATOM   768   N  NZ    . LYS A 1 325 ? 39.384  40.955  70.460  1.00 115.19 ? 593 LYS A NZ    1 
ATOM   769   N  N     . VAL A 1 326 ? 40.497  43.500  63.634  1.00 108.73 ? 594 VAL A N     1 
ATOM   770   C  CA    . VAL A 1 326 ? 40.381  44.831  63.053  1.00 108.73 ? 594 VAL A CA    1 
ATOM   771   C  C     . VAL A 1 326 ? 39.089  45.442  63.563  1.00 108.73 ? 594 VAL A C     1 
ATOM   772   O  O     . VAL A 1 326 ? 38.012  44.863  63.381  1.00 108.73 ? 594 VAL A O     1 
ATOM   773   C  CB    . VAL A 1 326 ? 40.395  44.789  61.519  1.00 108.73 ? 594 VAL A CB    1 
ATOM   774   C  CG1   . VAL A 1 326 ? 40.179  46.174  60.956  1.00 108.73 ? 594 VAL A CG1   1 
ATOM   775   C  CG2   . VAL A 1 326 ? 41.702  44.208  61.020  1.00 108.73 ? 594 VAL A CG2   1 
ATOM   776   N  N     . SER A 1 327 ? 39.192  46.603  64.202  1.00 109.16 ? 595 SER A N     1 
ATOM   777   C  CA    . SER A 1 327 ? 38.038  47.256  64.795  1.00 109.16 ? 595 SER A CA    1 
ATOM   778   C  C     . SER A 1 327 ? 38.009  48.729  64.424  1.00 109.16 ? 595 SER A C     1 
ATOM   779   O  O     . SER A 1 327 ? 39.049  49.346  64.186  1.00 109.16 ? 595 SER A O     1 
ATOM   780   C  CB    . SER A 1 327 ? 38.039  47.122  66.317  1.00 109.16 ? 595 SER A CB    1 
ATOM   781   O  OG    . SER A 1 327 ? 36.944  47.820  66.882  1.00 109.16 ? 595 SER A OG    1 
ATOM   782   N  N     . ILE A 1 328 ? 36.798  49.279  64.356  1.00 105.58 ? 596 ILE A N     1 
ATOM   783   C  CA    . ILE A 1 328 ? 36.584  50.720  64.223  1.00 105.58 ? 596 ILE A CA    1 
ATOM   784   C  C     . ILE A 1 328 ? 35.575  51.143  65.292  1.00 105.58 ? 596 ILE A C     1 
ATOM   785   O  O     . ILE A 1 328 ? 34.359  51.154  65.076  1.00 105.58 ? 596 ILE A O     1 
ATOM   786   C  CB    . ILE A 1 328 ? 36.151  51.132  62.809  1.00 105.58 ? 596 ILE A CB    1 
ATOM   787   C  CG1   . ILE A 1 328 ? 35.103  50.192  62.203  1.00 105.58 ? 596 ILE A CG1   1 
ATOM   788   C  CG2   . ILE A 1 328 ? 37.346  51.167  61.890  1.00 105.58 ? 596 ILE A CG2   1 
ATOM   789   C  CD1   . ILE A 1 328 ? 34.495  50.713  60.945  1.00 105.58 ? 596 ILE A CD1   1 
ATOM   790   N  N     . ILE A 1 329 ? 36.078  51.505  66.467  1.00 115.19 ? 597 ILE A N     1 
ATOM   791   C  CA    . ILE A 1 329 ? 35.229  51.935  67.577  1.00 115.19 ? 597 ILE A CA    1 
ATOM   792   C  C     . ILE A 1 329 ? 35.818  53.211  68.167  1.00 115.19 ? 597 ILE A C     1 
ATOM   793   O  O     . ILE A 1 329 ? 37.025  53.260  68.444  1.00 115.19 ? 597 ILE A O     1 
ATOM   794   C  CB    . ILE A 1 329 ? 35.081  50.828  68.638  1.00 115.19 ? 597 ILE A CB    1 
ATOM   795   C  CG1   . ILE A 1 329 ? 34.211  49.681  68.115  1.00 115.19 ? 597 ILE A CG1   1 
ATOM   796   C  CG2   . ILE A 1 329 ? 34.493  51.368  69.929  1.00 115.19 ? 597 ILE A CG2   1 
ATOM   797   C  CD1   . ILE A 1 329 ? 34.183  48.475  69.017  1.00 115.19 ? 597 ILE A CD1   1 
ATOM   798   N  N     . PRO A 1 330 ? 35.021  54.267  68.345  1.00 119.27 ? 598 PRO A N     1 
ATOM   799   C  CA    . PRO A 1 330 ? 35.540  55.513  68.933  1.00 119.27 ? 598 PRO A CA    1 
ATOM   800   C  C     . PRO A 1 330 ? 35.891  55.330  70.402  1.00 119.27 ? 598 PRO A C     1 
ATOM   801   O  O     . PRO A 1 330 ? 35.036  55.006  71.228  1.00 119.27 ? 598 PRO A O     1 
ATOM   802   C  CB    . PRO A 1 330 ? 34.385  56.503  68.742  1.00 119.27 ? 598 PRO A CB    1 
ATOM   803   C  CG    . PRO A 1 330 ? 33.163  55.648  68.633  1.00 119.27 ? 598 PRO A CG    1 
ATOM   804   C  CD    . PRO A 1 330 ? 33.607  54.387  67.950  1.00 119.27 ? 598 PRO A CD    1 
ATOM   805   N  N     . ARG A 1 331 ? 37.164  55.540  70.722  1.00 121.91 ? 599 ARG A N     1 
ATOM   806   C  CA    . ARG A 1 331 ? 37.659  55.335  72.072  1.00 121.91 ? 599 ARG A CA    1 
ATOM   807   C  C     . ARG A 1 331 ? 38.927  56.152  72.278  1.00 121.91 ? 599 ARG A C     1 
ATOM   808   O  O     . ARG A 1 331 ? 39.756  56.259  71.369  1.00 121.91 ? 599 ARG A O     1 
ATOM   809   C  CB    . ARG A 1 331 ? 37.917  53.844  72.342  1.00 121.91 ? 599 ARG A CB    1 
ATOM   810   C  CG    . ARG A 1 331 ? 38.920  53.179  71.419  1.00 121.91 ? 599 ARG A CG    1 
ATOM   811   C  CD    . ARG A 1 331 ? 39.102  51.726  71.759  1.00 121.91 ? 599 ARG A CD    1 
ATOM   812   N  NE    . ARG A 1 331 ? 37.940  50.912  71.436  1.00 121.91 ? 599 ARG A NE    1 
ATOM   813   C  CZ    . ARG A 1 331 ? 37.802  49.653  71.829  1.00 121.91 ? 599 ARG A CZ    1 
ATOM   814   N  NH1   . ARG A 1 331 ? 38.749  49.093  72.565  1.00 121.91 ? 599 ARG A NH1   1 
ATOM   815   N  NH2   . ARG A 1 331 ? 36.721  48.961  71.499  1.00 121.91 ? 599 ARG A NH2   1 
ATOM   816   N  N     . GLY A 1 332 ? 39.036  56.758  73.461  1.00 115.77 ? 600 GLY A N     1 
ATOM   817   C  CA    . GLY A 1 332 ? 40.284  57.348  73.927  1.00 115.77 ? 600 GLY A CA    1 
ATOM   818   C  C     . GLY A 1 332 ? 40.770  58.493  73.063  1.00 115.77 ? 600 GLY A C     1 
ATOM   819   O  O     . GLY A 1 332 ? 40.061  59.474  72.821  1.00 115.77 ? 600 GLY A O     1 
ATOM   820   N  N     . LYS A 1 333 ? 41.996  58.349  72.570  1.00 117.43 ? 601 LYS A N     1 
ATOM   821   C  CA    . LYS A 1 333 ? 42.599  59.333  71.685  1.00 117.43 ? 601 LYS A CA    1 
ATOM   822   C  C     . LYS A 1 333 ? 42.272  59.090  70.219  1.00 117.43 ? 601 LYS A C     1 
ATOM   823   O  O     . LYS A 1 333 ? 42.198  60.050  69.444  1.00 117.43 ? 601 LYS A O     1 
ATOM   824   C  CB    . LYS A 1 333 ? 44.118  59.340  71.871  1.00 117.43 ? 601 LYS A CB    1 
ATOM   825   C  CG    . LYS A 1 333 ? 44.572  59.781  73.249  1.00 117.43 ? 601 LYS A CG    1 
ATOM   826   C  CD    . LYS A 1 333 ? 44.223  61.235  73.484  1.00 117.43 ? 601 LYS A CD    1 
ATOM   827   C  CE    . LYS A 1 333 ? 45.065  62.143  72.607  1.00 117.43 ? 601 LYS A CE    1 
ATOM   828   N  NZ    . LYS A 1 333 ? 44.798  63.580  72.878  1.00 117.43 ? 601 LYS A NZ    1 
ATOM   829   N  N     . GLY A 1 334 ? 42.075  57.836  69.818  1.00 119.94 ? 602 GLY A N     1 
ATOM   830   C  CA    . GLY A 1 334 ? 41.856  57.532  68.417  1.00 119.94 ? 602 GLY A CA    1 
ATOM   831   C  C     . GLY A 1 334 ? 40.829  56.451  68.151  1.00 119.94 ? 602 GLY A C     1 
ATOM   832   O  O     . GLY A 1 334 ? 40.812  55.416  68.823  1.00 119.94 ? 602 GLY A O     1 
ATOM   833   N  N     . LEU A 1 335 ? 39.976  56.679  67.156  1.00 114.76 ? 603 LEU A N     1 
ATOM   834   C  CA    . LEU A 1 335 ? 38.953  55.705  66.805  1.00 114.76 ? 603 LEU A CA    1 
ATOM   835   C  C     . LEU A 1 335 ? 39.582  54.529  66.069  1.00 114.76 ? 603 LEU A C     1 
ATOM   836   O  O     . LEU A 1 335 ? 40.424  54.708  65.184  1.00 114.76 ? 603 LEU A O     1 
ATOM   837   C  CB    . LEU A 1 335 ? 37.853  56.354  65.956  1.00 114.76 ? 603 LEU A CB    1 
ATOM   838   C  CG    . LEU A 1 335 ? 38.005  56.713  64.469  1.00 114.76 ? 603 LEU A CG    1 
ATOM   839   C  CD1   . LEU A 1 335 ? 36.647  56.952  63.834  1.00 114.76 ? 603 LEU A CD1   1 
ATOM   840   C  CD2   . LEU A 1 335 ? 38.910  57.918  64.243  1.00 114.76 ? 603 LEU A CD2   1 
ATOM   841   N  N     . GLY A 1 336 ? 39.213  53.319  66.477  1.00 114.77 ? 604 GLY A N     1 
ATOM   842   C  CA    . GLY A 1 336 ? 39.654  52.122  65.791  1.00 114.77 ? 604 GLY A CA    1 
ATOM   843   C  C     . GLY A 1 336 ? 41.108  51.734  65.972  1.00 114.77 ? 604 GLY A C     1 
ATOM   844   O  O     . GLY A 1 336 ? 41.933  52.544  66.404  1.00 114.77 ? 604 GLY A O     1 
ATOM   845   N  N     . TYR A 1 337 ? 41.429  50.489  65.640  1.00 113.64 ? 605 TYR A N     1 
ATOM   846   C  CA    . TYR A 1 337 ? 42.796  49.986  65.696  1.00 113.64 ? 605 TYR A CA    1 
ATOM   847   C  C     . TYR A 1 337 ? 42.896  48.790  64.756  1.00 113.64 ? 605 TYR A C     1 
ATOM   848   O  O     . TYR A 1 337 ? 41.944  48.460  64.041  1.00 113.64 ? 605 TYR A O     1 
ATOM   849   C  CB    . TYR A 1 337 ? 43.201  49.632  67.134  1.00 113.64 ? 605 TYR A CB    1 
ATOM   850   C  CG    . TYR A 1 337 ? 42.427  48.493  67.755  1.00 113.64 ? 605 TYR A CG    1 
ATOM   851   C  CD1   . TYR A 1 337 ? 41.210  48.719  68.382  1.00 113.64 ? 605 TYR A CD1   1 
ATOM   852   C  CD2   . TYR A 1 337 ? 42.929  47.199  67.748  1.00 113.64 ? 605 TYR A CD2   1 
ATOM   853   C  CE1   . TYR A 1 337 ? 40.501  47.685  68.956  1.00 113.64 ? 605 TYR A CE1   1 
ATOM   854   C  CE2   . TYR A 1 337 ? 42.226  46.159  68.319  1.00 113.64 ? 605 TYR A CE2   1 
ATOM   855   C  CZ    . TYR A 1 337 ? 41.016  46.410  68.923  1.00 113.64 ? 605 TYR A CZ    1 
ATOM   856   O  OH    . TYR A 1 337 ? 40.313  45.383  69.498  1.00 113.64 ? 605 TYR A OH    1 
ATOM   857   N  N     . ALA A 1 338 ? 44.055  48.139  64.760  1.00 112.08 ? 606 ALA A N     1 
ATOM   858   C  CA    . ALA A 1 338 ? 44.272  46.933  63.971  1.00 112.08 ? 606 ALA A CA    1 
ATOM   859   C  C     . ALA A 1 338 ? 45.338  46.104  64.664  1.00 112.08 ? 606 ALA A C     1 
ATOM   860   O  O     . ALA A 1 338 ? 46.454  46.586  64.876  1.00 112.08 ? 606 ALA A O     1 
ATOM   861   C  CB    . ALA A 1 338 ? 44.698  47.268  62.543  1.00 112.08 ? 606 ALA A CB    1 
ATOM   862   N  N     . GLN A 1 339 ? 44.999  44.871  65.020  1.00 113.26 ? 607 GLN A N     1 
ATOM   863   C  CA    . GLN A 1 339 ? 45.925  43.964  65.681  1.00 113.26 ? 607 GLN A CA    1 
ATOM   864   C  C     . GLN A 1 339 ? 46.376  42.896  64.699  1.00 113.26 ? 607 GLN A C     1 
ATOM   865   O  O     . GLN A 1 339 ? 45.546  42.224  64.080  1.00 113.26 ? 607 GLN A O     1 
ATOM   866   C  CB    . GLN A 1 339 ? 45.283  43.317  66.906  1.00 113.26 ? 607 GLN A CB    1 
ATOM   867   C  CG    . GLN A 1 339 ? 46.218  42.402  67.665  1.00 113.26 ? 607 GLN A CG    1 
ATOM   868   C  CD    . GLN A 1 339 ? 45.580  41.819  68.904  1.00 113.26 ? 607 GLN A CD    1 
ATOM   869   O  OE1   . GLN A 1 339 ? 44.420  42.097  69.206  1.00 113.26 ? 607 GLN A OE1   1 
ATOM   870   N  NE2   . GLN A 1 339 ? 46.330  40.994  69.624  1.00 113.26 ? 607 GLN A NE2   1 
ATOM   871   N  N     . TYR A 1 340 ? 47.688  42.743  64.562  1.00 109.05 ? 608 TYR A N     1 
ATOM   872   C  CA    . TYR A 1 340 ? 48.274  41.790  63.638  1.00 109.05 ? 608 TYR A CA    1 
ATOM   873   C  C     . TYR A 1 340 ? 49.077  40.749  64.401  1.00 109.05 ? 608 TYR A C     1 
ATOM   874   O  O     . TYR A 1 340 ? 49.448  40.944  65.561  1.00 109.05 ? 608 TYR A O     1 
ATOM   875   C  CB    . TYR A 1 340 ? 49.167  42.492  62.614  1.00 109.05 ? 608 TYR A CB    1 
ATOM   876   C  CG    . TYR A 1 340 ? 48.390  43.344  61.650  1.00 109.05 ? 608 TYR A CG    1 
ATOM   877   C  CD1   . TYR A 1 340 ? 47.773  42.781  60.544  1.00 109.05 ? 608 TYR A CD1   1 
ATOM   878   C  CD2   . TYR A 1 340 ? 48.257  44.708  61.854  1.00 109.05 ? 608 TYR A CD2   1 
ATOM   879   C  CE1   . TYR A 1 340 ? 47.053  43.552  59.663  1.00 109.05 ? 608 TYR A CE1   1 
ATOM   880   C  CE2   . TYR A 1 340 ? 47.538  45.488  60.977  1.00 109.05 ? 608 TYR A CE2   1 
ATOM   881   C  CZ    . TYR A 1 340 ? 46.939  44.903  59.884  1.00 109.05 ? 608 TYR A CZ    1 
ATOM   882   O  OH    . TYR A 1 340 ? 46.220  45.675  59.008  1.00 109.05 ? 608 TYR A OH    1 
ATOM   883   N  N     . LEU A 1 341 ? 49.325  39.629  63.730  1.00 109.10 ? 609 LEU A N     1 
ATOM   884   C  CA    . LEU A 1 341 ? 50.158  38.557  64.262  1.00 109.10 ? 609 LEU A CA    1 
ATOM   885   C  C     . LEU A 1 341 ? 51.519  38.635  63.591  1.00 109.10 ? 609 LEU A C     1 
ATOM   886   O  O     . LEU A 1 341 ? 51.672  38.180  62.447  1.00 109.10 ? 609 LEU A O     1 
ATOM   887   C  CB    . LEU A 1 341 ? 49.511  37.193  64.014  1.00 109.10 ? 609 LEU A CB    1 
ATOM   888   C  CG    . LEU A 1 341 ? 50.264  35.976  64.548  1.00 109.10 ? 609 LEU A CG    1 
ATOM   889   C  CD1   . LEU A 1 341 ? 50.409  36.057  66.055  1.00 109.10 ? 609 LEU A CD1   1 
ATOM   890   C  CD2   . LEU A 1 341 ? 49.546  34.702  64.146  1.00 109.10 ? 609 LEU A CD2   1 
ATOM   891   N  N     . PRO A 1 342 ? 52.529  39.210  64.238  1.00 109.11 ? 610 PRO A N     1 
ATOM   892   C  CA    . PRO A 1 342 ? 53.830  39.353  63.583  1.00 109.11 ? 610 PRO A CA    1 
ATOM   893   C  C     . PRO A 1 342 ? 54.586  38.036  63.567  1.00 109.11 ? 610 PRO A C     1 
ATOM   894   O  O     . PRO A 1 342 ? 54.560  37.265  64.529  1.00 109.11 ? 610 PRO A O     1 
ATOM   895   C  CB    . PRO A 1 342 ? 54.545  40.397  64.448  1.00 109.11 ? 610 PRO A CB    1 
ATOM   896   C  CG    . PRO A 1 342 ? 53.948  40.219  65.798  1.00 109.11 ? 610 PRO A CG    1 
ATOM   897   C  CD    . PRO A 1 342 ? 52.516  39.819  65.580  1.00 109.11 ? 610 PRO A CD    1 
ATOM   898   N  N     . LYS A 1 343 ? 55.244  37.773  62.445  1.00 107.53 ? 611 LYS A N     1 
ATOM   899   C  CA    . LYS A 1 343 ? 56.095  36.597  62.350  1.00 107.53 ? 611 LYS A CA    1 
ATOM   900   C  C     . LYS A 1 343 ? 57.366  36.809  63.165  1.00 107.53 ? 611 LYS A C     1 
ATOM   901   O  O     . LYS A 1 343 ? 57.936  37.905  63.182  1.00 107.53 ? 611 LYS A O     1 
ATOM   902   C  CB    . LYS A 1 343 ? 56.401  36.292  60.883  1.00 107.53 ? 611 LYS A CB    1 
ATOM   903   C  CG    . LYS A 1 343 ? 57.015  37.443  60.107  1.00 107.53 ? 611 LYS A CG    1 
ATOM   904   C  CD    . LYS A 1 343 ? 57.239  37.071  58.658  1.00 107.53 ? 611 LYS A CD    1 
ATOM   905   C  CE    . LYS A 1 343 ? 55.932  37.010  57.894  1.00 107.53 ? 611 LYS A CE    1 
ATOM   906   N  NZ    . LYS A 1 343 ? 56.170  36.783  56.444  1.00 107.53 ? 611 LYS A NZ    1 
ATOM   907   N  N     . GLU A 1 344 ? 57.786  35.766  63.879  1.00 112.80 ? 612 GLU A N     1 
ATOM   908   C  CA    . GLU A 1 344 ? 58.901  35.870  64.819  1.00 112.80 ? 612 GLU A CA    1 
ATOM   909   C  C     . GLU A 1 344 ? 60.205  35.637  64.062  1.00 112.80 ? 612 GLU A C     1 
ATOM   910   O  O     . GLU A 1 344 ? 60.792  34.552  64.073  1.00 112.80 ? 612 GLU A O     1 
ATOM   911   C  CB    . GLU A 1 344 ? 58.722  34.887  65.968  1.00 112.80 ? 612 GLU A CB    1 
ATOM   912   C  CG    . GLU A 1 344 ? 57.536  35.217  66.866  1.00 112.80 ? 612 GLU A CG    1 
ATOM   913   C  CD    . GLU A 1 344 ? 57.341  34.211  67.984  1.00 112.80 ? 612 GLU A CD    1 
ATOM   914   O  OE1   . GLU A 1 344 ? 58.056  33.188  67.996  1.00 112.80 ? 612 GLU A OE1   1 
ATOM   915   O  OE2   . GLU A 1 344 ? 56.471  34.443  68.850  1.00 112.80 ? 612 GLU A OE2   1 
ATOM   916   N  N     . GLN A 1 345 ? 60.664  36.690  63.393  1.00 105.36 ? 613 GLN A N     1 
ATOM   917   C  CA    . GLN A 1 345 ? 61.868  36.640  62.580  1.00 105.36 ? 613 GLN A CA    1 
ATOM   918   C  C     . GLN A 1 345 ? 62.872  37.683  63.039  1.00 105.36 ? 613 GLN A C     1 
ATOM   919   O  O     . GLN A 1 345 ? 62.507  38.729  63.582  1.00 105.36 ? 613 GLN A O     1 
ATOM   920   C  CB    . GLN A 1 345 ? 61.561  36.876  61.105  1.00 105.36 ? 613 GLN A CB    1 
ATOM   921   C  CG    . GLN A 1 345 ? 60.830  35.751  60.435  1.00 105.36 ? 613 GLN A CG    1 
ATOM   922   C  CD    . GLN A 1 345 ? 60.581  36.042  58.980  1.00 105.36 ? 613 GLN A CD    1 
ATOM   923   O  OE1   . GLN A 1 345 ? 60.875  37.133  58.500  1.00 105.36 ? 613 GLN A OE1   1 
ATOM   924   N  NE2   . GLN A 1 345 ? 60.040  35.065  58.262  1.00 105.36 ? 613 GLN A NE2   1 
ATOM   925   N  N     . TYR A 1 346 ? 64.146  37.381  62.804  1.00 105.54 ? 614 TYR A N     1 
ATOM   926   C  CA    . TYR A 1 346 ? 65.215  38.346  62.999  1.00 105.54 ? 614 TYR A CA    1 
ATOM   927   C  C     . TYR A 1 346 ? 65.647  38.994  61.696  1.00 105.54 ? 614 TYR A C     1 
ATOM   928   O  O     . TYR A 1 346 ? 66.062  40.157  61.699  1.00 105.54 ? 614 TYR A O     1 
ATOM   929   C  CB    . TYR A 1 346 ? 66.424  37.673  63.646  1.00 105.54 ? 614 TYR A CB    1 
ATOM   930   C  CG    . TYR A 1 346 ? 66.178  37.211  65.058  1.00 105.54 ? 614 TYR A CG    1 
ATOM   931   C  CD1   . TYR A 1 346 ? 66.305  38.088  66.127  1.00 105.54 ? 614 TYR A CD1   1 
ATOM   932   C  CD2   . TYR A 1 346 ? 65.805  35.899  65.323  1.00 105.54 ? 614 TYR A CD2   1 
ATOM   933   C  CE1   . TYR A 1 346 ? 66.079  37.667  67.426  1.00 105.54 ? 614 TYR A CE1   1 
ATOM   934   C  CE2   . TYR A 1 346 ? 65.576  35.469  66.616  1.00 105.54 ? 614 TYR A CE2   1 
ATOM   935   C  CZ    . TYR A 1 346 ? 65.714  36.357  67.663  1.00 105.54 ? 614 TYR A CZ    1 
ATOM   936   O  OH    . TYR A 1 346 ? 65.485  35.932  68.950  1.00 105.54 ? 614 TYR A OH    1 
ATOM   937   N  N     . LEU A 1 347 ? 65.552  38.273  60.585  1.00 97.56  ? 615 LEU A N     1 
ATOM   938   C  CA    . LEU A 1 347 ? 66.068  38.734  59.309  1.00 97.56  ? 615 LEU A CA    1 
ATOM   939   C  C     . LEU A 1 347 ? 64.928  38.883  58.318  1.00 97.56  ? 615 LEU A C     1 
ATOM   940   O  O     . LEU A 1 347 ? 64.074  38.000  58.206  1.00 97.56  ? 615 LEU A O     1 
ATOM   941   C  CB    . LEU A 1 347 ? 67.091  37.757  58.749  1.00 97.56  ? 615 LEU A CB    1 
ATOM   942   C  CG    . LEU A 1 347 ? 68.252  37.444  59.685  1.00 97.56  ? 615 LEU A CG    1 
ATOM   943   C  CD1   . LEU A 1 347 ? 69.213  36.482  59.018  1.00 97.56  ? 615 LEU A CD1   1 
ATOM   944   C  CD2   . LEU A 1 347 ? 68.953  38.704  60.130  1.00 97.56  ? 615 LEU A CD2   1 
ATOM   945   N  N     . TYR A 1 348 ? 64.922  39.994  57.598  1.00 88.79  ? 616 TYR A N     1 
ATOM   946   C  CA    . TYR A 1 348 ? 63.960  40.228  56.538  1.00 88.79  ? 616 TYR A CA    1 
ATOM   947   C  C     . TYR A 1 348 ? 64.689  40.265  55.208  1.00 88.79  ? 616 TYR A C     1 
ATOM   948   O  O     . TYR A 1 348 ? 65.898  40.482  55.151  1.00 88.79  ? 616 TYR A O     1 
ATOM   949   C  CB    . TYR A 1 348 ? 63.204  41.537  56.771  1.00 88.79  ? 616 TYR A CB    1 
ATOM   950   C  CG    . TYR A 1 348 ? 62.286  41.495  57.969  1.00 88.79  ? 616 TYR A CG    1 
ATOM   951   C  CD1   . TYR A 1 348 ? 61.810  40.288  58.463  1.00 88.79  ? 616 TYR A CD1   1 
ATOM   952   C  CD2   . TYR A 1 348 ? 61.928  42.658  58.628  1.00 88.79  ? 616 TYR A CD2   1 
ATOM   953   C  CE1   . TYR A 1 348 ? 60.989  40.242  59.560  1.00 88.79  ? 616 TYR A CE1   1 
ATOM   954   C  CE2   . TYR A 1 348 ? 61.104  42.621  59.729  1.00 88.79  ? 616 TYR A CE2   1 
ATOM   955   C  CZ    . TYR A 1 348 ? 60.641  41.409  60.189  1.00 88.79  ? 616 TYR A CZ    1 
ATOM   956   O  OH    . TYR A 1 348 ? 59.818  41.362  61.286  1.00 88.79  ? 616 TYR A OH    1 
ATOM   957   N  N     . THR A 1 349 ? 63.955  40.033  54.135  1.00 85.37  ? 617 THR A N     1 
ATOM   958   C  CA    . THR A 1 349 ? 64.522  40.083  52.800  1.00 85.37  ? 617 THR A CA    1 
ATOM   959   C  C     . THR A 1 349 ? 63.978  41.303  52.075  1.00 85.37  ? 617 THR A C     1 
ATOM   960   O  O     . THR A 1 349 ? 63.181  42.068  52.614  1.00 85.37  ? 617 THR A O     1 
ATOM   961   C  CB    . THR A 1 349 ? 64.204  38.812  52.018  1.00 85.37  ? 617 THR A CB    1 
ATOM   962   O  OG1   . THR A 1 349 ? 62.801  38.767  51.749  1.00 85.37  ? 617 THR A OG1   1 
ATOM   963   C  CG2   . THR A 1 349 ? 64.575  37.593  52.828  1.00 85.37  ? 617 THR A CG2   1 
ATOM   964   N  N     . LYS A 1 350 ? 64.408  41.476  50.828  1.00 83.55  ? 618 LYS A N     1 
ATOM   965   C  CA    . LYS A 1 350 ? 63.855  42.555  50.022  1.00 83.55  ? 618 LYS A CA    1 
ATOM   966   C  C     . LYS A 1 350 ? 62.434  42.231  49.586  1.00 83.55  ? 618 LYS A C     1 
ATOM   967   O  O     . LYS A 1 350 ? 61.623  43.140  49.382  1.00 83.55  ? 618 LYS A O     1 
ATOM   968   C  CB    . LYS A 1 350 ? 64.756  42.813  48.817  1.00 83.55  ? 618 LYS A CB    1 
ATOM   969   C  CG    . LYS A 1 350 ? 64.418  44.059  48.023  1.00 83.55  ? 618 LYS A CG    1 
ATOM   970   C  CD    . LYS A 1 350 ? 65.424  44.288  46.916  1.00 83.55  ? 618 LYS A CD    1 
ATOM   971   C  CE    . LYS A 1 350 ? 65.085  45.529  46.117  1.00 83.55  ? 618 LYS A CE    1 
ATOM   972   N  NZ    . LYS A 1 350 ? 66.062  45.762  45.024  1.00 83.55  ? 618 LYS A NZ    1 
ATOM   973   N  N     . GLU A 1 351 ? 62.106  40.945  49.475  1.00 86.01  ? 619 GLU A N     1 
ATOM   974   C  CA    . GLU A 1 351 ? 60.754  40.526  49.134  1.00 86.01  ? 619 GLU A CA    1 
ATOM   975   C  C     . GLU A 1 351 ? 59.821  40.494  50.335  1.00 86.01  ? 619 GLU A C     1 
ATOM   976   O  O     . GLU A 1 351 ? 58.606  40.609  50.156  1.00 86.01  ? 619 GLU A O     1 
ATOM   977   C  CB    . GLU A 1 351 ? 60.781  39.150  48.467  1.00 86.01  ? 619 GLU A CB    1 
ATOM   978   C  CG    . GLU A 1 351 ? 61.321  39.146  47.044  1.00 86.01  ? 619 GLU A CG    1 
ATOM   979   C  CD    . GLU A 1 351 ? 62.836  39.083  46.973  1.00 86.01  ? 619 GLU A CD    1 
ATOM   980   O  OE1   . GLU A 1 351 ? 63.489  39.002  48.034  1.00 86.01  ? 619 GLU A OE1   1 
ATOM   981   O  OE2   . GLU A 1 351 ? 63.377  39.111  45.847  1.00 86.01  ? 619 GLU A OE2   1 
ATOM   982   N  N     . GLN A 1 352 ? 60.346  40.338  51.548  1.00 87.43  ? 620 GLN A N     1 
ATOM   983   C  CA    . GLN A 1 352 ? 59.485  40.422  52.718  1.00 87.43  ? 620 GLN A CA    1 
ATOM   984   C  C     . GLN A 1 352 ? 59.171  41.861  53.091  1.00 87.43  ? 620 GLN A C     1 
ATOM   985   O  O     . GLN A 1 352 ? 58.077  42.138  53.590  1.00 87.43  ? 620 GLN A O     1 
ATOM   986   C  CB    . GLN A 1 352 ? 60.120  39.715  53.910  1.00 87.43  ? 620 GLN A CB    1 
ATOM   987   C  CG    . GLN A 1 352 ? 60.206  38.214  53.766  1.00 87.43  ? 620 GLN A CG    1 
ATOM   988   C  CD    . GLN A 1 352 ? 60.857  37.562  54.962  1.00 87.43  ? 620 GLN A CD    1 
ATOM   989   O  OE1   . GLN A 1 352 ? 61.302  38.241  55.880  1.00 87.43  ? 620 GLN A OE1   1 
ATOM   990   N  NE2   . GLN A 1 352 ? 60.915  36.239  54.958  1.00 87.43  ? 620 GLN A NE2   1 
ATOM   991   N  N     . LEU A 1 353 ? 60.109  42.784  52.868  1.00 81.89  ? 621 LEU A N     1 
ATOM   992   C  CA    . LEU A 1 353 ? 59.868  44.179  53.213  1.00 81.89  ? 621 LEU A CA    1 
ATOM   993   C  C     . LEU A 1 353 ? 58.933  44.846  52.226  1.00 81.89  ? 621 LEU A C     1 
ATOM   994   O  O     . LEU A 1 353 ? 58.207  45.769  52.599  1.00 81.89  ? 621 LEU A O     1 
ATOM   995   C  CB    . LEU A 1 353 ? 61.181  44.949  53.277  1.00 81.89  ? 621 LEU A CB    1 
ATOM   996   C  CG    . LEU A 1 353 ? 62.121  44.593  54.422  1.00 81.89  ? 621 LEU A CG    1 
ATOM   997   C  CD1   . LEU A 1 353 ? 63.431  45.341  54.286  1.00 81.89  ? 621 LEU A CD1   1 
ATOM   998   C  CD2   . LEU A 1 353 ? 61.465  44.885  55.747  1.00 81.89  ? 621 LEU A CD2   1 
ATOM   999   N  N     . LEU A 1 354 ? 58.949  44.409  50.969  1.00 81.46  ? 622 LEU A N     1 
ATOM   1000  C  CA    . LEU A 1 354 ? 58.026  44.953  49.983  1.00 81.46  ? 622 LEU A CA    1 
ATOM   1001  C  C     . LEU A 1 354 ? 56.594  44.541  50.281  1.00 81.46  ? 622 LEU A C     1 
ATOM   1002  O  O     . LEU A 1 354 ? 55.661  45.299  50.005  1.00 81.46  ? 622 LEU A O     1 
ATOM   1003  C  CB    . LEU A 1 354 ? 58.445  44.505  48.586  1.00 81.46  ? 622 LEU A CB    1 
ATOM   1004  C  CG    . LEU A 1 354 ? 57.636  44.981  47.385  1.00 81.46  ? 622 LEU A CG    1 
ATOM   1005  C  CD1   . LEU A 1 354 ? 57.648  46.474  47.341  1.00 81.46  ? 622 LEU A CD1   1 
ATOM   1006  C  CD2   . LEU A 1 354 ? 58.236  44.432  46.113  1.00 81.46  ? 622 LEU A CD2   1 
ATOM   1007  N  N     . ASP A 1 355 ? 56.397  43.367  50.875  1.00 86.65  ? 623 ASP A N     1 
ATOM   1008  C  CA    . ASP A 1 355 ? 55.045  42.949  51.213  1.00 86.65  ? 623 ASP A CA    1 
ATOM   1009  C  C     . ASP A 1 355 ? 54.536  43.620  52.481  1.00 86.65  ? 623 ASP A C     1 
ATOM   1010  O  O     . ASP A 1 355 ? 53.327  43.835  52.611  1.00 86.65  ? 623 ASP A O     1 
ATOM   1011  C  CB    . ASP A 1 355 ? 54.977  41.432  51.353  1.00 86.65  ? 623 ASP A CB    1 
ATOM   1012  C  CG    . ASP A 1 355 ? 55.174  40.725  50.035  1.00 86.65  ? 623 ASP A CG    1 
ATOM   1013  O  OD1   . ASP A 1 355 ? 54.943  41.355  48.984  1.00 86.65  ? 623 ASP A OD1   1 
ATOM   1014  O  OD2   . ASP A 1 355 ? 55.533  39.532  50.047  1.00 86.65  ? 623 ASP A OD2   1 
ATOM   1015  N  N     . ARG A 1 356 ? 55.420  43.944  53.426  1.00 85.82  ? 624 ARG A N     1 
ATOM   1016  C  CA    . ARG A 1 356 ? 55.016  44.794  54.541  1.00 85.82  ? 624 ARG A CA    1 
ATOM   1017  C  C     . ARG A 1 356 ? 54.707  46.206  54.077  1.00 85.82  ? 624 ARG A C     1 
ATOM   1018  O  O     . ARG A 1 356 ? 53.833  46.872  54.639  1.00 85.82  ? 624 ARG A O     1 
ATOM   1019  C  CB    . ARG A 1 356 ? 56.103  44.842  55.608  1.00 85.82  ? 624 ARG A CB    1 
ATOM   1020  C  CG    . ARG A 1 356 ? 56.291  43.569  56.381  1.00 85.82  ? 624 ARG A CG    1 
ATOM   1021  C  CD    . ARG A 1 356 ? 57.344  43.766  57.449  1.00 85.82  ? 624 ARG A CD    1 
ATOM   1022  N  NE    . ARG A 1 356 ? 57.633  42.527  58.158  1.00 85.82  ? 624 ARG A NE    1 
ATOM   1023  C  CZ    . ARG A 1 356 ? 56.988  42.124  59.246  1.00 85.82  ? 624 ARG A CZ    1 
ATOM   1024  N  NH1   . ARG A 1 356 ? 56.016  42.869  59.754  1.00 85.82  ? 624 ARG A NH1   1 
ATOM   1025  N  NH2   . ARG A 1 356 ? 57.315  40.979  59.828  1.00 85.82  ? 624 ARG A NH2   1 
ATOM   1026  N  N     . MET A 1 357 ? 55.412  46.673  53.055  1.00 80.75  ? 625 MET A N     1 
ATOM   1027  C  CA    . MET A 1 357 ? 55.255  48.035  52.575  1.00 80.75  ? 625 MET A CA    1 
ATOM   1028  C  C     . MET A 1 357 ? 54.018  48.170  51.708  1.00 80.75  ? 625 MET A C     1 
ATOM   1029  O  O     . MET A 1 357 ? 53.348  49.206  51.732  1.00 80.75  ? 625 MET A O     1 
ATOM   1030  C  CB    . MET A 1 357 ? 56.505  48.425  51.804  1.00 80.75  ? 625 MET A CB    1 
ATOM   1031  C  CG    . MET A 1 357 ? 56.592  49.817  51.308  1.00 80.75  ? 625 MET A CG    1 
ATOM   1032  S  SD    . MET A 1 357 ? 58.243  49.928  50.621  1.00 80.75  ? 625 MET A SD    1 
ATOM   1033  C  CE    . MET A 1 357 ? 58.215  51.569  49.968  1.00 80.75  ? 625 MET A CE    1 
ATOM   1034  N  N     . CYS A 1 358 ? 53.700  47.133  50.937  1.00 82.32  ? 626 CYS A N     1 
ATOM   1035  C  CA    . CYS A 1 358 ? 52.464  47.139  50.173  1.00 82.32  ? 626 CYS A CA    1 
ATOM   1036  C  C     . CYS A 1 358 ? 51.247  46.928  51.057  1.00 82.32  ? 626 CYS A C     1 
ATOM   1037  O  O     . CYS A 1 358 ? 50.143  47.317  50.670  1.00 82.32  ? 626 CYS A O     1 
ATOM   1038  C  CB    . CYS A 1 358 ? 52.510  46.069  49.086  1.00 82.32  ? 626 CYS A CB    1 
ATOM   1039  S  SG    . CYS A 1 358 ? 53.642  46.400  47.725  1.00 82.32  ? 626 CYS A SG    1 
ATOM   1040  N  N     . MET A 1 359 ? 51.421  46.315  52.225  1.00 83.60  ? 627 MET A N     1 
ATOM   1041  C  CA    . MET A 1 359 ? 50.304  46.165  53.146  1.00 83.60  ? 627 MET A CA    1 
ATOM   1042  C  C     . MET A 1 359 ? 49.996  47.477  53.851  1.00 83.60  ? 627 MET A C     1 
ATOM   1043  O  O     . MET A 1 359 ? 48.828  47.793  54.091  1.00 83.60  ? 627 MET A O     1 
ATOM   1044  C  CB    . MET A 1 359 ? 50.606  45.059  54.157  1.00 83.60  ? 627 MET A CB    1 
ATOM   1045  C  CG    . MET A 1 359 ? 49.473  44.714  55.114  1.00 83.60  ? 627 MET A CG    1 
ATOM   1046  S  SD    . MET A 1 359 ? 49.464  45.617  56.672  1.00 83.60  ? 627 MET A SD    1 
ATOM   1047  C  CE    . MET A 1 359 ? 50.840  44.836  57.504  1.00 83.60  ? 627 MET A CE    1 
ATOM   1048  N  N     . THR A 1 360 ? 51.028  48.251  54.183  1.00 80.45  ? 628 THR A N     1 
ATOM   1049  C  CA    . THR A 1 360 ? 50.821  49.505  54.899  1.00 80.45  ? 628 THR A CA    1 
ATOM   1050  C  C     . THR A 1 360 ? 50.218  50.565  53.986  1.00 80.45  ? 628 THR A C     1 
ATOM   1051  O  O     . THR A 1 360 ? 49.336  51.323  54.401  1.00 80.45  ? 628 THR A O     1 
ATOM   1052  C  CB    . THR A 1 360 ? 52.145  49.982  55.484  1.00 80.45  ? 628 THR A CB    1 
ATOM   1053  O  OG1   . THR A 1 360 ? 52.697  48.940  56.294  1.00 80.45  ? 628 THR A OG1   1 
ATOM   1054  C  CG2   . THR A 1 360 ? 51.939  51.192  56.358  1.00 80.45  ? 628 THR A CG2   1 
ATOM   1055  N  N     . LEU A 1 361 ? 50.642  50.598  52.725  1.00 77.86  ? 629 LEU A N     1 
ATOM   1056  C  CA    . LEU A 1 361 ? 50.039  51.485  51.740  1.00 77.86  ? 629 LEU A CA    1 
ATOM   1057  C  C     . LEU A 1 361 ? 48.637  51.065  51.330  1.00 77.86  ? 629 LEU A C     1 
ATOM   1058  O  O     . LEU A 1 361 ? 47.966  51.839  50.641  1.00 77.86  ? 629 LEU A O     1 
ATOM   1059  C  CB    . LEU A 1 361 ? 50.900  51.543  50.485  1.00 77.86  ? 629 LEU A CB    1 
ATOM   1060  C  CG    . LEU A 1 361 ? 52.249  52.226  50.568  1.00 77.86  ? 629 LEU A CG    1 
ATOM   1061  C  CD1   . LEU A 1 361 ? 53.012  51.969  49.292  1.00 77.86  ? 629 LEU A CD1   1 
ATOM   1062  C  CD2   . LEU A 1 361 ? 52.014  53.698  50.755  1.00 77.86  ? 629 LEU A CD2   1 
ATOM   1063  N  N     . GLY A 1 362 ? 48.192  49.866  51.713  1.00 79.39  ? 630 GLY A N     1 
ATOM   1064  C  CA    . GLY A 1 362 ? 46.935  49.323  51.232  1.00 79.39  ? 630 GLY A CA    1 
ATOM   1065  C  C     . GLY A 1 362 ? 45.708  50.088  51.669  1.00 79.39  ? 630 GLY A C     1 
ATOM   1066  O  O     . GLY A 1 362 ? 44.692  50.057  50.966  1.00 79.39  ? 630 GLY A O     1 
ATOM   1067  N  N     . GLY A 1 363 ? 45.775  50.778  52.805  1.00 78.76  ? 631 GLY A N     1 
ATOM   1068  C  CA    . GLY A 1 363 ? 44.628  51.549  53.246  1.00 78.76  ? 631 GLY A CA    1 
ATOM   1069  C  C     . GLY A 1 363 ? 44.411  52.797  52.416  1.00 78.76  ? 631 GLY A C     1 
ATOM   1070  O  O     . GLY A 1 363 ? 43.272  53.174  52.134  1.00 78.76  ? 631 GLY A O     1 
ATOM   1071  N  N     . ARG A 1 364 ? 45.496  53.449  52.009  1.00 78.83  ? 632 ARG A N     1 
ATOM   1072  C  CA    . ARG A 1 364 ? 45.373  54.653  51.203  1.00 78.83  ? 632 ARG A CA    1 
ATOM   1073  C  C     . ARG A 1 364 ? 44.941  54.324  49.784  1.00 78.83  ? 632 ARG A C     1 
ATOM   1074  O  O     . ARG A 1 364 ? 44.260  55.128  49.139  1.00 78.83  ? 632 ARG A O     1 
ATOM   1075  C  CB    . ARG A 1 364 ? 46.701  55.402  51.196  1.00 78.83  ? 632 ARG A CB    1 
ATOM   1076  C  CG    . ARG A 1 364 ? 46.636  56.773  50.585  1.00 78.83  ? 632 ARG A CG    1 
ATOM   1077  C  CD    . ARG A 1 364 ? 47.963  57.470  50.691  1.00 78.83  ? 632 ARG A CD    1 
ATOM   1078  N  NE    . ARG A 1 364 ? 47.901  58.816  50.142  1.00 78.83  ? 632 ARG A NE    1 
ATOM   1079  C  CZ    . ARG A 1 364 ? 47.529  59.878  50.844  1.00 78.83  ? 632 ARG A CZ    1 
ATOM   1080  N  NH1   . ARG A 1 364 ? 47.191  59.746  52.115  1.00 78.83  ? 632 ARG A NH1   1 
ATOM   1081  N  NH2   . ARG A 1 364 ? 47.497  61.073  50.282  1.00 78.83  ? 632 ARG A NH2   1 
ATOM   1082  N  N     . VAL A 1 365 ? 45.327  53.149  49.287  1.00 78.30  ? 633 VAL A N     1 
ATOM   1083  C  CA    . VAL A 1 365 ? 44.920  52.725  47.954  1.00 78.30  ? 633 VAL A CA    1 
ATOM   1084  C  C     . VAL A 1 365 ? 43.429  52.420  47.930  1.00 78.30  ? 633 VAL A C     1 
ATOM   1085  O  O     . VAL A 1 365 ? 42.731  52.742  46.960  1.00 78.30  ? 633 VAL A O     1 
ATOM   1086  C  CB    . VAL A 1 365 ? 45.769  51.518  47.516  1.00 78.30  ? 633 VAL A CB    1 
ATOM   1087  C  CG1   . VAL A 1 365 ? 45.292  50.955  46.197  1.00 78.30  ? 633 VAL A CG1   1 
ATOM   1088  C  CG2   . VAL A 1 365 ? 47.225  51.914  47.412  1.00 78.30  ? 633 VAL A CG2   1 
ATOM   1089  N  N     . SER A 1 366 ? 42.911  51.841  49.019  1.00 79.34  ? 634 SER A N     1 
ATOM   1090  C  CA    . SER A 1 366 ? 41.487  51.541  49.124  1.00 79.34  ? 634 SER A CA    1 
ATOM   1091  C  C     . SER A 1 366 ? 40.634  52.802  49.113  1.00 79.34  ? 634 SER A C     1 
ATOM   1092  O  O     . SER A 1 366 ? 39.510  52.787  48.602  1.00 79.34  ? 634 SER A O     1 
ATOM   1093  C  CB    . SER A 1 366 ? 41.229  50.737  50.395  1.00 79.34  ? 634 SER A CB    1 
ATOM   1094  O  OG    . SER A 1 366 ? 39.848  50.490  50.568  1.00 79.34  ? 634 SER A OG    1 
ATOM   1095  N  N     . GLU A 1 367 ? 41.161  53.905  49.638  1.00 80.37  ? 635 GLU A N     1 
ATOM   1096  C  CA    . GLU A 1 367 ? 40.425  55.158  49.636  1.00 80.37  ? 635 GLU A CA    1 
ATOM   1097  C  C     . GLU A 1 367 ? 40.395  55.809  48.263  1.00 80.37  ? 635 GLU A C     1 
ATOM   1098  O  O     . GLU A 1 367 ? 39.498  56.612  47.996  1.00 80.37  ? 635 GLU A O     1 
ATOM   1099  C  CB    . GLU A 1 367 ? 41.039  56.113  50.653  1.00 80.37  ? 635 GLU A CB    1 
ATOM   1100  C  CG    . GLU A 1 367 ? 40.903  55.630  52.078  1.00 80.37  ? 635 GLU A CG    1 
ATOM   1101  C  CD    . GLU A 1 367 ? 41.599  56.535  53.066  1.00 80.37  ? 635 GLU A CD    1 
ATOM   1102  O  OE1   . GLU A 1 367 ? 42.303  57.468  52.628  1.00 80.37  ? 635 GLU A OE1   1 
ATOM   1103  O  OE2   . GLU A 1 367 ? 41.449  56.315  54.284  1.00 80.37  ? 635 GLU A OE2   1 
ATOM   1104  N  N     . GLU A 1 368 ? 41.351  55.502  47.392  1.00 80.94  ? 636 GLU A N     1 
ATOM   1105  C  CA    . GLU A 1 368 ? 41.316  56.060  46.047  1.00 80.94  ? 636 GLU A CA    1 
ATOM   1106  C  C     . GLU A 1 368 ? 40.465  55.246  45.091  1.00 80.94  ? 636 GLU A C     1 
ATOM   1107  O  O     . GLU A 1 368 ? 39.973  55.790  44.097  1.00 80.94  ? 636 GLU A O     1 
ATOM   1108  C  CB    . GLU A 1 368 ? 42.720  56.170  45.460  1.00 80.94  ? 636 GLU A CB    1 
ATOM   1109  C  CG    . GLU A 1 368 ? 43.566  57.259  46.045  1.00 80.94  ? 636 GLU A CG    1 
ATOM   1110  C  CD    . GLU A 1 368 ? 44.902  57.350  45.354  1.00 80.94  ? 636 GLU A CD    1 
ATOM   1111  O  OE1   . GLU A 1 368 ? 45.188  56.475  44.510  1.00 80.94  ? 636 GLU A OE1   1 
ATOM   1112  O  OE2   . GLU A 1 368 ? 45.676  58.284  45.643  1.00 80.94  ? 636 GLU A OE2   1 
ATOM   1113  N  N     . ILE A 1 369 ? 40.300  53.954  45.352  1.00 79.76  ? 637 ILE A N     1 
ATOM   1114  C  CA    . ILE A 1 369 ? 39.485  53.125  44.477  1.00 79.76  ? 637 ILE A CA    1 
ATOM   1115  C  C     . ILE A 1 369 ? 38.009  53.398  44.710  1.00 79.76  ? 637 ILE A C     1 
ATOM   1116  O  O     . ILE A 1 369 ? 37.246  53.638  43.768  1.00 79.76  ? 637 ILE A O     1 
ATOM   1117  C  CB    . ILE A 1 369 ? 39.824  51.643  44.695  1.00 79.76  ? 637 ILE A CB    1 
ATOM   1118  C  CG1   . ILE A 1 369 ? 41.281  51.384  44.350  1.00 79.76  ? 637 ILE A CG1   1 
ATOM   1119  C  CG2   . ILE A 1 369 ? 38.948  50.773  43.836  1.00 79.76  ? 637 ILE A CG2   1 
ATOM   1120  C  CD1   . ILE A 1 369 ? 41.766  50.068  44.858  1.00 79.76  ? 637 ILE A CD1   1 
ATOM   1121  N  N     . PHE A 1 370 ? 37.590  53.390  45.972  1.00 81.74  ? 638 PHE A N     1 
ATOM   1122  C  CA    . PHE A 1 370 ? 36.179  53.547  46.289  1.00 81.74  ? 638 PHE A CA    1 
ATOM   1123  C  C     . PHE A 1 370 ? 35.760  55.010  46.292  1.00 81.74  ? 638 PHE A C     1 
ATOM   1124  O  O     . PHE A 1 370 ? 34.773  55.378  45.648  1.00 81.74  ? 638 PHE A O     1 
ATOM   1125  C  CB    . PHE A 1 370 ? 35.888  52.885  47.631  1.00 81.74  ? 638 PHE A CB    1 
ATOM   1126  C  CG    . PHE A 1 370 ? 35.906  51.385  47.576  1.00 81.74  ? 638 PHE A CG    1 
ATOM   1127  C  CD1   . PHE A 1 370 ? 35.683  50.721  46.382  1.00 81.74  ? 638 PHE A CD1   1 
ATOM   1128  C  CD2   . PHE A 1 370 ? 36.185  50.639  48.705  1.00 81.74  ? 638 PHE A CD2   1 
ATOM   1129  C  CE1   . PHE A 1 370 ? 35.704  49.348  46.328  1.00 81.74  ? 638 PHE A CE1   1 
ATOM   1130  C  CE2   . PHE A 1 370 ? 36.211  49.268  48.655  1.00 81.74  ? 638 PHE A CE2   1 
ATOM   1131  C  CZ    . PHE A 1 370 ? 35.972  48.621  47.464  1.00 81.74  ? 638 PHE A CZ    1 
ATOM   1132  N  N     . PHE A 1 371 ? 36.493  55.862  47.003  1.00 80.60  ? 639 PHE A N     1 
ATOM   1133  C  CA    . PHE A 1 371 ? 36.097  57.262  47.073  1.00 80.60  ? 639 PHE A CA    1 
ATOM   1134  C  C     . PHE A 1 371 ? 36.734  58.112  45.986  1.00 80.60  ? 639 PHE A C     1 
ATOM   1135  O  O     . PHE A 1 371 ? 36.087  59.015  45.451  1.00 80.60  ? 639 PHE A O     1 
ATOM   1136  C  CB    . PHE A 1 371 ? 36.457  57.860  48.429  1.00 80.60  ? 639 PHE A CB    1 
ATOM   1137  C  CG    . PHE A 1 371 ? 35.740  57.237  49.574  1.00 80.60  ? 639 PHE A CG    1 
ATOM   1138  C  CD1   . PHE A 1 371 ? 34.383  57.434  49.748  1.00 80.60  ? 639 PHE A CD1   1 
ATOM   1139  C  CD2   . PHE A 1 371 ? 36.434  56.504  50.516  1.00 80.60  ? 639 PHE A CD2   1 
ATOM   1140  C  CE1   . PHE A 1 371 ? 33.724  56.870  50.820  1.00 80.60  ? 639 PHE A CE1   1 
ATOM   1141  C  CE2   . PHE A 1 371 ? 35.787  55.955  51.592  1.00 80.60  ? 639 PHE A CE2   1 
ATOM   1142  C  CZ    . PHE A 1 371 ? 34.430  56.129  51.743  1.00 80.60  ? 639 PHE A CZ    1 
ATOM   1143  N  N     . GLY A 1 372 ? 37.992  57.849  45.654  1.00 81.52  ? 640 GLY A N     1 
ATOM   1144  C  CA    . GLY A 1 372 ? 38.713  58.770  44.804  1.00 81.52  ? 640 GLY A CA    1 
ATOM   1145  C  C     . GLY A 1 372 ? 39.143  60.027  45.517  1.00 81.52  ? 640 GLY A C     1 
ATOM   1146  O  O     . GLY A 1 372 ? 39.361  61.053  44.871  1.00 81.52  ? 640 GLY A O     1 
ATOM   1147  N  N     . ARG A 1 373 ? 39.249  59.979  46.843  1.00 81.13  ? 641 ARG A N     1 
ATOM   1148  C  CA    . ARG A 1 373 ? 39.642  61.130  47.646  1.00 81.13  ? 641 ARG A CA    1 
ATOM   1149  C  C     . ARG A 1 373 ? 40.611  60.662  48.715  1.00 81.13  ? 641 ARG A C     1 
ATOM   1150  O  O     . ARG A 1 373 ? 40.236  59.879  49.591  1.00 81.13  ? 641 ARG A O     1 
ATOM   1151  C  CB    . ARG A 1 373 ? 38.432  61.799  48.304  1.00 81.13  ? 641 ARG A CB    1 
ATOM   1152  C  CG    . ARG A 1 373 ? 37.443  62.452  47.362  1.00 81.13  ? 641 ARG A CG    1 
ATOM   1153  C  CD    . ARG A 1 373 ? 36.275  63.002  48.152  1.00 81.13  ? 641 ARG A CD    1 
ATOM   1154  N  NE    . ARG A 1 373 ? 35.537  61.931  48.810  1.00 81.13  ? 641 ARG A NE    1 
ATOM   1155  C  CZ    . ARG A 1 373 ? 34.568  62.124  49.696  1.00 81.13  ? 641 ARG A CZ    1 
ATOM   1156  N  NH1   . ARG A 1 373 ? 34.215  63.355  50.038  1.00 81.13  ? 641 ARG A NH1   1 
ATOM   1157  N  NH2   . ARG A 1 373 ? 33.954  61.086  50.244  1.00 81.13  ? 641 ARG A NH2   1 
ATOM   1158  N  N     . ILE A 1 374 ? 41.839  61.136  48.646  1.00 77.56  ? 642 ILE A N     1 
ATOM   1159  C  CA    . ILE A 1 374 ? 42.817  60.883  49.696  1.00 77.56  ? 642 ILE A CA    1 
ATOM   1160  C  C     . ILE A 1 374 ? 42.512  61.749  50.909  1.00 77.56  ? 642 ILE A C     1 
ATOM   1161  O  O     . ILE A 1 374 ? 42.036  62.881  50.792  1.00 77.56  ? 642 ILE A O     1 
ATOM   1162  C  CB    . ILE A 1 374 ? 44.242  61.126  49.166  1.00 77.56  ? 642 ILE A CB    1 
ATOM   1163  C  CG1   . ILE A 1 374 ? 44.324  62.475  48.455  1.00 77.56  ? 642 ILE A CG1   1 
ATOM   1164  C  CG2   . ILE A 1 374 ? 44.665  60.016  48.257  1.00 77.56  ? 642 ILE A CG2   1 
ATOM   1165  C  CD1   . ILE A 1 374 ? 45.705  62.823  47.974  1.00 77.56  ? 642 ILE A CD1   1 
ATOM   1166  N  N     . THR A 1 375 ? 42.776  61.205  52.087  1.00 77.79  ? 643 THR A N     1 
ATOM   1167  C  CA    . THR A 1 375 ? 42.510  61.876  53.348  1.00 77.79  ? 643 THR A CA    1 
ATOM   1168  C  C     . THR A 1 375 ? 43.819  62.088  54.097  1.00 77.79  ? 643 THR A C     1 
ATOM   1169  O  O     . THR A 1 375 ? 44.909  61.877  53.564  1.00 77.79  ? 643 THR A O     1 
ATOM   1170  C  CB    . THR A 1 375 ? 41.521  61.070  54.187  1.00 77.79  ? 643 THR A CB    1 
ATOM   1171  O  OG1   . THR A 1 375 ? 42.079  59.781  54.460  1.00 77.79  ? 643 THR A OG1   1 
ATOM   1172  C  CG2   . THR A 1 375 ? 40.212  60.898  53.451  1.00 77.79  ? 643 THR A CG2   1 
ATOM   1173  N  N     . THR A 1 376 ? 43.708  62.526  55.346  1.00 76.49  ? 644 THR A N     1 
ATOM   1174  C  CA    . THR A 1 376 ? 44.859  62.655  56.224  1.00 76.49  ? 644 THR A CA    1 
ATOM   1175  C  C     . THR A 1 376 ? 44.943  61.525  57.228  1.00 76.49  ? 644 THR A C     1 
ATOM   1176  O  O     . THR A 1 376 ? 45.747  61.596  58.160  1.00 76.49  ? 644 THR A O     1 
ATOM   1177  C  CB    . THR A 1 376 ? 44.821  63.986  56.966  1.00 76.49  ? 644 THR A CB    1 
ATOM   1178  O  OG1   . THR A 1 376 ? 43.643  64.041  57.775  1.00 76.49  ? 644 THR A OG1   1 
ATOM   1179  C  CG2   . THR A 1 376 ? 44.816  65.131  55.992  1.00 76.49  ? 644 THR A CG2   1 
ATOM   1180  N  N     . GLY A 1 377 ? 44.121  60.488  57.071  1.00 76.36  ? 645 GLY A N     1 
ATOM   1181  C  CA    . GLY A 1 377 ? 44.210  59.344  57.957  1.00 76.36  ? 645 GLY A CA    1 
ATOM   1182  C  C     . GLY A 1 377 ? 45.420  58.477  57.708  1.00 76.36  ? 645 GLY A C     1 
ATOM   1183  O  O     . GLY A 1 377 ? 45.815  57.711  58.592  1.00 76.36  ? 645 GLY A O     1 
ATOM   1184  N  N     . ALA A 1 378 ? 46.027  58.590  56.531  1.00 76.05  ? 646 ALA A N     1 
ATOM   1185  C  CA    . ALA A 1 378 ? 47.173  57.778  56.168  1.00 76.05  ? 646 ALA A CA    1 
ATOM   1186  C  C     . ALA A 1 378 ? 48.496  58.427  56.538  1.00 76.05  ? 646 ALA A C     1 
ATOM   1187  O  O     . ALA A 1 378 ? 49.528  58.057  55.973  1.00 76.05  ? 646 ALA A O     1 
ATOM   1188  C  CB    . ALA A 1 378 ? 47.142  57.473  54.672  1.00 76.05  ? 646 ALA A CB    1 
ATOM   1189  N  N     . GLN A 1 379 ? 48.497  59.380  57.470  1.00 75.11  ? 647 GLN A N     1 
ATOM   1190  C  CA    . GLN A 1 379 ? 49.753  60.013  57.855  1.00 75.11  ? 647 GLN A CA    1 
ATOM   1191  C  C     . GLN A 1 379 ? 50.624  59.061  58.662  1.00 75.11  ? 647 GLN A C     1 
ATOM   1192  O  O     . GLN A 1 379 ? 51.839  58.993  58.451  1.00 75.11  ? 647 GLN A O     1 
ATOM   1193  C  CB    . GLN A 1 379 ? 49.489  61.286  58.652  1.00 75.11  ? 647 GLN A CB    1 
ATOM   1194  C  CG    . GLN A 1 379 ? 50.756  62.054  58.963  1.00 75.11  ? 647 GLN A CG    1 
ATOM   1195  C  CD    . GLN A 1 379 ? 50.512  63.299  59.778  1.00 75.11  ? 647 GLN A CD    1 
ATOM   1196  O  OE1   . GLN A 1 379 ? 49.391  63.563  60.208  1.00 75.11  ? 647 GLN A OE1   1 
ATOM   1197  N  NE2   . GLN A 1 379 ? 51.562  64.081  59.990  1.00 75.11  ? 647 GLN A NE2   1 
ATOM   1198  N  N     . ASP A 1 380 ? 50.022  58.307  59.581  1.00 77.84  ? 648 ASP A N     1 
ATOM   1199  C  CA    . ASP A 1 380 ? 50.777  57.304  60.319  1.00 77.84  ? 648 ASP A CA    1 
ATOM   1200  C  C     . ASP A 1 380 ? 51.156  56.115  59.452  1.00 77.84  ? 648 ASP A C     1 
ATOM   1201  O  O     . ASP A 1 380 ? 52.070  55.369  59.811  1.00 77.84  ? 648 ASP A O     1 
ATOM   1202  C  CB    . ASP A 1 380 ? 49.982  56.821  61.529  1.00 77.84  ? 648 ASP A CB    1 
ATOM   1203  C  CG    . ASP A 1 380 ? 49.864  57.877  62.609  1.00 77.84  ? 648 ASP A CG    1 
ATOM   1204  O  OD1   . ASP A 1 380 ? 50.779  58.719  62.721  1.00 77.84  ? 648 ASP A OD1   1 
ATOM   1205  O  OD2   . ASP A 1 380 ? 48.857  57.864  63.347  1.00 77.84  ? 648 ASP A OD2   1 
ATOM   1206  N  N     . ASP A 1 381 ? 50.470  55.913  58.331  1.00 79.25  ? 649 ASP A N     1 
ATOM   1207  C  CA    . ASP A 1 381 ? 50.835  54.860  57.398  1.00 79.25  ? 649 ASP A CA    1 
ATOM   1208  C  C     . ASP A 1 381 ? 51.910  55.303  56.423  1.00 79.25  ? 649 ASP A C     1 
ATOM   1209  O  O     . ASP A 1 381 ? 52.749  54.487  56.032  1.00 79.25  ? 649 ASP A O     1 
ATOM   1210  C  CB    . ASP A 1 381 ? 49.600  54.382  56.633  1.00 79.25  ? 649 ASP A CB    1 
ATOM   1211  C  CG    . ASP A 1 381 ? 48.639  53.617  57.514  1.00 79.25  ? 649 ASP A CG    1 
ATOM   1212  O  OD1   . ASP A 1 381 ? 49.104  52.939  58.451  1.00 79.25  ? 649 ASP A OD1   1 
ATOM   1213  O  OD2   . ASP A 1 381 ? 47.418  53.704  57.290  1.00 79.25  ? 649 ASP A OD2   1 
ATOM   1214  N  N     . LEU A 1 382 ? 51.920  56.575  56.029  1.00 72.94  ? 650 LEU A N     1 
ATOM   1215  C  CA    . LEU A 1 382 ? 53.000  57.080  55.194  1.00 72.94  ? 650 LEU A CA    1 
ATOM   1216  C  C     . LEU A 1 382 ? 54.264  57.382  55.980  1.00 72.94  ? 650 LEU A C     1 
ATOM   1217  O  O     . LEU A 1 382 ? 55.318  57.569  55.369  1.00 72.94  ? 650 LEU A O     1 
ATOM   1218  C  CB    . LEU A 1 382 ? 52.564  58.334  54.446  1.00 72.94  ? 650 LEU A CB    1 
ATOM   1219  C  CG    . LEU A 1 382 ? 51.524  58.068  53.369  1.00 72.94  ? 650 LEU A CG    1 
ATOM   1220  C  CD1   . LEU A 1 382 ? 51.055  59.361  52.769  1.00 72.94  ? 650 LEU A CD1   1 
ATOM   1221  C  CD2   . LEU A 1 382 ? 52.080  57.160  52.309  1.00 72.94  ? 650 LEU A CD2   1 
ATOM   1222  N  N     . ARG A 1 383 ? 54.194  57.437  57.306  1.00 75.76  ? 651 ARG A N     1 
ATOM   1223  C  CA    . ARG A 1 383 ? 55.418  57.600  58.076  1.00 75.76  ? 651 ARG A CA    1 
ATOM   1224  C  C     . ARG A 1 383 ? 56.196  56.295  58.150  1.00 75.76  ? 651 ARG A C     1 
ATOM   1225  O  O     . ARG A 1 383 ? 57.428  56.299  58.072  1.00 75.76  ? 651 ARG A O     1 
ATOM   1226  C  CB    . ARG A 1 383 ? 55.100  58.117  59.476  1.00 75.76  ? 651 ARG A CB    1 
ATOM   1227  C  CG    . ARG A 1 383 ? 56.330  58.443  60.300  1.00 75.76  ? 651 ARG A CG    1 
ATOM   1228  C  CD    . ARG A 1 383 ? 55.972  59.000  61.662  1.00 75.76  ? 651 ARG A CD    1 
ATOM   1229  N  NE    . ARG A 1 383 ? 55.291  60.286  61.565  1.00 75.76  ? 651 ARG A NE    1 
ATOM   1230  C  CZ    . ARG A 1 383 ? 54.033  60.492  61.934  1.00 75.76  ? 651 ARG A CZ    1 
ATOM   1231  N  NH1   . ARG A 1 383 ? 53.315  59.494  62.432  1.00 75.76  ? 651 ARG A NH1   1 
ATOM   1232  N  NH2   . ARG A 1 383 ? 53.491  61.696  61.811  1.00 75.76  ? 651 ARG A NH2   1 
ATOM   1233  N  N     . LYS A 1 384 ? 55.494  55.169  58.287  1.00 73.34  ? 652 LYS A N     1 
ATOM   1234  C  CA    . LYS A 1 384 ? 56.170  53.879  58.322  1.00 73.34  ? 652 LYS A CA    1 
ATOM   1235  C  C     . LYS A 1 384 ? 56.725  53.490  56.964  1.00 73.34  ? 652 LYS A C     1 
ATOM   1236  O  O     . LYS A 1 384 ? 57.695  52.734  56.896  1.00 73.34  ? 652 LYS A O     1 
ATOM   1237  C  CB    . LYS A 1 384 ? 55.218  52.794  58.805  1.00 73.34  ? 652 LYS A CB    1 
ATOM   1238  C  CG    . LYS A 1 384 ? 54.841  52.884  60.257  1.00 73.34  ? 652 LYS A CG    1 
ATOM   1239  C  CD    . LYS A 1 384 ? 53.923  51.733  60.624  1.00 73.34  ? 652 LYS A CD    1 
ATOM   1240  C  CE    . LYS A 1 384 ? 53.486  51.801  62.074  1.00 73.34  ? 652 LYS A CE    1 
ATOM   1241  N  NZ    . LYS A 1 384 ? 52.578  50.673  62.418  1.00 73.34  ? 652 LYS A NZ    1 
ATOM   1242  N  N     . VAL A 1 385 ? 56.122  53.972  55.880  1.00 71.41  ? 653 VAL A N     1 
ATOM   1243  C  CA    . VAL A 1 385 ? 56.635  53.665  54.551  1.00 71.41  ? 653 VAL A CA    1 
ATOM   1244  C  C     . VAL A 1 385 ? 57.948  54.389  54.311  1.00 71.41  ? 653 VAL A C     1 
ATOM   1245  O  O     . VAL A 1 385 ? 58.914  53.805  53.807  1.00 71.41  ? 653 VAL A O     1 
ATOM   1246  C  CB    . VAL A 1 385 ? 55.582  54.012  53.486  1.00 71.41  ? 653 VAL A CB    1 
ATOM   1247  C  CG1   . VAL A 1 385 ? 56.178  53.979  52.100  1.00 71.41  ? 653 VAL A CG1   1 
ATOM   1248  C  CG2   . VAL A 1 385 ? 54.450  53.023  53.564  1.00 71.41  ? 653 VAL A CG2   1 
ATOM   1249  N  N     . THR A 1 386 ? 58.023  55.653  54.719  1.00 73.01  ? 654 THR A N     1 
ATOM   1250  C  CA    . THR A 1 386 ? 59.225  56.438  54.477  1.00 73.01  ? 654 THR A CA    1 
ATOM   1251  C  C     . THR A 1 386 ? 60.364  55.994  55.384  1.00 73.01  ? 654 THR A C     1 
ATOM   1252  O  O     . THR A 1 386 ? 61.528  55.995  54.972  1.00 73.01  ? 654 THR A O     1 
ATOM   1253  C  CB    . THR A 1 386 ? 58.912  57.916  54.677  1.00 73.01  ? 654 THR A CB    1 
ATOM   1254  O  OG1   . THR A 1 386 ? 57.752  58.250  53.915  1.00 73.01  ? 654 THR A OG1   1 
ATOM   1255  C  CG2   . THR A 1 386 ? 60.039  58.763  54.170  1.00 73.01  ? 654 THR A CG2   1 
ATOM   1256  N  N     . GLN A 1 387 ? 60.050  55.576  56.610  1.00 72.85  ? 655 GLN A N     1 
ATOM   1257  C  CA    . GLN A 1 387 ? 61.106  55.115  57.504  1.00 72.85  ? 655 GLN A CA    1 
ATOM   1258  C  C     . GLN A 1 387 ? 61.613  53.734  57.118  1.00 72.85  ? 655 GLN A C     1 
ATOM   1259  O  O     . GLN A 1 387 ? 62.777  53.414  57.371  1.00 72.85  ? 655 GLN A O     1 
ATOM   1260  C  CB    . GLN A 1 387 ? 60.625  55.100  58.950  1.00 72.85  ? 655 GLN A CB    1 
ATOM   1261  C  CG    . GLN A 1 387 ? 60.394  56.466  59.547  1.00 72.85  ? 655 GLN A CG    1 
ATOM   1262  C  CD    . GLN A 1 387 ? 59.935  56.389  60.985  1.00 72.85  ? 655 GLN A CD    1 
ATOM   1263  O  OE1   . GLN A 1 387 ? 59.730  55.303  61.524  1.00 72.85  ? 655 GLN A OE1   1 
ATOM   1264  N  NE2   . GLN A 1 387 ? 59.772  57.544  61.618  1.00 72.85  ? 655 GLN A NE2   1 
ATOM   1265  N  N     . SER A 1 388 ? 60.767  52.905  56.520  1.00 71.46  ? 656 SER A N     1 
ATOM   1266  C  CA    . SER A 1 388 ? 61.178  51.586  56.068  1.00 71.46  ? 656 SER A CA    1 
ATOM   1267  C  C     . SER A 1 388 ? 61.666  51.587  54.634  1.00 71.46  ? 656 SER A C     1 
ATOM   1268  O  O     . SER A 1 388 ? 61.806  50.516  54.041  1.00 71.46  ? 656 SER A O     1 
ATOM   1269  C  CB    . SER A 1 388 ? 60.036  50.583  56.213  1.00 71.46  ? 656 SER A CB    1 
ATOM   1270  O  OG    . SER A 1 388 ? 60.413  49.317  55.703  1.00 71.46  ? 656 SER A OG    1 
ATOM   1271  N  N     . ALA A 1 389 ? 61.904  52.751  54.060  1.00 70.95  ? 657 ALA A N     1 
ATOM   1272  C  CA    . ALA A 1 389 ? 62.504  52.843  52.745  1.00 70.95  ? 657 ALA A CA    1 
ATOM   1273  C  C     . ALA A 1 389 ? 63.825  53.583  52.750  1.00 70.95  ? 657 ALA A C     1 
ATOM   1274  O  O     . ALA A 1 389 ? 64.679  53.293  51.911  1.00 70.95  ? 657 ALA A O     1 
ATOM   1275  C  CB    . ALA A 1 389 ? 61.545  53.522  51.765  1.00 70.95  ? 657 ALA A CB    1 
ATOM   1276  N  N     . TYR A 1 390 ? 64.015  54.532  53.665  1.00 73.88  ? 658 TYR A N     1 
ATOM   1277  C  CA    . TYR A 1 390 ? 65.353  55.045  53.923  1.00 73.88  ? 658 TYR A CA    1 
ATOM   1278  C  C     . TYR A 1 390 ? 66.241  53.966  54.511  1.00 73.88  ? 658 TYR A C     1 
ATOM   1279  O  O     . TYR A 1 390 ? 67.357  53.746  54.033  1.00 73.88  ? 658 TYR A O     1 
ATOM   1280  C  CB    . TYR A 1 390 ? 65.293  56.253  54.853  1.00 73.88  ? 658 TYR A CB    1 
ATOM   1281  C  CG    . TYR A 1 390 ? 64.949  57.535  54.152  1.00 73.88  ? 658 TYR A CG    1 
ATOM   1282  C  CD1   . TYR A 1 390 ? 65.030  57.623  52.784  1.00 73.88  ? 658 TYR A CD1   1 
ATOM   1283  C  CD2   . TYR A 1 390 ? 64.578  58.664  54.860  1.00 73.88  ? 658 TYR A CD2   1 
ATOM   1284  C  CE1   . TYR A 1 390 ? 64.733  58.780  52.127  1.00 73.88  ? 658 TYR A CE1   1 
ATOM   1285  C  CE2   . TYR A 1 390 ? 64.280  59.840  54.206  1.00 73.88  ? 658 TYR A CE2   1 
ATOM   1286  C  CZ    . TYR A 1 390 ? 64.361  59.884  52.834  1.00 73.88  ? 658 TYR A CZ    1 
ATOM   1287  O  OH    . TYR A 1 390 ? 64.072  61.037  52.145  1.00 73.88  ? 658 TYR A OH    1 
ATOM   1288  N  N     . ALA A 1 391 ? 65.756  53.270  55.539  1.00 74.56  ? 659 ALA A N     1 
ATOM   1289  C  CA    . ALA A 1 391 ? 66.555  52.230  56.172  1.00 74.56  ? 659 ALA A CA    1 
ATOM   1290  C  C     . ALA A 1 391 ? 66.756  51.033  55.262  1.00 74.56  ? 659 ALA A C     1 
ATOM   1291  O  O     . ALA A 1 391 ? 67.749  50.318  55.406  1.00 74.56  ? 659 ALA A O     1 
ATOM   1292  C  CB    . ALA A 1 391 ? 65.903  51.784  57.478  1.00 74.56  ? 659 ALA A CB    1 
ATOM   1293  N  N     . GLN A 1 392 ? 65.848  50.822  54.316  1.00 73.01  ? 660 GLN A N     1 
ATOM   1294  C  CA    . GLN A 1 392 ? 66.026  49.763  53.339  1.00 73.01  ? 660 GLN A CA    1 
ATOM   1295  C  C     . GLN A 1 392 ? 67.104  50.121  52.324  1.00 73.01  ? 660 GLN A C     1 
ATOM   1296  O  O     . GLN A 1 392 ? 67.812  49.235  51.843  1.00 73.01  ? 660 GLN A O     1 
ATOM   1297  C  CB    . GLN A 1 392 ? 64.681  49.486  52.670  1.00 73.01  ? 660 GLN A CB    1 
ATOM   1298  C  CG    . GLN A 1 392 ? 64.635  48.319  51.729  1.00 73.01  ? 660 GLN A CG    1 
ATOM   1299  C  CD    . GLN A 1 392 ? 63.230  48.000  51.287  1.00 73.01  ? 660 GLN A CD    1 
ATOM   1300  O  OE1   . GLN A 1 392 ? 62.279  48.662  51.688  1.00 73.01  ? 660 GLN A OE1   1 
ATOM   1301  N  NE2   . GLN A 1 392 ? 63.089  46.976  50.459  1.00 73.01  ? 660 GLN A NE2   1 
ATOM   1302  N  N     . ILE A 1 393 ? 67.282  51.401  52.022  1.00 70.87  ? 661 ILE A N     1 
ATOM   1303  C  CA    . ILE A 1 393 ? 68.279  51.837  51.048  1.00 70.87  ? 661 ILE A CA    1 
ATOM   1304  C  C     . ILE A 1 393 ? 69.566  52.304  51.716  1.00 70.87  ? 661 ILE A C     1 
ATOM   1305  O  O     . ILE A 1 393 ? 70.655  51.870  51.345  1.00 70.87  ? 661 ILE A O     1 
ATOM   1306  C  CB    . ILE A 1 393 ? 67.685  52.924  50.127  1.00 70.87  ? 661 ILE A CB    1 
ATOM   1307  C  CG1   . ILE A 1 393 ? 66.693  52.279  49.170  1.00 70.87  ? 661 ILE A CG1   1 
ATOM   1308  C  CG2   . ILE A 1 393 ? 68.761  53.674  49.377  1.00 70.87  ? 661 ILE A CG2   1 
ATOM   1309  C  CD1   . ILE A 1 393 ? 66.008  53.234  48.261  1.00 70.87  ? 661 ILE A CD1   1 
ATOM   1310  N  N     . VAL A 1 394 ? 69.468  53.181  52.712  1.00 75.35  ? 662 VAL A N     1 
ATOM   1311  C  CA    . VAL A 1 394 ? 70.672  53.732  53.325  1.00 75.35  ? 662 VAL A CA    1 
ATOM   1312  C  C     . VAL A 1 394 ? 71.317  52.726  54.267  1.00 75.35  ? 662 VAL A C     1 
ATOM   1313  O  O     . VAL A 1 394 ? 72.504  52.413  54.138  1.00 75.35  ? 662 VAL A O     1 
ATOM   1314  C  CB    . VAL A 1 394 ? 70.353  55.052  54.046  1.00 75.35  ? 662 VAL A CB    1 
ATOM   1315  C  CG1   . VAL A 1 394 ? 71.557  55.533  54.816  1.00 75.35  ? 662 VAL A CG1   1 
ATOM   1316  C  CG2   . VAL A 1 394 ? 69.937  56.089  53.046  1.00 75.35  ? 662 VAL A CG2   1 
ATOM   1317  N  N     . GLN A 1 395 ? 70.555  52.205  55.229  1.00 76.83  ? 663 GLN A N     1 
ATOM   1318  C  CA    . GLN A 1 395 ? 71.150  51.327  56.231  1.00 76.83  ? 663 GLN A CA    1 
ATOM   1319  C  C     . GLN A 1 395 ? 71.447  49.938  55.687  1.00 76.83  ? 663 GLN A C     1 
ATOM   1320  O  O     . GLN A 1 395 ? 72.344  49.258  56.196  1.00 76.83  ? 663 GLN A O     1 
ATOM   1321  C  CB    . GLN A 1 395 ? 70.239  51.210  57.448  1.00 76.83  ? 663 GLN A CB    1 
ATOM   1322  C  CG    . GLN A 1 395 ? 70.184  52.434  58.317  1.00 76.83  ? 663 GLN A CG    1 
ATOM   1323  C  CD    . GLN A 1 395 ? 69.286  52.228  59.513  1.00 76.83  ? 663 GLN A CD    1 
ATOM   1324  O  OE1   . GLN A 1 395 ? 68.611  51.210  59.623  1.00 76.83  ? 663 GLN A OE1   1 
ATOM   1325  N  NE2   . GLN A 1 395 ? 69.291  53.184  60.432  1.00 76.83  ? 663 GLN A NE2   1 
ATOM   1326  N  N     . PHE A 1 396 ? 70.709  49.488  54.686  1.00 77.16  ? 664 PHE A N     1 
ATOM   1327  C  CA    . PHE A 1 396 ? 70.891  48.157  54.129  1.00 77.16  ? 664 PHE A CA    1 
ATOM   1328  C  C     . PHE A 1 396 ? 71.506  48.313  52.747  1.00 77.16  ? 664 PHE A C     1 
ATOM   1329  O  O     . PHE A 1 396 ? 71.878  49.413  52.332  1.00 77.16  ? 664 PHE A O     1 
ATOM   1330  C  CB    . PHE A 1 396 ? 69.559  47.407  54.081  1.00 77.16  ? 664 PHE A CB    1 
ATOM   1331  C  CG    . PHE A 1 396 ? 68.909  47.219  55.426  1.00 77.16  ? 664 PHE A CG    1 
ATOM   1332  C  CD1   . PHE A 1 396 ? 69.655  47.176  56.590  1.00 77.16  ? 664 PHE A CD1   1 
ATOM   1333  C  CD2   . PHE A 1 396 ? 67.532  47.156  55.525  1.00 77.16  ? 664 PHE A CD2   1 
ATOM   1334  C  CE1   . PHE A 1 396 ? 69.043  47.039  57.814  1.00 77.16  ? 664 PHE A CE1   1 
ATOM   1335  C  CE2   . PHE A 1 396 ? 66.918  47.025  56.747  1.00 77.16  ? 664 PHE A CE2   1 
ATOM   1336  C  CZ    . PHE A 1 396 ? 67.676  46.963  57.891  1.00 77.16  ? 664 PHE A CZ    1 
ATOM   1337  N  N     . GLY A 1 397 ? 71.624  47.213  52.024  1.00 76.30  ? 665 GLY A N     1 
ATOM   1338  C  CA    . GLY A 1 397 ? 72.220  47.319  50.711  1.00 76.30  ? 665 GLY A CA    1 
ATOM   1339  C  C     . GLY A 1 397 ? 71.266  46.915  49.617  1.00 76.30  ? 665 GLY A C     1 
ATOM   1340  O  O     . GLY A 1 397 ? 71.673  46.298  48.631  1.00 76.30  ? 665 GLY A O     1 
ATOM   1341  N  N     . MET A 1 398 ? 69.990  47.249  49.785  1.00 78.80  ? 666 MET A N     1 
ATOM   1342  C  CA    . MET A 1 398 ? 68.969  46.716  48.897  1.00 78.80  ? 666 MET A CA    1 
ATOM   1343  C  C     . MET A 1 398 ? 68.982  47.386  47.534  1.00 78.80  ? 666 MET A C     1 
ATOM   1344  O  O     . MET A 1 398 ? 68.698  46.732  46.526  1.00 78.80  ? 666 MET A O     1 
ATOM   1345  C  CB    . MET A 1 398 ? 67.596  46.870  49.537  1.00 78.80  ? 666 MET A CB    1 
ATOM   1346  C  CG    . MET A 1 398 ? 67.456  46.158  50.865  1.00 78.80  ? 666 MET A CG    1 
ATOM   1347  S  SD    . MET A 1 398 ? 67.560  44.377  50.827  1.00 78.80  ? 666 MET A SD    1 
ATOM   1348  C  CE    . MET A 1 398 ? 67.531  44.047  52.580  1.00 78.80  ? 666 MET A CE    1 
ATOM   1349  N  N     . ASN A 1 399 ? 69.308  48.668  47.477  1.00 72.09  ? 667 ASN A N     1 
ATOM   1350  C  CA    . ASN A 1 399 ? 69.331  49.368  46.208  1.00 72.09  ? 667 ASN A CA    1 
ATOM   1351  C  C     . ASN A 1 399 ? 70.620  49.051  45.455  1.00 72.09  ? 667 ASN A C     1 
ATOM   1352  O  O     . ASN A 1 399 ? 71.630  48.654  46.038  1.00 72.09  ? 667 ASN A O     1 
ATOM   1353  C  CB    . ASN A 1 399 ? 69.205  50.869  46.434  1.00 72.09  ? 667 ASN A CB    1 
ATOM   1354  C  CG    . ASN A 1 399 ? 68.885  51.625  45.170  1.00 72.09  ? 667 ASN A CG    1 
ATOM   1355  O  OD1   . ASN A 1 399 ? 68.675  51.037  44.114  1.00 72.09  ? 667 ASN A OD1   1 
ATOM   1356  N  ND2   . ASN A 1 399 ? 68.885  52.935  45.262  1.00 72.09  ? 667 ASN A ND2   1 
ATOM   1357  N  N     . GLU A 1 400 ? 70.569  49.226  44.136  1.00 74.05  ? 668 GLU A N     1 
ATOM   1358  C  CA    . GLU A 1 400 ? 71.709  48.988  43.263  1.00 74.05  ? 668 GLU A CA    1 
ATOM   1359  C  C     . GLU A 1 400 ? 72.453  50.264  42.892  1.00 74.05  ? 668 GLU A C     1 
ATOM   1360  O  O     . GLU A 1 400 ? 73.685  50.256  42.827  1.00 74.05  ? 668 GLU A O     1 
ATOM   1361  C  CB    . GLU A 1 400 ? 71.249  48.273  41.990  1.00 74.05  ? 668 GLU A CB    1 
ATOM   1362  C  CG    . GLU A 1 400 ? 72.376  47.838  41.072  1.00 74.05  ? 668 GLU A CG    1 
ATOM   1363  C  CD    . GLU A 1 400 ? 71.880  47.080  39.861  1.00 74.05  ? 668 GLU A CD    1 
ATOM   1364  O  OE1   . GLU A 1 400 ? 70.651  46.911  39.727  1.00 74.05  ? 668 GLU A OE1   1 
ATOM   1365  O  OE2   . GLU A 1 400 ? 72.720  46.652  39.043  1.00 74.05  ? 668 GLU A OE2   1 
ATOM   1366  N  N     . LYS A 1 401 ? 71.741  51.368  42.661  1.00 71.33  ? 669 LYS A N     1 
ATOM   1367  C  CA    . LYS A 1 401 ? 72.415  52.604  42.281  1.00 71.33  ? 669 LYS A CA    1 
ATOM   1368  C  C     . LYS A 1 401 ? 73.119  53.267  43.455  1.00 71.33  ? 669 LYS A C     1 
ATOM   1369  O  O     . LYS A 1 401 ? 74.116  53.966  43.251  1.00 71.33  ? 669 LYS A O     1 
ATOM   1370  C  CB    . LYS A 1 401 ? 71.426  53.582  41.650  1.00 71.33  ? 669 LYS A CB    1 
ATOM   1371  C  CG    . LYS A 1 401 ? 70.939  53.161  40.286  1.00 71.33  ? 669 LYS A CG    1 
ATOM   1372  C  CD    . LYS A 1 401 ? 70.036  54.211  39.684  1.00 71.33  ? 669 LYS A CD    1 
ATOM   1373  C  CE    . LYS A 1 401 ? 69.517  53.776  38.328  1.00 71.33  ? 669 LYS A CE    1 
ATOM   1374  N  NZ    . LYS A 1 401 ? 68.605  54.789  37.735  1.00 71.33  ? 669 LYS A NZ    1 
ATOM   1375  N  N     . VAL A 1 402 ? 72.619  53.085  44.676  1.00 70.62  ? 670 VAL A N     1 
ATOM   1376  C  CA    . VAL A 1 402 ? 73.335  53.605  45.834  1.00 70.62  ? 670 VAL A CA    1 
ATOM   1377  C  C     . VAL A 1 402 ? 74.570  52.764  46.100  1.00 70.62  ? 670 VAL A C     1 
ATOM   1378  O  O     . VAL A 1 402 ? 75.654  53.291  46.376  1.00 70.62  ? 670 VAL A O     1 
ATOM   1379  C  CB    . VAL A 1 402 ? 72.401  53.667  47.056  1.00 70.62  ? 670 VAL A CB    1 
ATOM   1380  C  CG1   . VAL A 1 402 ? 73.165  54.026  48.315  1.00 70.62  ? 670 VAL A CG1   1 
ATOM   1381  C  CG2   . VAL A 1 402 ? 71.320  54.688  46.819  1.00 70.62  ? 670 VAL A CG2   1 
ATOM   1382  N  N     . GLY A 1 403 ? 74.441  51.444  45.973  1.00 70.83  ? 671 GLY A N     1 
ATOM   1383  C  CA    . GLY A 1 403 ? 75.549  50.533  46.162  1.00 70.83  ? 671 GLY A CA    1 
ATOM   1384  C  C     . GLY A 1 403 ? 75.306  49.634  47.360  1.00 70.83  ? 671 GLY A C     1 
ATOM   1385  O  O     . GLY A 1 403 ? 74.174  49.247  47.645  1.00 70.83  ? 671 GLY A O     1 
ATOM   1386  N  N     . GLN A 1 404 ? 76.387  49.321  48.064  1.00 75.80  ? 672 GLN A N     1 
ATOM   1387  C  CA    . GLN A 1 404 ? 76.337  48.444  49.220  1.00 75.80  ? 672 GLN A CA    1 
ATOM   1388  C  C     . GLN A 1 404 ? 76.663  49.205  50.497  1.00 75.80  ? 672 GLN A C     1 
ATOM   1389  O  O     . GLN A 1 404 ? 77.127  48.624  51.477  1.00 75.80  ? 672 GLN A O     1 
ATOM   1390  C  CB    . GLN A 1 404 ? 77.303  47.280  49.029  1.00 75.80  ? 672 GLN A CB    1 
ATOM   1391  C  CG    . GLN A 1 404 ? 77.087  46.495  47.756  1.00 75.80  ? 672 GLN A CG    1 
ATOM   1392  C  CD    . GLN A 1 404 ? 75.776  45.762  47.744  1.00 75.80  ? 672 GLN A CD    1 
ATOM   1393  O  OE1   . GLN A 1 404 ? 75.352  45.211  48.758  1.00 75.80  ? 672 GLN A OE1   1 
ATOM   1394  N  NE2   . GLN A 1 404 ? 75.117  45.751  46.595  1.00 75.80  ? 672 GLN A NE2   1 
ATOM   1395  N  N     . ILE A 1 405 ? 76.426  50.485  50.498  1.00 74.86  ? 673 ILE A N     1 
ATOM   1396  C  CA    . ILE A 1 405 ? 76.901  51.350  51.564  1.00 74.86  ? 673 ILE A CA    1 
ATOM   1397  C  C     . ILE A 1 405 ? 75.880  51.346  52.692  1.00 74.86  ? 673 ILE A C     1 
ATOM   1398  O  O     . ILE A 1 405 ? 74.670  51.388  52.448  1.00 74.86  ? 673 ILE A O     1 
ATOM   1399  C  CB    . ILE A 1 405 ? 77.142  52.766  51.024  1.00 74.86  ? 673 ILE A CB    1 
ATOM   1400  C  CG1   . ILE A 1 405 ? 77.976  52.710  49.754  1.00 74.86  ? 673 ILE A CG1   1 
ATOM   1401  C  CG2   . ILE A 1 405 ? 77.967  53.519  51.986  1.00 74.86  ? 673 ILE A CG2   1 
ATOM   1402  C  CD1   . ILE A 1 405 ? 78.029  54.026  49.023  1.00 74.86  ? 673 ILE A CD1   1 
ATOM   1403  N  N     . SER A 1 406 ? 76.359  51.292  53.933  1.00 77.90  ? 674 SER A N     1 
ATOM   1404  C  CA    . SER A 1 406 ? 75.494  51.194  55.107  1.00 77.90  ? 674 SER A CA    1 
ATOM   1405  C  C     . SER A 1 406 ? 75.848  52.287  56.107  1.00 77.90  ? 674 SER A C     1 
ATOM   1406  O  O     . SER A 1 406 ? 76.756  52.113  56.924  1.00 77.90  ? 674 SER A O     1 
ATOM   1407  C  CB    . SER A 1 406 ? 75.613  49.828  55.757  1.00 77.90  ? 674 SER A CB    1 
ATOM   1408  O  OG    . SER A 1 406 ? 74.805  49.761  56.917  1.00 77.90  ? 674 SER A OG    1 
ATOM   1409  N  N     . PHE A 1 407 ? 75.112  53.393  56.067  1.00 80.86  ? 675 PHE A N     1 
ATOM   1410  C  CA    . PHE A 1 407 ? 75.332  54.498  56.983  1.00 80.86  ? 675 PHE A CA    1 
ATOM   1411  C  C     . PHE A 1 407 ? 74.492  54.316  58.243  1.00 80.86  ? 675 PHE A C     1 
ATOM   1412  O  O     . PHE A 1 407 ? 73.935  53.249  58.504  1.00 80.86  ? 675 PHE A O     1 
ATOM   1413  C  CB    . PHE A 1 407 ? 74.986  55.825  56.327  1.00 80.86  ? 675 PHE A CB    1 
ATOM   1414  C  CG    . PHE A 1 407 ? 75.812  56.148  55.135  1.00 80.86  ? 675 PHE A CG    1 
ATOM   1415  C  CD1   . PHE A 1 407 ? 77.133  56.511  55.270  1.00 80.86  ? 675 PHE A CD1   1 
ATOM   1416  C  CD2   . PHE A 1 407 ? 75.244  56.150  53.880  1.00 80.86  ? 675 PHE A CD2   1 
ATOM   1417  C  CE1   . PHE A 1 407 ? 77.882  56.829  54.168  1.00 80.86  ? 675 PHE A CE1   1 
ATOM   1418  C  CE2   . PHE A 1 407 ? 75.984  56.471  52.777  1.00 80.86  ? 675 PHE A CE2   1 
ATOM   1419  C  CZ    . PHE A 1 407 ? 77.302  56.824  52.922  1.00 80.86  ? 675 PHE A CZ    1 
ATOM   1420  N  N     . ASP A 1 408 ? 74.397  55.375  59.039  1.00 94.69  ? 676 ASP A N     1 
ATOM   1421  C  CA    . ASP A 1 408 ? 73.480  55.457  60.163  1.00 94.69  ? 676 ASP A CA    1 
ATOM   1422  C  C     . ASP A 1 408 ? 72.383  56.471  59.863  1.00 94.69  ? 676 ASP A C     1 
ATOM   1423  O  O     . ASP A 1 408 ? 72.515  57.320  58.978  1.00 94.69  ? 676 ASP A O     1 
ATOM   1424  C  CB    . ASP A 1 408 ? 74.215  55.853  61.446  1.00 94.69  ? 676 ASP A CB    1 
ATOM   1425  C  CG    . ASP A 1 408 ? 75.121  54.761  61.952  1.00 94.69  ? 676 ASP A CG    1 
ATOM   1426  O  OD1   . ASP A 1 408 ? 74.814  53.579  61.701  1.00 94.69  ? 676 ASP A OD1   1 
ATOM   1427  O  OD2   . ASP A 1 408 ? 76.137  55.078  62.602  1.00 94.69  ? 676 ASP A OD2   1 
ATOM   1428  N  N     . LEU A 1 409 ? 71.292  56.374  60.618  1.00 105.75 ? 677 LEU A N     1 
ATOM   1429  C  CA    . LEU A 1 409 ? 70.163  57.276  60.465  1.00 105.75 ? 677 LEU A CA    1 
ATOM   1430  C  C     . LEU A 1 409 ? 69.849  57.973  61.785  1.00 105.75 ? 677 LEU A C     1 
ATOM   1431  O  O     . LEU A 1 409 ? 70.156  57.439  62.856  1.00 105.75 ? 677 LEU A O     1 
ATOM   1432  C  CB    . LEU A 1 409 ? 68.919  56.526  59.973  1.00 105.75 ? 677 LEU A CB    1 
ATOM   1433  C  CG    . LEU A 1 409 ? 68.962  56.052  58.523  1.00 105.75 ? 677 LEU A CG    1 
ATOM   1434  C  CD1   . LEU A 1 409 ? 67.715  55.252  58.186  1.00 105.75 ? 677 LEU A CD1   1 
ATOM   1435  C  CD2   . LEU A 1 409 ? 69.110  57.243  57.593  1.00 105.75 ? 677 LEU A CD2   1 
ATOM   1436  N  N     . PRO A 1 410 ? 69.263  59.172  61.742  1.00 126.54 ? 678 PRO A N     1 
ATOM   1437  C  CA    . PRO A 1 410 ? 68.847  59.846  62.984  1.00 126.54 ? 678 PRO A CA    1 
ATOM   1438  C  C     . PRO A 1 410 ? 67.687  59.113  63.642  1.00 126.54 ? 678 PRO A C     1 
ATOM   1439  O  O     . PRO A 1 410 ? 66.634  58.916  63.033  1.00 126.54 ? 678 PRO A O     1 
ATOM   1440  C  CB    . PRO A 1 410 ? 68.435  61.243  62.507  1.00 126.54 ? 678 PRO A CB    1 
ATOM   1441  C  CG    . PRO A 1 410 ? 69.154  61.428  61.218  1.00 126.54 ? 678 PRO A CG    1 
ATOM   1442  C  CD    . PRO A 1 410 ? 69.183  60.080  60.584  1.00 126.54 ? 678 PRO A CD    1 
ATOM   1443  N  N     . ARG A 1 411 ? 67.885  58.717  64.900  1.00 143.60 ? 679 ARG A N     1 
ATOM   1444  C  CA    . ARG A 1 411 ? 66.910  57.906  65.629  1.00 143.60 ? 679 ARG A CA    1 
ATOM   1445  C  C     . ARG A 1 411 ? 65.813  58.810  66.186  1.00 143.60 ? 679 ARG A C     1 
ATOM   1446  O  O     . ARG A 1 411 ? 65.840  59.231  67.347  1.00 143.60 ? 679 ARG A O     1 
ATOM   1447  C  CB    . ARG A 1 411 ? 67.598  57.113  66.732  1.00 143.60 ? 679 ARG A CB    1 
ATOM   1448  C  CG    . ARG A 1 411 ? 68.540  56.038  66.219  1.00 143.60 ? 679 ARG A CG    1 
ATOM   1449  C  CD    . ARG A 1 411 ? 69.212  55.290  67.357  1.00 143.60 ? 679 ARG A CD    1 
ATOM   1450  N  NE    . ARG A 1 411 ? 70.139  54.279  66.858  1.00 143.60 ? 679 ARG A NE    1 
ATOM   1451  C  CZ    . ARG A 1 411 ? 70.912  53.525  67.633  1.00 143.60 ? 679 ARG A CZ    1 
ATOM   1452  N  NH1   . ARG A 1 411 ? 70.872  53.666  68.951  1.00 143.60 ? 679 ARG A NH1   1 
ATOM   1453  N  NH2   . ARG A 1 411 ? 71.726  52.631  67.090  1.00 143.60 ? 679 ARG A NH2   1 
ATOM   1454  N  N     . GLN A 1 412 ? 64.837  59.104  65.317  1.00 150.69 ? 680 GLN A N     1 
ATOM   1455  C  CA    . GLN A 1 412 ? 63.582  59.795  65.647  1.00 150.69 ? 680 GLN A CA    1 
ATOM   1456  C  C     . GLN A 1 412 ? 63.823  61.189  66.233  1.00 150.69 ? 680 GLN A C     1 
ATOM   1457  O  O     . GLN A 1 412 ? 63.496  61.478  67.385  1.00 150.69 ? 680 GLN A O     1 
ATOM   1458  C  CB    . GLN A 1 412 ? 62.717  58.944  66.584  1.00 150.69 ? 680 GLN A CB    1 
ATOM   1459  C  CG    . GLN A 1 412 ? 62.202  57.662  65.953  1.00 150.69 ? 680 GLN A CG    1 
ATOM   1460  C  CD    . GLN A 1 412 ? 61.373  56.834  66.913  1.00 150.69 ? 680 GLN A CD    1 
ATOM   1461  O  OE1   . GLN A 1 412 ? 61.228  57.181  68.086  1.00 150.69 ? 680 GLN A OE1   1 
ATOM   1462  N  NE2   . GLN A 1 412 ? 60.824  55.729  66.420  1.00 150.69 ? 680 GLN A NE2   1 
ATOM   1463  N  N     . GLY A 1 413 ? 64.404  62.056  65.408  1.00 150.92 ? 681 GLY A N     1 
ATOM   1464  C  CA    . GLY A 1 413 ? 64.615  63.436  65.797  1.00 150.92 ? 681 GLY A CA    1 
ATOM   1465  C  C     . GLY A 1 413 ? 65.758  63.627  66.770  1.00 150.92 ? 681 GLY A C     1 
ATOM   1466  O  O     . GLY A 1 413 ? 65.572  64.183  67.857  1.00 150.92 ? 681 GLY A O     1 
ATOM   1467  N  N     . ASP A 1 414 ? 66.945  63.167  66.393  1.00 146.76 ? 682 ASP A N     1 
ATOM   1468  C  CA    . ASP A 1 414 ? 68.132  63.309  67.220  1.00 146.76 ? 682 ASP A CA    1 
ATOM   1469  C  C     . ASP A 1 414 ? 68.828  64.617  66.832  1.00 146.76 ? 682 ASP A C     1 
ATOM   1470  O  O     . ASP A 1 414 ? 68.385  65.335  65.932  1.00 146.76 ? 682 ASP A O     1 
ATOM   1471  C  CB    . ASP A 1 414 ? 69.015  62.070  67.057  1.00 146.76 ? 682 ASP A CB    1 
ATOM   1472  C  CG    . ASP A 1 414 ? 70.028  61.905  68.182  1.00 146.76 ? 682 ASP A CG    1 
ATOM   1473  O  OD1   . ASP A 1 414 ? 70.069  62.771  69.081  1.00 146.76 ? 682 ASP A OD1   1 
ATOM   1474  O  OD2   . ASP A 1 414 ? 70.781  60.908  68.164  1.00 146.76 ? 682 ASP A OD2   1 
ATOM   1475  N  N     . MET A 1 415 ? 69.927  64.950  67.512  1.00 143.32 ? 683 MET A N     1 
ATOM   1476  C  CA    . MET A 1 415 ? 70.708  66.148  67.204  1.00 143.32 ? 683 MET A CA    1 
ATOM   1477  C  C     . MET A 1 415 ? 71.516  65.879  65.936  1.00 143.32 ? 683 MET A C     1 
ATOM   1478  O  O     . MET A 1 415 ? 72.702  65.539  65.962  1.00 143.32 ? 683 MET A O     1 
ATOM   1479  C  CB    . MET A 1 415 ? 71.598  66.525  68.384  1.00 143.32 ? 683 MET A CB    1 
ATOM   1480  C  CG    . MET A 1 415 ? 72.341  67.853  68.244  1.00 143.32 ? 683 MET A CG    1 
ATOM   1481  S  SD    . MET A 1 415 ? 71.277  69.307  68.192  1.00 143.32 ? 683 MET A SD    1 
ATOM   1482  C  CE    . MET A 1 415 ? 70.743  69.410  69.899  1.00 143.32 ? 683 MET A CE    1 
ATOM   1483  N  N     . VAL A 1 416 ? 70.844  66.018  64.799  1.00 132.30 ? 684 VAL A N     1 
ATOM   1484  C  CA    . VAL A 1 416 ? 71.476  65.857  63.496  1.00 132.30 ? 684 VAL A CA    1 
ATOM   1485  C  C     . VAL A 1 416 ? 71.972  67.218  63.023  1.00 132.30 ? 684 VAL A C     1 
ATOM   1486  O  O     . VAL A 1 416 ? 71.287  68.238  63.166  1.00 132.30 ? 684 VAL A O     1 
ATOM   1487  C  CB    . VAL A 1 416 ? 70.509  65.186  62.493  1.00 132.30 ? 684 VAL A CB    1 
ATOM   1488  C  CG1   . VAL A 1 416 ? 69.197  65.954  62.343  1.00 132.30 ? 684 VAL A CG1   1 
ATOM   1489  C  CG2   . VAL A 1 416 ? 71.173  64.986  61.136  1.00 132.30 ? 684 VAL A CG2   1 
ATOM   1490  N  N     . LEU A 1 417 ? 73.202  67.248  62.521  1.00 125.20 ? 685 LEU A N     1 
ATOM   1491  C  CA    . LEU A 1 417 ? 73.810  68.484  62.050  1.00 125.20 ? 685 LEU A CA    1 
ATOM   1492  C  C     . LEU A 1 417 ? 74.138  68.438  60.568  1.00 125.20 ? 685 LEU A C     1 
ATOM   1493  O  O     . LEU A 1 417 ? 73.904  69.421  59.855  1.00 125.20 ? 685 LEU A O     1 
ATOM   1494  C  CB    . LEU A 1 417 ? 75.076  68.788  62.861  1.00 125.20 ? 685 LEU A CB    1 
ATOM   1495  C  CG    . LEU A 1 417 ? 74.862  69.106  64.341  1.00 125.20 ? 685 LEU A CG    1 
ATOM   1496  C  CD1   . LEU A 1 417 ? 76.195  69.245  65.061  1.00 125.20 ? 685 LEU A CD1   1 
ATOM   1497  C  CD2   . LEU A 1 417 ? 74.033  70.369  64.495  1.00 125.20 ? 685 LEU A CD2   1 
ATOM   1498  N  N     . GLU A 1 418 ? 74.674  67.322  60.082  1.00 111.07 ? 686 GLU A N     1 
ATOM   1499  C  CA    . GLU A 1 418 ? 74.953  67.165  58.666  1.00 111.07 ? 686 GLU A CA    1 
ATOM   1500  C  C     . GLU A 1 418 ? 74.856  65.685  58.327  1.00 111.07 ? 686 GLU A C     1 
ATOM   1501  O  O     . GLU A 1 418 ? 75.153  64.826  59.161  1.00 111.07 ? 686 GLU A O     1 
ATOM   1502  C  CB    . GLU A 1 418 ? 76.337  67.720  58.302  1.00 111.07 ? 686 GLU A CB    1 
ATOM   1503  C  CG    . GLU A 1 418 ? 76.597  67.842  56.807  1.00 111.07 ? 686 GLU A CG    1 
ATOM   1504  C  CD    . GLU A 1 418 ? 77.973  68.376  56.490  1.00 111.07 ? 686 GLU A CD    1 
ATOM   1505  O  OE1   . GLU A 1 418 ? 78.758  68.586  57.434  1.00 111.07 ? 686 GLU A OE1   1 
ATOM   1506  O  OE2   . GLU A 1 418 ? 78.268  68.591  55.296  1.00 111.07 ? 686 GLU A OE2   1 
ATOM   1507  N  N     . LYS A 1 419 ? 74.405  65.400  57.109  1.00 92.93  ? 687 LYS A N     1 
ATOM   1508  C  CA    . LYS A 1 419 ? 74.377  64.034  56.620  1.00 92.93  ? 687 LYS A CA    1 
ATOM   1509  C  C     . LYS A 1 419 ? 75.804  63.522  56.441  1.00 92.93  ? 687 LYS A C     1 
ATOM   1510  O  O     . LYS A 1 419 ? 76.696  64.293  56.084  1.00 92.93  ? 687 LYS A O     1 
ATOM   1511  C  CB    . LYS A 1 419 ? 73.626  63.968  55.293  1.00 92.93  ? 687 LYS A CB    1 
ATOM   1512  C  CG    . LYS A 1 419 ? 72.194  64.446  55.379  1.00 92.93  ? 687 LYS A CG    1 
ATOM   1513  C  CD    . LYS A 1 419 ? 71.361  63.504  56.219  1.00 92.93  ? 687 LYS A CD    1 
ATOM   1514  C  CE    . LYS A 1 419 ? 69.932  63.988  56.308  1.00 92.93  ? 687 LYS A CE    1 
ATOM   1515  N  NZ    . LYS A 1 419 ? 69.264  63.907  54.983  1.00 92.93  ? 687 LYS A NZ    1 
ATOM   1516  N  N     . PRO A 1 420 ? 76.058  62.236  56.686  1.00 85.35  ? 688 PRO A N     1 
ATOM   1517  C  CA    . PRO A 1 420 ? 77.417  61.704  56.541  1.00 85.35  ? 688 PRO A CA    1 
ATOM   1518  C  C     . PRO A 1 420 ? 77.857  61.458  55.107  1.00 85.35  ? 688 PRO A C     1 
ATOM   1519  O  O     . PRO A 1 420 ? 78.955  60.938  54.901  1.00 85.35  ? 688 PRO A O     1 
ATOM   1520  C  CB    . PRO A 1 420 ? 77.348  60.385  57.321  1.00 85.35  ? 688 PRO A CB    1 
ATOM   1521  C  CG    . PRO A 1 420 ? 75.936  59.986  57.251  1.00 85.35  ? 688 PRO A CG    1 
ATOM   1522  C  CD    . PRO A 1 420 ? 75.141  61.247  57.278  1.00 85.35  ? 688 PRO A CD    1 
ATOM   1523  N  N     . TYR A 1 421 ? 77.038  61.822  54.127  1.00 80.06  ? 689 TYR A N     1 
ATOM   1524  C  CA    . TYR A 1 421 ? 77.363  61.719  52.712  1.00 80.06  ? 689 TYR A CA    1 
ATOM   1525  C  C     . TYR A 1 421 ? 77.170  63.057  52.015  1.00 80.06  ? 689 TYR A C     1 
ATOM   1526  O  O     . TYR A 1 421 ? 76.886  64.067  52.663  1.00 80.06  ? 689 TYR A O     1 
ATOM   1527  C  CB    . TYR A 1 421 ? 76.522  60.627  52.046  1.00 80.06  ? 689 TYR A CB    1 
ATOM   1528  C  CG    . TYR A 1 421 ? 75.074  60.617  52.474  1.00 80.06  ? 689 TYR A CG    1 
ATOM   1529  C  CD1   . TYR A 1 421 ? 74.651  59.776  53.490  1.00 80.06  ? 689 TYR A CD1   1 
ATOM   1530  C  CD2   . TYR A 1 421 ? 74.137  61.446  51.880  1.00 80.06  ? 689 TYR A CD2   1 
ATOM   1531  C  CE1   . TYR A 1 421 ? 73.347  59.756  53.902  1.00 80.06  ? 689 TYR A CE1   1 
ATOM   1532  C  CE2   . TYR A 1 421 ? 72.815  61.430  52.292  1.00 80.06  ? 689 TYR A CE2   1 
ATOM   1533  C  CZ    . TYR A 1 421 ? 72.434  60.582  53.304  1.00 80.06  ? 689 TYR A CZ    1 
ATOM   1534  O  OH    . TYR A 1 421 ? 71.133  60.543  53.734  1.00 80.06  ? 689 TYR A OH    1 
ATOM   1535  N  N     . SER A 1 422 ? 77.308  63.072  50.699  1.00 74.54  ? 690 SER A N     1 
ATOM   1536  C  CA    . SER A 1 422 ? 77.314  64.315  49.945  1.00 74.54  ? 690 SER A CA    1 
ATOM   1537  C  C     . SER A 1 422 ? 75.883  64.755  49.668  1.00 74.54  ? 690 SER A C     1 
ATOM   1538  O  O     . SER A 1 422 ? 74.920  64.197  50.198  1.00 74.54  ? 690 SER A O     1 
ATOM   1539  C  CB    . SER A 1 422 ? 78.105  64.135  48.658  1.00 74.54  ? 690 SER A CB    1 
ATOM   1540  O  OG    . SER A 1 422 ? 77.438  63.239  47.793  1.00 74.54  ? 690 SER A OG    1 
ATOM   1541  N  N     . GLU A 1 423 ? 75.727  65.772  48.829  1.00 73.59  ? 691 GLU A N     1 
ATOM   1542  C  CA    . GLU A 1 423 ? 74.399  66.184  48.404  1.00 73.59  ? 691 GLU A CA    1 
ATOM   1543  C  C     . GLU A 1 423 ? 73.954  65.465  47.141  1.00 73.59  ? 691 GLU A C     1 
ATOM   1544  O  O     . GLU A 1 423 ? 72.770  65.133  47.011  1.00 73.59  ? 691 GLU A O     1 
ATOM   1545  C  CB    . GLU A 1 423 ? 74.355  67.702  48.198  1.00 73.59  ? 691 GLU A CB    1 
ATOM   1546  C  CG    . GLU A 1 423 ? 72.998  68.244  47.817  1.00 73.59  ? 691 GLU A CG    1 
ATOM   1547  C  CD    . GLU A 1 423 ? 71.964  68.025  48.896  1.00 73.59  ? 691 GLU A CD    1 
ATOM   1548  O  OE1   . GLU A 1 423 ? 72.316  68.057  50.096  1.00 73.59  ? 691 GLU A OE1   1 
ATOM   1549  O  OE2   . GLU A 1 423 ? 70.796  67.778  48.539  1.00 73.59  ? 691 GLU A OE2   1 
ATOM   1550  N  N     . ALA A 1 424 ? 74.883  65.189  46.221  1.00 71.09  ? 692 ALA A N     1 
ATOM   1551  C  CA    . ALA A 1 424 ? 74.556  64.387  45.048  1.00 71.09  ? 692 ALA A CA    1 
ATOM   1552  C  C     . ALA A 1 424 ? 74.221  62.954  45.427  1.00 71.09  ? 692 ALA A C     1 
ATOM   1553  O  O     . ALA A 1 424 ? 73.487  62.277  44.701  1.00 71.09  ? 692 ALA A O     1 
ATOM   1554  C  CB    . ALA A 1 424 ? 75.709  64.408  44.054  1.00 71.09  ? 692 ALA A CB    1 
ATOM   1555  N  N     . THR A 1 425 ? 74.755  62.475  46.549  1.00 71.93  ? 693 THR A N     1 
ATOM   1556  C  CA    . THR A 1 425 ? 74.290  61.215  47.106  1.00 71.93  ? 693 THR A CA    1 
ATOM   1557  C  C     . THR A 1 425 ? 72.874  61.352  47.647  1.00 71.93  ? 693 THR A C     1 
ATOM   1558  O  O     . THR A 1 425 ? 72.019  60.500  47.385  1.00 71.93  ? 693 THR A O     1 
ATOM   1559  C  CB    . THR A 1 425 ? 75.238  60.749  48.202  1.00 71.93  ? 693 THR A CB    1 
ATOM   1560  O  OG1   . THR A 1 425 ? 76.548  60.582  47.649  1.00 71.93  ? 693 THR A OG1   1 
ATOM   1561  C  CG2   . THR A 1 425 ? 74.784  59.435  48.778  1.00 71.93  ? 693 THR A CG2   1 
ATOM   1562  N  N     . ALA A 1 426 ? 72.601  62.431  48.385  1.00 71.19  ? 694 ALA A N     1 
ATOM   1563  C  CA    . ALA A 1 426 ? 71.275  62.634  48.956  1.00 71.19  ? 694 ALA A CA    1 
ATOM   1564  C  C     . ALA A 1 426 ? 70.235  62.948  47.888  1.00 71.19  ? 694 ALA A C     1 
ATOM   1565  O  O     . ALA A 1 426 ? 69.048  62.671  48.087  1.00 71.19  ? 694 ALA A O     1 
ATOM   1566  C  CB    . ALA A 1 426 ? 71.311  63.745  49.995  1.00 71.19  ? 694 ALA A CB    1 
ATOM   1567  N  N     . ARG A 1 427 ? 70.649  63.521  46.760  1.00 71.04  ? 695 ARG A N     1 
ATOM   1568  C  CA    . ARG A 1 427 ? 69.746  63.612  45.623  1.00 71.04  ? 695 ARG A CA    1 
ATOM   1569  C  C     . ARG A 1 427 ? 69.481  62.236  45.030  1.00 71.04  ? 695 ARG A C     1 
ATOM   1570  O  O     . ARG A 1 427 ? 68.372  61.963  44.564  1.00 71.04  ? 695 ARG A O     1 
ATOM   1571  C  CB    . ARG A 1 427 ? 70.320  64.559  44.571  1.00 71.04  ? 695 ARG A CB    1 
ATOM   1572  C  CG    . ARG A 1 427 ? 69.413  64.811  43.386  1.00 71.04  ? 695 ARG A CG    1 
ATOM   1573  C  CD    . ARG A 1 427 ? 69.996  65.835  42.435  1.00 71.04  ? 695 ARG A CD    1 
ATOM   1574  N  NE    . ARG A 1 427 ? 69.099  66.075  41.310  1.00 71.04  ? 695 ARG A NE    1 
ATOM   1575  C  CZ    . ARG A 1 427 ? 69.326  66.957  40.343  1.00 71.04  ? 695 ARG A CZ    1 
ATOM   1576  N  NH1   . ARG A 1 427 ? 70.427  67.693  40.360  1.00 71.04  ? 695 ARG A NH1   1 
ATOM   1577  N  NH2   . ARG A 1 427 ? 68.449  67.106  39.360  1.00 71.04  ? 695 ARG A NH2   1 
ATOM   1578  N  N     . LEU A 1 428 ? 70.469  61.346  45.077  1.00 70.61  ? 696 LEU A N     1 
ATOM   1579  C  CA    . LEU A 1 428 ? 70.284  59.996  44.560  1.00 70.61  ? 696 LEU A CA    1 
ATOM   1580  C  C     . LEU A 1 428 ? 69.448  59.146  45.506  1.00 70.61  ? 696 LEU A C     1 
ATOM   1581  O  O     . LEU A 1 428 ? 68.653  58.317  45.054  1.00 70.61  ? 696 LEU A O     1 
ATOM   1582  C  CB    . LEU A 1 428 ? 71.639  59.344  44.313  1.00 70.61  ? 696 LEU A CB    1 
ATOM   1583  C  CG    . LEU A 1 428 ? 71.665  57.935  43.728  1.00 70.61  ? 696 LEU A CG    1 
ATOM   1584  C  CD1   . LEU A 1 428 ? 71.095  57.918  42.326  1.00 70.61  ? 696 LEU A CD1   1 
ATOM   1585  C  CD2   . LEU A 1 428 ? 73.075  57.399  43.739  1.00 70.61  ? 696 LEU A CD2   1 
ATOM   1586  N  N     . ILE A 1 429 ? 69.616  59.330  46.819  1.00 68.77  ? 697 ILE A N     1 
ATOM   1587  C  CA    . ILE A 1 429 ? 68.887  58.520  47.793  1.00 68.77  ? 697 ILE A CA    1 
ATOM   1588  C  C     . ILE A 1 429 ? 67.396  58.828  47.746  1.00 68.77  ? 697 ILE A C     1 
ATOM   1589  O  O     . ILE A 1 429 ? 66.561  57.919  47.690  1.00 68.77  ? 697 ILE A O     1 
ATOM   1590  C  CB    . ILE A 1 429 ? 69.462  58.729  49.205  1.00 68.77  ? 697 ILE A CB    1 
ATOM   1591  C  CG1   . ILE A 1 429 ? 70.854  58.127  49.306  1.00 68.77  ? 697 ILE A CG1   1 
ATOM   1592  C  CG2   . ILE A 1 429 ? 68.575  58.116  50.248  1.00 68.77  ? 697 ILE A CG2   1 
ATOM   1593  C  CD1   . ILE A 1 429 ? 71.559  58.481  50.572  1.00 68.77  ? 697 ILE A CD1   1 
ATOM   1594  N  N     . ASP A 1 430 ? 67.040  60.112  47.733  1.00 71.74  ? 698 ASP A N     1 
ATOM   1595  C  CA    . ASP A 1 430 ? 65.630  60.481  47.717  1.00 71.74  ? 698 ASP A CA    1 
ATOM   1596  C  C     . ASP A 1 430 ? 64.976  60.187  46.377  1.00 71.74  ? 698 ASP A C     1 
ATOM   1597  O  O     . ASP A 1 430 ? 63.778  59.893  46.332  1.00 71.74  ? 698 ASP A O     1 
ATOM   1598  C  CB    . ASP A 1 430 ? 65.466  61.955  48.072  1.00 71.74  ? 698 ASP A CB    1 
ATOM   1599  C  CG    . ASP A 1 430 ? 65.730  62.224  49.528  1.00 71.74  ? 698 ASP A CG    1 
ATOM   1600  O  OD1   . ASP A 1 430 ? 65.524  61.299  50.334  1.00 71.74  ? 698 ASP A OD1   1 
ATOM   1601  O  OD2   . ASP A 1 430 ? 66.137  63.353  49.870  1.00 71.74  ? 698 ASP A OD2   1 
ATOM   1602  N  N     . ASP A 1 431 ? 65.731  60.247  45.281  1.00 71.25  ? 699 ASP A N     1 
ATOM   1603  C  CA    . ASP A 1 431 ? 65.151  59.904  43.990  1.00 71.25  ? 699 ASP A CA    1 
ATOM   1604  C  C     . ASP A 1 431 ? 64.971  58.408  43.818  1.00 71.25  ? 699 ASP A C     1 
ATOM   1605  O  O     . ASP A 1 431 ? 64.251  57.990  42.910  1.00 71.25  ? 699 ASP A O     1 
ATOM   1606  C  CB    . ASP A 1 431 ? 65.998  60.446  42.842  1.00 71.25  ? 699 ASP A CB    1 
ATOM   1607  C  CG    . ASP A 1 431 ? 65.851  61.941  42.666  1.00 71.25  ? 699 ASP A CG    1 
ATOM   1608  O  OD1   . ASP A 1 431 ? 64.783  62.480  43.013  1.00 71.25  ? 699 ASP A OD1   1 
ATOM   1609  O  OD2   . ASP A 1 431 ? 66.800  62.577  42.165  1.00 71.25  ? 699 ASP A OD2   1 
ATOM   1610  N  N     . GLU A 1 432 ? 65.602  57.594  44.655  1.00 72.72  ? 700 GLU A N     1 
ATOM   1611  C  CA    . GLU A 1 432 ? 65.400  56.156  44.586  1.00 72.72  ? 700 GLU A CA    1 
ATOM   1612  C  C     . GLU A 1 432 ? 64.372  55.650  45.577  1.00 72.72  ? 700 GLU A C     1 
ATOM   1613  O  O     . GLU A 1 432 ? 63.761  54.610  45.330  1.00 72.72  ? 700 GLU A O     1 
ATOM   1614  C  CB    . GLU A 1 432 ? 66.719  55.419  44.799  1.00 72.72  ? 700 GLU A CB    1 
ATOM   1615  C  CG    . GLU A 1 432 ? 67.671  55.564  43.632  1.00 72.72  ? 700 GLU A CG    1 
ATOM   1616  C  CD    . GLU A 1 432 ? 67.184  54.851  42.393  1.00 72.72  ? 700 GLU A CD    1 
ATOM   1617  O  OE1   . GLU A 1 432 ? 66.569  53.774  42.529  1.00 72.72  ? 700 GLU A OE1   1 
ATOM   1618  O  OE2   . GLU A 1 432 ? 67.402  55.375  41.282  1.00 72.72  ? 700 GLU A OE2   1 
ATOM   1619  N  N     . VAL A 1 433 ? 64.166  56.357  46.686  1.00 68.60  ? 701 VAL A N     1 
ATOM   1620  C  CA    . VAL A 1 433 ? 63.045  56.049  47.565  1.00 68.60  ? 701 VAL A CA    1 
ATOM   1621  C  C     . VAL A 1 433 ? 61.734  56.412  46.886  1.00 68.60  ? 701 VAL A C     1 
ATOM   1622  O  O     . VAL A 1 433 ? 60.736  55.690  46.995  1.00 68.60  ? 701 VAL A O     1 
ATOM   1623  C  CB    . VAL A 1 433 ? 63.223  56.777  48.906  1.00 68.60  ? 701 VAL A CB    1 
ATOM   1624  C  CG1   . VAL A 1 433 ? 62.027  56.599  49.793  1.00 68.60  ? 701 VAL A CG1   1 
ATOM   1625  C  CG2   . VAL A 1 433 ? 64.428  56.250  49.589  1.00 68.60  ? 701 VAL A CG2   1 
ATOM   1626  N  N     . ARG A 1 434 ? 61.732  57.514  46.136  1.00 70.94  ? 702 ARG A N     1 
ATOM   1627  C  CA    . ARG A 1 434 ? 60.550  57.939  45.398  1.00 70.94  ? 702 ARG A CA    1 
ATOM   1628  C  C     . ARG A 1 434 ? 60.182  56.947  44.302  1.00 70.94  ? 702 ARG A C     1 
ATOM   1629  O  O     . ARG A 1 434 ? 59.000  56.764  43.998  1.00 70.94  ? 702 ARG A O     1 
ATOM   1630  C  CB    . ARG A 1 434 ? 60.808  59.321  44.811  1.00 70.94  ? 702 ARG A CB    1 
ATOM   1631  C  CG    . ARG A 1 434 ? 59.611  59.999  44.212  1.00 70.94  ? 702 ARG A CG    1 
ATOM   1632  C  CD    . ARG A 1 434 ? 59.980  61.389  43.747  1.00 70.94  ? 702 ARG A CD    1 
ATOM   1633  N  NE    . ARG A 1 434 ? 60.476  62.197  44.855  1.00 70.94  ? 702 ARG A NE    1 
ATOM   1634  C  CZ    . ARG A 1 434 ? 61.706  62.690  44.924  1.00 70.94  ? 702 ARG A CZ    1 
ATOM   1635  N  NH1   . ARG A 1 434 ? 62.559  62.467  43.940  1.00 70.94  ? 702 ARG A NH1   1 
ATOM   1636  N  NH2   . ARG A 1 434 ? 62.079  63.407  45.972  1.00 70.94  ? 702 ARG A NH2   1 
ATOM   1637  N  N     . ILE A 1 435 ? 61.176  56.289  43.711  1.00 70.01  ? 703 ILE A N     1 
ATOM   1638  C  CA    . ILE A 1 435 ? 60.904  55.180  42.809  1.00 70.01  ? 703 ILE A CA    1 
ATOM   1639  C  C     . ILE A 1 435 ? 60.528  53.934  43.601  1.00 70.01  ? 703 ILE A C     1 
ATOM   1640  O  O     . ILE A 1 435 ? 59.667  53.158  43.168  1.00 70.01  ? 703 ILE A O     1 
ATOM   1641  C  CB    . ILE A 1 435 ? 62.121  54.963  41.891  1.00 70.01  ? 703 ILE A CB    1 
ATOM   1642  C  CG1   . ILE A 1 435 ? 62.293  56.167  40.970  1.00 70.01  ? 703 ILE A CG1   1 
ATOM   1643  C  CG2   . ILE A 1 435 ? 61.995  53.717  41.046  1.00 70.01  ? 703 ILE A CG2   1 
ATOM   1644  C  CD1   . ILE A 1 435 ? 63.576  56.145  40.175  1.00 70.01  ? 703 ILE A CD1   1 
ATOM   1645  N  N     . LEU A 1 436 ? 61.104  53.755  44.794  1.00 70.12  ? 704 LEU A N     1 
ATOM   1646  C  CA    . LEU A 1 436 ? 60.815  52.570  45.599  1.00 70.12  ? 704 LEU A CA    1 
ATOM   1647  C  C     . LEU A 1 436 ? 59.384  52.570  46.114  1.00 70.12  ? 704 LEU A C     1 
ATOM   1648  O  O     . LEU A 1 436 ? 58.732  51.521  46.140  1.00 70.12  ? 704 LEU A O     1 
ATOM   1649  C  CB    . LEU A 1 436 ? 61.789  52.472  46.770  1.00 70.12  ? 704 LEU A CB    1 
ATOM   1650  C  CG    . LEU A 1 436 ? 61.613  51.283  47.710  1.00 70.12  ? 704 LEU A CG    1 
ATOM   1651  C  CD1   . LEU A 1 436 ? 61.806  49.991  46.963  1.00 70.12  ? 704 LEU A CD1   1 
ATOM   1652  C  CD2   . LEU A 1 436 ? 62.580  51.373  48.859  1.00 70.12  ? 704 LEU A CD2   1 
ATOM   1653  N  N     . ILE A 1 437 ? 58.872  53.733  46.514  1.00 72.09  ? 705 ILE A N     1 
ATOM   1654  C  CA    . ILE A 1 437 ? 57.514  53.789  47.043  1.00 72.09  ? 705 ILE A CA    1 
ATOM   1655  C  C     . ILE A 1 437 ? 56.496  53.624  45.921  1.00 72.09  ? 705 ILE A C     1 
ATOM   1656  O  O     . ILE A 1 437 ? 55.496  52.918  46.083  1.00 72.09  ? 705 ILE A O     1 
ATOM   1657  C  CB    . ILE A 1 437 ? 57.308  55.086  47.843  1.00 72.09  ? 705 ILE A CB    1 
ATOM   1658  C  CG1   . ILE A 1 437 ? 58.227  55.090  49.058  1.00 72.09  ? 705 ILE A CG1   1 
ATOM   1659  C  CG2   . ILE A 1 437 ? 55.890  55.207  48.331  1.00 72.09  ? 705 ILE A CG2   1 
ATOM   1660  C  CD1   . ILE A 1 437 ? 58.233  56.361  49.818  1.00 72.09  ? 705 ILE A CD1   1 
ATOM   1661  N  N     . ASN A 1 438 ? 56.766  54.210  44.750  1.00 73.72  ? 706 ASN A N     1 
ATOM   1662  C  CA    . ASN A 1 438 ? 55.872  54.055  43.603  1.00 73.72  ? 706 ASN A CA    1 
ATOM   1663  C  C     . ASN A 1 438 ? 55.827  52.623  43.087  1.00 73.72  ? 706 ASN A C     1 
ATOM   1664  O  O     . ASN A 1 438 ? 54.812  52.207  42.522  1.00 73.72  ? 706 ASN A O     1 
ATOM   1665  C  CB    . ASN A 1 438 ? 56.287  54.986  42.467  1.00 73.72  ? 706 ASN A CB    1 
ATOM   1666  C  CG    . ASN A 1 438 ? 55.903  56.416  42.720  1.00 73.72  ? 706 ASN A CG    1 
ATOM   1667  O  OD1   . ASN A 1 438 ? 54.808  56.698  43.197  1.00 73.72  ? 706 ASN A OD1   1 
ATOM   1668  N  ND2   . ASN A 1 438 ? 56.799  57.336  42.395  1.00 73.72  ? 706 ASN A ND2   1 
ATOM   1669  N  N     . ASP A 1 439 ? 56.905  51.860  43.256  1.00 74.70  ? 707 ASP A N     1 
ATOM   1670  C  CA    . ASP A 1 439 ? 56.860  50.458  42.864  1.00 74.70  ? 707 ASP A CA    1 
ATOM   1671  C  C     . ASP A 1 439 ? 56.027  49.648  43.845  1.00 74.70  ? 707 ASP A C     1 
ATOM   1672  O  O     . ASP A 1 439 ? 55.324  48.714  43.447  1.00 74.70  ? 707 ASP A O     1 
ATOM   1673  C  CB    . ASP A 1 439 ? 58.272  49.892  42.755  1.00 74.70  ? 707 ASP A CB    1 
ATOM   1674  C  CG    . ASP A 1 439 ? 59.039  50.477  41.589  1.00 74.70  ? 707 ASP A CG    1 
ATOM   1675  O  OD1   . ASP A 1 439 ? 58.395  50.884  40.602  1.00 74.70  ? 707 ASP A OD1   1 
ATOM   1676  O  OD2   . ASP A 1 439 ? 60.284  50.524  41.656  1.00 74.70  ? 707 ASP A OD2   1 
ATOM   1677  N  N     . ALA A 1 440 ? 56.082  49.996  45.128  1.00 74.27  ? 708 ALA A N     1 
ATOM   1678  C  CA    . ALA A 1 440 ? 55.175  49.400  46.096  1.00 74.27  ? 708 ALA A CA    1 
ATOM   1679  C  C     . ALA A 1 440 ? 53.769  49.959  45.985  1.00 74.27  ? 708 ALA A C     1 
ATOM   1680  O  O     . ALA A 1 440 ? 52.820  49.315  46.437  1.00 74.27  ? 708 ALA A O     1 
ATOM   1681  C  CB    . ALA A 1 440 ? 55.691  49.616  47.516  1.00 74.27  ? 708 ALA A CB    1 
ATOM   1682  N  N     . TYR A 1 441 ? 53.617  51.142  45.402  1.00 74.15  ? 709 TYR A N     1 
ATOM   1683  C  CA    . TYR A 1 441 ? 52.297  51.740  45.268  1.00 74.15  ? 709 TYR A CA    1 
ATOM   1684  C  C     . TYR A 1 441 ? 51.521  51.096  44.132  1.00 74.15  ? 709 TYR A C     1 
ATOM   1685  O  O     . TYR A 1 441 ? 50.368  50.694  44.309  1.00 74.15  ? 709 TYR A O     1 
ATOM   1686  C  CB    . TYR A 1 441 ? 52.436  53.242  45.042  1.00 74.15  ? 709 TYR A CB    1 
ATOM   1687  C  CG    . TYR A 1 441 ? 51.140  53.988  44.955  1.00 74.15  ? 709 TYR A CG    1 
ATOM   1688  C  CD1   . TYR A 1 441 ? 50.391  54.243  46.091  1.00 74.15  ? 709 TYR A CD1   1 
ATOM   1689  C  CD2   . TYR A 1 441 ? 50.678  54.460  43.739  1.00 74.15  ? 709 TYR A CD2   1 
ATOM   1690  C  CE1   . TYR A 1 441 ? 49.213  54.937  46.015  1.00 74.15  ? 709 TYR A CE1   1 
ATOM   1691  C  CE2   . TYR A 1 441 ? 49.503  55.151  43.653  1.00 74.15  ? 709 TYR A CE2   1 
ATOM   1692  C  CZ    . TYR A 1 441 ? 48.775  55.382  44.791  1.00 74.15  ? 709 TYR A CZ    1 
ATOM   1693  O  OH    . TYR A 1 441 ? 47.604  56.075  44.695  1.00 74.15  ? 709 TYR A OH    1 
ATOM   1694  N  N     . LYS A 1 442 ? 52.143  50.984  42.960  1.00 75.20  ? 710 LYS A N     1 
ATOM   1695  C  CA    . LYS A 1 442 ? 51.464  50.422  41.802  1.00 75.20  ? 710 LYS A CA    1 
ATOM   1696  C  C     . LYS A 1 442 ? 51.248  48.925  41.927  1.00 75.20  ? 710 LYS A C     1 
ATOM   1697  O  O     . LYS A 1 442 ? 50.374  48.381  41.249  1.00 75.20  ? 710 LYS A O     1 
ATOM   1698  C  CB    . LYS A 1 442 ? 52.253  50.729  40.534  1.00 75.20  ? 710 LYS A CB    1 
ATOM   1699  C  CG    . LYS A 1 442 ? 52.277  52.198  40.188  1.00 75.20  ? 710 LYS A CG    1 
ATOM   1700  C  CD    . LYS A 1 442 ? 53.058  52.448  38.920  1.00 75.20  ? 710 LYS A CD    1 
ATOM   1701  C  CE    . LYS A 1 442 ? 53.096  53.924  38.592  1.00 75.20  ? 710 LYS A CE    1 
ATOM   1702  N  NZ    . LYS A 1 442 ? 53.883  54.182  37.359  1.00 75.20  ? 710 LYS A NZ    1 
ATOM   1703  N  N     . ARG A 1 443 ? 52.023  48.248  42.771  1.00 75.78  ? 711 ARG A N     1 
ATOM   1704  C  CA    . ARG A 1 443 ? 51.744  46.847  43.049  1.00 75.78  ? 711 ARG A CA    1 
ATOM   1705  C  C     . ARG A 1 443 ? 50.486  46.705  43.893  1.00 75.78  ? 711 ARG A C     1 
ATOM   1706  O  O     . ARG A 1 443 ? 49.694  45.778  43.690  1.00 75.78  ? 711 ARG A O     1 
ATOM   1707  C  CB    . ARG A 1 443 ? 52.935  46.201  43.755  1.00 75.78  ? 711 ARG A CB    1 
ATOM   1708  C  CG    . ARG A 1 443 ? 52.776  44.713  43.959  1.00 75.78  ? 711 ARG A CG    1 
ATOM   1709  C  CD    . ARG A 1 443 ? 53.924  44.104  44.731  1.00 75.78  ? 711 ARG A CD    1 
ATOM   1710  N  NE    . ARG A 1 443 ? 53.683  42.685  44.957  1.00 75.78  ? 711 ARG A NE    1 
ATOM   1711  C  CZ    . ARG A 1 443 ? 54.472  41.895  45.671  1.00 75.78  ? 711 ARG A CZ    1 
ATOM   1712  N  NH1   . ARG A 1 443 ? 55.556  42.385  46.244  1.00 75.78  ? 711 ARG A NH1   1 
ATOM   1713  N  NH2   . ARG A 1 443 ? 54.171  40.616  45.821  1.00 75.78  ? 711 ARG A NH2   1 
ATOM   1714  N  N     . THR A 1 444 ? 50.279  47.624  44.837  1.00 77.33  ? 712 THR A N     1 
ATOM   1715  C  CA    . THR A 1 444 ? 49.106  47.562  45.701  1.00 77.33  ? 712 THR A CA    1 
ATOM   1716  C  C     . THR A 1 444 ? 47.844  47.956  44.946  1.00 77.33  ? 712 THR A C     1 
ATOM   1717  O  O     . THR A 1 444 ? 46.773  47.393  45.198  1.00 77.33  ? 712 THR A O     1 
ATOM   1718  C  CB    . THR A 1 444 ? 49.312  48.470  46.909  1.00 77.33  ? 712 THR A CB    1 
ATOM   1719  O  OG1   . THR A 1 444 ? 50.568  48.165  47.516  1.00 77.33  ? 712 THR A OG1   1 
ATOM   1720  C  CG2   . THR A 1 444 ? 48.241  48.244  47.940  1.00 77.33  ? 712 THR A CG2   1 
ATOM   1721  N  N     . VAL A 1 445 ? 47.956  48.905  44.012  1.00 76.49  ? 713 VAL A N     1 
ATOM   1722  C  CA    . VAL A 1 445 ? 46.825  49.266  43.161  1.00 76.49  ? 713 VAL A CA    1 
ATOM   1723  C  C     . VAL A 1 445 ? 46.430  48.091  42.276  1.00 76.49  ? 713 VAL A C     1 
ATOM   1724  O  O     . VAL A 1 445 ? 45.246  47.755  42.159  1.00 76.49  ? 713 VAL A O     1 
ATOM   1725  C  CB    . VAL A 1 445 ? 47.159  50.516  42.325  1.00 76.49  ? 713 VAL A CB    1 
ATOM   1726  C  CG1   . VAL A 1 445 ? 46.051  50.814  41.339  1.00 76.49  ? 713 VAL A CG1   1 
ATOM   1727  C  CG2   . VAL A 1 445 ? 47.377  51.709  43.216  1.00 76.49  ? 713 VAL A CG2   1 
ATOM   1728  N  N     . ALA A 1 446 ? 47.418  47.421  41.679  1.00 77.99  ? 714 ALA A N     1 
ATOM   1729  C  CA    . ALA A 1 446 ? 47.140  46.269  40.829  1.00 77.99  ? 714 ALA A CA    1 
ATOM   1730  C  C     . ALA A 1 446 ? 46.591  45.095  41.624  1.00 77.99  ? 714 ALA A C     1 
ATOM   1731  O  O     . ALA A 1 446 ? 45.859  44.267  41.074  1.00 77.99  ? 714 ALA A O     1 
ATOM   1732  C  CB    . ALA A 1 446 ? 48.403  45.852  40.081  1.00 77.99  ? 714 ALA A CB    1 
ATOM   1733  N  N     . LEU A 1 447 ? 46.918  45.008  42.911  1.00 79.52  ? 715 LEU A N     1 
ATOM   1734  C  CA    . LEU A 1 447 ? 46.314  43.980  43.746  1.00 79.52  ? 715 LEU A CA    1 
ATOM   1735  C  C     . LEU A 1 447 ? 44.882  44.338  44.115  1.00 79.52  ? 715 LEU A C     1 
ATOM   1736  O  O     . LEU A 1 447 ? 43.976  43.510  43.985  1.00 79.52  ? 715 LEU A O     1 
ATOM   1737  C  CB    . LEU A 1 447 ? 47.141  43.768  45.009  1.00 79.52  ? 715 LEU A CB    1 
ATOM   1738  C  CG    . LEU A 1 447 ? 46.593  42.665  45.909  1.00 79.52  ? 715 LEU A CG    1 
ATOM   1739  C  CD1   . LEU A 1 447 ? 46.686  41.326  45.208  1.00 79.52  ? 715 LEU A CD1   1 
ATOM   1740  C  CD2   . LEU A 1 447 ? 47.314  42.632  47.234  1.00 79.52  ? 715 LEU A CD2   1 
ATOM   1741  N  N     . LEU A 1 448 ? 44.654  45.572  44.561  1.00 79.35  ? 716 LEU A N     1 
ATOM   1742  C  CA    . LEU A 1 448 ? 43.362  45.906  45.143  1.00 79.35  ? 716 LEU A CA    1 
ATOM   1743  C  C     . LEU A 1 448 ? 42.305  46.252  44.103  1.00 79.35  ? 716 LEU A C     1 
ATOM   1744  O  O     . LEU A 1 448 ? 41.118  46.050  44.368  1.00 79.35  ? 716 LEU A O     1 
ATOM   1745  C  CB    . LEU A 1 448 ? 43.509  47.050  46.141  1.00 79.35  ? 716 LEU A CB    1 
ATOM   1746  C  CG    . LEU A 1 448 ? 44.268  46.696  47.416  1.00 79.35  ? 716 LEU A CG    1 
ATOM   1747  C  CD1   . LEU A 1 448 ? 44.444  47.917  48.288  1.00 79.35  ? 716 LEU A CD1   1 
ATOM   1748  C  CD2   . LEU A 1 448 ? 43.548  45.613  48.174  1.00 79.35  ? 716 LEU A CD2   1 
ATOM   1749  N  N     . THR A 1 449 ? 42.683  46.786  42.937  1.00 80.27  ? 717 THR A N     1 
ATOM   1750  C  CA    . THR A 1 449 ? 41.681  46.981  41.890  1.00 80.27  ? 717 THR A CA    1 
ATOM   1751  C  C     . THR A 1 449 ? 41.235  45.654  41.297  1.00 80.27  ? 717 THR A C     1 
ATOM   1752  O  O     . THR A 1 449 ? 40.079  45.519  40.881  1.00 80.27  ? 717 THR A O     1 
ATOM   1753  C  CB    . THR A 1 449 ? 42.205  47.887  40.776  1.00 80.27  ? 717 THR A CB    1 
ATOM   1754  O  OG1   . THR A 1 449 ? 43.401  47.328  40.223  1.00 80.27  ? 717 THR A OG1   1 
ATOM   1755  C  CG2   . THR A 1 449 ? 42.475  49.284  41.286  1.00 80.27  ? 717 THR A CG2   1 
ATOM   1756  N  N     . GLU A 1 450 ? 42.132  44.671  41.244  1.00 82.26  ? 718 GLU A N     1 
ATOM   1757  C  CA    . GLU A 1 450 ? 41.740  43.335  40.819  1.00 82.26  ? 718 GLU A CA    1 
ATOM   1758  C  C     . GLU A 1 450 ? 40.874  42.658  41.869  1.00 82.26  ? 718 GLU A C     1 
ATOM   1759  O  O     . GLU A 1 450 ? 39.944  41.919  41.527  1.00 82.26  ? 718 GLU A O     1 
ATOM   1760  C  CB    . GLU A 1 450 ? 42.986  42.501  40.534  1.00 82.26  ? 718 GLU A CB    1 
ATOM   1761  C  CG    . GLU A 1 450 ? 42.716  41.127  39.967  1.00 82.26  ? 718 GLU A CG    1 
ATOM   1762  C  CD    . GLU A 1 450 ? 43.991  40.356  39.709  1.00 82.26  ? 718 GLU A CD    1 
ATOM   1763  O  OE1   . GLU A 1 450 ? 45.077  40.888  40.020  1.00 82.26  ? 718 GLU A OE1   1 
ATOM   1764  O  OE2   . GLU A 1 450 ? 43.909  39.222  39.194  1.00 82.26  ? 718 GLU A OE2   1 
ATOM   1765  N  N     . LYS A 1 451 ? 41.143  42.916  43.144  1.00 82.92  ? 719 LYS A N     1 
ATOM   1766  C  CA    . LYS A 1 451 ? 40.377  42.345  44.246  1.00 82.92  ? 719 LYS A CA    1 
ATOM   1767  C  C     . LYS A 1 451 ? 39.414  43.359  44.840  1.00 82.92  ? 719 LYS A C     1 
ATOM   1768  O  O     . LYS A 1 451 ? 39.233  43.423  46.057  1.00 82.92  ? 719 LYS A O     1 
ATOM   1769  C  CB    . LYS A 1 451 ? 41.325  41.808  45.307  1.00 82.92  ? 719 LYS A CB    1 
ATOM   1770  C  CG    . LYS A 1 451 ? 42.294  40.788  44.759  1.00 82.92  ? 719 LYS A CG    1 
ATOM   1771  C  CD    . LYS A 1 451 ? 41.577  39.533  44.310  1.00 82.92  ? 719 LYS A CD    1 
ATOM   1772  C  CE    . LYS A 1 451 ? 42.571  38.464  43.898  1.00 82.92  ? 719 LYS A CE    1 
ATOM   1773  N  NZ    . LYS A 1 451 ? 41.894  37.223  43.438  1.00 82.92  ? 719 LYS A NZ    1 
ATOM   1774  N  N     . LYS A 1 452 ? 38.799  44.170  43.975  1.00 84.26  ? 720 LYS A N     1 
ATOM   1775  C  CA    . LYS A 1 452 ? 37.935  45.261  44.416  1.00 84.26  ? 720 LYS A CA    1 
ATOM   1776  C  C     . LYS A 1 452 ? 36.665  44.754  45.082  1.00 84.26  ? 720 LYS A C     1 
ATOM   1777  O  O     . LYS A 1 452 ? 36.182  45.371  46.038  1.00 84.26  ? 720 LYS A O     1 
ATOM   1778  C  CB    . LYS A 1 452 ? 37.600  46.149  43.219  1.00 84.26  ? 720 LYS A CB    1 
ATOM   1779  C  CG    . LYS A 1 452 ? 36.790  47.380  43.537  1.00 84.26  ? 720 LYS A CG    1 
ATOM   1780  C  CD    . LYS A 1 452 ? 36.598  48.222  42.297  1.00 84.26  ? 720 LYS A CD    1 
ATOM   1781  C  CE    . LYS A 1 452 ? 35.726  49.430  42.573  1.00 84.26  ? 720 LYS A CE    1 
ATOM   1782  N  NZ    . LYS A 1 452 ? 35.545  50.253  41.346  1.00 84.26  ? 720 LYS A NZ    1 
ATOM   1783  N  N     . ALA A 1 453 ? 36.122  43.630  44.611  1.00 87.29  ? 721 ALA A N     1 
ATOM   1784  C  CA    . ALA A 1 453 ? 34.933  43.066  45.236  1.00 87.29  ? 721 ALA A CA    1 
ATOM   1785  C  C     . ALA A 1 453 ? 35.237  42.506  46.617  1.00 87.29  ? 721 ALA A C     1 
ATOM   1786  O  O     . ALA A 1 453 ? 34.359  42.498  47.484  1.00 87.29  ? 721 ALA A O     1 
ATOM   1787  C  CB    . ALA A 1 453 ? 34.336  41.980  44.347  1.00 87.29  ? 721 ALA A CB    1 
ATOM   1788  N  N     . ASP A 1 454 ? 36.467  42.050  46.843  1.00 88.75  ? 722 ASP A N     1 
ATOM   1789  C  CA    . ASP A 1 454 ? 36.826  41.494  48.139  1.00 88.75  ? 722 ASP A CA    1 
ATOM   1790  C  C     . ASP A 1 454 ? 37.000  42.570  49.197  1.00 88.75  ? 722 ASP A C     1 
ATOM   1791  O  O     . ASP A 1 454 ? 36.739  42.314  50.375  1.00 88.75  ? 722 ASP A O     1 
ATOM   1792  C  CB    . ASP A 1 454 ? 38.107  40.671  48.020  1.00 88.75  ? 722 ASP A CB    1 
ATOM   1793  C  CG    . ASP A 1 454 ? 37.895  39.371  47.275  1.00 88.75  ? 722 ASP A CG    1 
ATOM   1794  O  OD1   . ASP A 1 454 ? 36.769  38.836  47.327  1.00 88.75  ? 722 ASP A OD1   1 
ATOM   1795  O  OD2   . ASP A 1 454 ? 38.851  38.879  46.640  1.00 88.75  ? 722 ASP A OD2   1 
ATOM   1796  N  N     . VAL A 1 455 ? 37.449  43.763  48.806  1.00 86.22  ? 723 VAL A N     1 
ATOM   1797  C  CA    . VAL A 1 455 ? 37.603  44.841  49.776  1.00 86.22  ? 723 VAL A CA    1 
ATOM   1798  C  C     . VAL A 1 455 ? 36.237  45.338  50.218  1.00 86.22  ? 723 VAL A C     1 
ATOM   1799  O  O     . VAL A 1 455 ? 36.038  45.680  51.390  1.00 86.22  ? 723 VAL A O     1 
ATOM   1800  C  CB    . VAL A 1 455 ? 38.459  45.972  49.176  1.00 86.22  ? 723 VAL A CB    1 
ATOM   1801  C  CG1   . VAL A 1 455 ? 38.692  47.084  50.182  1.00 86.22  ? 723 VAL A CG1   1 
ATOM   1802  C  CG2   . VAL A 1 455 ? 39.778  45.426  48.679  1.00 86.22  ? 723 VAL A CG2   1 
ATOM   1803  N  N     . GLU A 1 456 ? 35.268  45.339  49.300  1.00 87.23  ? 724 GLU A N     1 
ATOM   1804  C  CA    . GLU A 1 456 ? 33.909  45.760  49.615  1.00 87.23  ? 724 GLU A CA    1 
ATOM   1805  C  C     . GLU A 1 456 ? 33.239  44.797  50.590  1.00 87.23  ? 724 GLU A C     1 
ATOM   1806  O  O     . GLU A 1 456 ? 32.498  45.226  51.480  1.00 87.23  ? 724 GLU A O     1 
ATOM   1807  C  CB    . GLU A 1 456 ? 33.105  45.864  48.320  1.00 87.23  ? 724 GLU A CB    1 
ATOM   1808  C  CG    . GLU A 1 456 ? 31.698  46.392  48.469  1.00 87.23  ? 724 GLU A CG    1 
ATOM   1809  C  CD    . GLU A 1 456 ? 31.661  47.869  48.778  1.00 87.23  ? 724 GLU A CD    1 
ATOM   1810  O  OE1   . GLU A 1 456 ? 32.602  48.583  48.376  1.00 87.23  ? 724 GLU A OE1   1 
ATOM   1811  O  OE2   . GLU A 1 456 ? 30.690  48.318  49.423  1.00 87.23  ? 724 GLU A OE2   1 
ATOM   1812  N  N     . LYS A 1 457 ? 33.505  43.495  50.449  1.00 88.58  ? 725 LYS A N     1 
ATOM   1813  C  CA    . LYS A 1 457 ? 32.871  42.500  51.309  1.00 88.58  ? 725 LYS A CA    1 
ATOM   1814  C  C     . LYS A 1 457 ? 33.392  42.576  52.734  1.00 88.58  ? 725 LYS A C     1 
ATOM   1815  O  O     . LYS A 1 457 ? 32.614  42.488  53.689  1.00 88.58  ? 725 LYS A O     1 
ATOM   1816  C  CB    . LYS A 1 457 ? 33.103  41.097  50.755  1.00 88.58  ? 725 LYS A CB    1 
ATOM   1817  C  CG    . LYS A 1 457 ? 32.375  40.790  49.470  1.00 88.58  ? 725 LYS A CG    1 
ATOM   1818  C  CD    . LYS A 1 457 ? 32.687  39.378  49.014  1.00 88.58  ? 725 LYS A CD    1 
ATOM   1819  C  CE    . LYS A 1 457 ? 32.029  39.073  47.684  1.00 88.58  ? 725 LYS A CE    1 
ATOM   1820  N  NZ    . LYS A 1 457 ? 32.353  37.699  47.221  1.00 88.58  ? 725 LYS A NZ    1 
ATOM   1821  N  N     . VAL A 1 458 ? 34.708  42.726  52.891  1.00 90.18  ? 726 VAL A N     1 
ATOM   1822  C  CA    . VAL A 1 458 ? 35.322  42.747  54.213  1.00 90.18  ? 726 VAL A CA    1 
ATOM   1823  C  C     . VAL A 1 458 ? 34.937  44.010  54.963  1.00 90.18  ? 726 VAL A C     1 
ATOM   1824  O  O     . VAL A 1 458 ? 34.719  43.984  56.182  1.00 90.18  ? 726 VAL A O     1 
ATOM   1825  C  CB    . VAL A 1 458 ? 36.847  42.595  54.057  1.00 90.18  ? 726 VAL A CB    1 
ATOM   1826  C  CG1   . VAL A 1 458 ? 37.566  42.742  55.376  1.00 90.18  ? 726 VAL A CG1   1 
ATOM   1827  C  CG2   . VAL A 1 458 ? 37.159  41.246  53.465  1.00 90.18  ? 726 VAL A CG2   1 
ATOM   1828  N  N     . ALA A 1 459 ? 34.766  45.111  54.244  1.00 89.71  ? 727 ALA A N     1 
ATOM   1829  C  CA    . ALA A 1 459 ? 34.561  46.395  54.892  1.00 89.71  ? 727 ALA A CA    1 
ATOM   1830  C  C     . ALA A 1 459 ? 33.138  46.576  55.387  1.00 89.71  ? 727 ALA A C     1 
ATOM   1831  O  O     . ALA A 1 459 ? 32.925  47.164  56.451  1.00 89.71  ? 727 ALA A O     1 
ATOM   1832  C  CB    . ALA A 1 459 ? 34.909  47.504  53.927  1.00 89.71  ? 727 ALA A CB    1 
ATOM   1833  N  N     . LEU A 1 460 ? 32.152  46.109  54.618  1.00 91.04  ? 728 LEU A N     1 
ATOM   1834  C  CA    . LEU A 1 460 ? 30.768  46.214  55.060  1.00 91.04  ? 728 LEU A CA    1 
ATOM   1835  C  C     . LEU A 1 460 ? 30.501  45.311  56.252  1.00 91.04  ? 728 LEU A C     1 
ATOM   1836  O  O     . LEU A 1 460 ? 29.659  45.635  57.095  1.00 91.04  ? 728 LEU A O     1 
ATOM   1837  C  CB    . LEU A 1 460 ? 29.824  45.882  53.911  1.00 91.04  ? 728 LEU A CB    1 
ATOM   1838  C  CG    . LEU A 1 460 ? 29.871  46.859  52.738  1.00 91.04  ? 728 LEU A CG    1 
ATOM   1839  C  CD1   . LEU A 1 460 ? 28.996  46.368  51.600  1.00 91.04  ? 728 LEU A CD1   1 
ATOM   1840  C  CD2   . LEU A 1 460 ? 29.454  48.245  53.174  1.00 91.04  ? 728 LEU A CD2   1 
ATOM   1841  N  N     . LEU A 1 461 ? 31.208  44.185  56.338  1.00 93.97  ? 729 LEU A N     1 
ATOM   1842  C  CA    . LEU A 1 461 ? 31.211  43.397  57.563  1.00 93.97  ? 729 LEU A CA    1 
ATOM   1843  C  C     . LEU A 1 461 ? 31.852  44.173  58.705  1.00 93.97  ? 729 LEU A C     1 
ATOM   1844  O  O     . LEU A 1 461 ? 31.396  44.097  59.851  1.00 93.97  ? 729 LEU A O     1 
ATOM   1845  C  CB    . LEU A 1 461 ? 31.949  42.083  57.327  1.00 93.97  ? 729 LEU A CB    1 
ATOM   1846  C  CG    . LEU A 1 461 ? 31.954  41.090  58.482  1.00 93.97  ? 729 LEU A CG    1 
ATOM   1847  C  CD1   . LEU A 1 461 ? 30.534  40.675  58.783  1.00 93.97  ? 729 LEU A CD1   1 
ATOM   1848  C  CD2   . LEU A 1 461 ? 32.801  39.878  58.140  1.00 93.97  ? 729 LEU A CD2   1 
ATOM   1849  N  N     . LEU A 1 462 ? 32.903  44.934  58.405  1.00 97.18  ? 730 LEU A N     1 
ATOM   1850  C  CA    . LEU A 1 462 ? 33.526  45.793  59.402  1.00 97.18  ? 730 LEU A CA    1 
ATOM   1851  C  C     . LEU A 1 462 ? 32.688  47.028  59.685  1.00 97.18  ? 730 LEU A C     1 
ATOM   1852  O  O     . LEU A 1 462 ? 32.701  47.536  60.807  1.00 97.18  ? 730 LEU A O     1 
ATOM   1853  C  CB    . LEU A 1 462 ? 34.926  46.191  58.933  1.00 97.18  ? 730 LEU A CB    1 
ATOM   1854  C  CG    . LEU A 1 462 ? 35.773  47.114  59.808  1.00 97.18  ? 730 LEU A CG    1 
ATOM   1855  C  CD1   . LEU A 1 462 ? 36.001  46.501  61.172  1.00 97.18  ? 730 LEU A CD1   1 
ATOM   1856  C  CD2   . LEU A 1 462 ? 37.093  47.414  59.129  1.00 97.18  ? 730 LEU A CD2   1 
ATOM   1857  N  N     . LEU A 1 463 ? 31.944  47.521  58.697  1.00 95.70  ? 731 LEU A N     1 
ATOM   1858  C  CA    . LEU A 1 463 ? 31.128  48.705  58.927  1.00 95.70  ? 731 LEU A CA    1 
ATOM   1859  C  C     . LEU A 1 463 ? 29.912  48.400  59.793  1.00 95.70  ? 731 LEU A C     1 
ATOM   1860  O  O     . LEU A 1 463 ? 29.393  49.303  60.457  1.00 95.70  ? 731 LEU A O     1 
ATOM   1861  C  CB    . LEU A 1 463 ? 30.715  49.308  57.584  1.00 95.70  ? 731 LEU A CB    1 
ATOM   1862  C  CG    . LEU A 1 463 ? 29.998  50.652  57.544  1.00 95.70  ? 731 LEU A CG    1 
ATOM   1863  C  CD1   . LEU A 1 463 ? 30.862  51.705  58.194  1.00 95.70  ? 731 LEU A CD1   1 
ATOM   1864  C  CD2   . LEU A 1 463 ? 29.697  51.028  56.110  1.00 95.70  ? 731 LEU A CD2   1 
ATOM   1865  N  N     . GLU A 1 464 ? 29.471  47.143  59.835  1.00 98.01  ? 732 GLU A N     1 
ATOM   1866  C  CA    . GLU A 1 464 ? 28.323  46.759  60.649  1.00 98.01  ? 732 GLU A CA    1 
ATOM   1867  C  C     . GLU A 1 464 ? 28.740  46.243  62.024  1.00 98.01  ? 732 GLU A C     1 
ATOM   1868  O  O     . GLU A 1 464 ? 28.358  46.814  63.049  1.00 98.01  ? 732 GLU A O     1 
ATOM   1869  C  CB    . GLU A 1 464 ? 27.499  45.702  59.912  1.00 98.01  ? 732 GLU A CB    1 
ATOM   1870  C  CG    . GLU A 1 464 ? 26.822  46.214  58.661  1.00 98.01  ? 732 GLU A CG    1 
ATOM   1871  C  CD    . GLU A 1 464 ? 26.084  45.122  57.920  1.00 98.01  ? 732 GLU A CD    1 
ATOM   1872  O  OE1   . GLU A 1 464 ? 26.206  43.946  58.320  1.00 98.01  ? 732 GLU A OE1   1 
ATOM   1873  O  OE2   . GLU A 1 464 ? 25.386  45.439  56.935  1.00 98.01  ? 732 GLU A OE2   1 
ATOM   1874  N  N     . LYS A 1 465 ? 29.525  45.168  62.061  1.00 99.80  ? 733 LYS A N     1 
ATOM   1875  C  CA    . LYS A 1 465 ? 29.865  44.542  63.331  1.00 99.80  ? 733 LYS A CA    1 
ATOM   1876  C  C     . LYS A 1 465 ? 30.935  45.295  64.104  1.00 99.80  ? 733 LYS A C     1 
ATOM   1877  O  O     . LYS A 1 465 ? 31.111  45.023  65.297  1.00 99.80  ? 733 LYS A O     1 
ATOM   1878  C  CB    . LYS A 1 465 ? 30.334  43.106  63.111  1.00 99.80  ? 733 LYS A CB    1 
ATOM   1879  C  CG    . LYS A 1 465 ? 29.239  42.144  62.710  1.00 99.80  ? 733 LYS A CG    1 
ATOM   1880  C  CD    . LYS A 1 465 ? 29.814  40.771  62.431  1.00 99.80  ? 733 LYS A CD    1 
ATOM   1881  C  CE    . LYS A 1 465 ? 30.304  40.115  63.709  1.00 99.80  ? 733 LYS A CE    1 
ATOM   1882  N  NZ    . LYS A 1 465 ? 30.764  38.719  63.475  1.00 99.80  ? 733 LYS A NZ    1 
ATOM   1883  N  N     . GLU A 1 466 ? 31.694  46.167  63.429  1.00 103.28 ? 734 GLU A N     1 
ATOM   1884  C  CA    . GLU A 1 466 ? 32.731  47.042  63.984  1.00 103.28 ? 734 GLU A CA    1 
ATOM   1885  C  C     . GLU A 1 466 ? 33.924  46.309  64.591  1.00 103.28 ? 734 GLU A C     1 
ATOM   1886  O  O     . GLU A 1 466 ? 34.803  46.952  65.168  1.00 103.28 ? 734 GLU A O     1 
ATOM   1887  C  CB    . GLU A 1 466 ? 32.139  48.007  65.015  1.00 103.28 ? 734 GLU A CB    1 
ATOM   1888  C  CG    . GLU A 1 466 ? 31.156  48.996  64.429  1.00 103.28 ? 734 GLU A CG    1 
ATOM   1889  C  CD    . GLU A 1 466 ? 30.584  49.927  65.474  1.00 103.28 ? 734 GLU A CD    1 
ATOM   1890  O  OE1   . GLU A 1 466 ? 30.880  49.727  66.671  1.00 103.28 ? 734 GLU A OE1   1 
ATOM   1891  O  OE2   . GLU A 1 466 ? 29.836  50.854  65.100  1.00 103.28 ? 734 GLU A OE2   1 
ATOM   1892  N  N     . VAL A 1 467 ? 33.972  44.981  64.472  1.00 105.46 ? 735 VAL A N     1 
ATOM   1893  C  CA    . VAL A 1 467 ? 35.078  44.150  64.944  1.00 105.46 ? 735 VAL A CA    1 
ATOM   1894  C  C     . VAL A 1 467 ? 35.264  43.030  63.931  1.00 105.46 ? 735 VAL A C     1 
ATOM   1895  O  O     . VAL A 1 467 ? 34.321  42.280  63.659  1.00 105.46 ? 735 VAL A O     1 
ATOM   1896  C  CB    . VAL A 1 467 ? 34.829  43.548  66.343  1.00 105.46 ? 735 VAL A CB    1 
ATOM   1897  C  CG1   . VAL A 1 467 ? 35.875  42.495  66.656  1.00 105.46 ? 735 VAL A CG1   1 
ATOM   1898  C  CG2   . VAL A 1 467 ? 34.859  44.603  67.441  1.00 105.46 ? 735 VAL A CG2   1 
ATOM   1899  N  N     . LEU A 1 468 ? 36.460  42.914  63.369  1.00 107.36 ? 736 LEU A N     1 
ATOM   1900  C  CA    . LEU A 1 468 ? 36.800  41.772  62.537  1.00 107.36 ? 736 LEU A CA    1 
ATOM   1901  C  C     . LEU A 1 468 ? 37.681  40.798  63.306  1.00 107.36 ? 736 LEU A C     1 
ATOM   1902  O  O     . LEU A 1 468 ? 38.182  41.088  64.393  1.00 107.36 ? 736 LEU A O     1 
ATOM   1903  C  CB    . LEU A 1 468 ? 37.494  42.211  61.250  1.00 107.36 ? 736 LEU A CB    1 
ATOM   1904  C  CG    . LEU A 1 468 ? 36.587  42.905  60.243  1.00 107.36 ? 736 LEU A CG    1 
ATOM   1905  C  CD1   . LEU A 1 468 ? 37.393  43.371  59.053  1.00 107.36 ? 736 LEU A CD1   1 
ATOM   1906  C  CD2   . LEU A 1 468 ? 35.480  41.973  59.809  1.00 107.36 ? 736 LEU A CD2   1 
ATOM   1907  N  N     . ASP A 1 469 ? 37.859  39.620  62.717  1.00 112.72 ? 737 ASP A N     1 
ATOM   1908  C  CA    . ASP A 1 469 ? 38.605  38.541  63.340  1.00 112.72 ? 737 ASP A CA    1 
ATOM   1909  C  C     . ASP A 1 469 ? 39.242  37.730  62.222  1.00 112.72 ? 737 ASP A C     1 
ATOM   1910  O  O     . ASP A 1 469 ? 38.878  37.869  61.053  1.00 112.72 ? 737 ASP A O     1 
ATOM   1911  C  CB    . ASP A 1 469 ? 37.686  37.678  64.217  1.00 112.72 ? 737 ASP A CB    1 
ATOM   1912  C  CG    . ASP A 1 469 ? 38.447  36.763  65.162  1.00 112.72 ? 737 ASP A CG    1 
ATOM   1913  O  OD1   . ASP A 1 469 ? 39.696  36.793  65.154  1.00 112.72 ? 737 ASP A OD1   1 
ATOM   1914  O  OD2   . ASP A 1 469 ? 37.791  36.004  65.905  1.00 112.72 ? 737 ASP A OD2   1 
ATOM   1915  N  N     . LYS A 1 470 ? 40.221  36.898  62.589  1.00 112.67 ? 738 LYS A N     1 
ATOM   1916  C  CA    . LYS A 1 470 ? 40.816  35.990  61.616  1.00 112.67 ? 738 LYS A CA    1 
ATOM   1917  C  C     . LYS A 1 470 ? 39.797  34.968  61.133  1.00 112.67 ? 738 LYS A C     1 
ATOM   1918  O  O     . LYS A 1 470 ? 39.782  34.605  59.952  1.00 112.67 ? 738 LYS A O     1 
ATOM   1919  C  CB    . LYS A 1 470 ? 42.034  35.293  62.221  1.00 112.67 ? 738 LYS A CB    1 
ATOM   1920  C  CG    . LYS A 1 470 ? 42.794  34.426  61.235  1.00 112.67 ? 738 LYS A CG    1 
ATOM   1921  C  CD    . LYS A 1 470 ? 44.042  33.827  61.853  1.00 112.67 ? 738 LYS A CD    1 
ATOM   1922  C  CE    . LYS A 1 470 ? 44.789  32.975  60.839  1.00 112.67 ? 738 LYS A CE    1 
ATOM   1923  N  NZ    . LYS A 1 470 ? 46.027  32.381  61.409  1.00 112.67 ? 738 LYS A NZ    1 
ATOM   1924  N  N     . ASN A 1 471 ? 38.918  34.515  62.030  1.00 110.50 ? 739 ASN A N     1 
ATOM   1925  C  CA    . ASN A 1 471 ? 37.863  33.591  61.635  1.00 110.50 ? 739 ASN A CA    1 
ATOM   1926  C  C     . ASN A 1 471 ? 36.838  34.266  60.737  1.00 110.50 ? 739 ASN A C     1 
ATOM   1927  O  O     . ASN A 1 471 ? 36.292  33.625  59.835  1.00 110.50 ? 739 ASN A O     1 
ATOM   1928  C  CB    . ASN A 1 471 ? 37.184  33.021  62.874  1.00 110.50 ? 739 ASN A CB    1 
ATOM   1929  C  CG    . ASN A 1 471 ? 38.118  32.172  63.703  1.00 110.50 ? 739 ASN A CG    1 
ATOM   1930  O  OD1   . ASN A 1 471 ? 38.912  31.400  63.168  1.00 110.50 ? 739 ASN A OD1   1 
ATOM   1931  N  ND2   . ASN A 1 471 ? 38.033  32.314  65.018  1.00 110.50 ? 739 ASN A ND2   1 
ATOM   1932  N  N     . ASP A 1 472 ? 36.584  35.556  60.954  1.00 109.12 ? 740 ASP A N     1 
ATOM   1933  C  CA    . ASP A 1 472 ? 35.653  36.292  60.108  1.00 109.12 ? 740 ASP A CA    1 
ATOM   1934  C  C     . ASP A 1 472 ? 36.217  36.544  58.719  1.00 109.12 ? 740 ASP A C     1 
ATOM   1935  O  O     . ASP A 1 472 ? 35.446  36.719  57.771  1.00 109.12 ? 740 ASP A O     1 
ATOM   1936  C  CB    . ASP A 1 472 ? 35.286  37.615  60.774  1.00 109.12 ? 740 ASP A CB    1 
ATOM   1937  C  CG    . ASP A 1 472 ? 34.484  37.420  62.043  1.00 109.12 ? 740 ASP A CG    1 
ATOM   1938  O  OD1   . ASP A 1 472 ? 33.738  36.423  62.126  1.00 109.12 ? 740 ASP A OD1   1 
ATOM   1939  O  OD2   . ASP A 1 472 ? 34.607  38.254  62.962  1.00 109.12 ? 740 ASP A OD2   1 
ATOM   1940  N  N     . MET A 1 473 ? 37.541  36.566  58.579  1.00 104.33 ? 741 MET A N     1 
ATOM   1941  C  CA    . MET A 1 473 ? 38.146  36.688  57.260  1.00 104.33 ? 741 MET A CA    1 
ATOM   1942  C  C     . MET A 1 473 ? 38.054  35.381  56.486  1.00 104.33 ? 741 MET A C     1 
ATOM   1943  O  O     . MET A 1 473 ? 37.847  35.392  55.267  1.00 104.33 ? 741 MET A O     1 
ATOM   1944  C  CB    . MET A 1 473 ? 39.604  37.119  57.396  1.00 104.33 ? 741 MET A CB    1 
ATOM   1945  C  CG    . MET A 1 473 ? 39.793  38.512  57.951  1.00 104.33 ? 741 MET A CG    1 
ATOM   1946  S  SD    . MET A 1 473 ? 39.092  39.753  56.866  1.00 104.33 ? 741 MET A SD    1 
ATOM   1947  C  CE    . MET A 1 473 ? 40.227  39.648  55.492  1.00 104.33 ? 741 MET A CE    1 
ATOM   1948  N  N     . VAL A 1 474 ? 38.215  34.252  57.179  1.00 105.92 ? 742 VAL A N     1 
ATOM   1949  C  CA    . VAL A 1 474 ? 38.150  32.951  56.525  1.00 105.92 ? 742 VAL A CA    1 
ATOM   1950  C  C     . VAL A 1 474 ? 36.718  32.636  56.118  1.00 105.92 ? 742 VAL A C     1 
ATOM   1951  O  O     . VAL A 1 474 ? 36.468  32.091  55.036  1.00 105.92 ? 742 VAL A O     1 
ATOM   1952  C  CB    . VAL A 1 474 ? 38.744  31.872  57.450  1.00 105.92 ? 742 VAL A CB    1 
ATOM   1953  C  CG1   . VAL A 1 474 ? 38.621  30.488  56.839  1.00 105.92 ? 742 VAL A CG1   1 
ATOM   1954  C  CG2   . VAL A 1 474 ? 40.195  32.177  57.738  1.00 105.92 ? 742 VAL A CG2   1 
ATOM   1955  N  N     . GLU A 1 475 ? 35.749  33.033  56.945  1.00 107.50 ? 743 GLU A N     1 
ATOM   1956  C  CA    . GLU A 1 475 ? 34.341  32.839  56.620  1.00 107.50 ? 743 GLU A CA    1 
ATOM   1957  C  C     . GLU A 1 475 ? 33.860  33.718  55.474  1.00 107.50 ? 743 GLU A C     1 
ATOM   1958  O  O     . GLU A 1 475 ? 32.751  33.499  54.978  1.00 107.50 ? 743 GLU A O     1 
ATOM   1959  C  CB    . GLU A 1 475 ? 33.476  33.103  57.851  1.00 107.50 ? 743 GLU A CB    1 
ATOM   1960  C  CG    . GLU A 1 475 ? 33.588  32.045  58.929  1.00 107.50 ? 743 GLU A CG    1 
ATOM   1961  C  CD    . GLU A 1 475 ? 32.771  32.385  60.158  1.00 107.50 ? 743 GLU A CD    1 
ATOM   1962  O  OE1   . GLU A 1 475 ? 32.219  33.503  60.215  1.00 107.50 ? 743 GLU A OE1   1 
ATOM   1963  O  OE2   . GLU A 1 475 ? 32.683  31.536  61.070  1.00 107.50 ? 743 GLU A OE2   1 
ATOM   1964  N  N     . LEU A 1 476 ? 34.649  34.692  55.046  1.00 101.08 ? 744 LEU A N     1 
ATOM   1965  C  CA    . LEU A 1 476 ? 34.229  35.624  54.013  1.00 101.08 ? 744 LEU A CA    1 
ATOM   1966  C  C     . LEU A 1 476 ? 35.077  35.561  52.756  1.00 101.08 ? 744 LEU A C     1 
ATOM   1967  O  O     . LEU A 1 476 ? 34.532  35.619  51.653  1.00 101.08 ? 744 LEU A O     1 
ATOM   1968  C  CB    . LEU A 1 476 ? 34.238  37.045  54.579  1.00 101.08 ? 744 LEU A CB    1 
ATOM   1969  C  CG    . LEU A 1 476 ? 33.720  38.152  53.672  1.00 101.08 ? 744 LEU A CG    1 
ATOM   1970  C  CD1   . LEU A 1 476 ? 32.317  37.840  53.198  1.00 101.08 ? 744 LEU A CD1   1 
ATOM   1971  C  CD2   . LEU A 1 476 ? 33.714  39.419  54.470  1.00 101.08 ? 744 LEU A CD2   1 
ATOM   1972  N  N     . LEU A 1 477 ? 36.395  35.433  52.882  1.00 99.15  ? 745 LEU A N     1 
ATOM   1973  C  CA    . LEU A 1 477 ? 37.266  35.359  51.719  1.00 99.15  ? 745 LEU A CA    1 
ATOM   1974  C  C     . LEU A 1 477 ? 37.819  33.967  51.466  1.00 99.15  ? 745 LEU A C     1 
ATOM   1975  O  O     . LEU A 1 477 ? 38.588  33.785  50.518  1.00 99.15  ? 745 LEU A O     1 
ATOM   1976  C  CB    . LEU A 1 477 ? 38.432  36.339  51.860  1.00 99.15  ? 745 LEU A CB    1 
ATOM   1977  C  CG    . LEU A 1 477 ? 38.087  37.821  51.866  1.00 99.15  ? 745 LEU A CG    1 
ATOM   1978  C  CD1   . LEU A 1 477 ? 39.357  38.631  51.989  1.00 99.15  ? 745 LEU A CD1   1 
ATOM   1979  C  CD2   . LEU A 1 477 ? 37.328  38.179  50.615  1.00 99.15  ? 745 LEU A CD2   1 
ATOM   1980  N  N     . GLY A 1 478 ? 37.451  32.982  52.276  1.00 103.50 ? 746 GLY A N     1 
ATOM   1981  C  CA    . GLY A 1 478 ? 38.047  31.674  52.185  1.00 103.50 ? 746 GLY A CA    1 
ATOM   1982  C  C     . GLY A 1 478 ? 39.333  31.633  52.979  1.00 103.50 ? 746 GLY A C     1 
ATOM   1983  O  O     . GLY A 1 478 ? 39.735  32.628  53.588  1.00 103.50 ? 746 GLY A O     1 
ATOM   1984  N  N     . PRO A 1 479 ? 39.994  30.480  53.011  1.00 102.78 ? 747 PRO A N     1 
ATOM   1985  C  CA    . PRO A 1 479 ? 41.289  30.397  53.690  1.00 102.78 ? 747 PRO A CA    1 
ATOM   1986  C  C     . PRO A 1 479 ? 42.356  31.161  52.926  1.00 102.78 ? 747 PRO A C     1 
ATOM   1987  O  O     . PRO A 1 479 ? 42.241  31.417  51.726  1.00 102.78 ? 747 PRO A O     1 
ATOM   1988  C  CB    . PRO A 1 479 ? 41.589  28.896  53.707  1.00 102.78 ? 747 PRO A CB    1 
ATOM   1989  C  CG    . PRO A 1 479 ? 40.263  28.245  53.545  1.00 102.78 ? 747 PRO A CG    1 
ATOM   1990  C  CD    . PRO A 1 479 ? 39.495  29.150  52.634  1.00 102.78 ? 747 PRO A CD    1 
ATOM   1991  N  N     . ARG A 1 480 ? 43.393  31.545  53.656  1.00 101.52 ? 748 ARG A N     1 
ATOM   1992  C  CA    . ARG A 1 480 ? 44.512  32.253  53.052  1.00 101.52 ? 748 ARG A CA    1 
ATOM   1993  C  C     . ARG A 1 480 ? 45.273  31.297  52.142  1.00 101.52 ? 748 ARG A C     1 
ATOM   1994  O  O     . ARG A 1 480 ? 45.638  30.201  52.578  1.00 101.52 ? 748 ARG A O     1 
ATOM   1995  C  CB    . ARG A 1 480 ? 45.427  32.811  54.137  1.00 101.52 ? 748 ARG A CB    1 
ATOM   1996  C  CG    . ARG A 1 480 ? 46.535  33.694  53.616  1.00 101.52 ? 748 ARG A CG    1 
ATOM   1997  C  CD    . ARG A 1 480 ? 47.355  34.295  54.735  1.00 101.52 ? 748 ARG A CD    1 
ATOM   1998  N  NE    . ARG A 1 480 ? 48.455  35.095  54.211  1.00 101.52 ? 748 ARG A NE    1 
ATOM   1999  C  CZ    . ARG A 1 480 ? 49.350  35.718  54.967  1.00 101.52 ? 748 ARG A CZ    1 
ATOM   2000  N  NH1   . ARG A 1 480 ? 49.280  35.631  56.286  1.00 101.52 ? 748 ARG A NH1   1 
ATOM   2001  N  NH2   . ARG A 1 480 ? 50.319  36.424  54.404  1.00 101.52 ? 748 ARG A NH2   1 
ATOM   2002  N  N     . PRO A 1 481 ? 45.549  31.671  50.891  1.00 104.62 ? 749 PRO A N     1 
ATOM   2003  C  CA    . PRO A 1 481 ? 46.066  30.709  49.907  1.00 104.62 ? 749 PRO A CA    1 
ATOM   2004  C  C     . PRO A 1 481 ? 47.527  30.321  50.080  1.00 104.62 ? 749 PRO A C     1 
ATOM   2005  O  O     . PRO A 1 481 ? 48.103  29.744  49.154  1.00 104.62 ? 749 PRO A O     1 
ATOM   2006  C  CB    . PRO A 1 481 ? 45.864  31.450  48.576  1.00 104.62 ? 749 PRO A CB    1 
ATOM   2007  C  CG    . PRO A 1 481 ? 45.888  32.878  48.933  1.00 104.62 ? 749 PRO A CG    1 
ATOM   2008  C  CD    . PRO A 1 481 ? 45.241  32.973  50.276  1.00 104.62 ? 749 PRO A CD    1 
ATOM   2009  N  N     . PHE A 1 482 ? 48.136  30.611  51.222  1.00 108.13 ? 750 PHE A N     1 
ATOM   2010  C  CA    . PHE A 1 482 ? 49.544  30.376  51.478  1.00 108.13 ? 750 PHE A CA    1 
ATOM   2011  C  C     . PHE A 1 482 ? 49.680  29.503  52.716  1.00 108.13 ? 750 PHE A C     1 
ATOM   2012  O  O     . PHE A 1 482 ? 48.801  29.498  53.583  1.00 108.13 ? 750 PHE A O     1 
ATOM   2013  C  CB    . PHE A 1 482 ? 50.247  31.718  51.652  1.00 108.13 ? 750 PHE A CB    1 
ATOM   2014  C  CG    . PHE A 1 482 ? 50.252  32.539  50.402  1.00 108.13 ? 750 PHE A CG    1 
ATOM   2015  C  CD1   . PHE A 1 482 ? 50.409  31.931  49.169  1.00 108.13 ? 750 PHE A CD1   1 
ATOM   2016  C  CD2   . PHE A 1 482 ? 49.955  33.887  50.443  1.00 108.13 ? 750 PHE A CD2   1 
ATOM   2017  C  CE1   . PHE A 1 482 ? 50.377  32.669  48.008  1.00 108.13 ? 750 PHE A CE1   1 
ATOM   2018  C  CE2   . PHE A 1 482 ? 49.904  34.629  49.281  1.00 108.13 ? 750 PHE A CE2   1 
ATOM   2019  C  CZ    . PHE A 1 482 ? 50.121  34.020  48.065  1.00 108.13 ? 750 PHE A CZ    1 
ATOM   2020  N  N     . ALA A 1 483 ? 50.774  28.746  52.779  1.00 123.85 ? 751 ALA A N     1 
ATOM   2021  C  CA    . ALA A 1 483 ? 50.973  27.798  53.868  1.00 123.85 ? 751 ALA A CA    1 
ATOM   2022  C  C     . ALA A 1 483 ? 51.225  28.532  55.178  1.00 123.85 ? 751 ALA A C     1 
ATOM   2023  O  O     . ALA A 1 483 ? 52.033  29.464  55.237  1.00 123.85 ? 751 ALA A O     1 
ATOM   2024  C  CB    . ALA A 1 483 ? 52.136  26.860  53.553  1.00 123.85 ? 751 ALA A CB    1 
ATOM   2025  N  N     . GLU A 1 484 ? 50.525  28.112  56.228  1.00 135.82 ? 752 GLU A N     1 
ATOM   2026  C  CA    . GLU A 1 484 ? 50.584  28.788  57.513  1.00 135.82 ? 752 GLU A CA    1 
ATOM   2027  C  C     . GLU A 1 484 ? 51.852  28.395  58.269  1.00 135.82 ? 752 GLU A C     1 
ATOM   2028  O  O     . GLU A 1 484 ? 52.662  27.585  57.811  1.00 135.82 ? 752 GLU A O     1 
ATOM   2029  C  CB    . GLU A 1 484 ? 49.339  28.468  58.336  1.00 135.82 ? 752 GLU A CB    1 
ATOM   2030  C  CG    . GLU A 1 484 ? 48.054  29.039  57.768  1.00 135.82 ? 752 GLU A CG    1 
ATOM   2031  C  CD    . GLU A 1 484 ? 46.839  28.678  58.600  1.00 135.82 ? 752 GLU A CD    1 
ATOM   2032  O  OE1   . GLU A 1 484 ? 46.980  27.873  59.543  1.00 135.82 ? 752 GLU A OE1   1 
ATOM   2033  O  OE2   . GLU A 1 484 ? 45.742  29.200  58.312  1.00 135.82 ? 752 GLU A OE2   1 
ATOM   2034  N  N     . LYS A 1 485 ? 52.018  28.977  59.452  1.00 140.66 ? 753 LYS A N     1 
ATOM   2035  C  CA    . LYS A 1 485 ? 53.190  28.722  60.280  1.00 140.66 ? 753 LYS A CA    1 
ATOM   2036  C  C     . LYS A 1 485 ? 52.837  28.810  61.761  1.00 140.66 ? 753 LYS A C     1 
ATOM   2037  O  O     . LYS A 1 485 ? 52.689  27.792  62.436  1.00 140.66 ? 753 LYS A O     1 
ATOM   2038  C  CB    . LYS A 1 485 ? 54.301  29.701  59.938  1.00 140.66 ? 753 LYS A CB    1 
ATOM   2039  N  N     . VAL B 1 23  ? 59.443  66.289  108.508 1.00 102.03 ? 291 VAL B N     1 
ATOM   2040  C  CA    . VAL B 1 23  ? 58.184  66.717  109.097 1.00 102.03 ? 291 VAL B CA    1 
ATOM   2041  C  C     . VAL B 1 23  ? 57.311  65.495  109.367 1.00 102.03 ? 291 VAL B C     1 
ATOM   2042  O  O     . VAL B 1 23  ? 57.146  65.088  110.516 1.00 102.03 ? 291 VAL B O     1 
ATOM   2043  C  CB    . VAL B 1 23  ? 57.468  67.731  108.190 1.00 102.03 ? 291 VAL B CB    1 
ATOM   2044  C  CG1   . VAL B 1 23  ? 56.152  68.178  108.815 1.00 102.03 ? 291 VAL B CG1   1 
ATOM   2045  C  CG2   . VAL B 1 23  ? 58.376  68.921  107.913 1.00 102.03 ? 291 VAL B CG2   1 
ATOM   2046  N  N     . GLY B 1 24  ? 56.761  64.905  108.303 1.00 105.03 ? 292 GLY B N     1 
ATOM   2047  C  CA    . GLY B 1 24  ? 55.940  63.717  108.406 1.00 105.03 ? 292 GLY B CA    1 
ATOM   2048  C  C     . GLY B 1 24  ? 54.445  63.955  108.339 1.00 105.03 ? 292 GLY B C     1 
ATOM   2049  O  O     . GLY B 1 24  ? 53.685  62.981  108.306 1.00 105.03 ? 292 GLY B O     1 
ATOM   2050  N  N     . GLU B 1 25  ? 54.003  65.209  108.324 1.00 106.51 ? 293 GLU B N     1 
ATOM   2051  C  CA    . GLU B 1 25  ? 52.577  65.503  108.301 1.00 106.51 ? 293 GLU B CA    1 
ATOM   2052  C  C     . GLU B 1 25  ? 51.994  65.211  106.924 1.00 106.51 ? 293 GLU B C     1 
ATOM   2053  O  O     . GLU B 1 25  ? 52.536  65.633  105.900 1.00 106.51 ? 293 GLU B O     1 
ATOM   2054  C  CB    . GLU B 1 25  ? 52.332  66.964  108.679 1.00 106.51 ? 293 GLU B CB    1 
ATOM   2055  C  CG    . GLU B 1 25  ? 52.706  67.303  110.114 1.00 106.51 ? 293 GLU B CG    1 
ATOM   2056  C  CD    . GLU B 1 25  ? 52.486  68.767  110.444 1.00 106.51 ? 293 GLU B CD    1 
ATOM   2057  O  OE1   . GLU B 1 25  ? 52.147  69.541  109.524 1.00 106.51 ? 293 GLU B OE1   1 
ATOM   2058  O  OE2   . GLU B 1 25  ? 52.657  69.145  111.623 1.00 106.51 ? 293 GLU B OE2   1 
ATOM   2059  N  N     . THR B 1 26  ? 50.870  64.498  106.904 1.00 103.74 ? 294 THR B N     1 
ATOM   2060  C  CA    . THR B 1 26  ? 50.334  63.963  105.660 1.00 103.74 ? 294 THR B CA    1 
ATOM   2061  C  C     . THR B 1 26  ? 49.593  64.987  104.813 1.00 103.74 ? 294 THR B C     1 
ATOM   2062  O  O     . THR B 1 26  ? 49.339  64.697  103.639 1.00 103.74 ? 294 THR B O     1 
ATOM   2063  C  CB    . THR B 1 26  ? 49.398  62.790  105.952 1.00 103.74 ? 294 THR B CB    1 
ATOM   2064  O  OG1   . THR B 1 26  ? 48.961  62.210  104.718 1.00 103.74 ? 294 THR B OG1   1 
ATOM   2065  C  CG2   . THR B 1 26  ? 48.192  63.252  106.753 1.00 103.74 ? 294 THR B CG2   1 
ATOM   2066  N  N     . THR B 1 27  ? 49.266  66.161  105.378 1.00 99.57  ? 295 THR B N     1 
ATOM   2067  C  CA    . THR B 1 27  ? 48.452  67.259  104.832 1.00 99.57  ? 295 THR B CA    1 
ATOM   2068  C  C     . THR B 1 27  ? 47.252  66.813  103.991 1.00 99.57  ? 295 THR B C     1 
ATOM   2069  O  O     . THR B 1 27  ? 46.920  67.426  102.971 1.00 99.57  ? 295 THR B O     1 
ATOM   2070  C  CB    . THR B 1 27  ? 49.322  68.297  104.073 1.00 99.57  ? 295 THR B CB    1 
ATOM   2071  O  OG1   . THR B 1 27  ? 48.493  69.379  103.629 1.00 99.57  ? 295 THR B OG1   1 
ATOM   2072  C  CG2   . THR B 1 27  ? 50.123  67.748  102.878 1.00 99.57  ? 295 THR B CG2   1 
ATOM   2073  N  N     . ALA B 1 28  ? 46.564  65.773  104.449 1.00 101.62 ? 296 ALA B N     1 
ATOM   2074  C  CA    . ALA B 1 28  ? 45.326  65.302  103.852 1.00 101.62 ? 296 ALA B CA    1 
ATOM   2075  C  C     . ALA B 1 28  ? 44.158  65.660  104.757 1.00 101.62 ? 296 ALA B C     1 
ATOM   2076  O  O     . ALA B 1 28  ? 44.309  65.816  105.971 1.00 101.62 ? 296 ALA B O     1 
ATOM   2077  C  CB    . ALA B 1 28  ? 45.362  63.790  103.628 1.00 101.62 ? 296 ALA B CB    1 
ATOM   2078  N  N     . LYS B 1 29  ? 42.979  65.780  104.155 1.00 105.57 ? 297 LYS B N     1 
ATOM   2079  C  CA    . LYS B 1 29  ? 41.784  66.206  104.874 1.00 105.57 ? 297 LYS B CA    1 
ATOM   2080  C  C     . LYS B 1 29  ? 40.686  65.172  104.678 1.00 105.57 ? 297 LYS B C     1 
ATOM   2081  O  O     . LYS B 1 29  ? 40.193  64.992  103.560 1.00 105.57 ? 297 LYS B O     1 
ATOM   2082  C  CB    . LYS B 1 29  ? 41.323  67.585  104.403 1.00 105.57 ? 297 LYS B CB    1 
ATOM   2083  C  CG    . LYS B 1 29  ? 42.273  68.706  104.787 1.00 105.57 ? 297 LYS B CG    1 
ATOM   2084  C  CD    . LYS B 1 29  ? 41.754  70.065  104.348 1.00 105.57 ? 297 LYS B CD    1 
ATOM   2085  C  CE    . LYS B 1 29  ? 42.740  71.168  104.704 1.00 105.57 ? 297 LYS B CE    1 
ATOM   2086  N  NZ    . LYS B 1 29  ? 42.272  72.512  104.267 1.00 105.57 ? 297 LYS B NZ    1 
ATOM   2087  N  N     . VAL B 1 30  ? 40.294  64.510  105.765 1.00 108.90 ? 298 VAL B N     1 
ATOM   2088  C  CA    . VAL B 1 30  ? 39.177  63.577  105.720 1.00 108.90 ? 298 VAL B CA    1 
ATOM   2089  C  C     . VAL B 1 30  ? 37.918  64.418  105.625 1.00 108.90 ? 298 VAL B C     1 
ATOM   2090  O  O     . VAL B 1 30  ? 37.417  64.918  106.638 1.00 108.90 ? 298 VAL B O     1 
ATOM   2091  C  CB    . VAL B 1 30  ? 39.132  62.669  106.961 1.00 108.90 ? 298 VAL B CB    1 
ATOM   2092  C  CG1   . VAL B 1 30  ? 38.038  61.623  106.816 1.00 108.90 ? 298 VAL B CG1   1 
ATOM   2093  C  CG2   . VAL B 1 30  ? 40.479  62.047  107.239 1.00 108.90 ? 298 VAL B CG2   1 
ATOM   2094  N  N     . LEU B 1 31  ? 37.403  64.597  104.417 1.00 111.98 ? 299 LEU B N     1 
ATOM   2095  C  CA    . LEU B 1 31  ? 36.278  65.492  104.196 1.00 111.98 ? 299 LEU B CA    1 
ATOM   2096  C  C     . LEU B 1 31  ? 34.996  64.677  104.074 1.00 111.98 ? 299 LEU B C     1 
ATOM   2097  O  O     . LEU B 1 31  ? 34.909  63.748  103.265 1.00 111.98 ? 299 LEU B O     1 
ATOM   2098  C  CB    . LEU B 1 31  ? 36.518  66.391  102.979 1.00 111.98 ? 299 LEU B CB    1 
ATOM   2099  C  CG    . LEU B 1 31  ? 36.781  65.911  101.554 1.00 111.98 ? 299 LEU B CG    1 
ATOM   2100  C  CD1   . LEU B 1 31  ? 35.497  65.763  100.766 1.00 111.98 ? 299 LEU B CD1   1 
ATOM   2101  C  CD2   . LEU B 1 31  ? 37.710  66.891  100.865 1.00 111.98 ? 299 LEU B CD2   1 
ATOM   2102  N  N     . LYS B 1 32  ? 34.030  64.999  104.929 1.00 123.75 ? 300 LYS B N     1 
ATOM   2103  C  CA    . LYS B 1 32  ? 32.693  64.425  104.902 1.00 123.75 ? 300 LYS B CA    1 
ATOM   2104  C  C     . LYS B 1 32  ? 31.653  65.498  104.619 1.00 123.75 ? 300 LYS B C     1 
ATOM   2105  O  O     . LYS B 1 32  ? 30.448  65.238  104.746 1.00 123.75 ? 300 LYS B O     1 
ATOM   2106  C  CB    . LYS B 1 32  ? 32.395  63.693  106.222 1.00 123.75 ? 300 LYS B CB    1 
ATOM   2107  C  CG    . LYS B 1 32  ? 32.054  64.567  107.453 1.00 123.75 ? 300 LYS B CG    1 
ATOM   2108  C  CD    . LYS B 1 32  ? 33.267  65.228  108.109 1.00 123.75 ? 300 LYS B CD    1 
ATOM   2109  C  CE    . LYS B 1 32  ? 34.144  64.214  108.825 1.00 123.75 ? 300 LYS B CE    1 
ATOM   2110  N  NZ    . LYS B 1 32  ? 35.342  64.855  109.437 1.00 123.75 ? 300 LYS B NZ    1 
ATOM   2111  N  N     . ASP B 1 33  ? 32.107  66.685  104.212 1.00 128.08 ? 301 ASP B N     1 
ATOM   2112  C  CA    . ASP B 1 33  ? 31.249  67.843  104.005 1.00 128.08 ? 301 ASP B CA    1 
ATOM   2113  C  C     . ASP B 1 33  ? 30.234  67.596  102.898 1.00 128.08 ? 301 ASP B C     1 
ATOM   2114  O  O     . ASP B 1 33  ? 30.519  66.917  101.908 1.00 128.08 ? 301 ASP B O     1 
ATOM   2115  C  CB    . ASP B 1 33  ? 32.110  69.058  103.659 1.00 128.08 ? 301 ASP B CB    1 
ATOM   2116  C  CG    . ASP B 1 33  ? 31.299  70.321  103.492 1.00 128.08 ? 301 ASP B CG    1 
ATOM   2117  O  OD1   . ASP B 1 33  ? 30.838  70.874  104.511 1.00 128.08 ? 301 ASP B OD1   1 
ATOM   2118  O  OD2   . ASP B 1 33  ? 31.117  70.757  102.337 1.00 128.08 ? 301 ASP B OD2   1 
ATOM   2119  N  N     . GLU B 1 34  ? 29.034  68.148  103.081 1.00 128.82 ? 302 GLU B N     1 
ATOM   2120  C  CA    . GLU B 1 34  ? 27.954  68.017  102.107 1.00 128.82 ? 302 GLU B CA    1 
ATOM   2121  C  C     . GLU B 1 34  ? 28.282  68.901  100.908 1.00 128.82 ? 302 GLU B C     1 
ATOM   2122  O  O     . GLU B 1 34  ? 27.821  70.038  100.779 1.00 128.82 ? 302 GLU B O     1 
ATOM   2123  C  CB    . GLU B 1 34  ? 26.617  68.390  102.734 1.00 128.82 ? 302 GLU B CB    1 
ATOM   2124  C  CG    . GLU B 1 34  ? 26.146  67.425  103.811 1.00 128.82 ? 302 GLU B CG    1 
ATOM   2125  C  CD    . GLU B 1 34  ? 24.833  67.848  104.439 1.00 128.82 ? 302 GLU B CD    1 
ATOM   2126  O  OE1   . GLU B 1 34  ? 24.363  68.966  104.138 1.00 128.82 ? 302 GLU B OE1   1 
ATOM   2127  O  OE2   . GLU B 1 34  ? 24.269  67.063  105.228 1.00 128.82 ? 302 GLU B OE2   1 
ATOM   2128  N  N     . ILE B 1 35  ? 29.117  68.361  100.019 1.00 119.76 ? 303 ILE B N     1 
ATOM   2129  C  CA    . ILE B 1 35  ? 29.477  69.065  98.800  1.00 119.76 ? 303 ILE B CA    1 
ATOM   2130  C  C     . ILE B 1 35  ? 28.290  69.036  97.851  1.00 119.76 ? 303 ILE B C     1 
ATOM   2131  O  O     . ILE B 1 35  ? 27.631  68.002  97.682  1.00 119.76 ? 303 ILE B O     1 
ATOM   2132  C  CB    . ILE B 1 35  ? 30.725  68.426  98.168  1.00 119.76 ? 303 ILE B CB    1 
ATOM   2133  C  CG1   . ILE B 1 35  ? 31.885  68.453  99.157  1.00 119.76 ? 303 ILE B CG1   1 
ATOM   2134  C  CG2   . ILE B 1 35  ? 31.150  69.165  96.915  1.00 119.76 ? 303 ILE B CG2   1 
ATOM   2135  C  CD1   . ILE B 1 35  ? 33.080  67.674  98.697  1.00 119.76 ? 303 ILE B CD1   1 
ATOM   2136  N  N     . ASP B 1 36  ? 28.010  70.173  97.219  1.00 116.52 ? 304 ASP B N     1 
ATOM   2137  C  CA    . ASP B 1 36  ? 26.885  70.295  96.306  1.00 116.52 ? 304 ASP B CA    1 
ATOM   2138  C  C     . ASP B 1 36  ? 27.176  69.730  94.915  1.00 116.52 ? 304 ASP B C     1 
ATOM   2139  O  O     . ASP B 1 36  ? 26.456  70.062  93.965  1.00 116.52 ? 304 ASP B O     1 
ATOM   2140  C  CB    . ASP B 1 36  ? 26.455  71.759  96.202  1.00 116.52 ? 304 ASP B CB    1 
ATOM   2141  C  CG    . ASP B 1 36  ? 25.820  72.269  97.481  1.00 116.52 ? 304 ASP B CG    1 
ATOM   2142  O  OD1   . ASP B 1 36  ? 25.226  71.452  98.215  1.00 116.52 ? 304 ASP B OD1   1 
ATOM   2143  O  OD2   . ASP B 1 36  ? 25.914  73.485  97.754  1.00 116.52 ? 304 ASP B OD2   1 
ATOM   2144  N  N     . VAL B 1 37  ? 28.204  68.901  94.769  1.00 106.25 ? 305 VAL B N     1 
ATOM   2145  C  CA    . VAL B 1 37  ? 28.503  68.226  93.516  1.00 106.25 ? 305 VAL B CA    1 
ATOM   2146  C  C     . VAL B 1 37  ? 27.917  66.824  93.586  1.00 106.25 ? 305 VAL B C     1 
ATOM   2147  O  O     . VAL B 1 37  ? 28.316  66.014  94.430  1.00 106.25 ? 305 VAL B O     1 
ATOM   2148  C  CB    . VAL B 1 37  ? 30.011  68.181  93.244  1.00 106.25 ? 305 VAL B CB    1 
ATOM   2149  C  CG1   . VAL B 1 37  ? 30.274  67.446  91.954  1.00 106.25 ? 305 VAL B CG1   1 
ATOM   2150  C  CG2   . VAL B 1 37  ? 30.572  69.585  93.179  1.00 106.25 ? 305 VAL B CG2   1 
ATOM   2151  N  N     . LYS B 1 38  ? 26.971  66.543  92.704  1.00 103.60 ? 306 LYS B N     1 
ATOM   2152  C  CA    . LYS B 1 38  ? 26.328  65.248  92.581  1.00 103.60 ? 306 LYS B CA    1 
ATOM   2153  C  C     . LYS B 1 38  ? 26.692  64.644  91.228  1.00 103.60 ? 306 LYS B C     1 
ATOM   2154  O  O     . LYS B 1 38  ? 27.385  65.260  90.416  1.00 103.60 ? 306 LYS B O     1 
ATOM   2155  C  CB    . LYS B 1 38  ? 24.811  65.393  92.718  1.00 103.60 ? 306 LYS B CB    1 
ATOM   2156  C  CG    . LYS B 1 38  ? 24.292  66.100  93.978  1.00 103.60 ? 306 LYS B CG    1 
ATOM   2157  C  CD    . LYS B 1 38  ? 24.340  65.257  95.248  1.00 103.60 ? 306 LYS B CD    1 
ATOM   2158  C  CE    . LYS B 1 38  ? 25.508  65.627  96.148  1.00 103.60 ? 306 LYS B CE    1 
ATOM   2159  N  NZ    . LYS B 1 38  ? 25.462  64.907  97.447  1.00 103.60 ? 306 LYS B NZ    1 
ATOM   2160  N  N     . PHE B 1 39  ? 26.193  63.433  90.969  1.00 102.79 ? 307 PHE B N     1 
ATOM   2161  C  CA    . PHE B 1 39  ? 26.350  62.844  89.642  1.00 102.79 ? 307 PHE B CA    1 
ATOM   2162  C  C     . PHE B 1 39  ? 25.508  63.541  88.583  1.00 102.79 ? 307 PHE B C     1 
ATOM   2163  O  O     . PHE B 1 39  ? 25.756  63.348  87.391  1.00 102.79 ? 307 PHE B O     1 
ATOM   2164  C  CB    . PHE B 1 39  ? 26.008  61.356  89.668  1.00 102.79 ? 307 PHE B CB    1 
ATOM   2165  C  CG    . PHE B 1 39  ? 27.135  60.479  90.128  1.00 102.79 ? 307 PHE B CG    1 
ATOM   2166  C  CD1   . PHE B 1 39  ? 28.443  60.922  90.073  1.00 102.79 ? 307 PHE B CD1   1 
ATOM   2167  C  CD2   . PHE B 1 39  ? 26.883  59.209  90.615  1.00 102.79 ? 307 PHE B CD2   1 
ATOM   2168  C  CE1   . PHE B 1 39  ? 29.481  60.115  90.493  1.00 102.79 ? 307 PHE B CE1   1 
ATOM   2169  C  CE2   . PHE B 1 39  ? 27.915  58.397  91.038  1.00 102.79 ? 307 PHE B CE2   1 
ATOM   2170  C  CZ    . PHE B 1 39  ? 29.216  58.853  90.976  1.00 102.79 ? 307 PHE B CZ    1 
ATOM   2171  N  N     . LYS B 1 40  ? 24.534  64.352  88.983  1.00 97.38  ? 308 LYS B N     1 
ATOM   2172  C  CA    . LYS B 1 40  ? 23.794  65.179  88.043  1.00 97.38  ? 308 LYS B CA    1 
ATOM   2173  C  C     . LYS B 1 40  ? 24.573  66.408  87.597  1.00 97.38  ? 308 LYS B C     1 
ATOM   2174  O  O     . LYS B 1 40  ? 24.075  67.160  86.755  1.00 97.38  ? 308 LYS B O     1 
ATOM   2175  C  CB    . LYS B 1 40  ? 22.470  65.608  88.670  1.00 97.38  ? 308 LYS B CB    1 
ATOM   2176  C  CG    . LYS B 1 40  ? 22.642  66.474  89.901  1.00 97.38  ? 308 LYS B CG    1 
ATOM   2177  C  CD    . LYS B 1 40  ? 21.311  66.790  90.551  1.00 97.38  ? 308 LYS B CD    1 
ATOM   2178  C  CE    . LYS B 1 40  ? 21.496  67.653  91.786  1.00 97.38  ? 308 LYS B CE    1 
ATOM   2179  N  NZ    . LYS B 1 40  ? 20.194  67.957  92.436  1.00 97.38  ? 308 LYS B NZ    1 
ATOM   2180  N  N     . ASP B 1 41  ? 25.769  66.629  88.136  1.00 96.90  ? 309 ASP B N     1 
ATOM   2181  C  CA    . ASP B 1 41  ? 26.584  67.787  87.810  1.00 96.90  ? 309 ASP B CA    1 
ATOM   2182  C  C     . ASP B 1 41  ? 27.731  67.463  86.866  1.00 96.90  ? 309 ASP B C     1 
ATOM   2183  O  O     . ASP B 1 41  ? 28.548  68.342  86.586  1.00 96.90  ? 309 ASP B O     1 
ATOM   2184  C  CB    . ASP B 1 41  ? 27.142  68.404  89.090  1.00 96.90  ? 309 ASP B CB    1 
ATOM   2185  C  CG    . ASP B 1 41  ? 26.058  68.956  89.979  1.00 96.90  ? 309 ASP B CG    1 
ATOM   2186  O  OD1   . ASP B 1 41  ? 24.999  69.345  89.448  1.00 96.90  ? 309 ASP B OD1   1 
ATOM   2187  O  OD2   . ASP B 1 41  ? 26.260  68.999  91.208  1.00 96.90  ? 309 ASP B OD2   1 
ATOM   2188  N  N     . VAL B 1 42  ? 27.817  66.231  86.371  1.00 94.28  ? 310 VAL B N     1 
ATOM   2189  C  CA    . VAL B 1 42  ? 28.919  65.846  85.500  1.00 94.28  ? 310 VAL B CA    1 
ATOM   2190  C  C     . VAL B 1 42  ? 28.453  65.911  84.055  1.00 94.28  ? 310 VAL B C     1 
ATOM   2191  O  O     . VAL B 1 42  ? 29.006  66.674  83.261  1.00 94.28  ? 310 VAL B O     1 
ATOM   2192  C  CB    . VAL B 1 42  ? 29.453  64.456  85.871  1.00 94.28  ? 310 VAL B CB    1 
ATOM   2193  C  CG1   . VAL B 1 42  ? 30.546  64.042  84.909  1.00 94.28  ? 310 VAL B CG1   1 
ATOM   2194  C  CG2   . VAL B 1 42  ? 29.965  64.480  87.297  1.00 94.28  ? 310 VAL B CG2   1 
ATOM   2195  N  N     . ALA B 1 43  ? 27.455  65.093  83.708  1.00 96.14  ? 311 ALA B N     1 
ATOM   2196  C  CA    . ALA B 1 43  ? 26.516  65.336  82.607  1.00 96.14  ? 311 ALA B CA    1 
ATOM   2197  C  C     . ALA B 1 43  ? 27.209  65.481  81.246  1.00 96.14  ? 311 ALA B C     1 
ATOM   2198  O  O     . ALA B 1 43  ? 27.238  66.552  80.646  1.00 96.14  ? 311 ALA B O     1 
ATOM   2199  C  CB    . ALA B 1 43  ? 25.659  66.568  82.905  1.00 96.14  ? 311 ALA B CB    1 
ATOM   2200  N  N     . GLY B 1 44  ? 27.773  64.376  80.774  1.00 105.54 ? 312 GLY B N     1 
ATOM   2201  C  CA    . GLY B 1 44  ? 28.336  64.377  79.438  1.00 105.54 ? 312 GLY B CA    1 
ATOM   2202  C  C     . GLY B 1 44  ? 29.530  63.469  79.271  1.00 105.54 ? 312 GLY B C     1 
ATOM   2203  O  O     . GLY B 1 44  ? 29.879  63.086  78.152  1.00 105.54 ? 312 GLY B O     1 
ATOM   2204  N  N     . CYS B 1 45  ? 30.169  63.122  80.377  1.00 110.97 ? 313 CYS B N     1 
ATOM   2205  C  CA    . CYS B 1 45  ? 31.177  62.067  80.387  1.00 110.97 ? 313 CYS B CA    1 
ATOM   2206  C  C     . CYS B 1 45  ? 30.550  60.761  80.863  1.00 110.97 ? 313 CYS B C     1 
ATOM   2207  O  O     . CYS B 1 45  ? 30.980  60.158  81.840  1.00 110.97 ? 313 CYS B O     1 
ATOM   2208  C  CB    . CYS B 1 45  ? 32.351  62.477  81.263  1.00 110.97 ? 313 CYS B CB    1 
ATOM   2209  S  SG    . CYS B 1 45  ? 33.182  63.953  80.658  1.00 110.97 ? 313 CYS B SG    1 
ATOM   2210  N  N     . GLU B 1 46  ? 29.513  60.330  80.141  1.00 114.98 ? 314 GLU B N     1 
ATOM   2211  C  CA    . GLU B 1 46  ? 28.619  59.297  80.656  1.00 114.98 ? 314 GLU B CA    1 
ATOM   2212  C  C     . GLU B 1 46  ? 29.222  57.904  80.572  1.00 114.98 ? 314 GLU B C     1 
ATOM   2213  O  O     . GLU B 1 46  ? 29.010  57.083  81.469  1.00 114.98 ? 314 GLU B O     1 
ATOM   2214  C  CB    . GLU B 1 46  ? 27.286  59.343  79.918  1.00 114.98 ? 314 GLU B CB    1 
ATOM   2215  C  CG    . GLU B 1 46  ? 26.476  60.578  80.240  1.00 114.98 ? 314 GLU B CG    1 
ATOM   2216  C  CD    . GLU B 1 46  ? 25.983  60.601  81.674  1.00 114.98 ? 314 GLU B CD    1 
ATOM   2217  O  OE1   . GLU B 1 46  ? 25.689  59.518  82.225  1.00 114.98 ? 314 GLU B OE1   1 
ATOM   2218  O  OE2   . GLU B 1 46  ? 25.891  61.704  82.253  1.00 114.98 ? 314 GLU B OE2   1 
ATOM   2219  N  N     . GLU B 1 47  ? 29.967  57.607  79.511  1.00 114.49 ? 315 GLU B N     1 
ATOM   2220  C  CA    . GLU B 1 47  ? 30.630  56.313  79.454  1.00 114.49 ? 315 GLU B CA    1 
ATOM   2221  C  C     . GLU B 1 47  ? 31.860  56.260  80.340  1.00 114.49 ? 315 GLU B C     1 
ATOM   2222  O  O     . GLU B 1 47  ? 32.335  55.167  80.657  1.00 114.49 ? 315 GLU B O     1 
ATOM   2223  C  CB    . GLU B 1 47  ? 30.986  55.969  78.012  1.00 114.49 ? 315 GLU B CB    1 
ATOM   2224  C  CG    . GLU B 1 47  ? 29.757  55.714  77.158  1.00 114.49 ? 315 GLU B CG    1 
ATOM   2225  C  CD    . GLU B 1 47  ? 28.995  54.470  77.584  1.00 114.49 ? 315 GLU B CD    1 
ATOM   2226  O  OE1   . GLU B 1 47  ? 29.636  53.492  78.027  1.00 114.49 ? 315 GLU B OE1   1 
ATOM   2227  O  OE2   . GLU B 1 47  ? 27.751  54.471  77.483  1.00 114.49 ? 315 GLU B OE2   1 
ATOM   2228  N  N     . ALA B 1 48  ? 32.376  57.413  80.747  1.00 112.84 ? 316 ALA B N     1 
ATOM   2229  C  CA    . ALA B 1 48  ? 33.360  57.497  81.810  1.00 112.84 ? 316 ALA B CA    1 
ATOM   2230  C  C     . ALA B 1 48  ? 32.717  57.584  83.183  1.00 112.84 ? 316 ALA B C     1 
ATOM   2231  O  O     . ALA B 1 48  ? 33.421  57.486  84.191  1.00 112.84 ? 316 ALA B O     1 
ATOM   2232  C  CB    . ALA B 1 48  ? 34.262  58.714  81.594  1.00 112.84 ? 316 ALA B CB    1 
ATOM   2233  N  N     . LYS B 1 49  ? 31.400  57.767  83.242  1.00 113.65 ? 317 LYS B N     1 
ATOM   2234  C  CA    . LYS B 1 49  ? 30.718  57.935  84.517  1.00 113.65 ? 317 LYS B CA    1 
ATOM   2235  C  C     . LYS B 1 49  ? 30.426  56.593  85.164  1.00 113.65 ? 317 LYS B C     1 
ATOM   2236  O  O     . LYS B 1 49  ? 30.509  56.460  86.390  1.00 113.65 ? 317 LYS B O     1 
ATOM   2237  C  CB    . LYS B 1 49  ? 29.421  58.713  84.311  1.00 113.65 ? 317 LYS B CB    1 
ATOM   2238  C  CG    . LYS B 1 49  ? 28.709  59.125  85.575  1.00 113.65 ? 317 LYS B CG    1 
ATOM   2239  C  CD    . LYS B 1 49  ? 27.373  59.775  85.257  1.00 113.65 ? 317 LYS B CD    1 
ATOM   2240  C  CE    . LYS B 1 49  ? 27.465  61.283  85.222  1.00 113.65 ? 317 LYS B CE    1 
ATOM   2241  N  NZ    . LYS B 1 49  ? 28.033  61.781  83.946  1.00 113.65 ? 317 LYS B NZ    1 
ATOM   2242  N  N     . LEU B 1 50  ? 30.092  55.590  84.349  1.00 118.86 ? 318 LEU B N     1 
ATOM   2243  C  CA    . LEU B 1 50  ? 29.693  54.291  84.876  1.00 118.86 ? 318 LEU B CA    1 
ATOM   2244  C  C     . LEU B 1 50  ? 30.866  53.539  85.484  1.00 118.86 ? 318 LEU B C     1 
ATOM   2245  O  O     . LEU B 1 50  ? 30.673  52.715  86.383  1.00 118.86 ? 318 LEU B O     1 
ATOM   2246  C  CB    . LEU B 1 50  ? 29.059  53.458  83.768  1.00 118.86 ? 318 LEU B CB    1 
ATOM   2247  C  CG    . LEU B 1 50  ? 27.808  54.044  83.120  1.00 118.86 ? 318 LEU B CG    1 
ATOM   2248  C  CD1   . LEU B 1 50  ? 27.355  53.169  81.972  1.00 118.86 ? 318 LEU B CD1   1 
ATOM   2249  C  CD2   . LEU B 1 50  ? 26.703  54.208  84.137  1.00 118.86 ? 318 LEU B CD2   1 
ATOM   2250  N  N     . GLU B 1 51  ? 32.083  53.814  85.026  1.00 119.18 ? 319 GLU B N     1 
ATOM   2251  C  CA    . GLU B 1 51  ? 33.232  53.059  85.498  1.00 119.18 ? 319 GLU B CA    1 
ATOM   2252  C  C     . GLU B 1 51  ? 33.697  53.506  86.874  1.00 119.18 ? 319 GLU B C     1 
ATOM   2253  O  O     . GLU B 1 51  ? 34.393  52.746  87.553  1.00 119.18 ? 319 GLU B O     1 
ATOM   2254  C  CB    . GLU B 1 51  ? 34.357  53.169  84.479  1.00 119.18 ? 319 GLU B CB    1 
ATOM   2255  C  CG    . GLU B 1 51  ? 33.965  52.543  83.166  1.00 119.18 ? 319 GLU B CG    1 
ATOM   2256  C  CD    . GLU B 1 51  ? 34.989  52.750  82.087  1.00 119.18 ? 319 GLU B CD    1 
ATOM   2257  O  OE1   . GLU B 1 51  ? 35.946  53.509  82.326  1.00 119.18 ? 319 GLU B OE1   1 
ATOM   2258  O  OE2   . GLU B 1 51  ? 34.814  52.184  80.986  1.00 119.18 ? 319 GLU B OE2   1 
ATOM   2259  N  N     . ILE B 1 52  ? 33.315  54.706  87.309  1.00 117.78 ? 320 ILE B N     1 
ATOM   2260  C  CA    . ILE B 1 52  ? 33.509  55.090  88.701  1.00 117.78 ? 320 ILE B CA    1 
ATOM   2261  C  C     . ILE B 1 52  ? 32.294  54.699  89.535  1.00 117.78 ? 320 ILE B C     1 
ATOM   2262  O  O     . ILE B 1 52  ? 32.433  54.427  90.737  1.00 117.78 ? 320 ILE B O     1 
ATOM   2263  C  CB    . ILE B 1 52  ? 33.851  56.590  88.767  1.00 117.78 ? 320 ILE B CB    1 
ATOM   2264  C  CG1   . ILE B 1 52  ? 35.139  56.825  87.992  1.00 117.78 ? 320 ILE B CG1   1 
ATOM   2265  C  CG2   . ILE B 1 52  ? 34.100  57.071  90.182  1.00 117.78 ? 320 ILE B CG2   1 
ATOM   2266  C  CD1   . ILE B 1 52  ? 35.504  58.252  87.831  1.00 117.78 ? 320 ILE B CD1   1 
ATOM   2267  N  N     . MET B 1 53  ? 31.119  54.574  88.912  1.00 123.53 ? 321 MET B N     1 
ATOM   2268  C  CA    . MET B 1 53  ? 30.005  53.901  89.570  1.00 123.53 ? 321 MET B CA    1 
ATOM   2269  C  C     . MET B 1 53  ? 30.311  52.430  89.815  1.00 123.53 ? 321 MET B C     1 
ATOM   2270  O  O     . MET B 1 53  ? 29.757  51.824  90.738  1.00 123.53 ? 321 MET B O     1 
ATOM   2271  C  CB    . MET B 1 53  ? 28.737  54.036  88.735  1.00 123.53 ? 321 MET B CB    1 
ATOM   2272  C  CG    . MET B 1 53  ? 28.171  55.430  88.669  1.00 123.53 ? 321 MET B CG    1 
ATOM   2273  S  SD    . MET B 1 53  ? 26.664  55.428  87.690  1.00 123.53 ? 321 MET B SD    1 
ATOM   2274  C  CE    . MET B 1 53  ? 26.233  57.161  87.707  1.00 123.53 ? 321 MET B CE    1 
ATOM   2275  N  N     . GLU B 1 54  ? 31.182  51.839  88.997  1.00 126.36 ? 322 GLU B N     1 
ATOM   2276  C  CA    . GLU B 1 54  ? 31.675  50.498  89.271  1.00 126.36 ? 322 GLU B CA    1 
ATOM   2277  C  C     . GLU B 1 54  ? 32.658  50.495  90.438  1.00 126.36 ? 322 GLU B C     1 
ATOM   2278  O  O     . GLU B 1 54  ? 32.757  49.499  91.163  1.00 126.36 ? 322 GLU B O     1 
ATOM   2279  C  CB    . GLU B 1 54  ? 32.315  49.934  88.002  1.00 126.36 ? 322 GLU B CB    1 
ATOM   2280  C  CG    . GLU B 1 54  ? 32.743  48.485  88.067  1.00 126.36 ? 322 GLU B CG    1 
ATOM   2281  C  CD    . GLU B 1 54  ? 33.289  47.987  86.744  1.00 126.36 ? 322 GLU B CD    1 
ATOM   2282  O  OE1   . GLU B 1 54  ? 33.329  48.781  85.780  1.00 126.36 ? 322 GLU B OE1   1 
ATOM   2283  O  OE2   . GLU B 1 54  ? 33.679  46.803  86.666  1.00 126.36 ? 322 GLU B OE2   1 
ATOM   2284  N  N     . PHE B 1 55  ? 33.385  51.597  90.642  1.00 120.49 ? 323 PHE B N     1 
ATOM   2285  C  CA    . PHE B 1 55  ? 34.296  51.689  91.780  1.00 120.49 ? 323 PHE B CA    1 
ATOM   2286  C  C     . PHE B 1 55  ? 33.548  51.814  93.097  1.00 120.49 ? 323 PHE B C     1 
ATOM   2287  O  O     . PHE B 1 55  ? 34.017  51.312  94.123  1.00 120.49 ? 323 PHE B O     1 
ATOM   2288  C  CB    . PHE B 1 55  ? 35.246  52.869  91.597  1.00 120.49 ? 323 PHE B CB    1 
ATOM   2289  C  CG    . PHE B 1 55  ? 36.359  52.606  90.632  1.00 120.49 ? 323 PHE B CG    1 
ATOM   2290  C  CD1   . PHE B 1 55  ? 36.776  51.315  90.377  1.00 120.49 ? 323 PHE B CD1   1 
ATOM   2291  C  CD2   . PHE B 1 55  ? 36.964  53.644  89.954  1.00 120.49 ? 323 PHE B CD2   1 
ATOM   2292  C  CE1   . PHE B 1 55  ? 37.798  51.060  89.489  1.00 120.49 ? 323 PHE B CE1   1 
ATOM   2293  C  CE2   . PHE B 1 55  ? 37.986  53.399  89.058  1.00 120.49 ? 323 PHE B CE2   1 
ATOM   2294  C  CZ    . PHE B 1 55  ? 38.402  52.101  88.825  1.00 120.49 ? 323 PHE B CZ    1 
ATOM   2295  N  N     . VAL B 1 56  ? 32.397  52.485  93.093  1.00 126.75 ? 324 VAL B N     1 
ATOM   2296  C  CA    . VAL B 1 56  ? 31.561  52.505  94.284  1.00 126.75 ? 324 VAL B CA    1 
ATOM   2297  C  C     . VAL B 1 56  ? 30.925  51.134  94.479  1.00 126.75 ? 324 VAL B C     1 
ATOM   2298  O  O     . VAL B 1 56  ? 30.695  50.695  95.614  1.00 126.75 ? 324 VAL B O     1 
ATOM   2299  C  CB    . VAL B 1 56  ? 30.516  53.632  94.160  1.00 126.75 ? 324 VAL B CB    1 
ATOM   2300  C  CG1   . VAL B 1 56  ? 29.678  53.760  95.424  1.00 126.75 ? 324 VAL B CG1   1 
ATOM   2301  C  CG2   . VAL B 1 56  ? 31.196  54.947  93.837  1.00 126.75 ? 324 VAL B CG2   1 
ATOM   2302  N  N     . ASN B 1 57  ? 30.688  50.415  93.379  1.00 130.14 ? 325 ASN B N     1 
ATOM   2303  C  CA    . ASN B 1 57  ? 30.130  49.070  93.445  1.00 130.14 ? 325 ASN B CA    1 
ATOM   2304  C  C     . ASN B 1 57  ? 31.125  48.085  94.047  1.00 130.14 ? 325 ASN B C     1 
ATOM   2305  O  O     . ASN B 1 57  ? 30.719  47.077  94.636  1.00 130.14 ? 325 ASN B O     1 
ATOM   2306  C  CB    . ASN B 1 57  ? 29.717  48.632  92.040  1.00 130.14 ? 325 ASN B CB    1 
ATOM   2307  C  CG    . ASN B 1 57  ? 28.735  47.483  92.039  1.00 130.14 ? 325 ASN B CG    1 
ATOM   2308  O  OD1   . ASN B 1 57  ? 28.325  46.984  93.085  1.00 130.14 ? 325 ASN B OD1   1 
ATOM   2309  N  ND2   . ASN B 1 57  ? 28.337  47.066  90.845  1.00 130.14 ? 325 ASN B ND2   1 
ATOM   2310  N  N     . PHE B 1 58  ? 32.425  48.361  93.913  1.00 127.56 ? 326 PHE B N     1 
ATOM   2311  C  CA    . PHE B 1 58  ? 33.441  47.499  94.510  1.00 127.56 ? 326 PHE B CA    1 
ATOM   2312  C  C     . PHE B 1 58  ? 33.423  47.599  96.026  1.00 127.56 ? 326 PHE B C     1 
ATOM   2313  O  O     . PHE B 1 58  ? 33.607  46.596  96.724  1.00 127.56 ? 326 PHE B O     1 
ATOM   2314  C  CB    . PHE B 1 58  ? 34.825  47.878  93.989  1.00 127.56 ? 326 PHE B CB    1 
ATOM   2315  C  CG    . PHE B 1 58  ? 35.050  47.548  92.546  1.00 127.56 ? 326 PHE B CG    1 
ATOM   2316  C  CD1   . PHE B 1 58  ? 34.258  46.621  91.891  1.00 127.56 ? 326 PHE B CD1   1 
ATOM   2317  C  CD2   . PHE B 1 58  ? 36.055  48.181  91.841  1.00 127.56 ? 326 PHE B CD2   1 
ATOM   2318  C  CE1   . PHE B 1 58  ? 34.473  46.331  90.562  1.00 127.56 ? 326 PHE B CE1   1 
ATOM   2319  C  CE2   . PHE B 1 58  ? 36.269  47.893  90.515  1.00 127.56 ? 326 PHE B CE2   1 
ATOM   2320  C  CZ    . PHE B 1 58  ? 35.482  46.968  89.875  1.00 127.56 ? 326 PHE B CZ    1 
ATOM   2321  N  N     . LEU B 1 59  ? 33.215  48.805  96.548  1.00 124.66 ? 327 LEU B N     1 
ATOM   2322  C  CA    . LEU B 1 59  ? 33.202  48.997  97.990  1.00 124.66 ? 327 LEU B CA    1 
ATOM   2323  C  C     . LEU B 1 59  ? 31.918  48.463  98.602  1.00 124.66 ? 327 LEU B C     1 
ATOM   2324  O  O     . LEU B 1 59  ? 31.943  47.834  99.665  1.00 124.66 ? 327 LEU B O     1 
ATOM   2325  C  CB    . LEU B 1 59  ? 33.360  50.478  98.317  1.00 124.66 ? 327 LEU B CB    1 
ATOM   2326  C  CG    . LEU B 1 59  ? 34.650  51.162  97.881  1.00 124.66 ? 327 LEU B CG    1 
ATOM   2327  C  CD1   . LEU B 1 59  ? 34.558  52.646  98.168  1.00 124.66 ? 327 LEU B CD1   1 
ATOM   2328  C  CD2   . LEU B 1 59  ? 35.838  50.548  98.590  1.00 124.66 ? 327 LEU B CD2   1 
ATOM   2329  N  N     . LYS B 1 60  ? 30.785  48.705  97.947  1.00 126.38 ? 328 LYS B N     1 
ATOM   2330  C  CA    . LYS B 1 60  ? 29.506  48.326  98.529  1.00 126.38 ? 328 LYS B CA    1 
ATOM   2331  C  C     . LYS B 1 60  ? 29.171  46.864  98.278  1.00 126.38 ? 328 LYS B C     1 
ATOM   2332  O  O     . LYS B 1 60  ? 28.475  46.247  99.091  1.00 126.38 ? 328 LYS B O     1 
ATOM   2333  C  CB    . LYS B 1 60  ? 28.400  49.223  97.979  1.00 126.38 ? 328 LYS B CB    1 
ATOM   2334  C  CG    . LYS B 1 60  ? 28.623  50.695  98.260  1.00 126.38 ? 328 LYS B CG    1 
ATOM   2335  C  CD    . LYS B 1 60  ? 28.588  50.970  99.747  1.00 126.38 ? 328 LYS B CD    1 
ATOM   2336  C  CE    . LYS B 1 60  ? 28.725  52.449  100.034 1.00 126.38 ? 328 LYS B CE    1 
ATOM   2337  N  NZ    . LYS B 1 60  ? 28.770  52.719  101.497 1.00 126.38 ? 328 LYS B NZ    1 
ATOM   2338  N  N     . ASN B 1 61  ? 29.653  46.292  97.176  1.00 130.53 ? 329 ASN B N     1 
ATOM   2339  C  CA    . ASN B 1 61  ? 29.357  44.907  96.813  1.00 130.53 ? 329 ASN B CA    1 
ATOM   2340  C  C     . ASN B 1 61  ? 30.640  44.187  96.422  1.00 130.53 ? 329 ASN B C     1 
ATOM   2341  O  O     . ASN B 1 61  ? 31.020  44.171  95.244  1.00 130.53 ? 329 ASN B O     1 
ATOM   2342  C  CB    . ASN B 1 61  ? 28.342  44.847  95.676  1.00 130.53 ? 329 ASN B CB    1 
ATOM   2343  C  CG    . ASN B 1 61  ? 26.971  45.321  96.097  1.00 130.53 ? 329 ASN B CG    1 
ATOM   2344  O  OD1   . ASN B 1 61  ? 26.498  44.996  97.185  1.00 130.53 ? 329 ASN B OD1   1 
ATOM   2345  N  ND2   . ASN B 1 61  ? 26.323  46.096  95.238  1.00 130.53 ? 329 ASN B ND2   1 
ATOM   2346  N  N     . PRO B 1 62  ? 31.337  43.576  97.381  1.00 130.66 ? 330 PRO B N     1 
ATOM   2347  C  CA    . PRO B 1 62  ? 32.477  42.719  97.043  1.00 130.66 ? 330 PRO B CA    1 
ATOM   2348  C  C     . PRO B 1 62  ? 32.096  41.316  96.597  1.00 130.66 ? 330 PRO B C     1 
ATOM   2349  O  O     . PRO B 1 62  ? 32.984  40.470  96.462  1.00 130.66 ? 330 PRO B O     1 
ATOM   2350  C  CB    . PRO B 1 62  ? 33.262  42.659  98.366  1.00 130.66 ? 330 PRO B CB    1 
ATOM   2351  C  CG    . PRO B 1 62  ? 32.757  43.801  99.185  1.00 130.66 ? 330 PRO B CG    1 
ATOM   2352  C  CD    . PRO B 1 62  ? 31.316  43.903  98.815  1.00 130.66 ? 330 PRO B CD    1 
ATOM   2353  N  N     . LYS B 1 63  ? 30.814  41.040  96.372  1.00 133.37 ? 331 LYS B N     1 
ATOM   2354  C  CA    . LYS B 1 63  ? 30.352  39.688  96.094  1.00 133.37 ? 331 LYS B CA    1 
ATOM   2355  C  C     . LYS B 1 63  ? 30.288  39.396  94.598  1.00 133.37 ? 331 LYS B C     1 
ATOM   2356  O  O     . LYS B 1 63  ? 30.865  38.409  94.135  1.00 133.37 ? 331 LYS B O     1 
ATOM   2357  C  CB    . LYS B 1 63  ? 28.983  39.471  96.753  1.00 133.37 ? 331 LYS B CB    1 
ATOM   2358  C  CG    . LYS B 1 63  ? 28.422  38.057  96.652  1.00 133.37 ? 331 LYS B CG    1 
ATOM   2359  C  CD    . LYS B 1 63  ? 27.305  37.956  95.623  1.00 133.37 ? 331 LYS B CD    1 
ATOM   2360  C  CE    . LYS B 1 63  ? 26.732  36.553  95.568  1.00 133.37 ? 331 LYS B CE    1 
ATOM   2361  N  NZ    . LYS B 1 63  ? 26.052  36.186  96.838  1.00 133.37 ? 331 LYS B NZ    1 
ATOM   2362  N  N     . GLN B 1 64  ? 29.603  40.243  93.829  1.00 132.80 ? 332 GLN B N     1 
ATOM   2363  C  CA    . GLN B 1 64  ? 29.334  39.935  92.428  1.00 132.80 ? 332 GLN B CA    1 
ATOM   2364  C  C     . GLN B 1 64  ? 30.533  40.149  91.516  1.00 132.80 ? 332 GLN B C     1 
ATOM   2365  O  O     . GLN B 1 64  ? 30.448  39.818  90.331  1.00 132.80 ? 332 GLN B O     1 
ATOM   2366  C  CB    . GLN B 1 64  ? 28.150  40.756  91.916  1.00 132.80 ? 332 GLN B CB    1 
ATOM   2367  C  CG    . GLN B 1 64  ? 28.389  42.245  91.842  1.00 132.80 ? 332 GLN B CG    1 
ATOM   2368  C  CD    . GLN B 1 64  ? 27.157  42.991  91.378  1.00 132.80 ? 332 GLN B CD    1 
ATOM   2369  O  OE1   . GLN B 1 64  ? 26.139  42.387  91.044  1.00 132.80 ? 332 GLN B OE1   1 
ATOM   2370  N  NE2   . GLN B 1 64  ? 27.238  44.310  91.364  1.00 132.80 ? 332 GLN B NE2   1 
ATOM   2371  N  N     . TYR B 1 65  ? 31.637  40.689  92.024  1.00 132.76 ? 333 TYR B N     1 
ATOM   2372  C  CA    . TYR B 1 65  ? 32.882  40.729  91.274  1.00 132.76 ? 333 TYR B CA    1 
ATOM   2373  C  C     . TYR B 1 65  ? 33.847  39.634  91.698  1.00 132.76 ? 333 TYR B C     1 
ATOM   2374  O  O     . TYR B 1 65  ? 34.870  39.437  91.037  1.00 132.76 ? 333 TYR B O     1 
ATOM   2375  C  CB    . TYR B 1 65  ? 33.544  42.101  91.425  1.00 132.76 ? 333 TYR B CB    1 
ATOM   2376  C  CG    . TYR B 1 65  ? 32.745  43.198  90.769  1.00 132.76 ? 333 TYR B CG    1 
ATOM   2377  C  CD1   . TYR B 1 65  ? 32.850  43.436  89.407  1.00 132.76 ? 333 TYR B CD1   1 
ATOM   2378  C  CD2   . TYR B 1 65  ? 31.863  43.974  91.507  1.00 132.76 ? 333 TYR B CD2   1 
ATOM   2379  C  CE1   . TYR B 1 65  ? 32.112  44.429  88.799  1.00 132.76 ? 333 TYR B CE1   1 
ATOM   2380  C  CE2   . TYR B 1 65  ? 31.120  44.969  90.910  1.00 132.76 ? 333 TYR B CE2   1 
ATOM   2381  C  CZ    . TYR B 1 65  ? 31.250  45.192  89.556  1.00 132.76 ? 333 TYR B CZ    1 
ATOM   2382  O  OH    . TYR B 1 65  ? 30.510  46.184  88.958  1.00 132.76 ? 333 TYR B OH    1 
ATOM   2383  N  N     . GLN B 1 66  ? 33.540  38.922  92.776  1.00 134.60 ? 334 GLN B N     1 
ATOM   2384  C  CA    . GLN B 1 66  ? 34.280  37.740  93.183  1.00 134.60 ? 334 GLN B CA    1 
ATOM   2385  C  C     . GLN B 1 66  ? 33.538  36.455  92.856  1.00 134.60 ? 334 GLN B C     1 
ATOM   2386  O  O     . GLN B 1 66  ? 34.040  35.371  93.168  1.00 134.60 ? 334 GLN B O     1 
ATOM   2387  C  CB    . GLN B 1 66  ? 34.580  37.796  94.682  1.00 134.60 ? 334 GLN B CB    1 
ATOM   2388  C  CG    . GLN B 1 66  ? 35.552  38.890  95.074  1.00 134.60 ? 334 GLN B CG    1 
ATOM   2389  C  CD    . GLN B 1 66  ? 35.757  38.965  96.568  1.00 134.60 ? 334 GLN B CD    1 
ATOM   2390  O  OE1   . GLN B 1 66  ? 35.113  38.245  97.330  1.00 134.60 ? 334 GLN B OE1   1 
ATOM   2391  N  NE2   . GLN B 1 66  ? 36.656  39.841  97.000  1.00 134.60 ? 334 GLN B NE2   1 
ATOM   2392  N  N     . ASP B 1 67  ? 32.352  36.550  92.249  1.00 135.72 ? 335 ASP B N     1 
ATOM   2393  C  CA    . ASP B 1 67  ? 31.627  35.347  91.858  1.00 135.72 ? 335 ASP B CA    1 
ATOM   2394  C  C     . ASP B 1 67  ? 32.295  34.649  90.684  1.00 135.72 ? 335 ASP B C     1 
ATOM   2395  O  O     . ASP B 1 67  ? 32.185  33.426  90.548  1.00 135.72 ? 335 ASP B O     1 
ATOM   2396  C  CB    . ASP B 1 67  ? 30.178  35.680  91.507  1.00 135.72 ? 335 ASP B CB    1 
ATOM   2397  C  CG    . ASP B 1 67  ? 29.349  36.028  92.721  1.00 135.72 ? 335 ASP B CG    1 
ATOM   2398  O  OD1   . ASP B 1 67  ? 29.689  35.560  93.827  1.00 135.72 ? 335 ASP B OD1   1 
ATOM   2399  O  OD2   . ASP B 1 67  ? 28.346  36.753  92.569  1.00 135.72 ? 335 ASP B OD2   1 
ATOM   2400  N  N     . LEU B 1 68  ? 32.986  35.400  89.834  1.00 138.23 ? 336 LEU B N     1 
ATOM   2401  C  CA    . LEU B 1 68  ? 33.650  34.840  88.669  1.00 138.23 ? 336 LEU B CA    1 
ATOM   2402  C  C     . LEU B 1 68  ? 35.154  34.713  88.863  1.00 138.23 ? 336 LEU B C     1 
ATOM   2403  O  O     . LEU B 1 68  ? 35.874  34.443  87.898  1.00 138.23 ? 336 LEU B O     1 
ATOM   2404  C  CB    . LEU B 1 68  ? 33.342  35.690  87.438  1.00 138.23 ? 336 LEU B CB    1 
ATOM   2405  C  CG    . LEU B 1 68  ? 31.859  35.740  87.074  1.00 138.23 ? 336 LEU B CG    1 
ATOM   2406  C  CD1   . LEU B 1 68  ? 31.622  36.689  85.917  1.00 138.23 ? 336 LEU B CD1   1 
ATOM   2407  C  CD2   . LEU B 1 68  ? 31.338  34.352  86.753  1.00 138.23 ? 336 LEU B CD2   1 
ATOM   2408  N  N     . GLY B 1 69  ? 35.643  34.896  90.086  1.00 135.81 ? 337 GLY B N     1 
ATOM   2409  C  CA    . GLY B 1 69  ? 37.065  34.799  90.336  1.00 135.81 ? 337 GLY B CA    1 
ATOM   2410  C  C     . GLY B 1 69  ? 37.869  35.975  89.842  1.00 135.81 ? 337 GLY B C     1 
ATOM   2411  O  O     . GLY B 1 69  ? 39.076  35.843  89.626  1.00 135.81 ? 337 GLY B O     1 
ATOM   2412  N  N     . ALA B 1 70  ? 37.236  37.129  89.659  1.00 132.49 ? 338 ALA B N     1 
ATOM   2413  C  CA    . ALA B 1 70  ? 37.913  38.308  89.145  1.00 132.49 ? 338 ALA B CA    1 
ATOM   2414  C  C     . ALA B 1 70  ? 38.589  39.061  90.279  1.00 132.49 ? 338 ALA B C     1 
ATOM   2415  O  O     . ALA B 1 70  ? 37.965  39.339  91.307  1.00 132.49 ? 338 ALA B O     1 
ATOM   2416  C  CB    . ALA B 1 70  ? 36.930  39.229  88.426  1.00 132.49 ? 338 ALA B CB    1 
ATOM   2417  N  N     . LYS B 1 71  ? 39.862  39.388  90.085  1.00 127.08 ? 339 LYS B N     1 
ATOM   2418  C  CA    . LYS B 1 71  ? 40.566  40.248  91.023  1.00 127.08 ? 339 LYS B CA    1 
ATOM   2419  C  C     . LYS B 1 71  ? 40.038  41.667  90.886  1.00 127.08 ? 339 LYS B C     1 
ATOM   2420  O  O     . LYS B 1 71  ? 40.089  42.250  89.799  1.00 127.08 ? 339 LYS B O     1 
ATOM   2421  C  CB    . LYS B 1 71  ? 42.067  40.203  90.761  1.00 127.08 ? 339 LYS B CB    1 
ATOM   2422  C  CG    . LYS B 1 71  ? 42.702  38.862  91.070  1.00 127.08 ? 339 LYS B CG    1 
ATOM   2423  C  CD    . LYS B 1 71  ? 44.199  38.889  90.829  1.00 127.08 ? 339 LYS B CD    1 
ATOM   2424  C  CE    . LYS B 1 71  ? 44.821  37.535  91.124  1.00 127.08 ? 339 LYS B CE    1 
ATOM   2425  N  NZ    . LYS B 1 71  ? 46.291  37.532  90.887  1.00 127.08 ? 339 LYS B NZ    1 
ATOM   2426  N  N     . ILE B 1 72  ? 39.516  42.211  91.981  1.00 123.60 ? 340 ILE B N     1 
ATOM   2427  C  CA    . ILE B 1 72  ? 38.935  43.551  91.992  1.00 123.60 ? 340 ILE B CA    1 
ATOM   2428  C  C     . ILE B 1 72  ? 40.053  44.575  91.846  1.00 123.60 ? 340 ILE B C     1 
ATOM   2429  O  O     . ILE B 1 72  ? 40.995  44.579  92.651  1.00 123.60 ? 340 ILE B O     1 
ATOM   2430  C  CB    . ILE B 1 72  ? 38.118  43.791  93.268  1.00 123.60 ? 340 ILE B CB    1 
ATOM   2431  C  CG1   . ILE B 1 72  ? 36.927  42.837  93.314  1.00 123.60 ? 340 ILE B CG1   1 
ATOM   2432  C  CG2   . ILE B 1 72  ? 37.647  45.227  93.334  1.00 123.60 ? 340 ILE B CG2   1 
ATOM   2433  C  CD1   . ILE B 1 72  ? 36.219  42.825  94.639  1.00 123.60 ? 340 ILE B CD1   1 
ATOM   2434  N  N     . PRO B 1 73  ? 40.000  45.440  90.834  1.00 119.23 ? 341 PRO B N     1 
ATOM   2435  C  CA    . PRO B 1 73  ? 41.108  46.365  90.589  1.00 119.23 ? 341 PRO B CA    1 
ATOM   2436  C  C     . PRO B 1 73  ? 41.176  47.462  91.635  1.00 119.23 ? 341 PRO B C     1 
ATOM   2437  O  O     . PRO B 1 73  ? 40.218  47.747  92.355  1.00 119.23 ? 341 PRO B O     1 
ATOM   2438  C  CB    . PRO B 1 73  ? 40.793  46.939  89.206  1.00 119.23 ? 341 PRO B CB    1 
ATOM   2439  C  CG    . PRO B 1 73  ? 39.335  46.815  89.078  1.00 119.23 ? 341 PRO B CG    1 
ATOM   2440  C  CD    . PRO B 1 73  ? 38.948  45.564  89.813  1.00 119.23 ? 341 PRO B CD    1 
ATOM   2441  N  N     . LYS B 1 74  ? 42.348  48.080  91.705  1.00 109.52 ? 342 LYS B N     1 
ATOM   2442  C  CA    . LYS B 1 74  ? 42.659  48.978  92.801  1.00 109.52 ? 342 LYS B CA    1 
ATOM   2443  C  C     . LYS B 1 74  ? 42.247  50.411  92.505  1.00 109.52 ? 342 LYS B C     1 
ATOM   2444  O  O     . LYS B 1 74  ? 41.969  51.175  93.435  1.00 109.52 ? 342 LYS B O     1 
ATOM   2445  C  CB    . LYS B 1 74  ? 44.155  48.902  93.107  1.00 109.52 ? 342 LYS B CB    1 
ATOM   2446  C  CG    . LYS B 1 74  ? 44.542  49.435  94.461  1.00 109.52 ? 342 LYS B CG    1 
ATOM   2447  C  CD    . LYS B 1 74  ? 43.914  48.581  95.545  1.00 109.52 ? 342 LYS B CD    1 
ATOM   2448  C  CE    . LYS B 1 74  ? 44.454  47.158  95.512  1.00 109.52 ? 342 LYS B CE    1 
ATOM   2449  N  NZ    . LYS B 1 74  ? 45.894  47.089  95.871  1.00 109.52 ? 342 LYS B NZ    1 
ATOM   2450  N  N     . GLY B 1 75  ? 42.182  50.785  91.237  1.00 104.44 ? 343 GLY B N     1 
ATOM   2451  C  CA    . GLY B 1 75  ? 41.716  52.106  90.870  1.00 104.44 ? 343 GLY B CA    1 
ATOM   2452  C  C     . GLY B 1 75  ? 42.168  52.467  89.478  1.00 104.44 ? 343 GLY B C     1 
ATOM   2453  O  O     . GLY B 1 75  ? 42.957  51.765  88.850  1.00 104.44 ? 343 GLY B O     1 
ATOM   2454  N  N     . ALA B 1 76  ? 41.646  53.587  88.996  1.00 97.42  ? 344 ALA B N     1 
ATOM   2455  C  CA    . ALA B 1 76  ? 41.965  54.070  87.666  1.00 97.42  ? 344 ALA B CA    1 
ATOM   2456  C  C     . ALA B 1 76  ? 42.643  55.427  87.750  1.00 97.42  ? 344 ALA B C     1 
ATOM   2457  O  O     . ALA B 1 76  ? 42.696  56.057  88.805  1.00 97.42  ? 344 ALA B O     1 
ATOM   2458  C  CB    . ALA B 1 76  ? 40.710  54.161  86.796  1.00 97.42  ? 344 ALA B CB    1 
ATOM   2459  N  N     . ILE B 1 77  ? 43.173  55.869  86.616  1.00 91.99  ? 345 ILE B N     1 
ATOM   2460  C  CA    . ILE B 1 77  ? 43.788  57.181  86.486  1.00 91.99  ? 345 ILE B CA    1 
ATOM   2461  C  C     . ILE B 1 77  ? 42.939  57.989  85.520  1.00 91.99  ? 345 ILE B C     1 
ATOM   2462  O  O     . ILE B 1 77  ? 42.805  57.623  84.347  1.00 91.99  ? 345 ILE B O     1 
ATOM   2463  C  CB    . ILE B 1 77  ? 45.237  57.088  85.992  1.00 91.99  ? 345 ILE B CB    1 
ATOM   2464  C  CG1   . ILE B 1 77  ? 46.093  56.300  86.974  1.00 91.99  ? 345 ILE B CG1   1 
ATOM   2465  C  CG2   . ILE B 1 77  ? 45.818  58.470  85.799  1.00 91.99  ? 345 ILE B CG2   1 
ATOM   2466  C  CD1   . ILE B 1 77  ? 47.454  55.964  86.417  1.00 91.99  ? 345 ILE B CD1   1 
ATOM   2467  N  N     . LEU B 1 78  ? 42.366  59.081  86.005  1.00 87.09  ? 346 LEU B N     1 
ATOM   2468  C  CA    . LEU B 1 78  ? 41.513  59.922  85.177  1.00 87.09  ? 346 LEU B CA    1 
ATOM   2469  C  C     . LEU B 1 78  ? 42.406  60.786  84.298  1.00 87.09  ? 346 LEU B C     1 
ATOM   2470  O  O     . LEU B 1 78  ? 43.142  61.638  84.801  1.00 87.09  ? 346 LEU B O     1 
ATOM   2471  C  CB    . LEU B 1 78  ? 40.604  60.770  86.058  1.00 87.09  ? 346 LEU B CB    1 
ATOM   2472  C  CG    . LEU B 1 78  ? 39.724  59.948  86.997  1.00 87.09  ? 346 LEU B CG    1 
ATOM   2473  C  CD1   . LEU B 1 78  ? 38.910  60.847  87.893  1.00 87.09  ? 346 LEU B CD1   1 
ATOM   2474  C  CD2   . LEU B 1 78  ? 38.833  59.026  86.222  1.00 87.09  ? 346 LEU B CD2   1 
ATOM   2475  N  N     . THR B 1 79  ? 42.360  60.561  82.988  1.00 87.75  ? 347 THR B N     1 
ATOM   2476  C  CA    . THR B 1 79  ? 43.222  61.258  82.048  1.00 87.75  ? 347 THR B CA    1 
ATOM   2477  C  C     . THR B 1 79  ? 42.391  62.067  81.064  1.00 87.75  ? 347 THR B C     1 
ATOM   2478  O  O     . THR B 1 79  ? 41.217  61.776  80.823  1.00 87.75  ? 347 THR B O     1 
ATOM   2479  C  CB    . THR B 1 79  ? 44.113  60.285  81.276  1.00 87.75  ? 347 THR B CB    1 
ATOM   2480  O  OG1   . THR B 1 79  ? 43.295  59.393  80.512  1.00 87.75  ? 347 THR B OG1   1 
ATOM   2481  C  CG2   . THR B 1 79  ? 44.976  59.481  82.228  1.00 87.75  ? 347 THR B CG2   1 
ATOM   2482  N  N     . GLY B 1 80  ? 43.018  63.091  80.492  1.00 81.53  ? 348 GLY B N     1 
ATOM   2483  C  CA    . GLY B 1 80  ? 42.378  63.910  79.492  1.00 81.53  ? 348 GLY B CA    1 
ATOM   2484  C  C     . GLY B 1 80  ? 42.933  65.317  79.431  1.00 81.53  ? 348 GLY B C     1 
ATOM   2485  O  O     . GLY B 1 80  ? 43.843  65.680  80.177  1.00 81.53  ? 348 GLY B O     1 
ATOM   2486  N  N     . PRO B 1 81  ? 42.401  66.133  78.527  1.00 79.53  ? 349 PRO B N     1 
ATOM   2487  C  CA    . PRO B 1 81  ? 42.836  67.526  78.422  1.00 79.53  ? 349 PRO B CA    1 
ATOM   2488  C  C     . PRO B 1 81  ? 42.404  68.328  79.635  1.00 79.53  ? 349 PRO B C     1 
ATOM   2489  O  O     . PRO B 1 81  ? 41.508  67.902  80.379  1.00 79.53  ? 349 PRO B O     1 
ATOM   2490  C  CB    . PRO B 1 81  ? 42.128  68.015  77.150  1.00 79.53  ? 349 PRO B CB    1 
ATOM   2491  C  CG    . PRO B 1 81  ? 41.843  66.789  76.388  1.00 79.53  ? 349 PRO B CG    1 
ATOM   2492  C  CD    . PRO B 1 81  ? 41.525  65.755  77.410  1.00 79.53  ? 349 PRO B CD    1 
ATOM   2493  N  N     . PRO B 1 82  ? 43.024  69.482  79.884  1.00 77.96  ? 350 PRO B N     1 
ATOM   2494  C  CA    . PRO B 1 82  ? 42.598  70.307  81.018  1.00 77.96  ? 350 PRO B CA    1 
ATOM   2495  C  C     . PRO B 1 82  ? 41.240  70.940  80.775  1.00 77.96  ? 350 PRO B C     1 
ATOM   2496  O  O     . PRO B 1 82  ? 40.909  71.343  79.658  1.00 77.96  ? 350 PRO B O     1 
ATOM   2497  C  CB    . PRO B 1 82  ? 43.693  71.374  81.110  1.00 77.96  ? 350 PRO B CB    1 
ATOM   2498  C  CG    . PRO B 1 82  ? 44.857  70.779  80.441  1.00 77.96  ? 350 PRO B CG    1 
ATOM   2499  C  CD    . PRO B 1 82  ? 44.296  69.965  79.324  1.00 77.96  ? 350 PRO B CD    1 
ATOM   2500  N  N     . GLY B 1 83  ? 40.452  71.019  81.841  1.00 77.81  ? 351 GLY B N     1 
ATOM   2501  C  CA    . GLY B 1 83  ? 39.142  71.623  81.780  1.00 77.81  ? 351 GLY B CA    1 
ATOM   2502  C  C     . GLY B 1 83  ? 38.008  70.674  81.510  1.00 77.81  ? 351 GLY B C     1 
ATOM   2503  O  O     . GLY B 1 83  ? 36.928  71.124  81.121  1.00 77.81  ? 351 GLY B O     1 
ATOM   2504  N  N     . THR B 1 84  ? 38.204  69.381  81.730  1.00 78.23  ? 352 THR B N     1 
ATOM   2505  C  CA    . THR B 1 84  ? 37.312  68.364  81.199  1.00 78.23  ? 352 THR B CA    1 
ATOM   2506  C  C     . THR B 1 84  ? 36.395  67.750  82.243  1.00 78.23  ? 352 THR B C     1 
ATOM   2507  O  O     . THR B 1 84  ? 35.217  67.526  81.964  1.00 78.23  ? 352 THR B O     1 
ATOM   2508  C  CB    . THR B 1 84  ? 38.140  67.268  80.535  1.00 78.23  ? 352 THR B CB    1 
ATOM   2509  O  OG1   . THR B 1 84  ? 39.073  67.872  79.636  1.00 78.23  ? 352 THR B OG1   1 
ATOM   2510  C  CG2   . THR B 1 84  ? 37.259  66.389  79.727  1.00 78.23  ? 352 THR B CG2   1 
ATOM   2511  N  N     . GLY B 1 85  ? 36.879  67.509  83.453  1.00 80.40  ? 353 GLY B N     1 
ATOM   2512  C  CA    . GLY B 1 85  ? 36.037  66.868  84.438  1.00 80.40  ? 353 GLY B CA    1 
ATOM   2513  C  C     . GLY B 1 85  ? 36.744  65.845  85.297  1.00 80.40  ? 353 GLY B C     1 
ATOM   2514  O  O     . GLY B 1 85  ? 36.103  65.181  86.109  1.00 80.40  ? 353 GLY B O     1 
ATOM   2515  N  N     . LYS B 1 86  ? 38.063  65.719  85.158  1.00 82.19  ? 354 LYS B N     1 
ATOM   2516  C  CA    . LYS B 1 86  ? 38.793  64.692  85.892  1.00 82.19  ? 354 LYS B CA    1 
ATOM   2517  C  C     . LYS B 1 86  ? 38.951  65.003  87.377  1.00 82.19  ? 354 LYS B C     1 
ATOM   2518  O  O     . LYS B 1 86  ? 39.435  64.142  88.117  1.00 82.19  ? 354 LYS B O     1 
ATOM   2519  C  CB    . LYS B 1 86  ? 40.162  64.474  85.247  1.00 82.19  ? 354 LYS B CB    1 
ATOM   2520  C  CG    . LYS B 1 86  ? 41.078  65.668  85.336  1.00 82.19  ? 354 LYS B CG    1 
ATOM   2521  C  CD    . LYS B 1 86  ? 42.429  65.399  84.716  1.00 82.19  ? 354 LYS B CD    1 
ATOM   2522  C  CE    . LYS B 1 86  ? 42.348  65.389  83.208  1.00 82.19  ? 354 LYS B CE    1 
ATOM   2523  N  NZ    . LYS B 1 86  ? 42.044  66.732  82.652  1.00 82.19  ? 354 LYS B NZ    1 
ATOM   2524  N  N     . THR B 1 87  ? 38.561  66.191  87.832  1.00 85.43  ? 355 THR B N     1 
ATOM   2525  C  CA    . THR B 1 87  ? 38.505  66.531  89.250  1.00 85.43  ? 355 THR B CA    1 
ATOM   2526  C  C     . THR B 1 87  ? 37.079  66.634  89.759  1.00 85.43  ? 355 THR B C     1 
ATOM   2527  O  O     . THR B 1 87  ? 36.791  66.204  90.880  1.00 85.43  ? 355 THR B O     1 
ATOM   2528  C  CB    . THR B 1 87  ? 39.236  67.859  89.503  1.00 85.43  ? 355 THR B CB    1 
ATOM   2529  O  OG1   . THR B 1 87  ? 40.567  67.779  88.981  1.00 85.43  ? 355 THR B OG1   1 
ATOM   2530  C  CG2   . THR B 1 87  ? 39.333  68.162  90.983  1.00 85.43  ? 355 THR B CG2   1 
ATOM   2531  N  N     . LEU B 1 88  ? 36.173  67.162  88.931  1.00 85.79  ? 356 LEU B N     1 
ATOM   2532  C  CA    . LEU B 1 88  ? 34.768  67.281  89.307  1.00 85.79  ? 356 LEU B CA    1 
ATOM   2533  C  C     . LEU B 1 88  ? 34.118  65.916  89.461  1.00 85.79  ? 356 LEU B C     1 
ATOM   2534  O  O     . LEU B 1 88  ? 33.263  65.721  90.332  1.00 85.79  ? 356 LEU B O     1 
ATOM   2535  C  CB    . LEU B 1 88  ? 34.019  68.088  88.256  1.00 85.79  ? 356 LEU B CB    1 
ATOM   2536  C  CG    . LEU B 1 88  ? 32.565  68.410  88.570  1.00 85.79  ? 356 LEU B CG    1 
ATOM   2537  C  CD1   . LEU B 1 88  ? 32.496  69.392  89.719  1.00 85.79  ? 356 LEU B CD1   1 
ATOM   2538  C  CD2   . LEU B 1 88  ? 31.866  68.943  87.356  1.00 85.79  ? 356 LEU B CD2   1 
ATOM   2539  N  N     . LEU B 1 89  ? 34.518  64.955  88.630  1.00 90.25  ? 357 LEU B N     1 
ATOM   2540  C  CA    . LEU B 1 89  ? 33.990  63.606  88.743  1.00 90.25  ? 357 LEU B CA    1 
ATOM   2541  C  C     . LEU B 1 89  ? 34.527  62.897  89.977  1.00 90.25  ? 357 LEU B C     1 
ATOM   2542  O  O     . LEU B 1 89  ? 33.922  61.924  90.435  1.00 90.25  ? 357 LEU B O     1 
ATOM   2543  C  CB    . LEU B 1 89  ? 34.305  62.837  87.464  1.00 90.25  ? 357 LEU B CB    1 
ATOM   2544  C  CG    . LEU B 1 89  ? 33.706  61.465  87.199  1.00 90.25  ? 357 LEU B CG    1 
ATOM   2545  C  CD1   . LEU B 1 89  ? 32.209  61.528  87.291  1.00 90.25  ? 357 LEU B CD1   1 
ATOM   2546  C  CD2   . LEU B 1 89  ? 34.107  61.041  85.811  1.00 90.25  ? 357 LEU B CD2   1 
ATOM   2547  N  N     . ALA B 1 90  ? 35.632  63.377  90.543  1.00 90.00  ? 358 ALA B N     1 
ATOM   2548  C  CA    . ALA B 1 90  ? 36.064  62.896  91.846  1.00 90.00  ? 358 ALA B CA    1 
ATOM   2549  C  C     . ALA B 1 90  ? 35.350  63.612  92.982  1.00 90.00  ? 358 ALA B C     1 
ATOM   2550  O  O     . ALA B 1 90  ? 35.217  63.047  94.072  1.00 90.00  ? 358 ALA B O     1 
ATOM   2551  C  CB    . ALA B 1 90  ? 37.570  63.066  91.995  1.00 90.00  ? 358 ALA B CB    1 
ATOM   2552  N  N     . LYS B 1 91  ? 34.912  64.854  92.758  1.00 93.07  ? 359 LYS B N     1 
ATOM   2553  C  CA    . LYS B 1 91  ? 34.067  65.527  93.738  1.00 93.07  ? 359 LYS B CA    1 
ATOM   2554  C  C     . LYS B 1 91  ? 32.715  64.843  93.845  1.00 93.07  ? 359 LYS B C     1 
ATOM   2555  O  O     . LYS B 1 91  ? 32.191  64.655  94.947  1.00 93.07  ? 359 LYS B O     1 
ATOM   2556  C  CB    . LYS B 1 91  ? 33.864  66.993  93.360  1.00 93.07  ? 359 LYS B CB    1 
ATOM   2557  C  CG    . LYS B 1 91  ? 35.085  67.877  93.444  1.00 93.07  ? 359 LYS B CG    1 
ATOM   2558  C  CD    . LYS B 1 91  ? 34.714  69.309  93.104  1.00 93.07  ? 359 LYS B CD    1 
ATOM   2559  C  CE    . LYS B 1 91  ? 35.919  70.222  93.145  1.00 93.07  ? 359 LYS B CE    1 
ATOM   2560  N  NZ    . LYS B 1 91  ? 35.560  71.612  92.758  1.00 93.07  ? 359 LYS B NZ    1 
ATOM   2561  N  N     . ALA B 1 92  ? 32.139  64.466  92.702  1.00 97.28  ? 360 ALA B N     1 
ATOM   2562  C  CA    . ALA B 1 92  ? 30.832  63.829  92.680  1.00 97.28  ? 360 ALA B CA    1 
ATOM   2563  C  C     . ALA B 1 92  ? 30.860  62.436  93.275  1.00 97.28  ? 360 ALA B C     1 
ATOM   2564  O  O     . ALA B 1 92  ? 29.826  61.960  93.750  1.00 97.28  ? 360 ALA B O     1 
ATOM   2565  C  CB    . ALA B 1 92  ? 30.305  63.770  91.250  1.00 97.28  ? 360 ALA B CB    1 
ATOM   2566  N  N     . THR B 1 93  ? 32.015  61.777  93.264  1.00 97.79  ? 361 THR B N     1 
ATOM   2567  C  CA    . THR B 1 93  ? 32.142  60.509  93.965  1.00 97.79  ? 361 THR B CA    1 
ATOM   2568  C  C     . THR B 1 93  ? 32.113  60.715  95.475  1.00 97.79  ? 361 THR B C     1 
ATOM   2569  O  O     . THR B 1 93  ? 31.587  59.871  96.207  1.00 97.79  ? 361 THR B O     1 
ATOM   2570  C  CB    . THR B 1 93  ? 33.428  59.816  93.513  1.00 97.79  ? 361 THR B CB    1 
ATOM   2571  O  OG1   . THR B 1 93  ? 33.418  59.711  92.087  1.00 97.79  ? 361 THR B OG1   1 
ATOM   2572  C  CG2   . THR B 1 93  ? 33.536  58.418  94.084  1.00 97.79  ? 361 THR B CG2   1 
ATOM   2573  N  N     . ALA B 1 94  ? 32.627  61.848  95.954  1.00 98.99  ? 362 ALA B N     1 
ATOM   2574  C  CA    . ALA B 1 94  ? 32.649  62.096  97.391  1.00 98.99  ? 362 ALA B CA    1 
ATOM   2575  C  C     . ALA B 1 94  ? 31.264  62.412  97.932  1.00 98.99  ? 362 ALA B C     1 
ATOM   2576  O  O     . ALA B 1 94  ? 30.977  62.128  99.099  1.00 98.99  ? 362 ALA B O     1 
ATOM   2577  C  CB    . ALA B 1 94  ? 33.608  63.238  97.711  1.00 98.99  ? 362 ALA B CB    1 
ATOM   2578  N  N     . GLY B 1 95  ? 30.398  62.994  97.110  1.00 101.85 ? 363 GLY B N     1 
ATOM   2579  C  CA    . GLY B 1 95  ? 29.070  63.349  97.560  1.00 101.85 ? 363 GLY B CA    1 
ATOM   2580  C  C     . GLY B 1 95  ? 28.051  62.245  97.376  1.00 101.85 ? 363 GLY B C     1 
ATOM   2581  O  O     . GLY B 1 95  ? 27.236  61.993  98.266  1.00 101.85 ? 363 GLY B O     1 
ATOM   2582  N  N     . GLU B 1 96  ? 28.087  61.585  96.217  1.00 102.96 ? 364 GLU B N     1 
ATOM   2583  C  CA    . GLU B 1 96  ? 27.111  60.541  95.925  1.00 102.96 ? 364 GLU B CA    1 
ATOM   2584  C  C     . GLU B 1 96  ? 27.357  59.298  96.766  1.00 102.96 ? 364 GLU B C     1 
ATOM   2585  O  O     . GLU B 1 96  ? 26.436  58.780  97.407  1.00 102.96 ? 364 GLU B O     1 
ATOM   2586  C  CB    . GLU B 1 96  ? 27.134  60.200  94.439  1.00 102.96 ? 364 GLU B CB    1 
ATOM   2587  C  CG    . GLU B 1 96  ? 26.459  61.236  93.566  1.00 102.96 ? 364 GLU B CG    1 
ATOM   2588  C  CD    . GLU B 1 96  ? 24.953  61.224  93.734  1.00 102.96 ? 364 GLU B CD    1 
ATOM   2589  O  OE1   . GLU B 1 96  ? 24.395  60.135  93.971  1.00 102.96 ? 364 GLU B OE1   1 
ATOM   2590  O  OE2   . GLU B 1 96  ? 24.326  62.297  93.640  1.00 102.96 ? 364 GLU B OE2   1 
ATOM   2591  N  N     . ALA B 1 97  ? 28.585  58.799  96.773  1.00 106.49 ? 365 ALA B N     1 
ATOM   2592  C  CA    . ALA B 1 97  ? 28.896  57.651  97.605  1.00 106.49 ? 365 ALA B CA    1 
ATOM   2593  C  C     . ALA B 1 97  ? 28.955  58.066  99.067  1.00 106.49 ? 365 ALA B C     1 
ATOM   2594  O  O     . ALA B 1 97  ? 29.536  59.095  99.417  1.00 106.49 ? 365 ALA B O     1 
ATOM   2595  C  CB    . ALA B 1 97  ? 30.219  57.026  97.177  1.00 106.49 ? 365 ALA B CB    1 
ATOM   2596  N  N     . ASN B 1 98  ? 28.341  57.256  99.923  1.00 109.54 ? 366 ASN B N     1 
ATOM   2597  C  CA    . ASN B 1 98  ? 28.298  57.541  101.350 1.00 109.54 ? 366 ASN B CA    1 
ATOM   2598  C  C     . ASN B 1 98  ? 29.590  57.181  102.068 1.00 109.54 ? 366 ASN B C     1 
ATOM   2599  O  O     . ASN B 1 98  ? 29.692  57.429  103.274 1.00 109.54 ? 366 ASN B O     1 
ATOM   2600  C  CB    . ASN B 1 98  ? 27.127  56.799  101.992 1.00 109.54 ? 366 ASN B CB    1 
ATOM   2601  C  CG    . ASN B 1 98  ? 25.788  57.348  101.556 1.00 109.54 ? 366 ASN B CG    1 
ATOM   2602  O  OD1   . ASN B 1 98  ? 25.602  58.560  101.463 1.00 109.54 ? 366 ASN B OD1   1 
ATOM   2603  N  ND2   . ASN B 1 98  ? 24.845  56.456  101.281 1.00 109.54 ? 366 ASN B ND2   1 
ATOM   2604  N  N     . VAL B 1 99  ? 30.564  56.604  101.371 1.00 109.66 ? 367 VAL B N     1 
ATOM   2605  C  CA    . VAL B 1 99  ? 31.865  56.284  101.950 1.00 109.66 ? 367 VAL B CA    1 
ATOM   2606  C  C     . VAL B 1 99  ? 32.625  57.577  102.226 1.00 109.66 ? 367 VAL B C     1 
ATOM   2607  O  O     . VAL B 1 99  ? 32.392  58.588  101.547 1.00 109.66 ? 367 VAL B O     1 
ATOM   2608  C  CB    . VAL B 1 99  ? 32.663  55.345  101.029 1.00 109.66 ? 367 VAL B CB    1 
ATOM   2609  C  CG1   . VAL B 1 99  ? 31.985  53.995  100.942 1.00 109.66 ? 367 VAL B CG1   1 
ATOM   2610  C  CG2   . VAL B 1 99  ? 32.814  55.946  99.650  1.00 109.66 ? 367 VAL B CG2   1 
ATOM   2611  N  N     . PRO B 1 100 ? 33.500  57.607  103.228 1.00 107.15 ? 368 PRO B N     1 
ATOM   2612  C  CA    . PRO B 1 100 ? 34.317  58.801  103.455 1.00 107.15 ? 368 PRO B CA    1 
ATOM   2613  C  C     . PRO B 1 100 ? 35.343  59.007  102.353 1.00 107.15 ? 368 PRO B C     1 
ATOM   2614  O  O     . PRO B 1 100 ? 35.685  58.098  101.595 1.00 107.15 ? 368 PRO B O     1 
ATOM   2615  C  CB    . PRO B 1 100 ? 34.992  58.521  104.800 1.00 107.15 ? 368 PRO B CB    1 
ATOM   2616  C  CG    . PRO B 1 100 ? 34.937  57.048  104.953 1.00 107.15 ? 368 PRO B CG    1 
ATOM   2617  C  CD    . PRO B 1 100 ? 33.663  56.624  104.310 1.00 107.15 ? 368 PRO B CD    1 
ATOM   2618  N  N     . PHE B 1 101 ? 35.833  60.239  102.275 1.00 102.61 ? 369 PHE B N     1 
ATOM   2619  C  CA    . PHE B 1 101 ? 36.677  60.685  101.181 1.00 102.61 ? 369 PHE B CA    1 
ATOM   2620  C  C     . PHE B 1 101 ? 37.916  61.368  101.737 1.00 102.61 ? 369 PHE B C     1 
ATOM   2621  O  O     . PHE B 1 101 ? 37.827  62.151  102.687 1.00 102.61 ? 369 PHE B O     1 
ATOM   2622  C  CB    . PHE B 1 101 ? 35.913  61.651  100.281 1.00 102.61 ? 369 PHE B CB    1 
ATOM   2623  C  CG    . PHE B 1 101 ? 36.644  62.030  99.038  1.00 102.61 ? 369 PHE B CG    1 
ATOM   2624  C  CD1   . PHE B 1 101 ? 36.654  61.181  97.952  1.00 102.61 ? 369 PHE B CD1   1 
ATOM   2625  C  CD2   . PHE B 1 101 ? 37.311  63.236  98.947  1.00 102.61 ? 369 PHE B CD2   1 
ATOM   2626  C  CE1   . PHE B 1 101 ? 37.316  61.520  96.798  1.00 102.61 ? 369 PHE B CE1   1 
ATOM   2627  C  CE2   . PHE B 1 101 ? 37.977  63.579  97.800  1.00 102.61 ? 369 PHE B CE2   1 
ATOM   2628  C  CZ    . PHE B 1 101 ? 37.980  62.720  96.723  1.00 102.61 ? 369 PHE B CZ    1 
ATOM   2629  N  N     . ILE B 1 102 ? 39.070  61.070  101.144 1.00 97.42  ? 370 ILE B N     1 
ATOM   2630  C  CA    . ILE B 1 102 ? 40.334  61.712  101.487 1.00 97.42  ? 370 ILE B CA    1 
ATOM   2631  C  C     . ILE B 1 102 ? 41.065  62.087  100.207 1.00 97.42  ? 370 ILE B C     1 
ATOM   2632  O  O     . ILE B 1 102 ? 41.099  61.309  99.250  1.00 97.42  ? 370 ILE B O     1 
ATOM   2633  C  CB    . ILE B 1 102 ? 41.207  60.815  102.392 1.00 97.42  ? 370 ILE B CB    1 
ATOM   2634  C  CG1   . ILE B 1 102 ? 41.272  59.386  101.869 1.00 97.42  ? 370 ILE B CG1   1 
ATOM   2635  C  CG2   . ILE B 1 102 ? 40.689  60.785  103.797 1.00 97.42  ? 370 ILE B CG2   1 
ATOM   2636  C  CD1   . ILE B 1 102 ? 42.238  58.527  102.634 1.00 97.42  ? 370 ILE B CD1   1 
ATOM   2637  N  N     . THR B 1 103 ? 41.635  63.288  100.181 1.00 91.53  ? 371 THR B N     1 
ATOM   2638  C  CA    . THR B 1 103 ? 42.273  63.803  98.981  1.00 91.53  ? 371 THR B CA    1 
ATOM   2639  C  C     . THR B 1 103 ? 43.593  64.479  99.315  1.00 91.53  ? 371 THR B C     1 
ATOM   2640  O  O     . THR B 1 103 ? 43.773  65.041  100.398 1.00 91.53  ? 371 THR B O     1 
ATOM   2641  C  CB    . THR B 1 103 ? 41.365  64.788  98.231  1.00 91.53  ? 371 THR B CB    1 
ATOM   2642  O  OG1   . THR B 1 103 ? 42.047  65.285  97.074  1.00 91.53  ? 371 THR B OG1   1 
ATOM   2643  C  CG2   . THR B 1 103 ? 40.944  65.947  99.118  1.00 91.53  ? 371 THR B CG2   1 
ATOM   2644  N  N     . VAL B 1 104 ? 44.532  64.374  98.378  1.00 85.55  ? 372 VAL B N     1 
ATOM   2645  C  CA    . VAL B 1 104 ? 45.777  65.124  98.370  1.00 85.55  ? 372 VAL B CA    1 
ATOM   2646  C  C     . VAL B 1 104 ? 46.005  65.631  96.954  1.00 85.55  ? 372 VAL B C     1 
ATOM   2647  O  O     . VAL B 1 104 ? 45.191  65.416  96.056  1.00 85.55  ? 372 VAL B O     1 
ATOM   2648  C  CB    . VAL B 1 104 ? 46.991  64.281  98.812  1.00 85.55  ? 372 VAL B CB    1 
ATOM   2649  C  CG1   . VAL B 1 104 ? 46.896  63.873  100.260 1.00 85.55  ? 372 VAL B CG1   1 
ATOM   2650  C  CG2   . VAL B 1 104 ? 47.119  63.062  97.930  1.00 85.55  ? 372 VAL B CG2   1 
ATOM   2651  N  N     . SER B 1 105 ? 47.123  66.309  96.760  1.00 81.88  ? 373 SER B N     1 
ATOM   2652  C  CA    . SER B 1 105 ? 47.706  66.461  95.441  1.00 81.88  ? 373 SER B CA    1 
ATOM   2653  C  C     . SER B 1 105 ? 49.022  65.704  95.417  1.00 81.88  ? 373 SER B C     1 
ATOM   2654  O  O     . SER B 1 105 ? 49.557  65.318  96.458  1.00 81.88  ? 373 SER B O     1 
ATOM   2655  C  CB    . SER B 1 105 ? 47.920  67.931  95.079  1.00 81.88  ? 373 SER B CB    1 
ATOM   2656  O  OG    . SER B 1 105 ? 48.947  68.508  95.854  1.00 81.88  ? 373 SER B OG    1 
ATOM   2657  N  N     . GLY B 1 106 ? 49.536  65.476  94.210  1.00 82.06  ? 374 GLY B N     1 
ATOM   2658  C  CA    . GLY B 1 106 ? 50.790  64.759  94.087  1.00 82.06  ? 374 GLY B CA    1 
ATOM   2659  C  C     . GLY B 1 106 ? 51.974  65.556  94.584  1.00 82.06  ? 374 GLY B C     1 
ATOM   2660  O  O     . GLY B 1 106 ? 52.953  64.985  95.068  1.00 82.06  ? 374 GLY B O     1 
ATOM   2661  N  N     . SER B 1 107 ? 51.896  66.878  94.506  1.00 81.30  ? 375 SER B N     1 
ATOM   2662  C  CA    . SER B 1 107 ? 53.012  67.718  94.902  1.00 81.30  ? 375 SER B CA    1 
ATOM   2663  C  C     . SER B 1 107 ? 53.134  67.902  96.408  1.00 81.30  ? 375 SER B C     1 
ATOM   2664  O  O     . SER B 1 107 ? 54.130  68.473  96.859  1.00 81.30  ? 375 SER B O     1 
ATOM   2665  C  CB    . SER B 1 107 ? 52.887  69.079  94.231  1.00 81.30  ? 375 SER B CB    1 
ATOM   2666  O  OG    . SER B 1 107 ? 51.718  69.733  94.679  1.00 81.30  ? 375 SER B OG    1 
ATOM   2667  N  N     . GLU B 1 108 ? 52.177  67.426  97.198  1.00 84.83  ? 376 GLU B N     1 
ATOM   2668  C  CA    . GLU B 1 108 ? 52.217  67.603  98.646  1.00 84.83  ? 376 GLU B CA    1 
ATOM   2669  C  C     . GLU B 1 108 ? 53.130  66.616  99.359  1.00 84.83  ? 376 GLU B C     1 
ATOM   2670  O  O     . GLU B 1 108 ? 53.123  66.588  100.592 1.00 84.83  ? 376 GLU B O     1 
ATOM   2671  C  CB    . GLU B 1 108 ? 50.813  67.479  99.238  1.00 84.83  ? 376 GLU B CB    1 
ATOM   2672  C  CG    . GLU B 1 108 ? 49.892  68.636  98.950  1.00 84.83  ? 376 GLU B CG    1 
ATOM   2673  C  CD    . GLU B 1 108 ? 48.519  68.448  99.559  1.00 84.83  ? 376 GLU B CD    1 
ATOM   2674  O  OE1   . GLU B 1 108 ? 48.259  67.362  100.112 1.00 84.83  ? 376 GLU B OE1   1 
ATOM   2675  O  OE2   . GLU B 1 108 ? 47.698  69.385  99.486  1.00 84.83  ? 376 GLU B OE2   1 
ATOM   2676  N  N     . PHE B 1 109 ? 53.909  65.812  98.641  1.00 86.11  ? 377 PHE B N     1 
ATOM   2677  C  CA    . PHE B 1 109 ? 54.684  64.740  99.253  1.00 86.11  ? 377 PHE B CA    1 
ATOM   2678  C  C     . PHE B 1 109 ? 56.161  65.064  99.385  1.00 86.11  ? 377 PHE B C     1 
ATOM   2679  O  O     . PHE B 1 109 ? 56.785  64.679  100.376 1.00 86.11  ? 377 PHE B O     1 
ATOM   2680  C  CB    . PHE B 1 109 ? 54.524  63.454  98.445  1.00 86.11  ? 377 PHE B CB    1 
ATOM   2681  C  CG    . PHE B 1 109 ? 53.164  62.851  98.542  1.00 86.11  ? 377 PHE B CG    1 
ATOM   2682  C  CD1   . PHE B 1 109 ? 52.349  63.116  99.624  1.00 86.11  ? 377 PHE B CD1   1 
ATOM   2683  C  CD2   . PHE B 1 109 ? 52.684  62.054  97.526  1.00 86.11  ? 377 PHE B CD2   1 
ATOM   2684  C  CE1   . PHE B 1 109 ? 51.091  62.566  99.703  1.00 86.11  ? 377 PHE B CE1   1 
ATOM   2685  C  CE2   . PHE B 1 109 ? 51.429  61.509  97.594  1.00 86.11  ? 377 PHE B CE2   1 
ATOM   2686  C  CZ    . PHE B 1 109 ? 50.631  61.764  98.683  1.00 86.11  ? 377 PHE B CZ    1 
ATOM   2687  N  N     . LEU B 1 110 ? 56.738  65.753  98.409  1.00 91.57  ? 378 LEU B N     1 
ATOM   2688  C  CA    . LEU B 1 110 ? 58.155  66.079  98.465  1.00 91.57  ? 378 LEU B CA    1 
ATOM   2689  C  C     . LEU B 1 110 ? 58.407  67.197  99.468  1.00 91.57  ? 378 LEU B C     1 
ATOM   2690  O  O     . LEU B 1 110 ? 57.784  68.260  99.404  1.00 91.57  ? 378 LEU B O     1 
ATOM   2691  C  CB    . LEU B 1 110 ? 58.652  66.478  97.081  1.00 91.57  ? 378 LEU B CB    1 
ATOM   2692  C  CG    . LEU B 1 110 ? 58.668  65.331  96.077  1.00 91.57  ? 378 LEU B CG    1 
ATOM   2693  C  CD1   . LEU B 1 110 ? 59.011  65.827  94.687  1.00 91.57  ? 378 LEU B CD1   1 
ATOM   2694  C  CD2   . LEU B 1 110 ? 59.660  64.278  96.531  1.00 91.57  ? 378 LEU B CD2   1 
ATOM   2695  N  N     . GLU B 1 111 ? 59.324  66.950  100.396 1.00 94.59  ? 379 GLU B N     1 
ATOM   2696  C  CA    . GLU B 1 111 ? 59.647  67.870  101.472 1.00 94.59  ? 379 GLU B CA    1 
ATOM   2697  C  C     . GLU B 1 111 ? 61.157  68.100  101.446 1.00 94.59  ? 379 GLU B C     1 
ATOM   2698  O  O     . GLU B 1 111 ? 61.886  67.446  100.694 1.00 94.59  ? 379 GLU B O     1 
ATOM   2699  C  CB    . GLU B 1 111 ? 59.125  67.303  102.811 1.00 94.59  ? 379 GLU B CB    1 
ATOM   2700  C  CG    . GLU B 1 111 ? 59.149  68.190  104.075 1.00 94.59  ? 379 GLU B CG    1 
ATOM   2701  C  CD    . GLU B 1 111 ? 58.295  69.438  103.961 1.00 94.59  ? 379 GLU B CD    1 
ATOM   2702  O  OE1   . GLU B 1 111 ? 57.301  69.429  103.207 1.00 94.59  ? 379 GLU B OE1   1 
ATOM   2703  O  OE2   . GLU B 1 111 ? 58.623  70.437  104.634 1.00 94.59  ? 379 GLU B OE2   1 
ATOM   2704  N  N     . MET B 1 112 ? 61.604  69.086  102.231 1.00 89.69  ? 380 MET B N     1 
ATOM   2705  C  CA    . MET B 1 112 ? 63.016  69.433  102.354 1.00 89.69  ? 380 MET B CA    1 
ATOM   2706  C  C     . MET B 1 112 ? 63.864  68.246  102.791 1.00 89.69  ? 380 MET B C     1 
ATOM   2707  O  O     . MET B 1 112 ? 64.852  67.902  102.135 1.00 89.69  ? 380 MET B O     1 
ATOM   2708  C  CB    . MET B 1 112 ? 63.151  70.580  103.353 1.00 89.69  ? 380 MET B CB    1 
ATOM   2709  C  CG    . MET B 1 112 ? 64.547  71.093  103.564 1.00 89.69  ? 380 MET B CG    1 
ATOM   2710  S  SD    . MET B 1 112 ? 64.539  72.448  104.747 1.00 89.69  ? 380 MET B SD    1 
ATOM   2711  C  CE    . MET B 1 112 ? 63.733  73.718  103.780 1.00 89.69  ? 380 MET B CE    1 
ATOM   2712  N  N     . PHE B 1 113 ? 63.493  67.604  103.889 1.00 89.97  ? 381 PHE B N     1 
ATOM   2713  C  CA    . PHE B 1 113 ? 64.343  66.574  104.464 1.00 89.97  ? 381 PHE B CA    1 
ATOM   2714  C  C     . PHE B 1 113 ? 64.191  65.257  103.717 1.00 89.97  ? 381 PHE B C     1 
ATOM   2715  O  O     . PHE B 1 113 ? 63.087  64.872  103.325 1.00 89.97  ? 381 PHE B O     1 
ATOM   2716  C  CB    . PHE B 1 113 ? 64.017  66.381  105.941 1.00 89.97  ? 381 PHE B CB    1 
ATOM   2717  C  CG    . PHE B 1 113 ? 64.289  67.589  106.771 1.00 89.97  ? 381 PHE B CG    1 
ATOM   2718  C  CD1   . PHE B 1 113 ? 65.575  67.891  107.173 1.00 89.97  ? 381 PHE B CD1   1 
ATOM   2719  C  CD2   . PHE B 1 113 ? 63.259  68.431  107.139 1.00 89.97  ? 381 PHE B CD2   1 
ATOM   2720  C  CE1   . PHE B 1 113 ? 65.828  69.011  107.937 1.00 89.97  ? 381 PHE B CE1   1 
ATOM   2721  C  CE2   . PHE B 1 113 ? 63.503  69.550  107.902 1.00 89.97  ? 381 PHE B CE2   1 
ATOM   2722  C  CZ    . PHE B 1 113 ? 64.789  69.841  108.301 1.00 89.97  ? 381 PHE B CZ    1 
ATOM   2723  N  N     . VAL B 1 114 ? 65.314  64.571  103.515 1.00 92.26  ? 382 VAL B N     1 
ATOM   2724  C  CA    . VAL B 1 114 ? 65.297  63.261  102.878 1.00 92.26  ? 382 VAL B CA    1 
ATOM   2725  C  C     . VAL B 1 114 ? 64.736  62.248  103.863 1.00 92.26  ? 382 VAL B C     1 
ATOM   2726  O  O     . VAL B 1 114 ? 65.302  62.027  104.938 1.00 92.26  ? 382 VAL B O     1 
ATOM   2727  C  CB    . VAL B 1 114 ? 66.697  62.859  102.406 1.00 92.26  ? 382 VAL B CB    1 
ATOM   2728  C  CG1   . VAL B 1 114 ? 66.698  61.423  101.934 1.00 92.26  ? 382 VAL B CG1   1 
ATOM   2729  C  CG2   . VAL B 1 114 ? 67.150  63.765  101.287 1.00 92.26  ? 382 VAL B CG2   1 
ATOM   2730  N  N     . GLY B 1 115 ? 63.620  61.629  103.499 1.00 93.64  ? 383 GLY B N     1 
ATOM   2731  C  CA    . GLY B 1 115 ? 62.957  60.667  104.358 1.00 93.64  ? 383 GLY B CA    1 
ATOM   2732  C  C     . GLY B 1 115 ? 61.539  61.033  104.720 1.00 93.64  ? 383 GLY B C     1 
ATOM   2733  O  O     . GLY B 1 115 ? 60.905  60.292  105.482 1.00 93.64  ? 383 GLY B O     1 
ATOM   2734  N  N     . VAL B 1 116 ? 61.010  62.144  104.219 1.00 95.07  ? 384 VAL B N     1 
ATOM   2735  C  CA    . VAL B 1 116 ? 59.650  62.562  104.512 1.00 95.07  ? 384 VAL B CA    1 
ATOM   2736  C  C     . VAL B 1 116 ? 58.690  62.142  103.408 1.00 95.07  ? 384 VAL B C     1 
ATOM   2737  O  O     . VAL B 1 116 ? 57.586  61.672  103.690 1.00 95.07  ? 384 VAL B O     1 
ATOM   2738  C  CB    . VAL B 1 116 ? 59.611  64.087  104.738 1.00 95.07  ? 384 VAL B CB    1 
ATOM   2739  C  CG1   . VAL B 1 116 ? 58.205  64.543  105.074 1.00 95.07  ? 384 VAL B CG1   1 
ATOM   2740  C  CG2   . VAL B 1 116 ? 60.564  64.470  105.839 1.00 95.07  ? 384 VAL B CG2   1 
ATOM   2741  N  N     . GLY B 1 117 ? 59.109  62.306  102.153 1.00 96.56  ? 385 GLY B N     1 
ATOM   2742  C  CA    . GLY B 1 117 ? 58.380  61.850  100.987 1.00 96.56  ? 385 GLY B CA    1 
ATOM   2743  C  C     . GLY B 1 117 ? 57.977  60.384  100.993 1.00 96.56  ? 385 GLY B C     1 
ATOM   2744  O  O     . GLY B 1 117 ? 56.811  60.048  100.775 1.00 96.56  ? 385 GLY B O     1 
ATOM   2745  N  N     . PRO B 1 118 ? 58.925  59.475  101.252 1.00 96.98  ? 386 PRO B N     1 
ATOM   2746  C  CA    . PRO B 1 118 ? 58.542  58.076  101.470 1.00 96.98  ? 386 PRO B CA    1 
ATOM   2747  C  C     . PRO B 1 118 ? 58.036  57.783  102.872 1.00 96.98  ? 386 PRO B C     1 
ATOM   2748  O  O     . PRO B 1 118 ? 58.053  56.625  103.289 1.00 96.98  ? 386 PRO B O     1 
ATOM   2749  C  CB    . PRO B 1 118 ? 59.842  57.310  101.202 1.00 96.98  ? 386 PRO B CB    1 
ATOM   2750  C  CG    . PRO B 1 118 ? 60.649  58.210  100.383 1.00 96.98  ? 386 PRO B CG    1 
ATOM   2751  C  CD    . PRO B 1 118 ? 60.344  59.574  100.878 1.00 96.98  ? 386 PRO B CD    1 
ATOM   2752  N  N     . ALA B 1 119 ? 57.643  58.805  103.630 1.00 94.97  ? 387 ALA B N     1 
ATOM   2753  C  CA    . ALA B 1 119 ? 57.000  58.609  104.916 1.00 94.97  ? 387 ALA B CA    1 
ATOM   2754  C  C     . ALA B 1 119 ? 55.604  59.194  104.991 1.00 94.97  ? 387 ALA B C     1 
ATOM   2755  O  O     . ALA B 1 119 ? 54.807  58.727  105.810 1.00 94.97  ? 387 ALA B O     1 
ATOM   2756  C  CB    . ALA B 1 119 ? 57.840  59.220  106.047 1.00 94.97  ? 387 ALA B CB    1 
ATOM   2757  N  N     . ARG B 1 120 ? 55.289  60.203  104.181 1.00 93.27  ? 388 ARG B N     1 
ATOM   2758  C  CA    . ARG B 1 120 ? 53.924  60.706  104.135 1.00 93.27  ? 388 ARG B CA    1 
ATOM   2759  C  C     . ARG B 1 120 ? 52.989  59.724  103.449 1.00 93.27  ? 388 ARG B C     1 
ATOM   2760  O  O     . ARG B 1 120 ? 51.799  59.673  103.778 1.00 93.27  ? 388 ARG B O     1 
ATOM   2761  C  CB    . ARG B 1 120 ? 53.881  62.053  103.423 1.00 93.27  ? 388 ARG B CB    1 
ATOM   2762  C  CG    . ARG B 1 120 ? 54.452  63.190  104.231 1.00 93.27  ? 388 ARG B CG    1 
ATOM   2763  C  CD    . ARG B 1 120 ? 54.390  64.491  103.464 1.00 93.27  ? 388 ARG B CD    1 
ATOM   2764  N  NE    . ARG B 1 120 ? 54.902  65.601  104.259 1.00 93.27  ? 388 ARG B NE    1 
ATOM   2765  C  CZ    . ARG B 1 120 ? 55.015  66.843  103.809 1.00 93.27  ? 388 ARG B CZ    1 
ATOM   2766  N  NH1   . ARG B 1 120 ? 54.651  67.135  102.571 1.00 93.27  ? 388 ARG B NH1   1 
ATOM   2767  N  NH2   . ARG B 1 120 ? 55.481  67.795  104.599 1.00 93.27  ? 388 ARG B NH2   1 
ATOM   2768  N  N     . VAL B 1 121 ? 53.507  58.934  102.506 1.00 94.35  ? 389 VAL B N     1 
ATOM   2769  C  CA    . VAL B 1 121 ? 52.682  57.979  101.779 1.00 94.35  ? 389 VAL B CA    1 
ATOM   2770  C  C     . VAL B 1 121 ? 52.274  56.823  102.686 1.00 94.35  ? 389 VAL B C     1 
ATOM   2771  O  O     . VAL B 1 121 ? 51.226  56.202  102.465 1.00 94.35  ? 389 VAL B O     1 
ATOM   2772  C  CB    . VAL B 1 121 ? 53.445  57.536  100.515 1.00 94.35  ? 389 VAL B CB    1 
ATOM   2773  C  CG1   . VAL B 1 121 ? 52.612  56.640  99.623  1.00 94.35  ? 389 VAL B CG1   1 
ATOM   2774  C  CG2   . VAL B 1 121 ? 53.896  58.750  99.739  1.00 94.35  ? 389 VAL B CG2   1 
ATOM   2775  N  N     . ARG B 1 122 ? 53.059  56.542  103.729 1.00 96.94  ? 390 ARG B N     1 
ATOM   2776  C  CA    . ARG B 1 122 ? 52.575  55.707  104.824 1.00 96.94  ? 390 ARG B CA    1 
ATOM   2777  C  C     . ARG B 1 122 ? 51.365  56.344  105.487 1.00 96.94  ? 390 ARG B C     1 
ATOM   2778  O  O     . ARG B 1 122 ? 50.318  55.707  105.638 1.00 96.94  ? 390 ARG B O     1 
ATOM   2779  C  CB    . ARG B 1 122 ? 53.659  55.493  105.881 1.00 96.94  ? 390 ARG B CB    1 
ATOM   2780  C  CG    . ARG B 1 122 ? 54.690  54.412  105.639 1.00 96.94  ? 390 ARG B CG    1 
ATOM   2781  C  CD    . ARG B 1 122 ? 55.743  54.890  104.683 1.00 96.94  ? 390 ARG B CD    1 
ATOM   2782  N  NE    . ARG B 1 122 ? 56.919  54.033  104.649 1.00 96.94  ? 390 ARG B NE    1 
ATOM   2783  C  CZ    . ARG B 1 122 ? 57.981  54.219  105.424 1.00 96.94  ? 390 ARG B CZ    1 
ATOM   2784  N  NH1   . ARG B 1 122 ? 58.003  55.231  106.278 1.00 96.94  ? 390 ARG B NH1   1 
ATOM   2785  N  NH2   . ARG B 1 122 ? 59.020  53.401  105.342 1.00 96.94  ? 390 ARG B NH2   1 
ATOM   2786  N  N     . ASP B 1 123 ? 51.488  57.618  105.871 1.00 98.45  ? 391 ASP B N     1 
ATOM   2787  C  CA    . ASP B 1 123 ? 50.441  58.290  106.631 1.00 98.45  ? 391 ASP B CA    1 
ATOM   2788  C  C     . ASP B 1 123 ? 49.201  58.579  105.801 1.00 98.45  ? 391 ASP B C     1 
ATOM   2789  O  O     . ASP B 1 123 ? 48.112  58.705  106.370 1.00 98.45  ? 391 ASP B O     1 
ATOM   2790  C  CB    . ASP B 1 123 ? 50.975  59.587  107.232 1.00 98.45  ? 391 ASP B CB    1 
ATOM   2791  C  CG    . ASP B 1 123 ? 51.942  59.343  108.370 1.00 98.45  ? 391 ASP B CG    1 
ATOM   2792  O  OD1   . ASP B 1 123 ? 51.808  58.303  109.046 1.00 98.45  ? 391 ASP B OD1   1 
ATOM   2793  O  OD2   . ASP B 1 123 ? 52.833  60.188  108.593 1.00 98.45  ? 391 ASP B OD2   1 
ATOM   2794  N  N     . LEU B 1 124 ? 49.328  58.689  104.479 1.00 96.66  ? 392 LEU B N     1 
ATOM   2795  C  CA    . LEU B 1 124 ? 48.135  58.807  103.651 1.00 96.66  ? 392 LEU B CA    1 
ATOM   2796  C  C     . LEU B 1 124 ? 47.403  57.475  103.565 1.00 96.66  ? 392 LEU B C     1 
ATOM   2797  O  O     . LEU B 1 124 ? 46.182  57.412  103.739 1.00 96.66  ? 392 LEU B O     1 
ATOM   2798  C  CB    . LEU B 1 124 ? 48.498  59.313  102.258 1.00 96.66  ? 392 LEU B CB    1 
ATOM   2799  C  CG    . LEU B 1 124 ? 47.297  59.504  101.335 1.00 96.66  ? 392 LEU B CG    1 
ATOM   2800  C  CD1   . LEU B 1 124 ? 46.354  60.524  101.921 1.00 96.66  ? 392 LEU B CD1   1 
ATOM   2801  C  CD2   . LEU B 1 124 ? 47.741  59.924  99.956  1.00 96.66  ? 392 LEU B CD2   1 
ATOM   2802  N  N     . PHE B 1 125 ? 48.137  56.396  103.314 1.00 100.69 ? 393 PHE B N     1 
ATOM   2803  C  CA    . PHE B 1 125 ? 47.530  55.079  103.207 1.00 100.69 ? 393 PHE B CA    1 
ATOM   2804  C  C     . PHE B 1 125 ? 47.212  54.455  104.557 1.00 100.69 ? 393 PHE B C     1 
ATOM   2805  O  O     . PHE B 1 125 ? 46.495  53.452  104.596 1.00 100.69 ? 393 PHE B O     1 
ATOM   2806  C  CB    . PHE B 1 125 ? 48.440  54.154  102.401 1.00 100.69 ? 393 PHE B CB    1 
ATOM   2807  C  CG    . PHE B 1 125 ? 48.414  54.412  100.920 1.00 100.69 ? 393 PHE B CG    1 
ATOM   2808  C  CD1   . PHE B 1 125 ? 47.303  54.968  100.317 1.00 100.69 ? 393 PHE B CD1   1 
ATOM   2809  C  CD2   . PHE B 1 125 ? 49.523  54.152  100.141 1.00 100.69 ? 393 PHE B CD2   1 
ATOM   2810  C  CE1   . PHE B 1 125 ? 47.289  55.208  98.962  1.00 100.69 ? 393 PHE B CE1   1 
ATOM   2811  C  CE2   . PHE B 1 125 ? 49.510  54.398  98.793  1.00 100.69 ? 393 PHE B CE2   1 
ATOM   2812  C  CZ    . PHE B 1 125 ? 48.392  54.930  98.206  1.00 100.69 ? 393 PHE B CZ    1 
ATOM   2813  N  N     . ALA B 1 126 ? 47.727  55.003  105.656 1.00 100.75 ? 394 ALA B N     1 
ATOM   2814  C  CA    . ALA B 1 126 ? 47.237  54.586  106.962 1.00 100.75 ? 394 ALA B CA    1 
ATOM   2815  C  C     . ALA B 1 126 ? 45.997  55.357  107.368 1.00 100.75 ? 394 ALA B C     1 
ATOM   2816  O  O     . ALA B 1 126 ? 45.214  54.865  108.185 1.00 100.75 ? 394 ALA B O     1 
ATOM   2817  C  CB    . ALA B 1 126 ? 48.314  54.753  108.033 1.00 100.75 ? 394 ALA B CB    1 
ATOM   2818  N  N     . LEU B 1 127 ? 45.814  56.559  106.822 1.00 102.50 ? 395 LEU B N     1 
ATOM   2819  C  CA    . LEU B 1 127 ? 44.569  57.286  107.024 1.00 102.50 ? 395 LEU B CA    1 
ATOM   2820  C  C     . LEU B 1 127 ? 43.417  56.605  106.302 1.00 102.50 ? 395 LEU B C     1 
ATOM   2821  O  O     . LEU B 1 127 ? 42.276  56.645  106.774 1.00 102.50 ? 395 LEU B O     1 
ATOM   2822  C  CB    . LEU B 1 127 ? 44.729  58.724  106.540 1.00 102.50 ? 395 LEU B CB    1 
ATOM   2823  C  CG    . LEU B 1 127 ? 43.575  59.690  106.775 1.00 102.50 ? 395 LEU B CG    1 
ATOM   2824  C  CD1   . LEU B 1 127 ? 43.381  59.906  108.263 1.00 102.50 ? 395 LEU B CD1   1 
ATOM   2825  C  CD2   . LEU B 1 127 ? 43.838  60.995  106.052 1.00 102.50 ? 395 LEU B CD2   1 
ATOM   2826  N  N     . ALA B 1 128 ? 43.702  55.954  105.172 1.00 105.65 ? 396 ALA B N     1 
ATOM   2827  C  CA    . ALA B 1 128 ? 42.685  55.234  104.418 1.00 105.65 ? 396 ALA B CA    1 
ATOM   2828  C  C     . ALA B 1 128 ? 42.261  53.934  105.079 1.00 105.65 ? 396 ALA B C     1 
ATOM   2829  O  O     . ALA B 1 128 ? 41.263  53.348  104.656 1.00 105.65 ? 396 ALA B O     1 
ATOM   2830  C  CB    . ALA B 1 128 ? 43.190  54.940  103.008 1.00 105.65 ? 396 ALA B CB    1 
ATOM   2831  N  N     . ARG B 1 129 ? 42.995  53.455  106.079 1.00 106.39 ? 397 ARG B N     1 
ATOM   2832  C  CA    . ARG B 1 129 ? 42.555  52.287  106.826 1.00 106.39 ? 397 ARG B CA    1 
ATOM   2833  C  C     . ARG B 1 129 ? 41.638  52.652  107.982 1.00 106.39 ? 397 ARG B C     1 
ATOM   2834  O  O     . ARG B 1 129 ? 40.719  51.893  108.302 1.00 106.39 ? 397 ARG B O     1 
ATOM   2835  C  CB    . ARG B 1 129 ? 43.750  51.510  107.372 1.00 106.39 ? 397 ARG B CB    1 
ATOM   2836  C  CG    . ARG B 1 129 ? 44.563  50.768  106.348 1.00 106.39 ? 397 ARG B CG    1 
ATOM   2837  C  CD    . ARG B 1 129 ? 45.627  49.980  107.072 1.00 106.39 ? 397 ARG B CD    1 
ATOM   2838  N  NE    . ARG B 1 129 ? 46.438  49.177  106.173 1.00 106.39 ? 397 ARG B NE    1 
ATOM   2839  C  CZ    . ARG B 1 129 ? 47.572  49.592  105.629 1.00 106.39 ? 397 ARG B CZ    1 
ATOM   2840  N  NH1   . ARG B 1 129 ? 48.034  50.807  105.891 1.00 106.39 ? 397 ARG B NH1   1 
ATOM   2841  N  NH2   . ARG B 1 129 ? 48.245  48.786  104.827 1.00 106.39 ? 397 ARG B NH2   1 
ATOM   2842  N  N     . LYS B 1 130 ? 41.877  53.793  108.630 1.00 110.36 ? 398 LYS B N     1 
ATOM   2843  C  CA    . LYS B 1 130 ? 41.035  54.187  109.751 1.00 110.36 ? 398 LYS B CA    1 
ATOM   2844  C  C     . LYS B 1 130 ? 39.664  54.654  109.290 1.00 110.36 ? 398 LYS B C     1 
ATOM   2845  O  O     . LYS B 1 130 ? 38.725  54.679  110.091 1.00 110.36 ? 398 LYS B O     1 
ATOM   2846  C  CB    . LYS B 1 130 ? 41.734  55.269  110.572 1.00 110.36 ? 398 LYS B CB    1 
ATOM   2847  C  CG    . LYS B 1 130 ? 42.974  54.751  111.289 1.00 110.36 ? 398 LYS B CG    1 
ATOM   2848  C  CD    . LYS B 1 130 ? 43.664  55.824  112.115 1.00 110.36 ? 398 LYS B CD    1 
ATOM   2849  C  CE    . LYS B 1 130 ? 44.915  55.271  112.789 1.00 110.36 ? 398 LYS B CE    1 
ATOM   2850  N  NZ    . LYS B 1 130 ? 45.634  56.302  113.588 1.00 110.36 ? 398 LYS B NZ    1 
ATOM   2851  N  N     . ASN B 1 131 ? 39.533  55.016  108.021 1.00 111.24 ? 399 ASN B N     1 
ATOM   2852  C  CA    . ASN B 1 131 ? 38.250  55.183  107.353 1.00 111.24 ? 399 ASN B CA    1 
ATOM   2853  C  C     . ASN B 1 131 ? 38.295  54.165  106.222 1.00 111.24 ? 399 ASN B C     1 
ATOM   2854  O  O     . ASN B 1 131 ? 38.674  54.512  105.103 1.00 111.24 ? 399 ASN B O     1 
ATOM   2855  C  CB    . ASN B 1 131 ? 38.081  56.595  106.841 1.00 111.24 ? 399 ASN B CB    1 
ATOM   2856  C  CG    . ASN B 1 131 ? 38.225  57.626  107.933 1.00 111.24 ? 399 ASN B CG    1 
ATOM   2857  O  OD1   . ASN B 1 131 ? 39.144  58.442  107.912 1.00 111.24 ? 399 ASN B OD1   1 
ATOM   2858  N  ND2   . ASN B 1 131 ? 37.323  57.588  108.904 1.00 111.24 ? 399 ASN B ND2   1 
ATOM   2859  N  N     . ALA B 1 132 ? 37.910  52.910  106.512 1.00 115.63 ? 400 ALA B N     1 
ATOM   2860  C  CA    . ALA B 1 132 ? 38.402  51.805  105.687 1.00 115.63 ? 400 ALA B CA    1 
ATOM   2861  C  C     . ALA B 1 132 ? 37.731  51.720  104.315 1.00 115.63 ? 400 ALA B C     1 
ATOM   2862  O  O     . ALA B 1 132 ? 38.464  51.717  103.311 1.00 115.63 ? 400 ALA B O     1 
ATOM   2863  C  CB    . ALA B 1 132 ? 38.350  50.489  106.478 1.00 115.63 ? 400 ALA B CB    1 
ATOM   2864  N  N     . PRO B 1 133 ? 36.368  51.678  104.163 1.00 114.90 ? 401 PRO B N     1 
ATOM   2865  C  CA    . PRO B 1 133 ? 35.836  51.774  102.797 1.00 114.90 ? 401 PRO B CA    1 
ATOM   2866  C  C     . PRO B 1 133 ? 35.857  53.231  102.367 1.00 114.90 ? 401 PRO B C     1 
ATOM   2867  O  O     . PRO B 1 133 ? 35.063  54.041  102.852 1.00 114.90 ? 401 PRO B O     1 
ATOM   2868  C  CB    . PRO B 1 133 ? 34.403  51.240  102.941 1.00 114.90 ? 401 PRO B CB    1 
ATOM   2869  C  CG    . PRO B 1 133 ? 34.345  50.586  104.271 1.00 114.90 ? 401 PRO B CG    1 
ATOM   2870  C  CD    . PRO B 1 133 ? 35.254  51.423  105.097 1.00 114.90 ? 401 PRO B CD    1 
ATOM   2871  N  N     . CYS B 1 134 ? 36.784  53.579  101.476 1.00 111.39 ? 402 CYS B N     1 
ATOM   2872  C  CA    . CYS B 1 134 ? 36.957  54.988  101.158 1.00 111.39 ? 402 CYS B CA    1 
ATOM   2873  C  C     . CYS B 1 134 ? 37.465  55.180  99.739  1.00 111.39 ? 402 CYS B C     1 
ATOM   2874  O  O     . CYS B 1 134 ? 38.193  54.346  99.196  1.00 111.39 ? 402 CYS B O     1 
ATOM   2875  C  CB    . CYS B 1 134 ? 37.924  55.672  102.130 1.00 111.39 ? 402 CYS B CB    1 
ATOM   2876  S  SG    . CYS B 1 134 ? 39.624  55.081  102.035 1.00 111.39 ? 402 CYS B SG    1 
ATOM   2877  N  N     . ILE B 1 135 ? 37.054  56.296  99.150  1.00 103.81 ? 403 ILE B N     1 
ATOM   2878  C  CA    . ILE B 1 135 ? 37.671  56.822  97.943  1.00 103.81 ? 403 ILE B CA    1 
ATOM   2879  C  C     . ILE B 1 135 ? 38.898  57.616  98.366  1.00 103.81 ? 403 ILE B C     1 
ATOM   2880  O  O     . ILE B 1 135 ? 38.892  58.278  99.410  1.00 103.81 ? 403 ILE B O     1 
ATOM   2881  C  CB    . ILE B 1 135 ? 36.672  57.706  97.179  1.00 103.81 ? 403 ILE B CB    1 
ATOM   2882  C  CG1   . ILE B 1 135 ? 35.310  57.028  97.057  1.00 103.81 ? 403 ILE B CG1   1 
ATOM   2883  C  CG2   . ILE B 1 135 ? 37.187  58.043  95.794  1.00 103.81 ? 403 ILE B CG2   1 
ATOM   2884  C  CD1   . ILE B 1 135 ? 35.296  55.793  96.227  1.00 103.81 ? 403 ILE B CD1   1 
ATOM   2885  N  N     . LEU B 1 136 ? 39.961  57.551  97.573  1.00 94.67  ? 404 LEU B N     1 
ATOM   2886  C  CA    . LEU B 1 136 ? 41.201  58.260  97.874  1.00 94.67  ? 404 LEU B CA    1 
ATOM   2887  C  C     . LEU B 1 136 ? 41.768  58.812  96.578  1.00 94.67  ? 404 LEU B C     1 
ATOM   2888  O  O     . LEU B 1 136 ? 42.279  58.058  95.748  1.00 94.67  ? 404 LEU B O     1 
ATOM   2889  C  CB    . LEU B 1 136 ? 42.187  57.338  98.583  1.00 94.67  ? 404 LEU B CB    1 
ATOM   2890  C  CG    . LEU B 1 136 ? 43.657  57.680  98.782  1.00 94.67  ? 404 LEU B CG    1 
ATOM   2891  C  CD1   . LEU B 1 136 ? 43.898  59.071  99.338  1.00 94.67  ? 404 LEU B CD1   1 
ATOM   2892  C  CD2   . LEU B 1 136 ? 44.148  56.667  99.777  1.00 94.67  ? 404 LEU B CD2   1 
ATOM   2893  N  N     . PHE B 1 137 ? 41.690  60.125  96.419  1.00 87.25  ? 405 PHE B N     1 
ATOM   2894  C  CA    . PHE B 1 137 ? 41.985  60.785  95.159  1.00 87.25  ? 405 PHE B CA    1 
ATOM   2895  C  C     . PHE B 1 137 ? 43.290  61.554  95.268  1.00 87.25  ? 405 PHE B C     1 
ATOM   2896  O  O     . PHE B 1 137 ? 43.508  62.282  96.240  1.00 87.25  ? 405 PHE B O     1 
ATOM   2897  C  CB    . PHE B 1 137 ? 40.843  61.723  94.778  1.00 87.25  ? 405 PHE B CB    1 
ATOM   2898  C  CG    . PHE B 1 137 ? 40.998  62.356  93.441  1.00 87.25  ? 405 PHE B CG    1 
ATOM   2899  C  CD1   . PHE B 1 137 ? 40.860  61.608  92.292  1.00 87.25  ? 405 PHE B CD1   1 
ATOM   2900  C  CD2   . PHE B 1 137 ? 41.236  63.707  93.329  1.00 87.25  ? 405 PHE B CD2   1 
ATOM   2901  C  CE1   . PHE B 1 137 ? 40.984  62.191  91.052  1.00 87.25  ? 405 PHE B CE1   1 
ATOM   2902  C  CE2   . PHE B 1 137 ? 41.352  64.297  92.092  1.00 87.25  ? 405 PHE B CE2   1 
ATOM   2903  C  CZ    . PHE B 1 137 ? 41.232  63.538  90.954  1.00 87.25  ? 405 PHE B CZ    1 
ATOM   2904  N  N     . ILE B 1 138 ? 44.154  61.390  94.273  1.00 84.69  ? 406 ILE B N     1 
ATOM   2905  C  CA    . ILE B 1 138 ? 45.434  62.078  94.211  1.00 84.69  ? 406 ILE B CA    1 
ATOM   2906  C  C     . ILE B 1 138 ? 45.407  62.914  92.939  1.00 84.69  ? 406 ILE B C     1 
ATOM   2907  O  O     . ILE B 1 138 ? 45.671  62.403  91.845  1.00 84.69  ? 406 ILE B O     1 
ATOM   2908  C  CB    . ILE B 1 138 ? 46.616  61.104  94.216  1.00 84.69  ? 406 ILE B CB    1 
ATOM   2909  C  CG1   . ILE B 1 138 ? 46.586  60.236  95.467  1.00 84.69  ? 406 ILE B CG1   1 
ATOM   2910  C  CG2   . ILE B 1 138 ? 47.920  61.858  94.189  1.00 84.69  ? 406 ILE B CG2   1 
ATOM   2911  C  CD1   . ILE B 1 138 ? 47.570  59.108  95.432  1.00 84.69  ? 406 ILE B CD1   1 
ATOM   2912  N  N     . ASP B 1 139 ? 45.068  64.193  93.063  1.00 84.10  ? 407 ASP B N     1 
ATOM   2913  C  CA    . ASP B 1 139 ? 45.010  65.066  91.900  1.00 84.10  ? 407 ASP B CA    1 
ATOM   2914  C  C     . ASP B 1 139 ? 46.420  65.428  91.464  1.00 84.10  ? 407 ASP B C     1 
ATOM   2915  O  O     . ASP B 1 139 ? 47.302  65.627  92.303  1.00 84.10  ? 407 ASP B O     1 
ATOM   2916  C  CB    . ASP B 1 139 ? 44.225  66.337  92.215  1.00 84.10  ? 407 ASP B CB    1 
ATOM   2917  C  CG    . ASP B 1 139 ? 43.753  67.058  90.966  1.00 84.10  ? 407 ASP B CG    1 
ATOM   2918  O  OD1   . ASP B 1 139 ? 44.024  66.575  89.849  1.00 84.10  ? 407 ASP B OD1   1 
ATOM   2919  O  OD2   . ASP B 1 139 ? 43.101  68.113  91.101  1.00 84.10  ? 407 ASP B OD2   1 
ATOM   2920  N  N     . GLN B 1 140 ? 46.616  65.516  90.143  1.00 83.45  ? 408 GLN B N     1 
ATOM   2921  C  CA    . GLN B 1 140 ? 47.901  65.817  89.501  1.00 83.45  ? 408 GLN B CA    1 
ATOM   2922  C  C     . GLN B 1 140 ? 48.984  64.832  89.951  1.00 83.45  ? 408 GLN B C     1 
ATOM   2923  O  O     . GLN B 1 140 ? 49.954  65.196  90.615  1.00 83.45  ? 408 GLN B O     1 
ATOM   2924  C  CB    . GLN B 1 140 ? 48.332  67.268  89.755  1.00 83.45  ? 408 GLN B CB    1 
ATOM   2925  C  CG    . GLN B 1 140 ? 47.342  68.339  89.309  1.00 83.45  ? 408 GLN B CG    1 
ATOM   2926  C  CD    . GLN B 1 140 ? 47.121  68.381  87.814  1.00 83.45  ? 408 GLN B CD    1 
ATOM   2927  O  OE1   . GLN B 1 140 ? 48.029  68.119  87.030  1.00 83.45  ? 408 GLN B OE1   1 
ATOM   2928  N  NE2   . GLN B 1 140 ? 45.914  68.747  87.409  1.00 83.45  ? 408 GLN B NE2   1 
ATOM   2929  N  N     . ILE B 1 141 ? 48.782  63.559  89.597  1.00 84.91  ? 409 ILE B N     1 
ATOM   2930  C  CA    . ILE B 1 141 ? 49.661  62.490  90.064  1.00 84.91  ? 409 ILE B CA    1 
ATOM   2931  C  C     . ILE B 1 141 ? 51.009  62.498  89.358  1.00 84.91  ? 409 ILE B C     1 
ATOM   2932  O  O     . ILE B 1 141 ? 51.969  61.890  89.847  1.00 84.91  ? 409 ILE B O     1 
ATOM   2933  C  CB    . ILE B 1 141 ? 48.951  61.127  89.910  1.00 84.91  ? 409 ILE B CB    1 
ATOM   2934  C  CG1   . ILE B 1 141 ? 49.592  60.068  90.810  1.00 84.91  ? 409 ILE B CG1   1 
ATOM   2935  C  CG2   . ILE B 1 141 ? 48.967  60.675  88.470  1.00 84.91  ? 409 ILE B CG2   1 
ATOM   2936  C  CD1   . ILE B 1 141 ? 48.813  58.831  90.940  1.00 84.91  ? 409 ILE B CD1   1 
ATOM   2937  N  N     . ASP B 1 142 ? 51.143  63.250  88.262  1.00 87.14  ? 410 ASP B N     1 
ATOM   2938  C  CA    . ASP B 1 142 ? 52.418  63.364  87.564  1.00 87.14  ? 410 ASP B CA    1 
ATOM   2939  C  C     . ASP B 1 142 ? 53.480  64.125  88.353  1.00 87.14  ? 410 ASP B C     1 
ATOM   2940  O  O     . ASP B 1 142 ? 54.619  64.220  87.890  1.00 87.14  ? 410 ASP B O     1 
ATOM   2941  C  CB    . ASP B 1 142 ? 52.199  64.015  86.198  1.00 87.14  ? 410 ASP B CB    1 
ATOM   2942  C  CG    . ASP B 1 142 ? 51.502  65.356  86.285  1.00 87.14  ? 410 ASP B CG    1 
ATOM   2943  O  OD1   . ASP B 1 142 ? 51.098  65.773  87.389  1.00 87.14  ? 410 ASP B OD1   1 
ATOM   2944  O  OD2   . ASP B 1 142 ? 51.346  65.999  85.228  1.00 87.14  ? 410 ASP B OD2   1 
ATOM   2945  N  N     . ALA B 1 143 ? 53.132  64.680  89.512  1.00 84.92  ? 411 ALA B N     1 
ATOM   2946  C  CA    . ALA B 1 143 ? 54.123  65.212  90.429  1.00 84.92  ? 411 ALA B CA    1 
ATOM   2947  C  C     . ALA B 1 143 ? 54.880  64.113  91.160  1.00 84.92  ? 411 ALA B C     1 
ATOM   2948  O  O     . ALA B 1 143 ? 56.000  64.353  91.620  1.00 84.92  ? 411 ALA B O     1 
ATOM   2949  C  CB    . ALA B 1 143 ? 53.443  66.139  91.431  1.00 84.92  ? 411 ALA B CB    1 
ATOM   2950  N  N     . VAL B 1 144 ? 54.297  62.923  91.293  1.00 89.08  ? 412 VAL B N     1 
ATOM   2951  C  CA    . VAL B 1 144 ? 54.974  61.768  91.882  1.00 89.08  ? 412 VAL B CA    1 
ATOM   2952  C  C     . VAL B 1 144 ? 55.348  60.752  90.815  1.00 89.08  ? 412 VAL B C     1 
ATOM   2953  O  O     . VAL B 1 144 ? 56.516  60.383  90.682  1.00 89.08  ? 412 VAL B O     1 
ATOM   2954  C  CB    . VAL B 1 144 ? 54.120  61.118  92.992  1.00 89.08  ? 412 VAL B CB    1 
ATOM   2955  C  CG1   . VAL B 1 144 ? 54.740  59.813  93.431  1.00 89.08  ? 412 VAL B CG1   1 
ATOM   2956  C  CG2   . VAL B 1 144 ? 54.031  62.036  94.165  1.00 89.08  ? 412 VAL B CG2   1 
ATOM   2957  N  N     . GLY B 1 145 ? 54.367  60.276  90.052  1.00 92.67  ? 413 GLY B N     1 
ATOM   2958  C  CA    . GLY B 1 145 ? 54.646  59.323  89.001  1.00 92.67  ? 413 GLY B CA    1 
ATOM   2959  C  C     . GLY B 1 145 ? 55.409  59.953  87.859  1.00 92.67  ? 413 GLY B C     1 
ATOM   2960  O  O     . GLY B 1 145 ? 54.850  60.702  87.055  1.00 92.67  ? 413 GLY B O     1 
ATOM   2961  N  N     . ARG B 1 146 ? 56.702  59.656  87.790  1.00 99.64  ? 414 ARG B N     1 
ATOM   2962  C  CA    . ARG B 1 146 ? 57.581  60.187  86.763  1.00 99.64  ? 414 ARG B CA    1 
ATOM   2963  C  C     . ARG B 1 146 ? 58.526  59.083  86.322  1.00 99.64  ? 414 ARG B C     1 
ATOM   2964  O  O     . ARG B 1 146 ? 58.557  57.993  86.897  1.00 99.64  ? 414 ARG B O     1 
ATOM   2965  C  CB    . ARG B 1 146 ? 58.387  61.396  87.257  1.00 99.64  ? 414 ARG B CB    1 
ATOM   2966  C  CG    . ARG B 1 146 ? 57.571  62.646  87.524  1.00 99.64  ? 414 ARG B CG    1 
ATOM   2967  C  CD    . ARG B 1 146 ? 58.446  63.790  88.005  1.00 99.64  ? 414 ARG B CD    1 
ATOM   2968  N  NE    . ARG B 1 146 ? 59.364  64.239  86.964  1.00 99.64  ? 414 ARG B NE    1 
ATOM   2969  C  CZ    . ARG B 1 146 ? 59.061  65.148  86.043  1.00 99.64  ? 414 ARG B CZ    1 
ATOM   2970  N  NH1   . ARG B 1 146 ? 59.959  65.495  85.133  1.00 99.64  ? 414 ARG B NH1   1 
ATOM   2971  N  NH2   . ARG B 1 146 ? 57.861  65.710  86.030  1.00 99.64  ? 414 ARG B NH2   1 
ATOM   2972  N  N     . LYS B 1 147 ? 59.303  59.375  85.288  1.00 107.22 ? 415 LYS B N     1 
ATOM   2973  C  CA    . LYS B 1 147 ? 60.336  58.447  84.861  1.00 107.22 ? 415 LYS B CA    1 
ATOM   2974  C  C     . LYS B 1 147 ? 61.478  58.458  85.866  1.00 107.22 ? 415 LYS B C     1 
ATOM   2975  O  O     . LYS B 1 147 ? 62.009  59.519  86.208  1.00 107.22 ? 415 LYS B O     1 
ATOM   2976  C  CB    . LYS B 1 147 ? 60.837  58.820  83.471  1.00 107.22 ? 415 LYS B CB    1 
ATOM   2977  C  CG    . LYS B 1 147 ? 59.760  58.760  82.415  1.00 107.22 ? 415 LYS B CG    1 
ATOM   2978  C  CD    . LYS B 1 147 ? 59.329  57.329  82.172  1.00 107.22 ? 415 LYS B CD    1 
ATOM   2979  C  CE    . LYS B 1 147 ? 58.224  57.262  81.138  1.00 107.22 ? 415 LYS B CE    1 
ATOM   2980  N  NZ    . LYS B 1 147 ? 58.702  57.664  79.788  1.00 107.22 ? 415 LYS B NZ    1 
ATOM   2981  N  N     . ARG B 1 148 ? 61.845  57.277  86.350  1.00 113.88 ? 416 ARG B N     1 
ATOM   2982  C  CA    . ARG B 1 148 ? 62.907  57.171  87.333  1.00 113.88 ? 416 ARG B CA    1 
ATOM   2983  C  C     . ARG B 1 148 ? 64.266  57.418  86.683  1.00 113.88 ? 416 ARG B C     1 
ATOM   2984  O  O     . ARG B 1 148 ? 64.417  57.414  85.459  1.00 113.88 ? 416 ARG B O     1 
ATOM   2985  C  CB    . ARG B 1 148 ? 62.884  55.798  87.999  1.00 113.88 ? 416 ARG B CB    1 
ATOM   2986  C  CG    . ARG B 1 148 ? 61.688  55.560  88.899  1.00 113.88 ? 416 ARG B CG    1 
ATOM   2987  C  CD    . ARG B 1 148 ? 61.871  54.295  89.723  1.00 113.88 ? 416 ARG B CD    1 
ATOM   2988  N  NE    . ARG B 1 148 ? 61.891  53.091  88.902  1.00 113.88 ? 416 ARG B NE    1 
ATOM   2989  C  CZ    . ARG B 1 148 ? 60.817  52.361  88.629  1.00 113.88 ? 416 ARG B CZ    1 
ATOM   2990  N  NH1   . ARG B 1 148 ? 59.640  52.707  89.127  1.00 113.88 ? 416 ARG B NH1   1 
ATOM   2991  N  NH2   . ARG B 1 148 ? 60.921  51.280  87.871  1.00 113.88 ? 416 ARG B NH2   1 
ATOM   2992  N  N     . GLY B 1 149 ? 65.266  57.634  87.529  1.00 122.77 ? 417 GLY B N     1 
ATOM   2993  C  CA    . GLY B 1 149 ? 66.620  57.858  87.061  1.00 122.77 ? 417 GLY B CA    1 
ATOM   2994  C  C     . GLY B 1 149 ? 67.679  57.197  87.921  1.00 122.77 ? 417 GLY B C     1 
ATOM   2995  O  O     . GLY B 1 149 ? 67.558  56.027  88.287  1.00 122.77 ? 417 GLY B O     1 
ATOM   2996  N  N     . ASN B 1 152 ? 70.439  58.746  90.033  1.00 131.01 ? 420 ASN B N     1 
ATOM   2997  C  CA    . ASN B 1 152 ? 71.216  59.894  89.581  1.00 131.01 ? 420 ASN B CA    1 
ATOM   2998  C  C     . ASN B 1 152 ? 71.558  60.808  90.755  1.00 131.01 ? 420 ASN B C     1 
ATOM   2999  O  O     . ASN B 1 152 ? 72.170  60.376  91.731  1.00 131.01 ? 420 ASN B O     1 
ATOM   3000  C  CB    . ASN B 1 152 ? 70.452  60.669  88.503  1.00 131.01 ? 420 ASN B CB    1 
ATOM   3001  C  CG    . ASN B 1 152 ? 70.342  59.903  87.200  1.00 131.01 ? 420 ASN B CG    1 
ATOM   3002  O  OD1   . ASN B 1 152 ? 71.290  59.248  86.769  1.00 131.01 ? 420 ASN B OD1   1 
ATOM   3003  N  ND2   . ASN B 1 152 ? 69.186  59.994  86.557  1.00 131.01 ? 420 ASN B ND2   1 
ATOM   3004  N  N     . PHE B 1 153 ? 71.161  62.074  90.652  1.00 126.37 ? 421 PHE B N     1 
ATOM   3005  C  CA    . PHE B 1 153 ? 71.370  63.036  91.721  1.00 126.37 ? 421 PHE B CA    1 
ATOM   3006  C  C     . PHE B 1 153 ? 70.388  62.745  92.860  1.00 126.37 ? 421 PHE B C     1 
ATOM   3007  O  O     . PHE B 1 153 ? 69.372  62.069  92.678  1.00 126.37 ? 421 PHE B O     1 
ATOM   3008  C  CB    . PHE B 1 153 ? 71.239  64.457  91.166  1.00 126.37 ? 421 PHE B CB    1 
ATOM   3009  C  CG    . PHE B 1 153 ? 71.567  65.536  92.158  1.00 126.37 ? 421 PHE B CG    1 
ATOM   3010  C  CD1   . PHE B 1 153 ? 72.878  65.763  92.549  1.00 126.37 ? 421 PHE B CD1   1 
ATOM   3011  C  CD2   . PHE B 1 153 ? 70.564  66.323  92.699  1.00 126.37 ? 421 PHE B CD2   1 
ATOM   3012  C  CE1   . PHE B 1 153 ? 73.182  66.753  93.470  1.00 126.37 ? 421 PHE B CE1   1 
ATOM   3013  C  CE2   . PHE B 1 153 ? 70.858  67.311  93.620  1.00 126.37 ? 421 PHE B CE2   1 
ATOM   3014  C  CZ    . PHE B 1 153 ? 72.171  67.527  94.005  1.00 126.37 ? 421 PHE B CZ    1 
ATOM   3015  N  N     . GLY B 1 154 ? 70.707  63.242  94.061  1.00 127.70 ? 422 GLY B N     1 
ATOM   3016  C  CA    . GLY B 1 154 ? 69.889  62.956  95.229  1.00 127.70 ? 422 GLY B CA    1 
ATOM   3017  C  C     . GLY B 1 154 ? 68.517  63.604  95.201  1.00 127.70 ? 422 GLY B C     1 
ATOM   3018  O  O     . GLY B 1 154 ? 67.595  63.133  95.872  1.00 127.70 ? 422 GLY B O     1 
ATOM   3019  N  N     . GLY B 1 155 ? 68.361  64.687  94.435  1.00 123.96 ? 423 GLY B N     1 
ATOM   3020  C  CA    . GLY B 1 155 ? 67.047  65.275  94.256  1.00 123.96 ? 423 GLY B CA    1 
ATOM   3021  C  C     . GLY B 1 155 ? 66.138  64.438  93.385  1.00 123.96 ? 423 GLY B C     1 
ATOM   3022  O  O     . GLY B 1 155 ? 64.914  64.499  93.527  1.00 123.96 ? 423 GLY B O     1 
ATOM   3023  N  N     . GLN B 1 156 ? 66.715  63.651  92.479  1.00 123.10 ? 424 GLN B N     1 
ATOM   3024  C  CA    . GLN B 1 156 ? 65.944  62.730  91.655  1.00 123.10 ? 424 GLN B CA    1 
ATOM   3025  C  C     . GLN B 1 156 ? 65.748  61.387  92.344  1.00 123.10 ? 424 GLN B C     1 
ATOM   3026  O  O     . GLN B 1 156 ? 64.753  60.702  92.090  1.00 123.10 ? 424 GLN B O     1 
ATOM   3027  C  CB    . GLN B 1 156 ? 66.639  62.548  90.300  1.00 123.10 ? 424 GLN B CB    1 
ATOM   3028  C  CG    . GLN B 1 156 ? 65.836  61.805  89.246  1.00 123.10 ? 424 GLN B CG    1 
ATOM   3029  C  CD    . GLN B 1 156 ? 66.527  61.790  87.896  1.00 123.10 ? 424 GLN B CD    1 
ATOM   3030  O  OE1   . GLN B 1 156 ? 67.634  62.308  87.747  1.00 123.10 ? 424 GLN B OE1   1 
ATOM   3031  N  NE2   . GLN B 1 156 ? 65.872  61.205  86.899  1.00 123.10 ? 424 GLN B NE2   1 
ATOM   3032  N  N     . SER B 1 157 ? 66.662  61.013  93.239  1.00 117.42 ? 425 SER B N     1 
ATOM   3033  C  CA    . SER B 1 157 ? 66.495  59.806  94.035  1.00 117.42 ? 425 SER B CA    1 
ATOM   3034  C  C     . SER B 1 157 ? 65.439  59.955  95.120  1.00 117.42 ? 425 SER B C     1 
ATOM   3035  O  O     . SER B 1 157 ? 65.011  58.943  95.682  1.00 117.42 ? 425 SER B O     1 
ATOM   3036  C  CB    . SER B 1 157 ? 67.824  59.405  94.670  1.00 117.42 ? 425 SER B CB    1 
ATOM   3037  O  OG    . SER B 1 157 ? 67.668  58.262  95.490  1.00 117.42 ? 425 SER B OG    1 
ATOM   3038  N  N     . GLU B 1 158 ? 65.014  61.181  95.432  1.00 110.12 ? 426 GLU B N     1 
ATOM   3039  C  CA    . GLU B 1 158 ? 63.988  61.373  96.451  1.00 110.12 ? 426 GLU B CA    1 
ATOM   3040  C  C     . GLU B 1 158 ? 62.613  60.988  95.926  1.00 110.12 ? 426 GLU B C     1 
ATOM   3041  O  O     . GLU B 1 158 ? 61.859  60.277  96.598  1.00 110.12 ? 426 GLU B O     1 
ATOM   3042  C  CB    . GLU B 1 158 ? 63.990  62.819  96.937  1.00 110.12 ? 426 GLU B CB    1 
ATOM   3043  C  CG    . GLU B 1 158 ? 62.940  63.118  97.993  1.00 110.12 ? 426 GLU B CG    1 
ATOM   3044  C  CD    . GLU B 1 158 ? 63.190  62.407  99.309  1.00 110.12 ? 426 GLU B CD    1 
ATOM   3045  O  OE1   . GLU B 1 158 ? 64.361  62.113  99.627  1.00 110.12 ? 426 GLU B OE1   1 
ATOM   3046  O  OE2   . GLU B 1 158 ? 62.209  62.151  100.034 1.00 110.12 ? 426 GLU B OE2   1 
ATOM   3047  N  N     . GLN B 1 159 ? 62.266  61.444  94.722  1.00 107.75 ? 427 GLN B N     1 
ATOM   3048  C  CA    . GLN B 1 159 ? 61.000  61.042  94.128  1.00 107.75 ? 427 GLN B CA    1 
ATOM   3049  C  C     . GLN B 1 159 ? 61.048  59.630  93.565  1.00 107.75 ? 427 GLN B C     1 
ATOM   3050  O  O     . GLN B 1 159 ? 60.001  59.088  93.202  1.00 107.75 ? 427 GLN B O     1 
ATOM   3051  C  CB    . GLN B 1 159 ? 60.582  62.045  93.047  1.00 107.75 ? 427 GLN B CB    1 
ATOM   3052  C  CG    . GLN B 1 159 ? 61.473  62.124  91.826  1.00 107.75 ? 427 GLN B CG    1 
ATOM   3053  C  CD    . GLN B 1 159 ? 61.012  61.213  90.707  1.00 107.75 ? 427 GLN B CD    1 
ATOM   3054  O  OE1   . GLN B 1 159 ? 59.822  60.930  90.578  1.00 107.75 ? 427 GLN B OE1   1 
ATOM   3055  N  NE2   . GLN B 1 159 ? 61.953  60.747  89.895  1.00 107.75 ? 427 GLN B NE2   1 
ATOM   3056  N  N     . GLU B 1 160 ? 62.236  59.034  93.471  1.00 109.75 ? 428 GLU B N     1 
ATOM   3057  C  CA    . GLU B 1 160 ? 62.336  57.616  93.158  1.00 109.75 ? 428 GLU B CA    1 
ATOM   3058  C  C     . GLU B 1 160 ? 61.906  56.771  94.346  1.00 109.75 ? 428 GLU B C     1 
ATOM   3059  O  O     . GLU B 1 160 ? 61.152  55.806  94.191  1.00 109.75 ? 428 GLU B O     1 
ATOM   3060  C  CB    . GLU B 1 160 ? 63.765  57.276  92.742  1.00 109.75 ? 428 GLU B CB    1 
ATOM   3061  C  CG    . GLU B 1 160 ? 63.979  55.819  92.378  1.00 109.75 ? 428 GLU B CG    1 
ATOM   3062  C  CD    . GLU B 1 160 ? 65.396  55.533  91.914  1.00 109.75 ? 428 GLU B CD    1 
ATOM   3063  O  OE1   . GLU B 1 160 ? 66.218  56.473  91.890  1.00 109.75 ? 428 GLU B OE1   1 
ATOM   3064  O  OE2   . GLU B 1 160 ? 65.686  54.368  91.572  1.00 109.75 ? 428 GLU B OE2   1 
ATOM   3065  N  N     . ASN B 1 161 ? 62.368  57.123  95.545  1.00 106.17 ? 429 ASN B N     1 
ATOM   3066  C  CA    . ASN B 1 161 ? 61.943  56.392  96.731  1.00 106.17 ? 429 ASN B CA    1 
ATOM   3067  C  C     . ASN B 1 161 ? 60.519  56.732  97.135  1.00 106.17 ? 429 ASN B C     1 
ATOM   3068  O  O     . ASN B 1 161 ? 59.874  55.929  97.816  1.00 106.17 ? 429 ASN B O     1 
ATOM   3069  C  CB    . ASN B 1 161 ? 62.885  56.668  97.901  1.00 106.17 ? 429 ASN B CB    1 
ATOM   3070  C  CG    . ASN B 1 161 ? 64.252  56.065  97.704  1.00 106.17 ? 429 ASN B CG    1 
ATOM   3071  O  OD1   . ASN B 1 161 ? 65.248  56.777  97.591  1.00 106.17 ? 429 ASN B OD1   1 
ATOM   3072  N  ND2   . ASN B 1 161 ? 64.313  54.740  97.670  1.00 106.17 ? 429 ASN B ND2   1 
ATOM   3073  N  N     . THR B 1 162 ? 60.022  57.905  96.743  1.00 101.53 ? 430 THR B N     1 
ATOM   3074  C  CA    . THR B 1 162 ? 58.631  58.252  97.014  1.00 101.53 ? 430 THR B CA    1 
ATOM   3075  C  C     . THR B 1 162 ? 57.691  57.432  96.143  1.00 101.53 ? 430 THR B C     1 
ATOM   3076  O  O     . THR B 1 162 ? 56.698  56.880  96.630  1.00 101.53 ? 430 THR B O     1 
ATOM   3077  C  CB    . THR B 1 162 ? 58.417  59.749  96.791  1.00 101.53 ? 430 THR B CB    1 
ATOM   3078  O  OG1   . THR B 1 162 ? 59.228  60.489  97.709  1.00 101.53 ? 430 THR B OG1   1 
ATOM   3079  C  CG2   . THR B 1 162 ? 56.973  60.126  97.009  1.00 101.53 ? 430 THR B CG2   1 
ATOM   3080  N  N     . LEU B 1 163 ? 58.007  57.324  94.849  1.00 100.12 ? 431 LEU B N     1 
ATOM   3081  C  CA    . LEU B 1 163 ? 57.203  56.523  93.933  1.00 100.12 ? 431 LEU B CA    1 
ATOM   3082  C  C     . LEU B 1 163 ? 57.286  55.038  94.257  1.00 100.12 ? 431 LEU B C     1 
ATOM   3083  O  O     . LEU B 1 163 ? 56.298  54.315  94.087  1.00 100.12 ? 431 LEU B O     1 
ATOM   3084  C  CB    . LEU B 1 163 ? 57.647  56.784  92.497  1.00 100.12 ? 431 LEU B CB    1 
ATOM   3085  C  CG    . LEU B 1 163 ? 56.910  56.075  91.369  1.00 100.12 ? 431 LEU B CG    1 
ATOM   3086  C  CD1   . LEU B 1 163 ? 55.459  56.465  91.365  1.00 100.12 ? 431 LEU B CD1   1 
ATOM   3087  C  CD2   . LEU B 1 163 ? 57.552  56.430  90.058  1.00 100.12 ? 431 LEU B CD2   1 
ATOM   3088  N  N     . ASN B 1 164 ? 58.440  54.571  94.739  1.00 101.79 ? 432 ASN B N     1 
ATOM   3089  C  CA    . ASN B 1 164 ? 58.541  53.197  95.213  1.00 101.79 ? 432 ASN B CA    1 
ATOM   3090  C  C     . ASN B 1 164 ? 57.697  52.975  96.456  1.00 101.79 ? 432 ASN B C     1 
ATOM   3091  O  O     . ASN B 1 164 ? 57.172  51.877  96.651  1.00 101.79 ? 432 ASN B O     1 
ATOM   3092  C  CB    . ASN B 1 164 ? 59.995  52.835  95.503  1.00 101.79 ? 432 ASN B CB    1 
ATOM   3093  C  CG    . ASN B 1 164 ? 60.820  52.699  94.247  1.00 101.79 ? 432 ASN B CG    1 
ATOM   3094  O  OD1   . ASN B 1 164 ? 60.368  52.137  93.252  1.00 101.79 ? 432 ASN B OD1   1 
ATOM   3095  N  ND2   . ASN B 1 164 ? 62.041  53.212  94.286  1.00 101.79 ? 432 ASN B ND2   1 
ATOM   3096  N  N     . GLN B 1 165 ? 57.548  53.998  97.298  1.00 98.46  ? 433 GLN B N     1 
ATOM   3097  C  CA    . GLN B 1 165 ? 56.693  53.858  98.469  1.00 98.46  ? 433 GLN B CA    1 
ATOM   3098  C  C     . GLN B 1 165 ? 55.225  53.793  98.077  1.00 98.46  ? 433 GLN B C     1 
ATOM   3099  O  O     . GLN B 1 165 ? 54.439  53.099  98.733  1.00 98.46  ? 433 GLN B O     1 
ATOM   3100  C  CB    . GLN B 1 165 ? 56.956  55.004  99.442  1.00 98.46  ? 433 GLN B CB    1 
ATOM   3101  C  CG    . GLN B 1 165 ? 56.159  54.911  100.713 1.00 98.46  ? 433 GLN B CG    1 
ATOM   3102  C  CD    . GLN B 1 165 ? 56.442  53.638  101.457 1.00 98.46  ? 433 GLN B CD    1 
ATOM   3103  O  OE1   . GLN B 1 165 ? 57.594  53.248  101.631 1.00 98.46  ? 433 GLN B OE1   1 
ATOM   3104  N  NE2   . GLN B 1 165 ? 55.386  52.955  101.874 1.00 98.46  ? 433 GLN B NE2   1 
ATOM   3105  N  N     . LEU B 1 166 ? 54.850  54.465  96.989  1.00 100.56 ? 434 LEU B N     1 
ATOM   3106  C  CA    . LEU B 1 166 ? 53.485  54.366  96.487  1.00 100.56 ? 434 LEU B CA    1 
ATOM   3107  C  C     . LEU B 1 166 ? 53.193  52.966  95.965  1.00 100.56 ? 434 LEU B C     1 
ATOM   3108  O  O     . LEU B 1 166 ? 52.120  52.414  96.226  1.00 100.56 ? 434 LEU B O     1 
ATOM   3109  C  CB    . LEU B 1 166 ? 53.260  55.402  95.388  1.00 100.56 ? 434 LEU B CB    1 
ATOM   3110  C  CG    . LEU B 1 166 ? 51.856  55.526  94.808  1.00 100.56 ? 434 LEU B CG    1 
ATOM   3111  C  CD1   . LEU B 1 166 ? 50.915  56.007  95.870  1.00 100.56 ? 434 LEU B CD1   1 
ATOM   3112  C  CD2   . LEU B 1 166 ? 51.853  56.477  93.637  1.00 100.56 ? 434 LEU B CD2   1 
ATOM   3113  N  N     . LEU B 1 167 ? 54.157  52.364  95.262  1.00 102.77 ? 435 LEU B N     1 
ATOM   3114  C  CA    . LEU B 1 167 ? 53.951  51.059  94.641  1.00 102.77 ? 435 LEU B CA    1 
ATOM   3115  C  C     . LEU B 1 167 ? 53.925  49.932  95.661  1.00 102.77 ? 435 LEU B C     1 
ATOM   3116  O  O     . LEU B 1 167 ? 53.252  48.921  95.438  1.00 102.77 ? 435 LEU B O     1 
ATOM   3117  C  CB    . LEU B 1 167 ? 55.049  50.801  93.615  1.00 102.77 ? 435 LEU B CB    1 
ATOM   3118  C  CG    . LEU B 1 167 ? 55.014  51.737  92.415  1.00 102.77 ? 435 LEU B CG    1 
ATOM   3119  C  CD1   . LEU B 1 167 ? 56.268  51.595  91.590  1.00 102.77 ? 435 LEU B CD1   1 
ATOM   3120  C  CD2   . LEU B 1 167 ? 53.803  51.414  91.588  1.00 102.77 ? 435 LEU B CD2   1 
ATOM   3121  N  N     . VAL B 1 168 ? 54.656  50.073  96.767  1.00 104.33 ? 436 VAL B N     1 
ATOM   3122  C  CA    . VAL B 1 168 ? 54.705  49.010  97.766  1.00 104.33 ? 436 VAL B CA    1 
ATOM   3123  C  C     . VAL B 1 168 ? 53.375  48.903  98.498  1.00 104.33 ? 436 VAL B C     1 
ATOM   3124  O  O     . VAL B 1 168 ? 52.810  47.813  98.641  1.00 104.33 ? 436 VAL B O     1 
ATOM   3125  C  CB    . VAL B 1 168 ? 55.876  49.237  98.739  1.00 104.33 ? 436 VAL B CB    1 
ATOM   3126  C  CG1   . VAL B 1 168 ? 55.750  48.335  99.955  1.00 104.33 ? 436 VAL B CG1   1 
ATOM   3127  C  CG2   . VAL B 1 168 ? 57.188  48.939  98.040  1.00 104.33 ? 436 VAL B CG2   1 
ATOM   3128  N  N     . GLU B 1 169 ? 52.838  50.033  98.942  1.00 108.72 ? 437 GLU B N     1 
ATOM   3129  C  CA    . GLU B 1 169 ? 51.600  49.988  99.700  1.00 108.72 ? 437 GLU B CA    1 
ATOM   3130  C  C     . GLU B 1 169 ? 50.381  49.885  98.786  1.00 108.72 ? 437 GLU B C     1 
ATOM   3131  O  O     . GLU B 1 169 ? 49.294  49.523  99.252  1.00 108.72 ? 437 GLU B O     1 
ATOM   3132  C  CB    . GLU B 1 169 ? 51.534  51.209  100.630 1.00 108.72 ? 437 GLU B CB    1 
ATOM   3133  C  CG    . GLU B 1 169 ? 50.475  51.140  101.724 1.00 108.72 ? 437 GLU B CG    1 
ATOM   3134  C  CD    . GLU B 1 169 ? 50.715  50.015  102.702 1.00 108.72 ? 437 GLU B CD    1 
ATOM   3135  O  OE1   . GLU B 1 169 ? 51.887  49.685  102.976 1.00 108.72 ? 437 GLU B OE1   1 
ATOM   3136  O  OE2   . GLU B 1 169 ? 49.721  49.432  103.170 1.00 108.72 ? 437 GLU B OE2   1 
ATOM   3137  N  N     . MET B 1 170 ? 50.548  50.152  97.488  1.00 106.89 ? 438 MET B N     1 
ATOM   3138  C  CA    . MET B 1 170 ? 49.494  49.838  96.529  1.00 106.89 ? 438 MET B CA    1 
ATOM   3139  C  C     . MET B 1 170 ? 49.275  48.335  96.447  1.00 106.89 ? 438 MET B C     1 
ATOM   3140  O  O     . MET B 1 170 ? 48.135  47.857  96.471  1.00 106.89 ? 438 MET B O     1 
ATOM   3141  C  CB    . MET B 1 170 ? 49.854  50.382  95.151  1.00 106.89 ? 438 MET B CB    1 
ATOM   3142  C  CG    . MET B 1 170 ? 48.724  50.359  94.163  1.00 106.89 ? 438 MET B CG    1 
ATOM   3143  S  SD    . MET B 1 170 ? 47.522  51.574  94.667  1.00 106.89 ? 438 MET B SD    1 
ATOM   3144  C  CE    . MET B 1 170 ? 48.506  53.040  94.417  1.00 106.89 ? 438 MET B CE    1 
ATOM   3145  N  N     . ASP B 1 171 ? 50.364  47.573  96.365  1.00 111.30 ? 439 ASP B N     1 
ATOM   3146  C  CA    . ASP B 1 171 ? 50.272  46.122  96.340  1.00 111.30 ? 439 ASP B CA    1 
ATOM   3147  C  C     . ASP B 1 171 ? 49.947  45.546  97.707  1.00 111.30 ? 439 ASP B C     1 
ATOM   3148  O  O     . ASP B 1 171 ? 49.492  44.403  97.791  1.00 111.30 ? 439 ASP B O     1 
ATOM   3149  C  CB    . ASP B 1 171 ? 51.582  45.530  95.828  1.00 111.30 ? 439 ASP B CB    1 
ATOM   3150  C  CG    . ASP B 1 171 ? 51.842  45.866  94.377  1.00 111.30 ? 439 ASP B CG    1 
ATOM   3151  O  OD1   . ASP B 1 171 ? 50.864  46.030  93.619  1.00 111.30 ? 439 ASP B OD1   1 
ATOM   3152  O  OD2   . ASP B 1 171 ? 53.026  45.970  93.995  1.00 111.30 ? 439 ASP B OD2   1 
ATOM   3153  N  N     . GLY B 1 172 ? 50.155  46.310  98.773  1.00 115.92 ? 440 GLY B N     1 
ATOM   3154  C  CA    . GLY B 1 172 ? 49.954  45.806  100.114 1.00 115.92 ? 440 GLY B CA    1 
ATOM   3155  C  C     . GLY B 1 172 ? 48.532  45.900  100.627 1.00 115.92 ? 440 GLY B C     1 
ATOM   3156  O  O     . GLY B 1 172 ? 48.311  45.883  101.840 1.00 115.92 ? 440 GLY B O     1 
ATOM   3157  N  N     . PHE B 1 173 ? 47.558  45.999  99.725  1.00 120.52 ? 441 PHE B N     1 
ATOM   3158  C  CA    . PHE B 1 173 ? 46.153  46.027  100.102 1.00 120.52 ? 441 PHE B CA    1 
ATOM   3159  C  C     . PHE B 1 173 ? 45.504  44.650  100.035 1.00 120.52 ? 441 PHE B C     1 
ATOM   3160  O  O     . PHE B 1 173 ? 44.275  44.552  99.954  1.00 120.52 ? 441 PHE B O     1 
ATOM   3161  C  CB    . PHE B 1 173 ? 45.390  47.024  99.230  1.00 120.52 ? 441 PHE B CB    1 
ATOM   3162  C  CG    . PHE B 1 173 ? 45.650  48.459  99.583  1.00 120.52 ? 441 PHE B CG    1 
ATOM   3163  C  CD1   . PHE B 1 173 ? 46.174  48.804  100.821 1.00 120.52 ? 441 PHE B CD1   1 
ATOM   3164  C  CD2   . PHE B 1 173 ? 45.375  49.465  98.677  1.00 120.52 ? 441 PHE B CD2   1 
ATOM   3165  C  CE1   . PHE B 1 173 ? 46.411  50.128  101.145 1.00 120.52 ? 441 PHE B CE1   1 
ATOM   3166  C  CE2   . PHE B 1 173 ? 45.613  50.786  98.991  1.00 120.52 ? 441 PHE B CE2   1 
ATOM   3167  C  CZ    . PHE B 1 173 ? 46.130  51.118  100.226 1.00 120.52 ? 441 PHE B CZ    1 
ATOM   3168  N  N     . ASN B 1 174 ? 46.304  43.585  100.069 1.00 131.24 ? 442 ASN B N     1 
ATOM   3169  C  CA    . ASN B 1 174 ? 45.738  42.244  100.106 1.00 131.24 ? 442 ASN B CA    1 
ATOM   3170  C  C     . ASN B 1 174 ? 45.147  41.924  101.471 1.00 131.24 ? 442 ASN B C     1 
ATOM   3171  O  O     . ASN B 1 174 ? 44.209  41.124  101.565 1.00 131.24 ? 442 ASN B O     1 
ATOM   3172  C  CB    . ASN B 1 174 ? 46.800  41.212  99.737  1.00 131.24 ? 442 ASN B CB    1 
ATOM   3173  C  CG    . ASN B 1 174 ? 47.290  41.368  98.313  1.00 131.24 ? 442 ASN B CG    1 
ATOM   3174  O  OD1   . ASN B 1 174 ? 48.456  41.680  98.075  1.00 131.24 ? 442 ASN B OD1   1 
ATOM   3175  N  ND2   . ASN B 1 174 ? 46.398  41.148  97.355  1.00 131.24 ? 442 ASN B ND2   1 
ATOM   3176  N  N     . THR B 1 175 ? 45.687  42.526  102.535 1.00 137.65 ? 443 THR B N     1 
ATOM   3177  C  CA    . THR B 1 175 ? 45.149  42.295  103.872 1.00 137.65 ? 443 THR B CA    1 
ATOM   3178  C  C     . THR B 1 175 ? 43.789  42.961  104.032 1.00 137.65 ? 443 THR B C     1 
ATOM   3179  O  O     . THR B 1 175 ? 42.848  42.355  104.556 1.00 137.65 ? 443 THR B O     1 
ATOM   3180  C  CB    . THR B 1 175 ? 46.124  42.802  104.938 1.00 137.65 ? 443 THR B CB    1 
ATOM   3181  O  OG1   . THR B 1 175 ? 46.293  44.219  104.802 1.00 137.65 ? 443 THR B OG1   1 
ATOM   3182  C  CG2   . THR B 1 175 ? 47.477  42.122  104.794 1.00 137.65 ? 443 THR B CG2   1 
ATOM   3183  N  N     . THR B 1 176 ? 43.665  44.207  103.582 1.00 134.27 ? 444 THR B N     1 
ATOM   3184  C  CA    . THR B 1 176 ? 42.373  44.866  103.625 1.00 134.27 ? 444 THR B CA    1 
ATOM   3185  C  C     . THR B 1 176 ? 41.467  44.321  102.528 1.00 134.27 ? 444 THR B C     1 
ATOM   3186  O  O     . THR B 1 176 ? 41.914  43.704  101.556 1.00 134.27 ? 444 THR B O     1 
ATOM   3187  C  CB    . THR B 1 176 ? 42.512  46.385  103.486 1.00 134.27 ? 444 THR B CB    1 
ATOM   3188  O  OG1   . THR B 1 176 ? 41.230  46.999  103.663 1.00 134.27 ? 444 THR B OG1   1 
ATOM   3189  C  CG2   . THR B 1 176 ? 43.048  46.763  102.120 1.00 134.27 ? 444 THR B CG2   1 
ATOM   3190  N  N     . THR B 1 177 ? 40.171  44.543  102.709 1.00 132.19 ? 445 THR B N     1 
ATOM   3191  C  CA    . THR B 1 177 ? 39.181  44.065  101.760 1.00 132.19 ? 445 THR B CA    1 
ATOM   3192  C  C     . THR B 1 177 ? 38.740  45.132  100.774 1.00 132.19 ? 445 THR B C     1 
ATOM   3193  O  O     . THR B 1 177 ? 38.400  44.799  99.633  1.00 132.19 ? 445 THR B O     1 
ATOM   3194  C  CB    . THR B 1 177 ? 37.953  43.531  102.505 1.00 132.19 ? 445 THR B CB    1 
ATOM   3195  O  OG1   . THR B 1 177 ? 37.336  44.598  103.235 1.00 132.19 ? 445 THR B OG1   1 
ATOM   3196  C  CG2   . THR B 1 177 ? 38.365  42.437  103.478 1.00 132.19 ? 445 THR B CG2   1 
ATOM   3197  N  N     . ASN B 1 178 ? 38.746  46.404  101.173 1.00 125.66 ? 446 ASN B N     1 
ATOM   3198  C  CA    . ASN B 1 178 ? 38.131  47.435  100.339 1.00 125.66 ? 446 ASN B CA    1 
ATOM   3199  C  C     . ASN B 1 178 ? 38.832  48.782  100.547 1.00 125.66 ? 446 ASN B C     1 
ATOM   3200  O  O     . ASN B 1 178 ? 38.460  49.562  101.422 1.00 125.66 ? 446 ASN B O     1 
ATOM   3201  C  CB    . ASN B 1 178 ? 36.641  47.510  100.639 1.00 125.66 ? 446 ASN B CB    1 
ATOM   3202  C  CG    . ASN B 1 178 ? 36.342  47.495  102.131 1.00 125.66 ? 446 ASN B CG    1 
ATOM   3203  O  OD1   . ASN B 1 178 ? 37.252  47.452  102.959 1.00 125.66 ? 446 ASN B OD1   1 
ATOM   3204  N  ND2   . ASN B 1 178 ? 35.062  47.539  102.479 1.00 125.66 ? 446 ASN B ND2   1 
ATOM   3205  N  N     . VAL B 1 179 ? 39.826  49.060  99.702  1.00 119.36 ? 447 VAL B N     1 
ATOM   3206  C  CA    . VAL B 1 179 ? 40.409  50.396  99.571  1.00 119.36 ? 447 VAL B CA    1 
ATOM   3207  C  C     . VAL B 1 179 ? 40.592  50.666  98.085  1.00 119.36 ? 447 VAL B C     1 
ATOM   3208  O  O     . VAL B 1 179 ? 41.357  49.964  97.417  1.00 119.36 ? 447 VAL B O     1 
ATOM   3209  C  CB    . VAL B 1 179 ? 41.761  50.555  100.293 1.00 119.36 ? 447 VAL B CB    1 
ATOM   3210  C  CG1   . VAL B 1 179 ? 42.338  51.928  99.997  1.00 119.36 ? 447 VAL B CG1   1 
ATOM   3211  C  CG2   . VAL B 1 179 ? 41.633  50.371  101.798 1.00 119.36 ? 447 VAL B CG2   1 
ATOM   3212  N  N     . VAL B 1 180 ? 39.906  51.676  97.566  1.00 108.02 ? 448 VAL B N     1 
ATOM   3213  C  CA    . VAL B 1 180 ? 40.010  52.050  96.162  1.00 108.02 ? 448 VAL B CA    1 
ATOM   3214  C  C     . VAL B 1 180 ? 40.676  53.418  96.085  1.00 108.02 ? 448 VAL B C     1 
ATOM   3215  O  O     . VAL B 1 180 ? 40.485  54.268  96.963  1.00 108.02 ? 448 VAL B O     1 
ATOM   3216  C  CB    . VAL B 1 180 ? 38.626  52.013  95.475  1.00 108.02 ? 448 VAL B CB    1 
ATOM   3217  C  CG1   . VAL B 1 180 ? 37.672  52.992  96.101  1.00 108.02 ? 448 VAL B CG1   1 
ATOM   3218  C  CG2   . VAL B 1 180 ? 38.728  52.232  93.967  1.00 108.02 ? 448 VAL B CG2   1 
ATOM   3219  N  N     . ILE B 1 181 ? 41.516  53.606  95.074  1.00 99.03  ? 449 ILE B N     1 
ATOM   3220  C  CA    . ILE B 1 181 ? 42.317  54.812  94.941  1.00 99.03  ? 449 ILE B CA    1 
ATOM   3221  C  C     . ILE B 1 181 ? 42.171  55.360  93.526  1.00 99.03  ? 449 ILE B C     1 
ATOM   3222  O  O     . ILE B 1 181 ? 42.664  54.766  92.561  1.00 99.03  ? 449 ILE B O     1 
ATOM   3223  C  CB    . ILE B 1 181 ? 43.786  54.563  95.315  1.00 99.03  ? 449 ILE B CB    1 
ATOM   3224  C  CG1   . ILE B 1 181 ? 44.668  55.755  94.936  1.00 99.03  ? 449 ILE B CG1   1 
ATOM   3225  C  CG2   . ILE B 1 181 ? 44.270  53.195  94.850  1.00 99.03  ? 449 ILE B CG2   1 
ATOM   3226  C  CD1   . ILE B 1 181 ? 46.057  55.670  95.496  1.00 99.03  ? 449 ILE B CD1   1 
ATOM   3227  N  N     . LEU B 1 182 ? 41.466  56.475  93.402  1.00 92.00  ? 450 LEU B N     1 
ATOM   3228  C  CA    . LEU B 1 182 ? 41.413  57.188  92.145  1.00 92.00  ? 450 LEU B CA    1 
ATOM   3229  C  C     . LEU B 1 182 ? 42.657  58.044  91.975  1.00 92.00  ? 450 LEU B C     1 
ATOM   3230  O  O     . LEU B 1 182 ? 43.457  58.226  92.894  1.00 92.00  ? 450 LEU B O     1 
ATOM   3231  C  CB    . LEU B 1 182 ? 40.172  58.064  92.072  1.00 92.00  ? 450 LEU B CB    1 
ATOM   3232  C  CG    . LEU B 1 182 ? 38.850  57.335  91.935  1.00 92.00  ? 450 LEU B CG    1 
ATOM   3233  C  CD1   . LEU B 1 182 ? 37.715  58.321  92.026  1.00 92.00  ? 450 LEU B CD1   1 
ATOM   3234  C  CD2   . LEU B 1 182 ? 38.834  56.645  90.602  1.00 92.00  ? 450 LEU B CD2   1 
ATOM   3235  N  N     . ALA B 1 183 ? 42.800  58.586  90.774  1.00 88.21  ? 451 ALA B N     1 
ATOM   3236  C  CA    . ALA B 1 183 ? 43.923  59.437  90.432  1.00 88.21  ? 451 ALA B CA    1 
ATOM   3237  C  C     . ALA B 1 183 ? 43.531  60.254  89.218  1.00 88.21  ? 451 ALA B C     1 
ATOM   3238  O  O     . ALA B 1 183 ? 42.801  59.779  88.347  1.00 88.21  ? 451 ALA B O     1 
ATOM   3239  C  CB    . ALA B 1 183 ? 45.183  58.623  90.136  1.00 88.21  ? 451 ALA B CB    1 
ATOM   3240  N  N     . GLY B 1 184 ? 44.015  61.482  89.168  1.00 84.17  ? 452 GLY B N     1 
ATOM   3241  C  CA    . GLY B 1 184 ? 43.689  62.322  88.042  1.00 84.17  ? 452 GLY B CA    1 
ATOM   3242  C  C     . GLY B 1 184 ? 44.867  63.147  87.590  1.00 84.17  ? 452 GLY B C     1 
ATOM   3243  O  O     . GLY B 1 184 ? 45.486  63.843  88.396  1.00 84.17  ? 452 GLY B O     1 
ATOM   3244  N  N     . THR B 1 185 ? 45.194  63.066  86.305  1.00 84.81  ? 453 THR B N     1 
ATOM   3245  C  CA    . THR B 1 185 ? 46.250  63.882  85.735  1.00 84.81  ? 453 THR B CA    1 
ATOM   3246  C  C     . THR B 1 185 ? 45.942  64.127  84.270  1.00 84.81  ? 453 THR B C     1 
ATOM   3247  O  O     . THR B 1 185 ? 45.201  63.376  83.635  1.00 84.81  ? 453 THR B O     1 
ATOM   3248  C  CB    . THR B 1 185 ? 47.630  63.237  85.887  1.00 84.81  ? 453 THR B CB    1 
ATOM   3249  O  OG1   . THR B 1 185 ? 48.628  64.125  85.370  1.00 84.81  ? 453 THR B OG1   1 
ATOM   3250  C  CG2   . THR B 1 185 ? 47.700  61.919  85.145  1.00 84.81  ? 453 THR B CG2   1 
ATOM   3251  N  N     . ASN B 1 186 ? 46.506  65.204  83.746  1.00 86.95  ? 454 ASN B N     1 
ATOM   3252  C  CA    . ASN B 1 186 ? 46.343  65.555  82.348  1.00 86.95  ? 454 ASN B CA    1 
ATOM   3253  C  C     . ASN B 1 186 ? 47.547  65.167  81.506  1.00 86.95  ? 454 ASN B C     1 
ATOM   3254  O  O     . ASN B 1 186 ? 47.627  65.555  80.337  1.00 86.95  ? 454 ASN B O     1 
ATOM   3255  C  CB    . ASN B 1 186 ? 46.042  67.049  82.222  1.00 86.95  ? 454 ASN B CB    1 
ATOM   3256  C  CG    . ASN B 1 186 ? 47.007  67.904  83.005  1.00 86.95  ? 454 ASN B CG    1 
ATOM   3257  O  OD1   . ASN B 1 186 ? 47.943  67.402  83.625  1.00 86.95  ? 454 ASN B OD1   1 
ATOM   3258  N  ND2   . ASN B 1 186 ? 46.782  69.210  82.988  1.00 86.95  ? 454 ASN B ND2   1 
ATOM   3259  N  N     . ARG B 1 187 ? 48.486  64.412  82.075  1.00 91.32  ? 455 ARG B N     1 
ATOM   3260  C  CA    . ARG B 1 187 ? 49.677  63.960  81.358  1.00 91.32  ? 455 ARG B CA    1 
ATOM   3261  C  C     . ARG B 1 187 ? 49.944  62.504  81.703  1.00 91.32  ? 455 ARG B C     1 
ATOM   3262  O  O     . ARG B 1 187 ? 50.715  62.201  82.621  1.00 91.32  ? 455 ARG B O     1 
ATOM   3263  C  CB    . ARG B 1 187 ? 50.897  64.809  81.707  1.00 91.32  ? 455 ARG B CB    1 
ATOM   3264  C  CG    . ARG B 1 187 ? 50.822  66.259  81.301  1.00 91.32  ? 455 ARG B CG    1 
ATOM   3265  C  CD    . ARG B 1 187 ? 52.103  66.919  81.696  1.00 91.32  ? 455 ARG B CD    1 
ATOM   3266  N  NE    . ARG B 1 187 ? 53.187  66.399  80.883  1.00 91.32  ? 455 ARG B NE    1 
ATOM   3267  C  CZ    . ARG B 1 187 ? 54.469  66.520  81.188  1.00 91.32  ? 455 ARG B CZ    1 
ATOM   3268  N  NH1   . ARG B 1 187 ? 54.829  67.119  82.311  1.00 91.32  ? 455 ARG B NH1   1 
ATOM   3269  N  NH2   . ARG B 1 187 ? 55.386  66.012  80.382  1.00 91.32  ? 455 ARG B NH2   1 
ATOM   3270  N  N     . PRO B 1 188 ? 49.325  61.567  80.983  1.00 91.01  ? 456 PRO B N     1 
ATOM   3271  C  CA    . PRO B 1 188 ? 49.567  60.148  81.265  1.00 91.01  ? 456 PRO B CA    1 
ATOM   3272  C  C     . PRO B 1 188 ? 50.870  59.621  80.691  1.00 91.01  ? 456 PRO B C     1 
ATOM   3273  O  O     . PRO B 1 188 ? 51.295  58.525  81.081  1.00 91.01  ? 456 PRO B O     1 
ATOM   3274  C  CB    . PRO B 1 188 ? 48.370  59.463  80.606  1.00 91.01  ? 456 PRO B CB    1 
ATOM   3275  C  CG    . PRO B 1 188 ? 48.022  60.360  79.484  1.00 91.01  ? 456 PRO B CG    1 
ATOM   3276  C  CD    . PRO B 1 188 ? 48.292  61.753  79.952  1.00 91.01  ? 456 PRO B CD    1 
ATOM   3277  N  N     . ASP B 1 189 ? 51.515  60.359  79.789  1.00 94.85  ? 457 ASP B N     1 
ATOM   3278  C  CA    . ASP B 1 189 ? 52.713  59.862  79.121  1.00 94.85  ? 457 ASP B CA    1 
ATOM   3279  C  C     . ASP B 1 189 ? 53.929  59.891  80.035  1.00 94.85  ? 457 ASP B C     1 
ATOM   3280  O  O     . ASP B 1 189 ? 54.777  58.996  79.972  1.00 94.85  ? 457 ASP B O     1 
ATOM   3281  C  CB    . ASP B 1 189 ? 52.982  60.685  77.865  1.00 94.85  ? 457 ASP B CB    1 
ATOM   3282  C  CG    . ASP B 1 189 ? 51.924  60.487  76.806  1.00 94.85  ? 457 ASP B CG    1 
ATOM   3283  O  OD1   . ASP B 1 189 ? 51.338  59.386  76.753  1.00 94.85  ? 457 ASP B OD1   1 
ATOM   3284  O  OD2   . ASP B 1 189 ? 51.673  61.434  76.032  1.00 94.85  ? 457 ASP B OD2   1 
ATOM   3285  N  N     . ILE B 1 190 ? 54.025  60.905  80.897  1.00 95.25  ? 458 ILE B N     1 
ATOM   3286  C  CA    . ILE B 1 190 ? 55.166  61.044  81.794  1.00 95.25  ? 458 ILE B CA    1 
ATOM   3287  C  C     . ILE B 1 190 ? 55.107  60.056  82.952  1.00 95.25  ? 458 ILE B C     1 
ATOM   3288  O  O     . ILE B 1 190 ? 56.086  59.910  83.692  1.00 95.25  ? 458 ILE B O     1 
ATOM   3289  C  CB    . ILE B 1 190 ? 55.222  62.512  82.273  1.00 95.25  ? 458 ILE B CB    1 
ATOM   3290  C  CG1   . ILE B 1 190 ? 56.601  62.897  82.823  1.00 95.25  ? 458 ILE B CG1   1 
ATOM   3291  C  CG2   . ILE B 1 190 ? 54.156  62.769  83.305  1.00 95.25  ? 458 ILE B CG2   1 
ATOM   3292  C  CD1   . ILE B 1 190 ? 56.786  64.374  83.047  1.00 95.25  ? 458 ILE B CD1   1 
ATOM   3293  N  N     . LEU B 1 191 ? 53.994  59.348  83.115  1.00 95.59  ? 459 LEU B N     1 
ATOM   3294  C  CA    . LEU B 1 191 ? 53.856  58.417  84.222  1.00 95.59  ? 459 LEU B CA    1 
ATOM   3295  C  C     . LEU B 1 191 ? 54.742  57.191  84.041  1.00 95.59  ? 459 LEU B C     1 
ATOM   3296  O  O     . LEU B 1 191 ? 55.008  56.741  82.924  1.00 95.59  ? 459 LEU B O     1 
ATOM   3297  C  CB    . LEU B 1 191 ? 52.404  57.978  84.379  1.00 95.59  ? 459 LEU B CB    1 
ATOM   3298  C  CG    . LEU B 1 191 ? 51.445  59.030  84.923  1.00 95.59  ? 459 LEU B CG    1 
ATOM   3299  C  CD1   . LEU B 1 191 ? 50.031  58.507  84.899  1.00 95.59  ? 459 LEU B CD1   1 
ATOM   3300  C  CD2   . LEU B 1 191 ? 51.844  59.405  86.332  1.00 95.59  ? 459 LEU B CD2   1 
ATOM   3301  N  N     . ASP B 1 192 ? 55.206  56.671  85.166  1.00 103.10 ? 460 ASP B N     1 
ATOM   3302  C  CA    . ASP B 1 192 ? 56.047  55.485  85.185  1.00 103.10 ? 460 ASP B CA    1 
ATOM   3303  C  C     . ASP B 1 192 ? 55.210  54.268  84.814  1.00 103.10 ? 460 ASP B C     1 
ATOM   3304  O  O     . ASP B 1 192 ? 54.119  54.086  85.367  1.00 103.10 ? 460 ASP B O     1 
ATOM   3305  C  CB    . ASP B 1 192 ? 56.631  55.324  86.582  1.00 103.10 ? 460 ASP B CB    1 
ATOM   3306  C  CG    . ASP B 1 192 ? 57.780  54.344  86.646  1.00 103.10 ? 460 ASP B CG    1 
ATOM   3307  O  OD1   . ASP B 1 192 ? 58.185  53.786  85.615  1.00 103.10 ? 460 ASP B OD1   1 
ATOM   3308  O  OD2   . ASP B 1 192 ? 58.289  54.122  87.761  1.00 103.10 ? 460 ASP B OD2   1 
ATOM   3309  N  N     . PRO B 1 193 ? 55.670  53.416  83.890  1.00 105.17 ? 461 PRO B N     1 
ATOM   3310  C  CA    . PRO B 1 193 ? 54.928  52.179  83.592  1.00 105.17 ? 461 PRO B CA    1 
ATOM   3311  C  C     . PRO B 1 193 ? 54.893  51.165  84.722  1.00 105.17 ? 461 PRO B C     1 
ATOM   3312  O  O     . PRO B 1 193 ? 54.213  50.143  84.576  1.00 105.17 ? 461 PRO B O     1 
ATOM   3313  C  CB    . PRO B 1 193 ? 55.669  51.614  82.377  1.00 105.17 ? 461 PRO B CB    1 
ATOM   3314  C  CG    . PRO B 1 193 ? 56.252  52.800  81.723  1.00 105.17 ? 461 PRO B CG    1 
ATOM   3315  C  CD    . PRO B 1 193 ? 56.641  53.728  82.827  1.00 105.17 ? 461 PRO B CD    1 
ATOM   3316  N  N     . ALA B 1 194 ? 55.592  51.395  85.833  1.00 103.19 ? 462 ALA B N     1 
ATOM   3317  C  CA    . ALA B 1 194 ? 55.437  50.529  86.990  1.00 103.19 ? 462 ALA B CA    1 
ATOM   3318  C  C     . ALA B 1 194 ? 54.094  50.724  87.676  1.00 103.19 ? 462 ALA B C     1 
ATOM   3319  O  O     . ALA B 1 194 ? 53.634  49.818  88.377  1.00 103.19 ? 462 ALA B O     1 
ATOM   3320  C  CB    . ALA B 1 194 ? 56.574  50.773  87.978  1.00 103.19 ? 462 ALA B CB    1 
ATOM   3321  N  N     . LEU B 1 195 ? 53.457  51.883  87.490  1.00 101.84 ? 463 LEU B N     1 
ATOM   3322  C  CA    . LEU B 1 195 ? 52.133  52.118  88.052  1.00 101.84 ? 463 LEU B CA    1 
ATOM   3323  C  C     . LEU B 1 195 ? 51.049  51.323  87.345  1.00 101.84 ? 463 LEU B C     1 
ATOM   3324  O  O     . LEU B 1 195 ? 49.984  51.101  87.929  1.00 101.84 ? 463 LEU B O     1 
ATOM   3325  C  CB    . LEU B 1 195 ? 51.775  53.602  87.975  1.00 101.84 ? 463 LEU B CB    1 
ATOM   3326  C  CG    . LEU B 1 195 ? 52.486  54.620  88.858  1.00 101.84 ? 463 LEU B CG    1 
ATOM   3327  C  CD1   . LEU B 1 195 ? 52.107  56.015  88.423  1.00 101.84 ? 463 LEU B CD1   1 
ATOM   3328  C  CD2   . LEU B 1 195 ? 52.080  54.409  90.289  1.00 101.84 ? 463 LEU B CD2   1 
ATOM   3329  N  N     . LEU B 1 196 ? 51.291  50.888  86.112  1.00 100.61 ? 464 LEU B N     1 
ATOM   3330  C  CA    . LEU B 1 196 ? 50.236  50.398  85.239  1.00 100.61 ? 464 LEU B CA    1 
ATOM   3331  C  C     . LEU B 1 196 ? 50.170  48.878  85.172  1.00 100.61 ? 464 LEU B C     1 
ATOM   3332  O  O     . LEU B 1 196 ? 49.501  48.335  84.289  1.00 100.61 ? 464 LEU B O     1 
ATOM   3333  C  CB    . LEU B 1 196 ? 50.424  50.986  83.844  1.00 100.61 ? 464 LEU B CB    1 
ATOM   3334  C  CG    . LEU B 1 196 ? 50.440  52.515  83.872  1.00 100.61 ? 464 LEU B CG    1 
ATOM   3335  C  CD1   . LEU B 1 196 ? 50.723  53.086  82.496  1.00 100.61 ? 464 LEU B CD1   1 
ATOM   3336  C  CD2   . LEU B 1 196 ? 49.146  53.062  84.435  1.00 100.61 ? 464 LEU B CD2   1 
ATOM   3337  N  N     . ARG B 1 197 ? 50.830  48.184  86.086  1.00 101.55 ? 465 ARG B N     1 
ATOM   3338  C  CA    . ARG B 1 197 ? 50.784  46.735  86.129  1.00 101.55 ? 465 ARG B CA    1 
ATOM   3339  C  C     . ARG B 1 197 ? 49.468  46.264  86.742  1.00 101.55 ? 465 ARG B C     1 
ATOM   3340  O  O     . ARG B 1 197 ? 48.746  47.054  87.353  1.00 101.55 ? 465 ARG B O     1 
ATOM   3341  C  CB    . ARG B 1 197 ? 51.977  46.211  86.924  1.00 101.55 ? 465 ARG B CB    1 
ATOM   3342  C  CG    . ARG B 1 197 ? 53.302  46.436  86.228  1.00 101.55 ? 465 ARG B CG    1 
ATOM   3343  C  CD    . ARG B 1 197 ? 54.454  45.861  87.022  1.00 101.55 ? 465 ARG B CD    1 
ATOM   3344  N  NE    . ARG B 1 197 ? 55.736  46.143  86.386  1.00 101.55 ? 465 ARG B NE    1 
ATOM   3345  C  CZ    . ARG B 1 197 ? 56.306  45.361  85.476  1.00 101.55 ? 465 ARG B CZ    1 
ATOM   3346  N  NH1   . ARG B 1 197 ? 55.709  44.241  85.094  1.00 101.55 ? 465 ARG B NH1   1 
ATOM   3347  N  NH2   . ARG B 1 197 ? 57.476  45.697  84.949  1.00 101.55 ? 465 ARG B NH2   1 
ATOM   3348  N  N     . PRO B 1 198 ? 49.104  44.991  86.551  1.00 103.33 ? 466 PRO B N     1 
ATOM   3349  C  CA    . PRO B 1 198 ? 47.968  44.438  87.298  1.00 103.33 ? 466 PRO B CA    1 
ATOM   3350  C  C     . PRO B 1 198 ? 48.216  44.425  88.800  1.00 103.33 ? 466 PRO B C     1 
ATOM   3351  O  O     . PRO B 1 198 ? 49.351  44.315  89.267  1.00 103.33 ? 466 PRO B O     1 
ATOM   3352  C  CB    . PRO B 1 198 ? 47.835  43.019  86.738  1.00 103.33 ? 466 PRO B CB    1 
ATOM   3353  C  CG    . PRO B 1 198 ? 48.353  43.133  85.356  1.00 103.33 ? 466 PRO B CG    1 
ATOM   3354  C  CD    . PRO B 1 198 ? 49.481  44.115  85.425  1.00 103.33 ? 466 PRO B CD    1 
ATOM   3355  N  N     . GLY B 1 199 ? 47.126  44.544  89.558  1.00 104.15 ? 467 GLY B N     1 
ATOM   3356  C  CA    . GLY B 1 199 ? 47.203  44.746  90.991  1.00 104.15 ? 467 GLY B CA    1 
ATOM   3357  C  C     . GLY B 1 199 ? 47.453  46.177  91.402  1.00 104.15 ? 467 GLY B C     1 
ATOM   3358  O  O     . GLY B 1 199 ? 47.673  46.440  92.589  1.00 104.15 ? 467 GLY B O     1 
ATOM   3359  N  N     . ARG B 1 200 ? 47.424  47.104  90.450  1.00 104.23 ? 468 ARG B N     1 
ATOM   3360  C  CA    . ARG B 1 200 ? 47.795  48.505  90.608  1.00 104.23 ? 468 ARG B CA    1 
ATOM   3361  C  C     . ARG B 1 200 ? 46.801  49.325  89.803  1.00 104.23 ? 468 ARG B C     1 
ATOM   3362  O  O     . ARG B 1 200 ? 45.658  48.894  89.624  1.00 104.23 ? 468 ARG B O     1 
ATOM   3363  C  CB    . ARG B 1 200 ? 49.236  48.765  90.166  1.00 104.23 ? 468 ARG B CB    1 
ATOM   3364  C  CG    . ARG B 1 200 ? 50.260  48.186  91.121  1.00 104.23 ? 468 ARG B CG    1 
ATOM   3365  C  CD    . ARG B 1 200 ? 51.676  48.383  90.658  1.00 104.23 ? 468 ARG B CD    1 
ATOM   3366  N  NE    . ARG B 1 200 ? 52.614  47.734  91.566  1.00 104.23 ? 468 ARG B NE    1 
ATOM   3367  C  CZ    . ARG B 1 200 ? 53.923  47.678  91.366  1.00 104.23 ? 468 ARG B CZ    1 
ATOM   3368  N  NH1   . ARG B 1 200 ? 54.452  48.234  90.288  1.00 104.23 ? 468 ARG B NH1   1 
ATOM   3369  N  NH2   . ARG B 1 200 ? 54.702  47.065  92.244  1.00 104.23 ? 468 ARG B NH2   1 
ATOM   3370  N  N     . PHE B 1 201 ? 47.195  50.516  89.360  1.00 101.09 ? 469 PHE B N     1 
ATOM   3371  C  CA    . PHE B 1 201 ? 46.290  51.363  88.594  1.00 101.09 ? 469 PHE B CA    1 
ATOM   3372  C  C     . PHE B 1 201 ? 45.991  50.736  87.241  1.00 101.09 ? 469 PHE B C     1 
ATOM   3373  O  O     . PHE B 1 201 ? 46.630  51.055  86.235  1.00 101.09 ? 469 PHE B O     1 
ATOM   3374  C  CB    . PHE B 1 201 ? 46.903  52.746  88.397  1.00 101.09 ? 469 PHE B CB    1 
ATOM   3375  C  CG    . PHE B 1 201 ? 46.937  53.580  89.637  1.00 101.09 ? 469 PHE B CG    1 
ATOM   3376  C  CD1   . PHE B 1 201 ? 46.104  53.301  90.705  1.00 101.09 ? 469 PHE B CD1   1 
ATOM   3377  C  CD2   . PHE B 1 201 ? 47.814  54.637  89.740  1.00 101.09 ? 469 PHE B CD2   1 
ATOM   3378  C  CE1   . PHE B 1 201 ? 46.143  54.073  91.840  1.00 101.09 ? 469 PHE B CE1   1 
ATOM   3379  C  CE2   . PHE B 1 201 ? 47.858  55.404  90.872  1.00 101.09 ? 469 PHE B CE2   1 
ATOM   3380  C  CZ    . PHE B 1 201 ? 47.021  55.129  91.920  1.00 101.09 ? 469 PHE B CZ    1 
ATOM   3381  N  N     . ASP B 1 202 ? 45.002  49.842  87.223  1.00 106.89 ? 470 ASP B N     1 
ATOM   3382  C  CA    . ASP B 1 202 ? 44.752  48.997  86.063  1.00 106.89 ? 470 ASP B CA    1 
ATOM   3383  C  C     . ASP B 1 202 ? 44.078  49.774  84.946  1.00 106.89 ? 470 ASP B C     1 
ATOM   3384  O  O     . ASP B 1 202 ? 44.619  49.897  83.843  1.00 106.89 ? 470 ASP B O     1 
ATOM   3385  C  CB    . ASP B 1 202 ? 43.884  47.805  86.465  1.00 106.89 ? 470 ASP B CB    1 
ATOM   3386  C  CG    . ASP B 1 202 ? 44.570  46.904  87.456  1.00 106.89 ? 470 ASP B CG    1 
ATOM   3387  O  OD1   . ASP B 1 202 ? 45.814  46.897  87.476  1.00 106.89 ? 470 ASP B OD1   1 
ATOM   3388  O  OD2   . ASP B 1 202 ? 43.869  46.204  88.213  1.00 106.89 ? 470 ASP B OD2   1 
ATOM   3389  N  N     . ARG B 1 203 ? 42.892  50.297  85.218  1.00 111.50 ? 471 ARG B N     1 
ATOM   3390  C  CA    . ARG B 1 203 ? 42.116  50.990  84.212  1.00 111.50 ? 471 ARG B CA    1 
ATOM   3391  C  C     . ARG B 1 203 ? 42.676  52.388  83.997  1.00 111.50 ? 471 ARG B C     1 
ATOM   3392  O  O     . ARG B 1 203 ? 43.344  52.957  84.860  1.00 111.50 ? 471 ARG B O     1 
ATOM   3393  C  CB    . ARG B 1 203 ? 40.656  51.062  84.645  1.00 111.50 ? 471 ARG B CB    1 
ATOM   3394  C  CG    . ARG B 1 203 ? 40.054  49.703  84.934  1.00 111.50 ? 471 ARG B CG    1 
ATOM   3395  C  CD    . ARG B 1 203 ? 38.627  49.825  85.412  1.00 111.50 ? 471 ARG B CD    1 
ATOM   3396  N  NE    . ARG B 1 203 ? 37.743  50.283  84.349  1.00 111.50 ? 471 ARG B NE    1 
ATOM   3397  C  CZ    . ARG B 1 203 ? 37.126  49.467  83.503  1.00 111.50 ? 471 ARG B CZ    1 
ATOM   3398  N  NH1   . ARG B 1 203 ? 37.294  48.158  83.600  1.00 111.50 ? 471 ARG B NH1   1 
ATOM   3399  N  NH2   . ARG B 1 203 ? 36.345  49.958  82.558  1.00 111.50 ? 471 ARG B NH2   1 
ATOM   3400  N  N     . GLN B 1 204 ? 42.423  52.933  82.815  1.00 101.65 ? 472 GLN B N     1 
ATOM   3401  C  CA    . GLN B 1 204 ? 42.741  54.326  82.520  1.00 101.65 ? 472 GLN B CA    1 
ATOM   3402  C  C     . GLN B 1 204 ? 41.478  54.943  81.944  1.00 101.65 ? 472 GLN B C     1 
ATOM   3403  O  O     . GLN B 1 204 ? 41.235  54.872  80.738  1.00 101.65 ? 472 GLN B O     1 
ATOM   3404  C  CB    . GLN B 1 204 ? 43.909  54.462  81.566  1.00 101.65 ? 472 GLN B CB    1 
ATOM   3405  C  CG    . GLN B 1 204 ? 45.243  54.097  82.154  1.00 101.65 ? 472 GLN B CG    1 
ATOM   3406  C  CD    . GLN B 1 204 ? 46.359  54.293  81.158  1.00 101.65 ? 472 GLN B CD    1 
ATOM   3407  O  OE1   . GLN B 1 204 ? 46.117  54.641  80.005  1.00 101.65 ? 472 GLN B OE1   1 
ATOM   3408  N  NE2   . GLN B 1 204 ? 47.587  54.075  81.595  1.00 101.65 ? 472 GLN B NE2   1 
ATOM   3409  N  N     . ILE B 1 205 ? 40.674  55.541  82.812  1.00 98.09  ? 473 ILE B N     1 
ATOM   3410  C  CA    . ILE B 1 205 ? 39.459  56.202  82.373  1.00 98.09  ? 473 ILE B CA    1 
ATOM   3411  C  C     . ILE B 1 205 ? 39.849  57.501  81.688  1.00 98.09  ? 473 ILE B C     1 
ATOM   3412  O  O     . ILE B 1 205 ? 40.219  58.479  82.346  1.00 98.09  ? 473 ILE B O     1 
ATOM   3413  C  CB    . ILE B 1 205 ? 38.506  56.445  83.550  1.00 98.09  ? 473 ILE B CB    1 
ATOM   3414  C  CG1   . ILE B 1 205 ? 38.130  55.118  84.191  1.00 98.09  ? 473 ILE B CG1   1 
ATOM   3415  C  CG2   . ILE B 1 205 ? 37.264  57.144  83.080  1.00 98.09  ? 473 ILE B CG2   1 
ATOM   3416  C  CD1   . ILE B 1 205 ? 37.387  55.266  85.477  1.00 98.09  ? 473 ILE B CD1   1 
ATOM   3417  N  N     . PHE B 1 206 ? 39.802  57.511  80.362  1.00 94.74  ? 474 PHE B N     1 
ATOM   3418  C  CA    . PHE B 1 206 ? 40.115  58.712  79.602  1.00 94.74  ? 474 PHE B CA    1 
ATOM   3419  C  C     . PHE B 1 206 ? 38.885  59.604  79.571  1.00 94.74  ? 474 PHE B C     1 
ATOM   3420  O  O     . PHE B 1 206 ? 37.884  59.273  78.931  1.00 94.74  ? 474 PHE B O     1 
ATOM   3421  C  CB    . PHE B 1 206 ? 40.565  58.364  78.190  1.00 94.74  ? 474 PHE B CB    1 
ATOM   3422  C  CG    . PHE B 1 206 ? 40.913  59.562  77.367  1.00 94.74  ? 474 PHE B CG    1 
ATOM   3423  C  CD1   . PHE B 1 206 ? 42.102  60.235  77.575  1.00 94.74  ? 474 PHE B CD1   1 
ATOM   3424  C  CD2   . PHE B 1 206 ? 40.045  60.023  76.397  1.00 94.74  ? 474 PHE B CD2   1 
ATOM   3425  C  CE1   . PHE B 1 206 ? 42.422  61.342  76.826  1.00 94.74  ? 474 PHE B CE1   1 
ATOM   3426  C  CE2   . PHE B 1 206 ? 40.356  61.130  75.647  1.00 94.74  ? 474 PHE B CE2   1 
ATOM   3427  C  CZ    . PHE B 1 206 ? 41.546  61.792  75.860  1.00 94.74  ? 474 PHE B CZ    1 
ATOM   3428  N  N     . ILE B 1 207 ? 38.958  60.733  80.260  1.00 88.87  ? 475 ILE B N     1 
ATOM   3429  C  CA    . ILE B 1 207 ? 37.887  61.719  80.280  1.00 88.87  ? 475 ILE B CA    1 
ATOM   3430  C  C     . ILE B 1 207 ? 38.257  62.775  79.247  1.00 88.87  ? 475 ILE B C     1 
ATOM   3431  O  O     . ILE B 1 207 ? 39.101  63.635  79.498  1.00 88.87  ? 475 ILE B O     1 
ATOM   3432  C  CB    . ILE B 1 207 ? 37.704  62.319  81.673  1.00 88.87  ? 475 ILE B CB    1 
ATOM   3433  C  CG1   . ILE B 1 207 ? 37.341  61.234  82.676  1.00 88.87  ? 475 ILE B CG1   1 
ATOM   3434  C  CG2   . ILE B 1 207 ? 36.603  63.324  81.670  1.00 88.87  ? 475 ILE B CG2   1 
ATOM   3435  C  CD1   . ILE B 1 207 ? 37.377  61.716  84.093  1.00 88.87  ? 475 ILE B CD1   1 
ATOM   3436  N  N     . GLY B 1 208 ? 37.644  62.699  78.070  1.00 88.43  ? 476 GLY B N     1 
ATOM   3437  C  CA    . GLY B 1 208 ? 37.991  63.573  76.974  1.00 88.43  ? 476 GLY B CA    1 
ATOM   3438  C  C     . GLY B 1 208 ? 36.942  64.632  76.718  1.00 88.43  ? 476 GLY B C     1 
ATOM   3439  O  O     . GLY B 1 208 ? 35.868  64.622  77.327  1.00 88.43  ? 476 GLY B O     1 
ATOM   3440  N  N     . PRO B 1 209 ? 37.242  65.576  75.825  1.00 86.23  ? 477 PRO B N     1 
ATOM   3441  C  CA    . PRO B 1 209 ? 36.308  66.670  75.541  1.00 86.23  ? 477 PRO B CA    1 
ATOM   3442  C  C     . PRO B 1 209 ? 35.060  66.152  74.858  1.00 86.23  ? 477 PRO B C     1 
ATOM   3443  O  O     . PRO B 1 209 ? 35.135  65.270  73.990  1.00 86.23  ? 477 PRO B O     1 
ATOM   3444  C  CB    . PRO B 1 209 ? 37.105  67.583  74.601  1.00 86.23  ? 477 PRO B CB    1 
ATOM   3445  C  CG    . PRO B 1 209 ? 38.512  67.226  74.827  1.00 86.23  ? 477 PRO B CG    1 
ATOM   3446  C  CD    . PRO B 1 209 ? 38.512  65.758  75.113  1.00 86.23  ? 477 PRO B CD    1 
ATOM   3447  N  N     . PRO B 1 210 ? 33.896  66.664  75.228  1.00 92.12  ? 478 PRO B N     1 
ATOM   3448  C  CA    . PRO B 1 210 ? 32.647  66.066  74.768  1.00 92.12  ? 478 PRO B CA    1 
ATOM   3449  C  C     . PRO B 1 210 ? 32.321  66.475  73.345  1.00 92.12  ? 478 PRO B C     1 
ATOM   3450  O  O     . PRO B 1 210 ? 32.815  67.472  72.821  1.00 92.12  ? 478 PRO B O     1 
ATOM   3451  C  CB    . PRO B 1 210 ? 31.616  66.635  75.741  1.00 92.12  ? 478 PRO B CB    1 
ATOM   3452  C  CG    . PRO B 1 210 ? 32.173  67.953  76.090  1.00 92.12  ? 478 PRO B CG    1 
ATOM   3453  C  CD    . PRO B 1 210 ? 33.657  67.802  76.129  1.00 92.12  ? 478 PRO B CD    1 
ATOM   3454  N  N     . ASP B 1 211 ? 31.477  65.666  72.719  1.00 104.24 ? 479 ASP B N     1 
ATOM   3455  C  CA    . ASP B 1 211 ? 30.833  66.066  71.480  1.00 104.24 ? 479 ASP B CA    1 
ATOM   3456  C  C     . ASP B 1 211 ? 29.603  66.900  71.828  1.00 104.24 ? 479 ASP B C     1 
ATOM   3457  O  O     . ASP B 1 211 ? 29.349  67.214  72.993  1.00 104.24 ? 479 ASP B O     1 
ATOM   3458  C  CB    . ASP B 1 211 ? 30.506  64.846  70.626  1.00 104.24 ? 479 ASP B CB    1 
ATOM   3459  C  CG    . ASP B 1 211 ? 29.666  63.820  71.360  1.00 104.24 ? 479 ASP B CG    1 
ATOM   3460  O  OD1   . ASP B 1 211 ? 29.474  63.942  72.589  1.00 104.24 ? 479 ASP B OD1   1 
ATOM   3461  O  OD2   . ASP B 1 211 ? 29.177  62.889  70.693  1.00 104.24 ? 479 ASP B OD2   1 
ATOM   3462  N  N     . ILE B 1 212 ? 28.798  67.240  70.825  1.00 103.82 ? 480 ILE B N     1 
ATOM   3463  C  CA    . ILE B 1 212 ? 27.736  68.210  71.050  1.00 103.82 ? 480 ILE B CA    1 
ATOM   3464  C  C     . ILE B 1 212 ? 26.544  67.603  71.790  1.00 103.82 ? 480 ILE B C     1 
ATOM   3465  O  O     . ILE B 1 212 ? 25.761  68.345  72.397  1.00 103.82 ? 480 ILE B O     1 
ATOM   3466  C  CB    . ILE B 1 212 ? 27.351  68.834  69.699  1.00 103.82 ? 480 ILE B CB    1 
ATOM   3467  C  CG1   . ILE B 1 212 ? 26.590  70.137  69.891  1.00 103.82 ? 480 ILE B CG1   1 
ATOM   3468  C  CG2   . ILE B 1 212 ? 26.547  67.868  68.853  1.00 103.82 ? 480 ILE B CG2   1 
ATOM   3469  C  CD1   . ILE B 1 212 ? 26.430  70.889  68.635  1.00 103.82 ? 480 ILE B CD1   1 
ATOM   3470  N  N     . LYS B 1 213 ? 26.403  66.273  71.790  1.00 110.73 ? 481 LYS B N     1 
ATOM   3471  C  CA    . LYS B 1 213 ? 25.395  65.633  72.631  1.00 110.73 ? 481 LYS B CA    1 
ATOM   3472  C  C     . LYS B 1 213 ? 25.714  65.840  74.102  1.00 110.73 ? 481 LYS B C     1 
ATOM   3473  O  O     . LYS B 1 213 ? 24.884  66.341  74.867  1.00 110.73 ? 481 LYS B O     1 
ATOM   3474  C  CB    . LYS B 1 213 ? 25.314  64.136  72.335  1.00 110.73 ? 481 LYS B CB    1 
ATOM   3475  C  CG    . LYS B 1 213 ? 24.746  63.745  70.992  1.00 110.73 ? 481 LYS B CG    1 
ATOM   3476  C  CD    . LYS B 1 213 ? 24.712  62.225  70.881  1.00 110.73 ? 481 LYS B CD    1 
ATOM   3477  C  CE    . LYS B 1 213 ? 24.202  61.763  69.531  1.00 110.73 ? 481 LYS B CE    1 
ATOM   3478  N  NZ    . LYS B 1 213 ? 24.181  60.281  69.431  1.00 110.73 ? 481 LYS B NZ    1 
ATOM   3479  N  N     . GLY B 1 214 ? 26.928  65.470  74.508  1.00 100.26 ? 482 GLY B N     1 
ATOM   3480  C  CA    . GLY B 1 214 ? 27.340  65.634  75.884  1.00 100.26 ? 482 GLY B CA    1 
ATOM   3481  C  C     . GLY B 1 214 ? 27.558  67.070  76.292  1.00 100.26 ? 482 GLY B C     1 
ATOM   3482  O  O     . GLY B 1 214 ? 27.480  67.378  77.483  1.00 100.26 ? 482 GLY B O     1 
ATOM   3483  N  N     . ARG B 1 215 ? 27.812  67.961  75.335  1.00 92.34  ? 483 ARG B N     1 
ATOM   3484  C  CA    . ARG B 1 215 ? 28.087  69.345  75.695  1.00 92.34  ? 483 ARG B CA    1 
ATOM   3485  C  C     . ARG B 1 215 ? 26.818  70.098  76.050  1.00 92.34  ? 483 ARG B C     1 
ATOM   3486  O  O     . ARG B 1 215 ? 26.846  70.968  76.926  1.00 92.34  ? 483 ARG B O     1 
ATOM   3487  C  CB    . ARG B 1 215 ? 28.803  70.061  74.556  1.00 92.34  ? 483 ARG B CB    1 
ATOM   3488  C  CG    . ARG B 1 215 ? 29.390  71.389  74.960  1.00 92.34  ? 483 ARG B CG    1 
ATOM   3489  C  CD    . ARG B 1 215 ? 30.026  72.088  73.800  1.00 92.34  ? 483 ARG B CD    1 
ATOM   3490  N  NE    . ARG B 1 215 ? 31.101  71.306  73.212  1.00 92.34  ? 483 ARG B NE    1 
ATOM   3491  C  CZ    . ARG B 1 215 ? 31.084  70.850  71.966  1.00 92.34  ? 483 ARG B CZ    1 
ATOM   3492  N  NH1   . ARG B 1 215 ? 30.051  71.111  71.180  1.00 92.34  ? 483 ARG B NH1   1 
ATOM   3493  N  NH2   . ARG B 1 215 ? 32.102  70.139  71.504  1.00 92.34  ? 483 ARG B NH2   1 
ATOM   3494  N  N     . ALA B 1 216 ? 25.703  69.780  75.388  1.00 92.39  ? 484 ALA B N     1 
ATOM   3495  C  CA    . ALA B 1 216 ? 24.427  70.386  75.746  1.00 92.39  ? 484 ALA B CA    1 
ATOM   3496  C  C     . ALA B 1 216 ? 23.982  69.968  77.137  1.00 92.39  ? 484 ALA B C     1 
ATOM   3497  O  O     . ALA B 1 216 ? 23.298  70.731  77.822  1.00 92.39  ? 484 ALA B O     1 
ATOM   3498  C  CB    . ALA B 1 216 ? 23.362  70.022  74.717  1.00 92.39  ? 484 ALA B CB    1 
ATOM   3499  N  N     . SER B 1 217 ? 24.365  68.770  77.574  1.00 92.64  ? 485 SER B N     1 
ATOM   3500  C  CA    . SER B 1 217 ? 24.115  68.375  78.950  1.00 92.64  ? 485 SER B CA    1 
ATOM   3501  C  C     . SER B 1 217 ? 25.002  69.124  79.931  1.00 92.64  ? 485 SER B C     1 
ATOM   3502  O  O     . SER B 1 217 ? 24.652  69.220  81.109  1.00 92.64  ? 485 SER B O     1 
ATOM   3503  C  CB    . SER B 1 217 ? 24.317  66.870  79.113  1.00 92.64  ? 485 SER B CB    1 
ATOM   3504  O  OG    . SER B 1 217 ? 23.378  66.144  78.341  1.00 92.64  ? 485 SER B OG    1 
ATOM   3505  N  N     . ILE B 1 218 ? 26.137  69.654  79.479  1.00 87.37  ? 486 ILE B N     1 
ATOM   3506  C  CA    . ILE B 1 218 ? 26.965  70.453  80.372  1.00 87.37  ? 486 ILE B CA    1 
ATOM   3507  C  C     . ILE B 1 218 ? 26.360  71.839  80.556  1.00 87.37  ? 486 ILE B C     1 
ATOM   3508  O  O     . ILE B 1 218 ? 26.395  72.399  81.657  1.00 87.37  ? 486 ILE B O     1 
ATOM   3509  C  CB    . ILE B 1 218 ? 28.412  70.514  79.850  1.00 87.37  ? 486 ILE B CB    1 
ATOM   3510  C  CG1   . ILE B 1 218 ? 29.008  69.119  79.784  1.00 87.37  ? 486 ILE B CG1   1 
ATOM   3511  C  CG2   . ILE B 1 218 ? 29.293  71.280  80.782  1.00 87.37  ? 486 ILE B CG2   1 
ATOM   3512  C  CD1   . ILE B 1 218 ? 30.340  69.059  79.105  1.00 87.37  ? 486 ILE B CD1   1 
ATOM   3513  N  N     . PHE B 1 219 ? 25.767  72.401  79.495  1.00 85.48  ? 487 PHE B N     1 
ATOM   3514  C  CA    . PHE B 1 219 ? 25.081  73.685  79.626  1.00 85.48  ? 487 PHE B CA    1 
ATOM   3515  C  C     . PHE B 1 219 ? 23.857  73.600  80.528  1.00 85.48  ? 487 PHE B C     1 
ATOM   3516  O  O     . PHE B 1 219 ? 23.531  74.577  81.204  1.00 85.48  ? 487 PHE B O     1 
ATOM   3517  C  CB    . PHE B 1 219 ? 24.658  74.230  78.265  1.00 85.48  ? 487 PHE B CB    1 
ATOM   3518  C  CG    . PHE B 1 219 ? 25.748  74.915  77.509  1.00 85.48  ? 487 PHE B CG    1 
ATOM   3519  C  CD1   . PHE B 1 219 ? 26.127  76.200  77.848  1.00 85.48  ? 487 PHE B CD1   1 
ATOM   3520  C  CD2   . PHE B 1 219 ? 26.354  74.307  76.428  1.00 85.48  ? 487 PHE B CD2   1 
ATOM   3521  C  CE1   . PHE B 1 219 ? 27.117  76.849  77.151  1.00 85.48  ? 487 PHE B CE1   1 
ATOM   3522  C  CE2   . PHE B 1 219 ? 27.341  74.951  75.722  1.00 85.48  ? 487 PHE B CE2   1 
ATOM   3523  C  CZ    . PHE B 1 219 ? 27.725  76.221  76.086  1.00 85.48  ? 487 PHE B CZ    1 
ATOM   3524  N  N     . LYS B 1 220 ? 23.180  72.449  80.568  1.00 85.53  ? 488 LYS B N     1 
ATOM   3525  C  CA    . LYS B 1 220 ? 22.015  72.296  81.434  1.00 85.53  ? 488 LYS B CA    1 
ATOM   3526  C  C     . LYS B 1 220 ? 22.377  72.318  82.910  1.00 85.53  ? 488 LYS B C     1 
ATOM   3527  O  O     . LYS B 1 220 ? 21.505  72.573  83.745  1.00 85.53  ? 488 LYS B O     1 
ATOM   3528  C  CB    . LYS B 1 220 ? 21.290  70.993  81.118  1.00 85.53  ? 488 LYS B CB    1 
ATOM   3529  C  CG    . LYS B 1 220 ? 20.643  70.957  79.757  1.00 85.53  ? 488 LYS B CG    1 
ATOM   3530  C  CD    . LYS B 1 220 ? 20.005  69.607  79.500  1.00 85.53  ? 488 LYS B CD    1 
ATOM   3531  C  CE    . LYS B 1 220 ? 19.444  69.523  78.095  1.00 85.53  ? 488 LYS B CE    1 
ATOM   3532  N  NZ    . LYS B 1 220 ? 18.865  68.184  77.813  1.00 85.53  ? 488 LYS B NZ    1 
ATOM   3533  N  N     . VAL B 1 221 ? 23.632  72.041  83.253  1.00 83.48  ? 489 VAL B N     1 
ATOM   3534  C  CA    . VAL B 1 221 ? 24.057  72.157  84.638  1.00 83.48  ? 489 VAL B CA    1 
ATOM   3535  C  C     . VAL B 1 221 ? 24.264  73.617  85.000  1.00 83.48  ? 489 VAL B C     1 
ATOM   3536  O  O     . VAL B 1 221 ? 23.960  74.044  86.118  1.00 83.48  ? 489 VAL B O     1 
ATOM   3537  C  CB    . VAL B 1 221 ? 25.331  71.323  84.859  1.00 83.48  ? 489 VAL B CB    1 
ATOM   3538  C  CG1   . VAL B 1 221 ? 25.782  71.373  86.306  1.00 83.48  ? 489 VAL B CG1   1 
ATOM   3539  C  CG2   . VAL B 1 221 ? 25.097  69.904  84.431  1.00 83.48  ? 489 VAL B CG2   1 
ATOM   3540  N  N     . HIS B 1 222 ? 24.743  74.416  84.052  1.00 81.41  ? 490 HIS B N     1 
ATOM   3541  C  CA    . HIS B 1 222 ? 25.152  75.777  84.345  1.00 81.41  ? 490 HIS B CA    1 
ATOM   3542  C  C     . HIS B 1 222 ? 24.200  76.838  83.823  1.00 81.41  ? 490 HIS B C     1 
ATOM   3543  O  O     . HIS B 1 222 ? 24.400  78.019  84.117  1.00 81.41  ? 490 HIS B O     1 
ATOM   3544  C  CB    . HIS B 1 222 ? 26.560  76.014  83.802  1.00 81.41  ? 490 HIS B CB    1 
ATOM   3545  C  CG    . HIS B 1 222 ? 27.589  75.170  84.473  1.00 81.41  ? 490 HIS B CG    1 
ATOM   3546  N  ND1   . HIS B 1 222 ? 28.020  75.415  85.757  1.00 81.41  ? 490 HIS B ND1   1 
ATOM   3547  C  CD2   . HIS B 1 222 ? 28.248  74.066  84.058  1.00 81.41  ? 490 HIS B CD2   1 
ATOM   3548  C  CE1   . HIS B 1 222 ? 28.912  74.506  86.100  1.00 81.41  ? 490 HIS B CE1   1 
ATOM   3549  N  NE2   . HIS B 1 222 ? 29.065  73.674  85.087  1.00 81.41  ? 490 HIS B NE2   1 
ATOM   3550  N  N     . LEU B 1 223 ? 23.171  76.458  83.071  1.00 81.33  ? 491 LEU B N     1 
ATOM   3551  C  CA    . LEU B 1 223 ? 22.009  77.319  82.938  1.00 81.33  ? 491 LEU B CA    1 
ATOM   3552  C  C     . LEU B 1 223 ? 21.092  77.222  84.144  1.00 81.33  ? 491 LEU B C     1 
ATOM   3553  O  O     . LEU B 1 223 ? 20.147  78.006  84.251  1.00 81.33  ? 491 LEU B O     1 
ATOM   3554  C  CB    . LEU B 1 223 ? 21.221  76.971  81.680  1.00 81.33  ? 491 LEU B CB    1 
ATOM   3555  C  CG    . LEU B 1 223 ? 21.900  77.276  80.356  1.00 81.33  ? 491 LEU B CG    1 
ATOM   3556  C  CD1   . LEU B 1 223 ? 21.049  76.801  79.207  1.00 81.33  ? 491 LEU B CD1   1 
ATOM   3557  C  CD2   . LEU B 1 223 ? 22.146  78.746  80.254  1.00 81.33  ? 491 LEU B CD2   1 
ATOM   3558  N  N     . ARG B 1 224 ? 21.367  76.291  85.054  1.00 84.51  ? 492 ARG B N     1 
ATOM   3559  C  CA    . ARG B 1 224 ? 20.451  76.036  86.164  1.00 84.51  ? 492 ARG B CA    1 
ATOM   3560  C  C     . ARG B 1 224 ? 20.455  77.126  87.239  1.00 84.51  ? 492 ARG B C     1 
ATOM   3561  O  O     . ARG B 1 224 ? 19.356  77.546  87.640  1.00 84.51  ? 492 ARG B O     1 
ATOM   3562  C  CB    . ARG B 1 224 ? 20.720  74.635  86.727  1.00 84.51  ? 492 ARG B CB    1 
ATOM   3563  C  CG    . ARG B 1 224 ? 19.744  74.149  87.763  1.00 84.51  ? 492 ARG B CG    1 
ATOM   3564  C  CD    . ARG B 1 224 ? 20.096  72.726  88.153  1.00 84.51  ? 492 ARG B CD    1 
ATOM   3565  N  NE    . ARG B 1 224 ? 21.373  72.657  88.854  1.00 84.51  ? 492 ARG B NE    1 
ATOM   3566  C  CZ    . ARG B 1 224 ? 22.034  71.530  89.095  1.00 84.51  ? 492 ARG B CZ    1 
ATOM   3567  N  NH1   . ARG B 1 224 ? 21.549  70.370  88.677  1.00 84.51  ? 492 ARG B NH1   1 
ATOM   3568  N  NH2   . ARG B 1 224 ? 23.189  71.564  89.745  1.00 84.51  ? 492 ARG B NH2   1 
ATOM   3569  N  N     . PRO B 1 225 ? 21.585  77.636  87.746  1.00 79.50  ? 493 PRO B N     1 
ATOM   3570  C  CA    . PRO B 1 225 ? 21.485  78.695  88.758  1.00 79.50  ? 493 PRO B CA    1 
ATOM   3571  C  C     . PRO B 1 225 ? 21.316  80.103  88.207  1.00 79.50  ? 493 PRO B C     1 
ATOM   3572  O  O     . PRO B 1 225 ? 21.512  81.059  88.960  1.00 79.50  ? 493 PRO B O     1 
ATOM   3573  C  CB    . PRO B 1 225 ? 22.818  78.580  89.511  1.00 79.50  ? 493 PRO B CB    1 
ATOM   3574  C  CG    . PRO B 1 225 ? 23.740  78.145  88.520  1.00 79.50  ? 493 PRO B CG    1 
ATOM   3575  C  CD    . PRO B 1 225 ? 22.997  77.197  87.645  1.00 79.50  ? 493 PRO B CD    1 
ATOM   3576  N  N     . LEU B 1 226 ? 20.963  80.279  86.940  1.00 80.87  ? 494 LEU B N     1 
ATOM   3577  C  CA    . LEU B 1 226 ? 20.831  81.608  86.364  1.00 80.87  ? 494 LEU B CA    1 
ATOM   3578  C  C     . LEU B 1 226 ? 19.375  82.049  86.326  1.00 80.87  ? 494 LEU B C     1 
ATOM   3579  O  O     . LEU B 1 226 ? 18.464  81.241  86.135  1.00 80.87  ? 494 LEU B O     1 
ATOM   3580  C  CB    . LEU B 1 226 ? 21.403  81.665  84.950  1.00 80.87  ? 494 LEU B CB    1 
ATOM   3581  C  CG    . LEU B 1 226 ? 22.903  81.462  84.782  1.00 80.87  ? 494 LEU B CG    1 
ATOM   3582  C  CD1   . LEU B 1 226 ? 23.256  81.531  83.314  1.00 80.87  ? 494 LEU B CD1   1 
ATOM   3583  C  CD2   . LEU B 1 226 ? 23.680  82.481  85.573  1.00 80.87  ? 494 LEU B CD2   1 
ATOM   3584  N  N     . LYS B 1 227 ? 19.172  83.351  86.500  1.00 82.45  ? 495 LYS B N     1 
ATOM   3585  C  CA    . LYS B 1 227 ? 17.858  83.973  86.358  1.00 82.45  ? 495 LYS B CA    1 
ATOM   3586  C  C     . LYS B 1 227 ? 17.751  84.453  84.920  1.00 82.45  ? 495 LYS B C     1 
ATOM   3587  O  O     . LYS B 1 227 ? 18.075  85.593  84.594  1.00 82.45  ? 495 LYS B O     1 
ATOM   3588  C  CB    . LYS B 1 227 ? 17.692  85.113  87.354  1.00 82.45  ? 495 LYS B CB    1 
ATOM   3589  C  CG    . LYS B 1 227 ? 16.322  85.760  87.363  1.00 82.45  ? 495 LYS B CG    1 
ATOM   3590  C  CD    . LYS B 1 227 ? 16.255  86.843  88.419  1.00 82.45  ? 495 LYS B CD    1 
ATOM   3591  C  CE    . LYS B 1 227 ? 14.904  87.526  88.425  1.00 82.45  ? 495 LYS B CE    1 
ATOM   3592  N  NZ    . LYS B 1 227 ? 14.845  88.596  89.456  1.00 82.45  ? 495 LYS B NZ    1 
ATOM   3593  N  N     . LEU B 1 228 ? 17.304  83.565  84.042  1.00 85.84  ? 496 LEU B N     1 
ATOM   3594  C  CA    . LEU B 1 228 ? 17.295  83.864  82.622  1.00 85.84  ? 496 LEU B CA    1 
ATOM   3595  C  C     . LEU B 1 228 ? 16.081  84.712  82.263  1.00 85.84  ? 496 LEU B C     1 
ATOM   3596  O  O     . LEU B 1 228 ? 15.251  85.055  83.107  1.00 85.84  ? 496 LEU B O     1 
ATOM   3597  C  CB    . LEU B 1 228 ? 17.307  82.574  81.809  1.00 85.84  ? 496 LEU B CB    1 
ATOM   3598  C  CG    . LEU B 1 228 ? 18.526  81.676  82.001  1.00 85.84  ? 496 LEU B CG    1 
ATOM   3599  C  CD1   . LEU B 1 228 ? 18.365  80.395  81.215  1.00 85.84  ? 496 LEU B CD1   1 
ATOM   3600  C  CD2   . LEU B 1 228 ? 19.793  82.394  81.597  1.00 85.84  ? 496 LEU B CD2   1 
ATOM   3601  N  N     . ASP B 1 229 ? 15.983  85.057  80.986  1.00 93.73  ? 497 ASP B N     1 
ATOM   3602  C  CA    . ASP B 1 229 ? 14.797  85.723  80.475  1.00 93.73  ? 497 ASP B CA    1 
ATOM   3603  C  C     . ASP B 1 229 ? 13.624  84.748  80.482  1.00 93.73  ? 497 ASP B C     1 
ATOM   3604  O  O     . ASP B 1 229 ? 13.802  83.530  80.412  1.00 93.73  ? 497 ASP B O     1 
ATOM   3605  C  CB    . ASP B 1 229 ? 15.061  86.247  79.063  1.00 93.73  ? 497 ASP B CB    1 
ATOM   3606  C  CG    . ASP B 1 229 ? 13.966  87.159  78.557  1.00 93.73  ? 497 ASP B CG    1 
ATOM   3607  O  OD1   . ASP B 1 229 ? 13.905  88.321  79.005  1.00 93.73  ? 497 ASP B OD1   1 
ATOM   3608  O  OD2   . ASP B 1 229 ? 13.165  86.713  77.710  1.00 93.73  ? 497 ASP B OD2   1 
ATOM   3609  N  N     . SER B 1 230 ? 12.412  85.293  80.588  1.00 96.27  ? 498 SER B N     1 
ATOM   3610  C  CA    . SER B 1 230 ? 11.228  84.445  80.656  1.00 96.27  ? 498 SER B CA    1 
ATOM   3611  C  C     . SER B 1 230 ? 10.886  83.805  79.318  1.00 96.27  ? 498 SER B C     1 
ATOM   3612  O  O     . SER B 1 230 ? 10.166  82.804  79.295  1.00 96.27  ? 498 SER B O     1 
ATOM   3613  C  CB    . SER B 1 230 ? 10.037  85.253  81.160  1.00 96.27  ? 498 SER B CB    1 
ATOM   3614  O  OG    . SER B 1 230 ? 9.682   86.255  80.226  1.00 96.27  ? 498 SER B OG    1 
ATOM   3615  N  N     . THR B 1 231 ? 11.385  84.351  78.210  1.00 96.23  ? 499 THR B N     1 
ATOM   3616  C  CA    . THR B 1 231 ? 11.133  83.797  76.888  1.00 96.23  ? 499 THR B CA    1 
ATOM   3617  C  C     . THR B 1 231 ? 12.216  82.824  76.444  1.00 96.23  ? 499 THR B C     1 
ATOM   3618  O  O     . THR B 1 231 ? 12.361  82.577  75.242  1.00 96.23  ? 499 THR B O     1 
ATOM   3619  C  CB    . THR B 1 231 ? 10.997  84.920  75.861  1.00 96.23  ? 499 THR B CB    1 
ATOM   3620  O  OG1   . THR B 1 231 ? 12.228  85.647  75.787  1.00 96.23  ? 499 THR B OG1   1 
ATOM   3621  C  CG2   . THR B 1 231 ? 9.884   85.866  76.266  1.00 96.23  ? 499 THR B CG2   1 
ATOM   3622  N  N     . LEU B 1 232 ? 12.980  82.273  77.383  1.00 95.13  ? 500 LEU B N     1 
ATOM   3623  C  CA    . LEU B 1 232 ? 14.025  81.306  77.085  1.00 95.13  ? 500 LEU B CA    1 
ATOM   3624  C  C     . LEU B 1 232 ? 13.789  80.056  77.913  1.00 95.13  ? 500 LEU B C     1 
ATOM   3625  O  O     . LEU B 1 232 ? 13.593  80.144  79.129  1.00 95.13  ? 500 LEU B O     1 
ATOM   3626  C  CB    . LEU B 1 232 ? 15.414  81.868  77.392  1.00 95.13  ? 500 LEU B CB    1 
ATOM   3627  C  CG    . LEU B 1 232 ? 15.917  83.055  76.576  1.00 95.13  ? 500 LEU B CG    1 
ATOM   3628  C  CD1   . LEU B 1 232 ? 17.240  83.536  77.132  1.00 95.13  ? 500 LEU B CD1   1 
ATOM   3629  C  CD2   . LEU B 1 232 ? 16.056  82.679  75.118  1.00 95.13  ? 500 LEU B CD2   1 
ATOM   3630  N  N     . GLU B 1 233 ? 13.817  78.902  77.262  1.00 96.31  ? 501 GLU B N     1 
ATOM   3631  C  CA    . GLU B 1 233 ? 13.723  77.622  77.944  1.00 96.31  ? 501 GLU B CA    1 
ATOM   3632  C  C     . GLU B 1 233 ? 15.122  77.061  78.154  1.00 96.31  ? 501 GLU B C     1 
ATOM   3633  O  O     . GLU B 1 233 ? 15.954  77.093  77.243  1.00 96.31  ? 501 GLU B O     1 
ATOM   3634  C  CB    . GLU B 1 233 ? 12.872  76.641  77.139  1.00 96.31  ? 501 GLU B CB    1 
ATOM   3635  C  CG    . GLU B 1 233 ? 12.645  75.307  77.821  1.00 96.31  ? 501 GLU B CG    1 
ATOM   3636  C  CD    . GLU B 1 233 ? 11.752  74.393  77.016  1.00 96.31  ? 501 GLU B CD    1 
ATOM   3637  O  OE1   . GLU B 1 233 ? 11.312  74.809  75.925  1.00 96.31  ? 501 GLU B OE1   1 
ATOM   3638  O  OE2   . GLU B 1 233 ? 11.492  73.259  77.471  1.00 96.31  ? 501 GLU B OE2   1 
ATOM   3639  N  N     . LYS B 1 234 ? 15.377  76.523  79.353  1.00 91.41  ? 502 LYS B N     1 
ATOM   3640  C  CA    . LYS B 1 234 ? 16.714  76.037  79.708  1.00 91.41  ? 502 LYS B CA    1 
ATOM   3641  C  C     . LYS B 1 234 ? 17.112  74.747  79.002  1.00 91.41  ? 502 LYS B C     1 
ATOM   3642  O  O     . LYS B 1 234 ? 18.174  74.221  79.345  1.00 91.41  ? 502 LYS B O     1 
ATOM   3643  C  CB    . LYS B 1 234 ? 16.825  75.841  81.219  1.00 91.41  ? 502 LYS B CB    1 
ATOM   3644  C  CG    . LYS B 1 234 ? 16.754  77.130  81.998  1.00 91.41  ? 502 LYS B CG    1 
ATOM   3645  C  CD    . LYS B 1 234 ? 17.007  76.916  83.475  1.00 91.41  ? 502 LYS B CD    1 
ATOM   3646  C  CE    . LYS B 1 234 ? 16.888  78.225  84.236  1.00 91.41  ? 502 LYS B CE    1 
ATOM   3647  N  NZ    . LYS B 1 234 ? 17.188  78.062  85.682  1.00 91.41  ? 502 LYS B NZ    1 
ATOM   3648  N  N     . ASP B 1 235 ? 16.339  74.204  78.068  1.00 96.24  ? 503 ASP B N     1 
ATOM   3649  C  CA    . ASP B 1 235 ? 16.778  73.093  77.241  1.00 96.24  ? 503 ASP B CA    1 
ATOM   3650  C  C     . ASP B 1 235 ? 16.844  73.435  75.764  1.00 96.24  ? 503 ASP B C     1 
ATOM   3651  O  O     . ASP B 1 235 ? 17.681  72.876  75.056  1.00 96.24  ? 503 ASP B O     1 
ATOM   3652  C  CB    . ASP B 1 235 ? 15.856  71.884  77.434  1.00 96.24  ? 503 ASP B CB    1 
ATOM   3653  C  CG    . ASP B 1 235 ? 15.976  71.283  78.814  1.00 96.24  ? 503 ASP B CG    1 
ATOM   3654  O  OD1   . ASP B 1 235 ? 17.064  71.396  79.415  1.00 96.24  ? 503 ASP B OD1   1 
ATOM   3655  O  OD2   . ASP B 1 235 ? 14.984  70.702  79.302  1.00 96.24  ? 503 ASP B OD2   1 
ATOM   3656  N  N     . LYS B 1 236 ? 15.987  74.333  75.279  1.00 95.74  ? 504 LYS B N     1 
ATOM   3657  C  CA    . LYS B 1 236 ? 16.125  74.810  73.911  1.00 95.74  ? 504 LYS B CA    1 
ATOM   3658  C  C     . LYS B 1 236 ? 17.313  75.741  73.757  1.00 95.74  ? 504 LYS B C     1 
ATOM   3659  O  O     . LYS B 1 236 ? 17.798  75.927  72.638  1.00 95.74  ? 504 LYS B O     1 
ATOM   3660  C  CB    . LYS B 1 236 ? 14.855  75.527  73.463  1.00 95.74  ? 504 LYS B CB    1 
ATOM   3661  C  CG    . LYS B 1 236 ? 13.651  74.624  73.312  1.00 95.74  ? 504 LYS B CG    1 
ATOM   3662  C  CD    . LYS B 1 236 ? 12.448  75.407  72.821  1.00 95.74  ? 504 LYS B CD    1 
ATOM   3663  C  CE    . LYS B 1 236 ? 11.266  74.495  72.543  1.00 95.74  ? 504 LYS B CE    1 
ATOM   3664  N  NZ    . LYS B 1 236 ? 10.730  73.875  73.784  1.00 95.74  ? 504 LYS B NZ    1 
ATOM   3665  N  N     . LEU B 1 237 ? 17.785  76.328  74.853  1.00 94.38  ? 505 LEU B N     1 
ATOM   3666  C  CA    . LEU B 1 237 ? 18.932  77.221  74.821  1.00 94.38  ? 505 LEU B CA    1 
ATOM   3667  C  C     . LEU B 1 237 ? 20.240  76.465  75.002  1.00 94.38  ? 505 LEU B C     1 
ATOM   3668  O  O     . LEU B 1 237 ? 21.242  76.811  74.371  1.00 94.38  ? 505 LEU B O     1 
ATOM   3669  C  CB    . LEU B 1 237 ? 18.787  78.291  75.903  1.00 94.38  ? 505 LEU B CB    1 
ATOM   3670  C  CG    . LEU B 1 237 ? 19.812  79.421  75.907  1.00 94.38  ? 505 LEU B CG    1 
ATOM   3671  C  CD1   . LEU B 1 237 ? 19.699  80.223  74.626  1.00 94.38  ? 505 LEU B CD1   1 
ATOM   3672  C  CD2   . LEU B 1 237 ? 19.623  80.314  77.116  1.00 94.38  ? 505 LEU B CD2   1 
ATOM   3673  N  N     . ALA B 1 238 ? 20.237  75.429  75.847  1.00 92.96  ? 506 ALA B N     1 
ATOM   3674  C  CA    . ALA B 1 238 ? 21.423  74.603  76.046  1.00 92.96  ? 506 ALA B CA    1 
ATOM   3675  C  C     . ALA B 1 238 ? 21.800  73.836  74.788  1.00 92.96  ? 506 ALA B C     1 
ATOM   3676  O  O     . ALA B 1 238 ? 22.973  73.507  74.591  1.00 92.96  ? 506 ALA B O     1 
ATOM   3677  C  CB    . ALA B 1 238 ? 21.191  73.630  77.196  1.00 92.96  ? 506 ALA B CB    1 
ATOM   3678  N  N     . ARG B 1 239 ? 20.825  73.536  73.935  1.00 101.41 ? 507 ARG B N     1 
ATOM   3679  C  CA    . ARG B 1 239 ? 21.132  72.985  72.626  1.00 101.41 ? 507 ARG B CA    1 
ATOM   3680  C  C     . ARG B 1 239 ? 21.623  74.062  71.674  1.00 101.41 ? 507 ARG B C     1 
ATOM   3681  O  O     . ARG B 1 239 ? 22.432  73.779  70.785  1.00 101.41 ? 507 ARG B O     1 
ATOM   3682  C  CB    . ARG B 1 239 ? 19.898  72.291  72.057  1.00 101.41 ? 507 ARG B CB    1 
ATOM   3683  C  CG    . ARG B 1 239 ? 19.468  71.083  72.861  1.00 101.41 ? 507 ARG B CG    1 
ATOM   3684  C  CD    . ARG B 1 239 ? 18.226  70.438  72.289  1.00 101.41 ? 507 ARG B CD    1 
ATOM   3685  N  NE    . ARG B 1 239 ? 17.820  69.282  73.078  1.00 101.41 ? 507 ARG B NE    1 
ATOM   3686  C  CZ    . ARG B 1 239 ? 16.752  68.538  72.818  1.00 101.41 ? 507 ARG B CZ    1 
ATOM   3687  N  NH1   . ARG B 1 239 ? 15.978  68.826  71.782  1.00 101.41 ? 507 ARG B NH1   1 
ATOM   3688  N  NH2   . ARG B 1 239 ? 16.461  67.501  73.591  1.00 101.41 ? 507 ARG B NH2   1 
ATOM   3689  N  N     . LYS B 1 240 ? 21.147  75.295  71.847  1.00 92.58  ? 508 LYS B N     1 
ATOM   3690  C  CA    . LYS B 1 240 ? 21.606  76.392  71.005  1.00 92.58  ? 508 LYS B CA    1 
ATOM   3691  C  C     . LYS B 1 240 ? 23.022  76.807  71.373  1.00 92.58  ? 508 LYS B C     1 
ATOM   3692  O  O     . LYS B 1 240 ? 23.836  77.106  70.494  1.00 92.58  ? 508 LYS B O     1 
ATOM   3693  C  CB    . LYS B 1 240 ? 20.650  77.577  71.124  1.00 92.58  ? 508 LYS B CB    1 
ATOM   3694  C  CG    . LYS B 1 240 ? 20.987  78.739  70.218  1.00 92.58  ? 508 LYS B CG    1 
ATOM   3695  C  CD    . LYS B 1 240 ? 20.816  78.349  68.766  1.00 92.58  ? 508 LYS B CD    1 
ATOM   3696  C  CE    . LYS B 1 240 ? 21.186  79.490  67.837  1.00 92.58  ? 508 LYS B CE    1 
ATOM   3697  N  NZ    . LYS B 1 240 ? 20.241  80.630  67.954  1.00 92.58  ? 508 LYS B NZ    1 
ATOM   3698  N  N     . LEU B 1 241 ? 23.337  76.814  72.668  1.00 90.01  ? 509 LEU B N     1 
ATOM   3699  C  CA    . LEU B 1 241 ? 24.676  77.191  73.099  1.00 90.01  ? 509 LEU B CA    1 
ATOM   3700  C  C     . LEU B 1 241 ? 25.700  76.115  72.776  1.00 90.01  ? 509 LEU B C     1 
ATOM   3701  O  O     . LEU B 1 241 ? 26.869  76.432  72.536  1.00 90.01  ? 509 LEU B O     1 
ATOM   3702  C  CB    . LEU B 1 241 ? 24.687  77.482  74.592  1.00 90.01  ? 509 LEU B CB    1 
ATOM   3703  C  CG    . LEU B 1 241 ? 23.878  78.689  75.039  1.00 90.01  ? 509 LEU B CG    1 
ATOM   3704  C  CD1   . LEU B 1 241 ? 23.953  78.827  76.543  1.00 90.01  ? 509 LEU B CD1   1 
ATOM   3705  C  CD2   . LEU B 1 241 ? 24.362  79.935  74.344  1.00 90.01  ? 509 LEU B CD2   1 
ATOM   3706  N  N     . ALA B 1 242 ? 25.294  74.847  72.772  1.00 90.94  ? 510 ALA B N     1 
ATOM   3707  C  CA    . ALA B 1 242 ? 26.214  73.801  72.349  1.00 90.94  ? 510 ALA B CA    1 
ATOM   3708  C  C     . ALA B 1 242 ? 26.469  73.874  70.854  1.00 90.94  ? 510 ALA B C     1 
ATOM   3709  O  O     . ALA B 1 242 ? 27.535  73.462  70.387  1.00 90.94  ? 510 ALA B O     1 
ATOM   3710  C  CB    . ALA B 1 242 ? 25.666  72.429  72.730  1.00 90.94  ? 510 ALA B CB    1 
ATOM   3711  N  N     . SER B 1 243 ? 25.512  74.409  70.096  1.00 93.75  ? 511 SER B N     1 
ATOM   3712  C  CA    . SER B 1 243 ? 25.706  74.560  68.662  1.00 93.75  ? 511 SER B CA    1 
ATOM   3713  C  C     . SER B 1 243 ? 26.713  75.655  68.357  1.00 93.75  ? 511 SER B C     1 
ATOM   3714  O  O     . SER B 1 243 ? 27.517  75.523  67.431  1.00 93.75  ? 511 SER B O     1 
ATOM   3715  C  CB    . SER B 1 243 ? 24.373  74.852  67.983  1.00 93.75  ? 511 SER B CB    1 
ATOM   3716  O  OG    . SER B 1 243 ? 24.548  75.049  66.594  1.00 93.75  ? 511 SER B OG    1 
ATOM   3717  N  N     . LEU B 1 244 ? 26.700  76.733  69.133  1.00 89.68  ? 512 LEU B N     1 
ATOM   3718  C  CA    . LEU B 1 244 ? 27.587  77.854  68.863  1.00 89.68  ? 512 LEU B CA    1 
ATOM   3719  C  C     . LEU B 1 244 ? 28.982  77.657  69.431  1.00 89.68  ? 512 LEU B C     1 
ATOM   3720  O  O     . LEU B 1 244 ? 29.879  78.440  69.108  1.00 89.68  ? 512 LEU B O     1 
ATOM   3721  C  CB    . LEU B 1 244 ? 26.990  79.141  69.428  1.00 89.68  ? 512 LEU B CB    1 
ATOM   3722  C  CG    . LEU B 1 244 ? 25.600  79.488  68.907  1.00 89.68  ? 512 LEU B CG    1 
ATOM   3723  C  CD1   . LEU B 1 244 ? 25.102  80.763  69.554  1.00 89.68  ? 512 LEU B CD1   1 
ATOM   3724  C  CD2   . LEU B 1 244 ? 25.591  79.594  67.401  1.00 89.68  ? 512 LEU B CD2   1 
ATOM   3725  N  N     . THR B 1 245 ? 29.189  76.642  70.268  1.00 88.61  ? 513 THR B N     1 
ATOM   3726  C  CA    . THR B 1 245 ? 30.462  76.420  70.955  1.00 88.61  ? 513 THR B CA    1 
ATOM   3727  C  C     . THR B 1 245 ? 31.032  75.049  70.619  1.00 88.61  ? 513 THR B C     1 
ATOM   3728  O  O     . THR B 1 245 ? 30.841  74.093  71.382  1.00 88.61  ? 513 THR B O     1 
ATOM   3729  C  CB    . THR B 1 245 ? 30.284  76.536  72.463  1.00 88.61  ? 513 THR B CB    1 
ATOM   3730  O  OG1   . THR B 1 245 ? 29.319  75.577  72.903  1.00 88.61  ? 513 THR B OG1   1 
ATOM   3731  C  CG2   . THR B 1 245 ? 29.840  77.910  72.851  1.00 88.61  ? 513 THR B CG2   1 
ATOM   3732  N  N     . PRO B 1 246 ? 31.745  74.901  69.508  1.00 88.14  ? 514 PRO B N     1 
ATOM   3733  C  CA    . PRO B 1 246 ? 32.419  73.632  69.240  1.00 88.14  ? 514 PRO B CA    1 
ATOM   3734  C  C     . PRO B 1 246 ? 33.821  73.609  69.823  1.00 88.14  ? 514 PRO B C     1 
ATOM   3735  O  O     . PRO B 1 246 ? 34.479  74.635  69.994  1.00 88.14  ? 514 PRO B O     1 
ATOM   3736  C  CB    . PRO B 1 246 ? 32.461  73.588  67.709  1.00 88.14  ? 514 PRO B CB    1 
ATOM   3737  C  CG    . PRO B 1 246 ? 32.572  74.989  67.342  1.00 88.14  ? 514 PRO B CG    1 
ATOM   3738  C  CD    . PRO B 1 246 ? 31.781  75.782  68.333  1.00 88.14  ? 514 PRO B CD    1 
ATOM   3739  N  N     . GLY B 1 247 ? 34.266  72.402  70.156  1.00 87.10  ? 515 GLY B N     1 
ATOM   3740  C  CA    . GLY B 1 247 ? 35.599  72.193  70.670  1.00 87.10  ? 515 GLY B CA    1 
ATOM   3741  C  C     . GLY B 1 247 ? 35.830  72.610  72.105  1.00 87.10  ? 515 GLY B C     1 
ATOM   3742  O  O     . GLY B 1 247 ? 36.930  72.382  72.621  1.00 87.10  ? 515 GLY B O     1 
ATOM   3743  N  N     . PHE B 1 248 ? 34.848  73.217  72.767  1.00 85.41  ? 516 PHE B N     1 
ATOM   3744  C  CA    . PHE B 1 248 ? 35.043  73.628  74.146  1.00 85.41  ? 516 PHE B CA    1 
ATOM   3745  C  C     . PHE B 1 248 ? 35.052  72.427  75.078  1.00 85.41  ? 516 PHE B C     1 
ATOM   3746  O  O     . PHE B 1 248 ? 34.517  71.359  74.776  1.00 85.41  ? 516 PHE B O     1 
ATOM   3747  C  CB    . PHE B 1 248 ? 33.957  74.598  74.602  1.00 85.41  ? 516 PHE B CB    1 
ATOM   3748  C  CG    . PHE B 1 248 ? 34.144  76.004  74.117  1.00 85.41  ? 516 PHE B CG    1 
ATOM   3749  C  CD1   . PHE B 1 248 ? 35.290  76.385  73.444  1.00 85.41  ? 516 PHE B CD1   1 
ATOM   3750  C  CD2   . PHE B 1 248 ? 33.200  76.965  74.413  1.00 85.41  ? 516 PHE B CD2   1 
ATOM   3751  C  CE1   . PHE B 1 248 ? 35.455  77.684  73.022  1.00 85.41  ? 516 PHE B CE1   1 
ATOM   3752  C  CE2   . PHE B 1 248 ? 33.358  78.262  73.992  1.00 85.41  ? 516 PHE B CE2   1 
ATOM   3753  C  CZ    . PHE B 1 248 ? 34.487  78.622  73.301  1.00 85.41  ? 516 PHE B CZ    1 
ATOM   3754  N  N     . SER B 1 249 ? 35.675  72.619  76.224  1.00 79.46  ? 517 SER B N     1 
ATOM   3755  C  CA    . SER B 1 249 ? 35.745  71.611  77.258  1.00 79.46  ? 517 SER B CA    1 
ATOM   3756  C  C     . SER B 1 249 ? 34.647  71.867  78.280  1.00 79.46  ? 517 SER B C     1 
ATOM   3757  O  O     . SER B 1 249 ? 33.760  72.694  78.076  1.00 79.46  ? 517 SER B O     1 
ATOM   3758  C  CB    . SER B 1 249 ? 37.130  71.624  77.891  1.00 79.46  ? 517 SER B CB    1 
ATOM   3759  O  OG    . SER B 1 249 ? 37.345  72.846  78.569  1.00 79.46  ? 517 SER B OG    1 
ATOM   3760  N  N     . GLY B 1 250 ? 34.701  71.156  79.399  1.00 78.50  ? 518 GLY B N     1 
ATOM   3761  C  CA    . GLY B 1 250 ? 33.740  71.382  80.457  1.00 78.50  ? 518 GLY B CA    1 
ATOM   3762  C  C     . GLY B 1 250 ? 33.997  72.606  81.300  1.00 78.50  ? 518 GLY B C     1 
ATOM   3763  O  O     . GLY B 1 250 ? 33.168  72.933  82.150  1.00 78.50  ? 518 GLY B O     1 
ATOM   3764  N  N     . ALA B 1 251 ? 35.125  73.287  81.094  1.00 76.76  ? 519 ALA B N     1 
ATOM   3765  C  CA    . ALA B 1 251 ? 35.420  74.530  81.795  1.00 76.76  ? 519 ALA B CA    1 
ATOM   3766  C  C     . ALA B 1 251 ? 35.024  75.758  80.987  1.00 76.76  ? 519 ALA B C     1 
ATOM   3767  O  O     . ALA B 1 251 ? 34.562  76.747  81.560  1.00 76.76  ? 519 ALA B O     1 
ATOM   3768  C  CB    . ALA B 1 251 ? 36.904  74.600  82.144  1.00 76.76  ? 519 ALA B CB    1 
ATOM   3769  N  N     . ASP B 1 252 ? 35.202  75.714  79.665  1.00 80.76  ? 520 ASP B N     1 
ATOM   3770  C  CA    . ASP B 1 252 ? 34.761  76.805  78.806  1.00 80.76  ? 520 ASP B CA    1 
ATOM   3771  C  C     . ASP B 1 252 ? 33.250  76.922  78.757  1.00 80.76  ? 520 ASP B C     1 
ATOM   3772  O  O     . ASP B 1 252 ? 32.736  77.998  78.449  1.00 80.76  ? 520 ASP B O     1 
ATOM   3773  C  CB    . ASP B 1 252 ? 35.280  76.608  77.386  1.00 80.76  ? 520 ASP B CB    1 
ATOM   3774  C  CG    . ASP B 1 252 ? 36.779  76.759  77.279  1.00 80.76  ? 520 ASP B CG    1 
ATOM   3775  O  OD1   . ASP B 1 252 ? 37.358  77.543  78.053  1.00 80.76  ? 520 ASP B OD1   1 
ATOM   3776  O  OD2   . ASP B 1 252 ? 37.379  76.091  76.411  1.00 80.76  ? 520 ASP B OD2   1 
ATOM   3777  N  N     . VAL B 1 253 ? 32.532  75.838  79.030  1.00 77.71  ? 521 VAL B N     1 
ATOM   3778  C  CA    . VAL B 1 253 ? 31.080  75.902  79.066  1.00 77.71  ? 521 VAL B CA    1 
ATOM   3779  C  C     . VAL B 1 253 ? 30.608  76.557  80.351  1.00 77.71  ? 521 VAL B C     1 
ATOM   3780  O  O     . VAL B 1 253 ? 29.713  77.411  80.335  1.00 77.71  ? 521 VAL B O     1 
ATOM   3781  C  CB    . VAL B 1 253 ? 30.498  74.493  78.888  1.00 77.71  ? 521 VAL B CB    1 
ATOM   3782  C  CG1   . VAL B 1 253 ? 29.019  74.508  79.093  1.00 77.71  ? 521 VAL B CG1   1 
ATOM   3783  C  CG2   . VAL B 1 253 ? 30.804  73.995  77.504  1.00 77.71  ? 521 VAL B CG2   1 
ATOM   3784  N  N     . ALA B 1 254 ? 31.225  76.203  81.479  1.00 76.25  ? 522 ALA B N     1 
ATOM   3785  C  CA    . ALA B 1 254 ? 30.891  76.830  82.750  1.00 76.25  ? 522 ALA B CA    1 
ATOM   3786  C  C     . ALA B 1 254 ? 31.324  78.287  82.818  1.00 76.25  ? 522 ALA B C     1 
ATOM   3787  O  O     . ALA B 1 254 ? 30.834  79.021  83.679  1.00 76.25  ? 522 ALA B O     1 
ATOM   3788  C  CB    . ALA B 1 254 ? 31.525  76.052  83.900  1.00 76.25  ? 522 ALA B CB    1 
ATOM   3789  N  N     . ASN B 1 255 ? 32.225  78.721  81.938  1.00 76.41  ? 523 ASN B N     1 
ATOM   3790  C  CA    . ASN B 1 255 ? 32.635  80.117  81.929  1.00 76.41  ? 523 ASN B CA    1 
ATOM   3791  C  C     . ASN B 1 255 ? 31.634  80.984  81.180  1.00 76.41  ? 523 ASN B C     1 
ATOM   3792  O  O     . ASN B 1 255 ? 31.346  82.104  81.610  1.00 76.41  ? 523 ASN B O     1 
ATOM   3793  C  CB    . ASN B 1 255 ? 34.013  80.258  81.298  1.00 76.41  ? 523 ASN B CB    1 
ATOM   3794  C  CG    . ASN B 1 255 ? 34.673  81.561  81.645  1.00 76.41  ? 523 ASN B CG    1 
ATOM   3795  O  OD1   . ASN B 1 255 ? 34.185  82.303  82.490  1.00 76.41  ? 523 ASN B OD1   1 
ATOM   3796  N  ND2   . ASN B 1 255 ? 35.772  81.867  80.973  1.00 76.41  ? 523 ASN B ND2   1 
ATOM   3797  N  N     . VAL B 1 256 ? 31.113  80.486  80.054  1.00 74.70  ? 524 VAL B N     1 
ATOM   3798  C  CA    . VAL B 1 256 ? 30.151  81.239  79.250  1.00 74.70  ? 524 VAL B CA    1 
ATOM   3799  C  C     . VAL B 1 256 ? 28.866  81.465  80.032  1.00 74.70  ? 524 VAL B C     1 
ATOM   3800  O  O     . VAL B 1 256 ? 28.270  82.547  79.985  1.00 74.70  ? 524 VAL B O     1 
ATOM   3801  C  CB    . VAL B 1 256 ? 29.897  80.505  77.920  1.00 74.70  ? 524 VAL B CB    1 
ATOM   3802  C  CG1   . VAL B 1 256 ? 28.762  81.131  77.143  1.00 74.70  ? 524 VAL B CG1   1 
ATOM   3803  C  CG2   . VAL B 1 256 ? 31.143  80.528  77.079  1.00 74.70  ? 524 VAL B CG2   1 
ATOM   3804  N  N     . CYS B 1 257 ? 28.456  80.473  80.815  1.00 78.34  ? 525 CYS B N     1 
ATOM   3805  C  CA    . CYS B 1 257 ? 27.288  80.636  81.662  1.00 78.34  ? 525 CYS B CA    1 
ATOM   3806  C  C     . CYS B 1 257 ? 27.551  81.538  82.856  1.00 78.34  ? 525 CYS B C     1 
ATOM   3807  O  O     . CYS B 1 257 ? 26.594  81.978  83.498  1.00 78.34  ? 525 CYS B O     1 
ATOM   3808  C  CB    . CYS B 1 257 ? 26.804  79.274  82.141  1.00 78.34  ? 525 CYS B CB    1 
ATOM   3809  S  SG    . CYS B 1 257 ? 26.288  78.185  80.810  1.00 78.34  ? 525 CYS B SG    1 
ATOM   3810  N  N     . ASN B 1 258 ? 28.810  81.820  83.174  1.00 75.07  ? 526 ASN B N     1 
ATOM   3811  C  CA    . ASN B 1 258 ? 29.150  82.760  84.231  1.00 75.07  ? 526 ASN B CA    1 
ATOM   3812  C  C     . ASN B 1 258 ? 29.445  84.149  83.693  1.00 75.07  ? 526 ASN B C     1 
ATOM   3813  O  O     . ASN B 1 258 ? 29.064  85.140  84.318  1.00 75.07  ? 526 ASN B O     1 
ATOM   3814  C  CB    . ASN B 1 258 ? 30.360  82.252  85.015  1.00 75.07  ? 526 ASN B CB    1 
ATOM   3815  C  CG    . ASN B 1 258 ? 30.551  82.964  86.336  1.00 75.07  ? 526 ASN B CG    1 
ATOM   3816  O  OD1   . ASN B 1 258 ? 29.751  83.804  86.734  1.00 75.07  ? 526 ASN B OD1   1 
ATOM   3817  N  ND2   . ASN B 1 258 ? 31.630  82.630  87.026  1.00 75.07  ? 526 ASN B ND2   1 
ATOM   3818  N  N     . GLU B 1 259 ? 30.110  84.240  82.539  1.00 76.43  ? 527 GLU B N     1 
ATOM   3819  C  CA    . GLU B 1 259 ? 30.434  85.545  81.972  1.00 76.43  ? 527 GLU B CA    1 
ATOM   3820  C  C     . GLU B 1 259 ? 29.186  86.269  81.497  1.00 76.43  ? 527 GLU B C     1 
ATOM   3821  O  O     . GLU B 1 259 ? 29.058  87.480  81.696  1.00 76.43  ? 527 GLU B O     1 
ATOM   3822  C  CB    . GLU B 1 259 ? 31.428  85.406  80.822  1.00 76.43  ? 527 GLU B CB    1 
ATOM   3823  C  CG    . GLU B 1 259 ? 32.820  84.986  81.238  1.00 76.43  ? 527 GLU B CG    1 
ATOM   3824  C  CD    . GLU B 1 259 ? 33.529  86.015  82.091  1.00 76.43  ? 527 GLU B CD    1 
ATOM   3825  O  OE1   . GLU B 1 259 ? 33.300  87.226  81.891  1.00 76.43  ? 527 GLU B OE1   1 
ATOM   3826  O  OE2   . GLU B 1 259 ? 34.324  85.610  82.965  1.00 76.43  ? 527 GLU B OE2   1 
ATOM   3827  N  N     . ALA B 1 260 ? 28.238  85.539  80.907  1.00 74.49  ? 528 ALA B N     1 
ATOM   3828  C  CA    . ALA B 1 260 ? 27.002  86.153  80.440  1.00 74.49  ? 528 ALA B CA    1 
ATOM   3829  C  C     . ALA B 1 260 ? 26.116  86.621  81.580  1.00 74.49  ? 528 ALA B C     1 
ATOM   3830  O  O     . ALA B 1 260 ? 25.237  87.457  81.358  1.00 74.49  ? 528 ALA B O     1 
ATOM   3831  C  CB    . ALA B 1 260 ? 26.235  85.179  79.558  1.00 74.49  ? 528 ALA B CB    1 
ATOM   3832  N  N     . ALA B 1 261 ? 26.321  86.111  82.790  1.00 74.55  ? 529 ALA B N     1 
ATOM   3833  C  CA    . ALA B 1 261 ? 25.656  86.695  83.944  1.00 74.55  ? 529 ALA B CA    1 
ATOM   3834  C  C     . ALA B 1 261 ? 26.381  87.937  84.434  1.00 74.55  ? 529 ALA B C     1 
ATOM   3835  O  O     . ALA B 1 261 ? 25.739  88.873  84.920  1.00 74.55  ? 529 ALA B O     1 
ATOM   3836  C  CB    . ALA B 1 261 ? 25.556  85.671  85.067  1.00 74.55  ? 529 ALA B CB    1 
ATOM   3837  N  N     . LEU B 1 262 ? 27.709  87.966  84.309  1.00 76.29  ? 530 LEU B N     1 
ATOM   3838  C  CA    . LEU B 1 262 ? 28.465  89.156  84.679  1.00 76.29  ? 530 LEU B CA    1 
ATOM   3839  C  C     . LEU B 1 262 ? 28.304  90.260  83.645  1.00 76.29  ? 530 LEU B C     1 
ATOM   3840  O  O     . LEU B 1 262 ? 28.368  91.442  83.991  1.00 76.29  ? 530 LEU B O     1 
ATOM   3841  C  CB    . LEU B 1 262 ? 29.936  88.797  84.862  1.00 76.29  ? 530 LEU B CB    1 
ATOM   3842  C  CG    . LEU B 1 262 ? 30.249  87.885  86.039  1.00 76.29  ? 530 LEU B CG    1 
ATOM   3843  C  CD1   . LEU B 1 262 ? 31.695  87.453  85.995  1.00 76.29  ? 530 LEU B CD1   1 
ATOM   3844  C  CD2   . LEU B 1 262 ? 29.969  88.606  87.323  1.00 76.29  ? 530 LEU B CD2   1 
ATOM   3845  N  N     . ILE B 1 263 ? 28.103  89.897  82.376  1.00 77.01  ? 531 ILE B N     1 
ATOM   3846  C  CA    . ILE B 1 263 ? 27.764  90.884  81.355  1.00 77.01  ? 531 ILE B CA    1 
ATOM   3847  C  C     . ILE B 1 263 ? 26.363  91.432  81.594  1.00 77.01  ? 531 ILE B C     1 
ATOM   3848  O  O     . ILE B 1 263 ? 26.099  92.616  81.350  1.00 77.01  ? 531 ILE B O     1 
ATOM   3849  C  CB    . ILE B 1 263 ? 27.920  90.252  79.956  1.00 77.01  ? 531 ILE B CB    1 
ATOM   3850  C  CG1   . ILE B 1 263 ? 29.385  89.945  79.670  1.00 77.01  ? 531 ILE B CG1   1 
ATOM   3851  C  CG2   . ILE B 1 263 ? 27.414  91.145  78.850  1.00 77.01  ? 531 ILE B CG2   1 
ATOM   3852  C  CD1   . ILE B 1 263 ? 29.588  89.094  78.446  1.00 77.01  ? 531 ILE B CD1   1 
ATOM   3853  N  N     . ALA B 1 264 ? 25.462  90.601  82.124  1.00 78.63  ? 532 ALA B N     1 
ATOM   3854  C  CA    . ALA B 1 264 ? 24.079  91.012  82.342  1.00 78.63  ? 532 ALA B CA    1 
ATOM   3855  C  C     . ALA B 1 264 ? 23.976  92.077  83.423  1.00 78.63  ? 532 ALA B C     1 
ATOM   3856  O  O     . ALA B 1 264 ? 23.366  93.129  83.215  1.00 78.63  ? 532 ALA B O     1 
ATOM   3857  C  CB    . ALA B 1 264 ? 23.229  89.804  82.716  1.00 78.63  ? 532 ALA B CB    1 
ATOM   3858  N  N     . ALA B 1 265 ? 24.578  91.830  84.579  1.00 80.09  ? 533 ALA B N     1 
ATOM   3859  C  CA    . ALA B 1 265 ? 24.491  92.781  85.674  1.00 80.09  ? 533 ALA B CA    1 
ATOM   3860  C  C     . ALA B 1 265 ? 25.443  93.957  85.524  1.00 80.09  ? 533 ALA B C     1 
ATOM   3861  O  O     . ALA B 1 265 ? 25.405  94.868  86.355  1.00 80.09  ? 533 ALA B O     1 
ATOM   3862  C  CB    . ALA B 1 265 ? 24.752  92.071  86.996  1.00 80.09  ? 533 ALA B CB    1 
ATOM   3863  N  N     . ARG B 1 266 ? 26.308  93.946  84.509  1.00 81.99  ? 534 ARG B N     1 
ATOM   3864  C  CA    . ARG B 1 266 ? 27.091  95.131  84.181  1.00 81.99  ? 534 ARG B CA    1 
ATOM   3865  C  C     . ARG B 1 266 ? 26.188  96.266  83.727  1.00 81.99  ? 534 ARG B C     1 
ATOM   3866  O  O     . ARG B 1 266 ? 26.415  97.429  84.073  1.00 81.99  ? 534 ARG B O     1 
ATOM   3867  C  CB    . ARG B 1 266 ? 28.109  94.791  83.095  1.00 81.99  ? 534 ARG B CB    1 
ATOM   3868  C  CG    . ARG B 1 266 ? 28.999  95.933  82.669  1.00 81.99  ? 534 ARG B CG    1 
ATOM   3869  C  CD    . ARG B 1 266 ? 29.950  95.497  81.570  1.00 81.99  ? 534 ARG B CD    1 
ATOM   3870  N  NE    . ARG B 1 266 ? 30.936  94.539  82.053  1.00 81.99  ? 534 ARG B NE    1 
ATOM   3871  C  CZ    . ARG B 1 266 ? 31.768  93.864  81.273  1.00 81.99  ? 534 ARG B CZ    1 
ATOM   3872  N  NH1   . ARG B 1 266 ? 31.732  94.034  79.960  1.00 81.99  ? 534 ARG B NH1   1 
ATOM   3873  N  NH2   . ARG B 1 266 ? 32.630  93.014  81.807  1.00 81.99  ? 534 ARG B NH2   1 
ATOM   3874  N  N     . HIS B 1 267 ? 25.147  95.943  82.967  1.00 82.93  ? 535 HIS B N     1 
ATOM   3875  C  CA    . HIS B 1 267 ? 24.197  96.927  82.480  1.00 82.93  ? 535 HIS B CA    1 
ATOM   3876  C  C     . HIS B 1 267 ? 22.970  97.047  83.371  1.00 82.93  ? 535 HIS B C     1 
ATOM   3877  O  O     . HIS B 1 267 ? 22.006  97.714  82.981  1.00 82.93  ? 535 HIS B O     1 
ATOM   3878  C  CB    . HIS B 1 267 ? 23.769  96.575  81.058  1.00 82.93  ? 535 HIS B CB    1 
ATOM   3879  C  CG    . HIS B 1 267 ? 24.900  96.536  80.082  1.00 82.93  ? 535 HIS B CG    1 
ATOM   3880  N  ND1   . HIS B 1 267 ? 25.503  97.674  79.594  1.00 82.93  ? 535 HIS B ND1   1 
ATOM   3881  C  CD2   . HIS B 1 267 ? 25.537  95.493  79.501  1.00 82.93  ? 535 HIS B CD2   1 
ATOM   3882  C  CE1   . HIS B 1 267 ? 26.465  97.334  78.755  1.00 82.93  ? 535 HIS B CE1   1 
ATOM   3883  N  NE2   . HIS B 1 267 ? 26.506  96.016  78.681  1.00 82.93  ? 535 HIS B NE2   1 
ATOM   3884  N  N     . LEU B 1 268 ? 23.005  96.429  84.559  1.00 85.14  ? 536 LEU B N     1 
ATOM   3885  C  CA    . LEU B 1 268 ? 21.868  96.316  85.484  1.00 85.14  ? 536 LEU B CA    1 
ATOM   3886  C  C     . LEU B 1 268 ? 20.625  95.758  84.799  1.00 85.14  ? 536 LEU B C     1 
ATOM   3887  O  O     . LEU B 1 268 ? 19.508  96.236  85.005  1.00 85.14  ? 536 LEU B O     1 
ATOM   3888  C  CB    . LEU B 1 268 ? 21.552  97.646  86.168  1.00 85.14  ? 536 LEU B CB    1 
ATOM   3889  C  CG    . LEU B 1 268 ? 22.530  98.126  87.231  1.00 85.14  ? 536 LEU B CG    1 
ATOM   3890  C  CD1   . LEU B 1 268 ? 22.091  99.475  87.752  1.00 85.14  ? 536 LEU B CD1   1 
ATOM   3891  C  CD2   . LEU B 1 268 ? 22.609  97.118  88.356  1.00 85.14  ? 536 LEU B CD2   1 
ATOM   3892  N  N     . SER B 1 269 ? 20.820  94.739  83.970  1.00 85.84  ? 537 SER B N     1 
ATOM   3893  C  CA    . SER B 1 269 ? 19.701  94.140  83.267  1.00 85.84  ? 537 SER B CA    1 
ATOM   3894  C  C     . SER B 1 269 ? 18.883  93.283  84.223  1.00 85.84  ? 537 SER B C     1 
ATOM   3895  O  O     . SER B 1 269 ? 19.388  92.781  85.229  1.00 85.84  ? 537 SER B O     1 
ATOM   3896  C  CB    . SER B 1 269 ? 20.192  93.300  82.092  1.00 85.84  ? 537 SER B CB    1 
ATOM   3897  O  OG    . SER B 1 269 ? 19.105  92.743  81.379  1.00 85.84  ? 537 SER B OG    1 
ATOM   3898  N  N     . ASP B 1 270 ? 17.599  93.135  83.905  1.00 88.26  ? 538 ASP B N     1 
ATOM   3899  C  CA    . ASP B 1 270 ? 16.693  92.410  84.786  1.00 88.26  ? 538 ASP B CA    1 
ATOM   3900  C  C     . ASP B 1 270 ? 16.917  90.908  84.707  1.00 88.26  ? 538 ASP B C     1 
ATOM   3901  O  O     . ASP B 1 270 ? 16.846  90.212  85.724  1.00 88.26  ? 538 ASP B O     1 
ATOM   3902  C  CB    . ASP B 1 270 ? 15.246  92.747  84.433  1.00 88.26  ? 538 ASP B CB    1 
ATOM   3903  C  CG    . ASP B 1 270 ? 14.900  94.188  84.727  1.00 88.26  ? 538 ASP B CG    1 
ATOM   3904  O  OD1   . ASP B 1 270 ? 15.504  94.766  85.654  1.00 88.26  ? 538 ASP B OD1   1 
ATOM   3905  O  OD2   . ASP B 1 270 ? 14.027  94.745  84.030  1.00 88.26  ? 538 ASP B OD2   1 
ATOM   3906  N  N     . SER B 1 271 ? 17.189  90.397  83.511  1.00 87.57  ? 539 SER B N     1 
ATOM   3907  C  CA    . SER B 1 271 ? 17.352  88.970  83.302  1.00 87.57  ? 539 SER B CA    1 
ATOM   3908  C  C     . SER B 1 271 ? 18.305  88.755  82.141  1.00 87.57  ? 539 SER B C     1 
ATOM   3909  O  O     . SER B 1 271 ? 18.448  89.610  81.266  1.00 87.57  ? 539 SER B O     1 
ATOM   3910  C  CB    . SER B 1 271 ? 16.012  88.293  83.021  1.00 87.57  ? 539 SER B CB    1 
ATOM   3911  O  OG    . SER B 1 271 ? 15.486  88.734  81.784  1.00 87.57  ? 539 SER B OG    1 
ATOM   3912  N  N     . ILE B 1 272 ? 18.953  87.600  82.137  1.00 82.41  ? 540 ILE B N     1 
ATOM   3913  C  CA    . ILE B 1 272 ? 19.927  87.282  81.102  1.00 82.41  ? 540 ILE B CA    1 
ATOM   3914  C  C     . ILE B 1 272 ? 19.182  86.851  79.850  1.00 82.41  ? 540 ILE B C     1 
ATOM   3915  O  O     . ILE B 1 272 ? 18.340  85.948  79.898  1.00 82.41  ? 540 ILE B O     1 
ATOM   3916  C  CB    . ILE B 1 272 ? 20.873  86.176  81.576  1.00 82.41  ? 540 ILE B CB    1 
ATOM   3917  C  CG1   . ILE B 1 272 ? 21.469  86.526  82.931  1.00 82.41  ? 540 ILE B CG1   1 
ATOM   3918  C  CG2   . ILE B 1 272 ? 21.991  86.024  80.591  1.00 82.41  ? 540 ILE B CG2   1 
ATOM   3919  C  CD1   . ILE B 1 272 ? 22.115  85.361  83.608  1.00 82.41  ? 540 ILE B CD1   1 
ATOM   3920  N  N     . ASN B 1 273 ? 19.483  87.484  78.726  1.00 84.29  ? 541 ASN B N     1 
ATOM   3921  C  CA    . ASN B 1 273 ? 18.850  87.128  77.468  1.00 84.29  ? 541 ASN B CA    1 
ATOM   3922  C  C     . ASN B 1 273 ? 19.849  86.418  76.559  1.00 84.29  ? 541 ASN B C     1 
ATOM   3923  O  O     . ASN B 1 273 ? 20.969  86.096  76.964  1.00 84.29  ? 541 ASN B O     1 
ATOM   3924  C  CB    . ASN B 1 273 ? 18.227  88.364  76.815  1.00 84.29  ? 541 ASN B CB    1 
ATOM   3925  C  CG    . ASN B 1 273 ? 19.201  89.510  76.665  1.00 84.29  ? 541 ASN B CG    1 
ATOM   3926  O  OD1   . ASN B 1 273 ? 20.377  89.398  76.994  1.00 84.29  ? 541 ASN B OD1   1 
ATOM   3927  N  ND2   . ASN B 1 273 ? 18.705  90.633  76.162  1.00 84.29  ? 541 ASN B ND2   1 
ATOM   3928  N  N     . GLN B 1 274 ? 19.429  86.162  75.320  1.00 83.88  ? 542 GLN B N     1 
ATOM   3929  C  CA    . GLN B 1 274 ? 20.267  85.412  74.392  1.00 83.88  ? 542 GLN B CA    1 
ATOM   3930  C  C     . GLN B 1 274 ? 21.437  86.249  73.892  1.00 83.88  ? 542 GLN B C     1 
ATOM   3931  O  O     . GLN B 1 274 ? 22.495  85.699  73.568  1.00 83.88  ? 542 GLN B O     1 
ATOM   3932  C  CB    . GLN B 1 274 ? 19.415  84.912  73.225  1.00 83.88  ? 542 GLN B CB    1 
ATOM   3933  C  CG    . GLN B 1 274 ? 20.112  83.954  72.274  1.00 83.88  ? 542 GLN B CG    1 
ATOM   3934  C  CD    . GLN B 1 274 ? 19.195  83.449  71.182  1.00 83.88  ? 542 GLN B CD    1 
ATOM   3935  O  OE1   . GLN B 1 274 ? 18.025  83.823  71.116  1.00 83.88  ? 542 GLN B OE1   1 
ATOM   3936  N  NE2   . GLN B 1 274 ? 19.724  82.600  70.312  1.00 83.88  ? 542 GLN B NE2   1 
ATOM   3937  N  N     . LYS B 1 275 ? 21.278  87.574  73.847  1.00 82.24  ? 543 LYS B N     1 
ATOM   3938  C  CA    . LYS B 1 275 ? 22.363  88.447  73.416  1.00 82.24  ? 543 LYS B CA    1 
ATOM   3939  C  C     . LYS B 1 275 ? 23.524  88.465  74.397  1.00 82.24  ? 543 LYS B C     1 
ATOM   3940  O  O     . LYS B 1 275 ? 24.653  88.748  73.991  1.00 82.24  ? 543 LYS B O     1 
ATOM   3941  C  CB    . LYS B 1 275 ? 21.849  89.869  73.211  1.00 82.24  ? 543 LYS B CB    1 
ATOM   3942  C  CG    . LYS B 1 275 ? 20.927  90.026  72.020  1.00 82.24  ? 543 LYS B CG    1 
ATOM   3943  C  CD    . LYS B 1 275 ? 20.515  91.477  71.840  1.00 82.24  ? 543 LYS B CD    1 
ATOM   3944  C  CE    . LYS B 1 275 ? 19.586  91.650  70.650  1.00 82.24  ? 543 LYS B CE    1 
ATOM   3945  N  NZ    . LYS B 1 275 ? 19.175  93.070  70.480  1.00 82.24  ? 543 LYS B NZ    1 
ATOM   3946  N  N     . HIS B 1 276 ? 23.279  88.162  75.667  1.00 82.23  ? 544 HIS B N     1 
ATOM   3947  C  CA    . HIS B 1 276 ? 24.370  88.123  76.628  1.00 82.23  ? 544 HIS B CA    1 
ATOM   3948  C  C     . HIS B 1 276 ? 25.206  86.861  76.491  1.00 82.23  ? 544 HIS B C     1 
ATOM   3949  O  O     . HIS B 1 276 ? 26.420  86.902  76.715  1.00 82.23  ? 544 HIS B O     1 
ATOM   3950  C  CB    . HIS B 1 276 ? 23.819  88.235  78.044  1.00 82.23  ? 544 HIS B CB    1 
ATOM   3951  C  CG    . HIS B 1 276 ? 23.187  89.557  78.336  1.00 82.23  ? 544 HIS B CG    1 
ATOM   3952  N  ND1   . HIS B 1 276 ? 22.419  89.780  79.455  1.00 82.23  ? 544 HIS B ND1   1 
ATOM   3953  C  CD2   . HIS B 1 276 ? 23.211  90.726  77.656  1.00 82.23  ? 544 HIS B CD2   1 
ATOM   3954  C  CE1   . HIS B 1 276 ? 21.992  91.029  79.451  1.00 82.23  ? 544 HIS B CE1   1 
ATOM   3955  N  NE2   . HIS B 1 276 ? 22.460  91.625  78.370  1.00 82.23  ? 544 HIS B NE2   1 
ATOM   3956  N  N     . PHE B 1 277 ? 24.588  85.735  76.129  1.00 80.72  ? 545 PHE B N     1 
ATOM   3957  C  CA    . PHE B 1 277 ? 25.362  84.518  75.917  1.00 80.72  ? 545 PHE B CA    1 
ATOM   3958  C  C     . PHE B 1 277 ? 26.171  84.588  74.636  1.00 80.72  ? 545 PHE B C     1 
ATOM   3959  O  O     . PHE B 1 277 ? 27.272  84.034  74.569  1.00 80.72  ? 545 PHE B O     1 
ATOM   3960  C  CB    . PHE B 1 277 ? 24.448  83.300  75.887  1.00 80.72  ? 545 PHE B CB    1 
ATOM   3961  C  CG    . PHE B 1 277 ? 23.907  82.925  77.221  1.00 80.72  ? 545 PHE B CG    1 
ATOM   3962  C  CD1   . PHE B 1 277 ? 24.690  82.232  78.125  1.00 80.72  ? 545 PHE B CD1   1 
ATOM   3963  C  CD2   . PHE B 1 277 ? 22.616  83.256  77.572  1.00 80.72  ? 545 PHE B CD2   1 
ATOM   3964  C  CE1   . PHE B 1 277 ? 24.197  81.881  79.361  1.00 80.72  ? 545 PHE B CE1   1 
ATOM   3965  C  CE2   . PHE B 1 277 ? 22.117  82.904  78.803  1.00 80.72  ? 545 PHE B CE2   1 
ATOM   3966  C  CZ    . PHE B 1 277 ? 22.911  82.222  79.700  1.00 80.72  ? 545 PHE B CZ    1 
ATOM   3967  N  N     . GLU B 1 278 ? 25.651  85.267  73.616  1.00 83.12  ? 546 GLU B N     1 
ATOM   3968  C  CA    . GLU B 1 278 ? 26.383  85.402  72.369  1.00 83.12  ? 546 GLU B CA    1 
ATOM   3969  C  C     . GLU B 1 278 ? 27.580  86.330  72.499  1.00 83.12  ? 546 GLU B C     1 
ATOM   3970  O  O     . GLU B 1 278 ? 28.448  86.318  71.624  1.00 83.12  ? 546 GLU B O     1 
ATOM   3971  C  CB    . GLU B 1 278 ? 25.450  85.903  71.272  1.00 83.12  ? 546 GLU B CB    1 
ATOM   3972  C  CG    . GLU B 1 278 ? 24.371  84.908  70.900  1.00 83.12  ? 546 GLU B CG    1 
ATOM   3973  C  CD    . GLU B 1 278 ? 23.418  85.438  69.848  1.00 83.12  ? 546 GLU B CD    1 
ATOM   3974  O  OE1   . GLU B 1 278 ? 23.524  86.630  69.491  1.00 83.12  ? 546 GLU B OE1   1 
ATOM   3975  O  OE2   . GLU B 1 278 ? 22.556  84.663  69.381  1.00 83.12  ? 546 GLU B OE2   1 
ATOM   3976  N  N     . GLN B 1 279 ? 27.645  87.133  73.561  1.00 80.89  ? 547 GLN B N     1 
ATOM   3977  C  CA    . GLN B 1 279 ? 28.823  87.943  73.838  1.00 80.89  ? 547 GLN B CA    1 
ATOM   3978  C  C     . GLN B 1 279 ? 29.827  87.231  74.725  1.00 80.89  ? 547 GLN B C     1 
ATOM   3979  O  O     . GLN B 1 279 ? 31.029  87.470  74.590  1.00 80.89  ? 547 GLN B O     1 
ATOM   3980  C  CB    . GLN B 1 279 ? 28.430  89.258  74.506  1.00 80.89  ? 547 GLN B CB    1 
ATOM   3981  C  CG    . GLN B 1 279 ? 27.636  90.183  73.620  1.00 80.89  ? 547 GLN B CG    1 
ATOM   3982  C  CD    . GLN B 1 279 ? 27.276  91.467  74.323  1.00 80.89  ? 547 GLN B CD    1 
ATOM   3983  O  OE1   . GLN B 1 279 ? 27.609  91.660  75.490  1.00 80.89  ? 547 GLN B OE1   1 
ATOM   3984  N  NE2   . GLN B 1 279 ? 26.579  92.350  73.622  1.00 80.89  ? 547 GLN B NE2   1 
ATOM   3985  N  N     . ALA B 1 280 ? 29.364  86.372  75.633  1.00 78.10  ? 548 ALA B N     1 
ATOM   3986  C  CA    . ALA B 1 280 ? 30.287  85.625  76.477  1.00 78.10  ? 548 ALA B CA    1 
ATOM   3987  C  C     . ALA B 1 280 ? 31.066  84.594  75.677  1.00 78.10  ? 548 ALA B C     1 
ATOM   3988  O  O     . ALA B 1 280 ? 32.224  84.313  75.999  1.00 78.10  ? 548 ALA B O     1 
ATOM   3989  C  CB    . ALA B 1 280 ? 29.532  84.951  77.617  1.00 78.10  ? 548 ALA B CB    1 
ATOM   3990  N  N     . ILE B 1 281 ? 30.448  84.014  74.646  1.00 81.29  ? 549 ILE B N     1 
ATOM   3991  C  CA    . ILE B 1 281 ? 31.188  83.203  73.686  1.00 81.29  ? 549 ILE B CA    1 
ATOM   3992  C  C     . ILE B 1 281 ? 32.174  84.075  72.929  1.00 81.29  ? 549 ILE B C     1 
ATOM   3993  O  O     . ILE B 1 281 ? 33.338  83.708  72.727  1.00 81.29  ? 549 ILE B O     1 
ATOM   3994  C  CB    . ILE B 1 281 ? 30.210  82.508  72.724  1.00 81.29  ? 549 ILE B CB    1 
ATOM   3995  C  CG1   . ILE B 1 281 ? 29.262  81.601  73.494  1.00 81.29  ? 549 ILE B CG1   1 
ATOM   3996  C  CG2   . ILE B 1 281 ? 30.957  81.694  71.696  1.00 81.29  ? 549 ILE B CG2   1 
ATOM   3997  C  CD1   . ILE B 1 281 ? 28.075  81.163  72.683  1.00 81.29  ? 549 ILE B CD1   1 
ATOM   3998  N  N     . GLU B 1 282 ? 31.723  85.259  72.531  1.00 82.89  ? 550 GLU B N     1 
ATOM   3999  C  CA    . GLU B 1 282 ? 32.520  86.216  71.787  1.00 82.89  ? 550 GLU B CA    1 
ATOM   4000  C  C     . GLU B 1 282 ? 33.636  86.814  72.634  1.00 82.89  ? 550 GLU B C     1 
ATOM   4001  O  O     . GLU B 1 282 ? 34.653  87.246  72.088  1.00 82.89  ? 550 GLU B O     1 
ATOM   4002  C  CB    . GLU B 1 282 ? 31.570  87.290  71.274  1.00 82.89  ? 550 GLU B CB    1 
ATOM   4003  C  CG    . GLU B 1 282 ? 32.103  88.261  70.291  1.00 82.89  ? 550 GLU B CG    1 
ATOM   4004  C  CD    . GLU B 1 282 ? 31.036  89.244  69.843  1.00 82.89  ? 550 GLU B CD    1 
ATOM   4005  O  OE1   . GLU B 1 282 ? 29.887  89.136  70.317  1.00 82.89  ? 550 GLU B OE1   1 
ATOM   4006  O  OE2   . GLU B 1 282 ? 31.341  90.130  69.019  1.00 82.89  ? 550 GLU B OE2   1 
ATOM   4007  N  N     . ARG B 1 283 ? 33.472  86.834  73.956  1.00 80.01  ? 551 ARG B N     1 
ATOM   4008  C  CA    . ARG B 1 283 ? 34.496  87.350  74.858  1.00 80.01  ? 551 ARG B CA    1 
ATOM   4009  C  C     . ARG B 1 283 ? 35.654  86.378  75.023  1.00 80.01  ? 551 ARG B C     1 
ATOM   4010  O  O     . ARG B 1 283 ? 36.817  86.796  75.039  1.00 80.01  ? 551 ARG B O     1 
ATOM   4011  C  CB    . ARG B 1 283 ? 33.872  87.653  76.220  1.00 80.01  ? 551 ARG B CB    1 
ATOM   4012  C  CG    . ARG B 1 283 ? 34.844  88.001  77.328  1.00 80.01  ? 551 ARG B CG    1 
ATOM   4013  C  CD    . ARG B 1 283 ? 35.547  89.312  77.086  1.00 80.01  ? 551 ARG B CD    1 
ATOM   4014  N  NE    . ARG B 1 283 ? 36.485  89.613  78.161  1.00 80.01  ? 551 ARG B NE    1 
ATOM   4015  C  CZ    . ARG B 1 283 ? 37.747  89.199  78.189  1.00 80.01  ? 551 ARG B CZ    1 
ATOM   4016  N  NH1   . ARG B 1 283 ? 38.230  88.471  77.196  1.00 80.01  ? 551 ARG B NH1   1 
ATOM   4017  N  NH2   . ARG B 1 283 ? 38.526  89.520  79.209  1.00 80.01  ? 551 ARG B NH2   1 
ATOM   4018  N  N     . VAL B 1 284 ? 35.352  85.085  75.149  1.00 80.42  ? 552 VAL B N     1 
ATOM   4019  C  CA    . VAL B 1 284 ? 36.367  84.100  75.511  1.00 80.42  ? 552 VAL B CA    1 
ATOM   4020  C  C     . VAL B 1 284 ? 37.339  83.880  74.362  1.00 80.42  ? 552 VAL B C     1 
ATOM   4021  O  O     . VAL B 1 284 ? 38.560  83.921  74.545  1.00 80.42  ? 552 VAL B O     1 
ATOM   4022  C  CB    . VAL B 1 284 ? 35.701  82.786  75.949  1.00 80.42  ? 552 VAL B CB    1 
ATOM   4023  C  CG1   . VAL B 1 284 ? 36.736  81.697  76.121  1.00 80.42  ? 552 VAL B CG1   1 
ATOM   4024  C  CG2   . VAL B 1 284 ? 34.968  82.991  77.250  1.00 80.42  ? 552 VAL B CG2   1 
ATOM   4025  N  N     . ILE B 1 285 ? 36.818  83.671  73.154  1.00 85.16  ? 553 ILE B N     1 
ATOM   4026  C  CA    . ILE B 1 285 ? 37.694  83.393  72.024  1.00 85.16  ? 553 ILE B CA    1 
ATOM   4027  C  C     . ILE B 1 285 ? 38.082  84.639  71.246  1.00 85.16  ? 553 ILE B C     1 
ATOM   4028  O  O     . ILE B 1 285 ? 39.033  84.586  70.453  1.00 85.16  ? 553 ILE B O     1 
ATOM   4029  C  CB    . ILE B 1 285 ? 37.042  82.373  71.076  1.00 85.16  ? 553 ILE B CB    1 
ATOM   4030  C  CG1   . ILE B 1 285 ? 35.758  82.929  70.481  1.00 85.16  ? 553 ILE B CG1   1 
ATOM   4031  C  CG2   . ILE B 1 285 ? 36.730  81.104  71.818  1.00 85.16  ? 553 ILE B CG2   1 
ATOM   4032  C  CD1   . ILE B 1 285 ? 35.203  82.060  69.402  1.00 85.16  ? 553 ILE B CD1   1 
ATOM   4033  N  N     . GLY B 1 286 ? 37.393  85.756  71.444  1.00 83.39  ? 554 GLY B N     1 
ATOM   4034  C  CA    . GLY B 1 286 ? 37.720  86.959  70.707  1.00 83.39  ? 554 GLY B CA    1 
ATOM   4035  C  C     . GLY B 1 286 ? 38.787  87.811  71.357  1.00 83.39  ? 554 GLY B C     1 
ATOM   4036  O  O     . GLY B 1 286 ? 39.835  88.057  70.756  1.00 83.39  ? 554 GLY B O     1 
ATOM   4037  N  N     . GLY B 1 287 ? 38.543  88.257  72.586  1.00 83.28  ? 555 GLY B N     1 
ATOM   4038  C  CA    . GLY B 1 287 ? 39.455  89.163  73.253  1.00 83.28  ? 555 GLY B CA    1 
ATOM   4039  C  C     . GLY B 1 287 ? 38.764  90.205  74.108  1.00 83.28  ? 555 GLY B C     1 
ATOM   4040  O  O     . GLY B 1 287 ? 38.013  89.862  75.023  1.00 83.28  ? 555 GLY B O     1 
ATOM   4041  N  N     . LEU B 1 288 ? 39.025  91.482  73.837  1.00 83.84  ? 556 LEU B N     1 
ATOM   4042  C  CA    . LEU B 1 288 ? 38.417  92.589  74.568  1.00 83.84  ? 556 LEU B CA    1 
ATOM   4043  C  C     . LEU B 1 288 ? 37.753  93.521  73.572  1.00 83.84  ? 556 LEU B C     1 
ATOM   4044  O  O     . LEU B 1 288 ? 38.440  94.219  72.822  1.00 83.84  ? 556 LEU B O     1 
ATOM   4045  C  CB    . LEU B 1 288 ? 39.452  93.348  75.388  1.00 83.84  ? 556 LEU B CB    1 
ATOM   4046  C  CG    . LEU B 1 288 ? 40.003  92.665  76.627  1.00 83.84  ? 556 LEU B CG    1 
ATOM   4047  C  CD1   . LEU B 1 288 ? 41.164  93.462  77.181  1.00 83.84  ? 556 LEU B CD1   1 
ATOM   4048  C  CD2   . LEU B 1 288 ? 38.890  92.568  77.637  1.00 83.84  ? 556 LEU B CD2   1 
ATOM   4049  N  N     . GLU B 1 289 ? 36.425  93.538  73.569  1.00 87.76  ? 557 GLU B N     1 
ATOM   4050  C  CA    . GLU B 1 289 ? 35.663  94.422  72.692  1.00 87.76  ? 557 GLU B CA    1 
ATOM   4051  C  C     . GLU B 1 289 ? 35.831  95.845  73.188  1.00 87.76  ? 557 GLU B C     1 
ATOM   4052  O  O     . GLU B 1 289 ? 35.188  96.262  74.152  1.00 87.76  ? 557 GLU B O     1 
ATOM   4053  C  CB    . GLU B 1 289 ? 34.195  94.014  72.670  1.00 87.76  ? 557 GLU B CB    1 
ATOM   4054  C  CG    . GLU B 1 289 ? 33.326  94.855  71.749  1.00 87.76  ? 557 GLU B CG    1 
ATOM   4055  C  CD    . GLU B 1 289 ? 31.884  94.387  71.730  1.00 87.76  ? 557 GLU B CD    1 
ATOM   4056  O  OE1   . GLU B 1 289 ? 31.566  93.421  72.453  1.00 87.76  ? 557 GLU B OE1   1 
ATOM   4057  O  OE2   . GLU B 1 289 ? 31.067  94.982  70.996  1.00 87.76  ? 557 GLU B OE2   1 
ATOM   4058  N  N     . LYS B 1 290 ? 36.709  96.599  72.538  1.00 87.10  ? 558 LYS B N     1 
ATOM   4059  C  CA    . LYS B 1 290 ? 37.047  97.941  72.979  1.00 87.10  ? 558 LYS B CA    1 
ATOM   4060  C  C     . LYS B 1 290 ? 36.643  98.961  71.924  1.00 87.10  ? 558 LYS B C     1 
ATOM   4061  O  O     . LYS B 1 290 ? 36.923  98.786  70.735  1.00 87.10  ? 558 LYS B O     1 
ATOM   4062  C  CB    . LYS B 1 290 ? 38.537  98.028  73.335  1.00 87.10  ? 558 LYS B CB    1 
ATOM   4063  C  CG    . LYS B 1 290 ? 39.512  97.621  72.255  1.00 87.10  ? 558 LYS B CG    1 
ATOM   4064  C  CD    . LYS B 1 290 ? 40.941  97.717  72.761  1.00 87.10  ? 558 LYS B CD    1 
ATOM   4065  C  CE    . LYS B 1 290 ? 41.258  96.617  73.746  1.00 87.10  ? 558 LYS B CE    1 
ATOM   4066  N  NZ    . LYS B 1 290 ? 41.241  95.283  73.092  1.00 87.10  ? 558 LYS B NZ    1 
ATOM   4067  N  N     . LYS B 1 291 ? 35.947  100.007 72.367  1.00 90.13  ? 559 LYS B N     1 
ATOM   4068  C  CA    . LYS B 1 291 ? 35.438  101.049 71.489  1.00 90.13  ? 559 LYS B CA    1 
ATOM   4069  C  C     . LYS B 1 291 ? 36.349  102.268 71.439  1.00 90.13  ? 559 LYS B C     1 
ATOM   4070  O  O     . LYS B 1 291 ? 36.325  103.007 70.447  1.00 90.13  ? 559 LYS B O     1 
ATOM   4071  C  CB    . LYS B 1 291 ? 34.024  101.452 71.946  1.00 90.13  ? 559 LYS B CB    1 
ATOM   4072  C  CG    . LYS B 1 291 ? 33.209  102.346 70.998  1.00 90.13  ? 559 LYS B CG    1 
ATOM   4073  C  CD    . LYS B 1 291 ? 33.264  103.824 71.395  1.00 90.13  ? 559 LYS B CD    1 
ATOM   4074  C  CE    . LYS B 1 291 ? 32.352  104.678 70.531  1.00 90.13  ? 559 LYS B CE    1 
ATOM   4075  N  NZ    . LYS B 1 291 ? 32.799  104.710 69.111  1.00 90.13  ? 559 LYS B NZ    1 
ATOM   4076  N  N     . THR B 1 292 ? 37.182  102.468 72.458  1.00 89.93  ? 560 THR B N     1 
ATOM   4077  C  CA    . THR B 1 292 ? 38.024  103.654 72.553  1.00 89.93  ? 560 THR B CA    1 
ATOM   4078  C  C     . THR B 1 292 ? 39.186  103.661 71.573  1.00 89.93  ? 560 THR B C     1 
ATOM   4079  O  O     . THR B 1 292 ? 39.938  104.641 71.569  1.00 89.93  ? 560 THR B O     1 
ATOM   4080  C  CB    . THR B 1 292 ? 38.576  103.795 73.971  1.00 89.93  ? 560 THR B CB    1 
ATOM   4081  O  OG1   . THR B 1 292 ? 39.377  102.650 74.290  1.00 89.93  ? 560 THR B OG1   1 
ATOM   4082  C  CG2   . THR B 1 292 ? 37.447  103.909 74.972  1.00 89.93  ? 560 THR B CG2   1 
ATOM   4083  N  N     . GLN B 1 293 ? 39.375  102.613 70.775  1.00 87.10  ? 561 GLN B N     1 
ATOM   4084  C  CA    . GLN B 1 293 ? 40.442  102.617 69.786  1.00 87.10  ? 561 GLN B CA    1 
ATOM   4085  C  C     . GLN B 1 293 ? 40.140  103.605 68.674  1.00 87.10  ? 561 GLN B C     1 
ATOM   4086  O  O     . GLN B 1 293 ? 39.003  103.715 68.207  1.00 87.10  ? 561 GLN B O     1 
ATOM   4087  C  CB    . GLN B 1 293 ? 40.641  101.229 69.191  1.00 87.10  ? 561 GLN B CB    1 
ATOM   4088  C  CG    . GLN B 1 293 ? 41.191  100.229 70.160  1.00 87.10  ? 561 GLN B CG    1 
ATOM   4089  C  CD    . GLN B 1 293 ? 42.564  100.604 70.671  1.00 87.10  ? 561 GLN B CD    1 
ATOM   4090  O  OE1   . GLN B 1 293 ? 42.724  100.979 71.831  1.00 87.10  ? 561 GLN B OE1   1 
ATOM   4091  N  NE2   . GLN B 1 293 ? 43.565  100.497 69.808  1.00 87.10  ? 561 GLN B NE2   1 
ATOM   4092  N  N     . VAL B 1 294 ? 41.166  104.330 68.256  1.00 82.31  ? 562 VAL B N     1 
ATOM   4093  C  CA    . VAL B 1 294 ? 41.039  105.263 67.151  1.00 82.31  ? 562 VAL B CA    1 
ATOM   4094  C  C     . VAL B 1 294 ? 41.472  104.566 65.869  1.00 82.31  ? 562 VAL B C     1 
ATOM   4095  O  O     . VAL B 1 294 ? 42.463  103.826 65.844  1.00 82.31  ? 562 VAL B O     1 
ATOM   4096  C  CB    . VAL B 1 294 ? 41.832  106.559 67.420  1.00 82.31  ? 562 VAL B CB    1 
ATOM   4097  C  CG1   . VAL B 1 294 ? 43.303  106.301 67.670  1.00 82.31  ? 562 VAL B CG1   1 
ATOM   4098  C  CG2   . VAL B 1 294 ? 41.657  107.555 66.283  1.00 82.31  ? 562 VAL B CG2   1 
ATOM   4099  N  N     . LEU B 1 295 ? 40.662  104.719 64.832  1.00 83.89  ? 563 LEU B N     1 
ATOM   4100  C  CA    . LEU B 1 295 ? 40.988  104.262 63.495  1.00 83.89  ? 563 LEU B CA    1 
ATOM   4101  C  C     . LEU B 1 295 ? 40.549  105.331 62.518  1.00 83.89  ? 563 LEU B C     1 
ATOM   4102  O  O     . LEU B 1 295 ? 39.468  105.907 62.664  1.00 83.89  ? 563 LEU B O     1 
ATOM   4103  C  CB    . LEU B 1 295 ? 40.305  102.942 63.155  1.00 83.89  ? 563 LEU B CB    1 
ATOM   4104  C  CG    . LEU B 1 295 ? 40.820  101.696 63.861  1.00 83.89  ? 563 LEU B CG    1 
ATOM   4105  C  CD1   . LEU B 1 295 ? 39.977  100.494 63.495  1.00 83.89  ? 563 LEU B CD1   1 
ATOM   4106  C  CD2   . LEU B 1 295 ? 42.261  101.478 63.468  1.00 83.89  ? 563 LEU B CD2   1 
ATOM   4107  N  N     . GLN B 1 296 ? 41.398  105.606 61.542  1.00 84.26  ? 564 GLN B N     1 
ATOM   4108  C  CA    . GLN B 1 296 ? 41.052  106.567 60.519  1.00 84.26  ? 564 GLN B CA    1 
ATOM   4109  C  C     . GLN B 1 296 ? 39.934  106.002 59.643  1.00 84.26  ? 564 GLN B C     1 
ATOM   4110  O  O     . GLN B 1 296 ? 39.781  104.783 59.534  1.00 84.26  ? 564 GLN B O     1 
ATOM   4111  C  CB    . GLN B 1 296 ? 42.279  106.894 59.674  1.00 84.26  ? 564 GLN B CB    1 
ATOM   4112  C  CG    . GLN B 1 296 ? 43.417  107.509 60.468  1.00 84.26  ? 564 GLN B CG    1 
ATOM   4113  C  CD    . GLN B 1 296 ? 43.066  108.867 61.039  1.00 84.26  ? 564 GLN B CD    1 
ATOM   4114  O  OE1   . GLN B 1 296 ? 42.399  109.674 60.394  1.00 84.26  ? 564 GLN B OE1   1 
ATOM   4115  N  NE2   . GLN B 1 296 ? 43.520  109.127 62.257  1.00 84.26  ? 564 GLN B NE2   1 
ATOM   4116  N  N     . PRO B 1 297 ? 39.131  106.867 59.011  1.00 84.29  ? 565 PRO B N     1 
ATOM   4117  C  CA    . PRO B 1 297 ? 38.077  106.372 58.109  1.00 84.29  ? 565 PRO B CA    1 
ATOM   4118  C  C     . PRO B 1 297 ? 38.588  105.681 56.852  1.00 84.29  ? 565 PRO B C     1 
ATOM   4119  O  O     . PRO B 1 297 ? 37.770  105.136 56.102  1.00 84.29  ? 565 PRO B O     1 
ATOM   4120  C  CB    . PRO B 1 297 ? 37.298  107.643 57.754  1.00 84.29  ? 565 PRO B CB    1 
ATOM   4121  C  CG    . PRO B 1 297 ? 37.545  108.556 58.888  1.00 84.29  ? 565 PRO B CG    1 
ATOM   4122  C  CD    . PRO B 1 297 ? 38.952  108.296 59.317  1.00 84.29  ? 565 PRO B CD    1 
ATOM   4123  N  N     . GLU B 1 298 ? 39.892  105.693 56.588  1.00 81.18  ? 566 GLU B N     1 
ATOM   4124  C  CA    . GLU B 1 298 ? 40.459  104.849 55.550  1.00 81.18  ? 566 GLU B CA    1 
ATOM   4125  C  C     . GLU B 1 298 ? 40.914  103.499 56.091  1.00 81.18  ? 566 GLU B C     1 
ATOM   4126  O  O     . GLU B 1 298 ? 40.805  102.490 55.386  1.00 81.18  ? 566 GLU B O     1 
ATOM   4127  C  CB    . GLU B 1 298 ? 41.626  105.574 54.873  1.00 81.18  ? 566 GLU B CB    1 
ATOM   4128  C  CG    . GLU B 1 298 ? 42.244  104.837 53.692  1.00 81.18  ? 566 GLU B CG    1 
ATOM   4129  C  CD    . GLU B 1 298 ? 41.296  104.697 52.513  1.00 81.18  ? 566 GLU B CD    1 
ATOM   4130  O  OE1   . GLU B 1 298 ? 40.423  105.573 52.332  1.00 81.18  ? 566 GLU B OE1   1 
ATOM   4131  O  OE2   . GLU B 1 298 ? 41.419  103.703 51.767  1.00 81.18  ? 566 GLU B OE2   1 
ATOM   4132  N  N     . GLU B 1 299 ? 41.387  103.438 57.333  1.00 81.33  ? 567 GLU B N     1 
ATOM   4133  C  CA    . GLU B 1 299 ? 41.825  102.158 57.870  1.00 81.33  ? 567 GLU B CA    1 
ATOM   4134  C  C     . GLU B 1 299 ? 40.689  101.311 58.426  1.00 81.33  ? 567 GLU B C     1 
ATOM   4135  O  O     . GLU B 1 299 ? 40.916  100.138 58.729  1.00 81.33  ? 567 GLU B O     1 
ATOM   4136  C  CB    . GLU B 1 299 ? 42.883  102.358 58.950  1.00 81.33  ? 567 GLU B CB    1 
ATOM   4137  C  CG    . GLU B 1 299 ? 44.224  102.811 58.413  1.00 81.33  ? 567 GLU B CG    1 
ATOM   4138  C  CD    . GLU B 1 299 ? 45.265  102.966 59.501  1.00 81.33  ? 567 GLU B CD    1 
ATOM   4139  O  OE1   . GLU B 1 299 ? 44.909  102.835 60.691  1.00 81.33  ? 567 GLU B OE1   1 
ATOM   4140  O  OE2   . GLU B 1 299 ? 46.441  103.221 59.167  1.00 81.33  ? 567 GLU B OE2   1 
ATOM   4141  N  N     . LYS B 1 300 ? 39.485  101.861 58.584  1.00 76.74  ? 568 LYS B N     1 
ATOM   4142  C  CA    . LYS B 1 300 ? 38.332  100.994 58.794  1.00 76.74  ? 568 LYS B CA    1 
ATOM   4143  C  C     . LYS B 1 300 ? 37.798  100.462 57.479  1.00 76.74  ? 568 LYS B C     1 
ATOM   4144  O  O     . LYS B 1 300 ? 37.291  99.339  57.430  1.00 76.74  ? 568 LYS B O     1 
ATOM   4145  C  CB    . LYS B 1 300 ? 37.209  101.722 59.530  1.00 76.74  ? 568 LYS B CB    1 
ATOM   4146  C  CG    . LYS B 1 300 ? 37.450  101.942 60.999  1.00 76.74  ? 568 LYS B CG    1 
ATOM   4147  C  CD    . LYS B 1 300 ? 36.251  102.614 61.640  1.00 76.74  ? 568 LYS B CD    1 
ATOM   4148  C  CE    . LYS B 1 300 ? 36.494  102.883 63.114  1.00 76.74  ? 568 LYS B CE    1 
ATOM   4149  N  NZ    . LYS B 1 300 ? 35.342  103.583 63.743  1.00 76.74  ? 568 LYS B NZ    1 
ATOM   4150  N  N     . LYS B 1 301 ? 37.899  101.254 56.413  1.00 74.98  ? 569 LYS B N     1 
ATOM   4151  C  CA    . LYS B 1 301 ? 37.413  100.823 55.112  1.00 74.98  ? 569 LYS B CA    1 
ATOM   4152  C  C     . LYS B 1 301 ? 38.281  99.710  54.547  1.00 74.98  ? 569 LYS B C     1 
ATOM   4153  O  O     . LYS B 1 301 ? 37.800  98.877  53.773  1.00 74.98  ? 569 LYS B O     1 
ATOM   4154  C  CB    . LYS B 1 301 ? 37.362  102.023 54.168  1.00 74.98  ? 569 LYS B CB    1 
ATOM   4155  C  CG    . LYS B 1 301 ? 36.716  101.770 52.826  1.00 74.98  ? 569 LYS B CG    1 
ATOM   4156  C  CD    . LYS B 1 301 ? 36.581  103.056 52.040  1.00 74.98  ? 569 LYS B CD    1 
ATOM   4157  C  CE    . LYS B 1 301 ? 37.926  103.525 51.525  1.00 74.98  ? 569 LYS B CE    1 
ATOM   4158  N  NZ    . LYS B 1 301 ? 37.800  104.722 50.648  1.00 74.98  ? 569 LYS B NZ    1 
ATOM   4159  N  N     . THR B 1 302 ? 39.550  99.655  54.952  1.00 73.15  ? 570 THR B N     1 
ATOM   4160  C  CA    . THR B 1 302 ? 40.415  98.563  54.523  1.00 73.15  ? 570 THR B CA    1 
ATOM   4161  C  C     . THR B 1 302 ? 40.087  97.276  55.270  1.00 73.15  ? 570 THR B C     1 
ATOM   4162  O  O     . THR B 1 302 ? 40.050  96.198  54.669  1.00 73.15  ? 570 THR B O     1 
ATOM   4163  C  CB    . THR B 1 302 ? 41.878  98.953  54.723  1.00 73.15  ? 570 THR B CB    1 
ATOM   4164  O  OG1   . THR B 1 302 ? 42.149  100.154 53.994  1.00 73.15  ? 570 THR B OG1   1 
ATOM   4165  C  CG2   . THR B 1 302 ? 42.803  97.868  54.215  1.00 73.15  ? 570 THR B CG2   1 
ATOM   4166  N  N     . VAL B 1 303 ? 39.815  97.373  56.572  1.00 72.15  ? 571 VAL B N     1 
ATOM   4167  C  CA    . VAL B 1 303 ? 39.501  96.189  57.369  1.00 72.15  ? 571 VAL B CA    1 
ATOM   4168  C  C     . VAL B 1 303 ? 38.119  95.647  57.016  1.00 72.15  ? 571 VAL B C     1 
ATOM   4169  O  O     . VAL B 1 303 ? 37.909  94.428  56.964  1.00 72.15  ? 571 VAL B O     1 
ATOM   4170  C  CB    . VAL B 1 303 ? 39.633  96.527  58.865  1.00 72.15  ? 571 VAL B CB    1 
ATOM   4171  C  CG1   . VAL B 1 303 ? 39.182  95.382  59.746  1.00 72.15  ? 571 VAL B CG1   1 
ATOM   4172  C  CG2   . VAL B 1 303 ? 41.063  96.851  59.180  1.00 72.15  ? 571 VAL B CG2   1 
ATOM   4173  N  N     . ALA B 1 304 ? 37.165  96.535  56.729  1.00 70.73  ? 572 ALA B N     1 
ATOM   4174  C  CA    . ALA B 1 304 ? 35.826  96.091  56.357  1.00 70.73  ? 572 ALA B CA    1 
ATOM   4175  C  C     . ALA B 1 304 ? 35.822  95.417  54.993  1.00 70.73  ? 572 ALA B C     1 
ATOM   4176  O  O     . ALA B 1 304 ? 35.143  94.405  54.802  1.00 70.73  ? 572 ALA B O     1 
ATOM   4177  C  CB    . ALA B 1 304 ? 34.857  97.267  56.370  1.00 70.73  ? 572 ALA B CB    1 
ATOM   4178  N  N     . TYR B 1 305 ? 36.589  95.943  54.037  1.00 71.12  ? 573 TYR B N     1 
ATOM   4179  C  CA    . TYR B 1 305 ? 36.721  95.244  52.768  1.00 71.12  ? 573 TYR B CA    1 
ATOM   4180  C  C     . TYR B 1 305 ? 37.583  94.001  52.894  1.00 71.12  ? 573 TYR B C     1 
ATOM   4181  O  O     . TYR B 1 305 ? 37.499  93.118  52.038  1.00 71.12  ? 573 TYR B O     1 
ATOM   4182  C  CB    . TYR B 1 305 ? 37.304  96.145  51.680  1.00 71.12  ? 573 TYR B CB    1 
ATOM   4183  C  CG    . TYR B 1 305 ? 36.366  97.188  51.115  1.00 71.12  ? 573 TYR B CG    1 
ATOM   4184  C  CD1   . TYR B 1 305 ? 35.049  97.234  51.485  1.00 71.12  ? 573 TYR B CD1   1 
ATOM   4185  C  CD2   . TYR B 1 305 ? 36.797  98.089  50.161  1.00 71.12  ? 573 TYR B CD2   1 
ATOM   4186  C  CE1   . TYR B 1 305 ? 34.182  98.167  50.961  1.00 71.12  ? 573 TYR B CE1   1 
ATOM   4187  C  CE2   . TYR B 1 305 ? 35.944  99.033  49.623  1.00 71.12  ? 573 TYR B CE2   1 
ATOM   4188  C  CZ    . TYR B 1 305 ? 34.632  99.064  50.029  1.00 71.12  ? 573 TYR B CZ    1 
ATOM   4189  O  OH    . TYR B 1 305 ? 33.774  99.997  49.500  1.00 71.12  ? 573 TYR B OH    1 
ATOM   4190  N  N     . HIS B 1 306 ? 38.407  93.908  53.936  1.00 70.08  ? 574 HIS B N     1 
ATOM   4191  C  CA    . HIS B 1 306 ? 39.202  92.705  54.140  1.00 70.08  ? 574 HIS B CA    1 
ATOM   4192  C  C     . HIS B 1 306 ? 38.331  91.555  54.612  1.00 70.08  ? 574 HIS B C     1 
ATOM   4193  O  O     . HIS B 1 306 ? 38.243  90.516  53.954  1.00 70.08  ? 574 HIS B O     1 
ATOM   4194  C  CB    . HIS B 1 306 ? 40.317  92.976  55.146  1.00 70.08  ? 574 HIS B CB    1 
ATOM   4195  C  CG    . HIS B 1 306 ? 41.180  91.789  55.426  1.00 70.08  ? 574 HIS B CG    1 
ATOM   4196  N  ND1   . HIS B 1 306 ? 42.115  91.321  54.532  1.00 70.08  ? 574 HIS B ND1   1 
ATOM   4197  C  CD2   . HIS B 1 306 ? 41.255  90.978  56.506  1.00 70.08  ? 574 HIS B CD2   1 
ATOM   4198  C  CE1   . HIS B 1 306 ? 42.724  90.269  55.046  1.00 70.08  ? 574 HIS B CE1   1 
ATOM   4199  N  NE2   . HIS B 1 306 ? 42.226  90.043  56.246  1.00 70.08  ? 574 HIS B NE2   1 
ATOM   4200  N  N     . GLN B 1 307 ? 37.658  91.729  55.741  1.00 74.82  ? 575 GLN B N     1 
ATOM   4201  C  CA    . GLN B 1 307 ? 36.941  90.615  56.341  1.00 74.82  ? 575 GLN B CA    1 
ATOM   4202  C  C     . GLN B 1 307 ? 35.561  90.382  55.754  1.00 74.82  ? 575 GLN B C     1 
ATOM   4203  O  O     . GLN B 1 307 ? 34.853  89.494  56.229  1.00 74.82  ? 575 GLN B O     1 
ATOM   4204  C  CB    . GLN B 1 307 ? 36.843  90.807  57.844  1.00 74.82  ? 575 GLN B CB    1 
ATOM   4205  C  CG    . GLN B 1 307 ? 38.186  90.693  58.468  1.00 74.82  ? 575 GLN B CG    1 
ATOM   4206  C  CD    . GLN B 1 307 ? 38.139  90.747  59.952  1.00 74.82  ? 575 GLN B CD    1 
ATOM   4207  O  OE1   . GLN B 1 307 ? 37.083  90.937  60.545  1.00 74.82  ? 575 GLN B OE1   1 
ATOM   4208  N  NE2   . GLN B 1 307 ? 39.289  90.569  60.576  1.00 74.82  ? 575 GLN B NE2   1 
ATOM   4209  N  N     . ALA B 1 308 ? 35.154  91.144  54.747  1.00 69.58  ? 576 ALA B N     1 
ATOM   4210  C  CA    . ALA B 1 308 ? 34.068  90.671  53.909  1.00 69.58  ? 576 ALA B CA    1 
ATOM   4211  C  C     . ALA B 1 308 ? 34.571  89.649  52.910  1.00 69.58  ? 576 ALA B C     1 
ATOM   4212  O  O     . ALA B 1 308 ? 33.801  88.803  52.450  1.00 69.58  ? 576 ALA B O     1 
ATOM   4213  C  CB    . ALA B 1 308 ? 33.405  91.828  53.174  1.00 69.58  ? 576 ALA B CB    1 
ATOM   4214  N  N     . GLY B 1 309 ? 35.857  89.714  52.568  1.00 67.95  ? 577 GLY B N     1 
ATOM   4215  C  CA    . GLY B 1 309 ? 36.456  88.722  51.701  1.00 67.95  ? 577 GLY B CA    1 
ATOM   4216  C  C     . GLY B 1 309 ? 36.640  87.376  52.355  1.00 67.95  ? 577 GLY B C     1 
ATOM   4217  O  O     . GLY B 1 309 ? 36.703  86.365  51.655  1.00 67.95  ? 577 GLY B O     1 
ATOM   4218  N  N     . HIS B 1 310 ? 36.743  87.338  53.680  1.00 69.44  ? 578 HIS B N     1 
ATOM   4219  C  CA    . HIS B 1 310 ? 36.700  86.057  54.364  1.00 69.44  ? 578 HIS B CA    1 
ATOM   4220  C  C     . HIS B 1 310 ? 35.276  85.551  54.510  1.00 69.44  ? 578 HIS B C     1 
ATOM   4221  O  O     . HIS B 1 310 ? 35.059  84.340  54.594  1.00 69.44  ? 578 HIS B O     1 
ATOM   4222  C  CB    . HIS B 1 310 ? 37.333  86.155  55.747  1.00 69.44  ? 578 HIS B CB    1 
ATOM   4223  C  CG    . HIS B 1 310 ? 38.793  86.467  55.729  1.00 69.44  ? 578 HIS B CG    1 
ATOM   4224  N  ND1   . HIS B 1 310 ? 39.741  85.570  55.296  1.00 69.44  ? 578 HIS B ND1   1 
ATOM   4225  C  CD2   . HIS B 1 310 ? 39.471  87.566  56.132  1.00 69.44  ? 578 HIS B CD2   1 
ATOM   4226  C  CE1   . HIS B 1 310 ? 40.940  86.112  55.409  1.00 69.44  ? 578 HIS B CE1   1 
ATOM   4227  N  NE2   . HIS B 1 310 ? 40.804  87.321  55.918  1.00 69.44  ? 578 HIS B NE2   1 
ATOM   4228  N  N     . ALA B 1 311 ? 34.301  86.457  54.549  1.00 71.41  ? 579 ALA B N     1 
ATOM   4229  C  CA    . ALA B 1 311 ? 32.922  86.060  54.792  1.00 71.41  ? 579 ALA B CA    1 
ATOM   4230  C  C     . ALA B 1 311 ? 32.267  85.508  53.539  1.00 71.41  ? 579 ALA B C     1 
ATOM   4231  O  O     . ALA B 1 311 ? 31.554  84.504  53.603  1.00 71.41  ? 579 ALA B O     1 
ATOM   4232  C  CB    . ALA B 1 311 ? 32.124  87.245  55.325  1.00 71.41  ? 579 ALA B CB    1 
ATOM   4233  N  N     . VAL B 1 312 ? 32.492  86.151  52.395  1.00 69.01  ? 580 VAL B N     1 
ATOM   4234  C  CA    . VAL B 1 312 ? 31.889  85.689  51.153  1.00 69.01  ? 580 VAL B CA    1 
ATOM   4235  C  C     . VAL B 1 312 ? 32.563  84.415  50.656  1.00 69.01  ? 580 VAL B C     1 
ATOM   4236  O  O     . VAL B 1 312 ? 31.897  83.526  50.112  1.00 69.01  ? 580 VAL B O     1 
ATOM   4237  C  CB    . VAL B 1 312 ? 31.933  86.829  50.124  1.00 69.01  ? 580 VAL B CB    1 
ATOM   4238  C  CG1   . VAL B 1 312 ? 31.382  86.396  48.784  1.00 69.01  ? 580 VAL B CG1   1 
ATOM   4239  C  CG2   . VAL B 1 312 ? 31.125  87.988  50.644  1.00 69.01  ? 580 VAL B CG2   1 
ATOM   4240  N  N     . ALA B 1 313 ? 33.874  84.277  50.876  1.00 70.69  ? 581 ALA B N     1 
ATOM   4241  C  CA    . ALA B 1 313 ? 34.591  83.091  50.415  1.00 70.69  ? 581 ALA B CA    1 
ATOM   4242  C  C     . ALA B 1 313 ? 34.171  81.846  51.182  1.00 70.69  ? 581 ALA B C     1 
ATOM   4243  O  O     . ALA B 1 313 ? 33.956  80.791  50.581  1.00 70.69  ? 581 ALA B O     1 
ATOM   4244  C  CB    . ALA B 1 313 ? 36.095  83.307  50.537  1.00 70.69  ? 581 ALA B CB    1 
ATOM   4245  N  N     . GLY B 1 314 ? 34.013  81.952  52.501  1.00 72.34  ? 582 GLY B N     1 
ATOM   4246  C  CA    . GLY B 1 314 ? 33.447  80.850  53.258  1.00 72.34  ? 582 GLY B CA    1 
ATOM   4247  C  C     . GLY B 1 314 ? 31.970  80.622  53.006  1.00 72.34  ? 582 GLY B C     1 
ATOM   4248  O  O     . GLY B 1 314 ? 31.442  79.568  53.372  1.00 72.34  ? 582 GLY B O     1 
ATOM   4249  N  N     . TRP B 1 315 ? 31.289  81.588  52.398  1.00 77.26  ? 583 TRP B N     1 
ATOM   4250  C  CA    . TRP B 1 315 ? 29.878  81.430  52.095  1.00 77.26  ? 583 TRP B CA    1 
ATOM   4251  C  C     . TRP B 1 315 ? 29.647  80.617  50.833  1.00 77.26  ? 583 TRP B C     1 
ATOM   4252  O  O     . TRP B 1 315 ? 28.576  80.025  50.682  1.00 77.26  ? 583 TRP B O     1 
ATOM   4253  C  CB    . TRP B 1 315 ? 29.228  82.802  51.933  1.00 77.26  ? 583 TRP B CB    1 
ATOM   4254  C  CG    . TRP B 1 315 ? 27.760  82.781  51.934  1.00 77.26  ? 583 TRP B CG    1 
ATOM   4255  C  CD1   . TRP B 1 315 ? 26.937  82.794  50.859  1.00 77.26  ? 583 TRP B CD1   1 
ATOM   4256  C  CD2   . TRP B 1 315 ? 26.916  82.792  53.086  1.00 77.26  ? 583 TRP B CD2   1 
ATOM   4257  N  NE1   . TRP B 1 315 ? 25.627  82.787  51.262  1.00 77.26  ? 583 TRP B NE1   1 
ATOM   4258  C  CE2   . TRP B 1 315 ? 25.591  82.788  52.630  1.00 77.26  ? 583 TRP B CE2   1 
ATOM   4259  C  CE3   . TRP B 1 315 ? 27.156  82.795  54.460  1.00 77.26  ? 583 TRP B CE3   1 
ATOM   4260  C  CZ2   . TRP B 1 315 ? 24.512  82.787  53.495  1.00 77.26  ? 583 TRP B CZ2   1 
ATOM   4261  C  CZ3   . TRP B 1 315 ? 26.090  82.789  55.312  1.00 77.26  ? 583 TRP B CZ3   1 
ATOM   4262  C  CH2   . TRP B 1 315 ? 24.783  82.789  54.831  1.00 77.26  ? 583 TRP B CH2   1 
ATOM   4263  N  N     . TYR B 1 316 ? 30.624  80.572  49.936  1.00 71.58  ? 584 TYR B N     1 
ATOM   4264  C  CA    . TYR B 1 316 ? 30.442  80.015  48.607  1.00 71.58  ? 584 TYR B CA    1 
ATOM   4265  C  C     . TYR B 1 316 ? 31.302  78.797  48.324  1.00 71.58  ? 584 TYR B C     1 
ATOM   4266  O  O     . TYR B 1 316 ? 31.265  78.286  47.202  1.00 71.58  ? 584 TYR B O     1 
ATOM   4267  C  CB    . TYR B 1 316 ? 30.721  81.093  47.559  1.00 71.58  ? 584 TYR B CB    1 
ATOM   4268  C  CG    . TYR B 1 316 ? 29.594  82.074  47.404  1.00 71.58  ? 584 TYR B CG    1 
ATOM   4269  C  CD1   . TYR B 1 316 ? 28.284  81.688  47.623  1.00 71.58  ? 584 TYR B CD1   1 
ATOM   4270  C  CD2   . TYR B 1 316 ? 29.842  83.400  47.107  1.00 71.58  ? 584 TYR B CD2   1 
ATOM   4271  C  CE1   . TYR B 1 316 ? 27.248  82.584  47.492  1.00 71.58  ? 584 TYR B CE1   1 
ATOM   4272  C  CE2   . TYR B 1 316 ? 28.813  84.304  46.989  1.00 71.58  ? 584 TYR B CE2   1 
ATOM   4273  C  CZ    . TYR B 1 316 ? 27.521  83.890  47.183  1.00 71.58  ? 584 TYR B CZ    1 
ATOM   4274  O  OH    . TYR B 1 316 ? 26.494  84.790  47.056  1.00 71.58  ? 584 TYR B OH    1 
ATOM   4275  N  N     . LEU B 1 317 ? 32.070  78.319  49.293  1.00 77.49  ? 585 LEU B N     1 
ATOM   4276  C  CA    . LEU B 1 317 ? 32.827  77.089  49.143  1.00 77.49  ? 585 LEU B CA    1 
ATOM   4277  C  C     . LEU B 1 317 ? 32.118  75.974  49.891  1.00 77.49  ? 585 LEU B C     1 
ATOM   4278  O  O     . LEU B 1 317 ? 31.549  76.199  50.961  1.00 77.49  ? 585 LEU B O     1 
ATOM   4279  C  CB    . LEU B 1 317 ? 34.249  77.254  49.666  1.00 77.49  ? 585 LEU B CB    1 
ATOM   4280  C  CG    . LEU B 1 317 ? 35.099  78.235  48.868  1.00 77.49  ? 585 LEU B CG    1 
ATOM   4281  C  CD1   . LEU B 1 317 ? 36.412  78.431  49.559  1.00 77.49  ? 585 LEU B CD1   1 
ATOM   4282  C  CD2   . LEU B 1 317 ? 35.303  77.754  47.452  1.00 77.49  ? 585 LEU B CD2   1 
ATOM   4283  N  N     . GLU B 1 318 ? 32.151  74.772  49.317  1.00 78.31  ? 586 GLU B N     1 
ATOM   4284  C  CA    . GLU B 1 318 ? 31.349  73.678  49.851  1.00 78.31  ? 586 GLU B CA    1 
ATOM   4285  C  C     . GLU B 1 318 ? 31.907  73.166  51.171  1.00 78.31  ? 586 GLU B C     1 
ATOM   4286  O  O     . GLU B 1 318 ? 31.147  72.881  52.102  1.00 78.31  ? 586 GLU B O     1 
ATOM   4287  C  CB    . GLU B 1 318 ? 31.258  72.549  48.832  1.00 78.31  ? 586 GLU B CB    1 
ATOM   4288  C  CG    . GLU B 1 318 ? 30.380  71.398  49.272  1.00 78.31  ? 586 GLU B CG    1 
ATOM   4289  C  CD    . GLU B 1 318 ? 30.260  70.324  48.219  1.00 78.31  ? 586 GLU B CD    1 
ATOM   4290  O  OE1   . GLU B 1 318 ? 30.882  70.470  47.147  1.00 78.31  ? 586 GLU B OE1   1 
ATOM   4291  O  OE2   . GLU B 1 318 ? 29.542  69.333  48.463  1.00 78.31  ? 586 GLU B OE2   1 
ATOM   4292  N  N     . HIS B 1 319 ? 33.225  73.060  51.281  1.00 78.54  ? 587 HIS B N     1 
ATOM   4293  C  CA    . HIS B 1 319 ? 33.841  72.426  52.432  1.00 78.54  ? 587 HIS B CA    1 
ATOM   4294  C  C     . HIS B 1 319 ? 34.414  73.431  53.414  1.00 78.54  ? 587 HIS B C     1 
ATOM   4295  O  O     . HIS B 1 319 ? 35.081  73.036  54.374  1.00 78.54  ? 587 HIS B O     1 
ATOM   4296  C  CB    . HIS B 1 319 ? 34.920  71.457  51.963  1.00 78.54  ? 587 HIS B CB    1 
ATOM   4297  C  CG    . HIS B 1 319 ? 34.398  70.387  51.058  1.00 78.54  ? 587 HIS B CG    1 
ATOM   4298  N  ND1   . HIS B 1 319 ? 33.672  69.312  51.519  1.00 78.54  ? 587 HIS B ND1   1 
ATOM   4299  C  CD2   . HIS B 1 319 ? 34.471  70.245  49.714  1.00 78.54  ? 587 HIS B CD2   1 
ATOM   4300  C  CE1   . HIS B 1 319 ? 33.334  68.545  50.500  1.00 78.54  ? 587 HIS B CE1   1 
ATOM   4301  N  NE2   . HIS B 1 319 ? 33.807  69.088  49.393  1.00 78.54  ? 587 HIS B NE2   1 
ATOM   4302  N  N     . ALA B 1 320 ? 34.168  74.718  53.197  1.00 80.90  ? 588 ALA B N     1 
ATOM   4303  C  CA    . ALA B 1 320 ? 34.542  75.724  54.172  1.00 80.90  ? 588 ALA B CA    1 
ATOM   4304  C  C     . ALA B 1 320 ? 33.639  75.627  55.395  1.00 80.90  ? 588 ALA B C     1 
ATOM   4305  O  O     . ALA B 1 320 ? 32.515  75.125  55.332  1.00 80.90  ? 588 ALA B O     1 
ATOM   4306  C  CB    . ALA B 1 320 ? 34.455  77.120  53.561  1.00 80.90  ? 588 ALA B CB    1 
ATOM   4307  N  N     . ASP B 1 321 ? 34.155  76.096  56.524  1.00 88.40  ? 589 ASP B N     1 
ATOM   4308  C  CA    . ASP B 1 321 ? 33.363  76.126  57.738  1.00 88.40  ? 589 ASP B CA    1 
ATOM   4309  C  C     . ASP B 1 321 ? 32.267  77.183  57.630  1.00 88.40  ? 589 ASP B C     1 
ATOM   4310  O  O     . ASP B 1 321 ? 32.459  78.220  56.990  1.00 88.40  ? 589 ASP B O     1 
ATOM   4311  C  CB    . ASP B 1 321 ? 34.249  76.417  58.942  1.00 88.40  ? 589 ASP B CB    1 
ATOM   4312  C  CG    . ASP B 1 321 ? 35.116  75.246  59.314  1.00 88.40  ? 589 ASP B CG    1 
ATOM   4313  O  OD1   . ASP B 1 321 ? 34.699  74.100  59.056  1.00 88.40  ? 589 ASP B OD1   1 
ATOM   4314  O  OD2   . ASP B 1 321 ? 36.210  75.466  59.871  1.00 88.40  ? 589 ASP B OD2   1 
ATOM   4315  N  N     . PRO B 1 322 ? 31.100  76.934  58.226  1.00 89.65  ? 590 PRO B N     1 
ATOM   4316  C  CA    . PRO B 1 322 ? 30.022  77.926  58.172  1.00 89.65  ? 590 PRO B CA    1 
ATOM   4317  C  C     . PRO B 1 322 ? 30.345  79.157  58.998  1.00 89.65  ? 590 PRO B C     1 
ATOM   4318  O  O     . PRO B 1 322 ? 30.983  79.076  60.049  1.00 89.65  ? 590 PRO B O     1 
ATOM   4319  C  CB    . PRO B 1 322 ? 28.816  77.171  58.738  1.00 89.65  ? 590 PRO B CB    1 
ATOM   4320  C  CG    . PRO B 1 322 ? 29.405  76.104  59.578  1.00 89.65  ? 590 PRO B CG    1 
ATOM   4321  C  CD    . PRO B 1 322 ? 30.665  75.693  58.886  1.00 89.65  ? 590 PRO B CD    1 
ATOM   4322  N  N     . LEU B 1 323 ? 29.900  80.305  58.500  1.00 88.62  ? 591 LEU B N     1 
ATOM   4323  C  CA    . LEU B 1 323 ? 30.202  81.579  59.128  1.00 88.62  ? 591 LEU B CA    1 
ATOM   4324  C  C     . LEU B 1 323 ? 29.367  81.765  60.383  1.00 88.62  ? 591 LEU B C     1 
ATOM   4325  O  O     . LEU B 1 323 ? 28.175  81.457  60.402  1.00 88.62  ? 591 LEU B O     1 
ATOM   4326  C  CB    . LEU B 1 323 ? 29.936  82.721  58.153  1.00 88.62  ? 591 LEU B CB    1 
ATOM   4327  C  CG    . LEU B 1 323 ? 30.358  84.089  58.668  1.00 88.62  ? 591 LEU B CG    1 
ATOM   4328  C  CD1   . LEU B 1 323 ? 31.838  84.034  58.927  1.00 88.62  ? 591 LEU B CD1   1 
ATOM   4329  C  CD2   . LEU B 1 323 ? 30.017  85.176  57.675  1.00 88.62  ? 591 LEU B CD2   1 
ATOM   4330  N  N     . LEU B 1 324 ? 29.996  82.271  61.440  1.00 88.38  ? 592 LEU B N     1 
ATOM   4331  C  CA    . LEU B 1 324 ? 29.295  82.489  62.693  1.00 88.38  ? 592 LEU B CA    1 
ATOM   4332  C  C     . LEU B 1 324 ? 29.157  83.961  63.046  1.00 88.38  ? 592 LEU B C     1 
ATOM   4333  O  O     . LEU B 1 324 ? 28.038  84.429  63.264  1.00 88.38  ? 592 LEU B O     1 
ATOM   4334  C  CB    . LEU B 1 324 ? 30.000  81.728  63.819  1.00 88.38  ? 592 LEU B CB    1 
ATOM   4335  C  CG    . LEU B 1 324 ? 29.234  81.700  65.130  1.00 88.38  ? 592 LEU B CG    1 
ATOM   4336  C  CD1   . LEU B 1 324 ? 27.883  81.081  64.882  1.00 88.38  ? 592 LEU B CD1   1 
ATOM   4337  C  CD2   . LEU B 1 324 ? 29.993  80.888  66.148  1.00 88.38  ? 592 LEU B CD2   1 
ATOM   4338  N  N     . LYS B 1 325 ? 30.256  84.716  63.087  1.00 87.38  ? 593 LYS B N     1 
ATOM   4339  C  CA    . LYS B 1 325 ? 30.185  86.143  63.391  1.00 87.38  ? 593 LYS B CA    1 
ATOM   4340  C  C     . LYS B 1 325 ? 31.412  86.857  62.843  1.00 87.38  ? 593 LYS B C     1 
ATOM   4341  O  O     . LYS B 1 325 ? 32.537  86.393  63.044  1.00 87.38  ? 593 LYS B O     1 
ATOM   4342  C  CB    . LYS B 1 325 ? 30.075  86.379  64.899  1.00 87.38  ? 593 LYS B CB    1 
ATOM   4343  C  CG    . LYS B 1 325 ? 29.862  87.828  65.266  1.00 87.38  ? 593 LYS B CG    1 
ATOM   4344  C  CD    . LYS B 1 325 ? 29.790  88.007  66.762  1.00 87.38  ? 593 LYS B CD    1 
ATOM   4345  C  CE    . LYS B 1 325 ? 28.471  87.498  67.302  1.00 87.38  ? 593 LYS B CE    1 
ATOM   4346  N  NZ    . LYS B 1 325 ? 28.334  87.786  68.753  1.00 87.38  ? 593 LYS B NZ    1 
ATOM   4347  N  N     . VAL B 1 326 ? 31.195  87.984  62.166  1.00 83.49  ? 594 VAL B N     1 
ATOM   4348  C  CA    . VAL B 1 326 ? 32.263  88.825  61.635  1.00 83.49  ? 594 VAL B CA    1 
ATOM   4349  C  C     . VAL B 1 326 ? 32.147  90.200  62.271  1.00 83.49  ? 594 VAL B C     1 
ATOM   4350  O  O     . VAL B 1 326 ? 31.067  90.801  62.257  1.00 83.49  ? 594 VAL B O     1 
ATOM   4351  C  CB    . VAL B 1 326 ? 32.187  88.948  60.103  1.00 83.49  ? 594 VAL B CB    1 
ATOM   4352  C  CG1   . VAL B 1 326 ? 33.261  89.878  59.587  1.00 83.49  ? 594 VAL B CG1   1 
ATOM   4353  C  CG2   . VAL B 1 326 ? 32.333  87.613  59.459  1.00 83.49  ? 594 VAL B CG2   1 
ATOM   4354  N  N     . SER B 1 327 ? 33.253  90.708  62.812  1.00 83.64  ? 595 SER B N     1 
ATOM   4355  C  CA    . SER B 1 327 ? 33.264  92.044  63.383  1.00 83.64  ? 595 SER B CA    1 
ATOM   4356  C  C     . SER B 1 327 ? 34.584  92.739  63.090  1.00 83.64  ? 595 SER B C     1 
ATOM   4357  O  O     . SER B 1 327 ? 35.608  92.100  62.845  1.00 83.64  ? 595 SER B O     1 
ATOM   4358  C  CB    . SER B 1 327 ? 33.028  92.014  64.891  1.00 83.64  ? 595 SER B CB    1 
ATOM   4359  O  OG    . SER B 1 327 ? 33.146  93.312  65.441  1.00 83.64  ? 595 SER B OG    1 
ATOM   4360  N  N     . ILE B 1 328 ? 34.545  94.071  63.120  1.00 79.87  ? 596 ILE B N     1 
ATOM   4361  C  CA    . ILE B 1 328 ? 35.726  94.898  62.931  1.00 79.87  ? 596 ILE B CA    1 
ATOM   4362  C  C     . ILE B 1 328 ? 36.062  95.703  64.174  1.00 79.87  ? 596 ILE B C     1 
ATOM   4363  O  O     . ILE B 1 328 ? 36.943  96.559  64.131  1.00 79.87  ? 596 ILE B O     1 
ATOM   4364  C  CB    . ILE B 1 328 ? 35.575  95.829  61.717  1.00 79.87  ? 596 ILE B CB    1 
ATOM   4365  C  CG1   . ILE B 1 328 ? 34.413  96.784  61.940  1.00 79.87  ? 596 ILE B CG1   1 
ATOM   4366  C  CG2   . ILE B 1 328 ? 35.368  95.031  60.458  1.00 79.87  ? 596 ILE B CG2   1 
ATOM   4367  C  CD1   . ILE B 1 328 ? 34.345  97.880  60.918  1.00 79.87  ? 596 ILE B CD1   1 
ATOM   4368  N  N     . ILE B 1 329 ? 35.365  95.465  65.272  1.00 82.73  ? 597 ILE B N     1 
ATOM   4369  C  CA    . ILE B 1 329 ? 35.745  96.086  66.543  1.00 82.73  ? 597 ILE B CA    1 
ATOM   4370  C  C     . ILE B 1 329 ? 36.991  95.383  67.070  1.00 82.73  ? 597 ILE B C     1 
ATOM   4371  O  O     . ILE B 1 329 ? 37.043  94.141  67.050  1.00 82.73  ? 597 ILE B O     1 
ATOM   4372  C  CB    . ILE B 1 329 ? 34.585  96.000  67.536  1.00 82.73  ? 597 ILE B CB    1 
ATOM   4373  C  CG1   . ILE B 1 329 ? 33.387  96.776  66.996  1.00 82.73  ? 597 ILE B CG1   1 
ATOM   4374  C  CG2   . ILE B 1 329 ? 34.965  96.557  68.885  1.00 82.73  ? 597 ILE B CG2   1 
ATOM   4375  C  CD1   . ILE B 1 329 ? 32.127  96.572  67.789  1.00 82.73  ? 597 ILE B CD1   1 
ATOM   4376  N  N     . PRO B 1 330 ? 38.023  96.114  67.500  1.00 85.25  ? 598 PRO B N     1 
ATOM   4377  C  CA    . PRO B 1 330 ? 39.305  95.471  67.824  1.00 85.25  ? 598 PRO B CA    1 
ATOM   4378  C  C     . PRO B 1 330 ? 39.242  94.591  69.063  1.00 85.25  ? 598 PRO B C     1 
ATOM   4379  O  O     . PRO B 1 330 ? 38.552  94.901  70.035  1.00 85.25  ? 598 PRO B O     1 
ATOM   4380  C  CB    . PRO B 1 330 ? 40.247  96.660  68.039  1.00 85.25  ? 598 PRO B CB    1 
ATOM   4381  C  CG    . PRO B 1 330 ? 39.625  97.773  67.273  1.00 85.25  ? 598 PRO B CG    1 
ATOM   4382  C  CD    . PRO B 1 330 ? 38.155  97.578  67.417  1.00 85.25  ? 598 PRO B CD    1 
ATOM   4383  N  N     . ARG B 1 331 ? 39.970  93.466  69.006  1.00 85.63  ? 599 ARG B N     1 
ATOM   4384  C  CA    . ARG B 1 331 ? 40.027  92.471  70.083  1.00 85.63  ? 599 ARG B CA    1 
ATOM   4385  C  C     . ARG B 1 331 ? 41.487  92.166  70.386  1.00 85.63  ? 599 ARG B C     1 
ATOM   4386  O  O     . ARG B 1 331 ? 42.018  91.162  69.905  1.00 85.63  ? 599 ARG B O     1 
ATOM   4387  C  CB    . ARG B 1 331 ? 39.292  91.203  69.692  1.00 85.63  ? 599 ARG B CB    1 
ATOM   4388  C  CG    . ARG B 1 331 ? 37.845  91.387  69.389  1.00 85.63  ? 599 ARG B CG    1 
ATOM   4389  C  CD    . ARG B 1 331 ? 37.094  91.709  70.633  1.00 85.63  ? 599 ARG B CD    1 
ATOM   4390  N  NE    . ARG B 1 331 ? 35.684  91.932  70.360  1.00 85.63  ? 599 ARG B NE    1 
ATOM   4391  C  CZ    . ARG B 1 331 ? 34.755  90.993  70.444  1.00 85.63  ? 599 ARG B CZ    1 
ATOM   4392  N  NH1   . ARG B 1 331 ? 35.088  89.765  70.807  1.00 85.63  ? 599 ARG B NH1   1 
ATOM   4393  N  NH2   . ARG B 1 331 ? 33.495  91.293  70.179  1.00 85.63  ? 599 ARG B NH2   1 
ATOM   4394  N  N     . GLY B 1 332 ? 42.111  92.997  71.217  1.00 85.34  ? 600 GLY B N     1 
ATOM   4395  C  CA    . GLY B 1 332 ? 43.470  92.735  71.648  1.00 85.34  ? 600 GLY B CA    1 
ATOM   4396  C  C     . GLY B 1 332 ? 44.485  92.789  70.527  1.00 85.34  ? 600 GLY B C     1 
ATOM   4397  O  O     . GLY B 1 332 ? 44.857  93.863  70.049  1.00 85.34  ? 600 GLY B O     1 
ATOM   4398  N  N     . LYS B 1 333 ? 44.932  91.612  70.100  1.00 85.55  ? 601 LYS B N     1 
ATOM   4399  C  CA    . LYS B 1 333 ? 45.936  91.467  69.058  1.00 85.55  ? 601 LYS B CA    1 
ATOM   4400  C  C     . LYS B 1 333 ? 45.337  91.449  67.656  1.00 85.55  ? 601 LYS B C     1 
ATOM   4401  O  O     . LYS B 1 333 ? 45.958  90.901  66.739  1.00 85.55  ? 601 LYS B O     1 
ATOM   4402  C  CB    . LYS B 1 333 ? 46.752  90.190  69.279  1.00 85.55  ? 601 LYS B CB    1 
ATOM   4403  C  CG    . LYS B 1 333 ? 47.934  90.324  70.235  1.00 85.55  ? 601 LYS B CG    1 
ATOM   4404  C  CD    . LYS B 1 333 ? 47.517  90.278  71.695  1.00 85.55  ? 601 LYS B CD    1 
ATOM   4405  C  CE    . LYS B 1 333 ? 47.056  88.890  72.095  1.00 85.55  ? 601 LYS B CE    1 
ATOM   4406  N  NZ    . LYS B 1 333 ? 46.709  88.824  73.539  1.00 85.55  ? 601 LYS B NZ    1 
ATOM   4407  N  N     . GLY B 1 334 ? 44.156  92.016  67.466  1.00 88.73  ? 602 GLY B N     1 
ATOM   4408  C  CA    . GLY B 1 334 ? 43.538  92.027  66.153  1.00 88.73  ? 602 GLY B CA    1 
ATOM   4409  C  C     . GLY B 1 334 ? 42.719  93.277  65.940  1.00 88.73  ? 602 GLY B C     1 
ATOM   4410  O  O     . GLY B 1 334 ? 42.110  93.810  66.873  1.00 88.73  ? 602 GLY B O     1 
ATOM   4411  N  N     . LEU B 1 335 ? 42.712  93.754  64.695  1.00 90.25  ? 603 LEU B N     1 
ATOM   4412  C  CA    . LEU B 1 335 ? 41.858  94.881  64.337  1.00 90.25  ? 603 LEU B CA    1 
ATOM   4413  C  C     . LEU B 1 335 ? 40.418  94.436  64.144  1.00 90.25  ? 603 LEU B C     1 
ATOM   4414  O  O     . LEU B 1 335 ? 39.487  95.137  64.549  1.00 90.25  ? 603 LEU B O     1 
ATOM   4415  C  CB    . LEU B 1 335 ? 42.368  95.562  63.067  1.00 90.25  ? 603 LEU B CB    1 
ATOM   4416  C  CG    . LEU B 1 335 ? 43.387  96.699  63.170  1.00 90.25  ? 603 LEU B CG    1 
ATOM   4417  C  CD1   . LEU B 1 335 ? 42.794  97.827  63.987  1.00 90.25  ? 603 LEU B CD1   1 
ATOM   4418  C  CD2   . LEU B 1 335 ? 44.724  96.261  63.738  1.00 90.25  ? 603 LEU B CD2   1 
ATOM   4419  N  N     . GLY B 1 336 ? 40.220  93.289  63.508  1.00 90.09  ? 604 GLY B N     1 
ATOM   4420  C  CA    . GLY B 1 336 ? 38.911  92.686  63.404  1.00 90.09  ? 604 GLY B CA    1 
ATOM   4421  C  C     . GLY B 1 336 ? 39.020  91.199  63.646  1.00 90.09  ? 604 GLY B C     1 
ATOM   4422  O  O     . GLY B 1 336 ? 40.088  90.720  64.032  1.00 90.09  ? 604 GLY B O     1 
ATOM   4423  N  N     . TYR B 1 337 ? 37.938  90.462  63.409  1.00 87.44  ? 605 TYR B N     1 
ATOM   4424  C  CA    . TYR B 1 337 ? 37.948  89.008  63.501  1.00 87.44  ? 605 TYR B CA    1 
ATOM   4425  C  C     . TYR B 1 337 ? 36.743  88.476  62.748  1.00 87.44  ? 605 TYR B C     1 
ATOM   4426  O  O     . TYR B 1 337 ? 35.779  89.198  62.490  1.00 87.44  ? 605 TYR B O     1 
ATOM   4427  C  CB    . TYR B 1 337 ? 37.927  88.511  64.956  1.00 87.44  ? 605 TYR B CB    1 
ATOM   4428  C  CG    . TYR B 1 337 ? 36.673  88.874  65.703  1.00 87.44  ? 605 TYR B CG    1 
ATOM   4429  C  CD1   . TYR B 1 337 ? 36.549  90.113  66.299  1.00 87.44  ? 605 TYR B CD1   1 
ATOM   4430  C  CD2   . TYR B 1 337 ? 35.625  87.972  65.839  1.00 87.44  ? 605 TYR B CD2   1 
ATOM   4431  C  CE1   . TYR B 1 337 ? 35.418  90.460  66.978  1.00 87.44  ? 605 TYR B CE1   1 
ATOM   4432  C  CE2   . TYR B 1 337 ? 34.483  88.316  66.518  1.00 87.44  ? 605 TYR B CE2   1 
ATOM   4433  C  CZ    . TYR B 1 337 ? 34.391  89.563  67.086  1.00 87.44  ? 605 TYR B CZ    1 
ATOM   4434  O  OH    . TYR B 1 337 ? 33.268  89.932  67.769  1.00 87.44  ? 605 TYR B OH    1 
ATOM   4435  N  N     . ALA B 1 338 ? 36.801  87.190  62.427  1.00 92.53  ? 606 ALA B N     1 
ATOM   4436  C  CA    . ALA B 1 338 ? 35.669  86.476  61.847  1.00 92.53  ? 606 ALA B CA    1 
ATOM   4437  C  C     . ALA B 1 338 ? 35.547  85.163  62.608  1.00 92.53  ? 606 ALA B C     1 
ATOM   4438  O  O     . ALA B 1 338 ? 36.286  84.216  62.337  1.00 92.53  ? 606 ALA B O     1 
ATOM   4439  C  CB    . ALA B 1 338 ? 35.856  86.245  60.352  1.00 92.53  ? 606 ALA B CB    1 
ATOM   4440  N  N     . GLN B 1 339 ? 34.635  85.120  63.571  1.00 89.85  ? 607 GLN B N     1 
ATOM   4441  C  CA    . GLN B 1 339 ? 34.369  83.890  64.299  1.00 89.85  ? 607 GLN B CA    1 
ATOM   4442  C  C     . GLN B 1 339 ? 33.697  82.883  63.379  1.00 89.85  ? 607 GLN B C     1 
ATOM   4443  O  O     . GLN B 1 339 ? 32.710  83.201  62.711  1.00 89.85  ? 607 GLN B O     1 
ATOM   4444  C  CB    . GLN B 1 339 ? 33.485  84.182  65.505  1.00 89.85  ? 607 GLN B CB    1 
ATOM   4445  C  CG    . GLN B 1 339 ? 33.169  82.992  66.376  1.00 89.85  ? 607 GLN B CG    1 
ATOM   4446  C  CD    . GLN B 1 339 ? 32.335  83.391  67.574  1.00 89.85  ? 607 GLN B CD    1 
ATOM   4447  O  OE1   . GLN B 1 339 ? 31.994  84.562  67.738  1.00 89.85  ? 607 GLN B OE1   1 
ATOM   4448  N  NE2   . GLN B 1 339 ? 31.994  82.422  68.412  1.00 89.85  ? 607 GLN B NE2   1 
ATOM   4449  N  N     . TYR B 1 340 ? 34.246  81.679  63.321  1.00 89.94  ? 608 TYR B N     1 
ATOM   4450  C  CA    . TYR B 1 340 ? 33.687  80.616  62.505  1.00 89.94  ? 608 TYR B CA    1 
ATOM   4451  C  C     . TYR B 1 340 ? 33.107  79.522  63.380  1.00 89.94  ? 608 TYR B C     1 
ATOM   4452  O  O     . TYR B 1 340 ? 33.261  79.511  64.603  1.00 89.94  ? 608 TYR B O     1 
ATOM   4453  C  CB    . TYR B 1 340 ? 34.739  80.020  61.569  1.00 89.94  ? 608 TYR B CB    1 
ATOM   4454  C  CG    . TYR B 1 340 ? 35.132  80.938  60.454  1.00 89.94  ? 608 TYR B CG    1 
ATOM   4455  C  CD1   . TYR B 1 340 ? 34.328  81.076  59.335  1.00 89.94  ? 608 TYR B CD1   1 
ATOM   4456  C  CD2   . TYR B 1 340 ? 36.306  81.663  60.515  1.00 89.94  ? 608 TYR B CD2   1 
ATOM   4457  C  CE1   . TYR B 1 340 ? 34.679  81.914  58.311  1.00 89.94  ? 608 TYR B CE1   1 
ATOM   4458  C  CE2   . TYR B 1 340 ? 36.666  82.512  59.501  1.00 89.94  ? 608 TYR B CE2   1 
ATOM   4459  C  CZ    . TYR B 1 340 ? 35.846  82.634  58.401  1.00 89.94  ? 608 TYR B CZ    1 
ATOM   4460  O  OH    . TYR B 1 340 ? 36.205  83.475  57.376  1.00 89.94  ? 608 TYR B OH    1 
ATOM   4461  N  N     . LEU B 1 341 ? 32.416  78.598  62.719  1.00 91.38  ? 609 LEU B N     1 
ATOM   4462  C  CA    . LEU B 1 341 ? 31.920  77.369  63.323  1.00 91.38  ? 609 LEU B CA    1 
ATOM   4463  C  C     . LEU B 1 341 ? 32.743  76.231  62.744  1.00 91.38  ? 609 LEU B C     1 
ATOM   4464  O  O     . LEU B 1 341 ? 32.418  75.713  61.668  1.00 91.38  ? 609 LEU B O     1 
ATOM   4465  C  CB    . LEU B 1 341 ? 30.432  77.178  63.027  1.00 91.38  ? 609 LEU B CB    1 
ATOM   4466  C  CG    . LEU B 1 341 ? 29.759  75.956  63.639  1.00 91.38  ? 609 LEU B CG    1 
ATOM   4467  C  CD1   . LEU B 1 341 ? 29.825  76.049  65.133  1.00 91.38  ? 609 LEU B CD1   1 
ATOM   4468  C  CD2   . LEU B 1 341 ? 28.323  75.864  63.175  1.00 91.38  ? 609 LEU B CD2   1 
ATOM   4469  N  N     . PRO B 1 342 ? 33.843  75.840  63.386  1.00 93.64  ? 610 PRO B N     1 
ATOM   4470  C  CA    . PRO B 1 342 ? 34.679  74.767  62.833  1.00 93.64  ? 610 PRO B CA    1 
ATOM   4471  C  C     . PRO B 1 342 ? 33.981  73.418  62.899  1.00 93.64  ? 610 PRO B C     1 
ATOM   4472  O  O     . PRO B 1 342 ? 33.503  72.994  63.952  1.00 93.64  ? 610 PRO B O     1 
ATOM   4473  C  CB    . PRO B 1 342 ? 35.932  74.803  63.714  1.00 93.64  ? 610 PRO B CB    1 
ATOM   4474  C  CG    . PRO B 1 342 ? 35.493  75.451  64.972  1.00 93.64  ? 610 PRO B CG    1 
ATOM   4475  C  CD    . PRO B 1 342 ? 34.454  76.450  64.576  1.00 93.64  ? 610 PRO B CD    1 
ATOM   4476  N  N     . LYS B 1 343 ? 33.909  72.763  61.745  1.00 98.28  ? 611 LYS B N     1 
ATOM   4477  C  CA    . LYS B 1 343 ? 33.294  71.448  61.618  1.00 98.28  ? 611 LYS B CA    1 
ATOM   4478  C  C     . LYS B 1 343 ? 34.159  70.426  62.340  1.00 98.28  ? 611 LYS B C     1 
ATOM   4479  O  O     . LYS B 1 343 ? 35.233  70.058  61.855  1.00 98.28  ? 611 LYS B O     1 
ATOM   4480  C  CB    . LYS B 1 343 ? 33.144  71.097  60.144  1.00 98.28  ? 611 LYS B CB    1 
ATOM   4481  C  CG    . LYS B 1 343 ? 32.352  69.843  59.872  1.00 98.28  ? 611 LYS B CG    1 
ATOM   4482  C  CD    . LYS B 1 343 ? 32.367  69.525  58.389  1.00 98.28  ? 611 LYS B CD    1 
ATOM   4483  C  CE    . LYS B 1 343 ? 31.520  70.509  57.602  1.00 98.28  ? 611 LYS B CE    1 
ATOM   4484  N  NZ    . LYS B 1 343 ? 31.443  70.136  56.163  1.00 98.28  ? 611 LYS B NZ    1 
ATOM   4485  N  N     . GLU B 1 344 ? 33.700  69.975  63.501  1.00 101.86 ? 612 GLU B N     1 
ATOM   4486  C  CA    . GLU B 1 344 ? 34.492  69.100  64.361  1.00 101.86 ? 612 GLU B CA    1 
ATOM   4487  C  C     . GLU B 1 344 ? 34.519  67.705  63.754  1.00 101.86 ? 612 GLU B C     1 
ATOM   4488  O  O     . GLU B 1 344 ? 33.578  66.926  63.910  1.00 101.86 ? 612 GLU B O     1 
ATOM   4489  C  CB    . GLU B 1 344 ? 33.912  69.091  65.769  1.00 101.86 ? 612 GLU B CB    1 
ATOM   4490  C  CG    . GLU B 1 344 ? 34.738  68.338  66.787  1.00 101.86 ? 612 GLU B CG    1 
ATOM   4491  C  CD    . GLU B 1 344 ? 34.170  68.465  68.183  1.00 101.86 ? 612 GLU B CD    1 
ATOM   4492  O  OE1   . GLU B 1 344 ? 33.113  69.111  68.334  1.00 101.86 ? 612 GLU B OE1   1 
ATOM   4493  O  OE2   . GLU B 1 344 ? 34.779  67.927  69.129  1.00 101.86 ? 612 GLU B OE2   1 
ATOM   4494  N  N     . GLN B 1 345 ? 35.603  67.389  63.050  1.00 96.68  ? 613 GLN B N     1 
ATOM   4495  C  CA    . GLN B 1 345 ? 35.734  66.122  62.350  1.00 96.68  ? 613 GLN B CA    1 
ATOM   4496  C  C     . GLN B 1 345 ? 37.151  65.597  62.521  1.00 96.68  ? 613 GLN B C     1 
ATOM   4497  O  O     . GLN B 1 345 ? 38.021  66.261  63.089  1.00 96.68  ? 613 GLN B O     1 
ATOM   4498  C  CB    . GLN B 1 345 ? 35.368  66.270  60.870  1.00 96.68  ? 613 GLN B CB    1 
ATOM   4499  C  CG    . GLN B 1 345 ? 36.281  67.175  60.076  1.00 96.68  ? 613 GLN B CG    1 
ATOM   4500  C  CD    . GLN B 1 345 ? 35.765  67.412  58.671  1.00 96.68  ? 613 GLN B CD    1 
ATOM   4501  O  OE1   . GLN B 1 345 ? 34.733  66.874  58.283  1.00 96.68  ? 613 GLN B OE1   1 
ATOM   4502  N  NE2   . GLN B 1 345 ? 36.476  68.224  57.905  1.00 96.68  ? 613 GLN B NE2   1 
ATOM   4503  N  N     . TYR B 1 346 ? 37.377  64.380  62.024  1.00 97.85  ? 614 TYR B N     1 
ATOM   4504  C  CA    . TYR B 1 346 ? 38.638  63.682  62.218  1.00 97.85  ? 614 TYR B CA    1 
ATOM   4505  C  C     . TYR B 1 346 ? 39.473  63.544  60.956  1.00 97.85  ? 614 TYR B C     1 
ATOM   4506  O  O     . TYR B 1 346 ? 40.690  63.373  61.062  1.00 97.85  ? 614 TYR B O     1 
ATOM   4507  C  CB    . TYR B 1 346 ? 38.387  62.277  62.784  1.00 97.85  ? 614 TYR B CB    1 
ATOM   4508  C  CG    . TYR B 1 346 ? 37.938  62.247  64.226  1.00 97.85  ? 614 TYR B CG    1 
ATOM   4509  C  CD1   . TYR B 1 346 ? 38.163  63.328  65.071  1.00 97.85  ? 614 TYR B CD1   1 
ATOM   4510  C  CD2   . TYR B 1 346 ? 37.274  61.140  64.738  1.00 97.85  ? 614 TYR B CD2   1 
ATOM   4511  C  CE1   . TYR B 1 346 ? 37.750  63.298  66.391  1.00 97.85  ? 614 TYR B CE1   1 
ATOM   4512  C  CE2   . TYR B 1 346 ? 36.854  61.102  66.053  1.00 97.85  ? 614 TYR B CE2   1 
ATOM   4513  C  CZ    . TYR B 1 346 ? 37.095  62.183  66.874  1.00 97.85  ? 614 TYR B CZ    1 
ATOM   4514  O  OH    . TYR B 1 346 ? 36.677  62.144  68.184  1.00 97.85  ? 614 TYR B OH    1 
ATOM   4515  N  N     . LEU B 1 347 ? 38.863  63.599  59.779  1.00 90.59  ? 615 LEU B N     1 
ATOM   4516  C  CA    . LEU B 1 347 ? 39.577  63.412  58.528  1.00 90.59  ? 615 LEU B CA    1 
ATOM   4517  C  C     . LEU B 1 347 ? 39.378  64.618  57.628  1.00 90.59  ? 615 LEU B C     1 
ATOM   4518  O  O     . LEU B 1 347 ? 38.289  65.192  57.570  1.00 90.59  ? 615 LEU B O     1 
ATOM   4519  C  CB    . LEU B 1 347 ? 39.110  62.156  57.802  1.00 90.59  ? 615 LEU B CB    1 
ATOM   4520  C  CG    . LEU B 1 347 ? 39.368  60.855  58.553  1.00 90.59  ? 615 LEU B CG    1 
ATOM   4521  C  CD1   . LEU B 1 347 ? 38.837  59.679  57.763  1.00 90.59  ? 615 LEU B CD1   1 
ATOM   4522  C  CD2   . LEU B 1 347 ? 40.842  60.695  58.844  1.00 90.59  ? 615 LEU B CD2   1 
ATOM   4523  N  N     . TYR B 1 348 ? 40.441  64.988  56.927  1.00 82.49  ? 616 TYR B N     1 
ATOM   4524  C  CA    . TYR B 1 348 ? 40.445  66.099  55.990  1.00 82.49  ? 616 TYR B CA    1 
ATOM   4525  C  C     . TYR B 1 348 ? 40.823  65.556  54.625  1.00 82.49  ? 616 TYR B C     1 
ATOM   4526  O  O     . TYR B 1 348 ? 41.893  64.964  54.472  1.00 82.49  ? 616 TYR B O     1 
ATOM   4527  C  CB    . TYR B 1 348 ? 41.451  67.162  56.422  1.00 82.49  ? 616 TYR B CB    1 
ATOM   4528  C  CG    . TYR B 1 348 ? 41.079  67.914  57.671  1.00 82.49  ? 616 TYR B CG    1 
ATOM   4529  C  CD1   . TYR B 1 348 ? 39.760  68.037  58.062  1.00 82.49  ? 616 TYR B CD1   1 
ATOM   4530  C  CD2   . TYR B 1 348 ? 42.056  68.468  58.483  1.00 82.49  ? 616 TYR B CD2   1 
ATOM   4531  C  CE1   . TYR B 1 348 ? 39.418  68.720  59.209  1.00 82.49  ? 616 TYR B CE1   1 
ATOM   4532  C  CE2   . TYR B 1 348 ? 41.723  69.146  59.637  1.00 82.49  ? 616 TYR B CE2   1 
ATOM   4533  C  CZ    . TYR B 1 348 ? 40.400  69.265  59.993  1.00 82.49  ? 616 TYR B CZ    1 
ATOM   4534  O  OH    . TYR B 1 348 ? 40.054  69.938  61.140  1.00 82.49  ? 616 TYR B OH    1 
ATOM   4535  N  N     . THR B 1 349 ? 39.969  65.766  53.634  1.00 77.94  ? 617 THR B N     1 
ATOM   4536  C  CA    . THR B 1 349 ? 40.340  65.367  52.289  1.00 77.94  ? 617 THR B CA    1 
ATOM   4537  C  C     . THR B 1 349 ? 41.245  66.425  51.669  1.00 77.94  ? 617 THR B C     1 
ATOM   4538  O  O     . THR B 1 349 ? 41.614  67.416  52.300  1.00 77.94  ? 617 THR B O     1 
ATOM   4539  C  CB    . THR B 1 349 ? 39.107  65.146  51.422  1.00 77.94  ? 617 THR B CB    1 
ATOM   4540  O  OG1   . THR B 1 349 ? 38.467  66.399  51.179  1.00 77.94  ? 617 THR B OG1   1 
ATOM   4541  C  CG2   . THR B 1 349 ? 38.134  64.228  52.122  1.00 77.94  ? 617 THR B CG2   1 
ATOM   4542  N  N     . LYS B 1 350 ? 41.604  66.213  50.404  1.00 76.49  ? 618 LYS B N     1 
ATOM   4543  C  CA    . LYS B 1 350 ? 42.479  67.162  49.732  1.00 76.49  ? 618 LYS B CA    1 
ATOM   4544  C  C     . LYS B 1 350 ? 41.746  68.451  49.398  1.00 76.49  ? 618 LYS B C     1 
ATOM   4545  O  O     . LYS B 1 350 ? 42.344  69.530  49.448  1.00 76.49  ? 618 LYS B O     1 
ATOM   4546  C  CB    . LYS B 1 350 ? 43.067  66.535  48.469  1.00 76.49  ? 618 LYS B CB    1 
ATOM   4547  C  CG    . LYS B 1 350 ? 44.122  67.382  47.788  1.00 76.49  ? 618 LYS B CG    1 
ATOM   4548  C  CD    . LYS B 1 350 ? 44.717  66.682  46.587  1.00 76.49  ? 618 LYS B CD    1 
ATOM   4549  C  CE    . LYS B 1 350 ? 45.735  67.570  45.899  1.00 76.49  ? 618 LYS B CE    1 
ATOM   4550  N  NZ    . LYS B 1 350 ? 46.317  66.912  44.701  1.00 76.49  ? 618 LYS B NZ    1 
ATOM   4551  N  N     . GLU B 1 351 ? 40.456  68.375  49.091  1.00 76.98  ? 619 GLU B N     1 
ATOM   4552  C  CA    . GLU B 1 351 ? 39.713  69.586  48.783  1.00 76.98  ? 619 GLU B CA    1 
ATOM   4553  C  C     . GLU B 1 351 ? 39.022  70.193  49.993  1.00 76.98  ? 619 GLU B C     1 
ATOM   4554  O  O     . GLU B 1 351 ? 38.561  71.334  49.907  1.00 76.98  ? 619 GLU B O     1 
ATOM   4555  C  CB    . GLU B 1 351 ? 38.681  69.328  47.687  1.00 76.98  ? 619 GLU B CB    1 
ATOM   4556  C  CG    . GLU B 1 351 ? 37.538  68.451  48.107  1.00 76.98  ? 619 GLU B CG    1 
ATOM   4557  C  CD    . GLU B 1 351 ? 37.788  66.995  47.811  1.00 76.98  ? 619 GLU B CD    1 
ATOM   4558  O  OE1   . GLU B 1 351 ? 38.949  66.622  47.541  1.00 76.98  ? 619 GLU B OE1   1 
ATOM   4559  O  OE2   . GLU B 1 351 ? 36.812  66.222  47.837  1.00 76.98  ? 619 GLU B OE2   1 
ATOM   4560  N  N     . GLN B 1 352 ? 38.932  69.478  51.114  1.00 77.49  ? 620 GLN B N     1 
ATOM   4561  C  CA    . GLN B 1 352 ? 38.500  70.148  52.334  1.00 77.49  ? 620 GLN B CA    1 
ATOM   4562  C  C     . GLN B 1 352 ? 39.608  71.025  52.891  1.00 77.49  ? 620 GLN B C     1 
ATOM   4563  O  O     . GLN B 1 352 ? 39.333  71.986  53.615  1.00 77.49  ? 620 GLN B O     1 
ATOM   4564  C  CB    . GLN B 1 352 ? 38.049  69.140  53.386  1.00 77.49  ? 620 GLN B CB    1 
ATOM   4565  C  CG    . GLN B 1 352 ? 36.764  68.417  53.059  1.00 77.49  ? 620 GLN B CG    1 
ATOM   4566  C  CD    . GLN B 1 352 ? 36.327  67.496  54.174  1.00 77.49  ? 620 GLN B CD    1 
ATOM   4567  O  OE1   . GLN B 1 352 ? 36.970  67.417  55.217  1.00 77.49  ? 620 GLN B OE1   1 
ATOM   4568  N  NE2   . GLN B 1 352 ? 35.234  66.780  53.954  1.00 77.49  ? 620 GLN B NE2   1 
ATOM   4569  N  N     . LEU B 1 353 ? 40.862  70.703  52.573  1.00 71.96  ? 621 LEU B N     1 
ATOM   4570  C  CA    . LEU B 1 353 ? 41.979  71.580  52.880  1.00 71.96  ? 621 LEU B CA    1 
ATOM   4571  C  C     . LEU B 1 353 ? 42.150  72.673  51.841  1.00 71.96  ? 621 LEU B C     1 
ATOM   4572  O  O     . LEU B 1 353 ? 42.740  73.711  52.145  1.00 71.96  ? 621 LEU B O     1 
ATOM   4573  C  CB    . LEU B 1 353 ? 43.267  70.771  52.985  1.00 71.96  ? 621 LEU B CB    1 
ATOM   4574  C  CG    . LEU B 1 353 ? 43.301  69.765  54.128  1.00 71.96  ? 621 LEU B CG    1 
ATOM   4575  C  CD1   . LEU B 1 353 ? 44.527  68.892  54.026  1.00 71.96  ? 621 LEU B CD1   1 
ATOM   4576  C  CD2   . LEU B 1 353 ? 43.271  70.471  55.461  1.00 71.96  ? 621 LEU B CD2   1 
ATOM   4577  N  N     . LEU B 1 354 ? 41.643  72.468  50.627  1.00 73.23  ? 622 LEU B N     1 
ATOM   4578  C  CA    . LEU B 1 354 ? 41.745  73.500  49.603  1.00 73.23  ? 622 LEU B CA    1 
ATOM   4579  C  C     . LEU B 1 354 ? 40.770  74.634  49.867  1.00 73.23  ? 622 LEU B C     1 
ATOM   4580  O  O     . LEU B 1 354 ? 41.097  75.804  49.646  1.00 73.23  ? 622 LEU B O     1 
ATOM   4581  C  CB    . LEU B 1 354 ? 41.503  72.893  48.226  1.00 73.23  ? 622 LEU B CB    1 
ATOM   4582  C  CG    . LEU B 1 354 ? 41.531  73.844  47.035  1.00 73.23  ? 622 LEU B CG    1 
ATOM   4583  C  CD1   . LEU B 1 354 ? 42.866  74.538  46.949  1.00 73.23  ? 622 LEU B CD1   1 
ATOM   4584  C  CD2   . LEU B 1 354 ? 41.246  73.097  45.752  1.00 73.23  ? 622 LEU B CD2   1 
ATOM   4585  N  N     . ASP B 1 355 ? 39.574  74.314  50.355  1.00 74.43  ? 623 ASP B N     1 
ATOM   4586  C  CA    . ASP B 1 355 ? 38.588  75.353  50.600  1.00 74.43  ? 623 ASP B CA    1 
ATOM   4587  C  C     . ASP B 1 355 ? 38.913  76.180  51.833  1.00 74.43  ? 623 ASP B C     1 
ATOM   4588  O  O     . ASP B 1 355 ? 38.438  77.313  51.943  1.00 74.43  ? 623 ASP B O     1 
ATOM   4589  C  CB    . ASP B 1 355 ? 37.199  74.742  50.725  1.00 74.43  ? 623 ASP B CB    1 
ATOM   4590  C  CG    . ASP B 1 355 ? 36.675  74.237  49.404  1.00 74.43  ? 623 ASP B CG    1 
ATOM   4591  O  OD1   . ASP B 1 355 ? 37.092  74.771  48.360  1.00 74.43  ? 623 ASP B OD1   1 
ATOM   4592  O  OD2   . ASP B 1 355 ? 35.835  73.318  49.404  1.00 74.43  ? 623 ASP B OD2   1 
ATOM   4593  N  N     . ARG B 1 356 ? 39.713  75.656  52.754  1.00 74.15  ? 624 ARG B N     1 
ATOM   4594  C  CA    . ARG B 1 356 ? 40.184  76.497  53.842  1.00 74.15  ? 624 ARG B CA    1 
ATOM   4595  C  C     . ARG B 1 356 ? 41.297  77.428  53.387  1.00 74.15  ? 624 ARG B C     1 
ATOM   4596  O  O     . ARG B 1 356 ? 41.379  78.562  53.867  1.00 74.15  ? 624 ARG B O     1 
ATOM   4597  C  CB    . ARG B 1 356 ? 40.651  75.636  55.005  1.00 74.15  ? 624 ARG B CB    1 
ATOM   4598  C  CG    . ARG B 1 356 ? 39.539  74.848  55.641  1.00 74.15  ? 624 ARG B CG    1 
ATOM   4599  C  CD    . ARG B 1 356 ? 40.083  73.974  56.736  1.00 74.15  ? 624 ARG B CD    1 
ATOM   4600  N  NE    . ARG B 1 356 ? 40.628  74.769  57.825  1.00 74.15  ? 624 ARG B NE    1 
ATOM   4601  C  CZ    . ARG B 1 356 ? 41.341  74.265  58.824  1.00 74.15  ? 624 ARG B CZ    1 
ATOM   4602  N  NH1   . ARG B 1 356 ? 41.596  72.966  58.866  1.00 74.15  ? 624 ARG B NH1   1 
ATOM   4603  N  NH2   . ARG B 1 356 ? 41.800  75.061  59.779  1.00 74.15  ? 624 ARG B NH2   1 
ATOM   4604  N  N     . MET B 1 357 ? 42.156  76.978  52.469  1.00 72.43  ? 625 MET B N     1 
ATOM   4605  C  CA    . MET B 1 357 ? 43.148  77.877  51.893  1.00 72.43  ? 625 MET B CA    1 
ATOM   4606  C  C     . MET B 1 357 ? 42.497  78.920  51.008  1.00 72.43  ? 625 MET B C     1 
ATOM   4607  O  O     . MET B 1 357 ? 42.952  80.064  50.958  1.00 72.43  ? 625 MET B O     1 
ATOM   4608  C  CB    . MET B 1 357 ? 44.181  77.105  51.083  1.00 72.43  ? 625 MET B CB    1 
ATOM   4609  C  CG    . MET B 1 357 ? 45.171  76.320  51.885  1.00 72.43  ? 625 MET B CG    1 
ATOM   4610  S  SD    . MET B 1 357 ? 46.254  75.481  50.732  1.00 72.43  ? 625 MET B SD    1 
ATOM   4611  C  CE    . MET B 1 357 ? 47.064  76.889  49.998  1.00 72.43  ? 625 MET B CE    1 
ATOM   4612  N  N     . CYS B 1 358 ? 41.443  78.544  50.292  1.00 72.48  ? 626 CYS B N     1 
ATOM   4613  C  CA    . CYS B 1 358 ? 40.790  79.517  49.434  1.00 72.48  ? 626 CYS B CA    1 
ATOM   4614  C  C     . CYS B 1 358 ? 39.992  80.536  50.229  1.00 72.48  ? 626 CYS B C     1 
ATOM   4615  O  O     . CYS B 1 358 ? 39.731  81.631  49.723  1.00 72.48  ? 626 CYS B O     1 
ATOM   4616  C  CB    . CYS B 1 358 ? 39.886  78.818  48.422  1.00 72.48  ? 626 CYS B CB    1 
ATOM   4617  S  SG    . CYS B 1 358 ? 40.735  77.876  47.144  1.00 72.48  ? 626 CYS B SG    1 
ATOM   4618  N  N     . MET B 1 359 ? 39.612  80.208  51.460  1.00 74.18  ? 627 MET B N     1 
ATOM   4619  C  CA    . MET B 1 359 ? 38.919  81.147  52.326  1.00 74.18  ? 627 MET B CA    1 
ATOM   4620  C  C     . MET B 1 359 ? 39.891  82.036  53.084  1.00 74.18  ? 627 MET B C     1 
ATOM   4621  O  O     . MET B 1 359 ? 39.640  83.236  53.230  1.00 74.18  ? 627 MET B O     1 
ATOM   4622  C  CB    . MET B 1 359 ? 38.015  80.381  53.296  1.00 74.18  ? 627 MET B CB    1 
ATOM   4623  C  CG    . MET B 1 359 ? 37.159  81.224  54.223  1.00 74.18  ? 627 MET B CG    1 
ATOM   4624  S  SD    . MET B 1 359 ? 37.921  81.592  55.812  1.00 74.18  ? 627 MET B SD    1 
ATOM   4625  C  CE    . MET B 1 359 ? 37.846  79.984  56.585  1.00 74.18  ? 627 MET B CE    1 
ATOM   4626  N  N     . THR B 1 360 ? 40.991  81.461  53.577  1.00 70.75  ? 628 THR B N     1 
ATOM   4627  C  CA    . THR B 1 360 ? 41.983  82.233  54.315  1.00 70.75  ? 628 THR B CA    1 
ATOM   4628  C  C     . THR B 1 360 ? 42.691  83.230  53.409  1.00 70.75  ? 628 THR B C     1 
ATOM   4629  O  O     . THR B 1 360 ? 43.008  84.344  53.837  1.00 70.75  ? 628 THR B O     1 
ATOM   4630  C  CB    . THR B 1 360 ? 42.980  81.283  54.972  1.00 70.75  ? 628 THR B CB    1 
ATOM   4631  O  OG1   . THR B 1 360 ? 42.263  80.315  55.742  1.00 70.75  ? 628 THR B OG1   1 
ATOM   4632  C  CG2   . THR B 1 360 ? 43.896  82.017  55.908  1.00 70.75  ? 628 THR B CG2   1 
ATOM   4633  N  N     . LEU B 1 361 ? 42.889  82.879  52.141  1.00 68.01  ? 629 LEU B N     1 
ATOM   4634  C  CA    . LEU B 1 361 ? 43.380  83.844  51.168  1.00 68.01  ? 629 LEU B CA    1 
ATOM   4635  C  C     . LEU B 1 361 ? 42.338  84.875  50.771  1.00 68.01  ? 629 LEU B C     1 
ATOM   4636  O  O     . LEU B 1 361 ? 42.691  85.839  50.091  1.00 68.01  ? 629 LEU B O     1 
ATOM   4637  C  CB    . LEU B 1 361 ? 43.853  83.135  49.903  1.00 68.01  ? 629 LEU B CB    1 
ATOM   4638  C  CG    . LEU B 1 361 ? 45.135  82.323  49.962  1.00 68.01  ? 629 LEU B CG    1 
ATOM   4639  C  CD1   . LEU B 1 361 ? 45.304  81.567  48.669  1.00 68.01  ? 629 LEU B CD1   1 
ATOM   4640  C  CD2   . LEU B 1 361 ? 46.303  83.240  50.196  1.00 68.01  ? 629 LEU B CD2   1 
ATOM   4641  N  N     . GLY B 1 362 ? 41.078  84.695  51.174  1.00 68.66  ? 630 GLY B N     1 
ATOM   4642  C  CA    . GLY B 1 362 ? 40.002  85.499  50.627  1.00 68.66  ? 630 GLY B CA    1 
ATOM   4643  C  C     . GLY B 1 362 ? 40.032  86.949  51.051  1.00 68.66  ? 630 GLY B C     1 
ATOM   4644  O  O     . GLY B 1 362 ? 39.609  87.825  50.293  1.00 68.66  ? 630 GLY B O     1 
ATOM   4645  N  N     . GLY B 1 363 ? 40.523  87.225  52.257  1.00 68.55  ? 631 GLY B N     1 
ATOM   4646  C  CA    . GLY B 1 363 ? 40.599  88.603  52.708  1.00 68.55  ? 631 GLY B CA    1 
ATOM   4647  C  C     . GLY B 1 363 ? 41.626  89.410  51.943  1.00 68.55  ? 631 GLY B C     1 
ATOM   4648  O  O     . GLY B 1 363 ? 41.406  90.583  51.637  1.00 68.55  ? 631 GLY B O     1 
ATOM   4649  N  N     . ARG B 1 364 ? 42.752  88.787  51.612  1.00 68.40  ? 632 ARG B N     1 
ATOM   4650  C  CA    . ARG B 1 364 ? 43.798  89.469  50.864  1.00 68.40  ? 632 ARG B CA    1 
ATOM   4651  C  C     . ARG B 1 364 ? 43.392  89.700  49.418  1.00 68.40  ? 632 ARG B C     1 
ATOM   4652  O  O     . ARG B 1 364 ? 43.808  90.690  48.808  1.00 68.40  ? 632 ARG B O     1 
ATOM   4653  C  CB    . ARG B 1 364 ? 45.069  88.639  50.935  1.00 68.40  ? 632 ARG B CB    1 
ATOM   4654  C  CG    . ARG B 1 364 ? 46.292  89.274  50.362  1.00 68.40  ? 632 ARG B CG    1 
ATOM   4655  C  CD    . ARG B 1 364 ? 47.429  88.329  50.574  1.00 68.40  ? 632 ARG B CD    1 
ATOM   4656  N  NE    . ARG B 1 364 ? 48.669  88.808  49.997  1.00 68.40  ? 632 ARG B NE    1 
ATOM   4657  C  CZ    . ARG B 1 364 ? 49.523  89.594  50.632  1.00 68.40  ? 632 ARG B CZ    1 
ATOM   4658  N  NH1   . ARG B 1 364 ? 49.275  89.995  51.869  1.00 68.40  ? 632 ARG B NH1   1 
ATOM   4659  N  NH2   . ARG B 1 364 ? 50.635  89.961  50.033  1.00 68.40  ? 632 ARG B NH2   1 
ATOM   4660  N  N     . VAL B 1 365 ? 42.583  88.800  48.861  1.00 68.19  ? 633 VAL B N     1 
ATOM   4661  C  CA    . VAL B 1 365 ? 42.099  88.961  47.496  1.00 68.19  ? 633 VAL B CA    1 
ATOM   4662  C  C     . VAL B 1 365 ? 41.134  90.135  47.407  1.00 68.19  ? 633 VAL B C     1 
ATOM   4663  O  O     . VAL B 1 365 ? 41.192  90.939  46.468  1.00 68.19  ? 633 VAL B O     1 
ATOM   4664  C  CB    . VAL B 1 365 ? 41.454  87.647  47.024  1.00 68.19  ? 633 VAL B CB    1 
ATOM   4665  C  CG1   . VAL B 1 365 ? 40.771  87.826  45.694  1.00 68.19  ? 633 VAL B CG1   1 
ATOM   4666  C  CG2   . VAL B 1 365 ? 42.505  86.576  46.915  1.00 68.19  ? 633 VAL B CG2   1 
ATOM   4667  N  N     . SER B 1 366 ? 40.263  90.278  48.408  1.00 67.38  ? 634 SER B N     1 
ATOM   4668  C  CA    . SER B 1 366 ? 39.273  91.347  48.404  1.00 67.38  ? 634 SER B CA    1 
ATOM   4669  C  C     . SER B 1 366 ? 39.910  92.717  48.588  1.00 67.38  ? 634 SER B C     1 
ATOM   4670  O  O     . SER B 1 366 ? 39.369  93.716  48.106  1.00 67.38  ? 634 SER B O     1 
ATOM   4671  C  CB    . SER B 1 366 ? 38.245  91.097  49.497  1.00 67.38  ? 634 SER B CB    1 
ATOM   4672  O  OG    . SER B 1 366 ? 37.305  92.150  49.549  1.00 67.38  ? 634 SER B OG    1 
ATOM   4673  N  N     . GLU B 1 367 ? 41.048  92.786  49.282  1.00 71.72  ? 635 GLU B N     1 
ATOM   4674  C  CA    . GLU B 1 367 ? 41.798  94.034  49.335  1.00 71.72  ? 635 GLU B CA    1 
ATOM   4675  C  C     . GLU B 1 367 ? 42.402  94.371  47.984  1.00 71.72  ? 635 GLU B C     1 
ATOM   4676  O  O     . GLU B 1 367 ? 42.635  95.545  47.688  1.00 71.72  ? 635 GLU B O     1 
ATOM   4677  C  CB    . GLU B 1 367 ? 42.909  93.952  50.375  1.00 71.72  ? 635 GLU B CB    1 
ATOM   4678  C  CG    . GLU B 1 367 ? 42.447  93.822  51.802  1.00 71.72  ? 635 GLU B CG    1 
ATOM   4679  C  CD    . GLU B 1 367 ? 43.607  93.710  52.766  1.00 71.72  ? 635 GLU B CD    1 
ATOM   4680  O  OE1   . GLU B 1 367 ? 44.760  93.648  52.297  1.00 71.72  ? 635 GLU B OE1   1 
ATOM   4681  O  OE2   . GLU B 1 367 ? 43.370  93.671  53.989  1.00 71.72  ? 635 GLU B OE2   1 
ATOM   4682  N  N     . GLU B 1 368 ? 42.668  93.368  47.153  1.00 71.85  ? 636 GLU B N     1 
ATOM   4683  C  CA    . GLU B 1 368 ? 43.304  93.638  45.874  1.00 71.85  ? 636 GLU B CA    1 
ATOM   4684  C  C     . GLU B 1 368 ? 42.296  94.057  44.813  1.00 71.85  ? 636 GLU B C     1 
ATOM   4685  O  O     . GLU B 1 368 ? 42.616  94.884  43.953  1.00 71.85  ? 636 GLU B O     1 
ATOM   4686  C  CB    . GLU B 1 368 ? 44.093  92.410  45.428  1.00 71.85  ? 636 GLU B CB    1 
ATOM   4687  C  CG    . GLU B 1 368 ? 44.914  92.604  44.174  1.00 71.85  ? 636 GLU B CG    1 
ATOM   4688  C  CD    . GLU B 1 368 ? 45.782  91.408  43.871  1.00 71.85  ? 636 GLU B CD    1 
ATOM   4689  O  OE1   . GLU B 1 368 ? 45.749  90.448  44.664  1.00 71.85  ? 636 GLU B OE1   1 
ATOM   4690  O  OE2   . GLU B 1 368 ? 46.493  91.425  42.845  1.00 71.85  ? 636 GLU B OE2   1 
ATOM   4691  N  N     . ILE B 1 369 ? 41.077  93.524  44.865  1.00 69.35  ? 637 ILE B N     1 
ATOM   4692  C  CA    . ILE B 1 369 ? 40.073  93.853  43.858  1.00 69.35  ? 637 ILE B CA    1 
ATOM   4693  C  C     . ILE B 1 369 ? 39.502  95.244  44.093  1.00 69.35  ? 637 ILE B C     1 
ATOM   4694  O  O     . ILE B 1 369 ? 39.336  96.030  43.155  1.00 69.35  ? 637 ILE B O     1 
ATOM   4695  C  CB    . ILE B 1 369 ? 38.971  92.783  43.865  1.00 69.35  ? 637 ILE B CB    1 
ATOM   4696  C  CG1   . ILE B 1 369 ? 39.568  91.418  43.554  1.00 69.35  ? 637 ILE B CG1   1 
ATOM   4697  C  CG2   . ILE B 1 369 ? 37.882  93.116  42.867  1.00 69.35  ? 637 ILE B CG2   1 
ATOM   4698  C  CD1   . ILE B 1 369 ? 38.623  90.285  43.797  1.00 69.35  ? 637 ILE B CD1   1 
ATOM   4699  N  N     . PHE B 1 370 ? 39.211  95.574  45.347  1.00 70.71  ? 638 PHE B N     1 
ATOM   4700  C  CA    . PHE B 1 370 ? 38.564  96.838  45.665  1.00 70.71  ? 638 PHE B CA    1 
ATOM   4701  C  C     . PHE B 1 370 ? 39.531  98.012  45.650  1.00 70.71  ? 638 PHE B C     1 
ATOM   4702  O  O     . PHE B 1 370 ? 39.126  99.134  45.332  1.00 70.71  ? 638 PHE B O     1 
ATOM   4703  C  CB    . PHE B 1 370 ? 37.894  96.732  47.030  1.00 70.71  ? 638 PHE B CB    1 
ATOM   4704  C  CG    . PHE B 1 370 ? 36.662  95.878  47.037  1.00 70.71  ? 638 PHE B CG    1 
ATOM   4705  C  CD1   . PHE B 1 370 ? 35.935  95.666  45.877  1.00 70.71  ? 638 PHE B CD1   1 
ATOM   4706  C  CD2   . PHE B 1 370 ? 36.251  95.261  48.200  1.00 70.71  ? 638 PHE B CD2   1 
ATOM   4707  C  CE1   . PHE B 1 370 ? 34.806  94.879  45.890  1.00 70.71  ? 638 PHE B CE1   1 
ATOM   4708  C  CE2   . PHE B 1 370 ? 35.132  94.473  48.218  1.00 70.71  ? 638 PHE B CE2   1 
ATOM   4709  C  CZ    . PHE B 1 370 ? 34.408  94.278  47.062  1.00 70.71  ? 638 PHE B CZ    1 
ATOM   4710  N  N     . PHE B 1 371 ? 40.798  97.783  45.982  1.00 71.99  ? 639 PHE B N     1 
ATOM   4711  C  CA    . PHE B 1 371 ? 41.775  98.852  46.141  1.00 71.99  ? 639 PHE B CA    1 
ATOM   4712  C  C     . PHE B 1 371 ? 42.874  98.821  45.094  1.00 71.99  ? 639 PHE B C     1 
ATOM   4713  O  O     . PHE B 1 371 ? 43.188  99.849  44.491  1.00 71.99  ? 639 PHE B O     1 
ATOM   4714  C  CB    . PHE B 1 371 ? 42.419  98.764  47.526  1.00 71.99  ? 639 PHE B CB    1 
ATOM   4715  C  CG    . PHE B 1 371 ? 41.492  99.070  48.651  1.00 71.99  ? 639 PHE B CG    1 
ATOM   4716  C  CD1   . PHE B 1 371 ? 40.366  99.850  48.460  1.00 71.99  ? 639 PHE B CD1   1 
ATOM   4717  C  CD2   . PHE B 1 371 ? 41.741  98.556  49.906  1.00 71.99  ? 639 PHE B CD2   1 
ATOM   4718  C  CE1   . PHE B 1 371 ? 39.523  100.126 49.507  1.00 71.99  ? 639 PHE B CE1   1 
ATOM   4719  C  CE2   . PHE B 1 371 ? 40.899  98.821  50.952  1.00 71.99  ? 639 PHE B CE2   1 
ATOM   4720  C  CZ    . PHE B 1 371 ? 39.795  99.609  50.757  1.00 71.99  ? 639 PHE B CZ    1 
ATOM   4721  N  N     . GLY B 1 372 ? 43.479  97.661  44.877  1.00 73.72  ? 640 GLY B N     1 
ATOM   4722  C  CA    . GLY B 1 372 ? 44.697  97.574  44.113  1.00 73.72  ? 640 GLY B CA    1 
ATOM   4723  C  C     . GLY B 1 372 ? 45.952  97.680  44.944  1.00 73.72  ? 640 GLY B C     1 
ATOM   4724  O  O     . GLY B 1 372 ? 47.053  97.630  44.383  1.00 73.72  ? 640 GLY B O     1 
ATOM   4725  N  N     . ARG B 1 373 ? 45.825  97.825  46.257  1.00 72.70  ? 641 ARG B N     1 
ATOM   4726  C  CA    . ARG B 1 373 ? 46.961  97.928  47.154  1.00 72.70  ? 641 ARG B CA    1 
ATOM   4727  C  C     . ARG B 1 373 ? 46.948  96.757  48.119  1.00 72.70  ? 641 ARG B C     1 
ATOM   4728  O  O     . ARG B 1 373 ? 45.890  96.235  48.470  1.00 72.70  ? 641 ARG B O     1 
ATOM   4729  C  CB    . ARG B 1 373 ? 46.935  99.240  47.933  1.00 72.70  ? 641 ARG B CB    1 
ATOM   4730  C  CG    . ARG B 1 373 ? 47.119  100.468 47.072  1.00 72.70  ? 641 ARG B CG    1 
ATOM   4731  C  CD    . ARG B 1 373 ? 47.224  101.708 47.931  1.00 72.70  ? 641 ARG B CD    1 
ATOM   4732  N  NE    . ARG B 1 373 ? 46.010  101.918 48.710  1.00 72.70  ? 641 ARG B NE    1 
ATOM   4733  C  CZ    . ARG B 1 373 ? 44.948  102.584 48.272  1.00 72.70  ? 641 ARG B CZ    1 
ATOM   4734  N  NH1   . ARG B 1 373 ? 44.947  103.112 47.056  1.00 72.70  ? 641 ARG B NH1   1 
ATOM   4735  N  NH2   . ARG B 1 373 ? 43.886  102.723 49.052  1.00 72.70  ? 641 ARG B NH2   1 
ATOM   4736  N  N     . ILE B 1 374 ? 48.134  96.362  48.557  1.00 69.72  ? 642 ILE B N     1 
ATOM   4737  C  CA    . ILE B 1 374 ? 48.326  95.174  49.373  1.00 69.72  ? 642 ILE B CA    1 
ATOM   4738  C  C     . ILE B 1 374 ? 48.874  95.606  50.722  1.00 69.72  ? 642 ILE B C     1 
ATOM   4739  O  O     . ILE B 1 374 ? 49.935  96.235  50.790  1.00 69.72  ? 642 ILE B O     1 
ATOM   4740  C  CB    . ILE B 1 374 ? 49.276  94.181  48.694  1.00 69.72  ? 642 ILE B CB    1 
ATOM   4741  C  CG1   . ILE B 1 374 ? 48.666  93.674  47.392  1.00 69.72  ? 642 ILE B CG1   1 
ATOM   4742  C  CG2   . ILE B 1 374 ? 49.584  93.057  49.619  1.00 69.72  ? 642 ILE B CG2   1 
ATOM   4743  C  CD1   . ILE B 1 374 ? 47.365  92.940  47.586  1.00 69.72  ? 642 ILE B CD1   1 
ATOM   4744  N  N     . THR B 1 375 ? 48.172  95.253  51.789  1.00 68.11  ? 643 THR B N     1 
ATOM   4745  C  CA    . THR B 1 375 ? 48.524  95.708  53.122  1.00 68.11  ? 643 THR B CA    1 
ATOM   4746  C  C     . THR B 1 375 ? 49.354  94.665  53.860  1.00 68.11  ? 643 THR B C     1 
ATOM   4747  O  O     . THR B 1 375 ? 49.457  93.510  53.453  1.00 68.11  ? 643 THR B O     1 
ATOM   4748  C  CB    . THR B 1 375 ? 47.268  96.031  53.926  1.00 68.11  ? 643 THR B CB    1 
ATOM   4749  O  OG1   . THR B 1 375 ? 46.535  94.825  54.152  1.00 68.11  ? 643 THR B OG1   1 
ATOM   4750  C  CG2   . THR B 1 375 ? 46.394  96.992  53.155  1.00 68.11  ? 643 THR B CG2   1 
ATOM   4751  N  N     . THR B 1 376 ? 49.944  95.094  54.978  1.00 71.12  ? 644 THR B N     1 
ATOM   4752  C  CA    . THR B 1 376 ? 50.562  94.155  55.904  1.00 71.12  ? 644 THR B CA    1 
ATOM   4753  C  C     . THR B 1 376 ? 49.535  93.395  56.720  1.00 71.12  ? 644 THR B C     1 
ATOM   4754  O  O     . THR B 1 376 ? 49.911  92.478  57.454  1.00 71.12  ? 644 THR B O     1 
ATOM   4755  C  CB    . THR B 1 376 ? 51.513  94.861  56.861  1.00 71.12  ? 644 THR B CB    1 
ATOM   4756  O  OG1   . THR B 1 376 ? 50.790  95.841  57.611  1.00 71.12  ? 644 THR B OG1   1 
ATOM   4757  C  CG2   . THR B 1 376 ? 52.625  95.527  56.108  1.00 71.12  ? 644 THR B CG2   1 
ATOM   4758  N  N     . GLY B 1 377 ? 48.264  93.776  56.641  1.00 68.97  ? 645 GLY B N     1 
ATOM   4759  C  CA    . GLY B 1 377 ? 47.208  92.876  57.047  1.00 68.97  ? 645 GLY B CA    1 
ATOM   4760  C  C     . GLY B 1 377 ? 47.176  91.640  56.173  1.00 68.97  ? 645 GLY B C     1 
ATOM   4761  O  O     . GLY B 1 377 ? 47.712  91.622  55.061  1.00 68.97  ? 645 GLY B O     1 
ATOM   4762  N  N     . ALA B 1 378 ? 46.500  90.615  56.688  1.00 70.64  ? 646 ALA B N     1 
ATOM   4763  C  CA    . ALA B 1 378 ? 46.624  89.234  56.219  1.00 70.64  ? 646 ALA B CA    1 
ATOM   4764  C  C     . ALA B 1 378 ? 48.085  88.806  56.206  1.00 70.64  ? 646 ALA B C     1 
ATOM   4765  O  O     . ALA B 1 378 ? 48.613  88.332  55.205  1.00 70.64  ? 646 ALA B O     1 
ATOM   4766  C  CB    . ALA B 1 378 ? 45.973  89.016  54.847  1.00 70.64  ? 646 ALA B CB    1 
ATOM   4767  N  N     . GLN B 1 379 ? 48.752  89.029  57.331  1.00 70.46  ? 647 GLN B N     1 
ATOM   4768  C  CA    . GLN B 1 379 ? 50.014  88.361  57.594  1.00 70.46  ? 647 GLN B CA    1 
ATOM   4769  C  C     . GLN B 1 379 ? 49.782  87.040  58.302  1.00 70.46  ? 647 GLN B C     1 
ATOM   4770  O  O     . GLN B 1 379 ? 50.397  86.029  57.951  1.00 70.46  ? 647 GLN B O     1 
ATOM   4771  C  CB    . GLN B 1 379 ? 50.924  89.246  58.441  1.00 70.46  ? 647 GLN B CB    1 
ATOM   4772  C  CG    . GLN B 1 379 ? 52.257  88.613  58.757  1.00 70.46  ? 647 GLN B CG    1 
ATOM   4773  C  CD    . GLN B 1 379 ? 53.111  89.487  59.637  1.00 70.46  ? 647 GLN B CD    1 
ATOM   4774  O  OE1   . GLN B 1 379 ? 52.711  90.583  60.019  1.00 70.46  ? 647 GLN B OE1   1 
ATOM   4775  N  NE2   . GLN B 1 379 ? 54.293  89.002  59.978  1.00 70.46  ? 647 GLN B NE2   1 
ATOM   4776  N  N     . ASP B 1 380 ? 48.880  87.026  59.283  1.00 72.88  ? 648 ASP B N     1 
ATOM   4777  C  CA    . ASP B 1 380 ? 48.494  85.777  59.922  1.00 72.88  ? 648 ASP B CA    1 
ATOM   4778  C  C     . ASP B 1 380 ? 47.624  84.919  59.022  1.00 72.88  ? 648 ASP B C     1 
ATOM   4779  O  O     . ASP B 1 380 ? 47.491  83.719  59.272  1.00 72.88  ? 648 ASP B O     1 
ATOM   4780  C  CB    . ASP B 1 380 ? 47.763  86.055  61.232  1.00 72.88  ? 648 ASP B CB    1 
ATOM   4781  C  CG    . ASP B 1 380 ? 48.683  86.592  62.306  1.00 72.88  ? 648 ASP B CG    1 
ATOM   4782  O  OD1   . ASP B 1 380 ? 49.889  86.273  62.270  1.00 72.88  ? 648 ASP B OD1   1 
ATOM   4783  O  OD2   . ASP B 1 380 ? 48.199  87.326  63.192  1.00 72.88  ? 648 ASP B OD2   1 
ATOM   4784  N  N     . ASP B 1 381 ? 47.018  85.506  57.992  1.00 73.48  ? 649 ASP B N     1 
ATOM   4785  C  CA    . ASP B 1 381 ? 46.344  84.692  56.993  1.00 73.48  ? 649 ASP B CA    1 
ATOM   4786  C  C     . ASP B 1 381 ? 47.353  83.939  56.142  1.00 73.48  ? 649 ASP B C     1 
ATOM   4787  O  O     . ASP B 1 381 ? 47.157  82.758  55.841  1.00 73.48  ? 649 ASP B O     1 
ATOM   4788  C  CB    . ASP B 1 381 ? 45.446  85.560  56.116  1.00 73.48  ? 649 ASP B CB    1 
ATOM   4789  C  CG    . ASP B 1 381 ? 44.261  86.126  56.872  1.00 73.48  ? 649 ASP B CG    1 
ATOM   4790  O  OD1   . ASP B 1 381 ? 43.838  85.501  57.863  1.00 73.48  ? 649 ASP B OD1   1 
ATOM   4791  O  OD2   . ASP B 1 381 ? 43.738  87.186  56.471  1.00 73.48  ? 649 ASP B OD2   1 
ATOM   4792  N  N     . LEU B 1 382 ? 48.450  84.596  55.763  1.00 64.31  ? 650 LEU B N     1 
ATOM   4793  C  CA    . LEU B 1 382 ? 49.431  83.966  54.893  1.00 64.31  ? 650 LEU B CA    1 
ATOM   4794  C  C     . LEU B 1 382 ? 50.326  82.976  55.617  1.00 64.31  ? 650 LEU B C     1 
ATOM   4795  O  O     . LEU B 1 382 ? 50.975  82.162  54.957  1.00 64.31  ? 650 LEU B O     1 
ATOM   4796  C  CB    . LEU B 1 382 ? 50.299  85.017  54.214  1.00 64.31  ? 650 LEU B CB    1 
ATOM   4797  C  CG    . LEU B 1 382 ? 49.588  85.916  53.223  1.00 64.31  ? 650 LEU B CG    1 
ATOM   4798  C  CD1   . LEU B 1 382 ? 50.573  86.926  52.710  1.00 64.31  ? 650 LEU B CD1   1 
ATOM   4799  C  CD2   . LEU B 1 382 ? 49.007  85.103  52.104  1.00 64.31  ? 650 LEU B CD2   1 
ATOM   4800  N  N     . ARG B 1 383 ? 50.385  83.035  56.945  1.00 72.39  ? 651 ARG B N     1 
ATOM   4801  C  CA    . ARG B 1 383 ? 51.048  81.981  57.701  1.00 72.39  ? 651 ARG B CA    1 
ATOM   4802  C  C     . ARG B 1 383 ? 50.290  80.671  57.576  1.00 72.39  ? 651 ARG B C     1 
ATOM   4803  O  O     . ARG B 1 383 ? 50.882  79.628  57.285  1.00 72.39  ? 651 ARG B O     1 
ATOM   4804  C  CB    . ARG B 1 383 ? 51.164  82.378  59.166  1.00 72.39  ? 651 ARG B CB    1 
ATOM   4805  C  CG    . ARG B 1 383 ? 52.051  83.563  59.418  1.00 72.39  ? 651 ARG B CG    1 
ATOM   4806  C  CD    . ARG B 1 383 ? 53.502  83.204  59.223  1.00 72.39  ? 651 ARG B CD    1 
ATOM   4807  N  NE    . ARG B 1 383 ? 53.926  82.169  60.158  1.00 72.39  ? 651 ARG B NE    1 
ATOM   4808  C  CZ    . ARG B 1 383 ? 54.388  82.412  61.380  1.00 72.39  ? 651 ARG B CZ    1 
ATOM   4809  N  NH1   . ARG B 1 383 ? 54.497  83.660  61.814  1.00 72.39  ? 651 ARG B NH1   1 
ATOM   4810  N  NH2   . ARG B 1 383 ? 54.750  81.407  62.166  1.00 72.39  ? 651 ARG B NH2   1 
ATOM   4811  N  N     . LYS B 1 384 ? 48.972  80.715  57.788  1.00 69.05  ? 652 LYS B N     1 
ATOM   4812  C  CA    . LYS B 1 384 ? 48.145  79.517  57.730  1.00 69.05  ? 652 LYS B CA    1 
ATOM   4813  C  C     . LYS B 1 384 ? 48.119  78.917  56.337  1.00 69.05  ? 652 LYS B C     1 
ATOM   4814  O  O     . LYS B 1 384 ? 48.005  77.699  56.191  1.00 69.05  ? 652 LYS B O     1 
ATOM   4815  C  CB    . LYS B 1 384 ? 46.724  79.851  58.167  1.00 69.05  ? 652 LYS B CB    1 
ATOM   4816  C  CG    . LYS B 1 384 ? 46.582  80.280  59.607  1.00 69.05  ? 652 LYS B CG    1 
ATOM   4817  C  CD    . LYS B 1 384 ? 45.127  80.592  59.910  1.00 69.05  ? 652 LYS B CD    1 
ATOM   4818  C  CE    . LYS B 1 384 ? 44.937  81.056  61.342  1.00 69.05  ? 652 LYS B CE    1 
ATOM   4819  N  NZ    . LYS B 1 384 ? 43.517  81.400  61.629  1.00 69.05  ? 652 LYS B NZ    1 
ATOM   4820  N  N     . VAL B 1 385 ? 48.221  79.753  55.307  1.00 63.44  ? 653 VAL B N     1 
ATOM   4821  C  CA    . VAL B 1 385 ? 48.327  79.255  53.945  1.00 63.44  ? 653 VAL B CA    1 
ATOM   4822  C  C     . VAL B 1 385 ? 49.657  78.547  53.744  1.00 63.44  ? 653 VAL B C     1 
ATOM   4823  O  O     . VAL B 1 385 ? 49.733  77.540  53.032  1.00 63.44  ? 653 VAL B O     1 
ATOM   4824  C  CB    . VAL B 1 385 ? 48.115  80.426  52.972  1.00 63.44  ? 653 VAL B CB    1 
ATOM   4825  C  CG1   . VAL B 1 385 ? 48.346  80.024  51.544  1.00 63.44  ? 653 VAL B CG1   1 
ATOM   4826  C  CG2   . VAL B 1 385 ? 46.713  80.929  53.117  1.00 63.44  ? 653 VAL B CG2   1 
ATOM   4827  N  N     . THR B 1 386 ? 50.708  79.009  54.412  1.00 67.71  ? 654 THR B N     1 
ATOM   4828  C  CA    . THR B 1 386 ? 51.993  78.332  54.315  1.00 67.71  ? 654 THR B CA    1 
ATOM   4829  C  C     . THR B 1 386 ? 52.022  77.054  55.144  1.00 67.71  ? 654 THR B C     1 
ATOM   4830  O  O     . THR B 1 386 ? 52.316  75.979  54.614  1.00 67.71  ? 654 THR B O     1 
ATOM   4831  C  CB    . THR B 1 386 ? 53.109  79.270  54.750  1.00 67.71  ? 654 THR B CB    1 
ATOM   4832  O  OG1   . THR B 1 386 ? 53.078  80.446  53.938  1.00 67.71  ? 654 THR B OG1   1 
ATOM   4833  C  CG2   . THR B 1 386 ? 54.451  78.595  54.591  1.00 67.71  ? 654 THR B CG2   1 
ATOM   4834  N  N     . GLN B 1 387 ? 51.713  77.137  56.444  1.00 70.88  ? 655 GLN B N     1 
ATOM   4835  C  CA    . GLN B 1 387 ? 51.837  75.946  57.282  1.00 70.88  ? 655 GLN B CA    1 
ATOM   4836  C  C     . GLN B 1 387 ? 50.756  74.906  57.034  1.00 70.88  ? 655 GLN B C     1 
ATOM   4837  O  O     . GLN B 1 387 ? 50.825  73.831  57.634  1.00 70.88  ? 655 GLN B O     1 
ATOM   4838  C  CB    . GLN B 1 387 ? 51.847  76.276  58.779  1.00 70.88  ? 655 GLN B CB    1 
ATOM   4839  C  CG    . GLN B 1 387 ? 53.173  76.836  59.303  1.00 70.88  ? 655 GLN B CG    1 
ATOM   4840  C  CD    . GLN B 1 387 ? 53.177  78.338  59.492  1.00 70.88  ? 655 GLN B CD    1 
ATOM   4841  O  OE1   . GLN B 1 387 ? 52.134  78.953  59.712  1.00 70.88  ? 655 GLN B OE1   1 
ATOM   4842  N  NE2   . GLN B 1 387 ? 54.360  78.942  59.393  1.00 70.88  ? 655 GLN B NE2   1 
ATOM   4843  N  N     . SER B 1 388 ? 49.762  75.185  56.196  1.00 66.70  ? 656 SER B N     1 
ATOM   4844  C  CA    . SER B 1 388 ? 48.927  74.100  55.709  1.00 66.70  ? 656 SER B CA    1 
ATOM   4845  C  C     . SER B 1 388 ? 49.566  73.449  54.498  1.00 66.70  ? 656 SER B C     1 
ATOM   4846  O  O     . SER B 1 388 ? 49.675  72.222  54.436  1.00 66.70  ? 656 SER B O     1 
ATOM   4847  C  CB    . SER B 1 388 ? 47.534  74.597  55.348  1.00 66.70  ? 656 SER B CB    1 
ATOM   4848  O  OG    . SER B 1 388 ? 47.583  75.382  54.174  1.00 66.70  ? 656 SER B OG    1 
ATOM   4849  N  N     . ALA B 1 389 ? 50.012  74.264  53.538  1.00 64.15  ? 657 ALA B N     1 
ATOM   4850  C  CA    . ALA B 1 389 ? 50.537  73.739  52.284  1.00 64.15  ? 657 ALA B CA    1 
ATOM   4851  C  C     . ALA B 1 389 ? 51.861  73.016  52.473  1.00 64.15  ? 657 ALA B C     1 
ATOM   4852  O  O     . ALA B 1 389 ? 52.148  72.074  51.735  1.00 64.15  ? 657 ALA B O     1 
ATOM   4853  C  CB    . ALA B 1 389 ? 50.696  74.863  51.268  1.00 64.15  ? 657 ALA B CB    1 
ATOM   4854  N  N     . TYR B 1 390 ? 52.677  73.432  53.442  1.00 66.65  ? 658 TYR B N     1 
ATOM   4855  C  CA    . TYR B 1 390 ? 53.859  72.643  53.776  1.00 66.65  ? 658 TYR B CA    1 
ATOM   4856  C  C     . TYR B 1 390 ? 53.480  71.302  54.372  1.00 66.65  ? 658 TYR B C     1 
ATOM   4857  O  O     . TYR B 1 390 ? 54.036  70.276  53.977  1.00 66.65  ? 658 TYR B O     1 
ATOM   4858  C  CB    . TYR B 1 390 ? 54.783  73.410  54.719  1.00 66.65  ? 658 TYR B CB    1 
ATOM   4859  C  CG    . TYR B 1 390 ? 55.806  74.246  54.000  1.00 66.65  ? 658 TYR B CG    1 
ATOM   4860  C  CD1   . TYR B 1 390 ? 56.158  73.955  52.698  1.00 66.65  ? 658 TYR B CD1   1 
ATOM   4861  C  CD2   . TYR B 1 390 ? 56.419  75.321  54.616  1.00 66.65  ? 658 TYR B CD2   1 
ATOM   4862  C  CE1   . TYR B 1 390 ? 57.087  74.702  52.027  1.00 66.65  ? 658 TYR B CE1   1 
ATOM   4863  C  CE2   . TYR B 1 390 ? 57.355  76.084  53.945  1.00 66.65  ? 658 TYR B CE2   1 
ATOM   4864  C  CZ    . TYR B 1 390 ? 57.684  75.761  52.649  1.00 66.65  ? 658 TYR B CZ    1 
ATOM   4865  O  OH    . TYR B 1 390 ? 58.614  76.501  51.962  1.00 66.65  ? 658 TYR B OH    1 
ATOM   4866  N  N     . ALA B 1 391 ? 52.530  71.283  55.305  1.00 67.34  ? 659 ALA B N     1 
ATOM   4867  C  CA    . ALA B 1 391 ? 52.084  70.017  55.877  1.00 67.34  ? 659 ALA B CA    1 
ATOM   4868  C  C     . ALA B 1 391 ? 51.367  69.163  54.847  1.00 67.34  ? 659 ALA B C     1 
ATOM   4869  O  O     . ALA B 1 391 ? 51.467  67.934  54.883  1.00 67.34  ? 659 ALA B O     1 
ATOM   4870  C  CB    . ALA B 1 391 ? 51.173  70.272  57.072  1.00 67.34  ? 659 ALA B CB    1 
ATOM   4871  N  N     . GLN B 1 392 ? 50.682  69.801  53.903  1.00 67.77  ? 660 GLN B N     1 
ATOM   4872  C  CA    . GLN B 1 392 ? 49.939  69.076  52.883  1.00 67.77  ? 660 GLN B CA    1 
ATOM   4873  C  C     . GLN B 1 392 ? 50.877  68.402  51.892  1.00 67.77  ? 660 GLN B C     1 
ATOM   4874  O  O     . GLN B 1 392 ? 50.661  67.248  51.520  1.00 67.77  ? 660 GLN B O     1 
ATOM   4875  C  CB    . GLN B 1 392 ? 48.984  70.046  52.191  1.00 67.77  ? 660 GLN B CB    1 
ATOM   4876  C  CG    . GLN B 1 392 ? 48.014  69.472  51.228  1.00 67.77  ? 660 GLN B CG    1 
ATOM   4877  C  CD    . GLN B 1 392 ? 46.969  70.481  50.842  1.00 67.77  ? 660 GLN B CD    1 
ATOM   4878  O  OE1   . GLN B 1 392 ? 46.991  71.612  51.317  1.00 67.77  ? 660 GLN B OE1   1 
ATOM   4879  N  NE2   . GLN B 1 392 ? 46.038  70.083  49.987  1.00 67.77  ? 660 GLN B NE2   1 
ATOM   4880  N  N     . ILE B 1 393 ? 51.948  69.083  51.489  1.00 66.85  ? 661 ILE B N     1 
ATOM   4881  C  CA    . ILE B 1 393 ? 52.896  68.484  50.554  1.00 66.85  ? 661 ILE B CA    1 
ATOM   4882  C  C     . ILE B 1 393 ? 53.821  67.506  51.266  1.00 66.85  ? 661 ILE B C     1 
ATOM   4883  O  O     . ILE B 1 393 ? 54.000  66.367  50.823  1.00 66.85  ? 661 ILE B O     1 
ATOM   4884  C  CB    . ILE B 1 393 ? 53.699  69.575  49.826  1.00 66.85  ? 661 ILE B CB    1 
ATOM   4885  C  CG1   . ILE B 1 393 ? 52.779  70.480  49.016  1.00 66.85  ? 661 ILE B CG1   1 
ATOM   4886  C  CG2   . ILE B 1 393 ? 54.727  68.959  48.928  1.00 66.85  ? 661 ILE B CG2   1 
ATOM   4887  C  CD1   . ILE B 1 393 ? 52.014  69.791  47.946  1.00 66.85  ? 661 ILE B CD1   1 
ATOM   4888  N  N     . VAL B 1 394 ? 54.412  67.922  52.383  1.00 69.21  ? 662 VAL B N     1 
ATOM   4889  C  CA    . VAL B 1 394 ? 55.501  67.153  52.976  1.00 69.21  ? 662 VAL B CA    1 
ATOM   4890  C  C     . VAL B 1 394 ? 54.973  65.958  53.753  1.00 69.21  ? 662 VAL B C     1 
ATOM   4891  O  O     . VAL B 1 394 ? 55.278  64.808  53.422  1.00 69.21  ? 662 VAL B O     1 
ATOM   4892  C  CB    . VAL B 1 394 ? 56.380  68.049  53.863  1.00 69.21  ? 662 VAL B CB    1 
ATOM   4893  C  CG1   . VAL B 1 394 ? 57.425  67.232  54.562  1.00 69.21  ? 662 VAL B CG1   1 
ATOM   4894  C  CG2   . VAL B 1 394 ? 57.030  69.124  53.025  1.00 69.21  ? 662 VAL B CG2   1 
ATOM   4895  N  N     . GLN B 1 395 ? 54.174  66.197  54.791  1.00 72.30  ? 663 GLN B N     1 
ATOM   4896  C  CA    . GLN B 1 395 ? 53.859  65.134  55.735  1.00 72.30  ? 663 GLN B CA    1 
ATOM   4897  C  C     . GLN B 1 395 ? 52.503  64.479  55.485  1.00 72.30  ? 663 GLN B C     1 
ATOM   4898  O  O     . GLN B 1 395 ? 51.996  63.773  56.362  1.00 72.30  ? 663 GLN B O     1 
ATOM   4899  C  CB    . GLN B 1 395 ? 53.960  65.646  57.170  1.00 72.30  ? 663 GLN B CB    1 
ATOM   4900  C  CG    . GLN B 1 395 ? 52.984  66.717  57.556  1.00 72.30  ? 663 GLN B CG    1 
ATOM   4901  C  CD    . GLN B 1 395 ? 53.219  67.189  58.969  1.00 72.30  ? 663 GLN B CD    1 
ATOM   4902  O  OE1   . GLN B 1 395 ? 54.086  66.670  59.667  1.00 72.30  ? 663 GLN B OE1   1 
ATOM   4903  N  NE2   . GLN B 1 395 ? 52.452  68.178  59.400  1.00 72.30  ? 663 GLN B NE2   1 
ATOM   4904  N  N     . PHE B 1 396 ? 51.912  64.680  54.311  1.00 70.15  ? 664 PHE B N     1 
ATOM   4905  C  CA    . PHE B 1 396 ? 50.877  63.773  53.834  1.00 70.15  ? 664 PHE B CA    1 
ATOM   4906  C  C     . PHE B 1 396 ? 51.292  63.307  52.447  1.00 70.15  ? 664 PHE B C     1 
ATOM   4907  O  O     . PHE B 1 396 ? 52.416  63.569  52.014  1.00 70.15  ? 664 PHE B O     1 
ATOM   4908  C  CB    . PHE B 1 396 ? 49.495  64.426  53.787  1.00 70.15  ? 664 PHE B CB    1 
ATOM   4909  C  CG    . PHE B 1 396 ? 49.043  65.002  55.096  1.00 70.15  ? 664 PHE B CG    1 
ATOM   4910  C  CD1   . PHE B 1 396 ? 48.822  64.193  56.193  1.00 70.15  ? 664 PHE B CD1   1 
ATOM   4911  C  CD2   . PHE B 1 396 ? 48.748  66.348  55.199  1.00 70.15  ? 664 PHE B CD2   1 
ATOM   4912  C  CE1   . PHE B 1 396 ? 48.391  64.737  57.390  1.00 70.15  ? 664 PHE B CE1   1 
ATOM   4913  C  CE2   . PHE B 1 396 ? 48.312  66.890  56.386  1.00 70.15  ? 664 PHE B CE2   1 
ATOM   4914  C  CZ    . PHE B 1 396 ? 48.136  66.086  57.480  1.00 70.15  ? 664 PHE B CZ    1 
ATOM   4915  N  N     . GLY B 1 397 ? 50.412  62.622  51.738  1.00 74.26  ? 665 GLY B N     1 
ATOM   4916  C  CA    . GLY B 1 397 ? 50.748  62.204  50.395  1.00 74.26  ? 665 GLY B CA    1 
ATOM   4917  C  C     . GLY B 1 397 ? 49.930  62.942  49.364  1.00 74.26  ? 665 GLY B C     1 
ATOM   4918  O  O     . GLY B 1 397 ? 49.511  62.368  48.357  1.00 74.26  ? 665 GLY B O     1 
ATOM   4919  N  N     . MET B 1 398 ? 49.699  64.224  49.605  1.00 75.11  ? 666 MET B N     1 
ATOM   4920  C  CA    . MET B 1 398 ? 48.760  64.980  48.799  1.00 75.11  ? 666 MET B CA    1 
ATOM   4921  C  C     . MET B 1 398 ? 49.331  65.422  47.462  1.00 75.11  ? 666 MET B C     1 
ATOM   4922  O  O     . MET B 1 398 ? 48.592  65.999  46.660  1.00 75.11  ? 666 MET B O     1 
ATOM   4923  C  CB    . MET B 1 398 ? 48.293  66.201  49.577  1.00 75.11  ? 666 MET B CB    1 
ATOM   4924  C  CG    . MET B 1 398 ? 47.540  65.899  50.860  1.00 75.11  ? 666 MET B CG    1 
ATOM   4925  S  SD    . MET B 1 398 ? 45.859  65.344  50.621  1.00 75.11  ? 666 MET B SD    1 
ATOM   4926  C  CE    . MET B 1 398 ? 45.408  64.998  52.312  1.00 75.11  ? 666 MET B CE    1 
ATOM   4927  N  N     . ASN B 1 399 ? 50.608  65.179  47.191  1.00 75.11  ? 667 ASN B N     1 
ATOM   4928  C  CA    . ASN B 1 399 ? 51.207  65.584  45.930  1.00 75.11  ? 667 ASN B CA    1 
ATOM   4929  C  C     . ASN B 1 399 ? 51.752  64.367  45.204  1.00 75.11  ? 667 ASN B C     1 
ATOM   4930  O  O     . ASN B 1 399 ? 52.466  63.551  45.794  1.00 75.11  ? 667 ASN B O     1 
ATOM   4931  C  CB    . ASN B 1 399 ? 52.318  66.598  46.146  1.00 75.11  ? 667 ASN B CB    1 
ATOM   4932  C  CG    . ASN B 1 399 ? 52.656  67.349  44.889  1.00 75.11  ? 667 ASN B CG    1 
ATOM   4933  O  OD1   . ASN B 1 399 ? 52.056  67.132  43.839  1.00 75.11  ? 667 ASN B OD1   1 
ATOM   4934  N  ND2   . ASN B 1 399 ? 53.610  68.246  44.985  1.00 75.11  ? 667 ASN B ND2   1 
ATOM   4935  N  N     . GLU B 1 400 ? 51.430  64.264  43.917  1.00 77.88  ? 668 GLU B N     1 
ATOM   4936  C  CA    . GLU B 1 400 ? 51.894  63.144  43.114  1.00 77.88  ? 668 GLU B CA    1 
ATOM   4937  C  C     . GLU B 1 400 ? 53.366  63.276  42.762  1.00 77.88  ? 668 GLU B C     1 
ATOM   4938  O  O     . GLU B 1 400 ? 54.077  62.269  42.689  1.00 77.88  ? 668 GLU B O     1 
ATOM   4939  C  CB    . GLU B 1 400 ? 51.052  63.042  41.842  1.00 77.88  ? 668 GLU B CB    1 
ATOM   4940  C  CG    . GLU B 1 400 ? 51.351  61.832  40.978  1.00 77.88  ? 668 GLU B CG    1 
ATOM   4941  C  CD    . GLU B 1 400 ? 50.465  61.759  39.753  1.00 77.88  ? 668 GLU B CD    1 
ATOM   4942  O  OE1   . GLU B 1 400 ? 49.622  62.662  39.572  1.00 77.88  ? 668 GLU B OE1   1 
ATOM   4943  O  OE2   . GLU B 1 400 ? 50.614  60.799  38.968  1.00 77.88  ? 668 GLU B OE2   1 
ATOM   4944  N  N     . LYS B 1 401 ? 53.846  64.502  42.568  1.00 73.22  ? 669 LYS B N     1 
ATOM   4945  C  CA    . LYS B 1 401 ? 55.215  64.698  42.114  1.00 73.22  ? 669 LYS B CA    1 
ATOM   4946  C  C     . LYS B 1 401 ? 56.215  64.496  43.244  1.00 73.22  ? 669 LYS B C     1 
ATOM   4947  O  O     . LYS B 1 401 ? 57.314  63.982  43.020  1.00 73.22  ? 669 LYS B O     1 
ATOM   4948  C  CB    . LYS B 1 401 ? 55.360  66.090  41.507  1.00 73.22  ? 669 LYS B CB    1 
ATOM   4949  C  CG    . LYS B 1 401 ? 56.648  66.302  40.753  1.00 73.22  ? 669 LYS B CG    1 
ATOM   4950  C  CD    . LYS B 1 401 ? 56.735  67.700  40.184  1.00 73.22  ? 669 LYS B CD    1 
ATOM   4951  C  CE    . LYS B 1 401 ? 56.269  67.762  38.744  1.00 73.22  ? 669 LYS B CE    1 
ATOM   4952  N  NZ    . LYS B 1 401 ? 54.790  67.772  38.632  1.00 73.22  ? 669 LYS B NZ    1 
ATOM   4953  N  N     . VAL B 1 402 ? 55.854  64.890  44.460  1.00 71.66  ? 670 VAL B N     1 
ATOM   4954  C  CA    . VAL B 1 402 ? 56.739  64.655  45.590  1.00 71.66  ? 670 VAL B CA    1 
ATOM   4955  C  C     . VAL B 1 402 ? 56.647  63.206  46.037  1.00 71.66  ? 670 VAL B C     1 
ATOM   4956  O  O     . VAL B 1 402 ? 57.663  62.574  46.339  1.00 71.66  ? 670 VAL B O     1 
ATOM   4957  C  CB    . VAL B 1 402 ? 56.412  65.639  46.724  1.00 71.66  ? 670 VAL B CB    1 
ATOM   4958  C  CG1   . VAL B 1 402 ? 57.318  65.421  47.904  1.00 71.66  ? 670 VAL B CG1   1 
ATOM   4959  C  CG2   . VAL B 1 402 ? 56.552  67.060  46.223  1.00 71.66  ? 670 VAL B CG2   1 
ATOM   4960  N  N     . GLY B 1 403 ? 55.448  62.648  46.061  1.00 73.25  ? 671 GLY B N     1 
ATOM   4961  C  CA    . GLY B 1 403 ? 55.267  61.227  46.270  1.00 73.25  ? 671 GLY B CA    1 
ATOM   4962  C  C     . GLY B 1 403 ? 54.536  60.926  47.558  1.00 73.25  ? 671 GLY B C     1 
ATOM   4963  O  O     . GLY B 1 403 ? 53.948  61.800  48.199  1.00 73.25  ? 671 GLY B O     1 
ATOM   4964  N  N     . GLN B 1 404 ? 54.573  59.654  47.934  1.00 75.04  ? 672 GLN B N     1 
ATOM   4965  C  CA    . GLN B 1 404 ? 53.859  59.157  49.106  1.00 75.04  ? 672 GLN B CA    1 
ATOM   4966  C  C     . GLN B 1 404 ? 54.793  59.091  50.312  1.00 75.04  ? 672 GLN B C     1 
ATOM   4967  O  O     . GLN B 1 404 ? 54.996  58.046  50.918  1.00 75.04  ? 672 GLN B O     1 
ATOM   4968  C  CB    . GLN B 1 404 ? 53.253  57.791  48.804  1.00 75.04  ? 672 GLN B CB    1 
ATOM   4969  C  CG    . GLN B 1 404 ? 52.357  57.770  47.585  1.00 75.04  ? 672 GLN B CG    1 
ATOM   4970  C  CD    . GLN B 1 404 ? 51.133  58.636  47.752  1.00 75.04  ? 672 GLN B CD    1 
ATOM   4971  O  OE1   . GLN B 1 404 ? 50.535  58.683  48.825  1.00 75.04  ? 672 GLN B OE1   1 
ATOM   4972  N  NE2   . GLN B 1 404 ? 50.753  59.334  46.690  1.00 75.04  ? 672 GLN B NE2   1 
ATOM   4973  N  N     . ILE B 1 405 ? 55.367  60.233  50.660  1.00 71.07  ? 673 ILE B N     1 
ATOM   4974  C  CA    . ILE B 1 405 ? 56.341  60.302  51.737  1.00 71.07  ? 673 ILE B CA    1 
ATOM   4975  C  C     . ILE B 1 405 ? 55.774  61.104  52.896  1.00 71.07  ? 673 ILE B C     1 
ATOM   4976  O  O     . ILE B 1 405 ? 54.847  61.902  52.746  1.00 71.07  ? 673 ILE B O     1 
ATOM   4977  C  CB    . ILE B 1 405 ? 57.676  60.904  51.265  1.00 71.07  ? 673 ILE B CB    1 
ATOM   4978  C  CG1   . ILE B 1 405 ? 57.445  62.265  50.623  1.00 71.07  ? 673 ILE B CG1   1 
ATOM   4979  C  CG2   . ILE B 1 405 ? 58.377  59.986  50.309  1.00 71.07  ? 673 ILE B CG2   1 
ATOM   4980  C  CD1   . ILE B 1 405 ? 58.718  62.946  50.238  1.00 71.07  ? 673 ILE B CD1   1 
ATOM   4981  N  N     . SER B 1 406 ? 56.358  60.891  54.071  1.00 75.26  ? 674 SER B N     1 
ATOM   4982  C  CA    . SER B 1 406 ? 55.976  61.617  55.271  1.00 75.26  ? 674 SER B CA    1 
ATOM   4983  C  C     . SER B 1 406 ? 57.206  61.887  56.115  1.00 75.26  ? 674 SER B C     1 
ATOM   4984  O  O     . SER B 1 406 ? 57.971  60.969  56.416  1.00 75.26  ? 674 SER B O     1 
ATOM   4985  C  CB    . SER B 1 406 ? 54.952  60.839  56.089  1.00 75.26  ? 674 SER B CB    1 
ATOM   4986  O  OG    . SER B 1 406 ? 54.665  61.515  57.297  1.00 75.26  ? 674 SER B OG    1 
ATOM   4987  N  N     . PHE B 1 407 ? 57.376  63.141  56.508  1.00 78.74  ? 675 PHE B N     1 
ATOM   4988  C  CA    . PHE B 1 407 ? 58.539  63.604  57.242  1.00 78.74  ? 675 PHE B CA    1 
ATOM   4989  C  C     . PHE B 1 407 ? 58.094  64.247  58.543  1.00 78.74  ? 675 PHE B C     1 
ATOM   4990  O  O     . PHE B 1 407 ? 57.056  64.910  58.591  1.00 78.74  ? 675 PHE B O     1 
ATOM   4991  C  CB    . PHE B 1 407 ? 59.304  64.612  56.412  1.00 78.74  ? 675 PHE B CB    1 
ATOM   4992  C  CG    . PHE B 1 407 ? 59.983  64.022  55.227  1.00 78.74  ? 675 PHE B CG    1 
ATOM   4993  C  CD1   . PHE B 1 407 ? 60.471  62.734  55.260  1.00 78.74  ? 675 PHE B CD1   1 
ATOM   4994  C  CD2   . PHE B 1 407 ? 60.060  64.730  54.049  1.00 78.74  ? 675 PHE B CD2   1 
ATOM   4995  C  CE1   . PHE B 1 407 ? 61.085  62.194  54.158  1.00 78.74  ? 675 PHE B CE1   1 
ATOM   4996  C  CE2   . PHE B 1 407 ? 60.671  64.193  52.946  1.00 78.74  ? 675 PHE B CE2   1 
ATOM   4997  C  CZ    . PHE B 1 407 ? 61.174  62.922  52.997  1.00 78.74  ? 675 PHE B CZ    1 
ATOM   4998  N  N     . ASP B 1 408 ? 58.885  64.057  59.594  1.00 99.77  ? 676 ASP B N     1 
ATOM   4999  C  CA    . ASP B 1 408 ? 58.603  64.708  60.863  1.00 99.77  ? 676 ASP B CA    1 
ATOM   5000  C  C     . ASP B 1 408 ? 58.930  66.188  60.726  1.00 99.77  ? 676 ASP B C     1 
ATOM   5001  O  O     . ASP B 1 408 ? 60.077  66.598  60.926  1.00 99.77  ? 676 ASP B O     1 
ATOM   5002  C  CB    . ASP B 1 408 ? 59.414  64.068  61.991  1.00 99.77  ? 676 ASP B CB    1 
ATOM   5003  C  CG    . ASP B 1 408 ? 58.923  64.467  63.374  1.00 99.77  ? 676 ASP B CG    1 
ATOM   5004  O  OD1   . ASP B 1 408 ? 57.936  65.225  63.479  1.00 99.77  ? 676 ASP B OD1   1 
ATOM   5005  O  OD2   . ASP B 1 408 ? 59.534  64.017  64.365  1.00 99.77  ? 676 ASP B OD2   1 
ATOM   5006  N  N     . LEU B 1 409 ? 57.931  66.988  60.379  1.00 105.85 ? 677 LEU B N     1 
ATOM   5007  C  CA    . LEU B 1 409 ? 58.149  68.403  60.111  1.00 105.85 ? 677 LEU B CA    1 
ATOM   5008  C  C     . LEU B 1 409 ? 58.325  69.160  61.423  1.00 105.85 ? 677 LEU B C     1 
ATOM   5009  O  O     . LEU B 1 409 ? 57.470  69.056  62.307  1.00 105.85 ? 677 LEU B O     1 
ATOM   5010  C  CB    . LEU B 1 409 ? 56.979  68.980  59.326  1.00 105.85 ? 677 LEU B CB    1 
ATOM   5011  C  CG    . LEU B 1 409 ? 57.114  70.426  58.861  1.00 105.85 ? 677 LEU B CG    1 
ATOM   5012  C  CD1   . LEU B 1 409 ? 58.276  70.563  57.898  1.00 105.85 ? 677 LEU B CD1   1 
ATOM   5013  C  CD2   . LEU B 1 409 ? 55.824  70.891  58.212  1.00 105.85 ? 677 LEU B CD2   1 
ATOM   5014  N  N     . PRO B 1 410 ? 59.421  69.903  61.592  1.00 120.12 ? 678 PRO B N     1 
ATOM   5015  C  CA    . PRO B 1 410 ? 59.631  70.641  62.845  1.00 120.12 ? 678 PRO B CA    1 
ATOM   5016  C  C     . PRO B 1 410 ? 58.661  71.805  62.966  1.00 120.12 ? 678 PRO B C     1 
ATOM   5017  O  O     . PRO B 1 410 ? 58.451  72.559  62.013  1.00 120.12 ? 678 PRO B O     1 
ATOM   5018  C  CB    . PRO B 1 410 ? 61.080  71.128  62.731  1.00 120.12 ? 678 PRO B CB    1 
ATOM   5019  C  CG    . PRO B 1 410 ? 61.712  70.210  61.744  1.00 120.12 ? 678 PRO B CG    1 
ATOM   5020  C  CD    . PRO B 1 410 ? 60.630  69.898  60.755  1.00 120.12 ? 678 PRO B CD    1 
ATOM   5021  N  N     . ARG B 1 411 ? 58.072  71.942  64.150  1.00 129.15 ? 679 ARG B N     1 
ATOM   5022  C  CA    . ARG B 1 411 ? 57.065  72.961  64.387  1.00 129.15 ? 679 ARG B CA    1 
ATOM   5023  C  C     . ARG B 1 411 ? 57.706  74.342  64.480  1.00 129.15 ? 679 ARG B C     1 
ATOM   5024  O  O     . ARG B 1 411 ? 58.905  74.488  64.732  1.00 129.15 ? 679 ARG B O     1 
ATOM   5025  C  CB    . ARG B 1 411 ? 56.290  72.654  65.666  1.00 129.15 ? 679 ARG B CB    1 
ATOM   5026  C  CG    . ARG B 1 411 ? 55.438  71.402  65.571  1.00 129.15 ? 679 ARG B CG    1 
ATOM   5027  C  CD    . ARG B 1 411 ? 54.704  71.127  66.870  1.00 129.15 ? 679 ARG B CD    1 
ATOM   5028  N  NE    . ARG B 1 411 ? 53.892  69.917  66.788  1.00 129.15 ? 679 ARG B NE    1 
ATOM   5029  C  CZ    . ARG B 1 411 ? 53.195  69.416  67.802  1.00 129.15 ? 679 ARG B CZ    1 
ATOM   5030  N  NH1   . ARG B 1 411 ? 53.212  70.020  68.983  1.00 129.15 ? 679 ARG B NH1   1 
ATOM   5031  N  NH2   . ARG B 1 411 ? 52.482  68.311  67.637  1.00 129.15 ? 679 ARG B NH2   1 
ATOM   5032  N  N     . GLN B 1 412 ? 56.883  75.364  64.263  1.00 127.29 ? 680 GLN B N     1 
ATOM   5033  C  CA    . GLN B 1 412 ? 57.364  76.736  64.309  1.00 127.29 ? 680 GLN B CA    1 
ATOM   5034  C  C     . GLN B 1 412 ? 57.632  77.158  65.747  1.00 127.29 ? 680 GLN B C     1 
ATOM   5035  O  O     . GLN B 1 412 ? 56.881  76.816  66.664  1.00 127.29 ? 680 GLN B O     1 
ATOM   5036  C  CB    . GLN B 1 412 ? 56.349  77.676  63.662  1.00 127.29 ? 680 GLN B CB    1 
ATOM   5037  C  CG    . GLN B 1 412 ? 56.099  77.397  62.189  1.00 127.29 ? 680 GLN B CG    1 
ATOM   5038  C  CD    . GLN B 1 412 ? 57.321  77.656  61.329  1.00 127.29 ? 680 GLN B CD    1 
ATOM   5039  O  OE1   . GLN B 1 412 ? 58.064  78.609  61.557  1.00 127.29 ? 680 GLN B OE1   1 
ATOM   5040  N  NE2   . GLN B 1 412 ? 57.533  76.806  60.332  1.00 127.29 ? 680 GLN B NE2   1 
ATOM   5041  N  N     . GLY B 1 413 ? 58.715  77.904  65.938  1.00 137.16 ? 681 GLY B N     1 
ATOM   5042  C  CA    . GLY B 1 413 ? 59.124  78.319  67.264  1.00 137.16 ? 681 GLY B CA    1 
ATOM   5043  C  C     . GLY B 1 413 ? 60.281  77.491  67.781  1.00 137.16 ? 681 GLY B C     1 
ATOM   5044  O  O     . GLY B 1 413 ? 61.222  78.024  68.375  1.00 137.16 ? 681 GLY B O     1 
ATOM   5045  N  N     . ASP B 1 414 ? 60.221  76.184  67.558  1.00 141.46 ? 682 ASP B N     1 
ATOM   5046  C  CA    . ASP B 1 414 ? 61.345  75.322  67.874  1.00 141.46 ? 682 ASP B CA    1 
ATOM   5047  C  C     . ASP B 1 414 ? 62.413  75.466  66.793  1.00 141.46 ? 682 ASP B C     1 
ATOM   5048  O  O     . ASP B 1 414 ? 62.132  75.833  65.649  1.00 141.46 ? 682 ASP B O     1 
ATOM   5049  C  CB    . ASP B 1 414 ? 60.886  73.866  67.996  1.00 141.46 ? 682 ASP B CB    1 
ATOM   5050  C  CG    . ASP B 1 414 ? 61.916  72.971  68.676  1.00 141.46 ? 682 ASP B CG    1 
ATOM   5051  O  OD1   . ASP B 1 414 ? 62.995  73.465  69.066  1.00 141.46 ? 682 ASP B OD1   1 
ATOM   5052  O  OD2   . ASP B 1 414 ? 61.640  71.762  68.820  1.00 141.46 ? 682 ASP B OD2   1 
ATOM   5053  N  N     . MET B 1 415 ? 63.654  75.183  67.176  1.00 138.42 ? 683 MET B N     1 
ATOM   5054  C  CA    . MET B 1 415 ? 64.762  75.285  66.240  1.00 138.42 ? 683 MET B CA    1 
ATOM   5055  C  C     . MET B 1 415 ? 64.701  74.167  65.206  1.00 138.42 ? 683 MET B C     1 
ATOM   5056  O  O     . MET B 1 415 ? 64.293  73.039  65.501  1.00 138.42 ? 683 MET B O     1 
ATOM   5057  C  CB    . MET B 1 415 ? 66.096  75.257  66.990  1.00 138.42 ? 683 MET B CB    1 
ATOM   5058  C  CG    . MET B 1 415 ? 66.374  73.991  67.789  1.00 138.42 ? 683 MET B CG    1 
ATOM   5059  S  SD    . MET B 1 415 ? 67.974  74.032  68.617  1.00 138.42 ? 683 MET B SD    1 
ATOM   5060  C  CE    . MET B 1 415 ? 69.075  73.840  67.219  1.00 138.42 ? 683 MET B CE    1 
ATOM   5061  N  N     . VAL B 1 416 ? 65.065  74.502  63.973  1.00 131.21 ? 684 VAL B N     1 
ATOM   5062  C  CA    . VAL B 1 416 ? 65.211  73.529  62.900  1.00 131.21 ? 684 VAL B CA    1 
ATOM   5063  C  C     . VAL B 1 416 ? 66.674  73.106  62.844  1.00 131.21 ? 684 VAL B C     1 
ATOM   5064  O  O     . VAL B 1 416 ? 67.578  73.942  62.733  1.00 131.21 ? 684 VAL B O     1 
ATOM   5065  C  CB    . VAL B 1 416 ? 64.701  74.080  61.556  1.00 131.21 ? 684 VAL B CB    1 
ATOM   5066  C  CG1   . VAL B 1 416 ? 63.188  74.028  61.520  1.00 131.21 ? 684 VAL B CG1   1 
ATOM   5067  C  CG2   . VAL B 1 416 ? 65.105  75.526  61.375  1.00 131.21 ? 684 VAL B CG2   1 
ATOM   5068  N  N     . LEU B 1 417 ? 66.909  71.804  62.959  1.00 127.32 ? 685 LEU B N     1 
ATOM   5069  C  CA    . LEU B 1 417 ? 68.253  71.281  63.180  1.00 127.32 ? 685 LEU B CA    1 
ATOM   5070  C  C     . LEU B 1 417 ? 68.953  70.986  61.858  1.00 127.32 ? 685 LEU B C     1 
ATOM   5071  O  O     . LEU B 1 417 ? 69.989  71.583  61.547  1.00 127.32 ? 685 LEU B O     1 
ATOM   5072  C  CB    . LEU B 1 417 ? 68.177  70.019  64.049  1.00 127.32 ? 685 LEU B CB    1 
ATOM   5073  C  CG    . LEU B 1 417 ? 68.021  70.103  65.574  1.00 127.32 ? 685 LEU B CG    1 
ATOM   5074  C  CD1   . LEU B 1 417 ? 66.658  70.605  66.036  1.00 127.32 ? 685 LEU B CD1   1 
ATOM   5075  C  CD2   . LEU B 1 417 ? 68.265  68.732  66.154  1.00 127.32 ? 685 LEU B CD2   1 
ATOM   5076  N  N     . GLU B 1 418 ? 68.380  70.079  61.072  1.00 113.77 ? 686 GLU B N     1 
ATOM   5077  C  CA    . GLU B 1 418 ? 68.865  69.708  59.751  1.00 113.77 ? 686 GLU B CA    1 
ATOM   5078  C  C     . GLU B 1 418 ? 67.737  68.963  59.059  1.00 113.77 ? 686 GLU B C     1 
ATOM   5079  O  O     . GLU B 1 418 ? 67.056  68.151  59.690  1.00 113.77 ? 686 GLU B O     1 
ATOM   5080  C  CB    . GLU B 1 418 ? 70.124  68.834  59.826  1.00 113.77 ? 686 GLU B CB    1 
ATOM   5081  C  CG    . GLU B 1 418 ? 70.700  68.422  58.477  1.00 113.77 ? 686 GLU B CG    1 
ATOM   5082  C  CD    . GLU B 1 418 ? 71.238  69.592  57.671  1.00 113.77 ? 686 GLU B CD    1 
ATOM   5083  O  OE1   . GLU B 1 418 ? 71.668  70.599  58.272  1.00 113.77 ? 686 GLU B OE1   1 
ATOM   5084  O  OE2   . GLU B 1 418 ? 71.230  69.504  56.426  1.00 113.77 ? 686 GLU B OE2   1 
ATOM   5085  N  N     . LYS B 1 419 ? 67.533  69.254  57.777  1.00 91.07  ? 687 LYS B N     1 
ATOM   5086  C  CA    . LYS B 1 419 ? 66.416  68.669  57.054  1.00 91.07  ? 687 LYS B CA    1 
ATOM   5087  C  C     . LYS B 1 419 ? 66.636  67.175  56.835  1.00 91.07  ? 687 LYS B C     1 
ATOM   5088  O  O     . LYS B 1 419 ? 67.756  66.746  56.546  1.00 91.07  ? 687 LYS B O     1 
ATOM   5089  C  CB    . LYS B 1 419 ? 66.225  69.354  55.710  1.00 91.07  ? 687 LYS B CB    1 
ATOM   5090  C  CG    . LYS B 1 419 ? 65.684  70.753  55.801  1.00 91.07  ? 687 LYS B CG    1 
ATOM   5091  C  CD    . LYS B 1 419 ? 65.494  71.315  54.416  1.00 91.07  ? 687 LYS B CD    1 
ATOM   5092  C  CE    . LYS B 1 419 ? 64.973  72.724  54.462  1.00 91.07  ? 687 LYS B CE    1 
ATOM   5093  N  NZ    . LYS B 1 419 ? 64.820  73.249  53.087  1.00 91.07  ? 687 LYS B NZ    1 
ATOM   5094  N  N     . PRO B 1 420 ? 65.589  66.360  56.960  1.00 84.83  ? 688 PRO B N     1 
ATOM   5095  C  CA    . PRO B 1 420 ? 65.722  64.922  56.719  1.00 84.83  ? 688 PRO B CA    1 
ATOM   5096  C  C     . PRO B 1 420 ? 65.708  64.525  55.252  1.00 84.83  ? 688 PRO B C     1 
ATOM   5097  O  O     . PRO B 1 420 ? 65.646  63.330  54.958  1.00 84.83  ? 688 PRO B O     1 
ATOM   5098  C  CB    . PRO B 1 420 ? 64.496  64.352  57.443  1.00 84.83  ? 688 PRO B CB    1 
ATOM   5099  C  CG    . PRO B 1 420 ? 63.497  65.432  57.354  1.00 84.83  ? 688 PRO B CG    1 
ATOM   5100  C  CD    . PRO B 1 420 ? 64.248  66.715  57.450  1.00 84.83  ? 688 PRO B CD    1 
ATOM   5101  N  N     . TYR B 1 421 ? 65.771  65.485  54.336  1.00 79.01  ? 689 TYR B N     1 
ATOM   5102  C  CA    . TYR B 1 421 ? 65.735  65.221  52.910  1.00 79.01  ? 689 TYR B CA    1 
ATOM   5103  C  C     . TYR B 1 421 ? 66.761  66.104  52.213  1.00 79.01  ? 689 TYR B C     1 
ATOM   5104  O  O     . TYR B 1 421 ? 67.444  66.916  52.841  1.00 79.01  ? 689 TYR B O     1 
ATOM   5105  C  CB    . TYR B 1 421 ? 64.317  65.404  52.359  1.00 79.01  ? 689 TYR B CB    1 
ATOM   5106  C  CG    . TYR B 1 421 ? 63.626  66.692  52.743  1.00 79.01  ? 689 TYR B CG    1 
ATOM   5107  C  CD1   . TYR B 1 421 ? 62.858  66.767  53.895  1.00 79.01  ? 689 TYR B CD1   1 
ATOM   5108  C  CD2   . TYR B 1 421 ? 63.711  67.817  51.945  1.00 79.01  ? 689 TYR B CD2   1 
ATOM   5109  C  CE1   . TYR B 1 421 ? 62.209  67.921  54.249  1.00 79.01  ? 689 TYR B CE1   1 
ATOM   5110  C  CE2   . TYR B 1 421 ? 63.068  68.985  52.300  1.00 79.01  ? 689 TYR B CE2   1 
ATOM   5111  C  CZ    . TYR B 1 421 ? 62.314  69.027  53.451  1.00 79.01  ? 689 TYR B CZ    1 
ATOM   5112  O  OH    . TYR B 1 421 ? 61.667  70.182  53.815  1.00 79.01  ? 689 TYR B OH    1 
ATOM   5113  N  N     . SER B 1 422 ? 66.880  65.926  50.904  1.00 74.53  ? 690 SER B N     1 
ATOM   5114  C  CA    . SER B 1 422 ? 67.937  66.564  50.141  1.00 74.53  ? 690 SER B CA    1 
ATOM   5115  C  C     . SER B 1 422 ? 67.590  68.014  49.830  1.00 74.53  ? 690 SER B C     1 
ATOM   5116  O  O     . SER B 1 422 ? 66.473  68.480  50.059  1.00 74.53  ? 690 SER B O     1 
ATOM   5117  C  CB    . SER B 1 422 ? 68.175  65.810  48.840  1.00 74.53  ? 690 SER B CB    1 
ATOM   5118  O  OG    . SER B 1 422 ? 67.067  65.959  47.974  1.00 74.53  ? 690 SER B OG    1 
ATOM   5119  N  N     . GLU B 1 423 ? 68.575  68.734  49.292  1.00 74.67  ? 691 GLU B N     1 
ATOM   5120  C  CA    . GLU B 1 423 ? 68.306  70.068  48.776  1.00 74.67  ? 691 GLU B CA    1 
ATOM   5121  C  C     . GLU B 1 423 ? 67.477  70.008  47.504  1.00 74.67  ? 691 GLU B C     1 
ATOM   5122  O  O     . GLU B 1 423 ? 66.640  70.887  47.269  1.00 74.67  ? 691 GLU B O     1 
ATOM   5123  C  CB    . GLU B 1 423 ? 69.621  70.810  48.529  1.00 74.67  ? 691 GLU B CB    1 
ATOM   5124  C  CG    . GLU B 1 423 ? 69.485  72.219  47.982  1.00 74.67  ? 691 GLU B CG    1 
ATOM   5125  C  CD    . GLU B 1 423 ? 68.833  73.170  48.957  1.00 74.67  ? 691 GLU B CD    1 
ATOM   5126  O  OE1   . GLU B 1 423 ? 68.983  72.974  50.181  1.00 74.67  ? 691 GLU B OE1   1 
ATOM   5127  O  OE2   . GLU B 1 423 ? 68.154  74.109  48.495  1.00 74.67  ? 691 GLU B OE2   1 
ATOM   5128  N  N     . ALA B 1 424 ? 67.670  68.969  46.691  1.00 70.62  ? 692 ALA B N     1 
ATOM   5129  C  CA    . ALA B 1 424 ? 66.890  68.839  45.466  1.00 70.62  ? 692 ALA B CA    1 
ATOM   5130  C  C     . ALA B 1 424 ? 65.442  68.479  45.756  1.00 70.62  ? 692 ALA B C     1 
ATOM   5131  O  O     . ALA B 1 424 ? 64.556  68.800  44.959  1.00 70.62  ? 692 ALA B O     1 
ATOM   5132  C  CB    . ALA B 1 424 ? 67.515  67.791  44.553  1.00 70.62  ? 692 ALA B CB    1 
ATOM   5133  N  N     . THR B 1 425 ? 65.185  67.809  46.878  1.00 72.55  ? 693 THR B N     1 
ATOM   5134  C  CA    . THR B 1 425 ? 63.810  67.597  47.302  1.00 72.55  ? 693 THR B CA    1 
ATOM   5135  C  C     . THR B 1 425 ? 63.197  68.897  47.800  1.00 72.55  ? 693 THR B C     1 
ATOM   5136  O  O     . THR B 1 425 ? 62.052  69.219  47.465  1.00 72.55  ? 693 THR B O     1 
ATOM   5137  C  CB    . THR B 1 425 ? 63.756  66.529  48.391  1.00 72.55  ? 693 THR B CB    1 
ATOM   5138  O  OG1   . THR B 1 425 ? 64.366  65.326  47.910  1.00 72.55  ? 693 THR B OG1   1 
ATOM   5139  C  CG2   . THR B 1 425 ? 62.329  66.222  48.763  1.00 72.55  ? 693 THR B CG2   1 
ATOM   5140  N  N     . ALA B 1 426 ? 63.959  69.670  48.578  1.00 69.34  ? 694 ALA B N     1 
ATOM   5141  C  CA    . ALA B 1 426 ? 63.475  70.949  49.086  1.00 69.34  ? 694 ALA B CA    1 
ATOM   5142  C  C     . ALA B 1 426 ? 63.282  71.963  47.971  1.00 69.34  ? 694 ALA B C     1 
ATOM   5143  O  O     . ALA B 1 426 ? 62.477  72.886  48.113  1.00 69.34  ? 694 ALA B O     1 
ATOM   5144  C  CB    . ALA B 1 426 ? 64.442  71.496  50.127  1.00 69.34  ? 694 ALA B CB    1 
ATOM   5145  N  N     . ARG B 1 427 ? 64.012  71.823  46.869  1.00 71.26  ? 695 ARG B N     1 
ATOM   5146  C  CA    . ARG B 1 427 ? 63.683  72.602  45.688  1.00 71.26  ? 695 ARG B CA    1 
ATOM   5147  C  C     . ARG B 1 427 ? 62.393  72.101  45.054  1.00 71.26  ? 695 ARG B C     1 
ATOM   5148  O  O     . ARG B 1 427 ? 61.585  72.896  44.561  1.00 71.26  ? 695 ARG B O     1 
ATOM   5149  C  CB    . ARG B 1 427 ? 64.831  72.549  44.685  1.00 71.26  ? 695 ARG B CB    1 
ATOM   5150  C  CG    . ARG B 1 427 ? 64.622  73.432  43.478  1.00 71.26  ? 695 ARG B CG    1 
ATOM   5151  C  CD    . ARG B 1 427 ? 65.816  73.405  42.561  1.00 71.26  ? 695 ARG B CD    1 
ATOM   5152  N  NE    . ARG B 1 427 ? 65.619  74.278  41.412  1.00 71.26  ? 695 ARG B NE    1 
ATOM   5153  C  CZ    . ARG B 1 427 ? 66.527  74.477  40.465  1.00 71.26  ? 695 ARG B CZ    1 
ATOM   5154  N  NH1   . ARG B 1 427 ? 67.698  73.861  40.531  1.00 71.26  ? 695 ARG B NH1   1 
ATOM   5155  N  NH2   . ARG B 1 427 ? 66.266  75.293  39.454  1.00 71.26  ? 695 ARG B NH2   1 
ATOM   5156  N  N     . LEU B 1 428 ? 62.175  70.786  45.077  1.00 68.85  ? 696 LEU B N     1 
ATOM   5157  C  CA    . LEU B 1 428 ? 60.953  70.221  44.517  1.00 68.85  ? 696 LEU B CA    1 
ATOM   5158  C  C     . LEU B 1 428 ? 59.752  70.520  45.399  1.00 68.85  ? 696 LEU B C     1 
ATOM   5159  O  O     . LEU B 1 428 ? 58.653  70.766  44.890  1.00 68.85  ? 696 LEU B O     1 
ATOM   5160  C  CB    . LEU B 1 428 ? 61.112  68.716  44.329  1.00 68.85  ? 696 LEU B CB    1 
ATOM   5161  C  CG    . LEU B 1 428 ? 59.928  67.969  43.725  1.00 68.85  ? 696 LEU B CG    1 
ATOM   5162  C  CD1   . LEU B 1 428 ? 59.675  68.478  42.333  1.00 68.85  ? 696 LEU B CD1   1 
ATOM   5163  C  CD2   . LEU B 1 428 ? 60.192  66.482  43.719  1.00 68.85  ? 696 LEU B CD2   1 
ATOM   5164  N  N     . ILE B 1 429 ? 59.940  70.501  46.720  1.00 68.89  ? 697 ILE B N     1 
ATOM   5165  C  CA    . ILE B 1 429 ? 58.853  70.820  47.642  1.00 68.89  ? 697 ILE B CA    1 
ATOM   5166  C  C     . ILE B 1 429 ? 58.437  72.278  47.498  1.00 68.89  ? 697 ILE B C     1 
ATOM   5167  O  O     . ILE B 1 429 ? 57.262  72.580  47.268  1.00 68.89  ? 697 ILE B O     1 
ATOM   5168  C  CB    . ILE B 1 429 ? 59.260  70.491  49.088  1.00 68.89  ? 697 ILE B CB    1 
ATOM   5169  C  CG1   . ILE B 1 429 ? 59.341  68.985  49.293  1.00 68.89  ? 697 ILE B CG1   1 
ATOM   5170  C  CG2   . ILE B 1 429 ? 58.301  71.104  50.069  1.00 68.89  ? 697 ILE B CG2   1 
ATOM   5171  C  CD1   . ILE B 1 429 ? 59.902  68.601  50.618  1.00 68.89  ? 697 ILE B CD1   1 
ATOM   5172  N  N     . ASP B 1 430 ? 59.394  73.198  47.588  1.00 68.87  ? 698 ASP B N     1 
ATOM   5173  C  CA    . ASP B 1 430 ? 59.076  74.618  47.590  1.00 68.87  ? 698 ASP B CA    1 
ATOM   5174  C  C     . ASP B 1 430 ? 58.614  75.134  46.238  1.00 68.87  ? 698 ASP B C     1 
ATOM   5175  O  O     . ASP B 1 430 ? 58.075  76.243  46.176  1.00 68.87  ? 698 ASP B O     1 
ATOM   5176  C  CB    . ASP B 1 430 ? 60.285  75.422  48.051  1.00 68.87  ? 698 ASP B CB    1 
ATOM   5177  C  CG    . ASP B 1 430 ? 60.629  75.164  49.494  1.00 68.87  ? 698 ASP B CG    1 
ATOM   5178  O  OD1   . ASP B 1 430 ? 59.716  74.808  50.258  1.00 68.87  ? 698 ASP B OD1   1 
ATOM   5179  O  OD2   . ASP B 1 430 ? 61.806  75.324  49.870  1.00 68.87  ? 698 ASP B OD2   1 
ATOM   5180  N  N     . ASP B 1 431 ? 58.819  74.386  45.162  1.00 67.83  ? 699 ASP B N     1 
ATOM   5181  C  CA    . ASP B 1 431 ? 58.244  74.769  43.884  1.00 67.83  ? 699 ASP B CA    1 
ATOM   5182  C  C     . ASP B 1 431 ? 56.832  74.249  43.705  1.00 67.83  ? 699 ASP B C     1 
ATOM   5183  O  O     . ASP B 1 431 ? 56.087  74.793  42.887  1.00 67.83  ? 699 ASP B O     1 
ATOM   5184  C  CB    . ASP B 1 431 ? 59.118  74.276  42.731  1.00 67.83  ? 699 ASP B CB    1 
ATOM   5185  C  CG    . ASP B 1 431 ? 60.391  75.081  42.584  1.00 67.83  ? 699 ASP B CG    1 
ATOM   5186  O  OD1   . ASP B 1 431 ? 60.376  76.281  42.931  1.00 67.83  ? 699 ASP B OD1   1 
ATOM   5187  O  OD2   . ASP B 1 431 ? 61.404  74.520  42.120  1.00 67.83  ? 699 ASP B OD2   1 
ATOM   5188  N  N     . GLU B 1 432 ? 56.448  73.223  44.453  1.00 69.52  ? 700 GLU B N     1 
ATOM   5189  C  CA    . GLU B 1 432 ? 55.096  72.692  44.386  1.00 69.52  ? 700 GLU B CA    1 
ATOM   5190  C  C     . GLU B 1 432 ? 54.152  73.378  45.357  1.00 69.52  ? 700 GLU B C     1 
ATOM   5191  O  O     . GLU B 1 432 ? 52.959  73.507  45.060  1.00 69.52  ? 700 GLU B O     1 
ATOM   5192  C  CB    . GLU B 1 432 ? 55.121  71.192  44.654  1.00 69.52  ? 700 GLU B CB    1 
ATOM   5193  C  CG    . GLU B 1 432 ? 55.700  70.400  43.505  1.00 69.52  ? 700 GLU B CG    1 
ATOM   5194  C  CD    . GLU B 1 432 ? 54.767  70.360  42.317  1.00 69.52  ? 700 GLU B CD    1 
ATOM   5195  O  OE1   . GLU B 1 432 ? 53.541  70.291  42.533  1.00 69.52  ? 700 GLU B OE1   1 
ATOM   5196  O  OE2   . GLU B 1 432 ? 55.250  70.422  41.169  1.00 69.52  ? 700 GLU B OE2   1 
ATOM   5197  N  N     . VAL B 1 433 ? 54.670  73.812  46.507  1.00 65.27  ? 701 VAL B N     1 
ATOM   5198  C  CA    . VAL B 1 433 ? 53.901  74.631  47.440  1.00 65.27  ? 701 VAL B CA    1 
ATOM   5199  C  C     . VAL B 1 433 ? 53.517  75.950  46.790  1.00 65.27  ? 701 VAL B C     1 
ATOM   5200  O  O     . VAL B 1 433 ? 52.406  76.457  46.977  1.00 65.27  ? 701 VAL B O     1 
ATOM   5201  C  CB    . VAL B 1 433 ? 54.715  74.834  48.729  1.00 65.27  ? 701 VAL B CB    1 
ATOM   5202  C  CG1   . VAL B 1 433 ? 54.029  75.779  49.680  1.00 65.27  ? 701 VAL B CG1   1 
ATOM   5203  C  CG2   . VAL B 1 433 ? 54.931  73.507  49.389  1.00 65.27  ? 701 VAL B CG2   1 
ATOM   5204  N  N     . ARG B 1 434 ? 54.410  76.495  45.973  1.00 66.32  ? 702 ARG B N     1 
ATOM   5205  C  CA    . ARG B 1 434 ? 54.115  77.709  45.232  1.00 66.32  ? 702 ARG B CA    1 
ATOM   5206  C  C     . ARG B 1 434 ? 53.074  77.464  44.148  1.00 66.32  ? 702 ARG B C     1 
ATOM   5207  O  O     . ARG B 1 434 ? 52.317  78.375  43.805  1.00 66.32  ? 702 ARG B O     1 
ATOM   5208  C  CB    . ARG B 1 434 ? 55.413  78.244  44.643  1.00 66.32  ? 702 ARG B CB    1 
ATOM   5209  C  CG    . ARG B 1 434 ? 55.366  79.630  44.067  1.00 66.32  ? 702 ARG B CG    1 
ATOM   5210  C  CD    . ARG B 1 434 ? 56.764  80.049  43.649  1.00 66.32  ? 702 ARG B CD    1 
ATOM   5211  N  NE    . ARG B 1 434 ? 57.681  80.057  44.786  1.00 66.32  ? 702 ARG B NE    1 
ATOM   5212  C  CZ    . ARG B 1 434 ? 58.729  79.250  44.909  1.00 66.32  ? 702 ARG B CZ    1 
ATOM   5213  N  NH1   . ARG B 1 434 ? 59.001  78.369  43.960  1.00 66.32  ? 702 ARG B NH1   1 
ATOM   5214  N  NH2   . ARG B 1 434 ? 59.504  79.322  45.980  1.00 66.32  ? 702 ARG B NH2   1 
ATOM   5215  N  N     . ILE B 1 435 ? 53.009  76.247  43.607  1.00 65.51  ? 703 ILE B N     1 
ATOM   5216  C  CA    . ILE B 1 435 ? 51.926  75.907  42.690  1.00 65.51  ? 703 ILE B CA    1 
ATOM   5217  C  C     . ILE B 1 435 ? 50.626  75.723  43.458  1.00 65.51  ? 703 ILE B C     1 
ATOM   5218  O  O     . ILE B 1 435 ? 49.557  76.155  43.009  1.00 65.51  ? 703 ILE B O     1 
ATOM   5219  C  CB    . ILE B 1 435 ? 52.302  74.658  41.868  1.00 65.51  ? 703 ILE B CB    1 
ATOM   5220  C  CG1   . ILE B 1 435 ? 53.465  74.973  40.934  1.00 65.51  ? 703 ILE B CG1   1 
ATOM   5221  C  CG2   . ILE B 1 435 ? 51.138  74.149  41.039  1.00 65.51  ? 703 ILE B CG2   1 
ATOM   5222  C  CD1   . ILE B 1 435 ? 54.047  73.761  40.247  1.00 65.51  ? 703 ILE B CD1   1 
ATOM   5223  N  N     . LEU B 1 436 ? 50.702  75.115  44.643  1.00 64.43  ? 704 LEU B N     1 
ATOM   5224  C  CA    . LEU B 1 436 ? 49.506  74.837  45.431  1.00 64.43  ? 704 LEU B CA    1 
ATOM   5225  C  C     . LEU B 1 436 ? 48.852  76.115  45.937  1.00 64.43  ? 704 LEU B C     1 
ATOM   5226  O  O     . LEU B 1 436 ? 47.623  76.212  45.976  1.00 64.43  ? 704 LEU B O     1 
ATOM   5227  C  CB    . LEU B 1 436 ? 49.864  73.923  46.596  1.00 64.43  ? 704 LEU B CB    1 
ATOM   5228  C  CG    . LEU B 1 436 ? 48.737  73.467  47.505  1.00 64.43  ? 704 LEU B CG    1 
ATOM   5229  C  CD1   . LEU B 1 436 ? 47.729  72.683  46.711  1.00 64.43  ? 704 LEU B CD1   1 
ATOM   5230  C  CD2   . LEU B 1 436 ? 49.321  72.611  48.593  1.00 64.43  ? 704 LEU B CD2   1 
ATOM   5231  N  N     . ILE B 1 437 ? 49.653  77.113  46.305  1.00 64.26  ? 705 ILE B N     1 
ATOM   5232  C  CA    . ILE B 1 437 ? 49.091  78.355  46.821  1.00 64.26  ? 705 ILE B CA    1 
ATOM   5233  C  C     . ILE B 1 437 ? 48.500  79.191  45.696  1.00 64.26  ? 705 ILE B C     1 
ATOM   5234  O  O     . ILE B 1 437 ? 47.414  79.756  45.844  1.00 64.26  ? 705 ILE B O     1 
ATOM   5235  C  CB    . ILE B 1 437 ? 50.153  79.118  47.631  1.00 64.26  ? 705 ILE B CB    1 
ATOM   5236  C  CG1   . ILE B 1 437 ? 50.485  78.324  48.890  1.00 64.26  ? 705 ILE B CG1   1 
ATOM   5237  C  CG2   . ILE B 1 437 ? 49.670  80.488  48.030  1.00 64.26  ? 705 ILE B CG2   1 
ATOM   5238  C  CD1   . ILE B 1 437 ? 51.669  78.831  49.631  1.00 64.26  ? 705 ILE B CD1   1 
ATOM   5239  N  N     . ASN B 1 438 ? 49.167  79.247  44.540  1.00 65.13  ? 706 ASN B N     1 
ATOM   5240  C  CA    . ASN B 1 438 ? 48.591  79.964  43.405  1.00 65.13  ? 706 ASN B CA    1 
ATOM   5241  C  C     . ASN B 1 438 ? 47.369  79.261  42.828  1.00 65.13  ? 706 ASN B C     1 
ATOM   5242  O  O     . ASN B 1 438 ? 46.515  79.919  42.226  1.00 65.13  ? 706 ASN B O     1 
ATOM   5243  C  CB    . ASN B 1 438 ? 49.633  80.175  42.313  1.00 65.13  ? 706 ASN B CB    1 
ATOM   5244  C  CG    . ASN B 1 438 ? 50.615  81.259  42.659  1.00 65.13  ? 706 ASN B CG    1 
ATOM   5245  O  OD1   . ASN B 1 438 ? 51.801  81.009  42.851  1.00 65.13  ? 706 ASN B OD1   1 
ATOM   5246  N  ND2   . ASN B 1 438 ? 50.126  82.486  42.729  1.00 65.13  ? 706 ASN B ND2   1 
ATOM   5247  N  N     . ASP B 1 439 ? 47.251  77.944  42.998  1.00 66.67  ? 707 ASP B N     1 
ATOM   5248  C  CA    . ASP B 1 439 ? 45.999  77.294  42.625  1.00 66.67  ? 707 ASP B CA    1 
ATOM   5249  C  C     . ASP B 1 439 ? 44.893  77.622  43.615  1.00 66.67  ? 707 ASP B C     1 
ATOM   5250  O  O     . ASP B 1 439 ? 43.726  77.725  43.226  1.00 66.67  ? 707 ASP B O     1 
ATOM   5251  C  CB    . ASP B 1 439 ? 46.184  75.784  42.517  1.00 66.67  ? 707 ASP B CB    1 
ATOM   5252  C  CG    . ASP B 1 439 ? 46.988  75.384  41.300  1.00 66.67  ? 707 ASP B CG    1 
ATOM   5253  O  OD1   . ASP B 1 439 ? 46.974  76.136  40.304  1.00 66.67  ? 707 ASP B OD1   1 
ATOM   5254  O  OD2   . ASP B 1 439 ? 47.622  74.310  41.331  1.00 66.67  ? 707 ASP B OD2   1 
ATOM   5255  N  N     . ALA B 1 440 ? 45.237  77.792  44.891  1.00 64.69  ? 708 ALA B N     1 
ATOM   5256  C  CA    . ALA B 1 440 ? 44.266  78.296  45.852  1.00 64.69  ? 708 ALA B CA    1 
ATOM   5257  C  C     . ALA B 1 440 ? 44.005  79.777  45.644  1.00 64.69  ? 708 ALA B C     1 
ATOM   5258  O  O     . ALA B 1 440 ? 42.927  80.272  45.982  1.00 64.69  ? 708 ALA B O     1 
ATOM   5259  C  CB    . ALA B 1 440 ? 44.753  78.044  47.276  1.00 64.69  ? 708 ALA B CB    1 
ATOM   5260  N  N     . TYR B 1 441 ? 44.976  80.498  45.094  1.00 63.93  ? 709 TYR B N     1 
ATOM   5261  C  CA    . TYR B 1 441 ? 44.820  81.932  44.922  1.00 63.93  ? 709 TYR B CA    1 
ATOM   5262  C  C     . TYR B 1 441 ? 43.969  82.249  43.707  1.00 63.93  ? 709 TYR B C     1 
ATOM   5263  O  O     . TYR B 1 441 ? 43.094  83.114  43.777  1.00 63.93  ? 709 TYR B O     1 
ATOM   5264  C  CB    . TYR B 1 441 ? 46.187  82.596  44.796  1.00 63.93  ? 709 TYR B CB    1 
ATOM   5265  C  CG    . TYR B 1 441 ? 46.152  84.100  44.744  1.00 63.93  ? 709 TYR B CG    1 
ATOM   5266  C  CD1   . TYR B 1 441 ? 45.996  84.848  45.900  1.00 63.93  ? 709 TYR B CD1   1 
ATOM   5267  C  CD2   . TYR B 1 441 ? 46.282  84.773  43.540  1.00 63.93  ? 709 TYR B CD2   1 
ATOM   5268  C  CE1   . TYR B 1 441 ? 45.970  86.218  45.858  1.00 63.93  ? 709 TYR B CE1   1 
ATOM   5269  C  CE2   . TYR B 1 441 ? 46.255  86.143  43.489  1.00 63.93  ? 709 TYR B CE2   1 
ATOM   5270  C  CZ    . TYR B 1 441 ? 46.096  86.856  44.650  1.00 63.93  ? 709 TYR B CZ    1 
ATOM   5271  O  OH    . TYR B 1 441 ? 46.069  88.221  44.599  1.00 63.93  ? 709 TYR B OH    1 
ATOM   5272  N  N     . LYS B 1 442 ? 44.215  81.564  42.589  1.00 65.63  ? 710 LYS B N     1 
ATOM   5273  C  CA    . LYS B 1 442 ? 43.460  81.831  41.370  1.00 65.63  ? 710 LYS B CA    1 
ATOM   5274  C  C     . LYS B 1 442 ? 42.009  81.402  41.498  1.00 65.63  ? 710 LYS B C     1 
ATOM   5275  O  O     . LYS B 1 442 ? 41.138  81.958  40.823  1.00 65.63  ? 710 LYS B O     1 
ATOM   5276  C  CB    . LYS B 1 442 ? 44.103  81.125  40.180  1.00 65.63  ? 710 LYS B CB    1 
ATOM   5277  C  CG    . LYS B 1 442 ? 45.416  81.719  39.719  1.00 65.63  ? 710 LYS B CG    1 
ATOM   5278  C  CD    . LYS B 1 442 ? 45.939  80.960  38.517  1.00 65.63  ? 710 LYS B CD    1 
ATOM   5279  C  CE    . LYS B 1 442 ? 47.255  81.528  38.035  1.00 65.63  ? 710 LYS B CE    1 
ATOM   5280  N  NZ    . LYS B 1 442 ? 47.776  80.769  36.867  1.00 65.63  ? 710 LYS B NZ    1 
ATOM   5281  N  N     . ARG B 1 443 ? 41.731  80.424  42.355  1.00 66.12  ? 711 ARG B N     1 
ATOM   5282  C  CA    . ARG B 1 443 ? 40.358  80.001  42.577  1.00 66.12  ? 711 ARG B CA    1 
ATOM   5283  C  C     . ARG B 1 443 ? 39.587  81.031  43.389  1.00 66.12  ? 711 ARG B C     1 
ATOM   5284  O  O     . ARG B 1 443 ? 38.389  81.224  43.164  1.00 66.12  ? 711 ARG B O     1 
ATOM   5285  C  CB    . ARG B 1 443 ? 40.366  78.635  43.256  1.00 66.12  ? 711 ARG B CB    1 
ATOM   5286  C  CG    . ARG B 1 443 ? 39.028  77.990  43.492  1.00 66.12  ? 711 ARG B CG    1 
ATOM   5287  C  CD    . ARG B 1 443 ? 39.260  76.543  43.873  1.00 66.12  ? 711 ARG B CD    1 
ATOM   5288  N  NE    . ARG B 1 443 ? 38.030  75.813  44.143  1.00 66.12  ? 711 ARG B NE    1 
ATOM   5289  C  CZ    . ARG B 1 443 ? 37.533  75.629  45.358  1.00 66.12  ? 711 ARG B CZ    1 
ATOM   5290  N  NH1   . ARG B 1 443 ? 38.171  76.104  46.415  1.00 66.12  ? 711 ARG B NH1   1 
ATOM   5291  N  NH2   . ARG B 1 443 ? 36.408  74.950  45.520  1.00 66.12  ? 711 ARG B NH2   1 
ATOM   5292  N  N     . THR B 1 444 ? 40.262  81.725  44.303  1.00 67.04  ? 712 THR B N     1 
ATOM   5293  C  CA    . THR B 1 444 ? 39.605  82.749  45.106  1.00 67.04  ? 712 THR B CA    1 
ATOM   5294  C  C     . THR B 1 444 ? 39.431  84.043  44.323  1.00 67.04  ? 712 THR B C     1 
ATOM   5295  O  O     . THR B 1 444 ? 38.398  84.709  44.446  1.00 67.04  ? 712 THR B O     1 
ATOM   5296  C  CB    . THR B 1 444 ? 40.408  82.990  46.379  1.00 67.04  ? 712 THR B CB    1 
ATOM   5297  O  OG1   . THR B 1 444 ? 40.529  81.759  47.087  1.00 67.04  ? 712 THR B OG1   1 
ATOM   5298  C  CG2   . THR B 1 444 ? 39.724  83.977  47.278  1.00 67.04  ? 712 THR B CG2   1 
ATOM   5299  N  N     . VAL B 1 445 ? 40.431  84.406  43.514  1.00 65.39  ? 713 VAL B N     1 
ATOM   5300  C  CA    . VAL B 1 445 ? 40.307  85.563  42.631  1.00 65.39  ? 713 VAL B CA    1 
ATOM   5301  C  C     . VAL B 1 445 ? 39.184  85.343  41.630  1.00 65.39  ? 713 VAL B C     1 
ATOM   5302  O  O     . VAL B 1 445 ? 38.406  86.256  41.342  1.00 65.39  ? 713 VAL B O     1 
ATOM   5303  C  CB    . VAL B 1 445 ? 41.649  85.854  41.932  1.00 65.39  ? 713 VAL B CB    1 
ATOM   5304  C  CG1   . VAL B 1 445 ? 41.513  86.969  40.916  1.00 65.39  ? 713 VAL B CG1   1 
ATOM   5305  C  CG2   . VAL B 1 445 ? 42.686  86.244  42.940  1.00 65.39  ? 713 VAL B CG2   1 
ATOM   5306  N  N     . ALA B 1 446 ? 39.038  84.114  41.134  1.00 66.47  ? 714 ALA B N     1 
ATOM   5307  C  CA    . ALA B 1 446 ? 37.891  83.805  40.292  1.00 66.47  ? 714 ALA B CA    1 
ATOM   5308  C  C     . ALA B 1 446 ? 36.591  83.777  41.079  1.00 66.47  ? 714 ALA B C     1 
ATOM   5309  O  O     . ALA B 1 446 ? 35.527  84.000  40.497  1.00 66.47  ? 714 ALA B O     1 
ATOM   5310  C  CB    . ALA B 1 446 ? 38.093  82.465  39.591  1.00 66.47  ? 714 ALA B CB    1 
ATOM   5311  N  N     . LEU B 1 447 ? 36.650  83.517  42.382  1.00 65.93  ? 715 LEU B N     1 
ATOM   5312  C  CA    . LEU B 1 447 ? 35.434  83.483  43.182  1.00 65.93  ? 715 LEU B CA    1 
ATOM   5313  C  C     . LEU B 1 447 ? 34.964  84.885  43.537  1.00 65.93  ? 715 LEU B C     1 
ATOM   5314  O  O     . LEU B 1 447 ? 33.800  85.231  43.322  1.00 65.93  ? 715 LEU B O     1 
ATOM   5315  C  CB    . LEU B 1 447 ? 35.661  82.664  44.449  1.00 65.93  ? 715 LEU B CB    1 
ATOM   5316  C  CG    . LEU B 1 447 ? 34.441  82.500  45.349  1.00 65.93  ? 715 LEU B CG    1 
ATOM   5317  C  CD1   . LEU B 1 447 ? 33.345  81.779  44.607  1.00 65.93  ? 715 LEU B CD1   1 
ATOM   5318  C  CD2   . LEU B 1 447 ? 34.810  81.737  46.598  1.00 65.93  ? 715 LEU B CD2   1 
ATOM   5319  N  N     . LEU B 1 448 ? 35.858  85.709  44.070  1.00 67.53  ? 716 LEU B N     1 
ATOM   5320  C  CA    . LEU B 1 448 ? 35.495  87.019  44.583  1.00 67.53  ? 716 LEU B CA    1 
ATOM   5321  C  C     . LEU B 1 448 ? 35.511  88.104  43.518  1.00 67.53  ? 716 LEU B C     1 
ATOM   5322  O  O     . LEU B 1 448 ? 35.411  89.282  43.862  1.00 67.53  ? 716 LEU B O     1 
ATOM   5323  C  CB    . LEU B 1 448 ? 36.421  87.410  45.733  1.00 67.53  ? 716 LEU B CB    1 
ATOM   5324  C  CG    . LEU B 1 448 ? 36.359  86.486  46.946  1.00 67.53  ? 716 LEU B CG    1 
ATOM   5325  C  CD1   . LEU B 1 448 ? 37.326  86.945  48.002  1.00 67.53  ? 716 LEU B CD1   1 
ATOM   5326  C  CD2   . LEU B 1 448 ? 34.965  86.426  47.500  1.00 67.53  ? 716 LEU B CD2   1 
ATOM   5327  N  N     . THR B 1 449 ? 35.641  87.746  42.245  1.00 70.36  ? 717 THR B N     1 
ATOM   5328  C  CA    . THR B 1 449 ? 35.438  88.704  41.165  1.00 70.36  ? 717 THR B CA    1 
ATOM   5329  C  C     . THR B 1 449 ? 34.083  88.520  40.501  1.00 70.36  ? 717 THR B C     1 
ATOM   5330  O  O     . THR B 1 449 ? 33.419  89.503  40.157  1.00 70.36  ? 717 THR B O     1 
ATOM   5331  C  CB    . THR B 1 449 ? 36.545  88.576  40.116  1.00 70.36  ? 717 THR B CB    1 
ATOM   5332  O  OG1   . THR B 1 449 ? 37.816  88.622  40.771  1.00 70.36  ? 717 THR B OG1   1 
ATOM   5333  C  CG2   . THR B 1 449 ? 36.493  89.719  39.115  1.00 70.36  ? 717 THR B CG2   1 
ATOM   5334  N  N     . GLU B 1 450 ? 33.660  87.267  40.330  1.00 73.93  ? 718 GLU B N     1 
ATOM   5335  C  CA    . GLU B 1 450 ? 32.292  86.986  39.914  1.00 73.93  ? 718 GLU B CA    1 
ATOM   5336  C  C     . GLU B 1 450 ? 31.301  87.420  40.983  1.00 73.93  ? 718 GLU B C     1 
ATOM   5337  O  O     . GLU B 1 450 ? 30.209  87.909  40.674  1.00 73.93  ? 718 GLU B O     1 
ATOM   5338  C  CB    . GLU B 1 450 ? 32.146  85.496  39.622  1.00 73.93  ? 718 GLU B CB    1 
ATOM   5339  C  CG    . GLU B 1 450 ? 30.789  85.077  39.111  1.00 73.93  ? 718 GLU B CG    1 
ATOM   5340  C  CD    . GLU B 1 450 ? 30.709  83.590  38.862  1.00 73.93  ? 718 GLU B CD    1 
ATOM   5341  O  OE1   . GLU B 1 450 ? 31.712  82.892  39.119  1.00 73.93  ? 718 GLU B OE1   1 
ATOM   5342  O  OE2   . GLU B 1 450 ? 29.646  83.117  38.410  1.00 73.93  ? 718 GLU B OE2   1 
ATOM   5343  N  N     . LYS B 1 451 ? 31.679  87.274  42.248  1.00 72.55  ? 719 LYS B N     1 
ATOM   5344  C  CA    . LYS B 1 451 ? 30.831  87.633  43.378  1.00 72.55  ? 719 LYS B CA    1 
ATOM   5345  C  C     . LYS B 1 451 ? 31.203  88.989  43.948  1.00 72.55  ? 719 LYS B C     1 
ATOM   5346  O  O     . LYS B 1 451 ? 31.155  89.183  45.163  1.00 72.55  ? 719 LYS B O     1 
ATOM   5347  C  CB    . LYS B 1 451 ? 30.918  86.559  44.453  1.00 72.55  ? 719 LYS B CB    1 
ATOM   5348  C  CG    . LYS B 1 451 ? 30.525  85.192  43.953  1.00 72.55  ? 719 LYS B CG    1 
ATOM   5349  C  CD    . LYS B 1 451 ? 29.068  85.163  43.536  1.00 72.55  ? 719 LYS B CD    1 
ATOM   5350  C  CE    . LYS B 1 451 ? 28.642  83.759  43.154  1.00 72.55  ? 719 LYS B CE    1 
ATOM   5351  N  NZ    . LYS B 1 451 ? 27.228  83.714  42.700  1.00 72.55  ? 719 LYS B NZ    1 
ATOM   5352  N  N     . LYS B 1 452 ? 31.583  89.937  43.087  1.00 71.68  ? 720 LYS B N     1 
ATOM   5353  C  CA    . LYS B 1 452 ? 32.159  91.196  43.552  1.00 71.68  ? 720 LYS B CA    1 
ATOM   5354  C  C     . LYS B 1 452 ? 31.121  92.077  44.231  1.00 71.68  ? 720 LYS B C     1 
ATOM   5355  O  O     . LYS B 1 452 ? 31.419  92.724  45.241  1.00 71.68  ? 720 LYS B O     1 
ATOM   5356  C  CB    . LYS B 1 452 ? 32.802  91.939  42.382  1.00 71.68  ? 720 LYS B CB    1 
ATOM   5357  C  CG    . LYS B 1 452 ? 33.506  93.224  42.770  1.00 71.68  ? 720 LYS B CG    1 
ATOM   5358  C  CD    . LYS B 1 452 ? 34.172  93.880  41.579  1.00 71.68  ? 720 LYS B CD    1 
ATOM   5359  C  CE    . LYS B 1 452 ? 34.823  95.189  41.980  1.00 71.68  ? 720 LYS B CE    1 
ATOM   5360  N  NZ    . LYS B 1 452 ? 35.470  95.860  40.823  1.00 71.68  ? 720 LYS B NZ    1 
ATOM   5361  N  N     . ALA B 1 453 ? 29.896  92.108  43.705  1.00 71.49  ? 721 ALA B N     1 
ATOM   5362  C  CA    . ALA B 1 453 ? 28.857  92.929  44.311  1.00 71.49  ? 721 ALA B CA    1 
ATOM   5363  C  C     . ALA B 1 453 ? 28.384  92.376  45.646  1.00 71.49  ? 721 ALA B C     1 
ATOM   5364  O  O     . ALA B 1 453 ? 27.855  93.134  46.461  1.00 71.49  ? 721 ALA B O     1 
ATOM   5365  C  CB    . ALA B 1 453 ? 27.670  93.068  43.361  1.00 71.49  ? 721 ALA B CB    1 
ATOM   5366  N  N     . ASP B 1 454 ? 28.565  91.080  45.890  1.00 72.87  ? 722 ASP B N     1 
ATOM   5367  C  CA    . ASP B 1 454 ? 28.165  90.517  47.171  1.00 72.87  ? 722 ASP B CA    1 
ATOM   5368  C  C     . ASP B 1 454 ? 29.183  90.809  48.262  1.00 72.87  ? 722 ASP B C     1 
ATOM   5369  O  O     . ASP B 1 454 ? 28.827  90.829  49.442  1.00 72.87  ? 722 ASP B O     1 
ATOM   5370  C  CB    . ASP B 1 454 ? 27.949  89.011  47.042  1.00 72.87  ? 722 ASP B CB    1 
ATOM   5371  C  CG    . ASP B 1 454 ? 26.721  88.667  46.222  1.00 72.87  ? 722 ASP B CG    1 
ATOM   5372  O  OD1   . ASP B 1 454 ? 25.776  89.481  46.199  1.00 72.87  ? 722 ASP B OD1   1 
ATOM   5373  O  OD2   . ASP B 1 454 ? 26.694  87.581  45.606  1.00 72.87  ? 722 ASP B OD2   1 
ATOM   5374  N  N     . VAL B 1 455 ? 30.445  91.026  47.900  1.00 70.81  ? 723 VAL B N     1 
ATOM   5375  C  CA    . VAL B 1 455 ? 31.419  91.435  48.902  1.00 70.81  ? 723 VAL B CA    1 
ATOM   5376  C  C     . VAL B 1 455 ? 31.226  92.914  49.224  1.00 70.81  ? 723 VAL B C     1 
ATOM   5377  O  O     . VAL B 1 455 ? 31.498  93.356  50.346  1.00 70.81  ? 723 VAL B O     1 
ATOM   5378  C  CB    . VAL B 1 455 ? 32.844  91.125  48.405  1.00 70.81  ? 723 VAL B CB    1 
ATOM   5379  C  CG1   . VAL B 1 455 ? 33.879  91.365  49.489  1.00 70.81  ? 723 VAL B CG1   1 
ATOM   5380  C  CG2   . VAL B 1 455 ? 32.942  89.705  47.896  1.00 70.81  ? 723 VAL B CG2   1 
ATOM   5381  N  N     . GLU B 1 456 ? 30.726  93.686  48.257  1.00 72.92  ? 724 GLU B N     1 
ATOM   5382  C  CA    . GLU B 1 456 ? 30.410  95.093  48.483  1.00 72.92  ? 724 GLU B CA    1 
ATOM   5383  C  C     . GLU B 1 456 ? 29.270  95.254  49.483  1.00 72.92  ? 724 GLU B C     1 
ATOM   5384  O  O     . GLU B 1 456 ? 29.274  96.190  50.288  1.00 72.92  ? 724 GLU B O     1 
ATOM   5385  C  CB    . GLU B 1 456 ? 30.047  95.749  47.151  1.00 72.92  ? 724 GLU B CB    1 
ATOM   5386  C  CG    . GLU B 1 456 ? 29.808  97.243  47.200  1.00 72.92  ? 724 GLU B CG    1 
ATOM   5387  C  CD    . GLU B 1 456 ? 31.083  98.028  47.381  1.00 72.92  ? 724 GLU B CD    1 
ATOM   5388  O  OE1   . GLU B 1 456 ? 32.151  97.525  46.977  1.00 72.92  ? 724 GLU B OE1   1 
ATOM   5389  O  OE2   . GLU B 1 456 ? 31.020  99.151  47.920  1.00 72.92  ? 724 GLU B OE2   1 
ATOM   5390  N  N     . LYS B 1 457 ? 28.295  94.342  49.458  1.00 70.59  ? 725 LYS B N     1 
ATOM   5391  C  CA    . LYS B 1 457 ? 27.147  94.450  50.353  1.00 70.59  ? 725 LYS B CA    1 
ATOM   5392  C  C     . LYS B 1 457 ? 27.520  94.092  51.783  1.00 70.59  ? 725 LYS B C     1 
ATOM   5393  O  O     . LYS B 1 457 ? 27.082  94.757  52.727  1.00 70.59  ? 725 LYS B O     1 
ATOM   5394  C  CB    . LYS B 1 457 ? 26.018  93.542  49.875  1.00 70.59  ? 725 LYS B CB    1 
ATOM   5395  C  CG    . LYS B 1 457 ? 25.407  93.924  48.549  1.00 70.59  ? 725 LYS B CG    1 
ATOM   5396  C  CD    . LYS B 1 457 ? 24.336  92.926  48.161  1.00 70.59  ? 725 LYS B CD    1 
ATOM   5397  C  CE    . LYS B 1 457 ? 23.786  93.217  46.782  1.00 70.59  ? 725 LYS B CE    1 
ATOM   5398  N  NZ    . LYS B 1 457 ? 22.776  92.205  46.373  1.00 70.59  ? 725 LYS B NZ    1 
ATOM   5399  N  N     . VAL B 1 458 ? 28.306  93.028  51.958  1.00 72.33  ? 726 VAL B N     1 
ATOM   5400  C  CA    . VAL B 1 458 ? 28.665  92.549  53.289  1.00 72.33  ? 726 VAL B CA    1 
ATOM   5401  C  C     . VAL B 1 458 ? 29.572  93.547  53.986  1.00 72.33  ? 726 VAL B C     1 
ATOM   5402  O  O     . VAL B 1 458 ? 29.479  93.750  55.203  1.00 72.33  ? 726 VAL B O     1 
ATOM   5403  C  CB    . VAL B 1 458 ? 29.313  91.156  53.168  1.00 72.33  ? 726 VAL B CB    1 
ATOM   5404  C  CG1   . VAL B 1 458 ? 29.829  90.654  54.501  1.00 72.33  ? 726 VAL B CG1   1 
ATOM   5405  C  CG2   . VAL B 1 458 ? 28.317  90.170  52.616  1.00 72.33  ? 726 VAL B CG2   1 
ATOM   5406  N  N     . ALA B 1 459 ? 30.402  94.242  53.224  1.00 70.92  ? 727 ALA B N     1 
ATOM   5407  C  CA    . ALA B 1 459 ? 31.394  95.116  53.825  1.00 70.92  ? 727 ALA B CA    1 
ATOM   5408  C  C     . ALA B 1 459 ? 30.807  96.444  54.269  1.00 70.92  ? 727 ALA B C     1 
ATOM   5409  O  O     . ALA B 1 459 ? 31.149  96.941  55.347  1.00 70.92  ? 727 ALA B O     1 
ATOM   5410  C  CB    . ALA B 1 459 ? 32.508  95.354  52.834  1.00 70.92  ? 727 ALA B CB    1 
ATOM   5411  N  N     . LEU B 1 460 ? 29.937  97.040  53.450  1.00 71.99  ? 728 LEU B N     1 
ATOM   5412  C  CA    . LEU B 1 460 ? 29.330  98.312  53.817  1.00 71.99  ? 728 LEU B CA    1 
ATOM   5413  C  C     . LEU B 1 460 ? 28.369  98.158  54.983  1.00 71.99  ? 728 LEU B C     1 
ATOM   5414  O  O     . LEU B 1 460 ? 28.131  99.121  55.719  1.00 71.99  ? 728 LEU B O     1 
ATOM   5415  C  CB    . LEU B 1 460 ? 28.607  98.911  52.618  1.00 71.99  ? 728 LEU B CB    1 
ATOM   5416  C  CG    . LEU B 1 460 ? 29.506  99.302  51.452  1.00 71.99  ? 728 LEU B CG    1 
ATOM   5417  C  CD1   . LEU B 1 460 ? 28.668  99.753  50.277  1.00 71.99  ? 728 LEU B CD1   1 
ATOM   5418  C  CD2   . LEU B 1 460 ? 30.463  100.390 51.873  1.00 71.99  ? 728 LEU B CD2   1 
ATOM   5419  N  N     . LEU B 1 461 ? 27.813  96.964  55.169  1.00 74.01  ? 729 LEU B N     1 
ATOM   5420  C  CA    . LEU B 1 461 ? 27.005  96.713  56.350  1.00 74.01  ? 729 LEU B CA    1 
ATOM   5421  C  C     . LEU B 1 461 ? 27.878  96.544  57.585  1.00 74.01  ? 729 LEU B C     1 
ATOM   5422  O  O     . LEU B 1 461 ? 27.439  96.854  58.693  1.00 74.01  ? 729 LEU B O     1 
ATOM   5423  C  CB    . LEU B 1 461 ? 26.120  95.490  56.122  1.00 74.01  ? 729 LEU B CB    1 
ATOM   5424  C  CG    . LEU B 1 461 ? 25.022  95.229  57.145  1.00 74.01  ? 729 LEU B CG    1 
ATOM   5425  C  CD1   . LEU B 1 461 ? 24.097  96.419  57.202  1.00 74.01  ? 729 LEU B CD1   1 
ATOM   5426  C  CD2   . LEU B 1 461 ? 24.248  93.990  56.760  1.00 74.01  ? 729 LEU B CD2   1 
ATOM   5427  N  N     . LEU B 1 462 ? 29.116  96.078  57.422  1.00 75.20  ? 730 LEU B N     1 
ATOM   5428  C  CA    . LEU B 1 462 ? 30.078  96.173  58.513  1.00 75.20  ? 730 LEU B CA    1 
ATOM   5429  C  C     . LEU B 1 462 ? 30.583  97.586  58.713  1.00 75.20  ? 730 LEU B C     1 
ATOM   5430  O  O     . LEU B 1 462 ? 31.105  97.900  59.784  1.00 75.20  ? 730 LEU B O     1 
ATOM   5431  C  CB    . LEU B 1 462 ? 31.280  95.273  58.268  1.00 75.20  ? 730 LEU B CB    1 
ATOM   5432  C  CG    . LEU B 1 462 ? 31.179  93.783  58.517  1.00 75.20  ? 730 LEU B CG    1 
ATOM   5433  C  CD1   . LEU B 1 462 ? 32.422  93.130  57.980  1.00 75.20  ? 730 LEU B CD1   1 
ATOM   5434  C  CD2   . LEU B 1 462 ? 31.077  93.557  60.005  1.00 75.20  ? 730 LEU B CD2   1 
ATOM   5435  N  N     . LEU B 1 463 ? 30.463  98.439  57.706  1.00 75.48  ? 731 LEU B N     1 
ATOM   5436  C  CA    . LEU B 1 463 ? 30.987  99.787  57.829  1.00 75.48  ? 731 LEU B CA    1 
ATOM   5437  C  C     . LEU B 1 463 ? 30.039  100.695 58.605  1.00 75.48  ? 731 LEU B C     1 
ATOM   5438  O  O     . LEU B 1 463 ? 30.423  101.812 58.964  1.00 75.48  ? 731 LEU B O     1 
ATOM   5439  C  CB    . LEU B 1 463 ? 31.272  100.334 56.428  1.00 75.48  ? 731 LEU B CB    1 
ATOM   5440  C  CG    . LEU B 1 463 ? 32.225  101.513 56.264  1.00 75.48  ? 731 LEU B CG    1 
ATOM   5441  C  CD1   . LEU B 1 463 ? 33.591  101.085 56.731  1.00 75.48  ? 731 LEU B CD1   1 
ATOM   5442  C  CD2   . LEU B 1 463 ? 32.273  101.978 54.823  1.00 75.48  ? 731 LEU B CD2   1 
ATOM   5443  N  N     . GLU B 1 464 ? 28.822  100.229 58.901  1.00 77.18  ? 732 GLU B N     1 
ATOM   5444  C  CA    . GLU B 1 464 ? 27.872  100.978 59.709  1.00 77.18  ? 732 GLU B CA    1 
ATOM   5445  C  C     . GLU B 1 464 ? 27.380  100.237 60.944  1.00 77.18  ? 732 GLU B C     1 
ATOM   5446  O  O     . GLU B 1 464 ? 26.928  100.892 61.886  1.00 77.18  ? 732 GLU B O     1 
ATOM   5447  C  CB    . GLU B 1 464 ? 26.655  101.390 58.866  1.00 77.18  ? 732 GLU B CB    1 
ATOM   5448  C  CG    . GLU B 1 464 ? 25.820  100.231 58.366  1.00 77.18  ? 732 GLU B CG    1 
ATOM   5449  C  CD    . GLU B 1 464 ? 24.659  100.683 57.507  1.00 77.18  ? 732 GLU B CD    1 
ATOM   5450  O  OE1   . GLU B 1 464 ? 24.521  101.904 57.289  1.00 77.18  ? 732 GLU B OE1   1 
ATOM   5451  O  OE2   . GLU B 1 464 ? 23.884  99.818  57.049  1.00 77.18  ? 732 GLU B OE2   1 
ATOM   5452  N  N     . LYS B 1 465 ? 27.446  98.909  60.972  1.00 77.85  ? 733 LYS B N     1 
ATOM   5453  C  CA    . LYS B 1 465 ? 26.981  98.130  62.110  1.00 77.85  ? 733 LYS B CA    1 
ATOM   5454  C  C     . LYS B 1 465 ? 28.120  97.542  62.924  1.00 77.85  ? 733 LYS B C     1 
ATOM   5455  O  O     . LYS B 1 465 ? 27.979  97.390  64.142  1.00 77.85  ? 733 LYS B O     1 
ATOM   5456  C  CB    . LYS B 1 465 ? 26.047  97.010  61.624  1.00 77.85  ? 733 LYS B CB    1 
ATOM   5457  C  CG    . LYS B 1 465 ? 25.440  96.111  62.685  1.00 77.85  ? 733 LYS B CG    1 
ATOM   5458  C  CD    . LYS B 1 465 ? 24.485  96.869  63.583  1.00 77.85  ? 733 LYS B CD    1 
ATOM   5459  C  CE    . LYS B 1 465 ? 23.789  95.929  64.553  1.00 77.85  ? 733 LYS B CE    1 
ATOM   5460  N  NZ    . LYS B 1 465 ? 24.748  95.333  65.525  1.00 77.85  ? 733 LYS B NZ    1 
ATOM   5461  N  N     . GLU B 1 466 ? 29.227  97.198  62.254  1.00 79.98  ? 734 GLU B N     1 
ATOM   5462  C  CA    . GLU B 1 466 ? 30.523  96.761  62.778  1.00 79.98  ? 734 GLU B CA    1 
ATOM   5463  C  C     . GLU B 1 466 ? 30.515  95.352  63.355  1.00 79.98  ? 734 GLU B C     1 
ATOM   5464  O  O     . GLU B 1 466 ? 31.572  94.843  63.732  1.00 79.98  ? 734 GLU B O     1 
ATOM   5465  C  CB    . GLU B 1 466 ? 31.073  97.744  63.817  1.00 79.98  ? 734 GLU B CB    1 
ATOM   5466  C  CG    . GLU B 1 466 ? 31.390  99.106  63.248  1.00 79.98  ? 734 GLU B CG    1 
ATOM   5467  C  CD    . GLU B 1 466 ? 31.954  100.047 64.288  1.00 79.98  ? 734 GLU B CD    1 
ATOM   5468  O  OE1   . GLU B 1 466 ? 31.986  99.668  65.476  1.00 79.98  ? 734 GLU B OE1   1 
ATOM   5469  O  OE2   . GLU B 1 466 ? 32.366  101.164 63.916  1.00 79.98  ? 734 GLU B OE2   1 
ATOM   5470  N  N     . VAL B 1 467 ? 29.349  94.713  63.433  1.00 79.97  ? 735 VAL B N     1 
ATOM   5471  C  CA    . VAL B 1 467 ? 29.222  93.310  63.819  1.00 79.97  ? 735 VAL B CA    1 
ATOM   5472  C  C     . VAL B 1 467 ? 28.173  92.683  62.916  1.00 79.97  ? 735 VAL B C     1 
ATOM   5473  O  O     . VAL B 1 467 ? 27.049  93.185  62.833  1.00 79.97  ? 735 VAL B O     1 
ATOM   5474  C  CB    . VAL B 1 467 ? 28.812  93.125  65.297  1.00 79.97  ? 735 VAL B CB    1 
ATOM   5475  C  CG1   . VAL B 1 467 ? 28.524  91.668  65.586  1.00 79.97  ? 735 VAL B CG1   1 
ATOM   5476  C  CG2   . VAL B 1 467 ? 29.885  93.609  66.260  1.00 79.97  ? 735 VAL B CG2   1 
ATOM   5477  N  N     . LEU B 1 468 ? 28.525  91.596  62.237  1.00 82.24  ? 736 LEU B N     1 
ATOM   5478  C  CA    . LEU B 1 468 ? 27.546  90.826  61.486  1.00 82.24  ? 736 LEU B CA    1 
ATOM   5479  C  C     . LEU B 1 468 ? 27.453  89.408  62.020  1.00 82.24  ? 736 LEU B C     1 
ATOM   5480  O  O     . LEU B 1 468 ? 28.466  88.775  62.323  1.00 82.24  ? 736 LEU B O     1 
ATOM   5481  C  CB    . LEU B 1 468 ? 27.862  90.789  59.997  1.00 82.24  ? 736 LEU B CB    1 
ATOM   5482  C  CG    . LEU B 1 468 ? 27.674  92.129  59.303  1.00 82.24  ? 736 LEU B CG    1 
ATOM   5483  C  CD1   . LEU B 1 468 ? 27.953  91.991  57.822  1.00 82.24  ? 736 LEU B CD1   1 
ATOM   5484  C  CD2   . LEU B 1 468 ? 26.281  92.656  59.555  1.00 82.24  ? 736 LEU B CD2   1 
ATOM   5485  N  N     . ASP B 1 469 ? 26.223  88.925  62.128  1.00 92.13  ? 737 ASP B N     1 
ATOM   5486  C  CA    . ASP B 1 469 ? 25.910  87.562  62.521  1.00 92.13  ? 737 ASP B CA    1 
ATOM   5487  C  C     . ASP B 1 469 ? 25.527  86.777  61.270  1.00 92.13  ? 737 ASP B C     1 
ATOM   5488  O  O     . ASP B 1 469 ? 25.391  87.341  60.183  1.00 92.13  ? 737 ASP B O     1 
ATOM   5489  C  CB    . ASP B 1 469 ? 24.778  87.578  63.559  1.00 92.13  ? 737 ASP B CB    1 
ATOM   5490  C  CG    . ASP B 1 469 ? 24.656  86.279  64.336  1.00 92.13  ? 737 ASP B CG    1 
ATOM   5491  O  OD1   . ASP B 1 469 ? 25.401  85.326  64.035  1.00 92.13  ? 737 ASP B OD1   1 
ATOM   5492  O  OD2   . ASP B 1 469 ? 23.812  86.217  65.253  1.00 92.13  ? 737 ASP B OD2   1 
ATOM   5493  N  N     . LYS B 1 470 ? 25.379  85.457  61.427  1.00 93.61  ? 738 LYS B N     1 
ATOM   5494  C  CA    . LYS B 1 470 ? 24.961  84.617  60.309  1.00 93.61  ? 738 LYS B CA    1 
ATOM   5495  C  C     . LYS B 1 470 ? 23.549  84.962  59.852  1.00 93.61  ? 738 LYS B C     1 
ATOM   5496  O  O     . LYS B 1 470 ? 23.241  84.866  58.659  1.00 93.61  ? 738 LYS B O     1 
ATOM   5497  C  CB    . LYS B 1 470 ? 25.054  83.141  60.697  1.00 93.61  ? 738 LYS B CB    1 
ATOM   5498  C  CG    . LYS B 1 470 ? 24.822  82.190  59.535  1.00 93.61  ? 738 LYS B CG    1 
ATOM   5499  C  CD    . LYS B 1 470 ? 24.999  80.738  59.921  1.00 93.61  ? 738 LYS B CD    1 
ATOM   5500  C  CE    . LYS B 1 470 ? 24.799  79.842  58.710  1.00 93.61  ? 738 LYS B CE    1 
ATOM   5501  N  NZ    . LYS B 1 470 ? 24.996  78.406  59.032  1.00 93.61  ? 738 LYS B NZ    1 
ATOM   5502  N  N     . ASN B 1 471 ? 22.694  85.400  60.780  1.00 93.08  ? 739 ASN B N     1 
ATOM   5503  C  CA    . ASN B 1 471 ? 21.357  85.856  60.420  1.00 93.08  ? 739 ASN B CA    1 
ATOM   5504  C  C     . ASN B 1 471 ? 21.403  87.109  59.558  1.00 93.08  ? 739 ASN B C     1 
ATOM   5505  O  O     . ASN B 1 471 ? 20.550  87.292  58.685  1.00 93.08  ? 739 ASN B O     1 
ATOM   5506  C  CB    . ASN B 1 471 ? 20.545  86.116  61.682  1.00 93.08  ? 739 ASN B CB    1 
ATOM   5507  C  CG    . ASN B 1 471 ? 20.242  84.849  62.441  1.00 93.08  ? 739 ASN B CG    1 
ATOM   5508  O  OD1   . ASN B 1 471 ? 19.879  83.832  61.852  1.00 93.08  ? 739 ASN B OD1   1 
ATOM   5509  N  ND2   . ASN B 1 471 ? 20.404  84.895  63.757  1.00 93.08  ? 739 ASN B ND2   1 
ATOM   5510  N  N     . ASP B 1 472 ? 22.394  87.972  59.775  1.00 91.40  ? 740 ASP B N     1 
ATOM   5511  C  CA    . ASP B 1 472 ? 22.567  89.127  58.905  1.00 91.40  ? 740 ASP B CA    1 
ATOM   5512  C  C     . ASP B 1 472 ? 23.123  88.737  57.545  1.00 91.40  ? 740 ASP B C     1 
ATOM   5513  O  O     . ASP B 1 472 ? 22.969  89.496  56.584  1.00 91.40  ? 740 ASP B O     1 
ATOM   5514  C  CB    . ASP B 1 472 ? 23.486  90.147  59.568  1.00 91.40  ? 740 ASP B CB    1 
ATOM   5515  C  CG    . ASP B 1 472 ? 22.858  90.786  60.785  1.00 91.40  ? 740 ASP B CG    1 
ATOM   5516  O  OD1   . ASP B 1 472 ? 21.617  90.920  60.811  1.00 91.40  ? 740 ASP B OD1   1 
ATOM   5517  O  OD2   . ASP B 1 472 ? 23.601  91.147  61.719  1.00 91.40  ? 740 ASP B OD2   1 
ATOM   5518  N  N     . MET B 1 473 ? 23.769  87.577  57.448  1.00 88.00  ? 741 MET B N     1 
ATOM   5519  C  CA    . MET B 1 473 ? 24.289  87.116  56.170  1.00 88.00  ? 741 MET B CA    1 
ATOM   5520  C  C     . MET B 1 473 ? 23.197  86.461  55.335  1.00 88.00  ? 741 MET B C     1 
ATOM   5521  O  O     . MET B 1 473 ? 23.193  86.584  54.106  1.00 88.00  ? 741 MET B O     1 
ATOM   5522  C  CB    . MET B 1 473 ? 25.431  86.134  56.404  1.00 88.00  ? 741 MET B CB    1 
ATOM   5523  C  CG    . MET B 1 473 ? 26.614  86.706  57.153  1.00 88.00  ? 741 MET B CG    1 
ATOM   5524  S  SD    . MET B 1 473 ? 27.428  88.040  56.274  1.00 88.00  ? 741 MET B SD    1 
ATOM   5525  C  CE    . MET B 1 473 ? 28.151  87.134  54.920  1.00 88.00  ? 741 MET B CE    1 
ATOM   5526  N  N     . VAL B 1 474 ? 22.273  85.755  55.991  1.00 86.62  ? 742 VAL B N     1 
ATOM   5527  C  CA    . VAL B 1 474 ? 21.172  85.111  55.283  1.00 86.62  ? 742 VAL B CA    1 
ATOM   5528  C  C     . VAL B 1 474 ? 20.195  86.157  54.765  1.00 86.62  ? 742 VAL B C     1 
ATOM   5529  O  O     . VAL B 1 474 ? 19.676  86.045  53.648  1.00 86.62  ? 742 VAL B O     1 
ATOM   5530  C  CB    . VAL B 1 474 ? 20.491  84.084  56.207  1.00 86.62  ? 742 VAL B CB    1 
ATOM   5531  C  CG1   . VAL B 1 474 ? 19.270  83.463  55.549  1.00 86.62  ? 742 VAL B CG1   1 
ATOM   5532  C  CG2   . VAL B 1 474 ? 21.471  82.998  56.589  1.00 86.62  ? 742 VAL B CG2   1 
ATOM   5533  N  N     . GLU B 1 475 ? 19.970  87.218  55.542  1.00 89.18  ? 743 GLU B N     1 
ATOM   5534  C  CA    . GLU B 1 475 ? 19.094  88.297  55.103  1.00 89.18  ? 743 GLU B CA    1 
ATOM   5535  C  C     . GLU B 1 475 ? 19.703  89.127  53.984  1.00 89.18  ? 743 GLU B C     1 
ATOM   5536  O  O     . GLU B 1 475 ? 18.975  89.855  53.303  1.00 89.18  ? 743 GLU B O     1 
ATOM   5537  C  CB    . GLU B 1 475 ? 18.751  89.206  56.280  1.00 89.18  ? 743 GLU B CB    1 
ATOM   5538  C  CG    . GLU B 1 475 ? 17.852  88.565  57.315  1.00 89.18  ? 743 GLU B CG    1 
ATOM   5539  C  CD    . GLU B 1 475 ? 17.605  89.470  58.501  1.00 89.18  ? 743 GLU B CD    1 
ATOM   5540  O  OE1   . GLU B 1 475 ? 18.245  90.538  58.575  1.00 89.18  ? 743 GLU B OE1   1 
ATOM   5541  O  OE2   . GLU B 1 475 ? 16.771  89.114  59.360  1.00 89.18  ? 743 GLU B OE2   1 
ATOM   5542  N  N     . LEU B 1 476 ? 21.010  89.034  53.775  1.00 83.93  ? 744 LEU B N     1 
ATOM   5543  C  CA    . LEU B 1 476 ? 21.697  89.827  52.768  1.00 83.93  ? 744 LEU B CA    1 
ATOM   5544  C  C     . LEU B 1 476 ? 22.087  89.031  51.534  1.00 83.93  ? 744 LEU B C     1 
ATOM   5545  O  O     . LEU B 1 476 ? 22.016  89.556  50.422  1.00 83.93  ? 744 LEU B O     1 
ATOM   5546  C  CB    . LEU B 1 476 ? 22.944  90.469  53.384  1.00 83.93  ? 744 LEU B CB    1 
ATOM   5547  C  CG    . LEU B 1 476 ? 23.752  91.451  52.543  1.00 83.93  ? 744 LEU B CG    1 
ATOM   5548  C  CD1   . LEU B 1 476 ? 22.885  92.617  52.125  1.00 83.93  ? 744 LEU B CD1   1 
ATOM   5549  C  CD2   . LEU B 1 476 ? 24.930  91.939  53.349  1.00 83.93  ? 744 LEU B CD2   1 
ATOM   5550  N  N     . LEU B 1 477 ? 22.480  87.769  51.694  1.00 81.40  ? 745 LEU B N     1 
ATOM   5551  C  CA    . LEU B 1 477 ? 22.946  86.955  50.581  1.00 81.40  ? 745 LEU B CA    1 
ATOM   5552  C  C     . LEU B 1 477 ? 21.978  85.852  50.187  1.00 81.40  ? 745 LEU B C     1 
ATOM   5553  O  O     . LEU B 1 477 ? 22.239  85.139  49.214  1.00 81.40  ? 745 LEU B O     1 
ATOM   5554  C  CB    . LEU B 1 477 ? 24.299  86.328  50.919  1.00 81.40  ? 745 LEU B CB    1 
ATOM   5555  C  CG    . LEU B 1 477 ? 25.455  87.295  51.129  1.00 81.40  ? 745 LEU B CG    1 
ATOM   5556  C  CD1   . LEU B 1 477 ? 26.678  86.528  51.561  1.00 81.40  ? 745 LEU B CD1   1 
ATOM   5557  C  CD2   . LEU B 1 477 ? 25.724  88.062  49.859  1.00 81.40  ? 745 LEU B CD2   1 
ATOM   5558  N  N     . GLY B 1 478 ? 20.875  85.688  50.904  1.00 82.69  ? 746 GLY B N     1 
ATOM   5559  C  CA    . GLY B 1 478 ? 20.025  84.541  50.715  1.00 82.69  ? 746 GLY B CA    1 
ATOM   5560  C  C     . GLY B 1 478 ? 20.569  83.369  51.497  1.00 82.69  ? 746 GLY B C     1 
ATOM   5561  O  O     . GLY B 1 478 ? 21.536  83.504  52.253  1.00 82.69  ? 746 GLY B O     1 
ATOM   5562  N  N     . PRO B 1 479 ? 19.953  82.200  51.354  1.00 82.45  ? 747 PRO B N     1 
ATOM   5563  C  CA    . PRO B 1 479 ? 20.489  81.006  52.009  1.00 82.45  ? 747 PRO B CA    1 
ATOM   5564  C  C     . PRO B 1 479 ? 21.786  80.562  51.356  1.00 82.45  ? 747 PRO B C     1 
ATOM   5565  O  O     . PRO B 1 479 ? 22.076  80.878  50.201  1.00 82.45  ? 747 PRO B O     1 
ATOM   5566  C  CB    . PRO B 1 479 ? 19.386  79.962  51.808  1.00 82.45  ? 747 PRO B CB    1 
ATOM   5567  C  CG    . PRO B 1 479 ? 18.159  80.752  51.537  1.00 82.45  ? 747 PRO B CG    1 
ATOM   5568  C  CD    . PRO B 1 479 ? 18.629  81.947  50.767  1.00 82.45  ? 747 PRO B CD    1 
ATOM   5569  N  N     . ARG B 1 480 ? 22.574  79.832  52.127  1.00 84.95  ? 748 ARG B N     1 
ATOM   5570  C  CA    . ARG B 1 480 ? 23.819  79.286  51.611  1.00 84.95  ? 748 ARG B CA    1 
ATOM   5571  C  C     . ARG B 1 480 ? 23.505  78.164  50.629  1.00 84.95  ? 748 ARG B C     1 
ATOM   5572  O  O     . ARG B 1 480 ? 22.683  77.295  50.937  1.00 84.95  ? 748 ARG B O     1 
ATOM   5573  C  CB    . ARG B 1 480 ? 24.678  78.773  52.757  1.00 84.95  ? 748 ARG B CB    1 
ATOM   5574  C  CG    . ARG B 1 480 ? 26.033  78.278  52.335  1.00 84.95  ? 748 ARG B CG    1 
ATOM   5575  C  CD    . ARG B 1 480 ? 26.854  77.870  53.527  1.00 84.95  ? 748 ARG B CD    1 
ATOM   5576  N  NE    . ARG B 1 480 ? 28.130  77.294  53.125  1.00 84.95  ? 748 ARG B NE    1 
ATOM   5577  C  CZ    . ARG B 1 480 ? 29.014  76.794  53.977  1.00 84.95  ? 748 ARG B CZ    1 
ATOM   5578  N  NH1   . ARG B 1 480 ? 28.752  76.792  55.271  1.00 84.95  ? 748 ARG B NH1   1 
ATOM   5579  N  NH2   . ARG B 1 480 ? 30.153  76.285  53.534  1.00 84.95  ? 748 ARG B NH2   1 
ATOM   5580  N  N     . PRO B 1 481 ? 24.137  78.132  49.445  1.00 86.44  ? 749 PRO B N     1 
ATOM   5581  C  CA    . PRO B 1 481 ? 23.691  77.205  48.391  1.00 86.44  ? 749 PRO B CA    1 
ATOM   5582  C  C     . PRO B 1 481 ? 24.064  75.745  48.604  1.00 86.44  ? 749 PRO B C     1 
ATOM   5583  O  O     . PRO B 1 481 ? 23.922  74.934  47.685  1.00 86.44  ? 749 PRO B O     1 
ATOM   5584  C  CB    . PRO B 1 481 ? 24.382  77.752  47.135  1.00 86.44  ? 749 PRO B CB    1 
ATOM   5585  C  CG    . PRO B 1 481 ? 24.724  79.158  47.458  1.00 86.44  ? 749 PRO B CG    1 
ATOM   5586  C  CD    . PRO B 1 481 ? 25.054  79.151  48.912  1.00 86.44  ? 749 PRO B CD    1 
ATOM   5587  N  N     . PHE B 1 482 ? 24.535  75.394  49.793  1.00 89.01  ? 750 PHE B N     1 
ATOM   5588  C  CA    . PHE B 1 482 ? 25.082  74.083  50.088  1.00 89.01  ? 750 PHE B CA    1 
ATOM   5589  C  C     . PHE B 1 482 ? 24.327  73.481  51.262  1.00 89.01  ? 750 PHE B C     1 
ATOM   5590  O  O     . PHE B 1 482 ? 23.792  74.203  52.107  1.00 89.01  ? 750 PHE B O     1 
ATOM   5591  C  CB    . PHE B 1 482 ? 26.569  74.213  50.400  1.00 89.01  ? 750 PHE B CB    1 
ATOM   5592  C  CG    . PHE B 1 482 ? 27.376  74.668  49.227  1.00 89.01  ? 750 PHE B CG    1 
ATOM   5593  C  CD1   . PHE B 1 482 ? 27.039  74.259  47.949  1.00 89.01  ? 750 PHE B CD1   1 
ATOM   5594  C  CD2   . PHE B 1 482 ? 28.379  75.603  49.382  1.00 89.01  ? 750 PHE B CD2   1 
ATOM   5595  C  CE1   . PHE B 1 482 ? 27.746  74.700  46.858  1.00 89.01  ? 750 PHE B CE1   1 
ATOM   5596  C  CE2   . PHE B 1 482 ? 29.087  76.055  48.289  1.00 89.01  ? 750 PHE B CE2   1 
ATOM   5597  C  CZ    . PHE B 1 482 ? 28.770  75.601  47.026  1.00 89.01  ? 750 PHE B CZ    1 
ATOM   5598  N  N     . ALA B 1 483 ? 24.291  72.150  51.316  1.00 100.13 ? 751 ALA B N     1 
ATOM   5599  C  CA    . ALA B 1 483 ? 23.586  71.442  52.385  1.00 100.13 ? 751 ALA B CA    1 
ATOM   5600  C  C     . ALA B 1 483 ? 24.412  71.551  53.663  1.00 100.13 ? 751 ALA B C     1 
ATOM   5601  O  O     . ALA B 1 483 ? 25.132  70.635  54.065  1.00 100.13 ? 751 ALA B O     1 
ATOM   5602  C  CB    . ALA B 1 483 ? 23.338  69.989  52.000  1.00 100.13 ? 751 ALA B CB    1 
ATOM   5603  N  N     . GLU B 1 484 ? 24.300  72.706  54.314  1.00 107.88 ? 752 GLU B N     1 
ATOM   5604  C  CA    . GLU B 1 484 ? 25.105  73.007  55.482  1.00 107.88 ? 752 GLU B CA    1 
ATOM   5605  C  C     . GLU B 1 484 ? 24.532  72.319  56.715  1.00 107.88 ? 752 GLU B C     1 
ATOM   5606  O  O     . GLU B 1 484 ? 23.489  71.661  56.674  1.00 107.88 ? 752 GLU B O     1 
ATOM   5607  C  CB    . GLU B 1 484 ? 25.188  74.514  55.706  1.00 107.88 ? 752 GLU B CB    1 
ATOM   5608  C  CG    . GLU B 1 484 ? 23.856  75.158  56.067  1.00 107.88 ? 752 GLU B CG    1 
ATOM   5609  C  CD    . GLU B 1 484 ? 23.971  76.651  56.316  1.00 107.88 ? 752 GLU B CD    1 
ATOM   5610  O  OE1   . GLU B 1 484 ? 25.092  77.191  56.214  1.00 107.88 ? 752 GLU B OE1   1 
ATOM   5611  O  OE2   . GLU B 1 484 ? 22.939  77.287  56.616  1.00 107.88 ? 752 GLU B OE2   1 
ATOM   5612  N  N     . LYS B 1 485 ? 25.234  72.476  57.833  1.00 119.02 ? 753 LYS B N     1 
ATOM   5613  C  CA    . LYS B 1 485 ? 24.805  71.937  59.119  1.00 119.02 ? 753 LYS B CA    1 
ATOM   5614  C  C     . LYS B 1 485 ? 25.102  72.991  60.175  1.00 119.02 ? 753 LYS B C     1 
ATOM   5615  O  O     . LYS B 1 485 ? 26.269  73.283  60.447  1.00 119.02 ? 753 LYS B O     1 
ATOM   5616  C  CB    . LYS B 1 485 ? 25.516  70.623  59.439  1.00 119.02 ? 753 LYS B CB    1 
ATOM   5617  C  CG    . LYS B 1 485 ? 25.101  69.433  58.596  1.00 119.02 ? 753 LYS B CG    1 
ATOM   5618  C  CD    . LYS B 1 485 ? 25.834  68.179  59.035  1.00 119.02 ? 753 LYS B CD    1 
ATOM   5619  C  CE    . LYS B 1 485 ? 25.425  66.979  58.198  1.00 119.02 ? 753 LYS B CE    1 
ATOM   5620  N  NZ    . LYS B 1 485 ? 26.140  65.742  58.618  1.00 119.02 ? 753 LYS B NZ    1 
ATOM   5621  N  N     . SER B 1 486 ? 24.060  73.589  60.734  1.00 123.91 ? 754 SER B N     1 
ATOM   5622  C  CA    . SER B 1 486 ? 24.225  74.600  61.773  1.00 123.91 ? 754 SER B CA    1 
ATOM   5623  C  C     . SER B 1 486 ? 23.370  74.344  63.004  1.00 123.91 ? 754 SER B C     1 
ATOM   5624  O  O     . SER B 1 486 ? 23.818  74.609  64.121  1.00 123.91 ? 754 SER B O     1 
ATOM   5625  C  CB    . SER B 1 486 ? 23.908  75.991  61.198  1.00 123.91 ? 754 SER B CB    1 
ATOM   5626  O  OG    . SER B 1 486 ? 22.545  76.094  60.825  1.00 123.91 ? 754 SER B OG    1 
ATOM   5627  N  N     . THR B 1 487 ? 22.155  73.837  62.827  1.00 125.75 ? 755 THR B N     1 
ATOM   5628  C  CA    . THR B 1 487 ? 21.234  73.605  63.927  1.00 125.75 ? 755 THR B CA    1 
ATOM   5629  C  C     . THR B 1 487 ? 21.707  72.394  64.730  1.00 125.75 ? 755 THR B C     1 
ATOM   5630  O  O     . THR B 1 487 ? 22.392  71.513  64.204  1.00 125.75 ? 755 THR B O     1 
ATOM   5631  C  CB    . THR B 1 487 ? 19.823  73.389  63.364  1.00 125.75 ? 755 THR B CB    1 
ATOM   5632  O  OG1   . THR B 1 487 ? 19.549  74.406  62.395  1.00 125.75 ? 755 THR B OG1   1 
ATOM   5633  C  CG2   . THR B 1 487 ? 18.753  73.507  64.435  1.00 125.75 ? 755 THR B CG2   1 
ATOM   5634  N  N     . TYR B 1 488 ? 21.384  72.381  66.029  1.00 119.39 ? 756 TYR B N     1 
ATOM   5635  C  CA    . TYR B 1 488 ? 21.726  71.233  66.866  1.00 119.39 ? 756 TYR B CA    1 
ATOM   5636  C  C     . TYR B 1 488 ? 20.975  69.980  66.437  1.00 119.39 ? 756 TYR B C     1 
ATOM   5637  O  O     . TYR B 1 488 ? 21.530  68.877  66.477  1.00 119.39 ? 756 TYR B O     1 
ATOM   5638  C  CB    . TYR B 1 488 ? 21.433  71.531  68.335  1.00 119.39 ? 756 TYR B CB    1 
ATOM   5639  C  CG    . TYR B 1 488 ? 21.705  70.353  69.245  1.00 119.39 ? 756 TYR B CG    1 
ATOM   5640  C  CD1   . TYR B 1 488 ? 23.001  69.994  69.573  1.00 119.39 ? 756 TYR B CD1   1 
ATOM   5641  C  CD2   . TYR B 1 488 ? 20.667  69.598  69.772  1.00 119.39 ? 756 TYR B CD2   1 
ATOM   5642  C  CE1   . TYR B 1 488 ? 23.259  68.916  70.400  1.00 119.39 ? 756 TYR B CE1   1 
ATOM   5643  C  CE2   . TYR B 1 488 ? 20.917  68.518  70.601  1.00 119.39 ? 756 TYR B CE2   1 
ATOM   5644  C  CZ    . TYR B 1 488 ? 22.216  68.184  70.910  1.00 119.39 ? 756 TYR B CZ    1 
ATOM   5645  O  OH    . TYR B 1 488 ? 22.478  67.114  71.733  1.00 119.39 ? 756 TYR B OH    1 
ATOM   5646  N  N     . GLU B 1 489 ? 19.713  70.126  66.029  1.00 127.31 ? 757 GLU B N     1 
ATOM   5647  C  CA    . GLU B 1 489 ? 18.922  68.954  65.676  1.00 127.31 ? 757 GLU B CA    1 
ATOM   5648  C  C     . GLU B 1 489 ? 19.341  68.335  64.348  1.00 127.31 ? 757 GLU B C     1 
ATOM   5649  O  O     . GLU B 1 489 ? 19.004  67.176  64.098  1.00 127.31 ? 757 GLU B O     1 
ATOM   5650  C  CB    . GLU B 1 489 ? 17.432  69.304  65.656  1.00 127.31 ? 757 GLU B CB    1 
ATOM   5651  C  CG    . GLU B 1 489 ? 16.815  69.476  67.041  1.00 127.31 ? 757 GLU B CG    1 
ATOM   5652  C  CD    . GLU B 1 489 ? 16.990  70.867  67.616  1.00 127.31 ? 757 GLU B CD    1 
ATOM   5653  O  OE1   . GLU B 1 489 ? 17.524  71.744  66.910  1.00 127.31 ? 757 GLU B OE1   1 
ATOM   5654  O  OE2   . GLU B 1 489 ? 16.592  71.081  68.779  1.00 127.31 ? 757 GLU B OE2   1 
ATOM   5655  N  N     . GLU B 1 490 ? 20.072  69.062  63.500  1.00 127.48 ? 758 GLU B N     1 
ATOM   5656  C  CA    . GLU B 1 490 ? 20.652  68.468  62.303  1.00 127.48 ? 758 GLU B CA    1 
ATOM   5657  C  C     . GLU B 1 490 ? 22.104  68.053  62.501  1.00 127.48 ? 758 GLU B C     1 
ATOM   5658  O  O     . GLU B 1 490 ? 22.646  67.327  61.663  1.00 127.48 ? 758 GLU B O     1 
ATOM   5659  C  CB    . GLU B 1 490 ? 20.541  69.426  61.108  1.00 127.48 ? 758 GLU B CB    1 
ATOM   5660  C  CG    . GLU B 1 490 ? 21.351  70.700  61.226  1.00 127.48 ? 758 GLU B CG    1 
ATOM   5661  C  CD    . GLU B 1 490 ? 21.133  71.637  60.056  1.00 127.48 ? 758 GLU B CD    1 
ATOM   5662  O  OE1   . GLU B 1 490 ? 20.357  71.279  59.146  1.00 127.48 ? 758 GLU B OE1   1 
ATOM   5663  O  OE2   . GLU B 1 490 ? 21.724  72.735  60.052  1.00 127.48 ? 758 GLU B OE2   1 
ATOM   5664  N  N     . PHE B 1 491 ? 22.736  68.495  63.589  1.00 126.01 ? 759 PHE B N     1 
ATOM   5665  C  CA    . PHE B 1 491 ? 24.017  67.945  64.016  1.00 126.01 ? 759 PHE B CA    1 
ATOM   5666  C  C     . PHE B 1 491 ? 23.886  66.543  64.597  1.00 126.01 ? 759 PHE B C     1 
ATOM   5667  O  O     . PHE B 1 491 ? 24.882  65.815  64.658  1.00 126.01 ? 759 PHE B O     1 
ATOM   5668  C  CB    . PHE B 1 491 ? 24.649  68.860  65.067  1.00 126.01 ? 759 PHE B CB    1 
ATOM   5669  C  CG    . PHE B 1 491 ? 25.347  70.067  64.505  1.00 126.01 ? 759 PHE B CG    1 
ATOM   5670  C  CD1   . PHE B 1 491 ? 25.910  70.044  63.246  1.00 126.01 ? 759 PHE B CD1   1 
ATOM   5671  C  CD2   . PHE B 1 491 ? 25.412  71.243  65.240  1.00 126.01 ? 759 PHE B CD2   1 
ATOM   5672  C  CE1   . PHE B 1 491 ? 26.560  71.154  62.754  1.00 126.01 ? 759 PHE B CE1   1 
ATOM   5673  C  CE2   . PHE B 1 491 ? 26.047  72.361  64.741  1.00 126.01 ? 759 PHE B CE2   1 
ATOM   5674  C  CZ    . PHE B 1 491 ? 26.615  72.317  63.495  1.00 126.01 ? 759 PHE B CZ    1 
ATOM   5675  N  N     . VAL B 1 492 ? 22.684  66.151  65.021  1.00 135.90 ? 760 VAL B N     1 
ATOM   5676  C  CA    . VAL B 1 492 ? 22.488  64.955  65.834  1.00 135.90 ? 760 VAL B CA    1 
ATOM   5677  C  C     . VAL B 1 492 ? 21.886  63.798  65.040  1.00 135.90 ? 760 VAL B C     1 
ATOM   5678  O  O     . VAL B 1 492 ? 21.905  62.654  65.525  1.00 135.90 ? 760 VAL B O     1 
ATOM   5679  C  CB    . VAL B 1 492 ? 21.616  65.275  67.072  1.00 135.90 ? 760 VAL B CB    1 
ATOM   5680  C  CG1   . VAL B 1 492 ? 20.137  65.369  66.698  1.00 135.90 ? 760 VAL B CG1   1 
ATOM   5681  C  CG2   . VAL B 1 492 ? 21.879  64.337  68.251  1.00 135.90 ? 760 VAL B CG2   1 
ATOM   5682  N  N     . GLU B 1 493 ? 21.406  64.040  63.818  1.00 139.78 ? 761 GLU B N     1 
ATOM   5683  C  CA    . GLU B 1 493 ? 20.731  63.010  63.033  1.00 139.78 ? 761 GLU B CA    1 
ATOM   5684  C  C     . GLU B 1 493 ? 21.665  61.930  62.497  1.00 139.78 ? 761 GLU B C     1 
ATOM   5685  O  O     . GLU B 1 493 ? 21.175  60.962  61.908  1.00 139.78 ? 761 GLU B O     1 
ATOM   5686  C  CB    . GLU B 1 493 ? 19.984  63.649  61.861  1.00 139.78 ? 761 GLU B CB    1 
ATOM   5687  C  CG    . GLU B 1 493 ? 18.782  64.470  62.271  1.00 139.78 ? 761 GLU B CG    1 
ATOM   5688  C  CD    . GLU B 1 493 ? 18.100  65.134  61.093  1.00 139.78 ? 761 GLU B CD    1 
ATOM   5689  O  OE1   . GLU B 1 493 ? 18.639  65.055  59.969  1.00 139.78 ? 761 GLU B OE1   1 
ATOM   5690  O  OE2   . GLU B 1 493 ? 17.027  65.739  61.293  1.00 139.78 ? 761 GLU B OE2   1 
ATOM   5691  N  N     . GLY B 1 494 ? 22.982  62.067  62.677  1.00 141.03 ? 762 GLY B N     1 
ATOM   5692  C  CA    . GLY B 1 494 ? 23.916  61.059  62.204  1.00 141.03 ? 762 GLY B CA    1 
ATOM   5693  C  C     . GLY B 1 494 ? 23.841  59.742  62.947  1.00 141.03 ? 762 GLY B C     1 
ATOM   5694  O  O     . GLY B 1 494 ? 24.216  58.705  62.389  1.00 141.03 ? 762 GLY B O     1 
ATOM   5695  N  N     . THR B 1 495 ? 23.367  59.757  64.190  1.00 141.25 ? 763 THR B N     1 
ATOM   5696  C  CA    . THR B 1 495 ? 23.174  58.538  64.963  1.00 141.25 ? 763 THR B CA    1 
ATOM   5697  C  C     . THR B 1 495 ? 21.714  58.119  65.049  1.00 141.25 ? 763 THR B C     1 
ATOM   5698  O  O     . THR B 1 495 ? 21.405  56.932  64.905  1.00 141.25 ? 763 THR B O     1 
ATOM   5699  C  CB    . THR B 1 495 ? 23.735  58.714  66.376  1.00 141.25 ? 763 THR B CB    1 
ATOM   5700  O  OG1   . THR B 1 495 ? 23.038  59.777  67.037  1.00 141.25 ? 763 THR B OG1   1 
ATOM   5701  C  CG2   . THR B 1 495 ? 25.215  59.047  66.315  1.00 141.25 ? 763 THR B CG2   1 
ATOM   5702  N  N     . GLY B 1 496 ? 20.807  59.067  65.275  1.00 145.46 ? 764 GLY B N     1 
ATOM   5703  C  CA    . GLY B 1 496 ? 19.388  58.784  65.346  1.00 145.46 ? 764 GLY B CA    1 
ATOM   5704  C  C     . GLY B 1 496 ? 18.802  58.796  66.739  1.00 145.46 ? 764 GLY B C     1 
ATOM   5705  O  O     . GLY B 1 496 ? 17.597  58.558  66.884  1.00 145.46 ? 764 GLY B O     1 
ATOM   5706  N  N     . SER B 1 497 ? 19.604  59.068  67.769  1.00 143.42 ? 765 SER B N     1 
ATOM   5707  C  CA    . SER B 1 497 ? 19.084  59.081  69.131  1.00 143.42 ? 765 SER B CA    1 
ATOM   5708  C  C     . SER B 1 497 ? 18.369  60.385  69.460  1.00 143.42 ? 765 SER B C     1 
ATOM   5709  O  O     . SER B 1 497 ? 17.535  60.405  70.375  1.00 143.42 ? 765 SER B O     1 
ATOM   5710  C  CB    . SER B 1 497 ? 20.218  58.838  70.128  1.00 143.42 ? 765 SER B CB    1 
ATOM   5711  O  OG    . SER B 1 497 ? 21.146  59.908  70.113  1.00 143.42 ? 765 SER B OG    1 
ATOM   5712  N  N     . LEU B 1 498 ? 18.757  61.483  68.790  1.00 142.77 ? 766 LEU B N     1 
ATOM   5713  C  CA    . LEU B 1 498 ? 18.122  62.808  68.770  1.00 142.77 ? 766 LEU B CA    1 
ATOM   5714  C  C     . LEU B 1 498 ? 18.308  63.577  70.084  1.00 142.77 ? 766 LEU B C     1 
ATOM   5715  O  O     . LEU B 1 498 ? 18.008  64.774  70.157  1.00 142.77 ? 766 LEU B O     1 
ATOM   5716  C  CB    . LEU B 1 498 ? 16.632  62.680  68.392  1.00 142.77 ? 766 LEU B CB    1 
ATOM   5717  C  CG    . LEU B 1 498 ? 15.722  63.872  68.066  1.00 142.77 ? 766 LEU B CG    1 
ATOM   5718  C  CD1   . LEU B 1 498 ? 16.207  64.596  66.822  1.00 142.77 ? 766 LEU B CD1   1 
ATOM   5719  C  CD2   . LEU B 1 498 ? 14.281  63.419  67.904  1.00 142.77 ? 766 LEU B CD2   1 
ATOM   5720  N  N     . ASP B 1 499 ? 18.866  62.928  71.103  1.00 139.13 ? 767 ASP B N     1 
ATOM   5721  C  CA    . ASP B 1 499 ? 19.117  63.550  72.394  1.00 139.13 ? 767 ASP B CA    1 
ATOM   5722  C  C     . ASP B 1 499 ? 20.155  62.707  73.119  1.00 139.13 ? 767 ASP B C     1 
ATOM   5723  O  O     . ASP B 1 499 ? 20.266  61.501  72.885  1.00 139.13 ? 767 ASP B O     1 
ATOM   5724  C  CB    . ASP B 1 499 ? 17.834  63.664  73.229  1.00 139.13 ? 767 ASP B CB    1 
ATOM   5725  C  CG    . ASP B 1 499 ? 17.980  64.603  74.416  1.00 139.13 ? 767 ASP B CG    1 
ATOM   5726  O  OD1   . ASP B 1 499 ? 19.070  65.184  74.601  1.00 139.13 ? 767 ASP B OD1   1 
ATOM   5727  O  OD2   . ASP B 1 499 ? 16.998  64.757  75.171  1.00 139.13 ? 767 ASP B OD2   1 
ATOM   5728  N  N     . GLU B 1 500 ? 20.912  63.356  73.996  1.00 135.08 ? 768 GLU B N     1 
ATOM   5729  C  CA    . GLU B 1 500 ? 21.924  62.661  74.776  1.00 135.08 ? 768 GLU B CA    1 
ATOM   5730  C  C     . GLU B 1 500 ? 21.249  61.898  75.909  1.00 135.08 ? 768 GLU B C     1 
ATOM   5731  O  O     . GLU B 1 500 ? 20.397  62.445  76.616  1.00 135.08 ? 768 GLU B O     1 
ATOM   5732  C  CB    . GLU B 1 500 ? 22.951  63.657  75.312  1.00 135.08 ? 768 GLU B CB    1 
ATOM   5733  C  CG    . GLU B 1 500 ? 24.234  63.032  75.828  1.00 135.08 ? 768 GLU B CG    1 
ATOM   5734  C  CD    . GLU B 1 500 ? 24.158  62.655  77.288  1.00 135.08 ? 768 GLU B CD    1 
ATOM   5735  O  OE1   . GLU B 1 500 ? 23.450  63.347  78.047  1.00 135.08 ? 768 GLU B OE1   1 
ATOM   5736  O  OE2   . GLU B 1 500 ? 24.792  61.654  77.670  1.00 135.08 ? 768 GLU B OE2   1 
ATOM   5737  N  N     . ASP B 1 501 ? 21.631  60.636  76.079  1.00 143.96 ? 769 ASP B N     1 
ATOM   5738  C  CA    . ASP B 1 501 ? 20.964  59.726  77.000  1.00 143.96 ? 769 ASP B CA    1 
ATOM   5739  C  C     . ASP B 1 501 ? 21.789  59.489  78.260  1.00 143.96 ? 769 ASP B C     1 
ATOM   5740  O  O     . ASP B 1 501 ? 23.016  59.359  78.204  1.00 143.96 ? 769 ASP B O     1 
ATOM   5741  C  CB    . ASP B 1 501 ? 20.646  58.394  76.308  1.00 143.96 ? 769 ASP B CB    1 
ATOM   5742  C  CG    . ASP B 1 501 ? 21.849  57.788  75.601  1.00 143.96 ? 769 ASP B CG    1 
ATOM   5743  O  OD1   . ASP B 1 501 ? 22.905  58.449  75.514  1.00 143.96 ? 769 ASP B OD1   1 
ATOM   5744  O  OD2   . ASP B 1 501 ? 21.732  56.643  75.119  1.00 143.96 ? 769 ASP B OD2   1 
ATOM   5745  N  N     . THR B 1 502 ? 21.102  59.455  79.403  1.00 144.80 ? 770 THR B N     1 
ATOM   5746  C  CA    . THR B 1 502 ? 21.701  59.147  80.701  1.00 144.80 ? 770 THR B CA    1 
ATOM   5747  C  C     . THR B 1 502 ? 20.908  57.990  81.303  1.00 144.80 ? 770 THR B C     1 
ATOM   5748  O  O     . THR B 1 502 ? 19.826  58.198  81.860  1.00 144.80 ? 770 THR B O     1 
ATOM   5749  C  CB    . THR B 1 502 ? 21.690  60.357  81.635  1.00 144.80 ? 770 THR B CB    1 
ATOM   5750  O  OG1   . THR B 1 502 ? 20.337  60.760  81.880  1.00 144.80 ? 770 THR B OG1   1 
ATOM   5751  C  CG2   . THR B 1 502 ? 22.458  61.526  81.035  1.00 144.80 ? 770 THR B CG2   1 
ATOM   5752  N  N     . SER B 1 503 ? 21.442  56.775  81.196  1.00 146.61 ? 771 SER B N     1 
ATOM   5753  C  CA    . SER B 1 503 ? 20.761  55.589  81.692  1.00 146.61 ? 771 SER B CA    1 
ATOM   5754  C  C     . SER B 1 503 ? 21.759  54.698  82.417  1.00 146.61 ? 771 SER B C     1 
ATOM   5755  O  O     . SER B 1 503 ? 22.969  54.768  82.185  1.00 146.61 ? 771 SER B O     1 
ATOM   5756  C  CB    . SER B 1 503 ? 20.082  54.814  80.556  1.00 146.61 ? 771 SER B CB    1 
ATOM   5757  O  OG    . SER B 1 503 ? 19.448  53.645  81.042  1.00 146.61 ? 771 SER B OG    1 
ATOM   5758  N  N     . LEU B 1 504 ? 21.233  53.850  83.305  1.00 146.16 ? 772 LEU B N     1 
ATOM   5759  C  CA    . LEU B 1 504 ? 22.090  52.964  84.075  1.00 146.16 ? 772 LEU B CA    1 
ATOM   5760  C  C     . LEU B 1 504 ? 22.035  51.542  83.531  1.00 146.16 ? 772 LEU B C     1 
ATOM   5761  O  O     . LEU B 1 504 ? 21.022  51.124  82.963  1.00 146.16 ? 772 LEU B O     1 
ATOM   5762  C  CB    . LEU B 1 504 ? 21.676  52.948  85.548  1.00 146.16 ? 772 LEU B CB    1 
ATOM   5763  C  CG    . LEU B 1 504 ? 21.886  54.243  86.326  1.00 146.16 ? 772 LEU B CG    1 
ATOM   5764  C  CD1   . LEU B 1 504 ? 21.349  54.109  87.737  1.00 146.16 ? 772 LEU B CD1   1 
ATOM   5765  C  CD2   . LEU B 1 504 ? 23.352  54.598  86.345  1.00 146.16 ? 772 LEU B CD2   1 
ATOM   5766  N  N     . PRO B 1 505 ? 23.115  50.772  83.687  1.00 145.29 ? 773 PRO B N     1 
ATOM   5767  C  CA    . PRO B 1 505 ? 23.056  49.348  83.338  1.00 145.29 ? 773 PRO B CA    1 
ATOM   5768  C  C     . PRO B 1 505 ? 22.284  48.536  84.364  1.00 145.29 ? 773 PRO B C     1 
ATOM   5769  O  O     . PRO B 1 505 ? 21.784  49.075  85.357  1.00 145.29 ? 773 PRO B O     1 
ATOM   5770  C  CB    . PRO B 1 505 ? 24.533  48.934  83.299  1.00 145.29 ? 773 PRO B CB    1 
ATOM   5771  C  CG    . PRO B 1 505 ? 25.284  50.204  83.114  1.00 145.29 ? 773 PRO B CG    1 
ATOM   5772  C  CD    . PRO B 1 505 ? 24.501  51.224  83.877  1.00 145.29 ? 773 PRO B CD    1 
ATOM   5773  N  N     . GLU B 1 506 ? 22.195  47.228  84.142  1.00 147.31 ? 774 GLU B N     1 
ATOM   5774  C  CA    . GLU B 1 506 ? 21.452  46.366  85.049  1.00 147.31 ? 774 GLU B CA    1 
ATOM   5775  C  C     . GLU B 1 506 ? 22.249  45.989  86.291  1.00 147.31 ? 774 GLU B C     1 
ATOM   5776  O  O     . GLU B 1 506 ? 21.649  45.623  87.307  1.00 147.31 ? 774 GLU B O     1 
ATOM   5777  C  CB    . GLU B 1 506 ? 20.999  45.101  84.316  1.00 147.31 ? 774 GLU B CB    1 
ATOM   5778  C  CG    . GLU B 1 506 ? 19.927  45.336  83.254  1.00 147.31 ? 774 GLU B CG    1 
ATOM   5779  C  CD    . GLU B 1 506 ? 20.493  45.751  81.905  1.00 147.31 ? 774 GLU B CD    1 
ATOM   5780  O  OE1   . GLU B 1 506 ? 21.732  45.808  81.761  1.00 147.31 ? 774 GLU B OE1   1 
ATOM   5781  O  OE2   . GLU B 1 506 ? 19.692  46.021  80.987  1.00 147.31 ? 774 GLU B OE2   1 
ATOM   5782  N  N     . GLY B 1 507 ? 23.573  46.071  86.241  1.00 145.08 ? 775 GLY B N     1 
ATOM   5783  C  CA    . GLY B 1 507 ? 24.404  45.773  87.386  1.00 145.08 ? 775 GLY B CA    1 
ATOM   5784  C  C     . GLY B 1 507 ? 24.730  46.959  88.263  1.00 145.08 ? 775 GLY B C     1 
ATOM   5785  O  O     . GLY B 1 507 ? 25.604  46.852  89.128  1.00 145.08 ? 775 GLY B O     1 
ATOM   5786  N  N     . LEU B 1 508 ? 24.055  48.089  88.067  1.00 144.07 ? 776 LEU B N     1 
ATOM   5787  C  CA    . LEU B 1 508 ? 24.337  49.342  88.763  1.00 144.07 ? 776 LEU B CA    1 
ATOM   5788  C  C     . LEU B 1 508 ? 23.070  49.870  89.425  1.00 144.07 ? 776 LEU B C     1 
ATOM   5789  O  O     . LEU B 1 508 ? 22.694  51.034  89.270  1.00 144.07 ? 776 LEU B O     1 
ATOM   5790  C  CB    . LEU B 1 508 ? 24.913  50.396  87.817  1.00 144.07 ? 776 LEU B CB    1 
ATOM   5791  C  CG    . LEU B 1 508 ? 26.409  50.438  87.466  1.00 144.07 ? 776 LEU B CG    1 
ATOM   5792  C  CD1   . LEU B 1 508 ? 27.264  50.588  88.711  1.00 144.07 ? 776 LEU B CD1   1 
ATOM   5793  C  CD2   . LEU B 1 508 ? 26.871  49.255  86.632  1.00 144.07 ? 776 LEU B CD2   1 
ATOM   5794  N  N     . LYS B 1 509 ? 22.387  49.010  90.181  1.00 144.74 ? 777 LYS B N     1 
ATOM   5795  C  CA    . LYS B 1 509 ? 21.058  49.305  90.700  1.00 144.74 ? 777 LYS B CA    1 
ATOM   5796  C  C     . LYS B 1 509 ? 21.074  50.039  92.037  1.00 144.74 ? 777 LYS B C     1 
ATOM   5797  O  O     . LYS B 1 509 ? 20.098  49.946  92.789  1.00 144.74 ? 777 LYS B O     1 
ATOM   5798  C  CB    . LYS B 1 509 ? 20.248  48.014  90.838  1.00 144.74 ? 777 LYS B CB    1 
ATOM   5799  C  CG    . LYS B 1 509 ? 19.837  47.377  89.523  1.00 144.74 ? 777 LYS B CG    1 
ATOM   5800  C  CD    . LYS B 1 509 ? 18.977  46.146  89.764  1.00 144.74 ? 777 LYS B CD    1 
ATOM   5801  C  CE    . LYS B 1 509 ? 18.545  45.499  88.460  1.00 144.74 ? 777 LYS B CE    1 
ATOM   5802  N  NZ    . LYS B 1 509 ? 17.711  44.287  88.692  1.00 144.74 ? 777 LYS B NZ    1 
ATOM   5803  N  N     . ASP B 1 510 ? 22.144  50.769  92.350  1.00 145.21 ? 778 ASP B N     1 
ATOM   5804  C  CA    . ASP B 1 510 ? 22.216  51.511  93.604  1.00 145.21 ? 778 ASP B CA    1 
ATOM   5805  C  C     . ASP B 1 510 ? 22.518  52.992  93.398  1.00 145.21 ? 778 ASP B C     1 
ATOM   5806  O  O     . ASP B 1 510 ? 22.849  53.682  94.369  1.00 145.21 ? 778 ASP B O     1 
ATOM   5807  C  CB    . ASP B 1 510 ? 23.275  50.898  94.527  1.00 145.21 ? 778 ASP B CB    1 
ATOM   5808  C  CG    . ASP B 1 510 ? 22.917  49.501  94.977  1.00 145.21 ? 778 ASP B CG    1 
ATOM   5809  O  OD1   . ASP B 1 510 ? 21.712  49.202  95.099  1.00 145.21 ? 778 ASP B OD1   1 
ATOM   5810  O  OD2   . ASP B 1 510 ? 23.845  48.696  95.199  1.00 145.21 ? 778 ASP B OD2   1 
ATOM   5811  N  N     . TRP B 1 511 ? 22.418  53.498  92.172  1.00 140.16 ? 779 TRP B N     1 
ATOM   5812  C  CA    . TRP B 1 511 ? 22.818  54.873  91.880  1.00 140.16 ? 779 TRP B CA    1 
ATOM   5813  C  C     . TRP B 1 511 ? 21.749  55.624  91.094  1.00 140.16 ? 779 TRP B C     1 
ATOM   5814  O  O     . TRP B 1 511 ? 21.954  56.765  90.681  1.00 140.16 ? 779 TRP B O     1 
ATOM   5815  C  CB    . TRP B 1 511 ? 24.146  54.883  91.115  1.00 140.16 ? 779 TRP B CB    1 
ATOM   5816  C  CG    . TRP B 1 511 ? 25.277  54.391  91.953  1.00 140.16 ? 779 TRP B CG    1 
ATOM   5817  C  CD1   . TRP B 1 511 ? 26.110  55.139  92.729  1.00 140.16 ? 779 TRP B CD1   1 
ATOM   5818  C  CD2   . TRP B 1 511 ? 25.672  53.028  92.136  1.00 140.16 ? 779 TRP B CD2   1 
ATOM   5819  N  NE1   . TRP B 1 511 ? 27.012  54.329  93.369  1.00 140.16 ? 779 TRP B NE1   1 
ATOM   5820  C  CE2   . TRP B 1 511 ? 26.762  53.027  93.024  1.00 140.16 ? 779 TRP B CE2   1 
ATOM   5821  C  CE3   . TRP B 1 511 ? 25.218  51.811  91.624  1.00 140.16 ? 779 TRP B CE3   1 
ATOM   5822  C  CZ2   . TRP B 1 511 ? 27.401  51.855  93.413  1.00 140.16 ? 779 TRP B CZ2   1 
ATOM   5823  C  CZ3   . TRP B 1 511 ? 25.848  50.651  92.019  1.00 140.16 ? 779 TRP B CZ3   1 
ATOM   5824  C  CH2   . TRP B 1 511 ? 26.928  50.682  92.903  1.00 140.16 ? 779 TRP B CH2   1 
ATOM   5825  N  N     . PHE C 1 21  ? 61.629  72.685  109.380 1.00 111.44 ? 289 PHE C N     1 
ATOM   5826  C  CA    . PHE C 1 21  ? 62.316  73.961  109.520 1.00 111.44 ? 289 PHE C CA    1 
ATOM   5827  C  C     . PHE C 1 21  ? 61.413  75.071  108.979 1.00 111.44 ? 289 PHE C C     1 
ATOM   5828  O  O     . PHE C 1 21  ? 60.505  74.808  108.192 1.00 111.44 ? 289 PHE C O     1 
ATOM   5829  C  CB    . PHE C 1 21  ? 63.670  73.917  108.801 1.00 111.44 ? 289 PHE C CB    1 
ATOM   5830  C  CG    . PHE C 1 21  ? 64.531  75.123  109.042 1.00 111.44 ? 289 PHE C CG    1 
ATOM   5831  C  CD1   . PHE C 1 21  ? 65.101  75.346  110.285 1.00 111.44 ? 289 PHE C CD1   1 
ATOM   5832  C  CD2   . PHE C 1 21  ? 64.787  76.022  108.022 1.00 111.44 ? 289 PHE C CD2   1 
ATOM   5833  C  CE1   . PHE C 1 21  ? 65.897  76.458  110.513 1.00 111.44 ? 289 PHE C CE1   1 
ATOM   5834  C  CE2   . PHE C 1 21  ? 65.586  77.134  108.242 1.00 111.44 ? 289 PHE C CE2   1 
ATOM   5835  C  CZ    . PHE C 1 21  ? 66.140  77.350  109.488 1.00 111.44 ? 289 PHE C CZ    1 
ATOM   5836  N  N     . SER C 1 22  ? 61.669  76.311  109.395 1.00 108.27 ? 290 SER C N     1 
ATOM   5837  C  CA    . SER C 1 22  ? 60.760  77.433  109.188 1.00 108.27 ? 290 SER C CA    1 
ATOM   5838  C  C     . SER C 1 22  ? 60.846  78.057  107.799 1.00 108.27 ? 290 SER C C     1 
ATOM   5839  O  O     . SER C 1 22  ? 60.410  79.200  107.634 1.00 108.27 ? 290 SER C O     1 
ATOM   5840  C  CB    . SER C 1 22  ? 61.017  78.511  110.242 1.00 108.27 ? 290 SER C CB    1 
ATOM   5841  O  OG    . SER C 1 22  ? 60.182  79.636  110.031 1.00 108.27 ? 290 SER C OG    1 
ATOM   5842  N  N     . VAL C 1 23  ? 61.402  77.371  106.806 1.00 100.37 ? 291 VAL C N     1 
ATOM   5843  C  CA    . VAL C 1 23  ? 61.289  77.825  105.413 1.00 100.37 ? 291 VAL C CA    1 
ATOM   5844  C  C     . VAL C 1 23  ? 60.023  77.168  104.876 1.00 100.37 ? 291 VAL C C     1 
ATOM   5845  O  O     . VAL C 1 23  ? 60.032  76.114  104.236 1.00 100.37 ? 291 VAL C O     1 
ATOM   5846  C  CB    . VAL C 1 23  ? 62.542  77.499  104.593 1.00 100.37 ? 291 VAL C CB    1 
ATOM   5847  C  CG1   . VAL C 1 23  ? 62.407  78.013  103.177 1.00 100.37 ? 291 VAL C CG1   1 
ATOM   5848  C  CG2   . VAL C 1 23  ? 63.762  78.111  105.240 1.00 100.37 ? 291 VAL C CG2   1 
ATOM   5849  N  N     . GLY C 1 24  ? 58.894  77.777  105.207 1.00 94.16  ? 292 GLY C N     1 
ATOM   5850  C  CA    . GLY C 1 24  ? 57.616  77.393  104.653 1.00 94.16  ? 292 GLY C CA    1 
ATOM   5851  C  C     . GLY C 1 24  ? 56.774  78.637  104.528 1.00 94.16  ? 292 GLY C C     1 
ATOM   5852  O  O     . GLY C 1 24  ? 55.599  78.585  104.160 1.00 94.16  ? 292 GLY C O     1 
ATOM   5853  N  N     . GLU C 1 25  ? 57.389  79.773  104.828 1.00 90.48  ? 293 GLU C N     1 
ATOM   5854  C  CA    . GLU C 1 25  ? 56.694  81.044  104.792 1.00 90.48  ? 293 GLU C CA    1 
ATOM   5855  C  C     . GLU C 1 25  ? 56.526  81.506  103.355 1.00 90.48  ? 293 GLU C C     1 
ATOM   5856  O  O     . GLU C 1 25  ? 57.380  81.270  102.498 1.00 90.48  ? 293 GLU C O     1 
ATOM   5857  C  CB    . GLU C 1 25  ? 57.454  82.089  105.605 1.00 90.48  ? 293 GLU C CB    1 
ATOM   5858  C  CG    . GLU C 1 25  ? 57.445  81.817  107.103 1.00 90.48  ? 293 GLU C CG    1 
ATOM   5859  C  CD    . GLU C 1 25  ? 58.249  82.833  107.889 1.00 90.48  ? 293 GLU C CD    1 
ATOM   5860  O  OE1   . GLU C 1 25  ? 58.942  83.658  107.259 1.00 90.48  ? 293 GLU C OE1   1 
ATOM   5861  O  OE2   . GLU C 1 25  ? 58.184  82.808  109.136 1.00 90.48  ? 293 GLU C OE2   1 
ATOM   5862  N  N     . THR C 1 26  ? 55.411  82.174  103.099 1.00 83.12  ? 294 THR C N     1 
ATOM   5863  C  CA    . THR C 1 26  ? 55.040  82.548  101.746 1.00 83.12  ? 294 THR C CA    1 
ATOM   5864  C  C     . THR C 1 26  ? 55.748  83.787  101.232 1.00 83.12  ? 294 THR C C     1 
ATOM   5865  O  O     . THR C 1 26  ? 55.588  84.102  100.048 1.00 83.12  ? 294 THR C O     1 
ATOM   5866  C  CB    . THR C 1 26  ? 53.538  82.786  101.658 1.00 83.12  ? 294 THR C CB    1 
ATOM   5867  O  OG1   . THR C 1 26  ? 53.196  83.084  100.301 1.00 83.12  ? 294 THR C OG1   1 
ATOM   5868  C  CG2   . THR C 1 26  ? 53.141  83.949  102.547 1.00 83.12  ? 294 THR C CG2   1 
ATOM   5869  N  N     . THR C 1 27  ? 56.514  84.479  102.093 1.00 80.47  ? 295 THR C N     1 
ATOM   5870  C  CA    . THR C 1 27  ? 57.127  85.805  101.925 1.00 80.47  ? 295 THR C CA    1 
ATOM   5871  C  C     . THR C 1 27  ? 56.241  86.797  101.168 1.00 80.47  ? 295 THR C C     1 
ATOM   5872  O  O     . THR C 1 27  ? 56.717  87.592  100.351 1.00 80.47  ? 295 THR C O     1 
ATOM   5873  C  CB    . THR C 1 27  ? 58.551  85.719  101.313 1.00 80.47  ? 295 THR C CB    1 
ATOM   5874  O  OG1   . THR C 1 27  ? 59.125  87.031  101.258 1.00 80.47  ? 295 THR C OG1   1 
ATOM   5875  C  CG2   . THR C 1 27  ? 58.649  85.062  99.920  1.00 80.47  ? 295 THR C CG2   1 
ATOM   5876  N  N     . ALA C 1 28  ? 54.947  86.785  101.480 1.00 77.74  ? 296 ALA C N     1 
ATOM   5877  C  CA    . ALA C 1 28  ? 53.966  87.664  100.868 1.00 77.74  ? 296 ALA C CA    1 
ATOM   5878  C  C     . ALA C 1 28  ? 53.418  88.598  101.932 1.00 77.74  ? 296 ALA C C     1 
ATOM   5879  O  O     . ALA C 1 28  ? 52.962  88.147  102.987 1.00 77.74  ? 296 ALA C O     1 
ATOM   5880  C  CB    . ALA C 1 28  ? 52.828  86.869  100.227 1.00 77.74  ? 296 ALA C CB    1 
ATOM   5881  N  N     . LYS C 1 29  ? 53.463  89.892  101.653 1.00 76.59  ? 297 LYS C N     1 
ATOM   5882  C  CA    . LYS C 1 29  ? 53.057  90.899  102.618 1.00 76.59  ? 297 LYS C CA    1 
ATOM   5883  C  C     . LYS C 1 29  ? 51.575  91.193  102.447 1.00 76.59  ? 297 LYS C C     1 
ATOM   5884  O  O     . LYS C 1 29  ? 51.136  91.554  101.351 1.00 76.59  ? 297 LYS C O     1 
ATOM   5885  C  CB    . LYS C 1 29  ? 53.878  92.172  102.433 1.00 76.59  ? 297 LYS C CB    1 
ATOM   5886  C  CG    . LYS C 1 29  ? 55.352  92.013  102.740 1.00 76.59  ? 297 LYS C CG    1 
ATOM   5887  C  CD    . LYS C 1 29  ? 56.090  93.324  102.548 1.00 76.59  ? 297 LYS C CD    1 
ATOM   5888  C  CE    . LYS C 1 29  ? 57.574  93.165  102.818 1.00 76.59  ? 297 LYS C CE    1 
ATOM   5889  N  NZ    . LYS C 1 29  ? 58.306  94.445  102.623 1.00 76.59  ? 297 LYS C NZ    1 
ATOM   5890  N  N     . VAL C 1 30  ? 50.807  91.038  103.523 1.00 77.14  ? 298 VAL C N     1 
ATOM   5891  C  CA    . VAL C 1 30  ? 49.434  91.530  103.531 1.00 77.14  ? 298 VAL C CA    1 
ATOM   5892  C  C     . VAL C 1 30  ? 49.508  93.050  103.522 1.00 77.14  ? 298 VAL C C     1 
ATOM   5893  O  O     . VAL C 1 30  ? 49.878  93.665  104.525 1.00 77.14  ? 298 VAL C O     1 
ATOM   5894  C  CB    . VAL C 1 30  ? 48.651  91.019  104.742 1.00 77.14  ? 298 VAL C CB    1 
ATOM   5895  C  CG1   . VAL C 1 30  ? 47.245  91.581  104.727 1.00 77.14  ? 298 VAL C CG1   1 
ATOM   5896  C  CG2   . VAL C 1 30  ? 48.629  89.508  104.763 1.00 77.14  ? 298 VAL C CG2   1 
ATOM   5897  N  N     . LEU C 1 31  ? 49.171  93.651  102.385 1.00 82.95  ? 299 LEU C N     1 
ATOM   5898  C  CA    . LEU C 1 31  ? 49.417  95.067  102.131 1.00 82.95  ? 299 LEU C CA    1 
ATOM   5899  C  C     . LEU C 1 31  ? 48.511  95.925  103.003 1.00 82.95  ? 299 LEU C C     1 
ATOM   5900  O  O     . LEU C 1 31  ? 47.311  96.049  102.741 1.00 82.95  ? 299 LEU C O     1 
ATOM   5901  C  CB    . LEU C 1 31  ? 49.206  95.355  100.650 1.00 82.95  ? 299 LEU C CB    1 
ATOM   5902  C  CG    . LEU C 1 31  ? 49.528  96.699  100.019 1.00 82.95  ? 299 LEU C CG    1 
ATOM   5903  C  CD1   . LEU C 1 31  ? 50.017  96.407  98.638  1.00 82.95  ? 299 LEU C CD1   1 
ATOM   5904  C  CD2   . LEU C 1 31  ? 48.296  97.570  99.933  1.00 82.95  ? 299 LEU C CD2   1 
ATOM   5905  N  N     . LYS C 1 32  ? 49.097  96.520  104.039 1.00 96.99  ? 300 LYS C N     1 
ATOM   5906  C  CA    . LYS C 1 32  ? 48.390  97.382  104.972 1.00 96.99  ? 300 LYS C CA    1 
ATOM   5907  C  C     . LYS C 1 32  ? 48.605  98.860  104.692 1.00 96.99  ? 300 LYS C C     1 
ATOM   5908  O  O     . LYS C 1 32  ? 47.865  99.688  105.233 1.00 96.99  ? 300 LYS C O     1 
ATOM   5909  C  CB    . LYS C 1 32  ? 48.831  97.071  106.403 1.00 96.99  ? 300 LYS C CB    1 
ATOM   5910  C  CG    . LYS C 1 32  ? 50.298  97.363  106.660 1.00 96.99  ? 300 LYS C CG    1 
ATOM   5911  C  CD    . LYS C 1 32  ? 50.687  96.987  108.076 1.00 96.99  ? 300 LYS C CD    1 
ATOM   5912  C  CE    . LYS C 1 32  ? 50.753  95.476  108.238 1.00 96.99  ? 300 LYS C CE    1 
ATOM   5913  N  NZ    . LYS C 1 32  ? 51.266  95.080  109.576 1.00 96.99  ? 300 LYS C NZ    1 
ATOM   5914  N  N     . ASP C 1 33  ? 49.599  99.207  103.880 1.00 102.50 ? 301 ASP C N     1 
ATOM   5915  C  CA    . ASP C 1 33  ? 49.828  100.598 103.521 1.00 102.50 ? 301 ASP C CA    1 
ATOM   5916  C  C     . ASP C 1 33  ? 48.724  101.093 102.601 1.00 102.50 ? 301 ASP C C     1 
ATOM   5917  O  O     . ASP C 1 33  ? 48.366  100.425 101.629 1.00 102.50 ? 301 ASP C O     1 
ATOM   5918  C  CB    . ASP C 1 33  ? 51.183  100.755 102.837 1.00 102.50 ? 301 ASP C CB    1 
ATOM   5919  C  CG    . ASP C 1 33  ? 51.485  102.192 102.472 1.00 102.50 ? 301 ASP C CG    1 
ATOM   5920  O  OD1   . ASP C 1 33  ? 51.807  102.985 103.381 1.00 102.50 ? 301 ASP C OD1   1 
ATOM   5921  O  OD2   . ASP C 1 33  ? 51.394  102.530 101.275 1.00 102.50 ? 301 ASP C OD2   1 
ATOM   5922  N  N     . GLU C 1 34  ? 48.180  102.263 102.911 1.00 102.69 ? 302 GLU C N     1 
ATOM   5923  C  CA    . GLU C 1 34  ? 47.146  102.856 102.071 1.00 102.69 ? 302 GLU C CA    1 
ATOM   5924  C  C     . GLU C 1 34  ? 47.801  103.376 100.803 1.00 102.69 ? 302 GLU C C     1 
ATOM   5925  O  O     . GLU C 1 34  ? 48.409  104.448 100.797 1.00 102.69 ? 302 GLU C O     1 
ATOM   5926  C  CB    . GLU C 1 34  ? 46.419  103.968 102.817 1.00 102.69 ? 302 GLU C CB    1 
ATOM   5927  C  CG    . GLU C 1 34  ? 45.565  103.480 103.972 1.00 102.69 ? 302 GLU C CG    1 
ATOM   5928  C  CD    . GLU C 1 34  ? 44.843  104.609 104.682 1.00 102.69 ? 302 GLU C CD    1 
ATOM   5929  O  OE1   . GLU C 1 34  ? 45.115  105.786 104.366 1.00 102.69 ? 302 GLU C OE1   1 
ATOM   5930  O  OE2   . GLU C 1 34  ? 43.998  104.318 105.554 1.00 102.69 ? 302 GLU C OE2   1 
ATOM   5931  N  N     . ILE C 1 35  ? 47.709  102.598 99.726  1.00 90.47  ? 303 ILE C N     1 
ATOM   5932  C  CA    . ILE C 1 35  ? 48.192  103.058 98.434  1.00 90.47  ? 303 ILE C CA    1 
ATOM   5933  C  C     . ILE C 1 35  ? 47.271  104.151 97.916  1.00 90.47  ? 303 ILE C C     1 
ATOM   5934  O  O     . ILE C 1 35  ? 46.049  103.972 97.841  1.00 90.47  ? 303 ILE C O     1 
ATOM   5935  C  CB    . ILE C 1 35  ? 48.292  101.888 97.448  1.00 90.47  ? 303 ILE C CB    1 
ATOM   5936  C  CG1   . ILE C 1 35  ? 49.429  100.959 97.852  1.00 90.47  ? 303 ILE C CG1   1 
ATOM   5937  C  CG2   . ILE C 1 35  ? 48.487  102.381 96.029  1.00 90.47  ? 303 ILE C CG2   1 
ATOM   5938  C  CD1   . ILE C 1 35  ? 49.477  99.705  97.041  1.00 90.47  ? 303 ILE C CD1   1 
ATOM   5939  N  N     . ASP C 1 36  ? 47.856  105.293 97.557  1.00 88.10  ? 304 ASP C N     1 
ATOM   5940  C  CA    . ASP C 1 36  ? 47.102  106.459 97.118  1.00 88.10  ? 304 ASP C CA    1 
ATOM   5941  C  C     . ASP C 1 36  ? 46.890  106.495 95.610  1.00 88.10  ? 304 ASP C C     1 
ATOM   5942  O  O     . ASP C 1 36  ? 46.814  107.582 95.023  1.00 88.10  ? 304 ASP C O     1 
ATOM   5943  C  CB    . ASP C 1 36  ? 47.793  107.735 97.598  1.00 88.10  ? 304 ASP C CB    1 
ATOM   5944  C  CG    . ASP C 1 36  ? 49.246  107.818 97.163  1.00 88.10  ? 304 ASP C CG    1 
ATOM   5945  O  OD1   . ASP C 1 36  ? 49.769  106.836 96.594  1.00 88.10  ? 304 ASP C OD1   1 
ATOM   5946  O  OD2   . ASP C 1 36  ? 49.870  108.875 97.392  1.00 88.10  ? 304 ASP C OD2   1 
ATOM   5947  N  N     . VAL C 1 37  ? 46.809  105.340 94.964  1.00 77.02  ? 305 VAL C N     1 
ATOM   5948  C  CA    . VAL C 1 37  ? 46.529  105.253 93.539  1.00 77.02  ? 305 VAL C CA    1 
ATOM   5949  C  C     . VAL C 1 37  ? 45.088  104.797 93.386  1.00 77.02  ? 305 VAL C C     1 
ATOM   5950  O  O     . VAL C 1 37  ? 44.763  103.636 93.655  1.00 77.02  ? 305 VAL C O     1 
ATOM   5951  C  CB    . VAL C 1 37  ? 47.486  104.295 92.827  1.00 77.02  ? 305 VAL C CB    1 
ATOM   5952  C  CG1   . VAL C 1 37  ? 47.145  104.228 91.360  1.00 77.02  ? 305 VAL C CG1   1 
ATOM   5953  C  CG2   . VAL C 1 37  ? 48.913  104.741 93.027  1.00 77.02  ? 305 VAL C CG2   1 
ATOM   5954  N  N     . LYS C 1 38  ? 44.219  105.706 92.971  1.00 74.04  ? 306 LYS C N     1 
ATOM   5955  C  CA    . LYS C 1 38  ? 42.834  105.368 92.698  1.00 74.04  ? 306 LYS C CA    1 
ATOM   5956  C  C     . LYS C 1 38  ? 42.722  104.880 91.258  1.00 74.04  ? 306 LYS C C     1 
ATOM   5957  O  O     . LYS C 1 38  ? 43.722  104.734 90.553  1.00 74.04  ? 306 LYS C O     1 
ATOM   5958  C  CB    . LYS C 1 38  ? 41.941  106.573 92.965  1.00 74.04  ? 306 LYS C CB    1 
ATOM   5959  C  CG    . LYS C 1 38  ? 42.039  107.093 94.380  1.00 74.04  ? 306 LYS C CG    1 
ATOM   5960  C  CD    . LYS C 1 38  ? 41.497  106.087 95.365  1.00 74.04  ? 306 LYS C CD    1 
ATOM   5961  C  CE    . LYS C 1 38  ? 41.515  106.642 96.771  1.00 74.04  ? 306 LYS C CE    1 
ATOM   5962  N  NZ    . LYS C 1 38  ? 41.004  105.647 97.752  1.00 74.04  ? 306 LYS C NZ    1 
ATOM   5963  N  N     . PHE C 1 39  ? 41.503  104.627 90.795  1.00 73.51  ? 307 PHE C N     1 
ATOM   5964  C  CA    . PHE C 1 39  ? 41.325  104.286 89.393  1.00 73.51  ? 307 PHE C CA    1 
ATOM   5965  C  C     . PHE C 1 39  ? 41.391  105.494 88.479  1.00 73.51  ? 307 PHE C C     1 
ATOM   5966  O  O     . PHE C 1 39  ? 41.459  105.320 87.260  1.00 73.51  ? 307 PHE C O     1 
ATOM   5967  C  CB    . PHE C 1 39  ? 40.000  103.561 89.173  1.00 73.51  ? 307 PHE C CB    1 
ATOM   5968  C  CG    . PHE C 1 39  ? 40.009  102.135 89.619  1.00 73.51  ? 307 PHE C CG    1 
ATOM   5969  C  CD1   . PHE C 1 39  ? 40.617  101.170 88.843  1.00 73.51  ? 307 PHE C CD1   1 
ATOM   5970  C  CD2   . PHE C 1 39  ? 39.387  101.752 90.792  1.00 73.51  ? 307 PHE C CD2   1 
ATOM   5971  C  CE1   . PHE C 1 39  ? 40.630  99.858  89.235  1.00 73.51  ? 307 PHE C CE1   1 
ATOM   5972  C  CE2   . PHE C 1 39  ? 39.391  100.433 91.183  1.00 73.51  ? 307 PHE C CE2   1 
ATOM   5973  C  CZ    . PHE C 1 39  ? 40.019  99.489  90.405  1.00 73.51  ? 307 PHE C CZ    1 
ATOM   5974  N  N     . LYS C 1 40  ? 41.375  106.708 89.027  1.00 69.76  ? 308 LYS C N     1 
ATOM   5975  C  CA    . LYS C 1 40  ? 41.513  107.893 88.193  1.00 69.76  ? 308 LYS C CA    1 
ATOM   5976  C  C     . LYS C 1 40  ? 42.941  108.088 87.711  1.00 69.76  ? 308 LYS C C     1 
ATOM   5977  O  O     . LYS C 1 40  ? 43.167  108.870 86.784  1.00 69.76  ? 308 LYS C O     1 
ATOM   5978  C  CB    . LYS C 1 40  ? 41.054  109.133 88.956  1.00 69.76  ? 308 LYS C CB    1 
ATOM   5979  C  CG    . LYS C 1 40  ? 41.926  109.457 90.143  1.00 69.76  ? 308 LYS C CG    1 
ATOM   5980  C  CD    . LYS C 1 40  ? 41.434  110.671 90.892  1.00 69.76  ? 308 LYS C CD    1 
ATOM   5981  C  CE    . LYS C 1 40  ? 42.366  110.987 92.047  1.00 69.76  ? 308 LYS C CE    1 
ATOM   5982  N  NZ    . LYS C 1 40  ? 41.920  112.177 92.813  1.00 69.76  ? 308 LYS C NZ    1 
ATOM   5983  N  N     . ASP C 1 41  ? 43.904  107.401 88.318  1.00 69.27  ? 309 ASP C N     1 
ATOM   5984  C  CA    . ASP C 1 41  ? 45.292  107.497 87.903  1.00 69.27  ? 309 ASP C CA    1 
ATOM   5985  C  C     . ASP C 1 41  ? 45.634  106.562 86.757  1.00 69.27  ? 309 ASP C C     1 
ATOM   5986  O  O     . ASP C 1 41  ? 46.654  106.768 86.093  1.00 69.27  ? 309 ASP C O     1 
ATOM   5987  C  CB    . ASP C 1 41  ? 46.207  107.195 89.086  1.00 69.27  ? 309 ASP C CB    1 
ATOM   5988  C  CG    . ASP C 1 41  ? 46.130  108.258 90.157  1.00 69.27  ? 309 ASP C CG    1 
ATOM   5989  O  OD1   . ASP C 1 41  ? 45.852  109.425 89.815  1.00 69.27  ? 309 ASP C OD1   1 
ATOM   5990  O  OD2   . ASP C 1 41  ? 46.344  107.929 91.341  1.00 69.27  ? 309 ASP C OD2   1 
ATOM   5991  N  N     . VAL C 1 42  ? 44.808  105.554 86.504  1.00 67.66  ? 310 VAL C N     1 
ATOM   5992  C  CA    . VAL C 1 42  ? 45.068  104.550 85.483  1.00 67.66  ? 310 VAL C CA    1 
ATOM   5993  C  C     . VAL C 1 42  ? 44.256  104.940 84.256  1.00 67.66  ? 310 VAL C C     1 
ATOM   5994  O  O     . VAL C 1 42  ? 43.051  104.692 84.187  1.00 67.66  ? 310 VAL C O     1 
ATOM   5995  C  CB    . VAL C 1 42  ? 44.716  103.147 85.975  1.00 67.66  ? 310 VAL C CB    1 
ATOM   5996  C  CG1   . VAL C 1 42  ? 44.995  102.129 84.900  1.00 67.66  ? 310 VAL C CG1   1 
ATOM   5997  C  CG2   . VAL C 1 42  ? 45.478  102.826 87.234  1.00 67.66  ? 310 VAL C CG2   1 
ATOM   5998  N  N     . ALA C 1 43  ? 44.906  105.557 83.286  1.00 66.94  ? 311 ALA C N     1 
ATOM   5999  C  CA    . ALA C 1 43  ? 44.240  106.008 82.080  1.00 66.94  ? 311 ALA C CA    1 
ATOM   6000  C  C     . ALA C 1 43  ? 44.661  105.150 80.898  1.00 66.94  ? 311 ALA C C     1 
ATOM   6001  O  O     . ALA C 1 43  ? 45.517  104.272 81.007  1.00 66.94  ? 311 ALA C O     1 
ATOM   6002  C  CB    . ALA C 1 43  ? 44.548  107.479 81.823  1.00 66.94  ? 311 ALA C CB    1 
ATOM   6003  N  N     . GLY C 1 44  ? 44.043  105.411 79.753  1.00 73.99  ? 312 GLY C N     1 
ATOM   6004  C  CA    . GLY C 1 44  ? 44.415  104.717 78.540  1.00 73.99  ? 312 GLY C CA    1 
ATOM   6005  C  C     . GLY C 1 44  ? 43.720  103.385 78.374  1.00 73.99  ? 312 GLY C C     1 
ATOM   6006  O  O     . GLY C 1 44  ? 42.922  103.209 77.451  1.00 73.99  ? 312 GLY C O     1 
ATOM   6007  N  N     . CYS C 1 45  ? 44.017  102.432 79.258  1.00 79.07  ? 313 CYS C N     1 
ATOM   6008  C  CA    . CYS C 1 45  ? 43.389  101.113 79.213  1.00 79.07  ? 313 CYS C CA    1 
ATOM   6009  C  C     . CYS C 1 45  ? 41.997  101.223 79.829  1.00 79.07  ? 313 CYS C C     1 
ATOM   6010  O  O     . CYS C 1 45  ? 41.760  100.935 81.002  1.00 79.07  ? 313 CYS C O     1 
ATOM   6011  C  CB    . CYS C 1 45  ? 44.268  100.068 79.895  1.00 79.07  ? 313 CYS C CB    1 
ATOM   6012  S  SG    . CYS C 1 45  ? 44.805  100.385 81.597  1.00 79.07  ? 313 CYS C SG    1 
ATOM   6013  N  N     . GLU C 1 46  ? 41.049  101.653 79.004  1.00 83.84  ? 314 GLU C N     1 
ATOM   6014  C  CA    . GLU C 1 46  ? 39.720  101.943 79.521  1.00 83.84  ? 314 GLU C CA    1 
ATOM   6015  C  C     . GLU C 1 46  ? 38.877  100.682 79.634  1.00 83.84  ? 314 GLU C C     1 
ATOM   6016  O  O     . GLU C 1 46  ? 38.238  100.447 80.663  1.00 83.84  ? 314 GLU C O     1 
ATOM   6017  C  CB    . GLU C 1 46  ? 39.026  102.977 78.640  1.00 83.84  ? 314 GLU C CB    1 
ATOM   6018  C  CG    . GLU C 1 46  ? 37.696  103.439 79.186  1.00 83.84  ? 314 GLU C CG    1 
ATOM   6019  C  CD    . GLU C 1 46  ? 37.834  104.246 80.463  1.00 83.84  ? 314 GLU C CD    1 
ATOM   6020  O  OE1   . GLU C 1 46  ? 38.885  104.892 80.660  1.00 83.84  ? 314 GLU C OE1   1 
ATOM   6021  O  OE2   . GLU C 1 46  ? 36.886  104.235 81.275  1.00 83.84  ? 314 GLU C OE2   1 
ATOM   6022  N  N     . GLU C 1 47  ? 38.864  99.854  78.591  1.00 86.17  ? 315 GLU C N     1 
ATOM   6023  C  CA    . GLU C 1 47  ? 38.116  98.605  78.643  1.00 86.17  ? 315 GLU C CA    1 
ATOM   6024  C  C     . GLU C 1 47  ? 38.831  97.513  79.416  1.00 86.17  ? 315 GLU C C     1 
ATOM   6025  O  O     . GLU C 1 47  ? 38.245  96.450  79.630  1.00 86.17  ? 315 GLU C O     1 
ATOM   6026  C  CB    . GLU C 1 47  ? 37.808  98.101  77.237  1.00 86.17  ? 315 GLU C CB    1 
ATOM   6027  C  CG    . GLU C 1 47  ? 36.697  98.861  76.547  1.00 86.17  ? 315 GLU C CG    1 
ATOM   6028  C  CD    . GLU C 1 47  ? 37.172  100.111 75.841  1.00 86.17  ? 315 GLU C CD    1 
ATOM   6029  O  OE1   . GLU C 1 47  ? 38.393  100.371 75.835  1.00 86.17  ? 315 GLU C OE1   1 
ATOM   6030  O  OE2   . GLU C 1 47  ? 36.317  100.826 75.277  1.00 86.17  ? 315 GLU C OE2   1 
ATOM   6031  N  N     . ALA C 1 48  ? 40.074  97.734  79.822  1.00 81.24  ? 316 ALA C N     1 
ATOM   6032  C  CA    . ALA C 1 48  ? 40.757  96.778  80.675  1.00 81.24  ? 316 ALA C CA    1 
ATOM   6033  C  C     . ALA C 1 48  ? 40.520  97.070  82.146  1.00 81.24  ? 316 ALA C C     1 
ATOM   6034  O  O     . ALA C 1 48  ? 40.424  96.140  82.952  1.00 81.24  ? 316 ALA C O     1 
ATOM   6035  C  CB    . ALA C 1 48  ? 42.255  96.784  80.379  1.00 81.24  ? 316 ALA C CB    1 
ATOM   6036  N  N     . LYS C 1 49  ? 40.420  98.347  82.518  1.00 78.46  ? 317 LYS C N     1 
ATOM   6037  C  CA    . LYS C 1 49  ? 40.167  98.689  83.910  1.00 78.46  ? 317 LYS C CA    1 
ATOM   6038  C  C     . LYS C 1 49  ? 38.718  98.467  84.294  1.00 78.46  ? 317 LYS C C     1 
ATOM   6039  O  O     . LYS C 1 49  ? 38.407  98.446  85.486  1.00 78.46  ? 317 LYS C O     1 
ATOM   6040  C  CB    . LYS C 1 49  ? 40.553  100.141 84.195  1.00 78.46  ? 317 LYS C CB    1 
ATOM   6041  C  CG    . LYS C 1 49  ? 39.646  101.164 83.568  1.00 78.46  ? 317 LYS C CG    1 
ATOM   6042  C  CD    . LYS C 1 49  ? 40.182  102.572 83.735  1.00 78.46  ? 317 LYS C CD    1 
ATOM   6043  C  CE    . LYS C 1 49  ? 40.065  103.056 85.155  1.00 78.46  ? 317 LYS C CE    1 
ATOM   6044  N  NZ    . LYS C 1 49  ? 40.426  104.492 85.240  1.00 78.46  ? 317 LYS C NZ    1 
ATOM   6045  N  N     . LEU C 1 50  ? 37.831  98.300  83.316  1.00 79.62  ? 318 LEU C N     1 
ATOM   6046  C  CA    . LEU C 1 50  ? 36.443  97.984  83.620  1.00 79.62  ? 318 LEU C CA    1 
ATOM   6047  C  C     . LEU C 1 50  ? 36.308  96.568  84.150  1.00 79.62  ? 318 LEU C C     1 
ATOM   6048  O  O     . LEU C 1 50  ? 35.516  96.311  85.062  1.00 79.62  ? 318 LEU C O     1 
ATOM   6049  C  CB    . LEU C 1 50  ? 35.591  98.167  82.373  1.00 79.62  ? 318 LEU C CB    1 
ATOM   6050  C  CG    . LEU C 1 50  ? 34.100  97.963  82.570  1.00 79.62  ? 318 LEU C CG    1 
ATOM   6051  C  CD1   . LEU C 1 50  ? 33.604  98.996  83.544  1.00 79.62  ? 318 LEU C CD1   1 
ATOM   6052  C  CD2   . LEU C 1 50  ? 33.375  98.080  81.247  1.00 79.62  ? 318 LEU C CD2   1 
ATOM   6053  N  N     . GLU C 1 51  ? 37.089  95.642  83.612  1.00 81.15  ? 319 GLU C N     1 
ATOM   6054  C  CA    . GLU C 1 51  ? 37.029  94.255  84.041  1.00 81.15  ? 319 GLU C CA    1 
ATOM   6055  C  C     . GLU C 1 51  ? 37.851  93.985  85.289  1.00 81.15  ? 319 GLU C C     1 
ATOM   6056  O  O     . GLU C 1 51  ? 37.925  92.830  85.717  1.00 81.15  ? 319 GLU C O     1 
ATOM   6057  C  CB    . GLU C 1 51  ? 37.489  93.336  82.912  1.00 81.15  ? 319 GLU C CB    1 
ATOM   6058  C  CG    . GLU C 1 51  ? 36.568  93.362  81.715  1.00 81.15  ? 319 GLU C CG    1 
ATOM   6059  C  CD    . GLU C 1 51  ? 36.970  92.382  80.639  1.00 81.15  ? 319 GLU C CD    1 
ATOM   6060  O  OE1   . GLU C 1 51  ? 38.022  91.727  80.788  1.00 81.15  ? 319 GLU C OE1   1 
ATOM   6061  O  OE2   . GLU C 1 51  ? 36.231  92.268  79.640  1.00 81.15  ? 319 GLU C OE2   1 
ATOM   6062  N  N     . ILE C 1 52  ? 38.472  95.003  85.875  1.00 76.78  ? 320 ILE C N     1 
ATOM   6063  C  CA    . ILE C 1 52  ? 39.142  94.863  87.160  1.00 76.78  ? 320 ILE C CA    1 
ATOM   6064  C  C     . ILE C 1 52  ? 38.237  95.489  88.209  1.00 76.78  ? 320 ILE C C     1 
ATOM   6065  O  O     . ILE C 1 52  ? 38.172  95.028  89.353  1.00 76.78  ? 320 ILE C O     1 
ATOM   6066  C  CB    . ILE C 1 52  ? 40.538  95.509  87.129  1.00 76.78  ? 320 ILE C CB    1 
ATOM   6067  C  CG1   . ILE C 1 52  ? 41.398  94.826  86.076  1.00 76.78  ? 320 ILE C CG1   1 
ATOM   6068  C  CG2   . ILE C 1 52  ? 41.239  95.375  88.450  1.00 76.78  ? 320 ILE C CG2   1 
ATOM   6069  C  CD1   . ILE C 1 52  ? 41.643  93.368  86.359  1.00 76.78  ? 320 ILE C CD1   1 
ATOM   6070  N  N     . MET C 1 53  ? 37.496  96.521  87.805  1.00 81.73  ? 321 MET C N     1 
ATOM   6071  C  CA    . MET C 1 53  ? 36.531  97.138  88.704  1.00 81.73  ? 321 MET C CA    1 
ATOM   6072  C  C     . MET C 1 53  ? 35.376  96.205  89.032  1.00 81.73  ? 321 MET C C     1 
ATOM   6073  O  O     . MET C 1 53  ? 34.801  96.305  90.119  1.00 81.73  ? 321 MET C O     1 
ATOM   6074  C  CB    . MET C 1 53  ? 36.015  98.441  88.103  1.00 81.73  ? 321 MET C CB    1 
ATOM   6075  C  CG    . MET C 1 53  ? 37.011  99.580  88.188  1.00 81.73  ? 321 MET C CG    1 
ATOM   6076  S  SD    . MET C 1 53  ? 36.540  101.017 87.216  1.00 81.73  ? 321 MET C SD    1 
ATOM   6077  C  CE    . MET C 1 53  ? 35.081  101.554 88.087  1.00 81.73  ? 321 MET C CE    1 
ATOM   6078  N  N     . GLU C 1 54  ? 35.043  95.273  88.137  1.00 79.92  ? 322 GLU C N     1 
ATOM   6079  C  CA    . GLU C 1 54  ? 34.000  94.301  88.438  1.00 79.92  ? 322 GLU C CA    1 
ATOM   6080  C  C     . GLU C 1 54  ? 34.426  93.283  89.483  1.00 79.92  ? 322 GLU C C     1 
ATOM   6081  O  O     . GLU C 1 54  ? 33.564  92.627  90.070  1.00 79.92  ? 322 GLU C O     1 
ATOM   6082  C  CB    . GLU C 1 54  ? 33.555  93.580  87.172  1.00 79.92  ? 322 GLU C CB    1 
ATOM   6083  C  CG    . GLU C 1 54  ? 32.712  94.446  86.275  1.00 79.92  ? 322 GLU C CG    1 
ATOM   6084  C  CD    . GLU C 1 54  ? 32.275  93.739  85.016  1.00 79.92  ? 322 GLU C CD    1 
ATOM   6085  O  OE1   . GLU C 1 54  ? 32.801  92.648  84.725  1.00 79.92  ? 322 GLU C OE1   1 
ATOM   6086  O  OE2   . GLU C 1 54  ? 31.384  94.270  84.330  1.00 79.92  ? 322 GLU C OE2   1 
ATOM   6087  N  N     . PHE C 1 55  ? 35.724  93.122  89.720  1.00 77.68  ? 323 PHE C N     1 
ATOM   6088  C  CA    . PHE C 1 55  ? 36.151  92.381  90.900  1.00 77.68  ? 323 PHE C CA    1 
ATOM   6089  C  C     . PHE C 1 55  ? 35.876  93.191  92.155  1.00 77.68  ? 323 PHE C C     1 
ATOM   6090  O  O     . PHE C 1 55  ? 35.479  92.641  93.187  1.00 77.68  ? 323 PHE C O     1 
ATOM   6091  C  CB    . PHE C 1 55  ? 37.638  92.051  90.818  1.00 77.68  ? 323 PHE C CB    1 
ATOM   6092  C  CG    . PHE C 1 55  ? 38.004  91.115  89.709  1.00 77.68  ? 323 PHE C CG    1 
ATOM   6093  C  CD1   . PHE C 1 55  ? 37.074  90.267  89.141  1.00 77.68  ? 323 PHE C CD1   1 
ATOM   6094  C  CD2   . PHE C 1 55  ? 39.290  91.115  89.208  1.00 77.68  ? 323 PHE C CD2   1 
ATOM   6095  C  CE1   . PHE C 1 55  ? 37.434  89.428  88.112  1.00 77.68  ? 323 PHE C CE1   1 
ATOM   6096  C  CE2   . PHE C 1 55  ? 39.642  90.275  88.184  1.00 77.68  ? 323 PHE C CE2   1 
ATOM   6097  C  CZ    . PHE C 1 55  ? 38.712  89.432  87.637  1.00 77.68  ? 323 PHE C CZ    1 
ATOM   6098  N  N     . VAL C 1 56  ? 36.100  94.503  92.084  1.00 80.51  ? 324 VAL C N     1 
ATOM   6099  C  CA    . VAL C 1 56  ? 35.824  95.372  93.218  1.00 80.51  ? 324 VAL C CA    1 
ATOM   6100  C  C     . VAL C 1 56  ? 34.327  95.579  93.364  1.00 80.51  ? 324 VAL C C     1 
ATOM   6101  O  O     . VAL C 1 56  ? 33.804  95.621  94.483  1.00 80.51  ? 324 VAL C O     1 
ATOM   6102  C  CB    . VAL C 1 56  ? 36.581  96.704  93.049  1.00 80.51  ? 324 VAL C CB    1 
ATOM   6103  C  CG1   . VAL C 1 56  ? 36.327  97.638  94.216  1.00 80.51  ? 324 VAL C CG1   1 
ATOM   6104  C  CG2   . VAL C 1 56  ? 38.058  96.451  92.906  1.00 80.51  ? 324 VAL C CG2   1 
ATOM   6105  N  N     . ASN C 1 57  ? 33.612  95.669  92.238  1.00 83.06  ? 325 ASN C N     1 
ATOM   6106  C  CA    . ASN C 1 57  ? 32.169  95.875  92.277  1.00 83.06  ? 325 ASN C CA    1 
ATOM   6107  C  C     . ASN C 1 57  ? 31.450  94.668  92.860  1.00 83.06  ? 325 ASN C C     1 
ATOM   6108  O  O     . ASN C 1 57  ? 30.408  94.822  93.502  1.00 83.06  ? 325 ASN C O     1 
ATOM   6109  C  CB    . ASN C 1 57  ? 31.644  96.167  90.874  1.00 83.06  ? 325 ASN C CB    1 
ATOM   6110  C  CG    . ASN C 1 57  ? 30.262  96.769  90.878  1.00 83.06  ? 325 ASN C CG    1 
ATOM   6111  O  OD1   . ASN C 1 57  ? 29.701  97.071  91.927  1.00 83.06  ? 325 ASN C OD1   1 
ATOM   6112  N  ND2   . ASN C 1 57  ? 29.697  96.938  89.694  1.00 83.06  ? 325 ASN C ND2   1 
ATOM   6113  N  N     . PHE C 1 58  ? 31.999  93.469  92.675  1.00 81.25  ? 326 PHE C N     1 
ATOM   6114  C  CA    . PHE C 1 58  ? 31.354  92.288  93.229  1.00 81.25  ? 326 PHE C CA    1 
ATOM   6115  C  C     . PHE C 1 58  ? 31.562  92.217  94.734  1.00 81.25  ? 326 PHE C C     1 
ATOM   6116  O  O     . PHE C 1 58  ? 30.618  91.963  95.486  1.00 81.25  ? 326 PHE C O     1 
ATOM   6117  C  CB    . PHE C 1 58  ? 31.888  91.022  92.564  1.00 81.25  ? 326 PHE C CB    1 
ATOM   6118  C  CG    . PHE C 1 58  ? 31.131  89.782  92.943  1.00 81.25  ? 326 PHE C CG    1 
ATOM   6119  C  CD1   . PHE C 1 58  ? 29.969  89.440  92.279  1.00 81.25  ? 326 PHE C CD1   1 
ATOM   6120  C  CD2   . PHE C 1 58  ? 31.561  88.975  93.987  1.00 81.25  ? 326 PHE C CD2   1 
ATOM   6121  C  CE1   . PHE C 1 58  ? 29.270  88.306  92.634  1.00 81.25  ? 326 PHE C CE1   1 
ATOM   6122  C  CE2   . PHE C 1 58  ? 30.851  87.858  94.355  1.00 81.25  ? 326 PHE C CE2   1 
ATOM   6123  C  CZ    . PHE C 1 58  ? 29.711  87.516  93.670  1.00 81.25  ? 326 PHE C CZ    1 
ATOM   6124  N  N     . LEU C 1 59  ? 32.798  92.426  95.192  1.00 79.23  ? 327 LEU C N     1 
ATOM   6125  C  CA    . LEU C 1 59  ? 33.099  92.310  96.614  1.00 79.23  ? 327 LEU C CA    1 
ATOM   6126  C  C     . LEU C 1 59  ? 32.499  93.444  97.434  1.00 79.23  ? 327 LEU C C     1 
ATOM   6127  O  O     . LEU C 1 59  ? 32.332  93.293  98.647  1.00 79.23  ? 327 LEU C O     1 
ATOM   6128  C  CB    . LEU C 1 59  ? 34.612  92.256  96.825  1.00 79.23  ? 327 LEU C CB    1 
ATOM   6129  C  CG    . LEU C 1 59  ? 35.346  91.010  96.331  1.00 79.23  ? 327 LEU C CG    1 
ATOM   6130  C  CD1   . LEU C 1 59  ? 36.838  91.196  96.461  1.00 79.23  ? 327 LEU C CD1   1 
ATOM   6131  C  CD2   . LEU C 1 59  ? 34.900  89.788  97.104  1.00 79.23  ? 327 LEU C CD2   1 
ATOM   6132  N  N     . LYS C 1 60  ? 32.164  94.565  96.804  1.00 81.27  ? 328 LYS C N     1 
ATOM   6133  C  CA    . LYS C 1 60  ? 31.575  95.695  97.506  1.00 81.27  ? 328 LYS C CA    1 
ATOM   6134  C  C     . LYS C 1 60  ? 30.053  95.679  97.441  1.00 81.27  ? 328 LYS C C     1 
ATOM   6135  O  O     . LYS C 1 60  ? 29.388  96.032  98.419  1.00 81.27  ? 328 LYS C O     1 
ATOM   6136  C  CB    . LYS C 1 60  ? 32.117  96.999  96.920  1.00 81.27  ? 328 LYS C CB    1 
ATOM   6137  C  CG    . LYS C 1 60  ? 31.703  98.259  97.641  1.00 81.27  ? 328 LYS C CG    1 
ATOM   6138  C  CD    . LYS C 1 60  ? 32.364  99.465  97.001  1.00 81.27  ? 328 LYS C CD    1 
ATOM   6139  C  CE    . LYS C 1 60  ? 31.951  100.751 97.689  1.00 81.27  ? 328 LYS C CE    1 
ATOM   6140  N  NZ    . LYS C 1 60  ? 32.586  101.938 97.052  1.00 81.27  ? 328 LYS C NZ    1 
ATOM   6141  N  N     . ASN C 1 61  ? 29.486  95.273  96.307  1.00 81.86  ? 329 ASN C N     1 
ATOM   6142  C  CA    . ASN C 1 61  ? 28.037  95.201  96.115  1.00 81.86  ? 329 ASN C CA    1 
ATOM   6143  C  C     . ASN C 1 61  ? 27.678  93.866  95.479  1.00 81.86  ? 329 ASN C C     1 
ATOM   6144  O  O     . ASN C 1 61  ? 27.498  93.781  94.259  1.00 81.86  ? 329 ASN C O     1 
ATOM   6145  C  CB    . ASN C 1 61  ? 27.544  96.351  95.241  1.00 81.86  ? 329 ASN C CB    1 
ATOM   6146  C  CG    . ASN C 1 61  ? 27.684  97.687  95.913  1.00 81.86  ? 329 ASN C CG    1 
ATOM   6147  O  OD1   . ASN C 1 61  ? 27.406  97.828  97.102  1.00 81.86  ? 329 ASN C OD1   1 
ATOM   6148  N  ND2   . ASN C 1 61  ? 28.121  98.683  95.158  1.00 81.86  ? 329 ASN C ND2   1 
ATOM   6149  N  N     . PRO C 1 62  ? 27.558  92.799  96.274  1.00 80.50  ? 330 PRO C N     1 
ATOM   6150  C  CA    . PRO C 1 62  ? 27.231  91.492  95.690  1.00 80.50  ? 330 PRO C CA    1 
ATOM   6151  C  C     . PRO C 1 62  ? 25.787  91.361  95.243  1.00 80.50  ? 330 PRO C C     1 
ATOM   6152  O  O     . PRO C 1 62  ? 25.467  90.387  94.553  1.00 80.50  ? 330 PRO C O     1 
ATOM   6153  C  CB    . PRO C 1 62  ? 27.530  90.511  96.829  1.00 80.50  ? 330 PRO C CB    1 
ATOM   6154  C  CG    . PRO C 1 62  ? 28.397  91.259  97.779  1.00 80.50  ? 330 PRO C CG    1 
ATOM   6155  C  CD    . PRO C 1 62  ? 27.923  92.673  97.693  1.00 80.50  ? 330 PRO C CD    1 
ATOM   6156  N  N     . LYS C 1 63  ? 24.911  92.301  95.601  1.00 81.58  ? 331 LYS C N     1 
ATOM   6157  C  CA    . LYS C 1 63  ? 23.483  92.141  95.348  1.00 81.58  ? 331 LYS C CA    1 
ATOM   6158  C  C     . LYS C 1 63  ? 23.142  92.288  93.870  1.00 81.58  ? 331 LYS C C     1 
ATOM   6159  O  O     . LYS C 1 63  ? 22.186  91.667  93.394  1.00 81.58  ? 331 LYS C O     1 
ATOM   6160  C  CB    . LYS C 1 63  ? 22.702  93.154  96.187  1.00 81.58  ? 331 LYS C CB    1 
ATOM   6161  C  CG    . LYS C 1 63  ? 21.189  93.005  96.142  1.00 81.58  ? 331 LYS C CG    1 
ATOM   6162  C  CD    . LYS C 1 63  ? 20.501  94.024  97.026  1.00 81.58  ? 331 LYS C CD    1 
ATOM   6163  C  CE    . LYS C 1 63  ? 18.997  93.829  97.006  1.00 81.58  ? 331 LYS C CE    1 
ATOM   6164  N  NZ    . LYS C 1 63  ? 18.426  94.145  95.667  1.00 81.58  ? 331 LYS C NZ    1 
ATOM   6165  N  N     . GLN C 1 64  ? 23.915  93.087  93.126  1.00 82.41  ? 332 GLN C N     1 
ATOM   6166  C  CA    . GLN C 1 64  ? 23.646  93.266  91.702  1.00 82.41  ? 332 GLN C CA    1 
ATOM   6167  C  C     . GLN C 1 64  ? 23.879  91.986  90.919  1.00 82.41  ? 332 GLN C C     1 
ATOM   6168  O  O     . GLN C 1 64  ? 23.202  91.745  89.916  1.00 82.41  ? 332 GLN C O     1 
ATOM   6169  C  CB    . GLN C 1 64  ? 24.529  94.366  91.122  1.00 82.41  ? 332 GLN C CB    1 
ATOM   6170  C  CG    . GLN C 1 64  ? 24.248  95.752  91.634  1.00 82.41  ? 332 GLN C CG    1 
ATOM   6171  C  CD    . GLN C 1 64  ? 25.220  96.762  91.069  1.00 82.41  ? 332 GLN C CD    1 
ATOM   6172  O  OE1   . GLN C 1 64  ? 26.145  96.405  90.344  1.00 82.41  ? 332 GLN C OE1   1 
ATOM   6173  N  NE2   . GLN C 1 64  ? 25.020  98.031  91.405  1.00 82.41  ? 332 GLN C NE2   1 
ATOM   6174  N  N     . TYR C 1 65  ? 24.810  91.155  91.374  1.00 81.77  ? 333 TYR C N     1 
ATOM   6175  C  CA    . TYR C 1 65  ? 25.233  89.966  90.653  1.00 81.77  ? 333 TYR C CA    1 
ATOM   6176  C  C     . TYR C 1 65  ? 24.617  88.689  91.200  1.00 81.77  ? 333 TYR C C     1 
ATOM   6177  O  O     . TYR C 1 65  ? 24.278  87.791  90.427  1.00 81.77  ? 333 TYR C O     1 
ATOM   6178  C  CB    . TYR C 1 65  ? 26.754  89.853  90.707  1.00 81.77  ? 333 TYR C CB    1 
ATOM   6179  C  CG    . TYR C 1 65  ? 27.482  91.006  90.068  1.00 81.77  ? 333 TYR C CG    1 
ATOM   6180  C  CD1   . TYR C 1 65  ? 27.696  91.043  88.704  1.00 81.77  ? 333 TYR C CD1   1 
ATOM   6181  C  CD2   . TYR C 1 65  ? 27.951  92.062  90.834  1.00 81.77  ? 333 TYR C CD2   1 
ATOM   6182  C  CE1   . TYR C 1 65  ? 28.360  92.095  88.115  1.00 81.77  ? 333 TYR C CE1   1 
ATOM   6183  C  CE2   . TYR C 1 65  ? 28.618  93.120  90.255  1.00 81.77  ? 333 TYR C CE2   1 
ATOM   6184  C  CZ    . TYR C 1 65  ? 28.818  93.130  88.895  1.00 81.77  ? 333 TYR C CZ    1 
ATOM   6185  O  OH    . TYR C 1 65  ? 29.481  94.180  88.312  1.00 81.77  ? 333 TYR C OH    1 
ATOM   6186  N  N     . GLN C 1 66  ? 24.460  88.588  92.520  1.00 81.73  ? 334 GLN C N     1 
ATOM   6187  C  CA    . GLN C 1 66  ? 23.908  87.376  93.107  1.00 81.73  ? 334 GLN C CA    1 
ATOM   6188  C  C     . GLN C 1 66  ? 22.411  87.249  92.877  1.00 81.73  ? 334 GLN C C     1 
ATOM   6189  O  O     . GLN C 1 66  ? 21.864  86.158  93.055  1.00 81.73  ? 334 GLN C O     1 
ATOM   6190  C  CB    . GLN C 1 66  ? 24.217  87.330  94.600  1.00 81.73  ? 334 GLN C CB    1 
ATOM   6191  C  CG    . GLN C 1 66  ? 25.685  87.120  94.904  1.00 81.73  ? 334 GLN C CG    1 
ATOM   6192  C  CD    . GLN C 1 66  ? 25.985  87.167  96.382  1.00 81.73  ? 334 GLN C CD    1 
ATOM   6193  O  OE1   . GLN C 1 66  ? 25.106  87.440  97.196  1.00 81.73  ? 334 GLN C OE1   1 
ATOM   6194  N  NE2   . GLN C 1 66  ? 27.233  86.901  96.740  1.00 81.73  ? 334 GLN C NE2   1 
ATOM   6195  N  N     . ASP C 1 67  ? 21.738  88.328  92.483  1.00 82.50  ? 335 ASP C N     1 
ATOM   6196  C  CA    . ASP C 1 67  ? 20.344  88.221  92.082  1.00 82.50  ? 335 ASP C CA    1 
ATOM   6197  C  C     . ASP C 1 67  ? 20.177  87.640  90.687  1.00 82.50  ? 335 ASP C C     1 
ATOM   6198  O  O     . ASP C 1 67  ? 19.063  87.251  90.328  1.00 82.50  ? 335 ASP C O     1 
ATOM   6199  C  CB    . ASP C 1 67  ? 19.659  89.584  92.154  1.00 82.50  ? 335 ASP C CB    1 
ATOM   6200  C  CG    . ASP C 1 67  ? 19.438  90.047  93.577  1.00 82.50  ? 335 ASP C CG    1 
ATOM   6201  O  OD1   . ASP C 1 67  ? 19.339  89.182  94.472  1.00 82.50  ? 335 ASP C OD1   1 
ATOM   6202  O  OD2   . ASP C 1 67  ? 19.345  91.271  93.802  1.00 82.50  ? 335 ASP C OD2   1 
ATOM   6203  N  N     . LEU C 1 68  ? 21.245  87.579  89.895  1.00 81.04  ? 336 LEU C N     1 
ATOM   6204  C  CA    . LEU C 1 68  ? 21.218  86.918  88.599  1.00 81.04  ? 336 LEU C CA    1 
ATOM   6205  C  C     . LEU C 1 68  ? 21.960  85.592  88.615  1.00 81.04  ? 336 LEU C C     1 
ATOM   6206  O  O     . LEU C 1 68  ? 22.165  84.996  87.555  1.00 81.04  ? 336 LEU C O     1 
ATOM   6207  C  CB    . LEU C 1 68  ? 21.801  87.828  87.523  1.00 81.04  ? 336 LEU C CB    1 
ATOM   6208  C  CG    . LEU C 1 68  ? 20.943  89.050  87.233  1.00 81.04  ? 336 LEU C CG    1 
ATOM   6209  C  CD1   . LEU C 1 68  ? 21.651  89.965  86.263  1.00 81.04  ? 336 LEU C CD1   1 
ATOM   6210  C  CD2   . LEU C 1 68  ? 19.615  88.610  86.675  1.00 81.04  ? 336 LEU C CD2   1 
ATOM   6211  N  N     . GLY C 1 69  ? 22.366  85.120  89.789  1.00 80.53  ? 337 GLY C N     1 
ATOM   6212  C  CA    . GLY C 1 69  ? 23.057  83.856  89.900  1.00 80.53  ? 337 GLY C CA    1 
ATOM   6213  C  C     . GLY C 1 69  ? 24.517  83.892  89.526  1.00 80.53  ? 337 GLY C C     1 
ATOM   6214  O  O     . GLY C 1 69  ? 25.123  82.827  89.367  1.00 80.53  ? 337 GLY C O     1 
ATOM   6215  N  N     . ALA C 1 70  ? 25.103  85.075  89.386  1.00 80.07  ? 338 ALA C N     1 
ATOM   6216  C  CA    . ALA C 1 70  ? 26.479  85.200  88.930  1.00 80.07  ? 338 ALA C CA    1 
ATOM   6217  C  C     . ALA C 1 70  ? 27.429  84.854  90.063  1.00 80.07  ? 338 ALA C C     1 
ATOM   6218  O  O     . ALA C 1 70  ? 27.425  85.514  91.105  1.00 80.07  ? 338 ALA C O     1 
ATOM   6219  C  CB    . ALA C 1 70  ? 26.744  86.615  88.433  1.00 80.07  ? 338 ALA C CB    1 
ATOM   6220  N  N     . LYS C 1 71  ? 28.239  83.820  89.865  1.00 77.83  ? 339 LYS C N     1 
ATOM   6221  C  CA    . LYS C 1 71  ? 29.250  83.484  90.851  1.00 77.83  ? 339 LYS C CA    1 
ATOM   6222  C  C     . LYS C 1 71  ? 30.398  84.480  90.770  1.00 77.83  ? 339 LYS C C     1 
ATOM   6223  O  O     . LYS C 1 71  ? 30.506  85.268  89.828  1.00 77.83  ? 339 LYS C O     1 
ATOM   6224  C  CB    . LYS C 1 71  ? 29.772  82.068  90.627  1.00 77.83  ? 339 LYS C CB    1 
ATOM   6225  C  CG    . LYS C 1 71  ? 28.762  80.977  90.907  1.00 77.83  ? 339 LYS C CG    1 
ATOM   6226  C  CD    . LYS C 1 71  ? 29.321  79.621  90.526  1.00 77.83  ? 339 LYS C CD    1 
ATOM   6227  C  CE    . LYS C 1 71  ? 30.444  79.214  91.455  1.00 77.83  ? 339 LYS C CE    1 
ATOM   6228  N  NZ    . LYS C 1 71  ? 29.942  78.959  92.831  1.00 77.83  ? 339 LYS C NZ    1 
ATOM   6229  N  N     . ILE C 1 72  ? 31.267  84.439  91.767  1.00 77.25  ? 340 ILE C N     1 
ATOM   6230  C  CA    . ILE C 1 72  ? 32.443  85.309  91.712  1.00 77.25  ? 340 ILE C CA    1 
ATOM   6231  C  C     . ILE C 1 72  ? 33.415  84.771  90.667  1.00 77.25  ? 340 ILE C C     1 
ATOM   6232  O  O     . ILE C 1 72  ? 33.622  83.547  90.581  1.00 77.25  ? 340 ILE C O     1 
ATOM   6233  C  CB    . ILE C 1 72  ? 33.096  85.432  93.099  1.00 77.25  ? 340 ILE C CB    1 
ATOM   6234  C  CG1   . ILE C 1 72  ? 34.259  86.426  93.064  1.00 77.25  ? 340 ILE C CG1   1 
ATOM   6235  C  CG2   . ILE C 1 72  ? 33.470  84.081  93.717  1.00 77.25  ? 340 ILE C CG2   1 
ATOM   6236  C  CD1   . ILE C 1 72  ? 34.709  86.862  94.427  1.00 77.25  ? 340 ILE C CD1   1 
ATOM   6237  N  N     . PRO C 1 73  ? 33.947  85.615  89.792  1.00 73.64  ? 341 PRO C N     1 
ATOM   6238  C  CA    . PRO C 1 73  ? 34.994  85.153  88.878  1.00 73.64  ? 341 PRO C CA    1 
ATOM   6239  C  C     . PRO C 1 73  ? 36.288  84.900  89.631  1.00 73.64  ? 341 PRO C C     1 
ATOM   6240  O  O     . PRO C 1 73  ? 36.645  85.630  90.557  1.00 73.64  ? 341 PRO C O     1 
ATOM   6241  C  CB    . PRO C 1 73  ? 35.119  86.300  87.873  1.00 73.64  ? 341 PRO C CB    1 
ATOM   6242  C  CG    . PRO C 1 73  ? 34.547  87.473  88.571  1.00 73.64  ? 341 PRO C CG    1 
ATOM   6243  C  CD    . PRO C 1 73  ? 33.485  86.971  89.471  1.00 73.64  ? 341 PRO C CD    1 
ATOM   6244  N  N     . LYS C 1 74  ? 36.985  83.838  89.232  1.00 72.32  ? 342 LYS C N     1 
ATOM   6245  C  CA    . LYS C 1 74  ? 38.049  83.294  90.065  1.00 72.32  ? 342 LYS C CA    1 
ATOM   6246  C  C     . LYS C 1 74  ? 39.328  84.117  89.986  1.00 72.32  ? 342 LYS C C     1 
ATOM   6247  O  O     . LYS C 1 74  ? 39.986  84.328  91.009  1.00 72.32  ? 342 LYS C O     1 
ATOM   6248  C  CB    . LYS C 1 74  ? 38.319  81.842  89.677  1.00 72.32  ? 342 LYS C CB    1 
ATOM   6249  C  CG    . LYS C 1 74  ? 39.358  81.137  90.536  1.00 72.32  ? 342 LYS C CG    1 
ATOM   6250  C  CD    . LYS C 1 74  ? 38.917  81.032  91.981  1.00 72.32  ? 342 LYS C CD    1 
ATOM   6251  C  CE    . LYS C 1 74  ? 37.686  80.158  92.117  1.00 72.32  ? 342 LYS C CE    1 
ATOM   6252  N  NZ    . LYS C 1 74  ? 37.974  78.737  91.799  1.00 72.32  ? 342 LYS C NZ    1 
ATOM   6253  N  N     . GLY C 1 75  ? 39.701  84.594  88.807  1.00 70.60  ? 343 GLY C N     1 
ATOM   6254  C  CA    . GLY C 1 75  ? 40.944  85.329  88.706  1.00 70.60  ? 343 GLY C CA    1 
ATOM   6255  C  C     . GLY C 1 75  ? 41.056  86.076  87.399  1.00 70.60  ? 343 GLY C C     1 
ATOM   6256  O  O     . GLY C 1 75  ? 40.099  86.168  86.631  1.00 70.60  ? 343 GLY C O     1 
ATOM   6257  N  N     . ALA C 1 76  ? 42.252  86.610  87.155  1.00 67.35  ? 344 ALA C N     1 
ATOM   6258  C  CA    . ALA C 1 76  ? 42.525  87.333  85.922  1.00 67.35  ? 344 ALA C CA    1 
ATOM   6259  C  C     . ALA C 1 76  ? 44.019  87.344  85.654  1.00 67.35  ? 344 ALA C C     1 
ATOM   6260  O  O     . ALA C 1 76  ? 44.827  87.342  86.583  1.00 67.35  ? 344 ALA C O     1 
ATOM   6261  C  CB    . ALA C 1 76  ? 42.009  88.769  85.978  1.00 67.35  ? 344 ALA C CB    1 
ATOM   6262  N  N     . ILE C 1 77  ? 44.374  87.364  84.373  1.00 68.45  ? 345 ILE C N     1 
ATOM   6263  C  CA    . ILE C 1 77  ? 45.750  87.528  83.927  1.00 68.45  ? 345 ILE C CA    1 
ATOM   6264  C  C     . ILE C 1 77  ? 45.848  88.884  83.258  1.00 68.45  ? 345 ILE C C     1 
ATOM   6265  O  O     . ILE C 1 77  ? 44.984  89.246  82.453  1.00 68.45  ? 345 ILE C O     1 
ATOM   6266  C  CB    . ILE C 1 77  ? 46.175  86.434  82.936  1.00 68.45  ? 345 ILE C CB    1 
ATOM   6267  C  CG1   . ILE C 1 77  ? 45.868  85.070  83.494  1.00 68.45  ? 345 ILE C CG1   1 
ATOM   6268  C  CG2   . ILE C 1 77  ? 47.659  86.468  82.724  1.00 68.45  ? 345 ILE C CG2   1 
ATOM   6269  C  CD1   . ILE C 1 77  ? 45.989  83.983  82.466  1.00 68.45  ? 345 ILE C CD1   1 
ATOM   6270  N  N     . LEU C 1 78  ? 46.892  89.627  83.573  1.00 67.30  ? 346 LEU C N     1 
ATOM   6271  C  CA    . LEU C 1 78  ? 47.121  90.927  82.961  1.00 67.30  ? 346 LEU C CA    1 
ATOM   6272  C  C     . LEU C 1 78  ? 48.351  90.804  82.071  1.00 67.30  ? 346 LEU C C     1 
ATOM   6273  O  O     . LEU C 1 78  ? 49.481  90.771  82.562  1.00 67.30  ? 346 LEU C O     1 
ATOM   6274  C  CB    . LEU C 1 78  ? 47.278  91.996  84.033  1.00 67.30  ? 346 LEU C CB    1 
ATOM   6275  C  CG    . LEU C 1 78  ? 46.000  92.220  84.836  1.00 67.30  ? 346 LEU C CG    1 
ATOM   6276  C  CD1   . LEU C 1 78  ? 46.233  93.141  86.003  1.00 67.30  ? 346 LEU C CD1   1 
ATOM   6277  C  CD2   . LEU C 1 78  ? 44.942  92.794  83.934  1.00 67.30  ? 346 LEU C CD2   1 
ATOM   6278  N  N     . THR C 1 79  ? 48.128  90.724  80.766  1.00 67.82  ? 347 THR C N     1 
ATOM   6279  C  CA    . THR C 1 79  ? 49.196  90.564  79.795  1.00 67.82  ? 347 THR C CA    1 
ATOM   6280  C  C     . THR C 1 79  ? 49.420  91.867  79.046  1.00 67.82  ? 347 THR C C     1 
ATOM   6281  O  O     . THR C 1 79  ? 48.664  92.830  79.184  1.00 67.82  ? 347 THR C O     1 
ATOM   6282  C  CB    . THR C 1 79  ? 48.873  89.445  78.805  1.00 67.82  ? 347 THR C CB    1 
ATOM   6283  O  OG1   . THR C 1 79  ? 47.741  89.823  78.019  1.00 67.82  ? 347 THR C OG1   1 
ATOM   6284  C  CG2   . THR C 1 79  ? 48.541  88.179  79.541  1.00 67.82  ? 347 THR C CG2   1 
ATOM   6285  N  N     . GLY C 1 80  ? 50.474  91.883  78.238  1.00 64.16  ? 348 GLY C N     1 
ATOM   6286  C  CA    . GLY C 1 80  ? 50.804  93.037  77.443  1.00 64.16  ? 348 GLY C CA    1 
ATOM   6287  C  C     . GLY C 1 80  ? 52.295  93.272  77.375  1.00 64.16  ? 348 GLY C C     1 
ATOM   6288  O  O     . GLY C 1 80  ? 53.077  92.601  78.048  1.00 64.16  ? 348 GLY C O     1 
ATOM   6289  N  N     . PRO C 1 81  ? 52.715  94.229  76.558  1.00 62.22  ? 349 PRO C N     1 
ATOM   6290  C  CA    . PRO C 1 81  ? 54.121  94.620  76.516  1.00 62.22  ? 349 PRO C CA    1 
ATOM   6291  C  C     . PRO C 1 81  ? 54.536  95.283  77.817  1.00 62.22  ? 349 PRO C C     1 
ATOM   6292  O  O     . PRO C 1 81  ? 53.677  95.760  78.573  1.00 62.22  ? 349 PRO C O     1 
ATOM   6293  C  CB    . PRO C 1 81  ? 54.164  95.610  75.344  1.00 62.22  ? 349 PRO C CB    1 
ATOM   6294  C  CG    . PRO C 1 81  ? 53.007  95.255  74.515  1.00 62.22  ? 349 PRO C CG    1 
ATOM   6295  C  CD    . PRO C 1 81  ? 51.947  94.848  75.471  1.00 62.22  ? 349 PRO C CD    1 
ATOM   6296  N  N     . PRO C 1 82  ? 55.833  95.323  78.128  1.00 61.12  ? 350 PRO C N     1 
ATOM   6297  C  CA    . PRO C 1 82  ? 56.250  95.894  79.410  1.00 61.12  ? 350 PRO C CA    1 
ATOM   6298  C  C     . PRO C 1 82  ? 56.117  97.406  79.436  1.00 61.12  ? 350 PRO C C     1 
ATOM   6299  O  O     . PRO C 1 82  ? 56.402  98.094  78.455  1.00 61.12  ? 350 PRO C O     1 
ATOM   6300  C  CB    . PRO C 1 82  ? 57.712  95.464  79.527  1.00 61.12  ? 350 PRO C CB    1 
ATOM   6301  C  CG    . PRO C 1 82  ? 58.153  95.299  78.150  1.00 61.12  ? 350 PRO C CG    1 
ATOM   6302  C  CD    . PRO C 1 82  ? 56.981  94.756  77.404  1.00 61.12  ? 350 PRO C CD    1 
ATOM   6303  N  N     . GLY C 1 83  ? 55.657  97.914  80.576  1.00 60.58  ? 351 GLY C N     1 
ATOM   6304  C  CA    . GLY C 1 83  ? 55.452  99.335  80.754  1.00 60.58  ? 351 GLY C CA    1 
ATOM   6305  C  C     . GLY C 1 83  ? 54.091  99.789  80.291  1.00 60.58  ? 351 GLY C C     1 
ATOM   6306  O  O     . GLY C 1 83  ? 53.978  100.756 79.536  1.00 60.58  ? 351 GLY C O     1 
ATOM   6307  N  N     . THR C 1 84  ? 53.045  99.091  80.720  1.00 59.92  ? 352 THR C N     1 
ATOM   6308  C  CA    . THR C 1 84  ? 51.713  99.393  80.237  1.00 59.92  ? 352 THR C CA    1 
ATOM   6309  C  C     . THR C 1 84  ? 50.721  99.574  81.381  1.00 59.92  ? 352 THR C C     1 
ATOM   6310  O  O     . THR C 1 84  ? 49.557  99.910  81.138  1.00 59.92  ? 352 THR C O     1 
ATOM   6311  C  CB    . THR C 1 84  ? 51.249  98.290  79.281  1.00 59.92  ? 352 THR C CB    1 
ATOM   6312  O  OG1   . THR C 1 84  ? 52.378  97.821  78.543  1.00 59.92  ? 352 THR C OG1   1 
ATOM   6313  C  CG2   . THR C 1 84  ? 50.337  98.868  78.243  1.00 59.92  ? 352 THR C CG2   1 
ATOM   6314  N  N     . GLY C 1 85  ? 51.155  99.414  82.624  1.00 63.67  ? 353 GLY C N     1 
ATOM   6315  C  CA    . GLY C 1 85  ? 50.248  99.630  83.723  1.00 63.67  ? 353 GLY C CA    1 
ATOM   6316  C  C     . GLY C 1 85  ? 49.389  98.420  83.983  1.00 63.67  ? 353 GLY C C     1 
ATOM   6317  O  O     . GLY C 1 85  ? 48.167  98.528  84.082  1.00 63.67  ? 353 GLY C O     1 
ATOM   6318  N  N     . LYS C 1 86  ? 50.017  97.255  84.060  1.00 63.08  ? 354 LYS C N     1 
ATOM   6319  C  CA    . LYS C 1 86  ? 49.362  96.067  84.568  1.00 63.08  ? 354 LYS C CA    1 
ATOM   6320  C  C     . LYS C 1 86  ? 49.739  95.786  86.013  1.00 63.08  ? 354 LYS C C     1 
ATOM   6321  O  O     . LYS C 1 86  ? 49.093  94.958  86.658  1.00 63.08  ? 354 LYS C O     1 
ATOM   6322  C  CB    . LYS C 1 86  ? 49.701  94.863  83.688  1.00 63.08  ? 354 LYS C CB    1 
ATOM   6323  C  CG    . LYS C 1 86  ? 51.118  94.402  83.837  1.00 63.08  ? 354 LYS C CG    1 
ATOM   6324  C  CD    . LYS C 1 86  ? 51.520  93.380  82.810  1.00 63.08  ? 354 LYS C CD    1 
ATOM   6325  C  CE    . LYS C 1 86  ? 51.769  94.066  81.494  1.00 63.08  ? 354 LYS C CE    1 
ATOM   6326  N  NZ    . LYS C 1 86  ? 52.394  93.135  80.536  1.00 63.08  ? 354 LYS C NZ    1 
ATOM   6327  N  N     . THR C 1 87  ? 50.771  96.453  86.527  1.00 65.27  ? 355 THR C N     1 
ATOM   6328  C  CA    . THR C 1 87  ? 51.048  96.511  87.955  1.00 65.27  ? 355 THR C CA    1 
ATOM   6329  C  C     . THR C 1 87  ? 50.363  97.718  88.576  1.00 65.27  ? 355 THR C C     1 
ATOM   6330  O  O     . THR C 1 87  ? 49.861  97.639  89.702  1.00 65.27  ? 355 THR C O     1 
ATOM   6331  C  CB    . THR C 1 87  ? 52.558  96.578  88.202  1.00 65.27  ? 355 THR C CB    1 
ATOM   6332  O  OG1   . THR C 1 87  ? 53.203  95.495  87.524  1.00 65.27  ? 355 THR C OG1   1 
ATOM   6333  C  CG2   . THR C 1 87  ? 52.877  96.466  89.676  1.00 65.27  ? 355 THR C CG2   1 
ATOM   6334  N  N     . LEU C 1 88  ? 50.316  98.827  87.833  1.00 64.00  ? 356 LEU C N     1 
ATOM   6335  C  CA    . LEU C 1 88  ? 49.594  100.015 88.276  1.00 64.00  ? 356 LEU C CA    1 
ATOM   6336  C  C     . LEU C 1 88  ? 48.103  99.747  88.378  1.00 64.00  ? 356 LEU C C     1 
ATOM   6337  O  O     . LEU C 1 88  ? 47.431  100.254 89.282  1.00 64.00  ? 356 LEU C O     1 
ATOM   6338  C  CB    . LEU C 1 88  ? 49.847  101.161 87.306  1.00 64.00  ? 356 LEU C CB    1 
ATOM   6339  C  CG    . LEU C 1 88  ? 49.195  102.485 87.667  1.00 64.00  ? 356 LEU C CG    1 
ATOM   6340  C  CD1   . LEU C 1 88  ? 49.803  103.043 88.932  1.00 64.00  ? 356 LEU C CD1   1 
ATOM   6341  C  CD2   . LEU C 1 88  ? 49.283  103.469 86.542  1.00 64.00  ? 356 LEU C CD2   1 
ATOM   6342  N  N     . LEU C 1 89  ? 47.569  98.943  87.461  1.00 67.73  ? 357 LEU C N     1 
ATOM   6343  C  CA    . LEU C 1 89  ? 46.167  98.563  87.542  1.00 67.73  ? 357 LEU C CA    1 
ATOM   6344  C  C     . LEU C 1 89  ? 45.919  97.634  88.720  1.00 67.73  ? 357 LEU C C     1 
ATOM   6345  O  O     . LEU C 1 89  ? 44.806  97.595  89.253  1.00 67.73  ? 357 LEU C O     1 
ATOM   6346  C  CB    . LEU C 1 89  ? 45.734  97.921  86.229  1.00 67.73  ? 357 LEU C CB    1 
ATOM   6347  C  CG    . LEU C 1 89  ? 44.254  97.640  86.039  1.00 67.73  ? 357 LEU C CG    1 
ATOM   6348  C  CD1   . LEU C 1 89  ? 43.488  98.917  86.213  1.00 67.73  ? 357 LEU C CD1   1 
ATOM   6349  C  CD2   . LEU C 1 89  ? 44.037  97.101  84.658  1.00 67.73  ? 357 LEU C CD2   1 
ATOM   6350  N  N     . ALA C 1 90  ? 46.943  96.909  89.165  1.00 67.70  ? 358 ALA C N     1 
ATOM   6351  C  CA    . ALA C 1 90  ? 46.830  96.201  90.430  1.00 67.70  ? 358 ALA C CA    1 
ATOM   6352  C  C     . ALA C 1 90  ? 47.033  97.127  91.620  1.00 67.70  ? 358 ALA C C     1 
ATOM   6353  O  O     . ALA C 1 90  ? 46.507  96.855  92.703  1.00 67.70  ? 358 ALA C O     1 
ATOM   6354  C  CB    . ALA C 1 90  ? 47.834  95.058  90.488  1.00 67.70  ? 358 ALA C CB    1 
ATOM   6355  N  N     . LYS C 1 91  ? 47.797  98.209  91.450  1.00 70.25  ? 359 LYS C N     1 
ATOM   6356  C  CA    . LYS C 1 91  ? 47.943  99.186  92.522  1.00 70.25  ? 359 LYS C CA    1 
ATOM   6357  C  C     . LYS C 1 91  ? 46.660  99.963  92.748  1.00 70.25  ? 359 LYS C C     1 
ATOM   6358  O  O     . LYS C 1 91  ? 46.406  100.421 93.865  1.00 70.25  ? 359 LYS C O     1 
ATOM   6359  C  CB    . LYS C 1 91  ? 49.068  100.167 92.213  1.00 70.25  ? 359 LYS C CB    1 
ATOM   6360  C  CG    . LYS C 1 91  ? 50.463  99.605  92.298  1.00 70.25  ? 359 LYS C CG    1 
ATOM   6361  C  CD    . LYS C 1 91  ? 51.468  100.685 91.978  1.00 70.25  ? 359 LYS C CD    1 
ATOM   6362  C  CE    . LYS C 1 91  ? 52.876  100.156 91.992  1.00 70.25  ? 359 LYS C CE    1 
ATOM   6363  N  NZ    . LYS C 1 91  ? 53.840  101.221 91.615  1.00 70.25  ? 359 LYS C NZ    1 
ATOM   6364  N  N     . ALA C 1 92  ? 45.857  100.140 91.701  1.00 72.44  ? 360 ALA C N     1 
ATOM   6365  C  CA    . ALA C 1 92  ? 44.593  100.842 91.860  1.00 72.44  ? 360 ALA C CA    1 
ATOM   6366  C  C     . ALA C 1 92  ? 43.599  100.012 92.648  1.00 72.44  ? 360 ALA C C     1 
ATOM   6367  O  O     . ALA C 1 92  ? 42.791  100.565 93.396  1.00 72.44  ? 360 ALA C O     1 
ATOM   6368  C  CB    . ALA C 1 92  ? 44.012  101.202 90.498  1.00 72.44  ? 360 ALA C CB    1 
ATOM   6369  N  N     . THR C 1 93  ? 43.659  98.690  92.509  1.00 67.71  ? 361 THR C N     1 
ATOM   6370  C  CA    . THR C 1 93  ? 42.723  97.825  93.210  1.00 67.71  ? 361 THR C CA    1 
ATOM   6371  C  C     . THR C 1 93  ? 43.030  97.767  94.698  1.00 67.71  ? 361 THR C C     1 
ATOM   6372  O  O     . THR C 1 93  ? 42.109  97.698  95.518  1.00 67.71  ? 361 THR C O     1 
ATOM   6373  C  CB    . THR C 1 93  ? 42.769  96.439  92.582  1.00 67.71  ? 361 THR C CB    1 
ATOM   6374  O  OG1   . THR C 1 93  ? 42.540  96.574  91.181  1.00 67.71  ? 361 THR C OG1   1 
ATOM   6375  C  CG2   . THR C 1 93  ? 41.706  95.532  93.154  1.00 67.71  ? 361 THR C CG2   1 
ATOM   6376  N  N     . ALA C 1 94  ? 44.312  97.828  95.063  1.00 72.53  ? 362 ALA C N     1 
ATOM   6377  C  CA    . ALA C 1 94  ? 44.686  97.839  96.472  1.00 72.53  ? 362 ALA C CA    1 
ATOM   6378  C  C     . ALA C 1 94  ? 44.218  99.112  97.159  1.00 72.53  ? 362 ALA C C     1 
ATOM   6379  O  O     . ALA C 1 94  ? 43.786  99.077  98.316  1.00 72.53  ? 362 ALA C O     1 
ATOM   6380  C  CB    . ALA C 1 94  ? 46.197  97.692  96.614  1.00 72.53  ? 362 ALA C CB    1 
ATOM   6381  N  N     . GLY C 1 95  ? 44.275  100.235 96.462  1.00 76.64  ? 363 GLY C N     1 
ATOM   6382  C  CA    . GLY C 1 95  ? 43.892  101.498 97.041  1.00 76.64  ? 363 GLY C CA    1 
ATOM   6383  C  C     . GLY C 1 95  ? 42.430  101.836 96.946  1.00 76.64  ? 363 GLY C C     1 
ATOM   6384  O  O     . GLY C 1 95  ? 42.010  102.872 97.468  1.00 76.64  ? 363 GLY C O     1 
ATOM   6385  N  N     . GLU C 1 96  ? 41.630  100.995 96.301  1.00 79.10  ? 364 GLU C N     1 
ATOM   6386  C  CA    . GLU C 1 96  ? 40.213  101.273 96.125  1.00 79.10  ? 364 GLU C CA    1 
ATOM   6387  C  C     . GLU C 1 96  ? 39.320  100.224 96.763  1.00 79.10  ? 364 GLU C C     1 
ATOM   6388  O  O     . GLU C 1 96  ? 38.354  100.578 97.449  1.00 79.10  ? 364 GLU C O     1 
ATOM   6389  C  CB    . GLU C 1 96  ? 39.888  101.402 94.635  1.00 79.10  ? 364 GLU C CB    1 
ATOM   6390  C  CG    . GLU C 1 96  ? 38.447  101.746 94.366  1.00 79.10  ? 364 GLU C CG    1 
ATOM   6391  C  CD    . GLU C 1 96  ? 38.077  103.146 94.814  1.00 79.10  ? 364 GLU C CD    1 
ATOM   6392  O  OE1   . GLU C 1 96  ? 38.962  104.026 94.818  1.00 79.10  ? 364 GLU C OE1   1 
ATOM   6393  O  OE2   . GLU C 1 96  ? 36.899  103.366 95.166  1.00 79.10  ? 364 GLU C OE2   1 
ATOM   6394  N  N     . ALA C 1 97  ? 39.606  98.943  96.554  1.00 76.26  ? 365 ALA C N     1 
ATOM   6395  C  CA    . ALA C 1 97  ? 38.816  97.890  97.172  1.00 76.26  ? 365 ALA C CA    1 
ATOM   6396  C  C     . ALA C 1 97  ? 39.085  97.841  98.668  1.00 76.26  ? 365 ALA C C     1 
ATOM   6397  O  O     . ALA C 1 97  ? 40.238  97.889  99.102  1.00 76.26  ? 365 ALA C O     1 
ATOM   6398  C  CB    . ALA C 1 97  ? 39.138  96.542  96.538  1.00 76.26  ? 365 ALA C CB    1 
ATOM   6399  N  N     . ASN C 1 98  ? 38.019  97.740  99.460  1.00 76.03  ? 366 ASN C N     1 
ATOM   6400  C  CA    . ASN C 1 98  ? 38.133  97.703  100.911 1.00 76.03  ? 366 ASN C CA    1 
ATOM   6401  C  C     . ASN C 1 98  ? 38.296  96.291  101.454 1.00 76.03  ? 366 ASN C C     1 
ATOM   6402  O  O     . ASN C 1 98  ? 37.963  96.039  102.616 1.00 76.03  ? 366 ASN C O     1 
ATOM   6403  C  CB    . ASN C 1 98  ? 36.925  98.382  101.553 1.00 76.03  ? 366 ASN C CB    1 
ATOM   6404  C  CG    . ASN C 1 98  ? 36.970  99.885  101.412 1.00 76.03  ? 366 ASN C CG    1 
ATOM   6405  O  OD1   . ASN C 1 98  ? 38.029  100.496 101.550 1.00 76.03  ? 366 ASN C OD1   1 
ATOM   6406  N  ND2   . ASN C 1 98  ? 35.822  100.493 101.139 1.00 76.03  ? 366 ASN C ND2   1 
ATOM   6407  N  N     . VAL C 1 99  ? 38.803  95.373  100.642 1.00 71.77  ? 367 VAL C N     1 
ATOM   6408  C  CA    . VAL C 1 99  ? 39.095  94.011  101.068 1.00 71.77  ? 367 VAL C CA    1 
ATOM   6409  C  C     . VAL C 1 99  ? 40.580  93.963  101.401 1.00 71.77  ? 367 VAL C C     1 
ATOM   6410  O  O     . VAL C 1 99  ? 41.315  94.877  101.006 1.00 71.77  ? 367 VAL C O     1 
ATOM   6411  C  CB    . VAL C 1 99  ? 38.712  93.007  99.972  1.00 71.77  ? 367 VAL C CB    1 
ATOM   6412  C  CG1   . VAL C 1 99  ? 37.224  93.067  99.719  1.00 71.77  ? 367 VAL C CG1   1 
ATOM   6413  C  CG2   . VAL C 1 99  ? 39.474  93.308  98.705  1.00 71.77  ? 367 VAL C CG2   1 
ATOM   6414  N  N     . PRO C 1 100 ? 41.058  92.976  102.157 1.00 70.80  ? 368 PRO C N     1 
ATOM   6415  C  CA    . PRO C 1 100 ? 42.505  92.814  102.301 1.00 70.80  ? 368 PRO C CA    1 
ATOM   6416  C  C     . PRO C 1 100 ? 43.135  92.447  100.973 1.00 70.80  ? 368 PRO C C     1 
ATOM   6417  O  O     . PRO C 1 100 ? 42.528  91.789  100.131 1.00 70.80  ? 368 PRO C O     1 
ATOM   6418  C  CB    . PRO C 1 100 ? 42.636  91.675  103.312 1.00 70.80  ? 368 PRO C CB    1 
ATOM   6419  C  CG    . PRO C 1 100 ? 41.380  91.715  104.071 1.00 70.80  ? 368 PRO C CG    1 
ATOM   6420  C  CD    . PRO C 1 100 ? 40.329  92.105  103.092 1.00 70.80  ? 368 PRO C CD    1 
ATOM   6421  N  N     . PHE C 1 101 ? 44.356  92.918  100.777 1.00 69.58  ? 369 PHE C N     1 
ATOM   6422  C  CA    . PHE C 1 101 ? 45.068  92.725  99.526  1.00 69.58  ? 369 PHE C CA    1 
ATOM   6423  C  C     . PHE C 1 101 ? 46.471  92.263  99.867  1.00 69.58  ? 369 PHE C C     1 
ATOM   6424  O  O     . PHE C 1 101 ? 47.120  92.859  100.727 1.00 69.58  ? 369 PHE C O     1 
ATOM   6425  C  CB    . PHE C 1 101 ? 45.106  94.026  98.726  1.00 69.58  ? 369 PHE C CB    1 
ATOM   6426  C  CG    . PHE C 1 101 ? 45.611  93.874  97.330  1.00 69.58  ? 369 PHE C CG    1 
ATOM   6427  C  CD1   . PHE C 1 101 ? 44.779  93.405  96.334  1.00 69.58  ? 369 PHE C CD1   1 
ATOM   6428  C  CD2   . PHE C 1 101 ? 46.910  94.206  97.008  1.00 69.58  ? 369 PHE C CD2   1 
ATOM   6429  C  CE1   . PHE C 1 101 ? 45.230  93.277  95.043  1.00 69.58  ? 369 PHE C CE1   1 
ATOM   6430  C  CE2   . PHE C 1 101 ? 47.366  94.077  95.717  1.00 69.58  ? 369 PHE C CE2   1 
ATOM   6431  C  CZ    . PHE C 1 101 ? 46.525  93.609  94.736  1.00 69.58  ? 369 PHE C CZ    1 
ATOM   6432  N  N     . ILE C 1 102 ? 46.932  91.185  99.239  1.00 68.99  ? 370 ILE C N     1 
ATOM   6433  C  CA    . ILE C 1 102 ? 48.301  90.750  99.462  1.00 68.99  ? 370 ILE C CA    1 
ATOM   6434  C  C     . ILE C 1 102 ? 49.005  90.713  98.113  1.00 68.99  ? 370 ILE C C     1 
ATOM   6435  O  O     . ILE C 1 102 ? 48.374  90.654  97.057  1.00 68.99  ? 370 ILE C O     1 
ATOM   6436  C  CB    . ILE C 1 102 ? 48.404  89.385  100.177 1.00 68.99  ? 370 ILE C CB    1 
ATOM   6437  C  CG1   . ILE C 1 102 ? 48.151  88.237  99.233  1.00 68.99  ? 370 ILE C CG1   1 
ATOM   6438  C  CG2   . ILE C 1 102 ? 47.367  89.254  101.280 1.00 68.99  ? 370 ILE C CG2   1 
ATOM   6439  C  CD1   . ILE C 1 102 ? 48.464  86.913  99.855  1.00 68.99  ? 370 ILE C CD1   1 
ATOM   6440  N  N     . THR C 1 103 ? 50.331  90.803  98.157  1.00 69.87  ? 371 THR C N     1 
ATOM   6441  C  CA    . THR C 1 103 ? 51.160  90.795  96.962  1.00 69.87  ? 371 THR C CA    1 
ATOM   6442  C  C     . THR C 1 103 ? 52.246  89.744  97.104  1.00 69.87  ? 371 THR C C     1 
ATOM   6443  O  O     . THR C 1 103 ? 52.742  89.488  98.201  1.00 69.87  ? 371 THR C O     1 
ATOM   6444  C  CB    . THR C 1 103 ? 51.835  92.140  96.706  1.00 69.87  ? 371 THR C CB    1 
ATOM   6445  O  OG1   . THR C 1 103 ? 52.695  92.451  97.806  1.00 69.87  ? 371 THR C OG1   1 
ATOM   6446  C  CG2   . THR C 1 103 ? 50.816  93.242  96.545  1.00 69.87  ? 371 THR C CG2   1 
ATOM   6447  N  N     . VAL C 1 104 ? 52.627  89.158  95.972  1.00 68.61  ? 372 VAL C N     1 
ATOM   6448  C  CA    . VAL C 1 104 ? 53.690  88.165  95.932  1.00 68.61  ? 372 VAL C CA    1 
ATOM   6449  C  C     . VAL C 1 104 ? 54.237  88.173  94.515  1.00 68.61  ? 372 VAL C C     1 
ATOM   6450  O  O     . VAL C 1 104 ? 53.537  88.538  93.568  1.00 68.61  ? 372 VAL C O     1 
ATOM   6451  C  CB    . VAL C 1 104 ? 53.167  86.773  96.378  1.00 68.61  ? 372 VAL C CB    1 
ATOM   6452  C  CG1   . VAL C 1 104 ? 52.225  86.180  95.362  1.00 68.61  ? 372 VAL C CG1   1 
ATOM   6453  C  CG2   . VAL C 1 104 ? 54.296  85.817  96.694  1.00 68.61  ? 372 VAL C CG2   1 
ATOM   6454  N  N     . SER C 1 105 ? 55.512  87.841  94.376  1.00 68.76  ? 373 SER C N     1 
ATOM   6455  C  CA    . SER C 1 105 ? 56.141  87.768  93.070  1.00 68.76  ? 373 SER C CA    1 
ATOM   6456  C  C     . SER C 1 105 ? 56.242  86.317  92.633  1.00 68.76  ? 373 SER C C     1 
ATOM   6457  O  O     . SER C 1 105 ? 56.354  85.410  93.458  1.00 68.76  ? 373 SER C O     1 
ATOM   6458  C  CB    . SER C 1 105 ? 57.526  88.406  93.086  1.00 68.76  ? 373 SER C CB    1 
ATOM   6459  O  OG    . SER C 1 105 ? 58.127  88.304  91.810  1.00 68.76  ? 373 SER C OG    1 
ATOM   6460  N  N     . GLY C 1 106 ? 56.201  86.109  91.318  1.00 69.22  ? 374 GLY C N     1 
ATOM   6461  C  CA    . GLY C 1 106 ? 56.163  84.763  90.780  1.00 69.22  ? 374 GLY C CA    1 
ATOM   6462  C  C     . GLY C 1 106 ? 57.453  83.996  90.935  1.00 69.22  ? 374 GLY C C     1 
ATOM   6463  O  O     . GLY C 1 106 ? 57.446  82.767  90.843  1.00 69.22  ? 374 GLY C O     1 
ATOM   6464  N  N     . SER C 1 107 ? 58.560  84.689  91.173  1.00 70.74  ? 375 SER C N     1 
ATOM   6465  C  CA    . SER C 1 107 ? 59.845  84.047  91.381  1.00 70.74  ? 375 SER C CA    1 
ATOM   6466  C  C     . SER C 1 107 ? 60.233  83.984  92.848  1.00 70.74  ? 375 SER C C     1 
ATOM   6467  O  O     . SER C 1 107 ? 61.418  83.851  93.160  1.00 70.74  ? 375 SER C O     1 
ATOM   6468  C  CB    . SER C 1 107 ? 60.919  84.775  90.583  1.00 70.74  ? 375 SER C CB    1 
ATOM   6469  O  OG    . SER C 1 107 ? 61.045  86.100  91.041  1.00 70.74  ? 375 SER C OG    1 
ATOM   6470  N  N     . GLU C 1 108 ? 59.268  84.089  93.754  1.00 74.12  ? 376 GLU C N     1 
ATOM   6471  C  CA    . GLU C 1 108 ? 59.557  83.953  95.173  1.00 74.12  ? 376 GLU C CA    1 
ATOM   6472  C  C     . GLU C 1 108 ? 59.328  82.546  95.690  1.00 74.12  ? 376 GLU C C     1 
ATOM   6473  O  O     . GLU C 1 108 ? 59.674  82.263  96.840  1.00 74.12  ? 376 GLU C O     1 
ATOM   6474  C  CB    . GLU C 1 108 ? 58.706  84.923  95.996  1.00 74.12  ? 376 GLU C CB    1 
ATOM   6475  C  CG    . GLU C 1 108 ? 59.069  86.374  95.795  1.00 74.12  ? 376 GLU C CG    1 
ATOM   6476  C  CD    . GLU C 1 108 ? 58.279  87.305  96.685  1.00 74.12  ? 376 GLU C CD    1 
ATOM   6477  O  OE1   . GLU C 1 108 ? 57.373  86.826  97.394  1.00 74.12  ? 376 GLU C OE1   1 
ATOM   6478  O  OE2   . GLU C 1 108 ? 58.564  88.520  96.678  1.00 74.12  ? 376 GLU C OE2   1 
ATOM   6479  N  N     . PHE C 1 109 ? 58.767  81.658  94.874  1.00 72.29  ? 377 PHE C N     1 
ATOM   6480  C  CA    . PHE C 1 109 ? 58.392  80.346  95.376  1.00 72.29  ? 377 PHE C CA    1 
ATOM   6481  C  C     . PHE C 1 109 ? 59.593  79.415  95.449  1.00 72.29  ? 377 PHE C C     1 
ATOM   6482  O  O     . PHE C 1 109 ? 59.789  78.718  96.448  1.00 72.29  ? 377 PHE C O     1 
ATOM   6483  C  CB    . PHE C 1 109 ? 57.309  79.744  94.494  1.00 72.29  ? 377 PHE C CB    1 
ATOM   6484  C  CG    . PHE C 1 109 ? 56.090  80.597  94.377  1.00 72.29  ? 377 PHE C CG    1 
ATOM   6485  C  CD1   . PHE C 1 109 ? 55.240  80.761  95.452  1.00 72.29  ? 377 PHE C CD1   1 
ATOM   6486  C  CD2   . PHE C 1 109 ? 55.777  81.210  93.181  1.00 72.29  ? 377 PHE C CD2   1 
ATOM   6487  C  CE1   . PHE C 1 109 ? 54.115  81.542  95.339  1.00 72.29  ? 377 PHE C CE1   1 
ATOM   6488  C  CE2   . PHE C 1 109 ? 54.652  81.980  93.062  1.00 72.29  ? 377 PHE C CE2   1 
ATOM   6489  C  CZ    . PHE C 1 109 ? 53.822  82.147  94.142  1.00 72.29  ? 377 PHE C CZ    1 
ATOM   6490  N  N     . LEU C 1 110 ? 60.408  79.399  94.402  1.00 78.28  ? 378 LEU C N     1 
ATOM   6491  C  CA    . LEU C 1 110 ? 61.526  78.474  94.317  1.00 78.28  ? 378 LEU C CA    1 
ATOM   6492  C  C     . LEU C 1 110 ? 62.672  78.938  95.203  1.00 78.28  ? 378 LEU C C     1 
ATOM   6493  O  O     . LEU C 1 110 ? 63.043  80.114  95.189  1.00 78.28  ? 378 LEU C O     1 
ATOM   6494  C  CB    . LEU C 1 110 ? 61.994  78.367  92.870  1.00 78.28  ? 378 LEU C CB    1 
ATOM   6495  C  CG    . LEU C 1 110 ? 60.940  77.794  91.931  1.00 78.28  ? 378 LEU C CG    1 
ATOM   6496  C  CD1   . LEU C 1 110 ? 61.368  77.933  90.488  1.00 78.28  ? 378 LEU C CD1   1 
ATOM   6497  C  CD2   . LEU C 1 110 ? 60.702  76.345  92.274  1.00 78.28  ? 378 LEU C CD2   1 
ATOM   6498  N  N     . GLU C 1 111 ? 63.231  78.013  95.973  1.00 83.79  ? 379 GLU C N     1 
ATOM   6499  C  CA    . GLU C 1 111 ? 64.450  78.266  96.724  1.00 83.79  ? 379 GLU C CA    1 
ATOM   6500  C  C     . GLU C 1 111 ? 65.289  76.997  96.601  1.00 83.79  ? 379 GLU C C     1 
ATOM   6501  O  O     . GLU C 1 111 ? 65.008  76.130  95.769  1.00 83.79  ? 379 GLU C O     1 
ATOM   6502  C  CB    . GLU C 1 111 ? 64.106  78.700  98.159  1.00 83.79  ? 379 GLU C CB    1 
ATOM   6503  C  CG    . GLU C 1 111 ? 65.193  79.483  98.910  1.00 83.79  ? 379 GLU C CG    1 
ATOM   6504  C  CD    . GLU C 1 111 ? 64.733  79.965  100.261 1.00 83.79  ? 379 GLU C CD    1 
ATOM   6505  O  OE1   . GLU C 1 111 ? 63.568  79.702  100.612 1.00 83.79  ? 379 GLU C OE1   1 
ATOM   6506  O  OE2   . GLU C 1 111 ? 65.531  80.615  100.968 1.00 83.79  ? 379 GLU C OE2   1 
ATOM   6507  N  N     . MET C 1 112 ? 66.322  76.859  97.427  1.00 86.31  ? 380 MET C N     1 
ATOM   6508  C  CA    . MET C 1 112 ? 67.360  75.858  97.221  1.00 86.31  ? 380 MET C CA    1 
ATOM   6509  C  C     . MET C 1 112 ? 67.015  74.504  97.819  1.00 86.31  ? 380 MET C C     1 
ATOM   6510  O  O     . MET C 1 112 ? 67.921  73.744  98.177  1.00 86.31  ? 380 MET C O     1 
ATOM   6511  C  CB    . MET C 1 112 ? 68.687  76.374  97.779  1.00 86.31  ? 380 MET C CB    1 
ATOM   6512  C  CG    . MET C 1 112 ? 68.619  76.793  99.232  1.00 86.31  ? 380 MET C CG    1 
ATOM   6513  S  SD    . MET C 1 112 ? 70.201  77.306  99.912  1.00 86.31  ? 380 MET C SD    1 
ATOM   6514  C  CE    . MET C 1 112 ? 70.986  75.716  100.149 1.00 86.31  ? 380 MET C CE    1 
ATOM   6515  N  N     . PHE C 1 113 ? 65.735  74.172  97.939  1.00 84.66  ? 381 PHE C N     1 
ATOM   6516  C  CA    . PHE C 1 113 ? 65.376  72.863  98.457  1.00 84.66  ? 381 PHE C CA    1 
ATOM   6517  C  C     . PHE C 1 113 ? 64.300  72.217  97.598  1.00 84.66  ? 381 PHE C C     1 
ATOM   6518  O  O     . PHE C 1 113 ? 63.954  72.737  96.535  1.00 84.66  ? 381 PHE C O     1 
ATOM   6519  C  CB    . PHE C 1 113 ? 64.933  72.982  99.908  1.00 84.66  ? 381 PHE C CB    1 
ATOM   6520  C  CG    . PHE C 1 113 ? 66.036  73.387  100.833 1.00 84.66  ? 381 PHE C CG    1 
ATOM   6521  C  CD1   . PHE C 1 113 ? 66.956  72.455  101.275 1.00 84.66  ? 381 PHE C CD1   1 
ATOM   6522  C  CD2   . PHE C 1 113 ? 66.168  74.699  101.243 1.00 84.66  ? 381 PHE C CD2   1 
ATOM   6523  C  CE1   . PHE C 1 113 ? 67.976  72.819  102.123 1.00 84.66  ? 381 PHE C CE1   1 
ATOM   6524  C  CE2   . PHE C 1 113 ? 67.186  75.069  102.093 1.00 84.66  ? 381 PHE C CE2   1 
ATOM   6525  C  CZ    . PHE C 1 113 ? 68.092  74.127  102.530 1.00 84.66  ? 381 PHE C CZ    1 
ATOM   6526  N  N     . VAL C 1 114 ? 63.778  71.080  98.043  1.00 84.67  ? 382 VAL C N     1 
ATOM   6527  C  CA    . VAL C 1 114 ? 62.835  70.286  97.264  1.00 84.67  ? 382 VAL C CA    1 
ATOM   6528  C  C     . VAL C 1 114 ? 61.395  70.577  97.657  1.00 84.67  ? 382 VAL C C     1 
ATOM   6529  O  O     . VAL C 1 114 ? 60.545  70.807  96.797  1.00 84.67  ? 382 VAL C O     1 
ATOM   6530  C  CB    . VAL C 1 114 ? 63.174  68.786  97.404  1.00 84.67  ? 382 VAL C CB    1 
ATOM   6531  C  CG1   . VAL C 1 114 ? 62.081  67.928  96.821  1.00 84.67  ? 382 VAL C CG1   1 
ATOM   6532  C  CG2   . VAL C 1 114 ? 64.456  68.500  96.677  1.00 84.67  ? 382 VAL C CG2   1 
ATOM   6533  N  N     . GLY C 1 115 ? 61.101  70.592  98.955  1.00 83.09  ? 383 GLY C N     1 
ATOM   6534  C  CA    . GLY C 1 115 ? 59.750  70.901  99.387  1.00 83.09  ? 383 GLY C CA    1 
ATOM   6535  C  C     . GLY C 1 115 ? 59.347  72.341  99.151  1.00 83.09  ? 383 GLY C C     1 
ATOM   6536  O  O     . GLY C 1 115 ? 58.179  72.618  98.873  1.00 83.09  ? 383 GLY C O     1 
ATOM   6537  N  N     . VAL C 1 116 ? 60.301  73.268  99.253  1.00 79.48  ? 384 VAL C N     1 
ATOM   6538  C  CA    . VAL C 1 116 ? 60.030  74.681  99.037  1.00 79.48  ? 384 VAL C CA    1 
ATOM   6539  C  C     . VAL C 1 116 ? 59.685  74.901  97.569  1.00 79.48  ? 384 VAL C C     1 
ATOM   6540  O  O     . VAL C 1 116 ? 60.204  74.220  96.677  1.00 79.48  ? 384 VAL C O     1 
ATOM   6541  C  CB    . VAL C 1 116 ? 61.260  75.493  99.478  1.00 79.48  ? 384 VAL C CB    1 
ATOM   6542  C  CG1   . VAL C 1 116 ? 61.009  76.987  99.442  1.00 79.48  ? 384 VAL C CG1   1 
ATOM   6543  C  CG2   . VAL C 1 116 ? 61.689  75.057  100.859 1.00 79.48  ? 384 VAL C CG2   1 
ATOM   6544  N  N     . GLY C 1 117 ? 58.798  75.854  97.305  1.00 76.22  ? 385 GLY C N     1 
ATOM   6545  C  CA    . GLY C 1 117 ? 58.038  75.818  96.087  1.00 76.22  ? 385 GLY C CA    1 
ATOM   6546  C  C     . GLY C 1 117 ? 56.618  75.406  96.402  1.00 76.22  ? 385 GLY C C     1 
ATOM   6547  O  O     . GLY C 1 117 ? 55.763  76.246  96.698  1.00 76.22  ? 385 GLY C O     1 
ATOM   6548  N  N     . PRO C 1 118 ? 56.326  74.108  96.267  1.00 75.38  ? 386 PRO C N     1 
ATOM   6549  C  CA    . PRO C 1 118 ? 54.987  73.606  96.611  1.00 75.38  ? 386 PRO C CA    1 
ATOM   6550  C  C     . PRO C 1 118 ? 54.574  73.850  98.050  1.00 75.38  ? 386 PRO C C     1 
ATOM   6551  O  O     . PRO C 1 118 ? 53.390  74.090  98.303  1.00 75.38  ? 386 PRO C O     1 
ATOM   6552  C  CB    . PRO C 1 118 ? 55.099  72.106  96.320  1.00 75.38  ? 386 PRO C CB    1 
ATOM   6553  C  CG    . PRO C 1 118 ? 56.198  71.999  95.344  1.00 75.38  ? 386 PRO C CG    1 
ATOM   6554  C  CD    . PRO C 1 118 ? 57.182  73.048  95.720  1.00 75.38  ? 386 PRO C CD    1 
ATOM   6555  N  N     . ALA C 1 119 ? 55.506  73.830  98.999  1.00 73.00  ? 387 ALA C N     1 
ATOM   6556  C  CA    . ALA C 1 119 ? 55.184  74.149  100.383 1.00 73.00  ? 387 ALA C CA    1 
ATOM   6557  C  C     . ALA C 1 119 ? 55.110  75.640  100.643 1.00 73.00  ? 387 ALA C C     1 
ATOM   6558  O  O     . ALA C 1 119 ? 54.915  76.040  101.793 1.00 73.00  ? 387 ALA C O     1 
ATOM   6559  C  CB    . ALA C 1 119 ? 56.210  73.533  101.332 1.00 73.00  ? 387 ALA C CB    1 
ATOM   6560  N  N     . ARG C 1 120 ? 55.278  76.463  99.620  1.00 76.79  ? 388 ARG C N     1 
ATOM   6561  C  CA    . ARG C 1 120 ? 55.148  77.902  99.742  1.00 76.79  ? 388 ARG C CA    1 
ATOM   6562  C  C     . ARG C 1 120 ? 53.901  78.437  99.053  1.00 76.79  ? 388 ARG C C     1 
ATOM   6563  O  O     . ARG C 1 120 ? 53.353  79.450  99.488  1.00 76.79  ? 388 ARG C O     1 
ATOM   6564  C  CB    . ARG C 1 120 ? 56.410  78.573  99.181  1.00 76.79  ? 388 ARG C CB    1 
ATOM   6565  C  CG    . ARG C 1 120 ? 56.505  80.060  99.387  1.00 76.79  ? 388 ARG C CG    1 
ATOM   6566  C  CD    . ARG C 1 120 ? 57.882  80.595  99.058  1.00 76.79  ? 388 ARG C CD    1 
ATOM   6567  N  NE    . ARG C 1 120 ? 58.872  80.224  100.061 1.00 76.79  ? 388 ARG C NE    1 
ATOM   6568  C  CZ    . ARG C 1 120 ? 60.169  80.482  99.953  1.00 76.79  ? 388 ARG C CZ    1 
ATOM   6569  N  NH1   . ARG C 1 120 ? 60.634  81.112  98.889  1.00 76.79  ? 388 ARG C NH1   1 
ATOM   6570  N  NH2   . ARG C 1 120 ? 61.001  80.119  100.911 1.00 76.79  ? 388 ARG C NH2   1 
ATOM   6571  N  N     . VAL C 1 121 ? 53.409  77.752  98.019  1.00 72.93  ? 389 VAL C N     1 
ATOM   6572  C  CA    . VAL C 1 121 ? 52.109  78.101  97.457  1.00 72.93  ? 389 VAL C CA    1 
ATOM   6573  C  C     . VAL C 1 121 ? 50.992  77.684  98.408  1.00 72.93  ? 389 VAL C C     1 
ATOM   6574  O  O     . VAL C 1 121 ? 49.974  78.378  98.518  1.00 72.93  ? 389 VAL C O     1 
ATOM   6575  C  CB    . VAL C 1 121 ? 51.957  77.466  96.063  1.00 72.93  ? 389 VAL C CB    1 
ATOM   6576  C  CG1   . VAL C 1 121 ? 50.624  77.807  95.435  1.00 72.93  ? 389 VAL C CG1   1 
ATOM   6577  C  CG2   . VAL C 1 121 ? 53.066  77.930  95.165  1.00 72.93  ? 389 VAL C CG2   1 
ATOM   6578  N  N     . ARG C 1 122 ? 51.180  76.581  99.145  1.00 75.64  ? 390 ARG C N     1 
ATOM   6579  C  CA    . ARG C 1 122 ? 50.165  76.110  100.087 1.00 75.64  ? 390 ARG C CA    1 
ATOM   6580  C  C     . ARG C 1 122 ? 49.947  77.082  101.232 1.00 75.64  ? 390 ARG C C     1 
ATOM   6581  O  O     . ARG C 1 122 ? 48.848  77.141  101.791 1.00 75.64  ? 390 ARG C O     1 
ATOM   6582  C  CB    . ARG C 1 122 ? 50.540  74.749  100.669 1.00 75.64  ? 390 ARG C CB    1 
ATOM   6583  C  CG    . ARG C 1 122 ? 50.474  73.620  99.693  1.00 75.64  ? 390 ARG C CG    1 
ATOM   6584  C  CD    . ARG C 1 122 ? 50.455  72.287  100.386 1.00 75.64  ? 390 ARG C CD    1 
ATOM   6585  N  NE    . ARG C 1 122 ? 51.662  72.003  101.151 1.00 75.64  ? 390 ARG C NE    1 
ATOM   6586  C  CZ    . ARG C 1 122 ? 52.744  71.428  100.644 1.00 75.64  ? 390 ARG C CZ    1 
ATOM   6587  N  NH1   . ARG C 1 122 ? 52.780  71.093  99.365  1.00 75.64  ? 390 ARG C NH1   1 
ATOM   6588  N  NH2   . ARG C 1 122 ? 53.791  71.190  101.414 1.00 75.64  ? 390 ARG C NH2   1 
ATOM   6589  N  N     . ASP C 1 123 ? 50.967  77.843  101.597 1.00 74.75  ? 391 ASP C N     1 
ATOM   6590  C  CA    . ASP C 1 123 ? 50.841  78.851  102.630 1.00 74.75  ? 391 ASP C CA    1 
ATOM   6591  C  C     . ASP C 1 123 ? 50.649  80.241  102.058 1.00 74.75  ? 391 ASP C C     1 
ATOM   6592  O  O     . ASP C 1 123 ? 50.470  81.191  102.821 1.00 74.75  ? 391 ASP C O     1 
ATOM   6593  C  CB    . ASP C 1 123 ? 52.062  78.812  103.542 1.00 74.75  ? 391 ASP C CB    1 
ATOM   6594  C  CG    . ASP C 1 123 ? 52.102  77.556  104.383 1.00 74.75  ? 391 ASP C CG    1 
ATOM   6595  O  OD1   . ASP C 1 123 ? 51.016  77.031  104.705 1.00 74.75  ? 391 ASP C OD1   1 
ATOM   6596  O  OD2   . ASP C 1 123 ? 53.207  77.080  104.715 1.00 74.75  ? 391 ASP C OD2   1 
ATOM   6597  N  N     . LEU C 1 124 ? 50.687  80.381  100.735 1.00 72.96  ? 392 LEU C N     1 
ATOM   6598  C  CA    . LEU C 1 124 ? 50.209  81.610  100.120 1.00 72.96  ? 392 LEU C CA    1 
ATOM   6599  C  C     . LEU C 1 124 ? 48.697  81.704  100.212 1.00 72.96  ? 392 LEU C C     1 
ATOM   6600  O  O     . LEU C 1 124 ? 48.151  82.786  100.453 1.00 72.96  ? 392 LEU C O     1 
ATOM   6601  C  CB    . LEU C 1 124 ? 50.657  81.684  98.665  1.00 72.96  ? 392 LEU C CB    1 
ATOM   6602  C  CG    . LEU C 1 124 ? 50.176  82.895  97.868  1.00 72.96  ? 392 LEU C CG    1 
ATOM   6603  C  CD1   . LEU C 1 124 ? 50.673  84.180  98.483  1.00 72.96  ? 392 LEU C CD1   1 
ATOM   6604  C  CD2   . LEU C 1 124 ? 50.618  82.794  96.430  1.00 72.96  ? 392 LEU C CD2   1 
ATOM   6605  N  N     . PHE C 1 125 ? 48.002  80.581  100.049 1.00 66.50  ? 393 PHE C N     1 
ATOM   6606  C  CA    . PHE C 1 125 ? 46.548  80.621  100.030 1.00 66.50  ? 393 PHE C CA    1 
ATOM   6607  C  C     . PHE C 1 125 ? 45.941  80.334  101.390 1.00 66.50  ? 393 PHE C C     1 
ATOM   6608  O  O     . PHE C 1 125 ? 44.811  80.759  101.646 1.00 66.50  ? 393 PHE C O     1 
ATOM   6609  C  CB    . PHE C 1 125 ? 45.965  79.632  99.015  1.00 66.50  ? 393 PHE C CB    1 
ATOM   6610  C  CG    . PHE C 1 125 ? 46.216  79.986  97.566  1.00 66.50  ? 393 PHE C CG    1 
ATOM   6611  C  CD1   . PHE C 1 125 ? 46.881  81.133  97.179  1.00 66.50  ? 393 PHE C CD1   1 
ATOM   6612  C  CD2   . PHE C 1 125 ? 45.710  79.181  96.585  1.00 66.50  ? 393 PHE C CD2   1 
ATOM   6613  C  CE1   . PHE C 1 125 ? 47.089  81.411  95.846  1.00 66.50  ? 393 PHE C CE1   1 
ATOM   6614  C  CE2   . PHE C 1 125 ? 45.904  79.461  95.257  1.00 66.50  ? 393 PHE C CE2   1 
ATOM   6615  C  CZ    . PHE C 1 125 ? 46.587  80.578  94.888  1.00 66.50  ? 393 PHE C CZ    1 
ATOM   6616  N  N     . ALA C 1 126 ? 46.651  79.613  102.259 1.00 71.13  ? 394 ALA C N     1 
ATOM   6617  C  CA    . ALA C 1 126 ? 46.205  79.482  103.640 1.00 71.13  ? 394 ALA C CA    1 
ATOM   6618  C  C     . ALA C 1 126 ? 46.251  80.821  104.357 1.00 71.13  ? 394 ALA C C     1 
ATOM   6619  O  O     . ALA C 1 126 ? 45.450  81.067  105.263 1.00 71.13  ? 394 ALA C O     1 
ATOM   6620  C  CB    . ALA C 1 126 ? 47.057  78.456  104.381 1.00 71.13  ? 394 ALA C CB    1 
ATOM   6621  N  N     . LEU C 1 127 ? 47.186  81.688  103.973 1.00 70.72  ? 395 LEU C N     1 
ATOM   6622  C  CA    . LEU C 1 127 ? 47.113  83.079  104.393 1.00 70.72  ? 395 LEU C CA    1 
ATOM   6623  C  C     . LEU C 1 127 ? 45.954  83.791  103.712 1.00 70.72  ? 395 LEU C C     1 
ATOM   6624  O  O     . LEU C 1 127 ? 45.260  84.601  104.336 1.00 70.72  ? 395 LEU C O     1 
ATOM   6625  C  CB    . LEU C 1 127 ? 48.428  83.789  104.086 1.00 70.72  ? 395 LEU C CB    1 
ATOM   6626  C  CG    . LEU C 1 127 ? 48.490  85.259  104.488 1.00 70.72  ? 395 LEU C CG    1 
ATOM   6627  C  CD1   . LEU C 1 127 ? 48.371  85.403  105.992 1.00 70.72  ? 395 LEU C CD1   1 
ATOM   6628  C  CD2   . LEU C 1 127 ? 49.761  85.896  103.980 1.00 70.72  ? 395 LEU C CD2   1 
ATOM   6629  N  N     . ALA C 1 128 ? 45.708  83.483  102.441 1.00 70.40  ? 396 ALA C N     1 
ATOM   6630  C  CA    . ALA C 1 128 ? 44.630  84.120  101.699 1.00 70.40  ? 396 ALA C CA    1 
ATOM   6631  C  C     . ALA C 1 128 ? 43.258  83.538  102.004 1.00 70.40  ? 396 ALA C C     1 
ATOM   6632  O  O     . ALA C 1 128 ? 42.277  83.973  101.400 1.00 70.40  ? 396 ALA C O     1 
ATOM   6633  C  CB    . ALA C 1 128 ? 44.896  84.027  100.201 1.00 70.40  ? 396 ALA C CB    1 
ATOM   6634  N  N     . ARG C 1 129 ? 43.162  82.548  102.888 1.00 73.05  ? 397 ARG C N     1 
ATOM   6635  C  CA    . ARG C 1 129 ? 41.877  82.109  103.407 1.00 73.05  ? 397 ARG C CA    1 
ATOM   6636  C  C     . ARG C 1 129 ? 41.585  82.662  104.790 1.00 73.05  ? 397 ARG C C     1 
ATOM   6637  O  O     . ARG C 1 129 ? 40.417  82.714  105.185 1.00 73.05  ? 397 ARG C O     1 
ATOM   6638  C  CB    . ARG C 1 129 ? 41.802  80.580  103.455 1.00 73.05  ? 397 ARG C CB    1 
ATOM   6639  C  CG    . ARG C 1 129 ? 41.671  79.925  102.097 1.00 73.05  ? 397 ARG C CG    1 
ATOM   6640  C  CD    . ARG C 1 129 ? 41.328  78.451  102.210 1.00 73.05  ? 397 ARG C CD    1 
ATOM   6641  N  NE    . ARG C 1 129 ? 42.422  77.652  102.748 1.00 73.05  ? 397 ARG C NE    1 
ATOM   6642  C  CZ    . ARG C 1 129 ? 43.336  77.047  101.998 1.00 73.05  ? 397 ARG C CZ    1 
ATOM   6643  N  NH1   . ARG C 1 129 ? 43.282  77.147  100.678 1.00 73.05  ? 397 ARG C NH1   1 
ATOM   6644  N  NH2   . ARG C 1 129 ? 44.298  76.335  102.568 1.00 73.05  ? 397 ARG C NH2   1 
ATOM   6645  N  N     . LYS C 1 130 ? 42.619  83.051  105.537 1.00 72.82  ? 398 LYS C N     1 
ATOM   6646  C  CA    . LYS C 1 130 ? 42.397  83.774  106.781 1.00 72.82  ? 398 LYS C CA    1 
ATOM   6647  C  C     . LYS C 1 130 ? 41.814  85.148  106.504 1.00 72.82  ? 398 LYS C C     1 
ATOM   6648  O  O     . LYS C 1 130 ? 40.996  85.651  107.280 1.00 72.82  ? 398 LYS C O     1 
ATOM   6649  C  CB    . LYS C 1 130 ? 43.702  83.890  107.559 1.00 72.82  ? 398 LYS C CB    1 
ATOM   6650  C  CG    . LYS C 1 130 ? 44.212  82.570  108.095 1.00 72.82  ? 398 LYS C CG    1 
ATOM   6651  C  CD    . LYS C 1 130 ? 45.486  82.762  108.893 1.00 72.82  ? 398 LYS C CD    1 
ATOM   6652  C  CE    . LYS C 1 130 ? 46.009  81.439  109.419 1.00 72.82  ? 398 LYS C CE    1 
ATOM   6653  N  NZ    . LYS C 1 130 ? 47.271  81.609  110.193 1.00 72.82  ? 398 LYS C NZ    1 
ATOM   6654  N  N     . ASN C 1 131 ? 42.226  85.767  105.405 1.00 75.11  ? 399 ASN C N     1 
ATOM   6655  C  CA    . ASN C 1 131 ? 41.570  86.963  104.888 1.00 75.11  ? 399 ASN C CA    1 
ATOM   6656  C  C     . ASN C 1 131 ? 40.547  86.480  103.869 1.00 75.11  ? 399 ASN C C     1 
ATOM   6657  O  O     . ASN C 1 131 ? 40.892  86.180  102.728 1.00 75.11  ? 399 ASN C O     1 
ATOM   6658  C  CB    . ASN C 1 131 ? 42.591  87.905  104.265 1.00 75.11  ? 399 ASN C CB    1 
ATOM   6659  C  CG    . ASN C 1 131 ? 43.623  88.379  105.258 1.00 75.11  ? 399 ASN C CG    1 
ATOM   6660  O  OD1   . ASN C 1 131 ? 43.309  88.661  106.412 1.00 75.11  ? 399 ASN C OD1   1 
ATOM   6661  N  ND2   . ASN C 1 131 ? 44.867  88.469  104.814 1.00 75.11  ? 399 ASN C ND2   1 
ATOM   6662  N  N     . ALA C 1 132 ? 39.279  86.395  104.281 1.00 76.81  ? 400 ALA C N     1 
ATOM   6663  C  CA    . ALA C 1 132 ? 38.315  85.623  103.495 1.00 76.81  ? 400 ALA C CA    1 
ATOM   6664  C  C     . ALA C 1 132 ? 37.887  86.297  102.190 1.00 76.81  ? 400 ALA C C     1 
ATOM   6665  O  O     . ALA C 1 132 ? 37.888  85.611  101.155 1.00 76.81  ? 400 ALA C O     1 
ATOM   6666  C  CB    . ALA C 1 132 ? 37.121  85.229  104.374 1.00 76.81  ? 400 ALA C CB    1 
ATOM   6667  N  N     . PRO C 1 133 ? 37.514  87.605  102.133 1.00 76.18  ? 401 PRO C N     1 
ATOM   6668  C  CA    . PRO C 1 133 ? 37.152  88.150  100.817 1.00 76.18  ? 401 PRO C CA    1 
ATOM   6669  C  C     . PRO C 1 133 ? 38.325  88.704  100.018 1.00 76.18  ? 401 PRO C C     1 
ATOM   6670  O  O     . PRO C 1 133 ? 38.102  89.518  99.119  1.00 76.18  ? 401 PRO C O     1 
ATOM   6671  C  CB    . PRO C 1 133 ? 36.156  89.258  101.163 1.00 76.18  ? 401 PRO C CB    1 
ATOM   6672  C  CG    . PRO C 1 133 ? 36.631  89.757  102.429 1.00 76.18  ? 401 PRO C CG    1 
ATOM   6673  C  CD    . PRO C 1 133 ? 37.152  88.580  103.187 1.00 76.18  ? 401 PRO C CD    1 
ATOM   6674  N  N     . CYS C 1 134 ? 39.557  88.303  100.333 1.00 72.92  ? 402 CYS C N     1 
ATOM   6675  C  CA    . CYS C 1 134 ? 40.747  89.021  99.887  1.00 72.92  ? 402 CYS C CA    1 
ATOM   6676  C  C     . CYS C 1 134 ? 40.994  88.877  98.384  1.00 72.92  ? 402 CYS C C     1 
ATOM   6677  O  O     . CYS C 1 134 ? 40.367  88.081  97.685  1.00 72.92  ? 402 CYS C O     1 
ATOM   6678  C  CB    . CYS C 1 134 ? 41.985  88.526  100.619 1.00 72.92  ? 402 CYS C CB    1 
ATOM   6679  S  SG    . CYS C 1 134 ? 42.534  86.924  100.055 1.00 72.92  ? 402 CYS C SG    1 
ATOM   6680  N  N     . ILE C 1 135 ? 41.925  89.695  97.899  1.00 70.85  ? 403 ILE C N     1 
ATOM   6681  C  CA    . ILE C 1 135 ? 42.430  89.661  96.532  1.00 70.85  ? 403 ILE C CA    1 
ATOM   6682  C  C     . ILE C 1 135 ? 43.939  89.514  96.620  1.00 70.85  ? 403 ILE C C     1 
ATOM   6683  O  O     . ILE C 1 135 ? 44.589  90.259  97.359  1.00 70.85  ? 403 ILE C O     1 
ATOM   6684  C  CB    . ILE C 1 135 ? 42.074  90.939  95.751  1.00 70.85  ? 403 ILE C CB    1 
ATOM   6685  C  CG1   . ILE C 1 135 ? 40.568  91.145  95.680  1.00 70.85  ? 403 ILE C CG1   1 
ATOM   6686  C  CG2   . ILE C 1 135 ? 42.617  90.885  94.345  1.00 70.85  ? 403 ILE C CG2   1 
ATOM   6687  C  CD1   . ILE C 1 135 ? 40.184  92.494  95.123  1.00 70.85  ? 403 ILE C CD1   1 
ATOM   6688  N  N     . LEU C 1 136 ? 44.502  88.570  95.876  1.00 67.13  ? 404 LEU C N     1 
ATOM   6689  C  CA    . LEU C 1 136 ? 45.942  88.385  95.878  1.00 67.13  ? 404 LEU C CA    1 
ATOM   6690  C  C     . LEU C 1 136 ? 46.492  88.624  94.482  1.00 67.13  ? 404 LEU C C     1 
ATOM   6691  O  O     . LEU C 1 136 ? 45.836  88.331  93.481  1.00 67.13  ? 404 LEU C O     1 
ATOM   6692  C  CB    . LEU C 1 136 ? 46.318  86.993  96.384  1.00 67.13  ? 404 LEU C CB    1 
ATOM   6693  C  CG    . LEU C 1 136 ? 46.091  85.687  95.645  1.00 67.13  ? 404 LEU C CG    1 
ATOM   6694  C  CD1   . LEU C 1 136 ? 47.336  85.277  94.897  1.00 67.13  ? 404 LEU C CD1   1 
ATOM   6695  C  CD2   . LEU C 1 136 ? 45.716  84.640  96.646  1.00 67.13  ? 404 LEU C CD2   1 
ATOM   6696  N  N     . PHE C 1 137 ? 47.702  89.167  94.421  1.00 66.74  ? 405 PHE C N     1 
ATOM   6697  C  CA    . PHE C 1 137 ? 48.318  89.542  93.159  1.00 66.74  ? 405 PHE C CA    1 
ATOM   6698  C  C     . PHE C 1 137 ? 49.657  88.840  93.017  1.00 66.74  ? 405 PHE C C     1 
ATOM   6699  O  O     . PHE C 1 137 ? 50.557  89.038  93.838  1.00 66.74  ? 405 PHE C O     1 
ATOM   6700  C  CB    . PHE C 1 137 ? 48.495  91.051  93.064  1.00 66.74  ? 405 PHE C CB    1 
ATOM   6701  C  CG    . PHE C 1 137 ? 49.115  91.493  91.785  1.00 66.74  ? 405 PHE C CG    1 
ATOM   6702  C  CD1   . PHE C 1 137 ? 48.408  91.417  90.604  1.00 66.74  ? 405 PHE C CD1   1 
ATOM   6703  C  CD2   . PHE C 1 137 ? 50.396  91.993  91.760  1.00 66.74  ? 405 PHE C CD2   1 
ATOM   6704  C  CE1   . PHE C 1 137 ? 48.975  91.822  89.417  1.00 66.74  ? 405 PHE C CE1   1 
ATOM   6705  C  CE2   . PHE C 1 137 ? 50.957  92.405  90.581  1.00 66.74  ? 405 PHE C CE2   1 
ATOM   6706  C  CZ    . PHE C 1 137 ? 50.250  92.313  89.408  1.00 66.74  ? 405 PHE C CZ    1 
ATOM   6707  N  N     . ILE C 1 138 ? 49.787  88.034  91.971  1.00 66.92  ? 406 ILE C N     1 
ATOM   6708  C  CA    . ILE C 1 138 ? 51.021  87.329  91.652  1.00 66.92  ? 406 ILE C CA    1 
ATOM   6709  C  C     . ILE C 1 138 ? 51.673  88.066  90.494  1.00 66.92  ? 406 ILE C C     1 
ATOM   6710  O  O     . ILE C 1 138 ? 51.163  88.049  89.371  1.00 66.92  ? 406 ILE C O     1 
ATOM   6711  C  CB    . ILE C 1 138 ? 50.759  85.864  91.289  1.00 66.92  ? 406 ILE C CB    1 
ATOM   6712  C  CG1   . ILE C 1 138 ? 50.166  85.118  92.472  1.00 66.92  ? 406 ILE C CG1   1 
ATOM   6713  C  CG2   . ILE C 1 138 ? 52.033  85.193  90.864  1.00 66.92  ? 406 ILE C CG2   1 
ATOM   6714  C  CD1   . ILE C 1 138 ? 49.639  83.766  92.117  1.00 66.92  ? 406 ILE C CD1   1 
ATOM   6715  N  N     . ASP C 1 139 ? 52.798  88.715  90.747  1.00 70.07  ? 407 ASP C N     1 
ATOM   6716  C  CA    . ASP C 1 139 ? 53.464  89.487  89.713  1.00 70.07  ? 407 ASP C CA    1 
ATOM   6717  C  C     . ASP C 1 139 ? 54.550  88.633  89.081  1.00 70.07  ? 407 ASP C C     1 
ATOM   6718  O  O     . ASP C 1 139 ? 55.256  87.904  89.785  1.00 70.07  ? 407 ASP C O     1 
ATOM   6719  C  CB    . ASP C 1 139 ? 54.064  90.768  90.283  1.00 70.07  ? 407 ASP C CB    1 
ATOM   6720  C  CG    . ASP C 1 139 ? 54.285  91.822  89.225  1.00 70.07  ? 407 ASP C CG    1 
ATOM   6721  O  OD1   . ASP C 1 139 ? 54.021  91.541  88.040  1.00 70.07  ? 407 ASP C OD1   1 
ATOM   6722  O  OD2   . ASP C 1 139 ? 54.703  92.943  89.579  1.00 70.07  ? 407 ASP C OD2   1 
ATOM   6723  N  N     . GLN C 1 140 ? 54.670  88.740  87.755  1.00 68.53  ? 408 GLN C N     1 
ATOM   6724  C  CA    . GLN C 1 140 ? 55.574  87.942  86.925  1.00 68.53  ? 408 GLN C CA    1 
ATOM   6725  C  C     . GLN C 1 140 ? 55.331  86.447  87.139  1.00 68.53  ? 408 GLN C C     1 
ATOM   6726  O  O     . GLN C 1 140 ? 56.185  85.711  87.630  1.00 68.53  ? 408 GLN C O     1 
ATOM   6727  C  CB    . GLN C 1 140 ? 57.039  88.316  87.170  1.00 68.53  ? 408 GLN C CB    1 
ATOM   6728  C  CG    . GLN C 1 140 ? 57.398  89.749  86.811  1.00 68.53  ? 408 GLN C CG    1 
ATOM   6729  C  CD    . GLN C 1 140 ? 57.319  90.028  85.332  1.00 68.53  ? 408 GLN C CD    1 
ATOM   6730  O  OE1   . GLN C 1 140 ? 57.653  89.177  84.511  1.00 68.53  ? 408 GLN C OE1   1 
ATOM   6731  N  NE2   . GLN C 1 140 ? 56.891  91.229  84.980  1.00 68.53  ? 408 GLN C NE2   1 
ATOM   6732  N  N     . ILE C 1 141 ? 54.130  86.010  86.749  1.00 69.51  ? 409 ILE C N     1 
ATOM   6733  C  CA    . ILE C 1 141 ? 53.700  84.639  87.001  1.00 69.51  ? 409 ILE C CA    1 
ATOM   6734  C  C     . ILE C 1 141 ? 54.423  83.646  86.095  1.00 69.51  ? 409 ILE C C     1 
ATOM   6735  O  O     . ILE C 1 141 ? 54.465  82.447  86.395  1.00 69.51  ? 409 ILE C O     1 
ATOM   6736  C  CB    . ILE C 1 141 ? 52.167  84.547  86.852  1.00 69.51  ? 409 ILE C CB    1 
ATOM   6737  C  CG1   . ILE C 1 141 ? 51.615  83.279  87.507  1.00 69.51  ? 409 ILE C CG1   1 
ATOM   6738  C  CG2   . ILE C 1 141 ? 51.760  84.617  85.394  1.00 69.51  ? 409 ILE C CG2   1 
ATOM   6739  C  CD1   . ILE C 1 141 ? 50.126  83.257  87.643  1.00 69.51  ? 409 ILE C CD1   1 
ATOM   6740  N  N     . ASP C 1 142 ? 55.071  84.116  85.028  1.00 73.02  ? 410 ASP C N     1 
ATOM   6741  C  CA    . ASP C 1 142 ? 55.831  83.267  84.110  1.00 73.02  ? 410 ASP C CA    1 
ATOM   6742  C  C     . ASP C 1 142 ? 57.130  82.722  84.699  1.00 73.02  ? 410 ASP C C     1 
ATOM   6743  O  O     . ASP C 1 142 ? 57.887  82.106  83.955  1.00 73.02  ? 410 ASP C O     1 
ATOM   6744  C  CB    . ASP C 1 142 ? 56.113  84.042  82.825  1.00 73.02  ? 410 ASP C CB    1 
ATOM   6745  C  CG    . ASP C 1 142 ? 56.756  85.386  83.081  1.00 73.02  ? 410 ASP C CG    1 
ATOM   6746  O  OD1   . ASP C 1 142 ? 56.933  85.756  84.258  1.00 73.02  ? 410 ASP C OD1   1 
ATOM   6747  O  OD2   . ASP C 1 142 ? 57.066  86.091  82.102  1.00 73.02  ? 410 ASP C OD2   1 
ATOM   6748  N  N     . ALA C 1 143 ? 57.406  82.938  85.982  1.00 70.22  ? 411 ALA C N     1 
ATOM   6749  C  CA    . ALA C 1 143 ? 58.539  82.311  86.638  1.00 70.22  ? 411 ALA C CA    1 
ATOM   6750  C  C     . ALA C 1 143 ? 58.195  80.919  87.152  1.00 70.22  ? 411 ALA C C     1 
ATOM   6751  O  O     . ALA C 1 143 ? 59.068  80.048  87.199  1.00 70.22  ? 411 ALA C O     1 
ATOM   6752  C  CB    . ALA C 1 143 ? 59.018  83.198  87.782  1.00 70.22  ? 411 ALA C CB    1 
ATOM   6753  N  N     . VAL C 1 144 ? 56.943  80.694  87.549  1.00 72.97  ? 412 VAL C N     1 
ATOM   6754  C  CA    . VAL C 1 144 ? 56.463  79.381  87.952  1.00 72.97  ? 412 VAL C CA    1 
ATOM   6755  C  C     . VAL C 1 144 ? 55.306  78.911  87.092  1.00 72.97  ? 412 VAL C C     1 
ATOM   6756  O  O     . VAL C 1 144 ? 54.728  77.862  87.360  1.00 72.97  ? 412 VAL C O     1 
ATOM   6757  C  CB    . VAL C 1 144 ? 56.066  79.350  89.439  1.00 72.97  ? 412 VAL C CB    1 
ATOM   6758  C  CG1   . VAL C 1 144 ? 57.281  79.528  90.315  1.00 72.97  ? 412 VAL C CG1   1 
ATOM   6759  C  CG2   . VAL C 1 144 ? 55.038  80.418  89.716  1.00 72.97  ? 412 VAL C CG2   1 
ATOM   6760  N  N     . GLY C 1 145 ? 54.958  79.663  86.060  1.00 73.79  ? 413 GLY C N     1 
ATOM   6761  C  CA    . GLY C 1 145 ? 53.892  79.287  85.164  1.00 73.79  ? 413 GLY C CA    1 
ATOM   6762  C  C     . GLY C 1 145 ? 54.341  78.603  83.897  1.00 73.79  ? 413 GLY C C     1 
ATOM   6763  O  O     . GLY C 1 145 ? 53.531  78.458  82.978  1.00 73.79  ? 413 GLY C O     1 
ATOM   6764  N  N     . ARG C 1 146 ? 55.596  78.171  83.820  1.00 80.37  ? 414 ARG C N     1 
ATOM   6765  C  CA    . ARG C 1 146 ? 56.147  77.613  82.593  1.00 80.37  ? 414 ARG C CA    1 
ATOM   6766  C  C     . ARG C 1 146 ? 55.517  76.261  82.274  1.00 80.37  ? 414 ARG C C     1 
ATOM   6767  O  O     . ARG C 1 146 ? 55.205  75.479  83.175  1.00 80.37  ? 414 ARG C O     1 
ATOM   6768  C  CB    . ARG C 1 146 ? 57.663  77.479  82.726  1.00 80.37  ? 414 ARG C CB    1 
ATOM   6769  C  CG    . ARG C 1 146 ? 58.394  77.128  81.444  1.00 80.37  ? 414 ARG C CG    1 
ATOM   6770  C  CD    . ARG C 1 146 ? 59.889  77.073  81.673  1.00 80.37  ? 414 ARG C CD    1 
ATOM   6771  N  NE    . ARG C 1 146 ? 60.419  78.378  82.052  1.00 80.37  ? 414 ARG C NE    1 
ATOM   6772  C  CZ    . ARG C 1 146 ? 60.786  79.317  81.186  1.00 80.37  ? 414 ARG C CZ    1 
ATOM   6773  N  NH1   . ARG C 1 146 ? 60.688  79.099  79.881  1.00 80.37  ? 414 ARG C NH1   1 
ATOM   6774  N  NH2   . ARG C 1 146 ? 61.253  80.475  81.627  1.00 80.37  ? 414 ARG C NH2   1 
ATOM   6775  N  N     . LYS C 1 147 ? 55.313  76.008  80.981  1.00 81.61  ? 415 LYS C N     1 
ATOM   6776  C  CA    . LYS C 1 147 ? 54.654  74.796  80.515  1.00 81.61  ? 415 LYS C CA    1 
ATOM   6777  C  C     . LYS C 1 147 ? 55.476  73.557  80.845  1.00 81.61  ? 415 LYS C C     1 
ATOM   6778  O  O     . LYS C 1 147 ? 56.700  73.545  80.695  1.00 81.61  ? 415 LYS C O     1 
ATOM   6779  C  CB    . LYS C 1 147 ? 54.415  74.886  79.010  1.00 81.61  ? 415 LYS C CB    1 
ATOM   6780  C  CG    . LYS C 1 147 ? 53.656  73.726  78.422  1.00 81.61  ? 415 LYS C CG    1 
ATOM   6781  C  CD    . LYS C 1 147 ? 53.357  73.948  76.960  1.00 81.61  ? 415 LYS C CD    1 
ATOM   6782  C  CE    . LYS C 1 147 ? 52.601  72.769  76.385  1.00 81.61  ? 415 LYS C CE    1 
ATOM   6783  N  NZ    . LYS C 1 147 ? 52.288  72.963  74.944  1.00 81.61  ? 415 LYS C NZ    1 
ATOM   6784  N  N     . ARG C 1 148 ? 54.791  72.516  81.309  1.00 86.93  ? 416 ARG C N     1 
ATOM   6785  C  CA    . ARG C 1 148 ? 55.460  71.318  81.793  1.00 86.93  ? 416 ARG C CA    1 
ATOM   6786  C  C     . ARG C 1 148 ? 55.996  70.490  80.632  1.00 86.93  ? 416 ARG C C     1 
ATOM   6787  O  O     . ARG C 1 148 ? 55.267  70.181  79.686  1.00 86.93  ? 416 ARG C O     1 
ATOM   6788  C  CB    . ARG C 1 148 ? 54.488  70.489  82.621  1.00 86.93  ? 416 ARG C CB    1 
ATOM   6789  C  CG    . ARG C 1 148 ? 53.989  71.185  83.862  1.00 86.93  ? 416 ARG C CG    1 
ATOM   6790  C  CD    . ARG C 1 148 ? 53.187  70.232  84.718  1.00 86.93  ? 416 ARG C CD    1 
ATOM   6791  N  NE    . ARG C 1 148 ? 52.019  69.728  84.005  1.00 86.93  ? 416 ARG C NE    1 
ATOM   6792  C  CZ    . ARG C 1 148 ? 50.845  70.341  83.979  1.00 86.93  ? 416 ARG C CZ    1 
ATOM   6793  N  NH1   . ARG C 1 148 ? 50.696  71.484  84.618  1.00 86.93  ? 416 ARG C NH1   1 
ATOM   6794  N  NH2   . ARG C 1 148 ? 49.829  69.826  83.308  1.00 86.93  ? 416 ARG C NH2   1 
ATOM   6795  N  N     . GLY C 1 149 ? 57.277  70.128  80.706  1.00 100.95 ? 417 GLY C N     1 
ATOM   6796  C  CA    . GLY C 1 149 ? 57.902  69.290  79.709  1.00 100.95 ? 417 GLY C CA    1 
ATOM   6797  C  C     . GLY C 1 149 ? 57.965  67.833  80.146  1.00 100.95 ? 417 GLY C C     1 
ATOM   6798  O  O     . GLY C 1 149 ? 57.480  67.445  81.205  1.00 100.95 ? 417 GLY C O     1 
ATOM   6799  N  N     . ARG C 1 150 ? 58.590  67.020  79.297  1.00 115.71 ? 418 ARG C N     1 
ATOM   6800  C  CA    . ARG C 1 150 ? 58.703  65.586  79.534  1.00 115.71 ? 418 ARG C CA    1 
ATOM   6801  C  C     . ARG C 1 150 ? 59.852  65.306  80.505  1.00 115.71 ? 418 ARG C C     1 
ATOM   6802  O  O     . ARG C 1 150 ? 60.365  66.207  81.175  1.00 115.71 ? 418 ARG C O     1 
ATOM   6803  C  CB    . ARG C 1 150 ? 58.880  64.845  78.212  1.00 115.71 ? 418 ARG C CB    1 
ATOM   6804  C  CG    . ARG C 1 150 ? 57.674  64.926  77.292  1.00 115.71 ? 418 ARG C CG    1 
ATOM   6805  C  CD    . ARG C 1 150 ? 57.924  64.188  75.986  1.00 115.71 ? 418 ARG C CD    1 
ATOM   6806  N  NE    . ARG C 1 150 ? 58.954  64.838  75.179  1.00 115.71 ? 418 ARG C NE    1 
ATOM   6807  C  CZ    . ARG C 1 150 ? 59.457  64.332  74.058  1.00 115.71 ? 418 ARG C CZ    1 
ATOM   6808  N  NH1   . ARG C 1 150 ? 59.027  63.163  73.602  1.00 115.71 ? 418 ARG C NH1   1 
ATOM   6809  N  NH2   . ARG C 1 150 ? 60.392  64.994  73.391  1.00 115.71 ? 418 ARG C NH2   1 
ATOM   6810  N  N     . GLY C 1 151 ? 60.251  64.035  80.608  1.00 122.91 ? 419 GLY C N     1 
ATOM   6811  C  CA    . GLY C 1 151 ? 61.379  63.647  81.438  1.00 122.91 ? 419 GLY C CA    1 
ATOM   6812  C  C     . GLY C 1 151 ? 62.673  64.242  80.928  1.00 122.91 ? 419 GLY C C     1 
ATOM   6813  O  O     . GLY C 1 151 ? 63.220  63.803  79.912  1.00 122.91 ? 419 GLY C O     1 
ATOM   6814  N  N     . ASN C 1 152 ? 63.173  65.243  81.641  1.00 121.63 ? 420 ASN C N     1 
ATOM   6815  C  CA    . ASN C 1 152 ? 64.150  66.183  81.103  1.00 121.63 ? 420 ASN C CA    1 
ATOM   6816  C  C     . ASN C 1 152 ? 65.053  66.649  82.239  1.00 121.63 ? 420 ASN C C     1 
ATOM   6817  O  O     . ASN C 1 152 ? 65.236  65.933  83.230  1.00 121.63 ? 420 ASN C O     1 
ATOM   6818  C  CB    . ASN C 1 152 ? 63.450  67.356  80.390  1.00 121.63 ? 420 ASN C CB    1 
ATOM   6819  C  CG    . ASN C 1 152 ? 62.882  66.969  79.036  1.00 121.63 ? 420 ASN C CG    1 
ATOM   6820  O  OD1   . ASN C 1 152 ? 63.521  66.256  78.263  1.00 121.63 ? 420 ASN C OD1   1 
ATOM   6821  N  ND2   . ASN C 1 152 ? 61.676  67.442  78.743  1.00 121.63 ? 420 ASN C ND2   1 
ATOM   6822  N  N     . PHE C 1 153 ? 65.672  67.817  82.030  1.00 116.20 ? 421 PHE C N     1 
ATOM   6823  C  CA    . PHE C 1 153 ? 66.598  68.469  82.956  1.00 116.20 ? 421 PHE C CA    1 
ATOM   6824  C  C     . PHE C 1 153 ? 66.075  68.523  84.391  1.00 116.20 ? 421 PHE C C     1 
ATOM   6825  O  O     . PHE C 1 153 ? 64.879  68.704  84.631  1.00 116.20 ? 421 PHE C O     1 
ATOM   6826  C  CB    . PHE C 1 153 ? 66.869  69.883  82.433  1.00 116.20 ? 421 PHE C CB    1 
ATOM   6827  C  CG    . PHE C 1 153 ? 67.813  70.681  83.271  1.00 116.20 ? 421 PHE C CG    1 
ATOM   6828  C  CD1   . PHE C 1 153 ? 69.170  70.405  83.263  1.00 116.20 ? 421 PHE C CD1   1 
ATOM   6829  C  CD2   . PHE C 1 153 ? 67.347  71.734  84.041  1.00 116.20 ? 421 PHE C CD2   1 
ATOM   6830  C  CE1   . PHE C 1 153 ? 70.042  71.150  84.028  1.00 116.20 ? 421 PHE C CE1   1 
ATOM   6831  C  CE2   . PHE C 1 153 ? 68.214  72.484  84.809  1.00 116.20 ? 421 PHE C CE2   1 
ATOM   6832  C  CZ    . PHE C 1 153 ? 69.563  72.193  84.802  1.00 116.20 ? 421 PHE C CZ    1 
ATOM   6833  N  N     . GLY C 1 154 ? 66.997  68.353  85.345  1.00 115.26 ? 422 GLY C N     1 
ATOM   6834  C  CA    . GLY C 1 154 ? 66.608  68.130  86.729  1.00 115.26 ? 422 GLY C CA    1 
ATOM   6835  C  C     . GLY C 1 154 ? 66.084  69.363  87.439  1.00 115.26 ? 422 GLY C C     1 
ATOM   6836  O  O     . GLY C 1 154 ? 65.317  69.247  88.399  1.00 115.26 ? 422 GLY C O     1 
ATOM   6837  N  N     . GLY C 1 155 ? 66.490  70.550  86.995  1.00 108.99 ? 423 GLY C N     1 
ATOM   6838  C  CA    . GLY C 1 155 ? 65.921  71.763  87.553  1.00 108.99 ? 423 GLY C CA    1 
ATOM   6839  C  C     . GLY C 1 155 ? 64.512  72.061  87.086  1.00 108.99 ? 423 GLY C C     1 
ATOM   6840  O  O     . GLY C 1 155 ? 63.832  72.882  87.710  1.00 108.99 ? 423 GLY C O     1 
ATOM   6841  N  N     . GLN C 1 156 ? 64.061  71.413  86.010  1.00 103.99 ? 424 GLN C N     1 
ATOM   6842  C  CA    . GLN C 1 156 ? 62.718  71.624  85.490  1.00 103.99 ? 424 GLN C CA    1 
ATOM   6843  C  C     . GLN C 1 156 ? 61.659  70.943  86.346  1.00 103.99 ? 424 GLN C C     1 
ATOM   6844  O  O     . GLN C 1 156 ? 60.501  71.374  86.339  1.00 103.99 ? 424 GLN C O     1 
ATOM   6845  C  CB    . GLN C 1 156 ? 62.650  71.120  84.043  1.00 103.99 ? 424 GLN C CB    1 
ATOM   6846  C  CG    . GLN C 1 156 ? 61.391  71.480  83.272  1.00 103.99 ? 424 GLN C CG    1 
ATOM   6847  C  CD    . GLN C 1 156 ? 61.420  70.985  81.843  1.00 103.99 ? 424 GLN C CD    1 
ATOM   6848  O  OE1   . GLN C 1 156 ? 62.368  70.324  81.422  1.00 103.99 ? 424 GLN C OE1   1 
ATOM   6849  N  NE2   . GLN C 1 156 ? 60.379  71.307  81.084  1.00 103.99 ? 424 GLN C NE2   1 
ATOM   6850  N  N     . SER C 1 157 ? 62.038  69.917  87.109  1.00 95.44  ? 425 SER C N     1 
ATOM   6851  C  CA    . SER C 1 157 ? 61.057  69.158  87.878  1.00 95.44  ? 425 SER C CA    1 
ATOM   6852  C  C     . SER C 1 157 ? 60.512  69.963  89.049  1.00 95.44  ? 425 SER C C     1 
ATOM   6853  O  O     . SER C 1 157 ? 59.331  69.842  89.388  1.00 95.44  ? 425 SER C O     1 
ATOM   6854  C  CB    . SER C 1 157 ? 61.675  67.857  88.380  1.00 95.44  ? 425 SER C CB    1 
ATOM   6855  O  OG    . SER C 1 157 ? 60.747  67.138  89.167  1.00 95.44  ? 425 SER C OG    1 
ATOM   6856  N  N     . GLU C 1 158 ? 61.347  70.796  89.670  1.00 88.87  ? 426 GLU C N     1 
ATOM   6857  C  CA    . GLU C 1 158 ? 60.884  71.580  90.810  1.00 88.87  ? 426 GLU C CA    1 
ATOM   6858  C  C     . GLU C 1 158 ? 59.959  72.706  90.388  1.00 88.87  ? 426 GLU C C     1 
ATOM   6859  O  O     . GLU C 1 158 ? 59.145  73.169  91.193  1.00 88.87  ? 426 GLU C O     1 
ATOM   6860  C  CB    . GLU C 1 158 ? 62.069  72.145  91.585  1.00 88.87  ? 426 GLU C CB    1 
ATOM   6861  C  CG    . GLU C 1 158 ? 62.850  71.098  92.334  1.00 88.87  ? 426 GLU C CG    1 
ATOM   6862  C  CD    . GLU C 1 158 ? 62.045  70.486  93.459  1.00 88.87  ? 426 GLU C CD    1 
ATOM   6863  O  OE1   . GLU C 1 158 ? 61.205  71.202  94.046  1.00 88.87  ? 426 GLU C OE1   1 
ATOM   6864  O  OE2   . GLU C 1 158 ? 62.251  69.291  93.754  1.00 88.87  ? 426 GLU C OE2   1 
ATOM   6865  N  N     . GLN C 1 159 ? 60.080  73.175  89.149  1.00 85.23  ? 427 GLN C N     1 
ATOM   6866  C  CA    . GLN C 1 159 ? 59.123  74.147  88.647  1.00 85.23  ? 427 GLN C CA    1 
ATOM   6867  C  C     . GLN C 1 159 ? 57.772  73.499  88.397  1.00 85.23  ? 427 GLN C C     1 
ATOM   6868  O  O     . GLN C 1 159 ? 56.735  74.141  88.589  1.00 85.23  ? 427 GLN C O     1 
ATOM   6869  C  CB    . GLN C 1 159 ? 59.666  74.799  87.376  1.00 85.23  ? 427 GLN C CB    1 
ATOM   6870  C  CG    . GLN C 1 159 ? 58.857  75.971  86.865  1.00 85.23  ? 427 GLN C CG    1 
ATOM   6871  C  CD    . GLN C 1 159 ? 57.805  75.555  85.870  1.00 85.23  ? 427 GLN C CD    1 
ATOM   6872  O  OE1   . GLN C 1 159 ? 57.994  74.605  85.116  1.00 85.23  ? 427 GLN C OE1   1 
ATOM   6873  N  NE2   . GLN C 1 159 ? 56.674  76.237  85.888  1.00 85.23  ? 427 GLN C NE2   1 
ATOM   6874  N  N     . GLU C 1 160 ? 57.762  72.236  87.976  1.00 87.60  ? 428 GLU C N     1 
ATOM   6875  C  CA    . GLU C 1 160 ? 56.506  71.557  87.696  1.00 87.60  ? 428 GLU C CA    1 
ATOM   6876  C  C     . GLU C 1 160 ? 55.779  71.158  88.968  1.00 87.60  ? 428 GLU C C     1 
ATOM   6877  O  O     . GLU C 1 160 ? 54.547  71.118  88.975  1.00 87.60  ? 428 GLU C O     1 
ATOM   6878  C  CB    . GLU C 1 160 ? 56.760  70.334  86.822  1.00 87.60  ? 428 GLU C CB    1 
ATOM   6879  C  CG    . GLU C 1 160 ? 57.292  70.682  85.447  1.00 87.60  ? 428 GLU C CG    1 
ATOM   6880  C  CD    . GLU C 1 160 ? 57.545  69.460  84.590  1.00 87.60  ? 428 GLU C CD    1 
ATOM   6881  O  OE1   . GLU C 1 160 ? 57.433  68.329  85.109  1.00 87.60  ? 428 GLU C OE1   1 
ATOM   6882  O  OE2   . GLU C 1 160 ? 57.858  69.631  83.394  1.00 87.60  ? 428 GLU C OE2   1 
ATOM   6883  N  N     . ASN C 1 161 ? 56.507  70.860  90.045  1.00 82.46  ? 429 ASN C N     1 
ATOM   6884  C  CA    . ASN C 1 161 ? 55.847  70.582  91.315  1.00 82.46  ? 429 ASN C CA    1 
ATOM   6885  C  C     . ASN C 1 161 ? 55.229  71.837  91.910  1.00 82.46  ? 429 ASN C C     1 
ATOM   6886  O  O     . ASN C 1 161 ? 54.181  71.762  92.557  1.00 82.46  ? 429 ASN C O     1 
ATOM   6887  C  CB    . ASN C 1 161 ? 56.826  69.977  92.317  1.00 82.46  ? 429 ASN C CB    1 
ATOM   6888  C  CG    . ASN C 1 161 ? 57.306  68.608  91.917  1.00 82.46  ? 429 ASN C CG    1 
ATOM   6889  O  OD1   . ASN C 1 161 ? 58.494  68.391  91.703  1.00 82.46  ? 429 ASN C OD1   1 
ATOM   6890  N  ND2   . ASN C 1 161 ? 56.388  67.669  91.824  1.00 82.46  ? 429 ASN C ND2   1 
ATOM   6891  N  N     . THR C 1 162 ? 55.866  72.991  91.715  1.00 78.97  ? 430 THR C N     1 
ATOM   6892  C  CA    . THR C 1 162 ? 55.306  74.240  92.214  1.00 78.97  ? 430 THR C CA    1 
ATOM   6893  C  C     . THR C 1 162 ? 54.108  74.667  91.377  1.00 78.97  ? 430 THR C C     1 
ATOM   6894  O  O     . THR C 1 162 ? 53.136  75.217  91.907  1.00 78.97  ? 430 THR C O     1 
ATOM   6895  C  CB    . THR C 1 162 ? 56.386  75.319  92.219  1.00 78.97  ? 430 THR C CB    1 
ATOM   6896  O  OG1   . THR C 1 162 ? 57.521  74.841  92.947  1.00 78.97  ? 430 THR C OG1   1 
ATOM   6897  C  CG2   . THR C 1 162 ? 55.898  76.572  92.905  1.00 78.97  ? 430 THR C CG2   1 
ATOM   6898  N  N     . LEU C 1 163 ? 54.149  74.399  90.073  1.00 76.25  ? 431 LEU C N     1 
ATOM   6899  C  CA    . LEU C 1 163 ? 52.998  74.681  89.227  1.00 76.25  ? 431 LEU C CA    1 
ATOM   6900  C  C     . LEU C 1 163 ? 51.833  73.752  89.540  1.00 76.25  ? 431 LEU C C     1 
ATOM   6901  O  O     . LEU C 1 163 ? 50.695  74.212  89.662  1.00 76.25  ? 431 LEU C O     1 
ATOM   6902  C  CB    . LEU C 1 163 ? 53.387  74.573  87.759  1.00 76.25  ? 431 LEU C CB    1 
ATOM   6903  C  CG    . LEU C 1 163 ? 52.251  74.834  86.785  1.00 76.25  ? 431 LEU C CG    1 
ATOM   6904  C  CD1   . LEU C 1 163 ? 51.728  76.220  86.996  1.00 76.25  ? 431 LEU C CD1   1 
ATOM   6905  C  CD2   . LEU C 1 163 ? 52.744  74.677  85.375  1.00 76.25  ? 431 LEU C CD2   1 
ATOM   6906  N  N     . ASN C 1 164 ? 52.099  72.449  89.700  1.00 78.77  ? 432 ASN C N     1 
ATOM   6907  C  CA    . ASN C 1 164 ? 51.032  71.494  89.991  1.00 78.77  ? 432 ASN C CA    1 
ATOM   6908  C  C     . ASN C 1 164 ? 50.408  71.734  91.355  1.00 78.77  ? 432 ASN C C     1 
ATOM   6909  O  O     . ASN C 1 164 ? 49.239  71.397  91.566  1.00 78.77  ? 432 ASN C O     1 
ATOM   6910  C  CB    . ASN C 1 164 ? 51.552  70.061  89.918  1.00 78.77  ? 432 ASN C CB    1 
ATOM   6911  C  CG    . ASN C 1 164 ? 51.818  69.612  88.507  1.00 78.77  ? 432 ASN C CG    1 
ATOM   6912  O  OD1   . ASN C 1 164 ? 51.075  69.948  87.588  1.00 78.77  ? 432 ASN C OD1   1 
ATOM   6913  N  ND2   . ASN C 1 164 ? 52.872  68.831  88.326  1.00 78.77  ? 432 ASN C ND2   1 
ATOM   6914  N  N     . GLN C 1 165 ? 51.160  72.309  92.289  1.00 71.70  ? 433 GLN C N     1 
ATOM   6915  C  CA    . GLN C 1 165 ? 50.555  72.732  93.541  1.00 71.70  ? 433 GLN C CA    1 
ATOM   6916  C  C     . GLN C 1 165 ? 49.665  73.942  93.326  1.00 71.70  ? 433 GLN C C     1 
ATOM   6917  O  O     . GLN C 1 165 ? 48.592  74.047  93.928  1.00 71.70  ? 433 GLN C O     1 
ATOM   6918  C  CB    . GLN C 1 165 ? 51.632  73.044  94.568  1.00 71.70  ? 433 GLN C CB    1 
ATOM   6919  C  CG    . GLN C 1 165 ? 51.051  73.368  95.902  1.00 71.70  ? 433 GLN C CG    1 
ATOM   6920  C  CD    . GLN C 1 165 ? 50.301  72.196  96.453  1.00 71.70  ? 433 GLN C CD    1 
ATOM   6921  O  OE1   . GLN C 1 165 ? 50.794  71.073  96.447  1.00 71.70  ? 433 GLN C OE1   1 
ATOM   6922  N  NE2   . GLN C 1 165 ? 49.078  72.430  96.881  1.00 71.70  ? 433 GLN C NE2   1 
ATOM   6923  N  N     . LEU C 1 166 ? 50.095  74.864  92.463  1.00 73.35  ? 434 LEU C N     1 
ATOM   6924  C  CA    . LEU C 1 166 ? 49.315  76.063  92.182  1.00 73.35  ? 434 LEU C CA    1 
ATOM   6925  C  C     . LEU C 1 166 ? 48.027  75.729  91.451  1.00 73.35  ? 434 LEU C C     1 
ATOM   6926  O  O     . LEU C 1 166 ? 47.011  76.397  91.651  1.00 73.35  ? 434 LEU C O     1 
ATOM   6927  C  CB    . LEU C 1 166 ? 50.154  77.044  91.366  1.00 73.35  ? 434 LEU C CB    1 
ATOM   6928  C  CG    . LEU C 1 166 ? 49.557  78.396  90.989  1.00 73.35  ? 434 LEU C CG    1 
ATOM   6929  C  CD1   . LEU C 1 166 ? 49.270  79.198  92.230  1.00 73.35  ? 434 LEU C CD1   1 
ATOM   6930  C  CD2   . LEU C 1 166 ? 50.487  79.159  90.075  1.00 73.35  ? 434 LEU C CD2   1 
ATOM   6931  N  N     . LEU C 1 167 ? 48.039  74.676  90.639  1.00 74.80  ? 435 LEU C N     1 
ATOM   6932  C  CA    . LEU C 1 167 ? 46.854  74.312  89.873  1.00 74.80  ? 435 LEU C CA    1 
ATOM   6933  C  C     . LEU C 1 167 ? 45.791  73.672  90.753  1.00 74.80  ? 435 LEU C C     1 
ATOM   6934  O  O     . LEU C 1 167 ? 44.593  73.852  90.516  1.00 74.80  ? 435 LEU C O     1 
ATOM   6935  C  CB    . LEU C 1 167 ? 47.237  73.352  88.761  1.00 74.80  ? 435 LEU C CB    1 
ATOM   6936  C  CG    . LEU C 1 167 ? 48.149  73.833  87.655  1.00 74.80  ? 435 LEU C CG    1 
ATOM   6937  C  CD1   . LEU C 1 167 ? 48.499  72.632  86.853  1.00 74.80  ? 435 LEU C CD1   1 
ATOM   6938  C  CD2   . LEU C 1 167 ? 47.435  74.853  86.829  1.00 74.80  ? 435 LEU C CD2   1 
ATOM   6939  N  N     . VAL C 1 168 ? 46.209  72.887  91.743  1.00 75.75  ? 436 VAL C N     1 
ATOM   6940  C  CA    . VAL C 1 168 ? 45.258  72.246  92.641  1.00 75.75  ? 436 VAL C CA    1 
ATOM   6941  C  C     . VAL C 1 168 ? 44.626  73.274  93.563  1.00 75.75  ? 436 VAL C C     1 
ATOM   6942  O  O     . VAL C 1 168 ? 43.410  73.261  93.797  1.00 75.75  ? 436 VAL C O     1 
ATOM   6943  C  CB    . VAL C 1 168 ? 45.964  71.128  93.424  1.00 75.75  ? 436 VAL C CB    1 
ATOM   6944  C  CG1   . VAL C 1 168 ? 45.075  70.576  94.515  1.00 75.75  ? 436 VAL C CG1   1 
ATOM   6945  C  CG2   . VAL C 1 168 ? 46.354  70.024  92.481  1.00 75.75  ? 436 VAL C CG2   1 
ATOM   6946  N  N     . GLU C 1 169 ? 45.430  74.207  94.062  1.00 75.57  ? 437 GLU C N     1 
ATOM   6947  C  CA    . GLU C 1 169 ? 44.954  75.188  95.021  1.00 75.57  ? 437 GLU C CA    1 
ATOM   6948  C  C     . GLU C 1 169 ? 44.032  76.230  94.402  1.00 75.57  ? 437 GLU C C     1 
ATOM   6949  O  O     . GLU C 1 169 ? 43.254  76.853  95.128  1.00 75.57  ? 437 GLU C O     1 
ATOM   6950  C  CB    . GLU C 1 169 ? 46.151  75.857  95.677  1.00 75.57  ? 437 GLU C CB    1 
ATOM   6951  C  CG    . GLU C 1 169 ? 46.907  74.976  96.634  1.00 75.57  ? 437 GLU C CG    1 
ATOM   6952  C  CD    . GLU C 1 169 ? 46.127  74.689  97.895  1.00 75.57  ? 437 GLU C CD    1 
ATOM   6953  O  OE1   . GLU C 1 169 ? 45.371  75.578  98.336  1.00 75.57  ? 437 GLU C OE1   1 
ATOM   6954  O  OE2   . GLU C 1 169 ? 46.266  73.578  98.450  1.00 75.57  ? 437 GLU C OE2   1 
ATOM   6955  N  N     . MET C 1 170 ? 44.085  76.433  93.092  1.00 75.13  ? 438 MET C N     1 
ATOM   6956  C  CA    . MET C 1 170 ? 43.193  77.393  92.461  1.00 75.13  ? 438 MET C CA    1 
ATOM   6957  C  C     . MET C 1 170 ? 41.870  76.779  92.040  1.00 75.13  ? 438 MET C C     1 
ATOM   6958  O  O     . MET C 1 170 ? 40.865  77.492  91.968  1.00 75.13  ? 438 MET C O     1 
ATOM   6959  C  CB    . MET C 1 170 ? 43.877  78.024  91.252  1.00 75.13  ? 438 MET C CB    1 
ATOM   6960  C  CG    . MET C 1 170 ? 44.999  78.961  91.627  1.00 75.13  ? 438 MET C CG    1 
ATOM   6961  S  SD    . MET C 1 170 ? 46.031  79.407  90.224  1.00 75.13  ? 438 MET C SD    1 
ATOM   6962  C  CE    . MET C 1 170 ? 44.891  80.418  89.305  1.00 75.13  ? 438 MET C CE    1 
ATOM   6963  N  N     . ASP C 1 171 ? 41.845  75.475  91.771  1.00 78.87  ? 439 ASP C N     1 
ATOM   6964  C  CA    . ASP C 1 171 ? 40.625  74.803  91.328  1.00 78.87  ? 439 ASP C CA    1 
ATOM   6965  C  C     . ASP C 1 171 ? 40.785  73.323  91.649  1.00 78.87  ? 439 ASP C C     1 
ATOM   6966  O  O     . ASP C 1 171 ? 41.533  72.621  90.964  1.00 78.87  ? 439 ASP C O     1 
ATOM   6967  C  CB    . ASP C 1 171 ? 40.397  75.024  89.839  1.00 78.87  ? 439 ASP C CB    1 
ATOM   6968  C  CG    . ASP C 1 171 ? 39.013  74.621  89.380  1.00 78.87  ? 439 ASP C CG    1 
ATOM   6969  O  OD1   . ASP C 1 171 ? 38.193  74.183  90.212  1.00 78.87  ? 439 ASP C OD1   1 
ATOM   6970  O  OD2   . ASP C 1 171 ? 38.748  74.741  88.165  1.00 78.87  ? 439 ASP C OD2   1 
ATOM   6971  N  N     . GLY C 1 172 ? 40.078  72.858  92.670  1.00 89.61  ? 440 GLY C N     1 
ATOM   6972  C  CA    . GLY C 1 172 ? 40.137  71.472  93.079  1.00 89.61  ? 440 GLY C CA    1 
ATOM   6973  C  C     . GLY C 1 172 ? 39.414  71.268  94.392  1.00 89.61  ? 440 GLY C C     1 
ATOM   6974  O  O     . GLY C 1 172 ? 38.385  71.901  94.642  1.00 89.61  ? 440 GLY C O     1 
ATOM   6975  N  N     . PHE C 1 173 ? 39.937  70.394  95.241  1.00 95.61  ? 441 PHE C N     1 
ATOM   6976  C  CA    . PHE C 1 173 ? 39.382  70.240  96.574  1.00 95.61  ? 441 PHE C CA    1 
ATOM   6977  C  C     . PHE C 1 173 ? 39.940  71.309  97.501  1.00 95.61  ? 441 PHE C C     1 
ATOM   6978  O  O     . PHE C 1 173 ? 41.064  71.789  97.321  1.00 95.61  ? 441 PHE C O     1 
ATOM   6979  C  CB    . PHE C 1 173 ? 39.679  68.849  97.123  1.00 95.61  ? 441 PHE C CB    1 
ATOM   6980  C  CG    . PHE C 1 173 ? 38.913  67.766  96.440  1.00 95.61  ? 441 PHE C CG    1 
ATOM   6981  C  CD1   . PHE C 1 173 ? 37.614  67.480  96.821  1.00 95.61  ? 441 PHE C CD1   1 
ATOM   6982  C  CD2   . PHE C 1 173 ? 39.476  67.052  95.399  1.00 95.61  ? 441 PHE C CD2   1 
ATOM   6983  C  CE1   . PHE C 1 173 ? 36.896  66.486  96.191  1.00 95.61  ? 441 PHE C CE1   1 
ATOM   6984  C  CE2   . PHE C 1 173 ? 38.763  66.058  94.761  1.00 95.61  ? 441 PHE C CE2   1 
ATOM   6985  C  CZ    . PHE C 1 173 ? 37.469  65.779  95.155  1.00 95.61  ? 441 PHE C CZ    1 
ATOM   6986  N  N     . ASN C 1 174 ? 39.116  71.690  98.485  1.00 98.59  ? 442 ASN C N     1 
ATOM   6987  C  CA    . ASN C 1 174 ? 39.388  72.768  99.443  1.00 98.59  ? 442 ASN C CA    1 
ATOM   6988  C  C     . ASN C 1 174 ? 39.666  74.099  98.750  1.00 98.59  ? 442 ASN C C     1 
ATOM   6989  O  O     . ASN C 1 174 ? 40.453  74.912  99.237  1.00 98.59  ? 442 ASN C O     1 
ATOM   6990  C  CB    . ASN C 1 174 ? 40.531  72.408  100.397 1.00 98.59  ? 442 ASN C CB    1 
ATOM   6991  C  CG    . ASN C 1 174 ? 40.215  71.199  101.244 1.00 98.59  ? 442 ASN C CG    1 
ATOM   6992  O  OD1   . ASN C 1 174 ? 40.858  70.156  101.122 1.00 98.59  ? 442 ASN C OD1   1 
ATOM   6993  N  ND2   . ASN C 1 174 ? 39.212  71.327  102.107 1.00 98.59  ? 442 ASN C ND2   1 
ATOM   6994  N  N     . THR C 1 175 ? 39.021  74.331  97.611  1.00 90.05  ? 443 THR C N     1 
ATOM   6995  C  CA    . THR C 1 175 ? 39.108  75.607  96.912  1.00 90.05  ? 443 THR C CA    1 
ATOM   6996  C  C     . THR C 1 175 ? 37.980  76.491  97.421  1.00 90.05  ? 443 THR C C     1 
ATOM   6997  O  O     . THR C 1 175 ? 36.811  76.275  97.086  1.00 90.05  ? 443 THR C O     1 
ATOM   6998  C  CB    . THR C 1 175 ? 39.022  75.411  95.402  1.00 90.05  ? 443 THR C CB    1 
ATOM   6999  O  OG1   . THR C 1 175 ? 40.110  74.591  94.966  1.00 90.05  ? 443 THR C OG1   1 
ATOM   7000  C  CG2   . THR C 1 175 ? 39.093  76.742  94.690  1.00 90.05  ? 443 THR C CG2   1 
ATOM   7001  N  N     . THR C 1 176 ? 38.326  77.471  98.247  1.00 89.36  ? 444 THR C N     1 
ATOM   7002  C  CA    . THR C 1 176 ? 37.336  78.383  98.787  1.00 89.36  ? 444 THR C CA    1 
ATOM   7003  C  C     . THR C 1 176 ? 36.892  79.378  97.723  1.00 89.36  ? 444 THR C C     1 
ATOM   7004  O  O     . THR C 1 176 ? 37.479  79.491  96.644  1.00 89.36  ? 444 THR C O     1 
ATOM   7005  C  CB    . THR C 1 176 ? 37.890  79.137  99.991  1.00 89.36  ? 444 THR C CB    1 
ATOM   7006  O  OG1   . THR C 1 176 ? 36.848  79.920  100.586 1.00 89.36  ? 444 THR C OG1   1 
ATOM   7007  C  CG2   . THR C 1 176 ? 39.001  80.058  99.551  1.00 89.36  ? 444 THR C CG2   1 
ATOM   7008  N  N     . THR C 1 177 ? 35.833  80.106  98.043  1.00 84.21  ? 445 THR C N     1 
ATOM   7009  C  CA    . THR C 1 177 ? 35.380  81.209  97.221  1.00 84.21  ? 445 THR C CA    1 
ATOM   7010  C  C     . THR C 1 177 ? 35.932  82.512  97.785  1.00 84.21  ? 445 THR C C     1 
ATOM   7011  O  O     . THR C 1 177 ? 36.694  82.522  98.757  1.00 84.21  ? 445 THR C O     1 
ATOM   7012  C  CB    . THR C 1 177 ? 33.852  81.233  97.144  1.00 84.21  ? 445 THR C CB    1 
ATOM   7013  O  OG1   . THR C 1 177 ? 33.307  81.385  98.461  1.00 84.21  ? 445 THR C OG1   1 
ATOM   7014  C  CG2   . THR C 1 177 ? 33.331  79.943  96.537  1.00 84.21  ? 445 THR C CG2   1 
ATOM   7015  N  N     . ASN C 1 178 ? 35.562  83.613  97.125  1.00 80.79  ? 446 ASN C N     1 
ATOM   7016  C  CA    . ASN C 1 178 ? 35.874  84.986  97.528  1.00 80.79  ? 446 ASN C CA    1 
ATOM   7017  C  C     . ASN C 1 178 ? 37.376  85.265  97.555  1.00 80.79  ? 446 ASN C C     1 
ATOM   7018  O  O     . ASN C 1 178 ? 37.844  86.107  98.317  1.00 80.79  ? 446 ASN C O     1 
ATOM   7019  C  CB    . ASN C 1 178 ? 35.234  85.329  98.878  1.00 80.79  ? 446 ASN C CB    1 
ATOM   7020  C  CG    . ASN C 1 178 ? 33.725  85.303  98.822  1.00 80.79  ? 446 ASN C CG    1 
ATOM   7021  O  OD1   . ASN C 1 178 ? 33.120  85.757  97.852  1.00 80.79  ? 446 ASN C OD1   1 
ATOM   7022  N  ND2   . ASN C 1 178 ? 33.106  84.767  99.865  1.00 80.79  ? 446 ASN C ND2   1 
ATOM   7023  N  N     . VAL C 1 179 ? 38.150  84.584  96.718  1.00 71.93  ? 447 VAL C N     1 
ATOM   7024  C  CA    . VAL C 1 179 ? 39.576  84.853  96.572  1.00 71.93  ? 447 VAL C CA    1 
ATOM   7025  C  C     . VAL C 1 179 ? 39.826  85.159  95.104  1.00 71.93  ? 447 VAL C C     1 
ATOM   7026  O  O     . VAL C 1 179 ? 39.806  84.254  94.261  1.00 71.93  ? 447 VAL C O     1 
ATOM   7027  C  CB    . VAL C 1 179 ? 40.444  83.684  97.051  1.00 71.93  ? 447 VAL C CB    1 
ATOM   7028  C  CG1   . VAL C 1 179 ? 41.903  83.957  96.774  1.00 71.93  ? 447 VAL C CG1   1 
ATOM   7029  C  CG2   . VAL C 1 179 ? 40.247  83.456  98.528  1.00 71.93  ? 447 VAL C CG2   1 
ATOM   7030  N  N     . VAL C 1 180 ? 40.038  86.429  94.792  1.00 70.73  ? 448 VAL C N     1 
ATOM   7031  C  CA    . VAL C 1 180 ? 40.291  86.859  93.426  1.00 70.73  ? 448 VAL C CA    1 
ATOM   7032  C  C     . VAL C 1 180 ? 41.794  86.872  93.215  1.00 70.73  ? 448 VAL C C     1 
ATOM   7033  O  O     . VAL C 1 180 ? 42.520  87.573  93.926  1.00 70.73  ? 448 VAL C O     1 
ATOM   7034  C  CB    . VAL C 1 180 ? 39.687  88.241  93.159  1.00 70.73  ? 448 VAL C CB    1 
ATOM   7035  C  CG1   . VAL C 1 180 ? 40.004  88.671  91.753  1.00 70.73  ? 448 VAL C CG1   1 
ATOM   7036  C  CG2   . VAL C 1 180 ? 38.198  88.211  93.387  1.00 70.73  ? 448 VAL C CG2   1 
ATOM   7037  N  N     . ILE C 1 181 ? 42.268  86.106  92.245  1.00 69.04  ? 449 ILE C N     1 
ATOM   7038  C  CA    . ILE C 1 181 ? 43.694  85.908  92.038  1.00 69.04  ? 449 ILE C CA    1 
ATOM   7039  C  C     . ILE C 1 181 ? 44.084  86.693  90.795  1.00 69.04  ? 449 ILE C C     1 
ATOM   7040  O  O     . ILE C 1 181 ? 43.947  86.213  89.667  1.00 69.04  ? 449 ILE C O     1 
ATOM   7041  C  CB    . ILE C 1 181 ? 44.049  84.425  91.919  1.00 69.04  ? 449 ILE C CB    1 
ATOM   7042  C  CG1   . ILE C 1 181 ? 43.641  83.705  93.193  1.00 69.04  ? 449 ILE C CG1   1 
ATOM   7043  C  CG2   . ILE C 1 181 ? 45.530  84.240  91.749  1.00 69.04  ? 449 ILE C CG2   1 
ATOM   7044  C  CD1   . ILE C 1 181 ? 43.733  82.219  93.091  1.00 69.04  ? 449 ILE C CD1   1 
ATOM   7045  N  N     . LEU C 1 182 ? 44.552  87.917  90.997  1.00 66.15  ? 450 LEU C N     1 
ATOM   7046  C  CA    . LEU C 1 182 ? 45.073  88.715  89.905  1.00 66.15  ? 450 LEU C CA    1 
ATOM   7047  C  C     . LEU C 1 182 ? 46.499  88.298  89.598  1.00 66.15  ? 450 LEU C C     1 
ATOM   7048  O  O     . LEU C 1 182 ? 47.253  87.891  90.482  1.00 66.15  ? 450 LEU C O     1 
ATOM   7049  C  CB    . LEU C 1 182 ? 45.032  90.196  90.258  1.00 66.15  ? 450 LEU C CB    1 
ATOM   7050  C  CG    . LEU C 1 182 ? 43.653  90.827  90.329  1.00 66.15  ? 450 LEU C CG    1 
ATOM   7051  C  CD1   . LEU C 1 182 ? 43.757  92.218  90.890  1.00 66.15  ? 450 LEU C CD1   1 
ATOM   7052  C  CD2   . LEU C 1 182 ? 43.100  90.876  88.941  1.00 66.15  ? 450 LEU C CD2   1 
ATOM   7053  N  N     . ALA C 1 183 ? 46.867  88.392  88.327  1.00 66.64  ? 451 ALA C N     1 
ATOM   7054  C  CA    . ALA C 1 183 ? 48.176  87.932  87.902  1.00 66.64  ? 451 ALA C CA    1 
ATOM   7055  C  C     . ALA C 1 183 ? 48.637  88.766  86.728  1.00 66.64  ? 451 ALA C C     1 
ATOM   7056  O  O     . ALA C 1 183 ? 47.827  89.265  85.943  1.00 66.64  ? 451 ALA C O     1 
ATOM   7057  C  CB    . ALA C 1 183 ? 48.161  86.458  87.515  1.00 66.64  ? 451 ALA C CB    1 
ATOM   7058  N  N     . GLY C 1 184 ? 49.946  88.906  86.610  1.00 67.14  ? 452 GLY C N     1 
ATOM   7059  C  CA    . GLY C 1 184 ? 50.496  89.731  85.563  1.00 67.14  ? 452 GLY C CA    1 
ATOM   7060  C  C     . GLY C 1 184 ? 51.731  89.118  84.957  1.00 67.14  ? 452 GLY C C     1 
ATOM   7061  O  O     . GLY C 1 184 ? 52.605  88.625  85.672  1.00 67.14  ? 452 GLY C O     1 
ATOM   7062  N  N     . THR C 1 185 ? 51.805  89.132  83.635  1.00 68.07  ? 453 THR C N     1 
ATOM   7063  C  CA    . THR C 1 185 ? 52.975  88.645  82.930  1.00 68.07  ? 453 THR C CA    1 
ATOM   7064  C  C     . THR C 1 185 ? 53.062  89.364  81.598  1.00 68.07  ? 453 THR C C     1 
ATOM   7065  O  O     . THR C 1 185 ? 52.127  90.037  81.171  1.00 68.07  ? 453 THR C O     1 
ATOM   7066  C  CB    . THR C 1 185 ? 52.922  87.137  82.719  1.00 68.07  ? 453 THR C CB    1 
ATOM   7067  O  OG1   . THR C 1 185 ? 54.132  86.710  82.088  1.00 68.07  ? 453 THR C OG1   1 
ATOM   7068  C  CG2   . THR C 1 185 ? 51.746  86.774  81.843  1.00 68.07  ? 453 THR C CG2   1 
ATOM   7069  N  N     . ASN C 1 186 ? 54.209  89.227  80.951  1.00 71.54  ? 454 ASN C N     1 
ATOM   7070  C  CA    . ASN C 1 186 ? 54.399  89.744  79.609  1.00 71.54  ? 454 ASN C CA    1 
ATOM   7071  C  C     . ASN C 1 186 ? 54.858  88.677  78.631  1.00 71.54  ? 454 ASN C C     1 
ATOM   7072  O  O     . ASN C 1 186 ? 55.145  88.997  77.474  1.00 71.54  ? 454 ASN C O     1 
ATOM   7073  C  CB    . ASN C 1 186 ? 55.375  90.927  79.635  1.00 71.54  ? 454 ASN C CB    1 
ATOM   7074  C  CG    . ASN C 1 186 ? 56.611  90.642  80.434  1.00 71.54  ? 454 ASN C CG    1 
ATOM   7075  O  OD1   . ASN C 1 186 ? 56.817  89.524  80.901  1.00 71.54  ? 454 ASN C OD1   1 
ATOM   7076  N  ND2   . ASN C 1 186 ? 57.442  91.656  80.615  1.00 71.54  ? 454 ASN C ND2   1 
ATOM   7077  N  N     . ARG C 1 187 ? 54.927  87.421  79.063  1.00 74.41  ? 455 ARG C N     1 
ATOM   7078  C  CA    . ARG C 1 187 ? 55.073  86.272  78.174  1.00 74.41  ? 455 ARG C CA    1 
ATOM   7079  C  C     . ARG C 1 187 ? 53.968  85.280  78.503  1.00 74.41  ? 455 ARG C C     1 
ATOM   7080  O  O     . ARG C 1 187 ? 54.200  84.303  79.225  1.00 74.41  ? 455 ARG C O     1 
ATOM   7081  C  CB    . ARG C 1 187 ? 56.431  85.599  78.332  1.00 74.41  ? 455 ARG C CB    1 
ATOM   7082  C  CG    . ARG C 1 187 ? 57.623  86.429  77.964  1.00 74.41  ? 455 ARG C CG    1 
ATOM   7083  C  CD    . ARG C 1 187 ? 58.853  85.578  78.124  1.00 74.41  ? 455 ARG C CD    1 
ATOM   7084  N  NE    . ARG C 1 187 ? 59.026  85.178  79.513  1.00 74.41  ? 455 ARG C NE    1 
ATOM   7085  C  CZ    . ARG C 1 187 ? 59.899  84.268  79.923  1.00 74.41  ? 455 ARG C CZ    1 
ATOM   7086  N  NH1   . ARG C 1 187 ? 60.676  83.654  79.046  1.00 74.41  ? 455 ARG C NH1   1 
ATOM   7087  N  NH2   . ARG C 1 187 ? 59.986  83.966  81.208  1.00 74.41  ? 455 ARG C NH2   1 
ATOM   7088  N  N     . PRO C 1 188 ? 52.749  85.500  78.005  1.00 71.17  ? 456 PRO C N     1 
ATOM   7089  C  CA    . PRO C 1 188 ? 51.681  84.535  78.278  1.00 71.17  ? 456 PRO C CA    1 
ATOM   7090  C  C     . PRO C 1 188 ? 51.774  83.287  77.430  1.00 71.17  ? 456 PRO C C     1 
ATOM   7091  O  O     . PRO C 1 188 ? 51.130  82.284  77.761  1.00 71.17  ? 456 PRO C O     1 
ATOM   7092  C  CB    . PRO C 1 188 ? 50.411  85.321  77.951  1.00 71.17  ? 456 PRO C CB    1 
ATOM   7093  C  CG    . PRO C 1 188 ? 50.841  86.250  76.894  1.00 71.17  ? 456 PRO C CG    1 
ATOM   7094  C  CD    . PRO C 1 188 ? 52.260  86.632  77.200  1.00 71.17  ? 456 PRO C CD    1 
ATOM   7095  N  N     . ASP C 1 189 ? 52.560  83.313  76.356  1.00 76.33  ? 457 ASP C N     1 
ATOM   7096  C  CA    . ASP C 1 189 ? 52.614  82.197  75.426  1.00 76.33  ? 457 ASP C CA    1 
ATOM   7097  C  C     . ASP C 1 189 ? 53.397  81.017  75.966  1.00 76.33  ? 457 ASP C C     1 
ATOM   7098  O  O     . ASP C 1 189 ? 53.172  79.889  75.519  1.00 76.33  ? 457 ASP C O     1 
ATOM   7099  C  CB    . ASP C 1 189 ? 53.220  82.659  74.107  1.00 76.33  ? 457 ASP C CB    1 
ATOM   7100  C  CG    . ASP C 1 189 ? 52.340  83.653  73.389  1.00 76.33  ? 457 ASP C CG    1 
ATOM   7101  O  OD1   . ASP C 1 189 ? 51.106  83.576  73.556  1.00 76.33  ? 457 ASP C OD1   1 
ATOM   7102  O  OD2   . ASP C 1 189 ? 52.879  84.516  72.668  1.00 76.33  ? 457 ASP C OD2   1 
ATOM   7103  N  N     . ILE C 1 190 ? 54.310  81.243  76.916  1.00 73.00  ? 458 ILE C N     1 
ATOM   7104  C  CA    . ILE C 1 190 ? 55.035  80.141  77.533  1.00 73.00  ? 458 ILE C CA    1 
ATOM   7105  C  C     . ILE C 1 190 ? 54.269  79.529  78.688  1.00 73.00  ? 458 ILE C C     1 
ATOM   7106  O  O     . ILE C 1 190 ? 54.755  78.573  79.306  1.00 73.00  ? 458 ILE C O     1 
ATOM   7107  C  CB    . ILE C 1 190 ? 56.413  80.574  78.060  1.00 73.00  ? 458 ILE C CB    1 
ATOM   7108  C  CG1   . ILE C 1 190 ? 56.251  81.509  79.250  1.00 73.00  ? 458 ILE C CG1   1 
ATOM   7109  C  CG2   . ILE C 1 190 ? 57.183  81.281  76.974  1.00 73.00  ? 458 ILE C CG2   1 
ATOM   7110  C  CD1   . ILE C 1 190 ? 57.507  81.688  80.027  1.00 73.00  ? 458 ILE C CD1   1 
ATOM   7111  N  N     . LEU C 1 191 ? 53.096  80.056  79.012  1.00 74.11  ? 459 LEU C N     1 
ATOM   7112  C  CA    . LEU C 1 191 ? 52.362  79.574  80.164  1.00 74.11  ? 459 LEU C CA    1 
ATOM   7113  C  C     . LEU C 1 191 ? 51.694  78.243  79.865  1.00 74.11  ? 459 LEU C C     1 
ATOM   7114  O  O     . LEU C 1 191 ? 51.387  77.918  78.716  1.00 74.11  ? 459 LEU C O     1 
ATOM   7115  C  CB    . LEU C 1 191 ? 51.313  80.589  80.608  1.00 74.11  ? 459 LEU C CB    1 
ATOM   7116  C  CG    . LEU C 1 191 ? 51.835  81.894  81.197  1.00 74.11  ? 459 LEU C CG    1 
ATOM   7117  C  CD1   . LEU C 1 191 ? 50.686  82.828  81.504  1.00 74.11  ? 459 LEU C CD1   1 
ATOM   7118  C  CD2   . LEU C 1 191 ? 52.648  81.622  82.441  1.00 74.11  ? 459 LEU C CD2   1 
ATOM   7119  N  N     . ASP C 1 192 ? 51.492  77.471  80.920  1.00 76.63  ? 460 ASP C N     1 
ATOM   7120  C  CA    . ASP C 1 192 ? 50.813  76.194  80.817  1.00 76.63  ? 460 ASP C CA    1 
ATOM   7121  C  C     . ASP C 1 192 ? 49.349  76.425  80.455  1.00 76.63  ? 460 ASP C C     1 
ATOM   7122  O  O     . ASP C 1 192 ? 48.714  77.328  81.007  1.00 76.63  ? 460 ASP C O     1 
ATOM   7123  C  CB    . ASP C 1 192 ? 50.912  75.471  82.155  1.00 76.63  ? 460 ASP C CB    1 
ATOM   7124  C  CG    . ASP C 1 192 ? 50.648  73.990  82.057  1.00 76.63  ? 460 ASP C CG    1 
ATOM   7125  O  OD1   . ASP C 1 192 ? 50.463  73.460  80.954  1.00 76.63  ? 460 ASP C OD1   1 
ATOM   7126  O  OD2   . ASP C 1 192 ? 50.622  73.336  83.112  1.00 76.63  ? 460 ASP C OD2   1 
ATOM   7127  N  N     . PRO C 1 193 ? 48.790  75.653  79.516  1.00 73.74  ? 461 PRO C N     1 
ATOM   7128  C  CA    . PRO C 1 193 ? 47.334  75.695  79.305  1.00 73.74  ? 461 PRO C CA    1 
ATOM   7129  C  C     . PRO C 1 193 ? 46.505  75.231  80.493  1.00 73.74  ? 461 PRO C C     1 
ATOM   7130  O  O     . PRO C 1 193 ? 45.291  75.458  80.492  1.00 73.74  ? 461 PRO C O     1 
ATOM   7131  C  CB    . PRO C 1 193 ? 47.134  74.770  78.102  1.00 73.74  ? 461 PRO C CB    1 
ATOM   7132  C  CG    . PRO C 1 193 ? 48.392  74.878  77.359  1.00 73.74  ? 461 PRO C CG    1 
ATOM   7133  C  CD    . PRO C 1 193 ? 49.475  75.022  78.375  1.00 73.74  ? 461 PRO C CD    1 
ATOM   7134  N  N     . ALA C 1 194 ? 47.101  74.590  81.495  1.00 73.24  ? 462 ALA C N     1 
ATOM   7135  C  CA    . ALA C 1 194 ? 46.364  74.279  82.708  1.00 73.24  ? 462 ALA C CA    1 
ATOM   7136  C  C     . ALA C 1 194 ? 46.158  75.503  83.585  1.00 73.24  ? 462 ALA C C     1 
ATOM   7137  O  O     . ALA C 1 194 ? 45.233  75.511  84.400  1.00 73.24  ? 462 ALA C O     1 
ATOM   7138  C  CB    . ALA C 1 194 ? 47.087  73.190  83.487  1.00 73.24  ? 462 ALA C CB    1 
ATOM   7139  N  N     . LEU C 1 195 ? 47.011  76.522  83.463  1.00 72.57  ? 463 LEU C N     1 
ATOM   7140  C  CA    . LEU C 1 195 ? 46.726  77.802  84.099  1.00 72.57  ? 463 LEU C CA    1 
ATOM   7141  C  C     . LEU C 1 195 ? 45.766  78.646  83.284  1.00 72.57  ? 463 LEU C C     1 
ATOM   7142  O  O     . LEU C 1 195 ? 44.983  79.411  83.851  1.00 72.57  ? 463 LEU C O     1 
ATOM   7143  C  CB    . LEU C 1 195 ? 47.999  78.608  84.313  1.00 72.57  ? 463 LEU C CB    1 
ATOM   7144  C  CG    . LEU C 1 195 ? 48.964  78.242  85.419  1.00 72.57  ? 463 LEU C CG    1 
ATOM   7145  C  CD1   . LEU C 1 195 ? 50.147  79.152  85.291  1.00 72.57  ? 463 LEU C CD1   1 
ATOM   7146  C  CD2   . LEU C 1 195 ? 48.290  78.459  86.742  1.00 72.57  ? 463 LEU C CD2   1 
ATOM   7147  N  N     . LEU C 1 196 ? 45.817  78.533  81.965  1.00 72.46  ? 464 LEU C N     1 
ATOM   7148  C  CA    . LEU C 1 196 ? 45.031  79.404  81.110  1.00 72.46  ? 464 LEU C CA    1 
ATOM   7149  C  C     . LEU C 1 196 ? 43.569  78.992  81.018  1.00 72.46  ? 464 LEU C C     1 
ATOM   7150  O  O     . LEU C 1 196 ? 42.785  79.708  80.388  1.00 72.46  ? 464 LEU C O     1 
ATOM   7151  C  CB    . LEU C 1 196 ? 45.642  79.434  79.711  1.00 72.46  ? 464 LEU C CB    1 
ATOM   7152  C  CG    . LEU C 1 196 ? 47.079  79.951  79.624  1.00 72.46  ? 464 LEU C CG    1 
ATOM   7153  C  CD1   . LEU C 1 196 ? 47.601  79.855  78.197  1.00 72.46  ? 464 LEU C CD1   1 
ATOM   7154  C  CD2   . LEU C 1 196 ? 47.193  81.360  80.148  1.00 72.46  ? 464 LEU C CD2   1 
ATOM   7155  N  N     . ARG C 1 197 ? 43.187  77.866  81.610  1.00 73.14  ? 465 ARG C N     1 
ATOM   7156  C  CA    . ARG C 1 197 ? 41.811  77.416  81.528  1.00 73.14  ? 465 ARG C CA    1 
ATOM   7157  C  C     . ARG C 1 197 ? 40.923  78.254  82.441  1.00 73.14  ? 465 ARG C C     1 
ATOM   7158  O  O     . ARG C 1 197 ? 41.392  78.815  83.432  1.00 73.14  ? 465 ARG C O     1 
ATOM   7159  C  CB    . ARG C 1 197 ? 41.694  75.946  81.913  1.00 73.14  ? 465 ARG C CB    1 
ATOM   7160  C  CG    . ARG C 1 197 ? 42.112  75.627  83.336  1.00 73.14  ? 465 ARG C CG    1 
ATOM   7161  C  CD    . ARG C 1 197 ? 41.865  74.172  83.633  1.00 73.14  ? 465 ARG C CD    1 
ATOM   7162  N  NE    . ARG C 1 197 ? 40.444  73.897  83.783  1.00 73.14  ? 465 ARG C NE    1 
ATOM   7163  C  CZ    . ARG C 1 197 ? 39.810  73.775  84.943  1.00 73.14  ? 465 ARG C CZ    1 
ATOM   7164  N  NH1   . ARG C 1 197 ? 40.463  73.838  86.085  1.00 73.14  ? 465 ARG C NH1   1 
ATOM   7165  N  NH2   . ARG C 1 197 ? 38.512  73.532  84.956  1.00 73.14  ? 465 ARG C NH2   1 
ATOM   7166  N  N     . PRO C 1 198 ? 39.645  78.382  82.110  1.00 70.75  ? 466 PRO C N     1 
ATOM   7167  C  CA    . PRO C 1 198 ? 38.718  79.024  83.039  1.00 70.75  ? 466 PRO C CA    1 
ATOM   7168  C  C     . PRO C 1 198 ? 38.470  78.139  84.244  1.00 70.75  ? 466 PRO C C     1 
ATOM   7169  O  O     . PRO C 1 198 ? 38.536  76.911  84.168  1.00 70.75  ? 466 PRO C O     1 
ATOM   7170  C  CB    . PRO C 1 198 ? 37.451  79.203  82.205  1.00 70.75  ? 466 PRO C CB    1 
ATOM   7171  C  CG    . PRO C 1 198 ? 37.934  79.225  80.813  1.00 70.75  ? 466 PRO C CG    1 
ATOM   7172  C  CD    . PRO C 1 198 ? 39.062  78.255  80.769  1.00 70.75  ? 466 PRO C CD    1 
ATOM   7173  N  N     . GLY C 1 199 ? 38.185  78.780  85.371  1.00 71.79  ? 467 GLY C N     1 
ATOM   7174  C  CA    . GLY C 1 199 ? 38.198  78.135  86.652  1.00 71.79  ? 467 GLY C CA    1 
ATOM   7175  C  C     . GLY C 1 199 ? 39.478  78.375  87.424  1.00 71.79  ? 467 GLY C C     1 
ATOM   7176  O  O     . GLY C 1 199 ? 39.462  78.362  88.658  1.00 71.79  ? 467 GLY C O     1 
ATOM   7177  N  N     . ARG C 1 200 ? 40.590  78.576  86.720  1.00 72.10  ? 468 ARG C N     1 
ATOM   7178  C  CA    . ARG C 1 200 ? 41.808  79.118  87.312  1.00 72.10  ? 468 ARG C CA    1 
ATOM   7179  C  C     . ARG C 1 200 ? 41.904  80.616  87.065  1.00 72.10  ? 468 ARG C C     1 
ATOM   7180  O  O     . ARG C 1 200 ? 42.002  81.412  88.002  1.00 72.10  ? 468 ARG C O     1 
ATOM   7181  C  CB    . ARG C 1 200 ? 43.058  78.429  86.742  1.00 72.10  ? 468 ARG C CB    1 
ATOM   7182  C  CG    . ARG C 1 200 ? 43.534  77.184  87.473  1.00 72.10  ? 468 ARG C CG    1 
ATOM   7183  C  CD    . ARG C 1 200 ? 42.666  76.032  87.139  1.00 72.10  ? 468 ARG C CD    1 
ATOM   7184  N  NE    . ARG C 1 200 ? 43.033  74.791  87.805  1.00 72.10  ? 468 ARG C NE    1 
ATOM   7185  C  CZ    . ARG C 1 200 ? 43.782  73.841  87.271  1.00 72.10  ? 468 ARG C CZ    1 
ATOM   7186  N  NH1   . ARG C 1 200 ? 44.039  72.741  87.957  1.00 72.10  ? 468 ARG C NH1   1 
ATOM   7187  N  NH2   . ARG C 1 200 ? 44.247  73.980  86.042  1.00 72.10  ? 468 ARG C NH2   1 
ATOM   7188  N  N     . PHE C 1 201 ? 41.863  81.009  85.799  1.00 70.94  ? 469 PHE C N     1 
ATOM   7189  C  CA    . PHE C 1 201 ? 42.014  82.390  85.357  1.00 70.94  ? 469 PHE C CA    1 
ATOM   7190  C  C     . PHE C 1 201 ? 40.900  82.632  84.353  1.00 70.94  ? 469 PHE C C     1 
ATOM   7191  O  O     . PHE C 1 201 ? 41.079  82.398  83.155  1.00 70.94  ? 469 PHE C O     1 
ATOM   7192  C  CB    . PHE C 1 201 ? 43.394  82.604  84.771  1.00 70.94  ? 469 PHE C CB    1 
ATOM   7193  C  CG    . PHE C 1 201 ? 44.453  82.854  85.799  1.00 70.94  ? 469 PHE C CG    1 
ATOM   7194  C  CD1   . PHE C 1 201 ? 44.160  83.564  86.945  1.00 70.94  ? 469 PHE C CD1   1 
ATOM   7195  C  CD2   . PHE C 1 201 ? 45.721  82.320  85.655  1.00 70.94  ? 469 PHE C CD2   1 
ATOM   7196  C  CE1   . PHE C 1 201 ? 45.127  83.795  87.891  1.00 70.94  ? 469 PHE C CE1   1 
ATOM   7197  C  CE2   . PHE C 1 201 ? 46.690  82.547  86.603  1.00 70.94  ? 469 PHE C CE2   1 
ATOM   7198  C  CZ    . PHE C 1 201 ? 46.393  83.279  87.719  1.00 70.94  ? 469 PHE C CZ    1 
ATOM   7199  N  N     . ASP C 1 202 ? 39.753  83.087  84.863  1.00 74.34  ? 470 ASP C N     1 
ATOM   7200  C  CA    . ASP C 1 202 ? 38.541  83.178  84.059  1.00 74.34  ? 470 ASP C CA    1 
ATOM   7201  C  C     . ASP C 1 202 ? 38.669  84.203  82.948  1.00 74.34  ? 470 ASP C C     1 
ATOM   7202  O  O     . ASP C 1 202 ? 38.018  84.074  81.908  1.00 74.34  ? 470 ASP C O     1 
ATOM   7203  C  CB    . ASP C 1 202 ? 37.356  83.537  84.948  1.00 74.34  ? 470 ASP C CB    1 
ATOM   7204  C  CG    . ASP C 1 202 ? 37.033  82.456  85.949  1.00 74.34  ? 470 ASP C CG    1 
ATOM   7205  O  OD1   . ASP C 1 202 ? 37.300  81.273  85.656  1.00 74.34  ? 470 ASP C OD1   1 
ATOM   7206  O  OD2   . ASP C 1 202 ? 36.519  82.786  87.035  1.00 74.34  ? 470 ASP C OD2   1 
ATOM   7207  N  N     . ARG C 1 203 ? 39.488  85.223  83.150  1.00 74.83  ? 471 ARG C N     1 
ATOM   7208  C  CA    . ARG C 1 203 ? 39.670  86.281  82.176  1.00 74.83  ? 471 ARG C CA    1 
ATOM   7209  C  C     . ARG C 1 203 ? 41.147  86.434  81.872  1.00 74.83  ? 471 ARG C C     1 
ATOM   7210  O  O     . ARG C 1 203 ? 41.986  86.319  82.766  1.00 74.83  ? 471 ARG C O     1 
ATOM   7211  C  CB    . ARG C 1 203 ? 39.105  87.592  82.693  1.00 74.83  ? 471 ARG C CB    1 
ATOM   7212  C  CG    . ARG C 1 203 ? 37.611  87.572  82.829  1.00 74.83  ? 471 ARG C CG    1 
ATOM   7213  C  CD    . ARG C 1 203 ? 37.094  88.873  83.367  1.00 74.83  ? 471 ARG C CD    1 
ATOM   7214  N  NE    . ARG C 1 203 ? 35.645  88.848  83.495  1.00 74.83  ? 471 ARG C NE    1 
ATOM   7215  C  CZ    . ARG C 1 203 ? 34.926  89.848  83.986  1.00 74.83  ? 471 ARG C CZ    1 
ATOM   7216  N  NH1   . ARG C 1 203 ? 35.522  90.955  84.399  1.00 74.83  ? 471 ARG C NH1   1 
ATOM   7217  N  NH2   . ARG C 1 203 ? 33.611  89.740  84.064  1.00 74.83  ? 471 ARG C NH2   1 
ATOM   7218  N  N     . GLN C 1 204 ? 41.457  86.681  80.609  1.00 72.95  ? 472 GLN C N     1 
ATOM   7219  C  CA    . GLN C 1 204 ? 42.810  87.016  80.186  1.00 72.95  ? 472 GLN C CA    1 
ATOM   7220  C  C     . GLN C 1 204 ? 42.730  88.398  79.562  1.00 72.95  ? 472 GLN C C     1 
ATOM   7221  O  O     . GLN C 1 204 ? 42.241  88.556  78.441  1.00 72.95  ? 472 GLN C O     1 
ATOM   7222  C  CB    . GLN C 1 204 ? 43.359  85.993  79.209  1.00 72.95  ? 472 GLN C CB    1 
ATOM   7223  C  CG    . GLN C 1 204 ? 43.457  84.615  79.797  1.00 72.95  ? 472 GLN C CG    1 
ATOM   7224  C  CD    . GLN C 1 204 ? 44.000  83.609  78.822  1.00 72.95  ? 472 GLN C CD    1 
ATOM   7225  O  OE1   . GLN C 1 204 ? 44.347  83.947  77.693  1.00 72.95  ? 472 GLN C OE1   1 
ATOM   7226  N  NE2   . GLN C 1 204 ? 44.046  82.355  79.239  1.00 72.95  ? 472 GLN C NE2   1 
ATOM   7227  N  N     . ILE C 1 205 ? 43.206  89.395  80.290  1.00 71.37  ? 473 ILE C N     1 
ATOM   7228  C  CA    . ILE C 1 205 ? 43.085  90.784  79.886  1.00 71.37  ? 473 ILE C CA    1 
ATOM   7229  C  C     . ILE C 1 205 ? 44.397  91.206  79.252  1.00 71.37  ? 473 ILE C C     1 
ATOM   7230  O  O     . ILE C 1 205 ? 45.458  91.101  79.876  1.00 71.37  ? 473 ILE C O     1 
ATOM   7231  C  CB    . ILE C 1 205 ? 42.735  91.675  81.081  1.00 71.37  ? 473 ILE C CB    1 
ATOM   7232  C  CG1   . ILE C 1 205 ? 41.438  91.190  81.711  1.00 71.37  ? 473 ILE C CG1   1 
ATOM   7233  C  CG2   . ILE C 1 205 ? 42.586  93.098  80.639  1.00 71.37  ? 473 ILE C CG2   1 
ATOM   7234  C  CD1   . ILE C 1 205 ? 41.168  91.797  83.031  1.00 71.37  ? 473 ILE C CD1   1 
ATOM   7235  N  N     . PHE C 1 206 ? 44.330  91.670  78.012  1.00 71.35  ? 474 PHE C N     1 
ATOM   7236  C  CA    . PHE C 1 206 ? 45.499  92.147  77.291  1.00 71.35  ? 474 PHE C CA    1 
ATOM   7237  C  C     . PHE C 1 206 ? 45.527  93.664  77.375  1.00 71.35  ? 474 PHE C C     1 
ATOM   7238  O  O     . PHE C 1 206 ? 44.684  94.341  76.781  1.00 71.35  ? 474 PHE C O     1 
ATOM   7239  C  CB    . PHE C 1 206 ? 45.483  91.683  75.840  1.00 71.35  ? 474 PHE C CB    1 
ATOM   7240  C  CG    . PHE C 1 206 ? 46.657  92.157  75.053  1.00 71.35  ? 474 PHE C CG    1 
ATOM   7241  C  CD1   . PHE C 1 206 ? 47.902  91.589  75.241  1.00 71.35  ? 474 PHE C CD1   1 
ATOM   7242  C  CD2   . PHE C 1 206 ? 46.521  93.179  74.132  1.00 71.35  ? 474 PHE C CD2   1 
ATOM   7243  C  CE1   . PHE C 1 206 ? 48.987  92.025  74.524  1.00 71.35  ? 474 PHE C CE1   1 
ATOM   7244  C  CE2   . PHE C 1 206 ? 47.601  93.620  73.412  1.00 71.35  ? 474 PHE C CE2   1 
ATOM   7245  C  CZ    . PHE C 1 206 ? 48.837  93.046  73.608  1.00 71.35  ? 474 PHE C CZ    1 
ATOM   7246  N  N     . ILE C 1 207 ? 46.494  94.193  78.111  1.00 67.95  ? 475 ILE C N     1 
ATOM   7247  C  CA    . ILE C 1 207 ? 46.677  95.633  78.245  1.00 67.95  ? 475 ILE C CA    1 
ATOM   7248  C  C     . ILE C 1 207 ? 47.747  96.010  77.230  1.00 67.95  ? 475 ILE C C     1 
ATOM   7249  O  O     . ILE C 1 207 ? 48.944  95.910  77.488  1.00 67.95  ? 475 ILE C O     1 
ATOM   7250  C  CB    . ILE C 1 207 ? 47.063  96.026  79.665  1.00 67.95  ? 475 ILE C CB    1 
ATOM   7251  C  CG1   . ILE C 1 207 ? 46.000  95.554  80.643  1.00 67.95  ? 475 ILE C CG1   1 
ATOM   7252  C  CG2   . ILE C 1 207 ? 47.177  97.519  79.780  1.00 67.95  ? 475 ILE C CG2   1 
ATOM   7253  C  CD1   . ILE C 1 207 ? 46.420  95.681  82.066  1.00 67.95  ? 475 ILE C CD1   1 
ATOM   7254  N  N     . GLY C 1 208 ? 47.312  96.428  76.050  1.00 65.98  ? 476 GLY C N     1 
ATOM   7255  C  CA    . GLY C 1 208 ? 48.230  96.799  75.004  1.00 65.98  ? 476 GLY C CA    1 
ATOM   7256  C  C     . GLY C 1 208 ? 48.633  98.248  75.125  1.00 65.98  ? 476 GLY C C     1 
ATOM   7257  O  O     . GLY C 1 208 ? 48.062  98.998  75.921  1.00 65.98  ? 476 GLY C O     1 
ATOM   7258  N  N     . PRO C 1 209 ? 49.635  98.665  74.355  1.00 63.13  ? 477 PRO C N     1 
ATOM   7259  C  CA    . PRO C 1 209 ? 50.038  100.069 74.346  1.00 63.13  ? 477 PRO C CA    1 
ATOM   7260  C  C     . PRO C 1 209 ? 48.930  100.939 73.788  1.00 63.13  ? 477 PRO C C     1 
ATOM   7261  O  O     . PRO C 1 209 ? 48.343  100.614 72.746  1.00 63.13  ? 477 PRO C O     1 
ATOM   7262  C  CB    . PRO C 1 209 ? 51.263  100.079 73.424  1.00 63.13  ? 477 PRO C CB    1 
ATOM   7263  C  CG    . PRO C 1 209 ? 51.759  98.694  73.444  1.00 63.13  ? 477 PRO C CG    1 
ATOM   7264  C  CD    . PRO C 1 209 ? 50.538  97.840  73.543  1.00 63.13  ? 477 PRO C CD    1 
ATOM   7265  N  N     . PRO C 1 210 ? 48.608  102.036 74.461  1.00 64.36  ? 478 PRO C N     1 
ATOM   7266  C  CA    . PRO C 1 210 ? 47.400  102.786 74.120  1.00 64.36  ? 478 PRO C CA    1 
ATOM   7267  C  C     . PRO C 1 210 ? 47.574  103.573 72.837  1.00 64.36  ? 478 PRO C C     1 
ATOM   7268  O  O     . PRO C 1 210 ? 48.668  103.729 72.300  1.00 64.36  ? 478 PRO C O     1 
ATOM   7269  C  CB    . PRO C 1 210 ? 47.220  103.713 75.317  1.00 64.36  ? 478 PRO C CB    1 
ATOM   7270  C  CG    . PRO C 1 210 ? 48.588  103.916 75.815  1.00 64.36  ? 478 PRO C CG    1 
ATOM   7271  C  CD    . PRO C 1 210 ? 49.318  102.632 75.602  1.00 64.36  ? 478 PRO C CD    1 
ATOM   7272  N  N     . ASP C 1 211 ? 46.451  104.057 72.345  1.00 70.44  ? 479 ASP C N     1 
ATOM   7273  C  CA    . ASP C 1 211 ? 46.406  104.882 71.155  1.00 70.44  ? 479 ASP C CA    1 
ATOM   7274  C  C     . ASP C 1 211 ? 46.573  106.348 71.548  1.00 70.44  ? 479 ASP C C     1 
ATOM   7275  O  O     . ASP C 1 211 ? 46.992  106.666 72.664  1.00 70.44  ? 479 ASP C O     1 
ATOM   7276  C  CB    . ASP C 1 211 ? 45.116  104.612 70.396  1.00 70.44  ? 479 ASP C CB    1 
ATOM   7277  C  CG    . ASP C 1 211 ? 43.898  104.716 71.276  1.00 70.44  ? 479 ASP C CG    1 
ATOM   7278  O  OD1   . ASP C 1 211 ? 44.056  104.812 72.510  1.00 70.44  ? 479 ASP C OD1   1 
ATOM   7279  O  OD2   . ASP C 1 211 ? 42.779  104.724 70.733  1.00 70.44  ? 479 ASP C OD2   1 
ATOM   7280  N  N     . ILE C 1 212 ? 46.261  107.261 70.625  1.00 64.58  ? 480 ILE C N     1 
ATOM   7281  C  CA    . ILE C 1 212 ? 46.510  108.673 70.887  1.00 64.58  ? 480 ILE C CA    1 
ATOM   7282  C  C     . ILE C 1 212 ? 45.507  109.228 71.888  1.00 64.58  ? 480 ILE C C     1 
ATOM   7283  O  O     . ILE C 1 212 ? 45.850  110.089 72.708  1.00 64.58  ? 480 ILE C O     1 
ATOM   7284  C  CB    . ILE C 1 212 ? 46.524  109.460 69.564  1.00 64.58  ? 480 ILE C CB    1 
ATOM   7285  C  CG1   . ILE C 1 212 ? 46.925  110.906 69.813  1.00 64.58  ? 480 ILE C CG1   1 
ATOM   7286  C  CG2   . ILE C 1 212 ? 45.208  109.363 68.816  1.00 64.58  ? 480 ILE C CG2   1 
ATOM   7287  C  CD1   . ILE C 1 212 ? 47.192  111.653 68.590  1.00 64.58  ? 480 ILE C CD1   1 
ATOM   7288  N  N     . LYS C 1 213 ? 44.282  108.708 71.894  1.00 69.21  ? 481 LYS C N     1 
ATOM   7289  C  CA    . LYS C 1 213 ? 43.313  109.116 72.893  1.00 69.21  ? 481 LYS C CA    1 
ATOM   7290  C  C     . LYS C 1 213 ? 43.650  108.535 74.252  1.00 69.21  ? 481 LYS C C     1 
ATOM   7291  O  O     . LYS C 1 213 ? 43.243  109.093 75.272  1.00 69.21  ? 481 LYS C O     1 
ATOM   7292  C  CB    . LYS C 1 213 ? 41.923  108.676 72.454  1.00 69.21  ? 481 LYS C CB    1 
ATOM   7293  C  CG    . LYS C 1 213 ? 41.513  109.291 71.142  1.00 69.21  ? 481 LYS C CG    1 
ATOM   7294  C  CD    . LYS C 1 213 ? 40.263  108.655 70.584  1.00 69.21  ? 481 LYS C CD    1 
ATOM   7295  C  CE    . LYS C 1 213 ? 39.025  109.116 71.306  1.00 69.21  ? 481 LYS C CE    1 
ATOM   7296  N  NZ    . LYS C 1 213 ? 37.810  108.606 70.619  1.00 69.21  ? 481 LYS C NZ    1 
ATOM   7297  N  N     . GLY C 1 214 ? 44.397  107.441 74.283  1.00 65.38  ? 482 GLY C N     1 
ATOM   7298  C  CA    . GLY C 1 214 ? 44.835  106.854 75.525  1.00 65.38  ? 482 GLY C CA    1 
ATOM   7299  C  C     . GLY C 1 214 ? 46.048  107.558 76.082  1.00 65.38  ? 482 GLY C C     1 
ATOM   7300  O  O     . GLY C 1 214 ? 46.145  107.749 77.295  1.00 65.38  ? 482 GLY C O     1 
ATOM   7301  N  N     . ARG C 1 215 ? 46.983  107.947 75.211  1.00 63.01  ? 483 ARG C N     1 
ATOM   7302  C  CA    . ARG C 1 215 ? 48.154  108.679 75.676  1.00 63.01  ? 483 ARG C CA    1 
ATOM   7303  C  C     . ARG C 1 215 ? 47.796  110.074 76.143  1.00 63.01  ? 483 ARG C C     1 
ATOM   7304  O  O     . ARG C 1 215 ? 48.422  110.586 77.075  1.00 63.01  ? 483 ARG C O     1 
ATOM   7305  C  CB    . ARG C 1 215 ? 49.204  108.790 74.581  1.00 63.01  ? 483 ARG C CB    1 
ATOM   7306  C  CG    . ARG C 1 215 ? 49.959  107.539 74.287  1.00 63.01  ? 483 ARG C CG    1 
ATOM   7307  C  CD    . ARG C 1 215 ? 51.112  107.905 73.415  1.00 63.01  ? 483 ARG C CD    1 
ATOM   7308  N  NE    . ARG C 1 215 ? 50.637  108.519 72.188  1.00 63.01  ? 483 ARG C NE    1 
ATOM   7309  C  CZ    . ARG C 1 215 ? 50.348  107.845 71.088  1.00 63.01  ? 483 ARG C CZ    1 
ATOM   7310  N  NH1   . ARG C 1 215 ? 50.503  106.533 71.063  1.00 63.01  ? 483 ARG C NH1   1 
ATOM   7311  N  NH2   . ARG C 1 215 ? 49.914  108.478 70.012  1.00 63.01  ? 483 ARG C NH2   1 
ATOM   7312  N  N     . ALA C 1 216 ? 46.804  110.698 75.509  1.00 59.58  ? 484 ALA C N     1 
ATOM   7313  C  CA    . ALA C 1 216 ? 46.385  112.034 75.905  1.00 59.58  ? 484 ALA C CA    1 
ATOM   7314  C  C     . ALA C 1 216 ? 45.783  112.046 77.298  1.00 59.58  ? 484 ALA C C     1 
ATOM   7315  O  O     . ALA C 1 216 ? 45.852  113.067 77.985  1.00 59.58  ? 484 ALA C O     1 
ATOM   7316  C  CB    . ALA C 1 216 ? 45.387  112.594 74.897  1.00 59.58  ? 484 ALA C CB    1 
ATOM   7317  N  N     . SER C 1 217 ? 45.204  110.933 77.735  1.00 61.45  ? 485 SER C N     1 
ATOM   7318  C  CA    . SER C 1 217 ? 44.722  110.824 79.101  1.00 61.45  ? 485 SER C CA    1 
ATOM   7319  C  C     . SER C 1 217 ? 45.793  110.356 80.069  1.00 61.45  ? 485 SER C C     1 
ATOM   7320  O  O     . SER C 1 217 ? 45.648  110.571 81.273  1.00 61.45  ? 485 SER C O     1 
ATOM   7321  C  CB    . SER C 1 217 ? 43.531  109.876 79.166  1.00 61.45  ? 485 SER C CB    1 
ATOM   7322  O  OG    . SER C 1 217 ? 42.460  110.368 78.385  1.00 61.45  ? 485 SER C OG    1 
ATOM   7323  N  N     . ILE C 1 218 ? 46.854  109.717 79.583  1.00 58.31  ? 486 ILE C N     1 
ATOM   7324  C  CA    . ILE C 1 218 ? 47.967  109.407 80.469  1.00 58.31  ? 486 ILE C CA    1 
ATOM   7325  C  C     . ILE C 1 218 ? 48.783  110.668 80.753  1.00 58.31  ? 486 ILE C C     1 
ATOM   7326  O  O     . ILE C 1 218 ? 49.322  110.829 81.855  1.00 58.31  ? 486 ILE C O     1 
ATOM   7327  C  CB    . ILE C 1 218 ? 48.801  108.258 79.872  1.00 58.31  ? 486 ILE C CB    1 
ATOM   7328  C  CG1   . ILE C 1 218 ? 47.974  106.981 79.867  1.00 58.31  ? 486 ILE C CG1   1 
ATOM   7329  C  CG2   . ILE C 1 218 ? 50.026  107.955 80.683  1.00 58.31  ? 486 ILE C CG2   1 
ATOM   7330  C  CD1   . ILE C 1 218 ? 48.582  105.856 79.093  1.00 58.31  ? 486 ILE C CD1   1 
ATOM   7331  N  N     . PHE C 1 219 ? 48.838  111.605 79.805  1.00 56.58  ? 487 PHE C N     1 
ATOM   7332  C  CA    . PHE C 1 219 ? 49.447  112.898 80.098  1.00 56.58  ? 487 PHE C CA    1 
ATOM   7333  C  C     . PHE C 1 219 ? 48.639  113.688 81.119  1.00 56.58  ? 487 PHE C C     1 
ATOM   7334  O  O     . PHE C 1 219 ? 49.220  114.376 81.961  1.00 56.58  ? 487 PHE C O     1 
ATOM   7335  C  CB    . PHE C 1 219 ? 49.623  113.720 78.825  1.00 56.58  ? 487 PHE C CB    1 
ATOM   7336  C  CG    . PHE C 1 219 ? 50.857  113.388 78.046  1.00 56.58  ? 487 PHE C CG    1 
ATOM   7337  C  CD1   . PHE C 1 219 ? 52.084  113.860 78.462  1.00 56.58  ? 487 PHE C CD1   1 
ATOM   7338  C  CD2   . PHE C 1 219 ? 50.792  112.660 76.878  1.00 56.58  ? 487 PHE C CD2   1 
ATOM   7339  C  CE1   . PHE C 1 219 ? 53.224  113.574 77.761  1.00 56.58  ? 487 PHE C CE1   1 
ATOM   7340  C  CE2   . PHE C 1 219 ? 51.930  112.379 76.162  1.00 56.58  ? 487 PHE C CE2   1 
ATOM   7341  C  CZ    . PHE C 1 219 ? 53.146  112.831 76.608  1.00 56.58  ? 487 PHE C CZ    1 
ATOM   7342  N  N     . LYS C 1 220 ? 47.308  113.586 81.083  1.00 59.47  ? 488 LYS C N     1 
ATOM   7343  C  CA    . LYS C 1 220 ? 46.476  114.293 82.051  1.00 59.47  ? 488 LYS C CA    1 
ATOM   7344  C  C     . LYS C 1 220 ? 46.678  113.797 83.474  1.00 59.47  ? 488 LYS C C     1 
ATOM   7345  O  O     . LYS C 1 220 ? 46.435  114.552 84.419  1.00 59.47  ? 488 LYS C O     1 
ATOM   7346  C  CB    . LYS C 1 220 ? 45.004  114.164 81.680  1.00 59.47  ? 488 LYS C CB    1 
ATOM   7347  C  CG    . LYS C 1 220 ? 44.627  114.890 80.418  1.00 59.47  ? 488 LYS C CG    1 
ATOM   7348  C  CD    . LYS C 1 220 ? 43.169  114.671 80.079  1.00 59.47  ? 488 LYS C CD    1 
ATOM   7349  C  CE    . LYS C 1 220 ? 42.827  115.278 78.734  1.00 59.47  ? 488 LYS C CE    1 
ATOM   7350  N  NZ    . LYS C 1 220 ? 41.414  115.036 78.353  1.00 59.47  ? 488 LYS C NZ    1 
ATOM   7351  N  N     . VAL C 1 221 ? 47.120  112.556 83.648  1.00 59.56  ? 489 VAL C N     1 
ATOM   7352  C  CA    . VAL C 1 221 ? 47.420  112.055 84.981  1.00 59.56  ? 489 VAL C CA    1 
ATOM   7353  C  C     . VAL C 1 221 ? 48.755  112.600 85.468  1.00 59.56  ? 489 VAL C C     1 
ATOM   7354  O  O     . VAL C 1 221 ? 48.897  112.970 86.638  1.00 59.56  ? 489 VAL C O     1 
ATOM   7355  C  CB    . VAL C 1 221 ? 47.388  110.517 84.971  1.00 59.56  ? 489 VAL C CB    1 
ATOM   7356  C  CG1   . VAL C 1 221 ? 47.815  109.946 86.306  1.00 59.56  ? 489 VAL C CG1   1 
ATOM   7357  C  CG2   . VAL C 1 221 ? 46.004  110.037 84.617  1.00 59.56  ? 489 VAL C CG2   1 
ATOM   7358  N  N     . HIS C 1 222 ? 49.741  112.708 84.582  1.00 56.76  ? 490 HIS C N     1 
ATOM   7359  C  CA    . HIS C 1 222 ? 51.097  113.032 85.000  1.00 56.76  ? 490 HIS C CA    1 
ATOM   7360  C  C     . HIS C 1 222 ? 51.505  114.479 84.757  1.00 56.76  ? 490 HIS C C     1 
ATOM   7361  O  O     . HIS C 1 222 ? 52.525  114.908 85.300  1.00 56.76  ? 490 HIS C O     1 
ATOM   7362  C  CB    . HIS C 1 222 ? 52.089  112.098 84.315  1.00 56.76  ? 490 HIS C CB    1 
ATOM   7363  C  CG    . HIS C 1 222 ? 51.971  110.680 84.760  1.00 56.76  ? 490 HIS C CG    1 
ATOM   7364  N  ND1   . HIS C 1 222 ? 52.324  110.274 86.027  1.00 56.76  ? 490 HIS C ND1   1 
ATOM   7365  C  CD2   . HIS C 1 222 ? 51.573  109.567 84.105  1.00 56.76  ? 490 HIS C CD2   1 
ATOM   7366  C  CE1   . HIS C 1 222 ? 52.123  108.976 86.141  1.00 56.76  ? 490 HIS C CE1   1 
ATOM   7367  N  NE2   . HIS C 1 222 ? 51.671  108.522 84.988  1.00 56.76  ? 490 HIS C NE2   1 
ATOM   7368  N  N     . LEU C 1 223 ? 50.751  115.247 83.973  1.00 57.52  ? 491 LEU C N     1 
ATOM   7369  C  CA    . LEU C 1 223 ? 50.955  116.689 83.970  1.00 57.52  ? 491 LEU C CA    1 
ATOM   7370  C  C     . LEU C 1 223 ? 50.409  117.346 85.221  1.00 57.52  ? 491 LEU C C     1 
ATOM   7371  O  O     . LEU C 1 223 ? 50.760  118.493 85.509  1.00 57.52  ? 491 LEU C O     1 
ATOM   7372  C  CB    . LEU C 1 223 ? 50.303  117.331 82.751  1.00 57.52  ? 491 LEU C CB    1 
ATOM   7373  C  CG    . LEU C 1 223 ? 50.996  117.073 81.427  1.00 57.52  ? 491 LEU C CG    1 
ATOM   7374  C  CD1   . LEU C 1 223 ? 50.145  117.519 80.271  1.00 57.52  ? 491 LEU C CD1   1 
ATOM   7375  C  CD2   . LEU C 1 223 ? 52.296  117.807 81.430  1.00 57.52  ? 491 LEU C CD2   1 
ATOM   7376  N  N     . ARG C 1 224 ? 49.574  116.649 85.957  1.00 60.21  ? 492 ARG C N     1 
ATOM   7377  C  CA    . ARG C 1 224 ? 48.872  117.122 87.136  1.00 60.21  ? 492 ARG C CA    1 
ATOM   7378  C  C     . ARG C 1 224 ? 49.771  117.507 88.320  1.00 60.21  ? 492 ARG C C     1 
ATOM   7379  O  O     . ARG C 1 224 ? 49.462  118.516 88.964  1.00 60.21  ? 492 ARG C O     1 
ATOM   7380  C  CB    . ARG C 1 224 ? 47.836  116.057 87.510  1.00 60.21  ? 492 ARG C CB    1 
ATOM   7381  C  CG    . ARG C 1 224 ? 46.857  116.405 88.586  1.00 60.21  ? 492 ARG C CG    1 
ATOM   7382  C  CD    . ARG C 1 224 ? 45.850  115.278 88.666  1.00 60.21  ? 492 ARG C CD    1 
ATOM   7383  N  NE    . ARG C 1 224 ? 46.465  114.037 89.124  1.00 60.21  ? 492 ARG C NE    1 
ATOM   7384  C  CZ    . ARG C 1 224 ? 45.905  112.839 89.002  1.00 60.21  ? 492 ARG C CZ    1 
ATOM   7385  N  NH1   . ARG C 1 224 ? 44.727  112.714 88.412  1.00 60.21  ? 492 ARG C NH1   1 
ATOM   7386  N  NH2   . ARG C 1 224 ? 46.532  111.763 89.456  1.00 60.21  ? 492 ARG C NH2   1 
ATOM   7387  N  N     . PRO C 1 225 ? 50.862  116.814 88.662  1.00 58.36  ? 493 PRO C N     1 
ATOM   7388  C  CA    . PRO C 1 225 ? 51.733  117.356 89.717  1.00 58.36  ? 493 PRO C CA    1 
ATOM   7389  C  C     . PRO C 1 225 ? 52.848  118.281 89.249  1.00 58.36  ? 493 PRO C C     1 
ATOM   7390  O  O     . PRO C 1 225 ? 53.719  118.601 90.060  1.00 58.36  ? 493 PRO C O     1 
ATOM   7391  C  CB    . PRO C 1 225 ? 52.335  116.090 90.337  1.00 58.36  ? 493 PRO C CB    1 
ATOM   7392  C  CG    . PRO C 1 225 ? 52.413  115.169 89.263  1.00 58.36  ? 493 PRO C CG    1 
ATOM   7393  C  CD    . PRO C 1 225 ? 51.209  115.397 88.421  1.00 58.36  ? 493 PRO C CD    1 
ATOM   7394  N  N     . LEU C 1 226 ? 52.865  118.725 87.999  1.00 61.50  ? 494 LEU C N     1 
ATOM   7395  C  CA    . LEU C 1 226 ? 53.920  119.617 87.544  1.00 61.50  ? 494 LEU C CA    1 
ATOM   7396  C  C     . LEU C 1 226 ? 53.563  121.063 87.873  1.00 61.50  ? 494 LEU C C     1 
ATOM   7397  O  O     . LEU C 1 226 ? 52.625  121.345 88.619  1.00 61.50  ? 494 LEU C O     1 
ATOM   7398  C  CB    . LEU C 1 226 ? 54.175  119.458 86.050  1.00 61.50  ? 494 LEU C CB    1 
ATOM   7399  C  CG    . LEU C 1 226 ? 54.741  118.132 85.553  1.00 61.50  ? 494 LEU C CG    1 
ATOM   7400  C  CD1   . LEU C 1 226 ? 54.987  118.216 84.063  1.00 61.50  ? 494 LEU C CD1   1 
ATOM   7401  C  CD2   . LEU C 1 226 ? 55.999  117.739 86.292  1.00 61.50  ? 494 LEU C CD2   1 
ATOM   7402  N  N     . LYS C 1 227 ? 54.321  121.998 87.312  1.00 66.40  ? 495 LYS C N     1 
ATOM   7403  C  CA    . LYS C 1 227 ? 54.062  123.426 87.469  1.00 66.40  ? 495 LYS C CA    1 
ATOM   7404  C  C     . LYS C 1 227 ? 54.298  124.085 86.116  1.00 66.40  ? 495 LYS C C     1 
ATOM   7405  O  O     . LYS C 1 227 ? 55.442  124.356 85.747  1.00 66.40  ? 495 LYS C O     1 
ATOM   7406  C  CB    . LYS C 1 227 ? 54.950  124.042 88.540  1.00 66.40  ? 495 LYS C CB    1 
ATOM   7407  C  CG    . LYS C 1 227 ? 54.677  125.514 88.750  1.00 66.40  ? 495 LYS C CG    1 
ATOM   7408  C  CD    . LYS C 1 227 ? 55.535  126.094 89.840  1.00 66.40  ? 495 LYS C CD    1 
ATOM   7409  C  CE    . LYS C 1 227 ? 55.292  127.578 89.976  1.00 66.40  ? 495 LYS C CE    1 
ATOM   7410  N  NZ    . LYS C 1 227 ? 56.156  128.166 91.030  1.00 66.40  ? 495 LYS C NZ    1 
ATOM   7411  N  N     . LEU C 1 228 ? 53.228  124.339 85.384  1.00 70.34  ? 496 LEU C N     1 
ATOM   7412  C  CA    . LEU C 1 228 ? 53.349  124.933 84.066  1.00 70.34  ? 496 LEU C CA    1 
ATOM   7413  C  C     . LEU C 1 228 ? 53.292  126.453 84.189  1.00 70.34  ? 496 LEU C C     1 
ATOM   7414  O  O     . LEU C 1 228 ? 53.274  127.004 85.290  1.00 70.34  ? 496 LEU C O     1 
ATOM   7415  C  CB    . LEU C 1 228 ? 52.266  124.377 83.154  1.00 70.34  ? 496 LEU C CB    1 
ATOM   7416  C  CG    . LEU C 1 228 ? 52.392  122.873 82.947  1.00 70.34  ? 496 LEU C CG    1 
ATOM   7417  C  CD1   . LEU C 1 228 ? 51.234  122.373 82.138  1.00 70.34  ? 496 LEU C CD1   1 
ATOM   7418  C  CD2   . LEU C 1 228 ? 53.693  122.542 82.262  1.00 70.34  ? 496 LEU C CD2   1 
ATOM   7419  N  N     . ASP C 1 229 ? 53.231  127.146 83.056  1.00 76.14  ? 497 ASP C N     1 
ATOM   7420  C  CA    . ASP C 1 229 ? 53.320  128.600 83.023  1.00 76.14  ? 497 ASP C CA    1 
ATOM   7421  C  C     . ASP C 1 229 ? 52.019  129.241 83.502  1.00 76.14  ? 497 ASP C C     1 
ATOM   7422  O  O     . ASP C 1 229 ? 51.101  128.581 83.996  1.00 76.14  ? 497 ASP C O     1 
ATOM   7423  C  CB    . ASP C 1 229 ? 53.644  129.079 81.613  1.00 76.14  ? 497 ASP C CB    1 
ATOM   7424  C  CG    . ASP C 1 229 ? 55.033  128.709 81.171  1.00 76.14  ? 497 ASP C CG    1 
ATOM   7425  O  OD1   . ASP C 1 229 ? 55.923  128.588 82.030  1.00 76.14  ? 497 ASP C OD1   1 
ATOM   7426  O  OD2   . ASP C 1 229 ? 55.235  128.549 79.952  1.00 76.14  ? 497 ASP C OD2   1 
ATOM   7427  N  N     . SER C 1 230 ? 51.936  130.564 83.359  1.00 80.91  ? 498 SER C N     1 
ATOM   7428  C  CA    . SER C 1 230 ? 50.645  131.232 83.452  1.00 80.91  ? 498 SER C CA    1 
ATOM   7429  C  C     . SER C 1 230 ? 49.768  130.876 82.262  1.00 80.91  ? 498 SER C C     1 
ATOM   7430  O  O     . SER C 1 230 ? 48.539  130.839 82.384  1.00 80.91  ? 498 SER C O     1 
ATOM   7431  C  CB    . SER C 1 230 ? 50.842  132.743 83.548  1.00 80.91  ? 498 SER C CB    1 
ATOM   7432  O  OG    . SER C 1 230 ? 51.425  133.251 82.362  1.00 80.91  ? 498 SER C OG    1 
ATOM   7433  N  N     . THR C 1 231 ? 50.380  130.616 81.112  1.00 79.28  ? 499 THR C N     1 
ATOM   7434  C  CA    . THR C 1 231 ? 49.728  129.951 79.994  1.00 79.28  ? 499 THR C CA    1 
ATOM   7435  C  C     . THR C 1 231 ? 49.892  128.440 80.179  1.00 79.28  ? 499 THR C C     1 
ATOM   7436  O  O     . THR C 1 231 ? 50.220  127.987 81.279  1.00 79.28  ? 499 THR C O     1 
ATOM   7437  C  CB    . THR C 1 231 ? 50.298  130.479 78.674  1.00 79.28  ? 499 THR C CB    1 
ATOM   7438  O  OG1   . THR C 1 231 ? 49.593  129.887 77.577  1.00 79.28  ? 499 THR C OG1   1 
ATOM   7439  C  CG2   . THR C 1 231 ? 51.783  130.178 78.557  1.00 79.28  ? 499 THR C CG2   1 
ATOM   7440  N  N     . LEU C 1 232 ? 49.646  127.655 79.123  1.00 75.21  ? 500 LEU C N     1 
ATOM   7441  C  CA    . LEU C 1 232 ? 49.808  126.194 79.097  1.00 75.21  ? 500 LEU C CA    1 
ATOM   7442  C  C     . LEU C 1 232 ? 48.907  125.508 80.129  1.00 75.21  ? 500 LEU C C     1 
ATOM   7443  O  O     . LEU C 1 232 ? 49.354  125.001 81.158  1.00 75.21  ? 500 LEU C O     1 
ATOM   7444  C  CB    . LEU C 1 232 ? 51.270  125.767 79.279  1.00 75.21  ? 500 LEU C CB    1 
ATOM   7445  C  CG    . LEU C 1 232 ? 52.213  126.087 78.129  1.00 75.21  ? 500 LEU C CG    1 
ATOM   7446  C  CD1   . LEU C 1 232 ? 53.624  125.703 78.501  1.00 75.21  ? 500 LEU C CD1   1 
ATOM   7447  C  CD2   . LEU C 1 232 ? 51.773  125.355 76.880  1.00 75.21  ? 500 LEU C CD2   1 
ATOM   7448  N  N     . GLU C 1 233 ? 47.610  125.582 79.843  1.00 71.75  ? 501 GLU C N     1 
ATOM   7449  C  CA    . GLU C 1 233 ? 46.625  124.771 80.542  1.00 71.75  ? 501 GLU C CA    1 
ATOM   7450  C  C     . GLU C 1 233 ? 46.957  123.289 80.406  1.00 71.75  ? 501 GLU C C     1 
ATOM   7451  O  O     . GLU C 1 233 ? 47.337  122.822 79.331  1.00 71.75  ? 501 GLU C O     1 
ATOM   7452  C  CB    . GLU C 1 233 ? 45.240  125.060 79.972  1.00 71.75  ? 501 GLU C CB    1 
ATOM   7453  C  CG    . GLU C 1 233 ? 44.108  124.319 80.639  1.00 71.75  ? 501 GLU C CG    1 
ATOM   7454  C  CD    . GLU C 1 233 ? 42.764  124.684 80.052  1.00 71.75  ? 501 GLU C CD    1 
ATOM   7455  O  OE1   . GLU C 1 233 ? 42.733  125.511 79.117  1.00 71.75  ? 501 GLU C OE1   1 
ATOM   7456  O  OE2   . GLU C 1 233 ? 41.741  124.144 80.522  1.00 71.75  ? 501 GLU C OE2   1 
ATOM   7457  N  N     . LYS C 1 234 ? 46.804  122.544 81.505  1.00 66.51  ? 502 LYS C N     1 
ATOM   7458  C  CA    . LYS C 1 234 ? 47.172  121.132 81.544  1.00 66.51  ? 502 LYS C CA    1 
ATOM   7459  C  C     . LYS C 1 234 ? 46.277  120.244 80.691  1.00 66.51  ? 502 LYS C C     1 
ATOM   7460  O  O     . LYS C 1 234 ? 46.617  119.076 80.488  1.00 66.51  ? 502 LYS C O     1 
ATOM   7461  C  CB    . LYS C 1 234 ? 47.148  120.618 82.981  1.00 66.51  ? 502 LYS C CB    1 
ATOM   7462  C  CG    . LYS C 1 234 ? 48.198  121.235 83.871  1.00 66.51  ? 502 LYS C CG    1 
ATOM   7463  C  CD    . LYS C 1 234 ? 48.177  120.652 85.267  1.00 66.51  ? 502 LYS C CD    1 
ATOM   7464  C  CE    . LYS C 1 234 ? 49.215  121.325 86.147  1.00 66.51  ? 502 LYS C CE    1 
ATOM   7465  N  NZ    . LYS C 1 234 ? 49.254  120.735 87.509  1.00 66.51  ? 502 LYS C NZ    1 
ATOM   7466  N  N     . ASP C 1 235 ? 45.150  120.748 80.201  1.00 68.65  ? 503 ASP C N     1 
ATOM   7467  C  CA    . ASP C 1 235 ? 44.280  119.948 79.353  1.00 68.65  ? 503 ASP C CA    1 
ATOM   7468  C  C     . ASP C 1 235 ? 44.688  120.031 77.888  1.00 68.65  ? 503 ASP C C     1 
ATOM   7469  O  O     . ASP C 1 235 ? 44.814  119.004 77.220  1.00 68.65  ? 503 ASP C O     1 
ATOM   7470  C  CB    . ASP C 1 235 ? 42.830  120.398 79.523  1.00 68.65  ? 503 ASP C CB    1 
ATOM   7471  C  CG    . ASP C 1 235 ? 41.860  119.512 78.782  1.00 68.65  ? 503 ASP C CG    1 
ATOM   7472  O  OD1   . ASP C 1 235 ? 41.624  118.377 79.245  1.00 68.65  ? 503 ASP C OD1   1 
ATOM   7473  O  OD2   . ASP C 1 235 ? 41.331  119.949 77.739  1.00 68.65  ? 503 ASP C OD2   1 
ATOM   7474  N  N     . LYS C 1 236 ? 44.893  121.244 77.376  1.00 64.53  ? 504 LYS C N     1 
ATOM   7475  C  CA    . LYS C 1 236 ? 45.277  121.414 75.981  1.00 64.53  ? 504 LYS C CA    1 
ATOM   7476  C  C     . LYS C 1 236 ? 46.699  120.961 75.710  1.00 64.53  ? 504 LYS C C     1 
ATOM   7477  O  O     . LYS C 1 236 ? 47.028  120.657 74.560  1.00 64.53  ? 504 LYS C O     1 
ATOM   7478  C  CB    . LYS C 1 236 ? 45.134  122.873 75.563  1.00 64.53  ? 504 LYS C CB    1 
ATOM   7479  C  CG    . LYS C 1 236 ? 43.714  123.369 75.492  1.00 64.53  ? 504 LYS C CG    1 
ATOM   7480  C  CD    . LYS C 1 236 ? 43.683  124.803 75.010  1.00 64.53  ? 504 LYS C CD    1 
ATOM   7481  C  CE    . LYS C 1 236 ? 42.266  125.336 74.954  1.00 64.53  ? 504 LYS C CE    1 
ATOM   7482  N  NZ    . LYS C 1 236 ? 42.233  126.754 74.509  1.00 64.53  ? 504 LYS C NZ    1 
ATOM   7483  N  N     . LEU C 1 237 ? 47.554  120.933 76.728  1.00 63.29  ? 505 LEU C N     1 
ATOM   7484  C  CA    . LEU C 1 237 ? 48.924  120.494 76.515  1.00 63.29  ? 505 LEU C CA    1 
ATOM   7485  C  C     . LEU C 1 237 ? 49.000  118.987 76.353  1.00 63.29  ? 505 LEU C C     1 
ATOM   7486  O  O     . LEU C 1 237 ? 49.819  118.493 75.570  1.00 63.29  ? 505 LEU C O     1 
ATOM   7487  C  CB    . LEU C 1 237 ? 49.805  120.935 77.676  1.00 63.29  ? 505 LEU C CB    1 
ATOM   7488  C  CG    . LEU C 1 237 ? 51.297  120.693 77.497  1.00 63.29  ? 505 LEU C CG    1 
ATOM   7489  C  CD1   . LEU C 1 237 ? 51.832  121.564 76.388  1.00 63.29  ? 505 LEU C CD1   1 
ATOM   7490  C  CD2   . LEU C 1 237 ? 52.021  120.946 78.782  1.00 63.29  ? 505 LEU C CD2   1 
ATOM   7491  N  N     . ALA C 1 238 ? 48.146  118.256 77.073  1.00 60.87  ? 506 ALA C N     1 
ATOM   7492  C  CA    . ALA C 1 238 ? 48.103  116.802 76.975  1.00 60.87  ? 506 ALA C CA    1 
ATOM   7493  C  C     . ALA C 1 238 ? 47.692  116.335 75.587  1.00 60.87  ? 506 ALA C C     1 
ATOM   7494  O  O     . ALA C 1 238 ? 48.125  115.272 75.138  1.00 60.87  ? 506 ALA C O     1 
ATOM   7495  C  CB    . ALA C 1 238 ? 47.137  116.249 78.014  1.00 60.87  ? 506 ALA C CB    1 
ATOM   7496  N  N     . ARG C 1 239 ? 46.861  117.113 74.896  1.00 64.19  ? 507 ARG C N     1 
ATOM   7497  C  CA    . ARG C 1 239 ? 46.544  116.799 73.510  1.00 64.19  ? 507 ARG C CA    1 
ATOM   7498  C  C     . ARG C 1 239 ? 47.741  117.051 72.609  1.00 64.19  ? 507 ARG C C     1 
ATOM   7499  O  O     . ARG C 1 239 ? 47.993  116.281 71.676  1.00 64.19  ? 507 ARG C O     1 
ATOM   7500  C  CB    . ARG C 1 239 ? 45.357  117.630 73.038  1.00 64.19  ? 507 ARG C CB    1 
ATOM   7501  C  CG    . ARG C 1 239 ? 44.045  117.312 73.704  1.00 64.19  ? 507 ARG C CG    1 
ATOM   7502  C  CD    . ARG C 1 239 ? 42.949  118.176 73.122  1.00 64.19  ? 507 ARG C CD    1 
ATOM   7503  N  NE    . ARG C 1 239 ? 41.658  117.856 73.706  1.00 64.19  ? 507 ARG C NE    1 
ATOM   7504  C  CZ    . ARG C 1 239 ? 41.158  118.469 74.768  1.00 64.19  ? 507 ARG C CZ    1 
ATOM   7505  N  NH1   . ARG C 1 239 ? 41.840  119.441 75.351  1.00 64.19  ? 507 ARG C NH1   1 
ATOM   7506  N  NH2   . ARG C 1 239 ? 39.974  118.116 75.242  1.00 64.19  ? 507 ARG C NH2   1 
ATOM   7507  N  N     . LYS C 1 240 ? 48.482  118.129 72.869  1.00 59.00  ? 508 LYS C N     1 
ATOM   7508  C  CA    . LYS C 1 240 ? 49.676  118.424 72.090  1.00 59.00  ? 508 LYS C CA    1 
ATOM   7509  C  C     . LYS C 1 240 ? 50.762  117.389 72.330  1.00 59.00  ? 508 LYS C C     1 
ATOM   7510  O  O     . LYS C 1 240 ? 51.442  116.965 71.391  1.00 59.00  ? 508 LYS C O     1 
ATOM   7511  C  CB    . LYS C 1 240 ? 50.189  119.819 72.434  1.00 59.00  ? 508 LYS C CB    1 
ATOM   7512  C  CG    . LYS C 1 240 ? 51.424  120.223 71.673  1.00 59.00  ? 508 LYS C CG    1 
ATOM   7513  C  CD    . LYS C 1 240 ? 51.104  120.388 70.210  1.00 59.00  ? 508 LYS C CD    1 
ATOM   7514  C  CE    . LYS C 1 240 ? 52.313  120.854 69.428  1.00 59.00  ? 508 LYS C CE    1 
ATOM   7515  N  NZ    . LYS C 1 240 ? 52.013  120.924 67.973  1.00 59.00  ? 508 LYS C NZ    1 
ATOM   7516  N  N     . LEU C 1 241 ? 50.918  116.943 73.570  1.00 59.04  ? 509 LEU C N     1 
ATOM   7517  C  CA    . LEU C 1 241 ? 52.018  116.047 73.881  1.00 59.04  ? 509 LEU C CA    1 
ATOM   7518  C  C     . LEU C 1 241 ? 51.774  114.621 73.422  1.00 59.04  ? 509 LEU C C     1 
ATOM   7519  O  O     . LEU C 1 241 ? 52.735  113.890 73.168  1.00 59.04  ? 509 LEU C O     1 
ATOM   7520  C  CB    . LEU C 1 241 ? 52.300  116.062 75.373  1.00 59.04  ? 509 LEU C CB    1 
ATOM   7521  C  CG    . LEU C 1 241 ? 52.944  117.338 75.873  1.00 59.04  ? 509 LEU C CG    1 
ATOM   7522  C  CD1   . LEU C 1 241 ? 53.087  117.280 77.371  1.00 59.04  ? 509 LEU C CD1   1 
ATOM   7523  C  CD2   . LEU C 1 241 ? 54.280  117.497 75.203  1.00 59.04  ? 509 LEU C CD2   1 
ATOM   7524  N  N     . ALA C 1 242 ? 50.521  114.194 73.313  1.00 57.70  ? 510 ALA C N     1 
ATOM   7525  C  CA    . ALA C 1 242 ? 50.273  112.876 72.749  1.00 57.70  ? 510 ALA C CA    1 
ATOM   7526  C  C     . ALA C 1 242 ? 50.449  112.867 71.240  1.00 57.70  ? 510 ALA C C     1 
ATOM   7527  O  O     . ALA C 1 242 ? 50.659  111.801 70.661  1.00 57.70  ? 510 ALA C O     1 
ATOM   7528  C  CB    . ALA C 1 242 ? 48.875  112.404 73.121  1.00 57.70  ? 510 ALA C CB    1 
ATOM   7529  N  N     . SER C 1 243 ? 50.362  114.031 70.596  1.00 58.34  ? 511 SER C N     1 
ATOM   7530  C  CA    . SER C 1 243 ? 50.636  114.117 69.169  1.00 58.34  ? 511 SER C CA    1 
ATOM   7531  C  C     . SER C 1 243 ? 52.108  113.900 68.888  1.00 58.34  ? 511 SER C C     1 
ATOM   7532  O  O     . SER C 1 243 ? 52.471  113.186 67.949  1.00 58.34  ? 511 SER C O     1 
ATOM   7533  C  CB    . SER C 1 243 ? 50.214  115.480 68.637  1.00 58.34  ? 511 SER C CB    1 
ATOM   7534  O  OG    . SER C 1 243 ? 48.838  115.695 68.833  1.00 58.34  ? 511 SER C OG    1 
ATOM   7535  N  N     . LEU C 1 244 ? 52.970  114.505 69.694  1.00 57.39  ? 512 LEU C N     1 
ATOM   7536  C  CA    . LEU C 1 244 ? 54.405  114.432 69.485  1.00 57.39  ? 512 LEU C CA    1 
ATOM   7537  C  C     . LEU C 1 244 ? 55.004  113.112 69.939  1.00 57.39  ? 512 LEU C C     1 
ATOM   7538  O  O     . LEU C 1 244 ? 56.208  112.910 69.770  1.00 57.39  ? 512 LEU C O     1 
ATOM   7539  C  CB    . LEU C 1 244 ? 55.093  115.580 70.217  1.00 57.39  ? 512 LEU C CB    1 
ATOM   7540  C  CG    . LEU C 1 244 ? 54.676  116.975 69.776  1.00 57.39  ? 512 LEU C CG    1 
ATOM   7541  C  CD1   . LEU C 1 244 ? 55.324  118.004 70.666  1.00 57.39  ? 512 LEU C CD1   1 
ATOM   7542  C  CD2   . LEU C 1 244 ? 55.048  117.203 68.336  1.00 57.39  ? 512 LEU C CD2   1 
ATOM   7543  N  N     . THR C 1 245 ? 54.211  112.206 70.503  1.00 57.18  ? 513 THR C N     1 
ATOM   7544  C  CA    . THR C 1 245 ? 54.714  110.933 71.015  1.00 57.18  ? 513 THR C CA    1 
ATOM   7545  C  C     . THR C 1 245 ? 53.963  109.743 70.429  1.00 57.18  ? 513 THR C C     1 
ATOM   7546  O  O     . THR C 1 245 ? 53.196  109.087 71.139  1.00 57.18  ? 513 THR C O     1 
ATOM   7547  C  CB    . THR C 1 245 ? 54.599  110.896 72.537  1.00 57.18  ? 513 THR C CB    1 
ATOM   7548  O  OG1   . THR C 1 245 ? 53.238  111.108 72.917  1.00 57.18  ? 513 THR C OG1   1 
ATOM   7549  C  CG2   . THR C 1 245 ? 55.470  111.933 73.183  1.00 57.18  ? 513 THR C CG2   1 
ATOM   7550  N  N     . PRO C 1 246 ? 54.179  109.403 69.157  1.00 55.99  ? 514 PRO C N     1 
ATOM   7551  C  CA    . PRO C 1 246 ? 53.515  108.215 68.617  1.00 55.99  ? 514 PRO C CA    1 
ATOM   7552  C  C     . PRO C 1 246 ? 54.193  106.946 69.085  1.00 55.99  ? 514 PRO C C     1 
ATOM   7553  O  O     . PRO C 1 246 ? 55.415  106.884 69.226  1.00 55.99  ? 514 PRO C O     1 
ATOM   7554  C  CB    . PRO C 1 246 ? 53.672  108.375 67.105  1.00 55.99  ? 514 PRO C CB    1 
ATOM   7555  C  CG    . PRO C 1 246 ? 54.020  109.776 66.898  1.00 55.99  ? 514 PRO C CG    1 
ATOM   7556  C  CD    . PRO C 1 246 ? 54.847  110.141 68.077  1.00 55.99  ? 514 PRO C CD    1 
ATOM   7557  N  N     . GLY C 1 247 ? 53.385  105.922 69.318  1.00 56.85  ? 515 GLY C N     1 
ATOM   7558  C  CA    . GLY C 1 247 ? 53.903  104.619 69.650  1.00 56.85  ? 515 GLY C CA    1 
ATOM   7559  C  C     . GLY C 1 247 ? 54.451  104.465 71.044  1.00 56.85  ? 515 GLY C C     1 
ATOM   7560  O  O     . GLY C 1 247 ? 54.988  103.400 71.358  1.00 56.85  ? 515 GLY C O     1 
ATOM   7561  N  N     . PHE C 1 248 ? 54.338  105.476 71.897  1.00 57.99  ? 516 PHE C N     1 
ATOM   7562  C  CA    . PHE C 1 248 ? 54.809  105.321 73.260  1.00 57.99  ? 516 PHE C CA    1 
ATOM   7563  C  C     . PHE C 1 248 ? 53.842  104.464 74.067  1.00 57.99  ? 516 PHE C C     1 
ATOM   7564  O  O     . PHE C 1 248 ? 52.800  104.016 73.585  1.00 57.99  ? 516 PHE C O     1 
ATOM   7565  C  CB    . PHE C 1 248 ? 55.007  106.672 73.937  1.00 57.99  ? 516 PHE C CB    1 
ATOM   7566  C  CG    . PHE C 1 248 ? 56.287  107.363 73.576  1.00 57.99  ? 516 PHE C CG    1 
ATOM   7567  C  CD1   . PHE C 1 248 ? 57.213  106.776 72.732  1.00 57.99  ? 516 PHE C CD1   1 
ATOM   7568  C  CD2   . PHE C 1 248 ? 56.609  108.562 74.173  1.00 57.99  ? 516 PHE C CD2   1 
ATOM   7569  C  CE1   . PHE C 1 248 ? 58.396  107.422 72.428  1.00 57.99  ? 516 PHE C CE1   1 
ATOM   7570  C  CE2   . PHE C 1 248 ? 57.780  109.211 73.869  1.00 57.99  ? 516 PHE C CE2   1 
ATOM   7571  C  CZ    . PHE C 1 248 ? 58.678  108.637 73.003  1.00 57.99  ? 516 PHE C CZ    1 
ATOM   7572  N  N     . SER C 1 249 ? 54.182  104.250 75.320  1.00 57.63  ? 517 SER C N     1 
ATOM   7573  C  CA    . SER C 1 249 ? 53.424  103.366 76.180  1.00 57.63  ? 517 SER C CA    1 
ATOM   7574  C  C     . SER C 1 249 ? 53.005  104.127 77.427  1.00 57.63  ? 517 SER C C     1 
ATOM   7575  O  O     . SER C 1 249 ? 53.120  105.348 77.501  1.00 57.63  ? 517 SER C O     1 
ATOM   7576  C  CB    . SER C 1 249 ? 54.245  102.124 76.513  1.00 57.63  ? 517 SER C CB    1 
ATOM   7577  O  OG    . SER C 1 249 ? 55.396  102.471 77.252  1.00 57.63  ? 517 SER C OG    1 
ATOM   7578  N  N     . GLY C 1 250 ? 52.497  103.391 78.412  1.00 56.81  ? 518 GLY C N     1 
ATOM   7579  C  CA    . GLY C 1 250 ? 52.035  104.023 79.630  1.00 56.81  ? 518 GLY C CA    1 
ATOM   7580  C  C     . GLY C 1 250 ? 53.143  104.562 80.502  1.00 56.81  ? 518 GLY C C     1 
ATOM   7581  O  O     . GLY C 1 250 ? 52.885  105.415 81.352  1.00 56.81  ? 518 GLY C O     1 
ATOM   7582  N  N     . ALA C 1 251 ? 54.372  104.085 80.311  1.00 56.51  ? 519 ALA C N     1 
ATOM   7583  C  CA    . ALA C 1 251 ? 55.510  104.547 81.083  1.00 56.51  ? 519 ALA C CA    1 
ATOM   7584  C  C     . ALA C 1 251 ? 56.442  105.460 80.311  1.00 56.51  ? 519 ALA C C     1 
ATOM   7585  O  O     . ALA C 1 251 ? 57.230  106.173 80.934  1.00 56.51  ? 519 ALA C O     1 
ATOM   7586  C  CB    . ALA C 1 251 ? 56.317  103.357 81.606  1.00 56.51  ? 519 ALA C CB    1 
ATOM   7587  N  N     . ASP C 1 252 ? 56.390  105.443 78.980  1.00 58.96  ? 520 ASP C N     1 
ATOM   7588  C  CA    . ASP C 1 252 ? 57.179  106.389 78.205  1.00 58.96  ? 520 ASP C CA    1 
ATOM   7589  C  C     . ASP C 1 252 ? 56.618  107.795 78.336  1.00 58.96  ? 520 ASP C C     1 
ATOM   7590  O  O     . ASP C 1 252 ? 57.365  108.772 78.240  1.00 58.96  ? 520 ASP C O     1 
ATOM   7591  C  CB    . ASP C 1 252 ? 57.200  105.990 76.735  1.00 58.96  ? 520 ASP C CB    1 
ATOM   7592  C  CG    . ASP C 1 252 ? 57.746  104.602 76.505  1.00 58.96  ? 520 ASP C CG    1 
ATOM   7593  O  OD1   . ASP C 1 252 ? 58.568  104.135 77.309  1.00 58.96  ? 520 ASP C OD1   1 
ATOM   7594  O  OD2   . ASP C 1 252 ? 57.343  103.968 75.509  1.00 58.96  ? 520 ASP C OD2   1 
ATOM   7595  N  N     . VAL C 1 253 ? 55.305  107.913 78.536  1.00 55.50  ? 521 VAL C N     1 
ATOM   7596  C  CA    . VAL C 1 253 ? 54.691  109.198 78.837  1.00 55.50  ? 521 VAL C CA    1 
ATOM   7597  C  C     . VAL C 1 253 ? 55.114  109.675 80.220  1.00 55.50  ? 521 VAL C C     1 
ATOM   7598  O  O     . VAL C 1 253 ? 55.267  110.881 80.449  1.00 55.50  ? 521 VAL C O     1 
ATOM   7599  C  CB    . VAL C 1 253 ? 53.166  109.059 78.691  1.00 55.50  ? 521 VAL C CB    1 
ATOM   7600  C  CG1   . VAL C 1 253 ? 52.442  110.305 79.097  1.00 55.50  ? 521 VAL C CG1   1 
ATOM   7601  C  CG2   . VAL C 1 253 ? 52.826  108.717 77.264  1.00 55.50  ? 521 VAL C CG2   1 
ATOM   7602  N  N     . ALA C 1 254 ? 55.370  108.747 81.142  1.00 55.34  ? 522 ALA C N     1 
ATOM   7603  C  CA    . ALA C 1 254 ? 55.761  109.123 82.495  1.00 55.34  ? 522 ALA C CA    1 
ATOM   7604  C  C     . ALA C 1 254 ? 57.148  109.757 82.554  1.00 55.34  ? 522 ALA C C     1 
ATOM   7605  O  O     . ALA C 1 254 ? 57.395  110.584 83.434  1.00 55.34  ? 522 ALA C O     1 
ATOM   7606  C  CB    . ALA C 1 254 ? 55.706  107.908 83.414  1.00 55.34  ? 522 ALA C CB    1 
ATOM   7607  N  N     . ASN C 1 255 ? 58.065  109.402 81.646  1.00 60.41  ? 523 ASN C N     1 
ATOM   7608  C  CA    . ASN C 1 255 ? 59.346  110.106 81.640  1.00 60.41  ? 523 ASN C CA    1 
ATOM   7609  C  C     . ASN C 1 255 ? 59.270  111.465 80.966  1.00 60.41  ? 523 ASN C C     1 
ATOM   7610  O  O     . ASN C 1 255 ? 59.982  112.389 81.370  1.00 60.41  ? 523 ASN C O     1 
ATOM   7611  C  CB    . ASN C 1 255 ? 60.447  109.305 80.959  1.00 60.41  ? 523 ASN C CB    1 
ATOM   7612  C  CG    . ASN C 1 255 ? 61.096  108.330 81.877  1.00 60.41  ? 523 ASN C CG    1 
ATOM   7613  O  OD1   . ASN C 1 255 ? 60.929  108.407 83.088  1.00 60.41  ? 523 ASN C OD1   1 
ATOM   7614  N  ND2   . ASN C 1 255 ? 62.005  107.545 81.334  1.00 60.41  ? 523 ASN C ND2   1 
ATOM   7615  N  N     . VAL C 1 256 ? 58.464  111.593 79.912  1.00 56.32  ? 524 VAL C N     1 
ATOM   7616  C  CA    . VAL C 1 256 ? 58.358  112.861 79.197  1.00 56.32  ? 524 VAL C CA    1 
ATOM   7617  C  C     . VAL C 1 256 ? 57.744  113.932 80.090  1.00 56.32  ? 524 VAL C C     1 
ATOM   7618  O  O     . VAL C 1 256 ? 58.134  115.104 80.035  1.00 56.32  ? 524 VAL C O     1 
ATOM   7619  C  CB    . VAL C 1 256 ? 57.559  112.639 77.901  1.00 56.32  ? 524 VAL C CB    1 
ATOM   7620  C  CG1   . VAL C 1 256 ? 57.310  113.930 77.176  1.00 56.32  ? 524 VAL C CG1   1 
ATOM   7621  C  CG2   . VAL C 1 256 ? 58.319  111.702 77.002  1.00 56.32  ? 524 VAL C CG2   1 
ATOM   7622  N  N     . CYS C 1 257 ? 56.831  113.541 80.973  1.00 59.33  ? 525 CYS C N     1 
ATOM   7623  C  CA    . CYS C 1 257 ? 56.362  114.467 81.991  1.00 59.33  ? 525 CYS C CA    1 
ATOM   7624  C  C     . CYS C 1 257 ? 57.437  114.728 83.034  1.00 59.33  ? 525 CYS C C     1 
ATOM   7625  O  O     . CYS C 1 257 ? 57.584  115.857 83.509  1.00 59.33  ? 525 CYS C O     1 
ATOM   7626  C  CB    . CYS C 1 257 ? 55.110  113.916 82.654  1.00 59.33  ? 525 CYS C CB    1 
ATOM   7627  S  SG    . CYS C 1 257 ? 53.735  113.817 81.540  1.00 59.33  ? 525 CYS C SG    1 
ATOM   7628  N  N     . ASN C 1 258 ? 58.195  113.698 83.403  1.00 58.75  ? 526 ASN C N     1 
ATOM   7629  C  CA    . ASN C 1 258 ? 59.168  113.851 84.476  1.00 58.75  ? 526 ASN C CA    1 
ATOM   7630  C  C     . ASN C 1 258 ? 60.410  114.578 83.994  1.00 58.75  ? 526 ASN C C     1 
ATOM   7631  O  O     . ASN C 1 258 ? 60.818  115.578 84.590  1.00 58.75  ? 526 ASN C O     1 
ATOM   7632  C  CB    . ASN C 1 258 ? 59.561  112.492 85.040  1.00 58.75  ? 526 ASN C CB    1 
ATOM   7633  C  CG    . ASN C 1 258 ? 60.287  112.600 86.354  1.00 58.75  ? 526 ASN C CG    1 
ATOM   7634  O  OD1   . ASN C 1 258 ? 60.409  113.678 86.924  1.00 58.75  ? 526 ASN C OD1   1 
ATOM   7635  N  ND2   . ASN C 1 258 ? 60.798  111.479 86.836  1.00 58.75  ? 526 ASN C ND2   1 
ATOM   7636  N  N     . GLU C 1 259 ? 61.025  114.095 82.918  1.00 62.66  ? 527 GLU C N     1 
ATOM   7637  C  CA    . GLU C 1 259 ? 62.302  114.650 82.498  1.00 62.66  ? 527 GLU C CA    1 
ATOM   7638  C  C     . GLU C 1 259 ? 62.180  116.008 81.834  1.00 62.66  ? 527 GLU C C     1 
ATOM   7639  O  O     . GLU C 1 259 ? 63.206  116.631 81.564  1.00 62.66  ? 527 GLU C O     1 
ATOM   7640  C  CB    . GLU C 1 259 ? 63.021  113.687 81.560  1.00 62.66  ? 527 GLU C CB    1 
ATOM   7641  C  CG    . GLU C 1 259 ? 63.449  112.413 82.248  1.00 62.66  ? 527 GLU C CG    1 
ATOM   7642  C  CD    . GLU C 1 259 ? 64.207  111.485 81.334  1.00 62.66  ? 527 GLU C CD    1 
ATOM   7643  O  OE1   . GLU C 1 259 ? 64.317  111.797 80.131  1.00 62.66  ? 527 GLU C OE1   1 
ATOM   7644  O  OE2   . GLU C 1 259 ? 64.686  110.440 81.817  1.00 62.66  ? 527 GLU C OE2   1 
ATOM   7645  N  N     . ALA C 1 260 ? 60.973  116.493 81.576  1.00 60.22  ? 528 ALA C N     1 
ATOM   7646  C  CA    . ALA C 1 260 ? 60.829  117.887 81.204  1.00 60.22  ? 528 ALA C CA    1 
ATOM   7647  C  C     . ALA C 1 260 ? 60.907  118.804 82.403  1.00 60.22  ? 528 ALA C C     1 
ATOM   7648  O  O     . ALA C 1 260 ? 61.187  119.992 82.237  1.00 60.22  ? 528 ALA C O     1 
ATOM   7649  C  CB    . ALA C 1 260 ? 59.510  118.115 80.496  1.00 60.22  ? 528 ALA C CB    1 
ATOM   7650  N  N     . ALA C 1 261 ? 60.637  118.291 83.598  1.00 61.57  ? 529 ALA C N     1 
ATOM   7651  C  CA    . ALA C 1 261 ? 60.838  119.080 84.801  1.00 61.57  ? 529 ALA C CA    1 
ATOM   7652  C  C     . ALA C 1 261 ? 62.304  119.123 85.192  1.00 61.57  ? 529 ALA C C     1 
ATOM   7653  O  O     . ALA C 1 261 ? 62.778  120.136 85.714  1.00 61.57  ? 529 ALA C O     1 
ATOM   7654  C  CB    . ALA C 1 261 ? 60.001  118.515 85.941  1.00 61.57  ? 529 ALA C CB    1 
ATOM   7655  N  N     . LEU C 1 262 ? 63.034  118.043 84.929  1.00 60.96  ? 530 LEU C N     1 
ATOM   7656  C  CA    . LEU C 1 262 ? 64.457  118.007 85.217  1.00 60.96  ? 530 LEU C CA    1 
ATOM   7657  C  C     . LEU C 1 262 ? 65.265  118.822 84.226  1.00 60.96  ? 530 LEU C C     1 
ATOM   7658  O  O     . LEU C 1 262 ? 66.406  119.176 84.525  1.00 60.96  ? 530 LEU C O     1 
ATOM   7659  C  CB    . LEU C 1 262 ? 64.935  116.565 85.220  1.00 60.96  ? 530 LEU C CB    1 
ATOM   7660  C  CG    . LEU C 1 262 ? 64.227  115.748 86.288  1.00 60.96  ? 530 LEU C CG    1 
ATOM   7661  C  CD1   . LEU C 1 262 ? 64.575  114.313 86.142  1.00 60.96  ? 530 LEU C CD1   1 
ATOM   7662  C  CD2   . LEU C 1 262 ? 64.590  116.229 87.662  1.00 60.96  ? 530 LEU C CD2   1 
ATOM   7663  N  N     . ILE C 1 263 ? 64.708  119.120 83.055  1.00 62.83  ? 531 ILE C N     1 
ATOM   7664  C  CA    . ILE C 1 263 ? 65.342  120.074 82.153  1.00 62.83  ? 531 ILE C CA    1 
ATOM   7665  C  C     . ILE C 1 263 ? 64.940  121.495 82.523  1.00 62.83  ? 531 ILE C C     1 
ATOM   7666  O  O     . ILE C 1 263 ? 65.754  122.423 82.451  1.00 62.83  ? 531 ILE C O     1 
ATOM   7667  C  CB    . ILE C 1 263 ? 64.988  119.724 80.698  1.00 62.83  ? 531 ILE C CB    1 
ATOM   7668  C  CG1   . ILE C 1 263 ? 65.606  118.387 80.325  1.00 62.83  ? 531 ILE C CG1   1 
ATOM   7669  C  CG2   . ILE C 1 263 ? 65.485  120.767 79.730  1.00 62.83  ? 531 ILE C CG2   1 
ATOM   7670  C  CD1   . ILE C 1 263 ? 65.121  117.857 79.012  1.00 62.83  ? 531 ILE C CD1   1 
ATOM   7671  N  N     . ALA C 1 264 ? 63.694  121.674 82.966  1.00 64.50  ? 532 ALA C N     1 
ATOM   7672  C  CA    . ALA C 1 264 ? 63.219  122.979 83.405  1.00 64.50  ? 532 ALA C CA    1 
ATOM   7673  C  C     . ALA C 1 264 ? 63.955  123.466 84.637  1.00 64.50  ? 532 ALA C C     1 
ATOM   7674  O  O     . ALA C 1 264 ? 64.151  124.673 84.804  1.00 64.50  ? 532 ALA C O     1 
ATOM   7675  C  CB    . ALA C 1 264 ? 61.728  122.922 83.707  1.00 64.50  ? 532 ALA C CB    1 
ATOM   7676  N  N     . ALA C 1 265 ? 64.366  122.559 85.505  1.00 64.51  ? 533 ALA C N     1 
ATOM   7677  C  CA    . ALA C 1 265 ? 65.065  122.958 86.709  1.00 64.51  ? 533 ALA C CA    1 
ATOM   7678  C  C     . ALA C 1 265 ? 66.575  122.859 86.582  1.00 64.51  ? 533 ALA C C     1 
ATOM   7679  O  O     . ALA C 1 265 ? 67.284  123.307 87.485  1.00 64.51  ? 533 ALA C O     1 
ATOM   7680  C  CB    . ALA C 1 265 ? 64.587  122.118 87.886  1.00 64.51  ? 533 ALA C CB    1 
ATOM   7681  N  N     . ARG C 1 266 ? 67.083  122.268 85.502  1.00 69.18  ? 534 ARG C N     1 
ATOM   7682  C  CA    . ARG C 1 266 ? 68.512  122.347 85.238  1.00 69.18  ? 534 ARG C CA    1 
ATOM   7683  C  C     . ARG C 1 266 ? 68.897  123.753 84.814  1.00 69.18  ? 534 ARG C C     1 
ATOM   7684  O  O     . ARG C 1 266 ? 69.941  124.268 85.223  1.00 69.18  ? 534 ARG C O     1 
ATOM   7685  C  CB    . ARG C 1 266 ? 68.914  121.324 84.176  1.00 69.18  ? 534 ARG C CB    1 
ATOM   7686  C  CG    . ARG C 1 266 ? 70.398  121.278 83.925  1.00 69.18  ? 534 ARG C CG    1 
ATOM   7687  C  CD    . ARG C 1 266 ? 70.838  120.149 83.010  1.00 69.18  ? 534 ARG C CD    1 
ATOM   7688  N  NE    . ARG C 1 266 ? 70.309  120.237 81.656  1.00 69.18  ? 534 ARG C NE    1 
ATOM   7689  C  CZ    . ARG C 1 266 ? 69.591  119.283 81.078  1.00 69.18  ? 534 ARG C CZ    1 
ATOM   7690  N  NH1   . ARG C 1 266 ? 69.331  118.161 81.734  1.00 69.18  ? 534 ARG C NH1   1 
ATOM   7691  N  NH2   . ARG C 1 266 ? 69.149  119.440 79.838  1.00 69.18  ? 534 ARG C NH2   1 
ATOM   7692  N  N     . HIS C 1 267 ? 68.051  124.405 84.024  1.00 70.86  ? 535 HIS C N     1 
ATOM   7693  C  CA    . HIS C 1 267 ? 68.298  125.786 83.641  1.00 70.86  ? 535 HIS C CA    1 
ATOM   7694  C  C     . HIS C 1 267 ? 67.813  126.783 84.678  1.00 70.86  ? 535 HIS C C     1 
ATOM   7695  O  O     . HIS C 1 267 ? 67.923  127.989 84.431  1.00 70.86  ? 535 HIS C O     1 
ATOM   7696  C  CB    . HIS C 1 267 ? 67.637  126.094 82.299  1.00 70.86  ? 535 HIS C CB    1 
ATOM   7697  C  CG    . HIS C 1 267 ? 68.184  125.293 81.163  1.00 70.86  ? 535 HIS C CG    1 
ATOM   7698  N  ND1   . HIS C 1 267 ? 67.661  124.074 80.794  1.00 70.86  ? 535 HIS C ND1   1 
ATOM   7699  C  CD2   . HIS C 1 267 ? 69.222  125.524 80.327  1.00 70.86  ? 535 HIS C CD2   1 
ATOM   7700  C  CE1   . HIS C 1 267 ? 68.344  123.595 79.771  1.00 70.86  ? 535 HIS C CE1   1 
ATOM   7701  N  NE2   . HIS C 1 267 ? 69.298  124.456 79.469  1.00 70.86  ? 535 HIS C NE2   1 
ATOM   7702  N  N     . LEU C 1 268 ? 67.285  126.302 85.809  1.00 69.63  ? 536 LEU C N     1 
ATOM   7703  C  CA    . LEU C 1 268 ? 66.790  127.104 86.930  1.00 69.63  ? 536 LEU C CA    1 
ATOM   7704  C  C     . LEU C 1 268 ? 65.699  128.070 86.455  1.00 69.63  ? 536 LEU C C     1 
ATOM   7705  O  O     . LEU C 1 268 ? 65.854  129.291 86.425  1.00 69.63  ? 536 LEU C O     1 
ATOM   7706  C  CB    . LEU C 1 268 ? 67.946  127.825 87.637  1.00 69.63  ? 536 LEU C CB    1 
ATOM   7707  C  CG    . LEU C 1 268 ? 67.704  128.529 88.972  1.00 69.63  ? 536 LEU C CG    1 
ATOM   7708  C  CD1   . LEU C 1 268 ? 67.266  127.528 90.010  1.00 69.63  ? 536 LEU C CD1   1 
ATOM   7709  C  CD2   . LEU C 1 268 ? 68.954  129.254 89.423  1.00 69.63  ? 536 LEU C CD2   1 
ATOM   7710  N  N     . SER C 1 269 ? 64.601  127.466 86.024  1.00 69.56  ? 537 SER C N     1 
ATOM   7711  C  CA    . SER C 1 269 ? 63.450  128.198 85.529  1.00 69.56  ? 537 SER C CA    1 
ATOM   7712  C  C     . SER C 1 269 ? 62.292  128.060 86.504  1.00 69.56  ? 537 SER C C     1 
ATOM   7713  O  O     . SER C 1 269 ? 62.258  127.157 87.343  1.00 69.56  ? 537 SER C O     1 
ATOM   7714  C  CB    . SER C 1 269 ? 63.043  127.702 84.142  1.00 69.56  ? 537 SER C CB    1 
ATOM   7715  O  OG    . SER C 1 269 ? 62.620  126.356 84.207  1.00 69.56  ? 537 SER C OG    1 
ATOM   7716  N  N     . ASP C 1 270 ? 61.336  128.980 86.386  1.00 73.66  ? 538 ASP C N     1 
ATOM   7717  C  CA    . ASP C 1 270 ? 60.241  129.040 87.345  1.00 73.66  ? 538 ASP C CA    1 
ATOM   7718  C  C     . ASP C 1 270 ? 59.106  128.092 86.994  1.00 73.66  ? 538 ASP C C     1 
ATOM   7719  O  O     . ASP C 1 270 ? 58.448  127.565 87.897  1.00 73.66  ? 538 ASP C O     1 
ATOM   7720  C  CB    . ASP C 1 270 ? 59.709  130.467 87.439  1.00 73.66  ? 538 ASP C CB    1 
ATOM   7721  C  CG    . ASP C 1 270 ? 60.693  131.408 88.091  1.00 73.66  ? 538 ASP C CG    1 
ATOM   7722  O  OD1   . ASP C 1 270 ? 61.478  130.944 88.943  1.00 73.66  ? 538 ASP C OD1   1 
ATOM   7723  O  OD2   . ASP C 1 270 ? 60.686  132.609 87.750  1.00 73.66  ? 538 ASP C OD2   1 
ATOM   7724  N  N     . SER C 1 271 ? 58.849  127.871 85.709  1.00 72.21  ? 539 SER C N     1 
ATOM   7725  C  CA    . SER C 1 271 ? 57.747  127.021 85.297  1.00 72.21  ? 539 SER C CA    1 
ATOM   7726  C  C     . SER C 1 271 ? 58.111  126.338 83.992  1.00 72.21  ? 539 SER C C     1 
ATOM   7727  O  O     . SER C 1 271 ? 58.882  126.869 83.191  1.00 72.21  ? 539 SER C O     1 
ATOM   7728  C  CB    . SER C 1 271 ? 56.457  127.823 85.143  1.00 72.21  ? 539 SER C CB    1 
ATOM   7729  O  OG    . SER C 1 271 ? 56.031  128.358 86.383  1.00 72.21  ? 539 SER C OG    1 
ATOM   7730  N  N     . ILE C 1 272 ? 57.533  125.161 83.781  1.00 65.37  ? 540 ILE C N     1 
ATOM   7731  C  CA    . ILE C 1 272 ? 57.922  124.293 82.676  1.00 65.37  ? 540 ILE C CA    1 
ATOM   7732  C  C     . ILE C 1 272 ? 57.286  124.803 81.388  1.00 65.37  ? 540 ILE C C     1 
ATOM   7733  O  O     . ILE C 1 272 ? 56.060  124.805 81.249  1.00 65.37  ? 540 ILE C O     1 
ATOM   7734  C  CB    . ILE C 1 272 ? 57.513  122.843 82.955  1.00 65.37  ? 540 ILE C CB    1 
ATOM   7735  C  CG1   . ILE C 1 272 ? 58.119  122.370 84.268  1.00 65.37  ? 540 ILE C CG1   1 
ATOM   7736  C  CG2   . ILE C 1 272 ? 58.009  121.953 81.869  1.00 65.37  ? 540 ILE C CG2   1 
ATOM   7737  C  CD1   . ILE C 1 272 ? 57.555  121.078 84.751  1.00 65.37  ? 540 ILE C CD1   1 
ATOM   7738  N  N     . ASN C 1 273 ? 58.118  125.230 80.442  1.00 68.76  ? 541 ASN C N     1 
ATOM   7739  C  CA    . ASN C 1 273 ? 57.641  125.726 79.162  1.00 68.76  ? 541 ASN C CA    1 
ATOM   7740  C  C     . ASN C 1 273 ? 57.254  124.564 78.256  1.00 68.76  ? 541 ASN C C     1 
ATOM   7741  O  O     . ASN C 1 273 ? 57.418  123.394 78.601  1.00 68.76  ? 541 ASN C O     1 
ATOM   7742  C  CB    . ASN C 1 273 ? 58.714  126.571 78.485  1.00 68.76  ? 541 ASN C CB    1 
ATOM   7743  C  CG    . ASN C 1 273 ? 59.020  127.835 79.242  1.00 68.76  ? 541 ASN C CG    1 
ATOM   7744  O  OD1   . ASN C 1 273 ? 58.124  128.506 79.743  1.00 68.76  ? 541 ASN C OD1   1 
ATOM   7745  N  ND2   . ASN C 1 273 ? 60.299  128.170 79.332  1.00 68.76  ? 541 ASN C ND2   1 
ATOM   7746  N  N     . GLN C 1 274 ? 56.738  124.886 77.069  1.00 66.69  ? 542 GLN C N     1 
ATOM   7747  C  CA    . GLN C 1 274 ? 56.522  123.840 76.078  1.00 66.69  ? 542 GLN C CA    1 
ATOM   7748  C  C     . GLN C 1 274 ? 57.841  123.374 75.480  1.00 66.69  ? 542 GLN C C     1 
ATOM   7749  O  O     . GLN C 1 274 ? 57.986  122.197 75.138  1.00 66.69  ? 542 GLN C O     1 
ATOM   7750  C  CB    . GLN C 1 274 ? 55.576  124.325 74.982  1.00 66.69  ? 542 GLN C CB    1 
ATOM   7751  C  CG    . GLN C 1 274 ? 55.173  123.250 73.986  1.00 66.69  ? 542 GLN C CG    1 
ATOM   7752  C  CD    . GLN C 1 274 ? 54.149  123.733 72.992  1.00 66.69  ? 542 GLN C CD    1 
ATOM   7753  O  OE1   . GLN C 1 274 ? 53.728  124.887 73.029  1.00 66.69  ? 542 GLN C OE1   1 
ATOM   7754  N  NE2   . GLN C 1 274 ? 53.741  122.852 72.091  1.00 66.69  ? 542 GLN C NE2   1 
ATOM   7755  N  N     . LYS C 1 275 ? 58.833  124.266 75.401  1.00 65.04  ? 543 LYS C N     1 
ATOM   7756  C  CA    . LYS C 1 275 ? 60.147  123.923 74.867  1.00 65.04  ? 543 LYS C CA    1 
ATOM   7757  C  C     . LYS C 1 275 ? 60.917  122.946 75.741  1.00 65.04  ? 543 LYS C C     1 
ATOM   7758  O  O     . LYS C 1 275 ? 61.933  122.415 75.290  1.00 65.04  ? 543 LYS C O     1 
ATOM   7759  C  CB    . LYS C 1 275 ? 60.985  125.185 74.678  1.00 65.04  ? 543 LYS C CB    1 
ATOM   7760  C  CG    . LYS C 1 275 ? 60.402  126.168 73.688  1.00 65.04  ? 543 LYS C CG    1 
ATOM   7761  C  CD    . LYS C 1 275 ? 60.410  125.589 72.287  1.00 65.04  ? 543 LYS C CD    1 
ATOM   7762  C  CE    . LYS C 1 275 ? 59.872  126.584 71.277  1.00 65.04  ? 543 LYS C CE    1 
ATOM   7763  N  NZ    . LYS C 1 275 ? 59.815  126.002 69.909  1.00 65.04  ? 543 LYS C NZ    1 
ATOM   7764  N  N     . HIS C 1 276 ? 60.474  122.701 76.966  1.00 64.34  ? 544 HIS C N     1 
ATOM   7765  C  CA    . HIS C 1 276 ? 61.134  121.749 77.838  1.00 64.34  ? 544 HIS C CA    1 
ATOM   7766  C  C     . HIS C 1 276 ? 60.583  120.343 77.696  1.00 64.34  ? 544 HIS C C     1 
ATOM   7767  O  O     . HIS C 1 276 ? 61.285  119.383 78.026  1.00 64.34  ? 544 HIS C O     1 
ATOM   7768  C  CB    . HIS C 1 276 ? 61.009  122.215 79.285  1.00 64.34  ? 544 HIS C CB    1 
ATOM   7769  C  CG    . HIS C 1 276 ? 61.704  123.511 79.551  1.00 64.34  ? 544 HIS C CG    1 
ATOM   7770  N  ND1   . HIS C 1 276 ? 61.469  124.265 80.677  1.00 64.34  ? 544 HIS C ND1   1 
ATOM   7771  C  CD2   . HIS C 1 276 ? 62.631  124.187 78.834  1.00 64.34  ? 544 HIS C CD2   1 
ATOM   7772  C  CE1   . HIS C 1 276 ? 62.216  125.353 80.642  1.00 64.34  ? 544 HIS C CE1   1 
ATOM   7773  N  NE2   . HIS C 1 276 ? 62.932  125.329 79.533  1.00 64.34  ? 544 HIS C NE2   1 
ATOM   7774  N  N     . PHE C 1 277 ? 59.348  120.198 77.212  1.00 62.28  ? 545 PHE C N     1 
ATOM   7775  C  CA    . PHE C 1 277 ? 58.810  118.868 76.945  1.00 62.28  ? 545 PHE C CA    1 
ATOM   7776  C  C     . PHE C 1 277 ? 59.411  118.280 75.683  1.00 62.28  ? 545 PHE C C     1 
ATOM   7777  O  O     . PHE C 1 277 ? 59.692  117.079 75.624  1.00 62.28  ? 545 PHE C O     1 
ATOM   7778  C  CB    . PHE C 1 277 ? 57.292  118.925 76.818  1.00 62.28  ? 545 PHE C CB    1 
ATOM   7779  C  CG    . PHE C 1 277 ? 56.586  119.175 78.105  1.00 62.28  ? 545 PHE C CG    1 
ATOM   7780  C  CD1   . PHE C 1 277 ? 56.320  118.135 78.975  1.00 62.28  ? 545 PHE C CD1   1 
ATOM   7781  C  CD2   . PHE C 1 277 ? 56.189  120.446 78.445  1.00 62.28  ? 545 PHE C CD2   1 
ATOM   7782  C  CE1   . PHE C 1 277 ? 55.677  118.361 80.164  1.00 62.28  ? 545 PHE C CE1   1 
ATOM   7783  C  CE2   . PHE C 1 277 ? 55.537  120.677 79.626  1.00 62.28  ? 545 PHE C CE2   1 
ATOM   7784  C  CZ    . PHE C 1 277 ? 55.283  119.633 80.489  1.00 62.28  ? 545 PHE C CZ    1 
ATOM   7785  N  N     . GLU C 1 278 ? 59.598  119.112 74.661  1.00 63.71  ? 546 GLU C N     1 
ATOM   7786  C  CA    . GLU C 1 278 ? 60.168  118.647 73.408  1.00 63.71  ? 546 GLU C CA    1 
ATOM   7787  C  C     . GLU C 1 278 ? 61.619  118.228 73.578  1.00 63.71  ? 546 GLU C C     1 
ATOM   7788  O  O     . GLU C 1 278 ? 62.085  117.318 72.888  1.00 63.71  ? 546 GLU C O     1 
ATOM   7789  C  CB    . GLU C 1 278 ? 60.046  119.743 72.360  1.00 63.71  ? 546 GLU C CB    1 
ATOM   7790  C  CG    . GLU C 1 278 ? 58.619  120.069 71.998  1.00 63.71  ? 546 GLU C CG    1 
ATOM   7791  C  CD    . GLU C 1 278 ? 58.519  121.254 71.062  1.00 63.71  ? 546 GLU C CD    1 
ATOM   7792  O  OE1   . GLU C 1 278 ? 59.556  121.906 70.821  1.00 63.71  ? 546 GLU C OE1   1 
ATOM   7793  O  OE2   . GLU C 1 278 ? 57.407  121.538 70.568  1.00 63.71  ? 546 GLU C OE2   1 
ATOM   7794  N  N     . GLN C 1 279 ? 62.336  118.850 74.507  1.00 62.62  ? 547 GLN C N     1 
ATOM   7795  C  CA    . GLN C 1 279 ? 63.670  118.394 74.853  1.00 62.62  ? 547 GLN C CA    1 
ATOM   7796  C  C     . GLN C 1 279 ? 63.649  117.157 75.731  1.00 62.62  ? 547 GLN C C     1 
ATOM   7797  O  O     . GLN C 1 279 ? 64.694  116.526 75.905  1.00 62.62  ? 547 GLN C O     1 
ATOM   7798  C  CB    . GLN C 1 279 ? 64.438  119.507 75.552  1.00 62.62  ? 547 GLN C CB    1 
ATOM   7799  C  CG    . GLN C 1 279 ? 64.678  120.696 74.663  1.00 62.62  ? 547 GLN C CG    1 
ATOM   7800  C  CD    . GLN C 1 279 ? 65.398  121.808 75.375  1.00 62.62  ? 547 GLN C CD    1 
ATOM   7801  O  OE1   . GLN C 1 279 ? 65.697  121.706 76.558  1.00 62.62  ? 547 GLN C OE1   1 
ATOM   7802  N  NE2   . GLN C 1 279 ? 65.672  122.888 74.659  1.00 62.62  ? 547 GLN C NE2   1 
ATOM   7803  N  N     . ALA C 1 280 ? 62.500  116.798 76.289  1.00 60.09  ? 548 ALA C N     1 
ATOM   7804  C  CA    . ALA C 1 280 ? 62.377  115.530 76.985  1.00 60.09  ? 548 ALA C CA    1 
ATOM   7805  C  C     . ALA C 1 280 ? 61.964  114.405 76.057  1.00 60.09  ? 548 ALA C C     1 
ATOM   7806  O  O     . ALA C 1 280 ? 62.238  113.242 76.359  1.00 60.09  ? 548 ALA C O     1 
ATOM   7807  C  CB    . ALA C 1 280 ? 61.371  115.643 78.130  1.00 60.09  ? 548 ALA C CB    1 
ATOM   7808  N  N     . ILE C 1 281 ? 61.302  114.723 74.946  1.00 59.61  ? 549 ILE C N     1 
ATOM   7809  C  CA    . ILE C 1 281 ? 60.983  113.706 73.950  1.00 59.61  ? 549 ILE C CA    1 
ATOM   7810  C  C     . ILE C 1 281 ? 62.234  113.300 73.190  1.00 59.61  ? 549 ILE C C     1 
ATOM   7811  O  O     . ILE C 1 281 ? 62.561  112.113 73.084  1.00 59.61  ? 549 ILE C O     1 
ATOM   7812  C  CB    . ILE C 1 281 ? 59.887  114.218 73.002  1.00 59.61  ? 549 ILE C CB    1 
ATOM   7813  C  CG1   . ILE C 1 281 ? 58.556  114.280 73.734  1.00 59.61  ? 549 ILE C CG1   1 
ATOM   7814  C  CG2   . ILE C 1 281 ? 59.782  113.359 71.773  1.00 59.61  ? 549 ILE C CG2   1 
ATOM   7815  C  CD1   . ILE C 1 281 ? 57.508  115.052 73.009  1.00 59.61  ? 549 ILE C CD1   1 
ATOM   7816  N  N     . GLU C 1 282 ? 62.965  114.286 72.675  1.00 62.00  ? 550 GLU C N     1 
ATOM   7817  C  CA    . GLU C 1 282 ? 64.115  114.040 71.820  1.00 62.00  ? 550 GLU C CA    1 
ATOM   7818  C  C     . GLU C 1 282 ? 65.285  113.421 72.566  1.00 62.00  ? 550 GLU C C     1 
ATOM   7819  O  O     . GLU C 1 282 ? 66.144  112.803 71.937  1.00 62.00  ? 550 GLU C O     1 
ATOM   7820  C  CB    . GLU C 1 282 ? 64.526  115.352 71.176  1.00 62.00  ? 550 GLU C CB    1 
ATOM   7821  C  CG    . GLU C 1 282 ? 63.463  115.906 70.262  1.00 62.00  ? 550 GLU C CG    1 
ATOM   7822  C  CD    . GLU C 1 282 ? 63.780  117.293 69.762  1.00 62.00  ? 550 GLU C CD    1 
ATOM   7823  O  OE1   . GLU C 1 282 ? 64.816  117.854 70.174  1.00 62.00  ? 550 GLU C OE1   1 
ATOM   7824  O  OE2   . GLU C 1 282 ? 62.969  117.833 68.982  1.00 62.00  ? 550 GLU C OE2   1 
ATOM   7825  N  N     . ARG C 1 283 ? 65.333  113.567 73.887  1.00 61.17  ? 551 ARG C N     1 
ATOM   7826  C  CA    . ARG C 1 283 ? 66.326  112.849 74.674  1.00 61.17  ? 551 ARG C CA    1 
ATOM   7827  C  C     . ARG C 1 283 ? 66.016  111.359 74.728  1.00 61.17  ? 551 ARG C C     1 
ATOM   7828  O  O     . ARG C 1 283 ? 66.930  110.530 74.676  1.00 61.17  ? 551 ARG C O     1 
ATOM   7829  C  CB    . ARG C 1 283 ? 66.399  113.457 76.073  1.00 61.17  ? 551 ARG C CB    1 
ATOM   7830  C  CG    . ARG C 1 283 ? 67.207  112.677 77.080  1.00 61.17  ? 551 ARG C CG    1 
ATOM   7831  C  CD    . ARG C 1 283 ? 68.661  112.559 76.699  1.00 61.17  ? 551 ARG C CD    1 
ATOM   7832  N  NE    . ARG C 1 283 ? 69.385  111.770 77.684  1.00 61.17  ? 551 ARG C NE    1 
ATOM   7833  C  CZ    . ARG C 1 283 ? 69.445  110.444 77.680  1.00 61.17  ? 551 ARG C CZ    1 
ATOM   7834  N  NH1   . ARG C 1 283 ? 68.824  109.752 76.740  1.00 61.17  ? 551 ARG C NH1   1 
ATOM   7835  N  NH2   . ARG C 1 283 ? 70.129  109.810 78.616  1.00 61.17  ? 551 ARG C NH2   1 
ATOM   7836  N  N     . VAL C 1 284 ? 64.738  110.993 74.800  1.00 58.45  ? 552 VAL C N     1 
ATOM   7837  C  CA    . VAL C 1 284 ? 64.392  109.581 74.920  1.00 58.45  ? 552 VAL C CA    1 
ATOM   7838  C  C     . VAL C 1 284 ? 64.434  108.895 73.560  1.00 58.45  ? 552 VAL C C     1 
ATOM   7839  O  O     . VAL C 1 284 ? 64.929  107.770 73.435  1.00 58.45  ? 552 VAL C O     1 
ATOM   7840  C  CB    . VAL C 1 284 ? 63.021  109.437 75.601  1.00 58.45  ? 552 VAL C CB    1 
ATOM   7841  C  CG1   . VAL C 1 284 ? 62.620  107.979 75.718  1.00 58.45  ? 552 VAL C CG1   1 
ATOM   7842  C  CG2   . VAL C 1 284 ? 63.054  110.079 76.967  1.00 58.45  ? 552 VAL C CG2   1 
ATOM   7843  N  N     . ILE C 1 285 ? 63.940  109.560 72.517  1.00 59.26  ? 553 ILE C N     1 
ATOM   7844  C  CA    . ILE C 1 285 ? 63.994  108.984 71.179  1.00 59.26  ? 553 ILE C CA    1 
ATOM   7845  C  C     . ILE C 1 285 ? 65.418  109.012 70.638  1.00 59.26  ? 553 ILE C C     1 
ATOM   7846  O  O     . ILE C 1 285 ? 65.940  107.995 70.171  1.00 59.26  ? 553 ILE C O     1 
ATOM   7847  C  CB    . ILE C 1 285 ? 63.015  109.708 70.244  1.00 59.26  ? 553 ILE C CB    1 
ATOM   7848  C  CG1   . ILE C 1 285 ? 61.584  109.384 70.652  1.00 59.26  ? 553 ILE C CG1   1 
ATOM   7849  C  CG2   . ILE C 1 285 ? 63.265  109.332 68.805  1.00 59.26  ? 553 ILE C CG2   1 
ATOM   7850  C  CD1   . ILE C 1 285 ? 60.550  110.197 69.927  1.00 59.26  ? 553 ILE C CD1   1 
ATOM   7851  N  N     . GLY C 1 286 ? 66.081  110.156 70.733  1.00 58.21  ? 554 GLY C N     1 
ATOM   7852  C  CA    . GLY C 1 286 ? 67.451  110.239 70.275  1.00 58.21  ? 554 GLY C CA    1 
ATOM   7853  C  C     . GLY C 1 286 ? 68.390  109.829 71.386  1.00 58.21  ? 554 GLY C C     1 
ATOM   7854  O  O     . GLY C 1 286 ? 68.365  108.681 71.833  1.00 58.21  ? 554 GLY C O     1 
ATOM   7855  N  N     . GLY C 1 287 ? 69.219  110.751 71.843  1.00 62.49  ? 555 GLY C N     1 
ATOM   7856  C  CA    . GLY C 1 287 ? 70.131  110.462 72.927  1.00 62.49  ? 555 GLY C CA    1 
ATOM   7857  C  C     . GLY C 1 287 ? 70.791  111.711 73.463  1.00 62.49  ? 555 GLY C C     1 
ATOM   7858  O  O     . GLY C 1 287 ? 70.197  112.791 73.445  1.00 62.49  ? 555 GLY C O     1 
ATOM   7859  N  N     . LEU C 1 288 ? 72.027  111.578 73.926  1.00 64.72  ? 556 LEU C N     1 
ATOM   7860  C  CA    . LEU C 1 288 ? 72.756  112.692 74.518  1.00 64.72  ? 556 LEU C CA    1 
ATOM   7861  C  C     . LEU C 1 288 ? 73.192  113.662 73.435  1.00 64.72  ? 556 LEU C C     1 
ATOM   7862  O  O     . LEU C 1 288 ? 74.009  113.315 72.578  1.00 64.72  ? 556 LEU C O     1 
ATOM   7863  C  CB    . LEU C 1 288 ? 73.966  112.165 75.272  1.00 64.72  ? 556 LEU C CB    1 
ATOM   7864  C  CG    . LEU C 1 288 ? 73.587  111.338 76.483  1.00 64.72  ? 556 LEU C CG    1 
ATOM   7865  C  CD1   . LEU C 1 288 ? 74.797  110.675 77.102  1.00 64.72  ? 556 LEU C CD1   1 
ATOM   7866  C  CD2   . LEU C 1 288 ? 72.944  112.263 77.449  1.00 64.72  ? 556 LEU C CD2   1 
ATOM   7867  N  N     . GLU C 1 289 ? 72.663  114.879 73.464  1.00 68.65  ? 557 GLU C N     1 
ATOM   7868  C  CA    . GLU C 1 289 ? 73.103  115.903 72.527  1.00 68.65  ? 557 GLU C CA    1 
ATOM   7869  C  C     . GLU C 1 289 ? 74.460  116.407 72.981  1.00 68.65  ? 557 GLU C C     1 
ATOM   7870  O  O     . GLU C 1 289 ? 74.577  117.006 74.052  1.00 68.65  ? 557 GLU C O     1 
ATOM   7871  C  CB    . GLU C 1 289 ? 72.103  117.047 72.449  1.00 68.65  ? 557 GLU C CB    1 
ATOM   7872  C  CG    . GLU C 1 289 ? 72.478  118.097 71.422  1.00 68.65  ? 557 GLU C CG    1 
ATOM   7873  C  CD    . GLU C 1 289 ? 71.442  119.195 71.295  1.00 68.65  ? 557 GLU C CD    1 
ATOM   7874  O  OE1   . GLU C 1 289 ? 70.431  119.148 72.023  1.00 68.65  ? 557 GLU C OE1   1 
ATOM   7875  O  OE2   . GLU C 1 289 ? 71.638  120.107 70.466  1.00 68.65  ? 557 GLU C OE2   1 
ATOM   7876  N  N     . LYS C 1 290 ? 75.483  116.175 72.171  1.00 72.35  ? 558 LYS C N     1 
ATOM   7877  C  CA    . LYS C 1 290 ? 76.835  116.542 72.555  1.00 72.35  ? 558 LYS C CA    1 
ATOM   7878  C  C     . LYS C 1 290 ? 77.090  118.013 72.261  1.00 72.35  ? 558 LYS C C     1 
ATOM   7879  O  O     . LYS C 1 290 ? 76.774  118.505 71.175  1.00 72.35  ? 558 LYS C O     1 
ATOM   7880  C  CB    . LYS C 1 290 ? 77.842  115.657 71.831  1.00 72.35  ? 558 LYS C CB    1 
ATOM   7881  C  CG    . LYS C 1 290 ? 77.731  114.215 72.261  1.00 72.35  ? 558 LYS C CG    1 
ATOM   7882  C  CD    . LYS C 1 290 ? 78.768  113.341 71.604  1.00 72.35  ? 558 LYS C CD    1 
ATOM   7883  C  CE    . LYS C 1 290 ? 78.536  111.887 71.972  1.00 72.35  ? 558 LYS C CE    1 
ATOM   7884  N  NZ    . LYS C 1 290 ? 78.746  111.645 73.424  1.00 72.35  ? 558 LYS C NZ    1 
ATOM   7885  N  N     . LYS C 1 291 ? 77.662  118.715 73.240  1.00 79.00  ? 559 LYS C N     1 
ATOM   7886  C  CA    . LYS C 1 291 ? 77.877  120.151 73.107  1.00 79.00  ? 559 LYS C CA    1 
ATOM   7887  C  C     . LYS C 1 291 ? 79.031  120.450 72.161  1.00 79.00  ? 559 LYS C C     1 
ATOM   7888  O  O     . LYS C 1 291 ? 78.867  121.163 71.165  1.00 79.00  ? 559 LYS C O     1 
ATOM   7889  C  CB    . LYS C 1 291 ? 78.138  120.765 74.480  1.00 79.00  ? 559 LYS C CB    1 
ATOM   7890  C  CG    . LYS C 1 291 ? 76.938  120.746 75.403  1.00 79.00  ? 559 LYS C CG    1 
ATOM   7891  C  CD    . LYS C 1 291 ? 77.299  121.236 76.796  1.00 79.00  ? 559 LYS C CD    1 
ATOM   7892  C  CE    . LYS C 1 291 ? 77.563  122.732 76.808  1.00 79.00  ? 559 LYS C CE    1 
ATOM   7893  N  NZ    . LYS C 1 291 ? 77.791  123.238 78.187  1.00 79.00  ? 559 LYS C NZ    1 
ATOM   7894  N  N     . THR C 1 292 ? 80.210  119.913 72.460  1.00 79.86  ? 560 THR C N     1 
ATOM   7895  C  CA    . THR C 1 292 ? 81.403  120.156 71.655  1.00 79.86  ? 560 THR C CA    1 
ATOM   7896  C  C     . THR C 1 292 ? 81.311  119.358 70.368  1.00 79.86  ? 560 THR C C     1 
ATOM   7897  O  O     . THR C 1 292 ? 81.555  118.151 70.356  1.00 79.86  ? 560 THR C O     1 
ATOM   7898  C  CB    . THR C 1 292 ? 82.656  119.766 72.427  1.00 79.86  ? 560 THR C CB    1 
ATOM   7899  O  OG1   . THR C 1 292 ? 82.606  118.369 72.736  1.00 79.86  ? 560 THR C OG1   1 
ATOM   7900  C  CG2   . THR C 1 292 ? 82.751  120.555 73.703  1.00 79.86  ? 560 THR C CG2   1 
ATOM   7901  N  N     . GLN C 1 293 ? 80.951  120.020 69.275  1.00 79.03  ? 561 GLN C N     1 
ATOM   7902  C  CA    . GLN C 1 293 ? 81.066  119.375 67.979  1.00 79.03  ? 561 GLN C CA    1 
ATOM   7903  C  C     . GLN C 1 293 ? 82.538  119.285 67.596  1.00 79.03  ? 561 GLN C C     1 
ATOM   7904  O  O     . GLN C 1 293 ? 83.328  120.195 67.861  1.00 79.03  ? 561 GLN C O     1 
ATOM   7905  C  CB    . GLN C 1 293 ? 80.238  120.113 66.920  1.00 79.03  ? 561 GLN C CB    1 
ATOM   7906  C  CG    . GLN C 1 293 ? 80.696  121.512 66.549  1.00 79.03  ? 561 GLN C CG    1 
ATOM   7907  C  CD    . GLN C 1 293 ? 80.117  122.589 67.446  1.00 79.03  ? 561 GLN C CD    1 
ATOM   7908  O  OE1   . GLN C 1 293 ? 79.604  122.307 68.528  1.00 79.03  ? 561 GLN C OE1   1 
ATOM   7909  N  NE2   . GLN C 1 293 ? 80.201  123.836 66.998  1.00 79.03  ? 561 GLN C NE2   1 
ATOM   7910  N  N     . VAL C 1 294 ? 82.920  118.138 67.044  1.00 75.64  ? 562 VAL C N     1 
ATOM   7911  C  CA    . VAL C 1 294 ? 84.322  117.803 66.837  1.00 75.64  ? 562 VAL C CA    1 
ATOM   7912  C  C     . VAL C 1 294 ? 84.658  117.700 65.352  1.00 75.64  ? 562 VAL C C     1 
ATOM   7913  O  O     . VAL C 1 294 ? 85.839  117.817 64.988  1.00 75.64  ? 562 VAL C O     1 
ATOM   7914  C  CB    . VAL C 1 294 ? 84.669  116.492 67.584  1.00 75.64  ? 562 VAL C CB    1 
ATOM   7915  C  CG1   . VAL C 1 294 ? 86.168  116.193 67.649  1.00 75.64  ? 562 VAL C CG1   1 
ATOM   7916  C  CG2   . VAL C 1 294 ? 84.108  116.533 68.981  1.00 75.64  ? 562 VAL C CG2   1 
ATOM   7917  N  N     . LEU C 1 295 ? 83.653  117.585 64.487  1.00 73.34  ? 563 LEU C N     1 
ATOM   7918  C  CA    . LEU C 1 295 ? 83.856  117.316 63.071  1.00 73.34  ? 563 LEU C CA    1 
ATOM   7919  C  C     . LEU C 1 295 ? 84.586  118.450 62.365  1.00 73.34  ? 563 LEU C C     1 
ATOM   7920  O  O     . LEU C 1 295 ? 84.399  119.628 62.679  1.00 73.34  ? 563 LEU C O     1 
ATOM   7921  C  CB    . LEU C 1 295 ? 82.507  117.095 62.395  1.00 73.34  ? 563 LEU C CB    1 
ATOM   7922  C  CG    . LEU C 1 295 ? 81.689  115.887 62.833  1.00 73.34  ? 563 LEU C CG    1 
ATOM   7923  C  CD1   . LEU C 1 295 ? 80.326  115.954 62.185  1.00 73.34  ? 563 LEU C CD1   1 
ATOM   7924  C  CD2   . LEU C 1 295 ? 82.403  114.613 62.444  1.00 73.34  ? 563 LEU C CD2   1 
ATOM   7925  N  N     . GLN C 1 296 ? 85.437  118.075 61.419  1.00 74.57  ? 564 GLN C N     1 
ATOM   7926  C  CA    . GLN C 1 296 ? 86.088  119.030 60.551  1.00 74.57  ? 564 GLN C CA    1 
ATOM   7927  C  C     . GLN C 1 296 ? 85.054  119.655 59.619  1.00 74.57  ? 564 GLN C C     1 
ATOM   7928  O  O     . GLN C 1 296 ? 84.005  119.062 59.362  1.00 74.57  ? 564 GLN C O     1 
ATOM   7929  C  CB    . GLN C 1 296 ? 87.174  118.332 59.740  1.00 74.57  ? 564 GLN C CB    1 
ATOM   7930  C  CG    . GLN C 1 296 ? 88.261  117.688 60.574  1.00 74.57  ? 564 GLN C CG    1 
ATOM   7931  C  CD    . GLN C 1 296 ? 89.096  118.697 61.323  1.00 74.57  ? 564 GLN C CD    1 
ATOM   7932  O  OE1   . GLN C 1 296 ? 89.394  119.777 60.814  1.00 74.57  ? 564 GLN C OE1   1 
ATOM   7933  N  NE2   . GLN C 1 296 ? 89.487  118.349 62.540  1.00 74.57  ? 564 GLN C NE2   1 
ATOM   7934  N  N     . PRO C 1 297 ? 85.327  120.852 59.088  1.00 73.74  ? 565 PRO C N     1 
ATOM   7935  C  CA    . PRO C 1 297 ? 84.395  121.459 58.124  1.00 73.74  ? 565 PRO C CA    1 
ATOM   7936  C  C     . PRO C 1 297 ? 84.272  120.721 56.800  1.00 73.74  ? 565 PRO C C     1 
ATOM   7937  O  O     . PRO C 1 297 ? 83.394  121.076 56.007  1.00 73.74  ? 565 PRO C O     1 
ATOM   7938  C  CB    . PRO C 1 297 ? 84.975  122.860 57.911  1.00 73.74  ? 565 PRO C CB    1 
ATOM   7939  C  CG    . PRO C 1 297 ? 85.709  123.140 59.145  1.00 73.74  ? 565 PRO C CG    1 
ATOM   7940  C  CD    . PRO C 1 297 ? 86.306  121.838 59.574  1.00 73.74  ? 565 PRO C CD    1 
ATOM   7941  N  N     . GLU C 1 298 ? 85.113  119.729 56.522  1.00 74.59  ? 566 GLU C N     1 
ATOM   7942  C  CA    . GLU C 1 298 ? 84.903  118.877 55.364  1.00 74.59  ? 566 GLU C CA    1 
ATOM   7943  C  C     . GLU C 1 298 ? 84.159  117.596 55.701  1.00 74.59  ? 566 GLU C C     1 
ATOM   7944  O  O     . GLU C 1 298 ? 83.797  116.853 54.786  1.00 74.59  ? 566 GLU C O     1 
ATOM   7945  C  CB    . GLU C 1 298 ? 86.239  118.539 54.702  1.00 74.59  ? 566 GLU C CB    1 
ATOM   7946  C  CG    . GLU C 1 298 ? 86.915  119.740 54.067  1.00 74.59  ? 566 GLU C CG    1 
ATOM   7947  C  CD    . GLU C 1 298 ? 86.135  120.301 52.890  1.00 74.59  ? 566 GLU C CD    1 
ATOM   7948  O  OE1   . GLU C 1 298 ? 85.490  119.514 52.164  1.00 74.59  ? 566 GLU C OE1   1 
ATOM   7949  O  OE2   . GLU C 1 298 ? 86.162  121.534 52.695  1.00 74.59  ? 566 GLU C OE2   1 
ATOM   7950  N  N     . GLU C 1 299 ? 83.925  117.319 56.981  1.00 70.22  ? 567 GLU C N     1 
ATOM   7951  C  CA    . GLU C 1 299 ? 83.098  116.193 57.380  1.00 70.22  ? 567 GLU C CA    1 
ATOM   7952  C  C     . GLU C 1 299 ? 81.898  116.590 58.214  1.00 70.22  ? 567 GLU C C     1 
ATOM   7953  O  O     . GLU C 1 299 ? 81.087  115.722 58.545  1.00 70.22  ? 567 GLU C O     1 
ATOM   7954  C  CB    . GLU C 1 299 ? 83.926  115.156 58.144  1.00 70.22  ? 567 GLU C CB    1 
ATOM   7955  C  CG    . GLU C 1 299 ? 84.897  114.447 57.240  1.00 70.22  ? 567 GLU C CG    1 
ATOM   7956  C  CD    . GLU C 1 299 ? 85.690  113.388 57.949  1.00 70.22  ? 567 GLU C CD    1 
ATOM   7957  O  OE1   . GLU C 1 299 ? 85.593  113.300 59.192  1.00 70.22  ? 567 GLU C OE1   1 
ATOM   7958  O  OE2   . GLU C 1 299 ? 86.399  112.636 57.249  1.00 70.22  ? 567 GLU C OE2   1 
ATOM   7959  N  N     . LYS C 1 300 ? 81.771  117.860 58.580  1.00 66.33  ? 568 LYS C N     1 
ATOM   7960  C  CA    . LYS C 1 300 ? 80.471  118.372 58.972  1.00 66.33  ? 568 LYS C CA    1 
ATOM   7961  C  C     . LYS C 1 300 ? 79.650  118.714 57.742  1.00 66.33  ? 568 LYS C C     1 
ATOM   7962  O  O     . LYS C 1 300 ? 78.421  118.608 57.767  1.00 66.33  ? 568 LYS C O     1 
ATOM   7963  C  CB    . LYS C 1 300 ? 80.638  119.599 59.865  1.00 66.33  ? 568 LYS C CB    1 
ATOM   7964  C  CG    . LYS C 1 300 ? 79.371  120.069 60.533  1.00 66.33  ? 568 LYS C CG    1 
ATOM   7965  C  CD    . LYS C 1 300 ? 79.596  121.376 61.260  1.00 66.33  ? 568 LYS C CD    1 
ATOM   7966  C  CE    . LYS C 1 300 ? 80.431  121.176 62.506  1.00 66.33  ? 568 LYS C CE    1 
ATOM   7967  N  NZ    . LYS C 1 300 ? 80.573  122.442 63.273  1.00 66.33  ? 568 LYS C NZ    1 
ATOM   7968  N  N     . LYS C 1 301 ? 80.323  119.108 56.660  1.00 65.25  ? 569 LYS C N     1 
ATOM   7969  C  CA    . LYS C 1 301 ? 79.652  119.385 55.397  1.00 65.25  ? 569 LYS C CA    1 
ATOM   7970  C  C     . LYS C 1 301 ? 79.053  118.125 54.797  1.00 65.25  ? 569 LYS C C     1 
ATOM   7971  O  O     . LYS C 1 301 ? 78.020  118.190 54.123  1.00 65.25  ? 569 LYS C O     1 
ATOM   7972  C  CB    . LYS C 1 301 ? 80.648  120.013 54.428  1.00 65.25  ? 569 LYS C CB    1 
ATOM   7973  C  CG    . LYS C 1 301 ? 80.075  120.502 53.125  1.00 65.25  ? 569 LYS C CG    1 
ATOM   7974  C  CD    . LYS C 1 301 ? 81.153  121.142 52.285  1.00 65.25  ? 569 LYS C CD    1 
ATOM   7975  C  CE    . LYS C 1 301 ? 80.601  121.636 50.966  1.00 65.25  ? 569 LYS C CE    1 
ATOM   7976  N  NZ    . LYS C 1 301 ? 81.669  122.245 50.132  1.00 65.25  ? 569 LYS C NZ    1 
ATOM   7977  N  N     . THR C 1 302 ? 79.671  116.971 55.043  1.00 62.73  ? 570 THR C N     1 
ATOM   7978  C  CA    . THR C 1 302 ? 79.143  115.721 54.512  1.00 62.73  ? 570 THR C CA    1 
ATOM   7979  C  C     . THR C 1 302 ? 77.908  115.279 55.285  1.00 62.73  ? 570 THR C C     1 
ATOM   7980  O  O     . THR C 1 302 ? 76.922  114.835 54.687  1.00 62.73  ? 570 THR C O     1 
ATOM   7981  C  CB    . THR C 1 302 ? 80.224  114.645 54.555  1.00 62.73  ? 570 THR C CB    1 
ATOM   7982  O  OG1   . THR C 1 302 ? 81.374  115.101 53.837  1.00 62.73  ? 570 THR C OG1   1 
ATOM   7983  C  CG2   . THR C 1 302 ? 79.734  113.369 53.913  1.00 62.73  ? 570 THR C CG2   1 
ATOM   7984  N  N     . VAL C 1 303 ? 77.936  115.421 56.612  1.00 62.31  ? 571 VAL C N     1 
ATOM   7985  C  CA    . VAL C 1 303 ? 76.772  115.121 57.439  1.00 62.31  ? 571 VAL C CA    1 
ATOM   7986  C  C     . VAL C 1 303 ? 75.627  116.084 57.139  1.00 62.31  ? 571 VAL C C     1 
ATOM   7987  O  O     . VAL C 1 303 ? 74.456  115.686 57.149  1.00 62.31  ? 571 VAL C O     1 
ATOM   7988  C  CB    . VAL C 1 303 ? 77.181  115.148 58.922  1.00 62.31  ? 571 VAL C CB    1 
ATOM   7989  C  CG1   . VAL C 1 303 ? 76.003  114.917 59.841  1.00 62.31  ? 571 VAL C CG1   1 
ATOM   7990  C  CG2   . VAL C 1 303 ? 78.229  114.107 59.184  1.00 62.31  ? 571 VAL C CG2   1 
ATOM   7991  N  N     . ALA C 1 304 ? 75.938  117.341 56.814  1.00 61.10  ? 572 ALA C N     1 
ATOM   7992  C  CA    . ALA C 1 304 ? 74.899  118.317 56.493  1.00 61.10  ? 572 ALA C CA    1 
ATOM   7993  C  C     . ALA C 1 304 ? 74.184  117.966 55.196  1.00 61.10  ? 572 ALA C C     1 
ATOM   7994  O  O     . ALA C 1 304 ? 72.952  117.983 55.137  1.00 61.10  ? 572 ALA C O     1 
ATOM   7995  C  CB    . ALA C 1 304 ? 75.502  119.715 56.408  1.00 61.10  ? 572 ALA C CB    1 
ATOM   7996  N  N     . TYR C 1 305 ? 74.938  117.624 54.151  1.00 60.42  ? 573 TYR C N     1 
ATOM   7997  C  CA    . TYR C 1 305 ? 74.329  117.159 52.913  1.00 60.42  ? 573 TYR C CA    1 
ATOM   7998  C  C     . TYR C 1 305 ? 73.649  115.808 53.075  1.00 60.42  ? 573 TYR C C     1 
ATOM   7999  O  O     . TYR C 1 305 ? 72.732  115.497 52.313  1.00 60.42  ? 573 TYR C O     1 
ATOM   8000  C  CB    . TYR C 1 305 ? 75.375  117.073 51.805  1.00 60.42  ? 573 TYR C CB    1 
ATOM   8001  C  CG    . TYR C 1 305 ? 75.833  118.401 51.259  1.00 60.42  ? 573 TYR C CG    1 
ATOM   8002  C  CD1   . TYR C 1 305 ? 75.069  119.529 51.410  1.00 60.42  ? 573 TYR C CD1   1 
ATOM   8003  C  CD2   . TYR C 1 305 ? 77.035  118.519 50.589  1.00 60.42  ? 573 TYR C CD2   1 
ATOM   8004  C  CE1   . TYR C 1 305 ? 75.475  120.747 50.918  1.00 60.42  ? 573 TYR C CE1   1 
ATOM   8005  C  CE2   . TYR C 1 305 ? 77.460  119.735 50.091  1.00 60.42  ? 573 TYR C CE2   1 
ATOM   8006  C  CZ    . TYR C 1 305 ? 76.668  120.846 50.263  1.00 60.42  ? 573 TYR C CZ    1 
ATOM   8007  O  OH    . TYR C 1 305 ? 77.069  122.064 49.773  1.00 60.42  ? 573 TYR C OH    1 
ATOM   8008  N  N     . HIS C 1 306 ? 74.072  115.001 54.047  1.00 61.24  ? 574 HIS C N     1 
ATOM   8009  C  CA    . HIS C 1 306 ? 73.421  113.717 54.280  1.00 61.24  ? 574 HIS C CA    1 
ATOM   8010  C  C     . HIS C 1 306 ? 72.073  113.906 54.959  1.00 61.24  ? 574 HIS C C     1 
ATOM   8011  O  O     . HIS C 1 306 ? 71.070  113.318 54.544  1.00 61.24  ? 574 HIS C O     1 
ATOM   8012  C  CB    . HIS C 1 306 ? 74.320  112.823 55.126  1.00 61.24  ? 574 HIS C CB    1 
ATOM   8013  C  CG    . HIS C 1 306 ? 73.768  111.454 55.365  1.00 61.24  ? 574 HIS C CG    1 
ATOM   8014  N  ND1   . HIS C 1 306 ? 73.793  110.464 54.410  1.00 61.24  ? 574 HIS C ND1   1 
ATOM   8015  C  CD2   . HIS C 1 306 ? 73.187  110.907 56.457  1.00 61.24  ? 574 HIS C CD2   1 
ATOM   8016  C  CE1   . HIS C 1 306 ? 73.249  109.366 54.901  1.00 61.24  ? 574 HIS C CE1   1 
ATOM   8017  N  NE2   . HIS C 1 306 ? 72.869  109.609 56.142  1.00 61.24  ? 574 HIS C NE2   1 
ATOM   8018  N  N     . GLN C 1 307 ? 72.028  114.735 56.004  1.00 59.63  ? 575 GLN C N     1 
ATOM   8019  C  CA    . GLN C 1 307 ? 70.785  114.967 56.728  1.00 59.63  ? 575 GLN C CA    1 
ATOM   8020  C  C     . GLN C 1 307 ? 69.785  115.776 55.922  1.00 59.63  ? 575 GLN C C     1 
ATOM   8021  O  O     . GLN C 1 307 ? 68.585  115.698 56.195  1.00 59.63  ? 575 GLN C O     1 
ATOM   8022  C  CB    . GLN C 1 307 ? 71.063  115.680 58.044  1.00 59.63  ? 575 GLN C CB    1 
ATOM   8023  C  CG    . GLN C 1 307 ? 71.884  114.882 59.016  1.00 59.63  ? 575 GLN C CG    1 
ATOM   8024  C  CD    . GLN C 1 307 ? 71.161  113.673 59.528  1.00 59.63  ? 575 GLN C CD    1 
ATOM   8025  O  OE1   . GLN C 1 307 ? 69.959  113.712 59.763  1.00 59.63  ? 575 GLN C OE1   1 
ATOM   8026  N  NE2   . GLN C 1 307 ? 71.889  112.586 59.716  1.00 59.63  ? 575 GLN C NE2   1 
ATOM   8027  N  N     . ALA C 1 308 ? 70.243  116.555 54.946  1.00 59.72  ? 576 ALA C N     1 
ATOM   8028  C  CA    . ALA C 1 308 ? 69.313  117.200 54.034  1.00 59.72  ? 576 ALA C CA    1 
ATOM   8029  C  C     . ALA C 1 308 ? 68.688  116.206 53.073  1.00 59.72  ? 576 ALA C C     1 
ATOM   8030  O  O     . ALA C 1 308 ? 67.587  116.453 52.577  1.00 59.72  ? 576 ALA C O     1 
ATOM   8031  C  CB    . ALA C 1 308 ? 70.014  118.301 53.249  1.00 59.72  ? 576 ALA C CB    1 
ATOM   8032  N  N     . GLY C 1 309 ? 69.362  115.089 52.804  1.00 58.79  ? 577 GLY C N     1 
ATOM   8033  C  CA    . GLY C 1 309 ? 68.761  114.049 51.994  1.00 58.79  ? 577 GLY C CA    1 
ATOM   8034  C  C     . GLY C 1 309 ? 67.644  113.323 52.711  1.00 58.79  ? 577 GLY C C     1 
ATOM   8035  O  O     . GLY C 1 309 ? 66.671  112.905 52.083  1.00 58.79  ? 577 GLY C O     1 
ATOM   8036  N  N     . HIS C 1 310 ? 67.767  113.149 54.026  1.00 59.56  ? 578 HIS C N     1 
ATOM   8037  C  CA    . HIS C 1 310 ? 66.639  112.647 54.795  1.00 59.56  ? 578 HIS C CA    1 
ATOM   8038  C  C     . HIS C 1 310 ? 65.533  113.684 54.890  1.00 59.56  ? 578 HIS C C     1 
ATOM   8039  O  O     . HIS C 1 310 ? 64.355  113.326 54.950  1.00 59.56  ? 578 HIS C O     1 
ATOM   8040  C  CB    . HIS C 1 310 ? 67.084  112.242 56.194  1.00 59.56  ? 578 HIS C CB    1 
ATOM   8041  C  CG    . HIS C 1 310 ? 68.020  111.077 56.223  1.00 59.56  ? 578 HIS C CG    1 
ATOM   8042  N  ND1   . HIS C 1 310 ? 67.599  109.779 56.050  1.00 59.56  ? 578 HIS C ND1   1 
ATOM   8043  C  CD2   . HIS C 1 310 ? 69.356  111.015 56.418  1.00 59.56  ? 578 HIS C CD2   1 
ATOM   8044  C  CE1   . HIS C 1 310 ? 68.636  108.966 56.135  1.00 59.56  ? 578 HIS C CE1   1 
ATOM   8045  N  NE2   . HIS C 1 310 ? 69.715  109.691 56.356  1.00 59.56  ? 578 HIS C NE2   1 
ATOM   8046  N  N     . ALA C 1 311 ? 65.890  114.967 54.894  1.00 59.25  ? 579 ALA C N     1 
ATOM   8047  C  CA    . ALA C 1 311 ? 64.897  116.019 55.061  1.00 59.25  ? 579 ALA C CA    1 
ATOM   8048  C  C     . ALA C 1 311 ? 64.050  116.184 53.810  1.00 59.25  ? 579 ALA C C     1 
ATOM   8049  O  O     . ALA C 1 311 ? 62.819  116.188 53.884  1.00 59.25  ? 579 ALA C O     1 
ATOM   8050  C  CB    . ALA C 1 311 ? 65.583  117.334 55.411  1.00 59.25  ? 579 ALA C CB    1 
ATOM   8051  N  N     . VAL C 1 312 ? 64.691  116.312 52.652  1.00 59.13  ? 580 VAL C N     1 
ATOM   8052  C  CA    . VAL C 1 312 ? 63.975  116.668 51.433  1.00 59.13  ? 580 VAL C CA    1 
ATOM   8053  C  C     . VAL C 1 312 ? 63.189  115.481 50.889  1.00 59.13  ? 580 VAL C C     1 
ATOM   8054  O  O     . VAL C 1 312 ? 62.052  115.640 50.428  1.00 59.13  ? 580 VAL C O     1 
ATOM   8055  C  CB    . VAL C 1 312 ? 64.970  117.234 50.407  1.00 59.13  ? 580 VAL C CB    1 
ATOM   8056  C  CG1   . VAL C 1 312 ? 64.306  117.495 49.076  1.00 59.13  ? 580 VAL C CG1   1 
ATOM   8057  C  CG2   . VAL C 1 312 ? 65.565  118.514 50.933  1.00 59.13  ? 580 VAL C CG2   1 
ATOM   8058  N  N     . ALA C 1 313 ? 63.758  114.275 50.966  1.00 59.35  ? 581 ALA C N     1 
ATOM   8059  C  CA    . ALA C 1 313 ? 63.046  113.083 50.513  1.00 59.35  ? 581 ALA C CA    1 
ATOM   8060  C  C     . ALA C 1 313 ? 61.837  112.792 51.390  1.00 59.35  ? 581 ALA C C     1 
ATOM   8061  O  O     . ALA C 1 313 ? 60.775  112.424 50.885  1.00 59.35  ? 581 ALA C O     1 
ATOM   8062  C  CB    . ALA C 1 313 ? 63.983  111.881 50.485  1.00 59.35  ? 581 ALA C CB    1 
ATOM   8063  N  N     . GLY C 1 314 ? 61.962  112.991 52.701  1.00 61.21  ? 582 GLY C N     1 
ATOM   8064  C  CA    . GLY C 1 314 ? 60.799  112.905 53.566  1.00 61.21  ? 582 GLY C CA    1 
ATOM   8065  C  C     . GLY C 1 314 ? 59.796  114.028 53.375  1.00 61.21  ? 582 GLY C C     1 
ATOM   8066  O  O     . GLY C 1 314 ? 58.644  113.895 53.795  1.00 61.21  ? 582 GLY C O     1 
ATOM   8067  N  N     . TRP C 1 315 ? 60.206  115.128 52.754  1.00 63.11  ? 583 TRP C N     1 
ATOM   8068  C  CA    . TRP C 1 315 ? 59.332  116.271 52.552  1.00 63.11  ? 583 TRP C CA    1 
ATOM   8069  C  C     . TRP C 1 315 ? 58.533  116.178 51.263  1.00 63.11  ? 583 TRP C C     1 
ATOM   8070  O  O     . TRP C 1 315 ? 57.454  116.771 51.176  1.00 63.11  ? 583 TRP C O     1 
ATOM   8071  C  CB    . TRP C 1 315 ? 60.161  117.560 52.536  1.00 63.11  ? 583 TRP C CB    1 
ATOM   8072  C  CG    . TRP C 1 315 ? 59.386  118.833 52.525  1.00 63.11  ? 583 TRP C CG    1 
ATOM   8073  C  CD1   . TRP C 1 315 ? 59.041  119.562 51.438  1.00 63.11  ? 583 TRP C CD1   1 
ATOM   8074  C  CD2   . TRP C 1 315 ? 58.922  119.569 53.661  1.00 63.11  ? 583 TRP C CD2   1 
ATOM   8075  N  NE1   . TRP C 1 315 ? 58.361  120.689 51.816  1.00 63.11  ? 583 TRP C NE1   1 
ATOM   8076  C  CE2   . TRP C 1 315 ? 58.280  120.718 53.179  1.00 63.11  ? 583 TRP C CE2   1 
ATOM   8077  C  CE3   . TRP C 1 315 ? 58.979  119.361 55.042  1.00 63.11  ? 583 TRP C CE3   1 
ATOM   8078  C  CZ2   . TRP C 1 315 ? 57.692  121.648 54.021  1.00 63.11  ? 583 TRP C CZ2   1 
ATOM   8079  C  CZ3   . TRP C 1 315 ? 58.402  120.285 55.871  1.00 63.11  ? 583 TRP C CZ3   1 
ATOM   8080  C  CH2   . TRP C 1 315 ? 57.764  121.413 55.361  1.00 63.11  ? 583 TRP C CH2   1 
ATOM   8081  N  N     . TYR C 1 316 ? 59.024  115.446 50.269  1.00 62.57  ? 584 TYR C N     1 
ATOM   8082  C  CA    . TYR C 1 316 ? 58.407  115.402 48.952  1.00 62.57  ? 584 TYR C CA    1 
ATOM   8083  C  C     . TYR C 1 316 ? 57.813  114.047 48.610  1.00 62.57  ? 584 TYR C C     1 
ATOM   8084  O  O     . TYR C 1 316 ? 57.385  113.844 47.472  1.00 62.57  ? 584 TYR C O     1 
ATOM   8085  C  CB    . TYR C 1 316 ? 59.422  115.810 47.887  1.00 62.57  ? 584 TYR C CB    1 
ATOM   8086  C  CG    . TYR C 1 316 ? 59.629  117.295 47.770  1.00 62.57  ? 584 TYR C CG    1 
ATOM   8087  C  CD1   . TYR C 1 316 ? 58.646  118.185 48.166  1.00 62.57  ? 584 TYR C CD1   1 
ATOM   8088  C  CD2   . TYR C 1 316 ? 60.815  117.810 47.284  1.00 62.57  ? 584 TYR C CD2   1 
ATOM   8089  C  CE1   . TYR C 1 316 ? 58.831  119.542 48.057  1.00 62.57  ? 584 TYR C CE1   1 
ATOM   8090  C  CE2   . TYR C 1 316 ? 61.012  119.163 47.182  1.00 62.57  ? 584 TYR C CE2   1 
ATOM   8091  C  CZ    . TYR C 1 316 ? 60.018  120.023 47.568  1.00 62.57  ? 584 TYR C CZ    1 
ATOM   8092  O  OH    . TYR C 1 316 ? 60.220  121.375 47.458  1.00 62.57  ? 584 TYR C OH    1 
ATOM   8093  N  N     . LEU C 1 317 ? 57.775  113.116 49.554  1.00 65.69  ? 585 LEU C N     1 
ATOM   8094  C  CA    . LEU C 1 317 ? 57.156  111.817 49.345  1.00 65.69  ? 585 LEU C CA    1 
ATOM   8095  C  C     . LEU C 1 317 ? 55.897  111.708 50.185  1.00 65.69  ? 585 LEU C C     1 
ATOM   8096  O  O     . LEU C 1 317 ? 55.935  111.919 51.401  1.00 65.69  ? 585 LEU C O     1 
ATOM   8097  C  CB    . LEU C 1 317 ? 58.108  110.676 49.695  1.00 65.69  ? 585 LEU C CB    1 
ATOM   8098  C  CG    . LEU C 1 317 ? 59.279  110.450 48.752  1.00 65.69  ? 585 LEU C CG    1 
ATOM   8099  C  CD1   . LEU C 1 317 ? 60.159  109.365 49.314  1.00 65.69  ? 585 LEU C CD1   1 
ATOM   8100  C  CD2   . LEU C 1 317 ? 58.782  110.094 47.372  1.00 65.69  ? 585 LEU C CD2   1 
ATOM   8101  N  N     . GLU C 1 318 ? 54.789  111.377 49.530  1.00 67.60  ? 586 GLU C N     1 
ATOM   8102  C  CA    . GLU C 1 318 ? 53.577  110.989 50.231  1.00 67.60  ? 586 GLU C CA    1 
ATOM   8103  C  C     . GLU C 1 318 ? 53.847  109.714 51.016  1.00 67.60  ? 586 GLU C C     1 
ATOM   8104  O  O     . GLU C 1 318 ? 54.717  108.921 50.652  1.00 67.60  ? 586 GLU C O     1 
ATOM   8105  C  CB    . GLU C 1 318 ? 52.451  110.780 49.221  1.00 67.60  ? 586 GLU C CB    1 
ATOM   8106  C  CG    . GLU C 1 318 ? 51.077  110.559 49.799  1.00 67.60  ? 586 GLU C CG    1 
ATOM   8107  C  CD    . GLU C 1 318 ? 50.030  110.419 48.724  1.00 67.60  ? 586 GLU C CD    1 
ATOM   8108  O  OE1   . GLU C 1 318 ? 50.403  110.449 47.534  1.00 67.60  ? 586 GLU C OE1   1 
ATOM   8109  O  OE2   . GLU C 1 318 ? 48.837  110.289 49.065  1.00 67.60  ? 586 GLU C OE2   1 
ATOM   8110  N  N     . HIS C 1 319 ? 53.150  109.566 52.145  1.00 66.35  ? 587 HIS C N     1 
ATOM   8111  C  CA    . HIS C 1 319 ? 53.208  108.472 53.120  1.00 66.35  ? 587 HIS C CA    1 
ATOM   8112  C  C     . HIS C 1 319 ? 54.506  108.468 53.916  1.00 66.35  ? 587 HIS C C     1 
ATOM   8113  O  O     . HIS C 1 319 ? 54.671  107.620 54.796  1.00 66.35  ? 587 HIS C O     1 
ATOM   8114  C  CB    . HIS C 1 319 ? 53.017  107.080 52.497  1.00 66.35  ? 587 HIS C CB    1 
ATOM   8115  C  CG    . HIS C 1 319 ? 51.839  106.987 51.585  1.00 66.35  ? 587 HIS C CG    1 
ATOM   8116  N  ND1   . HIS C 1 319 ? 50.542  106.939 52.043  1.00 66.35  ? 587 HIS C ND1   1 
ATOM   8117  C  CD2   . HIS C 1 319 ? 51.765  106.941 50.235  1.00 66.35  ? 587 HIS C CD2   1 
ATOM   8118  C  CE1   . HIS C 1 319 ? 49.719  106.865 51.013  1.00 66.35  ? 587 HIS C CE1   1 
ATOM   8119  N  NE2   . HIS C 1 319 ? 50.437  106.864 49.905  1.00 66.35  ? 587 HIS C NE2   1 
ATOM   8120  N  N     . ALA C 1 320 ? 55.433  109.375 53.637  1.00 64.06  ? 588 ALA C N     1 
ATOM   8121  C  CA    . ALA C 1 320 ? 56.573  109.573 54.505  1.00 64.06  ? 588 ALA C CA    1 
ATOM   8122  C  C     . ALA C 1 320 ? 56.129  110.336 55.739  1.00 64.06  ? 588 ALA C C     1 
ATOM   8123  O  O     . ALA C 1 320 ? 55.149  111.084 55.711  1.00 64.06  ? 588 ALA C O     1 
ATOM   8124  C  CB    . ALA C 1 320 ? 57.682  110.336 53.786  1.00 64.06  ? 588 ALA C CB    1 
ATOM   8125  N  N     . ASP C 1 321 ? 56.853  110.132 56.829  1.00 66.74  ? 589 ASP C N     1 
ATOM   8126  C  CA    . ASP C 1 321 ? 56.460  110.709 58.096  1.00 66.74  ? 589 ASP C CA    1 
ATOM   8127  C  C     . ASP C 1 321 ? 56.713  112.215 58.100  1.00 66.74  ? 589 ASP C C     1 
ATOM   8128  O  O     . ASP C 1 321 ? 57.604  112.702 57.398  1.00 66.74  ? 589 ASP C O     1 
ATOM   8129  C  CB    . ASP C 1 321 ? 57.231  110.048 59.226  1.00 66.74  ? 589 ASP C CB    1 
ATOM   8130  C  CG    . ASP C 1 321 ? 56.923  108.579 59.340  1.00 66.74  ? 589 ASP C CG    1 
ATOM   8131  O  OD1   . ASP C 1 321 ? 55.815  108.176 58.938  1.00 66.74  ? 589 ASP C OD1   1 
ATOM   8132  O  OD2   . ASP C 1 321 ? 57.784  107.825 59.834  1.00 66.74  ? 589 ASP C OD2   1 
ATOM   8133  N  N     . PRO C 1 322 ? 55.907  112.976 58.838  1.00 65.80  ? 590 PRO C N     1 
ATOM   8134  C  CA    . PRO C 1 322 ? 56.182  114.405 59.006  1.00 65.80  ? 590 PRO C CA    1 
ATOM   8135  C  C     . PRO C 1 322 ? 57.500  114.665 59.716  1.00 65.80  ? 590 PRO C C     1 
ATOM   8136  O  O     . PRO C 1 322 ? 57.947  113.884 60.557  1.00 65.80  ? 590 PRO C O     1 
ATOM   8137  C  CB    . PRO C 1 322 ? 54.998  114.890 59.845  1.00 65.80  ? 590 PRO C CB    1 
ATOM   8138  C  CG    . PRO C 1 322 ? 53.909  113.962 59.494  1.00 65.80  ? 590 PRO C CG    1 
ATOM   8139  C  CD    . PRO C 1 322 ? 54.548  112.630 59.283  1.00 65.80  ? 590 PRO C CD    1 
ATOM   8140  N  N     . LEU C 1 323 ? 58.113  115.786 59.365  1.00 64.28  ? 591 LEU C N     1 
ATOM   8141  C  CA    . LEU C 1 323 ? 59.437  116.154 59.838  1.00 64.28  ? 591 LEU C CA    1 
ATOM   8142  C  C     . LEU C 1 323 ? 59.318  117.123 61.004  1.00 64.28  ? 591 LEU C C     1 
ATOM   8143  O  O     . LEU C 1 323 ? 58.447  117.994 61.006  1.00 64.28  ? 591 LEU C O     1 
ATOM   8144  C  CB    . LEU C 1 323 ? 60.230  116.792 58.701  1.00 64.28  ? 591 LEU C CB    1 
ATOM   8145  C  CG    . LEU C 1 323 ? 61.683  117.142 58.967  1.00 64.28  ? 591 LEU C CG    1 
ATOM   8146  C  CD1   . LEU C 1 323 ? 62.426  115.870 59.268  1.00 64.28  ? 591 LEU C CD1   1 
ATOM   8147  C  CD2   . LEU C 1 323 ? 62.266  117.837 57.764  1.00 64.28  ? 591 LEU C CD2   1 
ATOM   8148  N  N     . LEU C 1 324 ? 60.185  116.965 62.000  1.00 63.50  ? 592 LEU C N     1 
ATOM   8149  C  CA    . LEU C 1 324 ? 60.202  117.889 63.126  1.00 63.50  ? 592 LEU C CA    1 
ATOM   8150  C  C     . LEU C 1 324 ? 61.513  118.646 63.256  1.00 63.50  ? 592 LEU C C     1 
ATOM   8151  O  O     . LEU C 1 324 ? 61.501  119.880 63.312  1.00 63.50  ? 592 LEU C O     1 
ATOM   8152  C  CB    . LEU C 1 324 ? 59.917  117.145 64.433  1.00 63.50  ? 592 LEU C CB    1 
ATOM   8153  C  CG    . LEU C 1 324 ? 58.578  116.433 64.526  1.00 63.50  ? 592 LEU C CG    1 
ATOM   8154  C  CD1   . LEU C 1 324 ? 58.503  115.692 65.837  1.00 63.50  ? 592 LEU C CD1   1 
ATOM   8155  C  CD2   . LEU C 1 324 ? 57.450  117.425 64.397  1.00 63.50  ? 592 LEU C CD2   1 
ATOM   8156  N  N     . LYS C 1 325 ? 62.650  117.950 63.302  1.00 64.90  ? 593 LYS C N     1 
ATOM   8157  C  CA    . LYS C 1 325 ? 63.896  118.606 63.692  1.00 64.90  ? 593 LYS C CA    1 
ATOM   8158  C  C     . LYS C 1 325 ? 65.077  117.911 63.024  1.00 64.90  ? 593 LYS C C     1 
ATOM   8159  O  O     . LYS C 1 325 ? 65.548  116.883 63.510  1.00 64.90  ? 593 LYS C O     1 
ATOM   8160  C  CB    . LYS C 1 325 ? 64.043  118.606 65.205  1.00 64.90  ? 593 LYS C CB    1 
ATOM   8161  C  CG    . LYS C 1 325 ? 65.227  119.392 65.717  1.00 64.90  ? 593 LYS C CG    1 
ATOM   8162  C  CD    . LYS C 1 325 ? 65.210  119.427 67.227  1.00 64.90  ? 593 LYS C CD    1 
ATOM   8163  C  CE    . LYS C 1 325 ? 66.365  120.218 67.796  1.00 64.90  ? 593 LYS C CE    1 
ATOM   8164  N  NZ    . LYS C 1 325 ? 66.323  120.250 69.284  1.00 64.90  ? 593 LYS C NZ    1 
ATOM   8165  N  N     . VAL C 1 326 ? 65.571  118.499 61.944  1.00 63.42  ? 594 VAL C N     1 
ATOM   8166  C  CA    . VAL C 1 326 ? 66.813  118.064 61.319  1.00 63.42  ? 594 VAL C CA    1 
ATOM   8167  C  C     . VAL C 1 326 ? 67.968  118.767 62.011  1.00 63.42  ? 594 VAL C C     1 
ATOM   8168  O  O     . VAL C 1 326 ? 67.992  119.999 62.093  1.00 63.42  ? 594 VAL C O     1 
ATOM   8169  C  CB    . VAL C 1 326 ? 66.805  118.371 59.817  1.00 63.42  ? 594 VAL C CB    1 
ATOM   8170  C  CG1   . VAL C 1 326 ? 68.151  118.070 59.212  1.00 63.42  ? 594 VAL C CG1   1 
ATOM   8171  C  CG2   . VAL C 1 326 ? 65.749  117.555 59.142  1.00 63.42  ? 594 VAL C CG2   1 
ATOM   8172  N  N     . SER C 1 327 ? 68.930  117.995 62.507  1.00 65.75  ? 595 SER C N     1 
ATOM   8173  C  CA    . SER C 1 327 ? 70.023  118.554 63.289  1.00 65.75  ? 595 SER C CA    1 
ATOM   8174  C  C     . SER C 1 327 ? 71.314  117.810 63.012  1.00 65.75  ? 595 SER C C     1 
ATOM   8175  O  O     . SER C 1 327 ? 71.354  116.582 63.107  1.00 65.75  ? 595 SER C O     1 
ATOM   8176  C  CB    . SER C 1 327 ? 69.711  118.489 64.781  1.00 65.75  ? 595 SER C CB    1 
ATOM   8177  O  OG    . SER C 1 327 ? 70.823  118.918 65.540  1.00 65.75  ? 595 SER C OG    1 
ATOM   8178  N  N     . ILE C 1 328 ? 72.374  118.557 62.687  1.00 63.46  ? 596 ILE C N     1 
ATOM   8179  C  CA    . ILE C 1 328 ? 73.681  117.951 62.473  1.00 63.46  ? 596 ILE C CA    1 
ATOM   8180  C  C     . ILE C 1 328 ? 74.545  117.983 63.717  1.00 63.46  ? 596 ILE C C     1 
ATOM   8181  O  O     . ILE C 1 328 ? 75.709  117.566 63.659  1.00 63.46  ? 596 ILE C O     1 
ATOM   8182  C  CB    . ILE C 1 328 ? 74.450  118.632 61.331  1.00 63.46  ? 596 ILE C CB    1 
ATOM   8183  C  CG1   . ILE C 1 328 ? 74.758  120.073 61.705  1.00 63.46  ? 596 ILE C CG1   1 
ATOM   8184  C  CG2   . ILE C 1 328 ? 73.641  118.581 60.067  1.00 63.46  ? 596 ILE C CG2   1 
ATOM   8185  C  CD1   . ILE C 1 328 ? 75.725  120.729 60.772  1.00 63.46  ? 596 ILE C CD1   1 
ATOM   8186  N  N     . ILE C 1 329 ? 74.028  118.482 64.829  1.00 64.53  ? 597 ILE C N     1 
ATOM   8187  C  CA    . ILE C 1 329 ? 74.717  118.298 66.108  1.00 64.53  ? 597 ILE C CA    1 
ATOM   8188  C  C     . ILE C 1 329 ? 74.682  116.818 66.466  1.00 64.53  ? 597 ILE C C     1 
ATOM   8189  O  O     . ILE C 1 329 ? 73.609  116.197 66.379  1.00 64.53  ? 597 ILE C O     1 
ATOM   8190  C  CB    . ILE C 1 329 ? 74.058  119.142 67.195  1.00 64.53  ? 597 ILE C CB    1 
ATOM   8191  C  CG1   . ILE C 1 329 ? 74.178  120.621 66.858  1.00 64.53  ? 597 ILE C CG1   1 
ATOM   8192  C  CG2   . ILE C 1 329 ? 74.706  118.891 68.531  1.00 64.53  ? 597 ILE C CG2   1 
ATOM   8193  C  CD1   . ILE C 1 329 ? 73.366  121.505 67.758  1.00 64.53  ? 597 ILE C CD1   1 
ATOM   8194  N  N     . PRO C 1 330 ? 75.816  116.206 66.805  1.00 66.09  ? 598 PRO C N     1 
ATOM   8195  C  CA    . PRO C 1 330 ? 75.829  114.770 67.094  1.00 66.09  ? 598 PRO C CA    1 
ATOM   8196  C  C     . PRO C 1 330 ? 75.007  114.430 68.323  1.00 66.09  ? 598 PRO C C     1 
ATOM   8197  O  O     . PRO C 1 330 ? 75.004  115.159 69.315  1.00 66.09  ? 598 PRO C O     1 
ATOM   8198  C  CB    . PRO C 1 330 ? 77.313  114.472 67.318  1.00 66.09  ? 598 PRO C CB    1 
ATOM   8199  C  CG    . PRO C 1 330 ? 78.019  115.541 66.585  1.00 66.09  ? 598 PRO C CG    1 
ATOM   8200  C  CD    . PRO C 1 330 ? 77.175  116.759 66.736  1.00 66.09  ? 598 PRO C CD    1 
ATOM   8201  N  N     . ARG C 1 331 ? 74.280  113.323 68.231  1.00 64.18  ? 599 ARG C N     1 
ATOM   8202  C  CA    . ARG C 1 331 ? 73.384  112.901 69.298  1.00 64.18  ? 599 ARG C CA    1 
ATOM   8203  C  C     . ARG C 1 331 ? 73.336  111.386 69.340  1.00 64.18  ? 599 ARG C C     1 
ATOM   8204  O  O     . ARG C 1 331 ? 73.015  110.749 68.334  1.00 64.18  ? 599 ARG C O     1 
ATOM   8205  C  CB    . ARG C 1 331 ? 71.986  113.475 69.099  1.00 64.18  ? 599 ARG C CB    1 
ATOM   8206  C  CG    . ARG C 1 331 ? 71.004  112.934 70.100  1.00 64.18  ? 599 ARG C CG    1 
ATOM   8207  C  CD    . ARG C 1 331 ? 69.681  113.655 70.074  1.00 64.18  ? 599 ARG C CD    1 
ATOM   8208  N  NE    . ARG C 1 331 ? 69.786  114.970 70.685  1.00 64.18  ? 599 ARG C NE    1 
ATOM   8209  C  CZ    . ARG C 1 331 ? 68.807  115.860 70.689  1.00 64.18  ? 599 ARG C CZ    1 
ATOM   8210  N  NH1   . ARG C 1 331 ? 67.657  115.565 70.120  1.00 64.18  ? 599 ARG C NH1   1 
ATOM   8211  N  NH2   . ARG C 1 331 ? 68.969  117.037 71.266  1.00 64.18  ? 599 ARG C NH2   1 
ATOM   8212  N  N     . GLY C 1 332 ? 73.636  110.818 70.503  1.00 67.63  ? 600 GLY C N     1 
ATOM   8213  C  CA    . GLY C 1 332 ? 73.631  109.374 70.631  1.00 67.63  ? 600 GLY C CA    1 
ATOM   8214  C  C     . GLY C 1 332 ? 74.824  108.769 69.922  1.00 67.63  ? 600 GLY C C     1 
ATOM   8215  O  O     . GLY C 1 332 ? 75.936  109.304 69.956  1.00 67.63  ? 600 GLY C O     1 
ATOM   8216  N  N     . LYS C 1 333 ? 74.591  107.640 69.258  1.00 71.42  ? 601 LYS C N     1 
ATOM   8217  C  CA    . LYS C 1 333 ? 75.613  106.986 68.458  1.00 71.42  ? 601 LYS C CA    1 
ATOM   8218  C  C     . LYS C 1 333 ? 75.596  107.444 67.011  1.00 71.42  ? 601 LYS C C     1 
ATOM   8219  O  O     . LYS C 1 333 ? 76.102  106.731 66.138  1.00 71.42  ? 601 LYS C O     1 
ATOM   8220  C  CB    . LYS C 1 333 ? 75.454  105.467 68.533  1.00 71.42  ? 601 LYS C CB    1 
ATOM   8221  C  CG    . LYS C 1 333 ? 75.715  104.899 69.910  1.00 71.42  ? 601 LYS C CG    1 
ATOM   8222  C  CD    . LYS C 1 333 ? 75.647  103.388 69.917  1.00 71.42  ? 601 LYS C CD    1 
ATOM   8223  C  CE    . LYS C 1 333 ? 74.218  102.909 69.772  1.00 71.42  ? 601 LYS C CE    1 
ATOM   8224  N  NZ    . LYS C 1 333 ? 73.396  103.277 70.958  1.00 71.42  ? 601 LYS C NZ    1 
ATOM   8225  N  N     . GLY C 1 334 ? 75.022  108.608 66.735  1.00 70.71  ? 602 GLY C N     1 
ATOM   8226  C  CA    . GLY C 1 334 ? 74.997  109.125 65.386  1.00 70.71  ? 602 GLY C CA    1 
ATOM   8227  C  C     . GLY C 1 334 ? 75.673  110.472 65.266  1.00 70.71  ? 602 GLY C C     1 
ATOM   8228  O  O     . GLY C 1 334 ? 75.923  111.140 66.271  1.00 70.71  ? 602 GLY C O     1 
ATOM   8229  N  N     . LEU C 1 335 ? 75.981  110.879 64.041  1.00 69.37  ? 603 LEU C N     1 
ATOM   8230  C  CA    . LEU C 1 335 ? 76.528  112.200 63.777  1.00 69.37  ? 603 LEU C CA    1 
ATOM   8231  C  C     . LEU C 1 335 ? 75.446  113.208 63.429  1.00 69.37  ? 603 LEU C C     1 
ATOM   8232  O  O     . LEU C 1 335 ? 75.757  114.378 63.196  1.00 69.37  ? 603 LEU C O     1 
ATOM   8233  C  CB    . LEU C 1 335 ? 77.559  112.142 62.645  1.00 69.37  ? 603 LEU C CB    1 
ATOM   8234  C  CG    . LEU C 1 335 ? 79.014  111.781 62.967  1.00 69.37  ? 603 LEU C CG    1 
ATOM   8235  C  CD1   . LEU C 1 335 ? 79.560  112.742 63.998  1.00 69.37  ? 603 LEU C CD1   1 
ATOM   8236  C  CD2   . LEU C 1 335 ? 79.214  110.347 63.407  1.00 69.37  ? 603 LEU C CD2   1 
ATOM   8237  N  N     . GLY C 1 336 ? 74.196  112.777 63.386  1.00 67.51  ? 604 GLY C N     1 
ATOM   8238  C  CA    . GLY C 1 336 ? 73.077  113.667 63.151  1.00 67.51  ? 604 GLY C CA    1 
ATOM   8239  C  C     . GLY C 1 336 ? 71.811  112.857 63.287  1.00 67.51  ? 604 GLY C C     1 
ATOM   8240  O  O     . GLY C 1 336 ? 71.845  111.632 63.428  1.00 67.51  ? 604 GLY C O     1 
ATOM   8241  N  N     . TYR C 1 337 ? 70.683  113.556 63.251  1.00 66.15  ? 605 TYR C N     1 
ATOM   8242  C  CA    . TYR C 1 337 ? 69.403  112.875 63.359  1.00 66.15  ? 605 TYR C CA    1 
ATOM   8243  C  C     . TYR C 1 337 ? 68.353  113.674 62.606  1.00 66.15  ? 605 TYR C C     1 
ATOM   8244  O  O     . TYR C 1 337 ? 68.602  114.786 62.142  1.00 66.15  ? 605 TYR C O     1 
ATOM   8245  C  CB    . TYR C 1 337 ? 69.012  112.647 64.823  1.00 66.15  ? 605 TYR C CB    1 
ATOM   8246  C  CG    . TYR C 1 337 ? 68.819  113.898 65.633  1.00 66.15  ? 605 TYR C CG    1 
ATOM   8247  C  CD1   . TYR C 1 337 ? 69.886  114.498 66.282  1.00 66.15  ? 605 TYR C CD1   1 
ATOM   8248  C  CD2   . TYR C 1 337 ? 67.563  114.460 65.780  1.00 66.15  ? 605 TYR C CD2   1 
ATOM   8249  C  CE1   . TYR C 1 337 ? 69.709  115.640 67.031  1.00 66.15  ? 605 TYR C CE1   1 
ATOM   8250  C  CE2   . TYR C 1 337 ? 67.375  115.597 66.523  1.00 66.15  ? 605 TYR C CE2   1 
ATOM   8251  C  CZ    . TYR C 1 337 ? 68.450  116.184 67.145  1.00 66.15  ? 605 TYR C CZ    1 
ATOM   8252  O  OH    . TYR C 1 337 ? 68.256  117.320 67.893  1.00 66.15  ? 605 TYR C OH    1 
ATOM   8253  N  N     . ALA C 1 338 ? 67.166  113.094 62.495  1.00 65.32  ? 606 ALA C N     1 
ATOM   8254  C  CA    . ALA C 1 338 ? 66.130  113.669 61.655  1.00 65.32  ? 606 ALA C CA    1 
ATOM   8255  C  C     . ALA C 1 338 ? 64.827  113.973 62.376  1.00 65.32  ? 606 ALA C C     1 
ATOM   8256  O  O     . ALA C 1 338 ? 64.146  114.918 61.971  1.00 65.32  ? 606 ALA C O     1 
ATOM   8257  C  CB    . ALA C 1 338 ? 65.842  112.742 60.471  1.00 65.32  ? 606 ALA C CB    1 
ATOM   8258  N  N     . GLN C 1 339 ? 64.465  113.202 63.411  1.00 66.26  ? 607 GLN C N     1 
ATOM   8259  C  CA    . GLN C 1 339 ? 63.309  113.446 64.285  1.00 66.26  ? 607 GLN C CA    1 
ATOM   8260  C  C     . GLN C 1 339 ? 62.005  113.485 63.479  1.00 66.26  ? 607 GLN C C     1 
ATOM   8261  O  O     . GLN C 1 339 ? 61.411  114.532 63.238  1.00 66.26  ? 607 GLN C O     1 
ATOM   8262  C  CB    . GLN C 1 339 ? 63.503  114.722 65.118  1.00 66.26  ? 607 GLN C CB    1 
ATOM   8263  C  CG    . GLN C 1 339 ? 62.475  114.962 66.226  1.00 66.26  ? 607 GLN C CG    1 
ATOM   8264  C  CD    . GLN C 1 339 ? 62.551  113.938 67.332  1.00 66.26  ? 607 GLN C CD    1 
ATOM   8265  O  OE1   . GLN C 1 339 ? 63.633  113.520 67.731  1.00 66.26  ? 607 GLN C OE1   1 
ATOM   8266  N  NE2   . GLN C 1 339 ? 61.397  113.541 67.848  1.00 66.26  ? 607 GLN C NE2   1 
ATOM   8267  N  N     . TYR C 1 340 ? 61.627  112.320 62.977  1.00 64.37  ? 608 TYR C N     1 
ATOM   8268  C  CA    . TYR C 1 340 ? 60.347  112.249 62.299  1.00 64.37  ? 608 TYR C CA    1 
ATOM   8269  C  C     . TYR C 1 340 ? 59.216  112.011 63.286  1.00 64.37  ? 608 TYR C C     1 
ATOM   8270  O  O     . TYR C 1 340 ? 59.420  111.601 64.430  1.00 64.37  ? 608 TYR C O     1 
ATOM   8271  C  CB    . TYR C 1 340 ? 60.330  111.147 61.253  1.00 64.37  ? 608 TYR C CB    1 
ATOM   8272  C  CG    . TYR C 1 340 ? 61.136  111.457 60.034  1.00 64.37  ? 608 TYR C CG    1 
ATOM   8273  C  CD1   . TYR C 1 340 ? 60.632  112.276 59.038  1.00 64.37  ? 608 TYR C CD1   1 
ATOM   8274  C  CD2   . TYR C 1 340 ? 62.395  110.922 59.872  1.00 64.37  ? 608 TYR C CD2   1 
ATOM   8275  C  CE1   . TYR C 1 340 ? 61.366  112.558 57.917  1.00 64.37  ? 608 TYR C CE1   1 
ATOM   8276  C  CE2   . TYR C 1 340 ? 63.133  111.194 58.758  1.00 64.37  ? 608 TYR C CE2   1 
ATOM   8277  C  CZ    . TYR C 1 340 ? 62.616  112.012 57.786  1.00 64.37  ? 608 TYR C CZ    1 
ATOM   8278  O  OH    . TYR C 1 340 ? 63.368  112.276 56.676  1.00 64.37  ? 608 TYR C OH    1 
ATOM   8279  N  N     . LEU C 1 341 ? 58.002  112.278 62.815  1.00 62.14  ? 609 LEU C N     1 
ATOM   8280  C  CA    . LEU C 1 341 ? 56.771  112.034 63.554  1.00 62.14  ? 609 LEU C CA    1 
ATOM   8281  C  C     . LEU C 1 341 ? 56.098  110.834 62.909  1.00 62.14  ? 609 LEU C C     1 
ATOM   8282  O  O     . LEU C 1 341 ? 55.363  110.993 61.928  1.00 62.14  ? 609 LEU C O     1 
ATOM   8283  C  CB    . LEU C 1 341 ? 55.864  113.261 63.503  1.00 62.14  ? 609 LEU C CB    1 
ATOM   8284  C  CG    . LEU C 1 341 ? 54.633  113.227 64.392  1.00 62.14  ? 609 LEU C CG    1 
ATOM   8285  C  CD1   . LEU C 1 341 ? 55.080  113.158 65.825  1.00 62.14  ? 609 LEU C CD1   1 
ATOM   8286  C  CD2   . LEU C 1 341 ? 53.797  114.459 64.158  1.00 62.14  ? 609 LEU C CD2   1 
ATOM   8287  N  N     . PRO C 1 342 ? 56.327  109.617 63.404  1.00 65.13  ? 610 PRO C N     1 
ATOM   8288  C  CA    . PRO C 1 342 ? 55.822  108.425 62.711  1.00 65.13  ? 610 PRO C CA    1 
ATOM   8289  C  C     . PRO C 1 342 ? 54.306  108.327 62.789  1.00 65.13  ? 610 PRO C C     1 
ATOM   8290  O  O     . PRO C 1 342 ? 53.715  108.472 63.858  1.00 65.13  ? 610 PRO C O     1 
ATOM   8291  C  CB    . PRO C 1 342 ? 56.500  107.272 63.454  1.00 65.13  ? 610 PRO C CB    1 
ATOM   8292  C  CG    . PRO C 1 342 ? 56.792  107.814 64.794  1.00 65.13  ? 610 PRO C CG    1 
ATOM   8293  C  CD    . PRO C 1 342 ? 57.096  109.268 64.607  1.00 65.13  ? 610 PRO C CD    1 
ATOM   8294  N  N     . LYS C 1 343 ? 53.683  108.133 61.630  1.00 69.78  ? 611 LYS C N     1 
ATOM   8295  C  CA    . LYS C 1 343 ? 52.234  108.010 61.554  1.00 69.78  ? 611 LYS C CA    1 
ATOM   8296  C  C     . LYS C 1 343 ? 51.801  106.740 62.264  1.00 69.78  ? 611 LYS C C     1 
ATOM   8297  O  O     . LYS C 1 343 ? 52.200  105.638 61.878  1.00 69.78  ? 611 LYS C O     1 
ATOM   8298  C  CB    . LYS C 1 343 ? 51.780  107.992 60.100  1.00 69.78  ? 611 LYS C CB    1 
ATOM   8299  C  CG    . LYS C 1 343 ? 51.983  109.304 59.379  1.00 69.78  ? 611 LYS C CG    1 
ATOM   8300  C  CD    . LYS C 1 343 ? 51.526  109.222 57.938  1.00 69.78  ? 611 LYS C CD    1 
ATOM   8301  C  CE    . LYS C 1 343 ? 51.751  110.542 57.225  1.00 69.78  ? 611 LYS C CE    1 
ATOM   8302  N  NZ    . LYS C 1 343 ? 51.321  110.491 55.802  1.00 69.78  ? 611 LYS C NZ    1 
ATOM   8303  N  N     . GLU C 1 344 ? 51.014  106.896 63.320  1.00 69.83  ? 612 GLU C N     1 
ATOM   8304  C  CA    . GLU C 1 344 ? 50.644  105.775 64.176  1.00 69.83  ? 612 GLU C CA    1 
ATOM   8305  C  C     . GLU C 1 344 ? 49.584  104.969 63.441  1.00 69.83  ? 612 GLU C C     1 
ATOM   8306  O  O     . GLU C 1 344 ? 48.382  105.180 63.595  1.00 69.83  ? 612 GLU C O     1 
ATOM   8307  C  CB    . GLU C 1 344 ? 50.161  106.277 65.528  1.00 69.83  ? 612 GLU C CB    1 
ATOM   8308  C  CG    . GLU C 1 344 ? 49.949  105.199 66.558  1.00 69.83  ? 612 GLU C CG    1 
ATOM   8309  C  CD    . GLU C 1 344 ? 49.620  105.771 67.918  1.00 69.83  ? 612 GLU C CD    1 
ATOM   8310  O  OE1   . GLU C 1 344 ? 49.541  107.011 68.040  1.00 69.83  ? 612 GLU C OE1   1 
ATOM   8311  O  OE2   . GLU C 1 344 ? 49.449  104.982 68.869  1.00 69.83  ? 612 GLU C OE2   1 
ATOM   8312  N  N     . GLN C 1 345 ? 50.048  104.042 62.612  1.00 77.30  ? 613 GLN C N     1 
ATOM   8313  C  CA    . GLN C 1 345 ? 49.193  103.241 61.755  1.00 77.30  ? 613 GLN C CA    1 
ATOM   8314  C  C     . GLN C 1 345 ? 49.256  101.779 62.162  1.00 77.30  ? 613 GLN C C     1 
ATOM   8315  O  O     . GLN C 1 345 ? 50.185  101.335 62.839  1.00 77.30  ? 613 GLN C O     1 
ATOM   8316  C  CB    . GLN C 1 345 ? 49.606  103.373 60.290  1.00 77.30  ? 613 GLN C CB    1 
ATOM   8317  C  CG    . GLN C 1 345 ? 49.391  104.735 59.698  1.00 77.30  ? 613 GLN C CG    1 
ATOM   8318  C  CD    . GLN C 1 345 ? 49.888  104.804 58.280  1.00 77.30  ? 613 GLN C CD    1 
ATOM   8319  O  OE1   . GLN C 1 345 ? 50.465  103.846 57.774  1.00 77.30  ? 613 GLN C OE1   1 
ATOM   8320  N  NE2   . GLN C 1 345 ? 49.673  105.939 57.627  1.00 77.30  ? 613 GLN C NE2   1 
ATOM   8321  N  N     . TYR C 1 346 ? 48.247  101.032 61.727  1.00 84.65  ? 614 TYR C N     1 
ATOM   8322  C  CA    . TYR C 1 346 ? 48.174  99.604  61.969  1.00 84.65  ? 614 TYR C CA    1 
ATOM   8323  C  C     . TYR C 1 346 ? 48.252  98.775  60.699  1.00 84.65  ? 614 TYR C C     1 
ATOM   8324  O  O     . TYR C 1 346 ? 48.466  97.562  60.787  1.00 84.65  ? 614 TYR C O     1 
ATOM   8325  C  CB    . TYR C 1 346 ? 46.877  99.260  62.716  1.00 84.65  ? 614 TYR C CB    1 
ATOM   8326  C  CG    . TYR C 1 346 ? 46.851  99.746  64.145  1.00 84.65  ? 614 TYR C CG    1 
ATOM   8327  C  CD1   . TYR C 1 346 ? 48.030  100.018 64.828  1.00 84.65  ? 614 TYR C CD1   1 
ATOM   8328  C  CD2   . TYR C 1 346 ? 45.649  99.962  64.804  1.00 84.65  ? 614 TYR C CD2   1 
ATOM   8329  C  CE1   . TYR C 1 346 ? 48.015  100.472 66.129  1.00 84.65  ? 614 TYR C CE1   1 
ATOM   8330  C  CE2   . TYR C 1 346 ? 45.623  100.416 66.110  1.00 84.65  ? 614 TYR C CE2   1 
ATOM   8331  C  CZ    . TYR C 1 346 ? 46.811  100.670 66.766  1.00 84.65  ? 614 TYR C CZ    1 
ATOM   8332  O  OH    . TYR C 1 346 ? 46.803  101.123 68.064  1.00 84.65  ? 614 TYR C OH    1 
ATOM   8333  N  N     . LEU C 1 347 ? 48.085  99.383  59.530  1.00 78.65  ? 615 LEU C N     1 
ATOM   8334  C  CA    . LEU C 1 347 ? 48.133  98.675  58.258  1.00 78.65  ? 615 LEU C CA    1 
ATOM   8335  C  C     . LEU C 1 347 ? 49.018  99.456  57.305  1.00 78.65  ? 615 LEU C C     1 
ATOM   8336  O  O     . LEU C 1 347 ? 48.605  100.494 56.780  1.00 78.65  ? 615 LEU C O     1 
ATOM   8337  C  CB    . LEU C 1 347 ? 46.742  98.503  57.659  1.00 78.65  ? 615 LEU C CB    1 
ATOM   8338  C  CG    . LEU C 1 347 ? 45.756  97.622  58.413  1.00 78.65  ? 615 LEU C CG    1 
ATOM   8339  C  CD1   . LEU C 1 347 ? 44.427  97.631  57.694  1.00 78.65  ? 615 LEU C CD1   1 
ATOM   8340  C  CD2   . LEU C 1 347 ? 46.287  96.212  58.552  1.00 78.65  ? 615 LEU C CD2   1 
ATOM   8341  N  N     . TYR C 1 348 ? 50.222  98.960  57.077  1.00 71.34  ? 616 TYR C N     1 
ATOM   8342  C  CA    . TYR C 1 348 ? 51.104  99.521  56.071  1.00 71.34  ? 616 TYR C CA    1 
ATOM   8343  C  C     . TYR C 1 348 ? 50.780  98.878  54.735  1.00 71.34  ? 616 TYR C C     1 
ATOM   8344  O  O     . TYR C 1 348 ? 50.679  97.656  54.644  1.00 71.34  ? 616 TYR C O     1 
ATOM   8345  C  CB    . TYR C 1 348 ? 52.557  99.266  56.450  1.00 71.34  ? 616 TYR C CB    1 
ATOM   8346  C  CG    . TYR C 1 348 ? 53.009  100.041 57.658  1.00 71.34  ? 616 TYR C CG    1 
ATOM   8347  C  CD1   . TYR C 1 348 ? 52.424  101.251 57.988  1.00 71.34  ? 616 TYR C CD1   1 
ATOM   8348  C  CD2   . TYR C 1 348 ? 53.979  99.531  58.504  1.00 71.34  ? 616 TYR C CD2   1 
ATOM   8349  C  CE1   . TYR C 1 348 ? 52.823  101.954 59.100  1.00 71.34  ? 616 TYR C CE1   1 
ATOM   8350  C  CE2   . TYR C 1 348 ? 54.381  100.222 59.622  1.00 71.34  ? 616 TYR C CE2   1 
ATOM   8351  C  CZ    . TYR C 1 348 ? 53.800  101.433 59.915  1.00 71.34  ? 616 TYR C CZ    1 
ATOM   8352  O  OH    . TYR C 1 348 ? 54.201  102.126 61.031  1.00 71.34  ? 616 TYR C OH    1 
ATOM   8353  N  N     . THR C 1 349 ? 50.604  99.688  53.707  1.00 68.20  ? 617 THR C N     1 
ATOM   8354  C  CA    . THR C 1 349 ? 50.393  99.132  52.384  1.00 68.20  ? 617 THR C CA    1 
ATOM   8355  C  C     . THR C 1 349 ? 51.746  98.937  51.711  1.00 68.20  ? 617 THR C C     1 
ATOM   8356  O  O     . THR C 1 349 ? 52.797  99.024  52.347  1.00 68.20  ? 617 THR C O     1 
ATOM   8357  C  CB    . THR C 1 349 ? 49.469  100.019 51.558  1.00 68.20  ? 617 THR C CB    1 
ATOM   8358  O  OG1   . THR C 1 349 ? 50.078  101.296 51.361  1.00 68.20  ? 617 THR C OG1   1 
ATOM   8359  C  CG2   . THR C 1 349 ? 48.147  100.205 52.263  1.00 68.20  ? 617 THR C CG2   1 
ATOM   8360  N  N     . LYS C 1 350 ? 51.739  98.662  50.412  1.00 65.44  ? 618 LYS C N     1 
ATOM   8361  C  CA    . LYS C 1 350 ? 53.001  98.432  49.725  1.00 65.44  ? 618 LYS C CA    1 
ATOM   8362  C  C     . LYS C 1 350 ? 53.675  99.744  49.361  1.00 65.44  ? 618 LYS C C     1 
ATOM   8363  O  O     . LYS C 1 350 ? 54.901  99.853  49.427  1.00 65.44  ? 618 LYS C O     1 
ATOM   8364  C  CB    . LYS C 1 350 ? 52.776  97.583  48.478  1.00 65.44  ? 618 LYS C CB    1 
ATOM   8365  C  CG    . LYS C 1 350 ? 54.054  97.117  47.810  1.00 65.44  ? 618 LYS C CG    1 
ATOM   8366  C  CD    . LYS C 1 350 ? 53.751  96.232  46.622  1.00 65.44  ? 618 LYS C CD    1 
ATOM   8367  C  CE    . LYS C 1 350 ? 55.018  95.752  45.950  1.00 65.44  ? 618 LYS C CE    1 
ATOM   8368  N  NZ    . LYS C 1 350 ? 54.711  94.901  44.771  1.00 65.44  ? 618 LYS C NZ    1 
ATOM   8369  N  N     . GLU C 1 351 ? 52.891  100.752 48.988  1.00 66.04  ? 619 GLU C N     1 
ATOM   8370  C  CA    . GLU C 1 351 ? 53.460  102.038 48.621  1.00 66.04  ? 619 GLU C CA    1 
ATOM   8371  C  C     . GLU C 1 351 ? 53.898  102.849 49.827  1.00 66.04  ? 619 GLU C C     1 
ATOM   8372  O  O     . GLU C 1 351 ? 54.766  103.712 49.687  1.00 66.04  ? 619 GLU C O     1 
ATOM   8373  C  CB    . GLU C 1 351 ? 52.457  102.847 47.804  1.00 66.04  ? 619 GLU C CB    1 
ATOM   8374  C  CG    . GLU C 1 351 ? 52.196  102.301 46.413  1.00 66.04  ? 619 GLU C CG    1 
ATOM   8375  C  CD    . GLU C 1 351 ? 51.131  101.224 46.387  1.00 66.04  ? 619 GLU C CD    1 
ATOM   8376  O  OE1   . GLU C 1 351 ? 50.543  100.940 47.450  1.00 66.04  ? 619 GLU C OE1   1 
ATOM   8377  O  OE2   . GLU C 1 351 ? 50.881  100.659 45.303  1.00 66.04  ? 619 GLU C OE2   1 
ATOM   8378  N  N     . GLN C 1 352 ? 53.314  102.607 50.998  1.00 67.93  ? 620 GLN C N     1 
ATOM   8379  C  CA    . GLN C 1 352 ? 53.751  103.325 52.189  1.00 67.93  ? 620 GLN C CA    1 
ATOM   8380  C  C     . GLN C 1 352 ? 55.101  102.816 52.658  1.00 67.93  ? 620 GLN C C     1 
ATOM   8381  O  O     . GLN C 1 352 ? 55.923  103.587 53.160  1.00 67.93  ? 620 GLN C O     1 
ATOM   8382  C  CB    . GLN C 1 352 ? 52.721  103.176 53.303  1.00 67.93  ? 620 GLN C CB    1 
ATOM   8383  C  CG    . GLN C 1 352 ? 51.377  103.782 52.998  1.00 67.93  ? 620 GLN C CG    1 
ATOM   8384  C  CD    . GLN C 1 352 ? 50.379  103.536 54.099  1.00 67.93  ? 620 GLN C CD    1 
ATOM   8385  O  OE1   . GLN C 1 352 ? 50.685  102.880 55.089  1.00 67.93  ? 620 GLN C OE1   1 
ATOM   8386  N  NE2   . GLN C 1 352 ? 49.166  104.039 53.923  1.00 67.93  ? 620 GLN C NE2   1 
ATOM   8387  N  N     . LEU C 1 353 ? 55.343  101.518 52.502  1.00 61.27  ? 621 LEU C N     1 
ATOM   8388  C  CA    . LEU C 1 353 ? 56.624  100.940 52.867  1.00 61.27  ? 621 LEU C CA    1 
ATOM   8389  C  C     . LEU C 1 353 ? 57.717  101.279 51.868  1.00 61.27  ? 621 LEU C C     1 
ATOM   8390  O  O     . LEU C 1 353 ? 58.896  101.233 52.224  1.00 61.27  ? 621 LEU C O     1 
ATOM   8391  C  CB    . LEU C 1 353 ? 56.488  99.428  52.988  1.00 61.27  ? 621 LEU C CB    1 
ATOM   8392  C  CG    . LEU C 1 353 ? 55.654  98.894  54.142  1.00 61.27  ? 621 LEU C CG    1 
ATOM   8393  C  CD1   . LEU C 1 353 ? 55.439  97.410  53.985  1.00 61.27  ? 621 LEU C CD1   1 
ATOM   8394  C  CD2   . LEU C 1 353 ? 56.355  99.177  55.441  1.00 61.27  ? 621 LEU C CD2   1 
ATOM   8395  N  N     . LEU C 1 354 ? 57.358  101.608 50.628  1.00 64.26  ? 622 LEU C N     1 
ATOM   8396  C  CA    . LEU C 1 354 ? 58.361  102.008 49.650  1.00 64.26  ? 622 LEU C CA    1 
ATOM   8397  C  C     . LEU C 1 354 ? 58.888  103.401 49.946  1.00 64.26  ? 622 LEU C C     1 
ATOM   8398  O  O     . LEU C 1 354 ? 60.090  103.658 49.815  1.00 64.26  ? 622 LEU C O     1 
ATOM   8399  C  CB    . LEU C 1 354 ? 57.770  101.955 48.246  1.00 64.26  ? 622 LEU C CB    1 
ATOM   8400  C  CG    . LEU C 1 354 ? 58.734  102.288 47.114  1.00 64.26  ? 622 LEU C CG    1 
ATOM   8401  C  CD1   . LEU C 1 354 ? 59.849  101.277 47.092  1.00 64.26  ? 622 LEU C CD1   1 
ATOM   8402  C  CD2   . LEU C 1 354 ? 58.018  102.303 45.788  1.00 64.26  ? 622 LEU C CD2   1 
ATOM   8403  N  N     . ASP C 1 355 ? 58.013  104.308 50.367  1.00 65.32  ? 623 ASP C N     1 
ATOM   8404  C  CA    . ASP C 1 355 ? 58.421  105.678 50.630  1.00 65.32  ? 623 ASP C CA    1 
ATOM   8405  C  C     . ASP C 1 355 ? 59.111  105.847 51.973  1.00 65.32  ? 623 ASP C C     1 
ATOM   8406  O  O     . ASP C 1 355 ? 59.578  106.949 52.269  1.00 65.32  ? 623 ASP C O     1 
ATOM   8407  C  CB    . ASP C 1 355 ? 57.213  106.601 50.528  1.00 65.32  ? 623 ASP C CB    1 
ATOM   8408  C  CG    . ASP C 1 355 ? 56.734  106.754 49.103  1.00 65.32  ? 623 ASP C CG    1 
ATOM   8409  O  OD1   . ASP C 1 355 ? 57.584  106.718 48.194  1.00 65.32  ? 623 ASP C OD1   1 
ATOM   8410  O  OD2   . ASP C 1 355 ? 55.516  106.871 48.877  1.00 65.32  ? 623 ASP C OD2   1 
ATOM   8411  N  N     . ARG C 1 356 ? 59.185  104.799 52.791  1.00 65.44  ? 624 ARG C N     1 
ATOM   8412  C  CA    . ARG C 1 356 ? 60.170  104.801 53.862  1.00 65.44  ? 624 ARG C CA    1 
ATOM   8413  C  C     . ARG C 1 356 ? 61.529  104.362 53.341  1.00 65.44  ? 624 ARG C C     1 
ATOM   8414  O  O     . ARG C 1 356 ? 62.559  104.883 53.775  1.00 65.44  ? 624 ARG C O     1 
ATOM   8415  C  CB    . ARG C 1 356 ? 59.731  103.894 55.003  1.00 65.44  ? 624 ARG C CB    1 
ATOM   8416  C  CG    . ARG C 1 356 ? 58.539  104.392 55.767  1.00 65.44  ? 624 ARG C CG    1 
ATOM   8417  C  CD    . ARG C 1 356 ? 58.215  103.432 56.889  1.00 65.44  ? 624 ARG C CD    1 
ATOM   8418  N  NE    . ARG C 1 356 ? 56.976  103.792 57.565  1.00 65.44  ? 624 ARG C NE    1 
ATOM   8419  C  CZ    . ARG C 1 356 ? 56.907  104.605 58.612  1.00 65.44  ? 624 ARG C CZ    1 
ATOM   8420  N  NH1   . ARG C 1 356 ? 58.012  105.142 59.111  1.00 65.44  ? 624 ARG C NH1   1 
ATOM   8421  N  NH2   . ARG C 1 356 ? 55.734  104.878 59.164  1.00 65.44  ? 624 ARG C NH2   1 
ATOM   8422  N  N     . MET C 1 357 ? 61.547  103.400 52.416  1.00 65.11  ? 625 MET C N     1 
ATOM   8423  C  CA    . MET C 1 357 ? 62.801  102.982 51.800  1.00 65.11  ? 625 MET C CA    1 
ATOM   8424  C  C     . MET C 1 357 ? 63.353  104.068 50.897  1.00 65.11  ? 625 MET C C     1 
ATOM   8425  O  O     . MET C 1 357 ? 64.570  104.269 50.830  1.00 65.11  ? 625 MET C O     1 
ATOM   8426  C  CB    . MET C 1 357 ? 62.599  101.698 51.002  1.00 65.11  ? 625 MET C CB    1 
ATOM   8427  C  CG    . MET C 1 357 ? 62.272  100.489 51.841  1.00 65.11  ? 625 MET C CG    1 
ATOM   8428  S  SD    . MET C 1 357 ? 61.906  99.066  50.807  1.00 65.11  ? 625 MET C SD    1 
ATOM   8429  C  CE    . MET C 1 357 ? 63.515  98.754  50.120  1.00 65.11  ? 625 MET C CE    1 
ATOM   8430  N  N     . CYS C 1 358 ? 62.481  104.789 50.206  1.00 65.30  ? 626 CYS C N     1 
ATOM   8431  C  CA    . CYS C 1 358 ? 62.951  105.872 49.360  1.00 65.30  ? 626 CYS C CA    1 
ATOM   8432  C  C     . CYS C 1 358 ? 63.333  107.109 50.151  1.00 65.30  ? 626 CYS C C     1 
ATOM   8433  O  O     . CYS C 1 358 ? 63.902  108.040 49.577  1.00 65.30  ? 626 CYS C O     1 
ATOM   8434  C  CB    . CYS C 1 358 ? 61.894  106.238 48.325  1.00 65.30  ? 626 CYS C CB    1 
ATOM   8435  S  SG    . CYS C 1 358 ? 61.569  104.956 47.113  1.00 65.30  ? 626 CYS C SG    1 
ATOM   8436  N  N     . MET C 1 359 ? 63.025  107.145 51.441  1.00 64.44  ? 627 MET C N     1 
ATOM   8437  C  CA    . MET C 1 359 ? 63.460  108.198 52.342  1.00 64.44  ? 627 MET C CA    1 
ATOM   8438  C  C     . MET C 1 359 ? 64.701  107.803 53.122  1.00 64.44  ? 627 MET C C     1 
ATOM   8439  O  O     . MET C 1 359 ? 65.596  108.629 53.309  1.00 64.44  ? 627 MET C O     1 
ATOM   8440  C  CB    . MET C 1 359 ? 62.319  108.558 53.298  1.00 64.44  ? 627 MET C CB    1 
ATOM   8441  C  CG    . MET C 1 359 ? 62.591  109.679 54.284  1.00 64.44  ? 627 MET C CG    1 
ATOM   8442  S  SD    . MET C 1 359 ? 63.241  109.130 55.873  1.00 64.44  ? 627 MET C SD    1 
ATOM   8443  C  CE    . MET C 1 359 ? 61.786  108.369 56.581  1.00 64.44  ? 627 MET C CE    1 
ATOM   8444  N  N     . THR C 1 360 ? 64.773  106.551 53.581  1.00 60.31  ? 628 THR C N     1 
ATOM   8445  C  CA    . THR C 1 360 ? 65.944  106.089 54.316  1.00 60.31  ? 628 THR C CA    1 
ATOM   8446  C  C     . THR C 1 360 ? 67.157  105.981 53.402  1.00 60.31  ? 628 THR C C     1 
ATOM   8447  O  O     . THR C 1 360 ? 68.291  106.197 53.842  1.00 60.31  ? 628 THR C O     1 
ATOM   8448  C  CB    . THR C 1 360 ? 65.634  104.753 54.988  1.00 60.31  ? 628 THR C CB    1 
ATOM   8449  O  OG1   . THR C 1 360 ? 64.412  104.873 55.718  1.00 60.31  ? 628 THR C OG1   1 
ATOM   8450  C  CG2   . THR C 1 360 ? 66.706  104.385 55.974  1.00 60.31  ? 628 THR C CG2   1 
ATOM   8451  N  N     . LEU C 1 361 ? 66.943  105.709 52.120  1.00 62.09  ? 629 LEU C N     1 
ATOM   8452  C  CA    . LEU C 1 361 ? 68.031  105.791 51.156  1.00 62.09  ? 629 LEU C CA    1 
ATOM   8453  C  C     . LEU C 1 361 ? 68.338  107.212 50.725  1.00 62.09  ? 629 LEU C C     1 
ATOM   8454  O  O     . LEU C 1 361 ? 69.293  107.409 49.974  1.00 62.09  ? 629 LEU C O     1 
ATOM   8455  C  CB    . LEU C 1 361 ? 67.724  104.970 49.907  1.00 62.09  ? 629 LEU C CB    1 
ATOM   8456  C  CG    . LEU C 1 361 ? 67.717  103.457 50.038  1.00 62.09  ? 629 LEU C CG    1 
ATOM   8457  C  CD1   . LEU C 1 361 ? 67.330  102.851 48.714  1.00 62.09  ? 629 LEU C CD1   1 
ATOM   8458  C  CD2   . LEU C 1 361 ? 69.071  102.967 50.483  1.00 62.09  ? 629 LEU C CD2   1 
ATOM   8459  N  N     . GLY C 1 362 ? 67.567  108.199 51.177  1.00 58.82  ? 630 GLY C N     1 
ATOM   8460  C  CA    . GLY C 1 362 ? 67.703  109.546 50.660  1.00 58.82  ? 630 GLY C CA    1 
ATOM   8461  C  C     . GLY C 1 362 ? 68.963  110.257 51.086  1.00 58.82  ? 630 GLY C C     1 
ATOM   8462  O  O     . GLY C 1 362 ? 69.392  111.189 50.402  1.00 58.82  ? 630 GLY C O     1 
ATOM   8463  N  N     . GLY C 1 363 ? 69.566  109.841 52.195  1.00 59.72  ? 631 GLY C N     1 
ATOM   8464  C  CA    . GLY C 1 363 ? 70.771  110.508 52.653  1.00 59.72  ? 631 GLY C CA    1 
ATOM   8465  C  C     . GLY C 1 363 ? 71.980  110.171 51.806  1.00 59.72  ? 631 GLY C C     1 
ATOM   8466  O  O     . GLY C 1 363 ? 72.773  111.050 51.463  1.00 59.72  ? 631 GLY C O     1 
ATOM   8467  N  N     . ARG C 1 364 ? 72.137  108.897 51.458  1.00 61.67  ? 632 ARG C N     1 
ATOM   8468  C  CA    . ARG C 1 364 ? 73.272  108.476 50.652  1.00 61.67  ? 632 ARG C CA    1 
ATOM   8469  C  C     . ARG C 1 364 ? 73.156  108.977 49.221  1.00 61.67  ? 632 ARG C C     1 
ATOM   8470  O  O     . ARG C 1 364 ? 74.173  109.210 48.561  1.00 61.67  ? 632 ARG C O     1 
ATOM   8471  C  CB    . ARG C 1 364 ? 73.373  106.958 50.684  1.00 61.67  ? 632 ARG C CB    1 
ATOM   8472  C  CG    . ARG C 1 364 ? 74.629  106.424 50.090  1.00 61.67  ? 632 ARG C CG    1 
ATOM   8473  C  CD    . ARG C 1 364 ? 74.667  104.942 50.165  1.00 61.67  ? 632 ARG C CD    1 
ATOM   8474  N  NE    . ARG C 1 364 ? 75.886  104.470 49.549  1.00 61.67  ? 632 ARG C NE    1 
ATOM   8475  C  CZ    . ARG C 1 364 ? 76.176  103.194 49.374  1.00 61.67  ? 632 ARG C CZ    1 
ATOM   8476  N  NH1   . ARG C 1 364 ? 75.325  102.258 49.753  1.00 61.67  ? 632 ARG C NH1   1 
ATOM   8477  N  NH2   . ARG C 1 364 ? 77.312  102.857 48.799  1.00 61.67  ? 632 ARG C NH2   1 
ATOM   8478  N  N     . VAL C 1 365 ? 71.930  109.155 48.734  1.00 60.43  ? 633 VAL C N     1 
ATOM   8479  C  CA    . VAL C 1 365 ? 71.717  109.702 47.400  1.00 60.43  ? 633 VAL C CA    1 
ATOM   8480  C  C     . VAL C 1 365 ? 72.196  111.147 47.328  1.00 60.43  ? 633 VAL C C     1 
ATOM   8481  O  O     . VAL C 1 365 ? 72.833  111.557 46.352  1.00 60.43  ? 633 VAL C O     1 
ATOM   8482  C  CB    . VAL C 1 365 ? 70.233  109.561 47.024  1.00 60.43  ? 633 VAL C CB    1 
ATOM   8483  C  CG1   . VAL C 1 365 ? 69.921  110.306 45.760  1.00 60.43  ? 633 VAL C CG1   1 
ATOM   8484  C  CG2   . VAL C 1 365 ? 69.897  108.116 46.841  1.00 60.43  ? 633 VAL C CG2   1 
ATOM   8485  N  N     . SER C 1 366 ? 71.944  111.928 48.380  1.00 60.43  ? 634 SER C N     1 
ATOM   8486  C  CA    . SER C 1 366 ? 72.374  113.320 48.387  1.00 60.43  ? 634 SER C CA    1 
ATOM   8487  C  C     . SER C 1 366 ? 73.882  113.451 48.513  1.00 60.43  ? 634 SER C C     1 
ATOM   8488  O  O     . SER C 1 366 ? 74.457  114.424 48.016  1.00 60.43  ? 634 SER C O     1 
ATOM   8489  C  CB    . SER C 1 366 ? 71.695  114.071 49.520  1.00 60.43  ? 634 SER C CB    1 
ATOM   8490  O  OG    . SER C 1 366 ? 72.177  115.399 49.579  1.00 60.43  ? 634 SER C OG    1 
ATOM   8491  N  N     . GLU C 1 367 ? 74.534  112.505 49.193  1.00 62.49  ? 635 GLU C N     1 
ATOM   8492  C  CA    . GLU C 1 367 ? 75.991  112.452 49.162  1.00 62.49  ? 635 GLU C CA    1 
ATOM   8493  C  C     . GLU C 1 367 ? 76.494  112.143 47.763  1.00 62.49  ? 635 GLU C C     1 
ATOM   8494  O  O     . GLU C 1 367 ? 77.468  112.740 47.297  1.00 62.49  ? 635 GLU C O     1 
ATOM   8495  C  CB    . GLU C 1 367 ? 76.513  111.390 50.123  1.00 62.49  ? 635 GLU C CB    1 
ATOM   8496  C  CG    . GLU C 1 367 ? 76.291  111.647 51.586  1.00 62.49  ? 635 GLU C CG    1 
ATOM   8497  C  CD    . GLU C 1 367 ? 76.821  110.510 52.434  1.00 62.49  ? 635 GLU C CD    1 
ATOM   8498  O  OE1   . GLU C 1 367 ? 77.240  109.492 51.853  1.00 62.49  ? 635 GLU C OE1   1 
ATOM   8499  O  OE2   . GLU C 1 367 ? 76.814  110.625 53.674  1.00 62.49  ? 635 GLU C OE2   1 
ATOM   8500  N  N     . GLU C 1 368 ? 75.831  111.217 47.077  1.00 62.90  ? 636 GLU C N     1 
ATOM   8501  C  CA    . GLU C 1 368 ? 76.308  110.737 45.790  1.00 62.90  ? 636 GLU C CA    1 
ATOM   8502  C  C     . GLU C 1 368 ? 76.069  111.750 44.681  1.00 62.90  ? 636 GLU C C     1 
ATOM   8503  O  O     . GLU C 1 368 ? 76.805  111.760 43.690  1.00 62.90  ? 636 GLU C O     1 
ATOM   8504  C  CB    . GLU C 1 368 ? 75.638  109.397 45.481  1.00 62.90  ? 636 GLU C CB    1 
ATOM   8505  C  CG    . GLU C 1 368 ? 76.232  108.594 44.339  1.00 62.90  ? 636 GLU C CG    1 
ATOM   8506  C  CD    . GLU C 1 368 ? 75.596  108.910 43.004  1.00 62.90  ? 636 GLU C CD    1 
ATOM   8507  O  OE1   . GLU C 1 368 ? 74.405  109.285 42.990  1.00 62.90  ? 636 GLU C OE1   1 
ATOM   8508  O  OE2   . GLU C 1 368 ? 76.284  108.783 41.969  1.00 62.90  ? 636 GLU C OE2   1 
ATOM   8509  N  N     . ILE C 1 369 ? 75.070  112.618 44.829  1.00 62.67  ? 637 ILE C N     1 
ATOM   8510  C  CA    . ILE C 1 369 ? 74.831  113.646 43.823  1.00 62.67  ? 637 ILE C CA    1 
ATOM   8511  C  C     . ILE C 1 369 ? 75.810  114.799 43.984  1.00 62.67  ? 637 ILE C C     1 
ATOM   8512  O  O     . ILE C 1 369 ? 76.399  115.272 43.007  1.00 62.67  ? 637 ILE C O     1 
ATOM   8513  C  CB    . ILE C 1 369 ? 73.370  114.117 43.899  1.00 62.67  ? 637 ILE C CB    1 
ATOM   8514  C  CG1   . ILE C 1 369 ? 72.436  112.997 43.459  1.00 62.67  ? 637 ILE C CG1   1 
ATOM   8515  C  CG2   . ILE C 1 369 ? 73.144  115.350 43.055  1.00 62.67  ? 637 ILE C CG2   1 
ATOM   8516  C  CD1   . ILE C 1 369 ? 70.995  113.279 43.746  1.00 62.67  ? 637 ILE C CD1   1 
ATOM   8517  N  N     . PHE C 1 370 ? 76.022  115.247 45.217  1.00 62.95  ? 638 PHE C N     1 
ATOM   8518  C  CA    . PHE C 1 370 ? 76.872  116.403 45.464  1.00 62.95  ? 638 PHE C CA    1 
ATOM   8519  C  C     . PHE C 1 370 ? 78.348  116.062 45.344  1.00 62.95  ? 638 PHE C C     1 
ATOM   8520  O  O     . PHE C 1 370 ? 79.101  116.760 44.660  1.00 62.95  ? 638 PHE C O     1 
ATOM   8521  C  CB    . PHE C 1 370 ? 76.578  116.966 46.848  1.00 62.95  ? 638 PHE C CB    1 
ATOM   8522  C  CG    . PHE C 1 370 ? 75.269  117.668 46.942  1.00 62.95  ? 638 PHE C CG    1 
ATOM   8523  C  CD1   . PHE C 1 370 ? 74.670  118.198 45.815  1.00 62.95  ? 638 PHE C CD1   1 
ATOM   8524  C  CD2   . PHE C 1 370 ? 74.620  117.767 48.150  1.00 62.95  ? 638 PHE C CD2   1 
ATOM   8525  C  CE1   . PHE C 1 370 ? 73.465  118.834 45.902  1.00 62.95  ? 638 PHE C CE1   1 
ATOM   8526  C  CE2   . PHE C 1 370 ? 73.417  118.402 48.241  1.00 62.95  ? 638 PHE C CE2   1 
ATOM   8527  C  CZ    . PHE C 1 370 ? 72.834  118.934 47.115  1.00 62.95  ? 638 PHE C CZ    1 
ATOM   8528  N  N     . PHE C 1 371 ? 78.778  114.996 46.006  1.00 64.60  ? 639 PHE C N     1 
ATOM   8529  C  CA    . PHE C 1 371 ? 80.192  114.678 46.125  1.00 64.60  ? 639 PHE C CA    1 
ATOM   8530  C  C     . PHE C 1 371 ? 80.673  113.692 45.079  1.00 64.60  ? 639 PHE C C     1 
ATOM   8531  O  O     . PHE C 1 371 ? 81.798  113.814 44.592  1.00 64.60  ? 639 PHE C O     1 
ATOM   8532  C  CB    . PHE C 1 371 ? 80.480  114.098 47.509  1.00 64.60  ? 639 PHE C CB    1 
ATOM   8533  C  CG    . PHE C 1 371 ? 80.326  115.080 48.627  1.00 64.60  ? 639 PHE C CG    1 
ATOM   8534  C  CD1   . PHE C 1 371 ? 80.365  116.447 48.395  1.00 64.60  ? 639 PHE C CD1   1 
ATOM   8535  C  CD2   . PHE C 1 371 ? 80.125  114.631 49.916  1.00 64.60  ? 639 PHE C CD2   1 
ATOM   8536  C  CE1   . PHE C 1 371 ? 80.220  117.338 49.434  1.00 64.60  ? 639 PHE C CE1   1 
ATOM   8537  C  CE2   . PHE C 1 371 ? 79.977  115.516 50.954  1.00 64.60  ? 639 PHE C CE2   1 
ATOM   8538  C  CZ    . PHE C 1 371 ? 80.032  116.867 50.715  1.00 64.60  ? 639 PHE C CZ    1 
ATOM   8539  N  N     . GLY C 1 372 ? 79.851  112.713 44.729  1.00 64.83  ? 640 GLY C N     1 
ATOM   8540  C  CA    . GLY C 1 372 ? 80.326  111.590 43.957  1.00 64.83  ? 640 GLY C CA    1 
ATOM   8541  C  C     . GLY C 1 372 ? 81.076  110.562 44.766  1.00 64.83  ? 640 GLY C C     1 
ATOM   8542  O  O     . GLY C 1 372 ? 81.730  109.693 44.183  1.00 64.83  ? 640 GLY C O     1 
ATOM   8543  N  N     . ARG C 1 373 ? 81.007  110.634 46.092  1.00 65.23  ? 641 ARG C N     1 
ATOM   8544  C  CA    . ARG C 1 373 ? 81.767  109.755 46.970  1.00 65.23  ? 641 ARG C CA    1 
ATOM   8545  C  C     . ARG C 1 373 ? 80.823  109.183 48.014  1.00 65.23  ? 641 ARG C C     1 
ATOM   8546  O  O     . ARG C 1 373 ? 80.387  109.899 48.919  1.00 65.23  ? 641 ARG C O     1 
ATOM   8547  C  CB    . ARG C 1 373 ? 82.922  110.501 47.634  1.00 65.23  ? 641 ARG C CB    1 
ATOM   8548  C  CG    . ARG C 1 373 ? 84.015  110.931 46.672  1.00 65.23  ? 641 ARG C CG    1 
ATOM   8549  C  CD    . ARG C 1 373 ? 85.228  111.486 47.397  1.00 65.23  ? 641 ARG C CD    1 
ATOM   8550  N  NE    . ARG C 1 373 ? 84.919  112.705 48.138  1.00 65.23  ? 641 ARG C NE    1 
ATOM   8551  C  CZ    . ARG C 1 373 ? 84.960  113.925 47.615  1.00 65.23  ? 641 ARG C CZ    1 
ATOM   8552  N  NH1   . ARG C 1 373 ? 85.293  114.092 46.343  1.00 65.23  ? 641 ARG C NH1   1 
ATOM   8553  N  NH2   . ARG C 1 373 ? 84.665  114.978 48.363  1.00 65.23  ? 641 ARG C NH2   1 
ATOM   8554  N  N     . ILE C 1 374 ? 80.507  107.900 47.880  1.00 62.76  ? 642 ILE C N     1 
ATOM   8555  C  CA    . ILE C 1 374 ? 79.748  107.198 48.900  1.00 62.76  ? 642 ILE C CA    1 
ATOM   8556  C  C     . ILE C 1 374 ? 80.591  107.075 50.162  1.00 62.76  ? 642 ILE C C     1 
ATOM   8557  O  O     . ILE C 1 374 ? 81.821  106.952 50.103  1.00 62.76  ? 642 ILE C O     1 
ATOM   8558  C  CB    . ILE C 1 374 ? 79.308  105.830 48.358  1.00 62.76  ? 642 ILE C CB    1 
ATOM   8559  C  CG1   . ILE C 1 374 ? 80.520  105.068 47.831  1.00 62.76  ? 642 ILE C CG1   1 
ATOM   8560  C  CG2   . ILE C 1 374 ? 78.295  106.007 47.252  1.00 62.76  ? 642 ILE C CG2   1 
ATOM   8561  C  CD1   . ILE C 1 374 ? 80.239  103.662 47.422  1.00 62.76  ? 642 ILE C CD1   1 
ATOM   8562  N  N     . THR C 1 375 ? 79.942  107.161 51.314  1.00 61.01  ? 643 THR C N     1 
ATOM   8563  C  CA    . THR C 1 375 ? 80.635  107.102 52.588  1.00 61.01  ? 643 THR C CA    1 
ATOM   8564  C  C     . THR C 1 375 ? 80.147  105.906 53.385  1.00 61.01  ? 643 THR C C     1 
ATOM   8565  O  O     . THR C 1 375 ? 79.200  105.220 53.004  1.00 61.01  ? 643 THR C O     1 
ATOM   8566  C  CB    . THR C 1 375 ? 80.428  108.379 53.409  1.00 61.01  ? 643 THR C CB    1 
ATOM   8567  O  OG1   . THR C 1 375 ? 79.037  108.538 53.703  1.00 61.01  ? 643 THR C OG1   1 
ATOM   8568  C  CG2   . THR C 1 375 ? 80.918  109.591 52.654  1.00 61.01  ? 643 THR C CG2   1 
ATOM   8569  N  N     . THR C 1 376 ? 80.803  105.668 54.511  1.00 62.40  ? 644 THR C N     1 
ATOM   8570  C  CA    . THR C 1 376 ? 80.394  104.616 55.422  1.00 62.40  ? 644 THR C CA    1 
ATOM   8571  C  C     . THR C 1 376 ? 79.449  105.121 56.491  1.00 62.40  ? 644 THR C C     1 
ATOM   8572  O  O     . THR C 1 376 ? 79.134  104.379 57.422  1.00 62.40  ? 644 THR C O     1 
ATOM   8573  C  CB    . THR C 1 376 ? 81.605  103.977 56.092  1.00 62.40  ? 644 THR C CB    1 
ATOM   8574  O  OG1   . THR C 1 376 ? 82.217  104.924 56.969  1.00 62.40  ? 644 THR C OG1   1 
ATOM   8575  C  CG2   . THR C 1 376 ? 82.612  103.554 55.050  1.00 62.40  ? 644 THR C CG2   1 
ATOM   8576  N  N     . GLY C 1 377 ? 79.006  106.369 56.392  1.00 63.36  ? 645 GLY C N     1 
ATOM   8577  C  CA    . GLY C 1 377 ? 78.088  106.903 57.375  1.00 63.36  ? 645 GLY C CA    1 
ATOM   8578  C  C     . GLY C 1 377 ? 76.657  106.473 57.200  1.00 63.36  ? 645 GLY C C     1 
ATOM   8579  O  O     . GLY C 1 377 ? 75.853  106.636 58.121  1.00 63.36  ? 645 GLY C O     1 
ATOM   8580  N  N     . ALA C 1 378 ? 76.320  105.916 56.042  1.00 62.80  ? 646 ALA C N     1 
ATOM   8581  C  CA    . ALA C 1 378 ? 74.974  105.439 55.767  1.00 62.80  ? 646 ALA C CA    1 
ATOM   8582  C  C     . ALA C 1 378 ? 74.801  103.970 56.104  1.00 62.80  ? 646 ALA C C     1 
ATOM   8583  O  O     . ALA C 1 378 ? 74.003  103.291 55.457  1.00 62.80  ? 646 ALA C O     1 
ATOM   8584  C  CB    . ALA C 1 378 ? 74.623  105.693 54.303  1.00 62.80  ? 646 ALA C CB    1 
ATOM   8585  N  N     . GLN C 1 379 ? 75.545  103.456 57.084  1.00 64.93  ? 647 GLN C N     1 
ATOM   8586  C  CA    . GLN C 1 379 ? 75.460  102.038 57.411  1.00 64.93  ? 647 GLN C CA    1 
ATOM   8587  C  C     . GLN C 1 379 ? 74.124  101.692 58.052  1.00 64.93  ? 647 GLN C C     1 
ATOM   8588  O  O     . GLN C 1 379 ? 73.507  100.681 57.702  1.00 64.93  ? 647 GLN C O     1 
ATOM   8589  C  CB    . GLN C 1 379 ? 76.606  101.640 58.333  1.00 64.93  ? 647 GLN C CB    1 
ATOM   8590  C  CG    . GLN C 1 379 ? 76.621  100.176 58.689  1.00 64.93  ? 647 GLN C CG    1 
ATOM   8591  C  CD    . GLN C 1 379 ? 77.781  99.816  59.578  1.00 64.93  ? 647 GLN C CD    1 
ATOM   8592  O  OE1   . GLN C 1 379 ? 78.586  100.669 59.939  1.00 64.93  ? 647 GLN C OE1   1 
ATOM   8593  N  NE2   . GLN C 1 379 ? 77.869  98.548  59.949  1.00 64.93  ? 647 GLN C NE2   1 
ATOM   8594  N  N     . ASP C 1 380 ? 73.653  102.522 58.979  1.00 68.65  ? 648 ASP C N     1 
ATOM   8595  C  CA    . ASP C 1 380 ? 72.370  102.264 59.615  1.00 68.65  ? 648 ASP C CA    1 
ATOM   8596  C  C     . ASP C 1 380 ? 71.191  102.589 58.715  1.00 68.65  ? 648 ASP C C     1 
ATOM   8597  O  O     . ASP C 1 380 ? 70.083  102.117 58.981  1.00 68.65  ? 648 ASP C O     1 
ATOM   8598  C  CB    . ASP C 1 380 ? 72.255  103.048 60.919  1.00 68.65  ? 648 ASP C CB    1 
ATOM   8599  C  CG    . ASP C 1 380 ? 73.108  102.461 62.020  1.00 68.65  ? 648 ASP C CG    1 
ATOM   8600  O  OD1   . ASP C 1 380 ? 73.336  101.234 62.000  1.00 68.65  ? 648 ASP C OD1   1 
ATOM   8601  O  OD2   . ASP C 1 380 ? 73.547  103.222 62.907  1.00 68.65  ? 648 ASP C OD2   1 
ATOM   8602  N  N     . ASP C 1 381 ? 71.388  103.396 57.674  1.00 67.05  ? 649 ASP C N     1 
ATOM   8603  C  CA    . ASP C 1 381 ? 70.320  103.582 56.703  1.00 67.05  ? 649 ASP C CA    1 
ATOM   8604  C  C     . ASP C 1 381 ? 70.138  102.331 55.859  1.00 67.05  ? 649 ASP C C     1 
ATOM   8605  O  O     . ASP C 1 381 ? 69.011  101.972 55.510  1.00 67.05  ? 649 ASP C O     1 
ATOM   8606  C  CB    . ASP C 1 381 ? 70.608  104.790 55.812  1.00 67.05  ? 649 ASP C CB    1 
ATOM   8607  C  CG    . ASP C 1 381 ? 70.563  106.101 56.569  1.00 67.05  ? 649 ASP C CG    1 
ATOM   8608  O  OD1   . ASP C 1 381 ? 69.851  106.180 57.586  1.00 67.05  ? 649 ASP C OD1   1 
ATOM   8609  O  OD2   . ASP C 1 381 ? 71.239  107.061 56.146  1.00 67.05  ? 649 ASP C OD2   1 
ATOM   8610  N  N     . LEU C 1 382 ? 71.233  101.640 55.541  1.00 62.10  ? 650 LEU C N     1 
ATOM   8611  C  CA    . LEU C 1 382 ? 71.157  100.476 54.668  1.00 62.10  ? 650 LEU C CA    1 
ATOM   8612  C  C     . LEU C 1 382 ? 70.660  99.233  55.389  1.00 62.10  ? 650 LEU C C     1 
ATOM   8613  O  O     . LEU C 1 382 ? 70.057  98.364  54.755  1.00 62.10  ? 650 LEU C O     1 
ATOM   8614  C  CB    . LEU C 1 382 ? 72.521  100.196 54.054  1.00 62.10  ? 650 LEU C CB    1 
ATOM   8615  C  CG    . LEU C 1 382 ? 73.009  101.262 53.088  1.00 62.10  ? 650 LEU C CG    1 
ATOM   8616  C  CD1   . LEU C 1 382 ? 74.436  100.986 52.754  1.00 62.10  ? 650 LEU C CD1   1 
ATOM   8617  C  CD2   . LEU C 1 382 ? 72.174  101.278 51.846  1.00 62.10  ? 650 LEU C CD2   1 
ATOM   8618  N  N     . ARG C 1 383 ? 70.919  99.119  56.691  1.00 65.02  ? 651 ARG C N     1 
ATOM   8619  C  CA    . ARG C 1 383 ? 70.400  97.988  57.450  1.00 65.02  ? 651 ARG C CA    1 
ATOM   8620  C  C     . ARG C 1 383 ? 68.887  98.067  57.597  1.00 65.02  ? 651 ARG C C     1 
ATOM   8621  O  O     . ARG C 1 383 ? 68.212  97.034  57.634  1.00 65.02  ? 651 ARG C O     1 
ATOM   8622  C  CB    . ARG C 1 383 ? 71.081  97.936  58.815  1.00 65.02  ? 651 ARG C CB    1 
ATOM   8623  C  CG    . ARG C 1 383 ? 70.761  96.719  59.648  1.00 65.02  ? 651 ARG C CG    1 
ATOM   8624  C  CD    . ARG C 1 383 ? 71.438  96.808  60.998  1.00 65.02  ? 651 ARG C CD    1 
ATOM   8625  N  NE    . ARG C 1 383 ? 72.889  96.752  60.888  1.00 65.02  ? 651 ARG C NE    1 
ATOM   8626  C  CZ    . ARG C 1 383 ? 73.589  95.624  60.872  1.00 65.02  ? 651 ARG C CZ    1 
ATOM   8627  N  NH1   . ARG C 1 383 ? 72.968  94.458  60.968  1.00 65.02  ? 651 ARG C NH1   1 
ATOM   8628  N  NH2   . ARG C 1 383 ? 74.910  95.662  60.769  1.00 65.02  ? 651 ARG C NH2   1 
ATOM   8629  N  N     . LYS C 1 384 ? 68.335  99.279  57.656  1.00 62.74  ? 652 LYS C N     1 
ATOM   8630  C  CA    . LYS C 1 384 ? 66.886  99.435  57.679  1.00 62.74  ? 652 LYS C CA    1 
ATOM   8631  C  C     . LYS C 1 384 ? 66.274  99.103  56.328  1.00 62.74  ? 652 LYS C C     1 
ATOM   8632  O  O     . LYS C 1 384 ? 65.192  98.514  56.259  1.00 62.74  ? 652 LYS C O     1 
ATOM   8633  C  CB    . LYS C 1 384 ? 66.520  100.858 58.080  1.00 62.74  ? 652 LYS C CB    1 
ATOM   8634  C  CG    . LYS C 1 384 ? 66.834  101.208 59.511  1.00 62.74  ? 652 LYS C CG    1 
ATOM   8635  C  CD    . LYS C 1 384 ? 66.454  102.644 59.788  1.00 62.74  ? 652 LYS C CD    1 
ATOM   8636  C  CE    . LYS C 1 384 ? 66.796  103.043 61.206  1.00 62.74  ? 652 LYS C CE    1 
ATOM   8637  N  NZ    . LYS C 1 384 ? 66.438  104.463 61.467  1.00 62.74  ? 652 LYS C NZ    1 
ATOM   8638  N  N     . VAL C 1 385 ? 66.938  99.502  55.245  1.00 59.49  ? 653 VAL C N     1 
ATOM   8639  C  CA    . VAL C 1 385 ? 66.440  99.208  53.910  1.00 59.49  ? 653 VAL C CA    1 
ATOM   8640  C  C     . VAL C 1 385 ? 66.577  97.724  53.607  1.00 59.49  ? 653 VAL C C     1 
ATOM   8641  O  O     . VAL C 1 385 ? 65.739  97.148  52.904  1.00 59.49  ? 653 VAL C O     1 
ATOM   8642  C  CB    . VAL C 1 385 ? 67.168  100.110 52.897  1.00 59.49  ? 653 VAL C CB    1 
ATOM   8643  C  CG1   . VAL C 1 385 ? 66.823  99.775  51.473  1.00 59.49  ? 653 VAL C CG1   1 
ATOM   8644  C  CG2   . VAL C 1 385 ? 66.794  101.541 53.150  1.00 59.49  ? 653 VAL C CG2   1 
ATOM   8645  N  N     . THR C 1 386 ? 67.590  97.070  54.174  1.00 61.11  ? 654 THR C N     1 
ATOM   8646  C  CA    . THR C 1 386 ? 67.712  95.621  54.050  1.00 61.11  ? 654 THR C CA    1 
ATOM   8647  C  C     . THR C 1 386 ? 66.576  94.903  54.763  1.00 61.11  ? 654 THR C C     1 
ATOM   8648  O  O     . THR C 1 386 ? 65.902  94.053  54.173  1.00 61.11  ? 654 THR C O     1 
ATOM   8649  C  CB    . THR C 1 386 ? 69.054  95.162  54.607  1.00 61.11  ? 654 THR C CB    1 
ATOM   8650  O  OG1   . THR C 1 386 ? 70.109  95.724  53.823  1.00 61.11  ? 654 THR C OG1   1 
ATOM   8651  C  CG2   . THR C 1 386 ? 69.157  93.654  54.583  1.00 61.11  ? 654 THR C CG2   1 
ATOM   8652  N  N     . GLN C 1 387 ? 66.331  95.247  56.027  1.00 59.51  ? 655 GLN C N     1 
ATOM   8653  C  CA    . GLN C 1 387 ? 65.337  94.519  56.803  1.00 59.51  ? 655 GLN C CA    1 
ATOM   8654  C  C     . GLN C 1 387 ? 63.909  94.851  56.401  1.00 59.51  ? 655 GLN C C     1 
ATOM   8655  O  O     . GLN C 1 387 ? 63.008  94.055  56.672  1.00 59.51  ? 655 GLN C O     1 
ATOM   8656  C  CB    . GLN C 1 387 ? 65.521  94.793  58.288  1.00 59.51  ? 655 GLN C CB    1 
ATOM   8657  C  CG    . GLN C 1 387 ? 66.796  94.231  58.851  1.00 59.51  ? 655 GLN C CG    1 
ATOM   8658  C  CD    . GLN C 1 387 ? 66.946  94.526  60.324  1.00 59.51  ? 655 GLN C CD    1 
ATOM   8659  O  OE1   . GLN C 1 387 ? 66.122  95.223  60.914  1.00 59.51  ? 655 GLN C OE1   1 
ATOM   8660  N  NE2   . GLN C 1 387 ? 67.998  93.994  60.930  1.00 59.51  ? 655 GLN C NE2   1 
ATOM   8661  N  N     . SER C 1 388 ? 63.673  95.999  55.777  1.00 60.00  ? 656 SER C N     1 
ATOM   8662  C  CA    . SER C 1 388 ? 62.363  96.313  55.231  1.00 60.00  ? 656 SER C CA    1 
ATOM   8663  C  C     . SER C 1 388 ? 62.241  95.926  53.770  1.00 60.00  ? 656 SER C C     1 
ATOM   8664  O  O     . SER C 1 388 ? 61.317  96.386  53.099  1.00 60.00  ? 656 SER C O     1 
ATOM   8665  C  CB    . SER C 1 388 ? 62.052  97.799  55.386  1.00 60.00  ? 656 SER C CB    1 
ATOM   8666  O  OG    . SER C 1 388 ? 62.898  98.579  54.564  1.00 60.00  ? 656 SER C OG    1 
ATOM   8667  N  N     . ALA C 1 389 ? 63.181  95.138  53.249  1.00 58.90  ? 657 ALA C N     1 
ATOM   8668  C  CA    . ALA C 1 389 ? 63.042  94.511  51.946  1.00 58.90  ? 657 ALA C CA    1 
ATOM   8669  C  C     . ALA C 1 389 ? 63.020  93.002  52.029  1.00 58.90  ? 657 ALA C C     1 
ATOM   8670  O  O     . ALA C 1 389 ? 62.585  92.354  51.075  1.00 58.90  ? 657 ALA C O     1 
ATOM   8671  C  CB    . ALA C 1 389 ? 64.171  94.946  51.004  1.00 58.90  ? 657 ALA C CB    1 
ATOM   8672  N  N     . TYR C 1 390 ? 63.466  92.430  53.139  1.00 63.05  ? 658 TYR C N     1 
ATOM   8673  C  CA    . TYR C 1 390 ? 63.296  91.015  53.421  1.00 63.05  ? 658 TYR C CA    1 
ATOM   8674  C  C     . TYR C 1 390 ? 61.977  90.717  54.106  1.00 63.05  ? 658 TYR C C     1 
ATOM   8675  O  O     . TYR C 1 390 ? 61.375  89.672  53.845  1.00 63.05  ? 658 TYR C O     1 
ATOM   8676  C  CB    . TYR C 1 390 ? 64.447  90.511  54.283  1.00 63.05  ? 658 TYR C CB    1 
ATOM   8677  C  CG    . TYR C 1 390 ? 65.670  90.135  53.504  1.00 63.05  ? 658 TYR C CG    1 
ATOM   8678  C  CD1   . TYR C 1 390 ? 65.807  88.861  52.991  1.00 63.05  ? 658 TYR C CD1   1 
ATOM   8679  C  CD2   . TYR C 1 390 ? 66.671  91.053  53.256  1.00 63.05  ? 658 TYR C CD2   1 
ATOM   8680  C  CE1   . TYR C 1 390 ? 66.914  88.503  52.280  1.00 63.05  ? 658 TYR C CE1   1 
ATOM   8681  C  CE2   . TYR C 1 390 ? 67.785  90.706  52.538  1.00 63.05  ? 658 TYR C CE2   1 
ATOM   8682  C  CZ    . TYR C 1 390 ? 67.898  89.433  52.054  1.00 63.05  ? 658 TYR C CZ    1 
ATOM   8683  O  OH    . TYR C 1 390 ? 69.013  89.087  51.341  1.00 63.05  ? 658 TYR C OH    1 
ATOM   8684  N  N     . ALA C 1 391 ? 61.514  91.604  54.986  1.00 62.04  ? 659 ALA C N     1 
ATOM   8685  C  CA    . ALA C 1 391 ? 60.230  91.380  55.631  1.00 62.04  ? 659 ALA C CA    1 
ATOM   8686  C  C     . ALA C 1 391 ? 59.071  91.566  54.671  1.00 62.04  ? 659 ALA C C     1 
ATOM   8687  O  O     . ALA C 1 391 ? 58.008  90.987  54.891  1.00 62.04  ? 659 ALA C O     1 
ATOM   8688  C  CB    . ALA C 1 391 ? 60.062  92.305  56.831  1.00 62.04  ? 659 ALA C CB    1 
ATOM   8689  N  N     . GLN C 1 392 ? 59.253  92.341  53.606  1.00 62.18  ? 660 GLN C N     1 
ATOM   8690  C  CA    . GLN C 1 392 ? 58.194  92.464  52.617  1.00 62.18  ? 660 GLN C CA    1 
ATOM   8691  C  C     . GLN C 1 392 ? 58.064  91.204  51.786  1.00 62.18  ? 660 GLN C C     1 
ATOM   8692  O  O     . GLN C 1 392 ? 56.959  90.846  51.373  1.00 62.18  ? 660 GLN C O     1 
ATOM   8693  C  CB    . GLN C 1 392 ? 58.452  93.645  51.694  1.00 62.18  ? 660 GLN C CB    1 
ATOM   8694  C  CG    . GLN C 1 392 ? 58.473  94.969  52.379  1.00 62.18  ? 660 GLN C CG    1 
ATOM   8695  C  CD    . GLN C 1 392 ? 58.635  96.089  51.398  1.00 62.18  ? 660 GLN C CD    1 
ATOM   8696  O  OE1   . GLN C 1 392 ? 58.636  95.870  50.195  1.00 62.18  ? 660 GLN C OE1   1 
ATOM   8697  N  NE2   . GLN C 1 392 ? 58.813  97.292  51.900  1.00 62.18  ? 660 GLN C NE2   1 
ATOM   8698  N  N     . ILE C 1 393 ? 59.170  90.519  51.539  1.00 59.91  ? 661 ILE C N     1 
ATOM   8699  C  CA    . ILE C 1 393 ? 59.164  89.376  50.643  1.00 59.91  ? 661 ILE C CA    1 
ATOM   8700  C  C     . ILE C 1 393 ? 59.001  88.072  51.407  1.00 59.91  ? 661 ILE C C     1 
ATOM   8701  O  O     . ILE C 1 393 ? 58.121  87.267  51.098  1.00 59.91  ? 661 ILE C O     1 
ATOM   8702  C  CB    . ILE C 1 393 ? 60.445  89.392  49.789  1.00 59.91  ? 661 ILE C CB    1 
ATOM   8703  C  CG1   . ILE C 1 393 ? 60.432  90.616  48.881  1.00 59.91  ? 661 ILE C CG1   1 
ATOM   8704  C  CG2   . ILE C 1 393 ? 60.563  88.134  48.975  1.00 59.91  ? 661 ILE C CG2   1 
ATOM   8705  C  CD1   . ILE C 1 393 ? 61.713  90.844  48.164  1.00 59.91  ? 661 ILE C CD1   1 
ATOM   8706  N  N     . VAL C 1 394 ? 59.821  87.840  52.426  1.00 65.53  ? 662 VAL C N     1 
ATOM   8707  C  CA    . VAL C 1 394 ? 59.734  86.590  53.170  1.00 65.53  ? 662 VAL C CA    1 
ATOM   8708  C  C     . VAL C 1 394 ? 58.571  86.629  54.150  1.00 65.53  ? 662 VAL C C     1 
ATOM   8709  O  O     . VAL C 1 394 ? 57.670  85.787  54.106  1.00 65.53  ? 662 VAL C O     1 
ATOM   8710  C  CB    . VAL C 1 394 ? 61.056  86.304  53.897  1.00 65.53  ? 662 VAL C CB    1 
ATOM   8711  C  CG1   . VAL C 1 394 ? 60.994  84.967  54.588  1.00 65.53  ? 662 VAL C CG1   1 
ATOM   8712  C  CG2   . VAL C 1 394 ? 62.208  86.360  52.938  1.00 65.53  ? 662 VAL C CG2   1 
ATOM   8713  N  N     . GLN C 1 395 ? 58.576  87.619  55.043  1.00 71.30  ? 663 GLN C N     1 
ATOM   8714  C  CA    . GLN C 1 395 ? 57.611  87.666  56.137  1.00 71.30  ? 663 GLN C CA    1 
ATOM   8715  C  C     . GLN C 1 395 ? 56.226  88.053  55.646  1.00 71.30  ? 663 GLN C C     1 
ATOM   8716  O  O     . GLN C 1 395 ? 55.225  87.471  56.072  1.00 71.30  ? 663 GLN C O     1 
ATOM   8717  C  CB    . GLN C 1 395 ? 58.086  88.662  57.189  1.00 71.30  ? 663 GLN C CB    1 
ATOM   8718  C  CG    . GLN C 1 395 ? 57.302  88.665  58.459  1.00 71.30  ? 663 GLN C CG    1 
ATOM   8719  C  CD    . GLN C 1 395 ? 57.577  87.444  59.291  1.00 71.30  ? 663 GLN C CD    1 
ATOM   8720  O  OE1   . GLN C 1 395 ? 58.723  87.016  59.417  1.00 71.30  ? 663 GLN C OE1   1 
ATOM   8721  N  NE2   . GLN C 1 395 ? 56.530  86.868  59.869  1.00 71.30  ? 663 GLN C NE2   1 
ATOM   8722  N  N     . PHE C 1 396 ? 56.146  89.044  54.775  1.00 64.26  ? 664 PHE C N     1 
ATOM   8723  C  CA    . PHE C 1 396 ? 54.882  89.463  54.192  1.00 64.26  ? 664 PHE C CA    1 
ATOM   8724  C  C     . PHE C 1 396 ? 54.719  88.710  52.877  1.00 64.26  ? 664 PHE C C     1 
ATOM   8725  O  O     . PHE C 1 396 ? 55.424  87.737  52.606  1.00 64.26  ? 664 PHE C O     1 
ATOM   8726  C  CB    . PHE C 1 396 ? 54.841  90.977  53.991  1.00 64.26  ? 664 PHE C CB    1 
ATOM   8727  C  CG    . PHE C 1 396 ? 55.002  91.778  55.259  1.00 64.26  ? 664 PHE C CG    1 
ATOM   8728  C  CD1   . PHE C 1 396 ? 54.701  91.242  56.503  1.00 64.26  ? 664 PHE C CD1   1 
ATOM   8729  C  CD2   . PHE C 1 396 ? 55.504  93.060  55.202  1.00 64.26  ? 664 PHE C CD2   1 
ATOM   8730  C  CE1   . PHE C 1 396 ? 54.885  91.977  57.651  1.00 64.26  ? 664 PHE C CE1   1 
ATOM   8731  C  CE2   . PHE C 1 396 ? 55.695  93.791  56.346  1.00 64.26  ? 664 PHE C CE2   1 
ATOM   8732  C  CZ    . PHE C 1 396 ? 55.374  93.252  57.569  1.00 64.26  ? 664 PHE C CZ    1 
ATOM   8733  N  N     . GLY C 1 397 ? 53.798  89.149  52.038  1.00 65.69  ? 665 GLY C N     1 
ATOM   8734  C  CA    . GLY C 1 397 ? 53.680  88.536  50.735  1.00 65.69  ? 665 GLY C CA    1 
ATOM   8735  C  C     . GLY C 1 397 ? 53.698  89.551  49.618  1.00 65.69  ? 665 GLY C C     1 
ATOM   8736  O  O     . GLY C 1 397 ? 52.967  89.407  48.637  1.00 65.69  ? 665 GLY C O     1 
ATOM   8737  N  N     . MET C 1 398 ? 54.520  90.587  49.755  1.00 67.34  ? 666 MET C N     1 
ATOM   8738  C  CA    . MET C 1 398 ? 54.479  91.712  48.831  1.00 67.34  ? 666 MET C CA    1 
ATOM   8739  C  C     . MET C 1 398 ? 55.067  91.399  47.463  1.00 67.34  ? 666 MET C C     1 
ATOM   8740  O  O     . MET C 1 398 ? 54.997  92.255  46.577  1.00 67.34  ? 666 MET C O     1 
ATOM   8741  C  CB    . MET C 1 398 ? 55.231  92.897  49.427  1.00 67.34  ? 666 MET C CB    1 
ATOM   8742  C  CG    . MET C 1 398 ? 54.649  93.445  50.715  1.00 67.34  ? 666 MET C CG    1 
ATOM   8743  S  SD    . MET C 1 398 ? 53.044  94.218  50.534  1.00 67.34  ? 666 MET C SD    1 
ATOM   8744  C  CE    . MET C 1 398 ? 52.664  94.516  52.250  1.00 67.34  ? 666 MET C CE    1 
ATOM   8745  N  N     . ASN C 1 399 ? 55.645  90.221  47.262  1.00 66.92  ? 667 ASN C N     1 
ATOM   8746  C  CA    . ASN C 1 399 ? 56.319  89.891  46.017  1.00 66.92  ? 667 ASN C CA    1 
ATOM   8747  C  C     . ASN C 1 399 ? 55.483  88.903  45.222  1.00 66.92  ? 667 ASN C C     1 
ATOM   8748  O  O     . ASN C 1 399 ? 55.041  87.881  45.756  1.00 66.92  ? 667 ASN C O     1 
ATOM   8749  C  CB    . ASN C 1 399 ? 57.701  89.306  46.281  1.00 66.92  ? 667 ASN C CB    1 
ATOM   8750  C  CG    . ASN C 1 399 ? 58.560  89.280  45.045  1.00 66.92  ? 667 ASN C CG    1 
ATOM   8751  O  OD1   . ASN C 1 399 ? 58.172  89.766  43.985  1.00 66.92  ? 667 ASN C OD1   1 
ATOM   8752  N  ND2   . ASN C 1 399 ? 59.732  88.688  45.167  1.00 66.92  ? 667 ASN C ND2   1 
ATOM   8753  N  N     . GLU C 1 400 ? 55.290  89.205  43.941  1.00 70.03  ? 668 GLU C N     1 
ATOM   8754  C  CA    . GLU C 1 400 ? 54.524  88.331  43.067  1.00 70.03  ? 668 GLU C CA    1 
ATOM   8755  C  C     . GLU C 1 400 ? 55.296  87.071  42.708  1.00 70.03  ? 668 GLU C C     1 
ATOM   8756  O  O     . GLU C 1 400 ? 54.696  86.002  42.558  1.00 70.03  ? 668 GLU C O     1 
ATOM   8757  C  CB    . GLU C 1 400 ? 54.130  89.096  41.803  1.00 70.03  ? 668 GLU C CB    1 
ATOM   8758  C  CG    . GLU C 1 400 ? 53.216  88.346  40.857  1.00 70.03  ? 668 GLU C CG    1 
ATOM   8759  C  CD    . GLU C 1 400 ? 52.815  89.177  39.658  1.00 70.03  ? 668 GLU C CD    1 
ATOM   8760  O  OE1   . GLU C 1 400 ? 53.267  90.337  39.560  1.00 70.03  ? 668 GLU C OE1   1 
ATOM   8761  O  OE2   . GLU C 1 400 ? 52.047  88.671  38.812  1.00 70.03  ? 668 GLU C OE2   1 
ATOM   8762  N  N     . LYS C 1 401 ? 56.619  87.162  42.602  1.00 66.81  ? 669 LYS C N     1 
ATOM   8763  C  CA    . LYS C 1 401 ? 57.393  86.047  42.071  1.00 66.81  ? 669 LYS C CA    1 
ATOM   8764  C  C     . LYS C 1 401 ? 57.650  84.974  43.122  1.00 66.81  ? 669 LYS C C     1 
ATOM   8765  O  O     . LYS C 1 401 ? 57.626  83.780  42.804  1.00 66.81  ? 669 LYS C O     1 
ATOM   8766  C  CB    . LYS C 1 401 ? 58.704  86.564  41.487  1.00 66.81  ? 669 LYS C CB    1 
ATOM   8767  C  CG    . LYS C 1 401 ? 59.474  85.544  40.690  1.00 66.81  ? 669 LYS C CG    1 
ATOM   8768  C  CD    . LYS C 1 401 ? 60.728  86.160  40.124  1.00 66.81  ? 669 LYS C CD    1 
ATOM   8769  C  CE    . LYS C 1 401 ? 60.390  87.123  39.004  1.00 66.81  ? 669 LYS C CE    1 
ATOM   8770  N  NZ    . LYS C 1 401 ? 61.613  87.658  38.352  1.00 66.81  ? 669 LYS C NZ    1 
ATOM   8771  N  N     . VAL C 1 402 ? 57.908  85.368  44.369  1.00 65.37  ? 670 VAL C N     1 
ATOM   8772  C  CA    . VAL C 1 402 ? 58.055  84.383  45.434  1.00 65.37  ? 670 VAL C CA    1 
ATOM   8773  C  C     . VAL C 1 402 ? 56.709  83.757  45.758  1.00 65.37  ? 670 VAL C C     1 
ATOM   8774  O  O     . VAL C 1 402 ? 56.595  82.535  45.913  1.00 65.37  ? 670 VAL C O     1 
ATOM   8775  C  CB    . VAL C 1 402 ? 58.700  85.028  46.671  1.00 65.37  ? 670 VAL C CB    1 
ATOM   8776  C  CG1   . VAL C 1 402 ? 58.739  84.054  47.828  1.00 65.37  ? 670 VAL C CG1   1 
ATOM   8777  C  CG2   . VAL C 1 402 ? 60.094  85.479  46.338  1.00 65.37  ? 670 VAL C CG2   1 
ATOM   8778  N  N     . GLY C 1 403 ? 55.670  84.565  45.825  1.00 65.58  ? 671 GLY C N     1 
ATOM   8779  C  CA    . GLY C 1 403 ? 54.322  84.071  45.983  1.00 65.58  ? 671 GLY C CA    1 
ATOM   8780  C  C     . GLY C 1 403 ? 53.658  84.662  47.202  1.00 65.58  ? 671 GLY C C     1 
ATOM   8781  O  O     . GLY C 1 403 ? 54.156  85.601  47.828  1.00 65.58  ? 671 GLY C O     1 
ATOM   8782  N  N     . GLN C 1 404 ? 52.510  84.093  47.544  1.00 67.63  ? 672 GLN C N     1 
ATOM   8783  C  CA    . GLN C 1 404 ? 51.735  84.542  48.695  1.00 67.63  ? 672 GLN C CA    1 
ATOM   8784  C  C     . GLN C 1 404 ? 52.126  83.763  49.943  1.00 67.63  ? 672 GLN C C     1 
ATOM   8785  O  O     . GLN C 1 404 ? 51.289  83.190  50.630  1.00 67.63  ? 672 GLN C O     1 
ATOM   8786  C  CB    . GLN C 1 404 ? 50.252  84.389  48.397  1.00 67.63  ? 672 GLN C CB    1 
ATOM   8787  C  CG    . GLN C 1 404 ? 49.812  85.087  47.132  1.00 67.63  ? 672 GLN C CG    1 
ATOM   8788  C  CD    . GLN C 1 404 ? 49.956  86.584  47.219  1.00 67.63  ? 672 GLN C CD    1 
ATOM   8789  O  OE1   . GLN C 1 404 ? 49.660  87.183  48.248  1.00 67.63  ? 672 GLN C OE1   1 
ATOM   8790  N  NE2   . GLN C 1 404 ? 50.423  87.199  46.140  1.00 67.63  ? 672 GLN C NE2   1 
ATOM   8791  N  N     . ILE C 1 405 ? 53.420  83.723  50.238  1.00 66.68  ? 673 ILE C N     1 
ATOM   8792  C  CA    . ILE C 1 405 ? 53.966  82.808  51.227  1.00 66.68  ? 673 ILE C CA    1 
ATOM   8793  C  C     . ILE C 1 405 ? 54.569  83.631  52.350  1.00 66.68  ? 673 ILE C C     1 
ATOM   8794  O  O     . ILE C 1 405 ? 55.359  84.545  52.097  1.00 66.68  ? 673 ILE C O     1 
ATOM   8795  C  CB    . ILE C 1 405 ? 55.028  81.883  50.612  1.00 66.68  ? 673 ILE C CB    1 
ATOM   8796  C  CG1   . ILE C 1 405 ? 54.490  81.209  49.357  1.00 66.68  ? 673 ILE C CG1   1 
ATOM   8797  C  CG2   . ILE C 1 405 ? 55.384  80.796  51.580  1.00 66.68  ? 673 ILE C CG2   1 
ATOM   8798  C  CD1   . ILE C 1 405 ? 55.547  80.492  48.561  1.00 66.68  ? 673 ILE C CD1   1 
ATOM   8799  N  N     . SER C 1 406 ? 54.217  83.299  53.584  1.00 68.94  ? 674 SER C N     1 
ATOM   8800  C  CA    . SER C 1 406 ? 54.760  83.979  54.745  1.00 68.94  ? 674 SER C CA    1 
ATOM   8801  C  C     . SER C 1 406 ? 55.561  83.008  55.590  1.00 68.94  ? 674 SER C C     1 
ATOM   8802  O  O     . SER C 1 406 ? 55.183  81.846  55.747  1.00 68.94  ? 674 SER C O     1 
ATOM   8803  C  CB    . SER C 1 406 ? 53.659  84.595  55.588  1.00 68.94  ? 674 SER C CB    1 
ATOM   8804  O  OG    . SER C 1 406 ? 54.194  85.237  56.727  1.00 68.94  ? 674 SER C OG    1 
ATOM   8805  N  N     . PHE C 1 407 ? 56.661  83.501  56.142  1.00 69.96  ? 675 PHE C N     1 
ATOM   8806  C  CA    . PHE C 1 407 ? 57.518  82.718  57.017  1.00 69.96  ? 675 PHE C CA    1 
ATOM   8807  C  C     . PHE C 1 407 ? 57.724  83.473  58.318  1.00 69.96  ? 675 PHE C C     1 
ATOM   8808  O  O     . PHE C 1 407 ? 57.010  84.440  58.595  1.00 69.96  ? 675 PHE C O     1 
ATOM   8809  C  CB    . PHE C 1 407 ? 58.860  82.443  56.357  1.00 69.96  ? 675 PHE C CB    1 
ATOM   8810  C  CG    . PHE C 1 407 ? 58.775  81.588  55.136  1.00 69.96  ? 675 PHE C CG    1 
ATOM   8811  C  CD1   . PHE C 1 407 ? 58.695  80.215  55.242  1.00 69.96  ? 675 PHE C CD1   1 
ATOM   8812  C  CD2   . PHE C 1 407 ? 58.800  82.159  53.878  1.00 69.96  ? 675 PHE C CD2   1 
ATOM   8813  C  CE1   . PHE C 1 407 ? 58.630  79.433  54.118  1.00 69.96  ? 675 PHE C CE1   1 
ATOM   8814  C  CE2   . PHE C 1 407 ? 58.739  81.383  52.754  1.00 69.96  ? 675 PHE C CE2   1 
ATOM   8815  C  CZ    . PHE C 1 407 ? 58.652  80.018  52.873  1.00 69.96  ? 675 PHE C CZ    1 
ATOM   8816  N  N     . ASP C 1 408 ? 58.678  83.036  59.131  1.00 89.42  ? 676 ASP C N     1 
ATOM   8817  C  CA    . ASP C 1 408 ? 59.098  83.786  60.306  1.00 89.42  ? 676 ASP C CA    1 
ATOM   8818  C  C     . ASP C 1 408 ? 60.562  84.188  60.173  1.00 89.42  ? 676 ASP C C     1 
ATOM   8819  O  O     . ASP C 1 408 ? 61.424  83.347  59.905  1.00 89.42  ? 676 ASP C O     1 
ATOM   8820  C  CB    . ASP C 1 408 ? 58.855  82.985  61.588  1.00 89.42  ? 676 ASP C CB    1 
ATOM   8821  C  CG    . ASP C 1 408 ? 59.401  81.571  61.520  1.00 89.42  ? 676 ASP C CG    1 
ATOM   8822  O  OD1   . ASP C 1 408 ? 59.766  81.104  60.422  1.00 89.42  ? 676 ASP C OD1   1 
ATOM   8823  O  OD2   . ASP C 1 408 ? 59.485  80.928  62.585  1.00 89.42  ? 676 ASP C OD2   1 
ATOM   8824  N  N     . LEU C 1 409 ? 60.838  85.475  60.346  1.00 96.92  ? 677 LEU C N     1 
ATOM   8825  C  CA    . LEU C 1 409 ? 62.215  85.944  60.258  1.00 96.92  ? 677 LEU C CA    1 
ATOM   8826  C  C     . LEU C 1 409 ? 62.930  85.771  61.594  1.00 96.92  ? 677 LEU C C     1 
ATOM   8827  O  O     . LEU C 1 409 ? 62.334  85.991  62.650  1.00 96.92  ? 677 LEU C O     1 
ATOM   8828  C  CB    . LEU C 1 409 ? 62.275  87.412  59.851  1.00 96.92  ? 677 LEU C CB    1 
ATOM   8829  C  CG    . LEU C 1 409 ? 62.485  87.793  58.386  1.00 96.92  ? 677 LEU C CG    1 
ATOM   8830  C  CD1   . LEU C 1 409 ? 63.855  87.348  57.923  1.00 96.92  ? 677 LEU C CD1   1 
ATOM   8831  C  CD2   . LEU C 1 409 ? 61.434  87.199  57.506  1.00 96.92  ? 677 LEU C CD2   1 
ATOM   8832  N  N     . PRO C 1 410 ? 64.200  85.380  61.575  1.00 111.68 ? 678 PRO C N     1 
ATOM   8833  C  CA    . PRO C 1 410 ? 65.007  85.479  62.791  1.00 111.68 ? 678 PRO C CA    1 
ATOM   8834  C  C     . PRO C 1 410 ? 65.303  86.936  63.102  1.00 111.68 ? 678 PRO C C     1 
ATOM   8835  O  O     . PRO C 1 410 ? 65.600  87.735  62.211  1.00 111.68 ? 678 PRO C O     1 
ATOM   8836  C  CB    . PRO C 1 410 ? 66.279  84.703  62.438  1.00 111.68 ? 678 PRO C CB    1 
ATOM   8837  C  CG    . PRO C 1 410 ? 66.369  84.800  60.958  1.00 111.68 ? 678 PRO C CG    1 
ATOM   8838  C  CD    . PRO C 1 410 ? 64.959  84.808  60.451  1.00 111.68 ? 678 PRO C CD    1 
ATOM   8839  N  N     . ARG C 1 411 ? 65.205  87.283  64.380  1.00 123.92 ? 679 ARG C N     1 
ATOM   8840  C  CA    . ARG C 1 411 ? 65.407  88.657  64.816  1.00 123.92 ? 679 ARG C CA    1 
ATOM   8841  C  C     . ARG C 1 411 ? 66.901  88.962  64.891  1.00 123.92 ? 679 ARG C C     1 
ATOM   8842  O  O     . ARG C 1 411 ? 67.752  88.131  64.561  1.00 123.92 ? 679 ARG C O     1 
ATOM   8843  C  CB    . ARG C 1 411 ? 64.707  88.891  66.151  1.00 123.92 ? 679 ARG C CB    1 
ATOM   8844  C  CG    . ARG C 1 411 ? 63.181  88.788  66.118  1.00 123.92 ? 679 ARG C CG    1 
ATOM   8845  C  CD    . ARG C 1 411 ? 62.519  89.951  65.376  1.00 123.92 ? 679 ARG C CD    1 
ATOM   8846  N  NE    . ARG C 1 411 ? 62.328  89.691  63.950  1.00 123.92 ? 679 ARG C NE    1 
ATOM   8847  C  CZ    . ARG C 1 411 ? 62.008  90.621  63.057  1.00 123.92 ? 679 ARG C CZ    1 
ATOM   8848  N  NH1   . ARG C 1 411 ? 61.838  91.880  63.435  1.00 123.92 ? 679 ARG C NH1   1 
ATOM   8849  N  NH2   . ARG C 1 411 ? 61.857  90.293  61.782  1.00 123.92 ? 679 ARG C NH2   1 
ATOM   8850  N  N     . GLN C 1 412 ? 67.240  90.179  65.321  1.00 130.13 ? 680 GLN C N     1 
ATOM   8851  C  CA    . GLN C 1 412 ? 68.644  90.526  65.511  1.00 130.13 ? 680 GLN C CA    1 
ATOM   8852  C  C     . GLN C 1 412 ? 69.226  89.798  66.715  1.00 130.13 ? 680 GLN C C     1 
ATOM   8853  O  O     . GLN C 1 412 ? 70.349  89.284  66.656  1.00 130.13 ? 680 GLN C O     1 
ATOM   8854  C  CB    . GLN C 1 412 ? 68.792  92.038  65.664  1.00 130.13 ? 680 GLN C CB    1 
ATOM   8855  C  CG    . GLN C 1 412 ? 70.228  92.510  65.785  1.00 130.13 ? 680 GLN C CG    1 
ATOM   8856  C  CD    . GLN C 1 412 ? 70.343  94.019  65.876  1.00 130.13 ? 680 GLN C CD    1 
ATOM   8857  O  OE1   . GLN C 1 412 ? 69.340  94.733  65.866  1.00 130.13 ? 680 GLN C OE1   1 
ATOM   8858  N  NE2   . GLN C 1 412 ? 71.571  94.513  65.972  1.00 130.13 ? 680 GLN C NE2   1 
ATOM   8859  N  N     . GLY C 1 413 ? 68.470  89.730  67.813  1.00 133.08 ? 681 GLY C N     1 
ATOM   8860  C  CA    . GLY C 1 413 ? 68.912  88.953  68.956  1.00 133.08 ? 681 GLY C CA    1 
ATOM   8861  C  C     . GLY C 1 413 ? 68.824  87.460  68.721  1.00 133.08 ? 681 GLY C C     1 
ATOM   8862  O  O     . GLY C 1 413 ? 69.601  86.692  69.296  1.00 133.08 ? 681 GLY C O     1 
ATOM   8863  N  N     . ASP C 1 414 ? 67.883  87.029  67.886  1.00 130.64 ? 682 ASP C N     1 
ATOM   8864  C  CA    . ASP C 1 414 ? 67.805  85.627  67.508  1.00 130.64 ? 682 ASP C CA    1 
ATOM   8865  C  C     . ASP C 1 414 ? 68.963  85.275  66.585  1.00 130.64 ? 682 ASP C C     1 
ATOM   8866  O  O     . ASP C 1 414 ? 69.430  86.106  65.803  1.00 130.64 ? 682 ASP C O     1 
ATOM   8867  C  CB    . ASP C 1 414 ? 66.472  85.332  66.821  1.00 130.64 ? 682 ASP C CB    1 
ATOM   8868  C  CG    . ASP C 1 414 ? 65.291  85.457  67.762  1.00 130.64 ? 682 ASP C CG    1 
ATOM   8869  O  OD1   . ASP C 1 414 ? 65.469  85.230  68.977  1.00 130.64 ? 682 ASP C OD1   1 
ATOM   8870  O  OD2   . ASP C 1 414 ? 64.183  85.783  67.286  1.00 130.64 ? 682 ASP C OD2   1 
ATOM   8871  N  N     . MET C 1 415 ? 69.435  84.040  66.687  1.00 129.02 ? 683 MET C N     1 
ATOM   8872  C  CA    . MET C 1 415 ? 70.584  83.585  65.922  1.00 129.02 ? 683 MET C CA    1 
ATOM   8873  C  C     . MET C 1 415 ? 70.134  82.665  64.796  1.00 129.02 ? 683 MET C C     1 
ATOM   8874  O  O     . MET C 1 415 ? 69.362  81.728  65.017  1.00 129.02 ? 683 MET C O     1 
ATOM   8875  C  CB    . MET C 1 415 ? 71.584  82.874  66.832  1.00 129.02 ? 683 MET C CB    1 
ATOM   8876  C  CG    . MET C 1 415 ? 72.883  82.494  66.155  1.00 129.02 ? 683 MET C CG    1 
ATOM   8877  S  SD    . MET C 1 415 ? 74.086  81.890  67.349  1.00 129.02 ? 683 MET C SD    1 
ATOM   8878  C  CE    . MET C 1 415 ? 74.536  83.426  68.157  1.00 129.02 ? 683 MET C CE    1 
ATOM   8879  N  N     . VAL C 1 416 ? 70.626  82.941  63.587  1.00 125.38 ? 684 VAL C N     1 
ATOM   8880  C  CA    . VAL C 1 416 ? 70.210  82.220  62.389  1.00 125.38 ? 684 VAL C CA    1 
ATOM   8881  C  C     . VAL C 1 416 ? 70.809  80.823  62.421  1.00 125.38 ? 684 VAL C C     1 
ATOM   8882  O  O     . VAL C 1 416 ? 72.001  80.639  62.154  1.00 125.38 ? 684 VAL C O     1 
ATOM   8883  C  CB    . VAL C 1 416 ? 70.631  82.965  61.110  1.00 125.38 ? 684 VAL C CB    1 
ATOM   8884  C  CG1   . VAL C 1 416 ? 70.165  82.206  59.875  1.00 125.38 ? 684 VAL C CG1   1 
ATOM   8885  C  CG2   . VAL C 1 416 ? 70.094  84.383  61.118  1.00 125.38 ? 684 VAL C CG2   1 
ATOM   8886  N  N     . LEU C 1 417 ? 69.986  79.831  62.745  1.00 120.94 ? 685 LEU C N     1 
ATOM   8887  C  CA    . LEU C 1 417 ? 70.452  78.465  62.943  1.00 120.94 ? 685 LEU C CA    1 
ATOM   8888  C  C     . LEU C 1 417 ? 70.226  77.556  61.741  1.00 120.94 ? 685 LEU C C     1 
ATOM   8889  O  O     . LEU C 1 417 ? 71.106  76.752  61.420  1.00 120.94 ? 685 LEU C O     1 
ATOM   8890  C  CB    . LEU C 1 417 ? 69.807  77.889  64.209  1.00 120.94 ? 685 LEU C CB    1 
ATOM   8891  C  CG    . LEU C 1 417 ? 68.314  78.106  64.479  1.00 120.94 ? 685 LEU C CG    1 
ATOM   8892  C  CD1   . LEU C 1 417 ? 67.431  77.028  63.892  1.00 120.94 ? 685 LEU C CD1   1 
ATOM   8893  C  CD2   . LEU C 1 417 ? 68.083  78.243  65.978  1.00 120.94 ? 685 LEU C CD2   1 
ATOM   8894  N  N     . GLU C 1 418 ? 69.088  77.678  61.055  1.00 109.34 ? 686 GLU C N     1 
ATOM   8895  C  CA    . GLU C 1 418 ? 68.846  76.985  59.792  1.00 109.34 ? 686 GLU C CA    1 
ATOM   8896  C  C     . GLU C 1 418 ? 67.701  77.681  59.080  1.00 109.34 ? 686 GLU C C     1 
ATOM   8897  O  O     . GLU C 1 418 ? 66.677  77.986  59.697  1.00 109.34 ? 686 GLU C O     1 
ATOM   8898  C  CB    . GLU C 1 418 ? 68.512  75.500  59.997  1.00 109.34 ? 686 GLU C CB    1 
ATOM   8899  C  CG    . GLU C 1 418 ? 68.237  74.726  58.714  1.00 109.34 ? 686 GLU C CG    1 
ATOM   8900  C  CD    . GLU C 1 418 ? 69.466  74.561  57.840  1.00 109.34 ? 686 GLU C CD    1 
ATOM   8901  O  OE1   . GLU C 1 418 ? 70.592  74.515  58.382  1.00 109.34 ? 686 GLU C OE1   1 
ATOM   8902  O  OE2   . GLU C 1 418 ? 69.306  74.481  56.604  1.00 109.34 ? 686 GLU C OE2   1 
ATOM   8903  N  N     . LYS C 1 419 ? 67.871  77.920  57.800  1.00 88.65  ? 687 LYS C N     1 
ATOM   8904  C  CA    . LYS C 1 419 ? 66.882  78.653  57.028  1.00 88.65  ? 687 LYS C CA    1 
ATOM   8905  C  C     . LYS C 1 419 ? 65.753  77.713  56.620  1.00 88.65  ? 687 LYS C C     1 
ATOM   8906  O  O     . LYS C 1 419 ? 66.018  76.651  56.053  1.00 88.65  ? 687 LYS C O     1 
ATOM   8907  C  CB    . LYS C 1 419 ? 67.560  79.262  55.813  1.00 88.65  ? 687 LYS C CB    1 
ATOM   8908  C  CG    . LYS C 1 419 ? 66.760  80.286  55.075  1.00 88.65  ? 687 LYS C CG    1 
ATOM   8909  C  CD    . LYS C 1 419 ? 67.561  80.793  53.894  1.00 88.65  ? 687 LYS C CD    1 
ATOM   8910  C  CE    . LYS C 1 419 ? 68.701  81.690  54.335  1.00 88.65  ? 687 LYS C CE    1 
ATOM   8911  N  NZ    . LYS C 1 419 ? 69.384  82.263  53.151  1.00 88.65  ? 687 LYS C NZ    1 
ATOM   8912  N  N     . PRO C 1 420 ? 64.488  78.054  56.901  1.00 81.61  ? 688 PRO C N     1 
ATOM   8913  C  CA    . PRO C 1 420 ? 63.413  77.057  56.774  1.00 81.61  ? 688 PRO C CA    1 
ATOM   8914  C  C     . PRO C 1 420 ? 62.830  76.911  55.381  1.00 81.61  ? 688 PRO C C     1 
ATOM   8915  O  O     . PRO C 1 420 ? 61.611  76.786  55.244  1.00 81.61  ? 688 PRO C O     1 
ATOM   8916  C  CB    . PRO C 1 420 ? 62.348  77.587  57.736  1.00 81.61  ? 688 PRO C CB    1 
ATOM   8917  C  CG    . PRO C 1 420 ? 62.527  79.059  57.671  1.00 81.61  ? 688 PRO C CG    1 
ATOM   8918  C  CD    . PRO C 1 420 ? 64.006  79.299  57.518  1.00 81.61  ? 688 PRO C CD    1 
ATOM   8919  N  N     . TYR C 1 421 ? 63.684  76.885  54.364  1.00 76.66  ? 689 TYR C N     1 
ATOM   8920  C  CA    . TYR C 1 421 ? 63.300  76.637  52.978  1.00 76.66  ? 689 TYR C CA    1 
ATOM   8921  C  C     . TYR C 1 421 ? 64.563  76.306  52.196  1.00 76.66  ? 689 TYR C C     1 
ATOM   8922  O  O     . TYR C 1 421 ? 65.657  76.206  52.758  1.00 76.66  ? 689 TYR C O     1 
ATOM   8923  C  CB    . TYR C 1 421 ? 62.523  77.812  52.371  1.00 76.66  ? 689 TYR C CB    1 
ATOM   8924  C  CG    . TYR C 1 421 ? 63.108  79.172  52.626  1.00 76.66  ? 689 TYR C CG    1 
ATOM   8925  C  CD1   . TYR C 1 421 ? 62.725  79.906  53.740  1.00 76.66  ? 689 TYR C CD1   1 
ATOM   8926  C  CD2   . TYR C 1 421 ? 64.015  79.735  51.754  1.00 76.66  ? 689 TYR C CD2   1 
ATOM   8927  C  CE1   . TYR C 1 421 ? 63.242  81.148  53.985  1.00 76.66  ? 689 TYR C CE1   1 
ATOM   8928  C  CE2   . TYR C 1 421 ? 64.542  80.981  51.996  1.00 76.66  ? 689 TYR C CE2   1 
ATOM   8929  C  CZ    . TYR C 1 421 ? 64.145  81.684  53.110  1.00 76.66  ? 689 TYR C CZ    1 
ATOM   8930  O  OH    . TYR C 1 421 ? 64.651  82.931  53.366  1.00 76.66  ? 689 TYR C OH    1 
ATOM   8931  N  N     . SER C 1 422 ? 64.401  76.110  50.896  1.00 73.39  ? 690 SER C N     1 
ATOM   8932  C  CA    . SER C 1 422 ? 65.501  75.647  50.072  1.00 73.39  ? 690 SER C CA    1 
ATOM   8933  C  C     . SER C 1 422 ? 66.456  76.782  49.740  1.00 73.39  ? 690 SER C C     1 
ATOM   8934  O  O     . SER C 1 422 ? 66.114  77.962  49.817  1.00 73.39  ? 690 SER C O     1 
ATOM   8935  C  CB    . SER C 1 422 ? 64.978  75.042  48.778  1.00 73.39  ? 690 SER C CB    1 
ATOM   8936  O  OG    . SER C 1 422 ? 64.386  76.045  47.978  1.00 73.39  ? 690 SER C OG    1 
ATOM   8937  N  N     . GLU C 1 423 ? 67.671  76.407  49.347  1.00 74.21  ? 691 GLU C N     1 
ATOM   8938  C  CA    . GLU C 1 423 ? 68.614  77.402  48.865  1.00 74.21  ? 691 GLU C CA    1 
ATOM   8939  C  C     . GLU C 1 423 ? 68.270  77.880  47.465  1.00 74.21  ? 691 GLU C C     1 
ATOM   8940  O  O     . GLU C 1 423 ? 68.765  78.929  47.047  1.00 74.21  ? 691 GLU C O     1 
ATOM   8941  C  CB    . GLU C 1 423 ? 70.034  76.849  48.900  1.00 74.21  ? 691 GLU C CB    1 
ATOM   8942  C  CG    . GLU C 1 423 ? 70.558  76.611  50.304  1.00 74.21  ? 691 GLU C CG    1 
ATOM   8943  C  CD    . GLU C 1 423 ? 71.959  76.036  50.312  1.00 74.21  ? 691 GLU C CD    1 
ATOM   8944  O  OE1   . GLU C 1 423 ? 72.469  75.699  49.222  1.00 74.21  ? 691 GLU C OE1   1 
ATOM   8945  O  OE2   . GLU C 1 423 ? 72.552  75.921  51.405  1.00 74.21  ? 691 GLU C OE2   1 
ATOM   8946  N  N     . ALA C 1 424 ? 67.444  77.140  46.731  1.00 71.09  ? 692 ALA C N     1 
ATOM   8947  C  CA    . ALA C 1 424 ? 66.929  77.650  45.470  1.00 71.09  ? 692 ALA C CA    1 
ATOM   8948  C  C     . ALA C 1 424 ? 65.816  78.659  45.677  1.00 71.09  ? 692 ALA C C     1 
ATOM   8949  O  O     . ALA C 1 424 ? 65.528  79.442  44.768  1.00 71.09  ? 692 ALA C O     1 
ATOM   8950  C  CB    . ALA C 1 424 ? 66.428  76.506  44.596  1.00 71.09  ? 692 ALA C CB    1 
ATOM   8951  N  N     . THR C 1 425 ? 65.181  78.648  46.846  1.00 69.78  ? 693 THR C N     1 
ATOM   8952  C  CA    . THR C 1 425 ? 64.233  79.696  47.185  1.00 69.78  ? 693 THR C CA    1 
ATOM   8953  C  C     . THR C 1 425 ? 64.959  80.922  47.718  1.00 69.78  ? 693 THR C C     1 
ATOM   8954  O  O     . THR C 1 425 ? 64.617  82.055  47.361  1.00 69.78  ? 693 THR C O     1 
ATOM   8955  C  CB    . THR C 1 425 ? 63.224  79.177  48.206  1.00 69.78  ? 693 THR C CB    1 
ATOM   8956  O  OG1   . THR C 1 425 ? 62.576  78.015  47.678  1.00 69.78  ? 693 THR C OG1   1 
ATOM   8957  C  CG2   . THR C 1 425 ? 62.170  80.217  48.495  1.00 69.78  ? 693 THR C CG2   1 
ATOM   8958  N  N     . ALA C 1 426 ? 65.986  80.710  48.545  1.00 68.64  ? 694 ALA C N     1 
ATOM   8959  C  CA    . ALA C 1 426 ? 66.782  81.823  49.051  1.00 68.64  ? 694 ALA C CA    1 
ATOM   8960  C  C     . ALA C 1 426 ? 67.594  82.487  47.948  1.00 68.64  ? 694 ALA C C     1 
ATOM   8961  O  O     . ALA C 1 426 ? 67.943  83.661  48.067  1.00 68.64  ? 694 ALA C O     1 
ATOM   8962  C  CB    . ALA C 1 426 ? 67.708  81.356  50.166  1.00 68.64  ? 694 ALA C CB    1 
ATOM   8963  N  N     . ARG C 1 427 ? 67.910  81.758  46.879  1.00 68.57  ? 695 ARG C N     1 
ATOM   8964  C  CA    . ARG C 1 427 ? 68.474  82.404  45.704  1.00 68.57  ? 695 ARG C CA    1 
ATOM   8965  C  C     . ARG C 1 427 ? 67.435  83.282  45.023  1.00 68.57  ? 695 ARG C C     1 
ATOM   8966  O  O     . ARG C 1 427 ? 67.761  84.354  44.504  1.00 68.57  ? 695 ARG C O     1 
ATOM   8967  C  CB    . ARG C 1 427 ? 69.015  81.355  44.735  1.00 68.57  ? 695 ARG C CB    1 
ATOM   8968  C  CG    . ARG C 1 427 ? 69.682  81.924  43.497  1.00 68.57  ? 695 ARG C CG    1 
ATOM   8969  C  CD    . ARG C 1 427 ? 70.224  80.833  42.594  1.00 68.57  ? 695 ARG C CD    1 
ATOM   8970  N  NE    . ARG C 1 427 ? 69.171  79.979  42.056  1.00 68.57  ? 695 ARG C NE    1 
ATOM   8971  C  CZ    . ARG C 1 427 ? 68.453  80.267  40.975  1.00 68.57  ? 695 ARG C CZ    1 
ATOM   8972  N  NH1   . ARG C 1 427 ? 68.672  81.390  40.308  1.00 68.57  ? 695 ARG C NH1   1 
ATOM   8973  N  NH2   . ARG C 1 427 ? 67.517  79.427  40.558  1.00 68.57  ? 695 ARG C NH2   1 
ATOM   8974  N  N     . LEU C 1 428 ? 66.172  82.856  45.039  1.00 63.90  ? 696 LEU C N     1 
ATOM   8975  C  CA    . LEU C 1 428 ? 65.112  83.657  44.442  1.00 63.90  ? 696 LEU C CA    1 
ATOM   8976  C  C     . LEU C 1 428 ? 64.799  84.877  45.291  1.00 63.90  ? 696 LEU C C     1 
ATOM   8977  O  O     . LEU C 1 428 ? 64.500  85.947  44.756  1.00 63.90  ? 696 LEU C O     1 
ATOM   8978  C  CB    . LEU C 1 428 ? 63.862  82.806  44.251  1.00 63.90  ? 696 LEU C CB    1 
ATOM   8979  C  CG    . LEU C 1 428 ? 62.655  83.495  43.628  1.00 63.90  ? 696 LEU C CG    1 
ATOM   8980  C  CD1   . LEU C 1 428 ? 62.997  83.993  42.244  1.00 63.90  ? 696 LEU C CD1   1 
ATOM   8981  C  CD2   . LEU C 1 428 ? 61.490  82.542  43.580  1.00 63.90  ? 696 LEU C CD2   1 
ATOM   8982  N  N     . ILE C 1 429 ? 64.883  84.738  46.613  1.00 64.06  ? 697 ILE C N     1 
ATOM   8983  C  CA    . ILE C 1 429 ? 64.572  85.846  47.510  1.00 64.06  ? 697 ILE C CA    1 
ATOM   8984  C  C     . ILE C 1 429 ? 65.618  86.947  47.394  1.00 64.06  ? 697 ILE C C     1 
ATOM   8985  O  O     . ILE C 1 429 ? 65.282  88.127  47.245  1.00 64.06  ? 697 ILE C O     1 
ATOM   8986  C  CB    . ILE C 1 429 ? 64.444  85.332  48.953  1.00 64.06  ? 697 ILE C CB    1 
ATOM   8987  C  CG1   . ILE C 1 429 ? 63.194  84.477  49.089  1.00 64.06  ? 697 ILE C CG1   1 
ATOM   8988  C  CG2   . ILE C 1 429 ? 64.415  86.468  49.935  1.00 64.06  ? 697 ILE C CG2   1 
ATOM   8989  C  CD1   . ILE C 1 429 ? 63.093  83.802  50.395  1.00 64.06  ? 697 ILE C CD1   1 
ATOM   8990  N  N     . ASP C 1 430 ? 66.901  86.575  47.432  1.00 63.93  ? 698 ASP C N     1 
ATOM   8991  C  CA    . ASP C 1 430 ? 67.970  87.566  47.397  1.00 63.93  ? 698 ASP C CA    1 
ATOM   8992  C  C     . ASP C 1 430 ? 68.074  88.259  46.053  1.00 63.93  ? 698 ASP C C     1 
ATOM   8993  O  O     . ASP C 1 430 ? 68.564  89.388  45.981  1.00 63.93  ? 698 ASP C O     1 
ATOM   8994  C  CB    . ASP C 1 430 ? 69.306  86.923  47.737  1.00 63.93  ? 698 ASP C CB    1 
ATOM   8995  C  CG    . ASP C 1 430 ? 69.439  86.640  49.196  1.00 63.93  ? 698 ASP C CG    1 
ATOM   8996  O  OD1   . ASP C 1 430 ? 68.781  87.346  49.964  1.00 63.93  ? 698 ASP C OD1   1 
ATOM   8997  O  OD2   . ASP C 1 430 ? 70.206  85.743  49.585  1.00 63.93  ? 698 ASP C OD2   1 
ATOM   8998  N  N     . ASP C 1 431 ? 67.642  87.605  44.982  1.00 64.28  ? 699 ASP C N     1 
ATOM   8999  C  CA    . ASP C 1 431 ? 67.585  88.296  43.707  1.00 64.28  ? 699 ASP C CA    1 
ATOM   9000  C  C     . ASP C 1 431 ? 66.449  89.301  43.660  1.00 64.28  ? 699 ASP C C     1 
ATOM   9001  O  O     . ASP C 1 431 ? 66.473  90.198  42.816  1.00 64.28  ? 699 ASP C O     1 
ATOM   9002  C  CB    . ASP C 1 431 ? 67.442  87.292  42.567  1.00 64.28  ? 699 ASP C CB    1 
ATOM   9003  C  CG    . ASP C 1 431 ? 68.699  86.479  42.349  1.00 64.28  ? 699 ASP C CG    1 
ATOM   9004  O  OD1   . ASP C 1 431 ? 69.797  86.995  42.640  1.00 64.28  ? 699 ASP C OD1   1 
ATOM   9005  O  OD2   . ASP C 1 431 ? 68.592  85.327  41.882  1.00 64.28  ? 699 ASP C OD2   1 
ATOM   9006  N  N     . GLU C 1 432 ? 65.463  89.177  44.548  1.00 65.56  ? 700 GLU C N     1 
ATOM   9007  C  CA    . GLU C 1 432 ? 64.317  90.070  44.558  1.00 65.56  ? 700 GLU C CA    1 
ATOM   9008  C  C     . GLU C 1 432 ? 64.420  91.181  45.586  1.00 65.56  ? 700 GLU C C     1 
ATOM   9009  O  O     . GLU C 1 432 ? 63.774  92.219  45.411  1.00 65.56  ? 700 GLU C O     1 
ATOM   9010  C  CB    . GLU C 1 432 ? 63.035  89.276  44.799  1.00 65.56  ? 700 GLU C CB    1 
ATOM   9011  C  CG    . GLU C 1 432 ? 62.673  88.376  43.642  1.00 65.56  ? 700 GLU C CG    1 
ATOM   9012  C  CD    . GLU C 1 432 ? 62.257  89.144  42.411  1.00 65.56  ? 700 GLU C CD    1 
ATOM   9013  O  OE1   . GLU C 1 432 ? 61.644  90.221  42.559  1.00 65.56  ? 700 GLU C OE1   1 
ATOM   9014  O  OE2   . GLU C 1 432 ? 62.549  88.674  41.293  1.00 65.56  ? 700 GLU C OE2   1 
ATOM   9015  N  N     . VAL C 1 433 ? 65.194  90.987  46.654  1.00 61.28  ? 701 VAL C N     1 
ATOM   9016  C  CA    . VAL C 1 433 ? 65.569  92.106  47.512  1.00 61.28  ? 701 VAL C CA    1 
ATOM   9017  C  C     . VAL C 1 433 ? 66.409  93.099  46.726  1.00 61.28  ? 701 VAL C C     1 
ATOM   9018  O  O     . VAL C 1 433 ? 66.226  94.318  46.826  1.00 61.28  ? 701 VAL C O     1 
ATOM   9019  C  CB    . VAL C 1 433 ? 66.315  91.584  48.752  1.00 61.28  ? 701 VAL C CB    1 
ATOM   9020  C  CG1   . VAL C 1 433 ? 66.819  92.712  49.600  1.00 61.28  ? 701 VAL C CG1   1 
ATOM   9021  C  CG2   . VAL C 1 433 ? 65.414  90.694  49.561  1.00 61.28  ? 701 VAL C CG2   1 
ATOM   9022  N  N     . ARG C 1 434 ? 67.299  92.584  45.884  1.00 62.00  ? 702 ARG C N     1 
ATOM   9023  C  CA    . ARG C 1 434 ? 68.207  93.421  45.118  1.00 62.00  ? 702 ARG C CA    1 
ATOM   9024  C  C     . ARG C 1 434 ? 67.477  94.188  44.022  1.00 62.00  ? 702 ARG C C     1 
ATOM   9025  O  O     . ARG C 1 434 ? 67.918  95.272  43.631  1.00 62.00  ? 702 ARG C O     1 
ATOM   9026  C  CB    . ARG C 1 434 ? 69.311  92.536  44.549  1.00 62.00  ? 702 ARG C CB    1 
ATOM   9027  C  CG    . ARG C 1 434 ? 70.487  93.245  43.943  1.00 62.00  ? 702 ARG C CG    1 
ATOM   9028  C  CD    . ARG C 1 434 ? 71.537  92.233  43.531  1.00 62.00  ? 702 ARG C CD    1 
ATOM   9029  N  NE    . ARG C 1 434 ? 72.041  91.481  44.676  1.00 62.00  ? 702 ARG C NE    1 
ATOM   9030  C  CZ    . ARG C 1 434 ? 71.903  90.170  44.827  1.00 62.00  ? 702 ARG C CZ    1 
ATOM   9031  N  NH1   . ARG C 1 434 ? 71.286  89.461  43.896  1.00 62.00  ? 702 ARG C NH1   1 
ATOM   9032  N  NH2   . ARG C 1 434 ? 72.390  89.568  45.901  1.00 62.00  ? 702 ARG C NH2   1 
ATOM   9033  N  N     . ILE C 1 435 ? 66.359  93.660  43.530  1.00 62.12  ? 703 ILE C N     1 
ATOM   9034  C  CA    . ILE C 1 435 ? 65.532  94.421  42.598  1.00 62.12  ? 703 ILE C CA    1 
ATOM   9035  C  C     . ILE C 1 435 ? 64.683  95.436  43.351  1.00 62.12  ? 703 ILE C C     1 
ATOM   9036  O  O     . ILE C 1 435 ? 64.468  96.558  42.878  1.00 62.12  ? 703 ILE C O     1 
ATOM   9037  C  CB    . ILE C 1 435 ? 64.679  93.460  41.748  1.00 62.12  ? 703 ILE C CB    1 
ATOM   9038  C  CG1   . ILE C 1 435 ? 65.580  92.624  40.850  1.00 62.12  ? 703 ILE C CG1   1 
ATOM   9039  C  CG2   . ILE C 1 435 ? 63.688  94.195  40.868  1.00 62.12  ? 703 ILE C CG2   1 
ATOM   9040  C  CD1   . ILE C 1 435 ? 64.857  91.506  40.155  1.00 62.12  ? 703 ILE C CD1   1 
ATOM   9041  N  N     . LEU C 1 436 ? 64.240  95.081  44.556  1.00 61.48  ? 704 LEU C N     1 
ATOM   9042  C  CA    . LEU C 1 436 ? 63.358  95.955  45.320  1.00 61.48  ? 704 LEU C CA    1 
ATOM   9043  C  C     . LEU C 1 436 ? 64.086  97.191  45.827  1.00 61.48  ? 704 LEU C C     1 
ATOM   9044  O  O     . LEU C 1 436 ? 63.540  98.298  45.778  1.00 61.48  ? 704 LEU C O     1 
ATOM   9045  C  CB    . LEU C 1 436 ? 62.752  95.182  46.483  1.00 61.48  ? 704 LEU C CB    1 
ATOM   9046  C  CG    . LEU C 1 436 ? 61.845  95.953  47.427  1.00 61.48  ? 704 LEU C CG    1 
ATOM   9047  C  CD1   . LEU C 1 436 ? 60.670  96.531  46.683  1.00 61.48  ? 704 LEU C CD1   1 
ATOM   9048  C  CD2   . LEU C 1 436 ? 61.377  95.029  48.514  1.00 61.48  ? 704 LEU C CD2   1 
ATOM   9049  N  N     . ILE C 1 437 ? 65.318  97.026  46.308  1.00 58.41  ? 705 ILE C N     1 
ATOM   9050  C  CA    . ILE C 1 437 ? 66.072  98.170  46.804  1.00 58.41  ? 705 ILE C CA    1 
ATOM   9051  C  C     . ILE C 1 437 ? 66.511  99.059  45.651  1.00 58.41  ? 705 ILE C C     1 
ATOM   9052  O  O     . ILE C 1 437 ? 66.428  100.289 45.737  1.00 58.41  ? 705 ILE C O     1 
ATOM   9053  C  CB    . ILE C 1 437 ? 67.261  97.695  47.652  1.00 58.41  ? 705 ILE C CB    1 
ATOM   9054  C  CG1   . ILE C 1 437 ? 66.753  96.976  48.891  1.00 58.41  ? 705 ILE C CG1   1 
ATOM   9055  C  CG2   . ILE C 1 437 ? 68.117  98.849  48.078  1.00 58.41  ? 705 ILE C CG2   1 
ATOM   9056  C  CD1   . ILE C 1 437 ? 67.838  96.335  49.678  1.00 58.41  ? 705 ILE C CD1   1 
ATOM   9057  N  N     . ASN C 1 438 ? 66.921  98.457  44.533  1.00 62.05  ? 706 ASN C N     1 
ATOM   9058  C  CA    . ASN C 1 438 ? 67.320  99.243  43.370  1.00 62.05  ? 706 ASN C CA    1 
ATOM   9059  C  C     . ASN C 1 438 ? 66.140  99.956  42.728  1.00 62.05  ? 706 ASN C C     1 
ATOM   9060  O  O     . ASN C 1 438 ? 66.323  101.004 42.104  1.00 62.05  ? 706 ASN C O     1 
ATOM   9061  C  CB    . ASN C 1 438 ? 68.015  98.359  42.345  1.00 62.05  ? 706 ASN C CB    1 
ATOM   9062  C  CG    . ASN C 1 438 ? 69.391  97.945  42.787  1.00 62.05  ? 706 ASN C CG    1 
ATOM   9063  O  OD1   . ASN C 1 438 ? 70.137  98.744  43.346  1.00 62.05  ? 706 ASN C OD1   1 
ATOM   9064  N  ND2   . ASN C 1 438 ? 69.741  96.690  42.543  1.00 62.05  ? 706 ASN C ND2   1 
ATOM   9065  N  N     . ASP C 1 439 ? 64.929  99.419  42.868  1.00 62.48  ? 707 ASP C N     1 
ATOM   9066  C  CA    . ASP C 1 439 ? 63.761  100.188 42.465  1.00 62.48  ? 707 ASP C CA    1 
ATOM   9067  C  C     . ASP C 1 439 ? 63.482  101.314 43.444  1.00 62.48  ? 707 ASP C C     1 
ATOM   9068  O  O     . ASP C 1 439 ? 63.047  102.394 43.035  1.00 62.48  ? 707 ASP C O     1 
ATOM   9069  C  CB    . ASP C 1 439 ? 62.545  99.279  42.335  1.00 62.48  ? 707 ASP C CB    1 
ATOM   9070  C  CG    . ASP C 1 439 ? 62.627  98.378  41.126  1.00 62.48  ? 707 ASP C CG    1 
ATOM   9071  O  OD1   . ASP C 1 439 ? 63.262  98.781  40.130  1.00 62.48  ? 707 ASP C OD1   1 
ATOM   9072  O  OD2   . ASP C 1 439 ? 62.058  97.268  41.169  1.00 62.48  ? 707 ASP C OD2   1 
ATOM   9073  N  N     . ALA C 1 440 ? 63.738  101.088 44.733  1.00 60.99  ? 708 ALA C N     1 
ATOM   9074  C  CA    . ALA C 1 440 ? 63.630  102.167 45.705  1.00 60.99  ? 708 ALA C CA    1 
ATOM   9075  C  C     . ALA C 1 440 ? 64.777  103.153 45.567  1.00 60.99  ? 708 ALA C C     1 
ATOM   9076  O  O     . ALA C 1 440 ? 64.623  104.332 45.896  1.00 60.99  ? 708 ALA C O     1 
ATOM   9077  C  CB    . ALA C 1 440 ? 63.595  101.599 47.121  1.00 60.99  ? 708 ALA C CB    1 
ATOM   9078  N  N     . TYR C 1 441 ? 65.926  102.695 45.076  1.00 61.45  ? 709 TYR C N     1 
ATOM   9079  C  CA    . TYR C 1 441 ? 67.080  103.572 44.948  1.00 61.45  ? 709 TYR C CA    1 
ATOM   9080  C  C     . TYR C 1 441 ? 66.958  104.487 43.743  1.00 61.45  ? 709 TYR C C     1 
ATOM   9081  O  O     . TYR C 1 441 ? 67.247  105.681 43.845  1.00 61.45  ? 709 TYR C O     1 
ATOM   9082  C  CB    . TYR C 1 441 ? 68.355  102.746 44.848  1.00 61.45  ? 709 TYR C CB    1 
ATOM   9083  C  CG    . TYR C 1 441 ? 69.607  103.563 44.767  1.00 61.45  ? 709 TYR C CG    1 
ATOM   9084  C  CD1   . TYR C 1 441 ? 70.094  104.215 45.882  1.00 61.45  ? 709 TYR C CD1   1 
ATOM   9085  C  CD2   . TYR C 1 441 ? 70.312  103.675 43.580  1.00 61.45  ? 709 TYR C CD2   1 
ATOM   9086  C  CE1   . TYR C 1 441 ? 71.242  104.958 45.823  1.00 61.45  ? 709 TYR C CE1   1 
ATOM   9087  C  CE2   . TYR C 1 441 ? 71.464  104.425 43.509  1.00 61.45  ? 709 TYR C CE2   1 
ATOM   9088  C  CZ    . TYR C 1 441 ? 71.923  105.062 44.637  1.00 61.45  ? 709 TYR C CZ    1 
ATOM   9089  O  OH    . TYR C 1 441 ? 73.070  105.812 44.582  1.00 61.45  ? 709 TYR C OH    1 
ATOM   9090  N  N     . LYS C 1 442 ? 66.544  103.942 42.597  1.00 62.64  ? 710 LYS C N     1 
ATOM   9091  C  CA    . LYS C 1 442 ? 66.416  104.749 41.388  1.00 62.64  ? 710 LYS C CA    1 
ATOM   9092  C  C     . LYS C 1 442 ? 65.311  105.786 41.508  1.00 62.64  ? 710 LYS C C     1 
ATOM   9093  O  O     . LYS C 1 442 ? 65.360  106.817 40.831  1.00 62.64  ? 710 LYS C O     1 
ATOM   9094  C  CB    . LYS C 1 442 ? 66.143  103.860 40.179  1.00 62.64  ? 710 LYS C CB    1 
ATOM   9095  C  CG    . LYS C 1 442 ? 67.303  103.009 39.727  1.00 62.64  ? 710 LYS C CG    1 
ATOM   9096  C  CD    . LYS C 1 442 ? 66.900  102.206 38.508  1.00 62.64  ? 710 LYS C CD    1 
ATOM   9097  C  CE    . LYS C 1 442 ? 68.027  101.318 38.030  1.00 62.64  ? 710 LYS C CE    1 
ATOM   9098  N  NZ    . LYS C 1 442 ? 67.624  100.533 36.833  1.00 62.64  ? 710 LYS C NZ    1 
ATOM   9099  N  N     . ARG C 1 443 ? 64.310  105.531 42.350  1.00 62.24  ? 711 ARG C N     1 
ATOM   9100  C  CA    . ARG C 1 443 ? 63.260  106.516 42.568  1.00 62.24  ? 711 ARG C CA    1 
ATOM   9101  C  C     . ARG C 1 443 ? 63.788  107.710 43.346  1.00 62.24  ? 711 ARG C C     1 
ATOM   9102  O  O     . ARG C 1 443 ? 63.433  108.856 43.052  1.00 62.24  ? 711 ARG C O     1 
ATOM   9103  C  CB    . ARG C 1 443 ? 62.087  105.876 43.304  1.00 62.24  ? 711 ARG C CB    1 
ATOM   9104  C  CG    . ARG C 1 443 ? 60.908  106.806 43.468  1.00 62.24  ? 711 ARG C CG    1 
ATOM   9105  C  CD    . ARG C 1 443 ? 59.753  106.152 44.189  1.00 62.24  ? 711 ARG C CD    1 
ATOM   9106  N  NE    . ARG C 1 443 ? 58.664  107.103 44.371  1.00 62.24  ? 711 ARG C NE    1 
ATOM   9107  C  CZ    . ARG C 1 443 ? 57.543  106.838 45.027  1.00 62.24  ? 711 ARG C CZ    1 
ATOM   9108  N  NH1   . ARG C 1 443 ? 57.367  105.650 45.582  1.00 62.24  ? 711 ARG C NH1   1 
ATOM   9109  N  NH2   . ARG C 1 443 ? 56.604  107.764 45.140  1.00 62.24  ? 711 ARG C NH2   1 
ATOM   9110  N  N     . THR C 1 444 ? 64.654  107.460 44.327  1.00 60.06  ? 712 THR C N     1 
ATOM   9111  C  CA    . THR C 1 444 ? 65.199  108.546 45.132  1.00 60.06  ? 712 THR C CA    1 
ATOM   9112  C  C     . THR C 1 444 ? 66.220  109.353 44.345  1.00 60.06  ? 712 THR C C     1 
ATOM   9113  O  O     . THR C 1 444 ? 66.271  110.583 44.463  1.00 60.06  ? 712 THR C O     1 
ATOM   9114  C  CB    . THR C 1 444 ? 65.827  107.979 46.397  1.00 60.06  ? 712 THR C CB    1 
ATOM   9115  O  OG1   . THR C 1 444 ? 64.871  107.155 47.060  1.00 60.06  ? 712 THR C OG1   1 
ATOM   9116  C  CG2   . THR C 1 444 ? 66.221  109.083 47.332  1.00 60.06  ? 712 THR C CG2   1 
ATOM   9117  N  N     . VAL C 1 445 ? 67.034  108.675 43.534  1.00 60.60  ? 713 VAL C N     1 
ATOM   9118  C  CA    . VAL C 1 445 ? 68.002  109.362 42.685  1.00 60.60  ? 713 VAL C CA    1 
ATOM   9119  C  C     . VAL C 1 445 ? 67.284  110.230 41.662  1.00 60.60  ? 713 VAL C C     1 
ATOM   9120  O  O     . VAL C 1 445 ? 67.688  111.366 41.404  1.00 60.60  ? 713 VAL C O     1 
ATOM   9121  C  CB    . VAL C 1 445 ? 68.948  108.341 42.025  1.00 60.60  ? 713 VAL C CB    1 
ATOM   9122  C  CG1   . VAL C 1 445 ? 69.864  109.011 41.025  1.00 60.60  ? 713 VAL C CG1   1 
ATOM   9123  C  CG2   . VAL C 1 445 ? 69.782  107.659 43.080  1.00 60.60  ? 713 VAL C CG2   1 
ATOM   9124  N  N     . ALA C 1 446 ? 66.159  109.755 41.143  1.00 60.93  ? 714 ALA C N     1 
ATOM   9125  C  CA    . ALA C 1 446 ? 65.328  110.565 40.264  1.00 60.93  ? 714 ALA C CA    1 
ATOM   9126  C  C     . ALA C 1 446 ? 64.369  111.474 41.021  1.00 60.93  ? 714 ALA C C     1 
ATOM   9127  O  O     . ALA C 1 446 ? 63.436  112.002 40.413  1.00 60.93  ? 714 ALA C O     1 
ATOM   9128  C  CB    . ALA C 1 446 ? 64.538  109.672 39.307  1.00 60.93  ? 714 ALA C CB    1 
ATOM   9129  N  N     . LEU C 1 447 ? 64.555  111.641 42.324  1.00 62.15  ? 715 LEU C N     1 
ATOM   9130  C  CA    . LEU C 1 447 ? 63.830  112.615 43.126  1.00 62.15  ? 715 LEU C CA    1 
ATOM   9131  C  C     . LEU C 1 447 ? 64.711  113.753 43.602  1.00 62.15  ? 715 LEU C C     1 
ATOM   9132  O  O     . LEU C 1 447 ? 64.294  114.910 43.566  1.00 62.15  ? 715 LEU C O     1 
ATOM   9133  C  CB    . LEU C 1 447 ? 63.199  111.931 44.341  1.00 62.15  ? 715 LEU C CB    1 
ATOM   9134  C  CG    . LEU C 1 447 ? 62.427  112.806 45.326  1.00 62.15  ? 715 LEU C CG    1 
ATOM   9135  C  CD1   . LEU C 1 447 ? 61.234  113.448 44.663  1.00 62.15  ? 715 LEU C CD1   1 
ATOM   9136  C  CD2   . LEU C 1 447 ? 62.004  111.994 46.527  1.00 62.15  ? 715 LEU C CD2   1 
ATOM   9137  N  N     . LEU C 1 448 ? 65.931  113.450 44.026  1.00 62.28  ? 716 LEU C N     1 
ATOM   9138  C  CA    . LEU C 1 448 ? 66.853  114.450 44.531  1.00 62.28  ? 716 LEU C CA    1 
ATOM   9139  C  C     . LEU C 1 448 ? 67.776  115.001 43.454  1.00 62.28  ? 716 LEU C C     1 
ATOM   9140  O  O     . LEU C 1 448 ? 68.708  115.738 43.782  1.00 62.28  ? 716 LEU C O     1 
ATOM   9141  C  CB    . LEU C 1 448 ? 67.684  113.866 45.672  1.00 62.28  ? 716 LEU C CB    1 
ATOM   9142  C  CG    . LEU C 1 448 ? 66.877  113.450 46.897  1.00 62.28  ? 716 LEU C CG    1 
ATOM   9143  C  CD1   . LEU C 1 448 ? 67.771  112.795 47.919  1.00 62.28  ? 716 LEU C CD1   1 
ATOM   9144  C  CD2   . LEU C 1 448 ? 66.184  114.637 47.492  1.00 62.28  ? 716 LEU C CD2   1 
ATOM   9145  N  N     . THR C 1 449 ? 67.552  114.664 42.183  1.00 64.71  ? 717 THR C N     1 
ATOM   9146  C  CA    . THR C 1 449 ? 68.353  115.243 41.116  1.00 64.71  ? 717 THR C CA    1 
ATOM   9147  C  C     . THR C 1 449 ? 67.644  116.374 40.386  1.00 64.71  ? 717 THR C C     1 
ATOM   9148  O  O     . THR C 1 449 ? 68.300  117.121 39.654  1.00 64.71  ? 717 THR C O     1 
ATOM   9149  C  CB    . THR C 1 449 ? 68.779  114.178 40.098  1.00 64.71  ? 717 THR C CB    1 
ATOM   9150  O  OG1   . THR C 1 449 ? 69.800  114.717 39.253  1.00 64.71  ? 717 THR C OG1   1 
ATOM   9151  C  CG2   . THR C 1 449 ? 67.614  113.763 39.219  1.00 64.71  ? 717 THR C CG2   1 
ATOM   9152  N  N     . GLU C 1 450 ? 66.331  116.516 40.559  1.00 66.48  ? 718 GLU C N     1 
ATOM   9153  C  CA    . GLU C 1 450 ? 65.635  117.713 40.118  1.00 66.48  ? 718 GLU C CA    1 
ATOM   9154  C  C     . GLU C 1 450 ? 65.316  118.639 41.274  1.00 66.48  ? 718 GLU C C     1 
ATOM   9155  O  O     . GLU C 1 450 ? 65.022  119.816 41.046  1.00 66.48  ? 718 GLU C O     1 
ATOM   9156  C  CB    . GLU C 1 450 ? 64.340  117.352 39.384  1.00 66.48  ? 718 GLU C CB    1 
ATOM   9157  C  CG    . GLU C 1 450 ? 63.232  116.818 40.269  1.00 66.48  ? 718 GLU C CG    1 
ATOM   9158  C  CD    . GLU C 1 450 ? 63.303  115.319 40.469  1.00 66.48  ? 718 GLU C CD    1 
ATOM   9159  O  OE1   . GLU C 1 450 ? 64.353  114.714 40.168  1.00 66.48  ? 718 GLU C OE1   1 
ATOM   9160  O  OE2   . GLU C 1 450 ? 62.299  114.737 40.931  1.00 66.48  ? 718 GLU C OE2   1 
ATOM   9161  N  N     . LYS C 1 451 ? 65.371  118.131 42.502  1.00 66.31  ? 719 LYS C N     1 
ATOM   9162  C  CA    . LYS C 1 451 ? 65.289  118.952 43.697  1.00 66.31  ? 719 LYS C CA    1 
ATOM   9163  C  C     . LYS C 1 451 ? 66.668  119.249 44.260  1.00 66.31  ? 719 LYS C C     1 
ATOM   9164  O  O     . LYS C 1 451 ? 66.834  119.357 45.477  1.00 66.31  ? 719 LYS C O     1 
ATOM   9165  C  CB    . LYS C 1 451 ? 64.413  118.274 44.743  1.00 66.31  ? 719 LYS C CB    1 
ATOM   9166  C  CG    . LYS C 1 451 ? 63.021  117.983 44.237  1.00 66.31  ? 719 LYS C CG    1 
ATOM   9167  C  CD    . LYS C 1 451 ? 62.309  119.266 43.856  1.00 66.31  ? 719 LYS C CD    1 
ATOM   9168  C  CE    . LYS C 1 451 ? 60.869  119.000 43.478  1.00 66.31  ? 719 LYS C CE    1 
ATOM   9169  N  NZ    . LYS C 1 451 ? 60.186  120.250 43.061  1.00 66.31  ? 719 LYS C NZ    1 
ATOM   9170  N  N     . LYS C 1 452 ? 67.664  119.368 43.380  1.00 67.64  ? 720 LYS C N     1 
ATOM   9171  C  CA    . LYS C 1 452 ? 69.041  119.562 43.809  1.00 67.64  ? 720 LYS C CA    1 
ATOM   9172  C  C     . LYS C 1 452 ? 69.240  120.936 44.428  1.00 67.64  ? 720 LYS C C     1 
ATOM   9173  O  O     . LYS C 1 452 ? 70.069  121.095 45.331  1.00 67.64  ? 720 LYS C O     1 
ATOM   9174  C  CB    . LYS C 1 452 ? 69.979  119.355 42.620  1.00 67.64  ? 720 LYS C CB    1 
ATOM   9175  C  CG    . LYS C 1 452 ? 71.447  119.299 42.977  1.00 67.64  ? 720 LYS C CG    1 
ATOM   9176  C  CD    . LYS C 1 452 ? 72.306  118.966 41.775  1.00 67.64  ? 720 LYS C CD    1 
ATOM   9177  C  CE    . LYS C 1 452 ? 73.774  118.921 42.156  1.00 67.64  ? 720 LYS C CE    1 
ATOM   9178  N  NZ    . LYS C 1 452 ? 74.635  118.600 40.990  1.00 67.64  ? 720 LYS C NZ    1 
ATOM   9179  N  N     . ALA C 1 453 ? 68.480  121.933 43.975  1.00 68.18  ? 721 ALA C N     1 
ATOM   9180  C  CA    . ALA C 1 453 ? 68.545  123.242 44.609  1.00 68.18  ? 721 ALA C CA    1 
ATOM   9181  C  C     . ALA C 1 453 ? 67.904  123.229 45.988  1.00 68.18  ? 721 ALA C C     1 
ATOM   9182  O  O     . ALA C 1 453 ? 68.354  123.950 46.883  1.00 68.18  ? 721 ALA C O     1 
ATOM   9183  C  CB    . ALA C 1 453 ? 67.875  124.289 43.723  1.00 68.18  ? 721 ALA C CB    1 
ATOM   9184  N  N     . ASP C 1 454 ? 66.868  122.416 46.185  1.00 68.21  ? 722 ASP C N     1 
ATOM   9185  C  CA    . ASP C 1 454 ? 66.185  122.393 47.472  1.00 68.21  ? 722 ASP C CA    1 
ATOM   9186  C  C     . ASP C 1 454 ? 66.984  121.656 48.534  1.00 68.21  ? 722 ASP C C     1 
ATOM   9187  O  O     . ASP C 1 454 ? 66.844  121.955 49.721  1.00 68.21  ? 722 ASP C O     1 
ATOM   9188  C  CB    . ASP C 1 454 ? 64.803  121.763 47.323  1.00 68.21  ? 722 ASP C CB    1 
ATOM   9189  C  CG    . ASP C 1 454 ? 63.841  122.649 46.557  1.00 68.21  ? 722 ASP C CG    1 
ATOM   9190  O  OD1   . ASP C 1 454 ? 63.992  123.886 46.624  1.00 68.21  ? 722 ASP C OD1   1 
ATOM   9191  O  OD2   . ASP C 1 454 ? 62.936  122.110 45.887  1.00 68.21  ? 722 ASP C OD2   1 
ATOM   9192  N  N     . VAL C 1 455 ? 67.809  120.687 48.140  1.00 64.66  ? 723 VAL C N     1 
ATOM   9193  C  CA    . VAL C 1 455 ? 68.705  120.056 49.100  1.00 64.66  ? 723 VAL C CA    1 
ATOM   9194  C  C     . VAL C 1 455 ? 69.847  121.007 49.425  1.00 64.66  ? 723 VAL C C     1 
ATOM   9195  O  O     . VAL C 1 455 ? 70.375  121.010 50.545  1.00 64.66  ? 723 VAL C O     1 
ATOM   9196  C  CB    . VAL C 1 455 ? 69.197  118.710 48.532  1.00 64.66  ? 723 VAL C CB    1 
ATOM   9197  C  CG1   . VAL C 1 455 ? 70.087  117.981 49.512  1.00 64.66  ? 723 VAL C CG1   1 
ATOM   9198  C  CG2   . VAL C 1 455 ? 68.023  117.841 48.160  1.00 64.66  ? 723 VAL C CG2   1 
ATOM   9199  N  N     . GLU C 1 456 ? 70.208  121.861 48.466  1.00 66.83  ? 724 GLU C N     1 
ATOM   9200  C  CA    . GLU C 1 456 ? 71.247  122.860 48.683  1.00 66.83  ? 724 GLU C CA    1 
ATOM   9201  C  C     . GLU C 1 456 ? 70.802  123.917 49.686  1.00 66.83  ? 724 GLU C C     1 
ATOM   9202  O  O     . GLU C 1 456 ? 71.605  124.380 50.500  1.00 66.83  ? 724 GLU C O     1 
ATOM   9203  C  CB    . GLU C 1 456 ? 71.612  123.507 47.347  1.00 66.83  ? 724 GLU C CB    1 
ATOM   9204  C  CG    . GLU C 1 456 ? 72.767  124.476 47.396  1.00 66.83  ? 724 GLU C CG    1 
ATOM   9205  C  CD    . GLU C 1 456 ? 74.089  123.783 47.607  1.00 66.83  ? 724 GLU C CD    1 
ATOM   9206  O  OE1   . GLU C 1 456 ? 74.212  122.610 47.201  1.00 66.83  ? 724 GLU C OE1   1 
ATOM   9207  O  OE2   . GLU C 1 456 ? 75.006  124.408 48.177  1.00 66.83  ? 724 GLU C OE2   1 
ATOM   9208  N  N     . LYS C 1 457 ? 69.522  124.296 49.657  1.00 66.08  ? 725 LYS C N     1 
ATOM   9209  C  CA    . LYS C 1 457 ? 69.027  125.326 50.566  1.00 66.08  ? 725 LYS C CA    1 
ATOM   9210  C  C     . LYS C 1 457 ? 68.961  124.837 52.003  1.00 66.08  ? 725 LYS C C     1 
ATOM   9211  O  O     . LYS C 1 457 ? 69.181  125.621 52.930  1.00 66.08  ? 725 LYS C O     1 
ATOM   9212  C  CB    . LYS C 1 457 ? 67.641  125.790 50.135  1.00 66.08  ? 725 LYS C CB    1 
ATOM   9213  C  CG    . LYS C 1 457 ? 67.602  126.535 48.830  1.00 66.08  ? 725 LYS C CG    1 
ATOM   9214  C  CD    . LYS C 1 457 ? 66.179  126.923 48.486  1.00 66.08  ? 725 LYS C CD    1 
ATOM   9215  C  CE    . LYS C 1 457 ? 66.114  127.630 47.148  1.00 66.08  ? 725 LYS C CE    1 
ATOM   9216  N  NZ    . LYS C 1 457 ? 64.721  128.010 46.795  1.00 66.08  ? 725 LYS C NZ    1 
ATOM   9217  N  N     . VAL C 1 458 ? 68.650  123.559 52.207  1.00 63.79  ? 726 VAL C N     1 
ATOM   9218  C  CA    . VAL C 1 458 ? 68.443  123.048 53.556  1.00 63.79  ? 726 VAL C CA    1 
ATOM   9219  C  C     . VAL C 1 458 ? 69.768  122.906 54.280  1.00 63.79  ? 726 VAL C C     1 
ATOM   9220  O  O     . VAL C 1 458 ? 69.931  123.369 55.414  1.00 63.79  ? 726 VAL C O     1 
ATOM   9221  C  CB    . VAL C 1 458 ? 67.687  121.711 53.510  1.00 63.79  ? 726 VAL C CB    1 
ATOM   9222  C  CG1   . VAL C 1 458 ? 67.636  121.087 54.882  1.00 63.79  ? 726 VAL C CG1   1 
ATOM   9223  C  CG2   . VAL C 1 458 ? 66.293  121.919 52.986  1.00 63.79  ? 726 VAL C CG2   1 
ATOM   9224  N  N     . ALA C 1 459 ? 70.738  122.277 53.632  1.00 61.67  ? 727 ALA C N     1 
ATOM   9225  C  CA    . ALA C 1 459 ? 71.968  121.934 54.317  1.00 61.67  ? 727 ALA C CA    1 
ATOM   9226  C  C     . ALA C 1 459 ? 72.900  123.114 54.510  1.00 61.67  ? 727 ALA C C     1 
ATOM   9227  O  O     . ALA C 1 459 ? 73.752  123.063 55.401  1.00 61.67  ? 727 ALA C O     1 
ATOM   9228  C  CB    . ALA C 1 459 ? 72.688  120.845 53.556  1.00 61.67  ? 727 ALA C CB    1 
ATOM   9229  N  N     . LEU C 1 460 ? 72.777  124.163 53.698  1.00 61.78  ? 728 LEU C N     1 
ATOM   9230  C  CA    . LEU C 1 460 ? 73.539  125.369 53.988  1.00 61.78  ? 728 LEU C CA    1 
ATOM   9231  C  C     . LEU C 1 460 ? 73.011  126.053 55.236  1.00 61.78  ? 728 LEU C C     1 
ATOM   9232  O  O     . LEU C 1 460 ? 73.794  126.574 56.032  1.00 61.78  ? 728 LEU C O     1 
ATOM   9233  C  CB    . LEU C 1 460 ? 73.521  126.321 52.798  1.00 61.78  ? 728 LEU C CB    1 
ATOM   9234  C  CG    . LEU C 1 460 ? 74.331  125.812 51.611  1.00 61.78  ? 728 LEU C CG    1 
ATOM   9235  C  CD1   . LEU C 1 460 ? 74.194  126.755 50.438  1.00 61.78  ? 728 LEU C CD1   1 
ATOM   9236  C  CD2   . LEU C 1 460 ? 75.782  125.620 51.985  1.00 61.78  ? 728 LEU C CD2   1 
ATOM   9237  N  N     . LEU C 1 461 ? 71.693  126.030 55.446  1.00 62.96  ? 729 LEU C N     1 
ATOM   9238  C  CA    . LEU C 1 461 ? 71.147  126.512 56.707  1.00 62.96  ? 729 LEU C CA    1 
ATOM   9239  C  C     . LEU C 1 461 ? 71.452  125.585 57.869  1.00 62.96  ? 729 LEU C C     1 
ATOM   9240  O  O     . LEU C 1 461 ? 71.389  126.023 59.020  1.00 62.96  ? 729 LEU C O     1 
ATOM   9241  C  CB    . LEU C 1 461 ? 69.639  126.707 56.618  1.00 62.96  ? 729 LEU C CB    1 
ATOM   9242  C  CG    . LEU C 1 461 ? 69.159  127.890 55.791  1.00 62.96  ? 729 LEU C CG    1 
ATOM   9243  C  CD1   . LEU C 1 461 ? 67.649  127.922 55.780  1.00 62.96  ? 729 LEU C CD1   1 
ATOM   9244  C  CD2   . LEU C 1 461 ? 69.719  129.183 56.352  1.00 62.96  ? 729 LEU C CD2   1 
ATOM   9245  N  N     . LEU C 1 462 ? 71.767  124.320 57.606  1.00 63.44  ? 730 LEU C N     1 
ATOM   9246  C  CA    . LEU C 1 462 ? 72.205  123.446 58.683  1.00 63.44  ? 730 LEU C CA    1 
ATOM   9247  C  C     . LEU C 1 462 ? 73.598  123.791 59.175  1.00 63.44  ? 730 LEU C C     1 
ATOM   9248  O  O     . LEU C 1 462 ? 73.937  123.455 60.311  1.00 63.44  ? 730 LEU C O     1 
ATOM   9249  C  CB    . LEU C 1 462 ? 72.169  121.992 58.234  1.00 63.44  ? 730 LEU C CB    1 
ATOM   9250  C  CG    . LEU C 1 462 ? 70.787  121.376 58.108  1.00 63.44  ? 730 LEU C CG    1 
ATOM   9251  C  CD1   . LEU C 1 462 ? 70.879  120.036 57.427  1.00 63.44  ? 730 LEU C CD1   1 
ATOM   9252  C  CD2   . LEU C 1 462 ? 70.236  121.216 59.495  1.00 63.44  ? 730 LEU C CD2   1 
ATOM   9253  N  N     . LEU C 1 463 ? 74.407  124.453 58.360  1.00 63.34  ? 731 LEU C N     1 
ATOM   9254  C  CA    . LEU C 1 463 ? 75.775  124.755 58.749  1.00 63.34  ? 731 LEU C CA    1 
ATOM   9255  C  C     . LEU C 1 463 ? 75.903  126.020 59.589  1.00 63.34  ? 731 LEU C C     1 
ATOM   9256  O  O     . LEU C 1 463 ? 77.025  126.370 59.967  1.00 63.34  ? 731 LEU C O     1 
ATOM   9257  C  CB    . LEU C 1 463 ? 76.658  124.852 57.505  1.00 63.34  ? 731 LEU C CB    1 
ATOM   9258  C  CG    . LEU C 1 463 ? 76.849  123.509 56.800  1.00 63.34  ? 731 LEU C CG    1 
ATOM   9259  C  CD1   . LEU C 1 463 ? 77.584  123.671 55.490  1.00 63.34  ? 731 LEU C CD1   1 
ATOM   9260  C  CD2   . LEU C 1 463 ? 77.594  122.562 57.708  1.00 63.34  ? 731 LEU C CD2   1 
ATOM   9261  N  N     . GLU C 1 464 ? 74.807  126.716 59.894  1.00 67.36  ? 732 GLU C N     1 
ATOM   9262  C  CA    . GLU C 1 464 ? 74.855  127.780 60.890  1.00 67.36  ? 732 GLU C CA    1 
ATOM   9263  C  C     . GLU C 1 464 ? 73.958  127.512 62.084  1.00 67.36  ? 732 GLU C C     1 
ATOM   9264  O  O     . GLU C 1 464 ? 74.428  127.567 63.226  1.00 67.36  ? 732 GLU C O     1 
ATOM   9265  C  CB    . GLU C 1 464 ? 74.484  129.138 60.283  1.00 67.36  ? 732 GLU C CB    1 
ATOM   9266  C  CG    . GLU C 1 464 ? 75.454  129.629 59.247  1.00 67.36  ? 732 GLU C CG    1 
ATOM   9267  C  CD    . GLU C 1 464 ? 75.018  129.252 57.865  1.00 67.36  ? 732 GLU C CD    1 
ATOM   9268  O  OE1   . GLU C 1 464 ? 73.870  128.792 57.743  1.00 67.36  ? 732 GLU C OE1   1 
ATOM   9269  O  OE2   . GLU C 1 464 ? 75.812  129.404 56.915  1.00 67.36  ? 732 GLU C OE2   1 
ATOM   9270  N  N     . LYS C 1 465 ? 72.676  127.229 61.859  1.00 67.61  ? 733 LYS C N     1 
ATOM   9271  C  CA    . LYS C 1 465 ? 71.763  127.067 62.982  1.00 67.61  ? 733 LYS C CA    1 
ATOM   9272  C  C     . LYS C 1 465 ? 71.971  125.741 63.693  1.00 67.61  ? 733 LYS C C     1 
ATOM   9273  O  O     . LYS C 1 465 ? 71.632  125.623 64.876  1.00 67.61  ? 733 LYS C O     1 
ATOM   9274  C  CB    . LYS C 1 465 ? 70.319  127.186 62.505  1.00 67.61  ? 733 LYS C CB    1 
ATOM   9275  C  CG    . LYS C 1 465 ? 69.933  128.574 62.044  1.00 67.61  ? 733 LYS C CG    1 
ATOM   9276  C  CD    . LYS C 1 465 ? 68.468  128.627 61.657  1.00 67.61  ? 733 LYS C CD    1 
ATOM   9277  C  CE    . LYS C 1 465 ? 68.069  130.013 61.188  1.00 67.61  ? 733 LYS C CE    1 
ATOM   9278  N  NZ    . LYS C 1 465 ? 66.629  130.078 60.822  1.00 67.61  ? 733 LYS C NZ    1 
ATOM   9279  N  N     . GLU C 1 466 ? 72.437  124.720 62.961  1.00 68.68  ? 734 GLU C N     1 
ATOM   9280  C  CA    . GLU C 1 466 ? 72.795  123.372 63.413  1.00 68.68  ? 734 GLU C CA    1 
ATOM   9281  C  C     . GLU C 1 466 ? 71.606  122.535 63.879  1.00 68.68  ? 734 GLU C C     1 
ATOM   9282  O  O     . GLU C 1 466 ? 71.767  121.353 64.195  1.00 68.68  ? 734 GLU C O     1 
ATOM   9283  C  CB    . GLU C 1 466 ? 73.858  123.423 64.513  1.00 68.68  ? 734 GLU C CB    1 
ATOM   9284  C  CG    . GLU C 1 466 ? 75.195  123.949 64.050  1.00 68.68  ? 734 GLU C CG    1 
ATOM   9285  C  CD    . GLU C 1 466 ? 76.213  123.995 65.166  1.00 68.68  ? 734 GLU C CD    1 
ATOM   9286  O  OE1   . GLU C 1 466 ? 75.833  123.737 66.327  1.00 68.68  ? 734 GLU C OE1   1 
ATOM   9287  O  OE2   . GLU C 1 466 ? 77.394  124.288 64.885  1.00 68.68  ? 734 GLU C OE2   1 
ATOM   9288  N  N     . VAL C 1 467 ? 70.417  123.134 63.934  1.00 67.44  ? 735 VAL C N     1 
ATOM   9289  C  CA    . VAL C 1 467 ? 69.145  122.441 64.057  1.00 67.44  ? 735 VAL C CA    1 
ATOM   9290  C  C     . VAL C 1 467 ? 68.199  123.107 63.071  1.00 67.44  ? 735 VAL C C     1 
ATOM   9291  O  O     . VAL C 1 467 ? 68.477  124.183 62.544  1.00 67.44  ? 735 VAL C O     1 
ATOM   9292  C  CB    . VAL C 1 467 ? 68.548  122.502 65.479  1.00 67.44  ? 735 VAL C CB    1 
ATOM   9293  C  CG1   . VAL C 1 467 ? 69.439  121.817 66.493  1.00 67.44  ? 735 VAL C CG1   1 
ATOM   9294  C  CG2   . VAL C 1 467 ? 68.298  123.941 65.877  1.00 67.44  ? 735 VAL C CG2   1 
ATOM   9295  N  N     . LEU C 1 468 ? 67.070  122.462 62.819  1.00 67.34  ? 736 LEU C N     1 
ATOM   9296  C  CA    . LEU C 1 468 ? 66.018  123.104 62.051  1.00 67.34  ? 736 LEU C CA    1 
ATOM   9297  C  C     . LEU C 1 468 ? 64.677  122.872 62.717  1.00 67.34  ? 736 LEU C C     1 
ATOM   9298  O  O     . LEU C 1 468 ? 64.381  121.768 63.171  1.00 67.34  ? 736 LEU C O     1 
ATOM   9299  C  CB    . LEU C 1 468 ? 65.956  122.609 60.609  1.00 67.34  ? 736 LEU C CB    1 
ATOM   9300  C  CG    . LEU C 1 468 ? 67.045  123.128 59.684  1.00 67.34  ? 736 LEU C CG    1 
ATOM   9301  C  CD1   . LEU C 1 468 ? 66.902  122.515 58.317  1.00 67.34  ? 736 LEU C CD1   1 
ATOM   9302  C  CD2   . LEU C 1 468 ? 66.961  124.629 59.594  1.00 67.34  ? 736 LEU C CD2   1 
ATOM   9303  N  N     . ASP C 1 469 ? 63.880  123.926 62.784  1.00 73.33  ? 737 ASP C N     1 
ATOM   9304  C  CA    . ASP C 1 469 ? 62.489  123.783 63.153  1.00 73.33  ? 737 ASP C CA    1 
ATOM   9305  C  C     . ASP C 1 469 ? 61.719  123.248 61.951  1.00 73.33  ? 737 ASP C C     1 
ATOM   9306  O  O     . ASP C 1 469 ? 62.207  123.257 60.819  1.00 73.33  ? 737 ASP C O     1 
ATOM   9307  C  CB    . ASP C 1 469 ? 61.930  125.135 63.607  1.00 73.33  ? 737 ASP C CB    1 
ATOM   9308  C  CG    . ASP C 1 469 ? 60.627  125.015 64.374  1.00 73.33  ? 737 ASP C CG    1 
ATOM   9309  O  OD1   . ASP C 1 469 ? 60.159  123.878 64.586  1.00 73.33  ? 737 ASP C OD1   1 
ATOM   9310  O  OD2   . ASP C 1 469 ? 60.065  126.063 64.754  1.00 73.33  ? 737 ASP C OD2   1 
ATOM   9311  N  N     . LYS C 1 470 ? 60.509  122.759 62.205  1.00 71.58  ? 738 LYS C N     1 
ATOM   9312  C  CA    . LYS C 1 470 ? 59.601  122.501 61.098  1.00 71.58  ? 738 LYS C CA    1 
ATOM   9313  C  C     . LYS C 1 470 ? 59.190  123.802 60.422  1.00 71.58  ? 738 LYS C C     1 
ATOM   9314  O  O     . LYS C 1 470 ? 58.993  123.833 59.203  1.00 71.58  ? 738 LYS C O     1 
ATOM   9315  C  CB    . LYS C 1 470 ? 58.378  121.739 61.594  1.00 71.58  ? 738 LYS C CB    1 
ATOM   9316  C  CG    . LYS C 1 470 ? 57.442  121.307 60.494  1.00 71.58  ? 738 LYS C CG    1 
ATOM   9317  C  CD    . LYS C 1 470 ? 56.279  120.522 61.031  1.00 71.58  ? 738 LYS C CD    1 
ATOM   9318  C  CE    . LYS C 1 470 ? 55.347  120.150 59.906  1.00 71.58  ? 738 LYS C CE    1 
ATOM   9319  N  NZ    . LYS C 1 470 ? 54.188  119.357 60.390  1.00 71.58  ? 738 LYS C NZ    1 
ATOM   9320  N  N     . ASN C 1 471 ? 59.093  124.888 61.194  1.00 73.99  ? 739 ASN C N     1 
ATOM   9321  C  CA    . ASN C 1 471 ? 58.780  126.196 60.630  1.00 73.99  ? 739 ASN C CA    1 
ATOM   9322  C  C     . ASN C 1 471 ? 59.909  126.717 59.752  1.00 73.99  ? 739 ASN C C     1 
ATOM   9323  O  O     . ASN C 1 471 ? 59.658  127.486 58.818  1.00 73.99  ? 739 ASN C O     1 
ATOM   9324  C  CB    . ASN C 1 471 ? 58.490  127.183 61.753  1.00 73.99  ? 739 ASN C CB    1 
ATOM   9325  C  CG    . ASN C 1 471 ? 57.241  126.829 62.521  1.00 73.99  ? 739 ASN C CG    1 
ATOM   9326  O  OD1   . ASN C 1 471 ? 56.225  126.459 61.937  1.00 73.99  ? 739 ASN C OD1   1 
ATOM   9327  N  ND2   . ASN C 1 471 ? 57.313  126.925 63.841  1.00 73.99  ? 739 ASN C ND2   1 
ATOM   9328  N  N     . ASP C 1 472 ? 61.150  126.317 60.038  1.00 73.14  ? 740 ASP C N     1 
ATOM   9329  C  CA    . ASP C 1 472 ? 62.272  126.683 59.182  1.00 73.14  ? 740 ASP C CA    1 
ATOM   9330  C  C     . ASP C 1 472 ? 62.175  126.011 57.823  1.00 73.14  ? 740 ASP C C     1 
ATOM   9331  O  O     . ASP C 1 472 ? 62.635  126.567 56.822  1.00 73.14  ? 740 ASP C O     1 
ATOM   9332  C  CB    . ASP C 1 472 ? 63.586  126.305 59.855  1.00 73.14  ? 740 ASP C CB    1 
ATOM   9333  C  CG    . ASP C 1 472 ? 63.843  127.098 61.113  1.00 73.14  ? 740 ASP C CG    1 
ATOM   9334  O  OD1   . ASP C 1 472 ? 63.374  128.251 61.196  1.00 73.14  ? 740 ASP C OD1   1 
ATOM   9335  O  OD2   . ASP C 1 472 ? 64.513  126.567 62.022  1.00 73.14  ? 740 ASP C OD2   1 
ATOM   9336  N  N     . MET C 1 473 ? 61.589  124.817 57.773  1.00 72.08  ? 741 MET C N     1 
ATOM   9337  C  CA    . MET C 1 473 ? 61.362  124.154 56.499  1.00 72.08  ? 741 MET C CA    1 
ATOM   9338  C  C     . MET C 1 473 ? 60.250  124.837 55.721  1.00 72.08  ? 741 MET C C     1 
ATOM   9339  O  O     . MET C 1 473 ? 60.272  124.846 54.487  1.00 72.08  ? 741 MET C O     1 
ATOM   9340  C  CB    . MET C 1 473 ? 61.017  122.690 56.740  1.00 72.08  ? 741 MET C CB    1 
ATOM   9341  C  CG    . MET C 1 473 ? 62.077  121.928 57.507  1.00 72.08  ? 741 MET C CG    1 
ATOM   9342  S  SD    . MET C 1 473 ? 63.656  121.865 56.659  1.00 72.08  ? 741 MET C SD    1 
ATOM   9343  C  CE    . MET C 1 473 ? 63.267  120.756 55.317  1.00 72.08  ? 741 MET C CE    1 
ATOM   9344  N  N     . VAL C 1 474 ? 59.276  125.411 56.428  1.00 73.07  ? 742 VAL C N     1 
ATOM   9345  C  CA    . VAL C 1 474 ? 58.179  126.107 55.770  1.00 73.07  ? 742 VAL C CA    1 
ATOM   9346  C  C     . VAL C 1 474 ? 58.660  127.436 55.202  1.00 73.07  ? 742 VAL C C     1 
ATOM   9347  O  O     . VAL C 1 474 ? 58.277  127.830 54.095  1.00 73.07  ? 742 VAL C O     1 
ATOM   9348  C  CB    . VAL C 1 474 ? 57.014  126.289 56.759  1.00 73.07  ? 742 VAL C CB    1 
ATOM   9349  C  CG1   . VAL C 1 474 ? 55.860  127.041 56.123  1.00 73.07  ? 742 VAL C CG1   1 
ATOM   9350  C  CG2   . VAL C 1 474 ? 56.548  124.943 57.268  1.00 73.07  ? 742 VAL C CG2   1 
ATOM   9351  N  N     . GLU C 1 475 ? 59.532  128.135 55.934  1.00 74.50  ? 743 GLU C N     1 
ATOM   9352  C  CA    . GLU C 1 475 ? 60.074  129.399 55.449  1.00 74.50  ? 743 GLU C CA    1 
ATOM   9353  C  C     . GLU C 1 475 ? 61.022  129.213 54.277  1.00 74.50  ? 743 GLU C C     1 
ATOM   9354  O  O     . GLU C 1 475 ? 61.253  130.163 53.524  1.00 74.50  ? 743 GLU C O     1 
ATOM   9355  C  CB    . GLU C 1 475 ? 60.809  130.122 56.574  1.00 74.50  ? 743 GLU C CB    1 
ATOM   9356  C  CG    . GLU C 1 475 ? 59.917  130.600 57.697  1.00 74.50  ? 743 GLU C CG    1 
ATOM   9357  C  CD    . GLU C 1 475 ? 60.700  131.257 58.814  1.00 74.50  ? 743 GLU C CD    1 
ATOM   9358  O  OE1   . GLU C 1 475 ? 61.947  131.233 58.760  1.00 74.50  ? 743 GLU C OE1   1 
ATOM   9359  O  OE2   . GLU C 1 475 ? 60.070  131.795 59.749  1.00 74.50  ? 743 GLU C OE2   1 
ATOM   9360  N  N     . LEU C 1 476 ? 61.569  128.014 54.106  1.00 71.12  ? 744 LEU C N     1 
ATOM   9361  C  CA    . LEU C 1 476 ? 62.565  127.731 53.087  1.00 71.12  ? 744 LEU C CA    1 
ATOM   9362  C  C     . LEU C 1 476 ? 61.975  127.032 51.871  1.00 71.12  ? 744 LEU C C     1 
ATOM   9363  O  O     . LEU C 1 476 ? 62.209  127.454 50.737  1.00 71.12  ? 744 LEU C O     1 
ATOM   9364  C  CB    . LEU C 1 476 ? 63.673  126.873 53.697  1.00 71.12  ? 744 LEU C CB    1 
ATOM   9365  C  CG    . LEU C 1 476 ? 64.882  126.591 52.824  1.00 71.12  ? 744 LEU C CG    1 
ATOM   9366  C  CD1   . LEU C 1 476 ? 65.608  127.881 52.520  1.00 71.12  ? 744 LEU C CD1   1 
ATOM   9367  C  CD2   . LEU C 1 476 ? 65.776  125.632 53.547  1.00 71.12  ? 744 LEU C CD2   1 
ATOM   9368  N  N     . LEU C 1 477 ? 61.203  125.970 52.087  1.00 69.75  ? 745 LEU C N     1 
ATOM   9369  C  CA    . LEU C 1 477 ? 60.657  125.185 50.992  1.00 69.75  ? 745 LEU C CA    1 
ATOM   9370  C  C     . LEU C 1 477 ? 59.210  125.519 50.671  1.00 69.75  ? 745 LEU C C     1 
ATOM   9371  O  O     . LEU C 1 477 ? 58.764  125.248 49.552  1.00 69.75  ? 745 LEU C O     1 
ATOM   9372  C  CB    . LEU C 1 477 ? 60.755  123.695 51.319  1.00 69.75  ? 745 LEU C CB    1 
ATOM   9373  C  CG    . LEU C 1 477 ? 62.173  123.166 51.489  1.00 69.75  ? 745 LEU C CG    1 
ATOM   9374  C  CD1   . LEU C 1 477 ? 62.145  121.719 51.905  1.00 69.75  ? 745 LEU C CD1   1 
ATOM   9375  C  CD2   . LEU C 1 477 ? 62.946  123.340 50.201  1.00 69.75  ? 745 LEU C CD2   1 
ATOM   9376  N  N     . GLY C 1 478 ? 58.474  126.096 51.612  1.00 70.19  ? 746 GLY C N     1 
ATOM   9377  C  CA    . GLY C 1 478 ? 57.071  126.354 51.419  1.00 70.19  ? 746 GLY C CA    1 
ATOM   9378  C  C     . GLY C 1 478 ? 56.232  125.362 52.192  1.00 70.19  ? 746 GLY C C     1 
ATOM   9379  O  O     . GLY C 1 478 ? 56.748  124.580 52.995  1.00 70.19  ? 746 GLY C O     1 
ATOM   9380  N  N     . PRO C 1 479 ? 54.919  125.391 51.990  1.00 70.31  ? 747 PRO C N     1 
ATOM   9381  C  CA    . PRO C 1 479 ? 54.064  124.377 52.609  1.00 70.31  ? 747 PRO C CA    1 
ATOM   9382  C  C     . PRO C 1 479 ? 54.285  123.023 51.960  1.00 70.31  ? 747 PRO C C     1 
ATOM   9383  O  O     . PRO C 1 479 ? 54.583  122.924 50.768  1.00 70.31  ? 747 PRO C O     1 
ATOM   9384  C  CB    . PRO C 1 479 ? 52.648  124.895 52.340  1.00 70.31  ? 747 PRO C CB    1 
ATOM   9385  C  CG    . PRO C 1 479 ? 52.819  126.353 52.081  1.00 70.31  ? 747 PRO C CG    1 
ATOM   9386  C  CD    . PRO C 1 479 ? 54.132  126.473 51.382  1.00 70.31  ? 747 PRO C CD    1 
ATOM   9387  N  N     . ARG C 1 480 ? 54.157  121.979 52.764  1.00 66.11  ? 748 ARG C N     1 
ATOM   9388  C  CA    . ARG C 1 480 ? 54.331  120.627 52.250  1.00 66.11  ? 748 ARG C CA    1 
ATOM   9389  C  C     . ARG C 1 480 ? 53.146  120.263 51.364  1.00 66.11  ? 748 ARG C C     1 
ATOM   9390  O  O     . ARG C 1 480 ? 51.998  120.369 51.804  1.00 66.11  ? 748 ARG C O     1 
ATOM   9391  C  CB    . ARG C 1 480 ? 54.466  119.635 53.397  1.00 66.11  ? 748 ARG C CB    1 
ATOM   9392  C  CG    . ARG C 1 480 ? 54.736  118.223 52.947  1.00 66.11  ? 748 ARG C CG    1 
ATOM   9393  C  CD    . ARG C 1 480 ? 54.954  117.298 54.115  1.00 66.11  ? 748 ARG C CD    1 
ATOM   9394  N  NE    . ARG C 1 480 ? 55.047  115.912 53.676  1.00 66.11  ? 748 ARG C NE    1 
ATOM   9395  C  CZ    . ARG C 1 480 ? 55.183  114.882 54.498  1.00 66.11  ? 748 ARG C CZ    1 
ATOM   9396  N  NH1   . ARG C 1 480 ? 55.241  115.084 55.802  1.00 66.11  ? 748 ARG C NH1   1 
ATOM   9397  N  NH2   . ARG C 1 480 ? 55.253  113.650 54.019  1.00 66.11  ? 748 ARG C NH2   1 
ATOM   9398  N  N     . PRO C 1 481 ? 53.374  119.827 50.124  1.00 69.59  ? 749 PRO C N     1 
ATOM   9399  C  CA    . PRO C 1 481 ? 52.281  119.717 49.151  1.00 69.59  ? 749 PRO C CA    1 
ATOM   9400  C  C     . PRO C 1 481 ? 51.370  118.513 49.329  1.00 69.59  ? 749 PRO C C     1 
ATOM   9401  O  O     . PRO C 1 481 ? 50.578  118.230 48.427  1.00 69.59  ? 749 PRO C O     1 
ATOM   9402  C  CB    . PRO C 1 481 ? 53.034  119.620 47.817  1.00 69.59  ? 749 PRO C CB    1 
ATOM   9403  C  CG    . PRO C 1 481 ? 54.321  119.006 48.168  1.00 69.59  ? 749 PRO C CG    1 
ATOM   9404  C  CD    . PRO C 1 481 ? 54.681  119.535 49.517  1.00 69.59  ? 749 PRO C CD    1 
ATOM   9405  N  N     . PHE C 1 482 ? 51.444  117.807 50.448  1.00 69.89  ? 750 PHE C N     1 
ATOM   9406  C  CA    . PHE C 1 482 ? 50.671  116.601 50.677  1.00 69.89  ? 750 PHE C CA    1 
ATOM   9407  C  C     . PHE C 1 482 ? 49.778  116.798 51.891  1.00 69.89  ? 750 PHE C C     1 
ATOM   9408  O  O     . PHE C 1 482 ? 50.004  117.687 52.715  1.00 69.89  ? 750 PHE C O     1 
ATOM   9409  C  CB    . PHE C 1 482 ? 51.614  115.412 50.856  1.00 69.89  ? 750 PHE C CB    1 
ATOM   9410  C  CG    . PHE C 1 482 ? 52.343  115.052 49.604  1.00 69.89  ? 750 PHE C CG    1 
ATOM   9411  C  CD1   . PHE C 1 482 ? 51.735  115.219 48.372  1.00 69.89  ? 750 PHE C CD1   1 
ATOM   9412  C  CD2   . PHE C 1 482 ? 53.666  114.663 49.644  1.00 69.89  ? 750 PHE C CD2   1 
ATOM   9413  C  CE1   . PHE C 1 482 ? 52.403  114.924 47.210  1.00 69.89  ? 750 PHE C CE1   1 
ATOM   9414  C  CE2   . PHE C 1 482 ? 54.346  114.380 48.481  1.00 69.89  ? 750 PHE C CE2   1 
ATOM   9415  C  CZ    . PHE C 1 482 ? 53.712  114.506 47.264  1.00 69.89  ? 750 PHE C CZ    1 
ATOM   9416  N  N     . ALA C 1 483 ? 48.751  115.954 51.996  1.00 74.99  ? 751 ALA C N     1 
ATOM   9417  C  CA    . ALA C 1 483 ? 47.727  116.097 53.030  1.00 74.99  ? 751 ALA C CA    1 
ATOM   9418  C  C     . ALA C 1 483 ? 48.320  115.682 54.372  1.00 74.99  ? 751 ALA C C     1 
ATOM   9419  O  O     . ALA C 1 483 ? 48.129  114.569 54.865  1.00 74.99  ? 751 ALA C O     1 
ATOM   9420  C  CB    . ALA C 1 483 ? 46.495  115.271 52.685  1.00 74.99  ? 751 ALA C CB    1 
ATOM   9421  N  N     . GLU C 1 484 ? 49.051  116.609 54.972  1.00 75.70  ? 752 GLU C N     1 
ATOM   9422  C  CA    . GLU C 1 484 ? 49.757  116.357 56.215  1.00 75.70  ? 752 GLU C CA    1 
ATOM   9423  C  C     . GLU C 1 484 ? 48.859  116.676 57.398  1.00 75.70  ? 752 GLU C C     1 
ATOM   9424  O  O     . GLU C 1 484 ? 48.157  117.690 57.405  1.00 75.70  ? 752 GLU C O     1 
ATOM   9425  C  CB    . GLU C 1 484 ? 51.025  117.207 56.278  1.00 75.70  ? 752 GLU C CB    1 
ATOM   9426  C  CG    . GLU C 1 484 ? 51.910  116.928 57.469  1.00 75.70  ? 752 GLU C CG    1 
ATOM   9427  C  CD    . GLU C 1 484 ? 53.138  117.806 57.489  1.00 75.70  ? 752 GLU C CD    1 
ATOM   9428  O  OE1   . GLU C 1 484 ? 53.261  118.682 56.610  1.00 75.70  ? 752 GLU C OE1   1 
ATOM   9429  O  OE2   . GLU C 1 484 ? 53.986  117.616 58.379  1.00 75.70  ? 752 GLU C OE2   1 
ATOM   9430  N  N     . LYS C 1 485 ? 48.881  115.803 58.398  1.00 78.03  ? 753 LYS C N     1 
ATOM   9431  C  CA    . LYS C 1 485 ? 48.149  116.017 59.636  1.00 78.03  ? 753 LYS C CA    1 
ATOM   9432  C  C     . LYS C 1 485 ? 49.110  115.908 60.811  1.00 78.03  ? 753 LYS C C     1 
ATOM   9433  O  O     . LYS C 1 485 ? 49.890  114.956 60.899  1.00 78.03  ? 753 LYS C O     1 
ATOM   9434  C  CB    . LYS C 1 485 ? 46.974  115.034 59.754  1.00 78.03  ? 753 LYS C CB    1 
ATOM   9435  C  CG    . LYS C 1 485 ? 47.320  113.577 59.520  1.00 78.03  ? 753 LYS C CG    1 
ATOM   9436  C  CD    . LYS C 1 485 ? 46.132  112.671 59.768  1.00 78.03  ? 753 LYS C CD    1 
ATOM   9437  C  CE    . LYS C 1 485 ? 45.112  112.779 58.659  1.00 78.03  ? 753 LYS C CE    1 
ATOM   9438  N  NZ    . LYS C 1 485 ? 44.029  111.778 58.834  1.00 78.03  ? 753 LYS C NZ    1 
ATOM   9439  N  N     . SER C 1 486 ? 49.075  116.896 61.686  1.00 75.16  ? 754 SER C N     1 
ATOM   9440  C  CA    . SER C 1 486 ? 50.073  117.002 62.742  1.00 75.16  ? 754 SER C CA    1 
ATOM   9441  C  C     . SER C 1 486 ? 49.482  117.167 64.132  1.00 75.16  ? 754 SER C C     1 
ATOM   9442  O  O     . SER C 1 486 ? 50.015  116.596 65.084  1.00 75.16  ? 754 SER C O     1 
ATOM   9443  C  CB    . SER C 1 486 ? 51.002  118.179 62.434  1.00 75.16  ? 754 SER C CB    1 
ATOM   9444  O  OG    . SER C 1 486 ? 50.287  119.401 62.458  1.00 75.16  ? 754 SER C OG    1 
ATOM   9445  N  N     . THR C 1 487 ? 48.398  117.923 64.278  1.00 74.55  ? 755 THR C N     1 
ATOM   9446  C  CA    . THR C 1 487 ? 47.892  118.207 65.610  1.00 74.55  ? 755 THR C CA    1 
ATOM   9447  C  C     . THR C 1 487 ? 47.039  117.045 66.109  1.00 74.55  ? 755 THR C C     1 
ATOM   9448  O  O     . THR C 1 487 ? 46.838  116.040 65.423  1.00 74.55  ? 755 THR C O     1 
ATOM   9449  C  CB    . THR C 1 487 ? 47.097  119.511 65.625  1.00 74.55  ? 755 THR C CB    1 
ATOM   9450  O  OG1   . THR C 1 487 ? 45.903  119.365 64.853  1.00 74.55  ? 755 THR C OG1   1 
ATOM   9451  C  CG2   . THR C 1 487 ? 47.920  120.636 65.035  1.00 74.55  ? 755 THR C CG2   1 
ATOM   9452  N  N     . TYR C 1 488 ? 46.538  117.186 67.334  1.00 69.24  ? 756 TYR C N     1 
ATOM   9453  C  CA    . TYR C 1 488 ? 45.711  116.143 67.930  1.00 69.24  ? 756 TYR C CA    1 
ATOM   9454  C  C     . TYR C 1 488 ? 44.331  116.106 67.301  1.00 69.24  ? 756 TYR C C     1 
ATOM   9455  O  O     . TYR C 1 488 ? 43.798  115.027 67.025  1.00 69.24  ? 756 TYR C O     1 
ATOM   9456  C  CB    . TYR C 1 488 ? 45.594  116.381 69.427  1.00 69.24  ? 756 TYR C CB    1 
ATOM   9457  C  CG    . TYR C 1 488 ? 44.766  115.376 70.174  1.00 69.24  ? 756 TYR C CG    1 
ATOM   9458  C  CD1   . TYR C 1 488 ? 45.293  114.155 70.547  1.00 69.24  ? 756 TYR C CD1   1 
ATOM   9459  C  CD2   . TYR C 1 488 ? 43.458  115.660 70.525  1.00 69.24  ? 756 TYR C CD2   1 
ATOM   9460  C  CE1   . TYR C 1 488 ? 44.541  113.246 71.249  1.00 69.24  ? 756 TYR C CE1   1 
ATOM   9461  C  CE2   . TYR C 1 488 ? 42.696  114.755 71.218  1.00 69.24  ? 756 TYR C CE2   1 
ATOM   9462  C  CZ    . TYR C 1 488 ? 43.243  113.552 71.576  1.00 69.24  ? 756 TYR C CZ    1 
ATOM   9463  O  OH    . TYR C 1 488 ? 42.485  112.645 72.271  1.00 69.24  ? 756 TYR C OH    1 
ATOM   9464  N  N     . GLU C 1 489 ? 43.739  117.275 67.069  1.00 75.27  ? 757 GLU C N     1 
ATOM   9465  C  CA    . GLU C 1 489 ? 42.373  117.340 66.574  1.00 75.27  ? 757 GLU C CA    1 
ATOM   9466  C  C     . GLU C 1 489 ? 42.253  116.883 65.129  1.00 75.27  ? 757 GLU C C     1 
ATOM   9467  O  O     . GLU C 1 489 ? 41.143  116.577 64.685  1.00 75.27  ? 757 GLU C O     1 
ATOM   9468  C  CB    . GLU C 1 489 ? 41.828  118.761 66.718  1.00 75.27  ? 757 GLU C CB    1 
ATOM   9469  C  CG    . GLU C 1 489 ? 41.572  119.192 68.156  1.00 75.27  ? 757 GLU C CG    1 
ATOM   9470  C  CD    . GLU C 1 489 ? 42.809  119.731 68.850  1.00 75.27  ? 757 GLU C CD    1 
ATOM   9471  O  OE1   . GLU C 1 489 ? 43.863  119.844 68.192  1.00 75.27  ? 757 GLU C OE1   1 
ATOM   9472  O  OE2   . GLU C 1 489 ? 42.729  120.037 70.058  1.00 75.27  ? 757 GLU C OE2   1 
ATOM   9473  N  N     . GLU C 1 490 ? 43.356  116.823 64.388  1.00 77.99  ? 758 GLU C N     1 
ATOM   9474  C  CA    . GLU C 1 490 ? 43.330  116.278 63.042  1.00 77.99  ? 758 GLU C CA    1 
ATOM   9475  C  C     . GLU C 1 490 ? 43.867  114.857 62.974  1.00 77.99  ? 758 GLU C C     1 
ATOM   9476  O  O     . GLU C 1 490 ? 43.848  114.254 61.897  1.00 77.99  ? 758 GLU C O     1 
ATOM   9477  C  CB    . GLU C 1 490 ? 44.092  117.195 62.083  1.00 77.99  ? 758 GLU C CB    1 
ATOM   9478  C  CG    . GLU C 1 490 ? 45.567  117.328 62.349  1.00 77.99  ? 758 GLU C CG    1 
ATOM   9479  C  CD    . GLU C 1 490 ? 46.203  118.397 61.483  1.00 77.99  ? 758 GLU C CD    1 
ATOM   9480  O  OE1   . GLU C 1 490 ? 45.481  119.016 60.675  1.00 77.99  ? 758 GLU C OE1   1 
ATOM   9481  O  OE2   . GLU C 1 490 ? 47.420  118.632 61.616  1.00 77.99  ? 758 GLU C OE2   1 
ATOM   9482  N  N     . PHE C 1 491 ? 44.340  114.310 64.091  1.00 74.87  ? 759 PHE C N     1 
ATOM   9483  C  CA    . PHE C 1 491 ? 44.551  112.875 64.209  1.00 74.87  ? 759 PHE C CA    1 
ATOM   9484  C  C     . PHE C 1 491 ? 43.308  112.129 64.661  1.00 74.87  ? 759 PHE C C     1 
ATOM   9485  O  O     . PHE C 1 491 ? 43.188  110.932 64.387  1.00 74.87  ? 759 PHE C O     1 
ATOM   9486  C  CB    . PHE C 1 491 ? 45.686  112.574 65.191  1.00 74.87  ? 759 PHE C CB    1 
ATOM   9487  C  CG    . PHE C 1 491 ? 47.061  112.684 64.599  1.00 74.87  ? 759 PHE C CG    1 
ATOM   9488  C  CD1   . PHE C 1 491 ? 47.252  112.623 63.237  1.00 74.87  ? 759 PHE C CD1   1 
ATOM   9489  C  CD2   . PHE C 1 491 ? 48.167  112.844 65.414  1.00 74.87  ? 759 PHE C CD2   1 
ATOM   9490  C  CE1   . PHE C 1 491 ? 48.519  112.710 62.707  1.00 74.87  ? 759 PHE C CE1   1 
ATOM   9491  C  CE2   . PHE C 1 491 ? 49.434  112.936 64.886  1.00 74.87  ? 759 PHE C CE2   1 
ATOM   9492  C  CZ    . PHE C 1 491 ? 49.608  112.874 63.529  1.00 74.87  ? 759 PHE C CZ    1 
ATOM   9493  N  N     . VAL C 1 492 ? 42.389  112.800 65.353  1.00 78.31  ? 760 VAL C N     1 
ATOM   9494  C  CA    . VAL C 1 492 ? 41.243  112.151 65.980  1.00 78.31  ? 760 VAL C CA    1 
ATOM   9495  C  C     . VAL C 1 492 ? 39.999  112.710 65.284  1.00 78.31  ? 760 VAL C C     1 
ATOM   9496  O  O     . VAL C 1 492 ? 38.962  112.975 65.901  1.00 78.31  ? 760 VAL C O     1 
ATOM   9497  C  CB    . VAL C 1 492 ? 41.261  112.364 67.512  1.00 78.31  ? 760 VAL C CB    1 
ATOM   9498  C  CG1   . VAL C 1 492 ? 40.297  111.443 68.248  1.00 78.31  ? 760 VAL C CG1   1 
ATOM   9499  C  CG2   . VAL C 1 492 ? 42.642  112.113 68.073  1.00 78.31  ? 760 VAL C CG2   1 
ATOM   9500  N  N     . GLU C 1 493 ? 40.110  112.959 63.980  1.00 85.74  ? 761 GLU C N     1 
ATOM   9501  C  CA    . GLU C 1 493 ? 38.929  113.376 63.230  1.00 85.74  ? 761 GLU C CA    1 
ATOM   9502  C  C     . GLU C 1 493 ? 37.936  112.238 63.046  1.00 85.74  ? 761 GLU C C     1 
ATOM   9503  O  O     . GLU C 1 493 ? 36.724  112.478 63.018  1.00 85.74  ? 761 GLU C O     1 
ATOM   9504  C  CB    . GLU C 1 493 ? 39.318  113.924 61.859  1.00 85.74  ? 761 GLU C CB    1 
ATOM   9505  C  CG    . GLU C 1 493 ? 39.950  115.294 61.874  1.00 85.74  ? 761 GLU C CG    1 
ATOM   9506  C  CD    . GLU C 1 493 ? 40.344  115.763 60.484  1.00 85.74  ? 761 GLU C CD    1 
ATOM   9507  O  OE1   . GLU C 1 493 ? 40.237  114.961 59.533  1.00 85.74  ? 761 GLU C OE1   1 
ATOM   9508  O  OE2   . GLU C 1 493 ? 40.761  116.931 60.342  1.00 85.74  ? 761 GLU C OE2   1 
ATOM   9509  N  N     . GLY C 1 494 ? 38.423  111.002 62.929  1.00 90.57  ? 762 GLY C N     1 
ATOM   9510  C  CA    . GLY C 1 494 ? 37.575  109.925 62.442  1.00 90.57  ? 762 GLY C CA    1 
ATOM   9511  C  C     . GLY C 1 494 ? 36.592  109.407 63.473  1.00 90.57  ? 762 GLY C C     1 
ATOM   9512  O  O     . GLY C 1 494 ? 35.433  109.133 63.150  1.00 90.57  ? 762 GLY C O     1 
ATOM   9513  N  N     . THR C 1 495 ? 37.033  109.262 64.722  1.00 89.77  ? 763 THR C N     1 
ATOM   9514  C  CA    . THR C 1 495 ? 36.156  108.715 65.747  1.00 89.77  ? 763 THR C CA    1 
ATOM   9515  C  C     . THR C 1 495 ? 35.099  109.707 66.201  1.00 89.77  ? 763 THR C C     1 
ATOM   9516  O  O     . THR C 1 495 ? 34.071  109.290 66.742  1.00 89.77  ? 763 THR C O     1 
ATOM   9517  C  CB    . THR C 1 495 ? 36.977  108.244 66.941  1.00 89.77  ? 763 THR C CB    1 
ATOM   9518  O  OG1   . THR C 1 495 ? 37.719  109.344 67.477  1.00 89.77  ? 763 THR C OG1   1 
ATOM   9519  C  CG2   . THR C 1 495 ? 37.929  107.167 66.510  1.00 89.77  ? 763 THR C CG2   1 
ATOM   9520  N  N     . GLY C 1 496 ? 35.331  111.002 66.004  1.00 94.19  ? 764 GLY C N     1 
ATOM   9521  C  CA    . GLY C 1 496 ? 34.324  112.007 66.276  1.00 94.19  ? 764 GLY C CA    1 
ATOM   9522  C  C     . GLY C 1 496 ? 34.009  112.255 67.732  1.00 94.19  ? 764 GLY C C     1 
ATOM   9523  O  O     . GLY C 1 496 ? 33.047  112.969 68.025  1.00 94.19  ? 764 GLY C O     1 
ATOM   9524  N  N     . SER C 1 497 ? 34.786  111.693 68.659  1.00 91.05  ? 765 SER C N     1 
ATOM   9525  C  CA    . SER C 1 497 ? 34.522  111.861 70.078  1.00 91.05  ? 765 SER C CA    1 
ATOM   9526  C  C     . SER C 1 497 ? 35.497  112.792 70.780  1.00 91.05  ? 765 SER C C     1 
ATOM   9527  O  O     . SER C 1 497 ? 35.175  113.267 71.875  1.00 91.05  ? 765 SER C O     1 
ATOM   9528  C  CB    . SER C 1 497 ? 34.537  110.501 70.788  1.00 91.05  ? 765 SER C CB    1 
ATOM   9529  O  OG    . SER C 1 497 ? 35.831  109.934 70.752  1.00 91.05  ? 765 SER C OG    1 
ATOM   9530  N  N     . LEU C 1 498 ? 36.706  112.980 70.227  1.00 87.89  ? 766 LEU C N     1 
ATOM   9531  C  CA    . LEU C 1 498 ? 37.696  114.001 70.588  1.00 87.89  ? 766 LEU C CA    1 
ATOM   9532  C  C     . LEU C 1 498 ? 38.369  113.747 71.942  1.00 87.89  ? 766 LEU C C     1 
ATOM   9533  O  O     . LEU C 1 498 ? 39.356  114.405 72.281  1.00 87.89  ? 766 LEU C O     1 
ATOM   9534  C  CB    . LEU C 1 498 ? 37.054  115.403 70.526  1.00 87.89  ? 766 LEU C CB    1 
ATOM   9535  C  CG    . LEU C 1 498 ? 37.800  116.728 70.728  1.00 87.89  ? 766 LEU C CG    1 
ATOM   9536  C  CD1   . LEU C 1 498 ? 38.887  116.896 69.691  1.00 87.89  ? 766 LEU C CD1   1 
ATOM   9537  C  CD2   . LEU C 1 498 ? 36.835  117.897 70.684  1.00 87.89  ? 766 LEU C CD2   1 
ATOM   9538  N  N     . ASP C 1 499 ? 37.910  112.751 72.693  1.00 87.30  ? 767 ASP C N     1 
ATOM   9539  C  CA    . ASP C 1 499 ? 38.488  112.474 73.997  1.00 87.30  ? 767 ASP C CA    1 
ATOM   9540  C  C     . ASP C 1 499 ? 38.188  111.028 74.359  1.00 87.30  ? 767 ASP C C     1 
ATOM   9541  O  O     . ASP C 1 499 ? 37.179  110.466 73.928  1.00 87.30  ? 767 ASP C O     1 
ATOM   9542  C  CB    . ASP C 1 499 ? 37.932  113.422 75.065  1.00 87.30  ? 767 ASP C CB    1 
ATOM   9543  C  CG    . ASP C 1 499 ? 38.757  113.425 76.335  1.00 87.30  ? 767 ASP C CG    1 
ATOM   9544  O  OD1   . ASP C 1 499 ? 39.777  112.706 76.396  1.00 87.30  ? 767 ASP C OD1   1 
ATOM   9545  O  OD2   . ASP C 1 499 ? 38.381  114.152 77.278  1.00 87.30  ? 767 ASP C OD2   1 
ATOM   9546  N  N     . GLU C 1 500 ? 39.086  110.432 75.140  1.00 84.53  ? 768 GLU C N     1 
ATOM   9547  C  CA    . GLU C 1 500 ? 38.865  109.088 75.660  1.00 84.53  ? 768 GLU C CA    1 
ATOM   9548  C  C     . GLU C 1 500 ? 37.715  109.128 76.653  1.00 84.53  ? 768 GLU C C     1 
ATOM   9549  O  O     . GLU C 1 500 ? 37.848  109.684 77.747  1.00 84.53  ? 768 GLU C O     1 
ATOM   9550  C  CB    . GLU C 1 500 ? 40.125  108.545 76.321  1.00 84.53  ? 768 GLU C CB    1 
ATOM   9551  C  CG    . GLU C 1 500 ? 39.948  107.142 76.874  1.00 84.53  ? 768 GLU C CG    1 
ATOM   9552  C  CD    . GLU C 1 500 ? 41.194  106.612 77.532  1.00 84.53  ? 768 GLU C CD    1 
ATOM   9553  O  OE1   . GLU C 1 500 ? 42.205  107.336 77.552  1.00 84.53  ? 768 GLU C OE1   1 
ATOM   9554  O  OE2   . GLU C 1 500 ? 41.161  105.474 78.042  1.00 84.53  ? 768 GLU C OE2   1 
ATOM   9555  N  N     . ASP C 1 501 ? 36.582  108.550 76.270  1.00 94.02  ? 769 ASP C N     1 
ATOM   9556  C  CA    . ASP C 1 501 ? 35.394  108.584 77.113  1.00 94.02  ? 769 ASP C CA    1 
ATOM   9557  C  C     . ASP C 1 501 ? 35.537  107.606 78.274  1.00 94.02  ? 769 ASP C C     1 
ATOM   9558  O  O     . ASP C 1 501 ? 35.541  106.386 78.087  1.00 94.02  ? 769 ASP C O     1 
ATOM   9559  C  CB    . ASP C 1 501 ? 34.152  108.299 76.272  1.00 94.02  ? 769 ASP C CB    1 
ATOM   9560  C  CG    . ASP C 1 501 ? 34.329  107.116 75.342  1.00 94.02  ? 769 ASP C CG    1 
ATOM   9561  O  OD1   . ASP C 1 501 ? 35.461  106.600 75.239  1.00 94.02  ? 769 ASP C OD1   1 
ATOM   9562  O  OD2   . ASP C 1 501 ? 33.335  106.704 74.712  1.00 94.02  ? 769 ASP C OD2   1 
ATOM   9563  N  N     . THR C 1 502 ? 35.667  108.145 79.480  1.00 95.07  ? 770 THR C N     1 
ATOM   9564  C  CA    . THR C 1 502 ? 35.701  107.327 80.687  1.00 95.07  ? 770 THR C CA    1 
ATOM   9565  C  C     . THR C 1 502 ? 34.307  107.180 81.283  1.00 95.07  ? 770 THR C C     1 
ATOM   9566  O  O     . THR C 1 502 ? 34.089  107.401 82.471  1.00 95.07  ? 770 THR C O     1 
ATOM   9567  C  CB    . THR C 1 502 ? 36.664  107.938 81.696  1.00 95.07  ? 770 THR C CB    1 
ATOM   9568  O  OG1   . THR C 1 502 ? 36.168  109.216 82.110  1.00 95.07  ? 770 THR C OG1   1 
ATOM   9569  C  CG2   . THR C 1 502 ? 38.029  108.128 81.065  1.00 95.07  ? 770 THR C CG2   1 
ATOM   9570  N  N     . SER C 1 503 ? 33.347  106.798 80.447  1.00 99.14  ? 771 SER C N     1 
ATOM   9571  C  CA    . SER C 1 503 ? 31.966  106.640 80.872  1.00 99.14  ? 771 SER C CA    1 
ATOM   9572  C  C     . SER C 1 503 ? 31.763  105.253 81.464  1.00 99.14  ? 771 SER C C     1 
ATOM   9573  O  O     . SER C 1 503 ? 32.255  104.257 80.928  1.00 99.14  ? 771 SER C O     1 
ATOM   9574  C  CB    . SER C 1 503 ? 31.014  106.860 79.697  1.00 99.14  ? 771 SER C CB    1 
ATOM   9575  O  OG    . SER C 1 503 ? 29.666  106.694 80.096  1.00 99.14  ? 771 SER C OG    1 
ATOM   9576  N  N     . LEU C 1 504 ? 31.059  105.198 82.539  1.00 94.43  ? 772 LEU C N     1 
ATOM   9577  C  CA    . LEU C 1 504 ? 30.909  103.925 83.213  1.00 94.43  ? 772 LEU C CA    1 
ATOM   9578  C  C     . LEU C 1 504 ? 29.559  103.295 82.896  1.00 94.43  ? 772 LEU C C     1 
ATOM   9579  O  O     . LEU C 1 504 ? 28.579  104.003 82.650  1.00 94.43  ? 772 LEU C O     1 
ATOM   9580  C  CB    . LEU C 1 504 ? 31.039  104.110 84.725  1.00 94.43  ? 772 LEU C CB    1 
ATOM   9581  C  CG    . LEU C 1 504 ? 32.422  104.542 85.194  1.00 94.43  ? 772 LEU C CG    1 
ATOM   9582  C  CD1   . LEU C 1 504 ? 32.411  104.868 86.671  1.00 94.43  ? 772 LEU C CD1   1 
ATOM   9583  C  CD2   . LEU C 1 504 ? 33.422  103.448 84.902  1.00 94.43  ? 772 LEU C CD2   1 
ATOM   9584  N  N     . PRO C 1 505 ? 29.482  101.967 82.885  1.00 92.59  ? 773 PRO C N     1 
ATOM   9585  C  CA    . PRO C 1 505 ? 28.184  101.298 82.772  1.00 92.59  ? 773 PRO C CA    1 
ATOM   9586  C  C     . PRO C 1 505 ? 27.356  101.492 84.033  1.00 92.59  ? 773 PRO C C     1 
ATOM   9587  O  O     . PRO C 1 505 ? 27.847  101.921 85.078  1.00 92.59  ? 773 PRO C O     1 
ATOM   9588  C  CB    . PRO C 1 505 ? 28.559  99.829  82.574  1.00 92.59  ? 773 PRO C CB    1 
ATOM   9589  C  CG    . PRO C 1 505 ? 29.941  99.864  82.047  1.00 92.59  ? 773 PRO C CG    1 
ATOM   9590  C  CD    . PRO C 1 505 ? 30.591  101.016 82.732  1.00 92.59  ? 773 PRO C CD    1 
ATOM   9591  N  N     . GLU C 1 506 ? 26.072  101.146 83.920  1.00 91.54  ? 774 GLU C N     1 
ATOM   9592  C  CA    . GLU C 1 506 ? 25.115  101.455 84.977  1.00 91.54  ? 774 GLU C CA    1 
ATOM   9593  C  C     . GLU C 1 506 ? 25.345  100.619 86.226  1.00 91.54  ? 774 GLU C C     1 
ATOM   9594  O  O     . GLU C 1 506 ? 25.017  101.061 87.331  1.00 91.54  ? 774 GLU C O     1 
ATOM   9595  C  CB    . GLU C 1 506 ? 23.690  101.260 84.464  1.00 91.54  ? 774 GLU C CB    1 
ATOM   9596  C  CG    . GLU C 1 506 ? 23.238  102.303 83.450  1.00 91.54  ? 774 GLU C CG    1 
ATOM   9597  C  CD    . GLU C 1 506 ? 23.671  101.988 82.031  1.00 91.54  ? 774 GLU C CD    1 
ATOM   9598  O  OE1   . GLU C 1 506 ? 24.287  100.925 81.812  1.00 91.54  ? 774 GLU C OE1   1 
ATOM   9599  O  OE2   . GLU C 1 506 ? 23.396  102.808 81.132  1.00 91.54  ? 774 GLU C OE2   1 
ATOM   9600  N  N     . GLY C 1 507 ? 25.914  99.434  86.082  1.00 90.69  ? 775 GLY C N     1 
ATOM   9601  C  CA    . GLY C 1 507 ? 26.257  98.655  87.248  1.00 90.69  ? 775 GLY C CA    1 
ATOM   9602  C  C     . GLY C 1 507 ? 27.586  98.992  87.864  1.00 90.69  ? 775 GLY C C     1 
ATOM   9603  O  O     . GLY C 1 507 ? 27.976  98.372  88.855  1.00 90.69  ? 775 GLY C O     1 
ATOM   9604  N  N     . LEU C 1 508 ? 28.298  99.966  87.306  1.00 92.91  ? 776 LEU C N     1 
ATOM   9605  C  CA    . LEU C 1 508 ? 29.629  100.338 87.765  1.00 92.91  ? 776 LEU C CA    1 
ATOM   9606  C  C     . LEU C 1 508 ? 29.680  101.796 88.206  1.00 92.91  ? 776 LEU C C     1 
ATOM   9607  O  O     . LEU C 1 508 ? 30.736  102.424 88.165  1.00 92.91  ? 776 LEU C O     1 
ATOM   9608  C  CB    . LEU C 1 508 ? 30.672  100.083 86.677  1.00 92.91  ? 776 LEU C CB    1 
ATOM   9609  C  CG    . LEU C 1 508 ? 31.360  98.722  86.534  1.00 92.91  ? 776 LEU C CG    1 
ATOM   9610  C  CD1   . LEU C 1 508 ? 32.157  98.397  87.782  1.00 92.91  ? 776 LEU C CD1   1 
ATOM   9611  C  CD2   . LEU C 1 508 ? 30.405  97.590  86.190  1.00 92.91  ? 776 LEU C CD2   1 
ATOM   9612  N  N     . LYS C 1 509 ? 28.552  102.345 88.645  1.00 94.32  ? 777 LYS C N     1 
ATOM   9613  C  CA    . LYS C 1 509 ? 28.456  103.763 88.983  1.00 94.32  ? 777 LYS C CA    1 
ATOM   9614  C  C     . LYS C 1 509 ? 28.627  104.011 90.471  1.00 94.32  ? 777 LYS C C     1 
ATOM   9615  O  O     . LYS C 1 509 ? 27.952  104.862 91.053  1.00 94.32  ? 777 LYS C O     1 
ATOM   9616  C  CB    . LYS C 1 509 ? 27.138  104.345 88.490  1.00 94.32  ? 777 LYS C CB    1 
ATOM   9617  C  CG    . LYS C 1 509 ? 27.081  104.513 86.990  1.00 94.32  ? 777 LYS C CG    1 
ATOM   9618  C  CD    . LYS C 1 509 ? 25.771  105.133 86.549  1.00 94.32  ? 777 LYS C CD    1 
ATOM   9619  C  CE    . LYS C 1 509 ? 25.720  105.278 85.037  1.00 94.32  ? 777 LYS C CE    1 
ATOM   9620  N  NZ    . LYS C 1 509 ? 24.433  105.864 84.581  1.00 94.32  ? 777 LYS C NZ    1 
ATOM   9621  N  N     . ASP C 1 510 ? 29.513  103.259 91.113  1.00 96.41  ? 778 ASP C N     1 
ATOM   9622  C  CA    . ASP C 1 510 ? 29.919  103.523 92.483  1.00 96.41  ? 778 ASP C CA    1 
ATOM   9623  C  C     . ASP C 1 510 ? 31.259  104.240 92.552  1.00 96.41  ? 778 ASP C C     1 
ATOM   9624  O  O     . ASP C 1 510 ? 31.865  104.308 93.626  1.00 96.41  ? 778 ASP C O     1 
ATOM   9625  C  CB    . ASP C 1 510 ? 29.977  102.215 93.265  1.00 96.41  ? 778 ASP C CB    1 
ATOM   9626  C  CG    . ASP C 1 510 ? 28.628  101.553 93.368  1.00 96.41  ? 778 ASP C CG    1 
ATOM   9627  O  OD1   . ASP C 1 510 ? 27.613  102.279 93.363  1.00 96.41  ? 778 ASP C OD1   1 
ATOM   9628  O  OD2   . ASP C 1 510 ? 28.579  100.310 93.437  1.00 96.41  ? 778 ASP C OD2   1 
ATOM   9629  N  N     . TRP C 1 511 ? 31.734  104.765 91.426  1.00 93.43  ? 779 TRP C N     1 
ATOM   9630  C  CA    . TRP C 1 511 ? 33.028  105.428 91.343  1.00 93.43  ? 779 TRP C CA    1 
ATOM   9631  C  C     . TRP C 1 511 ? 32.888  106.797 90.693  1.00 93.43  ? 779 TRP C C     1 
ATOM   9632  O  O     . TRP C 1 511 ? 33.613  107.734 91.023  1.00 93.43  ? 779 TRP C O     1 
ATOM   9633  C  CB    . TRP C 1 511 ? 34.018  104.567 90.554  1.00 93.43  ? 779 TRP C CB    1 
ATOM   9634  C  CG    . TRP C 1 511 ? 34.455  103.341 91.286  1.00 93.43  ? 779 TRP C CG    1 
ATOM   9635  C  CD1   . TRP C 1 511 ? 35.572  103.202 92.051  1.00 93.43  ? 779 TRP C CD1   1 
ATOM   9636  C  CD2   . TRP C 1 511 ? 33.764  102.091 91.355  1.00 93.43  ? 779 TRP C CD2   1 
ATOM   9637  N  NE1   . TRP C 1 511 ? 35.631  101.938 92.574  1.00 93.43  ? 779 TRP C NE1   1 
ATOM   9638  C  CE2   . TRP C 1 511 ? 34.532  101.236 92.161  1.00 93.43  ? 779 TRP C CE2   1 
ATOM   9639  C  CE3   . TRP C 1 511 ? 32.579  101.608 90.800  1.00 93.43  ? 779 TRP C CE3   1 
ATOM   9640  C  CZ2   . TRP C 1 511 ? 34.151  99.932  92.434  1.00 93.43  ? 779 TRP C CZ2   1 
ATOM   9641  C  CZ3   . TRP C 1 511 ? 32.201  100.314 91.075  1.00 93.43  ? 779 TRP C CZ3   1 
ATOM   9642  C  CH2   . TRP C 1 511 ? 32.985  99.489  91.883  1.00 93.43  ? 779 TRP C CH2   1 
ATOM   9643  N  N     . PHE D 1 21  ? 69.362  78.410  103.316 1.00 113.40 ? 289 PHE D N     1 
ATOM   9644  C  CA    . PHE D 1 21  ? 69.678  78.871  104.662 1.00 113.40 ? 289 PHE D CA    1 
ATOM   9645  C  C     . PHE D 1 21  ? 70.982  79.655  104.679 1.00 113.40 ? 289 PHE D C     1 
ATOM   9646  O  O     . PHE D 1 21  ? 70.980  80.876  104.834 1.00 113.40 ? 289 PHE D O     1 
ATOM   9647  C  CB    . PHE D 1 21  ? 69.768  77.688  105.629 1.00 113.40 ? 289 PHE D CB    1 
ATOM   9648  C  CG    . PHE D 1 21  ? 70.057  78.087  107.049 1.00 113.40 ? 289 PHE D CG    1 
ATOM   9649  C  CD1   . PHE D 1 21  ? 69.062  78.635  107.843 1.00 113.40 ? 289 PHE D CD1   1 
ATOM   9650  C  CD2   . PHE D 1 21  ? 71.324  77.914  107.590 1.00 113.40 ? 289 PHE D CD2   1 
ATOM   9651  C  CE1   . PHE D 1 21  ? 69.324  79.006  109.151 1.00 113.40 ? 289 PHE D CE1   1 
ATOM   9652  C  CE2   . PHE D 1 21  ? 71.594  78.283  108.895 1.00 113.40 ? 289 PHE D CE2   1 
ATOM   9653  C  CZ    . PHE D 1 21  ? 70.592  78.829  109.677 1.00 113.40 ? 289 PHE D CZ    1 
ATOM   9654  N  N     . SER D 1 22  ? 72.095  78.935  104.531 1.00 110.27 ? 290 SER D N     1 
ATOM   9655  C  CA    . SER D 1 22  ? 73.407  79.572  104.557 1.00 110.27 ? 290 SER D CA    1 
ATOM   9656  C  C     . SER D 1 22  ? 73.628  80.418  103.309 1.00 110.27 ? 290 SER D C     1 
ATOM   9657  O  O     . SER D 1 22  ? 73.933  81.611  103.399 1.00 110.27 ? 290 SER D O     1 
ATOM   9658  C  CB    . SER D 1 22  ? 74.498  78.509  104.696 1.00 110.27 ? 290 SER D CB    1 
ATOM   9659  O  OG    . SER D 1 22  ? 75.789  79.091  104.686 1.00 110.27 ? 290 SER D OG    1 
ATOM   9660  N  N     . VAL D 1 23  ? 73.477  79.812  102.134 1.00 101.14 ? 291 VAL D N     1 
ATOM   9661  C  CA    . VAL D 1 23  ? 73.547  80.551  100.883 1.00 101.14 ? 291 VAL D CA    1 
ATOM   9662  C  C     . VAL D 1 23  ? 72.295  81.405  100.739 1.00 101.14 ? 291 VAL D C     1 
ATOM   9663  O  O     . VAL D 1 23  ? 71.179  80.952  101.025 1.00 101.14 ? 291 VAL D O     1 
ATOM   9664  C  CB    . VAL D 1 23  ? 73.706  79.563  99.714  1.00 101.14 ? 291 VAL D CB    1 
ATOM   9665  C  CG1   . VAL D 1 23  ? 73.705  80.268  98.374  1.00 101.14 ? 291 VAL D CG1   1 
ATOM   9666  C  CG2   . VAL D 1 23  ? 74.976  78.750  99.881  1.00 101.14 ? 291 VAL D CG2   1 
ATOM   9667  N  N     . GLY D 1 24  ? 72.466  82.652  100.312 1.00 91.69  ? 292 GLY D N     1 
ATOM   9668  C  CA    . GLY D 1 24  ? 71.301  83.469  100.051 1.00 91.69  ? 292 GLY D CA    1 
ATOM   9669  C  C     . GLY D 1 24  ? 71.437  84.944  100.357 1.00 91.69  ? 292 GLY D C     1 
ATOM   9670  O  O     . GLY D 1 24  ? 70.644  85.742  99.853  1.00 91.69  ? 292 GLY D O     1 
ATOM   9671  N  N     . GLU D 1 25  ? 72.417  85.330  101.171 1.00 92.18  ? 293 GLU D N     1 
ATOM   9672  C  CA    . GLU D 1 25  ? 72.617  86.748  101.426 1.00 92.18  ? 293 GLU D CA    1 
ATOM   9673  C  C     . GLU D 1 25  ? 73.215  87.427  100.199 1.00 92.18  ? 293 GLU D C     1 
ATOM   9674  O  O     . GLU D 1 25  ? 73.827  86.793  99.338  1.00 92.18  ? 293 GLU D O     1 
ATOM   9675  C  CB    . GLU D 1 25  ? 73.518  86.973  102.641 1.00 92.18  ? 293 GLU D CB    1 
ATOM   9676  C  CG    . GLU D 1 25  ? 72.898  86.576  103.972 1.00 92.18  ? 293 GLU D CG    1 
ATOM   9677  C  CD    . GLU D 1 25  ? 73.143  85.123  104.313 1.00 92.18  ? 293 GLU D CD    1 
ATOM   9678  O  OE1   . GLU D 1 25  ? 73.873  84.459  103.550 1.00 92.18  ? 293 GLU D OE1   1 
ATOM   9679  O  OE2   . GLU D 1 25  ? 72.612  84.645  105.338 1.00 92.18  ? 293 GLU D OE2   1 
ATOM   9680  N  N     . THR D 1 26  ? 73.035  88.743  100.136 1.00 83.12  ? 294 THR D N     1 
ATOM   9681  C  CA    . THR D 1 26  ? 73.282  89.493  98.913  1.00 83.12  ? 294 THR D CA    1 
ATOM   9682  C  C     . THR D 1 26  ? 74.754  89.696  98.597  1.00 83.12  ? 294 THR D C     1 
ATOM   9683  O  O     . THR D 1 26  ? 75.055  90.099  97.468  1.00 83.12  ? 294 THR D O     1 
ATOM   9684  C  CB    . THR D 1 26  ? 72.599  90.856  98.985  1.00 83.12  ? 294 THR D CB    1 
ATOM   9685  O  OG1   . THR D 1 26  ? 72.768  91.536  97.736  1.00 83.12  ? 294 THR D OG1   1 
ATOM   9686  C  CG2   . THR D 1 26  ? 73.193  91.690  100.107 1.00 83.12  ? 294 THR D CG2   1 
ATOM   9687  N  N     . THR D 1 27  ? 75.652  89.417  99.555  1.00 84.24  ? 295 THR D N     1 
ATOM   9688  C  CA    . THR D 1 27  ? 77.086  89.735  99.597  1.00 84.24  ? 295 THR D CA    1 
ATOM   9689  C  C     . THR D 1 27  ? 77.426  91.103  98.999  1.00 84.24  ? 295 THR D C     1 
ATOM   9690  O  O     . THR D 1 27  ? 78.443  91.272  98.318  1.00 84.24  ? 295 THR D O     1 
ATOM   9691  C  CB    . THR D 1 27  ? 77.952  88.600  98.988  1.00 84.24  ? 295 THR D CB    1 
ATOM   9692  O  OG1   . THR D 1 27  ? 79.340  88.915  99.160  1.00 84.24  ? 295 THR D OG1   1 
ATOM   9693  C  CG2   . THR D 1 27  ? 77.684  88.266  97.500  1.00 84.24  ? 295 THR D CG2   1 
ATOM   9694  N  N     . ALA D 1 28  ? 76.597  92.099  99.298  1.00 83.11  ? 296 ALA D N     1 
ATOM   9695  C  CA    . ALA D 1 28  ? 76.864  93.473  98.920  1.00 83.11  ? 296 ALA D CA    1 
ATOM   9696  C  C     . ALA D 1 28  ? 77.782  94.124  99.942  1.00 83.11  ? 296 ALA D C     1 
ATOM   9697  O  O     . ALA D 1 28  ? 78.038  93.589  101.023 1.00 83.11  ? 296 ALA D O     1 
ATOM   9698  C  CB    . ALA D 1 28  ? 75.568  94.270  98.816  1.00 83.11  ? 296 ALA D CB    1 
ATOM   9699  N  N     . LYS D 1 29  ? 78.281  95.301  99.591  1.00 83.11  ? 297 LYS D N     1 
ATOM   9700  C  CA    . LYS D 1 29  ? 79.164  96.054  100.469 1.00 83.11  ? 297 LYS D CA    1 
ATOM   9701  C  C     . LYS D 1 29  ? 78.687  97.495  100.503 1.00 83.11  ? 297 LYS D C     1 
ATOM   9702  O  O     . LYS D 1 29  ? 78.825  98.222  99.514  1.00 83.11  ? 297 LYS D O     1 
ATOM   9703  C  CB    . LYS D 1 29  ? 80.619  95.961  100.005 1.00 83.11  ? 297 LYS D CB    1 
ATOM   9704  C  CG    . LYS D 1 29  ? 81.234  94.586  100.216 1.00 83.11  ? 297 LYS D CG    1 
ATOM   9705  C  CD    . LYS D 1 29  ? 82.695  94.534  99.818  1.00 83.11  ? 297 LYS D CD    1 
ATOM   9706  C  CE    . LYS D 1 29  ? 83.259  93.142  100.056 1.00 83.11  ? 297 LYS D CE    1 
ATOM   9707  N  NZ    . LYS D 1 29  ? 84.693  93.040  99.674  1.00 83.11  ? 297 LYS D NZ    1 
ATOM   9708  N  N     . VAL D 1 30  ? 78.119  97.904  101.633 1.00 82.63  ? 298 VAL D N     1 
ATOM   9709  C  CA    . VAL D 1 30  ? 77.835  99.312  101.856 1.00 82.63  ? 298 VAL D CA    1 
ATOM   9710  C  C     . VAL D 1 30  ? 79.185  99.960  102.101 1.00 82.63  ? 298 VAL D C     1 
ATOM   9711  O  O     . VAL D 1 30  ? 79.755  99.830  103.189 1.00 82.63  ? 298 VAL D O     1 
ATOM   9712  C  CB    . VAL D 1 30  ? 76.876  99.527  103.038 1.00 82.63  ? 298 VAL D CB    1 
ATOM   9713  C  CG1   . VAL D 1 30  ? 76.648  101.010 103.279 1.00 82.63  ? 298 VAL D CG1   1 
ATOM   9714  C  CG2   . VAL D 1 30  ? 75.563  98.814  102.785 1.00 82.63  ? 298 VAL D CG2   1 
ATOM   9715  N  N     . LEU D 1 31  ? 79.727  100.618 101.080 1.00 86.00  ? 299 LEU D N     1 
ATOM   9716  C  CA    . LEU D 1 31  ? 81.118  101.039 101.139 1.00 86.00  ? 299 LEU D CA    1 
ATOM   9717  C  C     . LEU D 1 31  ? 81.278  102.241 102.058 1.00 86.00  ? 299 LEU D C     1 
ATOM   9718  O  O     . LEU D 1 31  ? 80.534  103.222 101.968 1.00 86.00  ? 299 LEU D O     1 
ATOM   9719  C  CB    . LEU D 1 31  ? 81.660  101.330 99.738  1.00 86.00  ? 299 LEU D CB    1 
ATOM   9720  C  CG    . LEU D 1 31  ? 81.094  102.343 98.745  1.00 86.00  ? 299 LEU D CG    1 
ATOM   9721  C  CD1   . LEU D 1 31  ? 81.663  103.737 98.927  1.00 86.00  ? 299 LEU D CD1   1 
ATOM   9722  C  CD2   . LEU D 1 31  ? 81.405  101.847 97.354  1.00 86.00  ? 299 LEU D CD2   1 
ATOM   9723  N  N     . LYS D 1 32  ? 82.245  102.135 102.965 1.00 99.72  ? 300 LYS D N     1 
ATOM   9724  C  CA    . LYS D 1 32  ? 82.509  103.146 103.971 1.00 99.72  ? 300 LYS D CA    1 
ATOM   9725  C  C     . LYS D 1 32  ? 83.769  103.946 103.693 1.00 99.72  ? 300 LYS D C     1 
ATOM   9726  O  O     . LYS D 1 32  ? 83.960  105.000 104.309 1.00 99.72  ? 300 LYS D O     1 
ATOM   9727  C  CB    . LYS D 1 32  ? 82.615  102.502 105.364 1.00 99.72  ? 300 LYS D CB    1 
ATOM   9728  C  CG    . LYS D 1 32  ? 83.965  101.853 105.696 1.00 99.72  ? 300 LYS D CG    1 
ATOM   9729  C  CD    . LYS D 1 32  ? 84.152  100.476 105.067 1.00 99.72  ? 300 LYS D CD    1 
ATOM   9730  C  CE    . LYS D 1 32  ? 83.274  99.439  105.741 1.00 99.72  ? 300 LYS D CE    1 
ATOM   9731  N  NZ    . LYS D 1 32  ? 83.435  98.097  105.122 1.00 99.72  ? 300 LYS D NZ    1 
ATOM   9732  N  N     . ASP D 1 33  ? 84.630  103.476 102.796 1.00 108.04 ? 301 ASP D N     1 
ATOM   9733  C  CA    . ASP D 1 33  ? 85.809  104.238 102.421 1.00 108.04 ? 301 ASP D CA    1 
ATOM   9734  C  C     . ASP D 1 33  ? 85.402  105.448 101.599 1.00 108.04 ? 301 ASP D C     1 
ATOM   9735  O  O     . ASP D 1 33  ? 84.627  105.331 100.645 1.00 108.04 ? 301 ASP D O     1 
ATOM   9736  C  CB    . ASP D 1 33  ? 86.777  103.369 101.627 1.00 108.04 ? 301 ASP D CB    1 
ATOM   9737  C  CG    . ASP D 1 33  ? 88.050  104.101 101.270 1.00 108.04 ? 301 ASP D CG    1 
ATOM   9738  O  OD1   . ASP D 1 33  ? 88.906  104.282 102.161 1.00 108.04 ? 301 ASP D OD1   1 
ATOM   9739  O  OD2   . ASP D 1 33  ? 88.189  104.507 100.098 1.00 108.04 ? 301 ASP D OD2   1 
ATOM   9740  N  N     . GLU D 1 34  ? 85.914  106.614 101.976 1.00 106.60 ? 302 GLU D N     1 
ATOM   9741  C  CA    . GLU D 1 34  ? 85.639  107.840 101.235 1.00 106.60 ? 302 GLU D CA    1 
ATOM   9742  C  C     . GLU D 1 34  ? 86.400  107.787 99.919  1.00 106.60 ? 302 GLU D C     1 
ATOM   9743  O  O     . GLU D 1 34  ? 87.623  107.932 99.886  1.00 106.60 ? 302 GLU D O     1 
ATOM   9744  C  CB    . GLU D 1 34  ? 86.025  109.062 102.059 1.00 106.60 ? 302 GLU D CB    1 
ATOM   9745  C  CG    . GLU D 1 34  ? 85.124  109.296 103.258 1.00 106.60 ? 302 GLU D CG    1 
ATOM   9746  C  CD    . GLU D 1 34  ? 85.541  110.499 104.077 1.00 106.60 ? 302 GLU D CD    1 
ATOM   9747  O  OE1   . GLU D 1 34  ? 86.621  111.062 103.803 1.00 106.60 ? 302 GLU D OE1   1 
ATOM   9748  O  OE2   . GLU D 1 34  ? 84.785  110.886 104.992 1.00 106.60 ? 302 GLU D OE2   1 
ATOM   9749  N  N     . ILE D 1 35  ? 85.671  107.543 98.832  1.00 92.52  ? 303 ILE D N     1 
ATOM   9750  C  CA    . ILE D 1 35  ? 86.276  107.487 97.510  1.00 92.52  ? 303 ILE D CA    1 
ATOM   9751  C  C     . ILE D 1 35  ? 86.716  108.883 97.101  1.00 92.52  ? 303 ILE D C     1 
ATOM   9752  O  O     . ILE D 1 35  ? 85.930  109.837 97.142  1.00 92.52  ? 303 ILE D O     1 
ATOM   9753  C  CB    . ILE D 1 35  ? 85.289  106.889 96.499  1.00 92.52  ? 303 ILE D CB    1 
ATOM   9754  C  CG1   . ILE D 1 35  ? 84.994  105.437 96.857  1.00 92.52  ? 303 ILE D CG1   1 
ATOM   9755  C  CG2   . ILE D 1 35  ? 85.838  106.977 95.094  1.00 92.52  ? 303 ILE D CG2   1 
ATOM   9756  C  CD1   . ILE D 1 35  ? 83.864  104.841 96.069  1.00 92.52  ? 303 ILE D CD1   1 
ATOM   9757  N  N     . ASP D 1 36  ? 87.984  109.011 96.710  1.00 88.19  ? 304 ASP D N     1 
ATOM   9758  C  CA    . ASP D 1 36  ? 88.574  110.300 96.375  1.00 88.19  ? 304 ASP D CA    1 
ATOM   9759  C  C     . ASP D 1 36  ? 88.391  110.676 94.913  1.00 88.19  ? 304 ASP D C     1 
ATOM   9760  O  O     . ASP D 1 36  ? 89.195  111.444 94.369  1.00 88.19  ? 304 ASP D O     1 
ATOM   9761  C  CB    . ASP D 1 36  ? 90.055  110.305 96.755  1.00 88.19  ? 304 ASP D CB    1 
ATOM   9762  C  CG    . ASP D 1 36  ? 90.820  109.141 96.150  1.00 88.19  ? 304 ASP D CG    1 
ATOM   9763  O  OD1   . ASP D 1 36  ? 90.192  108.260 95.526  1.00 88.19  ? 304 ASP D OD1   1 
ATOM   9764  O  OD2   . ASP D 1 36  ? 92.059  109.106 96.305  1.00 88.19  ? 304 ASP D OD2   1 
ATOM   9765  N  N     . VAL D 1 37  ? 87.363  110.155 94.258  1.00 76.45  ? 305 VAL D N     1 
ATOM   9766  C  CA    . VAL D 1 37  ? 87.069  110.482 92.872  1.00 76.45  ? 305 VAL D CA    1 
ATOM   9767  C  C     . VAL D 1 37  ? 85.967  111.524 92.860  1.00 76.45  ? 305 VAL D C     1 
ATOM   9768  O  O     . VAL D 1 37  ? 84.857  111.271 93.338  1.00 76.45  ? 305 VAL D O     1 
ATOM   9769  C  CB    . VAL D 1 37  ? 86.654  109.239 92.077  1.00 76.45  ? 305 VAL D CB    1 
ATOM   9770  C  CG1   . VAL D 1 37  ? 86.300  109.628 90.667  1.00 76.45  ? 305 VAL D CG1   1 
ATOM   9771  C  CG2   . VAL D 1 37  ? 87.765  108.221 92.083  1.00 76.45  ? 305 VAL D CG2   1 
ATOM   9772  N  N     . LYS D 1 38  ? 86.266  112.688 92.310  1.00 74.10  ? 306 LYS D N     1 
ATOM   9773  C  CA    . LYS D 1 38  ? 85.297  113.755 92.150  1.00 74.10  ? 306 LYS D CA    1 
ATOM   9774  C  C     . LYS D 1 38  ? 84.849  113.803 90.695  1.00 74.10  ? 306 LYS D C     1 
ATOM   9775  O  O     . LYS D 1 38  ? 85.332  113.053 89.848  1.00 74.10  ? 306 LYS D O     1 
ATOM   9776  C  CB    . LYS D 1 38  ? 85.907  115.081 92.601  1.00 74.10  ? 306 LYS D CB    1 
ATOM   9777  C  CG    . LYS D 1 38  ? 86.362  115.084 94.049  1.00 74.10  ? 306 LYS D CG    1 
ATOM   9778  C  CD    . LYS D 1 38  ? 85.191  114.965 95.000  1.00 74.10  ? 306 LYS D CD    1 
ATOM   9779  C  CE    . LYS D 1 38  ? 85.640  115.051 96.443  1.00 74.10  ? 306 LYS D CE    1 
ATOM   9780  N  NZ    . LYS D 1 38  ? 84.498  114.896 97.381  1.00 74.10  ? 306 LYS D NZ    1 
ATOM   9781  N  N     . PHE D 1 39  ? 83.909  114.696 90.392  1.00 69.05  ? 307 PHE D N     1 
ATOM   9782  C  CA    . PHE D 1 39  ? 83.497  114.841 89.003  1.00 69.05  ? 307 PHE D CA    1 
ATOM   9783  C  C     . PHE D 1 39  ? 84.556  115.531 88.161  1.00 69.05  ? 307 PHE D C     1 
ATOM   9784  O  O     . PHE D 1 39  ? 84.534  115.396 86.936  1.00 69.05  ? 307 PHE D O     1 
ATOM   9785  C  CB    . PHE D 1 39  ? 82.175  115.598 88.897  1.00 69.05  ? 307 PHE D CB    1 
ATOM   9786  C  CG    . PHE D 1 39  ? 80.987  114.807 89.349  1.00 69.05  ? 307 PHE D CG    1 
ATOM   9787  C  CD1   . PHE D 1 39  ? 80.455  113.818 88.544  1.00 69.05  ? 307 PHE D CD1   1 
ATOM   9788  C  CD2   . PHE D 1 39  ? 80.390  115.062 90.562  1.00 69.05  ? 307 PHE D CD2   1 
ATOM   9789  C  CE1   . PHE D 1 39  ? 79.365  113.090 88.957  1.00 69.05  ? 307 PHE D CE1   1 
ATOM   9790  C  CE2   . PHE D 1 39  ? 79.302  114.333 90.981  1.00 69.05  ? 307 PHE D CE2   1 
ATOM   9791  C  CZ    . PHE D 1 39  ? 78.790  113.349 90.174  1.00 69.05  ? 307 PHE D CZ    1 
ATOM   9792  N  N     . LYS D 1 40  ? 85.489  116.250 88.786  1.00 70.39  ? 308 LYS D N     1 
ATOM   9793  C  CA    . LYS D 1 40  ? 86.580  116.849 88.034  1.00 70.39  ? 308 LYS D CA    1 
ATOM   9794  C  C     . LYS D 1 40  ? 87.564  115.806 87.521  1.00 70.39  ? 308 LYS D C     1 
ATOM   9795  O  O     . LYS D 1 40  ? 88.302  116.089 86.574  1.00 70.39  ? 308 LYS D O     1 
ATOM   9796  C  CB    . LYS D 1 40  ? 87.314  117.877 88.892  1.00 70.39  ? 308 LYS D CB    1 
ATOM   9797  C  CG    . LYS D 1 40  ? 88.040  117.276 90.074  1.00 70.39  ? 308 LYS D CG    1 
ATOM   9798  C  CD    . LYS D 1 40  ? 88.735  118.332 90.899  1.00 70.39  ? 308 LYS D CD    1 
ATOM   9799  C  CE    . LYS D 1 40  ? 89.504  117.696 92.040  1.00 70.39  ? 308 LYS D CE    1 
ATOM   9800  N  NZ    . LYS D 1 40  ? 90.185  118.722 92.871  1.00 70.39  ? 308 LYS D NZ    1 
ATOM   9801  N  N     . ASP D 1 41  ? 87.587  114.611 88.113  1.00 71.45  ? 309 ASP D N     1 
ATOM   9802  C  CA    . ASP D 1 41  ? 88.443  113.538 87.630  1.00 71.45  ? 309 ASP D CA    1 
ATOM   9803  C  C     . ASP D 1 41  ? 87.858  112.813 86.432  1.00 71.45  ? 309 ASP D C     1 
ATOM   9804  O  O     . ASP D 1 41  ? 88.549  111.983 85.835  1.00 71.45  ? 309 ASP D O     1 
ATOM   9805  C  CB    . ASP D 1 41  ? 88.707  112.528 88.742  1.00 71.45  ? 309 ASP D CB    1 
ATOM   9806  C  CG    . ASP D 1 41  ? 89.590  113.087 89.829  1.00 71.45  ? 309 ASP D CG    1 
ATOM   9807  O  OD1   . ASP D 1 41  ? 90.370  114.014 89.536  1.00 71.45  ? 309 ASP D OD1   1 
ATOM   9808  O  OD2   . ASP D 1 41  ? 89.520  112.590 90.972  1.00 71.45  ? 309 ASP D OD2   1 
ATOM   9809  N  N     . VAL D 1 42  ? 86.614  113.092 86.079  1.00 70.12  ? 310 VAL D N     1 
ATOM   9810  C  CA    . VAL D 1 42  ? 85.974  112.528 84.902  1.00 70.12  ? 310 VAL D CA    1 
ATOM   9811  C  C     . VAL D 1 42  ? 85.868  113.641 83.878  1.00 70.12  ? 310 VAL D C     1 
ATOM   9812  O  O     . VAL D 1 42  ? 85.151  114.623 84.091  1.00 70.12  ? 310 VAL D O     1 
ATOM   9813  C  CB    . VAL D 1 42  ? 84.593  111.952 85.227  1.00 70.12  ? 310 VAL D CB    1 
ATOM   9814  C  CG1   . VAL D 1 42  ? 83.929  111.457 83.968  1.00 70.12  ? 310 VAL D CG1   1 
ATOM   9815  C  CG2   . VAL D 1 42  ? 84.712  110.853 86.252  1.00 70.12  ? 310 VAL D CG2   1 
ATOM   9816  N  N     . ALA D 1 43  ? 86.578  113.503 82.771  1.00 67.37  ? 311 ALA D N     1 
ATOM   9817  C  CA    . ALA D 1 43  ? 86.505  114.473 81.697  1.00 67.37  ? 311 ALA D CA    1 
ATOM   9818  C  C     . ALA D 1 43  ? 86.251  113.736 80.397  1.00 67.37  ? 311 ALA D C     1 
ATOM   9819  O  O     . ALA D 1 43  ? 86.180  112.509 80.360  1.00 67.37  ? 311 ALA D O     1 
ATOM   9820  C  CB    . ALA D 1 43  ? 87.781  115.314 81.618  1.00 67.37  ? 311 ALA D CB    1 
ATOM   9821  N  N     . GLY D 1 44  ? 86.105  114.491 79.316  1.00 69.22  ? 312 GLY D N     1 
ATOM   9822  C  CA    . GLY D 1 44  ? 85.815  113.921 78.030  1.00 69.22  ? 312 GLY D CA    1 
ATOM   9823  C  C     . GLY D 1 44  ? 84.339  113.760 77.735  1.00 69.22  ? 312 GLY D C     1 
ATOM   9824  O  O     . GLY D 1 44  ? 83.944  113.795 76.567  1.00 69.22  ? 312 GLY D O     1 
ATOM   9825  N  N     . CYS D 1 45  ? 83.515  113.584 78.768  1.00 70.97  ? 313 CYS D N     1 
ATOM   9826  C  CA    . CYS D 1 45  ? 82.075  113.366 78.612  1.00 70.97  ? 313 CYS D CA    1 
ATOM   9827  C  C     . CYS D 1 45  ? 81.317  114.215 79.633  1.00 70.97  ? 313 CYS D C     1 
ATOM   9828  O  O     . CYS D 1 45  ? 80.974  113.747 80.718  1.00 70.97  ? 313 CYS D O     1 
ATOM   9829  C  CB    . CYS D 1 45  ? 81.758  111.879 78.737  1.00 70.97  ? 313 CYS D CB    1 
ATOM   9830  S  SG    . CYS D 1 45  ? 82.473  111.023 80.175  1.00 70.97  ? 313 CYS D SG    1 
ATOM   9831  N  N     . GLU D 1 46  ? 81.022  115.462 79.272  1.00 75.82  ? 314 GLU D N     1 
ATOM   9832  C  CA    . GLU D 1 46  ? 80.186  116.262 80.158  1.00 75.82  ? 314 GLU D CA    1 
ATOM   9833  C  C     . GLU D 1 46  ? 78.715  115.940 79.983  1.00 75.82  ? 314 GLU D C     1 
ATOM   9834  O  O     . GLU D 1 46  ? 77.934  116.111 80.922  1.00 75.82  ? 314 GLU D O     1 
ATOM   9835  C  CB    . GLU D 1 46  ? 80.396  117.757 79.934  1.00 75.82  ? 314 GLU D CB    1 
ATOM   9836  C  CG    . GLU D 1 46  ? 81.739  118.254 80.374  1.00 75.82  ? 314 GLU D CG    1 
ATOM   9837  C  CD    . GLU D 1 46  ? 82.743  118.171 79.269  1.00 75.82  ? 314 GLU D CD    1 
ATOM   9838  O  OE1   . GLU D 1 46  ? 82.322  117.882 78.131  1.00 75.82  ? 314 GLU D OE1   1 
ATOM   9839  O  OE2   . GLU D 1 46  ? 83.943  118.378 79.538  1.00 75.82  ? 314 GLU D OE2   1 
ATOM   9840  N  N     . GLU D 1 47  ? 78.324  115.471 78.801  1.00 74.34  ? 315 GLU D N     1 
ATOM   9841  C  CA    . GLU D 1 47  ? 76.929  115.146 78.553  1.00 74.34  ? 315 GLU D CA    1 
ATOM   9842  C  C     . GLU D 1 47  ? 76.494  113.898 79.297  1.00 74.34  ? 315 GLU D C     1 
ATOM   9843  O  O     . GLU D 1 47  ? 75.296  113.707 79.514  1.00 74.34  ? 315 GLU D O     1 
ATOM   9844  C  CB    . GLU D 1 47  ? 76.690  114.976 77.059  1.00 74.34  ? 315 GLU D CB    1 
ATOM   9845  C  CG    . GLU D 1 47  ? 76.882  116.250 76.268  1.00 74.34  ? 315 GLU D CG    1 
ATOM   9846  C  CD    . GLU D 1 47  ? 78.307  116.451 75.803  1.00 74.34  ? 315 GLU D CD    1 
ATOM   9847  O  OE1   . GLU D 1 47  ? 79.132  115.541 76.014  1.00 74.34  ? 315 GLU D OE1   1 
ATOM   9848  O  OE2   . GLU D 1 47  ? 78.603  117.521 75.232  1.00 74.34  ? 315 GLU D OE2   1 
ATOM   9849  N  N     . ALA D 1 48  ? 77.435  113.050 79.689  1.00 70.52  ? 316 ALA D N     1 
ATOM   9850  C  CA    . ALA D 1 48  ? 77.143  111.912 80.541  1.00 70.52  ? 316 ALA D CA    1 
ATOM   9851  C  C     . ALA D 1 48  ? 77.305  112.232 82.017  1.00 70.52  ? 316 ALA D C     1 
ATOM   9852  O  O     . ALA D 1 48  ? 76.621  111.625 82.848  1.00 70.52  ? 316 ALA D O     1 
ATOM   9853  C  CB    . ALA D 1 48  ? 78.052  110.742 80.174  1.00 70.52  ? 316 ALA D CB    1 
ATOM   9854  N  N     . LYS D 1 49  ? 78.220  113.145 82.361  1.00 70.71  ? 317 LYS D N     1 
ATOM   9855  C  CA    . LYS D 1 49  ? 78.339  113.607 83.741  1.00 70.71  ? 317 LYS D CA    1 
ATOM   9856  C  C     . LYS D 1 49  ? 77.094  114.341 84.189  1.00 70.71  ? 317 LYS D C     1 
ATOM   9857  O  O     . LYS D 1 49  ? 76.600  114.117 85.300  1.00 70.71  ? 317 LYS D O     1 
ATOM   9858  C  CB    . LYS D 1 49  ? 79.528  114.542 83.895  1.00 70.71  ? 317 LYS D CB    1 
ATOM   9859  C  CG    . LYS D 1 49  ? 80.860  113.900 83.986  1.00 70.71  ? 317 LYS D CG    1 
ATOM   9860  C  CD    . LYS D 1 49  ? 81.907  114.979 83.915  1.00 70.71  ? 317 LYS D CD    1 
ATOM   9861  C  CE    . LYS D 1 49  ? 81.847  115.885 85.116  1.00 70.71  ? 317 LYS D CE    1 
ATOM   9862  N  NZ    . LYS D 1 49  ? 82.960  116.863 85.070  1.00 70.71  ? 317 LYS D NZ    1 
ATOM   9863  N  N     . LEU D 1 50  ? 76.591  115.234 83.337  1.00 69.41  ? 318 LEU D N     1 
ATOM   9864  C  CA    . LEU D 1 50  ? 75.524  116.141 83.722  1.00 69.41  ? 318 LEU D CA    1 
ATOM   9865  C  C     . LEU D 1 50  ? 74.229  115.400 83.995  1.00 69.41  ? 318 LEU D C     1 
ATOM   9866  O  O     . LEU D 1 50  ? 73.465  115.807 84.870  1.00 69.41  ? 318 LEU D O     1 
ATOM   9867  C  CB    . LEU D 1 50  ? 75.331  117.181 82.628  1.00 69.41  ? 318 LEU D CB    1 
ATOM   9868  C  CG    . LEU D 1 50  ? 74.321  118.287 82.867  1.00 69.41  ? 318 LEU D CG    1 
ATOM   9869  C  CD1   . LEU D 1 50  ? 74.728  119.059 84.094  1.00 69.41  ? 318 LEU D CD1   1 
ATOM   9870  C  CD2   . LEU D 1 50  ? 74.260  119.190 81.657  1.00 69.41  ? 318 LEU D CD2   1 
ATOM   9871  N  N     . GLU D 1 51  ? 73.990  114.291 83.312  1.00 69.55  ? 319 GLU D N     1 
ATOM   9872  C  CA    . GLU D 1 51  ? 72.819  113.494 83.631  1.00 69.55  ? 319 GLU D CA    1 
ATOM   9873  C  C     . GLU D 1 51  ? 73.041  112.542 84.792  1.00 69.55  ? 319 GLU D C     1 
ATOM   9874  O  O     . GLU D 1 51  ? 72.103  111.840 85.178  1.00 69.55  ? 319 GLU D O     1 
ATOM   9875  C  CB    . GLU D 1 51  ? 72.352  112.719 82.407  1.00 69.55  ? 319 GLU D CB    1 
ATOM   9876  C  CG    . GLU D 1 51  ? 71.744  113.614 81.362  1.00 69.55  ? 319 GLU D CG    1 
ATOM   9877  C  CD    . GLU D 1 51  ? 71.066  112.838 80.272  1.00 69.55  ? 319 GLU D CD    1 
ATOM   9878  O  OE1   . GLU D 1 51  ? 71.164  111.595 80.278  1.00 69.55  ? 319 GLU D OE1   1 
ATOM   9879  O  OE2   . GLU D 1 51  ? 70.445  113.468 79.392  1.00 69.55  ? 319 GLU D OE2   1 
ATOM   9880  N  N     . ILE D 1 52  ? 74.243  112.488 85.351  1.00 68.21  ? 320 ILE D N     1 
ATOM   9881  C  CA    . ILE D 1 52  ? 74.469  111.786 86.605  1.00 68.21  ? 320 ILE D CA    1 
ATOM   9882  C  C     . ILE D 1 52  ? 74.723  112.761 87.751  1.00 68.21  ? 320 ILE D C     1 
ATOM   9883  O  O     . ILE D 1 52  ? 74.422  112.431 88.910  1.00 68.21  ? 320 ILE D O     1 
ATOM   9884  C  CB    . ILE D 1 52  ? 75.608  110.754 86.457  1.00 68.21  ? 320 ILE D CB    1 
ATOM   9885  C  CG1   . ILE D 1 52  ? 75.202  109.772 85.372  1.00 68.21  ? 320 ILE D CG1   1 
ATOM   9886  C  CG2   . ILE D 1 52  ? 75.812  109.901 87.683  1.00 68.21  ? 320 ILE D CG2   1 
ATOM   9887  C  CD1   . ILE D 1 52  ? 76.234  108.780 85.027  1.00 68.21  ? 320 ILE D CD1   1 
ATOM   9888  N  N     . MET D 1 53  ? 75.147  113.989 87.460  1.00 72.43  ? 321 MET D N     1 
ATOM   9889  C  CA    . MET D 1 53  ? 75.132  115.032 88.476  1.00 72.43  ? 321 MET D CA    1 
ATOM   9890  C  C     . MET D 1 53  ? 73.719  115.428 88.880  1.00 72.43  ? 321 MET D C     1 
ATOM   9891  O  O     . MET D 1 53  ? 73.535  115.946 89.983  1.00 72.43  ? 321 MET D O     1 
ATOM   9892  C  CB    . MET D 1 53  ? 75.893  116.259 87.983  1.00 72.43  ? 321 MET D CB    1 
ATOM   9893  C  CG    . MET D 1 53  ? 77.385  116.038 87.851  1.00 72.43  ? 321 MET D CG    1 
ATOM   9894  S  SD    . MET D 1 53  ? 78.247  117.441 87.133  1.00 72.43  ? 321 MET D SD    1 
ATOM   9895  C  CE    . MET D 1 53  ? 78.112  118.625 88.456  1.00 72.43  ? 321 MET D CE    1 
ATOM   9896  N  N     . GLU D 1 54  ? 72.719  115.186 88.029  1.00 69.49  ? 322 GLU D N     1 
ATOM   9897  C  CA    . GLU D 1 54  ? 71.335  115.460 88.399  1.00 69.49  ? 322 GLU D CA    1 
ATOM   9898  C  C     . GLU D 1 54  ? 70.817  114.513 89.467  1.00 69.49  ? 322 GLU D C     1 
ATOM   9899  O  O     . GLU D 1 54  ? 69.814  114.824 90.114  1.00 69.49  ? 322 GLU D O     1 
ATOM   9900  C  CB    . GLU D 1 54  ? 70.427  115.378 87.176  1.00 69.49  ? 322 GLU D CB    1 
ATOM   9901  C  CG    . GLU D 1 54  ? 70.630  116.500 86.192  1.00 69.49  ? 322 GLU D CG    1 
ATOM   9902  C  CD    . GLU D 1 54  ? 69.858  116.301 84.908  1.00 69.49  ? 322 GLU D CD    1 
ATOM   9903  O  OE1   . GLU D 1 54  ? 69.186  115.259 84.774  1.00 69.49  ? 322 GLU D OE1   1 
ATOM   9904  O  OE2   . GLU D 1 54  ? 69.943  117.170 84.017  1.00 69.49  ? 322 GLU D OE2   1 
ATOM   9905  N  N     . PHE D 1 55  ? 71.456  113.364 89.658  1.00 68.49  ? 323 PHE D N     1 
ATOM   9906  C  CA    . PHE D 1 55  ? 71.034  112.478 90.733  1.00 68.49  ? 323 PHE D CA    1 
ATOM   9907  C  C     . PHE D 1 55  ? 71.574  112.957 92.068  1.00 68.49  ? 323 PHE D C     1 
ATOM   9908  O  O     . PHE D 1 55  ? 70.880  112.887 93.087  1.00 68.49  ? 323 PHE D O     1 
ATOM   9909  C  CB    . PHE D 1 55  ? 71.500  111.047 90.477  1.00 68.49  ? 323 PHE D CB    1 
ATOM   9910  C  CG    . PHE D 1 55  ? 70.845  110.377 89.302  1.00 68.49  ? 323 PHE D CG    1 
ATOM   9911  C  CD1   . PHE D 1 55  ? 69.707  110.895 88.712  1.00 68.49  ? 323 PHE D CD1   1 
ATOM   9912  C  CD2   . PHE D 1 55  ? 71.375  109.207 88.795  1.00 68.49  ? 323 PHE D CD2   1 
ATOM   9913  C  CE1   . PHE D 1 55  ? 69.128  110.271 87.635  1.00 68.49  ? 323 PHE D CE1   1 
ATOM   9914  C  CE2   . PHE D 1 55  ? 70.792  108.577 87.723  1.00 68.49  ? 323 PHE D CE2   1 
ATOM   9915  C  CZ    . PHE D 1 55  ? 69.668  109.110 87.144  1.00 68.49  ? 323 PHE D CZ    1 
ATOM   9916  N  N     . VAL D 1 56  ? 72.815  113.441 92.075  1.00 69.65  ? 324 VAL D N     1 
ATOM   9917  C  CA    . VAL D 1 56  ? 73.416  113.951 93.298  1.00 69.65  ? 324 VAL D CA    1 
ATOM   9918  C  C     . VAL D 1 56  ? 72.840  115.319 93.644  1.00 69.65  ? 324 VAL D C     1 
ATOM   9919  O  O     . VAL D 1 56  ? 72.628  115.626 94.823  1.00 69.65  ? 324 VAL D O     1 
ATOM   9920  C  CB    . VAL D 1 56  ? 74.946  113.969 93.139  1.00 69.65  ? 324 VAL D CB    1 
ATOM   9921  C  CG1   . VAL D 1 56  ? 75.630  114.585 94.339  1.00 69.65  ? 324 VAL D CG1   1 
ATOM   9922  C  CG2   . VAL D 1 56  ? 75.455  112.562 92.936  1.00 69.65  ? 324 VAL D CG2   1 
ATOM   9923  N  N     . ASN D 1 57  ? 72.527  116.137 92.636  1.00 70.46  ? 325 ASN D N     1 
ATOM   9924  C  CA    . ASN D 1 57  ? 71.922  117.440 92.891  1.00 70.46  ? 325 ASN D CA    1 
ATOM   9925  C  C     . ASN D 1 57  ? 70.507  117.301 93.428  1.00 70.46  ? 325 ASN D C     1 
ATOM   9926  O  O     . ASN D 1 57  ? 70.029  118.185 94.144  1.00 70.46  ? 325 ASN D O     1 
ATOM   9927  C  CB    . ASN D 1 57  ? 71.904  118.273 91.615  1.00 70.46  ? 325 ASN D CB    1 
ATOM   9928  C  CG    . ASN D 1 57  ? 71.669  119.742 91.876  1.00 70.46  ? 325 ASN D CG    1 
ATOM   9929  O  OD1   . ASN D 1 57  ? 71.659  120.193 93.017  1.00 70.46  ? 325 ASN D OD1   1 
ATOM   9930  N  ND2   . ASN D 1 57  ? 71.458  120.499 90.810  1.00 70.46  ? 325 ASN D ND2   1 
ATOM   9931  N  N     . PHE D 1 58  ? 69.822  116.205 93.104  1.00 69.64  ? 326 PHE D N     1 
ATOM   9932  C  CA    . PHE D 1 58  ? 68.557  115.929 93.764  1.00 69.64  ? 326 PHE D CA    1 
ATOM   9933  C  C     . PHE D 1 58  ? 68.781  115.627 95.238  1.00 69.64  ? 326 PHE D C     1 
ATOM   9934  O  O     . PHE D 1 58  ? 68.067  116.150 96.098  1.00 69.64  ? 326 PHE D O     1 
ATOM   9935  C  CB    . PHE D 1 58  ? 67.845  114.758 93.086  1.00 69.64  ? 326 PHE D CB    1 
ATOM   9936  C  CG    . PHE D 1 58  ? 66.418  114.555 93.539  1.00 69.64  ? 326 PHE D CG    1 
ATOM   9937  C  CD1   . PHE D 1 58  ? 65.381  115.201 92.901  1.00 69.64  ? 326 PHE D CD1   1 
ATOM   9938  C  CD2   . PHE D 1 58  ? 66.120  113.738 94.622  1.00 69.64  ? 326 PHE D CD2   1 
ATOM   9939  C  CE1   . PHE D 1 58  ? 64.084  115.031 93.309  1.00 69.64  ? 326 PHE D CE1   1 
ATOM   9940  C  CE2   . PHE D 1 58  ? 64.821  113.574 95.048  1.00 69.64  ? 326 PHE D CE2   1 
ATOM   9941  C  CZ    . PHE D 1 58  ? 63.801  114.216 94.384  1.00 69.64  ? 326 PHE D CZ    1 
ATOM   9942  N  N     . LEU D 1 59  ? 69.774  114.799 95.553  1.00 67.87  ? 327 LEU D N     1 
ATOM   9943  C  CA    . LEU D 1 59  ? 69.985  114.383 96.932  1.00 67.87  ? 327 LEU D CA    1 
ATOM   9944  C  C     . LEU D 1 59  ? 70.647  115.455 97.790  1.00 67.87  ? 327 LEU D C     1 
ATOM   9945  O  O     . LEU D 1 59  ? 70.762  115.265 99.003  1.00 67.87  ? 327 LEU D O     1 
ATOM   9946  C  CB    . LEU D 1 59  ? 70.815  113.103 96.971  1.00 67.87  ? 327 LEU D CB    1 
ATOM   9947  C  CG    . LEU D 1 59  ? 70.151  111.891 96.322  1.00 67.87  ? 327 LEU D CG    1 
ATOM   9948  C  CD1   . LEU D 1 59  ? 71.060  110.681 96.382  1.00 67.87  ? 327 LEU D CD1   1 
ATOM   9949  C  CD2   . LEU D 1 59  ? 68.820  111.596 96.968  1.00 67.87  ? 327 LEU D CD2   1 
ATOM   9950  N  N     . LYS D 1 60  ? 71.085  116.562 97.200  1.00 70.19  ? 328 LYS D N     1 
ATOM   9951  C  CA    . LYS D 1 60  ? 71.547  117.721 97.950  1.00 70.19  ? 328 LYS D CA    1 
ATOM   9952  C  C     . LYS D 1 60  ? 70.554  118.866 97.954  1.00 70.19  ? 328 LYS D C     1 
ATOM   9953  O  O     . LYS D 1 60  ? 70.380  119.515 98.984  1.00 70.19  ? 328 LYS D O     1 
ATOM   9954  C  CB    . LYS D 1 60  ? 72.876  118.233 97.396  1.00 70.19  ? 328 LYS D CB    1 
ATOM   9955  C  CG    . LYS D 1 60  ? 74.056  117.345 97.682  1.00 70.19  ? 328 LYS D CG    1 
ATOM   9956  C  CD    . LYS D 1 60  ? 75.319  117.975 97.144  1.00 70.19  ? 328 LYS D CD    1 
ATOM   9957  C  CE    . LYS D 1 60  ? 76.523  117.116 97.446  1.00 70.19  ? 328 LYS D CE    1 
ATOM   9958  N  NZ    . LYS D 1 60  ? 77.781  117.706 96.917  1.00 70.19  ? 328 LYS D NZ    1 
ATOM   9959  N  N     . ASN D 1 61  ? 69.892  119.137 96.832  1.00 68.74  ? 329 ASN D N     1 
ATOM   9960  C  CA    . ASN D 1 61  ? 68.906  120.208 96.742  1.00 68.74  ? 329 ASN D CA    1 
ATOM   9961  C  C     . ASN D 1 61  ? 67.572  119.640 96.275  1.00 68.74  ? 329 ASN D C     1 
ATOM   9962  O  O     . ASN D 1 61  ? 67.230  119.749 95.089  1.00 68.74  ? 329 ASN D O     1 
ATOM   9963  C  CB    . ASN D 1 61  ? 69.385  121.302 95.795  1.00 68.74  ? 329 ASN D CB    1 
ATOM   9964  C  CG    . ASN D 1 61  ? 70.590  122.031 96.324  1.00 68.74  ? 329 ASN D CG    1 
ATOM   9965  O  OD1   . ASN D 1 61  ? 70.666  122.346 97.509  1.00 68.74  ? 329 ASN D OD1   1 
ATOM   9966  N  ND2   . ASN D 1 61  ? 71.548  122.300 95.449  1.00 68.74  ? 329 ASN D ND2   1 
ATOM   9967  N  N     . PRO D 1 62  ? 66.788  119.032 97.168  1.00 66.98  ? 330 PRO D N     1 
ATOM   9968  C  CA    . PRO D 1 62  ? 65.484  118.523 96.739  1.00 66.98  ? 330 PRO D CA    1 
ATOM   9969  C  C     . PRO D 1 62  ? 64.456  119.612 96.524  1.00 66.98  ? 330 PRO D C     1 
ATOM   9970  O  O     . PRO D 1 62  ? 63.519  119.393 95.751  1.00 66.98  ? 330 PRO D O     1 
ATOM   9971  C  CB    . PRO D 1 62  ? 65.070  117.597 97.889  1.00 66.98  ? 330 PRO D CB    1 
ATOM   9972  C  CG    . PRO D 1 62  ? 66.317  117.313 98.631  1.00 66.98  ? 330 PRO D CG    1 
ATOM   9973  C  CD    . PRO D 1 62  ? 67.108  118.571 98.526  1.00 66.98  ? 330 PRO D CD    1 
ATOM   9974  N  N     . LYS D 1 63  ? 64.602  120.774 97.169  1.00 67.91  ? 331 LYS D N     1 
ATOM   9975  C  CA    . LYS D 1 63  ? 63.596  121.831 97.075  1.00 67.91  ? 331 LYS D CA    1 
ATOM   9976  C  C     . LYS D 1 63  ? 63.540  122.444 95.682  1.00 67.91  ? 331 LYS D C     1 
ATOM   9977  O  O     . LYS D 1 63  ? 62.467  122.855 95.228  1.00 67.91  ? 331 LYS D O     1 
ATOM   9978  C  CB    . LYS D 1 63  ? 63.890  122.914 98.114  1.00 67.91  ? 331 LYS D CB    1 
ATOM   9979  C  CG    . LYS D 1 63  ? 62.852  124.017 98.197  1.00 67.91  ? 331 LYS D CG    1 
ATOM   9980  C  CD    . LYS D 1 63  ? 63.205  125.042 99.246  1.00 67.91  ? 331 LYS D CD    1 
ATOM   9981  C  CE    . LYS D 1 63  ? 62.106  126.074 99.362  1.00 67.91  ? 331 LYS D CE    1 
ATOM   9982  N  NZ    . LYS D 1 63  ? 62.001  126.888 98.124  1.00 67.91  ? 331 LYS D NZ    1 
ATOM   9983  N  N     . GLN D 1 64  ? 64.679  122.508 94.998  1.00 66.05  ? 332 GLN D N     1 
ATOM   9984  C  CA    . GLN D 1 64  ? 64.717  123.037 93.640  1.00 66.05  ? 332 GLN D CA    1 
ATOM   9985  C  C     . GLN D 1 64  ? 63.938  122.154 92.682  1.00 66.05  ? 332 GLN D C     1 
ATOM   9986  O  O     . GLN D 1 64  ? 63.197  122.651 91.829  1.00 66.05  ? 332 GLN D O     1 
ATOM   9987  C  CB    . GLN D 1 64  ? 66.164  123.142 93.182  1.00 66.05  ? 332 GLN D CB    1 
ATOM   9988  C  CG    . GLN D 1 64  ? 66.340  123.719 91.814  1.00 66.05  ? 332 GLN D CG    1 
ATOM   9989  C  CD    . GLN D 1 64  ? 67.777  123.676 91.375  1.00 66.05  ? 332 GLN D CD    1 
ATOM   9990  O  OE1   . GLN D 1 64  ? 68.637  123.156 92.082  1.00 66.05  ? 332 GLN D OE1   1 
ATOM   9991  N  NE2   . GLN D 1 64  ? 68.047  124.211 90.197  1.00 66.05  ? 332 GLN D NE2   1 
ATOM   9992  N  N     . TYR D 1 65  ? 64.084  120.843 92.826  1.00 67.74  ? 333 TYR D N     1 
ATOM   9993  C  CA    . TYR D 1 65  ? 63.444  119.902 91.923  1.00 67.74  ? 333 TYR D CA    1 
ATOM   9994  C  C     . TYR D 1 65  ? 61.983  119.668 92.279  1.00 67.74  ? 333 TYR D C     1 
ATOM   9995  O  O     . TYR D 1 65  ? 61.170  119.414 91.387  1.00 67.74  ? 333 TYR D O     1 
ATOM   9996  C  CB    . TYR D 1 65  ? 64.243  118.598 91.929  1.00 67.74  ? 333 TYR D CB    1 
ATOM   9997  C  CG    . TYR D 1 65  ? 65.525  118.692 91.130  1.00 67.74  ? 333 TYR D CG    1 
ATOM   9998  C  CD1   . TYR D 1 65  ? 65.615  119.531 90.043  1.00 67.74  ? 333 TYR D CD1   1 
ATOM   9999  C  CD2   . TYR D 1 65  ? 66.661  118.005 91.509  1.00 67.74  ? 333 TYR D CD2   1 
ATOM   10000 C  CE1   . TYR D 1 65  ? 66.773  119.635 89.316  1.00 67.74  ? 333 TYR D CE1   1 
ATOM   10001 C  CE2   . TYR D 1 65  ? 67.828  118.104 90.793  1.00 67.74  ? 333 TYR D CE2   1 
ATOM   10002 C  CZ    . TYR D 1 65  ? 67.877  118.926 89.698  1.00 67.74  ? 333 TYR D CZ    1 
ATOM   10003 O  OH    . TYR D 1 65  ? 69.039  119.037 88.977  1.00 67.74  ? 333 TYR D OH    1 
ATOM   10004 N  N     . GLN D 1 66  ? 61.624  119.783 93.553  1.00 67.59  ? 334 GLN D N     1 
ATOM   10005 C  CA    . GLN D 1 66  ? 60.266  119.517 94.002  1.00 67.59  ? 334 GLN D CA    1 
ATOM   10006 C  C     . GLN D 1 66  ? 59.371  120.747 93.991  1.00 67.59  ? 334 GLN D C     1 
ATOM   10007 O  O     . GLN D 1 66  ? 58.184  120.626 94.297  1.00 67.59  ? 334 GLN D O     1 
ATOM   10008 C  CB    . GLN D 1 66  ? 60.288  118.905 95.401  1.00 67.59  ? 334 GLN D CB    1 
ATOM   10009 C  CG    . GLN D 1 66  ? 60.838  117.499 95.423  1.00 67.59  ? 334 GLN D CG    1 
ATOM   10010 C  CD    . GLN D 1 66  ? 60.980  116.958 96.822  1.00 67.59  ? 334 GLN D CD    1 
ATOM   10011 O  OE1   . GLN D 1 66  ? 60.797  117.679 97.799  1.00 67.59  ? 334 GLN D OE1   1 
ATOM   10012 N  NE2   . GLN D 1 66  ? 61.295  115.676 96.930  1.00 67.59  ? 334 GLN D NE2   1 
ATOM   10013 N  N     . ASP D 1 67  ? 59.893  121.923 93.651  1.00 67.84  ? 335 ASP D N     1 
ATOM   10014 C  CA    . ASP D 1 67  ? 59.016  123.051 93.367  1.00 67.84  ? 335 ASP D CA    1 
ATOM   10015 C  C     . ASP D 1 67  ? 58.404  122.974 91.981  1.00 67.84  ? 335 ASP D C     1 
ATOM   10016 O  O     . ASP D 1 67  ? 57.471  123.728 91.689  1.00 67.84  ? 335 ASP D O     1 
ATOM   10017 C  CB    . ASP D 1 67  ? 59.763  124.375 93.511  1.00 67.84  ? 335 ASP D CB    1 
ATOM   10018 C  CG    . ASP D 1 67  ? 59.976  124.765 94.952  1.00 67.84  ? 335 ASP D CG    1 
ATOM   10019 O  OD1   . ASP D 1 67  ? 59.137  124.394 95.797  1.00 67.84  ? 335 ASP D OD1   1 
ATOM   10020 O  OD2   . ASP D 1 67  ? 60.980  125.447 95.241  1.00 67.84  ? 335 ASP D OD2   1 
ATOM   10021 N  N     . LEU D 1 68  ? 58.909  122.093 91.126  1.00 66.04  ? 336 LEU D N     1 
ATOM   10022 C  CA    . LEU D 1 68  ? 58.303  121.819 89.839  1.00 66.04  ? 336 LEU D CA    1 
ATOM   10023 C  C     . LEU D 1 68  ? 57.609  120.470 89.817  1.00 66.04  ? 336 LEU D C     1 
ATOM   10024 O  O     . LEU D 1 68  ? 57.055  120.089 88.785  1.00 66.04  ? 336 LEU D O     1 
ATOM   10025 C  CB    . LEU D 1 68  ? 59.356  121.885 88.734  1.00 66.04  ? 336 LEU D CB    1 
ATOM   10026 C  CG    . LEU D 1 68  ? 60.006  123.254 88.589  1.00 66.04  ? 336 LEU D CG    1 
ATOM   10027 C  CD1   . LEU D 1 68  ? 61.049  123.225 87.506  1.00 66.04  ? 336 LEU D CD1   1 
ATOM   10028 C  CD2   . LEU D 1 68  ? 58.975  124.306 88.299  1.00 66.04  ? 336 LEU D CD2   1 
ATOM   10029 N  N     . GLY D 1 69  ? 57.624  119.743 90.927  1.00 63.66  ? 337 GLY D N     1 
ATOM   10030 C  CA    . GLY D 1 69  ? 56.956  118.467 91.008  1.00 63.66  ? 337 GLY D CA    1 
ATOM   10031 C  C     . GLY D 1 69  ? 57.737  117.300 90.464  1.00 63.66  ? 337 GLY D C     1 
ATOM   10032 O  O     . GLY D 1 69  ? 57.152  116.234 90.245  1.00 63.66  ? 337 GLY D O     1 
ATOM   10033 N  N     . ALA D 1 70  ? 59.035  117.459 90.242  1.00 62.62  ? 338 ALA D N     1 
ATOM   10034 C  CA    . ALA D 1 70  ? 59.840  116.413 89.631  1.00 62.62  ? 338 ALA D CA    1 
ATOM   10035 C  C     . ALA D 1 70  ? 60.115  115.310 90.638  1.00 62.62  ? 338 ALA D C     1 
ATOM   10036 O  O     . ALA D 1 70  ? 60.669  115.563 91.709  1.00 62.62  ? 338 ALA D O     1 
ATOM   10037 C  CB    . ALA D 1 70  ? 61.151  116.987 89.111  1.00 62.62  ? 338 ALA D CB    1 
ATOM   10038 N  N     . LYS D 1 71  ? 59.738  114.088 90.289  1.00 64.48  ? 339 LYS D N     1 
ATOM   10039 C  CA    . LYS D 1 71  ? 60.141  112.944 91.081  1.00 64.48  ? 339 LYS D CA    1 
ATOM   10040 C  C     . LYS D 1 71  ? 61.610  112.637 90.829  1.00 64.48  ? 339 LYS D C     1 
ATOM   10041 O  O     . LYS D 1 71  ? 62.207  113.087 89.849  1.00 64.48  ? 339 LYS D O     1 
ATOM   10042 C  CB    . LYS D 1 71  ? 59.295  111.724 90.735  1.00 64.48  ? 339 LYS D CB    1 
ATOM   10043 C  CG    . LYS D 1 71  ? 57.832  111.863 91.068  1.00 64.48  ? 339 LYS D CG    1 
ATOM   10044 C  CD    . LYS D 1 71  ? 57.085  110.597 90.717  1.00 64.48  ? 339 LYS D CD    1 
ATOM   10045 C  CE    . LYS D 1 71  ? 55.606  110.733 91.022  1.00 64.48  ? 339 LYS D CE    1 
ATOM   10046 N  NZ    . LYS D 1 71  ? 54.856  109.496 90.673  1.00 64.48  ? 339 LYS D NZ    1 
ATOM   10047 N  N     . ILE D 1 72  ? 62.193  111.858 91.725  1.00 66.54  ? 340 ILE D N     1 
ATOM   10048 C  CA    . ILE D 1 72  ? 63.562  111.390 91.493  1.00 66.54  ? 340 ILE D CA    1 
ATOM   10049 C  C     . ILE D 1 72  ? 63.542  110.325 90.403  1.00 66.54  ? 340 ILE D C     1 
ATOM   10050 O  O     . ILE D 1 72  ? 62.567  109.556 90.312  1.00 66.54  ? 340 ILE D O     1 
ATOM   10051 C  CB    . ILE D 1 72  ? 64.169  110.859 92.799  1.00 66.54  ? 340 ILE D CB    1 
ATOM   10052 C  CG1   . ILE D 1 72  ? 65.641  110.484 92.633  1.00 66.54  ? 340 ILE D CG1   1 
ATOM   10053 C  CG2   . ILE D 1 72  ? 63.348  109.723 93.410  1.00 66.54  ? 340 ILE D CG2   1 
ATOM   10054 C  CD1   . ILE D 1 72  ? 66.332  110.214 93.935  1.00 66.54  ? 340 ILE D CD1   1 
ATOM   10055 N  N     . PRO D 1 73  ? 64.517  110.292 89.500  1.00 66.20  ? 341 PRO D N     1 
ATOM   10056 C  CA    . PRO D 1 73  ? 64.578  109.184 88.544  1.00 66.20  ? 341 PRO D CA    1 
ATOM   10057 C  C     . PRO D 1 73  ? 65.027  107.905 89.230  1.00 66.20  ? 341 PRO D C     1 
ATOM   10058 O  O     . PRO D 1 73  ? 65.936  107.912 90.059  1.00 66.20  ? 341 PRO D O     1 
ATOM   10059 C  CB    . PRO D 1 73  ? 65.603  109.661 87.513  1.00 66.20  ? 341 PRO D CB    1 
ATOM   10060 C  CG    . PRO D 1 73  ? 65.612  111.128 87.648  1.00 66.20  ? 341 PRO D CG    1 
ATOM   10061 C  CD    . PRO D 1 73  ? 65.387  111.405 89.095  1.00 66.20  ? 341 PRO D CD    1 
ATOM   10062 N  N     . LYS D 1 74  ? 64.386  106.797 88.871  1.00 67.00  ? 342 LYS D N     1 
ATOM   10063 C  CA    . LYS D 1 74  ? 64.582  105.554 89.604  1.00 67.00  ? 342 LYS D CA    1 
ATOM   10064 C  C     . LYS D 1 74  ? 65.859  104.818 89.234  1.00 67.00  ? 342 LYS D C     1 
ATOM   10065 O  O     . LYS D 1 74  ? 66.106  103.747 89.792  1.00 67.00  ? 342 LYS D O     1 
ATOM   10066 C  CB    . LYS D 1 74  ? 63.391  104.619 89.397  1.00 67.00  ? 342 LYS D CB    1 
ATOM   10067 C  CG    . LYS D 1 74  ? 62.117  105.092 90.060  1.00 67.00  ? 342 LYS D CG    1 
ATOM   10068 C  CD    . LYS D 1 74  ? 60.997  104.088 89.882  1.00 67.00  ? 342 LYS D CD    1 
ATOM   10069 C  CE    . LYS D 1 74  ? 59.715  104.572 90.534  1.00 67.00  ? 342 LYS D CE    1 
ATOM   10070 N  NZ    . LYS D 1 74  ? 58.608  103.594 90.351  1.00 67.00  ? 342 LYS D NZ    1 
ATOM   10071 N  N     . GLY D 1 75  ? 66.665  105.338 88.324  1.00 66.27  ? 343 GLY D N     1 
ATOM   10072 C  CA    . GLY D 1 75  ? 67.918  104.691 88.001  1.00 66.27  ? 343 GLY D CA    1 
ATOM   10073 C  C     . GLY D 1 75  ? 68.405  105.070 86.621  1.00 66.27  ? 343 GLY D C     1 
ATOM   10074 O  O     . GLY D 1 75  ? 67.758  105.814 85.888  1.00 66.27  ? 343 GLY D O     1 
ATOM   10075 N  N     . ALA D 1 76  ? 69.575  104.532 86.283  1.00 64.59  ? 344 ALA D N     1 
ATOM   10076 C  CA    . ALA D 1 76  ? 70.206  104.821 85.006  1.00 64.59  ? 344 ALA D CA    1 
ATOM   10077 C  C     . ALA D 1 76  ? 71.131  103.685 84.611  1.00 64.59  ? 344 ALA D C     1 
ATOM   10078 O  O     . ALA D 1 76  ? 71.727  103.024 85.462  1.00 64.59  ? 344 ALA D O     1 
ATOM   10079 C  CB    . ALA D 1 76  ? 71.000  106.124 85.050  1.00 64.59  ? 344 ALA D CB    1 
ATOM   10080 N  N     . ILE D 1 77  ? 71.249  103.474 83.304  1.00 64.89  ? 345 ILE D N     1 
ATOM   10081 C  CA    . ILE D 1 77  ? 72.145  102.478 82.734  1.00 64.89  ? 345 ILE D CA    1 
ATOM   10082 C  C     . ILE D 1 77  ? 73.267  103.214 82.013  1.00 64.89  ? 345 ILE D C     1 
ATOM   10083 O  O     . ILE D 1 77  ? 73.062  104.294 81.448  1.00 64.89  ? 345 ILE D O     1 
ATOM   10084 C  CB    . ILE D 1 77  ? 71.387  101.495 81.810  1.00 64.89  ? 345 ILE D CB    1 
ATOM   10085 C  CG1   . ILE D 1 77  ? 72.255  100.301 81.415  1.00 64.89  ? 345 ILE D CG1   1 
ATOM   10086 C  CG2   . ILE D 1 77  ? 70.828  102.168 80.585  1.00 64.89  ? 345 ILE D CG2   1 
ATOM   10087 C  CD1   . ILE D 1 77  ? 72.548  99.382  82.529  1.00 64.89  ? 345 ILE D CD1   1 
ATOM   10088 N  N     . LEU D 1 78  ? 74.470  102.661 82.099  1.00 65.93  ? 346 LEU D N     1 
ATOM   10089 C  CA    . LEU D 1 78  ? 75.667  103.245 81.508  1.00 65.93  ? 346 LEU D CA    1 
ATOM   10090 C  C     . LEU D 1 78  ? 76.185  102.278 80.457  1.00 65.93  ? 346 LEU D C     1 
ATOM   10091 O  O     . LEU D 1 78  ? 76.745  101.231 80.795  1.00 65.93  ? 346 LEU D O     1 
ATOM   10092 C  CB    . LEU D 1 78  ? 76.715  103.512 82.580  1.00 65.93  ? 346 LEU D CB    1 
ATOM   10093 C  CG    . LEU D 1 78  ? 76.335  104.639 83.525  1.00 65.93  ? 346 LEU D CG    1 
ATOM   10094 C  CD1   . LEU D 1 78  ? 77.269  104.696 84.698  1.00 65.93  ? 346 LEU D CD1   1 
ATOM   10095 C  CD2   . LEU D 1 78  ? 76.419  105.905 82.741  1.00 65.93  ? 346 LEU D CD2   1 
ATOM   10096 N  N     . THR D 1 79  ? 76.003  102.622 79.192  1.00 64.89  ? 347 THR D N     1 
ATOM   10097 C  CA    . THR D 1 79  ? 76.406  101.765 78.092  1.00 64.89  ? 347 THR D CA    1 
ATOM   10098 C  C     . THR D 1 79  ? 77.610  102.360 77.381  1.00 64.89  ? 347 THR D C     1 
ATOM   10099 O  O     . THR D 1 79  ? 77.821  103.575 77.399  1.00 64.89  ? 347 THR D O     1 
ATOM   10100 C  CB    . THR D 1 79  ? 75.267  101.588 77.096  1.00 64.89  ? 347 THR D CB    1 
ATOM   10101 O  OG1   . THR D 1 79  ? 74.971  102.847 76.487  1.00 64.89  ? 347 THR D OG1   1 
ATOM   10102 C  CG2   . THR D 1 79  ? 74.029  101.089 77.798  1.00 64.89  ? 347 THR D CG2   1 
ATOM   10103 N  N     . GLY D 1 80  ? 78.403  101.497 76.755  1.00 62.71  ? 348 GLY D N     1 
ATOM   10104 C  CA    . GLY D 1 80  ? 79.513  101.953 75.957  1.00 62.71  ? 348 GLY D CA    1 
ATOM   10105 C  C     . GLY D 1 80  ? 80.575  100.900 75.726  1.00 62.71  ? 348 GLY D C     1 
ATOM   10106 O  O     . GLY D 1 80  ? 80.511  99.793  76.262  1.00 62.71  ? 348 GLY D O     1 
ATOM   10107 N  N     . PRO D 1 81  ? 81.573  101.231 74.910  1.00 62.34  ? 349 PRO D N     1 
ATOM   10108 C  CA    . PRO D 1 81  ? 82.718  100.337 74.704  1.00 62.34  ? 349 PRO D CA    1 
ATOM   10109 C  C     . PRO D 1 81  ? 83.545  100.204 75.970  1.00 62.34  ? 349 PRO D C     1 
ATOM   10110 O  O     . PRO D 1 81  ? 83.364  100.983 76.916  1.00 62.34  ? 349 PRO D O     1 
ATOM   10111 C  CB    . PRO D 1 81  ? 83.509  101.050 73.595  1.00 62.34  ? 349 PRO D CB    1 
ATOM   10112 C  CG    . PRO D 1 81  ? 82.521  101.882 72.904  1.00 62.34  ? 349 PRO D CG    1 
ATOM   10113 C  CD    . PRO D 1 81  ? 81.589  102.356 73.964  1.00 62.34  ? 349 PRO D CD    1 
ATOM   10114 N  N     . PRO D 1 82  ? 84.450  99.227  76.045  1.00 64.42  ? 350 PRO D N     1 
ATOM   10115 C  CA    . PRO D 1 82  ? 85.300  99.121  77.235  1.00 64.42  ? 350 PRO D CA    1 
ATOM   10116 C  C     . PRO D 1 82  ? 86.305  100.258 77.320  1.00 64.42  ? 350 PRO D C     1 
ATOM   10117 O  O     . PRO D 1 82  ? 86.934  100.636 76.330  1.00 64.42  ? 350 PRO D O     1 
ATOM   10118 C  CB    . PRO D 1 82  ? 86.003  97.774  77.050  1.00 64.42  ? 350 PRO D CB    1 
ATOM   10119 C  CG    . PRO D 1 82  ? 85.125  97.021  76.151  1.00 64.42  ? 350 PRO D CG    1 
ATOM   10120 C  CD    . PRO D 1 82  ? 84.563  98.022  75.209  1.00 64.42  ? 350 PRO D CD    1 
ATOM   10121 N  N     . GLY D 1 83  ? 86.434  100.813 78.522  1.00 65.81  ? 351 GLY D N     1 
ATOM   10122 C  CA    . GLY D 1 83  ? 87.439  101.814 78.801  1.00 65.81  ? 351 GLY D CA    1 
ATOM   10123 C  C     . GLY D 1 83  ? 87.031  103.241 78.540  1.00 65.81  ? 351 GLY D C     1 
ATOM   10124 O  O     . GLY D 1 83  ? 87.882  104.054 78.170  1.00 65.81  ? 351 GLY D O     1 
ATOM   10125 N  N     . THR D 1 84  ? 85.760  103.581 78.728  1.00 62.52  ? 352 THR D N     1 
ATOM   10126 C  CA    . THR D 1 84  ? 85.271  104.923 78.452  1.00 62.52  ? 352 THR D CA    1 
ATOM   10127 C  C     . THR D 1 84  ? 84.883  105.698 79.700  1.00 62.52  ? 352 THR D C     1 
ATOM   10128 O  O     . THR D 1 84  ? 84.461  106.850 79.584  1.00 62.52  ? 352 THR D O     1 
ATOM   10129 C  CB    . THR D 1 84  ? 84.071  104.871 77.508  1.00 62.52  ? 352 THR D CB    1 
ATOM   10130 O  OG1   . THR D 1 84  ? 83.056  104.041 78.080  1.00 62.52  ? 352 THR D OG1   1 
ATOM   10131 C  CG2   . THR D 1 84  ? 84.471  104.337 76.156  1.00 62.52  ? 352 THR D CG2   1 
ATOM   10132 N  N     . GLY D 1 85  ? 84.999  105.108 80.882  1.00 69.43  ? 353 GLY D N     1 
ATOM   10133 C  CA    . GLY D 1 85  ? 84.680  105.834 82.092  1.00 69.43  ? 353 GLY D CA    1 
ATOM   10134 C  C     . GLY D 1 85  ? 83.275  105.621 82.595  1.00 69.43  ? 353 GLY D C     1 
ATOM   10135 O  O     . GLY D 1 85  ? 82.551  106.582 82.848  1.00 69.43  ? 353 GLY D O     1 
ATOM   10136 N  N     . LYS D 1 86  ? 82.875  104.363 82.742  1.00 67.55  ? 354 LYS D N     1 
ATOM   10137 C  CA    . LYS D 1 86  ? 81.550  104.018 83.233  1.00 67.55  ? 354 LYS D CA    1 
ATOM   10138 C  C     . LYS D 1 86  ? 81.559  103.569 84.682  1.00 67.55  ? 354 LYS D C     1 
ATOM   10139 O  O     . LYS D 1 86  ? 80.624  103.875 85.423  1.00 67.55  ? 354 LYS D O     1 
ATOM   10140 C  CB    . LYS D 1 86  ? 80.936  102.925 82.364  1.00 67.55  ? 354 LYS D CB    1 
ATOM   10141 C  CG    . LYS D 1 86  ? 80.650  103.383 80.964  1.00 67.55  ? 354 LYS D CG    1 
ATOM   10142 C  CD    . LYS D 1 86  ? 79.978  102.307 80.166  1.00 67.55  ? 354 LYS D CD    1 
ATOM   10143 C  CE    . LYS D 1 86  ? 80.955  101.223 79.792  1.00 67.55  ? 354 LYS D CE    1 
ATOM   10144 N  NZ    . LYS D 1 86  ? 80.321  100.241 78.882  1.00 67.55  ? 354 LYS D NZ    1 
ATOM   10145 N  N     . THR D 1 87  ? 82.589  102.847 85.108  1.00 67.89  ? 355 THR D N     1 
ATOM   10146 C  CA    . THR D 1 87  ? 82.725  102.560 86.527  1.00 67.89  ? 355 THR D CA    1 
ATOM   10147 C  C     . THR D 1 87  ? 83.334  103.751 87.259  1.00 67.89  ? 355 THR D C     1 
ATOM   10148 O  O     . THR D 1 87  ? 83.006  103.997 88.424  1.00 67.89  ? 355 THR D O     1 
ATOM   10149 C  CB    . THR D 1 87  ? 83.556  101.292 86.717  1.00 67.89  ? 355 THR D CB    1 
ATOM   10150 O  OG1   . THR D 1 87  ? 82.988  100.244 85.926  1.00 67.89  ? 355 THR D OG1   1 
ATOM   10151 C  CG2   . THR D 1 87  ? 83.529  100.839 88.153  1.00 67.89  ? 355 THR D CG2   1 
ATOM   10152 N  N     . LEU D 1 88  ? 84.178  104.523 86.571  1.00 69.29  ? 356 LEU D N     1 
ATOM   10153 C  CA    . LEU D 1 88  ? 84.728  105.748 87.144  1.00 69.29  ? 356 LEU D CA    1 
ATOM   10154 C  C     . LEU D 1 88  ? 83.643  106.786 87.385  1.00 69.29  ? 356 LEU D C     1 
ATOM   10155 O  O     . LEU D 1 88  ? 83.643  107.465 88.417  1.00 69.29  ? 356 LEU D O     1 
ATOM   10156 C  CB    . LEU D 1 88  ? 85.789  106.322 86.214  1.00 69.29  ? 356 LEU D CB    1 
ATOM   10157 C  CG    . LEU D 1 88  ? 86.472  107.587 86.709  1.00 69.29  ? 356 LEU D CG    1 
ATOM   10158 C  CD1   . LEU D 1 88  ? 87.302  107.271 87.924  1.00 69.29  ? 356 LEU D CD1   1 
ATOM   10159 C  CD2   . LEU D 1 88  ? 87.316  108.188 85.629  1.00 69.29  ? 356 LEU D CD2   1 
ATOM   10160 N  N     . LEU D 1 89  ? 82.696  106.909 86.454  1.00 68.84  ? 357 LEU D N     1 
ATOM   10161 C  CA    . LEU D 1 89  ? 81.610  107.863 86.622  1.00 68.84  ? 357 LEU D CA    1 
ATOM   10162 C  C     . LEU D 1 89  ? 80.614  107.398 87.674  1.00 68.84  ? 357 LEU D C     1 
ATOM   10163 O  O     . LEU D 1 89  ? 79.818  108.205 88.161  1.00 68.84  ? 357 LEU D O     1 
ATOM   10164 C  CB    . LEU D 1 89  ? 80.937  108.104 85.272  1.00 68.84  ? 357 LEU D CB    1 
ATOM   10165 C  CG    . LEU D 1 89  ? 79.943  109.237 85.089  1.00 68.84  ? 357 LEU D CG    1 
ATOM   10166 C  CD1   . LEU D 1 89  ? 80.578  110.519 85.533  1.00 68.84  ? 357 LEU D CD1   1 
ATOM   10167 C  CD2   . LEU D 1 89  ? 79.591  109.335 83.637  1.00 68.84  ? 357 LEU D CD2   1 
ATOM   10168 N  N     . ALA D 1 90  ? 80.661  106.128 88.061  1.00 69.48  ? 358 ALA D N     1 
ATOM   10169 C  CA    . ALA D 1 90  ? 79.951  105.679 89.246  1.00 69.48  ? 358 ALA D CA    1 
ATOM   10170 C  C     . ALA D 1 90  ? 80.772  105.836 90.514  1.00 69.48  ? 358 ALA D C     1 
ATOM   10171 O  O     . ALA D 1 90  ? 80.195  105.924 91.602  1.00 69.48  ? 358 ALA D O     1 
ATOM   10172 C  CB    . ALA D 1 90  ? 79.535  104.220 89.092  1.00 69.48  ? 358 ALA D CB    1 
ATOM   10173 N  N     . LYS D 1 91  ? 82.105  105.854 90.409  1.00 70.62  ? 359 LYS D N     1 
ATOM   10174 C  CA    . LYS D 1 91  ? 82.934  106.165 91.571  1.00 70.62  ? 359 LYS D CA    1 
ATOM   10175 C  C     . LYS D 1 91  ? 82.813  107.629 91.950  1.00 70.62  ? 359 LYS D C     1 
ATOM   10176 O  O     . LYS D 1 91  ? 82.798  107.969 93.136  1.00 70.62  ? 359 LYS D O     1 
ATOM   10177 C  CB    . LYS D 1 91  ? 84.397  105.831 91.298  1.00 70.62  ? 359 LYS D CB    1 
ATOM   10178 C  CG    . LYS D 1 91  ? 84.720  104.363 91.232  1.00 70.62  ? 359 LYS D CG    1 
ATOM   10179 C  CD    . LYS D 1 91  ? 86.198  104.138 91.005  1.00 70.62  ? 359 LYS D CD    1 
ATOM   10180 C  CE    . LYS D 1 91  ? 86.522  102.663 90.955  1.00 70.62  ? 359 LYS D CE    1 
ATOM   10181 N  NZ    . LYS D 1 91  ? 87.973  102.434 90.740  1.00 70.62  ? 359 LYS D NZ    1 
ATOM   10182 N  N     . ALA D 1 92  ? 82.742  108.508 90.949  1.00 69.99  ? 360 ALA D N     1 
ATOM   10183 C  CA    . ALA D 1 92  ? 82.555  109.928 91.204  1.00 69.99  ? 360 ALA D CA    1 
ATOM   10184 C  C     . ALA D 1 92  ? 81.195  110.210 91.818  1.00 69.99  ? 360 ALA D C     1 
ATOM   10185 O  O     . ALA D 1 92  ? 81.042  111.181 92.563  1.00 69.99  ? 360 ALA D O     1 
ATOM   10186 C  CB    . ALA D 1 92  ? 82.718  110.717 89.911  1.00 69.99  ? 360 ALA D CB    1 
ATOM   10187 N  N     . THR D 1 93  ? 80.204  109.372 91.523  1.00 68.09  ? 361 THR D N     1 
ATOM   10188 C  CA    . THR D 1 93  ? 78.880  109.558 92.095  1.00 68.09  ? 361 THR D CA    1 
ATOM   10189 C  C     . THR D 1 93  ? 78.876  109.205 93.573  1.00 68.09  ? 361 THR D C     1 
ATOM   10190 O  O     . THR D 1 93  ? 78.222  109.877 94.377  1.00 68.09  ? 361 THR D O     1 
ATOM   10191 C  CB    . THR D 1 93  ? 77.882  108.721 91.319  1.00 68.09  ? 361 THR D CB    1 
ATOM   10192 O  OG1   . THR D 1 93  ? 78.003  109.051 89.936  1.00 68.09  ? 361 THR D OG1   1 
ATOM   10193 C  CG2   . THR D 1 93  ? 76.474  109.024 91.760  1.00 68.09  ? 361 THR D CG2   1 
ATOM   10194 N  N     . ALA D 1 94  ? 79.631  108.178 93.957  1.00 68.86  ? 362 ALA D N     1 
ATOM   10195 C  CA    . ALA D 1 94  ? 79.830  107.883 95.369  1.00 68.86  ? 362 ALA D CA    1 
ATOM   10196 C  C     . ALA D 1 94  ? 80.720  108.902 96.062  1.00 68.86  ? 362 ALA D C     1 
ATOM   10197 O  O     . ALA D 1 94  ? 80.759  108.927 97.295  1.00 68.86  ? 362 ALA D O     1 
ATOM   10198 C  CB    . ALA D 1 94  ? 80.433  106.492 95.534  1.00 68.86  ? 362 ALA D CB    1 
ATOM   10199 N  N     . GLY D 1 95  ? 81.438  109.728 95.309  1.00 69.91  ? 363 GLY D N     1 
ATOM   10200 C  CA    . GLY D 1 95  ? 82.274  110.750 95.892  1.00 69.91  ? 363 GLY D CA    1 
ATOM   10201 C  C     . GLY D 1 95  ? 81.488  111.912 96.453  1.00 69.91  ? 363 GLY D C     1 
ATOM   10202 O  O     . GLY D 1 95  ? 81.501  112.135 97.665  1.00 69.91  ? 363 GLY D O     1 
ATOM   10203 N  N     . GLU D 1 96  ? 80.786  112.655 95.595  1.00 73.76  ? 364 GLU D N     1 
ATOM   10204 C  CA    . GLU D 1 96  ? 80.150  113.884 96.057  1.00 73.76  ? 364 GLU D CA    1 
ATOM   10205 C  C     . GLU D 1 96  ? 78.854  113.657 96.813  1.00 73.76  ? 364 GLU D C     1 
ATOM   10206 O  O     . GLU D 1 96  ? 78.499  114.486 97.656  1.00 73.76  ? 364 GLU D O     1 
ATOM   10207 C  CB    . GLU D 1 96  ? 79.868  114.830 94.896  1.00 73.76  ? 364 GLU D CB    1 
ATOM   10208 C  CG    . GLU D 1 96  ? 81.016  115.725 94.499  1.00 73.76  ? 364 GLU D CG    1 
ATOM   10209 C  CD    . GLU D 1 96  ? 81.955  115.108 93.511  1.00 73.76  ? 364 GLU D CD    1 
ATOM   10210 O  OE1   . GLU D 1 96  ? 81.823  113.903 93.221  1.00 73.76  ? 364 GLU D OE1   1 
ATOM   10211 O  OE2   . GLU D 1 96  ? 82.778  115.861 92.956  1.00 73.76  ? 364 GLU D OE2   1 
ATOM   10212 N  N     . ALA D 1 97  ? 78.129  112.584 96.526  1.00 70.48  ? 365 ALA D N     1 
ATOM   10213 C  CA    . ALA D 1 97  ? 76.834  112.389 97.160  1.00 70.48  ? 365 ALA D CA    1 
ATOM   10214 C  C     . ALA D 1 97  ? 77.007  112.035 98.628  1.00 70.48  ? 365 ALA D C     1 
ATOM   10215 O  O     . ALA D 1 97  ? 77.845  111.204 98.984  1.00 70.48  ? 365 ALA D O     1 
ATOM   10216 C  CB    . ALA D 1 97  ? 76.048  111.301 96.441  1.00 70.48  ? 365 ALA D CB    1 
ATOM   10217 N  N     . ASN D 1 98  ? 76.201  112.664 99.483  1.00 70.65  ? 366 ASN D N     1 
ATOM   10218 C  CA    . ASN D 1 98  ? 76.306  112.497 100.927 1.00 70.65  ? 366 ASN D CA    1 
ATOM   10219 C  C     . ASN D 1 98  ? 75.432  111.366 101.439 1.00 70.65  ? 366 ASN D C     1 
ATOM   10220 O  O     . ASN D 1 98  ? 74.915  111.433 102.561 1.00 70.65  ? 366 ASN D O     1 
ATOM   10221 C  CB    . ASN D 1 98  ? 75.965  113.807 101.632 1.00 70.65  ? 366 ASN D CB    1 
ATOM   10222 C  CG    . ASN D 1 98  ? 77.021  114.863 101.416 1.00 70.65  ? 366 ASN D CG    1 
ATOM   10223 O  OD1   . ASN D 1 98  ? 78.214  114.565 101.404 1.00 70.65  ? 366 ASN D OD1   1 
ATOM   10224 N  ND2   . ASN D 1 98  ? 76.593  116.107 101.256 1.00 70.65  ? 366 ASN D ND2   1 
ATOM   10225 N  N     . VAL D 1 99  ? 75.248  110.339 100.626 1.00 68.82  ? 367 VAL D N     1 
ATOM   10226 C  CA    . VAL D 1 99  ? 74.338  109.233 100.898 1.00 68.82  ? 367 VAL D CA    1 
ATOM   10227 C  C     . VAL D 1 99  ? 75.166  107.957 100.860 1.00 68.82  ? 367 VAL D C     1 
ATOM   10228 O  O     . VAL D 1 99  ? 76.275  107.948 100.298 1.00 68.82  ? 367 VAL D O     1 
ATOM   10229 C  CB    . VAL D 1 99  ? 73.174  109.202 99.883  1.00 68.82  ? 367 VAL D CB    1 
ATOM   10230 C  CG1   . VAL D 1 99  ? 72.359  110.470 99.974  1.00 68.82  ? 367 VAL D CG1   1 
ATOM   10231 C  CG2   . VAL D 1 99  ? 73.709  109.039 98.491  1.00 68.82  ? 367 VAL D CG2   1 
ATOM   10232 N  N     . PRO D 1 100 ? 74.693  106.872 101.472 1.00 67.39  ? 368 PRO D N     1 
ATOM   10233 C  CA    . PRO D 1 100 ? 75.410  105.603 101.340 1.00 67.39  ? 368 PRO D CA    1 
ATOM   10234 C  C     . PRO D 1 100 ? 75.318  105.052 99.930  1.00 67.39  ? 368 PRO D C     1 
ATOM   10235 O  O     . PRO D 1 100 ? 74.438  105.407 99.146  1.00 67.39  ? 368 PRO D O     1 
ATOM   10236 C  CB    . PRO D 1 100 ? 74.706  104.688 102.342 1.00 67.39  ? 368 PRO D CB    1 
ATOM   10237 C  CG    . PRO D 1 100 ? 73.393  105.295 102.544 1.00 67.39  ? 368 PRO D CG    1 
ATOM   10238 C  CD    . PRO D 1 100 ? 73.612  106.760 102.464 1.00 67.39  ? 368 PRO D CD    1 
ATOM   10239 N  N     . PHE D 1 101 ? 76.262  104.169 99.613  1.00 68.57  ? 369 PHE D N     1 
ATOM   10240 C  CA    . PHE D 1 101 ? 76.450  103.675 98.255  1.00 68.57  ? 369 PHE D CA    1 
ATOM   10241 C  C     . PHE D 1 101 ? 76.724  102.183 98.329  1.00 68.57  ? 369 PHE D C     1 
ATOM   10242 O  O     . PHE D 1 101 ? 77.656  101.757 99.013  1.00 68.57  ? 369 PHE D O     1 
ATOM   10243 C  CB    . PHE D 1 101 ? 77.603  104.411 97.573  1.00 68.57  ? 369 PHE D CB    1 
ATOM   10244 C  CG    . PHE D 1 101 ? 77.702  104.170 96.099  1.00 68.57  ? 369 PHE D CG    1 
ATOM   10245 C  CD1   . PHE D 1 101 ? 76.912  104.873 95.219  1.00 68.57  ? 369 PHE D CD1   1 
ATOM   10246 C  CD2   . PHE D 1 101 ? 78.587  103.245 95.595  1.00 68.57  ? 369 PHE D CD2   1 
ATOM   10247 C  CE1   . PHE D 1 101 ? 77.012  104.662 93.863  1.00 68.57  ? 369 PHE D CE1   1 
ATOM   10248 C  CE2   . PHE D 1 101 ? 78.683  103.026 94.242  1.00 68.57  ? 369 PHE D CE2   1 
ATOM   10249 C  CZ    . PHE D 1 101 ? 77.895  103.733 93.377  1.00 68.57  ? 369 PHE D CZ    1 
ATOM   10250 N  N     . ILE D 1 102 ? 75.910  101.392 97.638  1.00 72.15  ? 370 ILE D N     1 
ATOM   10251 C  CA    . ILE D 1 102 ? 75.939  99.939  97.727  1.00 72.15  ? 370 ILE D CA    1 
ATOM   10252 C  C     . ILE D 1 102 ? 76.324  99.384  96.364  1.00 72.15  ? 370 ILE D C     1 
ATOM   10253 O  O     . ILE D 1 102 ? 75.834  99.862  95.336  1.00 72.15  ? 370 ILE D O     1 
ATOM   10254 C  CB    . ILE D 1 102 ? 74.570  99.401  98.184  1.00 72.15  ? 370 ILE D CB    1 
ATOM   10255 C  CG1   . ILE D 1 102 ? 74.184  100.044 99.510  1.00 72.15  ? 370 ILE D CG1   1 
ATOM   10256 C  CG2   . ILE D 1 102 ? 74.606  97.907  98.373  1.00 72.15  ? 370 ILE D CG2   1 
ATOM   10257 C  CD1   . ILE D 1 102 ? 72.761  99.808  99.908  1.00 72.15  ? 370 ILE D CD1   1 
ATOM   10258 N  N     . THR D 1 103 ? 77.204  98.383  96.349  1.00 71.91  ? 371 THR D N     1 
ATOM   10259 C  CA    . THR D 1 103 ? 77.802  97.898  95.110  1.00 71.91  ? 371 THR D CA    1 
ATOM   10260 C  C     . THR D 1 103 ? 77.709  96.383  95.023  1.00 71.91  ? 371 THR D C     1 
ATOM   10261 O  O     . THR D 1 103 ? 78.176  95.679  95.922  1.00 71.91  ? 371 THR D O     1 
ATOM   10262 C  CB    . THR D 1 103 ? 79.263  98.328  95.016  1.00 71.91  ? 371 THR D CB    1 
ATOM   10263 O  OG1   . THR D 1 103 ? 79.344  99.751  95.121  1.00 71.91  ? 371 THR D OG1   1 
ATOM   10264 C  CG2   . THR D 1 103 ? 79.842  97.899  93.691  1.00 71.91  ? 371 THR D CG2   1 
ATOM   10265 N  N     . VAL D 1 104 ? 77.114  95.884  93.937  1.00 72.22  ? 372 VAL D N     1 
ATOM   10266 C  CA    . VAL D 1 104 ? 77.191  94.480  93.558  1.00 72.22  ? 372 VAL D CA    1 
ATOM   10267 C  C     . VAL D 1 104 ? 77.590  94.389  92.097  1.00 72.22  ? 372 VAL D C     1 
ATOM   10268 O  O     . VAL D 1 104 ? 77.526  95.363  91.346  1.00 72.22  ? 372 VAL D O     1 
ATOM   10269 C  CB    . VAL D 1 104 ? 75.874  93.713  93.763  1.00 72.22  ? 372 VAL D CB    1 
ATOM   10270 C  CG1   . VAL D 1 104 ? 75.541  93.617  95.209  1.00 72.22  ? 372 VAL D CG1   1 
ATOM   10271 C  CG2   . VAL D 1 104 ? 74.760  94.377  92.994  1.00 72.22  ? 372 VAL D CG2   1 
ATOM   10272 N  N     . SER D 1 105 ? 78.001  93.194  91.701  1.00 74.33  ? 373 SER D N     1 
ATOM   10273 C  CA    . SER D 1 105 ? 78.215  92.865  90.304  1.00 74.33  ? 373 SER D CA    1 
ATOM   10274 C  C     . SER D 1 105 ? 77.011  92.104  89.769  1.00 74.33  ? 373 SER D C     1 
ATOM   10275 O  O     . SER D 1 105 ? 76.131  91.679  90.517  1.00 74.33  ? 373 SER D O     1 
ATOM   10276 C  CB    . SER D 1 105 ? 79.487  92.039  90.130  1.00 74.33  ? 373 SER D CB    1 
ATOM   10277 O  OG    . SER D 1 105 ? 79.667  91.689  88.773  1.00 74.33  ? 373 SER D OG    1 
ATOM   10278 N  N     . GLY D 1 106 ? 76.976  91.937  88.449  1.00 74.42  ? 374 GLY D N     1 
ATOM   10279 C  CA    . GLY D 1 106 ? 75.883  91.195  87.847  1.00 74.42  ? 374 GLY D CA    1 
ATOM   10280 C  C     . GLY D 1 106 ? 75.968  89.707  88.119  1.00 74.42  ? 374 GLY D C     1 
ATOM   10281 O  O     . GLY D 1 106 ? 74.956  89.053  88.368  1.00 74.42  ? 374 GLY D O     1 
ATOM   10282 N  N     . SER D 1 107 ? 77.174  89.158  88.112  1.00 74.98  ? 375 SER D N     1 
ATOM   10283 C  CA    . SER D 1 107 ? 77.359  87.723  88.244  1.00 74.98  ? 375 SER D CA    1 
ATOM   10284 C  C     . SER D 1 107 ? 77.282  87.232  89.680  1.00 74.98  ? 375 SER D C     1 
ATOM   10285 O  O     . SER D 1 107 ? 77.497  86.040  89.913  1.00 74.98  ? 375 SER D O     1 
ATOM   10286 C  CB    . SER D 1 107 ? 78.706  87.323  87.653  1.00 74.98  ? 375 SER D CB    1 
ATOM   10287 O  OG    . SER D 1 107 ? 78.770  87.627  86.275  1.00 74.98  ? 375 SER D OG    1 
ATOM   10288 N  N     . GLU D 1 108 ? 76.995  88.100  90.643  1.00 77.03  ? 376 GLU D N     1 
ATOM   10289 C  CA    . GLU D 1 108 ? 77.013  87.695  92.041  1.00 77.03  ? 376 GLU D CA    1 
ATOM   10290 C  C     . GLU D 1 108 ? 75.750  86.977  92.477  1.00 77.03  ? 376 GLU D C     1 
ATOM   10291 O  O     . GLU D 1 108 ? 75.703  86.486  93.606  1.00 77.03  ? 376 GLU D O     1 
ATOM   10292 C  CB    . GLU D 1 108 ? 77.231  88.909  92.942  1.00 77.03  ? 376 GLU D CB    1 
ATOM   10293 C  CG    . GLU D 1 108 ? 78.598  89.538  92.788  1.00 77.03  ? 376 GLU D CG    1 
ATOM   10294 C  CD    . GLU D 1 108 ? 78.811  90.709  93.720  1.00 77.03  ? 376 GLU D CD    1 
ATOM   10295 O  OE1   . GLU D 1 108 ? 77.851  91.097  94.416  1.00 77.03  ? 376 GLU D OE1   1 
ATOM   10296 O  OE2   . GLU D 1 108 ? 79.940  91.240  93.760  1.00 77.03  ? 376 GLU D OE2   1 
ATOM   10297 N  N     . PHE D 1 109 ? 74.748  86.873  91.612  1.00 74.30  ? 377 PHE D N     1 
ATOM   10298 C  CA    . PHE D 1 109 ? 73.409  86.468  92.011  1.00 74.30  ? 377 PHE D CA    1 
ATOM   10299 C  C     . PHE D 1 109 ? 73.170  84.970  91.880  1.00 74.30  ? 377 PHE D C     1 
ATOM   10300 O  O     . PHE D 1 109 ? 72.516  84.375  92.741  1.00 74.30  ? 377 PHE D O     1 
ATOM   10301 C  CB    . PHE D 1 109 ? 72.399  87.252  91.180  1.00 74.30  ? 377 PHE D CB    1 
ATOM   10302 C  CG    . PHE D 1 109 ? 72.360  88.716  91.514  1.00 74.30  ? 377 PHE D CG    1 
ATOM   10303 C  CD1   . PHE D 1 109 ? 72.643  89.155  92.791  1.00 74.30  ? 377 PHE D CD1   1 
ATOM   10304 C  CD2   . PHE D 1 109 ? 72.128  89.655  90.533  1.00 74.30  ? 377 PHE D CD2   1 
ATOM   10305 C  CE1   . PHE D 1 109 ? 72.625  90.497  93.091  1.00 74.30  ? 377 PHE D CE1   1 
ATOM   10306 C  CE2   . PHE D 1 109 ? 72.121  90.992  90.823  1.00 74.30  ? 377 PHE D CE2   1 
ATOM   10307 C  CZ    . PHE D 1 109 ? 72.369  91.412  92.101  1.00 74.30  ? 377 PHE D CZ    1 
ATOM   10308 N  N     . LEU D 1 110 ? 73.683  84.345  90.827  1.00 78.04  ? 378 LEU D N     1 
ATOM   10309 C  CA    . LEU D 1 110 ? 73.477  82.923  90.584  1.00 78.04  ? 378 LEU D CA    1 
ATOM   10310 C  C     . LEU D 1 110 ? 74.595  82.109  91.218  1.00 78.04  ? 378 LEU D C     1 
ATOM   10311 O  O     . LEU D 1 110 ? 75.773  82.381  90.974  1.00 78.04  ? 378 LEU D O     1 
ATOM   10312 C  CB    . LEU D 1 110 ? 73.433  82.648  89.084  1.00 78.04  ? 378 LEU D CB    1 
ATOM   10313 C  CG    . LEU D 1 110 ? 72.279  83.274  88.317  1.00 78.04  ? 378 LEU D CG    1 
ATOM   10314 C  CD1   . LEU D 1 110 ? 72.447  83.047  86.833  1.00 78.04  ? 378 LEU D CD1   1 
ATOM   10315 C  CD2   . LEU D 1 110 ? 70.978  82.684  88.798  1.00 78.04  ? 378 LEU D CD2   1 
ATOM   10316 N  N     . GLU D 1 111 ? 74.231  81.110  92.028  1.00 84.33  ? 379 GLU D N     1 
ATOM   10317 C  CA    . GLU D 1 111 ? 75.254  80.227  92.592  1.00 84.33  ? 379 GLU D CA    1 
ATOM   10318 C  C     . GLU D 1 111 ? 74.652  78.844  92.848  1.00 84.33  ? 379 GLU D C     1 
ATOM   10319 O  O     . GLU D 1 111 ? 74.040  78.607  93.891  1.00 84.33  ? 379 GLU D O     1 
ATOM   10320 C  CB    . GLU D 1 111 ? 75.848  80.813  93.863  1.00 84.33  ? 379 GLU D CB    1 
ATOM   10321 C  CG    . GLU D 1 111 ? 77.008  80.016  94.421  1.00 84.33  ? 379 GLU D CG    1 
ATOM   10322 C  CD    . GLU D 1 111 ? 77.633  80.671  95.631  1.00 84.33  ? 379 GLU D CD    1 
ATOM   10323 O  OE1   . GLU D 1 111 ? 77.142  81.738  96.053  1.00 84.33  ? 379 GLU D OE1   1 
ATOM   10324 O  OE2   . GLU D 1 111 ? 78.620  80.120  96.160  1.00 84.33  ? 379 GLU D OE2   1 
ATOM   10325 N  N     . MET D 1 112 ? 74.790  77.959  91.855  1.00 88.85  ? 380 MET D N     1 
ATOM   10326 C  CA    . MET D 1 112 ? 74.842  76.501  91.992  1.00 88.85  ? 380 MET D CA    1 
ATOM   10327 C  C     . MET D 1 112 ? 73.505  75.839  92.338  1.00 88.85  ? 380 MET D C     1 
ATOM   10328 O  O     . MET D 1 112 ? 73.340  74.632  92.134  1.00 88.85  ? 380 MET D O     1 
ATOM   10329 C  CB    . MET D 1 112 ? 75.924  76.157  93.034  1.00 88.85  ? 380 MET D CB    1 
ATOM   10330 C  CG    . MET D 1 112 ? 76.315  74.700  93.202  1.00 88.85  ? 380 MET D CG    1 
ATOM   10331 S  SD    . MET D 1 112 ? 77.653  74.504  94.384  1.00 88.85  ? 380 MET D SD    1 
ATOM   10332 C  CE    . MET D 1 112 ? 76.819  74.924  95.907  1.00 88.85  ? 380 MET D CE    1 
ATOM   10333 N  N     . PHE D 1 113 ? 72.504  76.617  92.728  1.00 81.89  ? 381 PHE D N     1 
ATOM   10334 C  CA    . PHE D 1 113 ? 71.247  76.090  93.230  1.00 81.89  ? 381 PHE D CA    1 
ATOM   10335 C  C     . PHE D 1 113 ? 70.095  76.784  92.523  1.00 81.89  ? 381 PHE D C     1 
ATOM   10336 O  O     . PHE D 1 113 ? 70.281  77.768  91.807  1.00 81.89  ? 381 PHE D O     1 
ATOM   10337 C  CB    . PHE D 1 113 ? 71.141  76.282  94.745  1.00 81.89  ? 381 PHE D CB    1 
ATOM   10338 C  CG    . PHE D 1 113 ? 71.986  75.336  95.538  1.00 81.89  ? 381 PHE D CG    1 
ATOM   10339 C  CD1   . PHE D 1 113 ? 72.312  74.095  95.036  1.00 81.89  ? 381 PHE D CD1   1 
ATOM   10340 C  CD2   . PHE D 1 113 ? 72.488  75.703  96.773  1.00 81.89  ? 381 PHE D CD2   1 
ATOM   10341 C  CE1   . PHE D 1 113 ? 73.096  73.226  95.753  1.00 81.89  ? 381 PHE D CE1   1 
ATOM   10342 C  CE2   . PHE D 1 113 ? 73.282  74.835  97.495  1.00 81.89  ? 381 PHE D CE2   1 
ATOM   10343 C  CZ    . PHE D 1 113 ? 73.578  73.593  96.981  1.00 81.89  ? 381 PHE D CZ    1 
ATOM   10344 N  N     . VAL D 1 114 ? 68.905  76.258  92.714  1.00 80.60  ? 382 VAL D N     1 
ATOM   10345 C  CA    . VAL D 1 114 ? 67.710  76.891  92.175  1.00 80.60  ? 382 VAL D CA    1 
ATOM   10346 C  C     . VAL D 1 114 ? 67.171  77.853  93.216  1.00 80.60  ? 382 VAL D C     1 
ATOM   10347 O  O     . VAL D 1 114 ? 67.333  77.655  94.421  1.00 80.60  ? 382 VAL D O     1 
ATOM   10348 C  CB    . VAL D 1 114 ? 66.647  75.856  91.756  1.00 80.60  ? 382 VAL D CB    1 
ATOM   10349 C  CG1   . VAL D 1 114 ? 67.146  75.038  90.582  1.00 80.60  ? 382 VAL D CG1   1 
ATOM   10350 C  CG2   . VAL D 1 114 ? 66.295  74.953  92.914  1.00 80.60  ? 382 VAL D CG2   1 
ATOM   10351 N  N     . GLY D 1 115 ? 66.578  78.947  92.746  1.00 75.65  ? 383 GLY D N     1 
ATOM   10352 C  CA    . GLY D 1 115 ? 65.969  79.924  93.616  1.00 75.65  ? 383 GLY D CA    1 
ATOM   10353 C  C     . GLY D 1 115 ? 66.912  80.895  94.290  1.00 75.65  ? 383 GLY D C     1 
ATOM   10354 O  O     . GLY D 1 115 ? 66.464  81.959  94.723  1.00 75.65  ? 383 GLY D O     1 
ATOM   10355 N  N     . VAL D 1 116 ? 68.209  80.583  94.382  1.00 73.92  ? 384 VAL D N     1 
ATOM   10356 C  CA    . VAL D 1 116 ? 69.152  81.468  95.064  1.00 73.92  ? 384 VAL D CA    1 
ATOM   10357 C  C     . VAL D 1 116 ? 69.535  82.676  94.233  1.00 73.92  ? 384 VAL D C     1 
ATOM   10358 O  O     . VAL D 1 116 ? 70.283  83.530  94.714  1.00 73.92  ? 384 VAL D O     1 
ATOM   10359 C  CB    . VAL D 1 116 ? 70.444  80.733  95.453  1.00 73.92  ? 384 VAL D CB    1 
ATOM   10360 C  CG1   . VAL D 1 116 ? 70.131  79.577  96.376  1.00 73.92  ? 384 VAL D CG1   1 
ATOM   10361 C  CG2   . VAL D 1 116 ? 71.159  80.263  94.213  1.00 73.92  ? 384 VAL D CG2   1 
ATOM   10362 N  N     . GLY D 1 117 ? 69.076  82.750  92.995  1.00 70.56  ? 385 GLY D N     1 
ATOM   10363 C  CA    . GLY D 1 117 ? 69.131  83.962  92.216  1.00 70.56  ? 385 GLY D CA    1 
ATOM   10364 C  C     . GLY D 1 117 ? 68.130  85.010  92.668  1.00 70.56  ? 385 GLY D C     1 
ATOM   10365 O  O     . GLY D 1 117 ? 68.510  86.102  93.099  1.00 70.56  ? 385 GLY D O     1 
ATOM   10366 N  N     . PRO D 1 118 ? 66.829  84.713  92.558  1.00 70.84  ? 386 PRO D N     1 
ATOM   10367 C  CA    . PRO D 1 118 ? 65.819  85.643  93.082  1.00 70.84  ? 386 PRO D CA    1 
ATOM   10368 C  C     . PRO D 1 118 ? 65.854  85.834  94.586  1.00 70.84  ? 386 PRO D C     1 
ATOM   10369 O  O     . PRO D 1 118 ? 65.391  86.871  95.066  1.00 70.84  ? 386 PRO D O     1 
ATOM   10370 C  CB    . PRO D 1 118 ? 64.500  85.003  92.636  1.00 70.84  ? 386 PRO D CB    1 
ATOM   10371 C  CG    . PRO D 1 118 ? 64.817  83.600  92.341  1.00 70.84  ? 386 PRO D CG    1 
ATOM   10372 C  CD    . PRO D 1 118 ? 66.195  83.626  91.793  1.00 70.84  ? 386 PRO D CD    1 
ATOM   10373 N  N     . ALA D 1 119 ? 66.385  84.884  95.351  1.00 70.63  ? 387 ALA D N     1 
ATOM   10374 C  CA    . ALA D 1 119 ? 66.466  85.071  96.793  1.00 70.63  ? 387 ALA D CA    1 
ATOM   10375 C  C     . ALA D 1 119 ? 67.586  86.009  97.192  1.00 70.63  ? 387 ALA D C     1 
ATOM   10376 O  O     . ALA D 1 119 ? 67.615  86.472  98.335  1.00 70.63  ? 387 ALA D O     1 
ATOM   10377 C  CB    . ALA D 1 119 ? 66.655  83.729  97.504  1.00 70.63  ? 387 ALA D CB    1 
ATOM   10378 N  N     . ARG D 1 120 ? 68.503  86.285  96.281  1.00 74.27  ? 388 ARG D N     1 
ATOM   10379 C  CA    . ARG D 1 120 ? 69.620  87.169  96.534  1.00 74.27  ? 388 ARG D CA    1 
ATOM   10380 C  C     . ARG D 1 120 ? 69.380  88.562  95.968  1.00 74.27  ? 388 ARG D C     1 
ATOM   10381 O  O     . ARG D 1 120 ? 69.985  89.527  96.443  1.00 74.27  ? 388 ARG D O     1 
ATOM   10382 C  CB    . ARG D 1 120 ? 70.884  86.532  95.946  1.00 74.27  ? 388 ARG D CB    1 
ATOM   10383 C  CG    . ARG D 1 120 ? 72.168  87.160  96.343  1.00 74.27  ? 388 ARG D CG    1 
ATOM   10384 C  CD    . ARG D 1 120 ? 73.353  86.389  95.827  1.00 74.27  ? 388 ARG D CD    1 
ATOM   10385 N  NE    . ARG D 1 120 ? 73.581  85.128  96.523  1.00 74.27  ? 388 ARG D NE    1 
ATOM   10386 C  CZ    . ARG D 1 120 ? 74.504  84.245  96.160  1.00 74.27  ? 388 ARG D CZ    1 
ATOM   10387 N  NH1   . ARG D 1 120 ? 75.273  84.487  95.112  1.00 74.27  ? 388 ARG D NH1   1 
ATOM   10388 N  NH2   . ARG D 1 120 ? 74.661  83.125  96.841  1.00 74.27  ? 388 ARG D NH2   1 
ATOM   10389 N  N     . VAL D 1 121 ? 68.472  88.687  95.000  1.00 69.89  ? 389 VAL D N     1 
ATOM   10390 C  CA    . VAL D 1 121 ? 68.042  89.997  94.519  1.00 69.89  ? 389 VAL D CA    1 
ATOM   10391 C  C     . VAL D 1 121 ? 67.149  90.683  95.550  1.00 69.89  ? 389 VAL D C     1 
ATOM   10392 O  O     . VAL D 1 121 ? 67.244  91.898  95.762  1.00 69.89  ? 389 VAL D O     1 
ATOM   10393 C  CB    . VAL D 1 121 ? 67.350  89.835  93.154  1.00 69.89  ? 389 VAL D CB    1 
ATOM   10394 C  CG1   . VAL D 1 121 ? 66.664  91.091  92.723  1.00 69.89  ? 389 VAL D CG1   1 
ATOM   10395 C  CG2   . VAL D 1 121 ? 68.368  89.468  92.117  1.00 69.89  ? 389 VAL D CG2   1 
ATOM   10396 N  N     . ARG D 1 122 ? 66.299  89.914  96.234  1.00 68.41  ? 390 ARG D N     1 
ATOM   10397 C  CA    . ARG D 1 122 ? 65.441  90.486  97.268  1.00 68.41  ? 390 ARG D CA    1 
ATOM   10398 C  C     . ARG D 1 122 ? 66.253  90.975  98.458  1.00 68.41  ? 390 ARG D C     1 
ATOM   10399 O  O     . ARG D 1 122 ? 65.937  92.014  99.045  1.00 68.41  ? 390 ARG D O     1 
ATOM   10400 C  CB    . ARG D 1 122 ? 64.417  89.460  97.740  1.00 68.41  ? 390 ARG D CB    1 
ATOM   10401 C  CG    . ARG D 1 122 ? 63.394  89.052  96.710  1.00 68.41  ? 390 ARG D CG    1 
ATOM   10402 C  CD    . ARG D 1 122 ? 62.279  88.273  97.369  1.00 68.41  ? 390 ARG D CD    1 
ATOM   10403 N  NE    . ARG D 1 122 ? 62.769  87.062  98.014  1.00 68.41  ? 390 ARG D NE    1 
ATOM   10404 C  CZ    . ARG D 1 122 ? 62.860  85.884  97.412  1.00 68.41  ? 390 ARG D CZ    1 
ATOM   10405 N  NH1   . ARG D 1 122 ? 62.489  85.758  96.149  1.00 68.41  ? 390 ARG D NH1   1 
ATOM   10406 N  NH2   . ARG D 1 122 ? 63.310  84.832  98.073  1.00 68.41  ? 390 ARG D NH2   1 
ATOM   10407 N  N     . ASP D 1 123 ? 67.304  90.244  98.826  1.00 72.81  ? 391 ASP D N     1 
ATOM   10408 C  CA    . ASP D 1 123 ? 68.162  90.690  99.913  1.00 72.81  ? 391 ASP D CA    1 
ATOM   10409 C  C     . ASP D 1 123 ? 69.044  91.855  99.503  1.00 72.81  ? 391 ASP D C     1 
ATOM   10410 O  O     . ASP D 1 123 ? 69.562  92.555  100.376 1.00 72.81  ? 391 ASP D O     1 
ATOM   10411 C  CB    . ASP D 1 123 ? 69.020  89.535  100.415 1.00 72.81  ? 391 ASP D CB    1 
ATOM   10412 C  CG    . ASP D 1 123 ? 68.211  88.504  101.169 1.00 72.81  ? 391 ASP D CG    1 
ATOM   10413 O  OD1   . ASP D 1 123 ? 67.206  88.883  101.802 1.00 72.81  ? 391 ASP D OD1   1 
ATOM   10414 O  OD2   . ASP D 1 123 ? 68.569  87.311  101.127 1.00 72.81  ? 391 ASP D OD2   1 
ATOM   10415 N  N     . LEU D 1 124 ? 69.234  92.070  98.202  1.00 68.90  ? 392 LEU D N     1 
ATOM   10416 C  CA    . LEU D 1 124 ? 69.896  93.286  97.750  1.00 68.90  ? 392 LEU D CA    1 
ATOM   10417 C  C     . LEU D 1 124 ? 69.021  94.502  97.995  1.00 68.90  ? 392 LEU D C     1 
ATOM   10418 O  O     . LEU D 1 124 ? 69.498  95.528  98.491  1.00 68.90  ? 392 LEU D O     1 
ATOM   10419 C  CB    . LEU D 1 124 ? 70.250  93.180  96.270  1.00 68.90  ? 392 LEU D CB    1 
ATOM   10420 C  CG    . LEU D 1 124 ? 70.898  94.430  95.681  1.00 68.90  ? 392 LEU D CG    1 
ATOM   10421 C  CD1   . LEU D 1 124 ? 72.191  94.726  96.396  1.00 68.90  ? 392 LEU D CD1   1 
ATOM   10422 C  CD2   . LEU D 1 124 ? 71.126  94.280  94.197  1.00 68.90  ? 392 LEU D CD2   1 
ATOM   10423 N  N     . PHE D 1 125 ? 67.736  94.402  97.670  1.00 65.03  ? 393 PHE D N     1 
ATOM   10424 C  CA    . PHE D 1 125 ? 66.804  95.494  97.901  1.00 65.03  ? 393 PHE D CA    1 
ATOM   10425 C  C     . PHE D 1 125 ? 66.280  95.533  99.326  1.00 65.03  ? 393 PHE D C     1 
ATOM   10426 O  O     . PHE D 1 125 ? 65.586  96.487  99.686  1.00 65.03  ? 393 PHE D O     1 
ATOM   10427 C  CB    . PHE D 1 125 ? 65.655  95.401  96.907  1.00 65.03  ? 393 PHE D CB    1 
ATOM   10428 C  CG    . PHE D 1 125 ? 66.047  95.770  95.518  1.00 65.03  ? 393 PHE D CG    1 
ATOM   10429 C  CD1   . PHE D 1 125 ? 66.017  97.081  95.122  1.00 65.03  ? 393 PHE D CD1   1 
ATOM   10430 C  CD2   . PHE D 1 125 ? 66.493  94.823  94.627  1.00 65.03  ? 393 PHE D CD2   1 
ATOM   10431 C  CE1   . PHE D 1 125 ? 66.386  97.436  93.852  1.00 65.03  ? 393 PHE D CE1   1 
ATOM   10432 C  CE2   . PHE D 1 125 ? 66.856  95.177  93.351  1.00 65.03  ? 393 PHE D CE2   1 
ATOM   10433 C  CZ    . PHE D 1 125 ? 66.803  96.483  92.968  1.00 65.03  ? 393 PHE D CZ    1 
ATOM   10434 N  N     . ALA D 1 126 ? 66.586  94.526  100.142 1.00 67.26  ? 394 ALA D N     1 
ATOM   10435 C  CA    . ALA D 1 126 ? 66.390  94.667  101.579 1.00 67.26  ? 394 ALA D CA    1 
ATOM   10436 C  C     . ALA D 1 126 ? 67.414  95.628  102.159 1.00 67.26  ? 394 ALA D C     1 
ATOM   10437 O  O     . ALA D 1 126 ? 67.061  96.579  102.864 1.00 67.26  ? 394 ALA D O     1 
ATOM   10438 C  CB    . ALA D 1 126 ? 66.485  93.304  102.262 1.00 67.26  ? 394 ALA D CB    1 
ATOM   10439 N  N     . LEU D 1 127 ? 68.692  95.400  101.851 1.00 66.20  ? 395 LEU D N     1 
ATOM   10440 C  CA    . LEU D 1 127 ? 69.755  96.289  102.298 1.00 66.20  ? 395 LEU D CA    1 
ATOM   10441 C  C     . LEU D 1 127 ? 69.688  97.641  101.608 1.00 66.20  ? 395 LEU D C     1 
ATOM   10442 O  O     . LEU D 1 127 ? 70.116  98.645  102.186 1.00 66.20  ? 395 LEU D O     1 
ATOM   10443 C  CB    . LEU D 1 127 ? 71.110  95.626  102.056 1.00 66.20  ? 395 LEU D CB    1 
ATOM   10444 C  CG    . LEU D 1 127 ? 72.398  96.360  102.412 1.00 66.20  ? 395 LEU D CG    1 
ATOM   10445 C  CD1   . LEU D 1 127 ? 72.414  96.700  103.886 1.00 66.20  ? 395 LEU D CD1   1 
ATOM   10446 C  CD2   . LEU D 1 127 ? 73.593  95.509  102.048 1.00 66.20  ? 395 LEU D CD2   1 
ATOM   10447 N  N     . ALA D 1 128 ? 69.141  97.695  100.393 1.00 66.67  ? 396 ALA D N     1 
ATOM   10448 C  CA    . ALA D 1 128 ? 69.065  98.960  99.671  1.00 66.67  ? 396 ALA D CA    1 
ATOM   10449 C  C     . ALA D 1 128 ? 68.072  99.904  100.326 1.00 66.67  ? 396 ALA D C     1 
ATOM   10450 O  O     . ALA D 1 128 ? 68.446  100.974 100.807 1.00 66.67  ? 396 ALA D O     1 
ATOM   10451 C  CB    . ALA D 1 128 ? 68.686  98.722  98.214  1.00 66.67  ? 396 ALA D CB    1 
ATOM   10452 N  N     . ARG D 1 129 ? 66.810  99.496  100.412 1.00 69.64  ? 397 ARG D N     1 
ATOM   10453 C  CA    . ARG D 1 129 ? 65.760  100.357 100.933 1.00 69.64  ? 397 ARG D CA    1 
ATOM   10454 C  C     . ARG D 1 129 ? 65.811  100.522 102.443 1.00 69.64  ? 397 ARG D C     1 
ATOM   10455 O  O     . ARG D 1 129 ? 65.043  101.325 102.979 1.00 69.64  ? 397 ARG D O     1 
ATOM   10456 C  CB    . ARG D 1 129 ? 64.408  99.799  100.520 1.00 69.64  ? 397 ARG D CB    1 
ATOM   10457 C  CG    . ARG D 1 129 ? 64.215  99.773  99.025  1.00 69.64  ? 397 ARG D CG    1 
ATOM   10458 C  CD    . ARG D 1 129 ? 62.938  99.053  98.681  1.00 69.64  ? 397 ARG D CD    1 
ATOM   10459 N  NE    . ARG D 1 129 ? 63.054  97.631  98.966  1.00 69.64  ? 397 ARG D NE    1 
ATOM   10460 C  CZ    . ARG D 1 129 ? 62.032  96.788  98.962  1.00 69.64  ? 397 ARG D CZ    1 
ATOM   10461 N  NH1   . ARG D 1 129 ? 60.818  97.237  98.711  1.00 69.64  ? 397 ARG D NH1   1 
ATOM   10462 N  NH2   . ARG D 1 129 ? 62.219  95.505  99.228  1.00 69.64  ? 397 ARG D NH2   1 
ATOM   10463 N  N     . LYS D 1 130 ? 66.669  99.775  103.136 1.00 66.67  ? 398 LYS D N     1 
ATOM   10464 C  CA    . LYS D 1 130 ? 66.901  100.017 104.555 1.00 66.67  ? 398 LYS D CA    1 
ATOM   10465 C  C     . LYS D 1 130 ? 67.550  101.377 104.767 1.00 66.67  ? 398 LYS D C     1 
ATOM   10466 O  O     . LYS D 1 130 ? 67.132  102.152 105.634 1.00 66.67  ? 398 LYS D O     1 
ATOM   10467 C  CB    . LYS D 1 130 ? 67.775  98.907  105.131 1.00 66.67  ? 398 LYS D CB    1 
ATOM   10468 C  CG    . LYS D 1 130 ? 67.970  98.971  106.622 1.00 66.67  ? 398 LYS D CG    1 
ATOM   10469 C  CD    . LYS D 1 130 ? 68.905  97.869  107.071 1.00 66.67  ? 398 LYS D CD    1 
ATOM   10470 C  CE    . LYS D 1 130 ? 68.220  96.517  106.993 1.00 66.67  ? 398 LYS D CE    1 
ATOM   10471 N  NZ    . LYS D 1 130 ? 69.072  95.412  107.509 1.00 66.67  ? 398 LYS D NZ    1 
ATOM   10472 N  N     . ASN D 1 131 ? 68.579  101.677 103.986 1.00 68.52  ? 399 ASN D N     1 
ATOM   10473 C  CA    . ASN D 1 131 ? 69.103  103.028 103.891 1.00 68.52  ? 399 ASN D CA    1 
ATOM   10474 C  C     . ASN D 1 131 ? 68.140  103.845 103.049 1.00 68.52  ? 399 ASN D C     1 
ATOM   10475 O  O     . ASN D 1 131 ? 67.709  103.388 101.991 1.00 68.52  ? 399 ASN D O     1 
ATOM   10476 C  CB    . ASN D 1 131 ? 70.484  102.997 103.255 1.00 68.52  ? 399 ASN D CB    1 
ATOM   10477 C  CG    . ASN D 1 131 ? 71.432  102.093 103.995 1.00 68.52  ? 399 ASN D CG    1 
ATOM   10478 O  OD1   . ASN D 1 131 ? 71.854  101.063 103.478 1.00 68.52  ? 399 ASN D OD1   1 
ATOM   10479 N  ND2   . ASN D 1 131 ? 71.768  102.467 105.219 1.00 68.52  ? 399 ASN D ND2   1 
ATOM   10480 N  N     . ALA D 1 132 ? 67.765  105.030 103.522 1.00 70.59  ? 400 ALA D N     1 
ATOM   10481 C  CA    . ALA D 1 132 ? 66.645  105.651 102.824 1.00 70.59  ? 400 ALA D CA    1 
ATOM   10482 C  C     . ALA D 1 132 ? 67.062  106.305 101.499 1.00 70.59  ? 400 ALA D C     1 
ATOM   10483 O  O     . ALA D 1 132 ? 66.522  105.894 100.468 1.00 70.59  ? 400 ALA D O     1 
ATOM   10484 C  CB    . ALA D 1 132 ? 65.872  106.597 103.760 1.00 70.59  ? 400 ALA D CB    1 
ATOM   10485 N  N     . PRO D 1 133 ? 68.013  107.308 101.415 1.00 69.56  ? 401 PRO D N     1 
ATOM   10486 C  CA    . PRO D 1 133 ? 68.345  107.887 100.107 1.00 69.56  ? 401 PRO D CA    1 
ATOM   10487 C  C     . PRO D 1 133 ? 69.538  107.228 99.409  1.00 69.56  ? 401 PRO D C     1 
ATOM   10488 O  O     . PRO D 1 133 ? 70.400  107.905 98.850  1.00 69.56  ? 401 PRO D O     1 
ATOM   10489 C  CB    . PRO D 1 133 ? 68.652  109.344 100.458 1.00 69.56  ? 401 PRO D CB    1 
ATOM   10490 C  CG    . PRO D 1 133 ? 69.364  109.204 101.729 1.00 69.56  ? 401 PRO D CG    1 
ATOM   10491 C  CD    . PRO D 1 133 ? 68.778  108.031 102.459 1.00 69.56  ? 401 PRO D CD    1 
ATOM   10492 N  N     . CYS D 1 134 ? 69.571  105.895 99.387  1.00 69.61  ? 402 CYS D N     1 
ATOM   10493 C  CA    . CYS D 1 134 ? 70.787  105.208 98.967  1.00 69.61  ? 402 CYS D CA    1 
ATOM   10494 C  C     . CYS D 1 134 ? 70.952  105.247 97.448  1.00 69.61  ? 402 CYS D C     1 
ATOM   10495 O  O     . CYS D 1 134 ? 70.034  105.595 96.705  1.00 69.61  ? 402 CYS D O     1 
ATOM   10496 C  CB    . CYS D 1 134 ? 70.780  103.755 99.424  1.00 69.61  ? 402 CYS D CB    1 
ATOM   10497 S  SG    . CYS D 1 134